data_1I6H
# 
_entry.id   1I6H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I6H         
NDB   PH0004       
RCSB  RCSB012964   
WWPDB D_1000012964 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1I3Q 'Free RNA Polymerase II, Form I'  unspecified 
PDB 1I50 'Free RNA Polymerase II, Form II' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I6H 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gnatt, A.L.'    1 
'Cramer, P.'     2 
'Kornberg, R.D.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.' Science 292 1876 1882 
2001 SCIEAS US 0036-8075 0038 ? 11313499 10.1126/science.1059495      
1       'Structural Basis of Transcription: RNA Polymerase II at 2.8 A Resolution'                        Science 292 1863 1876 
2001 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.1059493      
2       'Architecture of RNA Polymerase II and Implications for the Transcription Mechanism'              Science 288 640  649  
2000 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.288.5466.640 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gnatt, A.L.'     1  
primary 'Cramer, P.'      2  
primary 'Fu, J.'          3  
primary 'Bushnell, D.A.'  4  
primary 'Kornberg, R.D.'  5  
1       'Cramer, P.'      6  
1       'Bushnell, D.A.'  7  
1       'Kornberg, R.D.'  8  
2       'Cramer, P.'      9  
2       'Bushnell, D.A.'  10 
2       'Fu, J.'          11 
2       'Gnatt, A.L.'     12 
2       'Maier-Davis, B.' 13 
2       'Thompson, N.E.'  14 
2       'Burgess, R.R.'   15 
2       'Edwards, A.M.'   16 
2       'David, P.R.'     17 
2       'Kornberg, R.D.'  18 
# 
_cell.entry_id           1I6H 
_cell.length_a           157.300 
_cell.length_b           220.700 
_cell.length_c           191.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.50 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1I6H 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man "5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'"  3966.596   1 ?       ? ? TEMPLATE   
2  polymer     syn "5'-R(P*GP*AP*CP*CP*AP*GP*GP*CP*A)-3'"              2893.823   1 ?       ? ? TRANSCRIPT 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT'    191821.578 1 2.7.7.6 ? ? ?          
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 140KD POLYPEPTIDE'  138937.297 1 2.7.7.6 ? ? ?          
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 45KD POLYPEPTIDE'   35330.457  1 2.7.7.6 ? ? ?          
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 27KD POLYPEPTIDE'   25117.094  1 2.7.7.6 ? ? ?          
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 23KD POLYPEPTIDE'   17931.834  1 2.7.7.6 ? ? ?          
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 14.5KD POLYPEPTIDE' 16525.363  1 2.7.7.6 ? ? ?          
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 14.2KD POLYPEPTIDE' 14308.161  1 2.7.7.6 ? ? ?          
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 8.3KD POLYPEPTIDE'  8290.732   1 2.7.7.6 ? ? ?          
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 13.6KD POLYPEPTIDE' 13633.493  1 2.7.7.6 ? ? ?          
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II 7.7KD POLYPEPTIDE'  7729.969   1 2.7.7.6 ? ? ?          
13 non-polymer syn 'MAGNESIUM ION'                                     24.305     1 ?       ? ? ?          
14 non-polymer syn 'ZINC ION'                                          65.409     8 ?       ? ? ?          
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  RPB1  
4  RPB2  
5  RPB3  
6  RPB5  
7  RPB6  
8  RPB8  
9  RPB9  
10 RPB10 
11 RPB11 
12 RPB12 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polydeoxyribonucleotide no no '(DA)(DA)(DA)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DT)(DC)(DT)' AAATGCCTGGTCT D ? 
2  polyribonucleotide      no no GACCAGGCA GACCAGGCA R ? 
3  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
4  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
5  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
6  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
7  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
8  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    DA  n 
1  2    DA  n 
1  3    DA  n 
1  4    DT  n 
1  5    DG  n 
1  6    DC  n 
1  7    DC  n 
1  8    DT  n 
1  9    DG  n 
1  10   DG  n 
1  11   DT  n 
1  12   DC  n 
1  13   DT  n 
2  1    G   n 
2  2    A   n 
2  3    C   n 
2  4    C   n 
2  5    A   n 
2  6    G   n 
2  7    G   n 
2  8    C   n 
2  9    A   n 
3  1    MET n 
3  2    VAL n 
3  3    GLY n 
3  4    GLN n 
3  5    GLN n 
3  6    TYR n 
3  7    SER n 
3  8    SER n 
3  9    ALA n 
3  10   PRO n 
3  11   LEU n 
3  12   ARG n 
3  13   THR n 
3  14   VAL n 
3  15   LYS n 
3  16   GLU n 
3  17   VAL n 
3  18   GLN n 
3  19   PHE n 
3  20   GLY n 
3  21   LEU n 
3  22   PHE n 
3  23   SER n 
3  24   PRO n 
3  25   GLU n 
3  26   GLU n 
3  27   VAL n 
3  28   ARG n 
3  29   ALA n 
3  30   ILE n 
3  31   SER n 
3  32   VAL n 
3  33   ALA n 
3  34   LYS n 
3  35   ILE n 
3  36   ARG n 
3  37   PHE n 
3  38   PRO n 
3  39   GLU n 
3  40   THR n 
3  41   MET n 
3  42   ASP n 
3  43   GLU n 
3  44   THR n 
3  45   GLN n 
3  46   THR n 
3  47   ARG n 
3  48   ALA n 
3  49   LYS n 
3  50   ILE n 
3  51   GLY n 
3  52   GLY n 
3  53   LEU n 
3  54   ASN n 
3  55   ASP n 
3  56   PRO n 
3  57   ARG n 
3  58   LEU n 
3  59   GLY n 
3  60   SER n 
3  61   ILE n 
3  62   ASP n 
3  63   ARG n 
3  64   ASN n 
3  65   LEU n 
3  66   LYS n 
3  67   CYS n 
3  68   GLN n 
3  69   THR n 
3  70   CYS n 
3  71   GLN n 
3  72   GLU n 
3  73   GLY n 
3  74   MET n 
3  75   ASN n 
3  76   GLU n 
3  77   CYS n 
3  78   PRO n 
3  79   GLY n 
3  80   HIS n 
3  81   PHE n 
3  82   GLY n 
3  83   HIS n 
3  84   ILE n 
3  85   ASP n 
3  86   LEU n 
3  87   ALA n 
3  88   LYS n 
3  89   PRO n 
3  90   VAL n 
3  91   PHE n 
3  92   HIS n 
3  93   VAL n 
3  94   GLY n 
3  95   PHE n 
3  96   ILE n 
3  97   ALA n 
3  98   LYS n 
3  99   ILE n 
3  100  LYS n 
3  101  LYS n 
3  102  VAL n 
3  103  CYS n 
3  104  GLU n 
3  105  CYS n 
3  106  VAL n 
3  107  CYS n 
3  108  MET n 
3  109  HIS n 
3  110  CYS n 
3  111  GLY n 
3  112  LYS n 
3  113  LEU n 
3  114  LEU n 
3  115  LEU n 
3  116  ASP n 
3  117  GLU n 
3  118  HIS n 
3  119  ASN n 
3  120  GLU n 
3  121  LEU n 
3  122  MET n 
3  123  ARG n 
3  124  GLN n 
3  125  ALA n 
3  126  LEU n 
3  127  ALA n 
3  128  ILE n 
3  129  LYS n 
3  130  ASP n 
3  131  SER n 
3  132  LYS n 
3  133  LYS n 
3  134  ARG n 
3  135  PHE n 
3  136  ALA n 
3  137  ALA n 
3  138  ILE n 
3  139  TRP n 
3  140  THR n 
3  141  LEU n 
3  142  CYS n 
3  143  LYS n 
3  144  THR n 
3  145  LYS n 
3  146  MET n 
3  147  VAL n 
3  148  CYS n 
3  149  GLU n 
3  150  THR n 
3  151  ASP n 
3  152  VAL n 
3  153  PRO n 
3  154  SER n 
3  155  GLU n 
3  156  ASP n 
3  157  ASP n 
3  158  PRO n 
3  159  THR n 
3  160  GLN n 
3  161  LEU n 
3  162  VAL n 
3  163  SER n 
3  164  ARG n 
3  165  GLY n 
3  166  GLY n 
3  167  CYS n 
3  168  GLY n 
3  169  ASN n 
3  170  THR n 
3  171  GLN n 
3  172  PRO n 
3  173  THR n 
3  174  ILE n 
3  175  ARG n 
3  176  LYS n 
3  177  ASP n 
3  178  GLY n 
3  179  LEU n 
3  180  LYS n 
3  181  LEU n 
3  182  VAL n 
3  183  GLY n 
3  184  SER n 
3  185  TRP n 
3  186  LYS n 
3  187  LYS n 
3  188  ASP n 
3  189  ARG n 
3  190  ALA n 
3  191  THR n 
3  192  GLY n 
3  193  ASP n 
3  194  ALA n 
3  195  ASP n 
3  196  GLU n 
3  197  PRO n 
3  198  GLU n 
3  199  LEU n 
3  200  ARG n 
3  201  VAL n 
3  202  LEU n 
3  203  SER n 
3  204  THR n 
3  205  GLU n 
3  206  GLU n 
3  207  ILE n 
3  208  LEU n 
3  209  ASN n 
3  210  ILE n 
3  211  PHE n 
3  212  LYS n 
3  213  HIS n 
3  214  ILE n 
3  215  SER n 
3  216  VAL n 
3  217  LYS n 
3  218  ASP n 
3  219  PHE n 
3  220  THR n 
3  221  SER n 
3  222  LEU n 
3  223  GLY n 
3  224  PHE n 
3  225  ASN n 
3  226  GLU n 
3  227  VAL n 
3  228  PHE n 
3  229  SER n 
3  230  ARG n 
3  231  PRO n 
3  232  GLU n 
3  233  TRP n 
3  234  MET n 
3  235  ILE n 
3  236  LEU n 
3  237  THR n 
3  238  CYS n 
3  239  LEU n 
3  240  PRO n 
3  241  VAL n 
3  242  PRO n 
3  243  PRO n 
3  244  PRO n 
3  245  PRO n 
3  246  VAL n 
3  247  ARG n 
3  248  PRO n 
3  249  SER n 
3  250  ILE n 
3  251  SER n 
3  252  PHE n 
3  253  ASN n 
3  254  GLU n 
3  255  SER n 
3  256  GLN n 
3  257  ARG n 
3  258  GLY n 
3  259  GLU n 
3  260  ASP n 
3  261  ASP n 
3  262  LEU n 
3  263  THR n 
3  264  PHE n 
3  265  LYS n 
3  266  LEU n 
3  267  ALA n 
3  268  ASP n 
3  269  ILE n 
3  270  LEU n 
3  271  LYS n 
3  272  ALA n 
3  273  ASN n 
3  274  ILE n 
3  275  SER n 
3  276  LEU n 
3  277  GLU n 
3  278  THR n 
3  279  LEU n 
3  280  GLU n 
3  281  HIS n 
3  282  ASN n 
3  283  GLY n 
3  284  ALA n 
3  285  PRO n 
3  286  HIS n 
3  287  HIS n 
3  288  ALA n 
3  289  ILE n 
3  290  GLU n 
3  291  GLU n 
3  292  ALA n 
3  293  GLU n 
3  294  SER n 
3  295  LEU n 
3  296  LEU n 
3  297  GLN n 
3  298  PHE n 
3  299  HIS n 
3  300  VAL n 
3  301  ALA n 
3  302  THR n 
3  303  TYR n 
3  304  MET n 
3  305  ASP n 
3  306  ASN n 
3  307  ASP n 
3  308  ILE n 
3  309  ALA n 
3  310  GLY n 
3  311  GLN n 
3  312  PRO n 
3  313  GLN n 
3  314  ALA n 
3  315  LEU n 
3  316  GLN n 
3  317  LYS n 
3  318  SER n 
3  319  GLY n 
3  320  ARG n 
3  321  PRO n 
3  322  VAL n 
3  323  LYS n 
3  324  SER n 
3  325  ILE n 
3  326  ARG n 
3  327  ALA n 
3  328  ARG n 
3  329  LEU n 
3  330  LYS n 
3  331  GLY n 
3  332  LYS n 
3  333  GLU n 
3  334  GLY n 
3  335  ARG n 
3  336  ILE n 
3  337  ARG n 
3  338  GLY n 
3  339  ASN n 
3  340  LEU n 
3  341  MET n 
3  342  GLY n 
3  343  LYS n 
3  344  ARG n 
3  345  VAL n 
3  346  ASP n 
3  347  PHE n 
3  348  SER n 
3  349  ALA n 
3  350  ARG n 
3  351  THR n 
3  352  VAL n 
3  353  ILE n 
3  354  SER n 
3  355  GLY n 
3  356  ASP n 
3  357  PRO n 
3  358  ASN n 
3  359  LEU n 
3  360  GLU n 
3  361  LEU n 
3  362  ASP n 
3  363  GLN n 
3  364  VAL n 
3  365  GLY n 
3  366  VAL n 
3  367  PRO n 
3  368  LYS n 
3  369  SER n 
3  370  ILE n 
3  371  ALA n 
3  372  LYS n 
3  373  THR n 
3  374  LEU n 
3  375  THR n 
3  376  TYR n 
3  377  PRO n 
3  378  GLU n 
3  379  VAL n 
3  380  VAL n 
3  381  THR n 
3  382  PRO n 
3  383  TYR n 
3  384  ASN n 
3  385  ILE n 
3  386  ASP n 
3  387  ARG n 
3  388  LEU n 
3  389  THR n 
3  390  GLN n 
3  391  LEU n 
3  392  VAL n 
3  393  ARG n 
3  394  ASN n 
3  395  GLY n 
3  396  PRO n 
3  397  ASN n 
3  398  GLU n 
3  399  HIS n 
3  400  PRO n 
3  401  GLY n 
3  402  ALA n 
3  403  LYS n 
3  404  TYR n 
3  405  VAL n 
3  406  ILE n 
3  407  ARG n 
3  408  ASP n 
3  409  SER n 
3  410  GLY n 
3  411  ASP n 
3  412  ARG n 
3  413  ILE n 
3  414  ASP n 
3  415  LEU n 
3  416  ARG n 
3  417  TYR n 
3  418  SER n 
3  419  LYS n 
3  420  ARG n 
3  421  ALA n 
3  422  GLY n 
3  423  ASP n 
3  424  ILE n 
3  425  GLN n 
3  426  LEU n 
3  427  GLN n 
3  428  TYR n 
3  429  GLY n 
3  430  TRP n 
3  431  LYS n 
3  432  VAL n 
3  433  GLU n 
3  434  ARG n 
3  435  HIS n 
3  436  ILE n 
3  437  MET n 
3  438  ASP n 
3  439  ASN n 
3  440  ASP n 
3  441  PRO n 
3  442  VAL n 
3  443  LEU n 
3  444  PHE n 
3  445  ASN n 
3  446  ARG n 
3  447  GLN n 
3  448  PRO n 
3  449  SER n 
3  450  LEU n 
3  451  HIS n 
3  452  LYS n 
3  453  MET n 
3  454  SER n 
3  455  MET n 
3  456  MET n 
3  457  ALA n 
3  458  HIS n 
3  459  ARG n 
3  460  VAL n 
3  461  LYS n 
3  462  VAL n 
3  463  ILE n 
3  464  PRO n 
3  465  TYR n 
3  466  SER n 
3  467  THR n 
3  468  PHE n 
3  469  ARG n 
3  470  LEU n 
3  471  ASN n 
3  472  LEU n 
3  473  SER n 
3  474  VAL n 
3  475  THR n 
3  476  SER n 
3  477  PRO n 
3  478  TYR n 
3  479  ASN n 
3  480  ALA n 
3  481  ASP n 
3  482  PHE n 
3  483  ASP n 
3  484  GLY n 
3  485  ASP n 
3  486  GLU n 
3  487  MET n 
3  488  ASN n 
3  489  LEU n 
3  490  HIS n 
3  491  VAL n 
3  492  PRO n 
3  493  GLN n 
3  494  SER n 
3  495  GLU n 
3  496  GLU n 
3  497  THR n 
3  498  ARG n 
3  499  ALA n 
3  500  GLU n 
3  501  LEU n 
3  502  SER n 
3  503  GLN n 
3  504  LEU n 
3  505  CYS n 
3  506  ALA n 
3  507  VAL n 
3  508  PRO n 
3  509  LEU n 
3  510  GLN n 
3  511  ILE n 
3  512  VAL n 
3  513  SER n 
3  514  PRO n 
3  515  GLN n 
3  516  SER n 
3  517  ASN n 
3  518  LYS n 
3  519  PRO n 
3  520  CYS n 
3  521  MET n 
3  522  GLY n 
3  523  ILE n 
3  524  VAL n 
3  525  GLN n 
3  526  ASP n 
3  527  THR n 
3  528  LEU n 
3  529  CYS n 
3  530  GLY n 
3  531  ILE n 
3  532  ARG n 
3  533  LYS n 
3  534  LEU n 
3  535  THR n 
3  536  LEU n 
3  537  ARG n 
3  538  ASP n 
3  539  THR n 
3  540  PHE n 
3  541  ILE n 
3  542  GLU n 
3  543  LEU n 
3  544  ASP n 
3  545  GLN n 
3  546  VAL n 
3  547  LEU n 
3  548  ASN n 
3  549  MET n 
3  550  LEU n 
3  551  TYR n 
3  552  TRP n 
3  553  VAL n 
3  554  PRO n 
3  555  ASP n 
3  556  TRP n 
3  557  ASP n 
3  558  GLY n 
3  559  VAL n 
3  560  ILE n 
3  561  PRO n 
3  562  THR n 
3  563  PRO n 
3  564  ALA n 
3  565  ILE n 
3  566  ILE n 
3  567  LYS n 
3  568  PRO n 
3  569  LYS n 
3  570  PRO n 
3  571  LEU n 
3  572  TRP n 
3  573  SER n 
3  574  GLY n 
3  575  LYS n 
3  576  GLN n 
3  577  ILE n 
3  578  LEU n 
3  579  SER n 
3  580  VAL n 
3  581  ALA n 
3  582  ILE n 
3  583  PRO n 
3  584  ASN n 
3  585  GLY n 
3  586  ILE n 
3  587  HIS n 
3  588  LEU n 
3  589  GLN n 
3  590  ARG n 
3  591  PHE n 
3  592  ASP n 
3  593  GLU n 
3  594  GLY n 
3  595  THR n 
3  596  THR n 
3  597  LEU n 
3  598  LEU n 
3  599  SER n 
3  600  PRO n 
3  601  LYS n 
3  602  ASP n 
3  603  ASN n 
3  604  GLY n 
3  605  MET n 
3  606  LEU n 
3  607  ILE n 
3  608  ILE n 
3  609  ASP n 
3  610  GLY n 
3  611  GLN n 
3  612  ILE n 
3  613  ILE n 
3  614  PHE n 
3  615  GLY n 
3  616  VAL n 
3  617  VAL n 
3  618  GLU n 
3  619  LYS n 
3  620  LYS n 
3  621  THR n 
3  622  VAL n 
3  623  GLY n 
3  624  SER n 
3  625  SER n 
3  626  ASN n 
3  627  GLY n 
3  628  GLY n 
3  629  LEU n 
3  630  ILE n 
3  631  HIS n 
3  632  VAL n 
3  633  VAL n 
3  634  THR n 
3  635  ARG n 
3  636  GLU n 
3  637  LYS n 
3  638  GLY n 
3  639  PRO n 
3  640  GLN n 
3  641  VAL n 
3  642  CYS n 
3  643  ALA n 
3  644  LYS n 
3  645  LEU n 
3  646  PHE n 
3  647  GLY n 
3  648  ASN n 
3  649  ILE n 
3  650  GLN n 
3  651  LYS n 
3  652  VAL n 
3  653  VAL n 
3  654  ASN n 
3  655  PHE n 
3  656  TRP n 
3  657  LEU n 
3  658  LEU n 
3  659  HIS n 
3  660  ASN n 
3  661  GLY n 
3  662  PHE n 
3  663  SER n 
3  664  THR n 
3  665  GLY n 
3  666  ILE n 
3  667  GLY n 
3  668  ASP n 
3  669  THR n 
3  670  ILE n 
3  671  ALA n 
3  672  ASP n 
3  673  GLY n 
3  674  PRO n 
3  675  THR n 
3  676  MET n 
3  677  ARG n 
3  678  GLU n 
3  679  ILE n 
3  680  THR n 
3  681  GLU n 
3  682  THR n 
3  683  ILE n 
3  684  ALA n 
3  685  GLU n 
3  686  ALA n 
3  687  LYS n 
3  688  LYS n 
3  689  LYS n 
3  690  VAL n 
3  691  LEU n 
3  692  ASP n 
3  693  VAL n 
3  694  THR n 
3  695  LYS n 
3  696  GLU n 
3  697  ALA n 
3  698  GLN n 
3  699  ALA n 
3  700  ASN n 
3  701  LEU n 
3  702  LEU n 
3  703  THR n 
3  704  ALA n 
3  705  LYS n 
3  706  HIS n 
3  707  GLY n 
3  708  MET n 
3  709  THR n 
3  710  LEU n 
3  711  ARG n 
3  712  GLU n 
3  713  SER n 
3  714  PHE n 
3  715  GLU n 
3  716  ASP n 
3  717  ASN n 
3  718  VAL n 
3  719  VAL n 
3  720  ARG n 
3  721  PHE n 
3  722  LEU n 
3  723  ASN n 
3  724  GLU n 
3  725  ALA n 
3  726  ARG n 
3  727  ASP n 
3  728  LYS n 
3  729  ALA n 
3  730  GLY n 
3  731  ARG n 
3  732  LEU n 
3  733  ALA n 
3  734  GLU n 
3  735  VAL n 
3  736  ASN n 
3  737  LEU n 
3  738  LYS n 
3  739  ASP n 
3  740  LEU n 
3  741  ASN n 
3  742  ASN n 
3  743  VAL n 
3  744  LYS n 
3  745  GLN n 
3  746  MET n 
3  747  VAL n 
3  748  MET n 
3  749  ALA n 
3  750  GLY n 
3  751  SER n 
3  752  LYS n 
3  753  GLY n 
3  754  SER n 
3  755  PHE n 
3  756  ILE n 
3  757  ASN n 
3  758  ILE n 
3  759  ALA n 
3  760  GLN n 
3  761  MET n 
3  762  SER n 
3  763  ALA n 
3  764  CYS n 
3  765  VAL n 
3  766  GLY n 
3  767  GLN n 
3  768  GLN n 
3  769  SER n 
3  770  VAL n 
3  771  GLU n 
3  772  GLY n 
3  773  LYS n 
3  774  ARG n 
3  775  ILE n 
3  776  ALA n 
3  777  PHE n 
3  778  GLY n 
3  779  PHE n 
3  780  VAL n 
3  781  ASP n 
3  782  ARG n 
3  783  THR n 
3  784  LEU n 
3  785  PRO n 
3  786  HIS n 
3  787  PHE n 
3  788  SER n 
3  789  LYS n 
3  790  ASP n 
3  791  ASP n 
3  792  TYR n 
3  793  SER n 
3  794  PRO n 
3  795  GLU n 
3  796  SER n 
3  797  LYS n 
3  798  GLY n 
3  799  PHE n 
3  800  VAL n 
3  801  GLU n 
3  802  ASN n 
3  803  SER n 
3  804  TYR n 
3  805  LEU n 
3  806  ARG n 
3  807  GLY n 
3  808  LEU n 
3  809  THR n 
3  810  PRO n 
3  811  GLN n 
3  812  GLU n 
3  813  PHE n 
3  814  PHE n 
3  815  PHE n 
3  816  HIS n 
3  817  ALA n 
3  818  MET n 
3  819  GLY n 
3  820  GLY n 
3  821  ARG n 
3  822  GLU n 
3  823  GLY n 
3  824  LEU n 
3  825  ILE n 
3  826  ASP n 
3  827  THR n 
3  828  ALA n 
3  829  VAL n 
3  830  LYS n 
3  831  THR n 
3  832  ALA n 
3  833  GLU n 
3  834  THR n 
3  835  GLY n 
3  836  TYR n 
3  837  ILE n 
3  838  GLN n 
3  839  ARG n 
3  840  ARG n 
3  841  LEU n 
3  842  VAL n 
3  843  LYS n 
3  844  ALA n 
3  845  LEU n 
3  846  GLU n 
3  847  ASP n 
3  848  ILE n 
3  849  MET n 
3  850  VAL n 
3  851  HIS n 
3  852  TYR n 
3  853  ASP n 
3  854  ASN n 
3  855  THR n 
3  856  THR n 
3  857  ARG n 
3  858  ASN n 
3  859  SER n 
3  860  LEU n 
3  861  GLY n 
3  862  ASN n 
3  863  VAL n 
3  864  ILE n 
3  865  GLN n 
3  866  PHE n 
3  867  ILE n 
3  868  TYR n 
3  869  GLY n 
3  870  GLU n 
3  871  ASP n 
3  872  GLY n 
3  873  MET n 
3  874  ASP n 
3  875  ALA n 
3  876  ALA n 
3  877  HIS n 
3  878  ILE n 
3  879  GLU n 
3  880  LYS n 
3  881  GLN n 
3  882  SER n 
3  883  LEU n 
3  884  ASP n 
3  885  THR n 
3  886  ILE n 
3  887  GLY n 
3  888  GLY n 
3  889  SER n 
3  890  ASP n 
3  891  ALA n 
3  892  ALA n 
3  893  PHE n 
3  894  GLU n 
3  895  LYS n 
3  896  ARG n 
3  897  TYR n 
3  898  ARG n 
3  899  VAL n 
3  900  ASP n 
3  901  LEU n 
3  902  LEU n 
3  903  ASN n 
3  904  THR n 
3  905  ASP n 
3  906  HIS n 
3  907  THR n 
3  908  LEU n 
3  909  ASP n 
3  910  PRO n 
3  911  SER n 
3  912  LEU n 
3  913  LEU n 
3  914  GLU n 
3  915  SER n 
3  916  GLY n 
3  917  SER n 
3  918  GLU n 
3  919  ILE n 
3  920  LEU n 
3  921  GLY n 
3  922  ASP n 
3  923  LEU n 
3  924  LYS n 
3  925  LEU n 
3  926  GLN n 
3  927  VAL n 
3  928  LEU n 
3  929  LEU n 
3  930  ASP n 
3  931  GLU n 
3  932  GLU n 
3  933  TYR n 
3  934  LYS n 
3  935  GLN n 
3  936  LEU n 
3  937  VAL n 
3  938  LYS n 
3  939  ASP n 
3  940  ARG n 
3  941  LYS n 
3  942  PHE n 
3  943  LEU n 
3  944  ARG n 
3  945  GLU n 
3  946  VAL n 
3  947  PHE n 
3  948  VAL n 
3  949  ASP n 
3  950  GLY n 
3  951  GLU n 
3  952  ALA n 
3  953  ASN n 
3  954  TRP n 
3  955  PRO n 
3  956  LEU n 
3  957  PRO n 
3  958  VAL n 
3  959  ASN n 
3  960  ILE n 
3  961  ARG n 
3  962  ARG n 
3  963  ILE n 
3  964  ILE n 
3  965  GLN n 
3  966  ASN n 
3  967  ALA n 
3  968  GLN n 
3  969  GLN n 
3  970  THR n 
3  971  PHE n 
3  972  HIS n 
3  973  ILE n 
3  974  ASP n 
3  975  HIS n 
3  976  THR n 
3  977  LYS n 
3  978  PRO n 
3  979  SER n 
3  980  ASP n 
3  981  LEU n 
3  982  THR n 
3  983  ILE n 
3  984  LYS n 
3  985  ASP n 
3  986  ILE n 
3  987  VAL n 
3  988  LEU n 
3  989  GLY n 
3  990  VAL n 
3  991  LYS n 
3  992  ASP n 
3  993  LEU n 
3  994  GLN n 
3  995  GLU n 
3  996  ASN n 
3  997  LEU n 
3  998  LEU n 
3  999  VAL n 
3  1000 LEU n 
3  1001 ARG n 
3  1002 GLY n 
3  1003 LYS n 
3  1004 ASN n 
3  1005 GLU n 
3  1006 ILE n 
3  1007 ILE n 
3  1008 GLN n 
3  1009 ASN n 
3  1010 ALA n 
3  1011 GLN n 
3  1012 ARG n 
3  1013 ASP n 
3  1014 ALA n 
3  1015 VAL n 
3  1016 THR n 
3  1017 LEU n 
3  1018 PHE n 
3  1019 CYS n 
3  1020 CYS n 
3  1021 LEU n 
3  1022 LEU n 
3  1023 ARG n 
3  1024 SER n 
3  1025 ARG n 
3  1026 LEU n 
3  1027 ALA n 
3  1028 THR n 
3  1029 ARG n 
3  1030 ARG n 
3  1031 VAL n 
3  1032 LEU n 
3  1033 GLN n 
3  1034 GLU n 
3  1035 TYR n 
3  1036 ARG n 
3  1037 LEU n 
3  1038 THR n 
3  1039 LYS n 
3  1040 GLN n 
3  1041 ALA n 
3  1042 PHE n 
3  1043 ASP n 
3  1044 TRP n 
3  1045 VAL n 
3  1046 LEU n 
3  1047 SER n 
3  1048 ASN n 
3  1049 ILE n 
3  1050 GLU n 
3  1051 ALA n 
3  1052 GLN n 
3  1053 PHE n 
3  1054 LEU n 
3  1055 ARG n 
3  1056 SER n 
3  1057 VAL n 
3  1058 VAL n 
3  1059 HIS n 
3  1060 PRO n 
3  1061 GLY n 
3  1062 GLU n 
3  1063 MET n 
3  1064 VAL n 
3  1065 GLY n 
3  1066 VAL n 
3  1067 LEU n 
3  1068 ALA n 
3  1069 ALA n 
3  1070 GLN n 
3  1071 SER n 
3  1072 ILE n 
3  1073 GLY n 
3  1074 GLU n 
3  1075 PRO n 
3  1076 ALA n 
3  1077 THR n 
3  1078 GLN n 
3  1079 MET n 
3  1080 THR n 
3  1081 LEU n 
3  1082 ASN n 
3  1083 THR n 
3  1084 PHE n 
3  1085 HIS n 
3  1086 PHE n 
3  1087 ALA n 
3  1088 GLY n 
3  1089 VAL n 
3  1090 ALA n 
3  1091 SER n 
3  1092 LYS n 
3  1093 LYS n 
3  1094 VAL n 
3  1095 THR n 
3  1096 SER n 
3  1097 GLY n 
3  1098 VAL n 
3  1099 PRO n 
3  1100 ARG n 
3  1101 LEU n 
3  1102 LYS n 
3  1103 GLU n 
3  1104 ILE n 
3  1105 LEU n 
3  1106 ASN n 
3  1107 VAL n 
3  1108 ALA n 
3  1109 LYS n 
3  1110 ASN n 
3  1111 MET n 
3  1112 LYS n 
3  1113 THR n 
3  1114 PRO n 
3  1115 SER n 
3  1116 LEU n 
3  1117 THR n 
3  1118 VAL n 
3  1119 TYR n 
3  1120 LEU n 
3  1121 GLU n 
3  1122 PRO n 
3  1123 GLY n 
3  1124 HIS n 
3  1125 ALA n 
3  1126 ALA n 
3  1127 ASP n 
3  1128 GLN n 
3  1129 GLU n 
3  1130 GLN n 
3  1131 ALA n 
3  1132 LYS n 
3  1133 LEU n 
3  1134 ILE n 
3  1135 ARG n 
3  1136 SER n 
3  1137 ALA n 
3  1138 ILE n 
3  1139 GLU n 
3  1140 HIS n 
3  1141 THR n 
3  1142 THR n 
3  1143 LEU n 
3  1144 LYS n 
3  1145 SER n 
3  1146 VAL n 
3  1147 THR n 
3  1148 ILE n 
3  1149 ALA n 
3  1150 SER n 
3  1151 GLU n 
3  1152 ILE n 
3  1153 TYR n 
3  1154 TYR n 
3  1155 ASP n 
3  1156 PRO n 
3  1157 ASP n 
3  1158 PRO n 
3  1159 ARG n 
3  1160 SER n 
3  1161 THR n 
3  1162 VAL n 
3  1163 ILE n 
3  1164 PRO n 
3  1165 GLU n 
3  1166 ASP n 
3  1167 GLU n 
3  1168 GLU n 
3  1169 ILE n 
3  1170 ILE n 
3  1171 GLN n 
3  1172 LEU n 
3  1173 HIS n 
3  1174 PHE n 
3  1175 SER n 
3  1176 LEU n 
3  1177 LEU n 
3  1178 ASP n 
3  1179 GLU n 
3  1180 GLU n 
3  1181 ALA n 
3  1182 GLU n 
3  1183 GLN n 
3  1184 SER n 
3  1185 PHE n 
3  1186 ASP n 
3  1187 GLN n 
3  1188 GLN n 
3  1189 SER n 
3  1190 PRO n 
3  1191 TRP n 
3  1192 LEU n 
3  1193 LEU n 
3  1194 ARG n 
3  1195 LEU n 
3  1196 GLU n 
3  1197 LEU n 
3  1198 ASP n 
3  1199 ARG n 
3  1200 ALA n 
3  1201 ALA n 
3  1202 MET n 
3  1203 ASN n 
3  1204 ASP n 
3  1205 LYS n 
3  1206 ASP n 
3  1207 LEU n 
3  1208 THR n 
3  1209 MET n 
3  1210 GLY n 
3  1211 GLN n 
3  1212 VAL n 
3  1213 GLY n 
3  1214 GLU n 
3  1215 ARG n 
3  1216 ILE n 
3  1217 LYS n 
3  1218 GLN n 
3  1219 THR n 
3  1220 PHE n 
3  1221 LYS n 
3  1222 ASN n 
3  1223 ASP n 
3  1224 LEU n 
3  1225 PHE n 
3  1226 VAL n 
3  1227 ILE n 
3  1228 TRP n 
3  1229 SER n 
3  1230 GLU n 
3  1231 ASP n 
3  1232 ASN n 
3  1233 ASP n 
3  1234 GLU n 
3  1235 LYS n 
3  1236 LEU n 
3  1237 ILE n 
3  1238 ILE n 
3  1239 ARG n 
3  1240 CYS n 
3  1241 ARG n 
3  1242 VAL n 
3  1243 VAL n 
3  1244 ARG n 
3  1245 PRO n 
3  1246 LYS n 
3  1247 SER n 
3  1248 LEU n 
3  1249 ASP n 
3  1250 ALA n 
3  1251 GLU n 
3  1252 THR n 
3  1253 GLU n 
3  1254 ALA n 
3  1255 GLU n 
3  1256 GLU n 
3  1257 ASP n 
3  1258 HIS n 
3  1259 MET n 
3  1260 LEU n 
3  1261 LYS n 
3  1262 LYS n 
3  1263 ILE n 
3  1264 GLU n 
3  1265 ASN n 
3  1266 THR n 
3  1267 MET n 
3  1268 LEU n 
3  1269 GLU n 
3  1270 ASN n 
3  1271 ILE n 
3  1272 THR n 
3  1273 LEU n 
3  1274 ARG n 
3  1275 GLY n 
3  1276 VAL n 
3  1277 GLU n 
3  1278 ASN n 
3  1279 ILE n 
3  1280 GLU n 
3  1281 ARG n 
3  1282 VAL n 
3  1283 VAL n 
3  1284 MET n 
3  1285 MET n 
3  1286 LYS n 
3  1287 TYR n 
3  1288 ASP n 
3  1289 ARG n 
3  1290 LYS n 
3  1291 VAL n 
3  1292 PRO n 
3  1293 SER n 
3  1294 PRO n 
3  1295 THR n 
3  1296 GLY n 
3  1297 GLU n 
3  1298 TYR n 
3  1299 VAL n 
3  1300 LYS n 
3  1301 GLU n 
3  1302 PRO n 
3  1303 GLU n 
3  1304 TRP n 
3  1305 VAL n 
3  1306 LEU n 
3  1307 GLU n 
3  1308 THR n 
3  1309 ASP n 
3  1310 GLY n 
3  1311 VAL n 
3  1312 ASN n 
3  1313 LEU n 
3  1314 SER n 
3  1315 GLU n 
3  1316 VAL n 
3  1317 MET n 
3  1318 THR n 
3  1319 VAL n 
3  1320 PRO n 
3  1321 GLY n 
3  1322 ILE n 
3  1323 ASP n 
3  1324 PRO n 
3  1325 THR n 
3  1326 ARG n 
3  1327 ILE n 
3  1328 TYR n 
3  1329 THR n 
3  1330 ASN n 
3  1331 SER n 
3  1332 PHE n 
3  1333 ILE n 
3  1334 ASP n 
3  1335 ILE n 
3  1336 MET n 
3  1337 GLU n 
3  1338 VAL n 
3  1339 LEU n 
3  1340 GLY n 
3  1341 ILE n 
3  1342 GLU n 
3  1343 ALA n 
3  1344 GLY n 
3  1345 ARG n 
3  1346 ALA n 
3  1347 ALA n 
3  1348 LEU n 
3  1349 TYR n 
3  1350 LYS n 
3  1351 GLU n 
3  1352 VAL n 
3  1353 TYR n 
3  1354 ASN n 
3  1355 VAL n 
3  1356 ILE n 
3  1357 ALA n 
3  1358 SER n 
3  1359 ASP n 
3  1360 GLY n 
3  1361 SER n 
3  1362 TYR n 
3  1363 VAL n 
3  1364 ASN n 
3  1365 TYR n 
3  1366 ARG n 
3  1367 HIS n 
3  1368 MET n 
3  1369 ALA n 
3  1370 LEU n 
3  1371 LEU n 
3  1372 VAL n 
3  1373 ASP n 
3  1374 VAL n 
3  1375 MET n 
3  1376 THR n 
3  1377 THR n 
3  1378 GLN n 
3  1379 GLY n 
3  1380 GLY n 
3  1381 LEU n 
3  1382 THR n 
3  1383 SER n 
3  1384 VAL n 
3  1385 THR n 
3  1386 ARG n 
3  1387 HIS n 
3  1388 GLY n 
3  1389 PHE n 
3  1390 ASN n 
3  1391 ARG n 
3  1392 SER n 
3  1393 ASN n 
3  1394 THR n 
3  1395 GLY n 
3  1396 ALA n 
3  1397 LEU n 
3  1398 MET n 
3  1399 ARG n 
3  1400 CYS n 
3  1401 SER n 
3  1402 PHE n 
3  1403 GLU n 
3  1404 GLU n 
3  1405 THR n 
3  1406 VAL n 
3  1407 GLU n 
3  1408 ILE n 
3  1409 LEU n 
3  1410 PHE n 
3  1411 GLU n 
3  1412 ALA n 
3  1413 GLY n 
3  1414 ALA n 
3  1415 SER n 
3  1416 ALA n 
3  1417 GLU n 
3  1418 LEU n 
3  1419 ASP n 
3  1420 ASP n 
3  1421 CYS n 
3  1422 ARG n 
3  1423 GLY n 
3  1424 VAL n 
3  1425 SER n 
3  1426 GLU n 
3  1427 ASN n 
3  1428 VAL n 
3  1429 ILE n 
3  1430 LEU n 
3  1431 GLY n 
3  1432 GLN n 
3  1433 MET n 
3  1434 ALA n 
3  1435 PRO n 
3  1436 ILE n 
3  1437 GLY n 
3  1438 THR n 
3  1439 GLY n 
3  1440 ALA n 
3  1441 PHE n 
3  1442 ASP n 
3  1443 VAL n 
3  1444 MET n 
3  1445 ILE n 
3  1446 ASP n 
3  1447 GLU n 
3  1448 GLU n 
3  1449 SER n 
3  1450 LEU n 
3  1451 VAL n 
3  1452 LYS n 
3  1453 TYR n 
3  1454 MET n 
3  1455 PRO n 
3  1456 GLU n 
3  1457 GLN n 
3  1458 LYS n 
3  1459 ILE n 
3  1460 THR n 
3  1461 GLU n 
3  1462 ILE n 
3  1463 GLU n 
3  1464 ASP n 
3  1465 GLY n 
3  1466 GLN n 
3  1467 ASP n 
3  1468 GLY n 
3  1469 GLY n 
3  1470 VAL n 
3  1471 THR n 
3  1472 PRO n 
3  1473 TYR n 
3  1474 SER n 
3  1475 ASN n 
3  1476 GLU n 
3  1477 SER n 
3  1478 GLY n 
3  1479 LEU n 
3  1480 VAL n 
3  1481 ASN n 
3  1482 ALA n 
3  1483 ASP n 
3  1484 LEU n 
3  1485 ASP n 
3  1486 VAL n 
3  1487 LYS n 
3  1488 ASP n 
3  1489 GLU n 
3  1490 LEU n 
3  1491 MET n 
3  1492 PHE n 
3  1493 SER n 
3  1494 PRO n 
3  1495 LEU n 
3  1496 VAL n 
3  1497 ASP n 
3  1498 SER n 
3  1499 GLY n 
3  1500 SER n 
3  1501 ASN n 
3  1502 ASP n 
3  1503 ALA n 
3  1504 MET n 
3  1505 ALA n 
3  1506 GLY n 
3  1507 GLY n 
3  1508 PHE n 
3  1509 THR n 
3  1510 ALA n 
3  1511 TYR n 
3  1512 GLY n 
3  1513 GLY n 
3  1514 ALA n 
3  1515 ASP n 
3  1516 TYR n 
3  1517 GLY n 
3  1518 GLU n 
3  1519 ALA n 
3  1520 THR n 
3  1521 SER n 
3  1522 PRO n 
3  1523 PHE n 
3  1524 GLY n 
3  1525 ALA n 
3  1526 TYR n 
3  1527 GLY n 
3  1528 GLU n 
3  1529 ALA n 
3  1530 PRO n 
3  1531 THR n 
3  1532 SER n 
3  1533 PRO n 
3  1534 GLY n 
3  1535 PHE n 
3  1536 GLY n 
3  1537 VAL n 
3  1538 SER n 
3  1539 SER n 
3  1540 PRO n 
3  1541 GLY n 
3  1542 PHE n 
3  1543 SER n 
3  1544 PRO n 
3  1545 THR n 
3  1546 SER n 
3  1547 PRO n 
3  1548 THR n 
3  1549 TYR n 
3  1550 SER n 
3  1551 PRO n 
3  1552 THR n 
3  1553 SER n 
3  1554 PRO n 
3  1555 ALA n 
3  1556 TYR n 
3  1557 SER n 
3  1558 PRO n 
3  1559 THR n 
3  1560 SER n 
3  1561 PRO n 
3  1562 SER n 
3  1563 TYR n 
3  1564 SER n 
3  1565 PRO n 
3  1566 THR n 
3  1567 SER n 
3  1568 PRO n 
3  1569 SER n 
3  1570 TYR n 
3  1571 SER n 
3  1572 PRO n 
3  1573 THR n 
3  1574 SER n 
3  1575 PRO n 
3  1576 SER n 
3  1577 TYR n 
3  1578 SER n 
3  1579 PRO n 
3  1580 THR n 
3  1581 SER n 
3  1582 PRO n 
3  1583 SER n 
3  1584 TYR n 
3  1585 SER n 
3  1586 PRO n 
3  1587 THR n 
3  1588 SER n 
3  1589 PRO n 
3  1590 SER n 
3  1591 TYR n 
3  1592 SER n 
3  1593 PRO n 
3  1594 THR n 
3  1595 SER n 
3  1596 PRO n 
3  1597 SER n 
3  1598 TYR n 
3  1599 SER n 
3  1600 PRO n 
3  1601 THR n 
3  1602 SER n 
3  1603 PRO n 
3  1604 SER n 
3  1605 TYR n 
3  1606 SER n 
3  1607 PRO n 
3  1608 THR n 
3  1609 SER n 
3  1610 PRO n 
3  1611 SER n 
3  1612 TYR n 
3  1613 SER n 
3  1614 PRO n 
3  1615 THR n 
3  1616 SER n 
3  1617 PRO n 
3  1618 SER n 
3  1619 TYR n 
3  1620 SER n 
3  1621 PRO n 
3  1622 THR n 
3  1623 SER n 
3  1624 PRO n 
3  1625 SER n 
3  1626 TYR n 
3  1627 SER n 
3  1628 PRO n 
3  1629 THR n 
3  1630 SER n 
3  1631 PRO n 
3  1632 SER n 
3  1633 TYR n 
3  1634 SER n 
3  1635 PRO n 
3  1636 THR n 
3  1637 SER n 
3  1638 PRO n 
3  1639 SER n 
3  1640 TYR n 
3  1641 SER n 
3  1642 PRO n 
3  1643 THR n 
3  1644 SER n 
3  1645 PRO n 
3  1646 SER n 
3  1647 TYR n 
3  1648 SER n 
3  1649 PRO n 
3  1650 THR n 
3  1651 SER n 
3  1652 PRO n 
3  1653 SER n 
3  1654 TYR n 
3  1655 SER n 
3  1656 PRO n 
3  1657 THR n 
3  1658 SER n 
3  1659 PRO n 
3  1660 ALA n 
3  1661 TYR n 
3  1662 SER n 
3  1663 PRO n 
3  1664 THR n 
3  1665 SER n 
3  1666 PRO n 
3  1667 SER n 
3  1668 TYR n 
3  1669 SER n 
3  1670 PRO n 
3  1671 THR n 
3  1672 SER n 
3  1673 PRO n 
3  1674 SER n 
3  1675 TYR n 
3  1676 SER n 
3  1677 PRO n 
3  1678 THR n 
3  1679 SER n 
3  1680 PRO n 
3  1681 SER n 
3  1682 TYR n 
3  1683 SER n 
3  1684 PRO n 
3  1685 THR n 
3  1686 SER n 
3  1687 PRO n 
3  1688 SER n 
3  1689 TYR n 
3  1690 SER n 
3  1691 PRO n 
3  1692 THR n 
3  1693 SER n 
3  1694 PRO n 
3  1695 ASN n 
3  1696 TYR n 
3  1697 SER n 
3  1698 PRO n 
3  1699 THR n 
3  1700 SER n 
3  1701 PRO n 
3  1702 SER n 
3  1703 TYR n 
3  1704 SER n 
3  1705 PRO n 
3  1706 THR n 
3  1707 SER n 
3  1708 PRO n 
3  1709 GLY n 
3  1710 TYR n 
3  1711 SER n 
3  1712 PRO n 
3  1713 GLY n 
3  1714 SER n 
3  1715 PRO n 
3  1716 ALA n 
3  1717 TYR n 
3  1718 SER n 
3  1719 PRO n 
3  1720 LYS n 
3  1721 GLN n 
3  1722 ASP n 
3  1723 GLU n 
3  1724 GLN n 
3  1725 LYS n 
3  1726 HIS n 
3  1727 ASN n 
3  1728 GLU n 
3  1729 ASN n 
3  1730 GLU n 
3  1731 ASN n 
3  1732 SER n 
3  1733 ARG n 
4  1    MET n 
4  2    SER n 
4  3    ASP n 
4  4    LEU n 
4  5    ALA n 
4  6    ASN n 
4  7    SER n 
4  8    GLU n 
4  9    LYS n 
4  10   TYR n 
4  11   TYR n 
4  12   ASP n 
4  13   GLU n 
4  14   ASP n 
4  15   PRO n 
4  16   TYR n 
4  17   GLY n 
4  18   PHE n 
4  19   GLU n 
4  20   ASP n 
4  21   GLU n 
4  22   SER n 
4  23   ALA n 
4  24   PRO n 
4  25   ILE n 
4  26   THR n 
4  27   ALA n 
4  28   GLU n 
4  29   ASP n 
4  30   SER n 
4  31   TRP n 
4  32   ALA n 
4  33   VAL n 
4  34   ILE n 
4  35   SER n 
4  36   ALA n 
4  37   PHE n 
4  38   PHE n 
4  39   ARG n 
4  40   GLU n 
4  41   LYS n 
4  42   GLY n 
4  43   LEU n 
4  44   VAL n 
4  45   SER n 
4  46   GLN n 
4  47   GLN n 
4  48   LEU n 
4  49   ASP n 
4  50   SER n 
4  51   PHE n 
4  52   ASN n 
4  53   GLN n 
4  54   PHE n 
4  55   VAL n 
4  56   ASP n 
4  57   TYR n 
4  58   THR n 
4  59   LEU n 
4  60   GLN n 
4  61   ASP n 
4  62   ILE n 
4  63   ILE n 
4  64   CYS n 
4  65   GLU n 
4  66   ASP n 
4  67   SER n 
4  68   THR n 
4  69   LEU n 
4  70   ILE n 
4  71   LEU n 
4  72   GLU n 
4  73   GLN n 
4  74   LEU n 
4  75   ALA n 
4  76   GLN n 
4  77   HIS n 
4  78   THR n 
4  79   THR n 
4  80   GLU n 
4  81   SER n 
4  82   ASP n 
4  83   ASN n 
4  84   ILE n 
4  85   SER n 
4  86   ARG n 
4  87   LYS n 
4  88   TYR n 
4  89   GLU n 
4  90   ILE n 
4  91   SER n 
4  92   PHE n 
4  93   GLY n 
4  94   LYS n 
4  95   ILE n 
4  96   TYR n 
4  97   VAL n 
4  98   THR n 
4  99   LYS n 
4  100  PRO n 
4  101  MET n 
4  102  VAL n 
4  103  ASN n 
4  104  GLU n 
4  105  SER n 
4  106  ASP n 
4  107  GLY n 
4  108  VAL n 
4  109  THR n 
4  110  HIS n 
4  111  ALA n 
4  112  LEU n 
4  113  TYR n 
4  114  PRO n 
4  115  GLN n 
4  116  GLU n 
4  117  ALA n 
4  118  ARG n 
4  119  LEU n 
4  120  ARG n 
4  121  ASN n 
4  122  LEU n 
4  123  THR n 
4  124  TYR n 
4  125  SER n 
4  126  SER n 
4  127  GLY n 
4  128  LEU n 
4  129  PHE n 
4  130  VAL n 
4  131  ASP n 
4  132  VAL n 
4  133  LYS n 
4  134  LYS n 
4  135  ARG n 
4  136  THR n 
4  137  TYR n 
4  138  GLU n 
4  139  ALA n 
4  140  ILE n 
4  141  ASP n 
4  142  VAL n 
4  143  PRO n 
4  144  GLY n 
4  145  ARG n 
4  146  GLU n 
4  147  LEU n 
4  148  LYS n 
4  149  TYR n 
4  150  GLU n 
4  151  LEU n 
4  152  ILE n 
4  153  ALA n 
4  154  GLU n 
4  155  GLU n 
4  156  SER n 
4  157  GLU n 
4  158  ASP n 
4  159  ASP n 
4  160  SER n 
4  161  GLU n 
4  162  SER n 
4  163  GLY n 
4  164  LYS n 
4  165  VAL n 
4  166  PHE n 
4  167  ILE n 
4  168  GLY n 
4  169  ARG n 
4  170  LEU n 
4  171  PRO n 
4  172  ILE n 
4  173  MET n 
4  174  LEU n 
4  175  ARG n 
4  176  SER n 
4  177  LYS n 
4  178  ASN n 
4  179  CYS n 
4  180  TYR n 
4  181  LEU n 
4  182  SER n 
4  183  GLU n 
4  184  ALA n 
4  185  THR n 
4  186  GLU n 
4  187  SER n 
4  188  ASP n 
4  189  LEU n 
4  190  TYR n 
4  191  LYS n 
4  192  LEU n 
4  193  LYS n 
4  194  GLU n 
4  195  CYS n 
4  196  PRO n 
4  197  PHE n 
4  198  ASP n 
4  199  MET n 
4  200  GLY n 
4  201  GLY n 
4  202  TYR n 
4  203  PHE n 
4  204  ILE n 
4  205  ILE n 
4  206  ASN n 
4  207  GLY n 
4  208  SER n 
4  209  GLU n 
4  210  LYS n 
4  211  VAL n 
4  212  LEU n 
4  213  ILE n 
4  214  ALA n 
4  215  GLN n 
4  216  GLU n 
4  217  ARG n 
4  218  SER n 
4  219  ALA n 
4  220  GLY n 
4  221  ASN n 
4  222  ILE n 
4  223  VAL n 
4  224  GLN n 
4  225  VAL n 
4  226  PHE n 
4  227  LYS n 
4  228  LYS n 
4  229  ALA n 
4  230  ALA n 
4  231  PRO n 
4  232  SER n 
4  233  PRO n 
4  234  ILE n 
4  235  SER n 
4  236  HIS n 
4  237  VAL n 
4  238  ALA n 
4  239  GLU n 
4  240  ILE n 
4  241  ARG n 
4  242  SER n 
4  243  ALA n 
4  244  LEU n 
4  245  GLU n 
4  246  LYS n 
4  247  GLY n 
4  248  SER n 
4  249  ARG n 
4  250  PHE n 
4  251  ILE n 
4  252  SER n 
4  253  THR n 
4  254  LEU n 
4  255  GLN n 
4  256  VAL n 
4  257  LYS n 
4  258  LEU n 
4  259  TYR n 
4  260  GLY n 
4  261  ARG n 
4  262  GLU n 
4  263  GLY n 
4  264  SER n 
4  265  SER n 
4  266  ALA n 
4  267  ARG n 
4  268  THR n 
4  269  ILE n 
4  270  LYS n 
4  271  ALA n 
4  272  THR n 
4  273  LEU n 
4  274  PRO n 
4  275  TYR n 
4  276  ILE n 
4  277  LYS n 
4  278  GLN n 
4  279  ASP n 
4  280  ILE n 
4  281  PRO n 
4  282  ILE n 
4  283  VAL n 
4  284  ILE n 
4  285  ILE n 
4  286  PHE n 
4  287  ARG n 
4  288  ALA n 
4  289  LEU n 
4  290  GLY n 
4  291  ILE n 
4  292  ILE n 
4  293  PRO n 
4  294  ASP n 
4  295  GLY n 
4  296  GLU n 
4  297  ILE n 
4  298  LEU n 
4  299  GLU n 
4  300  HIS n 
4  301  ILE n 
4  302  CYS n 
4  303  TYR n 
4  304  ASP n 
4  305  VAL n 
4  306  ASN n 
4  307  ASP n 
4  308  TRP n 
4  309  GLN n 
4  310  MET n 
4  311  LEU n 
4  312  GLU n 
4  313  MET n 
4  314  LEU n 
4  315  LYS n 
4  316  PRO n 
4  317  CYS n 
4  318  VAL n 
4  319  GLU n 
4  320  ASP n 
4  321  GLY n 
4  322  PHE n 
4  323  VAL n 
4  324  ILE n 
4  325  GLN n 
4  326  ASP n 
4  327  ARG n 
4  328  GLU n 
4  329  THR n 
4  330  ALA n 
4  331  LEU n 
4  332  ASP n 
4  333  PHE n 
4  334  ILE n 
4  335  GLY n 
4  336  ARG n 
4  337  ARG n 
4  338  GLY n 
4  339  THR n 
4  340  ALA n 
4  341  LEU n 
4  342  GLY n 
4  343  ILE n 
4  344  LYS n 
4  345  LYS n 
4  346  GLU n 
4  347  LYS n 
4  348  ARG n 
4  349  ILE n 
4  350  GLN n 
4  351  TYR n 
4  352  ALA n 
4  353  LYS n 
4  354  ASP n 
4  355  ILE n 
4  356  LEU n 
4  357  GLN n 
4  358  LYS n 
4  359  GLU n 
4  360  PHE n 
4  361  LEU n 
4  362  PRO n 
4  363  HIS n 
4  364  ILE n 
4  365  THR n 
4  366  GLN n 
4  367  LEU n 
4  368  GLU n 
4  369  GLY n 
4  370  PHE n 
4  371  GLU n 
4  372  SER n 
4  373  ARG n 
4  374  LYS n 
4  375  ALA n 
4  376  PHE n 
4  377  PHE n 
4  378  LEU n 
4  379  GLY n 
4  380  TYR n 
4  381  MET n 
4  382  ILE n 
4  383  ASN n 
4  384  ARG n 
4  385  LEU n 
4  386  LEU n 
4  387  LEU n 
4  388  CYS n 
4  389  ALA n 
4  390  LEU n 
4  391  ASP n 
4  392  ARG n 
4  393  LYS n 
4  394  ASP n 
4  395  GLN n 
4  396  ASP n 
4  397  ASP n 
4  398  ARG n 
4  399  ASP n 
4  400  HIS n 
4  401  PHE n 
4  402  GLY n 
4  403  LYS n 
4  404  LYS n 
4  405  ARG n 
4  406  LEU n 
4  407  ASP n 
4  408  LEU n 
4  409  ALA n 
4  410  GLY n 
4  411  PRO n 
4  412  LEU n 
4  413  LEU n 
4  414  ALA n 
4  415  GLN n 
4  416  LEU n 
4  417  PHE n 
4  418  LYS n 
4  419  THR n 
4  420  LEU n 
4  421  PHE n 
4  422  LYS n 
4  423  LYS n 
4  424  LEU n 
4  425  THR n 
4  426  LYS n 
4  427  ASP n 
4  428  ILE n 
4  429  PHE n 
4  430  ARG n 
4  431  TYR n 
4  432  MET n 
4  433  GLN n 
4  434  ARG n 
4  435  THR n 
4  436  VAL n 
4  437  GLU n 
4  438  GLU n 
4  439  ALA n 
4  440  HIS n 
4  441  ASP n 
4  442  PHE n 
4  443  ASN n 
4  444  MET n 
4  445  LYS n 
4  446  LEU n 
4  447  ALA n 
4  448  ILE n 
4  449  ASN n 
4  450  ALA n 
4  451  LYS n 
4  452  THR n 
4  453  ILE n 
4  454  THR n 
4  455  SER n 
4  456  GLY n 
4  457  LEU n 
4  458  LYS n 
4  459  TYR n 
4  460  ALA n 
4  461  LEU n 
4  462  ALA n 
4  463  THR n 
4  464  GLY n 
4  465  ASN n 
4  466  TRP n 
4  467  GLY n 
4  468  GLU n 
4  469  GLN n 
4  470  LYS n 
4  471  LYS n 
4  472  ALA n 
4  473  MET n 
4  474  SER n 
4  475  SER n 
4  476  ARG n 
4  477  ALA n 
4  478  GLY n 
4  479  VAL n 
4  480  SER n 
4  481  GLN n 
4  482  VAL n 
4  483  LEU n 
4  484  ASN n 
4  485  ARG n 
4  486  TYR n 
4  487  THR n 
4  488  TYR n 
4  489  SER n 
4  490  SER n 
4  491  THR n 
4  492  LEU n 
4  493  SER n 
4  494  HIS n 
4  495  LEU n 
4  496  ARG n 
4  497  ARG n 
4  498  THR n 
4  499  ASN n 
4  500  THR n 
4  501  PRO n 
4  502  ILE n 
4  503  GLY n 
4  504  ARG n 
4  505  ASP n 
4  506  GLY n 
4  507  LYS n 
4  508  LEU n 
4  509  ALA n 
4  510  LYS n 
4  511  PRO n 
4  512  ARG n 
4  513  GLN n 
4  514  LEU n 
4  515  HIS n 
4  516  ASN n 
4  517  THR n 
4  518  HIS n 
4  519  TRP n 
4  520  GLY n 
4  521  LEU n 
4  522  VAL n 
4  523  CYS n 
4  524  PRO n 
4  525  ALA n 
4  526  GLU n 
4  527  THR n 
4  528  PRO n 
4  529  GLU n 
4  530  GLY n 
4  531  GLN n 
4  532  ALA n 
4  533  CYS n 
4  534  GLY n 
4  535  LEU n 
4  536  VAL n 
4  537  LYS n 
4  538  ASN n 
4  539  LEU n 
4  540  SER n 
4  541  LEU n 
4  542  MET n 
4  543  SER n 
4  544  CYS n 
4  545  ILE n 
4  546  SER n 
4  547  VAL n 
4  548  GLY n 
4  549  THR n 
4  550  ASP n 
4  551  PRO n 
4  552  MET n 
4  553  PRO n 
4  554  ILE n 
4  555  ILE n 
4  556  THR n 
4  557  PHE n 
4  558  LEU n 
4  559  SER n 
4  560  GLU n 
4  561  TRP n 
4  562  GLY n 
4  563  MET n 
4  564  GLU n 
4  565  PRO n 
4  566  LEU n 
4  567  GLU n 
4  568  ASP n 
4  569  TYR n 
4  570  VAL n 
4  571  PRO n 
4  572  HIS n 
4  573  GLN n 
4  574  SER n 
4  575  PRO n 
4  576  ASP n 
4  577  ALA n 
4  578  THR n 
4  579  ARG n 
4  580  VAL n 
4  581  PHE n 
4  582  VAL n 
4  583  ASN n 
4  584  GLY n 
4  585  VAL n 
4  586  TRP n 
4  587  HIS n 
4  588  GLY n 
4  589  VAL n 
4  590  HIS n 
4  591  ARG n 
4  592  ASN n 
4  593  PRO n 
4  594  ALA n 
4  595  ARG n 
4  596  LEU n 
4  597  MET n 
4  598  GLU n 
4  599  THR n 
4  600  LEU n 
4  601  ARG n 
4  602  THR n 
4  603  LEU n 
4  604  ARG n 
4  605  ARG n 
4  606  LYS n 
4  607  GLY n 
4  608  ASP n 
4  609  ILE n 
4  610  ASN n 
4  611  PRO n 
4  612  GLU n 
4  613  VAL n 
4  614  SER n 
4  615  MET n 
4  616  ILE n 
4  617  ARG n 
4  618  ASP n 
4  619  ILE n 
4  620  ARG n 
4  621  GLU n 
4  622  LYS n 
4  623  GLU n 
4  624  LEU n 
4  625  LYS n 
4  626  ILE n 
4  627  PHE n 
4  628  THR n 
4  629  ASP n 
4  630  ALA n 
4  631  GLY n 
4  632  ARG n 
4  633  VAL n 
4  634  TYR n 
4  635  ARG n 
4  636  PRO n 
4  637  LEU n 
4  638  PHE n 
4  639  ILE n 
4  640  VAL n 
4  641  GLU n 
4  642  ASP n 
4  643  ASP n 
4  644  GLU n 
4  645  SER n 
4  646  LEU n 
4  647  GLY n 
4  648  HIS n 
4  649  LYS n 
4  650  GLU n 
4  651  LEU n 
4  652  LYS n 
4  653  VAL n 
4  654  ARG n 
4  655  LYS n 
4  656  GLY n 
4  657  HIS n 
4  658  ILE n 
4  659  ALA n 
4  660  LYS n 
4  661  LEU n 
4  662  MET n 
4  663  ALA n 
4  664  THR n 
4  665  GLU n 
4  666  TYR n 
4  667  GLN n 
4  668  ASP n 
4  669  ILE n 
4  670  GLU n 
4  671  GLY n 
4  672  GLY n 
4  673  PHE n 
4  674  GLU n 
4  675  ASP n 
4  676  VAL n 
4  677  GLU n 
4  678  GLU n 
4  679  TYR n 
4  680  THR n 
4  681  TRP n 
4  682  SER n 
4  683  SER n 
4  684  LEU n 
4  685  LEU n 
4  686  ASN n 
4  687  GLU n 
4  688  GLY n 
4  689  LEU n 
4  690  VAL n 
4  691  GLU n 
4  692  TYR n 
4  693  ILE n 
4  694  ASP n 
4  695  ALA n 
4  696  GLU n 
4  697  GLU n 
4  698  GLU n 
4  699  GLU n 
4  700  SER n 
4  701  ILE n 
4  702  LEU n 
4  703  ILE n 
4  704  ALA n 
4  705  MET n 
4  706  GLN n 
4  707  PRO n 
4  708  GLU n 
4  709  ASP n 
4  710  LEU n 
4  711  GLU n 
4  712  PRO n 
4  713  ALA n 
4  714  GLU n 
4  715  ALA n 
4  716  ASN n 
4  717  GLU n 
4  718  GLU n 
4  719  ASN n 
4  720  ASP n 
4  721  LEU n 
4  722  ASP n 
4  723  VAL n 
4  724  ASP n 
4  725  PRO n 
4  726  ALA n 
4  727  LYS n 
4  728  ARG n 
4  729  ILE n 
4  730  ARG n 
4  731  VAL n 
4  732  SER n 
4  733  HIS n 
4  734  HIS n 
4  735  ALA n 
4  736  THR n 
4  737  THR n 
4  738  PHE n 
4  739  THR n 
4  740  HIS n 
4  741  CYS n 
4  742  GLU n 
4  743  ILE n 
4  744  HIS n 
4  745  PRO n 
4  746  SER n 
4  747  MET n 
4  748  ILE n 
4  749  LEU n 
4  750  GLY n 
4  751  VAL n 
4  752  ALA n 
4  753  ALA n 
4  754  SER n 
4  755  ILE n 
4  756  ILE n 
4  757  PRO n 
4  758  PHE n 
4  759  PRO n 
4  760  ASP n 
4  761  HIS n 
4  762  ASN n 
4  763  GLN n 
4  764  SER n 
4  765  PRO n 
4  766  ARG n 
4  767  ASN n 
4  768  THR n 
4  769  TYR n 
4  770  GLN n 
4  771  SER n 
4  772  ALA n 
4  773  MET n 
4  774  GLY n 
4  775  LYS n 
4  776  GLN n 
4  777  ALA n 
4  778  MET n 
4  779  GLY n 
4  780  VAL n 
4  781  PHE n 
4  782  LEU n 
4  783  THR n 
4  784  ASN n 
4  785  TYR n 
4  786  ASN n 
4  787  VAL n 
4  788  ARG n 
4  789  MET n 
4  790  ASP n 
4  791  THR n 
4  792  MET n 
4  793  ALA n 
4  794  ASN n 
4  795  ILE n 
4  796  LEU n 
4  797  TYR n 
4  798  TYR n 
4  799  PRO n 
4  800  GLN n 
4  801  LYS n 
4  802  PRO n 
4  803  LEU n 
4  804  GLY n 
4  805  THR n 
4  806  THR n 
4  807  ARG n 
4  808  ALA n 
4  809  MET n 
4  810  GLU n 
4  811  TYR n 
4  812  LEU n 
4  813  LYS n 
4  814  PHE n 
4  815  ARG n 
4  816  GLU n 
4  817  LEU n 
4  818  PRO n 
4  819  ALA n 
4  820  GLY n 
4  821  GLN n 
4  822  ASN n 
4  823  ALA n 
4  824  ILE n 
4  825  VAL n 
4  826  ALA n 
4  827  ILE n 
4  828  ALA n 
4  829  CYS n 
4  830  TYR n 
4  831  SER n 
4  832  GLY n 
4  833  TYR n 
4  834  ASN n 
4  835  GLN n 
4  836  GLU n 
4  837  ASP n 
4  838  SER n 
4  839  MET n 
4  840  ILE n 
4  841  MET n 
4  842  ASN n 
4  843  GLN n 
4  844  SER n 
4  845  SER n 
4  846  ILE n 
4  847  ASP n 
4  848  ARG n 
4  849  GLY n 
4  850  LEU n 
4  851  PHE n 
4  852  ARG n 
4  853  SER n 
4  854  LEU n 
4  855  PHE n 
4  856  PHE n 
4  857  ARG n 
4  858  SER n 
4  859  TYR n 
4  860  MET n 
4  861  ASP n 
4  862  GLN n 
4  863  GLU n 
4  864  LYS n 
4  865  LYS n 
4  866  TYR n 
4  867  GLY n 
4  868  MET n 
4  869  SER n 
4  870  ILE n 
4  871  THR n 
4  872  GLU n 
4  873  THR n 
4  874  PHE n 
4  875  GLU n 
4  876  LYS n 
4  877  PRO n 
4  878  GLN n 
4  879  ARG n 
4  880  THR n 
4  881  ASN n 
4  882  THR n 
4  883  LEU n 
4  884  ARG n 
4  885  MET n 
4  886  LYS n 
4  887  HIS n 
4  888  GLY n 
4  889  THR n 
4  890  TYR n 
4  891  ASP n 
4  892  LYS n 
4  893  LEU n 
4  894  ASP n 
4  895  ASP n 
4  896  ASP n 
4  897  GLY n 
4  898  LEU n 
4  899  ILE n 
4  900  ALA n 
4  901  PRO n 
4  902  GLY n 
4  903  VAL n 
4  904  ARG n 
4  905  VAL n 
4  906  SER n 
4  907  GLY n 
4  908  GLU n 
4  909  ASP n 
4  910  VAL n 
4  911  ILE n 
4  912  ILE n 
4  913  GLY n 
4  914  LYS n 
4  915  THR n 
4  916  THR n 
4  917  PRO n 
4  918  ILE n 
4  919  SER n 
4  920  PRO n 
4  921  ASP n 
4  922  GLU n 
4  923  GLU n 
4  924  GLU n 
4  925  LEU n 
4  926  GLY n 
4  927  GLN n 
4  928  ARG n 
4  929  THR n 
4  930  ALA n 
4  931  TYR n 
4  932  HIS n 
4  933  SER n 
4  934  LYS n 
4  935  ARG n 
4  936  ASP n 
4  937  ALA n 
4  938  SER n 
4  939  THR n 
4  940  PRO n 
4  941  LEU n 
4  942  ARG n 
4  943  SER n 
4  944  THR n 
4  945  GLU n 
4  946  ASN n 
4  947  GLY n 
4  948  ILE n 
4  949  VAL n 
4  950  ASP n 
4  951  GLN n 
4  952  VAL n 
4  953  LEU n 
4  954  VAL n 
4  955  THR n 
4  956  THR n 
4  957  ASN n 
4  958  GLN n 
4  959  ASP n 
4  960  GLY n 
4  961  LEU n 
4  962  LYS n 
4  963  PHE n 
4  964  VAL n 
4  965  LYS n 
4  966  VAL n 
4  967  ARG n 
4  968  VAL n 
4  969  ARG n 
4  970  THR n 
4  971  THR n 
4  972  LYS n 
4  973  ILE n 
4  974  PRO n 
4  975  GLN n 
4  976  ILE n 
4  977  GLY n 
4  978  ASP n 
4  979  LYS n 
4  980  PHE n 
4  981  ALA n 
4  982  SER n 
4  983  ARG n 
4  984  HIS n 
4  985  GLY n 
4  986  GLN n 
4  987  LYS n 
4  988  GLY n 
4  989  THR n 
4  990  ILE n 
4  991  GLY n 
4  992  ILE n 
4  993  THR n 
4  994  TYR n 
4  995  ARG n 
4  996  ARG n 
4  997  GLU n 
4  998  ASP n 
4  999  MET n 
4  1000 PRO n 
4  1001 PHE n 
4  1002 THR n 
4  1003 ALA n 
4  1004 GLU n 
4  1005 GLY n 
4  1006 ILE n 
4  1007 VAL n 
4  1008 PRO n 
4  1009 ASP n 
4  1010 LEU n 
4  1011 ILE n 
4  1012 ILE n 
4  1013 ASN n 
4  1014 PRO n 
4  1015 HIS n 
4  1016 ALA n 
4  1017 ILE n 
4  1018 PRO n 
4  1019 SER n 
4  1020 ARG n 
4  1021 MET n 
4  1022 THR n 
4  1023 VAL n 
4  1024 ALA n 
4  1025 HIS n 
4  1026 LEU n 
4  1027 ILE n 
4  1028 GLU n 
4  1029 CYS n 
4  1030 LEU n 
4  1031 LEU n 
4  1032 SER n 
4  1033 LYS n 
4  1034 VAL n 
4  1035 ALA n 
4  1036 ALA n 
4  1037 LEU n 
4  1038 SER n 
4  1039 GLY n 
4  1040 ASN n 
4  1041 GLU n 
4  1042 GLY n 
4  1043 ASP n 
4  1044 ALA n 
4  1045 SER n 
4  1046 PRO n 
4  1047 PHE n 
4  1048 THR n 
4  1049 ASP n 
4  1050 ILE n 
4  1051 THR n 
4  1052 VAL n 
4  1053 GLU n 
4  1054 GLY n 
4  1055 ILE n 
4  1056 SER n 
4  1057 LYS n 
4  1058 LEU n 
4  1059 LEU n 
4  1060 ARG n 
4  1061 GLU n 
4  1062 HIS n 
4  1063 GLY n 
4  1064 TYR n 
4  1065 GLN n 
4  1066 SER n 
4  1067 ARG n 
4  1068 GLY n 
4  1069 PHE n 
4  1070 GLU n 
4  1071 VAL n 
4  1072 MET n 
4  1073 TYR n 
4  1074 ASN n 
4  1075 GLY n 
4  1076 HIS n 
4  1077 THR n 
4  1078 GLY n 
4  1079 LYS n 
4  1080 LYS n 
4  1081 LEU n 
4  1082 MET n 
4  1083 ALA n 
4  1084 GLN n 
4  1085 ILE n 
4  1086 PHE n 
4  1087 PHE n 
4  1088 GLY n 
4  1089 PRO n 
4  1090 THR n 
4  1091 TYR n 
4  1092 TYR n 
4  1093 GLN n 
4  1094 ARG n 
4  1095 LEU n 
4  1096 ARG n 
4  1097 HIS n 
4  1098 MET n 
4  1099 VAL n 
4  1100 ASP n 
4  1101 ASP n 
4  1102 LYS n 
4  1103 ILE n 
4  1104 HIS n 
4  1105 ALA n 
4  1106 ARG n 
4  1107 ALA n 
4  1108 ARG n 
4  1109 GLY n 
4  1110 PRO n 
4  1111 MET n 
4  1112 GLN n 
4  1113 VAL n 
4  1114 LEU n 
4  1115 THR n 
4  1116 ARG n 
4  1117 GLN n 
4  1118 PRO n 
4  1119 VAL n 
4  1120 GLU n 
4  1121 GLY n 
4  1122 ARG n 
4  1123 SER n 
4  1124 ARG n 
4  1125 ASP n 
4  1126 GLY n 
4  1127 GLY n 
4  1128 LEU n 
4  1129 ARG n 
4  1130 PHE n 
4  1131 GLY n 
4  1132 GLU n 
4  1133 MET n 
4  1134 GLU n 
4  1135 ARG n 
4  1136 ASP n 
4  1137 CYS n 
4  1138 MET n 
4  1139 ILE n 
4  1140 ALA n 
4  1141 HIS n 
4  1142 GLY n 
4  1143 ALA n 
4  1144 ALA n 
4  1145 SER n 
4  1146 PHE n 
4  1147 LEU n 
4  1148 LYS n 
4  1149 GLU n 
4  1150 ARG n 
4  1151 LEU n 
4  1152 MET n 
4  1153 GLU n 
4  1154 ALA n 
4  1155 SER n 
4  1156 ASP n 
4  1157 ALA n 
4  1158 PHE n 
4  1159 ARG n 
4  1160 VAL n 
4  1161 HIS n 
4  1162 ILE n 
4  1163 CYS n 
4  1164 GLY n 
4  1165 ILE n 
4  1166 CYS n 
4  1167 GLY n 
4  1168 LEU n 
4  1169 MET n 
4  1170 THR n 
4  1171 VAL n 
4  1172 ILE n 
4  1173 ALA n 
4  1174 LYS n 
4  1175 LEU n 
4  1176 ASN n 
4  1177 HIS n 
4  1178 ASN n 
4  1179 GLN n 
4  1180 PHE n 
4  1181 GLU n 
4  1182 CYS n 
4  1183 LYS n 
4  1184 GLY n 
4  1185 CYS n 
4  1186 ASP n 
4  1187 ASN n 
4  1188 LYS n 
4  1189 ILE n 
4  1190 ASP n 
4  1191 ILE n 
4  1192 TYR n 
4  1193 GLN n 
4  1194 ILE n 
4  1195 HIS n 
4  1196 ILE n 
4  1197 PRO n 
4  1198 TYR n 
4  1199 ALA n 
4  1200 ALA n 
4  1201 LYS n 
4  1202 LEU n 
4  1203 LEU n 
4  1204 PHE n 
4  1205 GLN n 
4  1206 GLU n 
4  1207 LEU n 
4  1208 MET n 
4  1209 ALA n 
4  1210 MET n 
4  1211 ASN n 
4  1212 ILE n 
4  1213 THR n 
4  1214 PRO n 
4  1215 ARG n 
4  1216 LEU n 
4  1217 TYR n 
4  1218 THR n 
4  1219 ASP n 
4  1220 ARG n 
4  1221 SER n 
4  1222 ARG n 
4  1223 ASP n 
4  1224 PHE n 
5  1    MET n 
5  2    SER n 
5  3    GLU n 
5  4    GLU n 
5  5    GLY n 
5  6    PRO n 
5  7    GLN n 
5  8    VAL n 
5  9    LYS n 
5  10   ILE n 
5  11   ARG n 
5  12   GLU n 
5  13   ALA n 
5  14   SER n 
5  15   LYS n 
5  16   ASP n 
5  17   ASN n 
5  18   VAL n 
5  19   ASP n 
5  20   PHE n 
5  21   ILE n 
5  22   LEU n 
5  23   SER n 
5  24   ASN n 
5  25   VAL n 
5  26   ASP n 
5  27   LEU n 
5  28   ALA n 
5  29   MET n 
5  30   ALA n 
5  31   ASN n 
5  32   SER n 
5  33   LEU n 
5  34   ARG n 
5  35   ARG n 
5  36   VAL n 
5  37   MET n 
5  38   ILE n 
5  39   ALA n 
5  40   GLU n 
5  41   ILE n 
5  42   PRO n 
5  43   THR n 
5  44   LEU n 
5  45   ALA n 
5  46   ILE n 
5  47   ASP n 
5  48   SER n 
5  49   VAL n 
5  50   GLU n 
5  51   VAL n 
5  52   GLU n 
5  53   THR n 
5  54   ASN n 
5  55   THR n 
5  56   THR n 
5  57   VAL n 
5  58   LEU n 
5  59   ALA n 
5  60   ASP n 
5  61   GLU n 
5  62   PHE n 
5  63   ILE n 
5  64   ALA n 
5  65   HIS n 
5  66   ARG n 
5  67   LEU n 
5  68   GLY n 
5  69   LEU n 
5  70   ILE n 
5  71   PRO n 
5  72   LEU n 
5  73   GLN n 
5  74   SER n 
5  75   MET n 
5  76   ASP n 
5  77   ILE n 
5  78   GLU n 
5  79   GLN n 
5  80   LEU n 
5  81   GLU n 
5  82   TYR n 
5  83   SER n 
5  84   ARG n 
5  85   ASP n 
5  86   CYS n 
5  87   PHE n 
5  88   CYS n 
5  89   GLU n 
5  90   ASP n 
5  91   HIS n 
5  92   CYS n 
5  93   ASP n 
5  94   LYS n 
5  95   CYS n 
5  96   SER n 
5  97   VAL n 
5  98   VAL n 
5  99   LEU n 
5  100  THR n 
5  101  LEU n 
5  102  GLN n 
5  103  ALA n 
5  104  PHE n 
5  105  GLY n 
5  106  GLU n 
5  107  SER n 
5  108  GLU n 
5  109  SER n 
5  110  THR n 
5  111  THR n 
5  112  ASN n 
5  113  VAL n 
5  114  TYR n 
5  115  SER n 
5  116  LYS n 
5  117  ASP n 
5  118  LEU n 
5  119  VAL n 
5  120  ILE n 
5  121  VAL n 
5  122  SER n 
5  123  ASN n 
5  124  LEU n 
5  125  MET n 
5  126  GLY n 
5  127  ARG n 
5  128  ASN n 
5  129  ILE n 
5  130  GLY n 
5  131  HIS n 
5  132  PRO n 
5  133  ILE n 
5  134  ILE n 
5  135  GLN n 
5  136  ASP n 
5  137  LYS n 
5  138  GLU n 
5  139  GLY n 
5  140  ASN n 
5  141  GLY n 
5  142  VAL n 
5  143  LEU n 
5  144  ILE n 
5  145  CYS n 
5  146  LYS n 
5  147  LEU n 
5  148  ARG n 
5  149  LYS n 
5  150  GLY n 
5  151  GLN n 
5  152  GLU n 
5  153  LEU n 
5  154  LYS n 
5  155  LEU n 
5  156  THR n 
5  157  CYS n 
5  158  VAL n 
5  159  ALA n 
5  160  LYS n 
5  161  LYS n 
5  162  GLY n 
5  163  ILE n 
5  164  ALA n 
5  165  LYS n 
5  166  GLU n 
5  167  HIS n 
5  168  ALA n 
5  169  LYS n 
5  170  TRP n 
5  171  GLY n 
5  172  PRO n 
5  173  ALA n 
5  174  ALA n 
5  175  ALA n 
5  176  ILE n 
5  177  GLU n 
5  178  PHE n 
5  179  GLU n 
5  180  TYR n 
5  181  ASP n 
5  182  PRO n 
5  183  TRP n 
5  184  ASN n 
5  185  LYS n 
5  186  LEU n 
5  187  LYS n 
5  188  HIS n 
5  189  THR n 
5  190  ASP n 
5  191  TYR n 
5  192  TRP n 
5  193  TYR n 
5  194  GLU n 
5  195  GLN n 
5  196  ASP n 
5  197  SER n 
5  198  ALA n 
5  199  LYS n 
5  200  GLU n 
5  201  TRP n 
5  202  PRO n 
5  203  GLN n 
5  204  SER n 
5  205  LYS n 
5  206  ASN n 
5  207  CYS n 
5  208  GLU n 
5  209  TYR n 
5  210  GLU n 
5  211  ASP n 
5  212  PRO n 
5  213  PRO n 
5  214  ASN n 
5  215  GLU n 
5  216  GLY n 
5  217  ASP n 
5  218  PRO n 
5  219  PHE n 
5  220  ASP n 
5  221  TYR n 
5  222  LYS n 
5  223  ALA n 
5  224  GLN n 
5  225  ALA n 
5  226  ASP n 
5  227  THR n 
5  228  PHE n 
5  229  TYR n 
5  230  MET n 
5  231  ASN n 
5  232  VAL n 
5  233  GLU n 
5  234  SER n 
5  235  VAL n 
5  236  GLY n 
5  237  SER n 
5  238  ILE n 
5  239  PRO n 
5  240  VAL n 
5  241  ASP n 
5  242  GLN n 
5  243  VAL n 
5  244  VAL n 
5  245  VAL n 
5  246  ARG n 
5  247  GLY n 
5  248  ILE n 
5  249  ASP n 
5  250  THR n 
5  251  LEU n 
5  252  GLN n 
5  253  LYS n 
5  254  LYS n 
5  255  VAL n 
5  256  ALA n 
5  257  SER n 
5  258  ILE n 
5  259  LEU n 
5  260  LEU n 
5  261  ALA n 
5  262  LEU n 
5  263  THR n 
5  264  GLN n 
5  265  MET n 
5  266  ASP n 
5  267  GLN n 
5  268  ASP n 
5  269  LYS n 
5  270  VAL n 
5  271  ASN n 
5  272  PHE n 
5  273  ALA n 
5  274  SER n 
5  275  GLY n 
5  276  ASP n 
5  277  ASN n 
5  278  ASN n 
5  279  THR n 
5  280  ALA n 
5  281  SER n 
5  282  ASN n 
5  283  MET n 
5  284  LEU n 
5  285  GLY n 
5  286  SER n 
5  287  ASN n 
5  288  GLU n 
5  289  ASP n 
5  290  VAL n 
5  291  MET n 
5  292  MET n 
5  293  THR n 
5  294  GLY n 
5  295  ALA n 
5  296  GLU n 
5  297  GLN n 
5  298  ASP n 
5  299  PRO n 
5  300  TYR n 
5  301  SER n 
5  302  ASN n 
5  303  ALA n 
5  304  SER n 
5  305  GLN n 
5  306  MET n 
5  307  GLY n 
5  308  ASN n 
5  309  THR n 
5  310  GLY n 
5  311  SER n 
5  312  GLY n 
5  313  GLY n 
5  314  TYR n 
5  315  ASP n 
5  316  ASN n 
5  317  ALA n 
5  318  TRP n 
6  1    MET n 
6  2    ASP n 
6  3    GLN n 
6  4    GLU n 
6  5    ASN n 
6  6    GLU n 
6  7    ARG n 
6  8    ASN n 
6  9    ILE n 
6  10   SER n 
6  11   ARG n 
6  12   LEU n 
6  13   TRP n 
6  14   ARG n 
6  15   ALA n 
6  16   PHE n 
6  17   ARG n 
6  18   THR n 
6  19   VAL n 
6  20   LYS n 
6  21   GLU n 
6  22   MET n 
6  23   VAL n 
6  24   LYS n 
6  25   ASP n 
6  26   ARG n 
6  27   GLY n 
6  28   TYR n 
6  29   PHE n 
6  30   ILE n 
6  31   THR n 
6  32   GLN n 
6  33   GLU n 
6  34   GLU n 
6  35   VAL n 
6  36   GLU n 
6  37   LEU n 
6  38   PRO n 
6  39   LEU n 
6  40   GLU n 
6  41   ASP n 
6  42   PHE n 
6  43   LYS n 
6  44   ALA n 
6  45   LYS n 
6  46   TYR n 
6  47   CYS n 
6  48   ASP n 
6  49   SER n 
6  50   MET n 
6  51   GLY n 
6  52   ARG n 
6  53   PRO n 
6  54   GLN n 
6  55   ARG n 
6  56   LYS n 
6  57   MET n 
6  58   MET n 
6  59   SER n 
6  60   PHE n 
6  61   GLN n 
6  62   ALA n 
6  63   ASN n 
6  64   PRO n 
6  65   THR n 
6  66   GLU n 
6  67   GLU n 
6  68   SER n 
6  69   ILE n 
6  70   SER n 
6  71   LYS n 
6  72   PHE n 
6  73   PRO n 
6  74   ASP n 
6  75   MET n 
6  76   GLY n 
6  77   SER n 
6  78   LEU n 
6  79   TRP n 
6  80   VAL n 
6  81   GLU n 
6  82   PHE n 
6  83   CYS n 
6  84   ASP n 
6  85   GLU n 
6  86   PRO n 
6  87   SER n 
6  88   VAL n 
6  89   GLY n 
6  90   VAL n 
6  91   LYS n 
6  92   THR n 
6  93   MET n 
6  94   LYS n 
6  95   THR n 
6  96   PHE n 
6  97   VAL n 
6  98   ILE n 
6  99   HIS n 
6  100  ILE n 
6  101  GLN n 
6  102  GLU n 
6  103  LYS n 
6  104  ASN n 
6  105  PHE n 
6  106  GLN n 
6  107  THR n 
6  108  GLY n 
6  109  ILE n 
6  110  PHE n 
6  111  VAL n 
6  112  TYR n 
6  113  GLN n 
6  114  ASN n 
6  115  ASN n 
6  116  ILE n 
6  117  THR n 
6  118  PRO n 
6  119  SER n 
6  120  ALA n 
6  121  MET n 
6  122  LYS n 
6  123  LEU n 
6  124  VAL n 
6  125  PRO n 
6  126  SER n 
6  127  ILE n 
6  128  PRO n 
6  129  PRO n 
6  130  ALA n 
6  131  THR n 
6  132  ILE n 
6  133  GLU n 
6  134  THR n 
6  135  PHE n 
6  136  ASN n 
6  137  GLU n 
6  138  ALA n 
6  139  ALA n 
6  140  LEU n 
6  141  VAL n 
6  142  VAL n 
6  143  ASN n 
6  144  ILE n 
6  145  THR n 
6  146  HIS n 
6  147  HIS n 
6  148  GLU n 
6  149  LEU n 
6  150  VAL n 
6  151  PRO n 
6  152  LYS n 
6  153  HIS n 
6  154  ILE n 
6  155  ARG n 
6  156  LEU n 
6  157  SER n 
6  158  SER n 
6  159  ASP n 
6  160  GLU n 
6  161  LYS n 
6  162  ARG n 
6  163  GLU n 
6  164  LEU n 
6  165  LEU n 
6  166  LYS n 
6  167  ARG n 
6  168  TYR n 
6  169  ARG n 
6  170  LEU n 
6  171  LYS n 
6  172  GLU n 
6  173  SER n 
6  174  GLN n 
6  175  LEU n 
6  176  PRO n 
6  177  ARG n 
6  178  ILE n 
6  179  GLN n 
6  180  ARG n 
6  181  ALA n 
6  182  ASP n 
6  183  PRO n 
6  184  VAL n 
6  185  ALA n 
6  186  LEU n 
6  187  TYR n 
6  188  LEU n 
6  189  GLY n 
6  190  LEU n 
6  191  LYS n 
6  192  ARG n 
6  193  GLY n 
6  194  GLU n 
6  195  VAL n 
6  196  VAL n 
6  197  LYS n 
6  198  ILE n 
6  199  ILE n 
6  200  ARG n 
6  201  LYS n 
6  202  SER n 
6  203  GLU n 
6  204  THR n 
6  205  SER n 
6  206  GLY n 
6  207  ARG n 
6  208  TYR n 
6  209  ALA n 
6  210  SER n 
6  211  TYR n 
6  212  ARG n 
6  213  ILE n 
6  214  CYS n 
6  215  MET n 
7  1    MET n 
7  2    SER n 
7  3    ASP n 
7  4    TYR n 
7  5    GLU n 
7  6    GLU n 
7  7    ALA n 
7  8    PHE n 
7  9    ASN n 
7  10   ASP n 
7  11   GLY n 
7  12   ASN n 
7  13   GLU n 
7  14   ASN n 
7  15   PHE n 
7  16   GLU n 
7  17   ASP n 
7  18   PHE n 
7  19   ASP n 
7  20   VAL n 
7  21   GLU n 
7  22   HIS n 
7  23   PHE n 
7  24   SER n 
7  25   ASP n 
7  26   GLU n 
7  27   GLU n 
7  28   THR n 
7  29   TYR n 
7  30   GLU n 
7  31   GLU n 
7  32   LYS n 
7  33   PRO n 
7  34   GLN n 
7  35   PHE n 
7  36   LYS n 
7  37   ASP n 
7  38   GLY n 
7  39   GLU n 
7  40   THR n 
7  41   THR n 
7  42   ASP n 
7  43   ALA n 
7  44   ASN n 
7  45   GLY n 
7  46   LYS n 
7  47   THR n 
7  48   ILE n 
7  49   VAL n 
7  50   THR n 
7  51   GLY n 
7  52   GLY n 
7  53   ASN n 
7  54   GLY n 
7  55   PRO n 
7  56   GLU n 
7  57   ASP n 
7  58   PHE n 
7  59   GLN n 
7  60   GLN n 
7  61   HIS n 
7  62   GLU n 
7  63   GLN n 
7  64   ILE n 
7  65   ARG n 
7  66   ARG n 
7  67   LYS n 
7  68   THR n 
7  69   LEU n 
7  70   LYS n 
7  71   GLU n 
7  72   LYS n 
7  73   ALA n 
7  74   ILE n 
7  75   PRO n 
7  76   LYS n 
7  77   ASP n 
7  78   GLN n 
7  79   ARG n 
7  80   ALA n 
7  81   THR n 
7  82   THR n 
7  83   PRO n 
7  84   TYR n 
7  85   MET n 
7  86   THR n 
7  87   LYS n 
7  88   TYR n 
7  89   GLU n 
7  90   ARG n 
7  91   ALA n 
7  92   ARG n 
7  93   ILE n 
7  94   LEU n 
7  95   GLY n 
7  96   THR n 
7  97   ARG n 
7  98   ALA n 
7  99   LEU n 
7  100  GLN n 
7  101  ILE n 
7  102  SER n 
7  103  MET n 
7  104  ASN n 
7  105  ALA n 
7  106  PRO n 
7  107  VAL n 
7  108  PHE n 
7  109  VAL n 
7  110  ASP n 
7  111  LEU n 
7  112  GLU n 
7  113  GLY n 
7  114  GLU n 
7  115  THR n 
7  116  ASP n 
7  117  PRO n 
7  118  LEU n 
7  119  ARG n 
7  120  ILE n 
7  121  ALA n 
7  122  MET n 
7  123  LYS n 
7  124  GLU n 
7  125  LEU n 
7  126  ALA n 
7  127  GLU n 
7  128  LYS n 
7  129  LYS n 
7  130  ILE n 
7  131  PRO n 
7  132  LEU n 
7  133  VAL n 
7  134  ILE n 
7  135  ARG n 
7  136  ARG n 
7  137  TYR n 
7  138  LEU n 
7  139  PRO n 
7  140  ASP n 
7  141  GLY n 
7  142  SER n 
7  143  PHE n 
7  144  GLU n 
7  145  ASP n 
7  146  TRP n 
7  147  SER n 
7  148  VAL n 
7  149  GLU n 
7  150  GLU n 
7  151  LEU n 
7  152  ILE n 
7  153  VAL n 
7  154  ASP n 
7  155  LEU n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
3  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;baker's yeast
;
'Saccharomyces cerevisiae' 4932 Saccharomyces ? DELTA-RPB4 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The RNA was synthesized by the polymerase before the crystal was formed.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  3  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 P04050 ? 
2  UNP RPB2_YEAST  4  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 P08518 ? 
3  UNP RPB3_YEAST  5  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 P16370 ? 
4  UNP RPB5_YEAST  6  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 P20434 ? 
5  UNP RPB6_YEAST  7  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 P20435 ? 
6  UNP RPB8_YEAST  8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 P20436 ? 
7  UNP RPB9_YEAST  9  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 P27999 ? 
8  UNP RPB10_YEAST 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 P22139 ? 
9  UNP RPB11_YEAST 11 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 P38902 ? 
10 UNP RPC10_YEAST 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 P40422 ? 
11 PDB 1I6H        1  ? ? 1I6H   ? 
12 PDB 1I6H        2  ? ? 1I6H   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1I6H A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  1I6H B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  1I6H C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  1I6H E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  1I6H F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  1I6H H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  1I6H I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  1I6H J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  1I6H K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 1I6H L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 1I6H D 1 ? 13   ? 1I6H   1 ? 13   ? 1 13   
12 12 1I6H R 1 ? 9    ? 1I6H   1 ? 9    ? 1 9    
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1I6H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.45 
_exptl_crystal.density_percent_sol   64.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_details    
;PEG 6000, AMMONIUM HYDROGEN PHOSPHATE, SODIUM DIHYDROGEN PHOSPHATE, DIOXANE, DTT, pH 6.00, VAPOR DIFFUSION, SITTING
DROP, temperature 100K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 6000'                    ? ? ? 
1 2 1 'AMMONIUM HYDROGEN PHOSPHATE' ? ? ? 
1 3 1 'SODIUM DIHYDROGEN PHOSPHATE' ? ? ? 
1 4 1 DIOXANE                       ? ? ? 
1 5 1 DTT                           ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   1999-11-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.998 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             0.998 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1I6H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            3.3 
_reflns.number_obs                   96867 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.1110000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.400 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.30 
_reflns_shell.d_res_low              3.40 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.3170000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I6H 
_refine.ls_number_reflns_obs                     87187 
_refine.ls_number_reflns_all                     96907 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             40.00 
_refine.ls_d_res_high                            3.30 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2500000 
_refine.ls_R_factor_R_free                       0.2980000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10 
_refine.ls_number_reflns_R_free                  9720 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               63.51 
_refine.aniso_B[1][1]                            -41.702 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            10.558 
_refine.aniso_B[1][3]                            18.922 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1I3Q 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        27958 
_refine_hist.pdbx_number_atoms_nucleic_acid   463 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28430 
_refine_hist.d_res_high                       3.30 
_refine_hist.d_res_low                        40.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_angle_deg 1.54717  ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d    0.008791 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1I6H 
_struct.title                     'RNA POLYMERASE II ELONGATION COMPLEX' 
_struct.pdbx_descriptor           'RNA POLYMERASE II/DNA/RNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I6H 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION/DNA-RNA HYBRID' 
_struct_keywords.text            
;TRANSCRIPTION, MRNA, MULTIPROTEIN COMPLEX, MOLECULAR MACHINE, DNA, TRANSCRIPTION-DNA-RNA COMPLEX, TRANSCRIPTION-DNA-RNA HYBRID complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 14 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? N ZN  .    ZN ? ? ? 1_555 C CYS 110  SG    ? ? A ZN  1734 A CYS 110  1_555 ? ? ? ? ? ? ?            2.340 ? 
metalc2  metalc ? ? N ZN  .    ZN ? ? ? 1_555 C CYS 167  SG    ? ? A ZN  1734 A CYS 167  1_555 ? ? ? ? ? ? ?            2.165 ? 
metalc3  metalc ? ? O ZN  .    ZN ? ? ? 1_555 C CYS 67   SG    ? ? A ZN  1735 A CYS 67   1_555 ? ? ? ? ? ? ?            2.018 ? 
metalc4  metalc ? ? O ZN  .    ZN ? ? ? 1_555 C CYS 70   SG    ? ? A ZN  1735 A CYS 70   1_555 ? ? ? ? ? ? ?            2.088 ? 
metalc5  metalc ? ? O ZN  .    ZN ? ? ? 1_555 C HIS 80   NE2   ? ? A ZN  1735 A HIS 80   1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc6  metalc ? ? P ZN  .    ZN ? ? ? 1_555 D CYS 1182 SG    ? ? B ZN  1307 B CYS 1182 1_555 ? ? ? ? ? ? ?            2.234 ? 
metalc7  metalc ? ? P ZN  .    ZN ? ? ? 1_555 D CYS 1163 SG    ? ? B ZN  1307 B CYS 1163 1_555 ? ? ? ? ? ? ?            2.725 ? 
metalc8  metalc ? ? P ZN  .    ZN ? ? ? 1_555 D CYS 1166 SG    ? ? B ZN  1307 B CYS 1166 1_555 ? ? ? ? ? ? ?            1.965 ? 
metalc9  metalc ? ? Q ZN  .    ZN ? ? ? 1_555 E CYS 92   SG    ? ? C ZN  319  C CYS 92   1_555 ? ? ? ? ? ? ?            2.159 ? 
metalc10 metalc ? ? Q ZN  .    ZN ? ? ? 1_555 E CYS 86   SG    ? ? C ZN  319  C CYS 86   1_555 ? ? ? ? ? ? ?            1.918 ? 
metalc11 metalc ? ? Q ZN  .    ZN ? ? ? 1_555 E CYS 95   SG    ? ? C ZN  319  C CYS 95   1_555 ? ? ? ? ? ? ?            2.199 ? 
metalc12 metalc ? ? Q ZN  .    ZN ? ? ? 1_555 E CYS 88   SG    ? ? C ZN  319  C CYS 88   1_555 ? ? ? ? ? ? ?            2.282 ? 
metalc13 metalc ? ? R ZN  .    ZN ? ? ? 1_555 I CYS 10   SG    ? ? I ZN  203  I CYS 10   1_555 ? ? ? ? ? ? ?            1.908 ? 
metalc14 metalc ? ? R ZN  .    ZN ? ? ? 1_555 I CYS 32   SG    ? ? I ZN  203  I CYS 32   1_555 ? ? ? ? ? ? ?            1.893 ? 
metalc15 metalc ? ? R ZN  .    ZN ? ? ? 1_555 I CYS 29   SG    ? ? I ZN  203  I CYS 29   1_555 ? ? ? ? ? ? ?            1.912 ? 
metalc16 metalc ? ? S ZN  .    ZN ? ? ? 1_555 I CYS 103  SG    ? ? I ZN  204  I CYS 103  1_555 ? ? ? ? ? ? ?            2.068 ? 
metalc17 metalc ? ? S ZN  .    ZN ? ? ? 1_555 I CYS 78   SG    ? ? I ZN  204  I CYS 78   1_555 ? ? ? ? ? ? ?            2.402 ? 
metalc18 metalc ? ? S ZN  .    ZN ? ? ? 1_555 I CYS 106  SG    ? ? I ZN  204  I CYS 106  1_555 ? ? ? ? ? ? ?            1.889 ? 
metalc19 metalc ? ? S ZN  .    ZN ? ? ? 1_555 I CYS 75   SG    ? ? I ZN  204  I CYS 75   1_555 ? ? ? ? ? ? ?            1.755 ? 
metalc20 metalc ? ? T ZN  .    ZN ? ? ? 1_555 J CYS 46   SG    ? ? J ZN  101  J CYS 46   1_555 ? ? ? ? ? ? ?            1.814 ? 
metalc21 metalc ? ? T ZN  .    ZN ? ? ? 1_555 J CYS 10   SG    ? ? J ZN  101  J CYS 10   1_555 ? ? ? ? ? ? ?            2.078 ? 
metalc22 metalc ? ? T ZN  .    ZN ? ? ? 1_555 J CYS 7    SG    ? ? J ZN  101  J CYS 7    1_555 ? ? ? ? ? ? ?            2.524 ? 
metalc23 metalc ? ? T ZN  .    ZN ? ? ? 1_555 J CYS 45   SG    ? ? J ZN  101  J CYS 45   1_555 ? ? ? ? ? ? ?            1.926 ? 
metalc24 metalc ? ? U ZN  .    ZN ? ? ? 1_555 L CYS 51   SG    ? ? L ZN  105  L CYS 51   1_555 ? ? ? ? ? ? ?            1.806 ? 
metalc25 metalc ? ? U ZN  .    ZN ? ? ? 1_555 L CYS 48   SG    ? ? L ZN  105  L CYS 48   1_555 ? ? ? ? ? ? ?            2.522 ? 
metalc26 metalc ? ? U ZN  .    ZN ? ? ? 1_555 L CYS 34   SG    ? ? L ZN  105  L CYS 34   1_555 ? ? ? ? ? ? ?            1.719 ? 
metalc27 metalc ? ? U ZN  .    ZN ? ? ? 1_555 L CYS 31   SG    ? ? L ZN  105  L CYS 31   1_555 ? ? ? ? ? ? ?            2.516 ? 
metalc28 metalc ? ? M MG  .    MG ? ? ? 1_555 B C   8    "O3'" ? ? R MG  10   R C   8    1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc29 metalc ? ? M MG  .    MG ? ? ? 1_555 B C   8    "O2'" ? ? R MG  10   R C   8    1_555 ? ? ? ? ? ? ?            2.989 ? 
metalc30 metalc ? ? M MG  .    MG ? ? ? 1_555 C ASP 481  OD2   ? ? R MG  10   A ASP 481  1_555 ? ? ? ? ? ? ?            2.690 ? 
metalc31 metalc ? ? M MG  .    MG ? ? ? 1_555 C ASP 483  OD2   ? ? R MG  10   A ASP 483  1_555 ? ? ? ? ? ? ?            2.658 ? 
metalc32 metalc ? ? M MG  .    MG ? ? ? 1_555 C ASP 485  OD1   ? ? R MG  10   A ASP 485  1_555 ? ? ? ? ? ? ?            2.781 ? 
metalc33 metalc ? ? M MG  .    MG ? ? ? 1_555 B A   9    "O5'" ? ? R MG  10   R A   9    1_555 ? ? ? ? ? ? ?            3.134 ? 
metalc34 metalc ? ? M MG  .    MG ? ? ? 1_555 B A   9    OP1   ? ? R MG  10   R A   9    1_555 ? ? ? ? ? ? ?            2.710 ? 
metalc35 metalc ? ? M MG  .    MG ? ? ? 1_555 C ASP 483  OD1   ? ? R MG  10   A ASP 483  1_555 ? ? ? ? ? ? ?            2.961 ? 
metalc36 metalc ? ? D CYS 1185 SG ? ? ? 1_555 P ZN  .    ZN    ? ? B CYS 1185 B ZN  1307 1_555 ? ? ? ? ? ? ?            2.934 ? 
metalc37 metalc ? ? I CYS 7    SG ? ? ? 1_555 R ZN  .    ZN    ? ? I CYS 7    I ZN  203  1_555 ? ? ? ? ? ? ?            2.801 ? 
hydrog1  hydrog ? ? A DT  4    N3 ? ? ? 1_555 B A   9    N1    ? ? D DT  4    R A   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  4    O4 ? ? ? 1_555 B A   9    N6    ? ? D DT  4    R A   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  5    N1 ? ? ? 1_555 B C   8    N3    ? ? D DG  5    R C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  5    N2 ? ? ? 1_555 B C   8    O2    ? ? D DG  5    R C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  5    O6 ? ? ? 1_555 B C   8    N4    ? ? D DG  5    R C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC  6    N3 ? ? ? 1_555 B G   7    N1    ? ? D DC  6    R G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DC  6    N4 ? ? ? 1_555 B G   7    O6    ? ? D DC  6    R G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DC  6    O2 ? ? ? 1_555 B G   7    N2    ? ? D DC  6    R G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DC  7    N3 ? ? ? 1_555 B G   6    N1    ? ? D DC  7    R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  7    N4 ? ? ? 1_555 B G   6    O6    ? ? D DC  7    R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC  7    O2 ? ? ? 1_555 B G   6    N2    ? ? D DC  7    R G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT  8    N3 ? ? ? 1_555 B A   5    N1    ? ? D DT  8    R A   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT  8    O4 ? ? ? 1_555 B A   5    N6    ? ? D DT  8    R A   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  10   N1 ? ? ? 1_555 B C   3    N3    ? ? D DG  10   R C   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DG  10   N2 ? ? ? 1_555 B C   3    O2    ? ? D DG  10   R C   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  10   O6 ? ? ? 1_555 B C   3    N4    ? ? D DG  10   R C   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DT  11   N3 ? ? ? 1_555 B A   2    N1    ? ? D DT  11   R A   2    1_555 ? ? ? ? ? ? 'DT-A PAIR'  ?     ? 
hydrog18 hydrog ? ? A DC  12   O2 ? ? ? 1_555 B G   1    N2    ? ? D DC  12   R G   1    1_555 ? ? ? ? ? ? 'DC-G PAIR'  ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 447 C . ? GLN 447 A PRO 448 C ? PRO 448 A 1 2.20  
2 PRO 128 F . ? PRO 128 E PRO 129 F ? PRO 129 E 1 -0.18 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 101'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 319'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN I 203'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 204'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 105'  
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ZN A 1734' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1307' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1735' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG R 10'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
2  AC1 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
3  AC1 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
4  AC1 4 CYS J 46   ? CYS J 46   . ? 1_555 ? 
5  AC2 4 CYS E 86   ? CYS C 86   . ? 1_555 ? 
6  AC2 4 CYS E 88   ? CYS C 88   . ? 1_555 ? 
7  AC2 4 CYS E 92   ? CYS C 92   . ? 1_555 ? 
8  AC2 4 CYS E 95   ? CYS C 95   . ? 1_555 ? 
9  AC3 5 CYS I 7    ? CYS I 7    . ? 1_555 ? 
10 AC3 5 CYS I 10   ? CYS I 10   . ? 1_555 ? 
11 AC3 5 CYS I 29   ? CYS I 29   . ? 1_555 ? 
12 AC3 5 THR I 31   ? THR I 31   . ? 1_555 ? 
13 AC3 5 CYS I 32   ? CYS I 32   . ? 1_555 ? 
14 AC4 4 CYS I 75   ? CYS I 75   . ? 1_555 ? 
15 AC4 4 CYS I 78   ? CYS I 78   . ? 1_555 ? 
16 AC4 4 CYS I 103  ? CYS I 103  . ? 1_555 ? 
17 AC4 4 CYS I 106  ? CYS I 106  . ? 1_555 ? 
18 AC5 4 CYS L 31   ? CYS L 31   . ? 1_555 ? 
19 AC5 4 CYS L 34   ? CYS L 34   . ? 1_555 ? 
20 AC5 4 CYS L 48   ? CYS L 48   . ? 1_555 ? 
21 AC5 4 CYS L 51   ? CYS L 51   . ? 1_555 ? 
22 AC6 2 CYS C 110  ? CYS A 110  . ? 1_555 ? 
23 AC6 2 CYS C 167  ? CYS A 167  . ? 1_555 ? 
24 AC7 4 CYS D 1163 ? CYS B 1163 . ? 1_555 ? 
25 AC7 4 CYS D 1166 ? CYS B 1166 . ? 1_555 ? 
26 AC7 4 CYS D 1182 ? CYS B 1182 . ? 1_555 ? 
27 AC7 4 CYS D 1185 ? CYS B 1185 . ? 1_555 ? 
28 AC8 4 CYS C 67   ? CYS A 67   . ? 1_555 ? 
29 AC8 4 CYS C 70   ? CYS A 70   . ? 1_555 ? 
30 AC8 4 CYS C 77   ? CYS A 77   . ? 1_555 ? 
31 AC8 4 HIS C 80   ? HIS A 80   . ? 1_555 ? 
32 AC9 5 ASP C 481  ? ASP A 481  . ? 1_555 ? 
33 AC9 5 ASP C 483  ? ASP A 483  . ? 1_555 ? 
34 AC9 5 ASP C 485  ? ASP A 485  . ? 1_555 ? 
35 AC9 5 C   B 8    ? C   R 8    . ? 1_555 ? 
36 AC9 5 A   B 9    ? A   R 9    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I6H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I6H 
_atom_sites.fract_transf_matrix[1][1]   0.006357 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000837 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004531 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005272 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . DA  A 1  1    ? 40.724  -28.545  50.170  1.00 129.27 ? 1    DA  D OP3   1 
ATOM   2     P  P     . DA  A 1  1    ? 39.307  -29.024  49.873  1.00 132.96 ? 1    DA  D P     1 
ATOM   3     O  OP1   . DA  A 1  1    ? 39.158  -29.671  48.502  1.00 131.48 ? 1    DA  D OP1   1 
ATOM   4     O  OP2   . DA  A 1  1    ? 38.236  -27.973  50.148  1.00 129.15 ? 1    DA  D OP2   1 
ATOM   5     O  "O5'" . DA  A 1  1    ? 39.037  -30.219  50.945  1.00 126.40 ? 1    DA  D "O5'" 1 
ATOM   6     C  "C5'" . DA  A 1  1    ? 38.928  -31.584  50.518  1.00 120.88 ? 1    DA  D "C5'" 1 
ATOM   7     C  "C4'" . DA  A 1  1    ? 37.694  -32.192  51.115  1.00 117.69 ? 1    DA  D "C4'" 1 
ATOM   8     O  "O4'" . DA  A 1  1    ? 37.580  -31.693  52.473  1.00 117.56 ? 1    DA  D "O4'" 1 
ATOM   9     C  "C3'" . DA  A 1  1    ? 36.384  -31.778  50.454  1.00 115.63 ? 1    DA  D "C3'" 1 
ATOM   10    O  "O3'" . DA  A 1  1    ? 36.083  -32.653  49.361  1.00 110.50 ? 1    DA  D "O3'" 1 
ATOM   11    C  "C2'" . DA  A 1  1    ? 35.379  -31.943  51.588  1.00 116.13 ? 1    DA  D "C2'" 1 
ATOM   12    C  "C1'" . DA  A 1  1    ? 36.216  -31.586  52.819  1.00 117.24 ? 1    DA  D "C1'" 1 
ATOM   13    N  N9    . DA  A 1  1    ? 35.972  -30.280  53.437  1.00 117.59 ? 1    DA  D N9    1 
ATOM   14    C  C8    . DA  A 1  1    ? 36.640  -29.091  53.251  1.00 117.78 ? 1    DA  D C8    1 
ATOM   15    N  N7    . DA  A 1  1    ? 36.181  -28.106  53.994  1.00 118.69 ? 1    DA  D N7    1 
ATOM   16    C  C5    . DA  A 1  1    ? 35.142  -28.684  54.715  1.00 118.44 ? 1    DA  D C5    1 
ATOM   17    C  C6    . DA  A 1  1    ? 34.251  -28.168  55.695  1.00 117.99 ? 1    DA  D C6    1 
ATOM   18    N  N6    . DA  A 1  1    ? 34.286  -26.903  56.149  1.00 114.34 ? 1    DA  D N6    1 
ATOM   19    N  N1    . DA  A 1  1    ? 33.319  -29.013  56.201  1.00 118.65 ? 1    DA  D N1    1 
ATOM   20    C  C2    . DA  A 1  1    ? 33.298  -30.287  55.764  1.00 117.87 ? 1    DA  D C2    1 
ATOM   21    N  N3    . DA  A 1  1    ? 34.086  -30.888  54.865  1.00 117.17 ? 1    DA  D N3    1 
ATOM   22    C  C4    . DA  A 1  1    ? 34.994  -30.024  54.373  1.00 118.04 ? 1    DA  D C4    1 
ATOM   23    P  P     . DA  A 1  2    ? 34.687  -32.506  48.572  1.00 109.21 ? 2    DA  D P     1 
ATOM   24    O  OP1   . DA  A 1  2    ? 34.611  -33.503  47.465  1.00 107.07 ? 2    DA  D OP1   1 
ATOM   25    O  OP2   . DA  A 1  2    ? 34.517  -31.062  48.274  1.00 109.81 ? 2    DA  D OP2   1 
ATOM   26    O  "O5'" . DA  A 1  2    ? 33.584  -32.925  49.641  1.00 102.95 ? 2    DA  D "O5'" 1 
ATOM   27    C  "C5'" . DA  A 1  2    ? 33.431  -34.275  50.088  1.00 99.57  ? 2    DA  D "C5'" 1 
ATOM   28    C  "C4'" . DA  A 1  2    ? 32.190  -34.376  50.936  1.00 98.89  ? 2    DA  D "C4'" 1 
ATOM   29    O  "O4'" . DA  A 1  2    ? 32.309  -33.593  52.143  1.00 103.07 ? 2    DA  D "O4'" 1 
ATOM   30    C  "C3'" . DA  A 1  2    ? 30.969  -33.843  50.233  1.00 97.90  ? 2    DA  D "C3'" 1 
ATOM   31    O  "O3'" . DA  A 1  2    ? 30.376  -34.982  49.725  1.00 90.97  ? 2    DA  D "O3'" 1 
ATOM   32    C  "C2'" . DA  A 1  2    ? 30.073  -33.356  51.356  1.00 97.10  ? 2    DA  D "C2'" 1 
ATOM   33    C  "C1'" . DA  A 1  2    ? 31.102  -32.880  52.378  1.00 100.90 ? 2    DA  D "C1'" 1 
ATOM   34    N  N9    . DA  A 1  2    ? 31.449  -31.462  52.344  1.00 101.01 ? 2    DA  D N9    1 
ATOM   35    C  C8    . DA  A 1  2    ? 32.485  -30.926  51.625  1.00 99.29  ? 2    DA  D C8    1 
ATOM   36    N  N7    . DA  A 1  2    ? 32.706  -29.662  51.876  1.00 102.35 ? 2    DA  D N7    1 
ATOM   37    C  C5    . DA  A 1  2    ? 31.723  -29.329  52.796  1.00 104.27 ? 2    DA  D C5    1 
ATOM   38    C  C6    . DA  A 1  2    ? 31.438  -28.131  53.478  1.00 107.46 ? 2    DA  D C6    1 
ATOM   39    N  N6    . DA  A 1  2    ? 32.181  -27.022  53.361  1.00 110.29 ? 2    DA  D N6    1 
ATOM   40    N  N1    . DA  A 1  2    ? 30.369  -28.119  54.308  1.00 108.15 ? 2    DA  D N1    1 
ATOM   41    C  C2    . DA  A 1  2    ? 29.657  -29.255  54.453  1.00 106.70 ? 2    DA  D C2    1 
ATOM   42    N  N3    . DA  A 1  2    ? 29.845  -30.451  53.885  1.00 103.17 ? 2    DA  D N3    1 
ATOM   43    C  C4    . DA  A 1  2    ? 30.907  -30.421  53.061  1.00 102.51 ? 2    DA  D C4    1 
ATOM   44    P  P     . DA  A 1  3    ? 29.066  -34.838  48.850  1.00 94.64  ? 3    DA  D P     1 
ATOM   45    O  OP1   . DA  A 1  3    ? 28.756  -36.318  48.497  1.00 94.84  ? 3    DA  D OP1   1 
ATOM   46    O  OP2   . DA  A 1  3    ? 29.296  -33.811  47.738  1.00 90.78  ? 3    DA  D OP2   1 
ATOM   47    O  "O5'" . DA  A 1  3    ? 27.943  -34.175  49.799  1.00 92.81  ? 3    DA  D "O5'" 1 
ATOM   48    C  "C5'" . DA  A 1  3    ? 27.110  -35.058  50.560  1.00 91.85  ? 3    DA  D "C5'" 1 
ATOM   49    C  "C4'" . DA  A 1  3    ? 26.135  -34.295  51.447  1.00 92.46  ? 3    DA  D "C4'" 1 
ATOM   50    O  "O4'" . DA  A 1  3    ? 26.796  -33.349  52.366  1.00 93.64  ? 3    DA  D "O4'" 1 
ATOM   51    C  "C3'" . DA  A 1  3    ? 25.159  -33.466  50.614  1.00 94.61  ? 3    DA  D "C3'" 1 
ATOM   52    O  "O3'" . DA  A 1  3    ? 24.205  -34.490  50.255  1.00 95.70  ? 3    DA  D "O3'" 1 
ATOM   53    C  "C2'" . DA  A 1  3    ? 24.720  -32.332  51.602  1.00 99.52  ? 3    DA  D "C2'" 1 
ATOM   54    C  "C1'" . DA  A 1  3    ? 26.006  -32.151  52.461  1.00 95.06  ? 3    DA  D "C1'" 1 
ATOM   55    N  N9    . DA  A 1  3    ? 26.803  -31.070  51.916  1.00 93.36  ? 3    DA  D N9    1 
ATOM   56    C  C8    . DA  A 1  3    ? 27.703  -31.099  50.842  1.00 95.10  ? 3    DA  D C8    1 
ATOM   57    N  N7    . DA  A 1  3    ? 28.218  -29.911  50.556  1.00 93.29  ? 3    DA  D N7    1 
ATOM   58    C  C5    . DA  A 1  3    ? 27.637  -29.062  51.504  1.00 96.23  ? 3    DA  D C5    1 
ATOM   59    C  C6    . DA  A 1  3    ? 27.783  -27.675  51.737  1.00 97.13  ? 3    DA  D C6    1 
ATOM   60    N  N6    . DA  A 1  3    ? 28.647  -26.898  51.032  1.00 94.93  ? 3    DA  D N6    1 
ATOM   61    N  N1    . DA  A 1  3    ? 27.028  -27.108  52.743  1.00 98.58  ? 3    DA  D N1    1 
ATOM   62    C  C2    . DA  A 1  3    ? 26.227  -27.933  53.488  1.00 96.81  ? 3    DA  D C2    1 
ATOM   63    N  N3    . DA  A 1  3    ? 26.041  -29.280  53.379  1.00 94.25  ? 3    DA  D N3    1 
ATOM   64    C  C4    . DA  A 1  3    ? 26.770  -29.769  52.348  1.00 94.44  ? 3    DA  D C4    1 
ATOM   65    P  P     . DT  A 1  4    ? 23.417  -34.433  48.860  1.00 92.87  ? 4    DT  D P     1 
ATOM   66    O  OP1   . DT  A 1  4    ? 24.493  -34.877  47.889  1.00 90.16  ? 4    DT  D OP1   1 
ATOM   67    O  OP2   . DT  A 1  4    ? 22.672  -33.121  48.709  1.00 90.10  ? 4    DT  D OP2   1 
ATOM   68    O  "O5'" . DT  A 1  4    ? 22.332  -35.577  49.037  1.00 90.93  ? 4    DT  D "O5'" 1 
ATOM   69    C  "C5'" . DT  A 1  4    ? 22.593  -36.765  49.735  1.00 96.11  ? 4    DT  D "C5'" 1 
ATOM   70    C  "C4'" . DT  A 1  4    ? 21.753  -37.837  49.091  1.00 101.55 ? 4    DT  D "C4'" 1 
ATOM   71    O  "O4'" . DT  A 1  4    ? 20.426  -37.940  49.686  1.00 104.77 ? 4    DT  D "O4'" 1 
ATOM   72    C  "C3'" . DT  A 1  4    ? 21.490  -37.626  47.601  1.00 102.94 ? 4    DT  D "C3'" 1 
ATOM   73    O  "O3'" . DT  A 1  4    ? 22.590  -38.076  46.839  1.00 101.80 ? 4    DT  D "O3'" 1 
ATOM   74    C  "C2'" . DT  A 1  4    ? 20.239  -38.465  47.356  1.00 104.52 ? 4    DT  D "C2'" 1 
ATOM   75    C  "C1'" . DT  A 1  4    ? 19.488  -38.318  48.686  1.00 105.20 ? 4    DT  D "C1'" 1 
ATOM   76    N  N1    . DT  A 1  4    ? 18.385  -37.329  48.652  1.00 106.03 ? 4    DT  D N1    1 
ATOM   77    C  C2    . DT  A 1  4    ? 17.113  -37.795  48.390  1.00 106.14 ? 4    DT  D C2    1 
ATOM   78    O  O2    . DT  A 1  4    ? 16.871  -38.966  48.129  1.00 106.94 ? 4    DT  D O2    1 
ATOM   79    N  N3    . DT  A 1  4    ? 16.131  -36.831  48.429  1.00 103.94 ? 4    DT  D N3    1 
ATOM   80    C  C4    . DT  A 1  4    ? 16.290  -35.480  48.675  1.00 103.01 ? 4    DT  D C4    1 
ATOM   81    O  O4    . DT  A 1  4    ? 15.310  -34.748  48.718  1.00 100.13 ? 4    DT  D O4    1 
ATOM   82    C  C5    . DT  A 1  4    ? 17.655  -35.049  48.882  1.00 105.33 ? 4    DT  D C5    1 
ATOM   83    C  C7    . DT  A 1  4    ? 17.934  -33.589  49.081  1.00 104.98 ? 4    DT  D C7    1 
ATOM   84    C  C6    . DT  A 1  4    ? 18.621  -35.986  48.874  1.00 107.08 ? 4    DT  D C6    1 
ATOM   85    P  P     . DG  A 1  5    ? 22.735  -37.625  45.289  1.00 97.56  ? 5    DG  D P     1 
ATOM   86    O  OP1   . DG  A 1  5    ? 24.135  -37.912  44.957  1.00 97.13  ? 5    DG  D OP1   1 
ATOM   87    O  OP2   . DG  A 1  5    ? 22.190  -36.249  45.043  1.00 98.23  ? 5    DG  D OP2   1 
ATOM   88    O  "O5'" . DG  A 1  5    ? 21.743  -38.565  44.477  1.00 97.93  ? 5    DG  D "O5'" 1 
ATOM   89    C  "C5'" . DG  A 1  5    ? 21.785  -39.967  44.579  1.00 102.58 ? 5    DG  D "C5'" 1 
ATOM   90    C  "C4'" . DG  A 1  5    ? 20.517  -40.543  43.998  1.00 104.57 ? 5    DG  D "C4'" 1 
ATOM   91    O  "O4'" . DG  A 1  5    ? 19.400  -40.401  44.920  1.00 106.24 ? 5    DG  D "O4'" 1 
ATOM   92    C  "C3'" . DG  A 1  5    ? 20.015  -39.882  42.724  1.00 104.92 ? 5    DG  D "C3'" 1 
ATOM   93    O  "O3'" . DG  A 1  5    ? 20.732  -40.360  41.592  1.00 102.28 ? 5    DG  D "O3'" 1 
ATOM   94    C  "C2'" . DG  A 1  5    ? 18.560  -40.333  42.696  1.00 106.66 ? 5    DG  D "C2'" 1 
ATOM   95    C  "C1'" . DG  A 1  5    ? 18.193  -40.254  44.178  1.00 106.12 ? 5    DG  D "C1'" 1 
ATOM   96    N  N9    . DG  A 1  5    ? 17.563  -38.985  44.535  1.00 105.94 ? 5    DG  D N9    1 
ATOM   97    C  C8    . DG  A 1  5    ? 18.179  -37.833  44.969  1.00 104.95 ? 5    DG  D C8    1 
ATOM   98    N  N7    . DG  A 1  5    ? 17.338  -36.876  45.252  1.00 103.82 ? 5    DG  D N7    1 
ATOM   99    C  C5    . DG  A 1  5    ? 16.092  -37.427  44.986  1.00 107.08 ? 5    DG  D C5    1 
ATOM   100   C  C6    . DG  A 1  5    ? 14.789  -36.876  45.133  1.00 109.38 ? 5    DG  D C6    1 
ATOM   101   O  O6    . DG  A 1  5    ? 14.467  -35.754  45.555  1.00 112.35 ? 5    DG  D O6    1 
ATOM   102   N  N1    . DG  A 1  5    ? 13.805  -37.780  44.739  1.00 108.70 ? 5    DG  D N1    1 
ATOM   103   C  C2    . DG  A 1  5    ? 14.045  -39.050  44.269  1.00 108.07 ? 5    DG  D C2    1 
ATOM   104   N  N2    . DG  A 1  5    ? 12.980  -39.775  43.932  1.00 107.39 ? 5    DG  D N2    1 
ATOM   105   N  N3    . DG  A 1  5    ? 15.250  -39.576  44.139  1.00 107.47 ? 5    DG  D N3    1 
ATOM   106   C  C4    . DG  A 1  5    ? 16.218  -38.719  44.517  1.00 106.53 ? 5    DG  D C4    1 
ATOM   107   P  P     . DC  A 1  6    ? 20.983  -39.392  40.320  1.00 99.39  ? 6    DC  D P     1 
ATOM   108   O  OP1   . DC  A 1  6    ? 21.918  -40.159  39.471  1.00 97.57  ? 6    DC  D OP1   1 
ATOM   109   O  OP2   . DC  A 1  6    ? 21.332  -37.994  40.735  1.00 98.86  ? 6    DC  D OP2   1 
ATOM   110   O  "O5'" . DC  A 1  6    ? 19.590  -39.412  39.560  1.00 96.48  ? 6    DC  D "O5'" 1 
ATOM   111   C  "C5'" . DC  A 1  6    ? 19.020  -40.657  39.207  1.00 92.52  ? 6    DC  D "C5'" 1 
ATOM   112   C  "C4'" . DC  A 1  6    ? 17.549  -40.498  38.963  1.00 90.88  ? 6    DC  D "C4'" 1 
ATOM   113   O  "O4'" . DC  A 1  6    ? 16.869  -40.159  40.198  1.00 87.71  ? 6    DC  D "O4'" 1 
ATOM   114   C  "C3'" . DC  A 1  6    ? 17.155  -39.394  38.004  1.00 91.05  ? 6    DC  D "C3'" 1 
ATOM   115   O  "O3'" . DC  A 1  6    ? 17.299  -39.837  36.656  1.00 90.98  ? 6    DC  D "O3'" 1 
ATOM   116   C  "C2'" . DC  A 1  6    ? 15.699  -39.166  38.384  1.00 90.60  ? 6    DC  D "C2'" 1 
ATOM   117   C  "C1'" . DC  A 1  6    ? 15.736  -39.368  39.903  1.00 86.38  ? 6    DC  D "C1'" 1 
ATOM   118   N  N1    . DC  A 1  6    ? 15.808  -38.123  40.693  1.00 81.87  ? 6    DC  D N1    1 
ATOM   119   C  C2    . DC  A 1  6    ? 14.611  -37.509  41.083  1.00 79.97  ? 6    DC  D C2    1 
ATOM   120   O  O2    . DC  A 1  6    ? 13.539  -38.031  40.752  1.00 79.21  ? 6    DC  D O2    1 
ATOM   121   N  N3    . DC  A 1  6    ? 14.657  -36.370  41.811  1.00 76.78  ? 6    DC  D N3    1 
ATOM   122   C  C4    . DC  A 1  6    ? 15.836  -35.845  42.153  1.00 76.50  ? 6    DC  D C4    1 
ATOM   123   N  N4    . DC  A 1  6    ? 15.827  -34.725  42.880  1.00 77.64  ? 6    DC  D N4    1 
ATOM   124   C  C5    . DC  A 1  6    ? 17.072  -36.447  41.768  1.00 76.14  ? 6    DC  D C5    1 
ATOM   125   C  C6    . DC  A 1  6    ? 17.011  -37.574  41.046  1.00 78.84  ? 6    DC  D C6    1 
ATOM   126   P  P     . DC  A 1  7    ? 17.317  -38.756  35.455  1.00 90.45  ? 7    DC  D P     1 
ATOM   127   O  OP1   . DC  A 1  7    ? 17.613  -39.482  34.201  1.00 89.91  ? 7    DC  D OP1   1 
ATOM   128   O  OP2   . DC  A 1  7    ? 18.178  -37.604  35.853  1.00 90.84  ? 7    DC  D OP2   1 
ATOM   129   O  "O5'" . DC  A 1  7    ? 15.812  -38.238  35.375  1.00 90.26  ? 7    DC  D "O5'" 1 
ATOM   130   C  "C5'" . DC  A 1  7    ? 14.723  -39.147  35.249  1.00 90.98  ? 7    DC  D "C5'" 1 
ATOM   131   C  "C4'" . DC  A 1  7    ? 13.422  -38.400  35.366  1.00 94.20  ? 7    DC  D "C4'" 1 
ATOM   132   O  "O4'" . DC  A 1  7    ? 13.130  -38.105  36.756  1.00 94.17  ? 7    DC  D "O4'" 1 
ATOM   133   C  "C3'" . DC  A 1  7    ? 13.367  -37.049  34.687  1.00 96.09  ? 7    DC  D "C3'" 1 
ATOM   134   O  "O3'" . DC  A 1  7    ? 13.253  -37.187  33.267  1.00 101.24 ? 7    DC  D "O3'" 1 
ATOM   135   C  "C2'" . DC  A 1  7    ? 12.184  -36.397  35.408  1.00 94.43  ? 7    DC  D "C2'" 1 
ATOM   136   C  "C1'" . DC  A 1  7    ? 12.381  -36.901  36.845  1.00 92.72  ? 7    DC  D "C1'" 1 
ATOM   137   N  N1    . DC  A 1  7    ? 13.112  -35.954  37.713  1.00 89.54  ? 7    DC  D N1    1 
ATOM   138   C  C2    . DC  A 1  7    ? 12.398  -35.011  38.463  1.00 86.77  ? 7    DC  D C2    1 
ATOM   139   O  O2    . DC  A 1  7    ? 11.160  -35.050  38.448  1.00 82.46  ? 7    DC  D O2    1 
ATOM   140   N  N3    . DC  A 1  7    ? 13.085  -34.096  39.191  1.00 86.15  ? 7    DC  D N3    1 
ATOM   141   C  C4    . DC  A 1  7    ? 14.423  -34.114  39.196  1.00 88.00  ? 7    DC  D C4    1 
ATOM   142   N  N4    . DC  A 1  7    ? 15.053  -33.163  39.899  1.00 88.70  ? 7    DC  D N4    1 
ATOM   143   C  C5    . DC  A 1  7    ? 15.168  -35.096  38.478  1.00 89.16  ? 7    DC  D C5    1 
ATOM   144   C  C6    . DC  A 1  7    ? 14.478  -35.984  37.764  1.00 90.74  ? 7    DC  D C6    1 
ATOM   145   P  P     . DT  A 1  8    ? 13.881  -36.058  32.314  1.00 102.97 ? 8    DT  D P     1 
ATOM   146   O  OP1   . DT  A 1  8    ? 13.980  -36.677  30.964  1.00 98.41  ? 8    DT  D OP1   1 
ATOM   147   O  OP2   . DT  A 1  8    ? 15.098  -35.476  32.953  1.00 101.56 ? 8    DT  D OP2   1 
ATOM   148   O  "O5'" . DT  A 1  8    ? 12.733  -34.955  32.288  1.00 102.84 ? 8    DT  D "O5'" 1 
ATOM   149   C  "C5'" . DT  A 1  8    ? 11.410  -35.343  31.959  1.00 106.04 ? 8    DT  D "C5'" 1 
ATOM   150   C  "C4'" . DT  A 1  8    ? 10.437  -34.219  32.201  1.00 107.20 ? 8    DT  D "C4'" 1 
ATOM   151   O  "O4'" . DT  A 1  8    ? 10.244  -33.961  33.618  1.00 107.39 ? 8    DT  D "O4'" 1 
ATOM   152   C  "C3'" . DT  A 1  8    ? 10.778  -32.861  31.617  1.00 107.07 ? 8    DT  D "C3'" 1 
ATOM   153   O  "O3'" . DT  A 1  8    ? 10.574  -32.949  30.203  1.00 108.22 ? 8    DT  D "O3'" 1 
ATOM   154   C  "C2'" . DT  A 1  8    ? 9.790   -31.976  32.378  1.00 106.10 ? 8    DT  D "C2'" 1 
ATOM   155   C  "C1'" . DT  A 1  8    ? 9.757   -32.642  33.768  1.00 103.91 ? 8    DT  D "C1'" 1 
ATOM   156   N  N1    . DT  A 1  8    ? 10.560  -31.966  34.801  1.00 97.28  ? 8    DT  D N1    1 
ATOM   157   C  C2    . DT  A 1  8    ? 9.968   -30.956  35.533  1.00 92.88  ? 8    DT  D C2    1 
ATOM   158   O  O2    . DT  A 1  8    ? 8.817   -30.579  35.358  1.00 89.81  ? 8    DT  D O2    1 
ATOM   159   N  N3    . DT  A 1  8    ? 10.786  -30.390  36.481  1.00 91.67  ? 8    DT  D N3    1 
ATOM   160   C  C4    . DT  A 1  8    ? 12.105  -30.722  36.758  1.00 91.77  ? 8    DT  D C4    1 
ATOM   161   O  O4    . DT  A 1  8    ? 12.710  -30.151  37.659  1.00 89.85  ? 8    DT  D O4    1 
ATOM   162   C  C5    . DT  A 1  8    ? 12.662  -31.764  35.939  1.00 92.69  ? 8    DT  D C5    1 
ATOM   163   C  C7    . DT  A 1  8    ? 14.092  -32.152  36.142  1.00 91.63  ? 8    DT  D C7    1 
ATOM   164   C  C6    . DT  A 1  8    ? 11.872  -32.336  35.022  1.00 95.05  ? 8    DT  D C6    1 
ATOM   165   P  P     . DG  A 1  9    ? 10.387  -31.626  29.312  1.00 108.30 ? 9    DG  D P     1 
ATOM   166   O  OP1   . DG  A 1  9    ? 9.962   -32.111  27.966  1.00 106.12 ? 9    DG  D OP1   1 
ATOM   167   O  OP2   . DG  A 1  9    ? 11.567  -30.750  29.444  1.00 104.15 ? 9    DG  D OP2   1 
ATOM   168   O  "O5'" . DG  A 1  9    ? 9.118   -30.914  29.963  1.00 106.64 ? 9    DG  D "O5'" 1 
ATOM   169   C  "C5'" . DG  A 1  9    ? 8.817   -29.545  29.680  1.00 106.39 ? 9    DG  D "C5'" 1 
ATOM   170   C  "C4'" . DG  A 1  9    ? 8.421   -28.781  30.930  1.00 106.93 ? 9    DG  D "C4'" 1 
ATOM   171   O  "O4'" . DG  A 1  9    ? 9.121   -29.296  32.097  1.00 109.07 ? 9    DG  D "O4'" 1 
ATOM   172   C  "C3'" . DG  A 1  9    ? 8.842   -27.325  30.877  1.00 104.49 ? 9    DG  D "C3'" 1 
ATOM   173   O  "O3'" . DG  A 1  9    ? 7.944   -26.545  30.095  1.00 99.54  ? 9    DG  D "O3'" 1 
ATOM   174   C  "C2'" . DG  A 1  9    ? 8.900   -26.935  32.362  1.00 105.21 ? 9    DG  D "C2'" 1 
ATOM   175   C  "C1'" . DG  A 1  9    ? 9.380   -28.237  33.017  1.00 106.21 ? 9    DG  D "C1'" 1 
ATOM   176   N  N9    . DG  A 1  9    ? 10.785  -28.286  33.431  1.00 104.02 ? 9    DG  D N9    1 
ATOM   177   C  C8    . DG  A 1  9    ? 11.725  -29.193  33.011  1.00 103.26 ? 9    DG  D C8    1 
ATOM   178   N  N7    . DG  A 1  9    ? 12.884  -29.045  33.591  1.00 101.35 ? 9    DG  D N7    1 
ATOM   179   C  C5    . DG  A 1  9    ? 12.708  -27.954  34.432  1.00 101.86 ? 9    DG  D C5    1 
ATOM   180   C  C6    . DG  A 1  9    ? 13.620  -27.315  35.322  1.00 101.97 ? 9    DG  D C6    1 
ATOM   181   O  O6    . DG  A 1  9    ? 14.803  -27.602  35.553  1.00 102.98 ? 9    DG  D O6    1 
ATOM   182   N  N1    . DG  A 1  9    ? 13.023  -26.238  35.978  1.00 102.93 ? 9    DG  D N1    1 
ATOM   183   C  C2    . DG  A 1  9    ? 11.716  -25.828  35.807  1.00 102.81 ? 9    DG  D C2    1 
ATOM   184   N  N2    . DG  A 1  9    ? 11.340  -24.752  36.525  1.00 101.24 ? 9    DG  D N2    1 
ATOM   185   N  N3    . DG  A 1  9    ? 10.853  -26.425  34.991  1.00 101.85 ? 9    DG  D N3    1 
ATOM   186   C  C4    . DG  A 1  9    ? 11.416  -27.468  34.338  1.00 102.35 ? 9    DG  D C4    1 
ATOM   187   P  P     . DG  A 1  10   ? 8.549   -25.508  29.043  1.00 94.55  ? 10   DG  D P     1 
ATOM   188   O  OP1   . DG  A 1  10   ? 7.550   -25.261  27.981  1.00 95.65  ? 10   DG  D OP1   1 
ATOM   189   O  OP2   . DG  A 1  10   ? 9.921   -25.954  28.674  1.00 94.40  ? 10   DG  D OP2   1 
ATOM   190   O  "O5'" . DG  A 1  10   ? 8.715   -24.169  29.881  1.00 97.52  ? 10   DG  D "O5'" 1 
ATOM   191   C  "C5'" . DG  A 1  10   ? 7.581   -23.490  30.397  1.00 101.42 ? 10   DG  D "C5'" 1 
ATOM   192   C  "C4'" . DG  A 1  10   ? 8.019   -22.460  31.408  1.00 105.92 ? 10   DG  D "C4'" 1 
ATOM   193   O  "O4'" . DG  A 1  10   ? 8.808   -23.159  32.399  1.00 107.53 ? 10   DG  D "O4'" 1 
ATOM   194   C  "C3'" . DG  A 1  10   ? 8.991   -21.431  30.826  1.00 108.25 ? 10   DG  D "C3'" 1 
ATOM   195   O  "O3'" . DG  A 1  10   ? 8.273   -20.323  30.257  1.00 111.52 ? 10   DG  D "O3'" 1 
ATOM   196   C  "C2'" . DG  A 1  10   ? 9.858   -21.041  32.018  1.00 105.93 ? 10   DG  D "C2'" 1 
ATOM   197   C  "C1'" . DG  A 1  10   ? 9.800   -22.295  32.884  1.00 105.16 ? 10   DG  D "C1'" 1 
ATOM   198   N  N9    . DG  A 1  10   ? 11.060  -23.007  32.963  1.00 104.31 ? 10   DG  D N9    1 
ATOM   199   C  C8    . DG  A 1  10   ? 11.490  -24.128  32.287  1.00 105.49 ? 10   DG  D C8    1 
ATOM   200   N  N7    . DG  A 1  10   ? 12.692  -24.498  32.644  1.00 104.56 ? 10   DG  D N7    1 
ATOM   201   C  C5    . DG  A 1  10   ? 13.059  -23.570  33.611  1.00 105.90 ? 10   DG  D C5    1 
ATOM   202   C  C6    . DG  A 1  10   ? 14.237  -23.467  34.396  1.00 107.47 ? 10   DG  D C6    1 
ATOM   203   O  O6    . DG  A 1  10   ? 15.230  -24.213  34.413  1.00 108.78 ? 10   DG  D O6    1 
ATOM   204   N  N1    . DG  A 1  10   ? 14.188  -22.367  35.244  1.00 108.04 ? 10   DG  D N1    1 
ATOM   205   C  C2    . DG  A 1  10   ? 13.139  -21.485  35.341  1.00 108.06 ? 10   DG  D C2    1 
ATOM   206   N  N2    . DG  A 1  10   ? 13.277  -20.464  36.214  1.00 108.22 ? 10   DG  D N2    1 
ATOM   207   N  N3    . DG  A 1  10   ? 12.035  -21.585  34.635  1.00 106.89 ? 10   DG  D N3    1 
ATOM   208   C  C4    . DG  A 1  10   ? 12.065  -22.642  33.798  1.00 105.23 ? 10   DG  D C4    1 
ATOM   209   P  P     . DT  A 1  11   ? 9.038   -19.210  29.363  1.00 114.42 ? 11   DT  D P     1 
ATOM   210   O  OP1   . DT  A 1  11   ? 8.012   -18.210  28.954  1.00 111.58 ? 11   DT  D OP1   1 
ATOM   211   O  OP2   . DT  A 1  11   ? 9.865   -19.899  28.322  1.00 113.33 ? 11   DT  D OP2   1 
ATOM   212   O  "O5'" . DT  A 1  11   ? 9.985   -18.466  30.408  1.00 113.29 ? 11   DT  D "O5'" 1 
ATOM   213   C  "C5'" . DT  A 1  11   ? 9.503   -17.331  31.146  1.00 110.73 ? 11   DT  D "C5'" 1 
ATOM   214   C  "C4'" . DT  A 1  11   ? 10.612  -16.716  31.967  1.00 111.38 ? 11   DT  D "C4'" 1 
ATOM   215   O  "O4'" . DT  A 1  11   ? 11.281  -17.780  32.669  1.00 109.95 ? 11   DT  D "O4'" 1 
ATOM   216   C  "C3'" . DT  A 1  11   ? 11.754  -16.011  31.244  1.00 110.90 ? 11   DT  D "C3'" 1 
ATOM   217   O  "O3'" . DT  A 1  11   ? 11.368  -14.672  30.937  1.00 112.79 ? 11   DT  D "O3'" 1 
ATOM   218   C  "C2'" . DT  A 1  11   ? 12.848  -16.020  32.308  1.00 109.78 ? 11   DT  D "C2'" 1 
ATOM   219   C  "C1'" . DT  A 1  11   ? 12.600  -17.368  32.973  1.00 105.37 ? 11   DT  D "C1'" 1 
ATOM   220   N  N1    . DT  A 1  11   ? 13.564  -18.446  32.627  1.00 98.51  ? 11   DT  D N1    1 
ATOM   221   C  C2    . DT  A 1  11   ? 14.830  -18.390  33.183  1.00 97.16  ? 11   DT  D C2    1 
ATOM   222   O  O2    . DT  A 1  11   ? 15.198  -17.486  33.916  1.00 97.04  ? 11   DT  D O2    1 
ATOM   223   N  N3    . DT  A 1  11   ? 15.651  -19.438  32.846  1.00 94.43  ? 11   DT  D N3    1 
ATOM   224   C  C4    . DT  A 1  11   ? 15.354  -20.503  32.016  1.00 92.77  ? 11   DT  D C4    1 
ATOM   225   O  O4    . DT  A 1  11   ? 16.217  -21.371  31.797  1.00 92.18  ? 11   DT  D O4    1 
ATOM   226   C  C5    . DT  A 1  11   ? 14.016  -20.497  31.462  1.00 91.51  ? 11   DT  D C5    1 
ATOM   227   C  C7    . DT  A 1  11   ? 13.612  -21.620  30.557  1.00 87.98  ? 11   DT  D C7    1 
ATOM   228   C  C6    . DT  A 1  11   ? 13.200  -19.481  31.791  1.00 94.05  ? 11   DT  D C6    1 
ATOM   229   P  P     . DC  A 1  12   ? 12.340  -13.730  30.058  1.00 113.17 ? 12   DC  D P     1 
ATOM   230   O  OP1   . DC  A 1  12   ? 11.763  -12.364  30.167  1.00 112.46 ? 12   DC  D OP1   1 
ATOM   231   O  OP2   . DC  A 1  12   ? 12.563  -14.315  28.705  1.00 112.67 ? 12   DC  D OP2   1 
ATOM   232   O  "O5'" . DC  A 1  12   ? 13.724  -13.673  30.851  1.00 110.98 ? 12   DC  D "O5'" 1 
ATOM   233   C  "C5'" . DC  A 1  12   ? 14.009  -12.583  31.718  1.00 110.91 ? 12   DC  D "C5'" 1 
ATOM   234   C  "C4'" . DC  A 1  12   ? 15.442  -12.647  32.154  1.00 111.97 ? 12   DC  D "C4'" 1 
ATOM   235   O  "O4'" . DC  A 1  12   ? 15.687  -13.993  32.633  1.00 108.84 ? 12   DC  D "O4'" 1 
ATOM   236   C  "C3'" . DC  A 1  12   ? 16.510  -12.430  31.082  1.00 113.33 ? 12   DC  D "C3'" 1 
ATOM   237   O  "O3'" . DC  A 1  12   ? 16.773  -11.025  30.916  1.00 116.84 ? 12   DC  D "O3'" 1 
ATOM   238   C  "C2'" . DC  A 1  12   ? 17.713  -13.169  31.669  1.00 111.41 ? 12   DC  D "C2'" 1 
ATOM   239   C  "C1'" . DC  A 1  12   ? 17.048  -14.312  32.441  1.00 108.22 ? 12   DC  D "C1'" 1 
ATOM   240   N  N1    . DC  A 1  12   ? 17.139  -15.596  31.747  1.00 103.23 ? 12   DC  D N1    1 
ATOM   241   C  C2    . DC  A 1  12   ? 18.179  -16.452  32.086  1.00 99.76  ? 12   DC  D C2    1 
ATOM   242   O  O2    . DC  A 1  12   ? 19.009  -16.077  32.939  1.00 97.18  ? 12   DC  D O2    1 
ATOM   243   N  N3    . DC  A 1  12   ? 18.266  -17.657  31.473  1.00 96.08  ? 12   DC  D N3    1 
ATOM   244   C  C4    . DC  A 1  12   ? 17.373  -18.000  30.544  1.00 95.76  ? 12   DC  D C4    1 
ATOM   245   N  N4    . DC  A 1  12   ? 17.508  -19.201  29.972  1.00 94.31  ? 12   DC  D N4    1 
ATOM   246   C  C5    . DC  A 1  12   ? 16.309  -17.130  30.163  1.00 97.98  ? 12   DC  D C5    1 
ATOM   247   C  C6    . DC  A 1  12   ? 16.229  -15.950  30.788  1.00 101.14 ? 12   DC  D C6    1 
ATOM   248   P  P     . DT  A 1  13   ? 17.857  -10.512  29.830  1.00 117.75 ? 13   DT  D P     1 
ATOM   249   O  OP1   . DT  A 1  13   ? 17.893  -9.029   29.972  1.00 116.71 ? 13   DT  D OP1   1 
ATOM   250   O  OP2   . DT  A 1  13   ? 17.568  -11.113  28.497  1.00 115.92 ? 13   DT  D OP2   1 
ATOM   251   O  "O5'" . DT  A 1  13   ? 19.254  -11.088  30.348  1.00 117.70 ? 13   DT  D "O5'" 1 
ATOM   252   C  "C5'" . DT  A 1  13   ? 20.005  -10.397  31.350  1.00 118.99 ? 13   DT  D "C5'" 1 
ATOM   253   C  "C4'" . DT  A 1  13   ? 21.415  -10.956  31.458  1.00 120.74 ? 13   DT  D "C4'" 1 
ATOM   254   O  "O4'" . DT  A 1  13   ? 21.411  -12.335  31.927  1.00 121.81 ? 13   DT  D "O4'" 1 
ATOM   255   C  "C3'" . DT  A 1  13   ? 22.242  -11.034  30.184  1.00 119.87 ? 13   DT  D "C3'" 1 
ATOM   256   O  "O3'" . DT  A 1  13   ? 22.699  -9.775   29.666  1.00 119.06 ? 13   DT  D "O3'" 1 
ATOM   257   C  "C2'" . DT  A 1  13   ? 23.362  -11.991  30.590  1.00 119.63 ? 13   DT  D "C2'" 1 
ATOM   258   C  "C1'" . DT  A 1  13   ? 22.621  -12.965  31.518  1.00 119.59 ? 13   DT  D "C1'" 1 
ATOM   259   N  N1    . DT  A 1  13   ? 22.311  -14.248  30.849  1.00 117.10 ? 13   DT  D N1    1 
ATOM   260   C  C2    . DT  A 1  13   ? 23.323  -15.184  30.759  1.00 115.99 ? 13   DT  D C2    1 
ATOM   261   O  O2    . DT  A 1  13   ? 24.445  -15.000  31.213  1.00 115.72 ? 13   DT  D O2    1 
ATOM   262   N  N3    . DT  A 1  13   ? 22.977  -16.346  30.111  1.00 112.39 ? 13   DT  D N3    1 
ATOM   263   C  C4    . DT  A 1  13   ? 21.757  -16.655  29.547  1.00 110.97 ? 13   DT  D C4    1 
ATOM   264   O  O4    . DT  A 1  13   ? 21.602  -17.741  28.990  1.00 107.95 ? 13   DT  D O4    1 
ATOM   265   C  C5    . DT  A 1  13   ? 20.741  -15.624  29.672  1.00 113.05 ? 13   DT  D C5    1 
ATOM   266   C  C7    . DT  A 1  13   ? 19.392  -15.854  29.065  1.00 112.49 ? 13   DT  D C7    1 
ATOM   267   C  C6    . DT  A 1  13   ? 21.062  -14.495  30.321  1.00 115.51 ? 13   DT  D C6    1 
ATOM   268   O  OP3   . G   B 2  1    ? 26.262  -24.271  34.519  1.00 124.93 ? 1    G   R OP3   1 
ATOM   269   P  P     . G   B 2  1    ? 26.953  -24.665  33.233  1.00 130.51 ? 1    G   R P     1 
ATOM   270   O  OP1   . G   B 2  1    ? 26.095  -25.730  32.520  1.00 129.64 ? 1    G   R OP1   1 
ATOM   271   O  OP2   . G   B 2  1    ? 28.422  -24.966  33.603  1.00 130.29 ? 1    G   R OP2   1 
ATOM   272   O  "O5'" . G   B 2  1    ? 26.969  -23.319  32.293  1.00 126.54 ? 1    G   R "O5'" 1 
ATOM   273   C  "C5'" . G   B 2  1    ? 28.008  -22.306  32.475  1.00 122.58 ? 1    G   R "C5'" 1 
ATOM   274   C  "C4'" . G   B 2  1    ? 27.383  -20.999  32.965  1.00 119.91 ? 1    G   R "C4'" 1 
ATOM   275   O  "O4'" . G   B 2  1    ? 26.571  -20.433  31.885  1.00 119.69 ? 1    G   R "O4'" 1 
ATOM   276   C  "C3'" . G   B 2  1    ? 26.394  -21.173  34.132  1.00 119.45 ? 1    G   R "C3'" 1 
ATOM   277   O  "O3'" . G   B 2  1    ? 27.159  -21.299  35.364  1.00 120.70 ? 1    G   R "O3'" 1 
ATOM   278   C  "C2'" . G   B 2  1    ? 25.501  -19.939  33.954  1.00 116.71 ? 1    G   R "C2'" 1 
ATOM   279   O  "O2'" . G   B 2  1    ? 26.022  -18.705  34.403  1.00 116.06 ? 1    G   R "O2'" 1 
ATOM   280   C  "C1'" . G   B 2  1    ? 25.365  -19.915  32.430  1.00 116.83 ? 1    G   R "C1'" 1 
ATOM   281   N  N9    . G   B 2  1    ? 24.270  -20.766  31.975  1.00 114.98 ? 1    G   R N9    1 
ATOM   282   C  C8    . G   B 2  1    ? 24.345  -22.075  31.539  1.00 113.63 ? 1    G   R C8    1 
ATOM   283   N  N7    . G   B 2  1    ? 23.193  -22.547  31.142  1.00 113.17 ? 1    G   R N7    1 
ATOM   284   C  C5    . G   B 2  1    ? 22.305  -21.491  31.317  1.00 111.64 ? 1    G   R C5    1 
ATOM   285   C  C6    . G   B 2  1    ? 20.909  -21.394  30.993  1.00 108.69 ? 1    G   R C6    1 
ATOM   286   O  O6    . G   B 2  1    ? 20.181  -22.240  30.442  1.00 106.66 ? 1    G   R O6    1 
ATOM   287   N  N1    . G   B 2  1    ? 20.387  -20.156  31.350  1.00 107.86 ? 1    G   R N1    1 
ATOM   288   C  C2    . G   B 2  1    ? 21.116  -19.128  31.918  1.00 108.48 ? 1    G   R C2    1 
ATOM   289   N  N2    . G   B 2  1    ? 20.435  -18.023  32.210  1.00 107.89 ? 1    G   R N2    1 
ATOM   290   N  N3    . G   B 2  1    ? 22.421  -19.187  32.189  1.00 108.93 ? 1    G   R N3    1 
ATOM   291   C  C4    . G   B 2  1    ? 22.946  -20.393  31.866  1.00 112.75 ? 1    G   R C4    1 
ATOM   292   P  P     . A   B 2  2    ? 26.394  -21.358  36.813  1.00 124.38 ? 2    A   R P     1 
ATOM   293   O  OP1   . A   B 2  2    ? 27.260  -20.839  37.893  1.00 120.59 ? 2    A   R OP1   1 
ATOM   294   O  OP2   . A   B 2  2    ? 25.657  -22.693  37.014  1.00 121.79 ? 2    A   R OP2   1 
ATOM   295   O  "O5'" . A   B 2  2    ? 25.313  -20.213  36.638  1.00 121.21 ? 2    A   R "O5'" 1 
ATOM   296   C  "C5'" . A   B 2  2    ? 25.563  -18.894  37.033  1.00 119.72 ? 2    A   R "C5'" 1 
ATOM   297   C  "C4'" . A   B 2  2    ? 24.265  -18.239  37.345  1.00 117.04 ? 2    A   R "C4'" 1 
ATOM   298   O  "O4'" . A   B 2  2    ? 23.593  -17.799  36.117  1.00 116.27 ? 2    A   R "O4'" 1 
ATOM   299   C  "C3'" . A   B 2  2    ? 23.257  -19.015  38.154  1.00 116.10 ? 2    A   R "C3'" 1 
ATOM   300   O  "O3'" . A   B 2  2    ? 23.634  -19.086  39.543  1.00 118.49 ? 2    A   R "O3'" 1 
ATOM   301   C  "C2'" . A   B 2  2    ? 22.014  -18.206  37.789  1.00 113.39 ? 2    A   R "C2'" 1 
ATOM   302   O  "O2'" . A   B 2  2    ? 22.011  -16.927  38.374  1.00 113.02 ? 2    A   R "O2'" 1 
ATOM   303   C  "C1'" . A   B 2  2    ? 22.209  -17.987  36.277  1.00 111.33 ? 2    A   R "C1'" 1 
ATOM   304   N  N9    . A   B 2  2    ? 21.839  -19.185  35.531  1.00 105.49 ? 2    A   R N9    1 
ATOM   305   C  C8    . A   B 2  2    ? 22.627  -20.269  35.246  1.00 102.95 ? 2    A   R C8    1 
ATOM   306   N  N7    . A   B 2  2    ? 21.986  -21.246  34.659  1.00 101.98 ? 2    A   R N7    1 
ATOM   307   C  C5    . A   B 2  2    ? 20.697  -20.755  34.523  1.00 101.12 ? 2    A   R C5    1 
ATOM   308   C  C6    . A   B 2  2    ? 19.545  -21.298  33.977  1.00 100.86 ? 2    A   R C6    1 
ATOM   309   N  N6    . A   B 2  2    ? 19.526  -22.514  33.434  1.00 100.03 ? 2    A   R N6    1 
ATOM   310   N  N1    . A   B 2  2    ? 18.409  -20.545  33.998  1.00 100.38 ? 2    A   R N1    1 
ATOM   311   C  C2    . A   B 2  2    ? 18.473  -19.308  34.521  1.00 100.67 ? 2    A   R C2    1 
ATOM   312   N  N3    . A   B 2  2    ? 19.514  -18.684  35.056  1.00 101.40 ? 2    A   R N3    1 
ATOM   313   C  C4    . A   B 2  2    ? 20.600  -19.476  35.032  1.00 102.18 ? 2    A   R C4    1 
ATOM   314   P  P     . C   B 2  3    ? 23.084  -20.350  40.416  1.00 122.14 ? 3    C   R P     1 
ATOM   315   O  OP1   . C   B 2  3    ? 23.799  -20.425  41.633  1.00 120.19 ? 3    C   R OP1   1 
ATOM   316   O  OP2   . C   B 2  3    ? 23.366  -21.441  39.363  1.00 119.23 ? 3    C   R OP2   1 
ATOM   317   O  "O5'" . C   B 2  3    ? 21.617  -19.859  40.893  1.00 121.49 ? 3    C   R "O5'" 1 
ATOM   318   C  "C5'" . C   B 2  3    ? 21.194  -18.494  40.569  1.00 120.03 ? 3    C   R "C5'" 1 
ATOM   319   C  "C4'" . C   B 2  3    ? 19.722  -18.480  40.189  1.00 119.13 ? 3    C   R "C4'" 1 
ATOM   320   O  "O4'" . C   B 2  3    ? 19.404  -18.727  38.772  1.00 116.65 ? 3    C   R "O4'" 1 
ATOM   321   C  "C3'" . C   B 2  3    ? 18.942  -19.625  40.806  1.00 119.00 ? 3    C   R "C3'" 1 
ATOM   322   O  "O3'" . C   B 2  3    ? 18.890  -19.509  42.230  1.00 122.36 ? 3    C   R "O3'" 1 
ATOM   323   C  "C2'" . C   B 2  3    ? 17.588  -19.404  40.121  1.00 117.70 ? 3    C   R "C2'" 1 
ATOM   324   O  "O2'" . C   B 2  3    ? 17.014  -18.162  40.571  1.00 116.90 ? 3    C   R "O2'" 1 
ATOM   325   C  "C1'" . C   B 2  3    ? 18.043  -19.170  38.681  1.00 114.57 ? 3    C   R "C1'" 1 
ATOM   326   N  N1    . C   B 2  3    ? 17.934  -20.367  37.832  1.00 111.56 ? 3    C   R N1    1 
ATOM   327   C  C2    . C   B 2  3    ? 16.720  -20.567  37.154  1.00 109.63 ? 3    C   R C2    1 
ATOM   328   O  O2    . C   B 2  3    ? 15.813  -19.729  37.294  1.00 108.86 ? 3    C   R O2    1 
ATOM   329   N  N3    . C   B 2  3    ? 16.566  -21.657  36.374  1.00 106.72 ? 3    C   R N3    1 
ATOM   330   C  C4    . C   B 2  3    ? 17.571  -22.532  36.252  1.00 106.32 ? 3    C   R C4    1 
ATOM   331   N  N4    . C   B 2  3    ? 17.385  -23.612  35.484  1.00 104.33 ? 3    C   R N4    1 
ATOM   332   C  C5    . C   B 2  3    ? 18.820  -22.347  36.921  1.00 106.74 ? 3    C   R C5    1 
ATOM   333   C  C6    . C   B 2  3    ? 18.957  -21.265  37.699  1.00 108.63 ? 3    C   R C6    1 
ATOM   334   P  P     . C   B 2  4    ? 18.802  -20.829  43.148  1.00 123.56 ? 4    C   R P     1 
ATOM   335   O  OP1   . C   B 2  4    ? 19.236  -20.460  44.533  1.00 123.45 ? 4    C   R OP1   1 
ATOM   336   O  OP2   . C   B 2  4    ? 19.490  -21.950  42.431  1.00 123.53 ? 4    C   R OP2   1 
ATOM   337   O  "O5'" . C   B 2  4    ? 17.228  -21.093  43.196  1.00 120.99 ? 4    C   R "O5'" 1 
ATOM   338   C  "C5'" . C   B 2  4    ? 16.371  -20.136  43.844  1.00 116.16 ? 4    C   R "C5'" 1 
ATOM   339   C  "C4'" . C   B 2  4    ? 15.108  -19.861  43.033  1.00 114.68 ? 4    C   R "C4'" 1 
ATOM   340   O  "O4'" . C   B 2  4    ? 15.408  -19.813  41.604  1.00 114.62 ? 4    C   R "O4'" 1 
ATOM   341   C  "C3'" . C   B 2  4    ? 13.965  -20.867  43.087  1.00 114.15 ? 4    C   R "C3'" 1 
ATOM   342   O  "O3'" . C   B 2  4    ? 13.182  -20.775  44.296  1.00 112.62 ? 4    C   R "O3'" 1 
ATOM   343   C  "C2'" . C   B 2  4    ? 13.148  -20.461  41.847  1.00 114.04 ? 4    C   R "C2'" 1 
ATOM   344   O  "O2'" . C   B 2  4    ? 12.390  -19.260  41.934  1.00 112.96 ? 4    C   R "O2'" 1 
ATOM   345   C  "C1'" . C   B 2  4    ? 14.264  -20.212  40.843  1.00 115.40 ? 4    C   R "C1'" 1 
ATOM   346   N  N1    . C   B 2  4    ? 14.589  -21.431  40.076  1.00 116.15 ? 4    C   R N1    1 
ATOM   347   C  C2    . C   B 2  4    ? 13.576  -22.021  39.276  1.00 115.84 ? 4    C   R C2    1 
ATOM   348   O  O2    . C   B 2  4    ? 12.435  -21.490  39.230  1.00 116.68 ? 4    C   R O2    1 
ATOM   349   N  N3    . C   B 2  4    ? 13.859  -23.153  38.573  1.00 114.27 ? 4    C   R N3    1 
ATOM   350   C  C4    . C   B 2  4    ? 15.074  -23.701  38.644  1.00 113.84 ? 4    C   R C4    1 
ATOM   351   N  N4    . C   B 2  4    ? 15.303  -24.823  37.940  1.00 110.83 ? 4    C   R N4    1 
ATOM   352   C  C5    . C   B 2  4    ? 16.115  -23.127  39.439  1.00 114.67 ? 4    C   R C5    1 
ATOM   353   C  C6    . C   B 2  4    ? 15.835  -21.997  40.128  1.00 115.62 ? 4    C   R C6    1 
ATOM   354   P  P     . A   B 2  5    ? 12.158  -21.965  44.656  1.00 111.45 ? 5    A   R P     1 
ATOM   355   O  OP1   . A   B 2  5    ? 11.158  -21.470  45.640  1.00 112.73 ? 5    A   R OP1   1 
ATOM   356   O  OP2   . A   B 2  5    ? 12.940  -23.199  44.986  1.00 111.56 ? 5    A   R OP2   1 
ATOM   357   O  "O5'" . A   B 2  5    ? 11.356  -22.125  43.281  1.00 107.96 ? 5    A   R "O5'" 1 
ATOM   358   C  "C5'" . A   B 2  5    ? 10.103  -21.436  43.085  1.00 102.22 ? 5    A   R "C5'" 1 
ATOM   359   C  "C4'" . A   B 2  5    ? 9.111   -22.303  42.324  1.00 98.88  ? 5    A   R "C4'" 1 
ATOM   360   O  "O4'" . A   B 2  5    ? 9.615   -22.507  40.986  1.00 97.63  ? 5    A   R "O4'" 1 
ATOM   361   C  "C3'" . A   B 2  5    ? 8.827   -23.725  42.782  1.00 97.32  ? 5    A   R "C3'" 1 
ATOM   362   O  "O3'" . A   B 2  5    ? 7.881   -23.812  43.854  1.00 98.36  ? 5    A   R "O3'" 1 
ATOM   363   C  "C2'" . A   B 2  5    ? 8.178   -24.278  41.529  1.00 94.72  ? 5    A   R "C2'" 1 
ATOM   364   O  "O2'" . A   B 2  5    ? 6.865   -23.813  41.375  1.00 92.62  ? 5    A   R "O2'" 1 
ATOM   365   C  "C1'" . A   B 2  5    ? 9.091   -23.705  40.455  1.00 95.24  ? 5    A   R "C1'" 1 
ATOM   366   N  N9    . A   B 2  5    ? 10.205  -24.596  40.127  1.00 95.87  ? 5    A   R N9    1 
ATOM   367   C  C8    . A   B 2  5    ? 11.524  -24.492  40.488  1.00 96.33  ? 5    A   R C8    1 
ATOM   368   N  N7    . A   B 2  5    ? 12.262  -25.505  40.096  1.00 97.70  ? 5    A   R N7    1 
ATOM   369   C  C5    . A   B 2  5    ? 11.365  -26.324  39.423  1.00 98.97  ? 5    A   R C5    1 
ATOM   370   C  C6    . A   B 2  5    ? 11.502  -27.569  38.799  1.00 99.35  ? 5    A   R C6    1 
ATOM   371   N  N6    . A   B 2  5    ? 12.639  -28.265  38.804  1.00 98.52  ? 5    A   R N6    1 
ATOM   372   N  N1    . A   B 2  5    ? 10.409  -28.091  38.182  1.00 98.36  ? 5    A   R N1    1 
ATOM   373   C  C2    . A   B 2  5    ? 9.255   -27.404  38.226  1.00 97.07  ? 5    A   R C2    1 
ATOM   374   N  N3    . A   B 2  5    ? 8.998   -26.244  38.812  1.00 97.81  ? 5    A   R N3    1 
ATOM   375   C  C4    . A   B 2  5    ? 10.105  -25.754  39.399  1.00 97.82  ? 5    A   R C4    1 
ATOM   376   P  P     . G   B 2  6    ? 7.669   -25.228  44.610  1.00 99.68  ? 6    G   R P     1 
ATOM   377   O  OP1   . G   B 2  6    ? 6.460   -25.108  45.447  1.00 100.21 ? 6    G   R OP1   1 
ATOM   378   O  OP2   . G   B 2  6    ? 8.964   -25.620  45.256  1.00 100.62 ? 6    G   R OP2   1 
ATOM   379   O  "O5'" . G   B 2  6    ? 7.342   -26.282  43.451  1.00 96.88  ? 6    G   R "O5'" 1 
ATOM   380   C  "C5'" . G   B 2  6    ? 6.049   -26.368  42.889  1.00 91.91  ? 6    G   R "C5'" 1 
ATOM   381   C  "C4'" . G   B 2  6    ? 5.969   -27.527  41.910  1.00 90.01  ? 6    G   R "C4'" 1 
ATOM   382   O  "O4'" . G   B 2  6    ? 7.087   -27.448  40.983  1.00 88.93  ? 6    G   R "O4'" 1 
ATOM   383   C  "C3'" . G   B 2  6    ? 6.096   -28.949  42.446  1.00 87.10  ? 6    G   R "C3'" 1 
ATOM   384   O  "O3'" . G   B 2  6    ? 4.887   -29.407  43.037  1.00 88.19  ? 6    G   R "O3'" 1 
ATOM   385   C  "C2'" . G   B 2  6    ? 6.424   -29.710  41.180  1.00 86.08  ? 6    G   R "C2'" 1 
ATOM   386   O  "O2'" . G   B 2  6    ? 5.344   -29.939  40.346  1.00 83.13  ? 6    G   R "O2'" 1 
ATOM   387   C  "C1'" . G   B 2  6    ? 7.379   -28.743  40.499  1.00 87.98  ? 6    G   R "C1'" 1 
ATOM   388   N  N9    . G   B 2  6    ? 8.754   -29.065  40.846  1.00 89.60  ? 6    G   R N9    1 
ATOM   389   C  C8    . G   B 2  6    ? 9.562   -28.446  41.775  1.00 90.05  ? 6    G   R C8    1 
ATOM   390   N  N7    . G   B 2  6    ? 10.753  -28.980  41.852  1.00 91.73  ? 6    G   R N7    1 
ATOM   391   C  C5    . G   B 2  6    ? 10.732  -30.001  40.908  1.00 93.29  ? 6    G   R C5    1 
ATOM   392   C  C6    . G   B 2  6    ? 11.746  -30.910  40.513  1.00 95.98  ? 6    G   R C6    1 
ATOM   393   O  O6    . G   B 2  6    ? 12.922  -30.969  40.902  1.00 98.85  ? 6    G   R O6    1 
ATOM   394   N  N1    . G   B 2  6    ? 11.286  -31.804  39.546  1.00 95.64  ? 6    G   R N1    1 
ATOM   395   C  C2    . G   B 2  6    ? 10.025  -31.807  39.005  1.00 94.67  ? 6    G   R C2    1 
ATOM   396   N  N2    . G   B 2  6    ? 9.771   -32.777  38.092  1.00 96.44  ? 6    G   R N2    1 
ATOM   397   N  N3    . G   B 2  6    ? 9.083   -30.937  39.334  1.00 93.28  ? 6    G   R N3    1 
ATOM   398   C  C4    . G   B 2  6    ? 9.502   -30.073  40.290  1.00 91.69  ? 6    G   R C4    1 
ATOM   399   P  P     . G   B 2  7    ? 4.878   -30.777  43.886  1.00 92.81  ? 7    G   R P     1 
ATOM   400   O  OP1   . G   B 2  7    ? 3.468   -31.039  44.272  1.00 94.28  ? 7    G   R OP1   1 
ATOM   401   O  OP2   . G   B 2  7    ? 5.944   -30.802  44.919  1.00 94.19  ? 7    G   R OP2   1 
ATOM   402   O  "O5'" . G   B 2  7    ? 5.331   -31.845  42.803  1.00 93.41  ? 7    G   R "O5'" 1 
ATOM   403   C  "C5'" . G   B 2  7    ? 4.415   -32.323  41.805  1.00 93.24  ? 7    G   R "C5'" 1 
ATOM   404   C  "C4'" . G   B 2  7    ? 4.811   -33.705  41.356  1.00 90.55  ? 7    G   R "C4'" 1 
ATOM   405   O  "O4'" . G   B 2  7    ? 5.999   -33.632  40.534  1.00 89.27  ? 7    G   R "O4'" 1 
ATOM   406   C  "C3'" . G   B 2  7    ? 5.151   -34.694  42.448  1.00 87.13  ? 7    G   R "C3'" 1 
ATOM   407   O  "O3'" . G   B 2  7    ? 3.940   -35.204  43.024  1.00 88.76  ? 7    G   R "O3'" 1 
ATOM   408   C  "C2'" . G   B 2  7    ? 6.030   -35.695  41.693  1.00 86.61  ? 7    G   R "C2'" 1 
ATOM   409   O  "O2'" . G   B 2  7    ? 5.267   -36.518  40.841  1.00 87.24  ? 7    G   R "O2'" 1 
ATOM   410   C  "C1'" . G   B 2  7    ? 6.814   -34.771  40.766  1.00 86.97  ? 7    G   R "C1'" 1 
ATOM   411   N  N9    . G   B 2  7    ? 8.114   -34.348  41.291  1.00 87.60  ? 7    G   R N9    1 
ATOM   412   C  C8    . G   B 2  7    ? 8.423   -33.134  41.847  1.00 87.97  ? 7    G   R C8    1 
ATOM   413   N  N7    . G   B 2  7    ? 9.681   -33.020  42.196  1.00 85.62  ? 7    G   R N7    1 
ATOM   414   C  C5    . G   B 2  7    ? 10.238  -34.246  41.863  1.00 86.42  ? 7    G   R C5    1 
ATOM   415   C  C6    . G   B 2  7    ? 11.574  -34.732  42.001  1.00 86.57  ? 7    G   R C6    1 
ATOM   416   O  O6    . G   B 2  7    ? 12.562  -34.146  42.457  1.00 85.93  ? 7    G   R O6    1 
ATOM   417   N  N1    . G   B 2  7    ? 11.689  -36.048  41.536  1.00 87.78  ? 7    G   R N1    1 
ATOM   418   C  C2    . G   B 2  7    ? 10.658  -36.792  41.009  1.00 87.88  ? 7    G   R C2    1 
ATOM   419   N  N2    . G   B 2  7    ? 10.970  -38.042  40.648  1.00 88.48  ? 7    G   R N2    1 
ATOM   420   N  N3    . G   B 2  7    ? 9.419   -36.346  40.859  1.00 87.01  ? 7    G   R N3    1 
ATOM   421   C  C4    . G   B 2  7    ? 9.280   -35.082  41.307  1.00 87.40  ? 7    G   R C4    1 
ATOM   422   P  P     . C   B 2  8    ? 4.001   -36.017  44.406  1.00 87.47  ? 8    C   R P     1 
ATOM   423   O  OP1   . C   B 2  8    ? 2.765   -36.825  44.450  1.00 87.98  ? 8    C   R OP1   1 
ATOM   424   O  OP2   . C   B 2  8    ? 4.379   -35.194  45.611  1.00 89.71  ? 8    C   R OP2   1 
ATOM   425   O  "O5'" . C   B 2  8    ? 5.129   -37.078  44.078  1.00 86.19  ? 8    C   R "O5'" 1 
ATOM   426   C  "C5'" . C   B 2  8    ? 4.827   -38.282  43.398  1.00 86.49  ? 8    C   R "C5'" 1 
ATOM   427   C  "C4'" . C   B 2  8    ? 5.862   -39.296  43.785  1.00 85.89  ? 8    C   R "C4'" 1 
ATOM   428   O  "O4'" . C   B 2  8    ? 7.112   -38.981  43.136  1.00 87.27  ? 8    C   R "O4'" 1 
ATOM   429   C  "C3'" . C   B 2  8    ? 6.277   -39.308  45.247  1.00 89.93  ? 8    C   R "C3'" 1 
ATOM   430   O  "O3'" . C   B 2  8    ? 5.578   -40.208  46.029  1.00 90.03  ? 8    C   R "O3'" 1 
ATOM   431   C  "C2'" . C   B 2  8    ? 7.607   -40.004  45.233  1.00 86.42  ? 8    C   R "C2'" 1 
ATOM   432   O  "O2'" . C   B 2  8    ? 7.401   -41.422  45.239  1.00 88.30  ? 8    C   R "O2'" 1 
ATOM   433   C  "C1'" . C   B 2  8    ? 8.180   -39.487  43.926  1.00 88.32  ? 8    C   R "C1'" 1 
ATOM   434   N  N1    . C   B 2  8    ? 9.129   -38.414  44.205  1.00 89.57  ? 8    C   R N1    1 
ATOM   435   C  C2    . C   B 2  8    ? 10.459  -38.732  44.170  1.00 91.04  ? 8    C   R C2    1 
ATOM   436   O  O2    . C   B 2  8    ? 10.771  -39.900  43.898  1.00 93.21  ? 8    C   R O2    1 
ATOM   437   N  N3    . C   B 2  8    ? 11.380  -37.778  44.422  1.00 88.81  ? 8    C   R N3    1 
ATOM   438   C  C4    . C   B 2  8    ? 10.995  -36.534  44.686  1.00 89.48  ? 8    C   R C4    1 
ATOM   439   N  N4    . C   B 2  8    ? 11.939  -35.642  44.935  1.00 90.47  ? 8    C   R N4    1 
ATOM   440   C  C5    . C   B 2  8    ? 9.624   -36.166  44.715  1.00 89.27  ? 8    C   R C5    1 
ATOM   441   C  C6    . C   B 2  8    ? 8.727   -37.139  44.491  1.00 88.30  ? 8    C   R C6    1 
ATOM   442   P  P     . A   B 2  9    ? 5.226   -39.791  47.574  1.00 83.99  ? 9    A   R P     1 
ATOM   443   O  OP1   . A   B 2  9    ? 3.648   -39.989  47.473  1.00 86.11  ? 9    A   R OP1   1 
ATOM   444   O  OP2   . A   B 2  9    ? 5.820   -38.313  47.866  1.00 88.57  ? 9    A   R OP2   1 
ATOM   445   O  "O5'" . A   B 2  9    ? 5.947   -40.927  48.495  1.00 92.22  ? 9    A   R "O5'" 1 
ATOM   446   C  "C5'" . A   B 2  9    ? 6.744   -41.929  47.845  1.00 92.09  ? 9    A   R "C5'" 1 
ATOM   447   C  "C4'" . A   B 2  9    ? 8.153   -41.689  48.231  1.00 89.99  ? 9    A   R "C4'" 1 
ATOM   448   O  "O4'" . A   B 2  9    ? 9.015   -41.243  47.182  1.00 90.05  ? 9    A   R "O4'" 1 
ATOM   449   C  "C3'" . A   B 2  9    ? 8.604   -40.925  49.521  1.00 89.41  ? 9    A   R "C3'" 1 
ATOM   450   O  "O3'" . A   B 2  9    ? 8.424   -41.897  50.592  1.00 93.03  ? 9    A   R "O3'" 1 
ATOM   451   C  "C2'" . A   B 2  9    ? 10.169  -41.030  49.394  1.00 92.01  ? 9    A   R "C2'" 1 
ATOM   452   O  "O2'" . A   B 2  9    ? 10.559  -42.455  49.468  1.00 94.79  ? 9    A   R "O2'" 1 
ATOM   453   C  "C1'" . A   B 2  9    ? 10.289  -40.923  47.847  1.00 89.33  ? 9    A   R "C1'" 1 
ATOM   454   N  N9    . A   B 2  9    ? 10.435  -39.516  47.825  1.00 87.52  ? 9    A   R N9    1 
ATOM   455   C  C8    . A   B 2  9    ? 9.380   -38.606  47.845  1.00 84.98  ? 9    A   R C8    1 
ATOM   456   N  N7    . A   B 2  9    ? 9.765   -37.357  47.908  1.00 83.04  ? 9    A   R N7    1 
ATOM   457   C  C5    . A   B 2  9    ? 11.178  -37.460  47.930  1.00 82.06  ? 9    A   R C5    1 
ATOM   458   C  C6    . A   B 2  9    ? 12.205  -36.522  48.035  1.00 80.70  ? 9    A   R C6    1 
ATOM   459   N  N6    . A   B 2  9    ? 11.990  -35.203  48.156  1.00 77.41  ? 9    A   R N6    1 
ATOM   460   N  N1    . A   B 2  9    ? 13.505  -36.996  48.035  1.00 79.68  ? 9    A   R N1    1 
ATOM   461   C  C2    . A   B 2  9    ? 13.729  -38.315  47.954  1.00 78.06  ? 9    A   R C2    1 
ATOM   462   N  N3    . A   B 2  9    ? 12.853  -39.296  47.882  1.00 78.06  ? 9    A   R N3    1 
ATOM   463   C  C4    . A   B 2  9    ? 11.583  -38.792  47.871  1.00 83.89  ? 9    A   R C4    1 
ATOM   464   N  N     . VAL C 3  2    ? 34.446  -50.357  18.311  1.00 126.83 ? 2    VAL A N     1 
ATOM   465   C  CA    . VAL C 3  2    ? 33.006  -50.254  18.533  1.00 126.66 ? 2    VAL A CA    1 
ATOM   466   C  C     . VAL C 3  2    ? 32.281  -49.677  17.309  1.00 125.95 ? 2    VAL A C     1 
ATOM   467   O  O     . VAL C 3  2    ? 31.469  -50.361  16.678  1.00 125.61 ? 2    VAL A O     1 
ATOM   468   C  CB    . VAL C 3  2    ? 32.709  -49.382  19.778  1.00 127.29 ? 2    VAL A CB    1 
ATOM   469   C  CG1   . VAL C 3  2    ? 31.203  -49.221  19.960  1.00 127.73 ? 2    VAL A CG1   1 
ATOM   470   C  CG2   . VAL C 3  2    ? 33.337  -50.020  21.018  1.00 126.56 ? 2    VAL A CG2   1 
ATOM   471   N  N     . GLY C 3  3    ? 32.578  -48.422  16.978  1.00 124.98 ? 3    GLY A N     1 
ATOM   472   C  CA    . GLY C 3  3    ? 31.953  -47.780  15.832  1.00 122.47 ? 3    GLY A CA    1 
ATOM   473   C  C     . GLY C 3  3    ? 32.989  -47.129  14.936  1.00 120.60 ? 3    GLY A C     1 
ATOM   474   O  O     . GLY C 3  3    ? 32.735  -46.097  14.313  1.00 119.85 ? 3    GLY A O     1 
ATOM   475   N  N     . GLN C 3  4    ? 34.166  -47.742  14.874  1.00 118.66 ? 4    GLN A N     1 
ATOM   476   C  CA    . GLN C 3  4    ? 35.254  -47.225  14.062  1.00 117.06 ? 4    GLN A CA    1 
ATOM   477   C  C     . GLN C 3  4    ? 35.859  -48.297  13.164  1.00 117.30 ? 4    GLN A C     1 
ATOM   478   O  O     . GLN C 3  4    ? 35.415  -49.448  13.162  1.00 117.06 ? 4    GLN A O     1 
ATOM   479   C  CB    . GLN C 3  4    ? 36.330  -46.625  14.963  1.00 115.02 ? 4    GLN A CB    1 
ATOM   480   C  CG    . GLN C 3  4    ? 35.875  -45.374  15.689  1.00 114.69 ? 4    GLN A CG    1 
ATOM   481   C  CD    . GLN C 3  4    ? 36.099  -45.439  17.194  1.00 114.51 ? 4    GLN A CD    1 
ATOM   482   O  OE1   . GLN C 3  4    ? 37.201  -45.714  17.658  1.00 115.08 ? 4    GLN A OE1   1 
ATOM   483   N  NE2   . GLN C 3  4    ? 35.050  -45.173  17.962  1.00 114.84 ? 4    GLN A NE2   1 
ATOM   484   N  N     . GLN C 3  5    ? 36.885  -47.901  12.414  1.00 117.08 ? 5    GLN A N     1 
ATOM   485   C  CA    . GLN C 3  5    ? 37.572  -48.779  11.470  1.00 116.53 ? 5    GLN A CA    1 
ATOM   486   C  C     . GLN C 3  5    ? 38.502  -49.798  12.141  1.00 115.45 ? 5    GLN A C     1 
ATOM   487   O  O     . GLN C 3  5    ? 38.773  -49.712  13.335  1.00 114.96 ? 5    GLN A O     1 
ATOM   488   C  CB    . GLN C 3  5    ? 38.360  -47.918  10.478  1.00 117.24 ? 5    GLN A CB    1 
ATOM   489   C  CG    . GLN C 3  5    ? 37.634  -46.632  10.101  1.00 118.38 ? 5    GLN A CG    1 
ATOM   490   C  CD    . GLN C 3  5    ? 38.397  -45.786  9.103   1.00 119.84 ? 5    GLN A CD    1 
ATOM   491   O  OE1   . GLN C 3  5    ? 39.597  -45.554  9.258   1.00 119.55 ? 5    GLN A OE1   1 
ATOM   492   N  NE2   . GLN C 3  5    ? 37.699  -45.306  8.077   1.00 120.24 ? 5    GLN A NE2   1 
ATOM   493   N  N     . TYR C 3  6    ? 38.980  -50.761  11.356  1.00 114.66 ? 6    TYR A N     1 
ATOM   494   C  CA    . TYR C 3  6    ? 39.875  -51.815  11.836  1.00 113.70 ? 6    TYR A CA    1 
ATOM   495   C  C     . TYR C 3  6    ? 41.132  -51.218  12.465  1.00 112.63 ? 6    TYR A C     1 
ATOM   496   O  O     . TYR C 3  6    ? 41.269  -50.000  12.560  1.00 113.06 ? 6    TYR A O     1 
ATOM   497   C  CB    . TYR C 3  6    ? 40.282  -52.709  10.664  1.00 115.41 ? 6    TYR A CB    1 
ATOM   498   C  CG    . TYR C 3  6    ? 40.621  -54.136  11.029  1.00 117.67 ? 6    TYR A CG    1 
ATOM   499   C  CD1   . TYR C 3  6    ? 39.613  -55.065  11.279  1.00 118.53 ? 6    TYR A CD1   1 
ATOM   500   C  CD2   . TYR C 3  6    ? 41.949  -54.568  11.096  1.00 118.87 ? 6    TYR A CD2   1 
ATOM   501   C  CE1   . TYR C 3  6    ? 39.914  -56.391  11.581  1.00 120.31 ? 6    TYR A CE1   1 
ATOM   502   C  CE2   . TYR C 3  6    ? 42.265  -55.893  11.401  1.00 119.83 ? 6    TYR A CE2   1 
ATOM   503   C  CZ    . TYR C 3  6    ? 41.241  -56.800  11.640  1.00 120.89 ? 6    TYR A CZ    1 
ATOM   504   O  OH    . TYR C 3  6    ? 41.542  -58.116  11.924  1.00 121.17 ? 6    TYR A OH    1 
ATOM   505   N  N     . SER C 3  7    ? 42.049  -52.081  12.892  1.00 111.48 ? 7    SER A N     1 
ATOM   506   C  CA    . SER C 3  7    ? 43.303  -51.633  13.489  1.00 110.45 ? 7    SER A CA    1 
ATOM   507   C  C     . SER C 3  7    ? 44.272  -52.795  13.646  1.00 109.75 ? 7    SER A C     1 
ATOM   508   O  O     . SER C 3  7    ? 44.053  -53.695  14.457  1.00 109.17 ? 7    SER A O     1 
ATOM   509   C  CB    . SER C 3  7    ? 43.065  -51.000  14.860  1.00 109.81 ? 7    SER A CB    1 
ATOM   510   O  OG    . SER C 3  7    ? 42.764  -51.996  15.816  1.00 111.50 ? 7    SER A OG    1 
ATOM   511   N  N     . SER C 3  8    ? 45.340  -52.771  12.856  1.00 109.47 ? 8    SER A N     1 
ATOM   512   C  CA    . SER C 3  8    ? 46.361  -53.806  12.918  1.00 107.87 ? 8    SER A CA    1 
ATOM   513   C  C     . SER C 3  8    ? 46.710  -54.001  14.385  1.00 106.69 ? 8    SER A C     1 
ATOM   514   O  O     . SER C 3  8    ? 46.959  -55.119  14.836  1.00 106.16 ? 8    SER A O     1 
ATOM   515   C  CB    . SER C 3  8    ? 47.602  -53.369  12.126  1.00 108.52 ? 8    SER A CB    1 
ATOM   516   O  OG    . SER C 3  8    ? 48.018  -52.059  12.486  1.00 107.41 ? 8    SER A OG    1 
ATOM   517   N  N     . ALA C 3  9    ? 46.705  -52.893  15.121  1.00 105.21 ? 9    ALA A N     1 
ATOM   518   C  CA    . ALA C 3  9    ? 47.009  -52.894  16.542  1.00 103.52 ? 9    ALA A CA    1 
ATOM   519   C  C     . ALA C 3  9    ? 46.136  -53.921  17.247  1.00 102.58 ? 9    ALA A C     1 
ATOM   520   O  O     . ALA C 3  9    ? 44.962  -54.078  16.914  1.00 103.28 ? 9    ALA A O     1 
ATOM   521   C  CB    . ALA C 3  9    ? 46.761  -51.511  17.121  1.00 103.04 ? 9    ALA A CB    1 
ATOM   522   N  N     . PRO C 3  10   ? 46.701  -54.643  18.228  1.00 101.39 ? 10   PRO A N     1 
ATOM   523   C  CA    . PRO C 3  10   ? 45.939  -55.653  18.962  1.00 100.48 ? 10   PRO A CA    1 
ATOM   524   C  C     . PRO C 3  10   ? 45.085  -54.973  20.022  1.00 100.24 ? 10   PRO A C     1 
ATOM   525   O  O     . PRO C 3  10   ? 45.429  -53.890  20.501  1.00 99.86  ? 10   PRO A O     1 
ATOM   526   C  CB    . PRO C 3  10   ? 47.030  -56.515  19.573  1.00 98.80  ? 10   PRO A CB    1 
ATOM   527   C  CG    . PRO C 3  10   ? 48.041  -55.484  19.950  1.00 99.46  ? 10   PRO A CG    1 
ATOM   528   C  CD    . PRO C 3  10   ? 48.089  -54.585  18.721  1.00 100.54 ? 10   PRO A CD    1 
ATOM   529   N  N     . LEU C 3  11   ? 43.974  -55.607  20.377  1.00 99.81  ? 11   LEU A N     1 
ATOM   530   C  CA    . LEU C 3  11   ? 43.072  -55.062  21.387  1.00 98.80  ? 11   LEU A CA    1 
ATOM   531   C  C     . LEU C 3  11   ? 43.422  -55.617  22.752  1.00 97.55  ? 11   LEU A C     1 
ATOM   532   O  O     . LEU C 3  11   ? 43.758  -56.795  22.876  1.00 96.96  ? 11   LEU A O     1 
ATOM   533   C  CB    . LEU C 3  11   ? 41.618  -55.426  21.074  1.00 99.04  ? 11   LEU A CB    1 
ATOM   534   C  CG    . LEU C 3  11   ? 40.624  -55.156  22.210  1.00 97.87  ? 11   LEU A CG    1 
ATOM   535   C  CD1   . LEU C 3  11   ? 40.529  -53.657  22.461  1.00 98.59  ? 11   LEU A CD1   1 
ATOM   536   C  CD2   . LEU C 3  11   ? 39.265  -55.738  21.856  1.00 97.71  ? 11   LEU A CD2   1 
ATOM   537   N  N     . ARG C 3  12   ? 43.339  -54.772  23.776  1.00 96.39  ? 12   ARG A N     1 
ATOM   538   C  CA    . ARG C 3  12   ? 43.636  -55.223  25.126  1.00 95.58  ? 12   ARG A CA    1 
ATOM   539   C  C     . ARG C 3  12   ? 42.882  -54.538  26.251  1.00 92.81  ? 12   ARG A C     1 
ATOM   540   O  O     . ARG C 3  12   ? 42.224  -53.510  26.063  1.00 93.53  ? 12   ARG A O     1 
ATOM   541   C  CB    . ARG C 3  12   ? 45.136  -55.156  25.399  1.00 98.81  ? 12   ARG A CB    1 
ATOM   542   C  CG    . ARG C 3  12   ? 45.890  -56.236  24.665  1.00 103.71 ? 12   ARG A CG    1 
ATOM   543   C  CD    . ARG C 3  12   ? 47.162  -56.634  25.364  1.00 107.01 ? 12   ARG A CD    1 
ATOM   544   N  NE    . ARG C 3  12   ? 47.665  -57.886  24.811  1.00 111.45 ? 12   ARG A NE    1 
ATOM   545   C  CZ    . ARG C 3  12   ? 48.799  -58.470  25.184  1.00 114.23 ? 12   ARG A CZ    1 
ATOM   546   N  NH1   . ARG C 3  12   ? 49.560  -57.913  26.118  1.00 115.31 ? 12   ARG A NH1   1 
ATOM   547   N  NH2   . ARG C 3  12   ? 49.167  -59.615  24.625  1.00 115.41 ? 12   ARG A NH2   1 
ATOM   548   N  N     . THR C 3  13   ? 42.994  -55.146  27.427  1.00 88.64  ? 13   THR A N     1 
ATOM   549   C  CA    . THR C 3  13   ? 42.337  -54.683  28.637  1.00 83.15  ? 13   THR A CA    1 
ATOM   550   C  C     . THR C 3  13   ? 43.368  -54.115  29.591  1.00 79.52  ? 13   THR A C     1 
ATOM   551   O  O     . THR C 3  13   ? 44.389  -54.747  29.841  1.00 79.78  ? 13   THR A O     1 
ATOM   552   C  CB    . THR C 3  13   ? 41.638  -55.856  29.342  1.00 82.33  ? 13   THR A CB    1 
ATOM   553   O  OG1   . THR C 3  13   ? 40.720  -56.477  28.438  1.00 81.97  ? 13   THR A OG1   1 
ATOM   554   C  CG2   . THR C 3  13   ? 40.898  -55.378  30.576  1.00 82.54  ? 13   THR A CG2   1 
ATOM   555   N  N     . VAL C 3  14   ? 43.109  -52.927  30.122  1.00 75.11  ? 14   VAL A N     1 
ATOM   556   C  CA    . VAL C 3  14   ? 44.039  -52.332  31.067  1.00 71.27  ? 14   VAL A CA    1 
ATOM   557   C  C     . VAL C 3  14   ? 44.147  -53.319  32.230  1.00 70.49  ? 14   VAL A C     1 
ATOM   558   O  O     . VAL C 3  14   ? 43.206  -54.071  32.492  1.00 70.49  ? 14   VAL A O     1 
ATOM   559   C  CB    . VAL C 3  14   ? 43.523  -50.972  31.582  1.00 70.24  ? 14   VAL A CB    1 
ATOM   560   C  CG1   . VAL C 3  14   ? 44.523  -50.364  32.537  1.00 70.60  ? 14   VAL A CG1   1 
ATOM   561   C  CG2   . VAL C 3  14   ? 43.285  -50.030  30.422  1.00 69.61  ? 14   VAL A CG2   1 
ATOM   562   N  N     . LYS C 3  15   ? 45.294  -53.333  32.909  1.00 68.88  ? 15   LYS A N     1 
ATOM   563   C  CA    . LYS C 3  15   ? 45.513  -54.236  34.039  1.00 66.39  ? 15   LYS A CA    1 
ATOM   564   C  C     . LYS C 3  15   ? 46.198  -53.508  35.199  1.00 65.50  ? 15   LYS A C     1 
ATOM   565   O  O     . LYS C 3  15   ? 46.180  -53.978  36.336  1.00 65.86  ? 15   LYS A O     1 
ATOM   566   C  CB    . LYS C 3  15   ? 46.366  -55.430  33.611  1.00 64.85  ? 15   LYS A CB    1 
ATOM   567   C  CG    . LYS C 3  15   ? 45.868  -56.173  32.391  1.00 67.74  ? 15   LYS A CG    1 
ATOM   568   C  CD    . LYS C 3  15   ? 44.515  -56.815  32.617  1.00 73.80  ? 15   LYS A CD    1 
ATOM   569   C  CE    . LYS C 3  15   ? 44.050  -57.552  31.358  1.00 79.04  ? 15   LYS A CE    1 
ATOM   570   N  NZ    . LYS C 3  15   ? 42.695  -58.176  31.498  1.00 82.08  ? 15   LYS A NZ    1 
ATOM   571   N  N     . GLU C 3  16   ? 46.810  -52.367  34.907  1.00 64.39  ? 16   GLU A N     1 
ATOM   572   C  CA    . GLU C 3  16   ? 47.477  -51.577  35.937  1.00 66.11  ? 16   GLU A CA    1 
ATOM   573   C  C     . GLU C 3  16   ? 47.458  -50.114  35.537  1.00 65.52  ? 16   GLU A C     1 
ATOM   574   O  O     . GLU C 3  16   ? 47.330  -49.780  34.361  1.00 64.92  ? 16   GLU A O     1 
ATOM   575   C  CB    . GLU C 3  16   ? 48.948  -51.980  36.109  1.00 69.74  ? 16   GLU A CB    1 
ATOM   576   C  CG    . GLU C 3  16   ? 49.241  -53.430  36.450  1.00 74.73  ? 16   GLU A CG    1 
ATOM   577   C  CD    . GLU C 3  16   ? 50.737  -53.678  36.634  1.00 79.01  ? 16   GLU A CD    1 
ATOM   578   O  OE1   . GLU C 3  16   ? 51.537  -53.231  35.784  1.00 81.16  ? 16   GLU A OE1   1 
ATOM   579   O  OE2   . GLU C 3  16   ? 51.117  -54.325  37.628  1.00 83.80  ? 16   GLU A OE2   1 
ATOM   580   N  N     . VAL C 3  17   ? 47.595  -49.239  36.520  1.00 64.70  ? 17   VAL A N     1 
ATOM   581   C  CA    . VAL C 3  17   ? 47.634  -47.819  36.244  1.00 66.30  ? 17   VAL A CA    1 
ATOM   582   C  C     . VAL C 3  17   ? 48.765  -47.247  37.068  1.00 68.36  ? 17   VAL A C     1 
ATOM   583   O  O     . VAL C 3  17   ? 48.745  -47.300  38.299  1.00 68.54  ? 17   VAL A O     1 
ATOM   584   C  CB    . VAL C 3  17   ? 46.322  -47.130  36.608  1.00 65.99  ? 17   VAL A CB    1 
ATOM   585   C  CG1   . VAL C 3  17   ? 46.429  -45.640  36.332  1.00 64.37  ? 17   VAL A CG1   1 
ATOM   586   C  CG2   . VAL C 3  17   ? 45.194  -47.729  35.787  1.00 67.75  ? 17   VAL A CG2   1 
ATOM   587   N  N     . GLN C 3  18   ? 49.759  -46.714  36.366  1.00 70.20  ? 18   GLN A N     1 
ATOM   588   C  CA    . GLN C 3  18   ? 50.947  -46.147  36.986  1.00 71.37  ? 18   GLN A CA    1 
ATOM   589   C  C     . GLN C 3  18   ? 50.875  -44.637  37.064  1.00 71.85  ? 18   GLN A C     1 
ATOM   590   O  O     . GLN C 3  18   ? 51.276  -43.947  36.137  1.00 70.49  ? 18   GLN A O     1 
ATOM   591   C  CB    . GLN C 3  18   ? 52.188  -46.545  36.183  1.00 71.62  ? 18   GLN A CB    1 
ATOM   592   C  CG    . GLN C 3  18   ? 53.305  -47.146  37.012  1.00 71.75  ? 18   GLN A CG    1 
ATOM   593   C  CD    . GLN C 3  18   ? 53.439  -46.476  38.365  1.00 74.60  ? 18   GLN A CD    1 
ATOM   594   O  OE1   . GLN C 3  18   ? 53.480  -45.242  38.474  1.00 72.47  ? 18   GLN A OE1   1 
ATOM   595   N  NE2   . GLN C 3  18   ? 53.509  -47.290  39.412  1.00 76.46  ? 18   GLN A NE2   1 
ATOM   596   N  N     . PHE C 3  19   ? 50.376  -44.109  38.168  1.00 74.12  ? 19   PHE A N     1 
ATOM   597   C  CA    . PHE C 3  19   ? 50.296  -42.664  38.274  1.00 78.46  ? 19   PHE A CA    1 
ATOM   598   C  C     . PHE C 3  19   ? 51.661  -42.016  38.467  1.00 80.55  ? 19   PHE A C     1 
ATOM   599   O  O     . PHE C 3  19   ? 52.638  -42.683  38.824  1.00 80.94  ? 19   PHE A O     1 
ATOM   600   C  CB    . PHE C 3  19   ? 49.354  -42.261  39.405  1.00 78.49  ? 19   PHE A CB    1 
ATOM   601   C  CG    . PHE C 3  19   ? 47.923  -42.541  39.104  1.00 78.39  ? 19   PHE A CG    1 
ATOM   602   C  CD1   . PHE C 3  19   ? 47.362  -43.777  39.404  1.00 78.20  ? 19   PHE A CD1   1 
ATOM   603   C  CD2   . PHE C 3  19   ? 47.142  -41.582  38.470  1.00 79.21  ? 19   PHE A CD2   1 
ATOM   604   C  CE1   . PHE C 3  19   ? 46.044  -44.058  39.076  1.00 76.77  ? 19   PHE A CE1   1 
ATOM   605   C  CE2   . PHE C 3  19   ? 45.822  -41.850  38.135  1.00 79.26  ? 19   PHE A CE2   1 
ATOM   606   C  CZ    . PHE C 3  19   ? 45.271  -43.093  38.440  1.00 79.02  ? 19   PHE A CZ    1 
ATOM   607   N  N     . GLY C 3  20   ? 51.714  -40.712  38.214  1.00 81.50  ? 20   GLY A N     1 
ATOM   608   C  CA    . GLY C 3  20   ? 52.953  -39.975  38.358  1.00 83.24  ? 20   GLY A CA    1 
ATOM   609   C  C     . GLY C 3  20   ? 52.843  -38.547  37.864  1.00 84.25  ? 20   GLY A C     1 
ATOM   610   O  O     . GLY C 3  20   ? 51.741  -38.021  37.695  1.00 83.45  ? 20   GLY A O     1 
ATOM   611   N  N     . LEU C 3  21   ? 53.995  -37.925  37.625  1.00 85.04  ? 21   LEU A N     1 
ATOM   612   C  CA    . LEU C 3  21   ? 54.045  -36.548  37.160  1.00 85.77  ? 21   LEU A CA    1 
ATOM   613   C  C     . LEU C 3  21   ? 54.725  -36.419  35.802  1.00 86.32  ? 21   LEU A C     1 
ATOM   614   O  O     . LEU C 3  21   ? 55.436  -37.319  35.361  1.00 84.79  ? 21   LEU A O     1 
ATOM   615   C  CB    . LEU C 3  21   ? 54.764  -35.679  38.195  1.00 86.11  ? 21   LEU A CB    1 
ATOM   616   C  CG    . LEU C 3  21   ? 54.133  -35.630  39.591  1.00 86.73  ? 21   LEU A CG    1 
ATOM   617   C  CD1   . LEU C 3  21   ? 55.040  -34.872  40.543  1.00 87.60  ? 21   LEU A CD1   1 
ATOM   618   C  CD2   . LEU C 3  21   ? 52.771  -34.962  39.517  1.00 88.93  ? 21   LEU A CD2   1 
ATOM   619   N  N     . PHE C 3  22   ? 54.488  -35.284  35.152  1.00 88.68  ? 22   PHE A N     1 
ATOM   620   C  CA    . PHE C 3  22   ? 55.038  -34.989  33.834  1.00 92.07  ? 22   PHE A CA    1 
ATOM   621   C  C     . PHE C 3  22   ? 56.338  -34.212  33.913  1.00 94.59  ? 22   PHE A C     1 
ATOM   622   O  O     . PHE C 3  22   ? 56.345  -33.033  34.275  1.00 94.93  ? 22   PHE A O     1 
ATOM   623   C  CB    . PHE C 3  22   ? 54.034  -34.172  33.017  1.00 92.30  ? 22   PHE A CB    1 
ATOM   624   C  CG    . PHE C 3  22   ? 53.306  -34.961  31.961  1.00 93.95  ? 22   PHE A CG    1 
ATOM   625   C  CD1   . PHE C 3  22   ? 52.037  -34.567  31.541  1.00 95.44  ? 22   PHE A CD1   1 
ATOM   626   C  CD2   . PHE C 3  22   ? 53.891  -36.077  31.366  1.00 91.96  ? 22   PHE A CD2   1 
ATOM   627   C  CE1   . PHE C 3  22   ? 51.364  -35.266  30.541  1.00 94.87  ? 22   PHE A CE1   1 
ATOM   628   C  CE2   . PHE C 3  22   ? 53.225  -36.781  30.365  1.00 91.39  ? 22   PHE A CE2   1 
ATOM   629   C  CZ    . PHE C 3  22   ? 51.961  -36.377  29.954  1.00 92.91  ? 22   PHE A CZ    1 
ATOM   630   N  N     . SER C 3  23   ? 57.436  -34.878  33.574  1.00 97.34  ? 23   SER A N     1 
ATOM   631   C  CA    . SER C 3  23   ? 58.749  -34.246  33.573  1.00 99.88  ? 23   SER A CA    1 
ATOM   632   C  C     . SER C 3  23   ? 58.713  -33.173  32.497  1.00 101.33 ? 23   SER A C     1 
ATOM   633   O  O     . SER C 3  23   ? 58.234  -33.430  31.395  1.00 101.84 ? 23   SER A O     1 
ATOM   634   C  CB    . SER C 3  23   ? 59.818  -35.280  33.228  1.00 100.19 ? 23   SER A CB    1 
ATOM   635   O  OG    . SER C 3  23   ? 59.416  -36.077  32.127  1.00 101.41 ? 23   SER A OG    1 
ATOM   636   N  N     . PRO C 3  24   ? 59.208  -31.956  32.793  1.00 102.92 ? 24   PRO A N     1 
ATOM   637   C  CA    . PRO C 3  24   ? 59.159  -30.942  31.732  1.00 103.44 ? 24   PRO A CA    1 
ATOM   638   C  C     . PRO C 3  24   ? 59.779  -31.451  30.428  1.00 103.81 ? 24   PRO A C     1 
ATOM   639   O  O     . PRO C 3  24   ? 59.501  -30.915  29.355  1.00 103.80 ? 24   PRO A O     1 
ATOM   640   C  CB    . PRO C 3  24   ? 59.903  -29.747  32.343  1.00 103.11 ? 24   PRO A CB    1 
ATOM   641   C  CG    . PRO C 3  24   ? 60.788  -30.371  33.393  1.00 104.48 ? 24   PRO A CG    1 
ATOM   642   C  CD    . PRO C 3  24   ? 59.912  -31.447  33.984  1.00 103.91 ? 24   PRO A CD    1 
ATOM   643   N  N     . GLU C 3  25   ? 60.601  -32.498  30.530  1.00 104.23 ? 25   GLU A N     1 
ATOM   644   C  CA    . GLU C 3  25   ? 61.242  -33.108  29.363  1.00 104.55 ? 25   GLU A CA    1 
ATOM   645   C  C     . GLU C 3  25   ? 60.203  -33.855  28.531  1.00 104.77 ? 25   GLU A C     1 
ATOM   646   O  O     . GLU C 3  25   ? 60.027  -33.580  27.344  1.00 104.33 ? 25   GLU A O     1 
ATOM   647   C  CB    . GLU C 3  25   ? 62.328  -34.111  29.783  1.00 104.86 ? 25   GLU A CB    1 
ATOM   648   C  CG    . GLU C 3  25   ? 63.715  -33.531  30.059  1.00 105.56 ? 25   GLU A CG    1 
ATOM   649   C  CD    . GLU C 3  25   ? 63.832  -32.880  31.422  1.00 106.45 ? 25   GLU A CD    1 
ATOM   650   O  OE1   . GLU C 3  25   ? 63.409  -33.508  32.420  1.00 107.35 ? 25   GLU A OE1   1 
ATOM   651   O  OE2   . GLU C 3  25   ? 64.361  -31.747  31.494  1.00 104.34 ? 25   GLU A OE2   1 
ATOM   652   N  N     . GLU C 3  26   ? 59.523  -34.804  29.171  1.00 105.61 ? 26   GLU A N     1 
ATOM   653   C  CA    . GLU C 3  26   ? 58.497  -35.623  28.523  1.00 105.77 ? 26   GLU A CA    1 
ATOM   654   C  C     . GLU C 3  26   ? 57.335  -34.798  27.964  1.00 105.23 ? 26   GLU A C     1 
ATOM   655   O  O     . GLU C 3  26   ? 56.753  -35.157  26.940  1.00 104.29 ? 26   GLU A O     1 
ATOM   656   C  CB    . GLU C 3  26   ? 57.975  -36.675  29.515  1.00 105.73 ? 26   GLU A CB    1 
ATOM   657   C  CG    . GLU C 3  26   ? 56.945  -37.647  28.944  1.00 106.27 ? 26   GLU A CG    1 
ATOM   658   C  CD    . GLU C 3  26   ? 56.628  -38.791  29.899  1.00 107.08 ? 26   GLU A CD    1 
ATOM   659   O  OE1   . GLU C 3  26   ? 56.380  -38.520  31.095  1.00 108.74 ? 26   GLU A OE1   1 
ATOM   660   O  OE2   . GLU C 3  26   ? 56.619  -39.960  29.453  1.00 105.25 ? 26   GLU A OE2   1 
ATOM   661   N  N     . VAL C 3  27   ? 57.001  -33.697  28.634  1.00 105.07 ? 27   VAL A N     1 
ATOM   662   C  CA    . VAL C 3  27   ? 55.918  -32.836  28.176  1.00 105.42 ? 27   VAL A CA    1 
ATOM   663   C  C     . VAL C 3  27   ? 56.251  -32.324  26.784  1.00 107.15 ? 27   VAL A C     1 
ATOM   664   O  O     . VAL C 3  27   ? 55.368  -32.194  25.937  1.00 108.53 ? 27   VAL A O     1 
ATOM   665   C  CB    . VAL C 3  27   ? 55.715  -31.626  29.106  1.00 104.11 ? 27   VAL A CB    1 
ATOM   666   C  CG1   . VAL C 3  27   ? 54.566  -30.768  28.600  1.00 102.20 ? 27   VAL A CG1   1 
ATOM   667   C  CG2   . VAL C 3  27   ? 55.433  -32.100  30.516  1.00 105.25 ? 27   VAL A CG2   1 
ATOM   668   N  N     . ARG C 3  28   ? 57.531  -32.038  26.552  1.00 108.09 ? 28   ARG A N     1 
ATOM   669   C  CA    . ARG C 3  28   ? 57.989  -31.544  25.252  1.00 108.48 ? 28   ARG A CA    1 
ATOM   670   C  C     . ARG C 3  28   ? 58.147  -32.699  24.262  1.00 107.50 ? 28   ARG A C     1 
ATOM   671   O  O     . ARG C 3  28   ? 57.729  -32.606  23.106  1.00 106.59 ? 28   ARG A O     1 
ATOM   672   C  CB    . ARG C 3  28   ? 59.328  -30.808  25.400  1.00 109.94 ? 28   ARG A CB    1 
ATOM   673   C  CG    . ARG C 3  28   ? 59.294  -29.650  26.386  1.00 110.54 ? 28   ARG A CG    1 
ATOM   674   C  CD    . ARG C 3  28   ? 60.616  -28.895  26.436  1.00 109.73 ? 28   ARG A CD    1 
ATOM   675   N  NE    . ARG C 3  28   ? 60.590  -27.880  27.484  1.00 111.98 ? 28   ARG A NE    1 
ATOM   676   C  CZ    . ARG C 3  28   ? 61.605  -27.076  27.781  1.00 112.82 ? 28   ARG A CZ    1 
ATOM   677   N  NH1   . ARG C 3  28   ? 62.740  -27.163  27.103  1.00 114.70 ? 28   ARG A NH1   1 
ATOM   678   N  NH2   . ARG C 3  28   ? 61.485  -26.186  28.760  1.00 113.12 ? 28   ARG A NH2   1 
ATOM   679   N  N     . ALA C 3  29   ? 58.756  -33.785  24.726  1.00 106.98 ? 29   ALA A N     1 
ATOM   680   C  CA    . ALA C 3  29   ? 58.968  -34.962  23.896  1.00 107.48 ? 29   ALA A CA    1 
ATOM   681   C  C     . ALA C 3  29   ? 57.663  -35.335  23.210  1.00 107.83 ? 29   ALA A C     1 
ATOM   682   O  O     . ALA C 3  29   ? 57.624  -35.609  22.008  1.00 107.79 ? 29   ALA A O     1 
ATOM   683   C  CB    . ALA C 3  29   ? 59.453  -36.124  24.758  1.00 107.07 ? 29   ALA A CB    1 
ATOM   684   N  N     . ILE C 3  30   ? 56.594  -35.335  23.998  1.00 108.34 ? 30   ILE A N     1 
ATOM   685   C  CA    . ILE C 3  30   ? 55.266  -35.677  23.514  1.00 107.36 ? 30   ILE A CA    1 
ATOM   686   C  C     . ILE C 3  30   ? 54.666  -34.584  22.644  1.00 106.67 ? 30   ILE A C     1 
ATOM   687   O  O     . ILE C 3  30   ? 54.332  -34.825  21.487  1.00 106.74 ? 30   ILE A O     1 
ATOM   688   C  CB    . ILE C 3  30   ? 54.316  -35.974  24.701  1.00 106.82 ? 30   ILE A CB    1 
ATOM   689   C  CG1   . ILE C 3  30   ? 54.621  -37.363  25.262  1.00 106.92 ? 30   ILE A CG1   1 
ATOM   690   C  CG2   . ILE C 3  30   ? 52.866  -35.875  24.265  1.00 107.38 ? 30   ILE A CG2   1 
ATOM   691   C  CD1   . ILE C 3  30   ? 53.752  -37.757  26.432  1.00 108.05 ? 30   ILE A CD1   1 
ATOM   692   N  N     . SER C 3  31   ? 54.543  -33.386  23.204  1.00 106.14 ? 31   SER A N     1 
ATOM   693   C  CA    . SER C 3  31   ? 53.958  -32.253  22.494  1.00 106.31 ? 31   SER A CA    1 
ATOM   694   C  C     . SER C 3  31   ? 54.221  -32.238  20.997  1.00 106.72 ? 31   SER A C     1 
ATOM   695   O  O     . SER C 3  31   ? 55.178  -32.836  20.506  1.00 105.92 ? 31   SER A O     1 
ATOM   696   C  CB    . SER C 3  31   ? 54.457  -30.940  23.084  1.00 105.77 ? 31   SER A CB    1 
ATOM   697   O  OG    . SER C 3  31   ? 55.314  -30.273  22.172  1.00 103.93 ? 31   SER A OG    1 
ATOM   698   N  N     . VAL C 3  32   ? 53.350  -31.533  20.287  1.00 107.91 ? 32   VAL A N     1 
ATOM   699   C  CA    . VAL C 3  32   ? 53.435  -31.385  18.839  1.00 109.40 ? 32   VAL A CA    1 
ATOM   700   C  C     . VAL C 3  32   ? 53.189  -29.923  18.516  1.00 110.47 ? 32   VAL A C     1 
ATOM   701   O  O     . VAL C 3  32   ? 53.427  -29.466  17.400  1.00 110.74 ? 32   VAL A O     1 
ATOM   702   C  CB    . VAL C 3  32   ? 52.367  -32.230  18.120  1.00 108.55 ? 32   VAL A CB    1 
ATOM   703   C  CG1   . VAL C 3  32   ? 52.842  -33.666  17.981  1.00 109.39 ? 32   VAL A CG1   1 
ATOM   704   C  CG2   . VAL C 3  32   ? 51.068  -32.181  18.905  1.00 108.92 ? 32   VAL A CG2   1 
ATOM   705   N  N     . ALA C 3  33   ? 52.699  -29.193  19.509  1.00 112.37 ? 33   ALA A N     1 
ATOM   706   C  CA    . ALA C 3  33   ? 52.424  -27.778  19.344  1.00 113.91 ? 33   ALA A CA    1 
ATOM   707   C  C     . ALA C 3  33   ? 53.529  -27.002  20.026  1.00 114.61 ? 33   ALA A C     1 
ATOM   708   O  O     . ALA C 3  33   ? 54.421  -27.581  20.643  1.00 114.50 ? 33   ALA A O     1 
ATOM   709   C  CB    . ALA C 3  33   ? 51.079  -27.424  19.963  1.00 115.09 ? 33   ALA A CB    1 
ATOM   710   N  N     . LYS C 3  34   ? 53.457  -25.685  19.909  1.00 115.83 ? 34   LYS A N     1 
ATOM   711   C  CA    . LYS C 3  34   ? 54.443  -24.805  20.506  1.00 117.88 ? 34   LYS A CA    1 
ATOM   712   C  C     . LYS C 3  34   ? 53.666  -23.641  21.111  1.00 119.16 ? 34   LYS A C     1 
ATOM   713   O  O     . LYS C 3  34   ? 53.981  -23.171  22.202  1.00 119.71 ? 34   LYS A O     1 
ATOM   714   C  CB    . LYS C 3  34   ? 55.419  -24.333  19.423  1.00 118.18 ? 34   LYS A CB    1 
ATOM   715   C  CG    . LYS C 3  34   ? 56.072  -25.498  18.666  1.00 118.03 ? 34   LYS A CG    1 
ATOM   716   C  CD    . LYS C 3  34   ? 56.452  -25.136  17.230  1.00 117.42 ? 34   LYS A CD    1 
ATOM   717   C  CE    . LYS C 3  34   ? 56.748  -26.391  16.407  1.00 116.23 ? 34   LYS A CE    1 
ATOM   718   N  NZ    . LYS C 3  34   ? 56.888  -26.118  14.946  1.00 114.81 ? 34   LYS A NZ    1 
ATOM   719   N  N     . ILE C 3  35   ? 52.638  -23.195  20.394  1.00 120.91 ? 35   ILE A N     1 
ATOM   720   C  CA    . ILE C 3  35   ? 51.772  -22.108  20.844  1.00 122.64 ? 35   ILE A CA    1 
ATOM   721   C  C     . ILE C 3  35   ? 52.500  -20.843  21.298  1.00 123.89 ? 35   ILE A C     1 
ATOM   722   O  O     . ILE C 3  35   ? 53.104  -20.809  22.371  1.00 124.21 ? 35   ILE A O     1 
ATOM   723   C  CB    . ILE C 3  35   ? 50.850  -22.591  21.997  1.00 122.28 ? 35   ILE A CB    1 
ATOM   724   C  CG1   . ILE C 3  35   ? 49.926  -23.702  21.486  1.00 120.80 ? 35   ILE A CG1   1 
ATOM   725   C  CG2   . ILE C 3  35   ? 50.051  -21.419  22.562  1.00 121.62 ? 35   ILE A CG2   1 
ATOM   726   C  CD1   . ILE C 3  35   ? 48.931  -24.204  22.507  1.00 119.65 ? 35   ILE A CD1   1 
ATOM   727   N  N     . ARG C 3  36   ? 52.429  -19.798  20.482  1.00 124.98 ? 36   ARG A N     1 
ATOM   728   C  CA    . ARG C 3  36   ? 53.073  -18.537  20.820  1.00 126.64 ? 36   ARG A CA    1 
ATOM   729   C  C     . ARG C 3  36   ? 52.030  -17.433  20.836  1.00 127.28 ? 36   ARG A C     1 
ATOM   730   O  O     . ARG C 3  36   ? 52.245  -16.373  21.423  1.00 127.43 ? 36   ARG A O     1 
ATOM   731   C  CB    . ARG C 3  36   ? 54.155  -18.190  19.799  1.00 128.02 ? 36   ARG A CB    1 
ATOM   732   C  CG    . ARG C 3  36   ? 55.175  -19.285  19.569  1.00 129.29 ? 36   ARG A CG    1 
ATOM   733   C  CD    . ARG C 3  36   ? 55.215  -19.639  18.095  1.00 131.40 ? 36   ARG A CD    1 
ATOM   734   N  NE    . ARG C 3  36   ? 56.183  -20.689  17.794  1.00 133.03 ? 36   ARG A NE    1 
ATOM   735   C  CZ    . ARG C 3  36   ? 56.374  -21.200  16.580  1.00 133.45 ? 36   ARG A CZ    1 
ATOM   736   N  NH1   . ARG C 3  36   ? 55.660  -20.759  15.551  1.00 133.23 ? 36   ARG A NH1   1 
ATOM   737   N  NH2   . ARG C 3  36   ? 57.281  -22.152  16.394  1.00 132.35 ? 36   ARG A NH2   1 
ATOM   738   N  N     . PHE C 3  37   ? 50.902  -17.688  20.181  1.00 128.11 ? 37   PHE A N     1 
ATOM   739   C  CA    . PHE C 3  37   ? 49.823  -16.712  20.119  1.00 129.28 ? 37   PHE A CA    1 
ATOM   740   C  C     . PHE C 3  37   ? 48.586  -17.153  20.886  1.00 129.68 ? 37   PHE A C     1 
ATOM   741   O  O     . PHE C 3  37   ? 48.117  -18.281  20.741  1.00 129.20 ? 37   PHE A O     1 
ATOM   742   C  CB    . PHE C 3  37   ? 49.443  -16.424  18.663  1.00 130.75 ? 37   PHE A CB    1 
ATOM   743   C  CG    . PHE C 3  37   ? 50.402  -15.509  17.955  1.00 132.96 ? 37   PHE A CG    1 
ATOM   744   C  CD1   . PHE C 3  37   ? 51.680  -15.943  17.607  1.00 133.27 ? 37   PHE A CD1   1 
ATOM   745   C  CD2   . PHE C 3  37   ? 50.036  -14.196  17.661  1.00 134.23 ? 37   PHE A CD2   1 
ATOM   746   C  CE1   . PHE C 3  37   ? 52.581  -15.080  16.975  1.00 133.78 ? 37   PHE A CE1   1 
ATOM   747   C  CE2   . PHE C 3  37   ? 50.929  -13.323  17.029  1.00 134.67 ? 37   PHE A CE2   1 
ATOM   748   C  CZ    . PHE C 3  37   ? 52.205  -13.767  16.687  1.00 134.09 ? 37   PHE A CZ    1 
ATOM   749   N  N     . PRO C 3  38   ? 48.045  -16.260  21.724  1.00 130.64 ? 38   PRO A N     1 
ATOM   750   C  CA    . PRO C 3  38   ? 46.854  -16.549  22.521  1.00 132.31 ? 38   PRO A CA    1 
ATOM   751   C  C     . PRO C 3  38   ? 45.612  -16.474  21.639  1.00 134.11 ? 38   PRO A C     1 
ATOM   752   O  O     . PRO C 3  38   ? 44.550  -16.997  21.987  1.00 135.06 ? 38   PRO A O     1 
ATOM   753   C  CB    . PRO C 3  38   ? 46.884  -15.449  23.574  1.00 131.87 ? 38   PRO A CB    1 
ATOM   754   C  CG    . PRO C 3  38   ? 47.397  -14.287  22.791  1.00 131.70 ? 38   PRO A CG    1 
ATOM   755   C  CD    . PRO C 3  38   ? 48.548  -14.906  22.016  1.00 131.22 ? 38   PRO A CD    1 
ATOM   756   N  N     . GLU C 3  39   ? 45.759  -15.815  20.494  1.00 135.41 ? 39   GLU A N     1 
ATOM   757   C  CA    . GLU C 3  39   ? 44.663  -15.661  19.548  1.00 136.28 ? 39   GLU A CA    1 
ATOM   758   C  C     . GLU C 3  39   ? 44.228  -17.042  19.049  1.00 136.71 ? 39   GLU A C     1 
ATOM   759   O  O     . GLU C 3  39   ? 44.941  -18.032  19.246  1.00 136.45 ? 39   GLU A O     1 
ATOM   760   C  CB    . GLU C 3  39   ? 45.108  -14.741  18.407  1.00 136.58 ? 39   GLU A CB    1 
ATOM   761   C  CG    . GLU C 3  39   ? 45.592  -13.380  18.923  1.00 136.67 ? 39   GLU A CG    1 
ATOM   762   C  CD    . GLU C 3  39   ? 46.112  -12.468  17.831  1.00 137.67 ? 39   GLU A CD    1 
ATOM   763   O  OE1   . GLU C 3  39   ? 47.061  -12.864  17.120  1.00 139.23 ? 39   GLU A OE1   1 
ATOM   764   O  OE2   . GLU C 3  39   ? 45.575  -11.351  17.686  1.00 136.79 ? 39   GLU A OE2   1 
ATOM   765   N  N     . THR C 3  40   ? 43.067  -17.113  18.402  1.00 137.22 ? 40   THR A N     1 
ATOM   766   C  CA    . THR C 3  40   ? 42.544  -18.402  17.962  1.00 137.21 ? 40   THR A CA    1 
ATOM   767   C  C     . THR C 3  40   ? 42.579  -18.800  16.492  1.00 137.97 ? 40   THR A C     1 
ATOM   768   O  O     . THR C 3  40   ? 43.424  -19.592  16.075  1.00 137.11 ? 40   THR A O     1 
ATOM   769   C  CB    . THR C 3  40   ? 41.088  -18.573  18.423  1.00 136.33 ? 40   THR A CB    1 
ATOM   770   O  OG1   . THR C 3  40   ? 40.945  -18.081  19.760  1.00 135.58 ? 40   THR A OG1   1 
ATOM   771   C  CG2   . THR C 3  40   ? 40.701  -20.041  18.390  1.00 136.20 ? 40   THR A CG2   1 
ATOM   772   N  N     . MET C 3  41   ? 41.655  -18.252  15.711  1.00 139.59 ? 41   MET A N     1 
ATOM   773   C  CA    . MET C 3  41   ? 41.539  -18.631  14.311  1.00 142.09 ? 41   MET A CA    1 
ATOM   774   C  C     . MET C 3  41   ? 41.738  -17.577  13.217  1.00 143.39 ? 41   MET A C     1 
ATOM   775   O  O     . MET C 3  41   ? 42.233  -17.902  12.136  1.00 143.76 ? 41   MET A O     1 
ATOM   776   C  CB    . MET C 3  41   ? 40.177  -19.300  14.117  1.00 143.24 ? 41   MET A CB    1 
ATOM   777   C  CG    . MET C 3  41   ? 39.904  -20.418  15.117  1.00 145.55 ? 41   MET A CG    1 
ATOM   778   S  SD    . MET C 3  41   ? 38.192  -21.001  15.127  1.00 148.70 ? 41   MET A SD    1 
ATOM   779   C  CE    . MET C 3  41   ? 37.509  -20.072  16.523  1.00 149.02 ? 41   MET A CE    1 
ATOM   780   N  N     . ASP C 3  42   ? 41.357  -16.328  13.475  1.00 144.79 ? 42   ASP A N     1 
ATOM   781   C  CA    . ASP C 3  42   ? 41.484  -15.284  12.454  1.00 145.80 ? 42   ASP A CA    1 
ATOM   782   C  C     . ASP C 3  42   ? 42.897  -14.930  11.994  1.00 146.50 ? 42   ASP A C     1 
ATOM   783   O  O     . ASP C 3  42   ? 43.871  -15.024  12.746  1.00 146.63 ? 42   ASP A O     1 
ATOM   784   C  CB    . ASP C 3  42   ? 40.771  -13.993  12.892  1.00 145.20 ? 42   ASP A CB    1 
ATOM   785   C  CG    . ASP C 3  42   ? 39.265  -14.048  12.673  1.00 144.26 ? 42   ASP A CG    1 
ATOM   786   O  OD1   . ASP C 3  42   ? 38.836  -14.510  11.595  1.00 142.10 ? 42   ASP A OD1   1 
ATOM   787   O  OD2   . ASP C 3  42   ? 38.512  -13.616  13.573  1.00 143.23 ? 42   ASP A OD2   1 
ATOM   788   N  N     . GLU C 3  43   ? 42.975  -14.523  10.732  1.00 147.04 ? 43   GLU A N     1 
ATOM   789   C  CA    . GLU C 3  43   ? 44.215  -14.113  10.089  1.00 148.16 ? 43   GLU A CA    1 
ATOM   790   C  C     . GLU C 3  43   ? 43.770  -13.045  9.098   1.00 149.04 ? 43   GLU A C     1 
ATOM   791   O  O     . GLU C 3  43   ? 43.378  -13.366  7.975   1.00 148.70 ? 43   GLU A O     1 
ATOM   792   C  CB    . GLU C 3  43   ? 44.848  -15.296  9.350   1.00 147.76 ? 43   GLU A CB    1 
ATOM   793   C  CG    . GLU C 3  43   ? 45.117  -16.506  10.234  1.00 147.05 ? 43   GLU A CG    1 
ATOM   794   C  CD    . GLU C 3  43   ? 45.780  -17.645  9.482   1.00 147.25 ? 43   GLU A CD    1 
ATOM   795   O  OE1   . GLU C 3  43   ? 45.199  -18.119  8.482   1.00 146.61 ? 43   GLU A OE1   1 
ATOM   796   O  OE2   . GLU C 3  43   ? 46.883  -18.066  9.894   1.00 147.22 ? 43   GLU A OE2   1 
ATOM   797   N  N     . THR C 3  44   ? 43.825  -11.782  9.523   1.00 150.48 ? 44   THR A N     1 
ATOM   798   C  CA    . THR C 3  44   ? 43.378  -10.654  8.697   1.00 151.90 ? 44   THR A CA    1 
ATOM   799   C  C     . THR C 3  44   ? 41.911  -10.949  8.379   1.00 152.39 ? 44   THR A C     1 
ATOM   800   O  O     . THR C 3  44   ? 41.403  -10.617  7.302   1.00 152.14 ? 44   THR A O     1 
ATOM   801   C  CB    . THR C 3  44   ? 44.191  -10.530  7.371   1.00 152.31 ? 44   THR A CB    1 
ATOM   802   O  OG1   . THR C 3  44   ? 45.578  -10.323  7.675   1.00 153.08 ? 44   THR A OG1   1 
ATOM   803   C  CG2   . THR C 3  44   ? 43.690  -9.346   6.535   1.00 151.35 ? 44   THR A CG2   1 
ATOM   804   N  N     . GLN C 3  45   ? 41.253  -11.576  9.356   1.00 152.61 ? 45   GLN A N     1 
ATOM   805   C  CA    . GLN C 3  45   ? 39.854  -11.994  9.280   1.00 152.28 ? 45   GLN A CA    1 
ATOM   806   C  C     . GLN C 3  45   ? 39.780  -13.408  8.708   1.00 152.00 ? 45   GLN A C     1 
ATOM   807   O  O     . GLN C 3  45   ? 39.100  -14.272  9.263   1.00 151.66 ? 45   GLN A O     1 
ATOM   808   C  CB    . GLN C 3  45   ? 39.024  -11.040  8.408   1.00 152.44 ? 45   GLN A CB    1 
ATOM   809   C  CG    . GLN C 3  45   ? 38.626  -9.736   9.082   1.00 151.48 ? 45   GLN A CG    1 
ATOM   810   C  CD    . GLN C 3  45   ? 37.747  -8.878   8.192   1.00 151.39 ? 45   GLN A CD    1 
ATOM   811   O  OE1   . GLN C 3  45   ? 36.744  -9.350   7.654   1.00 150.84 ? 45   GLN A OE1   1 
ATOM   812   N  NE2   . GLN C 3  45   ? 38.117  -7.611   8.035   1.00 150.51 ? 45   GLN A NE2   1 
ATOM   813   N  N     . THR C 3  46   ? 40.491  -13.635  7.604   1.00 151.80 ? 46   THR A N     1 
ATOM   814   C  CA    . THR C 3  46   ? 40.511  -14.939  6.943   1.00 151.43 ? 46   THR A CA    1 
ATOM   815   C  C     . THR C 3  46   ? 40.513  -16.075  7.962   1.00 151.25 ? 46   THR A C     1 
ATOM   816   O  O     . THR C 3  46   ? 41.473  -16.253  8.718   1.00 151.30 ? 46   THR A O     1 
ATOM   817   C  CB    . THR C 3  46   ? 41.743  -15.080  6.010   1.00 151.21 ? 46   THR A CB    1 
ATOM   818   O  OG1   . THR C 3  46   ? 41.628  -14.153  4.922   1.00 149.64 ? 46   THR A OG1   1 
ATOM   819   C  CG2   . THR C 3  46   ? 41.836  -16.496  5.451   1.00 151.17 ? 46   THR A CG2   1 
ATOM   820   N  N     . ARG C 3  47   ? 39.420  -16.834  7.972   1.00 150.66 ? 47   ARG A N     1 
ATOM   821   C  CA    . ARG C 3  47   ? 39.248  -17.949  8.894   1.00 149.79 ? 47   ARG A CA    1 
ATOM   822   C  C     . ARG C 3  47   ? 40.219  -19.101  8.686   1.00 149.58 ? 47   ARG A C     1 
ATOM   823   O  O     . ARG C 3  47   ? 40.604  -19.423  7.561   1.00 149.68 ? 47   ARG A O     1 
ATOM   824   C  CB    . ARG C 3  47   ? 37.814  -18.479  8.827   1.00 148.98 ? 47   ARG A CB    1 
ATOM   825   C  CG    . ARG C 3  47   ? 36.789  -17.565  9.474   1.00 147.53 ? 47   ARG A CG    1 
ATOM   826   C  CD    . ARG C 3  47   ? 35.468  -18.289  9.669   1.00 146.36 ? 47   ARG A CD    1 
ATOM   827   N  NE    . ARG C 3  47   ? 34.674  -17.687  10.736  1.00 146.09 ? 47   ARG A NE    1 
ATOM   828   C  CZ    . ARG C 3  47   ? 33.628  -18.273  11.312  1.00 145.55 ? 47   ARG A CZ    1 
ATOM   829   N  NH1   . ARG C 3  47   ? 33.244  -19.481  10.921  1.00 145.29 ? 47   ARG A NH1   1 
ATOM   830   N  NH2   . ARG C 3  47   ? 32.972  -17.657  12.289  1.00 144.85 ? 47   ARG A NH2   1 
ATOM   831   N  N     . ALA C 3  48   ? 40.593  -19.716  9.803   1.00 149.25 ? 48   ALA A N     1 
ATOM   832   C  CA    . ALA C 3  48   ? 41.520  -20.839  9.846   1.00 149.04 ? 48   ALA A CA    1 
ATOM   833   C  C     . ALA C 3  48   ? 41.935  -20.966  11.307  1.00 148.84 ? 48   ALA A C     1 
ATOM   834   O  O     . ALA C 3  48   ? 41.086  -21.135  12.178  1.00 148.74 ? 48   ALA A O     1 
ATOM   835   C  CB    . ALA C 3  48   ? 42.741  -20.559  8.970   1.00 149.35 ? 48   ALA A CB    1 
ATOM   836   N  N     . LYS C 3  49   ? 43.238  -20.864  11.562  1.00 148.80 ? 49   LYS A N     1 
ATOM   837   C  CA    . LYS C 3  49   ? 43.814  -20.945  12.908  1.00 148.05 ? 49   LYS A CA    1 
ATOM   838   C  C     . LYS C 3  49   ? 45.293  -20.544  12.799  1.00 146.62 ? 49   LYS A C     1 
ATOM   839   O  O     . LYS C 3  49   ? 45.933  -20.806  11.779  1.00 146.74 ? 49   LYS A O     1 
ATOM   840   C  CB    . LYS C 3  49   ? 43.711  -22.376  13.460  1.00 149.57 ? 49   LYS A CB    1 
ATOM   841   C  CG    . LYS C 3  49   ? 42.293  -22.879  13.771  1.00 151.51 ? 49   LYS A CG    1 
ATOM   842   C  CD    . LYS C 3  49   ? 42.281  -24.377  14.111  1.00 152.55 ? 49   LYS A CD    1 
ATOM   843   C  CE    . LYS C 3  49   ? 40.863  -24.922  14.310  1.00 151.45 ? 49   LYS A CE    1 
ATOM   844   N  NZ    . LYS C 3  49   ? 40.843  -26.401  14.532  1.00 149.09 ? 49   LYS A NZ    1 
ATOM   845   N  N     . ILE C 3  50   ? 45.837  -19.910  13.834  1.00 144.66 ? 50   ILE A N     1 
ATOM   846   C  CA    . ILE C 3  50   ? 47.241  -19.500  13.796  1.00 142.66 ? 50   ILE A CA    1 
ATOM   847   C  C     . ILE C 3  50   ? 48.097  -20.484  14.594  1.00 141.08 ? 50   ILE A C     1 
ATOM   848   O  O     . ILE C 3  50   ? 47.570  -21.306  15.345  1.00 140.66 ? 50   ILE A O     1 
ATOM   849   C  CB    . ILE C 3  50   ? 47.435  -18.073  14.384  1.00 142.85 ? 50   ILE A CB    1 
ATOM   850   C  CG1   . ILE C 3  50   ? 46.405  -17.109  13.784  1.00 142.33 ? 50   ILE A CG1   1 
ATOM   851   C  CG2   . ILE C 3  50   ? 48.846  -17.566  14.076  1.00 141.72 ? 50   ILE A CG2   1 
ATOM   852   C  CD1   . ILE C 3  50   ? 46.469  -15.699  14.352  1.00 140.97 ? 50   ILE A CD1   1 
ATOM   853   N  N     . GLY C 3  51   ? 49.414  -20.404  14.423  1.00 139.29 ? 51   GLY A N     1 
ATOM   854   C  CA    . GLY C 3  51   ? 50.304  -21.288  15.152  1.00 137.07 ? 51   GLY A CA    1 
ATOM   855   C  C     . GLY C 3  51   ? 50.159  -21.099  16.654  1.00 135.75 ? 51   GLY A C     1 
ATOM   856   O  O     . GLY C 3  51   ? 50.917  -21.669  17.440  1.00 135.72 ? 51   GLY A O     1 
ATOM   857   N  N     . GLY C 3  52   ? 49.184  -20.284  17.049  1.00 134.11 ? 52   GLY A N     1 
ATOM   858   C  CA    . GLY C 3  52   ? 48.940  -20.034  18.457  1.00 131.79 ? 52   GLY A CA    1 
ATOM   859   C  C     . GLY C 3  52   ? 48.229  -21.206  19.105  1.00 130.21 ? 52   GLY A C     1 
ATOM   860   O  O     . GLY C 3  52   ? 48.739  -22.327  19.086  1.00 130.71 ? 52   GLY A O     1 
ATOM   861   N  N     . LEU C 3  53   ? 47.050  -20.961  19.671  1.00 127.91 ? 53   LEU A N     1 
ATOM   862   C  CA    . LEU C 3  53   ? 46.293  -22.023  20.329  1.00 125.53 ? 53   LEU A CA    1 
ATOM   863   C  C     . LEU C 3  53   ? 45.792  -23.085  19.363  1.00 124.94 ? 53   LEU A C     1 
ATOM   864   O  O     . LEU C 3  53   ? 46.113  -23.062  18.176  1.00 124.98 ? 53   LEU A O     1 
ATOM   865   C  CB    . LEU C 3  53   ? 45.110  -21.436  21.101  1.00 123.70 ? 53   LEU A CB    1 
ATOM   866   C  CG    . LEU C 3  53   ? 45.469  -20.746  22.419  1.00 122.59 ? 53   LEU A CG    1 
ATOM   867   C  CD1   . LEU C 3  53   ? 44.233  -20.117  23.034  1.00 121.39 ? 53   LEU A CD1   1 
ATOM   868   C  CD2   . LEU C 3  53   ? 46.074  -21.762  23.371  1.00 121.46 ? 53   LEU A CD2   1 
ATOM   869   N  N     . ASN C 3  54   ? 45.006  -24.015  19.896  1.00 124.18 ? 54   ASN A N     1 
ATOM   870   C  CA    . ASN C 3  54   ? 44.426  -25.123  19.139  1.00 124.55 ? 54   ASN A CA    1 
ATOM   871   C  C     . ASN C 3  54   ? 44.582  -25.093  17.616  1.00 125.32 ? 54   ASN A C     1 
ATOM   872   O  O     . ASN C 3  54   ? 43.763  -24.488  16.926  1.00 124.58 ? 54   ASN A O     1 
ATOM   873   C  CB    . ASN C 3  54   ? 42.934  -25.259  19.478  1.00 123.87 ? 54   ASN A CB    1 
ATOM   874   C  CG    . ASN C 3  54   ? 42.184  -23.936  19.397  1.00 123.81 ? 54   ASN A CG    1 
ATOM   875   O  OD1   . ASN C 3  54   ? 42.640  -22.989  18.759  1.00 125.70 ? 54   ASN A OD1   1 
ATOM   876   N  ND2   . ASN C 3  54   ? 41.020  -23.874  20.037  1.00 122.51 ? 54   ASN A ND2   1 
ATOM   877   N  N     . ASP C 3  55   ? 45.617  -25.754  17.092  1.00 126.85 ? 55   ASP A N     1 
ATOM   878   C  CA    . ASP C 3  55   ? 45.824  -25.796  15.644  1.00 129.08 ? 55   ASP A CA    1 
ATOM   879   C  C     . ASP C 3  55   ? 47.052  -26.515  15.069  1.00 128.86 ? 55   ASP A C     1 
ATOM   880   O  O     . ASP C 3  55   ? 46.919  -27.605  14.506  1.00 127.61 ? 55   ASP A O     1 
ATOM   881   C  CB    . ASP C 3  55   ? 45.782  -24.376  15.061  1.00 133.73 ? 55   ASP A CB    1 
ATOM   882   C  CG    . ASP C 3  55   ? 46.263  -24.322  13.610  1.00 138.18 ? 55   ASP A CG    1 
ATOM   883   O  OD1   . ASP C 3  55   ? 45.784  -25.139  12.788  1.00 139.26 ? 55   ASP A OD1   1 
ATOM   884   O  OD2   . ASP C 3  55   ? 47.118  -23.459  13.295  1.00 140.96 ? 55   ASP A OD2   1 
ATOM   885   N  N     . PRO C 3  56   ? 48.260  -25.917  15.214  1.00 129.38 ? 56   PRO A N     1 
ATOM   886   C  CA    . PRO C 3  56   ? 49.528  -26.459  14.706  1.00 129.64 ? 56   PRO A CA    1 
ATOM   887   C  C     . PRO C 3  56   ? 49.477  -27.841  14.057  1.00 129.80 ? 56   PRO A C     1 
ATOM   888   O  O     . PRO C 3  56   ? 49.724  -27.977  12.859  1.00 129.85 ? 56   PRO A O     1 
ATOM   889   C  CB    . PRO C 3  56   ? 50.430  -26.386  15.927  1.00 129.07 ? 56   PRO A CB    1 
ATOM   890   C  CG    . PRO C 3  56   ? 50.071  -25.027  16.451  1.00 128.69 ? 56   PRO A CG    1 
ATOM   891   C  CD    . PRO C 3  56   ? 48.538  -24.976  16.321  1.00 129.10 ? 56   PRO A CD    1 
ATOM   892   N  N     . ARG C 3  57   ? 49.155  -28.862  14.840  1.00 130.00 ? 57   ARG A N     1 
ATOM   893   C  CA    . ARG C 3  57   ? 49.064  -30.219  14.316  1.00 129.85 ? 57   ARG A CA    1 
ATOM   894   C  C     . ARG C 3  57   ? 47.898  -30.926  15.011  1.00 128.60 ? 57   ARG A C     1 
ATOM   895   O  O     . ARG C 3  57   ? 47.455  -31.985  14.569  1.00 128.35 ? 57   ARG A O     1 
ATOM   896   C  CB    . ARG C 3  57   ? 50.363  -30.997  14.587  1.00 132.48 ? 57   ARG A CB    1 
ATOM   897   C  CG    . ARG C 3  57   ? 51.679  -30.287  14.236  1.00 133.74 ? 57   ARG A CG    1 
ATOM   898   C  CD    . ARG C 3  57   ? 52.869  -31.112  14.752  1.00 135.85 ? 57   ARG A CD    1 
ATOM   899   N  NE    . ARG C 3  57   ? 54.135  -30.377  14.756  1.00 137.73 ? 57   ARG A NE    1 
ATOM   900   C  CZ    . ARG C 3  57   ? 55.251  -30.815  15.337  1.00 138.91 ? 57   ARG A CZ    1 
ATOM   901   N  NH1   . ARG C 3  57   ? 55.260  -31.988  15.961  1.00 139.73 ? 57   ARG A NH1   1 
ATOM   902   N  NH2   . ARG C 3  57   ? 56.358  -30.082  15.301  1.00 138.65 ? 57   ARG A NH2   1 
ATOM   903   N  N     . LEU C 3  58   ? 47.413  -30.326  16.098  1.00 127.74 ? 58   LEU A N     1 
ATOM   904   C  CA    . LEU C 3  58   ? 46.310  -30.872  16.896  1.00 126.69 ? 58   LEU A CA    1 
ATOM   905   C  C     . LEU C 3  58   ? 45.089  -31.117  16.013  1.00 127.03 ? 58   LEU A C     1 
ATOM   906   O  O     . LEU C 3  58   ? 45.123  -30.825  14.815  1.00 127.94 ? 58   LEU A O     1 
ATOM   907   C  CB    . LEU C 3  58   ? 45.941  -29.892  18.021  1.00 124.54 ? 58   LEU A CB    1 
ATOM   908   C  CG    . LEU C 3  58   ? 47.075  -29.217  18.808  1.00 121.72 ? 58   LEU A CG    1 
ATOM   909   C  CD1   . LEU C 3  58   ? 46.508  -28.149  19.725  1.00 119.89 ? 58   LEU A CD1   1 
ATOM   910   C  CD2   . LEU C 3  58   ? 47.843  -30.246  19.607  1.00 119.95 ? 58   LEU A CD2   1 
ATOM   911   N  N     . GLY C 3  59   ? 44.017  -31.646  16.605  1.00 126.11 ? 59   GLY A N     1 
ATOM   912   C  CA    . GLY C 3  59   ? 42.798  -31.911  15.851  1.00 125.81 ? 59   GLY A CA    1 
ATOM   913   C  C     . GLY C 3  59   ? 42.266  -30.673  15.144  1.00 125.98 ? 59   GLY A C     1 
ATOM   914   O  O     . GLY C 3  59   ? 43.002  -29.701  14.953  1.00 127.41 ? 59   GLY A O     1 
ATOM   915   N  N     . SER C 3  60   ? 40.995  -30.679  14.752  1.00 124.78 ? 60   SER A N     1 
ATOM   916   C  CA    . SER C 3  60   ? 40.453  -29.510  14.068  1.00 124.15 ? 60   SER A CA    1 
ATOM   917   C  C     . SER C 3  60   ? 38.963  -29.324  14.272  1.00 123.94 ? 60   SER A C     1 
ATOM   918   O  O     . SER C 3  60   ? 38.364  -29.946  15.142  1.00 123.65 ? 60   SER A O     1 
ATOM   919   C  CB    . SER C 3  60   ? 40.742  -29.593  12.569  1.00 123.90 ? 60   SER A CB    1 
ATOM   920   O  OG    . SER C 3  60   ? 39.989  -30.633  11.972  1.00 123.47 ? 60   SER A OG    1 
ATOM   921   N  N     . ILE C 3  61   ? 38.380  -28.457  13.448  1.00 124.56 ? 61   ILE A N     1 
ATOM   922   C  CA    . ILE C 3  61   ? 36.953  -28.139  13.489  1.00 125.26 ? 61   ILE A CA    1 
ATOM   923   C  C     . ILE C 3  61   ? 36.410  -28.165  12.051  1.00 125.71 ? 61   ILE A C     1 
ATOM   924   O  O     . ILE C 3  61   ? 36.966  -28.855  11.197  1.00 126.08 ? 61   ILE A O     1 
ATOM   925   C  CB    . ILE C 3  61   ? 36.737  -26.737  14.117  1.00 125.46 ? 61   ILE A CB    1 
ATOM   926   C  CG1   . ILE C 3  61   ? 37.610  -26.602  15.371  1.00 125.41 ? 61   ILE A CG1   1 
ATOM   927   C  CG2   . ILE C 3  61   ? 35.268  -26.538  14.487  1.00 125.13 ? 61   ILE A CG2   1 
ATOM   928   C  CD1   . ILE C 3  61   ? 37.537  -25.248  16.042  1.00 126.19 ? 61   ILE A CD1   1 
ATOM   929   N  N     . ASP C 3  62   ? 35.333  -27.425  11.788  1.00 126.54 ? 62   ASP A N     1 
ATOM   930   C  CA    . ASP C 3  62   ? 34.719  -27.357  10.453  1.00 127.53 ? 62   ASP A CA    1 
ATOM   931   C  C     . ASP C 3  62   ? 34.690  -28.678  9.672   1.00 127.35 ? 62   ASP A C     1 
ATOM   932   O  O     . ASP C 3  62   ? 34.633  -28.675  8.440   1.00 126.80 ? 62   ASP A O     1 
ATOM   933   C  CB    . ASP C 3  62   ? 35.416  -26.286  9.599   1.00 129.35 ? 62   ASP A CB    1 
ATOM   934   C  CG    . ASP C 3  62   ? 34.996  -24.868  9.969   1.00 131.69 ? 62   ASP A CG    1 
ATOM   935   O  OD1   . ASP C 3  62   ? 33.803  -24.535  9.800   1.00 132.39 ? 62   ASP A OD1   1 
ATOM   936   O  OD2   . ASP C 3  62   ? 35.857  -24.085  10.425  1.00 133.15 ? 62   ASP A OD2   1 
ATOM   937   N  N     . ARG C 3  63   ? 34.727  -29.797  10.390  1.00 127.15 ? 63   ARG A N     1 
ATOM   938   C  CA    . ARG C 3  63   ? 34.695  -31.125  9.778   1.00 126.71 ? 63   ARG A CA    1 
ATOM   939   C  C     . ARG C 3  63   ? 35.782  -31.335  8.724   1.00 126.02 ? 63   ARG A C     1 
ATOM   940   O  O     . ARG C 3  63   ? 35.487  -31.663  7.576   1.00 124.89 ? 63   ARG A O     1 
ATOM   941   C  CB    . ARG C 3  63   ? 33.319  -31.375  9.154   1.00 128.60 ? 63   ARG A CB    1 
ATOM   942   C  CG    . ARG C 3  63   ? 32.154  -31.210  10.128  1.00 131.50 ? 63   ARG A CG    1 
ATOM   943   C  CD    . ARG C 3  63   ? 30.804  -31.340  9.427   1.00 134.10 ? 63   ARG A CD    1 
ATOM   944   N  NE    . ARG C 3  63   ? 29.682  -31.068  10.326  1.00 135.66 ? 63   ARG A NE    1 
ATOM   945   C  CZ    . ARG C 3  63   ? 28.405  -31.048  9.950   1.00 136.02 ? 63   ARG A CZ    1 
ATOM   946   N  NH1   . ARG C 3  63   ? 28.075  -31.285  8.686   1.00 136.12 ? 63   ARG A NH1   1 
ATOM   947   N  NH2   . ARG C 3  63   ? 27.455  -30.788  10.839  1.00 135.61 ? 63   ARG A NH2   1 
ATOM   948   N  N     . ASN C 3  64   ? 37.037  -31.147  9.121   1.00 125.88 ? 64   ASN A N     1 
ATOM   949   C  CA    . ASN C 3  64   ? 38.172  -31.329  8.218   1.00 125.98 ? 64   ASN A CA    1 
ATOM   950   C  C     . ASN C 3  64   ? 39.034  -32.490  8.721   1.00 126.27 ? 64   ASN A C     1 
ATOM   951   O  O     . ASN C 3  64   ? 39.617  -32.421  9.803   1.00 126.42 ? 64   ASN A O     1 
ATOM   952   C  CB    . ASN C 3  64   ? 39.002  -30.045  8.142   1.00 125.51 ? 64   ASN A CB    1 
ATOM   953   C  CG    . ASN C 3  64   ? 38.160  -28.827  7.800   1.00 124.94 ? 64   ASN A CG    1 
ATOM   954   O  OD1   . ASN C 3  64   ? 37.280  -28.891  6.943   1.00 125.56 ? 64   ASN A OD1   1 
ATOM   955   N  ND2   . ASN C 3  64   ? 38.433  -27.709  8.464   1.00 123.59 ? 64   ASN A ND2   1 
ATOM   956   N  N     . LEU C 3  65   ? 39.110  -33.551  7.923   1.00 126.27 ? 65   LEU A N     1 
ATOM   957   C  CA    . LEU C 3  65   ? 39.855  -34.757  8.281   1.00 126.30 ? 65   LEU A CA    1 
ATOM   958   C  C     . LEU C 3  65   ? 41.264  -34.577  8.846   1.00 126.70 ? 65   LEU A C     1 
ATOM   959   O  O     . LEU C 3  65   ? 41.726  -35.400  9.633   1.00 126.20 ? 65   LEU A O     1 
ATOM   960   C  CB    . LEU C 3  65   ? 39.915  -35.708  7.075   1.00 125.74 ? 65   LEU A CB    1 
ATOM   961   C  CG    . LEU C 3  65   ? 38.598  -36.286  6.531   1.00 125.65 ? 65   LEU A CG    1 
ATOM   962   C  CD1   . LEU C 3  65   ? 38.899  -37.194  5.349   1.00 124.76 ? 65   LEU A CD1   1 
ATOM   963   C  CD2   . LEU C 3  65   ? 37.861  -37.064  7.618   1.00 124.73 ? 65   LEU A CD2   1 
ATOM   964   N  N     . LYS C 3  66   ? 41.948  -33.508  8.461   1.00 127.98 ? 66   LYS A N     1 
ATOM   965   C  CA    . LYS C 3  66   ? 43.314  -33.283  8.930   1.00 130.06 ? 66   LYS A CA    1 
ATOM   966   C  C     . LYS C 3  66   ? 43.536  -33.330  10.445  1.00 129.46 ? 66   LYS A C     1 
ATOM   967   O  O     . LYS C 3  66   ? 42.749  -32.788  11.218  1.00 129.23 ? 66   LYS A O     1 
ATOM   968   C  CB    . LYS C 3  66   ? 43.844  -31.953  8.378   1.00 133.03 ? 66   LYS A CB    1 
ATOM   969   C  CG    . LYS C 3  66   ? 44.025  -31.932  6.861   1.00 134.79 ? 66   LYS A CG    1 
ATOM   970   C  CD    . LYS C 3  66   ? 44.779  -30.689  6.411   1.00 136.58 ? 66   LYS A CD    1 
ATOM   971   C  CE    . LYS C 3  66   ? 45.010  -30.702  4.909   1.00 137.84 ? 66   LYS A CE    1 
ATOM   972   N  NZ    . LYS C 3  66   ? 45.779  -29.507  4.464   1.00 138.84 ? 66   LYS A NZ    1 
ATOM   973   N  N     . CYS C 3  67   ? 44.625  -33.982  10.852  1.00 129.55 ? 67   CYS A N     1 
ATOM   974   C  CA    . CYS C 3  67   ? 44.993  -34.101  12.261  1.00 129.89 ? 67   CYS A CA    1 
ATOM   975   C  C     . CYS C 3  67   ? 46.270  -34.920  12.448  1.00 131.16 ? 67   CYS A C     1 
ATOM   976   O  O     . CYS C 3  67   ? 46.224  -36.150  12.483  1.00 131.30 ? 67   CYS A O     1 
ATOM   977   C  CB    . CYS C 3  67   ? 43.861  -34.746  13.065  1.00 128.08 ? 67   CYS A CB    1 
ATOM   978   S  SG    . CYS C 3  67   ? 44.208  -34.869  14.841  1.00 124.50 ? 67   CYS A SG    1 
ATOM   979   N  N     . GLN C 3  68   ? 47.404  -34.233  12.578  1.00 131.99 ? 68   GLN A N     1 
ATOM   980   C  CA    . GLN C 3  68   ? 48.689  -34.898  12.768  1.00 132.95 ? 68   GLN A CA    1 
ATOM   981   C  C     . GLN C 3  68   ? 48.812  -36.156  11.929  1.00 133.46 ? 68   GLN A C     1 
ATOM   982   O  O     . GLN C 3  68   ? 48.991  -37.255  12.461  1.00 132.30 ? 68   GLN A O     1 
ATOM   983   C  CB    . GLN C 3  68   ? 48.885  -35.258  14.230  1.00 133.77 ? 68   GLN A CB    1 
ATOM   984   C  CG    . GLN C 3  68   ? 49.454  -34.143  15.049  1.00 138.50 ? 68   GLN A CG    1 
ATOM   985   C  CD    . GLN C 3  68   ? 49.497  -34.488  16.514  1.00 142.94 ? 68   GLN A CD    1 
ATOM   986   O  OE1   . GLN C 3  68   ? 49.968  -35.560  16.900  1.00 144.53 ? 68   GLN A OE1   1 
ATOM   987   N  NE2   . GLN C 3  68   ? 49.008  -33.579  17.347  1.00 145.72 ? 68   GLN A NE2   1 
ATOM   988   N  N     . THR C 3  69   ? 48.717  -35.978  10.614  1.00 134.80 ? 69   THR A N     1 
ATOM   989   C  CA    . THR C 3  69   ? 48.808  -37.075  9.655   1.00 134.87 ? 69   THR A CA    1 
ATOM   990   C  C     . THR C 3  69   ? 48.062  -38.297  10.181  1.00 134.72 ? 69   THR A C     1 
ATOM   991   O  O     . THR C 3  69   ? 48.378  -39.429  9.818   1.00 136.13 ? 69   THR A O     1 
ATOM   992   C  CB    . THR C 3  69   ? 50.289  -37.468  9.368   1.00 134.38 ? 69   THR A CB    1 
ATOM   993   O  OG1   . THR C 3  69   ? 51.060  -36.289  9.097   1.00 134.51 ? 69   THR A OG1   1 
ATOM   994   C  CG2   . THR C 3  69   ? 50.374  -38.389  8.153   1.00 132.76 ? 69   THR A CG2   1 
ATOM   995   N  N     . CYS C 3  70   ? 47.073  -38.067  11.042  1.00 133.16 ? 70   CYS A N     1 
ATOM   996   C  CA    . CYS C 3  70   ? 46.297  -39.165  11.598  1.00 130.85 ? 70   CYS A CA    1 
ATOM   997   C  C     . CYS C 3  70   ? 44.878  -39.135  11.034  1.00 131.07 ? 70   CYS A C     1 
ATOM   998   O  O     . CYS C 3  70   ? 44.076  -40.026  11.301  1.00 131.17 ? 70   CYS A O     1 
ATOM   999   C  CB    . CYS C 3  70   ? 46.302  -39.100  13.135  1.00 127.84 ? 70   CYS A CB    1 
ATOM   1000  S  SG    . CYS C 3  70   ? 44.772  -38.599  13.943  1.00 119.48 ? 70   CYS A SG    1 
ATOM   1001  N  N     . GLN C 3  71   ? 44.586  -38.110  10.236  1.00 130.58 ? 71   GLN A N     1 
ATOM   1002  C  CA    . GLN C 3  71   ? 43.277  -37.969  9.602   1.00 131.20 ? 71   GLN A CA    1 
ATOM   1003  C  C     . GLN C 3  71   ? 42.120  -38.226  10.573  1.00 130.20 ? 71   GLN A C     1 
ATOM   1004  O  O     . GLN C 3  71   ? 42.030  -37.598  11.629  1.00 130.67 ? 71   GLN A O     1 
ATOM   1005  C  CB    . GLN C 3  71   ? 43.164  -38.948  8.431   1.00 133.10 ? 71   GLN A CB    1 
ATOM   1006  C  CG    . GLN C 3  71   ? 44.489  -39.305  7.780   1.00 136.19 ? 71   GLN A CG    1 
ATOM   1007  C  CD    . GLN C 3  71   ? 44.341  -40.369  6.705   1.00 138.59 ? 71   GLN A CD    1 
ATOM   1008  O  OE1   . GLN C 3  71   ? 43.748  -41.425  6.937   1.00 138.83 ? 71   GLN A OE1   1 
ATOM   1009  N  NE2   . GLN C 3  71   ? 44.885  -40.099  5.523   1.00 139.79 ? 71   GLN A NE2   1 
ATOM   1010  N  N     . GLU C 3  72   ? 41.235  -39.146  10.192  1.00 128.13 ? 72   GLU A N     1 
ATOM   1011  C  CA    . GLU C 3  72   ? 40.083  -39.526  11.003  1.00 126.27 ? 72   GLU A CA    1 
ATOM   1012  C  C     . GLU C 3  72   ? 38.975  -38.479  11.072  1.00 124.97 ? 72   GLU A C     1 
ATOM   1013  O  O     . GLU C 3  72   ? 37.837  -38.755  10.692  1.00 125.32 ? 72   GLU A O     1 
ATOM   1014  C  CB    . GLU C 3  72   ? 40.544  -39.877  12.413  1.00 127.94 ? 72   GLU A CB    1 
ATOM   1015  C  CG    . GLU C 3  72   ? 41.675  -40.888  12.446  1.00 130.19 ? 72   GLU A CG    1 
ATOM   1016  C  CD    . GLU C 3  72   ? 41.276  -42.240  11.893  1.00 132.04 ? 72   GLU A CD    1 
ATOM   1017  O  OE1   . GLU C 3  72   ? 40.813  -42.303  10.734  1.00 131.96 ? 72   GLU A OE1   1 
ATOM   1018  O  OE2   . GLU C 3  72   ? 41.432  -43.242  12.623  1.00 133.85 ? 72   GLU A OE2   1 
ATOM   1019  N  N     . GLY C 3  73   ? 39.300  -37.287  11.565  1.00 123.30 ? 73   GLY A N     1 
ATOM   1020  C  CA    . GLY C 3  73   ? 38.303  -36.232  11.668  1.00 122.12 ? 73   GLY A CA    1 
ATOM   1021  C  C     . GLY C 3  73   ? 37.756  -36.087  13.077  1.00 121.08 ? 73   GLY A C     1 
ATOM   1022  O  O     . GLY C 3  73   ? 38.008  -36.940  13.920  1.00 121.61 ? 73   GLY A O     1 
ATOM   1023  N  N     . MET C 3  74   ? 37.003  -35.018  13.331  1.00 119.79 ? 74   MET A N     1 
ATOM   1024  C  CA    . MET C 3  74   ? 36.433  -34.759  14.655  1.00 117.75 ? 74   MET A CA    1 
ATOM   1025  C  C     . MET C 3  74   ? 35.624  -35.936  15.200  1.00 115.58 ? 74   MET A C     1 
ATOM   1026  O  O     . MET C 3  74   ? 34.406  -35.850  15.339  1.00 116.40 ? 74   MET A O     1 
ATOM   1027  C  CB    . MET C 3  74   ? 35.544  -33.516  14.610  1.00 119.14 ? 74   MET A CB    1 
ATOM   1028  C  CG    . MET C 3  74   ? 36.140  -32.355  13.844  1.00 122.67 ? 74   MET A CG    1 
ATOM   1029  S  SD    . MET C 3  74   ? 35.092  -30.898  13.938  1.00 129.39 ? 74   MET A SD    1 
ATOM   1030  C  CE    . MET C 3  74   ? 33.651  -31.436  12.991  1.00 128.68 ? 74   MET A CE    1 
ATOM   1031  N  N     . ASN C 3  75   ? 36.322  -37.024  15.508  1.00 112.74 ? 75   ASN A N     1 
ATOM   1032  C  CA    . ASN C 3  75   ? 35.754  -38.260  16.050  1.00 110.43 ? 75   ASN A CA    1 
ATOM   1033  C  C     . ASN C 3  75   ? 36.765  -39.359  15.764  1.00 107.91 ? 75   ASN A C     1 
ATOM   1034  O  O     . ASN C 3  75   ? 37.086  -39.626  14.607  1.00 108.04 ? 75   ASN A O     1 
ATOM   1035  C  CB    . ASN C 3  75   ? 34.423  -38.626  15.394  1.00 112.83 ? 75   ASN A CB    1 
ATOM   1036  C  CG    . ASN C 3  75   ? 33.804  -39.883  16.000  1.00 114.39 ? 75   ASN A CG    1 
ATOM   1037  O  OD1   . ASN C 3  75   ? 34.427  -40.949  16.018  1.00 112.06 ? 75   ASN A OD1   1 
ATOM   1038  N  ND2   . ASN C 3  75   ? 32.575  -39.759  16.502  1.00 114.58 ? 75   ASN A ND2   1 
ATOM   1039  N  N     . GLU C 3  76   ? 37.239  -40.002  16.825  1.00 104.52 ? 76   GLU A N     1 
ATOM   1040  C  CA    . GLU C 3  76   ? 38.263  -41.041  16.748  1.00 101.00 ? 76   GLU A CA    1 
ATOM   1041  C  C     . GLU C 3  76   ? 39.607  -40.330  16.733  1.00 100.26 ? 76   GLU A C     1 
ATOM   1042  O  O     . GLU C 3  76   ? 40.659  -40.950  16.599  1.00 99.84  ? 76   GLU A O     1 
ATOM   1043  C  CB    . GLU C 3  76   ? 38.128  -41.901  15.493  1.00 98.21  ? 76   GLU A CB    1 
ATOM   1044  C  CG    . GLU C 3  76   ? 39.430  -42.585  15.119  1.00 93.87  ? 76   GLU A CG    1 
ATOM   1045  C  CD    . GLU C 3  76   ? 39.237  -43.908  14.435  1.00 94.51  ? 76   GLU A CD    1 
ATOM   1046  O  OE1   . GLU C 3  76   ? 38.467  -43.981  13.452  1.00 96.07  ? 76   GLU A OE1   1 
ATOM   1047  O  OE2   . GLU C 3  76   ? 39.874  -44.880  14.880  1.00 91.60  ? 76   GLU A OE2   1 
ATOM   1048  N  N     . CYS C 3  77   ? 39.543  -39.011  16.872  1.00 99.58  ? 77   CYS A N     1 
ATOM   1049  C  CA    . CYS C 3  77   ? 40.719  -38.158  16.896  1.00 98.69  ? 77   CYS A CA    1 
ATOM   1050  C  C     . CYS C 3  77   ? 41.116  -37.915  18.341  1.00 99.06  ? 77   CYS A C     1 
ATOM   1051  O  O     . CYS C 3  77   ? 40.791  -36.875  18.916  1.00 99.42  ? 77   CYS A O     1 
ATOM   1052  C  CB    . CYS C 3  77   ? 40.405  -36.822  16.222  1.00 98.41  ? 77   CYS A CB    1 
ATOM   1053  S  SG    . CYS C 3  77   ? 41.645  -35.543  16.467  1.00 98.52  ? 77   CYS A SG    1 
ATOM   1054  N  N     . PRO C 3  78   ? 41.809  -38.882  18.960  1.00 99.23  ? 78   PRO A N     1 
ATOM   1055  C  CA    . PRO C 3  78   ? 42.195  -38.650  20.351  1.00 99.73  ? 78   PRO A CA    1 
ATOM   1056  C  C     . PRO C 3  78   ? 42.970  -37.338  20.452  1.00 101.01 ? 78   PRO A C     1 
ATOM   1057  O  O     . PRO C 3  78   ? 44.136  -37.276  20.069  1.00 102.09 ? 78   PRO A O     1 
ATOM   1058  C  CB    . PRO C 3  78   ? 43.044  -39.881  20.679  1.00 98.93  ? 78   PRO A CB    1 
ATOM   1059  C  CG    . PRO C 3  78   ? 43.600  -40.296  19.343  1.00 97.18  ? 78   PRO A CG    1 
ATOM   1060  C  CD    . PRO C 3  78   ? 42.417  -40.121  18.442  1.00 98.04  ? 78   PRO A CD    1 
ATOM   1061  N  N     . GLY C 3  79   ? 42.309  -36.291  20.942  1.00 101.60 ? 79   GLY A N     1 
ATOM   1062  C  CA    . GLY C 3  79   ? 42.954  -34.993  21.072  1.00 103.07 ? 79   GLY A CA    1 
ATOM   1063  C  C     . GLY C 3  79   ? 44.447  -35.083  21.345  1.00 103.77 ? 79   GLY A C     1 
ATOM   1064  O  O     . GLY C 3  79   ? 44.874  -35.852  22.206  1.00 105.89 ? 79   GLY A O     1 
ATOM   1065  N  N     . HIS C 3  80   ? 45.244  -34.293  20.629  1.00 103.20 ? 80   HIS A N     1 
ATOM   1066  C  CA    . HIS C 3  80   ? 46.695  -34.326  20.799  1.00 102.66 ? 80   HIS A CA    1 
ATOM   1067  C  C     . HIS C 3  80   ? 47.238  -33.181  21.637  1.00 104.22 ? 80   HIS A C     1 
ATOM   1068  O  O     . HIS C 3  80   ? 46.888  -32.025  21.421  1.00 104.43 ? 80   HIS A O     1 
ATOM   1069  C  CB    . HIS C 3  80   ? 47.356  -34.312  19.436  1.00 99.50  ? 80   HIS A CB    1 
ATOM   1070  C  CG    . HIS C 3  80   ? 46.845  -35.373  18.518  1.00 95.99  ? 80   HIS A CG    1 
ATOM   1071  N  ND1   . HIS C 3  80   ? 47.070  -36.714  18.736  1.00 94.03  ? 80   HIS A ND1   1 
ATOM   1072  C  CD2   . HIS C 3  80   ? 46.096  -35.292  17.393  1.00 94.22  ? 80   HIS A CD2   1 
ATOM   1073  C  CE1   . HIS C 3  80   ? 46.483  -37.415  17.783  1.00 94.22  ? 80   HIS A CE1   1 
ATOM   1074  N  NE2   . HIS C 3  80   ? 45.885  -36.576  16.956  1.00 93.41  ? 80   HIS A NE2   1 
ATOM   1075  N  N     . PHE C 3  81   ? 48.114  -33.511  22.581  1.00 105.81 ? 81   PHE A N     1 
ATOM   1076  C  CA    . PHE C 3  81   ? 48.689  -32.508  23.468  1.00 107.99 ? 81   PHE A CA    1 
ATOM   1077  C  C     . PHE C 3  81   ? 49.689  -31.560  22.821  1.00 108.12 ? 81   PHE A C     1 
ATOM   1078  O  O     . PHE C 3  81   ? 50.445  -31.938  21.923  1.00 106.65 ? 81   PHE A O     1 
ATOM   1079  C  CB    . PHE C 3  81   ? 49.336  -33.183  24.683  1.00 110.52 ? 81   PHE A CB    1 
ATOM   1080  C  CG    . PHE C 3  81   ? 48.356  -33.570  25.756  1.00 112.49 ? 81   PHE A CG    1 
ATOM   1081  C  CD1   . PHE C 3  81   ? 47.379  -34.527  25.513  1.00 113.80 ? 81   PHE A CD1   1 
ATOM   1082  C  CD2   . PHE C 3  81   ? 48.408  -32.971  27.012  1.00 113.74 ? 81   PHE A CD2   1 
ATOM   1083  C  CE1   . PHE C 3  81   ? 46.464  -34.884  26.505  1.00 115.57 ? 81   PHE A CE1   1 
ATOM   1084  C  CE2   . PHE C 3  81   ? 47.497  -33.321  28.011  1.00 115.03 ? 81   PHE A CE2   1 
ATOM   1085  C  CZ    . PHE C 3  81   ? 46.524  -34.279  27.756  1.00 115.41 ? 81   PHE A CZ    1 
ATOM   1086  N  N     . GLY C 3  82   ? 49.680  -30.320  23.304  1.00 108.75 ? 82   GLY A N     1 
ATOM   1087  C  CA    . GLY C 3  82   ? 50.576  -29.303  22.793  1.00 108.93 ? 82   GLY A CA    1 
ATOM   1088  C  C     . GLY C 3  82   ? 51.731  -29.012  23.732  1.00 108.94 ? 82   GLY A C     1 
ATOM   1089  O  O     . GLY C 3  82   ? 52.005  -29.775  24.659  1.00 108.59 ? 82   GLY A O     1 
ATOM   1090  N  N     . HIS C 3  83   ? 52.394  -27.886  23.496  1.00 109.02 ? 83   HIS A N     1 
ATOM   1091  C  CA    . HIS C 3  83   ? 53.546  -27.481  24.284  1.00 109.02 ? 83   HIS A CA    1 
ATOM   1092  C  C     . HIS C 3  83   ? 53.536  -25.973  24.492  1.00 108.61 ? 83   HIS A C     1 
ATOM   1093  O  O     . HIS C 3  83   ? 53.090  -25.222  23.625  1.00 107.97 ? 83   HIS A O     1 
ATOM   1094  C  CB    . HIS C 3  83   ? 54.812  -27.919  23.539  1.00 111.38 ? 83   HIS A CB    1 
ATOM   1095  C  CG    . HIS C 3  83   ? 56.084  -27.339  24.071  1.00 113.45 ? 83   HIS A CG    1 
ATOM   1096  N  ND1   . HIS C 3  83   ? 56.483  -27.483  25.382  1.00 114.56 ? 83   HIS A ND1   1 
ATOM   1097  C  CD2   . HIS C 3  83   ? 57.074  -26.654  23.450  1.00 114.55 ? 83   HIS A CD2   1 
ATOM   1098  C  CE1   . HIS C 3  83   ? 57.664  -26.912  25.545  1.00 115.72 ? 83   HIS A CE1   1 
ATOM   1099  N  NE2   . HIS C 3  83   ? 58.045  -26.402  24.387  1.00 116.15 ? 83   HIS A NE2   1 
ATOM   1100  N  N     . ILE C 3  84   ? 54.018  -25.542  25.652  1.00 108.56 ? 84   ILE A N     1 
ATOM   1101  C  CA    . ILE C 3  84   ? 54.093  -24.122  25.990  1.00 109.34 ? 84   ILE A CA    1 
ATOM   1102  C  C     . ILE C 3  84   ? 55.133  -23.928  27.093  1.00 110.43 ? 84   ILE A C     1 
ATOM   1103  O  O     . ILE C 3  84   ? 55.015  -24.505  28.178  1.00 111.25 ? 84   ILE A O     1 
ATOM   1104  C  CB    . ILE C 3  84   ? 52.728  -23.577  26.479  1.00 108.33 ? 84   ILE A CB    1 
ATOM   1105  C  CG1   . ILE C 3  84   ? 52.868  -22.115  26.905  1.00 108.27 ? 84   ILE A CG1   1 
ATOM   1106  C  CG2   . ILE C 3  84   ? 52.219  -24.405  27.637  1.00 108.85 ? 84   ILE A CG2   1 
ATOM   1107  C  CD1   . ILE C 3  84   ? 51.625  -21.541  27.566  1.00 107.36 ? 84   ILE A CD1   1 
ATOM   1108  N  N     . ASP C 3  85   ? 56.155  -23.125  26.809  1.00 110.87 ? 85   ASP A N     1 
ATOM   1109  C  CA    . ASP C 3  85   ? 57.214  -22.872  27.781  1.00 110.55 ? 85   ASP A CA    1 
ATOM   1110  C  C     . ASP C 3  85   ? 56.995  -21.585  28.553  1.00 111.00 ? 85   ASP A C     1 
ATOM   1111  O  O     . ASP C 3  85   ? 56.730  -20.528  27.979  1.00 110.40 ? 85   ASP A O     1 
ATOM   1112  C  CB    . ASP C 3  85   ? 58.577  -22.841  27.087  1.00 108.60 ? 85   ASP A CB    1 
ATOM   1113  C  CG    . ASP C 3  85   ? 58.979  -24.199  26.539  1.00 107.04 ? 85   ASP A CG    1 
ATOM   1114  O  OD1   . ASP C 3  85   ? 59.091  -25.153  27.338  1.00 104.67 ? 85   ASP A OD1   1 
ATOM   1115  O  OD2   . ASP C 3  85   ? 59.180  -24.312  25.311  1.00 105.37 ? 85   ASP A OD2   1 
ATOM   1116  N  N     . LEU C 3  86   ? 57.106  -21.697  29.870  1.00 112.28 ? 86   LEU A N     1 
ATOM   1117  C  CA    . LEU C 3  86   ? 56.920  -20.570  30.771  1.00 114.12 ? 86   LEU A CA    1 
ATOM   1118  C  C     . LEU C 3  86   ? 58.281  -19.911  31.017  1.00 115.10 ? 86   LEU A C     1 
ATOM   1119  O  O     . LEU C 3  86   ? 59.325  -20.537  30.817  1.00 115.34 ? 86   LEU A O     1 
ATOM   1120  C  CB    . LEU C 3  86   ? 56.331  -21.081  32.091  1.00 114.64 ? 86   LEU A CB    1 
ATOM   1121  C  CG    . LEU C 3  86   ? 55.252  -22.171  31.978  1.00 114.11 ? 86   LEU A CG    1 
ATOM   1122  C  CD1   . LEU C 3  86   ? 55.133  -22.925  33.298  1.00 112.66 ? 86   LEU A CD1   1 
ATOM   1123  C  CD2   . LEU C 3  86   ? 53.922  -21.548  31.578  1.00 113.74 ? 86   LEU A CD2   1 
ATOM   1124  N  N     . ALA C 3  87   ? 58.274  -18.647  31.434  1.00 115.68 ? 87   ALA A N     1 
ATOM   1125  C  CA    . ALA C 3  87   ? 59.522  -17.946  31.717  1.00 116.07 ? 87   ALA A CA    1 
ATOM   1126  C  C     . ALA C 3  87   ? 60.056  -18.534  33.016  1.00 116.87 ? 87   ALA A C     1 
ATOM   1127  O  O     . ALA C 3  87   ? 60.618  -19.630  33.020  1.00 116.89 ? 87   ALA A O     1 
ATOM   1128  C  CB    . ALA C 3  87   ? 59.269  -16.455  31.871  1.00 115.15 ? 87   ALA A CB    1 
ATOM   1129  N  N     . LYS C 3  88   ? 59.882  -17.813  34.120  1.00 117.82 ? 88   LYS A N     1 
ATOM   1130  C  CA    . LYS C 3  88   ? 60.334  -18.318  35.413  1.00 118.84 ? 88   LYS A CA    1 
ATOM   1131  C  C     . LYS C 3  88   ? 59.383  -19.438  35.836  1.00 118.23 ? 88   LYS A C     1 
ATOM   1132  O  O     . LYS C 3  88   ? 58.167  -19.245  35.862  1.00 118.70 ? 88   LYS A O     1 
ATOM   1133  C  CB    . LYS C 3  88   ? 60.327  -17.207  36.478  1.00 120.17 ? 88   LYS A CB    1 
ATOM   1134  C  CG    . LYS C 3  88   ? 61.525  -16.251  36.433  1.00 120.21 ? 88   LYS A CG    1 
ATOM   1135  C  CD    . LYS C 3  88   ? 61.607  -15.409  37.709  1.00 119.17 ? 88   LYS A CD    1 
ATOM   1136  C  CE    . LYS C 3  88   ? 62.775  -14.429  37.679  1.00 118.47 ? 88   LYS A CE    1 
ATOM   1137  N  NZ    . LYS C 3  88   ? 62.873  -13.621  38.930  1.00 116.40 ? 88   LYS A NZ    1 
ATOM   1138  N  N     . PRO C 3  89   ? 59.926  -20.623  36.168  1.00 117.31 ? 89   PRO A N     1 
ATOM   1139  C  CA    . PRO C 3  89   ? 59.094  -21.759  36.587  1.00 116.15 ? 89   PRO A CA    1 
ATOM   1140  C  C     . PRO C 3  89   ? 57.978  -21.393  37.574  1.00 115.26 ? 89   PRO A C     1 
ATOM   1141  O  O     . PRO C 3  89   ? 58.151  -20.529  38.442  1.00 114.06 ? 89   PRO A O     1 
ATOM   1142  C  CB    . PRO C 3  89   ? 60.116  -22.741  37.169  1.00 116.13 ? 89   PRO A CB    1 
ATOM   1143  C  CG    . PRO C 3  89   ? 61.299  -21.869  37.519  1.00 116.92 ? 89   PRO A CG    1 
ATOM   1144  C  CD    . PRO C 3  89   ? 61.353  -20.930  36.358  1.00 116.56 ? 89   PRO A CD    1 
ATOM   1145  N  N     . VAL C 3  90   ? 56.832  -22.056  37.423  1.00 114.33 ? 90   VAL A N     1 
ATOM   1146  C  CA    . VAL C 3  90   ? 55.671  -21.801  38.273  1.00 113.26 ? 90   VAL A CA    1 
ATOM   1147  C  C     . VAL C 3  90   ? 55.233  -22.996  39.121  1.00 112.05 ? 90   VAL A C     1 
ATOM   1148  O  O     . VAL C 3  90   ? 55.381  -24.153  38.735  1.00 111.52 ? 90   VAL A O     1 
ATOM   1149  C  CB    . VAL C 3  90   ? 54.454  -21.333  37.430  1.00 113.41 ? 90   VAL A CB    1 
ATOM   1150  C  CG1   . VAL C 3  90   ? 53.248  -21.112  38.328  1.00 112.77 ? 90   VAL A CG1   1 
ATOM   1151  C  CG2   . VAL C 3  90   ? 54.792  -20.049  36.693  1.00 112.88 ? 90   VAL A CG2   1 
ATOM   1152  N  N     . PHE C 3  91   ? 54.685  -22.689  40.288  1.00 111.06 ? 91   PHE A N     1 
ATOM   1153  C  CA    . PHE C 3  91   ? 54.211  -23.699  41.211  1.00 110.47 ? 91   PHE A CA    1 
ATOM   1154  C  C     . PHE C 3  91   ? 52.927  -24.335  40.708  1.00 109.58 ? 91   PHE A C     1 
ATOM   1155  O  O     . PHE C 3  91   ? 52.221  -23.762  39.879  1.00 109.58 ? 91   PHE A O     1 
ATOM   1156  C  CB    . PHE C 3  91   ? 53.963  -23.062  42.581  1.00 112.66 ? 91   PHE A CB    1 
ATOM   1157  C  CG    . PHE C 3  91   ? 55.128  -23.170  43.522  1.00 114.65 ? 91   PHE A CG    1 
ATOM   1158  C  CD1   . PHE C 3  91   ? 56.428  -22.971  43.070  1.00 116.11 ? 91   PHE A CD1   1 
ATOM   1159  C  CD2   . PHE C 3  91   ? 54.924  -23.476  44.864  1.00 115.26 ? 91   PHE A CD2   1 
ATOM   1160  C  CE1   . PHE C 3  91   ? 57.511  -23.082  43.940  1.00 116.97 ? 91   PHE A CE1   1 
ATOM   1161  C  CE2   . PHE C 3  91   ? 56.000  -23.588  45.743  1.00 116.50 ? 91   PHE A CE2   1 
ATOM   1162  C  CZ    . PHE C 3  91   ? 57.295  -23.390  45.281  1.00 117.07 ? 91   PHE A CZ    1 
ATOM   1163  N  N     . HIS C 3  92   ? 52.638  -25.526  41.222  1.00 108.59 ? 92   HIS A N     1 
ATOM   1164  C  CA    . HIS C 3  92   ? 51.431  -26.260  40.867  1.00 107.12 ? 92   HIS A CA    1 
ATOM   1165  C  C     . HIS C 3  92   ? 50.480  -26.219  42.065  1.00 106.29 ? 92   HIS A C     1 
ATOM   1166  O  O     . HIS C 3  92   ? 50.756  -26.814  43.105  1.00 106.18 ? 92   HIS A O     1 
ATOM   1167  C  CB    . HIS C 3  92   ? 51.792  -27.707  40.512  1.00 106.59 ? 92   HIS A CB    1 
ATOM   1168  C  CG    . HIS C 3  92   ? 50.611  -28.574  40.199  1.00 106.05 ? 92   HIS A CG    1 
ATOM   1169  N  ND1   . HIS C 3  92   ? 50.714  -29.727  39.451  1.00 104.96 ? 92   HIS A ND1   1 
ATOM   1170  C  CD2   . HIS C 3  92   ? 49.307  -28.471  40.551  1.00 105.25 ? 92   HIS A CD2   1 
ATOM   1171  C  CE1   . HIS C 3  92   ? 49.526  -30.296  39.354  1.00 103.81 ? 92   HIS A CE1   1 
ATOM   1172  N  NE2   . HIS C 3  92   ? 48.656  -29.554  40.014  1.00 104.69 ? 92   HIS A NE2   1 
ATOM   1173  N  N     . VAL C 3  93   ? 49.364  -25.514  41.912  1.00 105.49 ? 93   VAL A N     1 
ATOM   1174  C  CA    . VAL C 3  93   ? 48.382  -25.381  42.986  1.00 105.02 ? 93   VAL A CA    1 
ATOM   1175  C  C     . VAL C 3  93   ? 48.170  -26.631  43.823  1.00 104.90 ? 93   VAL A C     1 
ATOM   1176  O  O     . VAL C 3  93   ? 48.145  -26.564  45.052  1.00 104.91 ? 93   VAL A O     1 
ATOM   1177  C  CB    . VAL C 3  93   ? 47.005  -24.957  42.448  1.00 104.98 ? 93   VAL A CB    1 
ATOM   1178  C  CG1   . VAL C 3  93   ? 46.765  -23.507  42.760  1.00 103.90 ? 93   VAL A CG1   1 
ATOM   1179  C  CG2   . VAL C 3  93   ? 46.924  -25.211  40.950  1.00 104.69 ? 93   VAL A CG2   1 
ATOM   1180  N  N     . GLY C 3  94   ? 48.008  -27.767  43.155  1.00 104.57 ? 94   GLY A N     1 
ATOM   1181  C  CA    . GLY C 3  94   ? 47.778  -29.011  43.864  1.00 104.54 ? 94   GLY A CA    1 
ATOM   1182  C  C     . GLY C 3  94   ? 48.922  -29.469  44.748  1.00 104.31 ? 94   GLY A C     1 
ATOM   1183  O  O     . GLY C 3  94   ? 48.705  -30.216  45.706  1.00 103.50 ? 94   GLY A O     1 
ATOM   1184  N  N     . PHE C 3  95   ? 50.136  -29.016  44.440  1.00 103.86 ? 95   PHE A N     1 
ATOM   1185  C  CA    . PHE C 3  95   ? 51.311  -29.416  45.207  1.00 103.69 ? 95   PHE A CA    1 
ATOM   1186  C  C     . PHE C 3  95   ? 51.955  -28.393  46.140  1.00 106.18 ? 95   PHE A C     1 
ATOM   1187  O  O     . PHE C 3  95   ? 52.972  -28.697  46.766  1.00 106.15 ? 95   PHE A O     1 
ATOM   1188  C  CB    . PHE C 3  95   ? 52.388  -29.944  44.271  1.00 98.06  ? 95   PHE A CB    1 
ATOM   1189  C  CG    . PHE C 3  95   ? 51.984  -31.163  43.528  1.00 93.58  ? 95   PHE A CG    1 
ATOM   1190  C  CD1   . PHE C 3  95   ? 51.348  -31.065  42.303  1.00 93.05  ? 95   PHE A CD1   1 
ATOM   1191  C  CD2   . PHE C 3  95   ? 52.252  -32.420  44.047  1.00 92.64  ? 95   PHE A CD2   1 
ATOM   1192  C  CE1   . PHE C 3  95   ? 50.987  -32.205  41.599  1.00 92.49  ? 95   PHE A CE1   1 
ATOM   1193  C  CE2   . PHE C 3  95   ? 51.896  -33.567  43.355  1.00 91.52  ? 95   PHE A CE2   1 
ATOM   1194  C  CZ    . PHE C 3  95   ? 51.264  -33.460  42.128  1.00 92.29  ? 95   PHE A CZ    1 
ATOM   1195  N  N     . ILE C 3  96   ? 51.395  -27.192  46.238  1.00 108.94 ? 96   ILE A N     1 
ATOM   1196  C  CA    . ILE C 3  96   ? 51.973  -26.191  47.133  1.00 111.53 ? 96   ILE A CA    1 
ATOM   1197  C  C     . ILE C 3  96   ? 52.048  -26.776  48.543  1.00 113.04 ? 96   ILE A C     1 
ATOM   1198  O  O     . ILE C 3  96   ? 53.110  -26.778  49.161  1.00 113.61 ? 96   ILE A O     1 
ATOM   1199  C  CB    . ILE C 3  96   ? 51.129  -24.890  47.171  1.00 112.20 ? 96   ILE A CB    1 
ATOM   1200  C  CG1   . ILE C 3  96   ? 51.102  -24.246  45.782  1.00 112.52 ? 96   ILE A CG1   1 
ATOM   1201  C  CG2   . ILE C 3  96   ? 51.707  -23.921  48.205  1.00 110.38 ? 96   ILE A CG2   1 
ATOM   1202  C  CD1   . ILE C 3  96   ? 50.287  -22.967  45.710  1.00 113.78 ? 96   ILE A CD1   1 
ATOM   1203  N  N     . ALA C 3  97   ? 50.920  -27.282  49.037  1.00 114.52 ? 97   ALA A N     1 
ATOM   1204  C  CA    . ALA C 3  97   ? 50.853  -27.875  50.370  1.00 115.95 ? 97   ALA A CA    1 
ATOM   1205  C  C     . ALA C 3  97   ? 51.906  -28.963  50.538  1.00 117.09 ? 97   ALA A C     1 
ATOM   1206  O  O     . ALA C 3  97   ? 52.479  -29.120  51.615  1.00 117.07 ? 97   ALA A O     1 
ATOM   1207  C  CB    . ALA C 3  97   ? 49.465  -28.451  50.617  1.00 116.40 ? 97   ALA A CB    1 
ATOM   1208  N  N     . LYS C 3  98   ? 52.149  -29.719  49.472  1.00 118.93 ? 98   LYS A N     1 
ATOM   1209  C  CA    . LYS C 3  98   ? 53.145  -30.788  49.496  1.00 120.72 ? 98   LYS A CA    1 
ATOM   1210  C  C     . LYS C 3  98   ? 54.532  -30.178  49.543  1.00 120.15 ? 98   LYS A C     1 
ATOM   1211  O  O     . LYS C 3  98   ? 55.323  -30.472  50.437  1.00 119.78 ? 98   LYS A O     1 
ATOM   1212  C  CB    . LYS C 3  98   ? 53.033  -31.664  48.246  1.00 123.80 ? 98   LYS A CB    1 
ATOM   1213  C  CG    . LYS C 3  98   ? 51.803  -32.558  48.207  1.00 128.95 ? 98   LYS A CG    1 
ATOM   1214  C  CD    . LYS C 3  98   ? 51.887  -33.662  49.252  1.00 132.00 ? 98   LYS A CD    1 
ATOM   1215  C  CE    . LYS C 3  98   ? 50.717  -34.626  49.132  1.00 134.07 ? 98   LYS A CE    1 
ATOM   1216  N  NZ    . LYS C 3  98   ? 50.872  -35.787  50.053  1.00 134.85 ? 98   LYS A NZ    1 
ATOM   1217  N  N     . ILE C 3  99   ? 54.815  -29.327  48.565  1.00 120.29 ? 99   ILE A N     1 
ATOM   1218  C  CA    . ILE C 3  99   ? 56.101  -28.659  48.477  1.00 120.91 ? 99   ILE A CA    1 
ATOM   1219  C  C     . ILE C 3  99   ? 56.560  -28.153  49.849  1.00 122.06 ? 99   ILE A C     1 
ATOM   1220  O  O     . ILE C 3  99   ? 57.657  -28.493  50.292  1.00 121.83 ? 99   ILE A O     1 
ATOM   1221  C  CB    . ILE C 3  99   ? 56.031  -27.493  47.475  1.00 119.54 ? 99   ILE A CB    1 
ATOM   1222  C  CG1   . ILE C 3  99   ? 55.566  -28.016  46.116  1.00 118.82 ? 99   ILE A CG1   1 
ATOM   1223  C  CG2   . ILE C 3  99   ? 57.395  -26.858  47.317  1.00 120.42 ? 99   ILE A CG2   1 
ATOM   1224  C  CD1   . ILE C 3  99   ? 55.352  -26.939  45.084  1.00 118.24 ? 99   ILE A CD1   1 
ATOM   1225  N  N     . LYS C 3  100  ? 55.725  -27.359  50.524  1.00 123.59 ? 100  LYS A N     1 
ATOM   1226  C  CA    . LYS C 3  100  ? 56.077  -26.839  51.851  1.00 125.10 ? 100  LYS A CA    1 
ATOM   1227  C  C     . LYS C 3  100  ? 56.643  -28.004  52.646  1.00 125.90 ? 100  LYS A C     1 
ATOM   1228  O  O     . LYS C 3  100  ? 57.844  -28.083  52.898  1.00 125.93 ? 100  LYS A O     1 
ATOM   1229  C  CB    . LYS C 3  100  ? 54.851  -26.327  52.623  1.00 125.75 ? 100  LYS A CB    1 
ATOM   1230  C  CG    . LYS C 3  100  ? 53.843  -25.493  51.853  1.00 127.26 ? 100  LYS A CG    1 
ATOM   1231  C  CD    . LYS C 3  100  ? 52.582  -25.309  52.702  1.00 126.57 ? 100  LYS A CD    1 
ATOM   1232  C  CE    . LYS C 3  100  ? 51.401  -24.813  51.880  1.00 125.29 ? 100  LYS A CE    1 
ATOM   1233  N  NZ    . LYS C 3  100  ? 50.135  -24.859  52.665  1.00 123.67 ? 100  LYS A NZ    1 
ATOM   1234  N  N     . LYS C 3  101  ? 55.744  -28.909  53.026  1.00 127.08 ? 101  LYS A N     1 
ATOM   1235  C  CA    . LYS C 3  101  ? 56.089  -30.095  53.800  1.00 128.12 ? 101  LYS A CA    1 
ATOM   1236  C  C     . LYS C 3  101  ? 57.351  -30.793  53.275  1.00 127.68 ? 101  LYS A C     1 
ATOM   1237  O  O     . LYS C 3  101  ? 57.985  -31.563  53.999  1.00 127.59 ? 101  LYS A O     1 
ATOM   1238  C  CB    . LYS C 3  101  ? 54.904  -31.075  53.814  1.00 129.53 ? 101  LYS A CB    1 
ATOM   1239  C  CG    . LYS C 3  101  ? 53.617  -30.529  54.447  1.00 130.90 ? 101  LYS A CG    1 
ATOM   1240  C  CD    . LYS C 3  101  ? 52.508  -31.581  54.423  1.00 133.72 ? 101  LYS A CD    1 
ATOM   1241  C  CE    . LYS C 3  101  ? 51.186  -31.048  54.967  1.00 135.20 ? 101  LYS A CE    1 
ATOM   1242  N  NZ    . LYS C 3  101  ? 50.103  -32.078  54.891  1.00 136.74 ? 101  LYS A NZ    1 
ATOM   1243  N  N     . VAL C 3  102  ? 57.713  -30.528  52.023  1.00 126.74 ? 102  VAL A N     1 
ATOM   1244  C  CA    . VAL C 3  102  ? 58.910  -31.132  51.449  1.00 126.54 ? 102  VAL A CA    1 
ATOM   1245  C  C     . VAL C 3  102  ? 60.131  -30.333  51.875  1.00 126.96 ? 102  VAL A C     1 
ATOM   1246  O  O     . VAL C 3  102  ? 61.126  -30.898  52.327  1.00 127.30 ? 102  VAL A O     1 
ATOM   1247  C  CB    . VAL C 3  102  ? 58.863  -31.158  49.912  1.00 125.94 ? 102  VAL A CB    1 
ATOM   1248  C  CG1   . VAL C 3  102  ? 60.173  -31.706  49.358  1.00 124.65 ? 102  VAL A CG1   1 
ATOM   1249  C  CG2   . VAL C 3  102  ? 57.705  -32.011  49.449  1.00 126.76 ? 102  VAL A CG2   1 
ATOM   1250  N  N     . CYS C 3  103  ? 60.051  -29.016  51.724  1.00 127.03 ? 103  CYS A N     1 
ATOM   1251  C  CA    . CYS C 3  103  ? 61.153  -28.139  52.098  1.00 127.51 ? 103  CYS A CA    1 
ATOM   1252  C  C     . CYS C 3  103  ? 61.392  -28.183  53.608  1.00 128.05 ? 103  CYS A C     1 
ATOM   1253  O  O     . CYS C 3  103  ? 62.526  -28.296  54.065  1.00 128.04 ? 103  CYS A O     1 
ATOM   1254  C  CB    . CYS C 3  103  ? 60.861  -26.702  51.650  1.00 127.03 ? 103  CYS A CB    1 
ATOM   1255  S  SG    . CYS C 3  103  ? 60.802  -26.462  49.848  1.00 125.14 ? 103  CYS A SG    1 
ATOM   1256  N  N     . GLU C 3  104  ? 60.319  -28.096  54.383  1.00 128.74 ? 104  GLU A N     1 
ATOM   1257  C  CA    . GLU C 3  104  ? 60.437  -28.140  55.833  1.00 130.14 ? 104  GLU A CA    1 
ATOM   1258  C  C     . GLU C 3  104  ? 61.010  -29.503  56.222  1.00 131.73 ? 104  GLU A C     1 
ATOM   1259  O  O     . GLU C 3  104  ? 61.455  -29.705  57.355  1.00 131.88 ? 104  GLU A O     1 
ATOM   1260  C  CB    . GLU C 3  104  ? 59.057  -27.941  56.470  1.00 129.30 ? 104  GLU A CB    1 
ATOM   1261  C  CG    . GLU C 3  104  ? 58.323  -26.714  55.946  1.00 128.81 ? 104  GLU A CG    1 
ATOM   1262  C  CD    . GLU C 3  104  ? 56.880  -26.638  56.407  1.00 128.84 ? 104  GLU A CD    1 
ATOM   1263  O  OE1   . GLU C 3  104  ? 56.132  -27.616  56.198  1.00 128.76 ? 104  GLU A OE1   1 
ATOM   1264  O  OE2   . GLU C 3  104  ? 56.491  -25.594  56.969  1.00 129.17 ? 104  GLU A OE2   1 
ATOM   1265  N  N     . CYS C 3  105  ? 61.010  -30.425  55.262  1.00 133.58 ? 105  CYS A N     1 
ATOM   1266  C  CA    . CYS C 3  105  ? 61.501  -31.785  55.479  1.00 136.14 ? 105  CYS A CA    1 
ATOM   1267  C  C     . CYS C 3  105  ? 62.965  -31.955  55.057  1.00 137.15 ? 105  CYS A C     1 
ATOM   1268  O  O     . CYS C 3  105  ? 63.680  -32.808  55.587  1.00 137.37 ? 105  CYS A O     1 
ATOM   1269  C  CB    . CYS C 3  105  ? 60.614  -32.780  54.711  1.00 136.93 ? 105  CYS A CB    1 
ATOM   1270  S  SG    . CYS C 3  105  ? 60.515  -34.464  55.408  1.00 138.92 ? 105  CYS A SG    1 
ATOM   1271  N  N     . VAL C 3  106  ? 63.407  -31.145  54.100  1.00 138.20 ? 106  VAL A N     1 
ATOM   1272  C  CA    . VAL C 3  106  ? 64.785  -31.209  53.620  1.00 139.41 ? 106  VAL A CA    1 
ATOM   1273  C  C     . VAL C 3  106  ? 65.435  -29.840  53.824  1.00 140.53 ? 106  VAL A C     1 
ATOM   1274  O  O     . VAL C 3  106  ? 64.777  -28.815  53.656  1.00 140.75 ? 106  VAL A O     1 
ATOM   1275  C  CB    . VAL C 3  106  ? 64.832  -31.564  52.119  1.00 138.84 ? 106  VAL A CB    1 
ATOM   1276  C  CG1   . VAL C 3  106  ? 66.267  -31.789  51.682  1.00 139.17 ? 106  VAL A CG1   1 
ATOM   1277  C  CG2   . VAL C 3  106  ? 63.988  -32.796  51.849  1.00 138.21 ? 106  VAL A CG2   1 
ATOM   1278  N  N     . CYS C 3  107  ? 66.716  -29.811  54.187  1.00 141.58 ? 107  CYS A N     1 
ATOM   1279  C  CA    . CYS C 3  107  ? 67.383  -28.527  54.397  1.00 142.40 ? 107  CYS A CA    1 
ATOM   1280  C  C     . CYS C 3  107  ? 67.770  -27.884  53.072  1.00 143.19 ? 107  CYS A C     1 
ATOM   1281  O  O     . CYS C 3  107  ? 68.239  -28.555  52.148  1.00 142.45 ? 107  CYS A O     1 
ATOM   1282  C  CB    . CYS C 3  107  ? 68.634  -28.676  55.273  1.00 141.74 ? 107  CYS A CB    1 
ATOM   1283  S  SG    . CYS C 3  107  ? 69.300  -27.085  55.882  1.00 140.17 ? 107  CYS A SG    1 
ATOM   1284  N  N     . MET C 3  108  ? 67.565  -26.573  52.994  1.00 144.42 ? 108  MET A N     1 
ATOM   1285  C  CA    . MET C 3  108  ? 67.877  -25.804  51.797  1.00 145.70 ? 108  MET A CA    1 
ATOM   1286  C  C     . MET C 3  108  ? 69.389  -25.722  51.602  1.00 146.71 ? 108  MET A C     1 
ATOM   1287  O  O     . MET C 3  108  ? 70.152  -25.911  52.554  1.00 147.51 ? 108  MET A O     1 
ATOM   1288  C  CB    . MET C 3  108  ? 67.296  -24.394  51.930  1.00 145.48 ? 108  MET A CB    1 
ATOM   1289  C  CG    . MET C 3  108  ? 65.886  -24.372  52.497  1.00 145.86 ? 108  MET A CG    1 
ATOM   1290  S  SD    . MET C 3  108  ? 64.735  -25.336  51.500  1.00 147.00 ? 108  MET A SD    1 
ATOM   1291  C  CE    . MET C 3  108  ? 63.822  -24.025  50.672  1.00 146.73 ? 108  MET A CE    1 
ATOM   1292  N  N     . HIS C 3  109  ? 69.805  -25.451  50.363  1.00 146.93 ? 109  HIS A N     1 
ATOM   1293  C  CA    . HIS C 3  109  ? 71.217  -25.314  49.978  1.00 146.79 ? 109  HIS A CA    1 
ATOM   1294  C  C     . HIS C 3  109  ? 71.919  -26.583  49.453  1.00 144.89 ? 109  HIS A C     1 
ATOM   1295  O  O     . HIS C 3  109  ? 72.144  -26.695  48.246  1.00 144.34 ? 109  HIS A O     1 
ATOM   1296  C  CB    . HIS C 3  109  ? 72.038  -24.691  51.125  1.00 149.96 ? 109  HIS A CB    1 
ATOM   1297  C  CG    . HIS C 3  109  ? 71.681  -23.263  51.426  1.00 152.59 ? 109  HIS A CG    1 
ATOM   1298  N  ND1   . HIS C 3  109  ? 71.748  -22.262  50.479  1.00 153.80 ? 109  HIS A ND1   1 
ATOM   1299  C  CD2   . HIS C 3  109  ? 71.275  -22.665  52.573  1.00 153.41 ? 109  HIS A CD2   1 
ATOM   1300  C  CE1   . HIS C 3  109  ? 71.400  -21.111  51.030  1.00 153.83 ? 109  HIS A CE1   1 
ATOM   1301  N  NE2   . HIS C 3  109  ? 71.109  -21.329  52.300  1.00 153.68 ? 109  HIS A NE2   1 
ATOM   1302  N  N     . CYS C 3  110  ? 72.276  -27.526  50.329  1.00 142.90 ? 110  CYS A N     1 
ATOM   1303  C  CA    . CYS C 3  110  ? 72.951  -28.745  49.865  1.00 141.39 ? 110  CYS A CA    1 
ATOM   1304  C  C     . CYS C 3  110  ? 72.006  -29.943  49.727  1.00 140.61 ? 110  CYS A C     1 
ATOM   1305  O  O     . CYS C 3  110  ? 72.445  -31.079  49.523  1.00 140.42 ? 110  CYS A O     1 
ATOM   1306  C  CB    . CYS C 3  110  ? 74.134  -29.105  50.780  1.00 141.05 ? 110  CYS A CB    1 
ATOM   1307  S  SG    . CYS C 3  110  ? 73.745  -30.043  52.274  1.00 140.91 ? 110  CYS A SG    1 
ATOM   1308  N  N     . GLY C 3  111  ? 70.708  -29.664  49.843  1.00 139.25 ? 111  GLY A N     1 
ATOM   1309  C  CA    . GLY C 3  111  ? 69.667  -30.671  49.703  1.00 137.07 ? 111  GLY A CA    1 
ATOM   1310  C  C     . GLY C 3  111  ? 69.830  -32.069  50.271  1.00 135.71 ? 111  GLY A C     1 
ATOM   1311  O  O     . GLY C 3  111  ? 69.905  -33.044  49.521  1.00 135.10 ? 111  GLY A O     1 
ATOM   1312  N  N     . LYS C 3  112  ? 69.872  -32.179  51.592  1.00 134.69 ? 112  LYS A N     1 
ATOM   1313  C  CA    . LYS C 3  112  ? 69.988  -33.484  52.227  1.00 134.51 ? 112  LYS A CA    1 
ATOM   1314  C  C     . LYS C 3  112  ? 68.951  -33.552  53.341  1.00 134.09 ? 112  LYS A C     1 
ATOM   1315  O  O     . LYS C 3  112  ? 68.318  -32.546  53.672  1.00 133.48 ? 112  LYS A O     1 
ATOM   1316  C  CB    . LYS C 3  112  ? 71.397  -33.704  52.798  1.00 135.34 ? 112  LYS A CB    1 
ATOM   1317  C  CG    . LYS C 3  112  ? 71.656  -35.142  53.268  1.00 135.89 ? 112  LYS A CG    1 
ATOM   1318  C  CD    . LYS C 3  112  ? 73.045  -35.320  53.876  1.00 135.89 ? 112  LYS A CD    1 
ATOM   1319  C  CE    . LYS C 3  112  ? 73.245  -36.744  54.391  1.00 135.55 ? 112  LYS A CE    1 
ATOM   1320  N  NZ    . LYS C 3  112  ? 74.551  -36.915  55.093  1.00 135.55 ? 112  LYS A NZ    1 
ATOM   1321  N  N     . LEU C 3  113  ? 68.775  -34.738  53.912  1.00 133.85 ? 113  LEU A N     1 
ATOM   1322  C  CA    . LEU C 3  113  ? 67.803  -34.932  54.979  1.00 133.58 ? 113  LEU A CA    1 
ATOM   1323  C  C     . LEU C 3  113  ? 68.281  -34.448  56.345  1.00 132.91 ? 113  LEU A C     1 
ATOM   1324  O  O     . LEU C 3  113  ? 69.371  -34.796  56.799  1.00 132.11 ? 113  LEU A O     1 
ATOM   1325  C  CB    . LEU C 3  113  ? 67.406  -36.410  55.061  1.00 134.04 ? 113  LEU A CB    1 
ATOM   1326  C  CG    . LEU C 3  113  ? 66.521  -36.931  53.922  1.00 133.49 ? 113  LEU A CG    1 
ATOM   1327  C  CD1   . LEU C 3  113  ? 66.266  -38.425  54.106  1.00 132.06 ? 113  LEU A CD1   1 
ATOM   1328  C  CD2   . LEU C 3  113  ? 65.206  -36.147  53.900  1.00 133.05 ? 113  LEU A CD2   1 
ATOM   1329  N  N     . LEU C 3  114  ? 67.439  -33.647  56.992  1.00 132.84 ? 114  LEU A N     1 
ATOM   1330  C  CA    . LEU C 3  114  ? 67.726  -33.092  58.310  1.00 133.18 ? 114  LEU A CA    1 
ATOM   1331  C  C     . LEU C 3  114  ? 68.072  -34.181  59.319  1.00 133.03 ? 114  LEU A C     1 
ATOM   1332  O  O     . LEU C 3  114  ? 68.444  -33.887  60.454  1.00 133.42 ? 114  LEU A O     1 
ATOM   1333  C  CB    . LEU C 3  114  ? 66.514  -32.311  58.821  1.00 134.53 ? 114  LEU A CB    1 
ATOM   1334  C  CG    . LEU C 3  114  ? 65.869  -31.335  57.835  1.00 136.00 ? 114  LEU A CG    1 
ATOM   1335  C  CD1   . LEU C 3  114  ? 64.641  -30.691  58.466  1.00 136.82 ? 114  LEU A CD1   1 
ATOM   1336  C  CD2   . LEU C 3  114  ? 66.885  -30.287  57.430  1.00 136.09 ? 114  LEU A CD2   1 
ATOM   1337  N  N     . LEU C 3  115  ? 67.935  -35.437  58.907  1.00 132.78 ? 115  LEU A N     1 
ATOM   1338  C  CA    . LEU C 3  115  ? 68.233  -36.563  59.782  1.00 133.12 ? 115  LEU A CA    1 
ATOM   1339  C  C     . LEU C 3  115  ? 68.748  -37.756  58.993  1.00 134.00 ? 115  LEU A C     1 
ATOM   1340  O  O     . LEU C 3  115  ? 68.523  -37.865  57.789  1.00 133.29 ? 115  LEU A O     1 
ATOM   1341  C  CB    . LEU C 3  115  ? 66.981  -36.982  60.555  1.00 132.67 ? 115  LEU A CB    1 
ATOM   1342  C  CG    . LEU C 3  115  ? 66.377  -35.993  61.551  1.00 133.53 ? 115  LEU A CG    1 
ATOM   1343  C  CD1   . LEU C 3  115  ? 65.035  -36.523  62.052  1.00 133.35 ? 115  LEU A CD1   1 
ATOM   1344  C  CD2   . LEU C 3  115  ? 67.348  -35.779  62.707  1.00 134.06 ? 115  LEU A CD2   1 
ATOM   1345  N  N     . ASP C 3  116  ? 69.451  -38.644  59.687  1.00 136.17 ? 116  ASP A N     1 
ATOM   1346  C  CA    . ASP C 3  116  ? 69.992  -39.858  59.085  1.00 138.97 ? 116  ASP A CA    1 
ATOM   1347  C  C     . ASP C 3  116  ? 69.822  -40.997  60.088  1.00 140.37 ? 116  ASP A C     1 
ATOM   1348  O  O     . ASP C 3  116  ? 69.448  -40.765  61.241  1.00 140.94 ? 116  ASP A O     1 
ATOM   1349  C  CB    . ASP C 3  116  ? 71.475  -39.687  58.729  1.00 139.66 ? 116  ASP A CB    1 
ATOM   1350  C  CG    . ASP C 3  116  ? 71.700  -38.691  57.600  1.00 141.03 ? 116  ASP A CG    1 
ATOM   1351  O  OD1   . ASP C 3  116  ? 71.066  -38.839  56.531  1.00 140.61 ? 116  ASP A OD1   1 
ATOM   1352  O  OD2   . ASP C 3  116  ? 72.520  -37.765  57.777  1.00 142.05 ? 116  ASP A OD2   1 
ATOM   1353  N  N     . GLU C 3  117  ? 70.101  -42.222  59.648  1.00 141.65 ? 117  GLU A N     1 
ATOM   1354  C  CA    . GLU C 3  117  ? 69.962  -43.408  60.494  1.00 142.88 ? 117  GLU A CA    1 
ATOM   1355  C  C     . GLU C 3  117  ? 70.484  -43.188  61.912  1.00 142.40 ? 117  GLU A C     1 
ATOM   1356  O  O     . GLU C 3  117  ? 70.053  -43.850  62.856  1.00 142.03 ? 117  GLU A O     1 
ATOM   1357  C  CB    . GLU C 3  117  ? 70.697  -44.599  59.864  1.00 144.75 ? 117  GLU A CB    1 
ATOM   1358  C  CG    . GLU C 3  117  ? 70.542  -44.710  58.351  1.00 148.05 ? 117  GLU A CG    1 
ATOM   1359  C  CD    . GLU C 3  117  ? 71.666  -44.013  57.592  1.00 150.32 ? 117  GLU A CD    1 
ATOM   1360  O  OE1   . GLU C 3  117  ? 72.816  -44.506  57.646  1.00 150.33 ? 117  GLU A OE1   1 
ATOM   1361  O  OE2   . GLU C 3  117  ? 71.403  -42.973  56.945  1.00 151.61 ? 117  GLU A OE2   1 
ATOM   1362  N  N     . HIS C 3  118  ? 71.415  -42.252  62.050  1.00 142.36 ? 118  HIS A N     1 
ATOM   1363  C  CA    . HIS C 3  118  ? 72.013  -41.934  63.339  1.00 142.19 ? 118  HIS A CA    1 
ATOM   1364  C  C     . HIS C 3  118  ? 70.956  -41.771  64.427  1.00 141.76 ? 118  HIS A C     1 
ATOM   1365  O  O     . HIS C 3  118  ? 71.060  -42.374  65.494  1.00 141.86 ? 118  HIS A O     1 
ATOM   1366  C  CB    . HIS C 3  118  ? 72.848  -40.660  63.208  1.00 142.91 ? 118  HIS A CB    1 
ATOM   1367  C  CG    . HIS C 3  118  ? 73.809  -40.693  62.059  1.00 143.36 ? 118  HIS A CG    1 
ATOM   1368  N  ND1   . HIS C 3  118  ? 74.791  -41.654  61.936  1.00 143.07 ? 118  HIS A ND1   1 
ATOM   1369  C  CD2   . HIS C 3  118  ? 73.921  -39.900  60.967  1.00 143.19 ? 118  HIS A CD2   1 
ATOM   1370  C  CE1   . HIS C 3  118  ? 75.464  -41.453  60.817  1.00 142.69 ? 118  HIS A CE1   1 
ATOM   1371  N  NE2   . HIS C 3  118  ? 74.956  -40.395  60.210  1.00 143.02 ? 118  HIS A NE2   1 
ATOM   1372  N  N     . ASN C 3  119  ? 69.941  -40.958  64.155  1.00 140.99 ? 119  ASN A N     1 
ATOM   1373  C  CA    . ASN C 3  119  ? 68.870  -40.741  65.120  1.00 140.71 ? 119  ASN A CA    1 
ATOM   1374  C  C     . ASN C 3  119  ? 68.027  -42.022  65.159  1.00 141.28 ? 119  ASN A C     1 
ATOM   1375  O  O     . ASN C 3  119  ? 67.665  -42.557  64.110  1.00 141.24 ? 119  ASN A O     1 
ATOM   1376  C  CB    . ASN C 3  119  ? 68.024  -39.540  64.681  1.00 139.41 ? 119  ASN A CB    1 
ATOM   1377  C  CG    . ASN C 3  119  ? 67.164  -38.986  65.801  1.00 138.35 ? 119  ASN A CG    1 
ATOM   1378  O  OD1   . ASN C 3  119  ? 66.258  -39.657  66.300  1.00 138.10 ? 119  ASN A OD1   1 
ATOM   1379  N  ND2   . ASN C 3  119  ? 67.447  -37.750  66.204  1.00 135.90 ? 119  ASN A ND2   1 
ATOM   1380  N  N     . GLU C 3  120  ? 67.730  -42.522  66.360  1.00 141.99 ? 120  GLU A N     1 
ATOM   1381  C  CA    . GLU C 3  120  ? 66.945  -43.752  66.497  1.00 142.62 ? 120  GLU A CA    1 
ATOM   1382  C  C     . GLU C 3  120  ? 65.453  -43.544  66.248  1.00 142.58 ? 120  GLU A C     1 
ATOM   1383  O  O     . GLU C 3  120  ? 64.712  -44.508  66.043  1.00 142.85 ? 120  GLU A O     1 
ATOM   1384  C  CB    . GLU C 3  120  ? 67.149  -44.384  67.881  1.00 143.29 ? 120  GLU A CB    1 
ATOM   1385  C  CG    . GLU C 3  120  ? 66.484  -45.756  68.031  1.00 144.05 ? 120  GLU A CG    1 
ATOM   1386  C  CD    . GLU C 3  120  ? 66.822  -46.446  69.341  1.00 144.67 ? 120  GLU A CD    1 
ATOM   1387  O  OE1   . GLU C 3  120  ? 66.494  -45.893  70.415  1.00 144.52 ? 120  GLU A OE1   1 
ATOM   1388  O  OE2   . GLU C 3  120  ? 67.418  -47.545  69.293  1.00 144.55 ? 120  GLU A OE2   1 
ATOM   1389  N  N     . LEU C 3  121  ? 65.011  -42.290  66.278  1.00 141.99 ? 121  LEU A N     1 
ATOM   1390  C  CA    . LEU C 3  121  ? 63.612  -41.984  66.018  1.00 141.69 ? 121  LEU A CA    1 
ATOM   1391  C  C     . LEU C 3  121  ? 63.418  -41.884  64.511  1.00 142.15 ? 121  LEU A C     1 
ATOM   1392  O  O     . LEU C 3  121  ? 62.299  -41.982  64.006  1.00 142.89 ? 121  LEU A O     1 
ATOM   1393  C  CB    . LEU C 3  121  ? 63.215  -40.671  66.687  1.00 140.70 ? 121  LEU A CB    1 
ATOM   1394  C  CG    . LEU C 3  121  ? 62.995  -40.767  68.195  1.00 141.00 ? 121  LEU A CG    1 
ATOM   1395  C  CD1   . LEU C 3  121  ? 62.765  -39.377  68.757  1.00 141.85 ? 121  LEU A CD1   1 
ATOM   1396  C  CD2   . LEU C 3  121  ? 61.804  -41.676  68.488  1.00 140.19 ? 121  LEU A CD2   1 
ATOM   1397  N  N     . MET C 3  122  ? 64.525  -41.692  63.799  1.00 142.14 ? 122  MET A N     1 
ATOM   1398  C  CA    . MET C 3  122  ? 64.506  -41.597  62.346  1.00 142.08 ? 122  MET A CA    1 
ATOM   1399  C  C     . MET C 3  122  ? 64.652  -42.991  61.739  1.00 141.87 ? 122  MET A C     1 
ATOM   1400  O  O     . MET C 3  122  ? 64.211  -43.237  60.618  1.00 142.15 ? 122  MET A O     1 
ATOM   1401  C  CB    . MET C 3  122  ? 65.642  -40.701  61.856  1.00 142.85 ? 122  MET A CB    1 
ATOM   1402  C  CG    . MET C 3  122  ? 65.764  -40.652  60.346  1.00 144.05 ? 122  MET A CG    1 
ATOM   1403  S  SD    . MET C 3  122  ? 64.283  -39.985  59.570  1.00 147.16 ? 122  MET A SD    1 
ATOM   1404  C  CE    . MET C 3  122  ? 64.983  -38.703  58.543  1.00 145.92 ? 122  MET A CE    1 
ATOM   1405  N  N     . ARG C 3  123  ? 65.281  -43.897  62.481  1.00 141.76 ? 123  ARG A N     1 
ATOM   1406  C  CA    . ARG C 3  123  ? 65.461  -45.270  62.021  1.00 142.07 ? 123  ARG A CA    1 
ATOM   1407  C  C     . ARG C 3  123  ? 64.091  -45.925  61.899  1.00 142.37 ? 123  ARG A C     1 
ATOM   1408  O  O     . ARG C 3  123  ? 63.700  -46.374  60.819  1.00 142.69 ? 123  ARG A O     1 
ATOM   1409  C  CB    . ARG C 3  123  ? 66.301  -46.071  63.016  1.00 142.56 ? 123  ARG A CB    1 
ATOM   1410  C  CG    . ARG C 3  123  ? 67.733  -45.609  63.157  1.00 143.73 ? 123  ARG A CG    1 
ATOM   1411  C  CD    . ARG C 3  123  ? 68.481  -46.475  64.156  1.00 144.23 ? 123  ARG A CD    1 
ATOM   1412  N  NE    . ARG C 3  123  ? 69.900  -46.134  64.213  1.00 145.74 ? 123  ARG A NE    1 
ATOM   1413  C  CZ    . ARG C 3  123  ? 70.779  -46.720  65.021  1.00 146.47 ? 123  ARG A CZ    1 
ATOM   1414  N  NH1   . ARG C 3  123  ? 70.387  -47.680  65.848  1.00 146.38 ? 123  ARG A NH1   1 
ATOM   1415  N  NH2   . ARG C 3  123  ? 72.052  -46.346  65.001  1.00 146.83 ? 123  ARG A NH2   1 
ATOM   1416  N  N     . GLN C 3  124  ? 63.373  -45.976  63.021  1.00 142.29 ? 124  GLN A N     1 
ATOM   1417  C  CA    . GLN C 3  124  ? 62.037  -46.567  63.073  1.00 141.97 ? 124  GLN A CA    1 
ATOM   1418  C  C     . GLN C 3  124  ? 61.138  -45.953  62.001  1.00 141.30 ? 124  GLN A C     1 
ATOM   1419  O  O     . GLN C 3  124  ? 60.182  -46.583  61.548  1.00 142.02 ? 124  GLN A O     1 
ATOM   1420  C  CB    . GLN C 3  124  ? 61.401  -46.344  64.453  1.00 142.53 ? 124  GLN A CB    1 
ATOM   1421  C  CG    . GLN C 3  124  ? 62.213  -46.874  65.628  1.00 144.38 ? 124  GLN A CG    1 
ATOM   1422  C  CD    . GLN C 3  124  ? 61.505  -46.683  66.962  1.00 146.01 ? 124  GLN A CD    1 
ATOM   1423  O  OE1   . GLN C 3  124  ? 61.093  -45.574  67.309  1.00 146.68 ? 124  GLN A OE1   1 
ATOM   1424  N  NE2   . GLN C 3  124  ? 61.367  -47.766  67.719  1.00 146.76 ? 124  GLN A NE2   1 
ATOM   1425  N  N     . ALA C 3  125  ? 61.453  -44.722  61.600  1.00 139.76 ? 125  ALA A N     1 
ATOM   1426  C  CA    . ALA C 3  125  ? 60.680  -44.015  60.583  1.00 137.25 ? 125  ALA A CA    1 
ATOM   1427  C  C     . ALA C 3  125  ? 61.165  -44.328  59.165  1.00 135.58 ? 125  ALA A C     1 
ATOM   1428  O  O     . ALA C 3  125  ? 60.516  -43.955  58.187  1.00 135.31 ? 125  ALA A O     1 
ATOM   1429  C  CB    . ALA C 3  125  ? 60.742  -42.511  60.839  1.00 137.05 ? 125  ALA A CB    1 
ATOM   1430  N  N     . LEU C 3  126  ? 62.299  -45.013  59.054  1.00 133.65 ? 126  LEU A N     1 
ATOM   1431  C  CA    . LEU C 3  126  ? 62.844  -45.363  57.749  1.00 132.54 ? 126  LEU A CA    1 
ATOM   1432  C  C     . LEU C 3  126  ? 62.473  -46.765  57.296  1.00 132.74 ? 126  LEU A C     1 
ATOM   1433  O  O     . LEU C 3  126  ? 62.514  -47.061  56.105  1.00 133.16 ? 126  LEU A O     1 
ATOM   1434  C  CB    . LEU C 3  126  ? 64.367  -45.230  57.741  1.00 131.50 ? 126  LEU A CB    1 
ATOM   1435  C  CG    . LEU C 3  126  ? 64.940  -43.814  57.763  1.00 131.33 ? 126  LEU A CG    1 
ATOM   1436  C  CD1   . LEU C 3  126  ? 66.437  -43.877  57.507  1.00 131.39 ? 126  LEU A CD1   1 
ATOM   1437  C  CD2   . LEU C 3  126  ? 64.267  -42.965  56.701  1.00 130.86 ? 126  LEU A CD2   1 
ATOM   1438  N  N     . ALA C 3  127  ? 62.118  -47.630  58.239  1.00 133.09 ? 127  ALA A N     1 
ATOM   1439  C  CA    . ALA C 3  127  ? 61.743  -49.001  57.902  1.00 133.41 ? 127  ALA A CA    1 
ATOM   1440  C  C     . ALA C 3  127  ? 60.299  -49.081  57.413  1.00 134.01 ? 127  ALA A C     1 
ATOM   1441  O  O     . ALA C 3  127  ? 59.909  -50.066  56.786  1.00 133.78 ? 127  ALA A O     1 
ATOM   1442  C  CB    . ALA C 3  127  ? 61.934  -49.908  59.109  1.00 133.03 ? 127  ALA A CB    1 
ATOM   1443  N  N     . ILE C 3  128  ? 59.515  -48.043  57.705  1.00 134.74 ? 128  ILE A N     1 
ATOM   1444  C  CA    . ILE C 3  128  ? 58.108  -47.977  57.299  1.00 135.34 ? 128  ILE A CA    1 
ATOM   1445  C  C     . ILE C 3  128  ? 57.968  -48.109  55.782  1.00 135.81 ? 128  ILE A C     1 
ATOM   1446  O  O     . ILE C 3  128  ? 58.689  -47.453  55.031  1.00 136.20 ? 128  ILE A O     1 
ATOM   1447  C  CB    . ILE C 3  128  ? 57.463  -46.636  57.738  1.00 135.35 ? 128  ILE A CB    1 
ATOM   1448  C  CG1   . ILE C 3  128  ? 57.434  -46.541  59.265  1.00 135.08 ? 128  ILE A CG1   1 
ATOM   1449  C  CG2   . ILE C 3  128  ? 56.050  -46.525  57.179  1.00 135.49 ? 128  ILE A CG2   1 
ATOM   1450  C  CD1   . ILE C 3  128  ? 56.841  -45.242  59.790  1.00 134.71 ? 128  ILE A CD1   1 
ATOM   1451  N  N     . LYS C 3  129  ? 57.032  -48.944  55.335  1.00 136.16 ? 129  LYS A N     1 
ATOM   1452  C  CA    . LYS C 3  129  ? 56.822  -49.160  53.902  1.00 136.74 ? 129  LYS A CA    1 
ATOM   1453  C  C     . LYS C 3  129  ? 55.538  -48.550  53.344  1.00 136.45 ? 129  LYS A C     1 
ATOM   1454  O  O     . LYS C 3  129  ? 54.711  -49.257  52.767  1.00 136.18 ? 129  LYS A O     1 
ATOM   1455  C  CB    . LYS C 3  129  ? 56.833  -50.660  53.586  1.00 138.22 ? 129  LYS A CB    1 
ATOM   1456  C  CG    . LYS C 3  129  ? 58.176  -51.349  53.798  1.00 139.93 ? 129  LYS A CG    1 
ATOM   1457  C  CD    . LYS C 3  129  ? 58.155  -52.776  53.258  1.00 140.31 ? 129  LYS A CD    1 
ATOM   1458  C  CE    . LYS C 3  129  ? 59.529  -53.430  53.340  1.00 140.70 ? 129  LYS A CE    1 
ATOM   1459  N  NZ    . LYS C 3  129  ? 59.561  -54.767  52.674  1.00 140.22 ? 129  LYS A NZ    1 
ATOM   1460  N  N     . ASP C 3  130  ? 55.381  -47.241  53.500  1.00 136.42 ? 130  ASP A N     1 
ATOM   1461  C  CA    . ASP C 3  130  ? 54.196  -46.547  53.004  1.00 136.63 ? 130  ASP A CA    1 
ATOM   1462  C  C     . ASP C 3  130  ? 54.492  -45.069  52.788  1.00 136.14 ? 130  ASP A C     1 
ATOM   1463  O  O     . ASP C 3  130  ? 54.821  -44.354  53.733  1.00 136.25 ? 130  ASP A O     1 
ATOM   1464  C  CB    . ASP C 3  130  ? 53.038  -46.689  53.998  1.00 138.34 ? 130  ASP A CB    1 
ATOM   1465  C  CG    . ASP C 3  130  ? 52.540  -48.118  54.120  1.00 140.12 ? 130  ASP A CG    1 
ATOM   1466  O  OD1   . ASP C 3  130  ? 51.949  -48.628  53.144  1.00 141.08 ? 130  ASP A OD1   1 
ATOM   1467  O  OD2   . ASP C 3  130  ? 52.741  -48.733  55.192  1.00 141.33 ? 130  ASP A OD2   1 
ATOM   1468  N  N     . SER C 3  131  ? 54.371  -44.614  51.545  1.00 135.79 ? 131  SER A N     1 
ATOM   1469  C  CA    . SER C 3  131  ? 54.621  -43.214  51.216  1.00 135.59 ? 131  SER A CA    1 
ATOM   1470  C  C     . SER C 3  131  ? 54.012  -42.302  52.277  1.00 134.08 ? 131  SER A C     1 
ATOM   1471  O  O     . SER C 3  131  ? 54.727  -41.627  53.014  1.00 133.91 ? 131  SER A O     1 
ATOM   1472  C  CB    . SER C 3  131  ? 54.017  -42.865  49.848  1.00 138.16 ? 131  SER A CB    1 
ATOM   1473  O  OG    . SER C 3  131  ? 52.595  -42.822  49.892  1.00 140.77 ? 131  SER A OG    1 
ATOM   1474  N  N     . LYS C 3  132  ? 52.685  -42.301  52.348  1.00 132.46 ? 132  LYS A N     1 
ATOM   1475  C  CA    . LYS C 3  132  ? 51.959  -41.478  53.304  1.00 130.57 ? 132  LYS A CA    1 
ATOM   1476  C  C     . LYS C 3  132  ? 52.516  -41.561  54.725  1.00 128.67 ? 132  LYS A C     1 
ATOM   1477  O  O     . LYS C 3  132  ? 52.587  -40.550  55.420  1.00 128.53 ? 132  LYS A O     1 
ATOM   1478  C  CB    . LYS C 3  132  ? 50.480  -41.874  53.328  1.00 132.64 ? 132  LYS A CB    1 
ATOM   1479  C  CG    . LYS C 3  132  ? 49.691  -41.602  52.051  1.00 132.47 ? 132  LYS A CG    1 
ATOM   1480  C  CD    . LYS C 3  132  ? 48.227  -41.981  52.276  1.00 133.60 ? 132  LYS A CD    1 
ATOM   1481  C  CE    . LYS C 3  132  ? 47.351  -41.726  51.059  1.00 133.41 ? 132  LYS A CE    1 
ATOM   1482  N  NZ    . LYS C 3  132  ? 45.939  -42.146  51.308  1.00 131.47 ? 132  LYS A NZ    1 
ATOM   1483  N  N     . LYS C 3  133  ? 52.902  -42.757  55.162  1.00 126.20 ? 133  LYS A N     1 
ATOM   1484  C  CA    . LYS C 3  133  ? 53.427  -42.924  56.514  1.00 123.80 ? 133  LYS A CA    1 
ATOM   1485  C  C     . LYS C 3  133  ? 54.870  -42.455  56.684  1.00 121.80 ? 133  LYS A C     1 
ATOM   1486  O  O     . LYS C 3  133  ? 55.193  -41.804  57.675  1.00 121.72 ? 133  LYS A O     1 
ATOM   1487  C  CB    . LYS C 3  133  ? 53.281  -44.379  56.968  1.00 124.42 ? 133  LYS A CB    1 
ATOM   1488  C  CG    . LYS C 3  133  ? 51.830  -44.799  57.198  1.00 125.41 ? 133  LYS A CG    1 
ATOM   1489  C  CD    . LYS C 3  133  ? 51.736  -46.201  57.786  1.00 126.67 ? 133  LYS A CD    1 
ATOM   1490  C  CE    . LYS C 3  133  ? 50.288  -46.632  57.977  1.00 126.88 ? 133  LYS A CE    1 
ATOM   1491  N  NZ    . LYS C 3  133  ? 50.185  -48.019  58.518  1.00 125.84 ? 133  LYS A NZ    1 
ATOM   1492  N  N     . ARG C 3  134  ? 55.742  -42.783  55.735  1.00 119.29 ? 134  ARG A N     1 
ATOM   1493  C  CA    . ARG C 3  134  ? 57.127  -42.335  55.830  1.00 116.31 ? 134  ARG A CA    1 
ATOM   1494  C  C     . ARG C 3  134  ? 57.115  -40.819  55.833  1.00 115.55 ? 134  ARG A C     1 
ATOM   1495  O  O     . ARG C 3  134  ? 57.219  -40.185  56.879  1.00 115.07 ? 134  ARG A O     1 
ATOM   1496  C  CB    . ARG C 3  134  ? 57.956  -42.791  54.630  1.00 115.16 ? 134  ARG A CB    1 
ATOM   1497  C  CG    . ARG C 3  134  ? 58.366  -44.244  54.611  1.00 112.99 ? 134  ARG A CG    1 
ATOM   1498  C  CD    . ARG C 3  134  ? 59.342  -44.463  53.471  1.00 110.43 ? 134  ARG A CD    1 
ATOM   1499  N  NE    . ARG C 3  134  ? 59.609  -45.872  53.231  1.00 111.05 ? 134  ARG A NE    1 
ATOM   1500  C  CZ    . ARG C 3  134  ? 60.460  -46.318  52.315  1.00 112.28 ? 134  ARG A CZ    1 
ATOM   1501  N  NH1   . ARG C 3  134  ? 61.123  -45.456  51.558  1.00 112.47 ? 134  ARG A NH1   1 
ATOM   1502  N  NH2   . ARG C 3  134  ? 60.650  -47.622  52.156  1.00 112.43 ? 134  ARG A NH2   1 
ATOM   1503  N  N     . PHE C 3  135  ? 56.982  -40.253  54.638  1.00 115.11 ? 135  PHE A N     1 
ATOM   1504  C  CA    . PHE C 3  135  ? 56.954  -38.810  54.439  1.00 115.57 ? 135  PHE A CA    1 
ATOM   1505  C  C     . PHE C 3  135  ? 56.221  -38.065  55.555  1.00 114.67 ? 135  PHE A C     1 
ATOM   1506  O  O     . PHE C 3  135  ? 56.521  -36.904  55.836  1.00 114.08 ? 135  PHE A O     1 
ATOM   1507  C  CB    . PHE C 3  135  ? 56.314  -38.492  53.079  1.00 118.10 ? 135  PHE A CB    1 
ATOM   1508  C  CG    . PHE C 3  135  ? 56.142  -37.022  52.813  1.00 120.65 ? 135  PHE A CG    1 
ATOM   1509  C  CD1   . PHE C 3  135  ? 57.247  -36.181  52.743  1.00 121.86 ? 135  PHE A CD1   1 
ATOM   1510  C  CD2   . PHE C 3  135  ? 54.869  -36.476  52.646  1.00 122.14 ? 135  PHE A CD2   1 
ATOM   1511  C  CE1   . PHE C 3  135  ? 57.091  -34.816  52.516  1.00 122.70 ? 135  PHE A CE1   1 
ATOM   1512  C  CE2   . PHE C 3  135  ? 54.700  -35.114  52.418  1.00 123.18 ? 135  PHE A CE2   1 
ATOM   1513  C  CZ    . PHE C 3  135  ? 55.815  -34.281  52.353  1.00 123.40 ? 135  PHE A CZ    1 
ATOM   1514  N  N     . ALA C 3  136  ? 55.261  -38.731  56.189  1.00 113.84 ? 136  ALA A N     1 
ATOM   1515  C  CA    . ALA C 3  136  ? 54.514  -38.109  57.270  1.00 114.22 ? 136  ALA A CA    1 
ATOM   1516  C  C     . ALA C 3  136  ? 55.263  -38.271  58.587  1.00 114.99 ? 136  ALA A C     1 
ATOM   1517  O  O     . ALA C 3  136  ? 55.357  -37.330  59.376  1.00 116.09 ? 136  ALA A O     1 
ATOM   1518  C  CB    . ALA C 3  136  ? 53.132  -38.722  57.376  1.00 113.90 ? 136  ALA A CB    1 
ATOM   1519  N  N     . ALA C 3  137  ? 55.793  -39.465  58.831  1.00 114.82 ? 137  ALA A N     1 
ATOM   1520  C  CA    . ALA C 3  137  ? 56.540  -39.711  60.059  1.00 114.28 ? 137  ALA A CA    1 
ATOM   1521  C  C     . ALA C 3  137  ? 57.815  -38.871  60.023  1.00 113.81 ? 137  ALA A C     1 
ATOM   1522  O  O     . ALA C 3  137  ? 58.163  -38.214  61.006  1.00 114.39 ? 137  ALA A O     1 
ATOM   1523  C  CB    . ALA C 3  137  ? 56.880  -41.193  60.186  1.00 114.77 ? 137  ALA A CB    1 
ATOM   1524  N  N     . ILE C 3  138  ? 58.499  -38.891  58.881  1.00 112.64 ? 138  ILE A N     1 
ATOM   1525  C  CA    . ILE C 3  138  ? 59.730  -38.125  58.697  1.00 111.49 ? 138  ILE A CA    1 
ATOM   1526  C  C     . ILE C 3  138  ? 59.472  -36.658  59.028  1.00 110.98 ? 138  ILE A C     1 
ATOM   1527  O  O     . ILE C 3  138  ? 60.120  -36.077  59.899  1.00 109.74 ? 138  ILE A O     1 
ATOM   1528  C  CB    . ILE C 3  138  ? 60.239  -38.252  57.239  1.00 110.64 ? 138  ILE A CB    1 
ATOM   1529  C  CG1   . ILE C 3  138  ? 60.789  -39.666  57.013  1.00 108.99 ? 138  ILE A CG1   1 
ATOM   1530  C  CG2   . ILE C 3  138  ? 61.294  -37.191  56.949  1.00 111.17 ? 138  ILE A CG2   1 
ATOM   1531  C  CD1   . ILE C 3  138  ? 61.307  -39.913  55.615  1.00 107.06 ? 138  ILE A CD1   1 
ATOM   1532  N  N     . TRP C 3  139  ? 58.516  -36.073  58.321  1.00 111.37 ? 139  TRP A N     1 
ATOM   1533  C  CA    . TRP C 3  139  ? 58.131  -34.685  58.531  1.00 112.69 ? 139  TRP A CA    1 
ATOM   1534  C  C     . TRP C 3  139  ? 58.049  -34.421  60.041  1.00 114.16 ? 139  TRP A C     1 
ATOM   1535  O  O     . TRP C 3  139  ? 58.946  -33.811  60.625  1.00 114.22 ? 139  TRP A O     1 
ATOM   1536  C  CB    . TRP C 3  139  ? 56.767  -34.440  57.867  1.00 111.19 ? 139  TRP A CB    1 
ATOM   1537  C  CG    . TRP C 3  139  ? 56.387  -33.001  57.663  1.00 108.24 ? 139  TRP A CG    1 
ATOM   1538  C  CD1   . TRP C 3  139  ? 57.083  -32.061  56.964  1.00 107.15 ? 139  TRP A CD1   1 
ATOM   1539  C  CD2   . TRP C 3  139  ? 55.183  -32.361  58.105  1.00 107.75 ? 139  TRP A CD2   1 
ATOM   1540  N  NE1   . TRP C 3  139  ? 56.388  -30.876  56.937  1.00 107.00 ? 139  TRP A NE1   1 
ATOM   1541  C  CE2   . TRP C 3  139  ? 55.217  -31.033  57.629  1.00 107.88 ? 139  TRP A CE2   1 
ATOM   1542  C  CE3   . TRP C 3  139  ? 54.076  -32.783  58.854  1.00 109.07 ? 139  TRP A CE3   1 
ATOM   1543  C  CZ2   . TRP C 3  139  ? 54.184  -30.118  57.877  1.00 108.54 ? 139  TRP A CZ2   1 
ATOM   1544  C  CZ3   . TRP C 3  139  ? 53.046  -31.870  59.102  1.00 110.07 ? 139  TRP A CZ3   1 
ATOM   1545  C  CH2   . TRP C 3  139  ? 53.111  -30.555  58.613  1.00 108.99 ? 139  TRP A CH2   1 
ATOM   1546  N  N     . THR C 3  140  ? 56.978  -34.907  60.666  1.00 115.50 ? 140  THR A N     1 
ATOM   1547  C  CA    . THR C 3  140  ? 56.756  -34.729  62.099  1.00 116.79 ? 140  THR A CA    1 
ATOM   1548  C  C     . THR C 3  140  ? 58.036  -34.855  62.931  1.00 117.92 ? 140  THR A C     1 
ATOM   1549  O  O     . THR C 3  140  ? 58.178  -34.191  63.958  1.00 117.42 ? 140  THR A O     1 
ATOM   1550  C  CB    . THR C 3  140  ? 55.697  -35.747  62.632  1.00 116.53 ? 140  THR A CB    1 
ATOM   1551  O  OG1   . THR C 3  140  ? 54.424  -35.484  62.028  1.00 114.80 ? 140  THR A OG1   1 
ATOM   1552  C  CG2   . THR C 3  140  ? 55.553  -35.637  64.143  1.00 116.04 ? 140  THR A CG2   1 
ATOM   1553  N  N     . LEU C 3  141  ? 58.970  -35.691  62.483  1.00 119.54 ? 141  LEU A N     1 
ATOM   1554  C  CA    . LEU C 3  141  ? 60.217  -35.894  63.220  1.00 121.92 ? 141  LEU A CA    1 
ATOM   1555  C  C     . LEU C 3  141  ? 61.337  -34.896  62.915  1.00 123.45 ? 141  LEU A C     1 
ATOM   1556  O  O     . LEU C 3  141  ? 62.272  -34.756  63.705  1.00 123.58 ? 141  LEU A O     1 
ATOM   1557  C  CB    . LEU C 3  141  ? 60.735  -37.325  63.016  1.00 121.77 ? 141  LEU A CB    1 
ATOM   1558  C  CG    . LEU C 3  141  ? 59.940  -38.463  63.675  1.00 121.32 ? 141  LEU A CG    1 
ATOM   1559  C  CD1   . LEU C 3  141  ? 60.605  -39.786  63.350  1.00 121.12 ? 141  LEU A CD1   1 
ATOM   1560  C  CD2   . LEU C 3  141  ? 59.868  -38.267  65.184  1.00 119.39 ? 141  LEU A CD2   1 
ATOM   1561  N  N     . CYS C 3  142  ? 61.260  -34.209  61.779  1.00 125.12 ? 142  CYS A N     1 
ATOM   1562  C  CA    . CYS C 3  142  ? 62.283  -33.224  61.440  1.00 126.97 ? 142  CYS A CA    1 
ATOM   1563  C  C     . CYS C 3  142  ? 61.705  -31.908  60.917  1.00 128.01 ? 142  CYS A C     1 
ATOM   1564  O  O     . CYS C 3  142  ? 62.231  -31.304  59.982  1.00 126.91 ? 142  CYS A O     1 
ATOM   1565  C  CB    . CYS C 3  142  ? 63.296  -33.810  60.445  1.00 127.33 ? 142  CYS A CB    1 
ATOM   1566  S  SG    . CYS C 3  142  ? 62.634  -34.956  59.220  1.00 130.02 ? 142  CYS A SG    1 
ATOM   1567  N  N     . LYS C 3  143  ? 60.616  -31.472  61.545  1.00 130.22 ? 143  LYS A N     1 
ATOM   1568  C  CA    . LYS C 3  143  ? 59.951  -30.220  61.194  1.00 132.76 ? 143  LYS A CA    1 
ATOM   1569  C  C     . LYS C 3  143  ? 60.265  -29.220  62.304  1.00 135.10 ? 143  LYS A C     1 
ATOM   1570  O  O     . LYS C 3  143  ? 60.180  -28.007  62.109  1.00 134.76 ? 143  LYS A O     1 
ATOM   1571  C  CB    . LYS C 3  143  ? 58.434  -30.415  61.115  1.00 131.52 ? 143  LYS A CB    1 
ATOM   1572  C  CG    . LYS C 3  143  ? 57.768  -30.582  62.475  1.00 130.76 ? 143  LYS A CG    1 
ATOM   1573  C  CD    . LYS C 3  143  ? 56.258  -30.721  62.363  1.00 130.09 ? 143  LYS A CD    1 
ATOM   1574  C  CE    . LYS C 3  143  ? 55.613  -30.814  63.740  1.00 129.46 ? 143  LYS A CE    1 
ATOM   1575  N  NZ    . LYS C 3  143  ? 54.149  -31.075  63.661  1.00 128.38 ? 143  LYS A NZ    1 
ATOM   1576  N  N     . THR C 3  144  ? 60.611  -29.757  63.475  1.00 138.26 ? 144  THR A N     1 
ATOM   1577  C  CA    . THR C 3  144  ? 60.958  -28.955  64.651  1.00 141.13 ? 144  THR A CA    1 
ATOM   1578  C  C     . THR C 3  144  ? 62.417  -28.500  64.537  1.00 142.93 ? 144  THR A C     1 
ATOM   1579  O  O     . THR C 3  144  ? 62.750  -27.358  64.872  1.00 143.15 ? 144  THR A O     1 
ATOM   1580  C  CB    . THR C 3  144  ? 60.797  -29.771  65.977  1.00 141.06 ? 144  THR A CB    1 
ATOM   1581  O  OG1   . THR C 3  144  ? 59.450  -30.249  66.097  1.00 140.83 ? 144  THR A OG1   1 
ATOM   1582  C  CG2   . THR C 3  144  ? 61.127  -28.901  67.193  1.00 139.92 ? 144  THR A CG2   1 
ATOM   1583  N  N     . LYS C 3  145  ? 63.279  -29.400  64.065  1.00 144.13 ? 145  LYS A N     1 
ATOM   1584  C  CA    . LYS C 3  145  ? 64.696  -29.096  63.903  1.00 144.89 ? 145  LYS A CA    1 
ATOM   1585  C  C     . LYS C 3  145  ? 64.899  -28.047  62.824  1.00 145.59 ? 145  LYS A C     1 
ATOM   1586  O  O     . LYS C 3  145  ? 64.337  -28.144  61.734  1.00 145.50 ? 145  LYS A O     1 
ATOM   1587  C  CB    . LYS C 3  145  ? 65.484  -30.362  63.557  1.00 144.72 ? 145  LYS A CB    1 
ATOM   1588  C  CG    . LYS C 3  145  ? 65.557  -31.352  64.707  1.00 145.17 ? 145  LYS A CG    1 
ATOM   1589  C  CD    . LYS C 3  145  ? 66.672  -32.361  64.512  1.00 146.32 ? 145  LYS A CD    1 
ATOM   1590  C  CE    . LYS C 3  145  ? 66.869  -33.198  65.768  1.00 146.82 ? 145  LYS A CE    1 
ATOM   1591  N  NZ    . LYS C 3  145  ? 68.019  -34.141  65.646  1.00 148.76 ? 145  LYS A NZ    1 
ATOM   1592  N  N     . MET C 3  146  ? 65.708  -27.043  63.139  1.00 146.51 ? 146  MET A N     1 
ATOM   1593  C  CA    . MET C 3  146  ? 65.975  -25.961  62.207  1.00 148.15 ? 146  MET A CA    1 
ATOM   1594  C  C     . MET C 3  146  ? 67.466  -25.671  62.106  1.00 148.63 ? 146  MET A C     1 
ATOM   1595  O  O     . MET C 3  146  ? 67.879  -24.513  62.024  1.00 148.78 ? 146  MET A O     1 
ATOM   1596  C  CB    . MET C 3  146  ? 65.224  -24.707  62.657  1.00 149.80 ? 146  MET A CB    1 
ATOM   1597  C  CG    . MET C 3  146  ? 63.719  -24.908  62.768  1.00 152.48 ? 146  MET A CG    1 
ATOM   1598  S  SD    . MET C 3  146  ? 62.859  -23.519  63.541  1.00 156.99 ? 146  MET A SD    1 
ATOM   1599  C  CE    . MET C 3  146  ? 62.791  -24.071  65.264  1.00 154.97 ? 146  MET A CE    1 
ATOM   1600  N  N     . VAL C 3  147  ? 68.269  -26.732  62.114  1.00 149.16 ? 147  VAL A N     1 
ATOM   1601  C  CA    . VAL C 3  147  ? 69.722  -26.610  62.016  1.00 150.04 ? 147  VAL A CA    1 
ATOM   1602  C  C     . VAL C 3  147  ? 70.302  -27.864  61.373  1.00 149.89 ? 147  VAL A C     1 
ATOM   1603  O  O     . VAL C 3  147  ? 70.106  -28.968  61.882  1.00 150.23 ? 147  VAL A O     1 
ATOM   1604  C  CB    . VAL C 3  147  ? 70.377  -26.442  63.415  1.00 151.06 ? 147  VAL A CB    1 
ATOM   1605  C  CG1   . VAL C 3  147  ? 71.897  -26.366  63.275  1.00 150.78 ? 147  VAL A CG1   1 
ATOM   1606  C  CG2   . VAL C 3  147  ? 69.842  -25.191  64.102  1.00 152.02 ? 147  VAL A CG2   1 
ATOM   1607  N  N     . CYS C 3  148  ? 71.011  -27.700  60.260  1.00 149.69 ? 148  CYS A N     1 
ATOM   1608  C  CA    . CYS C 3  148  ? 71.615  -28.845  59.585  1.00 150.32 ? 148  CYS A CA    1 
ATOM   1609  C  C     . CYS C 3  148  ? 72.802  -29.333  60.411  1.00 152.22 ? 148  CYS A C     1 
ATOM   1610  O  O     . CYS C 3  148  ? 73.896  -28.773  60.336  1.00 152.77 ? 148  CYS A O     1 
ATOM   1611  C  CB    . CYS C 3  148  ? 72.081  -28.462  58.176  1.00 148.49 ? 148  CYS A CB    1 
ATOM   1612  S  SG    . CYS C 3  148  ? 72.715  -29.850  57.182  1.00 144.01 ? 148  CYS A SG    1 
ATOM   1613  N  N     . GLU C 3  149  ? 72.576  -30.377  61.205  1.00 153.87 ? 149  GLU A N     1 
ATOM   1614  C  CA    . GLU C 3  149  ? 73.619  -30.944  62.058  1.00 155.19 ? 149  GLU A CA    1 
ATOM   1615  C  C     . GLU C 3  149  ? 74.826  -31.425  61.250  1.00 155.31 ? 149  GLU A C     1 
ATOM   1616  O  O     . GLU C 3  149  ? 74.680  -32.180  60.288  1.00 155.53 ? 149  GLU A O     1 
ATOM   1617  C  CB    . GLU C 3  149  ? 73.049  -32.112  62.876  1.00 156.34 ? 149  GLU A CB    1 
ATOM   1618  C  CG    . GLU C 3  149  ? 71.929  -31.727  63.845  1.00 158.24 ? 149  GLU A CG    1 
ATOM   1619  C  CD    . GLU C 3  149  ? 71.297  -32.935  64.528  1.00 159.54 ? 149  GLU A CD    1 
ATOM   1620  O  OE1   . GLU C 3  149  ? 70.663  -33.754  63.826  1.00 159.29 ? 149  GLU A OE1   1 
ATOM   1621  O  OE2   . GLU C 3  149  ? 71.436  -33.066  65.766  1.00 159.93 ? 149  GLU A OE2   1 
ATOM   1622  N  N     . THR C 3  150  ? 76.017  -30.979  61.640  1.00 155.53 ? 150  THR A N     1 
ATOM   1623  C  CA    . THR C 3  150  ? 77.241  -31.389  60.957  1.00 155.66 ? 150  THR A CA    1 
ATOM   1624  C  C     . THR C 3  150  ? 77.734  -32.663  61.627  1.00 155.92 ? 150  THR A C     1 
ATOM   1625  O  O     . THR C 3  150  ? 78.503  -33.432  61.044  1.00 155.73 ? 150  THR A O     1 
ATOM   1626  C  CB    . THR C 3  150  ? 78.360  -30.322  61.079  1.00 155.22 ? 150  THR A CB    1 
ATOM   1627  O  OG1   . THR C 3  150  ? 77.876  -29.060  60.606  1.00 155.69 ? 150  THR A OG1   1 
ATOM   1628  C  CG2   . THR C 3  150  ? 79.579  -30.728  60.252  1.00 153.84 ? 150  THR A CG2   1 
ATOM   1629  N  N     . ASP C 3  151  ? 77.276  -32.877  62.859  1.00 156.13 ? 151  ASP A N     1 
ATOM   1630  C  CA    . ASP C 3  151  ? 77.679  -34.038  63.640  1.00 156.19 ? 151  ASP A CA    1 
ATOM   1631  C  C     . ASP C 3  151  ? 76.620  -34.438  64.672  1.00 156.10 ? 151  ASP A C     1 
ATOM   1632  O  O     . ASP C 3  151  ? 75.918  -33.586  65.225  1.00 155.64 ? 151  ASP A O     1 
ATOM   1633  C  CB    . ASP C 3  151  ? 79.010  -33.730  64.330  1.00 156.76 ? 151  ASP A CB    1 
ATOM   1634  C  CG    . ASP C 3  151  ? 80.047  -33.161  63.366  1.00 157.70 ? 151  ASP A CG    1 
ATOM   1635  O  OD1   . ASP C 3  151  ? 80.569  -33.925  62.525  1.00 158.37 ? 151  ASP A OD1   1 
ATOM   1636  O  OD2   . ASP C 3  151  ? 80.325  -31.942  63.436  1.00 157.35 ? 151  ASP A OD2   1 
ATOM   1637  N  N     . VAL C 3  152  ? 76.516  -35.741  64.925  1.00 155.96 ? 152  VAL A N     1 
ATOM   1638  C  CA    . VAL C 3  152  ? 75.540  -36.283  65.870  1.00 155.91 ? 152  VAL A CA    1 
ATOM   1639  C  C     . VAL C 3  152  ? 76.159  -37.437  66.667  1.00 155.60 ? 152  VAL A C     1 
ATOM   1640  O  O     . VAL C 3  152  ? 76.944  -38.221  66.129  1.00 154.68 ? 152  VAL A O     1 
ATOM   1641  C  CB    . VAL C 3  152  ? 74.284  -36.817  65.118  1.00 156.52 ? 152  VAL A CB    1 
ATOM   1642  C  CG1   . VAL C 3  152  ? 73.192  -37.212  66.106  1.00 156.95 ? 152  VAL A CG1   1 
ATOM   1643  C  CG2   . VAL C 3  152  ? 73.767  -35.763  64.151  1.00 156.76 ? 152  VAL A CG2   1 
ATOM   1644  N  N     . PRO C 3  153  ? 75.814  -37.555  67.964  1.00 155.82 ? 153  PRO A N     1 
ATOM   1645  C  CA    . PRO C 3  153  ? 76.368  -38.642  68.783  1.00 155.90 ? 153  PRO A CA    1 
ATOM   1646  C  C     . PRO C 3  153  ? 76.021  -40.026  68.224  1.00 156.02 ? 153  PRO A C     1 
ATOM   1647  O  O     . PRO C 3  153  ? 74.850  -40.408  68.176  1.00 156.34 ? 153  PRO A O     1 
ATOM   1648  C  CB    . PRO C 3  153  ? 75.749  -38.386  70.162  1.00 155.45 ? 153  PRO A CB    1 
ATOM   1649  C  CG    . PRO C 3  153  ? 74.454  -37.687  69.838  1.00 155.72 ? 153  PRO A CG    1 
ATOM   1650  C  CD    . PRO C 3  153  ? 74.885  -36.727  68.754  1.00 155.81 ? 153  PRO A CD    1 
ATOM   1651  N  N     . SER C 3  154  ? 77.046  -40.768  67.805  1.00 156.05 ? 154  SER A N     1 
ATOM   1652  C  CA    . SER C 3  154  ? 76.874  -42.108  67.237  1.00 156.33 ? 154  SER A CA    1 
ATOM   1653  C  C     . SER C 3  154  ? 76.039  -43.058  68.098  1.00 156.36 ? 154  SER A C     1 
ATOM   1654  O  O     . SER C 3  154  ? 75.335  -42.642  69.019  1.00 156.52 ? 154  SER A O     1 
ATOM   1655  C  CB    . SER C 3  154  ? 78.242  -42.748  66.975  1.00 156.12 ? 154  SER A CB    1 
ATOM   1656  O  OG    . SER C 3  154  ? 79.008  -42.840  68.166  1.00 157.24 ? 154  SER A OG    1 
ATOM   1657  N  N     . LEU C 3  161  ? 81.063  -37.621  68.766  1.00 156.28 ? 161  LEU A N     1 
ATOM   1658  C  CA    . LEU C 3  161  ? 80.098  -37.283  67.723  1.00 156.59 ? 161  LEU A CA    1 
ATOM   1659  C  C     . LEU C 3  161  ? 80.556  -37.828  66.368  1.00 156.18 ? 161  LEU A C     1 
ATOM   1660  O  O     . LEU C 3  161  ? 81.740  -38.119  66.173  1.00 156.50 ? 161  LEU A O     1 
ATOM   1661  C  CB    . LEU C 3  161  ? 79.915  -35.757  67.635  1.00 156.90 ? 161  LEU A CB    1 
ATOM   1662  C  CG    . LEU C 3  161  ? 79.389  -34.983  68.857  1.00 156.77 ? 161  LEU A CG    1 
ATOM   1663  C  CD1   . LEU C 3  161  ? 79.383  -33.491  68.551  1.00 155.82 ? 161  LEU A CD1   1 
ATOM   1664  C  CD2   . LEU C 3  161  ? 77.986  -35.448  69.220  1.00 156.59 ? 161  LEU A CD2   1 
ATOM   1665  N  N     . VAL C 3  162  ? 79.610  -37.966  65.440  1.00 155.30 ? 162  VAL A N     1 
ATOM   1666  C  CA    . VAL C 3  162  ? 79.896  -38.473  64.097  1.00 153.91 ? 162  VAL A CA    1 
ATOM   1667  C  C     . VAL C 3  162  ? 79.676  -37.370  63.061  1.00 152.81 ? 162  VAL A C     1 
ATOM   1668  O  O     . VAL C 3  162  ? 78.819  -36.511  63.246  1.00 152.57 ? 162  VAL A O     1 
ATOM   1669  C  CB    . VAL C 3  162  ? 78.982  -39.671  63.751  1.00 154.02 ? 162  VAL A CB    1 
ATOM   1670  C  CG1   . VAL C 3  162  ? 79.269  -40.156  62.340  1.00 154.20 ? 162  VAL A CG1   1 
ATOM   1671  C  CG2   . VAL C 3  162  ? 79.198  -40.796  64.748  1.00 153.28 ? 162  VAL A CG2   1 
ATOM   1672  N  N     . SER C 3  163  ? 80.443  -37.400  61.972  1.00 151.60 ? 163  SER A N     1 
ATOM   1673  C  CA    . SER C 3  163  ? 80.324  -36.387  60.921  1.00 150.63 ? 163  SER A CA    1 
ATOM   1674  C  C     . SER C 3  163  ? 79.463  -36.827  59.735  1.00 150.77 ? 163  SER A C     1 
ATOM   1675  O  O     . SER C 3  163  ? 79.600  -37.944  59.232  1.00 150.63 ? 163  SER A O     1 
ATOM   1676  C  CB    . SER C 3  163  ? 81.712  -35.991  60.415  1.00 149.54 ? 163  SER A CB    1 
ATOM   1677  O  OG    . SER C 3  163  ? 82.383  -37.108  59.859  1.00 147.85 ? 163  SER A OG    1 
ATOM   1678  N  N     . ARG C 3  164  ? 78.582  -35.929  59.293  1.00 150.60 ? 164  ARG A N     1 
ATOM   1679  C  CA    . ARG C 3  164  ? 77.677  -36.181  58.167  1.00 149.69 ? 164  ARG A CA    1 
ATOM   1680  C  C     . ARG C 3  164  ? 77.680  -34.985  57.211  1.00 148.65 ? 164  ARG A C     1 
ATOM   1681  O  O     . ARG C 3  164  ? 78.680  -34.273  57.102  1.00 148.32 ? 164  ARG A O     1 
ATOM   1682  C  CB    . ARG C 3  164  ? 76.249  -36.422  58.679  1.00 149.96 ? 164  ARG A CB    1 
ATOM   1683  C  CG    . ARG C 3  164  ? 75.822  -35.460  59.783  1.00 150.14 ? 164  ARG A CG    1 
ATOM   1684  C  CD    . ARG C 3  164  ? 74.314  -35.440  59.983  1.00 150.78 ? 164  ARG A CD    1 
ATOM   1685  N  NE    . ARG C 3  164  ? 73.629  -34.786  58.870  1.00 150.54 ? 164  ARG A NE    1 
ATOM   1686  C  CZ    . ARG C 3  164  ? 72.346  -34.437  58.880  1.00 150.11 ? 164  ARG A CZ    1 
ATOM   1687  N  NH1   . ARG C 3  164  ? 71.599  -34.680  59.950  1.00 151.05 ? 164  ARG A NH1   1 
ATOM   1688  N  NH2   . ARG C 3  164  ? 71.814  -33.837  57.824  1.00 148.84 ? 164  ARG A NH2   1 
ATOM   1689  N  N     . GLY C 3  165  ? 76.564  -34.773  56.517  1.00 147.42 ? 165  GLY A N     1 
ATOM   1690  C  CA    . GLY C 3  165  ? 76.476  -33.648  55.604  1.00 146.34 ? 165  GLY A CA    1 
ATOM   1691  C  C     . GLY C 3  165  ? 76.838  -32.375  56.347  1.00 146.08 ? 165  GLY A C     1 
ATOM   1692  O  O     . GLY C 3  165  ? 76.249  -32.069  57.386  1.00 146.07 ? 165  GLY A O     1 
ATOM   1693  N  N     . GLY C 3  166  ? 77.803  -31.627  55.822  1.00 145.66 ? 166  GLY A N     1 
ATOM   1694  C  CA    . GLY C 3  166  ? 78.228  -30.409  56.488  1.00 145.50 ? 166  GLY A CA    1 
ATOM   1695  C  C     . GLY C 3  166  ? 77.690  -29.106  55.931  1.00 145.68 ? 166  GLY A C     1 
ATOM   1696  O  O     . GLY C 3  166  ? 77.812  -28.836  54.736  1.00 145.40 ? 166  GLY A O     1 
ATOM   1697  N  N     . CYS C 3  167  ? 77.101  -28.305  56.819  1.00 146.25 ? 167  CYS A N     1 
ATOM   1698  C  CA    . CYS C 3  167  ? 76.528  -26.989  56.508  1.00 147.45 ? 167  CYS A CA    1 
ATOM   1699  C  C     . CYS C 3  167  ? 75.423  -26.643  57.511  1.00 146.77 ? 167  CYS A C     1 
ATOM   1700  O  O     . CYS C 3  167  ? 74.242  -26.592  57.163  1.00 146.92 ? 167  CYS A O     1 
ATOM   1701  C  CB    . CYS C 3  167  ? 75.964  -26.937  55.075  1.00 149.51 ? 167  CYS A CB    1 
ATOM   1702  S  SG    . CYS C 3  167  ? 74.521  -27.987  54.727  1.00 155.17 ? 167  CYS A SG    1 
ATOM   1703  N  N     . GLY C 3  168  ? 75.825  -26.396  58.756  1.00 146.14 ? 168  GLY A N     1 
ATOM   1704  C  CA    . GLY C 3  168  ? 74.880  -26.072  59.815  1.00 145.30 ? 168  GLY A CA    1 
ATOM   1705  C  C     . GLY C 3  168  ? 73.934  -24.905  59.582  1.00 144.78 ? 168  GLY A C     1 
ATOM   1706  O  O     . GLY C 3  168  ? 73.336  -24.394  60.532  1.00 144.23 ? 168  GLY A O     1 
ATOM   1707  N  N     . ASN C 3  169  ? 73.797  -24.484  58.328  1.00 144.50 ? 169  ASN A N     1 
ATOM   1708  C  CA    . ASN C 3  169  ? 72.915  -23.378  57.968  1.00 144.46 ? 169  ASN A CA    1 
ATOM   1709  C  C     . ASN C 3  169  ? 71.547  -23.543  58.621  1.00 145.12 ? 169  ASN A C     1 
ATOM   1710  O  O     . ASN C 3  169  ? 70.983  -24.641  58.627  1.00 145.37 ? 169  ASN A O     1 
ATOM   1711  C  CB    . ASN C 3  169  ? 72.745  -23.320  56.450  1.00 143.15 ? 169  ASN A CB    1 
ATOM   1712  C  CG    . ASN C 3  169  ? 74.065  -23.184  55.723  1.00 141.87 ? 169  ASN A CG    1 
ATOM   1713  O  OD1   . ASN C 3  169  ? 74.763  -22.179  55.864  1.00 141.10 ? 169  ASN A OD1   1 
ATOM   1714  N  ND2   . ASN C 3  169  ? 74.418  -24.198  54.940  1.00 139.83 ? 169  ASN A ND2   1 
ATOM   1715  N  N     . THR C 3  170  ? 71.016  -22.451  59.167  1.00 145.44 ? 170  THR A N     1 
ATOM   1716  C  CA    . THR C 3  170  ? 69.710  -22.486  59.820  1.00 145.72 ? 170  THR A CA    1 
ATOM   1717  C  C     . THR C 3  170  ? 68.590  -22.583  58.781  1.00 145.92 ? 170  THR A C     1 
ATOM   1718  O  O     . THR C 3  170  ? 68.648  -21.957  57.717  1.00 145.61 ? 170  THR A O     1 
ATOM   1719  C  CB    . THR C 3  170  ? 69.486  -21.233  60.709  1.00 145.43 ? 170  THR A CB    1 
ATOM   1720  O  OG1   . THR C 3  170  ? 70.548  -21.126  61.666  1.00 145.61 ? 170  THR A OG1   1 
ATOM   1721  C  CG2   . THR C 3  170  ? 68.162  -21.338  61.463  1.00 144.96 ? 170  THR A CG2   1 
ATOM   1722  N  N     . GLN C 3  171  ? 67.575  -23.382  59.099  1.00 145.97 ? 171  GLN A N     1 
ATOM   1723  C  CA    . GLN C 3  171  ? 66.437  -23.589  58.210  1.00 145.78 ? 171  GLN A CA    1 
ATOM   1724  C  C     . GLN C 3  171  ? 65.356  -22.536  58.424  1.00 145.52 ? 171  GLN A C     1 
ATOM   1725  O  O     . GLN C 3  171  ? 65.229  -21.971  59.514  1.00 145.42 ? 171  GLN A O     1 
ATOM   1726  C  CB    . GLN C 3  171  ? 65.832  -24.973  58.444  1.00 146.56 ? 171  GLN A CB    1 
ATOM   1727  C  CG    . GLN C 3  171  ? 66.811  -26.125  58.306  1.00 146.92 ? 171  GLN A CG    1 
ATOM   1728  C  CD    . GLN C 3  171  ? 66.162  -27.460  58.617  1.00 147.02 ? 171  GLN A CD    1 
ATOM   1729  O  OE1   . GLN C 3  171  ? 65.198  -27.863  57.959  1.00 146.33 ? 171  GLN A OE1   1 
ATOM   1730  N  NE2   . GLN C 3  171  ? 66.683  -28.154  59.627  1.00 146.80 ? 171  GLN A NE2   1 
ATOM   1731  N  N     . PRO C 3  172  ? 64.555  -22.266  57.378  1.00 145.22 ? 172  PRO A N     1 
ATOM   1732  C  CA    . PRO C 3  172  ? 63.476  -21.276  57.449  1.00 144.32 ? 172  PRO A CA    1 
ATOM   1733  C  C     . PRO C 3  172  ? 62.163  -21.808  58.019  1.00 143.58 ? 172  PRO A C     1 
ATOM   1734  O  O     . PRO C 3  172  ? 61.807  -22.973  57.821  1.00 142.97 ? 172  PRO A O     1 
ATOM   1735  C  CB    . PRO C 3  172  ? 63.324  -20.845  55.997  1.00 143.28 ? 172  PRO A CB    1 
ATOM   1736  C  CG    . PRO C 3  172  ? 63.539  -22.137  55.274  1.00 143.54 ? 172  PRO A CG    1 
ATOM   1737  C  CD    . PRO C 3  172  ? 64.750  -22.723  55.987  1.00 144.27 ? 172  PRO A CD    1 
ATOM   1738  N  N     . THR C 3  173  ? 61.459  -20.940  58.739  1.00 143.17 ? 173  THR A N     1 
ATOM   1739  C  CA    . THR C 3  173  ? 60.161  -21.272  59.313  1.00 142.53 ? 173  THR A CA    1 
ATOM   1740  C  C     . THR C 3  173  ? 59.171  -20.761  58.263  1.00 141.62 ? 173  THR A C     1 
ATOM   1741  O  O     . THR C 3  173  ? 58.707  -19.616  58.317  1.00 141.21 ? 173  THR A O     1 
ATOM   1742  C  CB    . THR C 3  173  ? 59.938  -20.550  60.669  1.00 142.94 ? 173  THR A CB    1 
ATOM   1743  O  OG1   . THR C 3  173  ? 60.972  -20.931  61.589  1.00 142.38 ? 173  THR A OG1   1 
ATOM   1744  C  CG2   . THR C 3  173  ? 58.582  -20.923  61.264  1.00 142.69 ? 173  THR A CG2   1 
ATOM   1745  N  N     . ILE C 3  174  ? 58.878  -21.626  57.296  1.00 140.16 ? 174  ILE A N     1 
ATOM   1746  C  CA    . ILE C 3  174  ? 57.993  -21.305  56.186  1.00 138.58 ? 174  ILE A CA    1 
ATOM   1747  C  C     . ILE C 3  174  ? 56.512  -21.228  56.525  1.00 139.41 ? 174  ILE A C     1 
ATOM   1748  O  O     . ILE C 3  174  ? 55.984  -22.055  57.272  1.00 139.55 ? 174  ILE A O     1 
ATOM   1749  C  CB    . ILE C 3  174  ? 58.178  -22.322  55.057  1.00 136.00 ? 174  ILE A CB    1 
ATOM   1750  C  CG1   . ILE C 3  174  ? 59.669  -22.479  54.760  1.00 134.18 ? 174  ILE A CG1   1 
ATOM   1751  C  CG2   . ILE C 3  174  ? 57.431  -21.862  53.816  1.00 135.33 ? 174  ILE A CG2   1 
ATOM   1752  C  CD1   . ILE C 3  174  ? 60.000  -23.668  53.904  1.00 132.73 ? 174  ILE A CD1   1 
ATOM   1753  N  N     . ARG C 3  175  ? 55.853  -20.222  55.957  1.00 139.52 ? 175  ARG A N     1 
ATOM   1754  C  CA    . ARG C 3  175  ? 54.427  -19.999  56.153  1.00 139.60 ? 175  ARG A CA    1 
ATOM   1755  C  C     . ARG C 3  175  ? 53.804  -19.747  54.782  1.00 139.22 ? 175  ARG A C     1 
ATOM   1756  O  O     . ARG C 3  175  ? 54.379  -19.045  53.950  1.00 139.13 ? 175  ARG A O     1 
ATOM   1757  C  CB    . ARG C 3  175  ? 54.192  -18.790  57.070  1.00 140.34 ? 175  ARG A CB    1 
ATOM   1758  C  CG    . ARG C 3  175  ? 54.610  -17.453  56.472  1.00 142.30 ? 175  ARG A CG    1 
ATOM   1759  C  CD    . ARG C 3  175  ? 54.524  -16.325  57.495  1.00 145.03 ? 175  ARG A CD    1 
ATOM   1760  N  NE    . ARG C 3  175  ? 54.898  -15.034  56.918  1.00 147.04 ? 175  ARG A NE    1 
ATOM   1761  C  CZ    . ARG C 3  175  ? 55.124  -13.930  57.625  1.00 147.89 ? 175  ARG A CZ    1 
ATOM   1762  N  NH1   . ARG C 3  175  ? 55.018  -13.949  58.950  1.00 148.34 ? 175  ARG A NH1   1 
ATOM   1763  N  NH2   . ARG C 3  175  ? 55.459  -12.803  57.008  1.00 147.36 ? 175  ARG A NH2   1 
ATOM   1764  N  N     . LYS C 3  176  ? 52.637  -20.334  54.543  1.00 138.93 ? 176  LYS A N     1 
ATOM   1765  C  CA    . LYS C 3  176  ? 51.958  -20.155  53.268  1.00 138.09 ? 176  LYS A CA    1 
ATOM   1766  C  C     . LYS C 3  176  ? 51.219  -18.827  53.217  1.00 137.49 ? 176  LYS A C     1 
ATOM   1767  O  O     . LYS C 3  176  ? 50.592  -18.409  54.192  1.00 136.99 ? 176  LYS A O     1 
ATOM   1768  C  CB    . LYS C 3  176  ? 50.958  -21.292  53.017  1.00 138.40 ? 176  LYS A CB    1 
ATOM   1769  C  CG    . LYS C 3  176  ? 50.090  -21.085  51.766  1.00 139.30 ? 176  LYS A CG    1 
ATOM   1770  C  CD    . LYS C 3  176  ? 49.015  -22.166  51.597  1.00 138.76 ? 176  LYS A CD    1 
ATOM   1771  C  CE    . LYS C 3  176  ? 48.140  -21.906  50.369  1.00 136.34 ? 176  LYS A CE    1 
ATOM   1772  N  NZ    . LYS C 3  176  ? 47.117  -22.969  50.161  1.00 134.06 ? 176  LYS A NZ    1 
ATOM   1773  N  N     . ASP C 3  177  ? 51.309  -18.168  52.068  1.00 137.26 ? 177  ASP A N     1 
ATOM   1774  C  CA    . ASP C 3  177  ? 50.632  -16.899  51.842  1.00 137.31 ? 177  ASP A CA    1 
ATOM   1775  C  C     . ASP C 3  177  ? 50.320  -16.747  50.360  1.00 136.82 ? 177  ASP A C     1 
ATOM   1776  O  O     . ASP C 3  177  ? 51.203  -16.452  49.551  1.00 136.99 ? 177  ASP A O     1 
ATOM   1777  C  CB    . ASP C 3  177  ? 51.489  -15.725  52.325  1.00 138.03 ? 177  ASP A CB    1 
ATOM   1778  C  CG    . ASP C 3  177  ? 51.311  -15.446  53.807  1.00 138.85 ? 177  ASP A CG    1 
ATOM   1779  O  OD1   . ASP C 3  177  ? 50.159  -15.215  54.236  1.00 137.42 ? 177  ASP A OD1   1 
ATOM   1780  O  OD2   . ASP C 3  177  ? 52.320  -15.454  54.543  1.00 141.29 ? 177  ASP A OD2   1 
ATOM   1781  N  N     . GLY C 3  178  ? 49.054  -16.968  50.014  1.00 136.07 ? 178  GLY A N     1 
ATOM   1782  C  CA    . GLY C 3  178  ? 48.623  -16.856  48.633  1.00 134.42 ? 178  GLY A CA    1 
ATOM   1783  C  C     . GLY C 3  178  ? 49.070  -18.023  47.778  1.00 133.04 ? 178  GLY A C     1 
ATOM   1784  O  O     . GLY C 3  178  ? 48.440  -19.080  47.768  1.00 133.09 ? 178  GLY A O     1 
ATOM   1785  N  N     . LEU C 3  179  ? 50.167  -17.829  47.058  1.00 131.75 ? 179  LEU A N     1 
ATOM   1786  C  CA    . LEU C 3  179  ? 50.701  -18.864  46.188  1.00 130.50 ? 179  LEU A CA    1 
ATOM   1787  C  C     . LEU C 3  179  ? 52.220  -18.866  46.286  1.00 129.96 ? 179  LEU A C     1 
ATOM   1788  O  O     . LEU C 3  179  ? 52.916  -19.352  45.395  1.00 129.43 ? 179  LEU A O     1 
ATOM   1789  C  CB    . LEU C 3  179  ? 50.263  -18.593  44.749  1.00 130.03 ? 179  LEU A CB    1 
ATOM   1790  C  CG    . LEU C 3  179  ? 48.765  -18.319  44.576  1.00 128.87 ? 179  LEU A CG    1 
ATOM   1791  C  CD1   . LEU C 3  179  ? 48.494  -17.835  43.164  1.00 129.07 ? 179  LEU A CD1   1 
ATOM   1792  C  CD2   . LEU C 3  179  ? 47.970  -19.574  44.888  1.00 126.56 ? 179  LEU A CD2   1 
ATOM   1793  N  N     . LYS C 3  180  ? 52.727  -18.313  47.382  1.00 129.89 ? 180  LYS A N     1 
ATOM   1794  C  CA    . LYS C 3  180  ? 54.162  -18.241  47.612  1.00 130.38 ? 180  LYS A CA    1 
ATOM   1795  C  C     . LYS C 3  180  ? 54.488  -18.674  49.037  1.00 131.17 ? 180  LYS A C     1 
ATOM   1796  O  O     . LYS C 3  180  ? 53.609  -18.727  49.901  1.00 130.35 ? 180  LYS A O     1 
ATOM   1797  C  CB    . LYS C 3  180  ? 54.658  -16.815  47.376  1.00 130.38 ? 180  LYS A CB    1 
ATOM   1798  C  CG    . LYS C 3  180  ? 54.361  -16.279  45.985  1.00 130.18 ? 180  LYS A CG    1 
ATOM   1799  C  CD    . LYS C 3  180  ? 54.659  -14.792  45.899  1.00 129.78 ? 180  LYS A CD    1 
ATOM   1800  C  CE    . LYS C 3  180  ? 54.282  -14.230  44.541  1.00 129.70 ? 180  LYS A CE    1 
ATOM   1801  N  NZ    . LYS C 3  180  ? 54.441  -12.751  44.501  1.00 129.93 ? 180  LYS A NZ    1 
ATOM   1802  N  N     . LEU C 3  181  ? 55.759  -18.973  49.277  1.00 132.38 ? 181  LEU A N     1 
ATOM   1803  C  CA    . LEU C 3  181  ? 56.211  -19.422  50.590  1.00 134.21 ? 181  LEU A CA    1 
ATOM   1804  C  C     . LEU C 3  181  ? 57.161  -18.427  51.258  1.00 136.07 ? 181  LEU A C     1 
ATOM   1805  O  O     . LEU C 3  181  ? 58.206  -18.087  50.704  1.00 136.79 ? 181  LEU A O     1 
ATOM   1806  C  CB    . LEU C 3  181  ? 56.912  -20.774  50.450  1.00 132.67 ? 181  LEU A CB    1 
ATOM   1807  C  CG    . LEU C 3  181  ? 56.100  -21.883  49.782  1.00 130.90 ? 181  LEU A CG    1 
ATOM   1808  C  CD1   . LEU C 3  181  ? 56.997  -23.066  49.455  1.00 128.98 ? 181  LEU A CD1   1 
ATOM   1809  C  CD2   . LEU C 3  181  ? 54.965  -22.292  50.706  1.00 130.89 ? 181  LEU A CD2   1 
ATOM   1810  N  N     . VAL C 3  182  ? 56.797  -17.969  52.454  1.00 138.06 ? 182  VAL A N     1 
ATOM   1811  C  CA    . VAL C 3  182  ? 57.621  -17.018  53.203  1.00 139.60 ? 182  VAL A CA    1 
ATOM   1812  C  C     . VAL C 3  182  ? 58.276  -17.727  54.388  1.00 140.41 ? 182  VAL A C     1 
ATOM   1813  O  O     . VAL C 3  182  ? 57.605  -18.431  55.142  1.00 140.88 ? 182  VAL A O     1 
ATOM   1814  C  CB    . VAL C 3  182  ? 56.772  -15.833  53.742  1.00 139.92 ? 182  VAL A CB    1 
ATOM   1815  C  CG1   . VAL C 3  182  ? 57.654  -14.864  54.517  1.00 139.65 ? 182  VAL A CG1   1 
ATOM   1816  C  CG2   . VAL C 3  182  ? 56.084  -15.114  52.589  1.00 140.74 ? 182  VAL A CG2   1 
ATOM   1817  N  N     . GLY C 3  183  ? 59.584  -17.539  54.551  1.00 141.23 ? 183  GLY A N     1 
ATOM   1818  C  CA    . GLY C 3  183  ? 60.286  -18.181  55.652  1.00 142.21 ? 183  GLY A CA    1 
ATOM   1819  C  C     . GLY C 3  183  ? 61.131  -17.252  56.510  1.00 142.25 ? 183  GLY A C     1 
ATOM   1820  O  O     . GLY C 3  183  ? 61.717  -16.289  56.005  1.00 142.42 ? 183  GLY A O     1 
ATOM   1821  N  N     . SER C 3  184  ? 61.199  -17.542  57.810  1.00 141.87 ? 184  SER A N     1 
ATOM   1822  C  CA    . SER C 3  184  ? 61.980  -16.729  58.742  1.00 141.32 ? 184  SER A CA    1 
ATOM   1823  C  C     . SER C 3  184  ? 63.257  -17.435  59.189  1.00 141.04 ? 184  SER A C     1 
ATOM   1824  O  O     . SER C 3  184  ? 63.322  -18.664  59.237  1.00 140.43 ? 184  SER A O     1 
ATOM   1825  C  CB    . SER C 3  184  ? 61.144  -16.363  59.976  1.00 140.75 ? 184  SER A CB    1 
ATOM   1826  O  OG    . SER C 3  184  ? 60.828  -17.505  60.752  1.00 140.78 ? 184  SER A OG    1 
ATOM   1827  N  N     . TRP C 3  185  ? 64.270  -16.640  59.517  1.00 141.22 ? 185  TRP A N     1 
ATOM   1828  C  CA    . TRP C 3  185  ? 65.554  -17.163  59.964  1.00 140.79 ? 185  TRP A CA    1 
ATOM   1829  C  C     . TRP C 3  185  ? 65.932  -16.572  61.316  1.00 139.48 ? 185  TRP A C     1 
ATOM   1830  O  O     . TRP C 3  185  ? 65.440  -15.511  61.704  1.00 137.87 ? 185  TRP A O     1 
ATOM   1831  C  CB    . TRP C 3  185  ? 66.635  -16.845  58.926  1.00 143.13 ? 185  TRP A CB    1 
ATOM   1832  C  CG    . TRP C 3  185  ? 66.603  -17.750  57.717  1.00 144.76 ? 185  TRP A CG    1 
ATOM   1833  C  CD1   . TRP C 3  185  ? 67.231  -18.959  57.577  1.00 145.22 ? 185  TRP A CD1   1 
ATOM   1834  C  CD2   . TRP C 3  185  ? 65.893  -17.525  56.491  1.00 145.64 ? 185  TRP A CD2   1 
ATOM   1835  N  NE1   . TRP C 3  185  ? 66.957  -19.498  56.341  1.00 145.51 ? 185  TRP A NE1   1 
ATOM   1836  C  CE2   . TRP C 3  185  ? 66.138  -18.640  55.654  1.00 145.83 ? 185  TRP A CE2   1 
ATOM   1837  C  CE3   . TRP C 3  185  ? 65.072  -16.490  56.017  1.00 145.79 ? 185  TRP A CE3   1 
ATOM   1838  C  CZ2   . TRP C 3  185  ? 65.591  -18.748  54.369  1.00 145.53 ? 185  TRP A CZ2   1 
ATOM   1839  C  CZ3   . TRP C 3  185  ? 64.527  -16.599  54.738  1.00 145.65 ? 185  TRP A CZ3   1 
ATOM   1840  C  CH2   . TRP C 3  185  ? 64.790  -17.722  53.930  1.00 145.42 ? 185  TRP A CH2   1 
ATOM   1841  N  N     . LYS C 3  186  ? 66.813  -17.264  62.028  1.00 139.14 ? 186  LYS A N     1 
ATOM   1842  C  CA    . LYS C 3  186  ? 67.241  -16.819  63.344  1.00 139.56 ? 186  LYS A CA    1 
ATOM   1843  C  C     . LYS C 3  186  ? 68.422  -17.655  63.824  1.00 139.37 ? 186  LYS A C     1 
ATOM   1844  O  O     . LYS C 3  186  ? 68.446  -18.872  63.639  1.00 139.86 ? 186  LYS A O     1 
ATOM   1845  C  CB    . LYS C 3  186  ? 66.071  -16.950  64.323  1.00 140.09 ? 186  LYS A CB    1 
ATOM   1846  C  CG    . LYS C 3  186  ? 66.311  -16.376  65.715  1.00 141.06 ? 186  LYS A CG    1 
ATOM   1847  C  CD    . LYS C 3  186  ? 65.079  -16.570  66.598  1.00 140.24 ? 186  LYS A CD    1 
ATOM   1848  C  CE    . LYS C 3  186  ? 63.845  -15.925  65.976  1.00 139.29 ? 186  LYS A CE    1 
ATOM   1849  N  NZ    . LYS C 3  186  ? 62.597  -16.244  66.719  1.00 138.46 ? 186  LYS A NZ    1 
ATOM   1850  N  N     . LEU C 3  199  ? 62.743  -11.983  57.016  1.00 145.14 ? 199  LEU A N     1 
ATOM   1851  C  CA    . LEU C 3  199  ? 61.670  -12.577  56.226  1.00 145.46 ? 199  LEU A CA    1 
ATOM   1852  C  C     . LEU C 3  199  ? 61.818  -12.267  54.736  1.00 145.67 ? 199  LEU A C     1 
ATOM   1853  O  O     . LEU C 3  199  ? 61.546  -11.147  54.299  1.00 145.44 ? 199  LEU A O     1 
ATOM   1854  C  CB    . LEU C 3  199  ? 60.304  -12.066  56.706  1.00 145.42 ? 199  LEU A CB    1 
ATOM   1855  C  CG    . LEU C 3  199  ? 59.924  -12.181  58.187  1.00 145.48 ? 199  LEU A CG    1 
ATOM   1856  C  CD1   . LEU C 3  199  ? 58.472  -11.755  58.372  1.00 145.32 ? 199  LEU A CD1   1 
ATOM   1857  C  CD2   . LEU C 3  199  ? 60.107  -13.604  58.667  1.00 145.77 ? 199  LEU A CD2   1 
ATOM   1858  N  N     . ARG C 3  200  ? 62.250  -13.258  53.960  1.00 146.23 ? 200  ARG A N     1 
ATOM   1859  C  CA    . ARG C 3  200  ? 62.411  -13.084  52.517  1.00 146.69 ? 200  ARG A CA    1 
ATOM   1860  C  C     . ARG C 3  200  ? 61.460  -14.030  51.794  1.00 146.78 ? 200  ARG A C     1 
ATOM   1861  O  O     . ARG C 3  200  ? 60.895  -14.939  52.404  1.00 147.37 ? 200  ARG A O     1 
ATOM   1862  C  CB    . ARG C 3  200  ? 63.845  -13.392  52.084  1.00 147.29 ? 200  ARG A CB    1 
ATOM   1863  C  CG    . ARG C 3  200  ? 64.139  -14.872  51.938  1.00 147.64 ? 200  ARG A CG    1 
ATOM   1864  C  CD    . ARG C 3  200  ? 65.573  -15.100  51.519  1.00 149.89 ? 200  ARG A CD    1 
ATOM   1865  N  NE    . ARG C 3  200  ? 65.896  -16.520  51.466  1.00 152.86 ? 200  ARG A NE    1 
ATOM   1866  C  CZ    . ARG C 3  200  ? 67.134  -17.003  51.431  1.00 154.95 ? 200  ARG A CZ    1 
ATOM   1867  N  NH1   . ARG C 3  200  ? 68.173  -16.176  51.442  1.00 155.89 ? 200  ARG A NH1   1 
ATOM   1868  N  NH2   . ARG C 3  200  ? 67.336  -18.314  51.395  1.00 155.15 ? 200  ARG A NH2   1 
ATOM   1869  N  N     . VAL C 3  201  ? 61.295  -13.827  50.491  1.00 146.29 ? 201  VAL A N     1 
ATOM   1870  C  CA    . VAL C 3  201  ? 60.403  -14.669  49.705  1.00 145.61 ? 201  VAL A CA    1 
ATOM   1871  C  C     . VAL C 3  201  ? 61.177  -15.785  48.991  1.00 144.93 ? 201  VAL A C     1 
ATOM   1872  O  O     . VAL C 3  201  ? 62.174  -15.529  48.312  1.00 144.94 ? 201  VAL A O     1 
ATOM   1873  C  CB    . VAL C 3  201  ? 59.625  -13.826  48.658  1.00 146.16 ? 201  VAL A CB    1 
ATOM   1874  C  CG1   . VAL C 3  201  ? 58.523  -14.664  48.028  1.00 146.27 ? 201  VAL A CG1   1 
ATOM   1875  C  CG2   . VAL C 3  201  ? 59.034  -12.581  49.319  1.00 145.63 ? 201  VAL A CG2   1 
ATOM   1876  N  N     . LEU C 3  202  ? 60.710  -17.021  49.163  1.00 144.03 ? 202  LEU A N     1 
ATOM   1877  C  CA    . LEU C 3  202  ? 61.331  -18.197  48.549  1.00 142.61 ? 202  LEU A CA    1 
ATOM   1878  C  C     . LEU C 3  202  ? 60.778  -18.379  47.134  1.00 141.87 ? 202  LEU A C     1 
ATOM   1879  O  O     . LEU C 3  202  ? 59.672  -18.891  46.952  1.00 141.85 ? 202  LEU A O     1 
ATOM   1880  C  CB    . LEU C 3  202  ? 61.030  -19.447  49.390  1.00 141.95 ? 202  LEU A CB    1 
ATOM   1881  C  CG    . LEU C 3  202  ? 61.351  -19.371  50.890  1.00 141.15 ? 202  LEU A CG    1 
ATOM   1882  C  CD1   . LEU C 3  202  ? 60.773  -20.578  51.607  1.00 139.91 ? 202  LEU A CD1   1 
ATOM   1883  C  CD2   . LEU C 3  202  ? 62.855  -19.289  51.094  1.00 140.91 ? 202  LEU A CD2   1 
ATOM   1884  N  N     . SER C 3  203  ? 61.554  -17.961  46.136  1.00 141.00 ? 203  SER A N     1 
ATOM   1885  C  CA    . SER C 3  203  ? 61.135  -18.053  44.739  1.00 140.23 ? 203  SER A CA    1 
ATOM   1886  C  C     . SER C 3  203  ? 61.144  -19.471  44.174  1.00 139.50 ? 203  SER A C     1 
ATOM   1887  O  O     . SER C 3  203  ? 61.496  -20.429  44.866  1.00 139.36 ? 203  SER A O     1 
ATOM   1888  C  CB    . SER C 3  203  ? 62.014  -17.158  43.865  1.00 140.65 ? 203  SER A CB    1 
ATOM   1889  O  OG    . SER C 3  203  ? 63.340  -17.650  43.814  1.00 142.13 ? 203  SER A OG    1 
ATOM   1890  N  N     . THR C 3  204  ? 60.768  -19.582  42.900  1.00 138.67 ? 204  THR A N     1 
ATOM   1891  C  CA    . THR C 3  204  ? 60.683  -20.863  42.201  1.00 137.64 ? 204  THR A CA    1 
ATOM   1892  C  C     . THR C 3  204  ? 62.020  -21.460  41.769  1.00 137.18 ? 204  THR A C     1 
ATOM   1893  O  O     . THR C 3  204  ? 62.280  -22.643  41.996  1.00 137.18 ? 204  THR A O     1 
ATOM   1894  C  CB    . THR C 3  204  ? 59.799  -20.750  40.941  1.00 137.50 ? 204  THR A CB    1 
ATOM   1895  O  OG1   . THR C 3  204  ? 58.558  -20.112  41.271  1.00 137.21 ? 204  THR A OG1   1 
ATOM   1896  C  CG2   . THR C 3  204  ? 59.514  -22.133  40.378  1.00 136.86 ? 204  THR A CG2   1 
ATOM   1897  N  N     . GLU C 3  205  ? 62.855  -20.648  41.128  1.00 136.34 ? 205  GLU A N     1 
ATOM   1898  C  CA    . GLU C 3  205  ? 64.156  -21.111  40.656  1.00 135.26 ? 205  GLU A CA    1 
ATOM   1899  C  C     . GLU C 3  205  ? 64.965  -21.795  41.764  1.00 134.17 ? 205  GLU A C     1 
ATOM   1900  O  O     . GLU C 3  205  ? 65.657  -22.784  41.510  1.00 133.91 ? 205  GLU A O     1 
ATOM   1901  C  CB    . GLU C 3  205  ? 64.934  -19.934  40.065  1.00 135.87 ? 205  GLU A CB    1 
ATOM   1902  C  CG    . GLU C 3  205  ? 64.245  -19.303  38.859  1.00 137.83 ? 205  GLU A CG    1 
ATOM   1903  C  CD    . GLU C 3  205  ? 64.838  -17.956  38.477  1.00 140.34 ? 205  GLU A CD    1 
ATOM   1904  O  OE1   . GLU C 3  205  ? 66.057  -17.888  38.211  1.00 141.88 ? 205  GLU A OE1   1 
ATOM   1905  O  OE2   . GLU C 3  205  ? 64.081  -16.962  38.441  1.00 140.08 ? 205  GLU A OE2   1 
ATOM   1906  N  N     . GLU C 3  206  ? 64.872  -21.271  42.987  1.00 132.76 ? 206  GLU A N     1 
ATOM   1907  C  CA    . GLU C 3  206  ? 65.581  -21.844  44.135  1.00 130.86 ? 206  GLU A CA    1 
ATOM   1908  C  C     . GLU C 3  206  ? 65.116  -23.277  44.351  1.00 129.15 ? 206  GLU A C     1 
ATOM   1909  O  O     . GLU C 3  206  ? 65.886  -24.229  44.202  1.00 128.03 ? 206  GLU A O     1 
ATOM   1910  C  CB    . GLU C 3  206  ? 65.291  -21.049  45.416  1.00 131.94 ? 206  GLU A CB    1 
ATOM   1911  C  CG    . GLU C 3  206  ? 66.061  -19.745  45.589  1.00 132.40 ? 206  GLU A CG    1 
ATOM   1912  C  CD    . GLU C 3  206  ? 65.714  -19.038  46.895  1.00 133.01 ? 206  GLU A CD    1 
ATOM   1913  O  OE1   . GLU C 3  206  ? 65.839  -19.667  47.968  1.00 132.76 ? 206  GLU A OE1   1 
ATOM   1914  O  OE2   . GLU C 3  206  ? 65.318  -17.853  46.852  1.00 133.08 ? 206  GLU A OE2   1 
ATOM   1915  N  N     . ILE C 3  207  ? 63.843  -23.405  44.716  1.00 127.68 ? 207  ILE A N     1 
ATOM   1916  C  CA    . ILE C 3  207  ? 63.219  -24.694  44.975  1.00 126.27 ? 207  ILE A CA    1 
ATOM   1917  C  C     . ILE C 3  207  ? 63.634  -25.679  43.892  1.00 126.11 ? 207  ILE A C     1 
ATOM   1918  O  O     . ILE C 3  207  ? 63.949  -26.835  44.178  1.00 125.07 ? 207  ILE A O     1 
ATOM   1919  C  CB    . ILE C 3  207  ? 61.680  -24.567  44.989  1.00 125.72 ? 207  ILE A CB    1 
ATOM   1920  C  CG1   . ILE C 3  207  ? 61.255  -23.348  45.815  1.00 125.23 ? 207  ILE A CG1   1 
ATOM   1921  C  CG2   . ILE C 3  207  ? 61.063  -25.817  45.588  1.00 125.07 ? 207  ILE A CG2   1 
ATOM   1922  C  CD1   . ILE C 3  207  ? 61.589  -23.435  47.290  1.00 124.59 ? 207  ILE A CD1   1 
ATOM   1923  N  N     . LEU C 3  208  ? 63.635  -25.213  42.646  1.00 126.59 ? 208  LEU A N     1 
ATOM   1924  C  CA    . LEU C 3  208  ? 64.037  -26.053  41.526  1.00 127.57 ? 208  LEU A CA    1 
ATOM   1925  C  C     . LEU C 3  208  ? 65.361  -26.706  41.875  1.00 128.65 ? 208  LEU A C     1 
ATOM   1926  O  O     . LEU C 3  208  ? 65.441  -27.926  42.027  1.00 128.23 ? 208  LEU A O     1 
ATOM   1927  C  CB    . LEU C 3  208  ? 64.210  -25.220  40.258  1.00 127.13 ? 208  LEU A CB    1 
ATOM   1928  C  CG    . LEU C 3  208  ? 63.051  -25.218  39.266  1.00 127.23 ? 208  LEU A CG    1 
ATOM   1929  C  CD1   . LEU C 3  208  ? 63.439  -24.382  38.054  1.00 128.21 ? 208  LEU A CD1   1 
ATOM   1930  C  CD2   . LEU C 3  208  ? 62.728  -26.650  38.846  1.00 126.94 ? 208  LEU A CD2   1 
ATOM   1931  N  N     . ASN C 3  209  ? 66.397  -25.880  42.001  1.00 129.78 ? 209  ASN A N     1 
ATOM   1932  C  CA    . ASN C 3  209  ? 67.723  -26.369  42.351  1.00 130.88 ? 209  ASN A CA    1 
ATOM   1933  C  C     . ASN C 3  209  ? 67.590  -27.380  43.479  1.00 131.03 ? 209  ASN A C     1 
ATOM   1934  O  O     . ASN C 3  209  ? 67.808  -28.576  43.286  1.00 130.98 ? 209  ASN A O     1 
ATOM   1935  C  CB    . ASN C 3  209  ? 68.630  -25.219  42.814  1.00 132.42 ? 209  ASN A CB    1 
ATOM   1936  C  CG    . ASN C 3  209  ? 69.308  -24.492  41.659  1.00 133.86 ? 209  ASN A CG    1 
ATOM   1937  O  OD1   . ASN C 3  209  ? 69.866  -25.121  40.755  1.00 133.55 ? 209  ASN A OD1   1 
ATOM   1938  N  ND2   . ASN C 3  209  ? 69.283  -23.160  41.698  1.00 134.00 ? 209  ASN A ND2   1 
ATOM   1939  N  N     . ILE C 3  210  ? 67.215  -26.884  44.652  1.00 130.97 ? 210  ILE A N     1 
ATOM   1940  C  CA    . ILE C 3  210  ? 67.057  -27.719  45.835  1.00 131.59 ? 210  ILE A CA    1 
ATOM   1941  C  C     . ILE C 3  210  ? 66.486  -29.097  45.513  1.00 131.22 ? 210  ILE A C     1 
ATOM   1942  O  O     . ILE C 3  210  ? 67.045  -30.120  45.914  1.00 131.41 ? 210  ILE A O     1 
ATOM   1943  C  CB    . ILE C 3  210  ? 66.135  -27.039  46.869  1.00 132.75 ? 210  ILE A CB    1 
ATOM   1944  C  CG1   . ILE C 3  210  ? 66.614  -25.608  47.129  1.00 132.99 ? 210  ILE A CG1   1 
ATOM   1945  C  CG2   . ILE C 3  210  ? 66.126  -27.845  48.169  1.00 133.27 ? 210  ILE A CG2   1 
ATOM   1946  C  CD1   . ILE C 3  210  ? 65.726  -24.822  48.074  1.00 132.88 ? 210  ILE A CD1   1 
ATOM   1947  N  N     . PHE C 3  211  ? 65.378  -29.119  44.781  1.00 130.25 ? 211  PHE A N     1 
ATOM   1948  C  CA    . PHE C 3  211  ? 64.725  -30.369  44.422  1.00 129.10 ? 211  PHE A CA    1 
ATOM   1949  C  C     . PHE C 3  211  ? 65.492  -31.186  43.383  1.00 128.62 ? 211  PHE A C     1 
ATOM   1950  O  O     . PHE C 3  211  ? 65.532  -32.416  43.461  1.00 128.24 ? 211  PHE A O     1 
ATOM   1951  C  CB    . PHE C 3  211  ? 63.310  -30.076  43.924  1.00 128.62 ? 211  PHE A CB    1 
ATOM   1952  C  CG    . PHE C 3  211  ? 62.355  -29.671  45.013  1.00 128.40 ? 211  PHE A CG    1 
ATOM   1953  C  CD1   . PHE C 3  211  ? 62.800  -28.963  46.124  1.00 127.86 ? 211  PHE A CD1   1 
ATOM   1954  C  CD2   . PHE C 3  211  ? 61.003  -29.979  44.915  1.00 129.69 ? 211  PHE A CD2   1 
ATOM   1955  C  CE1   . PHE C 3  211  ? 61.914  -28.567  47.123  1.00 128.86 ? 211  PHE A CE1   1 
ATOM   1956  C  CE2   . PHE C 3  211  ? 60.106  -29.586  45.909  1.00 130.95 ? 211  PHE A CE2   1 
ATOM   1957  C  CZ    . PHE C 3  211  ? 60.564  -28.879  47.016  1.00 130.14 ? 211  PHE A CZ    1 
ATOM   1958  N  N     . LYS C 3  212  ? 66.104  -30.505  42.417  1.00 127.86 ? 212  LYS A N     1 
ATOM   1959  C  CA    . LYS C 3  212  ? 66.860  -31.185  41.366  1.00 127.25 ? 212  LYS A CA    1 
ATOM   1960  C  C     . LYS C 3  212  ? 68.135  -31.846  41.873  1.00 127.06 ? 212  LYS A C     1 
ATOM   1961  O  O     . LYS C 3  212  ? 68.574  -32.862  41.330  1.00 126.38 ? 212  LYS A O     1 
ATOM   1962  C  CB    . LYS C 3  212  ? 67.218  -30.206  40.246  1.00 126.69 ? 212  LYS A CB    1 
ATOM   1963  C  CG    . LYS C 3  212  ? 66.038  -29.757  39.409  1.00 126.54 ? 212  LYS A CG    1 
ATOM   1964  C  CD    . LYS C 3  212  ? 66.482  -28.861  38.272  1.00 125.99 ? 212  LYS A CD    1 
ATOM   1965  C  CE    . LYS C 3  212  ? 65.318  -28.516  37.363  1.00 126.29 ? 212  LYS A CE    1 
ATOM   1966  N  NZ    . LYS C 3  212  ? 65.736  -27.608  36.260  1.00 128.22 ? 212  LYS A NZ    1 
ATOM   1967  N  N     . HIS C 3  213  ? 68.729  -31.268  42.911  1.00 126.98 ? 213  HIS A N     1 
ATOM   1968  C  CA    . HIS C 3  213  ? 69.961  -31.809  43.466  1.00 127.25 ? 213  HIS A CA    1 
ATOM   1969  C  C     . HIS C 3  213  ? 69.723  -32.977  44.426  1.00 126.36 ? 213  HIS A C     1 
ATOM   1970  O  O     . HIS C 3  213  ? 70.670  -33.675  44.794  1.00 126.98 ? 213  HIS A O     1 
ATOM   1971  C  CB    . HIS C 3  213  ? 70.751  -30.715  44.204  1.00 129.39 ? 213  HIS A CB    1 
ATOM   1972  C  CG    . HIS C 3  213  ? 71.058  -29.505  43.372  1.00 130.88 ? 213  HIS A CG    1 
ATOM   1973  N  ND1   . HIS C 3  213  ? 71.549  -29.585  42.086  1.00 131.14 ? 213  HIS A ND1   1 
ATOM   1974  C  CD2   . HIS C 3  213  ? 70.981  -28.183  43.663  1.00 130.83 ? 213  HIS A CD2   1 
ATOM   1975  C  CE1   . HIS C 3  213  ? 71.761  -28.366  41.621  1.00 131.54 ? 213  HIS A CE1   1 
ATOM   1976  N  NE2   . HIS C 3  213  ? 71.425  -27.497  42.559  1.00 131.25 ? 213  HIS A NE2   1 
ATOM   1977  N  N     . ILE C 3  214  ? 68.472  -33.193  44.831  1.00 124.55 ? 214  ILE A N     1 
ATOM   1978  C  CA    . ILE C 3  214  ? 68.157  -34.274  45.765  1.00 122.72 ? 214  ILE A CA    1 
ATOM   1979  C  C     . ILE C 3  214  ? 68.518  -35.656  45.219  1.00 122.26 ? 214  ILE A C     1 
ATOM   1980  O  O     . ILE C 3  214  ? 68.376  -35.924  44.023  1.00 121.50 ? 214  ILE A O     1 
ATOM   1981  C  CB    . ILE C 3  214  ? 66.664  -34.253  46.169  1.00 121.75 ? 214  ILE A CB    1 
ATOM   1982  C  CG1   . ILE C 3  214  ? 66.325  -32.907  46.818  1.00 121.52 ? 214  ILE A CG1   1 
ATOM   1983  C  CG2   . ILE C 3  214  ? 66.375  -35.378  47.155  1.00 121.21 ? 214  ILE A CG2   1 
ATOM   1984  C  CD1   . ILE C 3  214  ? 64.898  -32.795  47.329  1.00 121.37 ? 214  ILE A CD1   1 
ATOM   1985  N  N     . SER C 3  215  ? 68.990  -36.527  46.109  1.00 122.11 ? 215  SER A N     1 
ATOM   1986  C  CA    . SER C 3  215  ? 69.401  -37.876  45.730  1.00 122.34 ? 215  SER A CA    1 
ATOM   1987  C  C     . SER C 3  215  ? 68.293  -38.911  45.856  1.00 122.96 ? 215  SER A C     1 
ATOM   1988  O  O     . SER C 3  215  ? 67.457  -38.844  46.757  1.00 122.22 ? 215  SER A O     1 
ATOM   1989  C  CB    . SER C 3  215  ? 70.601  -38.324  46.573  1.00 121.68 ? 215  SER A CB    1 
ATOM   1990  O  OG    . SER C 3  215  ? 70.240  -38.512  47.931  1.00 119.00 ? 215  SER A OG    1 
ATOM   1991  N  N     . VAL C 3  216  ? 68.321  -39.879  44.946  1.00 124.17 ? 216  VAL A N     1 
ATOM   1992  C  CA    . VAL C 3  216  ? 67.344  -40.961  44.894  1.00 125.67 ? 216  VAL A CA    1 
ATOM   1993  C  C     . VAL C 3  216  ? 66.892  -41.484  46.260  1.00 126.88 ? 216  VAL A C     1 
ATOM   1994  O  O     . VAL C 3  216  ? 65.697  -41.472  46.564  1.00 127.38 ? 216  VAL A O     1 
ATOM   1995  C  CB    . VAL C 3  216  ? 67.894  -42.151  44.076  1.00 125.07 ? 216  VAL A CB    1 
ATOM   1996  C  CG1   . VAL C 3  216  ? 66.827  -43.224  43.937  1.00 125.55 ? 216  VAL A CG1   1 
ATOM   1997  C  CG2   . VAL C 3  216  ? 68.356  -41.674  42.709  1.00 124.35 ? 216  VAL A CG2   1 
ATOM   1998  N  N     . LYS C 3  217  ? 67.836  -41.951  47.074  1.00 127.80 ? 217  LYS A N     1 
ATOM   1999  C  CA    . LYS C 3  217  ? 67.500  -42.484  48.394  1.00 128.56 ? 217  LYS A CA    1 
ATOM   2000  C  C     . LYS C 3  217  ? 66.628  -41.531  49.214  1.00 127.99 ? 217  LYS A C     1 
ATOM   2001  O  O     . LYS C 3  217  ? 65.798  -41.972  50.015  1.00 127.83 ? 217  LYS A O     1 
ATOM   2002  C  CB    . LYS C 3  217  ? 68.773  -42.842  49.173  1.00 130.49 ? 217  LYS A CB    1 
ATOM   2003  C  CG    . LYS C 3  217  ? 69.466  -44.106  48.672  1.00 132.23 ? 217  LYS A CG    1 
ATOM   2004  C  CD    . LYS C 3  217  ? 70.625  -44.510  49.577  1.00 134.54 ? 217  LYS A CD    1 
ATOM   2005  C  CE    . LYS C 3  217  ? 71.265  -45.818  49.113  1.00 135.54 ? 217  LYS A CE    1 
ATOM   2006  N  NZ    . LYS C 3  217  ? 72.420  -46.222  49.966  1.00 134.43 ? 217  LYS A NZ    1 
ATOM   2007  N  N     . ASP C 3  218  ? 66.811  -40.229  49.019  1.00 127.09 ? 218  ASP A N     1 
ATOM   2008  C  CA    . ASP C 3  218  ? 65.999  -39.257  49.738  1.00 126.70 ? 218  ASP A CA    1 
ATOM   2009  C  C     . ASP C 3  218  ? 64.607  -39.256  49.107  1.00 125.42 ? 218  ASP A C     1 
ATOM   2010  O  O     . ASP C 3  218  ? 63.606  -38.986  49.772  1.00 125.66 ? 218  ASP A O     1 
ATOM   2011  C  CB    . ASP C 3  218  ? 66.636  -37.866  49.670  1.00 128.85 ? 218  ASP A CB    1 
ATOM   2012  C  CG    . ASP C 3  218  ? 67.935  -37.781  50.462  1.00 131.14 ? 218  ASP A CG    1 
ATOM   2013  O  OD1   . ASP C 3  218  ? 67.934  -38.165  51.653  1.00 131.29 ? 218  ASP A OD1   1 
ATOM   2014  O  OD2   . ASP C 3  218  ? 68.955  -37.327  49.896  1.00 133.11 ? 218  ASP A OD2   1 
ATOM   2015  N  N     . PHE C 3  219  ? 64.549  -39.558  47.814  1.00 123.22 ? 219  PHE A N     1 
ATOM   2016  C  CA    . PHE C 3  219  ? 63.270  -39.639  47.129  1.00 120.15 ? 219  PHE A CA    1 
ATOM   2017  C  C     . PHE C 3  219  ? 62.580  -40.805  47.794  1.00 118.02 ? 219  PHE A C     1 
ATOM   2018  O  O     . PHE C 3  219  ? 61.576  -40.639  48.466  1.00 117.47 ? 219  PHE A O     1 
ATOM   2019  C  CB    . PHE C 3  219  ? 63.455  -39.952  45.643  1.00 120.46 ? 219  PHE A CB    1 
ATOM   2020  C  CG    . PHE C 3  219  ? 63.936  -38.790  44.831  1.00 121.04 ? 219  PHE A CG    1 
ATOM   2021  C  CD1   . PHE C 3  219  ? 64.401  -38.985  43.535  1.00 121.61 ? 219  PHE A CD1   1 
ATOM   2022  C  CD2   . PHE C 3  219  ? 63.923  -37.500  45.354  1.00 121.78 ? 219  PHE A CD2   1 
ATOM   2023  C  CE1   . PHE C 3  219  ? 64.853  -37.914  42.771  1.00 123.53 ? 219  PHE A CE1   1 
ATOM   2024  C  CE2   . PHE C 3  219  ? 64.371  -36.421  44.600  1.00 123.92 ? 219  PHE A CE2   1 
ATOM   2025  C  CZ    . PHE C 3  219  ? 64.838  -36.627  43.303  1.00 124.37 ? 219  PHE A CZ    1 
ATOM   2026  N  N     . THR C 3  220  ? 63.152  -41.987  47.610  1.00 116.21 ? 220  THR A N     1 
ATOM   2027  C  CA    . THR C 3  220  ? 62.617  -43.208  48.186  1.00 115.79 ? 220  THR A CA    1 
ATOM   2028  C  C     . THR C 3  220  ? 62.076  -42.991  49.597  1.00 115.35 ? 220  THR A C     1 
ATOM   2029  O  O     . THR C 3  220  ? 61.092  -43.614  49.985  1.00 115.81 ? 220  THR A O     1 
ATOM   2030  C  CB    . THR C 3  220  ? 63.698  -44.315  48.219  1.00 116.43 ? 220  THR A CB    1 
ATOM   2031  O  OG1   . THR C 3  220  ? 64.063  -44.663  46.877  1.00 115.78 ? 220  THR A OG1   1 
ATOM   2032  C  CG2   . THR C 3  220  ? 63.186  -45.558  48.939  1.00 115.87 ? 220  THR A CG2   1 
ATOM   2033  N  N     . SER C 3  221  ? 62.708  -42.106  50.361  1.00 114.72 ? 221  SER A N     1 
ATOM   2034  C  CA    . SER C 3  221  ? 62.256  -41.837  51.725  1.00 114.92 ? 221  SER A CA    1 
ATOM   2035  C  C     . SER C 3  221  ? 60.937  -41.071  51.693  1.00 114.09 ? 221  SER A C     1 
ATOM   2036  O  O     . SER C 3  221  ? 60.128  -41.149  52.620  1.00 113.92 ? 221  SER A O     1 
ATOM   2037  C  CB    . SER C 3  221  ? 63.302  -41.021  52.482  1.00 116.50 ? 221  SER A CB    1 
ATOM   2038  O  OG    . SER C 3  221  ? 63.340  -39.685  52.018  1.00 117.62 ? 221  SER A OG    1 
ATOM   2039  N  N     . LEU C 3  222  ? 60.742  -40.317  50.620  1.00 113.14 ? 222  LEU A N     1 
ATOM   2040  C  CA    . LEU C 3  222  ? 59.527  -39.548  50.417  1.00 112.65 ? 222  LEU A CA    1 
ATOM   2041  C  C     . LEU C 3  222  ? 58.767  -40.308  49.334  1.00 112.62 ? 222  LEU A C     1 
ATOM   2042  O  O     . LEU C 3  222  ? 59.354  -41.109  48.609  1.00 113.52 ? 222  LEU A O     1 
ATOM   2043  C  CB    . LEU C 3  222  ? 59.887  -38.139  49.949  1.00 112.48 ? 222  LEU A CB    1 
ATOM   2044  C  CG    . LEU C 3  222  ? 60.997  -37.494  50.788  1.00 111.48 ? 222  LEU A CG    1 
ATOM   2045  C  CD1   . LEU C 3  222  ? 61.377  -36.144  50.209  1.00 111.17 ? 222  LEU A CD1   1 
ATOM   2046  C  CD2   . LEU C 3  222  ? 60.533  -37.351  52.228  1.00 110.40 ? 222  LEU A CD2   1 
ATOM   2047  N  N     . GLY C 3  223  ? 57.467  -40.082  49.219  1.00 112.07 ? 223  GLY A N     1 
ATOM   2048  C  CA    . GLY C 3  223  ? 56.709  -40.808  48.215  1.00 111.17 ? 223  GLY A CA    1 
ATOM   2049  C  C     . GLY C 3  223  ? 57.103  -40.545  46.770  1.00 109.89 ? 223  GLY A C     1 
ATOM   2050  O  O     . GLY C 3  223  ? 56.283  -40.064  45.996  1.00 111.69 ? 223  GLY A O     1 
ATOM   2051  N  N     . PHE C 3  224  ? 58.339  -40.851  46.385  1.00 106.84 ? 224  PHE A N     1 
ATOM   2052  C  CA    . PHE C 3  224  ? 58.739  -40.614  45.004  1.00 103.82 ? 224  PHE A CA    1 
ATOM   2053  C  C     . PHE C 3  224  ? 59.375  -41.823  44.342  1.00 103.57 ? 224  PHE A C     1 
ATOM   2054  O  O     . PHE C 3  224  ? 60.069  -42.612  44.984  1.00 102.64 ? 224  PHE A O     1 
ATOM   2055  C  CB    . PHE C 3  224  ? 59.657  -39.395  44.914  1.00 100.67 ? 224  PHE A CB    1 
ATOM   2056  C  CG    . PHE C 3  224  ? 58.995  -38.122  45.347  1.00 98.42  ? 224  PHE A CG    1 
ATOM   2057  C  CD1   . PHE C 3  224  ? 58.912  -37.791  46.697  1.00 96.84  ? 224  PHE A CD1   1 
ATOM   2058  C  CD2   . PHE C 3  224  ? 58.405  -37.275  44.410  1.00 98.18  ? 224  PHE A CD2   1 
ATOM   2059  C  CE1   . PHE C 3  224  ? 58.248  -36.634  47.115  1.00 96.77  ? 224  PHE A CE1   1 
ATOM   2060  C  CE2   . PHE C 3  224  ? 57.736  -36.114  44.815  1.00 98.10  ? 224  PHE A CE2   1 
ATOM   2061  C  CZ    . PHE C 3  224  ? 57.659  -35.795  46.172  1.00 97.52  ? 224  PHE A CZ    1 
ATOM   2062  N  N     . ASN C 3  225  ? 59.120  -41.957  43.044  1.00 103.88 ? 225  ASN A N     1 
ATOM   2063  C  CA    . ASN C 3  225  ? 59.622  -43.082  42.275  1.00 104.82 ? 225  ASN A CA    1 
ATOM   2064  C  C     . ASN C 3  225  ? 60.781  -42.736  41.358  1.00 106.54 ? 225  ASN A C     1 
ATOM   2065  O  O     . ASN C 3  225  ? 61.209  -43.581  40.572  1.00 108.24 ? 225  ASN A O     1 
ATOM   2066  C  CB    . ASN C 3  225  ? 58.501  -43.686  41.431  1.00 102.66 ? 225  ASN A CB    1 
ATOM   2067  C  CG    . ASN C 3  225  ? 58.883  -45.023  40.838  1.00 100.73 ? 225  ASN A CG    1 
ATOM   2068  O  OD1   . ASN C 3  225  ? 58.866  -46.040  41.522  1.00 100.82 ? 225  ASN A OD1   1 
ATOM   2069  N  ND2   . ASN C 3  225  ? 59.252  -45.024  39.567  1.00 99.61  ? 225  ASN A ND2   1 
ATOM   2070  N  N     . GLU C 3  226  ? 61.282  -41.505  41.453  1.00 107.40 ? 226  GLU A N     1 
ATOM   2071  C  CA    . GLU C 3  226  ? 62.406  -41.043  40.628  1.00 107.38 ? 226  GLU A CA    1 
ATOM   2072  C  C     . GLU C 3  226  ? 62.070  -41.172  39.144  1.00 106.78 ? 226  GLU A C     1 
ATOM   2073  O  O     . GLU C 3  226  ? 62.315  -40.257  38.356  1.00 107.19 ? 226  GLU A O     1 
ATOM   2074  C  CB    . GLU C 3  226  ? 63.678  -41.862  40.924  1.00 107.48 ? 226  GLU A CB    1 
ATOM   2075  C  CG    . GLU C 3  226  ? 63.898  -43.039  39.961  1.00 106.46 ? 226  GLU A CG    1 
ATOM   2076  C  CD    . GLU C 3  226  ? 65.034  -43.957  40.357  1.00 106.58 ? 226  GLU A CD    1 
ATOM   2077  O  OE1   . GLU C 3  226  ? 64.947  -44.581  41.437  1.00 105.88 ? 226  GLU A OE1   1 
ATOM   2078  O  OE2   . GLU C 3  226  ? 66.010  -44.060  39.581  1.00 106.58 ? 226  GLU A OE2   1 
ATOM   2079  N  N     . VAL C 3  227  ? 61.513  -42.325  38.784  1.00 105.64 ? 227  VAL A N     1 
ATOM   2080  C  CA    . VAL C 3  227  ? 61.138  -42.651  37.420  1.00 104.48 ? 227  VAL A CA    1 
ATOM   2081  C  C     . VAL C 3  227  ? 59.854  -41.937  37.018  1.00 105.63 ? 227  VAL A C     1 
ATOM   2082  O  O     . VAL C 3  227  ? 59.826  -41.201  36.024  1.00 106.10 ? 227  VAL A O     1 
ATOM   2083  C  CB    . VAL C 3  227  ? 60.904  -44.166  37.261  1.00 102.32 ? 227  VAL A CB    1 
ATOM   2084  C  CG1   . VAL C 3  227  ? 60.901  -44.532  35.792  1.00 100.87 ? 227  VAL A CG1   1 
ATOM   2085  C  CG2   . VAL C 3  227  ? 61.956  -44.951  38.030  1.00 99.68  ? 227  VAL A CG2   1 
ATOM   2086  N  N     . PHE C 3  228  ? 58.795  -42.159  37.798  1.00 105.39 ? 228  PHE A N     1 
ATOM   2087  C  CA    . PHE C 3  228  ? 57.495  -41.556  37.518  1.00 103.76 ? 228  PHE A CA    1 
ATOM   2088  C  C     . PHE C 3  228  ? 57.205  -40.313  38.343  1.00 104.23 ? 228  PHE A C     1 
ATOM   2089  O  O     . PHE C 3  228  ? 56.212  -39.628  38.102  1.00 104.61 ? 228  PHE A O     1 
ATOM   2090  C  CB    . PHE C 3  228  ? 56.378  -42.578  37.738  1.00 99.66  ? 228  PHE A CB    1 
ATOM   2091  C  CG    . PHE C 3  228  ? 56.593  -43.869  37.010  1.00 94.84  ? 228  PHE A CG    1 
ATOM   2092  C  CD1   . PHE C 3  228  ? 57.049  -44.989  37.687  1.00 92.67  ? 228  PHE A CD1   1 
ATOM   2093  C  CD2   . PHE C 3  228  ? 56.371  -43.958  35.642  1.00 93.14  ? 228  PHE A CD2   1 
ATOM   2094  C  CE1   . PHE C 3  228  ? 57.282  -46.184  37.014  1.00 91.78  ? 228  PHE A CE1   1 
ATOM   2095  C  CE2   . PHE C 3  228  ? 56.602  -45.150  34.958  1.00 91.41  ? 228  PHE A CE2   1 
ATOM   2096  C  CZ    . PHE C 3  228  ? 57.059  -46.265  35.647  1.00 90.86  ? 228  PHE A CZ    1 
ATOM   2097  N  N     . SER C 3  229  ? 58.064  -40.015  39.312  1.00 104.49 ? 229  SER A N     1 
ATOM   2098  C  CA    . SER C 3  229  ? 57.846  -38.833  40.130  1.00 105.27 ? 229  SER A CA    1 
ATOM   2099  C  C     . SER C 3  229  ? 59.077  -38.337  40.867  1.00 104.66 ? 229  SER A C     1 
ATOM   2100  O  O     . SER C 3  229  ? 59.643  -39.028  41.713  1.00 103.88 ? 229  SER A O     1 
ATOM   2101  C  CB    . SER C 3  229  ? 56.733  -39.095  41.133  1.00 106.28 ? 229  SER A CB    1 
ATOM   2102  O  OG    . SER C 3  229  ? 57.096  -40.161  41.985  1.00 110.17 ? 229  SER A OG    1 
ATOM   2103  N  N     . ARG C 3  230  ? 59.473  -37.117  40.525  1.00 104.90 ? 230  ARG A N     1 
ATOM   2104  C  CA    . ARG C 3  230  ? 60.614  -36.446  41.124  1.00 104.93 ? 230  ARG A CA    1 
ATOM   2105  C  C     . ARG C 3  230  ? 60.108  -35.124  41.675  1.00 103.85 ? 230  ARG A C     1 
ATOM   2106  O  O     . ARG C 3  230  ? 59.393  -34.389  40.992  1.00 103.53 ? 230  ARG A O     1 
ATOM   2107  C  CB    . ARG C 3  230  ? 61.696  -36.185  40.074  1.00 107.69 ? 230  ARG A CB    1 
ATOM   2108  C  CG    . ARG C 3  230  ? 62.576  -37.391  39.759  1.00 110.80 ? 230  ARG A CG    1 
ATOM   2109  C  CD    . ARG C 3  230  ? 63.559  -37.106  38.621  1.00 112.03 ? 230  ARG A CD    1 
ATOM   2110  N  NE    . ARG C 3  230  ? 64.701  -38.018  38.664  1.00 113.50 ? 230  ARG A NE    1 
ATOM   2111  C  CZ    . ARG C 3  230  ? 65.791  -37.821  39.403  1.00 113.62 ? 230  ARG A CZ    1 
ATOM   2112  N  NH1   . ARG C 3  230  ? 65.905  -36.735  40.161  1.00 111.83 ? 230  ARG A NH1   1 
ATOM   2113  N  NH2   . ARG C 3  230  ? 66.762  -38.725  39.400  1.00 113.75 ? 230  ARG A NH2   1 
ATOM   2114  N  N     . PRO C 3  231  ? 60.468  -34.807  42.923  1.00 102.94 ? 231  PRO A N     1 
ATOM   2115  C  CA    . PRO C 3  231  ? 60.051  -33.567  43.579  1.00 103.14 ? 231  PRO A CA    1 
ATOM   2116  C  C     . PRO C 3  231  ? 60.166  -32.371  42.645  1.00 103.40 ? 231  PRO A C     1 
ATOM   2117  O  O     . PRO C 3  231  ? 59.258  -31.542  42.561  1.00 104.75 ? 231  PRO A O     1 
ATOM   2118  C  CB    . PRO C 3  231  ? 61.004  -33.474  44.761  1.00 102.79 ? 231  PRO A CB    1 
ATOM   2119  C  CG    . PRO C 3  231  ? 61.195  -34.907  45.126  1.00 103.66 ? 231  PRO A CG    1 
ATOM   2120  C  CD    . PRO C 3  231  ? 61.388  -35.570  43.781  1.00 102.62 ? 231  PRO A CD    1 
ATOM   2121  N  N     . GLU C 3  232  ? 61.289  -32.304  41.938  1.00 102.99 ? 232  GLU A N     1 
ATOM   2122  C  CA    . GLU C 3  232  ? 61.566  -31.224  40.994  1.00 102.00 ? 232  GLU A CA    1 
ATOM   2123  C  C     . GLU C 3  232  ? 60.417  -31.011  40.017  1.00 101.43 ? 232  GLU A C     1 
ATOM   2124  O  O     . GLU C 3  232  ? 60.273  -29.931  39.438  1.00 101.36 ? 232  GLU A O     1 
ATOM   2125  C  CB    . GLU C 3  232  ? 62.841  -31.546  40.215  1.00 101.90 ? 232  GLU A CB    1 
ATOM   2126  C  CG    . GLU C 3  232  ? 62.751  -32.824  39.394  1.00 101.85 ? 232  GLU A CG    1 
ATOM   2127  C  CD    . GLU C 3  232  ? 64.110  -33.452  39.131  1.00 102.38 ? 232  GLU A CD    1 
ATOM   2128  O  OE1   . GLU C 3  232  ? 64.758  -33.892  40.107  1.00 102.73 ? 232  GLU A OE1   1 
ATOM   2129  O  OE2   . GLU C 3  232  ? 64.531  -33.508  37.954  1.00 101.59 ? 232  GLU A OE2   1 
ATOM   2130  N  N     . TRP C 3  233  ? 59.603  -32.048  39.843  1.00 100.51 ? 233  TRP A N     1 
ATOM   2131  C  CA    . TRP C 3  233  ? 58.473  -31.987  38.932  1.00 98.10  ? 233  TRP A CA    1 
ATOM   2132  C  C     . TRP C 3  233  ? 57.233  -31.332  39.516  1.00 96.87  ? 233  TRP A C     1 
ATOM   2133  O  O     . TRP C 3  233  ? 56.474  -30.699  38.785  1.00 96.61  ? 233  TRP A O     1 
ATOM   2134  C  CB    . TRP C 3  233  ? 58.146  -33.386  38.420  1.00 96.98  ? 233  TRP A CB    1 
ATOM   2135  C  CG    . TRP C 3  233  ? 59.214  -33.923  37.515  1.00 94.64  ? 233  TRP A CG    1 
ATOM   2136  C  CD1   . TRP C 3  233  ? 60.081  -33.191  36.756  1.00 93.88  ? 233  TRP A CD1   1 
ATOM   2137  C  CD2   . TRP C 3  233  ? 59.494  -35.300  37.229  1.00 92.78  ? 233  TRP A CD2   1 
ATOM   2138  N  NE1   . TRP C 3  233  ? 60.881  -34.025  36.015  1.00 94.43  ? 233  TRP A NE1   1 
ATOM   2139  C  CE2   . TRP C 3  233  ? 60.543  -35.324  36.287  1.00 93.51  ? 233  TRP A CE2   1 
ATOM   2140  C  CE3   . TRP C 3  233  ? 58.958  -36.515  37.676  1.00 92.09  ? 233  TRP A CE3   1 
ATOM   2141  C  CZ2   . TRP C 3  233  ? 61.070  -36.521  35.781  1.00 94.14  ? 233  TRP A CZ2   1 
ATOM   2142  C  CZ3   . TRP C 3  233  ? 59.482  -37.705  37.171  1.00 92.37  ? 233  TRP A CZ3   1 
ATOM   2143  C  CH2   . TRP C 3  233  ? 60.528  -37.696  36.234  1.00 93.55  ? 233  TRP A CH2   1 
ATOM   2144  N  N     . MET C 3  234  ? 57.028  -31.472  40.824  1.00 95.50  ? 234  MET A N     1 
ATOM   2145  C  CA    . MET C 3  234  ? 55.874  -30.854  41.471  1.00 95.26  ? 234  MET A CA    1 
ATOM   2146  C  C     . MET C 3  234  ? 55.835  -29.387  41.063  1.00 95.62  ? 234  MET A C     1 
ATOM   2147  O  O     . MET C 3  234  ? 54.834  -28.688  41.252  1.00 94.60  ? 234  MET A O     1 
ATOM   2148  C  CB    . MET C 3  234  ? 55.988  -30.963  42.989  1.00 94.03  ? 234  MET A CB    1 
ATOM   2149  C  CG    . MET C 3  234  ? 56.074  -32.387  43.488  1.00 93.41  ? 234  MET A CG    1 
ATOM   2150  S  SD    . MET C 3  234  ? 55.808  -32.487  45.261  1.00 94.38  ? 234  MET A SD    1 
ATOM   2151  C  CE    . MET C 3  234  ? 57.466  -32.543  45.847  1.00 97.23  ? 234  MET A CE    1 
ATOM   2152  N  N     . ILE C 3  235  ? 56.952  -28.940  40.498  1.00 96.72  ? 235  ILE A N     1 
ATOM   2153  C  CA    . ILE C 3  235  ? 57.113  -27.577  40.026  1.00 98.65  ? 235  ILE A CA    1 
ATOM   2154  C  C     . ILE C 3  235  ? 56.874  -27.565  38.530  1.00 99.31  ? 235  ILE A C     1 
ATOM   2155  O  O     . ILE C 3  235  ? 57.355  -28.437  37.809  1.00 98.76  ? 235  ILE A O     1 
ATOM   2156  C  CB    . ILE C 3  235  ? 58.529  -27.064  40.311  1.00 99.17  ? 235  ILE A CB    1 
ATOM   2157  C  CG1   . ILE C 3  235  ? 58.793  -27.118  41.818  1.00 99.80  ? 235  ILE A CG1   1 
ATOM   2158  C  CG2   . ILE C 3  235  ? 58.688  -25.648  39.774  1.00 98.82  ? 235  ILE A CG2   1 
ATOM   2159  C  CD1   . ILE C 3  235  ? 60.199  -26.756  42.207  1.00 100.92 ? 235  ILE A CD1   1 
ATOM   2160  N  N     . LEU C 3  236  ? 56.134  -26.566  38.066  1.00 101.34 ? 236  LEU A N     1 
ATOM   2161  C  CA    . LEU C 3  236  ? 55.806  -26.459  36.652  1.00 103.22 ? 236  LEU A CA    1 
ATOM   2162  C  C     . LEU C 3  236  ? 56.795  -25.677  35.791  1.00 104.33 ? 236  LEU A C     1 
ATOM   2163  O  O     . LEU C 3  236  ? 56.865  -24.443  35.838  1.00 104.46 ? 236  LEU A O     1 
ATOM   2164  C  CB    . LEU C 3  236  ? 54.401  -25.873  36.492  1.00 102.64 ? 236  LEU A CB    1 
ATOM   2165  C  CG    . LEU C 3  236  ? 53.278  -26.766  37.022  1.00 101.11 ? 236  LEU A CG    1 
ATOM   2166  C  CD1   . LEU C 3  236  ? 51.960  -26.020  36.945  1.00 100.43 ? 236  LEU A CD1   1 
ATOM   2167  C  CD2   . LEU C 3  236  ? 53.224  -28.061  36.217  1.00 98.53  ? 236  LEU A CD2   1 
ATOM   2168  N  N     . THR C 3  237  ? 57.548  -26.427  34.994  1.00 104.77 ? 237  THR A N     1 
ATOM   2169  C  CA    . THR C 3  237  ? 58.536  -25.879  34.079  1.00 105.08 ? 237  THR A CA    1 
ATOM   2170  C  C     . THR C 3  237  ? 57.871  -25.758  32.716  1.00 104.77 ? 237  THR A C     1 
ATOM   2171  O  O     . THR C 3  237  ? 57.706  -24.665  32.166  1.00 104.15 ? 237  THR A O     1 
ATOM   2172  C  CB    . THR C 3  237  ? 59.724  -26.836  33.940  1.00 106.11 ? 237  THR A CB    1 
ATOM   2173  O  OG1   . THR C 3  237  ? 60.355  -26.997  35.215  1.00 107.59 ? 237  THR A OG1   1 
ATOM   2174  C  CG2   . THR C 3  237  ? 60.720  -26.309  32.920  1.00 106.94 ? 237  THR A CG2   1 
ATOM   2175  N  N     . CYS C 3  238  ? 57.490  -26.912  32.183  1.00 104.43 ? 238  CYS A N     1 
ATOM   2176  C  CA    . CYS C 3  238  ? 56.834  -26.992  30.893  1.00 103.61 ? 238  CYS A CA    1 
ATOM   2177  C  C     . CYS C 3  238  ? 55.373  -27.392  31.096  1.00 103.31 ? 238  CYS A C     1 
ATOM   2178  O  O     . CYS C 3  238  ? 55.079  -28.364  31.796  1.00 104.36 ? 238  CYS A O     1 
ATOM   2179  C  CB    . CYS C 3  238  ? 57.542  -28.027  30.025  1.00 102.69 ? 238  CYS A CB    1 
ATOM   2180  S  SG    . CYS C 3  238  ? 56.973  -28.037  28.329  1.00 102.68 ? 238  CYS A SG    1 
ATOM   2181  N  N     . LEU C 3  239  ? 54.462  -26.637  30.491  1.00 101.51 ? 239  LEU A N     1 
ATOM   2182  C  CA    . LEU C 3  239  ? 53.034  -26.914  30.611  1.00 98.64  ? 239  LEU A CA    1 
ATOM   2183  C  C     . LEU C 3  239  ? 52.529  -27.681  29.399  1.00 97.27  ? 239  LEU A C     1 
ATOM   2184  O  O     . LEU C 3  239  ? 52.813  -27.312  28.261  1.00 97.67  ? 239  LEU A O     1 
ATOM   2185  C  CB    . LEU C 3  239  ? 52.251  -25.603  30.733  1.00 98.76  ? 239  LEU A CB    1 
ATOM   2186  C  CG    . LEU C 3  239  ? 50.723  -25.680  30.686  1.00 97.08  ? 239  LEU A CG    1 
ATOM   2187  C  CD1   . LEU C 3  239  ? 50.214  -26.340  31.951  1.00 96.35  ? 239  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU C 3  239  ? 50.139  -24.277  30.543  1.00 97.11  ? 239  LEU A CD2   1 
ATOM   2189  N  N     . PRO C 3  240  ? 51.793  -28.778  29.629  1.00 95.96  ? 240  PRO A N     1 
ATOM   2190  C  CA    . PRO C 3  240  ? 51.248  -29.582  28.530  1.00 94.29  ? 240  PRO A CA    1 
ATOM   2191  C  C     . PRO C 3  240  ? 49.912  -28.964  28.116  1.00 92.49  ? 240  PRO A C     1 
ATOM   2192  O  O     . PRO C 3  240  ? 49.094  -28.615  28.973  1.00 91.34  ? 240  PRO A O     1 
ATOM   2193  C  CB    . PRO C 3  240  ? 51.099  -30.961  29.161  1.00 93.63  ? 240  PRO A CB    1 
ATOM   2194  C  CG    . PRO C 3  240  ? 50.706  -30.626  30.551  1.00 95.66  ? 240  PRO A CG    1 
ATOM   2195  C  CD    . PRO C 3  240  ? 51.627  -29.473  30.916  1.00 96.36  ? 240  PRO A CD    1 
ATOM   2196  N  N     . VAL C 3  241  ? 49.697  -28.815  26.810  1.00 90.41  ? 241  VAL A N     1 
ATOM   2197  C  CA    . VAL C 3  241  ? 48.465  -28.199  26.325  1.00 87.83  ? 241  VAL A CA    1 
ATOM   2198  C  C     . VAL C 3  241  ? 47.390  -29.179  25.867  1.00 86.79  ? 241  VAL A C     1 
ATOM   2199  O  O     . VAL C 3  241  ? 47.557  -29.892  24.874  1.00 84.94  ? 241  VAL A O     1 
ATOM   2200  C  CB    . VAL C 3  241  ? 48.745  -27.212  25.173  1.00 86.49  ? 241  VAL A CB    1 
ATOM   2201  C  CG1   . VAL C 3  241  ? 47.465  -26.490  24.791  1.00 84.87  ? 241  VAL A CG1   1 
ATOM   2202  C  CG2   . VAL C 3  241  ? 49.801  -26.211  25.595  1.00 85.54  ? 241  VAL A CG2   1 
ATOM   2203  N  N     . PRO C 3  242  ? 46.254  -29.205  26.589  1.00 85.69  ? 242  PRO A N     1 
ATOM   2204  C  CA    . PRO C 3  242  ? 45.127  -30.086  26.282  1.00 83.64  ? 242  PRO A CA    1 
ATOM   2205  C  C     . PRO C 3  242  ? 44.572  -29.771  24.903  1.00 83.48  ? 242  PRO A C     1 
ATOM   2206  O  O     . PRO C 3  242  ? 44.310  -28.614  24.575  1.00 84.79  ? 242  PRO A O     1 
ATOM   2207  C  CB    . PRO C 3  242  ? 44.138  -29.773  27.396  1.00 83.14  ? 242  PRO A CB    1 
ATOM   2208  C  CG    . PRO C 3  242  ? 44.402  -28.323  27.663  1.00 83.07  ? 242  PRO A CG    1 
ATOM   2209  C  CD    . PRO C 3  242  ? 45.904  -28.277  27.680  1.00 84.11  ? 242  PRO A CD    1 
ATOM   2210  N  N     . PRO C 3  243  ? 44.387  -30.804  24.077  1.00 82.07  ? 243  PRO A N     1 
ATOM   2211  C  CA    . PRO C 3  243  ? 43.866  -30.683  22.715  1.00 81.46  ? 243  PRO A CA    1 
ATOM   2212  C  C     . PRO C 3  243  ? 42.464  -30.096  22.641  1.00 83.30  ? 243  PRO A C     1 
ATOM   2213  O  O     . PRO C 3  243  ? 41.844  -29.810  23.665  1.00 83.69  ? 243  PRO A O     1 
ATOM   2214  C  CB    . PRO C 3  243  ? 43.916  -32.116  22.209  1.00 78.90  ? 243  PRO A CB    1 
ATOM   2215  C  CG    . PRO C 3  243  ? 43.668  -32.902  23.449  1.00 78.36  ? 243  PRO A CG    1 
ATOM   2216  C  CD    . PRO C 3  243  ? 44.558  -32.219  24.443  1.00 79.81  ? 243  PRO A CD    1 
ATOM   2217  N  N     . PRO C 3  244  ? 41.949  -29.896  21.416  1.00 85.71  ? 244  PRO A N     1 
ATOM   2218  C  CA    . PRO C 3  244  ? 40.604  -29.342  21.223  1.00 86.86  ? 244  PRO A CA    1 
ATOM   2219  C  C     . PRO C 3  244  ? 39.489  -30.143  21.907  1.00 87.61  ? 244  PRO A C     1 
ATOM   2220  O  O     . PRO C 3  244  ? 38.645  -29.569  22.597  1.00 87.27  ? 244  PRO A O     1 
ATOM   2221  C  CB    . PRO C 3  244  ? 40.462  -29.280  19.695  1.00 87.66  ? 244  PRO A CB    1 
ATOM   2222  C  CG    . PRO C 3  244  ? 41.541  -30.206  19.171  1.00 87.53  ? 244  PRO A CG    1 
ATOM   2223  C  CD    . PRO C 3  244  ? 42.664  -30.002  20.132  1.00 86.02  ? 244  PRO A CD    1 
ATOM   2224  N  N     . PRO C 3  245  ? 39.467  -31.477  21.723  1.00 88.28  ? 245  PRO A N     1 
ATOM   2225  C  CA    . PRO C 3  245  ? 38.426  -32.280  22.365  1.00 89.79  ? 245  PRO A CA    1 
ATOM   2226  C  C     . PRO C 3  245  ? 38.136  -31.814  23.790  1.00 91.28  ? 245  PRO A C     1 
ATOM   2227  O  O     . PRO C 3  245  ? 37.015  -31.417  24.103  1.00 92.58  ? 245  PRO A O     1 
ATOM   2228  C  CB    . PRO C 3  245  ? 39.019  -33.682  22.319  1.00 89.18  ? 245  PRO A CB    1 
ATOM   2229  C  CG    . PRO C 3  245  ? 39.683  -33.687  20.983  1.00 86.43  ? 245  PRO A CG    1 
ATOM   2230  C  CD    . PRO C 3  245  ? 40.377  -32.340  20.947  1.00 86.96  ? 245  PRO A CD    1 
ATOM   2231  N  N     . VAL C 3  246  ? 39.152  -31.855  24.645  1.00 91.68  ? 246  VAL A N     1 
ATOM   2232  C  CA    . VAL C 3  246  ? 38.999  -31.430  26.025  1.00 93.63  ? 246  VAL A CA    1 
ATOM   2233  C  C     . VAL C 3  246  ? 38.261  -30.106  26.122  1.00 96.19  ? 246  VAL A C     1 
ATOM   2234  O  O     . VAL C 3  246  ? 37.432  -29.914  27.007  1.00 96.21  ? 246  VAL A O     1 
ATOM   2235  C  CB    . VAL C 3  246  ? 40.358  -31.278  26.706  1.00 92.38  ? 246  VAL A CB    1 
ATOM   2236  C  CG1   . VAL C 3  246  ? 40.182  -30.685  28.089  1.00 92.11  ? 246  VAL A CG1   1 
ATOM   2237  C  CG2   . VAL C 3  246  ? 41.033  -32.630  26.798  1.00 93.65  ? 246  VAL A CG2   1 
ATOM   2238  N  N     . ARG C 3  247  ? 38.566  -29.191  25.211  1.00 99.87  ? 247  ARG A N     1 
ATOM   2239  C  CA    . ARG C 3  247  ? 37.916  -27.886  25.200  1.00 105.03 ? 247  ARG A CA    1 
ATOM   2240  C  C     . ARG C 3  247  ? 37.356  -27.581  23.817  1.00 107.67 ? 247  ARG A C     1 
ATOM   2241  O  O     . ARG C 3  247  ? 38.049  -27.030  22.964  1.00 107.78 ? 247  ARG A O     1 
ATOM   2242  C  CB    . ARG C 3  247  ? 38.907  -26.798  25.615  1.00 106.34 ? 247  ARG A CB    1 
ATOM   2243  C  CG    . ARG C 3  247  ? 40.345  -27.169  25.331  1.00 108.84 ? 247  ARG A CG    1 
ATOM   2244  C  CD    . ARG C 3  247  ? 41.112  -26.033  24.695  1.00 111.09 ? 247  ARG A CD    1 
ATOM   2245  N  NE    . ARG C 3  247  ? 42.439  -26.480  24.287  1.00 111.99 ? 247  ARG A NE    1 
ATOM   2246  C  CZ    . ARG C 3  247  ? 43.224  -25.817  23.448  1.00 113.59 ? 247  ARG A CZ    1 
ATOM   2247  N  NH1   . ARG C 3  247  ? 42.815  -24.670  22.923  1.00 115.97 ? 247  ARG A NH1   1 
ATOM   2248  N  NH2   . ARG C 3  247  ? 44.412  -26.305  23.128  1.00 114.66 ? 247  ARG A NH2   1 
ATOM   2249  N  N     . PRO C 3  248  ? 36.087  -27.949  23.578  1.00 110.58 ? 248  PRO A N     1 
ATOM   2250  C  CA    . PRO C 3  248  ? 35.388  -27.736  22.308  1.00 112.77 ? 248  PRO A CA    1 
ATOM   2251  C  C     . PRO C 3  248  ? 34.944  -26.290  22.085  1.00 114.27 ? 248  PRO A C     1 
ATOM   2252  O  O     . PRO C 3  248  ? 34.799  -25.510  23.032  1.00 114.60 ? 248  PRO A O     1 
ATOM   2253  C  CB    . PRO C 3  248  ? 34.207  -28.690  22.414  1.00 113.02 ? 248  PRO A CB    1 
ATOM   2254  C  CG    . PRO C 3  248  ? 33.865  -28.590  23.861  1.00 112.61 ? 248  PRO A CG    1 
ATOM   2255  C  CD    . PRO C 3  248  ? 35.229  -28.695  24.516  1.00 111.79 ? 248  PRO A CD    1 
ATOM   2256  N  N     . SER C 3  249  ? 34.720  -25.952  20.820  1.00 115.20 ? 249  SER A N     1 
ATOM   2257  C  CA    . SER C 3  249  ? 34.303  -24.614  20.434  1.00 116.01 ? 249  SER A CA    1 
ATOM   2258  C  C     . SER C 3  249  ? 32.810  -24.555  20.125  1.00 116.55 ? 249  SER A C     1 
ATOM   2259  O  O     . SER C 3  249  ? 32.359  -25.064  19.100  1.00 117.56 ? 249  SER A O     1 
ATOM   2260  C  CB    . SER C 3  249  ? 35.115  -24.170  19.218  1.00 116.12 ? 249  SER A CB    1 
ATOM   2261  O  OG    . SER C 3  249  ? 35.240  -25.234  18.289  1.00 114.14 ? 249  SER A OG    1 
ATOM   2262  N  N     . GLU C 3  259  ? 34.205  -19.721  22.754  1.00 118.06 ? 259  GLU A N     1 
ATOM   2263  C  CA    . GLU C 3  259  ? 34.911  -20.979  22.973  1.00 118.69 ? 259  GLU A CA    1 
ATOM   2264  C  C     . GLU C 3  259  ? 34.946  -21.330  24.464  1.00 118.21 ? 259  GLU A C     1 
ATOM   2265  O  O     . GLU C 3  259  ? 34.627  -20.492  25.308  1.00 118.93 ? 259  GLU A O     1 
ATOM   2266  C  CB    . GLU C 3  259  ? 36.321  -20.881  22.380  1.00 119.21 ? 259  GLU A CB    1 
ATOM   2267  C  CG    . GLU C 3  259  ? 36.289  -20.514  20.894  1.00 121.78 ? 259  GLU A CG    1 
ATOM   2268  C  CD    . GLU C 3  259  ? 37.639  -20.592  20.209  1.00 123.35 ? 259  GLU A CD    1 
ATOM   2269  O  OE1   . GLU C 3  259  ? 38.238  -21.691  20.190  1.00 123.56 ? 259  GLU A OE1   1 
ATOM   2270  O  OE2   . GLU C 3  259  ? 38.095  -19.554  19.679  1.00 123.74 ? 259  GLU A OE2   1 
ATOM   2271  N  N     . ASP C 3  260  ? 35.325  -22.564  24.785  1.00 117.20 ? 260  ASP A N     1 
ATOM   2272  C  CA    . ASP C 3  260  ? 35.351  -23.024  26.173  1.00 116.95 ? 260  ASP A CA    1 
ATOM   2273  C  C     . ASP C 3  260  ? 36.154  -22.156  27.140  1.00 116.05 ? 260  ASP A C     1 
ATOM   2274  O  O     . ASP C 3  260  ? 37.032  -21.400  26.731  1.00 116.90 ? 260  ASP A O     1 
ATOM   2275  C  CB    . ASP C 3  260  ? 35.867  -24.461  26.242  1.00 118.78 ? 260  ASP A CB    1 
ATOM   2276  C  CG    . ASP C 3  260  ? 35.559  -25.128  27.576  1.00 121.59 ? 260  ASP A CG    1 
ATOM   2277  O  OD1   . ASP C 3  260  ? 36.038  -24.640  28.624  1.00 123.29 ? 260  ASP A OD1   1 
ATOM   2278  O  OD2   . ASP C 3  260  ? 34.830  -26.143  27.576  1.00 122.37 ? 260  ASP A OD2   1 
ATOM   2279  N  N     . ASP C 3  261  ? 35.844  -22.285  28.429  1.00 114.75 ? 261  ASP A N     1 
ATOM   2280  C  CA    . ASP C 3  261  ? 36.516  -21.526  29.480  1.00 113.48 ? 261  ASP A CA    1 
ATOM   2281  C  C     . ASP C 3  261  ? 37.989  -21.884  29.666  1.00 111.64 ? 261  ASP A C     1 
ATOM   2282  O  O     . ASP C 3  261  ? 38.774  -21.058  30.126  1.00 111.64 ? 261  ASP A O     1 
ATOM   2283  C  CB    . ASP C 3  261  ? 35.777  -21.697  30.812  1.00 114.55 ? 261  ASP A CB    1 
ATOM   2284  C  CG    . ASP C 3  261  ? 34.432  -20.989  30.830  1.00 116.62 ? 261  ASP A CG    1 
ATOM   2285  O  OD1   . ASP C 3  261  ? 34.406  -19.744  30.707  1.00 118.82 ? 261  ASP A OD1   1 
ATOM   2286  O  OD2   . ASP C 3  261  ? 33.400  -21.679  30.966  1.00 116.66 ? 261  ASP A OD2   1 
ATOM   2287  N  N     . LEU C 3  262  ? 38.371  -23.109  29.320  1.00 109.80 ? 262  LEU A N     1 
ATOM   2288  C  CA    . LEU C 3  262  ? 39.767  -23.505  29.462  1.00 108.24 ? 262  LEU A CA    1 
ATOM   2289  C  C     . LEU C 3  262  ? 40.633  -22.647  28.566  1.00 108.06 ? 262  LEU A C     1 
ATOM   2290  O  O     . LEU C 3  262  ? 41.680  -22.155  28.974  1.00 108.76 ? 262  LEU A O     1 
ATOM   2291  C  CB    . LEU C 3  262  ? 39.965  -24.973  29.090  1.00 106.99 ? 262  LEU A CB    1 
ATOM   2292  C  CG    . LEU C 3  262  ? 39.639  -26.004  30.172  1.00 106.24 ? 262  LEU A CG    1 
ATOM   2293  C  CD1   . LEU C 3  262  ? 40.040  -27.383  29.690  1.00 104.66 ? 262  LEU A CD1   1 
ATOM   2294  C  CD2   . LEU C 3  262  ? 40.392  -25.669  31.446  1.00 105.99 ? 262  LEU A CD2   1 
ATOM   2295  N  N     . THR C 3  263  ? 40.183  -22.467  27.336  1.00 108.18 ? 263  THR A N     1 
ATOM   2296  C  CA    . THR C 3  263  ? 40.916  -21.669  26.375  1.00 108.87 ? 263  THR A CA    1 
ATOM   2297  C  C     . THR C 3  263  ? 41.188  -20.259  26.888  1.00 108.86 ? 263  THR A C     1 
ATOM   2298  O  O     . THR C 3  263  ? 42.333  -19.816  26.902  1.00 108.39 ? 263  THR A O     1 
ATOM   2299  C  CB    . THR C 3  263  ? 40.149  -21.588  25.060  1.00 109.77 ? 263  THR A CB    1 
ATOM   2300  O  OG1   . THR C 3  263  ? 39.827  -22.915  24.620  1.00 109.02 ? 263  THR A OG1   1 
ATOM   2301  C  CG2   . THR C 3  263  ? 40.989  -20.896  24.004  1.00 112.33 ? 263  THR A CG2   1 
ATOM   2302  N  N     . PHE C 3  264  ? 40.136  -19.558  27.305  1.00 109.87 ? 264  PHE A N     1 
ATOM   2303  C  CA    . PHE C 3  264  ? 40.276  -18.197  27.823  1.00 112.44 ? 264  PHE A CA    1 
ATOM   2304  C  C     . PHE C 3  264  ? 41.384  -18.084  28.859  1.00 112.65 ? 264  PHE A C     1 
ATOM   2305  O  O     . PHE C 3  264  ? 42.193  -17.151  28.826  1.00 113.48 ? 264  PHE A O     1 
ATOM   2306  C  CB    . PHE C 3  264  ? 38.967  -17.716  28.461  1.00 114.97 ? 264  PHE A CB    1 
ATOM   2307  C  CG    . PHE C 3  264  ? 37.962  -17.185  27.476  1.00 119.40 ? 264  PHE A CG    1 
ATOM   2308  C  CD1   . PHE C 3  264  ? 36.755  -16.653  27.925  1.00 120.53 ? 264  PHE A CD1   1 
ATOM   2309  C  CD2   . PHE C 3  264  ? 38.220  -17.209  26.102  1.00 120.98 ? 264  PHE A CD2   1 
ATOM   2310  C  CE1   . PHE C 3  264  ? 35.816  -16.150  27.023  1.00 121.77 ? 264  PHE A CE1   1 
ATOM   2311  C  CE2   . PHE C 3  264  ? 37.288  -16.709  25.190  1.00 121.42 ? 264  PHE A CE2   1 
ATOM   2312  C  CZ    . PHE C 3  264  ? 36.084  -16.178  25.652  1.00 122.03 ? 264  PHE A CZ    1 
ATOM   2313  N  N     . LYS C 3  265  ? 41.410  -19.032  29.788  1.00 112.23 ? 265  LYS A N     1 
ATOM   2314  C  CA    . LYS C 3  265  ? 42.416  -19.034  30.837  1.00 111.36 ? 265  LYS A CA    1 
ATOM   2315  C  C     . LYS C 3  265  ? 43.746  -19.541  30.299  1.00 111.15 ? 265  LYS A C     1 
ATOM   2316  O  O     . LYS C 3  265  ? 44.774  -19.413  30.955  1.00 111.62 ? 265  LYS A O     1 
ATOM   2317  C  CB    . LYS C 3  265  ? 41.919  -19.866  32.022  1.00 110.53 ? 265  LYS A CB    1 
ATOM   2318  C  CG    . LYS C 3  265  ? 40.700  -19.222  32.684  1.00 110.16 ? 265  LYS A CG    1 
ATOM   2319  C  CD    . LYS C 3  265  ? 39.839  -20.193  33.489  1.00 109.91 ? 265  LYS A CD    1 
ATOM   2320  C  CE    . LYS C 3  265  ? 38.514  -19.525  33.898  1.00 108.52 ? 265  LYS A CE    1 
ATOM   2321  N  NZ    . LYS C 3  265  ? 37.579  -20.390  34.688  1.00 104.15 ? 265  LYS A NZ    1 
ATOM   2322  N  N     . LEU C 3  266  ? 43.723  -20.113  29.098  1.00 110.95 ? 266  LEU A N     1 
ATOM   2323  C  CA    . LEU C 3  266  ? 44.950  -20.578  28.462  1.00 111.20 ? 266  LEU A CA    1 
ATOM   2324  C  C     . LEU C 3  266  ? 45.517  -19.387  27.722  1.00 111.72 ? 266  LEU A C     1 
ATOM   2325  O  O     . LEU C 3  266  ? 46.713  -19.317  27.447  1.00 112.55 ? 266  LEU A O     1 
ATOM   2326  C  CB    . LEU C 3  266  ? 44.680  -21.707  27.474  1.00 110.40 ? 266  LEU A CB    1 
ATOM   2327  C  CG    . LEU C 3  266  ? 44.816  -23.100  28.082  1.00 109.94 ? 266  LEU A CG    1 
ATOM   2328  C  CD1   . LEU C 3  266  ? 44.652  -24.149  27.000  1.00 110.68 ? 266  LEU A CD1   1 
ATOM   2329  C  CD2   . LEU C 3  266  ? 46.179  -23.230  28.741  1.00 108.83 ? 266  LEU A CD2   1 
ATOM   2330  N  N     . ALA C 3  267  ? 44.630  -18.453  27.394  1.00 111.83 ? 267  ALA A N     1 
ATOM   2331  C  CA    . ALA C 3  267  ? 45.016  -17.227  26.718  1.00 111.68 ? 267  ALA A CA    1 
ATOM   2332  C  C     . ALA C 3  267  ? 45.616  -16.333  27.801  1.00 111.61 ? 267  ALA A C     1 
ATOM   2333  O  O     . ALA C 3  267  ? 46.620  -15.654  27.581  1.00 112.13 ? 267  ALA A O     1 
ATOM   2334  C  CB    . ALA C 3  267  ? 43.793  -16.561  26.096  1.00 111.81 ? 267  ALA A CB    1 
ATOM   2335  N  N     . ASP C 3  268  ? 44.995  -16.350  28.978  1.00 110.42 ? 268  ASP A N     1 
ATOM   2336  C  CA    . ASP C 3  268  ? 45.473  -15.555  30.097  1.00 110.00 ? 268  ASP A CA    1 
ATOM   2337  C  C     . ASP C 3  268  ? 46.826  -16.063  30.576  1.00 108.85 ? 268  ASP A C     1 
ATOM   2338  O  O     . ASP C 3  268  ? 47.581  -15.327  31.209  1.00 109.49 ? 268  ASP A O     1 
ATOM   2339  C  CB    . ASP C 3  268  ? 44.461  -15.591  31.240  1.00 112.30 ? 268  ASP A CB    1 
ATOM   2340  C  CG    . ASP C 3  268  ? 43.273  -14.677  30.996  1.00 114.82 ? 268  ASP A CG    1 
ATOM   2341  O  OD1   . ASP C 3  268  ? 43.478  -13.448  30.865  1.00 115.13 ? 268  ASP A OD1   1 
ATOM   2342  O  OD2   . ASP C 3  268  ? 42.134  -15.186  30.938  1.00 116.83 ? 268  ASP A OD2   1 
ATOM   2343  N  N     . ILE C 3  269  ? 47.125  -17.324  30.270  1.00 107.27 ? 269  ILE A N     1 
ATOM   2344  C  CA    . ILE C 3  269  ? 48.398  -17.937  30.647  1.00 106.01 ? 269  ILE A CA    1 
ATOM   2345  C  C     . ILE C 3  269  ? 49.483  -17.566  29.641  1.00 106.57 ? 269  ILE A C     1 
ATOM   2346  O  O     . ILE C 3  269  ? 50.649  -17.392  29.994  1.00 106.84 ? 269  ILE A O     1 
ATOM   2347  C  CB    . ILE C 3  269  ? 48.286  -19.480  30.712  1.00 103.91 ? 269  ILE A CB    1 
ATOM   2348  C  CG1   . ILE C 3  269  ? 48.047  -19.913  32.158  1.00 102.27 ? 269  ILE A CG1   1 
ATOM   2349  C  CG2   . ILE C 3  269  ? 49.542  -20.137  30.146  1.00 102.87 ? 269  ILE A CG2   1 
ATOM   2350  C  CD1   . ILE C 3  269  ? 48.099  -21.408  32.366  1.00 100.82 ? 269  ILE A CD1   1 
ATOM   2351  N  N     . LEU C 3  270  ? 49.087  -17.452  28.381  1.00 106.84 ? 270  LEU A N     1 
ATOM   2352  C  CA    . LEU C 3  270  ? 50.018  -17.099  27.327  1.00 107.03 ? 270  LEU A CA    1 
ATOM   2353  C  C     . LEU C 3  270  ? 50.388  -15.621  27.440  1.00 107.20 ? 270  LEU A C     1 
ATOM   2354  O  O     . LEU C 3  270  ? 51.558  -15.267  27.332  1.00 108.25 ? 270  LEU A O     1 
ATOM   2355  C  CB    . LEU C 3  270  ? 49.384  -17.389  25.968  1.00 108.09 ? 270  LEU A CB    1 
ATOM   2356  C  CG    . LEU C 3  270  ? 50.311  -17.917  24.871  1.00 110.12 ? 270  LEU A CG    1 
ATOM   2357  C  CD1   . LEU C 3  270  ? 51.046  -19.159  25.359  1.00 109.00 ? 270  LEU A CD1   1 
ATOM   2358  C  CD2   . LEU C 3  270  ? 49.489  -18.243  23.634  1.00 111.67 ? 270  LEU A CD2   1 
ATOM   2359  N  N     . LYS C 3  271  ? 49.391  -14.765  27.665  1.00 107.15 ? 271  LYS A N     1 
ATOM   2360  C  CA    . LYS C 3  271  ? 49.620  -13.323  27.804  1.00 107.11 ? 271  LYS A CA    1 
ATOM   2361  C  C     . LYS C 3  271  ? 50.516  -13.026  29.004  1.00 106.13 ? 271  LYS A C     1 
ATOM   2362  O  O     . LYS C 3  271  ? 51.393  -12.165  28.944  1.00 105.55 ? 271  LYS A O     1 
ATOM   2363  C  CB    . LYS C 3  271  ? 48.293  -12.575  27.989  1.00 108.79 ? 271  LYS A CB    1 
ATOM   2364  C  CG    . LYS C 3  271  ? 47.334  -12.619  26.802  1.00 110.23 ? 271  LYS A CG    1 
ATOM   2365  C  CD    . LYS C 3  271  ? 46.060  -11.819  27.104  1.00 110.47 ? 271  LYS A CD    1 
ATOM   2366  C  CE    . LYS C 3  271  ? 45.037  -11.908  25.971  1.00 110.69 ? 271  LYS A CE    1 
ATOM   2367  N  NZ    . LYS C 3  271  ? 43.778  -11.157  26.269  1.00 108.00 ? 271  LYS A NZ    1 
ATOM   2368  N  N     . ALA C 3  272  ? 50.271  -13.730  30.102  1.00 105.29 ? 272  ALA A N     1 
ATOM   2369  C  CA    . ALA C 3  272  ? 51.058  -13.547  31.309  1.00 105.19 ? 272  ALA A CA    1 
ATOM   2370  C  C     . ALA C 3  272  ? 52.448  -14.103  31.048  1.00 105.51 ? 272  ALA A C     1 
ATOM   2371  O  O     . ALA C 3  272  ? 53.435  -13.625  31.603  1.00 106.01 ? 272  ALA A O     1 
ATOM   2372  C  CB    . ALA C 3  272  ? 50.407  -14.277  32.477  1.00 105.10 ? 272  ALA A CB    1 
ATOM   2373  N  N     . ASN C 3  273  ? 52.513  -15.119  30.193  1.00 105.87 ? 273  ASN A N     1 
ATOM   2374  C  CA    . ASN C 3  273  ? 53.775  -15.758  29.837  1.00 107.12 ? 273  ASN A CA    1 
ATOM   2375  C  C     . ASN C 3  273  ? 54.583  -14.877  28.895  1.00 109.35 ? 273  ASN A C     1 
ATOM   2376  O  O     . ASN C 3  273  ? 55.808  -14.814  28.984  1.00 110.74 ? 273  ASN A O     1 
ATOM   2377  C  CB    . ASN C 3  273  ? 53.515  -17.097  29.149  1.00 105.11 ? 273  ASN A CB    1 
ATOM   2378  C  CG    . ASN C 3  273  ? 54.792  -17.756  28.663  1.00 103.14 ? 273  ASN A CG    1 
ATOM   2379  O  OD1   . ASN C 3  273  ? 55.563  -18.291  29.457  1.00 101.09 ? 273  ASN A OD1   1 
ATOM   2380  N  ND2   . ASN C 3  273  ? 55.027  -17.707  27.353  1.00 101.17 ? 273  ASN A ND2   1 
ATOM   2381  N  N     . ILE C 3  274  ? 53.884  -14.208  27.983  1.00 111.33 ? 274  ILE A N     1 
ATOM   2382  C  CA    . ILE C 3  274  ? 54.511  -13.328  27.000  1.00 112.28 ? 274  ILE A CA    1 
ATOM   2383  C  C     . ILE C 3  274  ? 55.069  -12.037  27.607  1.00 112.82 ? 274  ILE A C     1 
ATOM   2384  O  O     . ILE C 3  274  ? 56.273  -11.780  27.523  1.00 112.10 ? 274  ILE A O     1 
ATOM   2385  C  CB    . ILE C 3  274  ? 53.505  -12.971  25.877  1.00 112.29 ? 274  ILE A CB    1 
ATOM   2386  C  CG1   . ILE C 3  274  ? 53.220  -14.216  25.032  1.00 111.72 ? 274  ILE A CG1   1 
ATOM   2387  C  CG2   . ILE C 3  274  ? 54.047  -11.837  25.016  1.00 112.34 ? 274  ILE A CG2   1 
ATOM   2388  C  CD1   . ILE C 3  274  ? 52.191  -13.996  23.947  1.00 112.28 ? 274  ILE A CD1   1 
ATOM   2389  N  N     . SER C 3  275  ? 54.199  -11.234  28.216  1.00 113.55 ? 275  SER A N     1 
ATOM   2390  C  CA    . SER C 3  275  ? 54.625  -9.976   28.819  1.00 114.71 ? 275  SER A CA    1 
ATOM   2391  C  C     . SER C 3  275  ? 55.785  -10.182  29.788  1.00 116.52 ? 275  SER A C     1 
ATOM   2392  O  O     . SER C 3  275  ? 56.470  -9.224   30.146  1.00 118.04 ? 275  SER A O     1 
ATOM   2393  C  CB    . SER C 3  275  ? 53.457  -9.295   29.545  1.00 112.86 ? 275  SER A CB    1 
ATOM   2394  O  OG    . SER C 3  275  ? 53.064  -10.020  30.694  1.00 111.99 ? 275  SER A OG    1 
ATOM   2395  N  N     . LEU C 3  276  ? 56.009  -11.427  30.208  1.00 117.94 ? 276  LEU A N     1 
ATOM   2396  C  CA    . LEU C 3  276  ? 57.104  -11.729  31.128  1.00 119.43 ? 276  LEU A CA    1 
ATOM   2397  C  C     . LEU C 3  276  ? 58.413  -11.902  30.363  1.00 120.87 ? 276  LEU A C     1 
ATOM   2398  O  O     . LEU C 3  276  ? 59.460  -11.425  30.804  1.00 121.22 ? 276  LEU A O     1 
ATOM   2399  C  CB    . LEU C 3  276  ? 56.806  -12.994  31.942  1.00 118.99 ? 276  LEU A CB    1 
ATOM   2400  C  CG    . LEU C 3  276  ? 57.836  -13.356  33.024  1.00 119.78 ? 276  LEU A CG    1 
ATOM   2401  C  CD1   . LEU C 3  276  ? 58.037  -12.179  33.977  1.00 119.44 ? 276  LEU A CD1   1 
ATOM   2402  C  CD2   . LEU C 3  276  ? 57.367  -14.585  33.793  1.00 119.94 ? 276  LEU A CD2   1 
ATOM   2403  N  N     . GLU C 3  277  ? 58.354  -12.586  29.220  1.00 122.65 ? 277  GLU A N     1 
ATOM   2404  C  CA    . GLU C 3  277  ? 59.544  -12.788  28.394  1.00 124.40 ? 277  GLU A CA    1 
ATOM   2405  C  C     . GLU C 3  277  ? 59.984  -11.432  27.849  1.00 124.93 ? 277  GLU A C     1 
ATOM   2406  O  O     . GLU C 3  277  ? 61.175  -11.176  27.666  1.00 124.64 ? 277  GLU A O     1 
ATOM   2407  C  CB    . GLU C 3  277  ? 59.249  -13.750  27.234  1.00 125.21 ? 277  GLU A CB    1 
ATOM   2408  C  CG    . GLU C 3  277  ? 59.122  -15.213  27.653  1.00 126.58 ? 277  GLU A CG    1 
ATOM   2409  C  CD    . GLU C 3  277  ? 58.970  -16.161  26.471  1.00 127.24 ? 277  GLU A CD    1 
ATOM   2410  O  OE1   . GLU C 3  277  ? 59.871  -16.191  25.604  1.00 127.27 ? 277  GLU A OE1   1 
ATOM   2411  O  OE2   . GLU C 3  277  ? 57.950  -16.882  26.411  1.00 127.45 ? 277  GLU A OE2   1 
ATOM   2412  N  N     . THR C 3  278  ? 59.002  -10.569  27.602  1.00 125.42 ? 278  THR A N     1 
ATOM   2413  C  CA    . THR C 3  278  ? 59.247  -9.223   27.104  1.00 125.93 ? 278  THR A CA    1 
ATOM   2414  C  C     . THR C 3  278  ? 60.140  -8.450   28.063  1.00 127.07 ? 278  THR A C     1 
ATOM   2415  O  O     . THR C 3  278  ? 61.270  -8.101   27.728  1.00 127.89 ? 278  THR A O     1 
ATOM   2416  C  CB    . THR C 3  278  ? 57.923  -8.445   26.940  1.00 125.36 ? 278  THR A CB    1 
ATOM   2417  O  OG1   . THR C 3  278  ? 57.274  -8.860   25.734  1.00 125.75 ? 278  THR A OG1   1 
ATOM   2418  C  CG2   . THR C 3  278  ? 58.172  -6.940   26.903  1.00 124.74 ? 278  THR A CG2   1 
ATOM   2419  N  N     . LEU C 3  279  ? 59.626  -8.190   29.258  1.00 128.22 ? 279  LEU A N     1 
ATOM   2420  C  CA    . LEU C 3  279  ? 60.365  -7.441   30.264  1.00 130.37 ? 279  LEU A CA    1 
ATOM   2421  C  C     . LEU C 3  279  ? 61.793  -7.943   30.530  1.00 132.65 ? 279  LEU A C     1 
ATOM   2422  O  O     . LEU C 3  279  ? 62.697  -7.137   30.760  1.00 133.48 ? 279  LEU A O     1 
ATOM   2423  C  CB    . LEU C 3  279  ? 59.572  -7.409   31.578  1.00 128.14 ? 279  LEU A CB    1 
ATOM   2424  C  CG    . LEU C 3  279  ? 58.145  -6.847   31.526  1.00 126.28 ? 279  LEU A CG    1 
ATOM   2425  C  CD1   . LEU C 3  279  ? 57.605  -6.713   32.945  1.00 124.62 ? 279  LEU A CD1   1 
ATOM   2426  C  CD2   . LEU C 3  279  ? 58.134  -5.493   30.828  1.00 125.75 ? 279  LEU A CD2   1 
ATOM   2427  N  N     . GLU C 3  280  ? 62.003  -9.259   30.488  1.00 134.52 ? 280  GLU A N     1 
ATOM   2428  C  CA    . GLU C 3  280  ? 63.328  -9.830   30.753  1.00 136.50 ? 280  GLU A CA    1 
ATOM   2429  C  C     . GLU C 3  280  ? 64.347  -9.689   29.623  1.00 138.00 ? 280  GLU A C     1 
ATOM   2430  O  O     . GLU C 3  280  ? 65.543  -9.911   29.831  1.00 137.56 ? 280  GLU A O     1 
ATOM   2431  C  CB    . GLU C 3  280  ? 63.206  -11.308  31.121  1.00 136.62 ? 280  GLU A CB    1 
ATOM   2432  C  CG    . GLU C 3  280  ? 62.382  -11.576  32.364  1.00 136.75 ? 280  GLU A CG    1 
ATOM   2433  C  CD    . GLU C 3  280  ? 62.440  -13.030  32.781  1.00 136.99 ? 280  GLU A CD    1 
ATOM   2434  O  OE1   . GLU C 3  280  ? 62.234  -13.906  31.912  1.00 136.30 ? 280  GLU A OE1   1 
ATOM   2435  O  OE2   . GLU C 3  280  ? 62.688  -13.296  33.977  1.00 137.20 ? 280  GLU A OE2   1 
ATOM   2436  N  N     . HIS C 3  281  ? 63.878  -9.332   28.431  1.00 140.24 ? 281  HIS A N     1 
ATOM   2437  C  CA    . HIS C 3  281  ? 64.769  -9.159   27.285  1.00 142.82 ? 281  HIS A CA    1 
ATOM   2438  C  C     . HIS C 3  281  ? 65.012  -7.689   26.950  1.00 143.46 ? 281  HIS A C     1 
ATOM   2439  O  O     . HIS C 3  281  ? 66.149  -7.288   26.687  1.00 143.84 ? 281  HIS A O     1 
ATOM   2440  C  CB    . HIS C 3  281  ? 64.211  -9.891   26.060  1.00 144.11 ? 281  HIS A CB    1 
ATOM   2441  C  CG    . HIS C 3  281  ? 64.382  -11.376  26.126  1.00 147.02 ? 281  HIS A CG    1 
ATOM   2442  N  ND1   . HIS C 3  281  ? 65.621  -11.982  26.112  1.00 147.72 ? 281  HIS A ND1   1 
ATOM   2443  C  CD2   . HIS C 3  281  ? 63.475  -12.375  26.238  1.00 148.31 ? 281  HIS A CD2   1 
ATOM   2444  C  CE1   . HIS C 3  281  ? 65.469  -13.291  26.215  1.00 148.42 ? 281  HIS A CE1   1 
ATOM   2445  N  NE2   . HIS C 3  281  ? 64.177  -13.556  26.293  1.00 149.15 ? 281  HIS A NE2   1 
ATOM   2446  N  N     . ASN C 3  282  ? 63.948  -6.888   26.966  1.00 143.70 ? 282  ASN A N     1 
ATOM   2447  C  CA    . ASN C 3  282  ? 64.058  -5.462   26.670  1.00 143.59 ? 282  ASN A CA    1 
ATOM   2448  C  C     . ASN C 3  282  ? 64.486  -4.652   27.896  1.00 144.14 ? 282  ASN A C     1 
ATOM   2449  O  O     . ASN C 3  282  ? 65.679  -4.547   28.190  1.00 144.43 ? 282  ASN A O     1 
ATOM   2450  C  CB    . ASN C 3  282  ? 62.729  -4.932   26.125  1.00 142.03 ? 282  ASN A CB    1 
ATOM   2451  C  CG    . ASN C 3  282  ? 62.381  -5.524   24.774  1.00 140.84 ? 282  ASN A CG    1 
ATOM   2452  O  OD1   . ASN C 3  282  ? 63.116  -5.356   23.801  1.00 140.15 ? 282  ASN A OD1   1 
ATOM   2453  N  ND2   . ASN C 3  282  ? 61.258  -6.223   24.708  1.00 140.74 ? 282  ASN A ND2   1 
ATOM   2454  N  N     . GLY C 3  283  ? 63.516  -4.082   28.607  1.00 144.26 ? 283  GLY A N     1 
ATOM   2455  C  CA    . GLY C 3  283  ? 63.836  -3.291   29.784  1.00 144.81 ? 283  GLY A CA    1 
ATOM   2456  C  C     . GLY C 3  283  ? 63.471  -3.977   31.087  1.00 145.17 ? 283  GLY A C     1 
ATOM   2457  O  O     . GLY C 3  283  ? 62.290  -4.122   31.405  1.00 145.21 ? 283  GLY A O     1 
ATOM   2458  N  N     . ALA C 3  284  ? 64.483  -4.387   31.849  1.00 145.43 ? 284  ALA A N     1 
ATOM   2459  C  CA    . ALA C 3  284  ? 64.268  -5.073   33.123  1.00 145.93 ? 284  ALA A CA    1 
ATOM   2460  C  C     . ALA C 3  284  ? 64.325  -4.136   34.336  1.00 146.09 ? 284  ALA A C     1 
ATOM   2461  O  O     . ALA C 3  284  ? 65.406  -3.713   34.754  1.00 146.52 ? 284  ALA A O     1 
ATOM   2462  C  CB    . ALA C 3  284  ? 65.298  -6.192   33.283  1.00 145.92 ? 284  ALA A CB    1 
ATOM   2463  N  N     . PRO C 3  285  ? 63.155  -3.808   34.920  1.00 145.92 ? 285  PRO A N     1 
ATOM   2464  C  CA    . PRO C 3  285  ? 63.063  -2.922   36.087  1.00 145.87 ? 285  PRO A CA    1 
ATOM   2465  C  C     . PRO C 3  285  ? 63.344  -3.606   37.428  1.00 145.97 ? 285  PRO A C     1 
ATOM   2466  O  O     . PRO C 3  285  ? 62.872  -3.150   38.473  1.00 145.86 ? 285  PRO A O     1 
ATOM   2467  C  CB    . PRO C 3  285  ? 61.637  -2.394   35.998  1.00 145.04 ? 285  PRO A CB    1 
ATOM   2468  C  CG    . PRO C 3  285  ? 60.900  -3.580   35.483  1.00 145.23 ? 285  PRO A CG    1 
ATOM   2469  C  CD    . PRO C 3  285  ? 61.811  -4.093   34.382  1.00 145.41 ? 285  PRO A CD    1 
ATOM   2470  N  N     . HIS C 3  286  ? 64.111  -4.695   37.388  1.00 145.99 ? 286  HIS A N     1 
ATOM   2471  C  CA    . HIS C 3  286  ? 64.476  -5.447   38.589  1.00 145.91 ? 286  HIS A CA    1 
ATOM   2472  C  C     . HIS C 3  286  ? 63.283  -6.048   39.337  1.00 145.47 ? 286  HIS A C     1 
ATOM   2473  O  O     . HIS C 3  286  ? 62.616  -6.958   38.841  1.00 144.97 ? 286  HIS A O     1 
ATOM   2474  C  CB    . HIS C 3  286  ? 65.280  -4.557   39.552  1.00 146.74 ? 286  HIS A CB    1 
ATOM   2475  C  CG    . HIS C 3  286  ? 66.686  -4.288   39.108  1.00 147.68 ? 286  HIS A CG    1 
ATOM   2476  N  ND1   . HIS C 3  286  ? 67.632  -5.283   38.988  1.00 148.24 ? 286  HIS A ND1   1 
ATOM   2477  C  CD2   . HIS C 3  286  ? 67.309  -3.134   38.768  1.00 147.70 ? 286  HIS A CD2   1 
ATOM   2478  C  CE1   . HIS C 3  286  ? 68.778  -4.754   38.595  1.00 148.10 ? 286  HIS A CE1   1 
ATOM   2479  N  NE2   . HIS C 3  286  ? 68.608  -3.452   38.454  1.00 148.12 ? 286  HIS A NE2   1 
ATOM   2480  N  N     . HIS C 3  287  ? 63.032  -5.525   40.536  1.00 145.18 ? 287  HIS A N     1 
ATOM   2481  C  CA    . HIS C 3  287  ? 61.946  -5.992   41.396  1.00 144.15 ? 287  HIS A CA    1 
ATOM   2482  C  C     . HIS C 3  287  ? 60.596  -5.360   41.077  1.00 142.12 ? 287  HIS A C     1 
ATOM   2483  O  O     . HIS C 3  287  ? 59.820  -5.043   41.978  1.00 141.80 ? 287  HIS A O     1 
ATOM   2484  C  CB    . HIS C 3  287  ? 62.291  -5.728   42.867  1.00 146.88 ? 287  HIS A CB    1 
ATOM   2485  C  CG    . HIS C 3  287  ? 63.525  -6.437   43.340  1.00 149.87 ? 287  HIS A CG    1 
ATOM   2486  N  ND1   . HIS C 3  287  ? 63.663  -7.808   43.293  1.00 150.89 ? 287  HIS A ND1   1 
ATOM   2487  C  CD2   . HIS C 3  287  ? 64.672  -5.962   43.884  1.00 150.99 ? 287  HIS A CD2   1 
ATOM   2488  C  CE1   . HIS C 3  287  ? 64.840  -8.148   43.789  1.00 151.38 ? 287  HIS A CE1   1 
ATOM   2489  N  NE2   . HIS C 3  287  ? 65.472  -7.047   44.155  1.00 151.64 ? 287  HIS A NE2   1 
ATOM   2490  N  N     . ALA C 3  288  ? 60.326  -5.166   39.794  1.00 140.25 ? 288  ALA A N     1 
ATOM   2491  C  CA    . ALA C 3  288  ? 59.060  -4.598   39.353  1.00 138.62 ? 288  ALA A CA    1 
ATOM   2492  C  C     . ALA C 3  288  ? 58.516  -5.576   38.322  1.00 137.54 ? 288  ALA A C     1 
ATOM   2493  O  O     . ALA C 3  288  ? 57.466  -5.355   37.715  1.00 136.99 ? 288  ALA A O     1 
ATOM   2494  C  CB    . ALA C 3  288  ? 59.280  -3.221   38.730  1.00 138.29 ? 288  ALA A CB    1 
ATOM   2495  N  N     . ILE C 3  289  ? 59.259  -6.667   38.144  1.00 136.51 ? 289  ILE A N     1 
ATOM   2496  C  CA    . ILE C 3  289  ? 58.914  -7.728   37.204  1.00 136.21 ? 289  ILE A CA    1 
ATOM   2497  C  C     . ILE C 3  289  ? 58.173  -8.845   37.927  1.00 135.69 ? 289  ILE A C     1 
ATOM   2498  O  O     . ILE C 3  289  ? 57.311  -9.511   37.352  1.00 135.40 ? 289  ILE A O     1 
ATOM   2499  C  CB    . ILE C 3  289  ? 60.181  -8.335   36.564  1.00 136.71 ? 289  ILE A CB    1 
ATOM   2500  C  CG1   . ILE C 3  289  ? 60.911  -7.272   35.744  1.00 137.45 ? 289  ILE A CG1   1 
ATOM   2501  C  CG2   . ILE C 3  289  ? 59.811  -9.534   35.694  1.00 136.17 ? 289  ILE A CG2   1 
ATOM   2502  C  CD1   . ILE C 3  289  ? 62.196  -7.768   35.116  1.00 138.90 ? 289  ILE A CD1   1 
ATOM   2503  N  N     . GLU C 3  290  ? 58.527  -9.049   39.191  1.00 135.32 ? 290  GLU A N     1 
ATOM   2504  C  CA    . GLU C 3  290  ? 57.909  -10.080  40.017  1.00 135.25 ? 290  GLU A CA    1 
ATOM   2505  C  C     . GLU C 3  290  ? 56.396  -9.874   40.150  1.00 134.75 ? 290  GLU A C     1 
ATOM   2506  O  O     . GLU C 3  290  ? 55.702  -10.690  40.760  1.00 134.92 ? 290  GLU A O     1 
ATOM   2507  C  CB    . GLU C 3  290  ? 58.564  -10.080  41.401  1.00 135.94 ? 290  GLU A CB    1 
ATOM   2508  C  CG    . GLU C 3  290  ? 58.709  -8.682   41.990  1.00 138.15 ? 290  GLU A CG    1 
ATOM   2509  C  CD    . GLU C 3  290  ? 59.313  -8.675   43.381  1.00 138.96 ? 290  GLU A CD    1 
ATOM   2510  O  OE1   . GLU C 3  290  ? 60.446  -9.178   43.546  1.00 139.55 ? 290  GLU A OE1   1 
ATOM   2511  O  OE2   . GLU C 3  290  ? 58.653  -8.157   44.307  1.00 139.40 ? 290  GLU A OE2   1 
ATOM   2512  N  N     . GLU C 3  291  ? 55.894  -8.782   39.577  1.00 133.68 ? 291  GLU A N     1 
ATOM   2513  C  CA    . GLU C 3  291  ? 54.469  -8.463   39.620  1.00 131.84 ? 291  GLU A CA    1 
ATOM   2514  C  C     . GLU C 3  291  ? 53.773  -9.045   38.390  1.00 131.04 ? 291  GLU A C     1 
ATOM   2515  O  O     . GLU C 3  291  ? 52.596  -8.776   38.139  1.00 130.34 ? 291  GLU A O     1 
ATOM   2516  C  CB    . GLU C 3  291  ? 54.277  -6.945   39.662  1.00 131.45 ? 291  GLU A CB    1 
ATOM   2517  C  CG    . GLU C 3  291  ? 55.010  -6.263   40.813  1.00 130.77 ? 291  GLU A CG    1 
ATOM   2518  C  CD    . GLU C 3  291  ? 54.960  -4.747   40.727  1.00 131.24 ? 291  GLU A CD    1 
ATOM   2519  O  OE1   . GLU C 3  291  ? 53.844  -4.187   40.734  1.00 132.70 ? 291  GLU A OE1   1 
ATOM   2520  O  OE2   . GLU C 3  291  ? 56.037  -4.113   40.653  1.00 129.31 ? 291  GLU A OE2   1 
ATOM   2521  N  N     . ALA C 3  292  ? 54.521  -9.841   37.628  1.00 130.12 ? 292  ALA A N     1 
ATOM   2522  C  CA    . ALA C 3  292  ? 54.008  -10.485  36.423  1.00 129.22 ? 292  ALA A CA    1 
ATOM   2523  C  C     . ALA C 3  292  ? 54.296  -11.986  36.466  1.00 128.69 ? 292  ALA A C     1 
ATOM   2524  O  O     . ALA C 3  292  ? 53.801  -12.744  35.629  1.00 129.05 ? 292  ALA A O     1 
ATOM   2525  C  CB    . ALA C 3  292  ? 54.638  -9.862   35.182  1.00 129.12 ? 292  ALA A CB    1 
ATOM   2526  N  N     . GLU C 3  293  ? 55.106  -12.404  37.438  1.00 127.88 ? 293  GLU A N     1 
ATOM   2527  C  CA    . GLU C 3  293  ? 55.449  -13.816  37.624  1.00 126.82 ? 293  GLU A CA    1 
ATOM   2528  C  C     . GLU C 3  293  ? 54.340  -14.461  38.439  1.00 125.68 ? 293  GLU A C     1 
ATOM   2529  O  O     . GLU C 3  293  ? 53.885  -15.564  38.137  1.00 125.41 ? 293  GLU A O     1 
ATOM   2530  C  CB    . GLU C 3  293  ? 56.763  -13.959  38.393  1.00 127.84 ? 293  GLU A CB    1 
ATOM   2531  C  CG    . GLU C 3  293  ? 58.016  -13.668  37.594  1.00 129.94 ? 293  GLU A CG    1 
ATOM   2532  C  CD    . GLU C 3  293  ? 59.231  -13.507  38.488  1.00 130.87 ? 293  GLU A CD    1 
ATOM   2533  O  OE1   . GLU C 3  293  ? 59.395  -14.323  39.421  1.00 130.34 ? 293  GLU A OE1   1 
ATOM   2534  O  OE2   . GLU C 3  293  ? 60.025  -12.570  38.255  1.00 131.78 ? 293  GLU A OE2   1 
ATOM   2535  N  N     . SER C 3  294  ? 53.921  -13.756  39.486  1.00 124.79 ? 294  SER A N     1 
ATOM   2536  C  CA    . SER C 3  294  ? 52.856  -14.221  40.364  1.00 123.53 ? 294  SER A CA    1 
ATOM   2537  C  C     . SER C 3  294  ? 51.536  -14.273  39.597  1.00 121.62 ? 294  SER A C     1 
ATOM   2538  O  O     . SER C 3  294  ? 50.574  -14.901  40.041  1.00 121.50 ? 294  SER A O     1 
ATOM   2539  C  CB    . SER C 3  294  ? 52.727  -13.290  41.578  1.00 124.90 ? 294  SER A CB    1 
ATOM   2540  O  OG    . SER C 3  294  ? 52.567  -11.936  41.184  1.00 126.11 ? 294  SER A OG    1 
ATOM   2541  N  N     . LEU C 3  295  ? 51.500  -13.602  38.447  1.00 119.24 ? 295  LEU A N     1 
ATOM   2542  C  CA    . LEU C 3  295  ? 50.311  -13.585  37.604  1.00 116.35 ? 295  LEU A CA    1 
ATOM   2543  C  C     . LEU C 3  295  ? 50.323  -14.899  36.839  1.00 114.77 ? 295  LEU A C     1 
ATOM   2544  O  O     . LEU C 3  295  ? 49.322  -15.614  36.792  1.00 115.02 ? 295  LEU A O     1 
ATOM   2545  C  CB    . LEU C 3  295  ? 50.357  -12.412  36.625  1.00 115.53 ? 295  LEU A CB    1 
ATOM   2546  C  CG    . LEU C 3  295  ? 49.047  -12.117  35.895  1.00 114.38 ? 295  LEU A CG    1 
ATOM   2547  C  CD1   . LEU C 3  295  ? 48.014  -11.611  36.897  1.00 113.40 ? 295  LEU A CD1   1 
ATOM   2548  C  CD2   . LEU C 3  295  ? 49.286  -11.085  34.804  1.00 113.82 ? 295  LEU A CD2   1 
ATOM   2549  N  N     . LEU C 3  296  ? 51.465  -15.211  36.235  1.00 112.53 ? 296  LEU A N     1 
ATOM   2550  C  CA    . LEU C 3  296  ? 51.609  -16.463  35.514  1.00 111.29 ? 296  LEU A CA    1 
ATOM   2551  C  C     . LEU C 3  296  ? 51.302  -17.525  36.564  1.00 111.87 ? 296  LEU A C     1 
ATOM   2552  O  O     . LEU C 3  296  ? 50.483  -18.420  36.349  1.00 112.28 ? 296  LEU A O     1 
ATOM   2553  C  CB    . LEU C 3  296  ? 53.044  -16.625  35.007  1.00 109.49 ? 296  LEU A CB    1 
ATOM   2554  C  CG    . LEU C 3  296  ? 53.377  -17.911  34.244  1.00 108.53 ? 296  LEU A CG    1 
ATOM   2555  C  CD1   . LEU C 3  296  ? 52.560  -17.978  32.969  1.00 108.00 ? 296  LEU A CD1   1 
ATOM   2556  C  CD2   . LEU C 3  296  ? 54.859  -17.948  33.916  1.00 107.24 ? 296  LEU A CD2   1 
ATOM   2557  N  N     . GLN C 3  297  ? 51.957  -17.397  37.714  1.00 112.00 ? 297  GLN A N     1 
ATOM   2558  C  CA    . GLN C 3  297  ? 51.760  -18.319  38.825  1.00 111.56 ? 297  GLN A CA    1 
ATOM   2559  C  C     . GLN C 3  297  ? 50.276  -18.421  39.180  1.00 110.38 ? 297  GLN A C     1 
ATOM   2560  O  O     . GLN C 3  297  ? 49.801  -19.485  39.584  1.00 110.50 ? 297  GLN A O     1 
ATOM   2561  C  CB    . GLN C 3  297  ? 52.547  -17.840  40.052  1.00 113.07 ? 297  GLN A CB    1 
ATOM   2562  C  CG    . GLN C 3  297  ? 52.147  -18.523  41.356  1.00 114.63 ? 297  GLN A CG    1 
ATOM   2563  C  CD    . GLN C 3  297  ? 52.732  -19.912  41.503  1.00 114.85 ? 297  GLN A CD    1 
ATOM   2564  O  OE1   . GLN C 3  297  ? 53.826  -20.078  42.042  1.00 116.45 ? 297  GLN A OE1   1 
ATOM   2565  N  NE2   . GLN C 3  297  ? 52.011  -20.917  41.016  1.00 113.18 ? 297  GLN A NE2   1 
ATOM   2566  N  N     . PHE C 3  298  ? 49.552  -17.314  39.022  1.00 108.43 ? 298  PHE A N     1 
ATOM   2567  C  CA    . PHE C 3  298  ? 48.127  -17.270  39.339  1.00 106.05 ? 298  PHE A CA    1 
ATOM   2568  C  C     . PHE C 3  298  ? 47.246  -17.889  38.271  1.00 103.65 ? 298  PHE A C     1 
ATOM   2569  O  O     . PHE C 3  298  ? 46.289  -18.594  38.583  1.00 103.75 ? 298  PHE A O     1 
ATOM   2570  C  CB    . PHE C 3  298  ? 47.673  -15.831  39.578  1.00 107.40 ? 298  PHE A CB    1 
ATOM   2571  C  CG    . PHE C 3  298  ? 46.208  -15.702  39.899  1.00 108.78 ? 298  PHE A CG    1 
ATOM   2572  C  CD1   . PHE C 3  298  ? 45.652  -16.388  40.977  1.00 109.90 ? 298  PHE A CD1   1 
ATOM   2573  C  CD2   . PHE C 3  298  ? 45.387  -14.880  39.137  1.00 109.57 ? 298  PHE A CD2   1 
ATOM   2574  C  CE1   . PHE C 3  298  ? 44.299  -16.253  41.292  1.00 110.70 ? 298  PHE A CE1   1 
ATOM   2575  C  CE2   . PHE C 3  298  ? 44.033  -14.738  39.445  1.00 110.05 ? 298  PHE A CE2   1 
ATOM   2576  C  CZ    . PHE C 3  298  ? 43.489  -15.427  40.525  1.00 110.22 ? 298  PHE A CZ    1 
ATOM   2577  N  N     . HIS C 3  299  ? 47.550  -17.618  37.009  1.00 100.50 ? 299  HIS A N     1 
ATOM   2578  C  CA    . HIS C 3  299  ? 46.747  -18.186  35.946  1.00 97.53  ? 299  HIS A CA    1 
ATOM   2579  C  C     . HIS C 3  299  ? 47.026  -19.672  35.785  1.00 95.91  ? 299  HIS A C     1 
ATOM   2580  O  O     . HIS C 3  299  ? 46.095  -20.452  35.631  1.00 96.73  ? 299  HIS A O     1 
ATOM   2581  C  CB    . HIS C 3  299  ? 46.982  -17.438  34.631  1.00 96.00  ? 299  HIS A CB    1 
ATOM   2582  C  CG    . HIS C 3  299  ? 46.295  -16.107  34.569  1.00 94.34  ? 299  HIS A CG    1 
ATOM   2583  N  ND1   . HIS C 3  299  ? 46.464  -15.227  33.521  1.00 94.07  ? 299  HIS A ND1   1 
ATOM   2584  C  CD2   . HIS C 3  299  ? 45.445  -15.502  35.432  1.00 93.45  ? 299  HIS A CD2   1 
ATOM   2585  C  CE1   . HIS C 3  299  ? 45.751  -14.137  33.743  1.00 93.71  ? 299  HIS A CE1   1 
ATOM   2586  N  NE2   . HIS C 3  299  ? 45.123  -14.279  34.896  1.00 93.47  ? 299  HIS A NE2   1 
ATOM   2587  N  N     . VAL C 3  300  ? 48.293  -20.075  35.844  1.00 93.86  ? 300  VAL A N     1 
ATOM   2588  C  CA    . VAL C 3  300  ? 48.624  -21.492  35.698  1.00 92.72  ? 300  VAL A CA    1 
ATOM   2589  C  C     . VAL C 3  300  ? 47.943  -22.303  36.790  1.00 91.99  ? 300  VAL A C     1 
ATOM   2590  O  O     . VAL C 3  300  ? 47.334  -23.340  36.531  1.00 91.25  ? 300  VAL A O     1 
ATOM   2591  C  CB    . VAL C 3  300  ? 50.148  -21.751  35.785  1.00 93.01  ? 300  VAL A CB    1 
ATOM   2592  C  CG1   . VAL C 3  300  ? 50.422  -23.247  35.728  1.00 92.11  ? 300  VAL A CG1   1 
ATOM   2593  C  CG2   . VAL C 3  300  ? 50.868  -21.056  34.642  1.00 92.94  ? 300  VAL A CG2   1 
ATOM   2594  N  N     . ALA C 3  301  ? 48.053  -21.823  38.018  1.00 91.69  ? 301  ALA A N     1 
ATOM   2595  C  CA    . ALA C 3  301  ? 47.449  -22.504  39.148  1.00 91.79  ? 301  ALA A CA    1 
ATOM   2596  C  C     . ALA C 3  301  ? 45.925  -22.459  39.043  1.00 91.61  ? 301  ALA A C     1 
ATOM   2597  O  O     . ALA C 3  301  ? 45.252  -23.488  39.131  1.00 92.36  ? 301  ALA A O     1 
ATOM   2598  C  CB    . ALA C 3  301  ? 47.908  -21.850  40.437  1.00 92.28  ? 301  ALA A CB    1 
ATOM   2599  N  N     . THR C 3  302  ? 45.395  -21.255  38.847  1.00 90.27  ? 302  THR A N     1 
ATOM   2600  C  CA    . THR C 3  302  ? 43.959  -21.028  38.733  1.00 88.41  ? 302  THR A CA    1 
ATOM   2601  C  C     . THR C 3  302  ? 43.344  -21.923  37.649  1.00 87.35  ? 302  THR A C     1 
ATOM   2602  O  O     . THR C 3  302  ? 42.219  -22.404  37.777  1.00 86.49  ? 302  THR A O     1 
ATOM   2603  C  CB    . THR C 3  302  ? 43.696  -19.527  38.434  1.00 88.36  ? 302  THR A CB    1 
ATOM   2604  O  OG1   . THR C 3  302  ? 42.673  -19.038  39.310  1.00 87.82  ? 302  THR A OG1   1 
ATOM   2605  C  CG2   . THR C 3  302  ? 43.298  -19.311  36.971  1.00 88.27  ? 302  THR A CG2   1 
ATOM   2606  N  N     . TYR C 3  303  ? 44.111  -22.148  36.591  1.00 86.93  ? 303  TYR A N     1 
ATOM   2607  C  CA    . TYR C 3  303  ? 43.711  -22.982  35.460  1.00 86.17  ? 303  TYR A CA    1 
ATOM   2608  C  C     . TYR C 3  303  ? 43.360  -24.398  35.912  1.00 88.44  ? 303  TYR A C     1 
ATOM   2609  O  O     . TYR C 3  303  ? 42.773  -25.172  35.161  1.00 88.14  ? 303  TYR A O     1 
ATOM   2610  C  CB    . TYR C 3  303  ? 44.865  -22.987  34.450  1.00 80.31  ? 303  TYR A CB    1 
ATOM   2611  C  CG    . TYR C 3  303  ? 44.967  -24.148  33.488  1.00 72.69  ? 303  TYR A CG    1 
ATOM   2612  C  CD1   . TYR C 3  303  ? 44.171  -24.218  32.350  1.00 69.78  ? 303  TYR A CD1   1 
ATOM   2613  C  CD2   . TYR C 3  303  ? 45.940  -25.129  33.672  1.00 71.34  ? 303  TYR A CD2   1 
ATOM   2614  C  CE1   . TYR C 3  303  ? 44.354  -25.237  31.409  1.00 68.38  ? 303  TYR A CE1   1 
ATOM   2615  C  CE2   . TYR C 3  303  ? 46.130  -26.148  32.745  1.00 68.17  ? 303  TYR A CE2   1 
ATOM   2616  C  CZ    . TYR C 3  303  ? 45.340  -26.197  31.617  1.00 68.32  ? 303  TYR A CZ    1 
ATOM   2617  O  OH    . TYR C 3  303  ? 45.555  -27.197  30.695  1.00 67.91  ? 303  TYR A OH    1 
ATOM   2618  N  N     . MET C 3  304  ? 43.706  -24.726  37.152  1.00 91.52  ? 304  MET A N     1 
ATOM   2619  C  CA    . MET C 3  304  ? 43.429  -26.051  37.685  1.00 95.18  ? 304  MET A CA    1 
ATOM   2620  C  C     . MET C 3  304  ? 42.570  -26.027  38.950  1.00 98.51  ? 304  MET A C     1 
ATOM   2621  O  O     . MET C 3  304  ? 42.220  -27.080  39.480  1.00 98.86  ? 304  MET A O     1 
ATOM   2622  C  CB    . MET C 3  304  ? 44.747  -26.783  37.961  1.00 93.80  ? 304  MET A CB    1 
ATOM   2623  C  CG    . MET C 3  304  ? 45.657  -26.890  36.740  1.00 93.75  ? 304  MET A CG    1 
ATOM   2624  S  SD    . MET C 3  304  ? 47.131  -27.928  36.970  1.00 92.60  ? 304  MET A SD    1 
ATOM   2625  C  CE    . MET C 3  304  ? 48.199  -26.790  37.839  1.00 95.46  ? 304  MET A CE    1 
ATOM   2626  N  N     . ASP C 3  305  ? 42.225  -24.834  39.429  1.00 102.41 ? 305  ASP A N     1 
ATOM   2627  C  CA    . ASP C 3  305  ? 41.407  -24.704  40.636  1.00 106.74 ? 305  ASP A CA    1 
ATOM   2628  C  C     . ASP C 3  305  ? 40.894  -23.270  40.828  1.00 110.48 ? 305  ASP A C     1 
ATOM   2629  O  O     . ASP C 3  305  ? 41.628  -22.304  40.620  1.00 110.24 ? 305  ASP A O     1 
ATOM   2630  C  CB    . ASP C 3  305  ? 42.224  -25.128  41.856  1.00 106.49 ? 305  ASP A CB    1 
ATOM   2631  C  CG    . ASP C 3  305  ? 41.365  -25.367  43.082  1.00 107.66 ? 305  ASP A CG    1 
ATOM   2632  O  OD1   . ASP C 3  305  ? 40.452  -24.553  43.342  1.00 107.93 ? 305  ASP A OD1   1 
ATOM   2633  O  OD2   . ASP C 3  305  ? 41.613  -26.364  43.794  1.00 108.16 ? 305  ASP A OD2   1 
ATOM   2634  N  N     . ASN C 3  306  ? 39.636  -23.136  41.238  1.00 115.19 ? 306  ASN A N     1 
ATOM   2635  C  CA    . ASN C 3  306  ? 39.028  -21.820  41.434  1.00 120.83 ? 306  ASN A CA    1 
ATOM   2636  C  C     . ASN C 3  306  ? 38.678  -21.541  42.890  1.00 123.97 ? 306  ASN A C     1 
ATOM   2637  O  O     . ASN C 3  306  ? 38.722  -20.393  43.338  1.00 124.67 ? 306  ASN A O     1 
ATOM   2638  C  CB    . ASN C 3  306  ? 37.741  -21.707  40.616  1.00 123.72 ? 306  ASN A CB    1 
ATOM   2639  C  CG    . ASN C 3  306  ? 37.837  -22.401  39.279  1.00 126.61 ? 306  ASN A CG    1 
ATOM   2640  O  OD1   . ASN C 3  306  ? 38.710  -22.087  38.474  1.00 129.96 ? 306  ASN A OD1   1 
ATOM   2641  N  ND2   . ASN C 3  306  ? 36.935  -23.352  39.030  1.00 126.36 ? 306  ASN A ND2   1 
ATOM   2642  N  N     . ASP C 3  307  ? 38.314  -22.596  43.615  1.00 126.70 ? 307  ASP A N     1 
ATOM   2643  C  CA    . ASP C 3  307  ? 37.917  -22.484  45.015  1.00 129.48 ? 307  ASP A CA    1 
ATOM   2644  C  C     . ASP C 3  307  ? 39.086  -22.362  45.992  1.00 130.76 ? 307  ASP A C     1 
ATOM   2645  O  O     . ASP C 3  307  ? 38.950  -22.695  47.172  1.00 131.20 ? 307  ASP A O     1 
ATOM   2646  C  CB    . ASP C 3  307  ? 37.054  -23.688  45.400  1.00 131.66 ? 307  ASP A CB    1 
ATOM   2647  C  CG    . ASP C 3  307  ? 35.912  -23.919  44.430  1.00 134.64 ? 307  ASP A CG    1 
ATOM   2648  O  OD1   . ASP C 3  307  ? 35.099  -22.990  44.243  1.00 136.32 ? 307  ASP A OD1   1 
ATOM   2649  O  OD2   . ASP C 3  307  ? 35.829  -25.028  43.854  1.00 137.04 ? 307  ASP A OD2   1 
ATOM   2650  N  N     . ILE C 3  308  ? 40.226  -21.878  45.505  1.00 131.90 ? 308  ILE A N     1 
ATOM   2651  C  CA    . ILE C 3  308  ? 41.415  -21.710  46.342  1.00 132.33 ? 308  ILE A CA    1 
ATOM   2652  C  C     . ILE C 3  308  ? 41.339  -20.435  47.174  1.00 132.88 ? 308  ILE A C     1 
ATOM   2653  O  O     . ILE C 3  308  ? 40.821  -19.414  46.715  1.00 132.92 ? 308  ILE A O     1 
ATOM   2654  C  CB    . ILE C 3  308  ? 42.699  -21.640  45.487  1.00 131.85 ? 308  ILE A CB    1 
ATOM   2655  C  CG1   . ILE C 3  308  ? 42.842  -22.914  44.661  1.00 133.30 ? 308  ILE A CG1   1 
ATOM   2656  C  CG2   . ILE C 3  308  ? 43.916  -21.478  46.382  1.00 130.82 ? 308  ILE A CG2   1 
ATOM   2657  C  CD1   . ILE C 3  308  ? 43.978  -22.864  43.686  1.00 132.98 ? 308  ILE A CD1   1 
ATOM   2658  N  N     . ALA C 3  309  ? 41.861  -20.502  48.398  1.00 133.80 ? 309  ALA A N     1 
ATOM   2659  C  CA    . ALA C 3  309  ? 41.870  -19.355  49.301  1.00 134.71 ? 309  ALA A CA    1 
ATOM   2660  C  C     . ALA C 3  309  ? 42.716  -18.234  48.701  1.00 135.49 ? 309  ALA A C     1 
ATOM   2661  O  O     . ALA C 3  309  ? 43.937  -18.357  48.576  1.00 135.56 ? 309  ALA A O     1 
ATOM   2662  C  CB    . ALA C 3  309  ? 42.425  -19.763  50.662  1.00 133.62 ? 309  ALA A CB    1 
ATOM   2663  N  N     . GLY C 3  310  ? 42.060  -17.142  48.328  1.00 136.13 ? 310  GLY A N     1 
ATOM   2664  C  CA    . GLY C 3  310  ? 42.767  -16.024  47.737  1.00 136.70 ? 310  GLY A CA    1 
ATOM   2665  C  C     . GLY C 3  310  ? 41.871  -15.254  46.792  1.00 137.42 ? 310  GLY A C     1 
ATOM   2666  O  O     . GLY C 3  310  ? 41.111  -14.385  47.214  1.00 137.40 ? 310  GLY A O     1 
ATOM   2667  N  N     . GLN C 3  311  ? 41.943  -15.580  45.509  1.00 138.40 ? 311  GLN A N     1 
ATOM   2668  C  CA    . GLN C 3  311  ? 41.130  -14.887  44.523  1.00 140.51 ? 311  GLN A CA    1 
ATOM   2669  C  C     . GLN C 3  311  ? 40.498  -15.823  43.497  1.00 141.06 ? 311  GLN A C     1 
ATOM   2670  O  O     . GLN C 3  311  ? 41.007  -16.913  43.233  1.00 140.49 ? 311  GLN A O     1 
ATOM   2671  C  CB    . GLN C 3  311  ? 41.979  -13.828  43.808  1.00 142.27 ? 311  GLN A CB    1 
ATOM   2672  C  CG    . GLN C 3  311  ? 42.320  -12.607  44.667  1.00 145.33 ? 311  GLN A CG    1 
ATOM   2673  C  CD    . GLN C 3  311  ? 43.369  -11.692  44.032  1.00 147.02 ? 311  GLN A CD    1 
ATOM   2674  O  OE1   . GLN C 3  311  ? 43.260  -11.309  42.863  1.00 147.84 ? 311  GLN A OE1   1 
ATOM   2675  N  NE2   . GLN C 3  311  ? 44.386  -11.329  44.812  1.00 146.31 ? 311  GLN A NE2   1 
ATOM   2676  N  N     . PRO C 3  312  ? 39.357  -15.411  42.919  1.00 141.88 ? 312  PRO A N     1 
ATOM   2677  C  CA    . PRO C 3  312  ? 38.655  -16.213  41.915  1.00 141.95 ? 312  PRO A CA    1 
ATOM   2678  C  C     . PRO C 3  312  ? 39.123  -15.819  40.522  1.00 142.19 ? 312  PRO A C     1 
ATOM   2679  O  O     . PRO C 3  312  ? 40.065  -15.046  40.369  1.00 141.59 ? 312  PRO A O     1 
ATOM   2680  C  CB    . PRO C 3  312  ? 37.200  -15.840  42.148  1.00 141.59 ? 312  PRO A CB    1 
ATOM   2681  C  CG    . PRO C 3  312  ? 37.307  -14.371  42.428  1.00 141.84 ? 312  PRO A CG    1 
ATOM   2682  C  CD    . PRO C 3  312  ? 38.505  -14.292  43.374  1.00 142.21 ? 312  PRO A CD    1 
ATOM   2683  N  N     . GLN C 3  313  ? 38.457  -16.353  39.510  1.00 143.62 ? 313  GLN A N     1 
ATOM   2684  C  CA    . GLN C 3  313  ? 38.788  -16.038  38.131  1.00 145.53 ? 313  GLN A CA    1 
ATOM   2685  C  C     . GLN C 3  313  ? 37.541  -15.405  37.534  1.00 145.50 ? 313  GLN A C     1 
ATOM   2686  O  O     . GLN C 3  313  ? 36.425  -15.786  37.879  1.00 145.95 ? 313  GLN A O     1 
ATOM   2687  C  CB    . GLN C 3  313  ? 39.135  -17.311  37.373  1.00 148.36 ? 313  GLN A CB    1 
ATOM   2688  C  CG    . GLN C 3  313  ? 40.181  -18.165  38.055  1.00 153.88 ? 313  GLN A CG    1 
ATOM   2689  C  CD    . GLN C 3  313  ? 40.117  -19.615  37.615  1.00 157.67 ? 313  GLN A CD    1 
ATOM   2690  O  OE1   . GLN C 3  313  ? 39.594  -19.927  36.542  1.00 160.23 ? 313  GLN A OE1   1 
ATOM   2691  N  NE2   . GLN C 3  313  ? 40.660  -20.509  38.436  1.00 158.21 ? 313  GLN A NE2   1 
ATOM   2692  N  N     . ALA C 3  314  ? 37.721  -14.439  36.644  1.00 145.36 ? 314  ALA A N     1 
ATOM   2693  C  CA    . ALA C 3  314  ? 36.578  -13.776  36.037  1.00 145.65 ? 314  ALA A CA    1 
ATOM   2694  C  C     . ALA C 3  314  ? 36.796  -13.543  34.548  1.00 145.91 ? 314  ALA A C     1 
ATOM   2695  O  O     . ALA C 3  314  ? 37.519  -12.630  34.152  1.00 147.01 ? 314  ALA A O     1 
ATOM   2696  C  CB    . ALA C 3  314  ? 36.314  -12.452  36.750  1.00 145.22 ? 314  ALA A CB    1 
ATOM   2697  N  N     . PRO C 3  321  ? 31.774  -15.365  35.971  1.00 129.94 ? 321  PRO A N     1 
ATOM   2698  C  CA    . PRO C 3  321  ? 31.670  -16.818  36.155  1.00 129.25 ? 321  PRO A CA    1 
ATOM   2699  C  C     . PRO C 3  321  ? 33.022  -17.469  36.472  1.00 128.47 ? 321  PRO A C     1 
ATOM   2700  O  O     . PRO C 3  321  ? 33.839  -16.876  37.175  1.00 128.05 ? 321  PRO A O     1 
ATOM   2701  C  CB    . PRO C 3  321  ? 31.078  -17.285  34.825  1.00 130.03 ? 321  PRO A CB    1 
ATOM   2702  C  CG    . PRO C 3  321  ? 31.656  -16.309  33.847  1.00 131.09 ? 321  PRO A CG    1 
ATOM   2703  C  CD    . PRO C 3  321  ? 31.505  -14.987  34.572  1.00 130.88 ? 321  PRO A CD    1 
ATOM   2704  N  N     . VAL C 3  322  ? 33.246  -18.684  35.964  1.00 127.75 ? 322  VAL A N     1 
ATOM   2705  C  CA    . VAL C 3  322  ? 34.504  -19.414  36.179  1.00 126.27 ? 322  VAL A CA    1 
ATOM   2706  C  C     . VAL C 3  322  ? 34.355  -20.931  35.946  1.00 125.07 ? 322  VAL A C     1 
ATOM   2707  O  O     . VAL C 3  322  ? 33.246  -21.466  36.016  1.00 126.27 ? 322  VAL A O     1 
ATOM   2708  C  CB    . VAL C 3  322  ? 35.052  -19.169  37.614  1.00 126.06 ? 322  VAL A CB    1 
ATOM   2709  C  CG1   . VAL C 3  322  ? 34.677  -20.315  38.540  1.00 128.06 ? 322  VAL A CG1   1 
ATOM   2710  C  CG2   . VAL C 3  322  ? 36.541  -18.972  37.564  1.00 124.95 ? 322  VAL A CG2   1 
ATOM   2711  N  N     . LYS C 3  323  ? 35.472  -21.611  35.675  1.00 122.05 ? 323  LYS A N     1 
ATOM   2712  C  CA    . LYS C 3  323  ? 35.486  -23.064  35.433  1.00 119.18 ? 323  LYS A CA    1 
ATOM   2713  C  C     . LYS C 3  323  ? 36.917  -23.595  35.302  1.00 115.17 ? 323  LYS A C     1 
ATOM   2714  O  O     . LYS C 3  323  ? 37.558  -23.376  34.278  1.00 115.54 ? 323  LYS A O     1 
ATOM   2715  C  CB    . LYS C 3  323  ? 34.733  -23.410  34.138  1.00 122.84 ? 323  LYS A CB    1 
ATOM   2716  C  CG    . LYS C 3  323  ? 33.220  -23.642  34.257  1.00 126.29 ? 323  LYS A CG    1 
ATOM   2717  C  CD    . LYS C 3  323  ? 32.619  -23.941  32.874  1.00 128.83 ? 323  LYS A CD    1 
ATOM   2718  C  CE    . LYS C 3  323  ? 31.116  -24.200  32.914  1.00 129.30 ? 323  LYS A CE    1 
ATOM   2719  N  NZ    . LYS C 3  323  ? 30.551  -24.431  31.544  1.00 128.33 ? 323  LYS A NZ    1 
ATOM   2720  N  N     . SER C 3  324  ? 37.413  -24.301  36.317  1.00 110.57 ? 324  SER A N     1 
ATOM   2721  C  CA    . SER C 3  324  ? 38.776  -24.847  36.275  1.00 105.47 ? 324  SER A CA    1 
ATOM   2722  C  C     . SER C 3  324  ? 38.757  -26.279  35.770  1.00 102.16 ? 324  SER A C     1 
ATOM   2723  O  O     . SER C 3  324  ? 37.995  -26.610  34.869  1.00 103.38 ? 324  SER A O     1 
ATOM   2724  C  CB    . SER C 3  324  ? 39.405  -24.834  37.665  1.00 104.93 ? 324  SER A CB    1 
ATOM   2725  O  OG    . SER C 3  324  ? 38.747  -25.755  38.515  1.00 104.41 ? 324  SER A OG    1 
ATOM   2726  N  N     . ILE C 3  325  ? 39.611  -27.122  36.342  1.00 97.98  ? 325  ILE A N     1 
ATOM   2727  C  CA    . ILE C 3  325  ? 39.647  -28.528  35.961  1.00 93.78  ? 325  ILE A CA    1 
ATOM   2728  C  C     . ILE C 3  325  ? 39.063  -29.321  37.115  1.00 92.25  ? 325  ILE A C     1 
ATOM   2729  O  O     . ILE C 3  325  ? 38.346  -30.300  36.914  1.00 92.63  ? 325  ILE A O     1 
ATOM   2730  C  CB    . ILE C 3  325  ? 41.079  -29.021  35.673  1.00 92.44  ? 325  ILE A CB    1 
ATOM   2731  C  CG1   . ILE C 3  325  ? 41.564  -28.449  34.340  1.00 90.68  ? 325  ILE A CG1   1 
ATOM   2732  C  CG2   . ILE C 3  325  ? 41.105  -30.538  35.619  1.00 90.97  ? 325  ILE A CG2   1 
ATOM   2733  C  CD1   . ILE C 3  325  ? 42.914  -28.969  33.898  1.00 87.76  ? 325  ILE A CD1   1 
ATOM   2734  N  N     . ARG C 3  326  ? 39.374  -28.890  38.329  1.00 89.80  ? 326  ARG A N     1 
ATOM   2735  C  CA    . ARG C 3  326  ? 38.846  -29.542  39.511  1.00 87.29  ? 326  ARG A CA    1 
ATOM   2736  C  C     . ARG C 3  326  ? 37.350  -29.676  39.281  1.00 85.73  ? 326  ARG A C     1 
ATOM   2737  O  O     . ARG C 3  326  ? 36.801  -30.773  39.272  1.00 85.60  ? 326  ARG A O     1 
ATOM   2738  C  CB    . ARG C 3  326  ? 39.075  -28.666  40.736  1.00 88.71  ? 326  ARG A CB    1 
ATOM   2739  C  CG    . ARG C 3  326  ? 39.990  -29.256  41.780  1.00 89.78  ? 326  ARG A CG    1 
ATOM   2740  C  CD    . ARG C 3  326  ? 39.422  -28.986  43.157  1.00 90.53  ? 326  ARG A CD    1 
ATOM   2741  N  NE    . ARG C 3  326  ? 40.376  -29.277  44.214  1.00 91.88  ? 326  ARG A NE    1 
ATOM   2742  C  CZ    . ARG C 3  326  ? 40.095  -29.182  45.507  1.00 94.25  ? 326  ARG A CZ    1 
ATOM   2743  N  NH1   . ARG C 3  326  ? 38.882  -28.809  45.895  1.00 93.08  ? 326  ARG A NH1   1 
ATOM   2744  N  NH2   . ARG C 3  326  ? 41.034  -29.442  46.407  1.00 96.86  ? 326  ARG A NH2   1 
ATOM   2745  N  N     . ALA C 3  327  ? 36.707  -28.532  39.079  1.00 84.16  ? 327  ALA A N     1 
ATOM   2746  C  CA    . ALA C 3  327  ? 35.275  -28.468  38.848  1.00 82.86  ? 327  ALA A CA    1 
ATOM   2747  C  C     . ALA C 3  327  ? 34.789  -29.550  37.894  1.00 82.12  ? 327  ALA A C     1 
ATOM   2748  O  O     . ALA C 3  327  ? 33.653  -30.013  38.010  1.00 84.00  ? 327  ALA A O     1 
ATOM   2749  C  CB    . ALA C 3  327  ? 34.905  -27.100  38.309  1.00 83.86  ? 327  ALA A CB    1 
ATOM   2750  N  N     . ARG C 3  328  ? 35.638  -29.952  36.953  1.00 79.36  ? 328  ARG A N     1 
ATOM   2751  C  CA    . ARG C 3  328  ? 35.258  -30.982  35.993  1.00 77.00  ? 328  ARG A CA    1 
ATOM   2752  C  C     . ARG C 3  328  ? 35.189  -32.381  36.601  1.00 77.77  ? 328  ARG A C     1 
ATOM   2753  O  O     . ARG C 3  328  ? 34.211  -33.104  36.401  1.00 78.16  ? 328  ARG A O     1 
ATOM   2754  C  CB    . ARG C 3  328  ? 36.230  -31.009  34.816  1.00 72.72  ? 328  ARG A CB    1 
ATOM   2755  C  CG    . ARG C 3  328  ? 36.129  -29.826  33.876  1.00 68.07  ? 328  ARG A CG    1 
ATOM   2756  C  CD    . ARG C 3  328  ? 36.907  -30.111  32.598  1.00 62.65  ? 328  ARG A CD    1 
ATOM   2757  N  NE    . ARG C 3  328  ? 36.780  -29.045  31.609  1.00 56.46  ? 328  ARG A NE    1 
ATOM   2758  C  CZ    . ARG C 3  328  ? 37.157  -29.165  30.341  1.00 54.81  ? 328  ARG A CZ    1 
ATOM   2759  N  NH1   . ARG C 3  328  ? 37.685  -30.309  29.911  1.00 48.71  ? 328  ARG A NH1   1 
ATOM   2760  N  NH2   . ARG C 3  328  ? 36.996  -28.147  29.502  1.00 54.00  ? 328  ARG A NH2   1 
ATOM   2761  N  N     . LEU C 3  329  ? 36.227  -32.753  37.346  1.00 78.27  ? 329  LEU A N     1 
ATOM   2762  C  CA    . LEU C 3  329  ? 36.316  -34.077  37.967  1.00 78.47  ? 329  LEU A CA    1 
ATOM   2763  C  C     . LEU C 3  329  ? 35.570  -34.207  39.293  1.00 78.60  ? 329  LEU A C     1 
ATOM   2764  O  O     . LEU C 3  329  ? 35.272  -35.315  39.733  1.00 78.95  ? 329  LEU A O     1 
ATOM   2765  C  CB    . LEU C 3  329  ? 37.785  -34.445  38.213  1.00 77.96  ? 329  LEU A CB    1 
ATOM   2766  C  CG    . LEU C 3  329  ? 38.860  -34.154  37.160  1.00 75.29  ? 329  LEU A CG    1 
ATOM   2767  C  CD1   . LEU C 3  329  ? 40.201  -34.625  37.695  1.00 74.97  ? 329  LEU A CD1   1 
ATOM   2768  C  CD2   . LEU C 3  329  ? 38.539  -34.847  35.850  1.00 72.65  ? 329  LEU A CD2   1 
ATOM   2769  N  N     . LYS C 3  330  ? 35.277  -33.077  39.925  1.00 79.70  ? 330  LYS A N     1 
ATOM   2770  C  CA    . LYS C 3  330  ? 34.598  -33.056  41.219  1.00 81.53  ? 330  LYS A CA    1 
ATOM   2771  C  C     . LYS C 3  330  ? 33.297  -33.832  41.356  1.00 81.74  ? 330  LYS A C     1 
ATOM   2772  O  O     . LYS C 3  330  ? 32.438  -33.820  40.477  1.00 81.64  ? 330  LYS A O     1 
ATOM   2773  C  CB    . LYS C 3  330  ? 34.359  -31.617  41.659  1.00 84.99  ? 330  LYS A CB    1 
ATOM   2774  C  CG    . LYS C 3  330  ? 35.139  -31.242  42.896  1.00 86.25  ? 330  LYS A CG    1 
ATOM   2775  C  CD    . LYS C 3  330  ? 34.883  -29.807  43.269  1.00 89.65  ? 330  LYS A CD    1 
ATOM   2776  C  CE    . LYS C 3  330  ? 35.610  -29.456  44.548  1.00 93.65  ? 330  LYS A CE    1 
ATOM   2777  N  NZ    . LYS C 3  330  ? 35.488  -28.007  44.863  1.00 97.05  ? 330  LYS A NZ    1 
ATOM   2778  N  N     . GLY C 3  331  ? 33.164  -34.475  42.510  1.00 82.52  ? 331  GLY A N     1 
ATOM   2779  C  CA    . GLY C 3  331  ? 32.007  -35.296  42.815  1.00 83.97  ? 331  GLY A CA    1 
ATOM   2780  C  C     . GLY C 3  331  ? 30.621  -34.822  42.433  1.00 83.34  ? 331  GLY A C     1 
ATOM   2781  O  O     . GLY C 3  331  ? 30.285  -33.645  42.579  1.00 83.91  ? 331  GLY A O     1 
ATOM   2782  N  N     . LYS C 3  332  ? 29.813  -35.768  41.957  1.00 82.54  ? 332  LYS A N     1 
ATOM   2783  C  CA    . LYS C 3  332  ? 28.443  -35.495  41.561  1.00 81.93  ? 332  LYS A CA    1 
ATOM   2784  C  C     . LYS C 3  332  ? 28.431  -34.482  40.436  1.00 82.23  ? 332  LYS A C     1 
ATOM   2785  O  O     . LYS C 3  332  ? 29.181  -33.510  40.460  1.00 83.58  ? 332  LYS A O     1 
ATOM   2786  C  CB    . LYS C 3  332  ? 27.658  -34.941  42.751  1.00 81.42  ? 332  LYS A CB    1 
ATOM   2787  C  CG    . LYS C 3  332  ? 26.174  -34.825  42.515  1.00 82.17  ? 332  LYS A CG    1 
ATOM   2788  C  CD    . LYS C 3  332  ? 25.570  -36.195  42.298  1.00 86.11  ? 332  LYS A CD    1 
ATOM   2789  C  CE    . LYS C 3  332  ? 24.083  -36.110  42.035  1.00 89.58  ? 332  LYS A CE    1 
ATOM   2790  N  NZ    . LYS C 3  332  ? 23.529  -37.443  41.673  1.00 90.05  ? 332  LYS A NZ    1 
ATOM   2791  N  N     . GLU C 3  333  ? 27.586  -34.703  39.442  1.00 81.77  ? 333  GLU A N     1 
ATOM   2792  C  CA    . GLU C 3  333  ? 27.501  -33.767  38.331  1.00 82.37  ? 333  GLU A CA    1 
ATOM   2793  C  C     . GLU C 3  333  ? 28.865  -33.554  37.662  1.00 81.08  ? 333  GLU A C     1 
ATOM   2794  O  O     . GLU C 3  333  ? 29.003  -32.677  36.810  1.00 83.67  ? 333  GLU A O     1 
ATOM   2795  C  CB    . GLU C 3  333  ? 26.976  -32.406  38.823  1.00 84.29  ? 333  GLU A CB    1 
ATOM   2796  C  CG    . GLU C 3  333  ? 25.616  -32.418  39.535  1.00 88.46  ? 333  GLU A CG    1 
ATOM   2797  C  CD    . GLU C 3  333  ? 24.459  -32.789  38.619  1.00 91.89  ? 333  GLU A CD    1 
ATOM   2798  O  OE1   . GLU C 3  333  ? 24.641  -32.742  37.381  1.00 95.10  ? 333  GLU A OE1   1 
ATOM   2799  O  OE2   . GLU C 3  333  ? 23.365  -33.114  39.138  1.00 91.32  ? 333  GLU A OE2   1 
ATOM   2800  N  N     . GLY C 3  334  ? 29.872  -34.341  38.038  1.00 78.54  ? 334  GLY A N     1 
ATOM   2801  C  CA    . GLY C 3  334  ? 31.187  -34.164  37.441  1.00 74.53  ? 334  GLY A CA    1 
ATOM   2802  C  C     . GLY C 3  334  ? 31.973  -35.433  37.159  1.00 72.14  ? 334  GLY A C     1 
ATOM   2803  O  O     . GLY C 3  334  ? 32.126  -36.293  38.028  1.00 72.17  ? 334  GLY A O     1 
ATOM   2804  N  N     . ARG C 3  335  ? 32.490  -35.531  35.938  1.00 69.68  ? 335  ARG A N     1 
ATOM   2805  C  CA    . ARG C 3  335  ? 33.270  -36.685  35.486  1.00 67.20  ? 335  ARG A CA    1 
ATOM   2806  C  C     . ARG C 3  335  ? 32.995  -37.987  36.203  1.00 65.13  ? 335  ARG A C     1 
ATOM   2807  O  O     . ARG C 3  335  ? 31.957  -38.619  36.028  1.00 66.11  ? 335  ARG A O     1 
ATOM   2808  C  CB    . ARG C 3  335  ? 34.771  -36.418  35.591  1.00 65.43  ? 335  ARG A CB    1 
ATOM   2809  C  CG    . ARG C 3  335  ? 35.250  -35.279  34.751  1.00 67.32  ? 335  ARG A CG    1 
ATOM   2810  C  CD    . ARG C 3  335  ? 34.810  -35.403  33.310  1.00 63.02  ? 335  ARG A CD    1 
ATOM   2811  N  NE    . ARG C 3  335  ? 34.533  -34.074  32.787  1.00 61.87  ? 335  ARG A NE    1 
ATOM   2812  C  CZ    . ARG C 3  335  ? 34.229  -33.818  31.526  1.00 62.94  ? 335  ARG A CZ    1 
ATOM   2813  N  NH1   . ARG C 3  335  ? 34.166  -34.808  30.650  1.00 63.75  ? 335  ARG A NH1   1 
ATOM   2814  N  NH2   . ARG C 3  335  ? 33.985  -32.572  31.148  1.00 64.49  ? 335  ARG A NH2   1 
ATOM   2815  N  N     . ILE C 3  336  ? 33.969  -38.379  37.007  1.00 62.94  ? 336  ILE A N     1 
ATOM   2816  C  CA    . ILE C 3  336  ? 33.926  -39.607  37.766  1.00 58.96  ? 336  ILE A CA    1 
ATOM   2817  C  C     . ILE C 3  336  ? 32.555  -40.054  38.241  1.00 57.19  ? 336  ILE A C     1 
ATOM   2818  O  O     . ILE C 3  336  ? 32.103  -41.149  37.892  1.00 54.62  ? 336  ILE A O     1 
ATOM   2819  C  CB    . ILE C 3  336  ? 34.905  -39.487  38.914  1.00 57.37  ? 336  ILE A CB    1 
ATOM   2820  C  CG1   . ILE C 3  336  ? 36.312  -39.543  38.318  1.00 57.40  ? 336  ILE A CG1   1 
ATOM   2821  C  CG2   . ILE C 3  336  ? 34.677  -40.575  39.927  1.00 57.43  ? 336  ILE A CG2   1 
ATOM   2822  C  CD1   . ILE C 3  336  ? 37.403  -39.186  39.247  1.00 59.80  ? 336  ILE A CD1   1 
ATOM   2823  N  N     . ARG C 3  337  ? 31.890  -39.213  39.023  1.00 56.59  ? 337  ARG A N     1 
ATOM   2824  C  CA    . ARG C 3  337  ? 30.558  -39.540  39.529  1.00 56.23  ? 337  ARG A CA    1 
ATOM   2825  C  C     . ARG C 3  337  ? 29.415  -39.559  38.498  1.00 55.94  ? 337  ARG A C     1 
ATOM   2826  O  O     . ARG C 3  337  ? 28.599  -40.480  38.488  1.00 57.78  ? 337  ARG A O     1 
ATOM   2827  C  CB    . ARG C 3  337  ? 30.173  -38.573  40.637  1.00 56.18  ? 337  ARG A CB    1 
ATOM   2828  C  CG    . ARG C 3  337  ? 30.670  -38.941  42.003  1.00 53.91  ? 337  ARG A CG    1 
ATOM   2829  C  CD    . ARG C 3  337  ? 29.599  -38.579  43.010  1.00 51.60  ? 337  ARG A CD    1 
ATOM   2830  N  NE    . ARG C 3  337  ? 30.168  -38.281  44.311  1.00 52.24  ? 337  ARG A NE    1 
ATOM   2831  C  CZ    . ARG C 3  337  ? 29.465  -37.857  45.353  1.00 56.16  ? 337  ARG A CZ    1 
ATOM   2832  N  NH1   . ARG C 3  337  ? 28.156  -37.682  45.244  1.00 54.64  ? 337  ARG A NH1   1 
ATOM   2833  N  NH2   . ARG C 3  337  ? 30.071  -37.616  46.509  1.00 62.62  ? 337  ARG A NH2   1 
ATOM   2834  N  N     . GLY C 3  338  ? 29.347  -38.546  37.638  1.00 54.86  ? 338  GLY A N     1 
ATOM   2835  C  CA    . GLY C 3  338  ? 28.276  -38.485  36.656  1.00 52.46  ? 338  GLY A CA    1 
ATOM   2836  C  C     . GLY C 3  338  ? 28.581  -38.822  35.207  1.00 50.95  ? 338  GLY A C     1 
ATOM   2837  O  O     . GLY C 3  338  ? 27.710  -38.689  34.345  1.00 52.36  ? 338  GLY A O     1 
ATOM   2838  N  N     . ASN C 3  339  ? 29.800  -39.256  34.920  1.00 48.55  ? 339  ASN A N     1 
ATOM   2839  C  CA    . ASN C 3  339  ? 30.157  -39.604  33.556  1.00 47.05  ? 339  ASN A CA    1 
ATOM   2840  C  C     . ASN C 3  339  ? 30.812  -40.966  33.483  1.00 47.92  ? 339  ASN A C     1 
ATOM   2841  O  O     . ASN C 3  339  ? 30.625  -41.692  32.516  1.00 48.89  ? 339  ASN A O     1 
ATOM   2842  C  CB    . ASN C 3  339  ? 31.102  -38.561  32.960  1.00 44.65  ? 339  ASN A CB    1 
ATOM   2843  C  CG    . ASN C 3  339  ? 30.435  -37.224  32.766  1.00 46.23  ? 339  ASN A CG    1 
ATOM   2844  O  OD1   . ASN C 3  339  ? 29.400  -37.146  32.123  1.00 52.57  ? 339  ASN A OD1   1 
ATOM   2845  N  ND2   . ASN C 3  339  ? 31.023  -36.160  33.315  1.00 45.90  ? 339  ASN A ND2   1 
ATOM   2846  N  N     . LEU C 3  340  ? 31.573  -41.325  34.509  1.00 48.85  ? 340  LEU A N     1 
ATOM   2847  C  CA    . LEU C 3  340  ? 32.267  -42.606  34.494  1.00 50.03  ? 340  LEU A CA    1 
ATOM   2848  C  C     . LEU C 3  340  ? 31.577  -43.751  35.210  1.00 48.27  ? 340  LEU A C     1 
ATOM   2849  O  O     . LEU C 3  340  ? 31.488  -44.854  34.669  1.00 47.29  ? 340  LEU A O     1 
ATOM   2850  C  CB    . LEU C 3  340  ? 33.691  -42.431  35.031  1.00 55.77  ? 340  LEU A CB    1 
ATOM   2851  C  CG    . LEU C 3  340  ? 34.701  -41.969  33.973  1.00 56.94  ? 340  LEU A CG    1 
ATOM   2852  C  CD1   . LEU C 3  340  ? 36.017  -41.582  34.627  1.00 58.00  ? 340  LEU A CD1   1 
ATOM   2853  C  CD2   . LEU C 3  340  ? 34.898  -43.092  32.957  1.00 55.71  ? 340  LEU A CD2   1 
ATOM   2854  N  N     . MET C 3  341  ? 31.103  -43.503  36.424  1.00 46.30  ? 341  MET A N     1 
ATOM   2855  C  CA    . MET C 3  341  ? 30.410  -44.544  37.158  1.00 46.76  ? 341  MET A CA    1 
ATOM   2856  C  C     . MET C 3  341  ? 28.897  -44.424  37.023  1.00 45.80  ? 341  MET A C     1 
ATOM   2857  O  O     . MET C 3  341  ? 28.158  -45.345  37.349  1.00 45.12  ? 341  MET A O     1 
ATOM   2858  C  CB    . MET C 3  341  ? 30.839  -44.515  38.613  1.00 48.41  ? 341  MET A CB    1 
ATOM   2859  C  CG    . MET C 3  341  ? 32.286  -44.968  38.783  1.00 51.61  ? 341  MET A CG    1 
ATOM   2860  S  SD    . MET C 3  341  ? 32.749  -45.081  40.501  1.00 50.78  ? 341  MET A SD    1 
ATOM   2861  C  CE    . MET C 3  341  ? 31.733  -43.718  41.141  1.00 52.18  ? 341  MET A CE    1 
ATOM   2862  N  N     . GLY C 3  342  ? 28.456  -43.278  36.516  1.00 46.72  ? 342  GLY A N     1 
ATOM   2863  C  CA    . GLY C 3  342  ? 27.046  -43.025  36.289  1.00 45.55  ? 342  GLY A CA    1 
ATOM   2864  C  C     . GLY C 3  342  ? 26.860  -42.328  34.947  1.00 45.26  ? 342  GLY A C     1 
ATOM   2865  O  O     . GLY C 3  342  ? 27.120  -41.131  34.830  1.00 44.13  ? 342  GLY A O     1 
ATOM   2866  N  N     . LYS C 3  343  ? 26.414  -43.067  33.932  1.00 44.29  ? 343  LYS A N     1 
ATOM   2867  C  CA    . LYS C 3  343  ? 26.213  -42.497  32.600  1.00 44.09  ? 343  LYS A CA    1 
ATOM   2868  C  C     . LYS C 3  343  ? 24.754  -42.524  32.166  1.00 43.05  ? 343  LYS A C     1 
ATOM   2869  O  O     . LYS C 3  343  ? 23.935  -43.212  32.764  1.00 43.00  ? 343  LYS A O     1 
ATOM   2870  C  CB    . LYS C 3  343  ? 26.997  -43.290  31.557  1.00 44.63  ? 343  LYS A CB    1 
ATOM   2871  C  CG    . LYS C 3  343  ? 28.449  -43.521  31.862  1.00 48.26  ? 343  LYS A CG    1 
ATOM   2872  C  CD    . LYS C 3  343  ? 29.027  -44.495  30.845  1.00 54.04  ? 343  LYS A CD    1 
ATOM   2873  C  CE    . LYS C 3  343  ? 30.473  -44.855  31.140  1.00 56.26  ? 343  LYS A CE    1 
ATOM   2874  N  NZ    . LYS C 3  343  ? 31.388  -43.700  30.931  1.00 60.55  ? 343  LYS A NZ    1 
ATOM   2875  N  N     . ARG C 3  344  ? 24.449  -41.770  31.113  1.00 41.70  ? 344  ARG A N     1 
ATOM   2876  C  CA    . ARG C 3  344  ? 23.115  -41.737  30.520  1.00 40.49  ? 344  ARG A CA    1 
ATOM   2877  C  C     . ARG C 3  344  ? 23.206  -42.796  29.435  1.00 38.37  ? 344  ARG A C     1 
ATOM   2878  O  O     . ARG C 3  344  ? 23.941  -42.640  28.472  1.00 39.78  ? 344  ARG A O     1 
ATOM   2879  C  CB    . ARG C 3  344  ? 22.851  -40.392  29.864  1.00 43.86  ? 344  ARG A CB    1 
ATOM   2880  C  CG    . ARG C 3  344  ? 22.927  -39.238  30.808  1.00 52.48  ? 344  ARG A CG    1 
ATOM   2881  C  CD    . ARG C 3  344  ? 21.570  -38.602  30.993  1.00 57.69  ? 344  ARG A CD    1 
ATOM   2882  N  NE    . ARG C 3  344  ? 21.573  -37.711  32.143  1.00 65.53  ? 344  ARG A NE    1 
ATOM   2883  C  CZ    . ARG C 3  344  ? 20.542  -36.968  32.513  1.00 69.69  ? 344  ARG A CZ    1 
ATOM   2884  N  NH1   . ARG C 3  344  ? 19.414  -37.005  31.817  1.00 73.82  ? 344  ARG A NH1   1 
ATOM   2885  N  NH2   . ARG C 3  344  ? 20.638  -36.197  33.585  1.00 72.99  ? 344  ARG A NH2   1 
ATOM   2886  N  N     . VAL C 3  345  ? 22.456  -43.871  29.570  1.00 35.28  ? 345  VAL A N     1 
ATOM   2887  C  CA    . VAL C 3  345  ? 22.556  -44.932  28.595  1.00 33.86  ? 345  VAL A CA    1 
ATOM   2888  C  C     . VAL C 3  345  ? 21.462  -44.971  27.568  1.00 32.51  ? 345  VAL A C     1 
ATOM   2889  O  O     . VAL C 3  345  ? 20.376  -44.456  27.796  1.00 33.69  ? 345  VAL A O     1 
ATOM   2890  C  CB    . VAL C 3  345  ? 22.556  -46.269  29.294  1.00 35.31  ? 345  VAL A CB    1 
ATOM   2891  C  CG1   . VAL C 3  345  ? 23.734  -46.356  30.234  1.00 38.71  ? 345  VAL A CG1   1 
ATOM   2892  C  CG2   . VAL C 3  345  ? 21.266  -46.430  30.062  1.00 37.86  ? 345  VAL A CG2   1 
ATOM   2893  N  N     . ASP C 3  346  ? 21.754  -45.601  26.437  1.00 31.41  ? 346  ASP A N     1 
ATOM   2894  C  CA    . ASP C 3  346  ? 20.765  -45.750  25.382  1.00 31.90  ? 346  ASP A CA    1 
ATOM   2895  C  C     . ASP C 3  346  ? 19.889  -46.951  25.738  1.00 31.48  ? 346  ASP A C     1 
ATOM   2896  O  O     . ASP C 3  346  ? 20.215  -47.694  26.663  1.00 30.55  ? 346  ASP A O     1 
ATOM   2897  C  CB    . ASP C 3  346  ? 21.434  -45.998  24.030  1.00 32.14  ? 346  ASP A CB    1 
ATOM   2898  C  CG    . ASP C 3  346  ? 22.170  -44.787  23.510  1.00 32.98  ? 346  ASP A CG    1 
ATOM   2899  O  OD1   . ASP C 3  346  ? 21.765  -43.649  23.835  1.00 31.61  ? 346  ASP A OD1   1 
ATOM   2900  O  OD2   . ASP C 3  346  ? 23.143  -44.978  22.749  1.00 35.69  ? 346  ASP A OD2   1 
ATOM   2901  N  N     . PHE C 3  347  ? 18.795  -47.134  24.993  1.00 30.87  ? 347  PHE A N     1 
ATOM   2902  C  CA    . PHE C 3  347  ? 17.837  -48.230  25.206  1.00 26.98  ? 347  PHE A CA    1 
ATOM   2903  C  C     . PHE C 3  347  ? 17.262  -48.197  26.613  1.00 25.96  ? 347  PHE A C     1 
ATOM   2904  O  O     . PHE C 3  347  ? 17.291  -49.190  27.344  1.00 25.87  ? 347  PHE A O     1 
ATOM   2905  C  CB    . PHE C 3  347  ? 18.495  -49.582  24.974  1.00 24.65  ? 347  PHE A CB    1 
ATOM   2906  C  CG    . PHE C 3  347  ? 19.212  -49.679  23.679  1.00 29.16  ? 347  PHE A CG    1 
ATOM   2907  C  CD1   . PHE C 3  347  ? 20.604  -49.745  23.647  1.00 31.48  ? 347  PHE A CD1   1 
ATOM   2908  C  CD2   . PHE C 3  347  ? 18.504  -49.708  22.480  1.00 31.49  ? 347  PHE A CD2   1 
ATOM   2909  C  CE1   . PHE C 3  347  ? 21.290  -49.847  22.433  1.00 34.24  ? 347  PHE A CE1   1 
ATOM   2910  C  CE2   . PHE C 3  347  ? 19.172  -49.808  21.261  1.00 33.26  ? 347  PHE A CE2   1 
ATOM   2911  C  CZ    . PHE C 3  347  ? 20.573  -49.879  21.236  1.00 35.07  ? 347  PHE A CZ    1 
ATOM   2912  N  N     . SER C 3  348  ? 16.747  -47.043  26.994  1.00 22.05  ? 348  SER A N     1 
ATOM   2913  C  CA    . SER C 3  348  ? 16.174  -46.891  28.302  1.00 22.37  ? 348  SER A CA    1 
ATOM   2914  C  C     . SER C 3  348  ? 14.836  -46.272  28.028  1.00 22.93  ? 348  SER A C     1 
ATOM   2915  O  O     . SER C 3  348  ? 14.668  -45.671  26.980  1.00 24.93  ? 348  SER A O     1 
ATOM   2916  C  CB    . SER C 3  348  ? 17.013  -45.935  29.121  1.00 24.35  ? 348  SER A CB    1 
ATOM   2917  O  OG    . SER C 3  348  ? 16.924  -44.636  28.572  1.00 28.87  ? 348  SER A OG    1 
ATOM   2918  N  N     . ALA C 3  349  ? 13.895  -46.413  28.959  1.00 22.72  ? 349  ALA A N     1 
ATOM   2919  C  CA    . ALA C 3  349  ? 12.552  -45.855  28.808  1.00 22.35  ? 349  ALA A CA    1 
ATOM   2920  C  C     . ALA C 3  349  ? 11.982  -45.555  30.181  1.00 23.16  ? 349  ALA A C     1 
ATOM   2921  O  O     . ALA C 3  349  ? 12.348  -46.215  31.164  1.00 24.35  ? 349  ALA A O     1 
ATOM   2922  C  CB    . ALA C 3  349  ? 11.655  -46.840  28.080  1.00 23.72  ? 349  ALA A CB    1 
ATOM   2923  N  N     . ARG C 3  350  ? 11.078  -44.578  30.249  1.00 20.87  ? 350  ARG A N     1 
ATOM   2924  C  CA    . ARG C 3  350  ? 10.476  -44.182  31.524  1.00 19.15  ? 350  ARG A CA    1 
ATOM   2925  C  C     . ARG C 3  350  ? 9.075   -43.596  31.374  1.00 21.02  ? 350  ARG A C     1 
ATOM   2926  O  O     . ARG C 3  350  ? 8.832   -42.833  30.434  1.00 22.82  ? 350  ARG A O     1 
ATOM   2927  C  CB    . ARG C 3  350  ? 11.366  -43.146  32.196  1.00 15.06  ? 350  ARG A CB    1 
ATOM   2928  C  CG    . ARG C 3  350  ? 10.802  -42.586  33.468  1.00 16.30  ? 350  ARG A CG    1 
ATOM   2929  C  CD    . ARG C 3  350  ? 11.565  -41.354  33.861  1.00 18.37  ? 350  ARG A CD    1 
ATOM   2930  N  NE    . ARG C 3  350  ? 11.098  -40.764  35.112  1.00 22.02  ? 350  ARG A NE    1 
ATOM   2931  C  CZ    . ARG C 3  350  ? 11.534  -41.108  36.321  1.00 25.39  ? 350  ARG A CZ    1 
ATOM   2932  N  NH1   . ARG C 3  350  ? 12.454  -42.053  36.462  1.00 25.35  ? 350  ARG A NH1   1 
ATOM   2933  N  NH2   . ARG C 3  350  ? 11.068  -40.482  37.396  1.00 28.59  ? 350  ARG A NH2   1 
ATOM   2934  N  N     . THR C 3  351  ? 8.163   -43.950  32.289  1.00 19.19  ? 351  THR A N     1 
ATOM   2935  C  CA    . THR C 3  351  ? 6.785   -43.432  32.268  1.00 19.80  ? 351  THR A CA    1 
ATOM   2936  C  C     . THR C 3  351  ? 6.152   -43.572  33.601  1.00 19.67  ? 351  THR A C     1 
ATOM   2937  O  O     . THR C 3  351  ? 6.814   -43.919  34.564  1.00 24.72  ? 351  THR A O     1 
ATOM   2938  C  CB    . THR C 3  351  ? 5.835   -44.196  31.386  1.00 19.51  ? 351  THR A CB    1 
ATOM   2939  O  OG1   . THR C 3  351  ? 6.502   -45.325  30.815  1.00 28.39  ? 351  THR A OG1   1 
ATOM   2940  C  CG2   . THR C 3  351  ? 5.267   -43.287  30.332  1.00 21.98  ? 351  THR A CG2   1 
ATOM   2941  N  N     . VAL C 3  352  ? 4.846   -43.322  33.646  1.00 18.65  ? 352  VAL A N     1 
ATOM   2942  C  CA    . VAL C 3  352  ? 4.093   -43.454  34.886  1.00 17.16  ? 352  VAL A CA    1 
ATOM   2943  C  C     . VAL C 3  352  ? 3.779   -44.930  35.038  1.00 17.98  ? 352  VAL A C     1 
ATOM   2944  O  O     . VAL C 3  352  ? 3.751   -45.663  34.049  1.00 20.76  ? 352  VAL A O     1 
ATOM   2945  C  CB    . VAL C 3  352  ? 2.750   -42.714  34.823  1.00 9.55   ? 352  VAL A CB    1 
ATOM   2946  C  CG1   . VAL C 3  352  ? 1.948   -42.990  36.080  1.00 2.65   ? 352  VAL A CG1   1 
ATOM   2947  C  CG2   . VAL C 3  352  ? 2.981   -41.250  34.666  1.00 5.99   ? 352  VAL A CG2   1 
ATOM   2948  N  N     . ILE C 3  353  ? 3.560   -45.382  36.263  1.00 17.09  ? 353  ILE A N     1 
ATOM   2949  C  CA    . ILE C 3  353  ? 3.192   -46.774  36.453  1.00 16.58  ? 353  ILE A CA    1 
ATOM   2950  C  C     . ILE C 3  353  ? 1.817   -46.862  37.108  1.00 16.95  ? 353  ILE A C     1 
ATOM   2951  O  O     . ILE C 3  353  ? 1.341   -45.910  37.723  1.00 15.51  ? 353  ILE A O     1 
ATOM   2952  C  CB    . ILE C 3  353  ? 4.219   -47.554  37.320  1.00 14.97  ? 353  ILE A CB    1 
ATOM   2953  C  CG1   . ILE C 3  353  ? 4.433   -46.880  38.666  1.00 10.35  ? 353  ILE A CG1   1 
ATOM   2954  C  CG2   . ILE C 3  353  ? 5.523   -47.645  36.610  1.00 16.97  ? 353  ILE A CG2   1 
ATOM   2955  C  CD1   . ILE C 3  353  ? 4.742   -47.879  39.732  1.00 9.71   ? 353  ILE A CD1   1 
ATOM   2956  N  N     . SER C 3  354  ? 1.167   -48.002  36.935  1.00 18.49  ? 354  SER A N     1 
ATOM   2957  C  CA    . SER C 3  354  ? -0.138  -48.247  37.534  1.00 21.89  ? 354  SER A CA    1 
ATOM   2958  C  C     . SER C 3  354  ? -0.255  -49.769  37.715  1.00 23.26  ? 354  SER A C     1 
ATOM   2959  O  O     . SER C 3  354  ? 0.358   -50.547  36.967  1.00 24.59  ? 354  SER A O     1 
ATOM   2960  C  CB    . SER C 3  354  ? -1.280  -47.660  36.664  1.00 21.28  ? 354  SER A CB    1 
ATOM   2961  O  OG    . SER C 3  354  ? -1.273  -48.126  35.322  1.00 18.98  ? 354  SER A OG    1 
ATOM   2962  N  N     . GLY C 3  355  ? -1.001  -50.199  38.727  1.00 22.29  ? 355  GLY A N     1 
ATOM   2963  C  CA    . GLY C 3  355  ? -1.117  -51.628  38.962  1.00 21.26  ? 355  GLY A CA    1 
ATOM   2964  C  C     . GLY C 3  355  ? -2.045  -52.319  37.995  1.00 19.22  ? 355  GLY A C     1 
ATOM   2965  O  O     . GLY C 3  355  ? -3.010  -51.716  37.532  1.00 23.69  ? 355  GLY A O     1 
ATOM   2966  N  N     . ASP C 3  356  ? -1.759  -53.578  37.696  1.00 14.93  ? 356  ASP A N     1 
ATOM   2967  C  CA    . ASP C 3  356  ? -2.583  -54.346  36.778  1.00 15.26  ? 356  ASP A CA    1 
ATOM   2968  C  C     . ASP C 3  356  ? -2.779  -55.741  37.361  1.00 15.94  ? 356  ASP A C     1 
ATOM   2969  O  O     . ASP C 3  356  ? -1.872  -56.575  37.320  1.00 15.62  ? 356  ASP A O     1 
ATOM   2970  C  CB    . ASP C 3  356  ? -1.894  -54.439  35.431  1.00 17.38  ? 356  ASP A CB    1 
ATOM   2971  C  CG    . ASP C 3  356  ? -2.732  -55.142  34.399  1.00 19.80  ? 356  ASP A CG    1 
ATOM   2972  O  OD1   . ASP C 3  356  ? -3.261  -56.235  34.686  1.00 22.09  ? 356  ASP A OD1   1 
ATOM   2973  O  OD2   . ASP C 3  356  ? -2.854  -54.598  33.289  1.00 24.21  ? 356  ASP A OD2   1 
ATOM   2974  N  N     . PRO C 3  357  ? -3.979  -56.026  37.889  1.00 14.80  ? 357  PRO A N     1 
ATOM   2975  C  CA    . PRO C 3  357  ? -4.238  -57.335  38.484  1.00 14.27  ? 357  PRO A CA    1 
ATOM   2976  C  C     . PRO C 3  357  ? -4.279  -58.561  37.585  1.00 16.44  ? 357  PRO A C     1 
ATOM   2977  O  O     . PRO C 3  357  ? -4.383  -59.694  38.070  1.00 18.82  ? 357  PRO A O     1 
ATOM   2978  C  CB    . PRO C 3  357  ? -5.531  -57.103  39.255  1.00 13.30  ? 357  PRO A CB    1 
ATOM   2979  C  CG    . PRO C 3  357  ? -6.210  -56.048  38.477  1.00 12.09  ? 357  PRO A CG    1 
ATOM   2980  C  CD    . PRO C 3  357  ? -5.119  -55.117  38.088  1.00 13.10  ? 357  PRO A CD    1 
ATOM   2981  N  N     . ASN C 3  358  ? -4.194  -58.362  36.281  1.00 16.02  ? 358  ASN A N     1 
ATOM   2982  C  CA    . ASN C 3  358  ? -4.200  -59.517  35.406  1.00 18.59  ? 358  ASN A CA    1 
ATOM   2983  C  C     . ASN C 3  358  ? -2.874  -59.634  34.674  1.00 23.25  ? 358  ASN A C     1 
ATOM   2984  O  O     . ASN C 3  358  ? -2.824  -60.001  33.498  1.00 24.83  ? 358  ASN A O     1 
ATOM   2985  C  CB    . ASN C 3  358  ? -5.359  -59.442  34.422  1.00 16.90  ? 358  ASN A CB    1 
ATOM   2986  C  CG    . ASN C 3  358  ? -6.686  -59.347  35.114  1.00 16.61  ? 358  ASN A CG    1 
ATOM   2987  O  OD1   . ASN C 3  358  ? -6.985  -60.134  36.008  1.00 18.69  ? 358  ASN A OD1   1 
ATOM   2988  N  ND2   . ASN C 3  358  ? -7.497  -58.380  34.713  1.00 18.68  ? 358  ASN A ND2   1 
ATOM   2989  N  N     . LEU C 3  359  ? -1.800  -59.295  35.381  1.00 24.86  ? 359  LEU A N     1 
ATOM   2990  C  CA    . LEU C 3  359  ? -0.447  -59.389  34.848  1.00 25.98  ? 359  LEU A CA    1 
ATOM   2991  C  C     . LEU C 3  359  ? 0.298   -60.242  35.843  1.00 29.41  ? 359  LEU A C     1 
ATOM   2992  O  O     . LEU C 3  359  ? 0.049   -60.148  37.049  1.00 29.66  ? 359  LEU A O     1 
ATOM   2993  C  CB    . LEU C 3  359  ? 0.205   -58.023  34.758  1.00 24.13  ? 359  LEU A CB    1 
ATOM   2994  C  CG    . LEU C 3  359  ? 0.353   -57.501  33.337  1.00 24.97  ? 359  LEU A CG    1 
ATOM   2995  C  CD1   . LEU C 3  359  ? 0.954   -56.110  33.372  1.00 24.56  ? 359  LEU A CD1   1 
ATOM   2996  C  CD2   . LEU C 3  359  ? 1.233   -58.448  32.539  1.00 25.76  ? 359  LEU A CD2   1 
ATOM   2997  N  N     . GLU C 3  360  ? 1.200   -61.083  35.349  1.00 31.00  ? 360  GLU A N     1 
ATOM   2998  C  CA    . GLU C 3  360  ? 1.944   -61.968  36.235  1.00 32.83  ? 360  GLU A CA    1 
ATOM   2999  C  C     . GLU C 3  360  ? 2.998   -61.211  37.030  1.00 32.05  ? 360  GLU A C     1 
ATOM   3000  O  O     . GLU C 3  360  ? 3.576   -60.245  36.536  1.00 33.72  ? 360  GLU A O     1 
ATOM   3001  C  CB    . GLU C 3  360  ? 2.598   -63.096  35.433  1.00 38.36  ? 360  GLU A CB    1 
ATOM   3002  C  CG    . GLU C 3  360  ? 1.618   -64.069  34.788  1.00 44.46  ? 360  GLU A CG    1 
ATOM   3003  C  CD    . GLU C 3  360  ? 0.633   -64.638  35.787  1.00 50.02  ? 360  GLU A CD    1 
ATOM   3004  O  OE1   . GLU C 3  360  ? 1.071   -65.117  36.863  1.00 50.27  ? 360  GLU A OE1   1 
ATOM   3005  O  OE2   . GLU C 3  360  ? -0.581  -64.604  35.490  1.00 54.37  ? 360  GLU A OE2   1 
ATOM   3006  N  N     . LEU C 3  361  ? 3.235   -61.657  38.259  1.00 28.90  ? 361  LEU A N     1 
ATOM   3007  C  CA    . LEU C 3  361  ? 4.211   -61.036  39.147  1.00 24.80  ? 361  LEU A CA    1 
ATOM   3008  C  C     . LEU C 3  361  ? 5.462   -60.588  38.412  1.00 24.95  ? 361  LEU A C     1 
ATOM   3009  O  O     . LEU C 3  361  ? 5.824   -59.407  38.448  1.00 28.61  ? 361  LEU A O     1 
ATOM   3010  C  CB    . LEU C 3  361  ? 4.599   -62.020  40.248  1.00 22.74  ? 361  LEU A CB    1 
ATOM   3011  C  CG    . LEU C 3  361  ? 5.831   -61.750  41.102  1.00 18.60  ? 361  LEU A CG    1 
ATOM   3012  C  CD1   . LEU C 3  361  ? 5.632   -60.512  41.925  1.00 18.84  ? 361  LEU A CD1   1 
ATOM   3013  C  CD2   . LEU C 3  361  ? 6.074   -62.948  42.003  1.00 17.89  ? 361  LEU A CD2   1 
ATOM   3014  N  N     . ASP C 3  362  ? 6.101   -61.525  37.718  1.00 21.62  ? 362  ASP A N     1 
ATOM   3015  C  CA    . ASP C 3  362  ? 7.326   -61.221  37.007  1.00 19.24  ? 362  ASP A CA    1 
ATOM   3016  C  C     . ASP C 3  362  ? 7.237   -60.526  35.654  1.00 17.43  ? 362  ASP A C     1 
ATOM   3017  O  O     . ASP C 3  362  ? 8.250   -60.347  34.998  1.00 20.79  ? 362  ASP A O     1 
ATOM   3018  C  CB    . ASP C 3  362  ? 8.180   -62.483  36.863  1.00 24.15  ? 362  ASP A CB    1 
ATOM   3019  C  CG    . ASP C 3  362  ? 7.561   -63.512  35.944  1.00 27.73  ? 362  ASP A CG    1 
ATOM   3020  O  OD1   . ASP C 3  362  ? 8.322   -64.235  35.255  1.00 25.87  ? 362  ASP A OD1   1 
ATOM   3021  O  OD2   . ASP C 3  362  ? 6.320   -63.605  35.924  1.00 33.73  ? 362  ASP A OD2   1 
ATOM   3022  N  N     . GLN C 3  363  ? 6.058   -60.129  35.210  1.00 16.43  ? 363  GLN A N     1 
ATOM   3023  C  CA    . GLN C 3  363  ? 5.998   -59.433  33.934  1.00 17.54  ? 363  GLN A CA    1 
ATOM   3024  C  C     . GLN C 3  363  ? 6.065   -57.945  34.197  1.00 19.84  ? 363  GLN A C     1 
ATOM   3025  O  O     . GLN C 3  363  ? 6.323   -57.499  35.327  1.00 22.09  ? 363  GLN A O     1 
ATOM   3026  C  CB    . GLN C 3  363  ? 4.701   -59.726  33.206  1.00 17.65  ? 363  GLN A CB    1 
ATOM   3027  C  CG    . GLN C 3  363  ? 4.558   -61.148  32.758  1.00 25.31  ? 363  GLN A CG    1 
ATOM   3028  C  CD    . GLN C 3  363  ? 3.254   -61.391  32.033  1.00 28.08  ? 363  GLN A CD    1 
ATOM   3029  O  OE1   . GLN C 3  363  ? 2.175   -61.327  32.632  1.00 29.32  ? 363  GLN A OE1   1 
ATOM   3030  N  NE2   . GLN C 3  363  ? 3.343   -61.662  30.730  1.00 28.46  ? 363  GLN A NE2   1 
ATOM   3031  N  N     . VAL C 3  364  ? 5.824   -57.180  33.140  1.00 19.98  ? 364  VAL A N     1 
ATOM   3032  C  CA    . VAL C 3  364  ? 5.803   -55.726  33.208  1.00 20.60  ? 364  VAL A CA    1 
ATOM   3033  C  C     . VAL C 3  364  ? 5.090   -55.292  31.950  1.00 20.80  ? 364  VAL A C     1 
ATOM   3034  O  O     . VAL C 3  364  ? 5.381   -55.779  30.857  1.00 21.84  ? 364  VAL A O     1 
ATOM   3035  C  CB    . VAL C 3  364  ? 7.212   -55.120  33.231  1.00 22.74  ? 364  VAL A CB    1 
ATOM   3036  C  CG1   . VAL C 3  364  ? 7.976   -55.498  31.973  1.00 25.84  ? 364  VAL A CG1   1 
ATOM   3037  C  CG2   . VAL C 3  364  ? 7.112   -53.622  33.352  1.00 22.95  ? 364  VAL A CG2   1 
ATOM   3038  N  N     . GLY C 3  365  ? 4.140   -54.386  32.101  1.00 20.60  ? 365  GLY A N     1 
ATOM   3039  C  CA    . GLY C 3  365  ? 3.381   -53.948  30.946  1.00 20.46  ? 365  GLY A CA    1 
ATOM   3040  C  C     . GLY C 3  365  ? 4.039   -52.809  30.217  1.00 19.46  ? 365  GLY A C     1 
ATOM   3041  O  O     . GLY C 3  365  ? 4.116   -51.698  30.742  1.00 21.04  ? 365  GLY A O     1 
ATOM   3042  N  N     . VAL C 3  366  ? 4.514   -53.069  29.006  1.00 18.02  ? 366  VAL A N     1 
ATOM   3043  C  CA    . VAL C 3  366  ? 5.161   -52.012  28.252  1.00 16.11  ? 366  VAL A CA    1 
ATOM   3044  C  C     . VAL C 3  366  ? 4.236   -51.476  27.167  1.00 14.68  ? 366  VAL A C     1 
ATOM   3045  O  O     . VAL C 3  366  ? 3.830   -52.199  26.249  1.00 15.56  ? 366  VAL A O     1 
ATOM   3046  C  CB    . VAL C 3  366  ? 6.515   -52.483  27.631  1.00 11.91  ? 366  VAL A CB    1 
ATOM   3047  C  CG1   . VAL C 3  366  ? 7.164   -51.339  26.874  1.00 6.10   ? 366  VAL A CG1   1 
ATOM   3048  C  CG2   . VAL C 3  366  ? 7.451   -52.946  28.730  1.00 8.99   ? 366  VAL A CG2   1 
ATOM   3049  N  N     . PRO C 3  367  ? 3.854   -50.200  27.296  1.00 12.32  ? 367  PRO A N     1 
ATOM   3050  C  CA    . PRO C 3  367  ? 2.982   -49.531  26.342  1.00 14.26  ? 367  PRO A CA    1 
ATOM   3051  C  C     . PRO C 3  367  ? 3.538   -49.594  24.937  1.00 15.18  ? 367  PRO A C     1 
ATOM   3052  O  O     . PRO C 3  367  ? 4.637   -49.120  24.656  1.00 12.56  ? 367  PRO A O     1 
ATOM   3053  C  CB    . PRO C 3  367  ? 2.893   -48.106  26.877  1.00 12.50  ? 367  PRO A CB    1 
ATOM   3054  C  CG    . PRO C 3  367  ? 3.992   -48.016  27.896  1.00 14.56  ? 367  PRO A CG    1 
ATOM   3055  C  CD    . PRO C 3  367  ? 4.038   -49.370  28.489  1.00 11.66  ? 367  PRO A CD    1 
ATOM   3056  N  N     . LYS C 3  368  ? 2.739   -50.202  24.069  1.00 18.34  ? 368  LYS A N     1 
ATOM   3057  C  CA    . LYS C 3  368  ? 3.052   -50.394  22.671  1.00 19.34  ? 368  LYS A CA    1 
ATOM   3058  C  C     . LYS C 3  368  ? 4.051   -49.382  22.124  1.00 19.13  ? 368  LYS A C     1 
ATOM   3059  O  O     . LYS C 3  368  ? 5.106   -49.773  21.636  1.00 18.58  ? 368  LYS A O     1 
ATOM   3060  C  CB    . LYS C 3  368  ? 1.755   -50.380  21.853  1.00 18.04  ? 368  LYS A CB    1 
ATOM   3061  C  CG    . LYS C 3  368  ? 1.938   -50.861  20.431  1.00 25.85  ? 368  LYS A CG    1 
ATOM   3062  C  CD    . LYS C 3  368  ? 0.607   -51.046  19.686  1.00 36.15  ? 368  LYS A CD    1 
ATOM   3063  C  CE    . LYS C 3  368  ? -0.210  -52.233  20.219  1.00 38.63  ? 368  LYS A CE    1 
ATOM   3064  N  NZ    . LYS C 3  368  ? -0.857  -53.021  19.109  1.00 39.29  ? 368  LYS A NZ    1 
ATOM   3065  N  N     . SER C 3  369  ? 3.757   -48.090  22.223  1.00 18.48  ? 369  SER A N     1 
ATOM   3066  C  CA    . SER C 3  369  ? 4.686   -47.097  21.678  1.00 20.60  ? 369  SER A CA    1 
ATOM   3067  C  C     . SER C 3  369  ? 6.132   -47.297  22.142  1.00 20.73  ? 369  SER A C     1 
ATOM   3068  O  O     . SER C 3  369  ? 7.051   -47.369  21.321  1.00 20.56  ? 369  SER A O     1 
ATOM   3069  C  CB    . SER C 3  369  ? 4.222   -45.674  22.001  1.00 21.05  ? 369  SER A CB    1 
ATOM   3070  O  OG    . SER C 3  369  ? 4.319   -45.394  23.382  1.00 31.31  ? 369  SER A OG    1 
ATOM   3071  N  N     . ILE C 3  370  ? 6.335   -47.393  23.452  1.00 19.76  ? 370  ILE A N     1 
ATOM   3072  C  CA    . ILE C 3  370  ? 7.672   -47.595  23.985  1.00 16.08  ? 370  ILE A CA    1 
ATOM   3073  C  C     . ILE C 3  370  ? 8.308   -48.827  23.370  1.00 17.36  ? 370  ILE A C     1 
ATOM   3074  O  O     . ILE C 3  370  ? 9.484   -48.812  23.052  1.00 17.35  ? 370  ILE A O     1 
ATOM   3075  C  CB    . ILE C 3  370  ? 7.659   -47.780  25.507  1.00 13.17  ? 370  ILE A CB    1 
ATOM   3076  C  CG1   . ILE C 3  370  ? 7.350   -46.458  26.190  1.00 10.75  ? 370  ILE A CG1   1 
ATOM   3077  C  CG2   . ILE C 3  370  ? 8.994   -48.280  25.977  1.00 10.49  ? 370  ILE A CG2   1 
ATOM   3078  C  CD1   . ILE C 3  370  ? 7.531   -46.509  27.691  1.00 13.24  ? 370  ILE A CD1   1 
ATOM   3079  N  N     . ALA C 3  371  ? 7.537   -49.898  23.212  1.00 19.16  ? 371  ALA A N     1 
ATOM   3080  C  CA    . ALA C 3  371  ? 8.074   -51.127  22.632  1.00 22.43  ? 371  ALA A CA    1 
ATOM   3081  C  C     . ALA C 3  371  ? 8.510   -50.884  21.196  1.00 24.63  ? 371  ALA A C     1 
ATOM   3082  O  O     . ALA C 3  371  ? 9.487   -51.465  20.729  1.00 25.79  ? 371  ALA A O     1 
ATOM   3083  C  CB    . ALA C 3  371  ? 7.030   -52.233  22.665  1.00 19.86  ? 371  ALA A CB    1 
ATOM   3084  N  N     . LYS C 3  372  ? 7.773   -50.026  20.500  1.00 26.37  ? 372  LYS A N     1 
ATOM   3085  C  CA    . LYS C 3  372  ? 8.070   -49.709  19.112  1.00 28.47  ? 372  LYS A CA    1 
ATOM   3086  C  C     . LYS C 3  372  ? 9.353   -48.887  18.976  1.00 28.39  ? 372  LYS A C     1 
ATOM   3087  O  O     . LYS C 3  372  ? 9.882   -48.730  17.869  1.00 30.17  ? 372  LYS A O     1 
ATOM   3088  C  CB    . LYS C 3  372  ? 6.911   -48.925  18.491  1.00 32.92  ? 372  LYS A CB    1 
ATOM   3089  C  CG    . LYS C 3  372  ? 5.784   -49.734  17.863  1.00 34.28  ? 372  LYS A CG    1 
ATOM   3090  C  CD    . LYS C 3  372  ? 4.791   -48.764  17.200  1.00 42.02  ? 372  LYS A CD    1 
ATOM   3091  C  CE    . LYS C 3  372  ? 3.651   -49.476  16.478  1.00 51.16  ? 372  LYS A CE    1 
ATOM   3092  N  NZ    . LYS C 3  372  ? 2.597   -48.542  15.975  1.00 53.87  ? 372  LYS A NZ    1 
ATOM   3093  N  N     . THR C 3  373  ? 9.838   -48.347  20.093  1.00 26.23  ? 373  THR A N     1 
ATOM   3094  C  CA    . THR C 3  373  ? 11.063  -47.546  20.098  1.00 23.23  ? 373  THR A CA    1 
ATOM   3095  C  C     . THR C 3  373  ? 12.263  -48.380  20.523  1.00 21.12  ? 373  THR A C     1 
ATOM   3096  O  O     . THR C 3  373  ? 13.225  -48.501  19.775  1.00 21.52  ? 373  THR A O     1 
ATOM   3097  C  CB    . THR C 3  373  ? 10.946  -46.341  21.045  1.00 22.32  ? 373  THR A CB    1 
ATOM   3098  O  OG1   . THR C 3  373  ? 10.066  -45.377  20.472  1.00 24.85  ? 373  THR A OG1   1 
ATOM   3099  C  CG2   . THR C 3  373  ? 12.286  -45.700  21.267  1.00 23.25  ? 373  THR A CG2   1 
ATOM   3100  N  N     . LEU C 3  374  ? 12.201  -48.944  21.726  1.00 17.96  ? 374  LEU A N     1 
ATOM   3101  C  CA    . LEU C 3  374  ? 13.280  -49.771  22.234  1.00 18.36  ? 374  LEU A CA    1 
ATOM   3102  C  C     . LEU C 3  374  ? 13.406  -50.937  21.273  1.00 21.93  ? 374  LEU A C     1 
ATOM   3103  O  O     . LEU C 3  374  ? 12.401  -51.488  20.830  1.00 24.25  ? 374  LEU A O     1 
ATOM   3104  C  CB    . LEU C 3  374  ? 12.950  -50.263  23.634  1.00 17.45  ? 374  LEU A CB    1 
ATOM   3105  C  CG    . LEU C 3  374  ? 12.665  -49.129  24.615  1.00 18.55  ? 374  LEU A CG    1 
ATOM   3106  C  CD1   . LEU C 3  374  ? 11.941  -49.656  25.825  1.00 20.47  ? 374  LEU A CD1   1 
ATOM   3107  C  CD2   . LEU C 3  374  ? 13.961  -48.470  25.018  1.00 20.62  ? 374  LEU A CD2   1 
ATOM   3108  N  N     . THR C 3  375  ? 14.637  -51.325  20.962  1.00 23.27  ? 375  THR A N     1 
ATOM   3109  C  CA    . THR C 3  375  ? 14.872  -52.389  20.006  1.00 24.64  ? 375  THR A CA    1 
ATOM   3110  C  C     . THR C 3  375  ? 15.858  -53.414  20.560  1.00 26.23  ? 375  THR A C     1 
ATOM   3111  O  O     . THR C 3  375  ? 16.383  -53.226  21.646  1.00 28.93  ? 375  THR A O     1 
ATOM   3112  C  CB    . THR C 3  375  ? 15.421  -51.766  18.717  1.00 26.92  ? 375  THR A CB    1 
ATOM   3113  O  OG1   . THR C 3  375  ? 14.994  -52.539  17.592  1.00 32.11  ? 375  THR A OG1   1 
ATOM   3114  C  CG2   . THR C 3  375  ? 16.954  -51.695  18.764  1.00 27.74  ? 375  THR A CG2   1 
ATOM   3115  N  N     . TYR C 3  376  ? 16.106  -54.494  19.822  1.00 27.32  ? 376  TYR A N     1 
ATOM   3116  C  CA    . TYR C 3  376  ? 17.046  -55.529  20.255  1.00 28.44  ? 376  TYR A CA    1 
ATOM   3117  C  C     . TYR C 3  376  ? 17.747  -56.216  19.086  1.00 31.05  ? 376  TYR A C     1 
ATOM   3118  O  O     . TYR C 3  376  ? 17.107  -56.941  18.326  1.00 30.35  ? 376  TYR A O     1 
ATOM   3119  C  CB    . TYR C 3  376  ? 16.328  -56.596  21.052  1.00 28.41  ? 376  TYR A CB    1 
ATOM   3120  C  CG    . TYR C 3  376  ? 17.243  -57.731  21.440  1.00 30.39  ? 376  TYR A CG    1 
ATOM   3121  C  CD1   . TYR C 3  376  ? 17.779  -57.807  22.721  1.00 31.47  ? 376  TYR A CD1   1 
ATOM   3122  C  CD2   . TYR C 3  376  ? 17.610  -58.703  20.513  1.00 28.69  ? 376  TYR A CD2   1 
ATOM   3123  C  CE1   . TYR C 3  376  ? 18.657  -58.813  23.068  1.00 32.10  ? 376  TYR A CE1   1 
ATOM   3124  C  CE2   . TYR C 3  376  ? 18.489  -59.710  20.850  1.00 31.30  ? 376  TYR A CE2   1 
ATOM   3125  C  CZ    . TYR C 3  376  ? 19.010  -59.764  22.129  1.00 31.80  ? 376  TYR A CZ    1 
ATOM   3126  O  OH    . TYR C 3  376  ? 19.879  -60.774  22.476  1.00 32.57  ? 376  TYR A OH    1 
ATOM   3127  N  N     . PRO C 3  377  ? 19.078  -56.038  18.959  1.00 33.70  ? 377  PRO A N     1 
ATOM   3128  C  CA    . PRO C 3  377  ? 19.919  -56.612  17.899  1.00 35.13  ? 377  PRO A CA    1 
ATOM   3129  C  C     . PRO C 3  377  ? 19.987  -58.113  17.918  1.00 37.11  ? 377  PRO A C     1 
ATOM   3130  O  O     . PRO C 3  377  ? 20.809  -58.682  18.635  1.00 37.90  ? 377  PRO A O     1 
ATOM   3131  C  CB    . PRO C 3  377  ? 21.283  -56.008  18.174  1.00 34.26  ? 377  PRO A CB    1 
ATOM   3132  C  CG    . PRO C 3  377  ? 21.293  -55.968  19.643  1.00 37.86  ? 377  PRO A CG    1 
ATOM   3133  C  CD    . PRO C 3  377  ? 19.927  -55.369  19.954  1.00 35.02  ? 377  PRO A CD    1 
ATOM   3134  N  N     . GLU C 3  378  ? 19.127  -58.738  17.117  1.00 40.41  ? 378  GLU A N     1 
ATOM   3135  C  CA    . GLU C 3  378  ? 19.046  -60.190  16.991  1.00 42.53  ? 378  GLU A CA    1 
ATOM   3136  C  C     . GLU C 3  378  ? 19.696  -60.590  15.689  1.00 44.05  ? 378  GLU A C     1 
ATOM   3137  O  O     . GLU C 3  378  ? 19.386  -60.013  14.651  1.00 46.99  ? 378  GLU A O     1 
ATOM   3138  C  CB    . GLU C 3  378  ? 17.583  -60.634  16.982  1.00 40.07  ? 378  GLU A CB    1 
ATOM   3139  C  CG    . GLU C 3  378  ? 17.365  -61.991  16.362  1.00 44.65  ? 378  GLU A CG    1 
ATOM   3140  C  CD    . GLU C 3  378  ? 16.365  -62.824  17.134  1.00 50.27  ? 378  GLU A CD    1 
ATOM   3141  O  OE1   . GLU C 3  378  ? 15.257  -62.309  17.417  1.00 54.59  ? 378  GLU A OE1   1 
ATOM   3142  O  OE2   . GLU C 3  378  ? 16.686  -63.993  17.455  1.00 48.79  ? 378  GLU A OE2   1 
ATOM   3143  N  N     . VAL C 3  379  ? 20.599  -61.562  15.726  1.00 45.60  ? 379  VAL A N     1 
ATOM   3144  C  CA    . VAL C 3  379  ? 21.241  -61.991  14.489  1.00 49.21  ? 379  VAL A CA    1 
ATOM   3145  C  C     . VAL C 3  379  ? 20.374  -63.013  13.754  1.00 51.37  ? 379  VAL A C     1 
ATOM   3146  O  O     . VAL C 3  379  ? 19.700  -63.837  14.382  1.00 50.91  ? 379  VAL A O     1 
ATOM   3147  C  CB    . VAL C 3  379  ? 22.639  -62.583  14.750  1.00 49.84  ? 379  VAL A CB    1 
ATOM   3148  C  CG1   . VAL C 3  379  ? 23.105  -63.389  13.536  1.00 49.61  ? 379  VAL A CG1   1 
ATOM   3149  C  CG2   . VAL C 3  379  ? 23.627  -61.450  15.029  1.00 48.39  ? 379  VAL A CG2   1 
ATOM   3150  N  N     . VAL C 3  380  ? 20.385  -62.940  12.422  1.00 53.23  ? 380  VAL A N     1 
ATOM   3151  C  CA    . VAL C 3  380  ? 19.592  -63.842  11.589  1.00 55.37  ? 380  VAL A CA    1 
ATOM   3152  C  C     . VAL C 3  380  ? 20.109  -65.275  11.661  1.00 56.75  ? 380  VAL A C     1 
ATOM   3153  O  O     . VAL C 3  380  ? 21.303  -65.535  11.499  1.00 57.61  ? 380  VAL A O     1 
ATOM   3154  C  CB    . VAL C 3  380  ? 19.578  -63.386  10.118  1.00 54.08  ? 380  VAL A CB    1 
ATOM   3155  C  CG1   . VAL C 3  380  ? 18.620  -64.240  9.339   1.00 54.10  ? 380  VAL A CG1   1 
ATOM   3156  C  CG2   . VAL C 3  380  ? 19.164  -61.932  10.020  1.00 52.62  ? 380  VAL A CG2   1 
ATOM   3157  N  N     . THR C 3  381  ? 19.196  -66.206  11.893  1.00 57.44  ? 381  THR A N     1 
ATOM   3158  C  CA    . THR C 3  381  ? 19.564  -67.599  12.028  1.00 59.02  ? 381  THR A CA    1 
ATOM   3159  C  C     . THR C 3  381  ? 18.498  -68.518  11.511  1.00 60.53  ? 381  THR A C     1 
ATOM   3160  O  O     . THR C 3  381  ? 17.317  -68.306  11.748  1.00 61.97  ? 381  THR A O     1 
ATOM   3161  C  CB    . THR C 3  381  ? 19.801  -67.946  13.488  1.00 60.24  ? 381  THR A CB    1 
ATOM   3162  O  OG1   . THR C 3  381  ? 21.186  -67.770  13.790  1.00 64.56  ? 381  THR A OG1   1 
ATOM   3163  C  CG2   . THR C 3  381  ? 19.381  -69.366  13.778  1.00 60.24  ? 381  THR A CG2   1 
ATOM   3164  N  N     . PRO C 3  382  ? 18.905  -69.580  10.819  1.00 61.60  ? 382  PRO A N     1 
ATOM   3165  C  CA    . PRO C 3  382  ? 17.903  -70.499  10.299  1.00 62.82  ? 382  PRO A CA    1 
ATOM   3166  C  C     . PRO C 3  382  ? 16.796  -70.817  11.308  1.00 64.51  ? 382  PRO A C     1 
ATOM   3167  O  O     . PRO C 3  382  ? 15.676  -71.132  10.904  1.00 66.65  ? 382  PRO A O     1 
ATOM   3168  C  CB    . PRO C 3  382  ? 18.734  -71.715  9.879   1.00 62.84  ? 382  PRO A CB    1 
ATOM   3169  C  CG    . PRO C 3  382  ? 20.028  -71.559  10.653  1.00 61.97  ? 382  PRO A CG    1 
ATOM   3170  C  CD    . PRO C 3  382  ? 20.263  -70.098  10.602  1.00 61.54  ? 382  PRO A CD    1 
ATOM   3171  N  N     . TYR C 3  383  ? 17.078  -70.718  12.609  1.00 64.04  ? 383  TYR A N     1 
ATOM   3172  C  CA    . TYR C 3  383  ? 16.026  -71.002  13.586  1.00 65.21  ? 383  TYR A CA    1 
ATOM   3173  C  C     . TYR C 3  383  ? 15.086  -69.804  13.702  1.00 64.24  ? 383  TYR A C     1 
ATOM   3174  O  O     . TYR C 3  383  ? 14.238  -69.776  14.588  1.00 65.49  ? 383  TYR A O     1 
ATOM   3175  C  CB    . TYR C 3  383  ? 16.565  -71.280  15.008  1.00 67.66  ? 383  TYR A CB    1 
ATOM   3176  C  CG    . TYR C 3  383  ? 17.838  -72.083  15.139  1.00 69.43  ? 383  TYR A CG    1 
ATOM   3177  C  CD1   . TYR C 3  383  ? 18.950  -71.532  15.775  1.00 70.07  ? 383  TYR A CD1   1 
ATOM   3178  C  CD2   . TYR C 3  383  ? 17.948  -73.375  14.620  1.00 72.08  ? 383  TYR A CD2   1 
ATOM   3179  C  CE1   . TYR C 3  383  ? 20.149  -72.235  15.887  1.00 71.60  ? 383  TYR A CE1   1 
ATOM   3180  C  CE2   . TYR C 3  383  ? 19.150  -74.099  14.730  1.00 73.36  ? 383  TYR A CE2   1 
ATOM   3181  C  CZ    . TYR C 3  383  ? 20.246  -73.518  15.359  1.00 72.82  ? 383  TYR A CZ    1 
ATOM   3182  O  OH    . TYR C 3  383  ? 21.440  -74.201  15.427  1.00 70.46  ? 383  TYR A OH    1 
ATOM   3183  N  N     . ASN C 3  384  ? 15.222  -68.804  12.838  1.00 63.23  ? 384  ASN A N     1 
ATOM   3184  C  CA    . ASN C 3  384  ? 14.334  -67.652  12.969  1.00 62.98  ? 384  ASN A CA    1 
ATOM   3185  C  C     . ASN C 3  384  ? 13.956  -66.855  11.723  1.00 63.59  ? 384  ASN A C     1 
ATOM   3186  O  O     . ASN C 3  384  ? 12.847  -66.325  11.654  1.00 64.71  ? 384  ASN A O     1 
ATOM   3187  C  CB    . ASN C 3  384  ? 14.885  -66.679  14.023  1.00 60.32  ? 384  ASN A CB    1 
ATOM   3188  C  CG    . ASN C 3  384  ? 16.130  -65.943  13.561  1.00 57.18  ? 384  ASN A CG    1 
ATOM   3189  O  OD1   . ASN C 3  384  ? 16.380  -65.803  12.365  1.00 57.05  ? 384  ASN A OD1   1 
ATOM   3190  N  ND2   . ASN C 3  384  ? 16.905  -65.443  14.517  1.00 54.41  ? 384  ASN A ND2   1 
ATOM   3191  N  N     . ILE C 3  385  ? 14.860  -66.765  10.751  1.00 62.91  ? 385  ILE A N     1 
ATOM   3192  C  CA    . ILE C 3  385  ? 14.599  -65.997  9.541   1.00 61.44  ? 385  ILE A CA    1 
ATOM   3193  C  C     . ILE C 3  385  ? 13.130  -65.726  9.259   1.00 62.72  ? 385  ILE A C     1 
ATOM   3194  O  O     . ILE C 3  385  ? 12.737  -64.573  9.087   1.00 63.19  ? 385  ILE A O     1 
ATOM   3195  C  CB    . ILE C 3  385  ? 15.217  -66.663  8.307   1.00 59.36  ? 385  ILE A CB    1 
ATOM   3196  C  CG1   . ILE C 3  385  ? 16.536  -65.966  7.985   1.00 54.76  ? 385  ILE A CG1   1 
ATOM   3197  C  CG2   . ILE C 3  385  ? 14.248  -66.602  7.121   1.00 59.86  ? 385  ILE A CG2   1 
ATOM   3198  C  CD1   . ILE C 3  385  ? 17.084  -66.255  6.613   1.00 50.49  ? 385  ILE A CD1   1 
ATOM   3199  N  N     . ASP C 3  386  ? 12.321  -66.781  9.209   1.00 63.16  ? 386  ASP A N     1 
ATOM   3200  C  CA    . ASP C 3  386  ? 10.897  -66.617  8.939   1.00 63.33  ? 386  ASP A CA    1 
ATOM   3201  C  C     . ASP C 3  386  ? 10.295  -65.498  9.784   1.00 60.55  ? 386  ASP A C     1 
ATOM   3202  O  O     . ASP C 3  386  ? 9.714   -64.561  9.240   1.00 60.91  ? 386  ASP A O     1 
ATOM   3203  C  CB    . ASP C 3  386  ? 10.144  -67.932  9.180   1.00 68.70  ? 386  ASP A CB    1 
ATOM   3204  C  CG    . ASP C 3  386  ? 10.605  -69.051  8.247   1.00 73.66  ? 386  ASP A CG    1 
ATOM   3205  O  OD1   . ASP C 3  386  ? 10.725  -68.807  7.021   1.00 73.42  ? 386  ASP A OD1   1 
ATOM   3206  O  OD2   . ASP C 3  386  ? 10.839  -70.178  8.743   1.00 76.83  ? 386  ASP A OD2   1 
ATOM   3207  N  N     . ARG C 3  387  ? 10.441  -65.589  11.104  1.00 57.29  ? 387  ARG A N     1 
ATOM   3208  C  CA    . ARG C 3  387  ? 9.914   -64.556  11.992  1.00 53.90  ? 387  ARG A CA    1 
ATOM   3209  C  C     . ARG C 3  387  ? 10.621  -63.237  11.751  1.00 51.05  ? 387  ARG A C     1 
ATOM   3210  O  O     . ARG C 3  387  ? 9.985   -62.194  11.663  1.00 50.98  ? 387  ARG A O     1 
ATOM   3211  C  CB    . ARG C 3  387  ? 10.100  -64.936  13.458  1.00 56.70  ? 387  ARG A CB    1 
ATOM   3212  C  CG    . ARG C 3  387  ? 9.850   -63.770  14.412  1.00 57.58  ? 387  ARG A CG    1 
ATOM   3213  C  CD    . ARG C 3  387  ? 10.343  -64.069  15.829  1.00 60.80  ? 387  ARG A CD    1 
ATOM   3214  N  NE    . ARG C 3  387  ? 11.744  -64.484  15.853  1.00 59.15  ? 387  ARG A NE    1 
ATOM   3215  C  CZ    . ARG C 3  387  ? 12.574  -64.247  16.861  1.00 58.85  ? 387  ARG A CZ    1 
ATOM   3216  N  NH1   . ARG C 3  387  ? 12.150  -63.593  17.931  1.00 61.76  ? 387  ARG A NH1   1 
ATOM   3217  N  NH2   . ARG C 3  387  ? 13.829  -64.663  16.799  1.00 59.09  ? 387  ARG A NH2   1 
ATOM   3218  N  N     . LEU C 3  388  ? 11.944  -63.284  11.658  1.00 48.69  ? 388  LEU A N     1 
ATOM   3219  C  CA    . LEU C 3  388  ? 12.718  -62.077  11.423  1.00 46.28  ? 388  LEU A CA    1 
ATOM   3220  C  C     . LEU C 3  388  ? 12.332  -61.377  10.131  1.00 45.72  ? 388  LEU A C     1 
ATOM   3221  O  O     . LEU C 3  388  ? 12.007  -60.194  10.138  1.00 44.85  ? 388  LEU A O     1 
ATOM   3222  C  CB    . LEU C 3  388  ? 14.204  -62.400  11.421  1.00 44.15  ? 388  LEU A CB    1 
ATOM   3223  C  CG    . LEU C 3  388  ? 14.776  -62.326  12.830  1.00 42.16  ? 388  LEU A CG    1 
ATOM   3224  C  CD1   . LEU C 3  388  ? 16.214  -62.791  12.867  1.00 46.17  ? 388  LEU A CD1   1 
ATOM   3225  C  CD2   . LEU C 3  388  ? 14.683  -60.899  13.288  1.00 43.44  ? 388  LEU A CD2   1 
ATOM   3226  N  N     . THR C 3  389  ? 12.366  -62.091  9.017   1.00 46.31  ? 389  THR A N     1 
ATOM   3227  C  CA    . THR C 3  389  ? 11.986  -61.467  7.760   1.00 48.65  ? 389  THR A CA    1 
ATOM   3228  C  C     . THR C 3  389  ? 10.574  -60.909  7.871   1.00 47.61  ? 389  THR A C     1 
ATOM   3229  O  O     . THR C 3  389  ? 10.323  -59.764  7.486   1.00 47.76  ? 389  THR A O     1 
ATOM   3230  C  CB    . THR C 3  389  ? 12.031  -62.457  6.584   1.00 51.05  ? 389  THR A CB    1 
ATOM   3231  O  OG1   . THR C 3  389  ? 13.388  -62.654  6.164   1.00 51.05  ? 389  THR A OG1   1 
ATOM   3232  C  CG2   . THR C 3  389  ? 11.229  -61.910  5.420   1.00 55.25  ? 389  THR A CG2   1 
ATOM   3233  N  N     . GLN C 3  390  ? 9.660   -61.725  8.394   1.00 46.45  ? 390  GLN A N     1 
ATOM   3234  C  CA    . GLN C 3  390  ? 8.275   -61.315  8.566   1.00 46.40  ? 390  GLN A CA    1 
ATOM   3235  C  C     . GLN C 3  390  ? 8.215   -59.978  9.308   1.00 45.38  ? 390  GLN A C     1 
ATOM   3236  O  O     . GLN C 3  390  ? 7.481   -59.075  8.903   1.00 46.09  ? 390  GLN A O     1 
ATOM   3237  C  CB    . GLN C 3  390  ? 7.499   -62.403  9.320   1.00 48.73  ? 390  GLN A CB    1 
ATOM   3238  C  CG    . GLN C 3  390  ? 6.128   -62.003  9.882   1.00 55.08  ? 390  GLN A CG    1 
ATOM   3239  C  CD    . GLN C 3  390  ? 5.118   -61.576  8.825   1.00 58.32  ? 390  GLN A CD    1 
ATOM   3240  O  OE1   . GLN C 3  390  ? 5.286   -60.551  8.165   1.00 58.30  ? 390  GLN A OE1   1 
ATOM   3241  N  NE2   . GLN C 3  390  ? 4.053   -62.361  8.670   1.00 61.22  ? 390  GLN A NE2   1 
ATOM   3242  N  N     . LEU C 3  391  ? 8.994   -59.829  10.376  1.00 43.42  ? 391  LEU A N     1 
ATOM   3243  C  CA    . LEU C 3  391  ? 8.984   -58.562  11.110  1.00 42.72  ? 391  LEU A CA    1 
ATOM   3244  C  C     . LEU C 3  391  ? 9.545   -57.434  10.239  1.00 43.93  ? 391  LEU A C     1 
ATOM   3245  O  O     . LEU C 3  391  ? 8.913   -56.392  10.087  1.00 46.56  ? 391  LEU A O     1 
ATOM   3246  C  CB    . LEU C 3  391  ? 9.812   -58.643  12.399  1.00 38.04  ? 391  LEU A CB    1 
ATOM   3247  C  CG    . LEU C 3  391  ? 9.635   -59.812  13.362  1.00 31.92  ? 391  LEU A CG    1 
ATOM   3248  C  CD1   . LEU C 3  391  ? 10.250  -59.448  14.687  1.00 23.35  ? 391  LEU A CD1   1 
ATOM   3249  C  CD2   . LEU C 3  391  ? 8.171   -60.131  13.530  1.00 32.34  ? 391  LEU A CD2   1 
ATOM   3250  N  N     . VAL C 3  392  ? 10.731  -57.638  9.670   1.00 43.40  ? 392  VAL A N     1 
ATOM   3251  C  CA    . VAL C 3  392  ? 11.338  -56.615  8.829   1.00 42.11  ? 392  VAL A CA    1 
ATOM   3252  C  C     . VAL C 3  392  ? 10.325  -56.114  7.822   1.00 42.05  ? 392  VAL A C     1 
ATOM   3253  O  O     . VAL C 3  392  ? 10.356  -54.952  7.419   1.00 38.49  ? 392  VAL A O     1 
ATOM   3254  C  CB    . VAL C 3  392  ? 12.554  -57.145  8.060   1.00 42.05  ? 392  VAL A CB    1 
ATOM   3255  C  CG1   . VAL C 3  392  ? 13.192  -56.013  7.268   1.00 41.31  ? 392  VAL A CG1   1 
ATOM   3256  C  CG2   . VAL C 3  392  ? 13.559  -57.733  9.022   1.00 41.45  ? 392  VAL A CG2   1 
ATOM   3257  N  N     . ARG C 3  393  ? 9.429   -57.001  7.405   1.00 43.89  ? 393  ARG A N     1 
ATOM   3258  C  CA    . ARG C 3  393  ? 8.404   -56.601  6.457   1.00 48.89  ? 393  ARG A CA    1 
ATOM   3259  C  C     . ARG C 3  393  ? 7.360   -55.764  7.187   1.00 48.57  ? 393  ARG A C     1 
ATOM   3260  O  O     . ARG C 3  393  ? 6.801   -54.824  6.618   1.00 49.01  ? 393  ARG A O     1 
ATOM   3261  C  CB    . ARG C 3  393  ? 7.741   -57.821  5.800   1.00 53.18  ? 393  ARG A CB    1 
ATOM   3262  C  CG    . ARG C 3  393  ? 8.573   -58.500  4.703   1.00 60.70  ? 393  ARG A CG    1 
ATOM   3263  C  CD    . ARG C 3  393  ? 7.766   -59.614  4.033   1.00 67.62  ? 393  ARG A CD    1 
ATOM   3264  N  NE    . ARG C 3  393  ? 8.582   -60.507  3.210   1.00 72.23  ? 393  ARG A NE    1 
ATOM   3265  C  CZ    . ARG C 3  393  ? 8.132   -61.633  2.659   1.00 74.98  ? 393  ARG A CZ    1 
ATOM   3266  N  NH1   . ARG C 3  393  ? 6.871   -62.006  2.841   1.00 78.13  ? 393  ARG A NH1   1 
ATOM   3267  N  NH2   . ARG C 3  393  ? 8.940   -62.395  1.931   1.00 76.59  ? 393  ARG A NH2   1 
ATOM   3268  N  N     . ASN C 3  394  ? 7.105   -56.097  8.448   1.00 46.87  ? 394  ASN A N     1 
ATOM   3269  C  CA    . ASN C 3  394  ? 6.136   -55.348  9.221   1.00 45.88  ? 394  ASN A CA    1 
ATOM   3270  C  C     . ASN C 3  394  ? 6.565   -53.911  9.413   1.00 44.54  ? 394  ASN A C     1 
ATOM   3271  O  O     . ASN C 3  394  ? 5.732   -53.046  9.652   1.00 48.38  ? 394  ASN A O     1 
ATOM   3272  C  CB    . ASN C 3  394  ? 5.891   -55.999  10.574  1.00 48.79  ? 394  ASN A CB    1 
ATOM   3273  C  CG    . ASN C 3  394  ? 4.708   -56.925  10.547  1.00 55.32  ? 394  ASN A CG    1 
ATOM   3274  O  OD1   . ASN C 3  394  ? 3.641   -56.556  10.054  1.00 57.75  ? 394  ASN A OD1   1 
ATOM   3275  N  ND2   . ASN C 3  394  ? 4.879   -58.135  11.077  1.00 60.54  ? 394  ASN A ND2   1 
ATOM   3276  N  N     . GLY C 3  395  ? 7.858   -53.640  9.319   1.00 41.53  ? 395  GLY A N     1 
ATOM   3277  C  CA    . GLY C 3  395  ? 8.298   -52.265  9.463   1.00 41.24  ? 395  GLY A CA    1 
ATOM   3278  C  C     . GLY C 3  395  ? 8.207   -51.663  10.853  1.00 40.09  ? 395  GLY A C     1 
ATOM   3279  O  O     . GLY C 3  395  ? 7.532   -52.198  11.723  1.00 39.87  ? 395  GLY A O     1 
ATOM   3280  N  N     . PRO C 3  396  ? 8.863   -50.514  11.073  1.00 39.55  ? 396  PRO A N     1 
ATOM   3281  C  CA    . PRO C 3  396  ? 8.929   -49.766  12.331  1.00 41.20  ? 396  PRO A CA    1 
ATOM   3282  C  C     . PRO C 3  396  ? 7.683   -49.096  12.916  1.00 44.23  ? 396  PRO A C     1 
ATOM   3283  O  O     . PRO C 3  396  ? 7.803   -48.328  13.870  1.00 43.75  ? 396  PRO A O     1 
ATOM   3284  C  CB    . PRO C 3  396  ? 10.022  -48.747  12.044  1.00 36.74  ? 396  PRO A CB    1 
ATOM   3285  C  CG    . PRO C 3  396  ? 9.785   -48.432  10.626  1.00 33.35  ? 396  PRO A CG    1 
ATOM   3286  C  CD    . PRO C 3  396  ? 9.600   -49.796  10.019  1.00 36.11  ? 396  PRO A CD    1 
ATOM   3287  N  N     . ASN C 3  397  ? 6.495   -49.370  12.391  1.00 47.63  ? 397  ASN A N     1 
ATOM   3288  C  CA    . ASN C 3  397  ? 5.334   -48.690  12.950  1.00 51.90  ? 397  ASN A CA    1 
ATOM   3289  C  C     . ASN C 3  397  ? 4.090   -49.543  13.082  1.00 52.71  ? 397  ASN A C     1 
ATOM   3290  O  O     . ASN C 3  397  ? 2.968   -49.048  13.041  1.00 53.19  ? 397  ASN A O     1 
ATOM   3291  C  CB    . ASN C 3  397  ? 5.036   -47.431  12.138  1.00 58.10  ? 397  ASN A CB    1 
ATOM   3292  C  CG    . ASN C 3  397  ? 6.250   -46.947  11.355  1.00 64.99  ? 397  ASN A CG    1 
ATOM   3293  O  OD1   . ASN C 3  397  ? 6.769   -47.671  10.500  1.00 72.05  ? 397  ASN A OD1   1 
ATOM   3294  N  ND2   . ASN C 3  397  ? 6.712   -45.730  11.644  1.00 63.77  ? 397  ASN A ND2   1 
ATOM   3295  N  N     . GLU C 3  398  ? 4.310   -50.839  13.223  1.00 53.94  ? 398  GLU A N     1 
ATOM   3296  C  CA    . GLU C 3  398  ? 3.250   -51.810  13.450  1.00 56.40  ? 398  GLU A CA    1 
ATOM   3297  C  C     . GLU C 3  398  ? 4.013   -52.614  14.501  1.00 55.34  ? 398  GLU A C     1 
ATOM   3298  O  O     . GLU C 3  398  ? 5.171   -52.971  14.267  1.00 54.77  ? 398  GLU A O     1 
ATOM   3299  C  CB    . GLU C 3  398  ? 2.965   -52.632  12.187  1.00 61.12  ? 398  GLU A CB    1 
ATOM   3300  C  CG    . GLU C 3  398  ? 1.560   -53.255  12.163  1.00 67.16  ? 398  GLU A CG    1 
ATOM   3301  C  CD    . GLU C 3  398  ? 1.294   -54.076  10.911  1.00 73.07  ? 398  GLU A CD    1 
ATOM   3302  O  OE1   . GLU C 3  398  ? 1.989   -55.094  10.692  1.00 72.82  ? 398  GLU A OE1   1 
ATOM   3303  O  OE2   . GLU C 3  398  ? 0.384   -53.698  10.141  1.00 78.52  ? 398  GLU A OE2   1 
ATOM   3304  N  N     . HIS C 3  399  ? 3.400   -52.908  15.645  1.00 54.55  ? 399  HIS A N     1 
ATOM   3305  C  CA    . HIS C 3  399  ? 4.170   -53.560  16.689  1.00 54.35  ? 399  HIS A CA    1 
ATOM   3306  C  C     . HIS C 3  399  ? 5.142   -54.699  16.427  1.00 54.64  ? 399  HIS A C     1 
ATOM   3307  O  O     . HIS C 3  399  ? 6.352   -54.481  16.471  1.00 58.98  ? 399  HIS A O     1 
ATOM   3308  C  CB    . HIS C 3  399  ? 3.338   -53.985  17.882  1.00 54.48  ? 399  HIS A CB    1 
ATOM   3309  C  CG    . HIS C 3  399  ? 4.180   -54.622  18.940  1.00 55.98  ? 399  HIS A CG    1 
ATOM   3310  N  ND1   . HIS C 3  399  ? 5.381   -54.073  19.342  1.00 56.02  ? 399  HIS A ND1   1 
ATOM   3311  C  CD2   . HIS C 3  399  ? 4.075   -55.806  19.586  1.00 57.93  ? 399  HIS A CD2   1 
ATOM   3312  C  CE1   . HIS C 3  399  ? 5.982   -54.894  20.183  1.00 55.25  ? 399  HIS A CE1   1 
ATOM   3313  N  NE2   . HIS C 3  399  ? 5.211   -55.954  20.348  1.00 59.58  ? 399  HIS A NE2   1 
ATOM   3314  N  N     . PRO C 3  400  ? 4.659   -55.931  16.193  1.00 50.51  ? 400  PRO A N     1 
ATOM   3315  C  CA    . PRO C 3  400  ? 5.720   -56.926  15.972  1.00 46.06  ? 400  PRO A CA    1 
ATOM   3316  C  C     . PRO C 3  400  ? 6.682   -56.626  14.809  1.00 43.70  ? 400  PRO A C     1 
ATOM   3317  O  O     . PRO C 3  400  ? 7.107   -57.534  14.113  1.00 45.66  ? 400  PRO A O     1 
ATOM   3318  C  CB    . PRO C 3  400  ? 4.939   -58.221  15.778  1.00 43.87  ? 400  PRO A CB    1 
ATOM   3319  C  CG    . PRO C 3  400  ? 3.691   -57.987  16.595  1.00 46.51  ? 400  PRO A CG    1 
ATOM   3320  C  CD    . PRO C 3  400  ? 3.331   -56.565  16.249  1.00 46.57  ? 400  PRO A CD    1 
ATOM   3321  N  N     . GLY C 3  401  ? 7.038   -55.359  14.612  1.00 39.98  ? 401  GLY A N     1 
ATOM   3322  C  CA    . GLY C 3  401  ? 7.941   -54.998  13.537  1.00 39.93  ? 401  GLY A CA    1 
ATOM   3323  C  C     . GLY C 3  401  ? 9.360   -54.699  13.991  1.00 39.01  ? 401  GLY A C     1 
ATOM   3324  O  O     . GLY C 3  401  ? 9.741   -55.065  15.096  1.00 40.25  ? 401  GLY A O     1 
ATOM   3325  N  N     . ALA C 3  402  ? 10.138  -54.023  13.147  1.00 37.36  ? 402  ALA A N     1 
ATOM   3326  C  CA    . ALA C 3  402  ? 11.516  -53.678  13.477  1.00 35.13  ? 402  ALA A CA    1 
ATOM   3327  C  C     . ALA C 3  402  ? 11.999  -52.370  12.838  1.00 35.65  ? 402  ALA A C     1 
ATOM   3328  O  O     . ALA C 3  402  ? 11.283  -51.722  12.077  1.00 35.97  ? 402  ALA A O     1 
ATOM   3329  C  CB    . ALA C 3  402  ? 12.424  -54.803  13.067  1.00 32.60  ? 402  ALA A CB    1 
ATOM   3330  N  N     . LYS C 3  403  ? 13.225  -51.989  13.171  1.00 35.75  ? 403  LYS A N     1 
ATOM   3331  C  CA    . LYS C 3  403  ? 13.865  -50.787  12.646  1.00 35.84  ? 403  LYS A CA    1 
ATOM   3332  C  C     . LYS C 3  403  ? 15.261  -51.265  12.327  1.00 36.97  ? 403  LYS A C     1 
ATOM   3333  O  O     . LYS C 3  403  ? 15.704  -52.254  12.894  1.00 42.69  ? 403  LYS A O     1 
ATOM   3334  C  CB    . LYS C 3  403  ? 13.956  -49.728  13.732  1.00 35.20  ? 403  LYS A CB    1 
ATOM   3335  C  CG    . LYS C 3  403  ? 12.636  -49.471  14.447  1.00 41.45  ? 403  LYS A CG    1 
ATOM   3336  C  CD    . LYS C 3  403  ? 12.825  -48.717  15.770  1.00 46.16  ? 403  LYS A CD    1 
ATOM   3337  C  CE    . LYS C 3  403  ? 13.516  -47.363  15.598  1.00 48.84  ? 403  LYS A CE    1 
ATOM   3338  N  NZ    . LYS C 3  403  ? 13.821  -46.721  16.919  1.00 49.67  ? 403  LYS A NZ    1 
ATOM   3339  N  N     . TYR C 3  404  ? 15.958  -50.612  11.413  1.00 35.13  ? 404  TYR A N     1 
ATOM   3340  C  CA    . TYR C 3  404  ? 17.333  -51.020  11.107  1.00 32.96  ? 404  TYR A CA    1 
ATOM   3341  C  C     . TYR C 3  404  ? 17.684  -52.485  10.802  1.00 32.32  ? 404  TYR A C     1 
ATOM   3342  O  O     . TYR C 3  404  ? 17.241  -53.412  11.476  1.00 28.56  ? 404  TYR A O     1 
ATOM   3343  C  CB    . TYR C 3  404  ? 18.233  -50.567  12.250  1.00 31.25  ? 404  TYR A CB    1 
ATOM   3344  C  CG    . TYR C 3  404  ? 18.198  -49.088  12.465  1.00 32.53  ? 404  TYR A CG    1 
ATOM   3345  C  CD1   . TYR C 3  404  ? 17.849  -48.558  13.692  1.00 35.99  ? 404  TYR A CD1   1 
ATOM   3346  C  CD2   . TYR C 3  404  ? 18.508  -48.212  11.431  1.00 35.12  ? 404  TYR A CD2   1 
ATOM   3347  C  CE1   . TYR C 3  404  ? 17.807  -47.185  13.895  1.00 41.46  ? 404  TYR A CE1   1 
ATOM   3348  C  CE2   . TYR C 3  404  ? 18.469  -46.838  11.617  1.00 38.71  ? 404  TYR A CE2   1 
ATOM   3349  C  CZ    . TYR C 3  404  ? 18.116  -46.329  12.853  1.00 41.45  ? 404  TYR A CZ    1 
ATOM   3350  O  OH    . TYR C 3  404  ? 18.059  -44.965  13.047  1.00 46.05  ? 404  TYR A OH    1 
ATOM   3351  N  N     . VAL C 3  405  ? 18.510  -52.674  9.779   1.00 35.64  ? 405  VAL A N     1 
ATOM   3352  C  CA    . VAL C 3  405  ? 19.012  -53.999  9.420   1.00 40.28  ? 405  VAL A CA    1 
ATOM   3353  C  C     . VAL C 3  405  ? 20.522  -53.864  9.205   1.00 42.20  ? 405  VAL A C     1 
ATOM   3354  O  O     . VAL C 3  405  ? 20.978  -53.129  8.335   1.00 40.56  ? 405  VAL A O     1 
ATOM   3355  C  CB    . VAL C 3  405  ? 18.362  -54.565  8.149   1.00 41.04  ? 405  VAL A CB    1 
ATOM   3356  C  CG1   . VAL C 3  405  ? 19.069  -55.858  7.752   1.00 40.42  ? 405  VAL A CG1   1 
ATOM   3357  C  CG2   . VAL C 3  405  ? 16.888  -54.859  8.403   1.00 41.21  ? 405  VAL A CG2   1 
ATOM   3358  N  N     . ILE C 3  406  ? 21.284  -54.582  10.017  1.00 46.46  ? 406  ILE A N     1 
ATOM   3359  C  CA    . ILE C 3  406  ? 22.735  -54.531  9.983   1.00 52.46  ? 406  ILE A CA    1 
ATOM   3360  C  C     . ILE C 3  406  ? 23.376  -55.636  9.149   1.00 57.43  ? 406  ILE A C     1 
ATOM   3361  O  O     . ILE C 3  406  ? 23.009  -56.804  9.269   1.00 58.02  ? 406  ILE A O     1 
ATOM   3362  C  CB    . ILE C 3  406  ? 23.246  -54.585  11.407  1.00 51.33  ? 406  ILE A CB    1 
ATOM   3363  C  CG1   . ILE C 3  406  ? 22.455  -53.575  12.241  1.00 52.44  ? 406  ILE A CG1   1 
ATOM   3364  C  CG2   . ILE C 3  406  ? 24.714  -54.266  11.445  1.00 55.10  ? 406  ILE A CG2   1 
ATOM   3365  C  CD1   . ILE C 3  406  ? 22.826  -53.516  13.706  1.00 56.76  ? 406  ILE A CD1   1 
ATOM   3366  N  N     . ARG C 3  407  ? 24.348  -55.261  8.320   1.00 63.23  ? 407  ARG A N     1 
ATOM   3367  C  CA    . ARG C 3  407  ? 25.021  -56.210  7.433   1.00 70.71  ? 407  ARG A CA    1 
ATOM   3368  C  C     . ARG C 3  407  ? 26.511  -56.427  7.687   1.00 76.23  ? 407  ARG A C     1 
ATOM   3369  O  O     . ARG C 3  407  ? 27.150  -55.682  8.434   1.00 77.46  ? 407  ARG A O     1 
ATOM   3370  C  CB    . ARG C 3  407  ? 24.853  -55.762  5.989   1.00 71.27  ? 407  ARG A CB    1 
ATOM   3371  C  CG    . ARG C 3  407  ? 23.425  -55.565  5.568   1.00 73.97  ? 407  ARG A CG    1 
ATOM   3372  C  CD    . ARG C 3  407  ? 23.338  -54.441  4.560   1.00 76.03  ? 407  ARG A CD    1 
ATOM   3373  N  NE    . ARG C 3  407  ? 24.142  -54.707  3.375   1.00 78.75  ? 407  ARG A NE    1 
ATOM   3374  C  CZ    . ARG C 3  407  ? 24.461  -53.787  2.473   1.00 79.54  ? 407  ARG A CZ    1 
ATOM   3375  N  NH1   . ARG C 3  407  ? 24.046  -52.535  2.625   1.00 78.73  ? 407  ARG A NH1   1 
ATOM   3376  N  NH2   . ARG C 3  407  ? 25.194  -54.120  1.421   1.00 80.40  ? 407  ARG A NH2   1 
ATOM   3377  N  N     . ASP C 3  408  ? 27.044  -57.453  7.020   1.00 81.31  ? 408  ASP A N     1 
ATOM   3378  C  CA    . ASP C 3  408  ? 28.453  -57.858  7.094   1.00 85.82  ? 408  ASP A CA    1 
ATOM   3379  C  C     . ASP C 3  408  ? 29.434  -56.688  7.193   1.00 87.48  ? 408  ASP A C     1 
ATOM   3380  O  O     . ASP C 3  408  ? 30.245  -56.616  8.118   1.00 87.96  ? 408  ASP A O     1 
ATOM   3381  C  CB    . ASP C 3  408  ? 28.817  -58.696  5.855   1.00 89.03  ? 408  ASP A CB    1 
ATOM   3382  C  CG    . ASP C 3  408  ? 28.238  -60.106  5.893   1.00 92.03  ? 408  ASP A CG    1 
ATOM   3383  O  OD1   . ASP C 3  408  ? 27.931  -60.648  4.807   1.00 92.14  ? 408  ASP A OD1   1 
ATOM   3384  O  OD2   . ASP C 3  408  ? 28.108  -60.679  6.996   1.00 94.63  ? 408  ASP A OD2   1 
ATOM   3385  N  N     . SER C 3  409  ? 29.358  -55.785  6.221   1.00 88.57  ? 409  SER A N     1 
ATOM   3386  C  CA    . SER C 3  409  ? 30.240  -54.628  6.159   1.00 90.14  ? 409  SER A CA    1 
ATOM   3387  C  C     . SER C 3  409  ? 30.081  -53.661  7.326   1.00 91.17  ? 409  SER A C     1 
ATOM   3388  O  O     . SER C 3  409  ? 30.986  -52.872  7.619   1.00 91.66  ? 409  SER A O     1 
ATOM   3389  C  CB    . SER C 3  409  ? 30.012  -53.897  4.838   1.00 90.44  ? 409  SER A CB    1 
ATOM   3390  O  OG    . SER C 3  409  ? 28.630  -53.846  4.538   1.00 89.95  ? 409  SER A OG    1 
ATOM   3391  N  N     . GLY C 3  410  ? 28.931  -53.726  7.987   1.00 91.57  ? 410  GLY A N     1 
ATOM   3392  C  CA    . GLY C 3  410  ? 28.684  -52.850  9.116   1.00 91.58  ? 410  GLY A CA    1 
ATOM   3393  C  C     . GLY C 3  410  ? 27.832  -51.666  8.723   1.00 90.92  ? 410  GLY A C     1 
ATOM   3394  O  O     . GLY C 3  410  ? 27.936  -50.593  9.315   1.00 91.62  ? 410  GLY A O     1 
ATOM   3395  N  N     . ASP C 3  411  ? 26.991  -51.860  7.711   1.00 90.47  ? 411  ASP A N     1 
ATOM   3396  C  CA    . ASP C 3  411  ? 26.105  -50.803  7.239   1.00 88.79  ? 411  ASP A CA    1 
ATOM   3397  C  C     . ASP C 3  411  ? 24.746  -50.879  7.911   1.00 84.08  ? 411  ASP A C     1 
ATOM   3398  O  O     . ASP C 3  411  ? 24.294  -51.951  8.313   1.00 84.81  ? 411  ASP A O     1 
ATOM   3399  C  CB    . ASP C 3  411  ? 25.933  -50.889  5.725   1.00 95.01  ? 411  ASP A CB    1 
ATOM   3400  C  CG    . ASP C 3  411  ? 27.152  -50.388  4.979   1.00 101.33 ? 411  ASP A CG    1 
ATOM   3401  O  OD1   . ASP C 3  411  ? 27.592  -49.255  5.285   1.00 103.27 ? 411  ASP A OD1   1 
ATOM   3402  O  OD2   . ASP C 3  411  ? 27.663  -51.114  4.091   1.00 104.45 ? 411  ASP A OD2   1 
ATOM   3403  N  N     . ARG C 3  412  ? 24.089  -49.734  8.028   1.00 78.20  ? 412  ARG A N     1 
ATOM   3404  C  CA    . ARG C 3  412  ? 22.792  -49.696  8.672   1.00 72.14  ? 412  ARG A CA    1 
ATOM   3405  C  C     . ARG C 3  412  ? 21.667  -49.355  7.709   1.00 66.88  ? 412  ARG A C     1 
ATOM   3406  O  O     . ARG C 3  412  ? 21.527  -48.212  7.274   1.00 66.45  ? 412  ARG A O     1 
ATOM   3407  C  CB    . ARG C 3  412  ? 22.815  -48.695  9.836   1.00 74.66  ? 412  ARG A CB    1 
ATOM   3408  C  CG    . ARG C 3  412  ? 22.460  -49.334  11.171  1.00 77.72  ? 412  ARG A CG    1 
ATOM   3409  C  CD    . ARG C 3  412  ? 22.634  -48.410  12.377  1.00 80.60  ? 412  ARG A CD    1 
ATOM   3410  N  NE    . ARG C 3  412  ? 22.165  -49.082  13.589  1.00 86.32  ? 412  ARG A NE    1 
ATOM   3411  C  CZ    . ARG C 3  412  ? 22.790  -50.097  14.186  1.00 90.05  ? 412  ARG A CZ    1 
ATOM   3412  N  NH1   . ARG C 3  412  ? 23.934  -50.565  13.701  1.00 90.76  ? 412  ARG A NH1   1 
ATOM   3413  N  NH2   . ARG C 3  412  ? 22.249  -50.678  15.252  1.00 92.14  ? 412  ARG A NH2   1 
ATOM   3414  N  N     . ILE C 3  413  ? 20.875  -50.364  7.365   1.00 60.96  ? 413  ILE A N     1 
ATOM   3415  C  CA    . ILE C 3  413  ? 19.736  -50.163  6.481   1.00 54.07  ? 413  ILE A CA    1 
ATOM   3416  C  C     . ILE C 3  413  ? 18.593  -49.693  7.356   1.00 50.61  ? 413  ILE A C     1 
ATOM   3417  O  O     . ILE C 3  413  ? 18.042  -50.455  8.148   1.00 48.14  ? 413  ILE A O     1 
ATOM   3418  C  CB    . ILE C 3  413  ? 19.317  -51.456  5.780   1.00 52.80  ? 413  ILE A CB    1 
ATOM   3419  C  CG1   . ILE C 3  413  ? 20.432  -51.909  4.846   1.00 52.62  ? 413  ILE A CG1   1 
ATOM   3420  C  CG2   . ILE C 3  413  ? 18.037  -51.230  4.990   1.00 50.10  ? 413  ILE A CG2   1 
ATOM   3421  C  CD1   . ILE C 3  413  ? 20.142  -53.202  4.140   1.00 53.82  ? 413  ILE A CD1   1 
ATOM   3422  N  N     . ASP C 3  414  ? 18.253  -48.424  7.208   1.00 46.14  ? 414  ASP A N     1 
ATOM   3423  C  CA    . ASP C 3  414  ? 17.202  -47.817  7.994   1.00 43.75  ? 414  ASP A CA    1 
ATOM   3424  C  C     . ASP C 3  414  ? 15.830  -48.175  7.451   1.00 42.28  ? 414  ASP A C     1 
ATOM   3425  O  O     . ASP C 3  414  ? 15.401  -47.624  6.456   1.00 43.64  ? 414  ASP A O     1 
ATOM   3426  C  CB    . ASP C 3  414  ? 17.387  -46.314  7.974   1.00 46.32  ? 414  ASP A CB    1 
ATOM   3427  C  CG    . ASP C 3  414  ? 16.417  -45.614  8.864   1.00 49.20  ? 414  ASP A CG    1 
ATOM   3428  O  OD1   . ASP C 3  414  ? 15.211  -45.907  8.730   1.00 54.26  ? 414  ASP A OD1   1 
ATOM   3429  O  OD2   . ASP C 3  414  ? 16.856  -44.780  9.689   1.00 46.78  ? 414  ASP A OD2   1 
ATOM   3430  N  N     . LEU C 3  415  ? 15.121  -49.061  8.134   1.00 40.37  ? 415  LEU A N     1 
ATOM   3431  C  CA    . LEU C 3  415  ? 13.816  -49.516  7.671   1.00 38.12  ? 415  LEU A CA    1 
ATOM   3432  C  C     . LEU C 3  415  ? 12.644  -48.553  7.512   1.00 38.76  ? 415  LEU A C     1 
ATOM   3433  O  O     . LEU C 3  415  ? 11.572  -48.974  7.083   1.00 39.35  ? 415  LEU A O     1 
ATOM   3434  C  CB    . LEU C 3  415  ? 13.353  -50.688  8.529   1.00 35.04  ? 415  LEU A CB    1 
ATOM   3435  C  CG    . LEU C 3  415  ? 14.020  -52.019  8.219   1.00 33.35  ? 415  LEU A CG    1 
ATOM   3436  C  CD1   . LEU C 3  415  ? 13.405  -53.096  9.085   1.00 34.10  ? 415  LEU A CD1   1 
ATOM   3437  C  CD2   . LEU C 3  415  ? 13.845  -52.349  6.753   1.00 31.74  ? 415  LEU A CD2   1 
ATOM   3438  N  N     . ARG C 3  416  ? 12.801  -47.282  7.842   1.00 39.13  ? 416  ARG A N     1 
ATOM   3439  C  CA    . ARG C 3  416  ? 11.662  -46.387  7.690   1.00 42.67  ? 416  ARG A CA    1 
ATOM   3440  C  C     . ARG C 3  416  ? 11.776  -45.482  6.471   1.00 44.46  ? 416  ARG A C     1 
ATOM   3441  O  O     . ARG C 3  416  ? 10.787  -44.888  6.030   1.00 47.34  ? 416  ARG A O     1 
ATOM   3442  C  CB    . ARG C 3  416  ? 11.472  -45.566  8.954   1.00 44.97  ? 416  ARG A CB    1 
ATOM   3443  C  CG    . ARG C 3  416  ? 12.706  -44.856  9.392   1.00 50.66  ? 416  ARG A CG    1 
ATOM   3444  C  CD    . ARG C 3  416  ? 12.525  -44.263  10.768  1.00 57.58  ? 416  ARG A CD    1 
ATOM   3445  N  NE    . ARG C 3  416  ? 13.689  -43.475  11.155  1.00 63.32  ? 416  ARG A NE    1 
ATOM   3446  C  CZ    . ARG C 3  416  ? 13.776  -42.770  12.276  1.00 66.00  ? 416  ARG A CZ    1 
ATOM   3447  N  NH1   . ARG C 3  416  ? 12.763  -42.747  13.135  1.00 66.90  ? 416  ARG A NH1   1 
ATOM   3448  N  NH2   . ARG C 3  416  ? 14.881  -42.085  12.536  1.00 68.12  ? 416  ARG A NH2   1 
ATOM   3449  N  N     . TYR C 3  417  ? 12.994  -45.379  5.945   1.00 44.57  ? 417  TYR A N     1 
ATOM   3450  C  CA    . TYR C 3  417  ? 13.307  -44.606  4.741   1.00 41.56  ? 417  TYR A CA    1 
ATOM   3451  C  C     . TYR C 3  417  ? 14.147  -45.645  4.033   1.00 39.53  ? 417  TYR A C     1 
ATOM   3452  O  O     . TYR C 3  417  ? 14.837  -46.392  4.702   1.00 41.12  ? 417  TYR A O     1 
ATOM   3453  C  CB    . TYR C 3  417  ? 14.204  -43.421  5.068   1.00 42.23  ? 417  TYR A CB    1 
ATOM   3454  C  CG    . TYR C 3  417  ? 13.746  -42.570  6.226   1.00 48.42  ? 417  TYR A CG    1 
ATOM   3455  C  CD1   . TYR C 3  417  ? 14.674  -41.903  7.032   1.00 51.11  ? 417  TYR A CD1   1 
ATOM   3456  C  CD2   . TYR C 3  417  ? 12.389  -42.394  6.502   1.00 51.27  ? 417  TYR A CD2   1 
ATOM   3457  C  CE1   . TYR C 3  417  ? 14.259  -41.078  8.089   1.00 52.51  ? 417  TYR A CE1   1 
ATOM   3458  C  CE2   . TYR C 3  417  ? 11.962  -41.569  7.553   1.00 52.04  ? 417  TYR A CE2   1 
ATOM   3459  C  CZ    . TYR C 3  417  ? 12.903  -40.917  8.341   1.00 51.65  ? 417  TYR A CZ    1 
ATOM   3460  O  OH    . TYR C 3  417  ? 12.488  -40.112  9.376   1.00 48.69  ? 417  TYR A OH    1 
ATOM   3461  N  N     . SER C 3  418  ? 14.097  -45.720  2.714   1.00 36.26  ? 418  SER A N     1 
ATOM   3462  C  CA    . SER C 3  418  ? 14.909  -46.697  1.996   1.00 35.32  ? 418  SER A CA    1 
ATOM   3463  C  C     . SER C 3  418  ? 14.175  -47.318  0.838   1.00 34.99  ? 418  SER A C     1 
ATOM   3464  O  O     . SER C 3  418  ? 13.499  -48.325  1.007   1.00 34.75  ? 418  SER A O     1 
ATOM   3465  C  CB    . SER C 3  418  ? 15.367  -47.835  2.907   1.00 33.36  ? 418  SER A CB    1 
ATOM   3466  O  OG    . SER C 3  418  ? 16.285  -48.677  2.232   1.00 39.35  ? 418  SER A OG    1 
ATOM   3467  N  N     . LYS C 3  419  ? 14.313  -46.723  -0.336  1.00 33.81  ? 419  LYS A N     1 
ATOM   3468  C  CA    . LYS C 3  419  ? 13.671  -47.252  -1.511  1.00 35.37  ? 419  LYS A CA    1 
ATOM   3469  C  C     . LYS C 3  419  ? 13.565  -48.765  -1.346  1.00 38.64  ? 419  LYS A C     1 
ATOM   3470  O  O     . LYS C 3  419  ? 12.560  -49.374  -1.724  1.00 40.85  ? 419  LYS A O     1 
ATOM   3471  C  CB    . LYS C 3  419  ? 14.514  -46.914  -2.728  1.00 33.77  ? 419  LYS A CB    1 
ATOM   3472  C  CG    . LYS C 3  419  ? 15.974  -47.244  -2.515  1.00 33.34  ? 419  LYS A CG    1 
ATOM   3473  C  CD    . LYS C 3  419  ? 16.831  -46.886  -3.706  1.00 34.41  ? 419  LYS A CD    1 
ATOM   3474  C  CE    . LYS C 3  419  ? 16.768  -45.414  -3.988  1.00 34.66  ? 419  LYS A CE    1 
ATOM   3475  N  NZ    . LYS C 3  419  ? 16.893  -44.663  -2.718  1.00 39.82  ? 419  LYS A NZ    1 
ATOM   3476  N  N     . ARG C 3  420  ? 14.593  -49.371  -0.752  1.00 40.18  ? 420  ARG A N     1 
ATOM   3477  C  CA    . ARG C 3  420  ? 14.598  -50.817  -0.564  1.00 43.17  ? 420  ARG A CA    1 
ATOM   3478  C  C     . ARG C 3  420  ? 14.232  -51.300  0.831   1.00 43.40  ? 420  ARG A C     1 
ATOM   3479  O  O     . ARG C 3  420  ? 14.900  -52.171  1.376   1.00 44.29  ? 420  ARG A O     1 
ATOM   3480  C  CB    . ARG C 3  420  ? 15.958  -51.406  -0.968  1.00 46.12  ? 420  ARG A CB    1 
ATOM   3481  C  CG    . ARG C 3  420  ? 16.254  -51.328  -2.467  1.00 51.16  ? 420  ARG A CG    1 
ATOM   3482  C  CD    . ARG C 3  420  ? 17.469  -52.154  -2.840  1.00 57.98  ? 420  ARG A CD    1 
ATOM   3483  N  NE    . ARG C 3  420  ? 17.264  -53.581  -2.601  1.00 62.51  ? 420  ARG A NE    1 
ATOM   3484  C  CZ    . ARG C 3  420  ? 18.235  -54.492  -2.636  1.00 64.90  ? 420  ARG A CZ    1 
ATOM   3485  N  NH1   . ARG C 3  420  ? 19.482  -54.125  -2.899  1.00 65.15  ? 420  ARG A NH1   1 
ATOM   3486  N  NH2   . ARG C 3  420  ? 17.965  -55.771  -2.406  1.00 67.39  ? 420  ARG A NH2   1 
ATOM   3487  N  N     . ALA C 3  421  ? 13.161  -50.757  1.398   1.00 44.65  ? 421  ALA A N     1 
ATOM   3488  C  CA    . ALA C 3  421  ? 12.725  -51.164  2.731   1.00 46.02  ? 421  ALA A CA    1 
ATOM   3489  C  C     . ALA C 3  421  ? 11.610  -52.181  2.612   1.00 47.80  ? 421  ALA A C     1 
ATOM   3490  O  O     . ALA C 3  421  ? 11.249  -52.832  3.587   1.00 48.31  ? 421  ALA A O     1 
ATOM   3491  C  CB    . ALA C 3  421  ? 12.247  -49.965  3.519   1.00 46.71  ? 421  ALA A CB    1 
ATOM   3492  N  N     . GLY C 3  422  ? 11.056  -52.294  1.410   1.00 50.04  ? 422  GLY A N     1 
ATOM   3493  C  CA    . GLY C 3  422  ? 9.996   -53.251  1.163   1.00 53.29  ? 422  GLY A CA    1 
ATOM   3494  C  C     . GLY C 3  422  ? 10.572  -54.417  0.387   1.00 55.10  ? 422  GLY A C     1 
ATOM   3495  O  O     . GLY C 3  422  ? 9.852   -55.289  -0.093  1.00 56.30  ? 422  GLY A O     1 
ATOM   3496  N  N     . ASP C 3  423  ? 11.895  -54.408  0.270   1.00 57.32  ? 423  ASP A N     1 
ATOM   3497  C  CA    . ASP C 3  423  ? 12.662  -55.428  -0.434  1.00 59.87  ? 423  ASP A CA    1 
ATOM   3498  C  C     . ASP C 3  423  ? 13.409  -56.185  0.669   1.00 61.04  ? 423  ASP A C     1 
ATOM   3499  O  O     . ASP C 3  423  ? 12.792  -56.832  1.521   1.00 63.09  ? 423  ASP A O     1 
ATOM   3500  C  CB    . ASP C 3  423  ? 13.655  -54.730  -1.366  1.00 63.19  ? 423  ASP A CB    1 
ATOM   3501  C  CG    . ASP C 3  423  ? 14.269  -55.662  -2.376  1.00 68.98  ? 423  ASP A CG    1 
ATOM   3502  O  OD1   . ASP C 3  423  ? 14.590  -56.816  -2.006  1.00 73.68  ? 423  ASP A OD1   1 
ATOM   3503  O  OD2   . ASP C 3  423  ? 14.443  -55.228  -3.540  1.00 69.31  ? 423  ASP A OD2   1 
ATOM   3504  N  N     . ILE C 3  424  ? 14.736  -56.097  0.652   1.00 61.10  ? 424  ILE A N     1 
ATOM   3505  C  CA    . ILE C 3  424  ? 15.573  -56.719  1.678   1.00 60.06  ? 424  ILE A CA    1 
ATOM   3506  C  C     . ILE C 3  424  ? 15.382  -58.208  1.917   1.00 59.41  ? 424  ILE A C     1 
ATOM   3507  O  O     . ILE C 3  424  ? 14.446  -58.624  2.599   1.00 58.06  ? 424  ILE A O     1 
ATOM   3508  C  CB    . ILE C 3  424  ? 15.377  -56.004  3.034   1.00 59.81  ? 424  ILE A CB    1 
ATOM   3509  C  CG1   . ILE C 3  424  ? 15.726  -54.523  2.889   1.00 60.62  ? 424  ILE A CG1   1 
ATOM   3510  C  CG2   . ILE C 3  424  ? 16.250  -56.639  4.099   1.00 58.34  ? 424  ILE A CG2   1 
ATOM   3511  C  CD1   . ILE C 3  424  ? 15.337  -53.681  4.077   1.00 60.17  ? 424  ILE A CD1   1 
ATOM   3512  N  N     . GLN C 3  425  ? 16.285  -59.005  1.361   1.00 60.04  ? 425  GLN A N     1 
ATOM   3513  C  CA    . GLN C 3  425  ? 16.247  -60.448  1.546   1.00 62.25  ? 425  GLN A CA    1 
ATOM   3514  C  C     . GLN C 3  425  ? 17.255  -60.691  2.673   1.00 61.15  ? 425  GLN A C     1 
ATOM   3515  O  O     . GLN C 3  425  ? 18.460  -60.492  2.491   1.00 60.79  ? 425  GLN A O     1 
ATOM   3516  C  CB    . GLN C 3  425  ? 16.716  -61.168  0.275   1.00 68.80  ? 425  GLN A CB    1 
ATOM   3517  C  CG    . GLN C 3  425  ? 16.314  -60.493  -1.040  1.00 80.37  ? 425  GLN A CG    1 
ATOM   3518  C  CD    . GLN C 3  425  ? 14.990  -60.998  -1.607  1.00 87.90  ? 425  GLN A CD    1 
ATOM   3519  O  OE1   . GLN C 3  425  ? 13.962  -60.991  -0.925  1.00 93.15  ? 425  GLN A OE1   1 
ATOM   3520  N  NE2   . GLN C 3  425  ? 15.011  -61.432  -2.868  1.00 90.37  ? 425  GLN A NE2   1 
ATOM   3521  N  N     . LEU C 3  426  ? 16.774  -61.101  3.841   1.00 59.49  ? 426  LEU A N     1 
ATOM   3522  C  CA    . LEU C 3  426  ? 17.674  -61.330  4.963   1.00 56.94  ? 426  LEU A CA    1 
ATOM   3523  C  C     . LEU C 3  426  ? 18.715  -62.401  4.651   1.00 57.43  ? 426  LEU A C     1 
ATOM   3524  O  O     . LEU C 3  426  ? 18.418  -63.398  3.995   1.00 56.33  ? 426  LEU A O     1 
ATOM   3525  C  CB    . LEU C 3  426  ? 16.880  -61.714  6.215   1.00 54.26  ? 426  LEU A CB    1 
ATOM   3526  C  CG    . LEU C 3  426  ? 15.971  -60.649  6.826   1.00 47.68  ? 426  LEU A CG    1 
ATOM   3527  C  CD1   . LEU C 3  426  ? 15.307  -61.198  8.076   1.00 45.40  ? 426  LEU A CD1   1 
ATOM   3528  C  CD2   . LEU C 3  426  ? 16.788  -59.421  7.158   1.00 46.59  ? 426  LEU A CD2   1 
ATOM   3529  N  N     . GLN C 3  427  ? 19.933  -62.174  5.134   1.00 58.77  ? 427  GLN A N     1 
ATOM   3530  C  CA    . GLN C 3  427  ? 21.059  -63.082  4.937   1.00 60.56  ? 427  GLN A CA    1 
ATOM   3531  C  C     . GLN C 3  427  ? 21.591  -63.598  6.275   1.00 61.04  ? 427  GLN A C     1 
ATOM   3532  O  O     . GLN C 3  427  ? 21.850  -62.808  7.182   1.00 62.41  ? 427  GLN A O     1 
ATOM   3533  C  CB    . GLN C 3  427  ? 22.191  -62.348  4.219   1.00 61.99  ? 427  GLN A CB    1 
ATOM   3534  C  CG    . GLN C 3  427  ? 21.848  -61.866  2.833   1.00 69.38  ? 427  GLN A CG    1 
ATOM   3535  C  CD    . GLN C 3  427  ? 21.717  -63.002  1.843   1.00 74.75  ? 427  GLN A CD    1 
ATOM   3536  O  OE1   . GLN C 3  427  ? 20.765  -63.785  1.887   1.00 76.26  ? 427  GLN A OE1   1 
ATOM   3537  N  NE2   . GLN C 3  427  ? 22.689  -63.108  0.943   1.00 80.64  ? 427  GLN A NE2   1 
ATOM   3538  N  N     . TYR C 3  428  ? 21.760  -64.912  6.405   1.00 60.25  ? 428  TYR A N     1 
ATOM   3539  C  CA    . TYR C 3  428  ? 22.292  -65.470  7.642   1.00 59.73  ? 428  TYR A CA    1 
ATOM   3540  C  C     . TYR C 3  428  ? 23.535  -64.648  7.984   1.00 58.54  ? 428  TYR A C     1 
ATOM   3541  O  O     . TYR C 3  428  ? 24.387  -64.416  7.123   1.00 56.41  ? 428  TYR A O     1 
ATOM   3542  C  CB    . TYR C 3  428  ? 22.716  -66.928  7.447   1.00 65.99  ? 428  TYR A CB    1 
ATOM   3543  C  CG    . TYR C 3  428  ? 21.614  -67.935  7.175   1.00 74.59  ? 428  TYR A CG    1 
ATOM   3544  C  CD1   . TYR C 3  428  ? 21.906  -69.147  6.548   1.00 79.73  ? 428  TYR A CD1   1 
ATOM   3545  C  CD2   . TYR C 3  428  ? 20.299  -67.713  7.581   1.00 79.23  ? 428  TYR A CD2   1 
ATOM   3546  C  CE1   . TYR C 3  428  ? 20.921  -70.117  6.334   1.00 82.31  ? 428  TYR A CE1   1 
ATOM   3547  C  CE2   . TYR C 3  428  ? 19.300  -68.684  7.370   1.00 81.62  ? 428  TYR A CE2   1 
ATOM   3548  C  CZ    . TYR C 3  428  ? 19.625  -69.882  6.747   1.00 82.43  ? 428  TYR A CZ    1 
ATOM   3549  O  OH    . TYR C 3  428  ? 18.671  -70.854  6.546   1.00 84.66  ? 428  TYR A OH    1 
ATOM   3550  N  N     . GLY C 3  429  ? 23.639  -64.202  9.231   1.00 58.39  ? 429  GLY A N     1 
ATOM   3551  C  CA    . GLY C 3  429  ? 24.798  -63.423  9.637   1.00 57.84  ? 429  GLY A CA    1 
ATOM   3552  C  C     . GLY C 3  429  ? 24.494  -61.954  9.867   1.00 57.34  ? 429  GLY A C     1 
ATOM   3553  O  O     . GLY C 3  429  ? 25.238  -61.258  10.561  1.00 57.26  ? 429  GLY A O     1 
ATOM   3554  N  N     . TRP C 3  430  ? 23.399  -61.486  9.275   1.00 56.34  ? 430  TRP A N     1 
ATOM   3555  C  CA    . TRP C 3  430  ? 22.951  -60.097  9.398   1.00 55.08  ? 430  TRP A CA    1 
ATOM   3556  C  C     . TRP C 3  430  ? 22.276  -59.845  10.754  1.00 53.76  ? 430  TRP A C     1 
ATOM   3557  O  O     . TRP C 3  430  ? 21.997  -60.784  11.506  1.00 53.63  ? 430  TRP A O     1 
ATOM   3558  C  CB    . TRP C 3  430  ? 21.956  -59.775  8.275   1.00 55.58  ? 430  TRP A CB    1 
ATOM   3559  C  CG    . TRP C 3  430  ? 22.566  -59.563  6.919   1.00 53.60  ? 430  TRP A CG    1 
ATOM   3560  C  CD1   . TRP C 3  430  ? 23.800  -59.958  6.500   1.00 54.36  ? 430  TRP A CD1   1 
ATOM   3561  C  CD2   . TRP C 3  430  ? 21.968  -58.874  5.817   1.00 51.39  ? 430  TRP A CD2   1 
ATOM   3562  N  NE1   . TRP C 3  430  ? 24.013  -59.551  5.206   1.00 55.70  ? 430  TRP A NE1   1 
ATOM   3563  C  CE2   . TRP C 3  430  ? 22.903  -58.883  4.763   1.00 52.16  ? 430  TRP A CE2   1 
ATOM   3564  C  CE3   . TRP C 3  430  ? 20.732  -58.249  5.620   1.00 50.50  ? 430  TRP A CE3   1 
ATOM   3565  C  CZ2   . TRP C 3  430  ? 22.644  -58.287  3.528   1.00 52.91  ? 430  TRP A CZ2   1 
ATOM   3566  C  CZ3   . TRP C 3  430  ? 20.472  -57.656  4.390   1.00 50.89  ? 430  TRP A CZ3   1 
ATOM   3567  C  CH2   . TRP C 3  430  ? 21.425  -57.679  3.360   1.00 52.10  ? 430  TRP A CH2   1 
ATOM   3568  N  N     . LYS C 3  431  ? 22.004  -58.579  11.061  1.00 51.52  ? 431  LYS A N     1 
ATOM   3569  C  CA    . LYS C 3  431  ? 21.360  -58.233  12.324  1.00 50.06  ? 431  LYS A CA    1 
ATOM   3570  C  C     . LYS C 3  431  ? 20.096  -57.427  12.083  1.00 46.04  ? 431  LYS A C     1 
ATOM   3571  O  O     . LYS C 3  431  ? 20.085  -56.486  11.293  1.00 45.84  ? 431  LYS A O     1 
ATOM   3572  C  CB    . LYS C 3  431  ? 22.321  -57.446  13.221  1.00 53.96  ? 431  LYS A CB    1 
ATOM   3573  C  CG    . LYS C 3  431  ? 23.464  -58.282  13.797  1.00 60.63  ? 431  LYS A CG    1 
ATOM   3574  C  CD    . LYS C 3  431  ? 24.525  -57.398  14.458  1.00 67.49  ? 431  LYS A CD    1 
ATOM   3575  C  CE    . LYS C 3  431  ? 25.794  -58.177  14.802  1.00 70.24  ? 431  LYS A CE    1 
ATOM   3576  N  NZ    . LYS C 3  431  ? 26.913  -57.268  15.195  1.00 70.20  ? 431  LYS A NZ    1 
ATOM   3577  N  N     . VAL C 3  432  ? 19.033  -57.800  12.780  1.00 41.80  ? 432  VAL A N     1 
ATOM   3578  C  CA    . VAL C 3  432  ? 17.754  -57.134  12.624  1.00 38.11  ? 432  VAL A CA    1 
ATOM   3579  C  C     . VAL C 3  432  ? 17.286  -56.459  13.891  1.00 35.43  ? 432  VAL A C     1 
ATOM   3580  O  O     . VAL C 3  432  ? 16.545  -57.059  14.659  1.00 37.08  ? 432  VAL A O     1 
ATOM   3581  C  CB    . VAL C 3  432  ? 16.656  -58.134  12.227  1.00 38.20  ? 432  VAL A CB    1 
ATOM   3582  C  CG1   . VAL C 3  432  ? 15.351  -57.396  12.005  1.00 36.52  ? 432  VAL A CG1   1 
ATOM   3583  C  CG2   . VAL C 3  432  ? 17.066  -58.912  10.990  1.00 38.08  ? 432  VAL A CG2   1 
ATOM   3584  N  N     . GLU C 3  433  ? 17.697  -55.221  14.119  1.00 31.74  ? 433  GLU A N     1 
ATOM   3585  C  CA    . GLU C 3  433  ? 17.251  -54.521  15.317  1.00 29.50  ? 433  GLU A CA    1 
ATOM   3586  C  C     . GLU C 3  433  ? 15.725  -54.613  15.383  1.00 28.72  ? 433  GLU A C     1 
ATOM   3587  O  O     . GLU C 3  433  ? 15.028  -53.860  14.714  1.00 28.93  ? 433  GLU A O     1 
ATOM   3588  C  CB    . GLU C 3  433  ? 17.668  -53.054  15.259  1.00 29.58  ? 433  GLU A CB    1 
ATOM   3589  C  CG    . GLU C 3  433  ? 19.147  -52.838  15.067  1.00 33.18  ? 433  GLU A CG    1 
ATOM   3590  C  CD    . GLU C 3  433  ? 19.711  -51.881  16.080  1.00 36.77  ? 433  GLU A CD    1 
ATOM   3591  O  OE1   . GLU C 3  433  ? 19.578  -50.656  15.887  1.00 37.26  ? 433  GLU A OE1   1 
ATOM   3592  O  OE2   . GLU C 3  433  ? 20.275  -52.361  17.086  1.00 40.15  ? 433  GLU A OE2   1 
ATOM   3593  N  N     . ARG C 3  434  ? 15.197  -55.532  16.181  1.00 27.35  ? 434  ARG A N     1 
ATOM   3594  C  CA    . ARG C 3  434  ? 13.748  -55.674  16.262  1.00 27.99  ? 434  ARG A CA    1 
ATOM   3595  C  C     . ARG C 3  434  ? 13.123  -54.943  17.444  1.00 28.59  ? 434  ARG A C     1 
ATOM   3596  O  O     . ARG C 3  434  ? 13.811  -54.565  18.390  1.00 29.57  ? 434  ARG A O     1 
ATOM   3597  C  CB    . ARG C 3  434  ? 13.361  -57.151  16.327  1.00 25.78  ? 434  ARG A CB    1 
ATOM   3598  C  CG    . ARG C 3  434  ? 14.058  -57.910  17.425  1.00 28.27  ? 434  ARG A CG    1 
ATOM   3599  C  CD    . ARG C 3  434  ? 13.250  -59.104  17.886  1.00 28.46  ? 434  ARG A CD    1 
ATOM   3600  N  NE    . ARG C 3  434  ? 13.027  -59.012  19.319  1.00 33.07  ? 434  ARG A NE    1 
ATOM   3601  C  CZ    . ARG C 3  434  ? 13.370  -59.955  20.184  1.00 39.25  ? 434  ARG A CZ    1 
ATOM   3602  N  NH1   . ARG C 3  434  ? 13.947  -61.072  19.754  1.00 43.75  ? 434  ARG A NH1   1 
ATOM   3603  N  NH2   . ARG C 3  434  ? 13.166  -59.766  21.478  1.00 40.18  ? 434  ARG A NH2   1 
ATOM   3604  N  N     . HIS C 3  435  ? 11.812  -54.731  17.378  1.00 27.80  ? 435  HIS A N     1 
ATOM   3605  C  CA    . HIS C 3  435  ? 11.107  -54.073  18.461  1.00 26.50  ? 435  HIS A CA    1 
ATOM   3606  C  C     . HIS C 3  435  ? 11.231  -54.984  19.651  1.00 27.21  ? 435  HIS A C     1 
ATOM   3607  O  O     . HIS C 3  435  ? 11.631  -56.135  19.518  1.00 28.00  ? 435  HIS A O     1 
ATOM   3608  C  CB    . HIS C 3  435  ? 9.621   -53.940  18.155  1.00 25.17  ? 435  HIS A CB    1 
ATOM   3609  C  CG    . HIS C 3  435  ? 9.305   -52.956  17.084  1.00 23.74  ? 435  HIS A CG    1 
ATOM   3610  N  ND1   . HIS C 3  435  ? 9.859   -51.699  17.046  1.00 28.54  ? 435  HIS A ND1   1 
ATOM   3611  C  CD2   . HIS C 3  435  ? 8.463   -53.029  16.032  1.00 24.24  ? 435  HIS A CD2   1 
ATOM   3612  C  CE1   . HIS C 3  435  ? 9.374   -51.038  16.012  1.00 31.56  ? 435  HIS A CE1   1 
ATOM   3613  N  NE2   . HIS C 3  435  ? 8.524   -51.825  15.379  1.00 32.10  ? 435  HIS A NE2   1 
ATOM   3614  N  N     . ILE C 3  436  ? 10.883  -54.473  20.820  1.00 28.09  ? 436  ILE A N     1 
ATOM   3615  C  CA    . ILE C 3  436  ? 10.906  -55.290  22.016  1.00 31.06  ? 436  ILE A CA    1 
ATOM   3616  C  C     . ILE C 3  436  ? 9.628   -56.118  21.917  1.00 31.78  ? 436  ILE A C     1 
ATOM   3617  O  O     . ILE C 3  436  ? 8.550   -55.556  21.728  1.00 34.94  ? 436  ILE A O     1 
ATOM   3618  C  CB    . ILE C 3  436  ? 10.832  -54.425  23.269  1.00 31.52  ? 436  ILE A CB    1 
ATOM   3619  C  CG1   . ILE C 3  436  ? 12.047  -53.517  23.350  1.00 34.34  ? 436  ILE A CG1   1 
ATOM   3620  C  CG2   . ILE C 3  436  ? 10.801  -55.300  24.480  1.00 35.32  ? 436  ILE A CG2   1 
ATOM   3621  C  CD1   . ILE C 3  436  ? 13.354  -54.285  23.375  1.00 37.00  ? 436  ILE A CD1   1 
ATOM   3622  N  N     . MET C 3  437  ? 9.725   -57.437  22.028  1.00 32.24  ? 437  MET A N     1 
ATOM   3623  C  CA    . MET C 3  437  ? 8.520   -58.261  21.928  1.00 33.65  ? 437  MET A CA    1 
ATOM   3624  C  C     . MET C 3  437  ? 8.068   -58.846  23.254  1.00 33.12  ? 437  MET A C     1 
ATOM   3625  O  O     . MET C 3  437  ? 8.647   -58.578  24.308  1.00 33.69  ? 437  MET A O     1 
ATOM   3626  C  CB    . MET C 3  437  ? 8.720   -59.412  20.944  1.00 37.10  ? 437  MET A CB    1 
ATOM   3627  C  CG    . MET C 3  437  ? 9.159   -58.999  19.554  1.00 40.82  ? 437  MET A CG    1 
ATOM   3628  S  SD    . MET C 3  437  ? 8.781   -60.271  18.320  1.00 43.77  ? 437  MET A SD    1 
ATOM   3629  C  CE    . MET C 3  437  ? 9.483   -61.785  19.102  1.00 46.89  ? 437  MET A CE    1 
ATOM   3630  N  N     . ASP C 3  438  ? 7.020   -59.653  23.203  1.00 31.61  ? 438  ASP A N     1 
ATOM   3631  C  CA    . ASP C 3  438  ? 6.537   -60.251  24.422  1.00 29.61  ? 438  ASP A CA    1 
ATOM   3632  C  C     . ASP C 3  438  ? 7.601   -61.186  24.921  1.00 28.44  ? 438  ASP A C     1 
ATOM   3633  O  O     . ASP C 3  438  ? 8.399   -61.700  24.145  1.00 27.57  ? 438  ASP A O     1 
ATOM   3634  C  CB    . ASP C 3  438  ? 5.230   -61.000  24.181  1.00 30.40  ? 438  ASP A CB    1 
ATOM   3635  C  CG    . ASP C 3  438  ? 4.013   -60.109  24.343  1.00 33.87  ? 438  ASP A CG    1 
ATOM   3636  O  OD1   . ASP C 3  438  ? 4.177   -58.874  24.464  1.00 36.66  ? 438  ASP A OD1   1 
ATOM   3637  O  OD2   . ASP C 3  438  ? 2.887   -60.644  24.349  1.00 34.79  ? 438  ASP A OD2   1 
ATOM   3638  N  N     . ASN C 3  439  ? 7.611   -61.370  26.233  1.00 28.97  ? 439  ASN A N     1 
ATOM   3639  C  CA    . ASN C 3  439  ? 8.547   -62.235  26.920  1.00 29.25  ? 439  ASN A CA    1 
ATOM   3640  C  C     . ASN C 3  439  ? 10.013  -61.874  26.899  1.00 29.14  ? 439  ASN A C     1 
ATOM   3641  O  O     . ASN C 3  439  ? 10.839  -62.659  27.334  1.00 31.69  ? 439  ASN A O     1 
ATOM   3642  C  CB    . ASN C 3  439  ? 8.369   -63.672  26.464  1.00 29.74  ? 439  ASN A CB    1 
ATOM   3643  C  CG    . ASN C 3  439  ? 7.194   -64.331  27.139  1.00 36.61  ? 439  ASN A CG    1 
ATOM   3644  O  OD1   . ASN C 3  439  ? 6.609   -63.773  28.083  1.00 38.34  ? 439  ASN A OD1   1 
ATOM   3645  N  ND2   . ASN C 3  439  ? 6.838   -65.527  26.677  1.00 40.25  ? 439  ASN A ND2   1 
ATOM   3646  N  N     . ASP C 3  440  ? 10.361  -60.699  26.400  1.00 29.14  ? 440  ASP A N     1 
ATOM   3647  C  CA    . ASP C 3  440  ? 11.762  -60.321  26.440  1.00 28.04  ? 440  ASP A CA    1 
ATOM   3648  C  C     . ASP C 3  440  ? 12.120  -60.085  27.904  1.00 26.74  ? 440  ASP A C     1 
ATOM   3649  O  O     . ASP C 3  440  ? 11.258  -59.863  28.750  1.00 26.75  ? 440  ASP A O     1 
ATOM   3650  C  CB    . ASP C 3  440  ? 12.016  -59.049  25.633  1.00 31.06  ? 440  ASP A CB    1 
ATOM   3651  C  CG    . ASP C 3  440  ? 12.109  -59.322  24.156  1.00 35.29  ? 440  ASP A CG    1 
ATOM   3652  O  OD1   . ASP C 3  440  ? 12.260  -60.514  23.818  1.00 38.51  ? 440  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP C 3  440  ? 12.044  -58.366  23.343  1.00 35.71  ? 440  ASP A OD2   1 
ATOM   3654  N  N     . PRO C 3  441  ? 13.401  -60.153  28.230  1.00 24.63  ? 441  PRO A N     1 
ATOM   3655  C  CA    . PRO C 3  441  ? 13.738  -59.926  29.625  1.00 21.62  ? 441  PRO A CA    1 
ATOM   3656  C  C     . PRO C 3  441  ? 14.144  -58.483  29.695  1.00 19.43  ? 441  PRO A C     1 
ATOM   3657  O  O     . PRO C 3  441  ? 14.885  -58.033  28.842  1.00 21.05  ? 441  PRO A O     1 
ATOM   3658  C  CB    . PRO C 3  441  ? 14.915  -60.854  29.818  1.00 23.67  ? 441  PRO A CB    1 
ATOM   3659  C  CG    . PRO C 3  441  ? 15.667  -60.644  28.521  1.00 23.40  ? 441  PRO A CG    1 
ATOM   3660  C  CD    . PRO C 3  441  ? 14.562  -60.661  27.479  1.00 24.32  ? 441  PRO A CD    1 
ATOM   3661  N  N     . VAL C 3  442  ? 13.659  -57.740  30.672  1.00 18.29  ? 442  VAL A N     1 
ATOM   3662  C  CA    . VAL C 3  442  ? 14.067  -56.342  30.772  1.00 22.77  ? 442  VAL A CA    1 
ATOM   3663  C  C     . VAL C 3  442  ? 14.299  -55.928  32.222  1.00 25.21  ? 442  VAL A C     1 
ATOM   3664  O  O     . VAL C 3  442  ? 13.625  -56.423  33.140  1.00 26.45  ? 442  VAL A O     1 
ATOM   3665  C  CB    . VAL C 3  442  ? 13.031  -55.383  30.137  1.00 21.89  ? 442  VAL A CB    1 
ATOM   3666  C  CG1   . VAL C 3  442  ? 13.057  -55.507  28.647  1.00 21.79  ? 442  VAL A CG1   1 
ATOM   3667  C  CG2   . VAL C 3  442  ? 11.643  -55.695  30.653  1.00 25.68  ? 442  VAL A CG2   1 
ATOM   3668  N  N     . LEU C 3  443  ? 15.257  -55.025  32.431  1.00 24.84  ? 443  LEU A N     1 
ATOM   3669  C  CA    . LEU C 3  443  ? 15.569  -54.564  33.779  1.00 23.76  ? 443  LEU A CA    1 
ATOM   3670  C  C     . LEU C 3  443  ? 14.691  -53.383  34.087  1.00 21.84  ? 443  LEU A C     1 
ATOM   3671  O  O     . LEU C 3  443  ? 14.799  -52.332  33.466  1.00 22.28  ? 443  LEU A O     1 
ATOM   3672  C  CB    . LEU C 3  443  ? 17.036  -54.166  33.896  1.00 27.31  ? 443  LEU A CB    1 
ATOM   3673  C  CG    . LEU C 3  443  ? 17.686  -54.550  35.224  1.00 28.94  ? 443  LEU A CG    1 
ATOM   3674  C  CD1   . LEU C 3  443  ? 19.117  -54.085  35.204  1.00 31.70  ? 443  LEU A CD1   1 
ATOM   3675  C  CD2   . LEU C 3  443  ? 16.930  -53.941  36.401  1.00 23.49  ? 443  LEU A CD2   1 
ATOM   3676  N  N     . PHE C 3  444  ? 13.829  -53.562  35.071  1.00 20.18  ? 444  PHE A N     1 
ATOM   3677  C  CA    . PHE C 3  444  ? 12.871  -52.536  35.448  1.00 19.26  ? 444  PHE A CA    1 
ATOM   3678  C  C     . PHE C 3  444  ? 13.219  -51.997  36.829  1.00 18.05  ? 444  PHE A C     1 
ATOM   3679  O  O     . PHE C 3  444  ? 13.360  -52.793  37.762  1.00 19.49  ? 444  PHE A O     1 
ATOM   3680  C  CB    . PHE C 3  444  ? 11.490  -53.202  35.439  1.00 20.66  ? 444  PHE A CB    1 
ATOM   3681  C  CG    . PHE C 3  444  ? 10.346  -52.265  35.542  1.00 16.93  ? 444  PHE A CG    1 
ATOM   3682  C  CD1   . PHE C 3  444  ? 10.296  -51.120  34.771  1.00 20.13  ? 444  PHE A CD1   1 
ATOM   3683  C  CD2   . PHE C 3  444  ? 9.324   -52.526  36.423  1.00 14.76  ? 444  PHE A CD2   1 
ATOM   3684  C  CE1   . PHE C 3  444  ? 9.238   -50.239  34.879  1.00 21.08  ? 444  PHE A CE1   1 
ATOM   3685  C  CE2   . PHE C 3  444  ? 8.270   -51.664  36.541  1.00 21.27  ? 444  PHE A CE2   1 
ATOM   3686  C  CZ    . PHE C 3  444  ? 8.226   -50.507  35.766  1.00 22.84  ? 444  PHE A CZ    1 
ATOM   3687  N  N     . ASN C 3  445  ? 13.387  -50.677  36.971  1.00 13.42  ? 445  ASN A N     1 
ATOM   3688  C  CA    . ASN C 3  445  ? 13.702  -50.129  38.296  1.00 15.05  ? 445  ASN A CA    1 
ATOM   3689  C  C     . ASN C 3  445  ? 13.014  -48.828  38.687  1.00 13.47  ? 445  ASN A C     1 
ATOM   3690  O  O     . ASN C 3  445  ? 12.596  -48.041  37.841  1.00 15.86  ? 445  ASN A O     1 
ATOM   3691  C  CB    . ASN C 3  445  ? 15.255  -50.030  38.512  1.00 18.87  ? 445  ASN A CB    1 
ATOM   3692  C  CG    . ASN C 3  445  ? 15.853  -48.582  38.394  1.00 22.43  ? 445  ASN A CG    1 
ATOM   3693  O  OD1   . ASN C 3  445  ? 16.109  -48.078  37.294  1.00 26.19  ? 445  ASN A OD1   1 
ATOM   3694  N  ND2   . ASN C 3  445  ? 16.112  -47.947  39.539  1.00 16.14  ? 445  ASN A ND2   1 
ATOM   3695  N  N     . ARG C 3  446  ? 12.857  -48.638  39.988  1.00 10.87  ? 446  ARG A N     1 
ATOM   3696  C  CA    . ARG C 3  446  ? 12.273  -47.428  40.522  1.00 14.73  ? 446  ARG A CA    1 
ATOM   3697  C  C     . ARG C 3  446  ? 13.323  -46.785  41.399  1.00 18.86  ? 446  ARG A C     1 
ATOM   3698  O  O     . ARG C 3  446  ? 14.017  -47.467  42.156  1.00 18.67  ? 446  ARG A O     1 
ATOM   3699  C  CB    . ARG C 3  446  ? 11.059  -47.703  41.388  1.00 16.55  ? 446  ARG A CB    1 
ATOM   3700  C  CG    . ARG C 3  446  ? 10.826  -46.580  42.394  1.00 13.36  ? 446  ARG A CG    1 
ATOM   3701  C  CD    . ARG C 3  446  ? 9.425   -46.522  42.845  1.00 12.34  ? 446  ARG A CD    1 
ATOM   3702  N  NE    . ARG C 3  446  ? 9.139   -45.254  43.489  1.00 17.69  ? 446  ARG A NE    1 
ATOM   3703  C  CZ    . ARG C 3  446  ? 9.825   -44.778  44.518  1.00 24.47  ? 446  ARG A CZ    1 
ATOM   3704  N  NH1   . ARG C 3  446  ? 10.851  -45.480  44.999  1.00 26.93  ? 446  ARG A NH1   1 
ATOM   3705  N  NH2   . ARG C 3  446  ? 9.453   -43.632  45.092  1.00 24.88  ? 446  ARG A NH2   1 
ATOM   3706  N  N     . GLN C 3  447  ? 13.416  -45.462  41.338  1.00 20.11  ? 447  GLN A N     1 
ATOM   3707  C  CA    . GLN C 3  447  ? 14.413  -44.768  42.133  1.00 22.51  ? 447  GLN A CA    1 
ATOM   3708  C  C     . GLN C 3  447  ? 13.774  -44.067  43.304  1.00 23.36  ? 447  GLN A C     1 
ATOM   3709  O  O     . GLN C 3  447  ? 12.635  -43.683  43.245  1.00 24.79  ? 447  GLN A O     1 
ATOM   3710  C  CB    . GLN C 3  447  ? 15.144  -43.793  41.243  1.00 25.59  ? 447  GLN A CB    1 
ATOM   3711  C  CG    . GLN C 3  447  ? 15.821  -44.500  40.102  1.00 28.65  ? 447  GLN A CG    1 
ATOM   3712  C  CD    . GLN C 3  447  ? 16.132  -43.575  38.976  1.00 31.18  ? 447  GLN A CD    1 
ATOM   3713  O  OE1   . GLN C 3  447  ? 15.243  -42.914  38.454  1.00 32.92  ? 447  GLN A OE1   1 
ATOM   3714  N  NE2   . GLN C 3  447  ? 17.402  -43.510  38.591  1.00 37.14  ? 447  GLN A NE2   1 
ATOM   3715  N  N     . PRO C 3  448  ? 14.527  -43.910  44.408  1.00 26.35  ? 448  PRO A N     1 
ATOM   3716  C  CA    . PRO C 3  448  ? 15.930  -44.318  44.564  1.00 26.66  ? 448  PRO A CA    1 
ATOM   3717  C  C     . PRO C 3  448  ? 16.125  -45.830  44.648  1.00 27.68  ? 448  PRO A C     1 
ATOM   3718  O  O     . PRO C 3  448  ? 15.331  -46.544  45.266  1.00 27.91  ? 448  PRO A O     1 
ATOM   3719  C  CB    . PRO C 3  448  ? 16.320  -43.629  45.859  1.00 27.28  ? 448  PRO A CB    1 
ATOM   3720  C  CG    . PRO C 3  448  ? 15.107  -43.797  46.678  1.00 28.58  ? 448  PRO A CG    1 
ATOM   3721  C  CD    . PRO C 3  448  ? 13.997  -43.418  45.690  1.00 25.50  ? 448  PRO A CD    1 
ATOM   3722  N  N     . SER C 3  449  ? 17.210  -46.294  44.045  1.00 27.08  ? 449  SER A N     1 
ATOM   3723  C  CA    . SER C 3  449  ? 17.517  -47.716  44.019  1.00 27.47  ? 449  SER A CA    1 
ATOM   3724  C  C     . SER C 3  449  ? 18.441  -48.150  45.151  1.00 26.88  ? 449  SER A C     1 
ATOM   3725  O  O     . SER C 3  449  ? 19.632  -48.353  44.933  1.00 27.65  ? 449  SER A O     1 
ATOM   3726  C  CB    . SER C 3  449  ? 18.169  -48.058  42.682  1.00 26.68  ? 449  SER A CB    1 
ATOM   3727  O  OG    . SER C 3  449  ? 17.579  -47.290  41.645  1.00 30.87  ? 449  SER A OG    1 
ATOM   3728  N  N     . LEU C 3  450  ? 17.898  -48.304  46.352  1.00 27.20  ? 450  LEU A N     1 
ATOM   3729  C  CA    . LEU C 3  450  ? 18.703  -48.704  47.507  1.00 29.44  ? 450  LEU A CA    1 
ATOM   3730  C  C     . LEU C 3  450  ? 18.495  -50.176  47.845  1.00 30.95  ? 450  LEU A C     1 
ATOM   3731  O  O     . LEU C 3  450  ? 18.346  -50.542  49.002  1.00 32.24  ? 450  LEU A O     1 
ATOM   3732  C  CB    . LEU C 3  450  ? 18.343  -47.820  48.707  1.00 32.06  ? 450  LEU A CB    1 
ATOM   3733  C  CG    . LEU C 3  450  ? 16.944  -47.182  48.691  1.00 34.86  ? 450  LEU A CG    1 
ATOM   3734  C  CD1   . LEU C 3  450  ? 15.919  -48.273  48.850  1.00 37.77  ? 450  LEU A CD1   1 
ATOM   3735  C  CD2   . LEU C 3  450  ? 16.778  -46.148  49.803  1.00 31.21  ? 450  LEU A CD2   1 
ATOM   3736  N  N     . HIS C 3  451  ? 18.537  -51.016  46.815  1.00 32.40  ? 451  HIS A N     1 
ATOM   3737  C  CA    . HIS C 3  451  ? 18.290  -52.450  46.939  1.00 30.46  ? 451  HIS A CA    1 
ATOM   3738  C  C     . HIS C 3  451  ? 18.710  -53.114  45.651  1.00 29.61  ? 451  HIS A C     1 
ATOM   3739  O  O     . HIS C 3  451  ? 19.151  -52.463  44.715  1.00 29.50  ? 451  HIS A O     1 
ATOM   3740  C  CB    . HIS C 3  451  ? 16.795  -52.685  47.006  1.00 35.84  ? 451  HIS A CB    1 
ATOM   3741  C  CG    . HIS C 3  451  ? 16.259  -52.900  48.372  1.00 39.66  ? 451  HIS A CG    1 
ATOM   3742  N  ND1   . HIS C 3  451  ? 14.906  -52.964  48.621  1.00 41.64  ? 451  HIS A ND1   1 
ATOM   3743  C  CD2   . HIS C 3  451  ? 16.879  -53.131  49.552  1.00 43.72  ? 451  HIS A CD2   1 
ATOM   3744  C  CE1   . HIS C 3  451  ? 14.714  -53.230  49.900  1.00 49.75  ? 451  HIS A CE1   1 
ATOM   3745  N  NE2   . HIS C 3  451  ? 15.894  -53.336  50.487  1.00 48.66  ? 451  HIS A NE2   1 
ATOM   3746  N  N     . LYS C 3  452  ? 18.528  -54.424  45.601  1.00 28.21  ? 452  LYS A N     1 
ATOM   3747  C  CA    . LYS C 3  452  ? 18.786  -55.158  44.378  1.00 27.38  ? 452  LYS A CA    1 
ATOM   3748  C  C     . LYS C 3  452  ? 17.371  -55.121  43.829  1.00 28.00  ? 452  LYS A C     1 
ATOM   3749  O  O     . LYS C 3  452  ? 17.140  -54.848  42.650  1.00 24.16  ? 452  LYS A O     1 
ATOM   3750  C  CB    . LYS C 3  452  ? 19.160  -56.593  44.681  1.00 24.96  ? 452  LYS A CB    1 
ATOM   3751  C  CG    . LYS C 3  452  ? 20.178  -56.732  45.754  1.00 24.73  ? 452  LYS A CG    1 
ATOM   3752  C  CD    . LYS C 3  452  ? 20.196  -58.155  46.275  1.00 28.46  ? 452  LYS A CD    1 
ATOM   3753  C  CE    . LYS C 3  452  ? 20.571  -59.165  45.207  1.00 27.05  ? 452  LYS A CE    1 
ATOM   3754  N  NZ    . LYS C 3  452  ? 20.809  -60.487  45.845  1.00 33.11  ? 452  LYS A NZ    1 
ATOM   3755  N  N     . MET C 3  453  ? 16.439  -55.378  44.753  1.00 29.82  ? 453  MET A N     1 
ATOM   3756  C  CA    . MET C 3  453  ? 14.994  -55.395  44.512  1.00 30.11  ? 453  MET A CA    1 
ATOM   3757  C  C     . MET C 3  453  ? 14.480  -54.140  43.851  1.00 29.28  ? 453  MET A C     1 
ATOM   3758  O  O     . MET C 3  453  ? 13.346  -54.114  43.382  1.00 30.32  ? 453  MET A O     1 
ATOM   3759  C  CB    . MET C 3  453  ? 14.221  -55.571  45.819  1.00 29.83  ? 453  MET A CB    1 
ATOM   3760  C  CG    . MET C 3  453  ? 14.365  -56.927  46.440  1.00 33.71  ? 453  MET A CG    1 
ATOM   3761  S  SD    . MET C 3  453  ? 15.910  -57.118  47.290  1.00 34.20  ? 453  MET A SD    1 
ATOM   3762  C  CE    . MET C 3  453  ? 15.292  -57.028  48.965  1.00 34.85  ? 453  MET A CE    1 
ATOM   3763  N  N     . SER C 3  454  ? 15.291  -53.090  43.840  1.00 26.53  ? 454  SER A N     1 
ATOM   3764  C  CA    . SER C 3  454  ? 14.872  -51.864  43.200  1.00 25.97  ? 454  SER A CA    1 
ATOM   3765  C  C     . SER C 3  454  ? 15.058  -52.015  41.688  1.00 26.06  ? 454  SER A C     1 
ATOM   3766  O  O     . SER C 3  454  ? 14.494  -51.260  40.900  1.00 24.98  ? 454  SER A O     1 
ATOM   3767  C  CB    . SER C 3  454  ? 15.690  -50.704  43.737  1.00 28.95  ? 454  SER A CB    1 
ATOM   3768  O  OG    . SER C 3  454  ? 15.479  -50.560  45.125  1.00 32.65  ? 454  SER A OG    1 
ATOM   3769  N  N     . MET C 3  455  ? 15.859  -52.999  41.289  1.00 25.39  ? 455  MET A N     1 
ATOM   3770  C  CA    . MET C 3  455  ? 16.095  -53.271  39.879  1.00 24.31  ? 455  MET A CA    1 
ATOM   3771  C  C     . MET C 3  455  ? 15.873  -54.739  39.643  1.00 24.25  ? 455  MET A C     1 
ATOM   3772  O  O     . MET C 3  455  ? 16.607  -55.560  40.179  1.00 24.43  ? 455  MET A O     1 
ATOM   3773  C  CB    . MET C 3  455  ? 17.521  -52.931  39.497  1.00 24.72  ? 455  MET A CB    1 
ATOM   3774  C  CG    . MET C 3  455  ? 17.831  -51.478  39.598  1.00 26.13  ? 455  MET A CG    1 
ATOM   3775  S  SD    . MET C 3  455  ? 19.227  -51.162  38.586  1.00 33.80  ? 455  MET A SD    1 
ATOM   3776  C  CE    . MET C 3  455  ? 18.521  -51.181  36.964  1.00 32.66  ? 455  MET A CE    1 
ATOM   3777  N  N     . MET C 3  456  ? 14.858  -55.084  38.861  1.00 24.71  ? 456  MET A N     1 
ATOM   3778  C  CA    . MET C 3  456  ? 14.590  -56.496  38.596  1.00 24.84  ? 456  MET A CA    1 
ATOM   3779  C  C     . MET C 3  456  ? 14.185  -56.748  37.150  1.00 24.96  ? 456  MET A C     1 
ATOM   3780  O  O     . MET C 3  456  ? 13.658  -55.863  36.456  1.00 23.83  ? 456  MET A O     1 
ATOM   3781  C  CB    . MET C 3  456  ? 13.501  -57.036  39.532  1.00 23.91  ? 456  MET A CB    1 
ATOM   3782  C  CG    . MET C 3  456  ? 13.629  -56.580  40.973  1.00 23.03  ? 456  MET A CG    1 
ATOM   3783  S  SD    . MET C 3  456  ? 12.615  -57.547  42.075  1.00 25.86  ? 456  MET A SD    1 
ATOM   3784  C  CE    . MET C 3  456  ? 11.054  -56.778  41.875  1.00 24.82  ? 456  MET A CE    1 
ATOM   3785  N  N     . ALA C 3  457  ? 14.443  -57.968  36.705  1.00 23.68  ? 457  ALA A N     1 
ATOM   3786  C  CA    . ALA C 3  457  ? 14.129  -58.355  35.351  1.00 24.24  ? 457  ALA A CA    1 
ATOM   3787  C  C     . ALA C 3  457  ? 12.686  -58.845  35.280  1.00 25.90  ? 457  ALA A C     1 
ATOM   3788  O  O     . ALA C 3  457  ? 12.254  -59.652  36.102  1.00 28.40  ? 457  ALA A O     1 
ATOM   3789  C  CB    . ALA C 3  457  ? 15.088  -59.442  34.901  1.00 19.45  ? 457  ALA A CB    1 
ATOM   3790  N  N     . HIS C 3  458  ? 11.942  -58.345  34.300  1.00 25.29  ? 458  HIS A N     1 
ATOM   3791  C  CA    . HIS C 3  458  ? 10.553  -58.739  34.108  1.00 23.88  ? 458  HIS A CA    1 
ATOM   3792  C  C     . HIS C 3  458  ? 10.343  -59.244  32.687  1.00 25.47  ? 458  HIS A C     1 
ATOM   3793  O  O     . HIS C 3  458  ? 11.039  -58.828  31.759  1.00 27.17  ? 458  HIS A O     1 
ATOM   3794  C  CB    . HIS C 3  458  ? 9.631   -57.541  34.300  1.00 19.34  ? 458  HIS A CB    1 
ATOM   3795  C  CG    . HIS C 3  458  ? 9.603   -57.005  35.690  1.00 15.27  ? 458  HIS A CG    1 
ATOM   3796  N  ND1   . HIS C 3  458  ? 8.912   -57.616  36.709  1.00 18.02  ? 458  HIS A ND1   1 
ATOM   3797  C  CD2   . HIS C 3  458  ? 10.137  -55.882  36.219  1.00 17.78  ? 458  HIS A CD2   1 
ATOM   3798  C  CE1   . HIS C 3  458  ? 9.016   -56.888  37.806  1.00 21.21  ? 458  HIS A CE1   1 
ATOM   3799  N  NE2   . HIS C 3  458  ? 9.756   -55.830  37.535  1.00 19.45  ? 458  HIS A NE2   1 
ATOM   3800  N  N     . ARG C 3  459  ? 9.375   -60.133  32.512  1.00 26.13  ? 459  ARG A N     1 
ATOM   3801  C  CA    . ARG C 3  459  ? 9.050   -60.623  31.184  1.00 26.55  ? 459  ARG A CA    1 
ATOM   3802  C  C     . ARG C 3  459  ? 8.198   -59.519  30.558  1.00 26.58  ? 459  ARG A C     1 
ATOM   3803  O  O     . ARG C 3  459  ? 7.231   -59.050  31.161  1.00 26.58  ? 459  ARG A O     1 
ATOM   3804  C  CB    . ARG C 3  459  ? 8.230   -61.910  31.267  1.00 30.46  ? 459  ARG A CB    1 
ATOM   3805  C  CG    . ARG C 3  459  ? 8.984   -63.163  31.690  1.00 32.14  ? 459  ARG A CG    1 
ATOM   3806  C  CD    . ARG C 3  459  ? 8.018   -64.160  32.323  1.00 34.36  ? 459  ARG A CD    1 
ATOM   3807  N  NE    . ARG C 3  459  ? 6.841   -64.379  31.488  1.00 37.29  ? 459  ARG A NE    1 
ATOM   3808  C  CZ    . ARG C 3  459  ? 5.611   -64.549  31.966  1.00 35.94  ? 459  ARG A CZ    1 
ATOM   3809  N  NH1   . ARG C 3  459  ? 5.401   -64.527  33.273  1.00 29.46  ? 459  ARG A NH1   1 
ATOM   3810  N  NH2   . ARG C 3  459  ? 4.588   -64.724  31.138  1.00 37.52  ? 459  ARG A NH2   1 
ATOM   3811  N  N     . VAL C 3  460  ? 8.566   -59.096  29.359  1.00 26.10  ? 460  VAL A N     1 
ATOM   3812  C  CA    . VAL C 3  460  ? 7.838   -58.052  28.657  1.00 27.00  ? 460  VAL A CA    1 
ATOM   3813  C  C     . VAL C 3  460  ? 6.441   -58.542  28.276  1.00 29.83  ? 460  VAL A C     1 
ATOM   3814  O  O     . VAL C 3  460  ? 6.225   -59.744  28.067  1.00 32.15  ? 460  VAL A O     1 
ATOM   3815  C  CB    . VAL C 3  460  ? 8.595   -57.634  27.372  1.00 25.58  ? 460  VAL A CB    1 
ATOM   3816  C  CG1   . VAL C 3  460  ? 7.831   -56.568  26.627  1.00 28.86  ? 460  VAL A CG1   1 
ATOM   3817  C  CG2   . VAL C 3  460  ? 9.969   -57.118  27.727  1.00 26.49  ? 460  VAL A CG2   1 
ATOM   3818  N  N     . LYS C 3  461  ? 5.499   -57.599  28.215  1.00 30.03  ? 461  LYS A N     1 
ATOM   3819  C  CA    . LYS C 3  461  ? 4.102   -57.848  27.842  1.00 29.37  ? 461  LYS A CA    1 
ATOM   3820  C  C     . LYS C 3  461  ? 3.655   -56.538  27.218  1.00 28.76  ? 461  LYS A C     1 
ATOM   3821  O  O     . LYS C 3  461  ? 3.288   -55.598  27.931  1.00 28.74  ? 461  LYS A O     1 
ATOM   3822  C  CB    . LYS C 3  461  ? 3.219   -58.132  29.076  1.00 32.33  ? 461  LYS A CB    1 
ATOM   3823  C  CG    . LYS C 3  461  ? 1.950   -58.980  28.815  1.00 32.70  ? 461  LYS A CG    1 
ATOM   3824  C  CD    . LYS C 3  461  ? 0.986   -58.339  27.819  1.00 37.79  ? 461  LYS A CD    1 
ATOM   3825  C  CE    . LYS C 3  461  ? -0.115  -59.315  27.342  1.00 44.46  ? 461  LYS A CE    1 
ATOM   3826  N  NZ    . LYS C 3  461  ? -1.300  -59.483  28.263  1.00 49.86  ? 461  LYS A NZ    1 
ATOM   3827  N  N     . VAL C 3  462  ? 3.705   -56.460  25.893  1.00 27.02  ? 462  VAL A N     1 
ATOM   3828  C  CA    . VAL C 3  462  ? 3.293   -55.241  25.209  1.00 23.54  ? 462  VAL A CA    1 
ATOM   3829  C  C     . VAL C 3  462  ? 1.781   -55.072  25.311  1.00 20.63  ? 462  VAL A C     1 
ATOM   3830  O  O     . VAL C 3  462  ? 1.032   -55.998  25.020  1.00 19.84  ? 462  VAL A O     1 
ATOM   3831  C  CB    . VAL C 3  462  ? 3.698   -55.267  23.733  1.00 24.36  ? 462  VAL A CB    1 
ATOM   3832  C  CG1   . VAL C 3  462  ? 3.339   -53.936  23.097  1.00 24.73  ? 462  VAL A CG1   1 
ATOM   3833  C  CG2   . VAL C 3  462  ? 5.202   -55.543  23.603  1.00 22.31  ? 462  VAL A CG2   1 
ATOM   3834  N  N     . ILE C 3  463  ? 1.346   -53.879  25.709  1.00 18.39  ? 463  ILE A N     1 
ATOM   3835  C  CA    . ILE C 3  463  ? -0.075  -53.582  25.885  1.00 15.36  ? 463  ILE A CA    1 
ATOM   3836  C  C     . ILE C 3  463  ? -0.439  -52.150  25.512  1.00 15.07  ? 463  ILE A C     1 
ATOM   3837  O  O     . ILE C 3  463  ? 0.407   -51.272  25.469  1.00 14.18  ? 463  ILE A O     1 
ATOM   3838  C  CB    . ILE C 3  463  ? -0.454  -53.732  27.324  1.00 15.31  ? 463  ILE A CB    1 
ATOM   3839  C  CG1   . ILE C 3  463  ? 0.482   -52.821  28.124  1.00 14.73  ? 463  ILE A CG1   1 
ATOM   3840  C  CG2   . ILE C 3  463  ? -0.431  -55.207  27.724  1.00 8.96   ? 463  ILE A CG2   1 
ATOM   3841  C  CD1   . ILE C 3  463  ? 0.080   -52.553  29.522  1.00 17.22  ? 463  ILE A CD1   1 
ATOM   3842  N  N     . PRO C 3  464  ? -1.730  -51.891  25.293  1.00 17.47  ? 464  PRO A N     1 
ATOM   3843  C  CA    . PRO C 3  464  ? -2.242  -50.569  24.926  1.00 19.12  ? 464  PRO A CA    1 
ATOM   3844  C  C     . PRO C 3  464  ? -2.005  -49.544  26.008  1.00 20.24  ? 464  PRO A C     1 
ATOM   3845  O  O     . PRO C 3  464  ? -1.476  -49.863  27.064  1.00 23.38  ? 464  PRO A O     1 
ATOM   3846  C  CB    . PRO C 3  464  ? -3.723  -50.827  24.737  1.00 19.68  ? 464  PRO A CB    1 
ATOM   3847  C  CG    . PRO C 3  464  ? -3.993  -51.842  25.808  1.00 21.26  ? 464  PRO A CG    1 
ATOM   3848  C  CD    . PRO C 3  464  ? -2.847  -52.808  25.586  1.00 19.25  ? 464  PRO A CD    1 
ATOM   3849  N  N     . TYR C 3  465  ? -2.423  -48.313  25.736  1.00 22.57  ? 465  TYR A N     1 
ATOM   3850  C  CA    . TYR C 3  465  ? -2.287  -47.198  26.671  1.00 24.90  ? 465  TYR A CA    1 
ATOM   3851  C  C     . TYR C 3  465  ? -0.827  -46.963  27.045  1.00 24.83  ? 465  TYR A C     1 
ATOM   3852  O  O     . TYR C 3  465  ? 0.015   -47.803  26.763  1.00 27.20  ? 465  TYR A O     1 
ATOM   3853  C  CB    . TYR C 3  465  ? -3.165  -47.461  27.888  1.00 26.42  ? 465  TYR A CB    1 
ATOM   3854  C  CG    . TYR C 3  465  ? -4.581  -47.832  27.488  1.00 24.91  ? 465  TYR A CG    1 
ATOM   3855  C  CD1   . TYR C 3  465  ? -4.989  -49.158  27.475  1.00 24.32  ? 465  TYR A CD1   1 
ATOM   3856  C  CD2   . TYR C 3  465  ? -5.500  -46.852  27.107  1.00 22.60  ? 465  TYR A CD2   1 
ATOM   3857  C  CE1   . TYR C 3  465  ? -6.277  -49.503  27.098  1.00 32.43  ? 465  TYR A CE1   1 
ATOM   3858  C  CE2   . TYR C 3  465  ? -6.789  -47.179  26.727  1.00 26.91  ? 465  TYR A CE2   1 
ATOM   3859  C  CZ    . TYR C 3  465  ? -7.181  -48.509  26.726  1.00 34.29  ? 465  TYR A CZ    1 
ATOM   3860  O  OH    . TYR C 3  465  ? -8.480  -48.858  26.381  1.00 39.07  ? 465  TYR A OH    1 
ATOM   3861  N  N     . SER C 3  466  ? -0.506  -45.841  27.681  1.00 24.22  ? 466  SER A N     1 
ATOM   3862  C  CA    . SER C 3  466  ? 0.908   -45.568  27.942  1.00 22.27  ? 466  SER A CA    1 
ATOM   3863  C  C     . SER C 3  466  ? 1.537   -45.529  29.327  1.00 19.50  ? 466  SER A C     1 
ATOM   3864  O  O     . SER C 3  466  ? 2.276   -44.596  29.635  1.00 18.27  ? 466  SER A O     1 
ATOM   3865  C  CB    . SER C 3  466  ? 1.341   -44.290  27.174  1.00 23.12  ? 466  SER A CB    1 
ATOM   3866  O  OG    . SER C 3  466  ? 0.301   -43.326  27.022  1.00 19.17  ? 466  SER A OG    1 
ATOM   3867  N  N     . THR C 3  467  ? 1.278   -46.540  30.151  1.00 18.18  ? 467  THR A N     1 
ATOM   3868  C  CA    . THR C 3  467  ? 1.894   -46.607  31.487  1.00 15.62  ? 467  THR A CA    1 
ATOM   3869  C  C     . THR C 3  467  ? 2.520   -47.978  31.674  1.00 16.74  ? 467  THR A C     1 
ATOM   3870  O  O     . THR C 3  467  ? 2.007   -48.966  31.158  1.00 18.04  ? 467  THR A O     1 
ATOM   3871  C  CB    . THR C 3  467  ? 0.881   -46.415  32.652  1.00 11.12  ? 467  THR A CB    1 
ATOM   3872  O  OG1   . THR C 3  467  ? -0.246  -47.282  32.473  1.00 10.93  ? 467  THR A OG1   1 
ATOM   3873  C  CG2   . THR C 3  467  ? 0.419   -44.995  32.730  1.00 8.92   ? 467  THR A CG2   1 
ATOM   3874  N  N     . PHE C 3  468  ? 3.642   -48.053  32.377  1.00 15.93  ? 468  PHE A N     1 
ATOM   3875  C  CA    . PHE C 3  468  ? 4.222   -49.361  32.615  1.00 16.11  ? 468  PHE A CA    1 
ATOM   3876  C  C     . PHE C 3  468  ? 3.193   -49.998  33.539  1.00 17.63  ? 468  PHE A C     1 
ATOM   3877  O  O     . PHE C 3  468  ? 2.671   -49.341  34.449  1.00 19.72  ? 468  PHE A O     1 
ATOM   3878  C  CB    . PHE C 3  468  ? 5.588   -49.257  33.303  1.00 13.52  ? 468  PHE A CB    1 
ATOM   3879  C  CG    . PHE C 3  468  ? 6.705   -48.953  32.368  1.00 12.19  ? 468  PHE A CG    1 
ATOM   3880  C  CD1   . PHE C 3  468  ? 7.569   -47.907  32.618  1.00 19.08  ? 468  PHE A CD1   1 
ATOM   3881  C  CD2   . PHE C 3  468  ? 6.887   -49.706  31.221  1.00 17.01  ? 468  PHE A CD2   1 
ATOM   3882  C  CE1   . PHE C 3  468  ? 8.611   -47.609  31.730  1.00 20.99  ? 468  PHE A CE1   1 
ATOM   3883  C  CE2   . PHE C 3  468  ? 7.918   -49.422  30.332  1.00 20.92  ? 468  PHE A CE2   1 
ATOM   3884  C  CZ    . PHE C 3  468  ? 8.782   -48.367  30.588  1.00 21.05  ? 468  PHE A CZ    1 
ATOM   3885  N  N     . ARG C 3  469  ? 2.862   -51.255  33.286  1.00 15.04  ? 469  ARG A N     1 
ATOM   3886  C  CA    . ARG C 3  469  ? 1.879   -51.927  34.108  1.00 12.97  ? 469  ARG A CA    1 
ATOM   3887  C  C     . ARG C 3  469  ? 2.564   -52.976  34.926  1.00 14.67  ? 469  ARG A C     1 
ATOM   3888  O  O     . ARG C 3  469  ? 3.229   -53.858  34.379  1.00 18.44  ? 469  ARG A O     1 
ATOM   3889  C  CB    . ARG C 3  469  ? 0.819   -52.555  33.226  1.00 9.48   ? 469  ARG A CB    1 
ATOM   3890  C  CG    . ARG C 3  469  ? 0.003   -51.517  32.547  1.00 7.31   ? 469  ARG A CG    1 
ATOM   3891  C  CD    . ARG C 3  469  ? -1.420  -51.958  32.377  1.00 8.79   ? 469  ARG A CD    1 
ATOM   3892  N  NE    . ARG C 3  469  ? -2.266  -50.789  32.403  1.00 5.97   ? 469  ARG A NE    1 
ATOM   3893  C  CZ    . ARG C 3  469  ? -2.857  -50.352  33.494  1.00 10.21  ? 469  ARG A CZ    1 
ATOM   3894  N  NH1   . ARG C 3  469  ? -2.702  -51.008  34.633  1.00 7.03   ? 469  ARG A NH1   1 
ATOM   3895  N  NH2   . ARG C 3  469  ? -3.569  -49.241  33.449  1.00 16.82  ? 469  ARG A NH2   1 
ATOM   3896  N  N     . LEU C 3  470  ? 2.413   -52.912  36.238  1.00 11.46  ? 470  LEU A N     1 
ATOM   3897  C  CA    . LEU C 3  470  ? 3.105   -53.905  37.018  1.00 9.03   ? 470  LEU A CA    1 
ATOM   3898  C  C     . LEU C 3  470  ? 2.247   -54.590  38.038  1.00 6.85   ? 470  LEU A C     1 
ATOM   3899  O  O     . LEU C 3  470  ? 1.308   -53.991  38.525  1.00 9.53   ? 470  LEU A O     1 
ATOM   3900  C  CB    . LEU C 3  470  ? 4.346   -53.267  37.650  1.00 8.00   ? 470  LEU A CB    1 
ATOM   3901  C  CG    . LEU C 3  470  ? 4.206   -51.983  38.445  1.00 6.85   ? 470  LEU A CG    1 
ATOM   3902  C  CD1   . LEU C 3  470  ? 3.657   -52.319  39.817  1.00 6.95   ? 470  LEU A CD1   1 
ATOM   3903  C  CD2   . LEU C 3  470  ? 5.554   -51.314  38.557  1.00 2.64   ? 470  LEU A CD2   1 
ATOM   3904  N  N     . ASN C 3  471  ? 2.566   -55.856  38.318  1.00 6.29   ? 471  ASN A N     1 
ATOM   3905  C  CA    . ASN C 3  471  ? 1.844   -56.689  39.280  1.00 8.76   ? 471  ASN A CA    1 
ATOM   3906  C  C     . ASN C 3  471  ? 1.978   -56.039  40.646  1.00 9.60   ? 471  ASN A C     1 
ATOM   3907  O  O     . ASN C 3  471  ? 3.043   -55.511  40.967  1.00 9.86   ? 471  ASN A O     1 
ATOM   3908  C  CB    . ASN C 3  471  ? 2.439   -58.102  39.317  1.00 12.40  ? 471  ASN A CB    1 
ATOM   3909  C  CG    . ASN C 3  471  ? 1.624   -59.066  40.182  1.00 18.09  ? 471  ASN A CG    1 
ATOM   3910  O  OD1   . ASN C 3  471  ? 1.478   -58.886  41.404  1.00 18.07  ? 471  ASN A OD1   1 
ATOM   3911  N  ND2   . ASN C 3  471  ? 1.089   -60.095  39.547  1.00 15.67  ? 471  ASN A ND2   1 
ATOM   3912  N  N     . LEU C 3  472  ? 0.918   -56.083  41.456  1.00 10.06  ? 472  LEU A N     1 
ATOM   3913  C  CA    . LEU C 3  472  ? 0.967   -55.419  42.754  1.00 11.06  ? 472  LEU A CA    1 
ATOM   3914  C  C     . LEU C 3  472  ? 1.987   -55.934  43.718  1.00 16.48  ? 472  LEU A C     1 
ATOM   3915  O  O     . LEU C 3  472  ? 2.606   -55.146  44.436  1.00 17.54  ? 472  LEU A O     1 
ATOM   3916  C  CB    . LEU C 3  472  ? -0.365  -55.473  43.455  1.00 4.80   ? 472  LEU A CB    1 
ATOM   3917  C  CG    . LEU C 3  472  ? -1.437  -54.615  42.870  1.00 1.00   ? 472  LEU A CG    1 
ATOM   3918  C  CD1   . LEU C 3  472  ? -2.751  -55.251  43.259  1.00 10.88  ? 472  LEU A CD1   1 
ATOM   3919  C  CD2   . LEU C 3  472  ? -1.322  -53.227  43.365  1.00 1.00   ? 472  LEU A CD2   1 
ATOM   3920  N  N     . SER C 3  473  ? 2.159   -57.250  43.757  1.00 19.22  ? 473  SER A N     1 
ATOM   3921  C  CA    . SER C 3  473  ? 3.101   -57.824  44.701  1.00 23.37  ? 473  SER A CA    1 
ATOM   3922  C  C     . SER C 3  473  ? 4.561   -57.624  44.322  1.00 25.06  ? 473  SER A C     1 
ATOM   3923  O  O     . SER C 3  473  ? 5.439   -58.295  44.852  1.00 28.82  ? 473  SER A O     1 
ATOM   3924  C  CB    . SER C 3  473  ? 2.781   -59.297  44.911  1.00 24.34  ? 473  SER A CB    1 
ATOM   3925  O  OG    . SER C 3  473  ? 1.457   -59.417  45.404  1.00 29.58  ? 473  SER A OG    1 
ATOM   3926  N  N     . VAL C 3  474  ? 4.801   -56.699  43.395  1.00 23.14  ? 474  VAL A N     1 
ATOM   3927  C  CA    . VAL C 3  474  ? 6.139   -56.340  42.954  1.00 22.03  ? 474  VAL A CA    1 
ATOM   3928  C  C     . VAL C 3  474  ? 6.282   -54.904  43.460  1.00 22.08  ? 474  VAL A C     1 
ATOM   3929  O  O     . VAL C 3  474  ? 7.327   -54.271  43.354  1.00 23.78  ? 474  VAL A O     1 
ATOM   3930  C  CB    . VAL C 3  474  ? 6.245   -56.386  41.408  1.00 22.23  ? 474  VAL A CB    1 
ATOM   3931  C  CG1   . VAL C 3  474  ? 6.529   -55.010  40.839  1.00 22.40  ? 474  VAL A CG1   1 
ATOM   3932  C  CG2   . VAL C 3  474  ? 7.343   -57.326  41.001  1.00 28.74  ? 474  VAL A CG2   1 
ATOM   3933  N  N     . THR C 3  475  ? 5.196   -54.415  44.036  1.00 21.03  ? 475  THR A N     1 
ATOM   3934  C  CA    . THR C 3  475  ? 5.117   -53.073  44.561  1.00 20.06  ? 475  THR A CA    1 
ATOM   3935  C  C     . THR C 3  475  ? 6.176   -52.716  45.580  1.00 18.53  ? 475  THR A C     1 
ATOM   3936  O  O     . THR C 3  475  ? 7.015   -51.867  45.321  1.00 15.98  ? 475  THR A O     1 
ATOM   3937  C  CB    . THR C 3  475  ? 3.689   -52.835  45.142  1.00 23.69  ? 475  THR A CB    1 
ATOM   3938  O  OG1   . THR C 3  475  ? 2.940   -52.067  44.198  1.00 24.79  ? 475  THR A OG1   1 
ATOM   3939  C  CG2   . THR C 3  475  ? 3.705   -52.120  46.508  1.00 25.56  ? 475  THR A CG2   1 
ATOM   3940  N  N     . SER C 3  476  ? 6.144   -53.386  46.725  1.00 18.63  ? 476  SER A N     1 
ATOM   3941  C  CA    . SER C 3  476  ? 7.059   -53.107  47.827  1.00 21.50  ? 476  SER A CA    1 
ATOM   3942  C  C     . SER C 3  476  ? 8.565   -53.154  47.590  1.00 21.23  ? 476  SER A C     1 
ATOM   3943  O  O     . SER C 3  476  ? 9.294   -52.306  48.092  1.00 23.09  ? 476  SER A O     1 
ATOM   3944  C  CB    . SER C 3  476  ? 6.694   -53.987  49.026  1.00 24.61  ? 476  SER A CB    1 
ATOM   3945  O  OG    . SER C 3  476  ? 6.203   -55.244  48.595  1.00 32.25  ? 476  SER A OG    1 
ATOM   3946  N  N     . PRO C 3  477  ? 9.061   -54.154  46.862  1.00 19.78  ? 477  PRO A N     1 
ATOM   3947  C  CA    . PRO C 3  477  ? 10.502  -54.185  46.634  1.00 19.30  ? 477  PRO A CA    1 
ATOM   3948  C  C     . PRO C 3  477  ? 10.978  -52.886  46.007  1.00 18.76  ? 477  PRO A C     1 
ATOM   3949  O  O     . PRO C 3  477  ? 12.031  -52.372  46.359  1.00 21.32  ? 477  PRO A O     1 
ATOM   3950  C  CB    . PRO C 3  477  ? 10.664  -55.372  45.709  1.00 21.33  ? 477  PRO A CB    1 
ATOM   3951  C  CG    . PRO C 3  477  ? 9.641   -56.316  46.246  1.00 22.05  ? 477  PRO A CG    1 
ATOM   3952  C  CD    . PRO C 3  477  ? 8.439   -55.412  46.423  1.00 23.21  ? 477  PRO A CD    1 
ATOM   3953  N  N     . TYR C 3  478  ? 10.198  -52.350  45.079  1.00 17.20  ? 478  TYR A N     1 
ATOM   3954  C  CA    . TYR C 3  478  ? 10.556  -51.096  44.432  1.00 18.60  ? 478  TYR A CA    1 
ATOM   3955  C  C     . TYR C 3  478  ? 10.054  -49.917  45.260  1.00 20.82  ? 478  TYR A C     1 
ATOM   3956  O  O     . TYR C 3  478  ? 10.390  -48.763  44.983  1.00 22.63  ? 478  TYR A O     1 
ATOM   3957  C  CB    . TYR C 3  478  ? 9.910   -51.001  43.056  1.00 15.06  ? 478  TYR A CB    1 
ATOM   3958  C  CG    . TYR C 3  478  ? 10.296  -52.076  42.091  1.00 11.31  ? 478  TYR A CG    1 
ATOM   3959  C  CD1   . TYR C 3  478  ? 9.387   -53.050  41.714  1.00 14.78  ? 478  TYR A CD1   1 
ATOM   3960  C  CD2   . TYR C 3  478  ? 11.560  -52.107  41.534  1.00 13.83  ? 478  TYR A CD2   1 
ATOM   3961  C  CE1   . TYR C 3  478  ? 9.727   -54.035  40.798  1.00 18.30  ? 478  TYR A CE1   1 
ATOM   3962  C  CE2   . TYR C 3  478  ? 11.918  -53.082  40.620  1.00 17.21  ? 478  TYR A CE2   1 
ATOM   3963  C  CZ    . TYR C 3  478  ? 10.997  -54.045  40.255  1.00 19.89  ? 478  TYR A CZ    1 
ATOM   3964  O  OH    . TYR C 3  478  ? 11.347  -55.025  39.358  1.00 20.76  ? 478  TYR A OH    1 
ATOM   3965  N  N     . ASN C 3  479  ? 9.234   -50.219  46.261  1.00 21.58  ? 479  ASN A N     1 
ATOM   3966  C  CA    . ASN C 3  479  ? 8.627   -49.211  47.114  1.00 22.36  ? 479  ASN A CA    1 
ATOM   3967  C  C     . ASN C 3  479  ? 7.884   -48.225  46.244  1.00 23.11  ? 479  ASN A C     1 
ATOM   3968  O  O     . ASN C 3  479  ? 8.145   -47.032  46.268  1.00 24.36  ? 479  ASN A O     1 
ATOM   3969  C  CB    . ASN C 3  479  ? 9.661   -48.449  47.933  1.00 27.64  ? 479  ASN A CB    1 
ATOM   3970  C  CG    . ASN C 3  479  ? 9.040   -47.726  49.129  1.00 30.84  ? 479  ASN A CG    1 
ATOM   3971  O  OD1   . ASN C 3  479  ? 7.823   -47.530  49.200  1.00 29.13  ? 479  ASN A OD1   1 
ATOM   3972  N  ND2   . ASN C 3  479  ? 9.882   -47.327  50.073  1.00 36.98  ? 479  ASN A ND2   1 
ATOM   3973  N  N     . ALA C 3  480  ? 6.963   -48.724  45.447  1.00 24.51  ? 480  ALA A N     1 
ATOM   3974  C  CA    . ALA C 3  480  ? 6.192   -47.832  44.619  1.00 25.60  ? 480  ALA A CA    1 
ATOM   3975  C  C     . ALA C 3  480  ? 4.756   -47.893  45.103  1.00 28.75  ? 480  ALA A C     1 
ATOM   3976  O  O     . ALA C 3  480  ? 4.388   -48.707  45.968  1.00 30.96  ? 480  ALA A O     1 
ATOM   3977  C  CB    . ALA C 3  480  ? 6.269   -48.266  43.187  1.00 22.40  ? 480  ALA A CB    1 
ATOM   3978  N  N     . ASP C 3  481  ? 3.960   -46.993  44.560  1.00 28.52  ? 481  ASP A N     1 
ATOM   3979  C  CA    . ASP C 3  481  ? 2.543   -46.919  44.837  1.00 27.66  ? 481  ASP A CA    1 
ATOM   3980  C  C     . ASP C 3  481  ? 2.133   -46.147  43.592  1.00 24.90  ? 481  ASP A C     1 
ATOM   3981  O  O     . ASP C 3  481  ? 2.989   -45.579  42.917  1.00 25.56  ? 481  ASP A O     1 
ATOM   3982  C  CB    . ASP C 3  481  ? 2.265   -46.166  46.137  1.00 29.74  ? 481  ASP A CB    1 
ATOM   3983  C  CG    . ASP C 3  481  ? 2.627   -44.720  46.049  1.00 41.11  ? 481  ASP A CG    1 
ATOM   3984  O  OD1   . ASP C 3  481  ? 2.132   -44.062  45.112  1.00 44.48  ? 481  ASP A OD1   1 
ATOM   3985  O  OD2   . ASP C 3  481  ? 3.398   -44.227  46.910  1.00 50.36  ? 481  ASP A OD2   1 
ATOM   3986  N  N     . PHE C 3  482  ? 0.853   -46.115  43.265  1.00 22.10  ? 482  PHE A N     1 
ATOM   3987  C  CA    . PHE C 3  482  ? 0.470   -45.453  42.044  1.00 19.78  ? 482  PHE A CA    1 
ATOM   3988  C  C     . PHE C 3  482  ? -0.090  -44.037  42.117  1.00 20.17  ? 482  PHE A C     1 
ATOM   3989  O  O     . PHE C 3  482  ? -1.005  -43.702  41.380  1.00 22.02  ? 482  PHE A O     1 
ATOM   3990  C  CB    . PHE C 3  482  ? -0.475  -46.380  41.287  1.00 15.57  ? 482  PHE A CB    1 
ATOM   3991  C  CG    . PHE C 3  482  ? 0.020   -47.810  41.201  1.00 13.83  ? 482  PHE A CG    1 
ATOM   3992  C  CD1   . PHE C 3  482  ? -0.530  -48.807  41.997  1.00 13.42  ? 482  PHE A CD1   1 
ATOM   3993  C  CD2   . PHE C 3  482  ? 1.040   -48.163  40.326  1.00 15.56  ? 482  PHE A CD2   1 
ATOM   3994  C  CE1   . PHE C 3  482  ? -0.071  -50.136  41.914  1.00 9.75   ? 482  PHE A CE1   1 
ATOM   3995  C  CE2   . PHE C 3  482  ? 1.503   -49.497  40.242  1.00 12.21  ? 482  PHE A CE2   1 
ATOM   3996  C  CZ    . PHE C 3  482  ? 0.945   -50.474  41.036  1.00 5.74   ? 482  PHE A CZ    1 
ATOM   3997  N  N     . ASP C 3  483  ? 0.470   -43.193  42.978  1.00 20.41  ? 483  ASP A N     1 
ATOM   3998  C  CA    . ASP C 3  483  ? -0.002  -41.815  43.069  1.00 23.05  ? 483  ASP A CA    1 
ATOM   3999  C  C     . ASP C 3  483  ? 0.708   -40.919  42.069  1.00 23.17  ? 483  ASP A C     1 
ATOM   4000  O  O     . ASP C 3  483  ? 0.514   -39.710  42.063  1.00 23.29  ? 483  ASP A O     1 
ATOM   4001  C  CB    . ASP C 3  483  ? 0.189   -41.252  44.480  1.00 27.41  ? 483  ASP A CB    1 
ATOM   4002  C  CG    . ASP C 3  483  ? 1.650   -41.226  44.928  1.00 36.52  ? 483  ASP A CG    1 
ATOM   4003  O  OD1   . ASP C 3  483  ? 1.889   -40.716  46.050  1.00 41.35  ? 483  ASP A OD1   1 
ATOM   4004  O  OD2   . ASP C 3  483  ? 2.548   -41.707  44.185  1.00 38.74  ? 483  ASP A OD2   1 
ATOM   4005  N  N     . GLY C 3  484  ? 1.534   -41.518  41.221  1.00 24.53  ? 484  GLY A N     1 
ATOM   4006  C  CA    . GLY C 3  484  ? 2.246   -40.736  40.229  1.00 25.07  ? 484  GLY A CA    1 
ATOM   4007  C  C     . GLY C 3  484  ? 3.674   -41.164  39.934  1.00 26.04  ? 484  GLY A C     1 
ATOM   4008  O  O     . GLY C 3  484  ? 4.286   -40.668  38.994  1.00 28.55  ? 484  GLY A O     1 
ATOM   4009  N  N     . ASP C 3  485  ? 4.212   -42.077  40.731  1.00 25.43  ? 485  ASP A N     1 
ATOM   4010  C  CA    . ASP C 3  485  ? 5.576   -42.553  40.543  1.00 23.34  ? 485  ASP A CA    1 
ATOM   4011  C  C     . ASP C 3  485  ? 5.884   -42.892  39.079  1.00 23.29  ? 485  ASP A C     1 
ATOM   4012  O  O     . ASP C 3  485  ? 5.026   -43.388  38.349  1.00 24.56  ? 485  ASP A O     1 
ATOM   4013  C  CB    . ASP C 3  485  ? 5.802   -43.808  41.399  1.00 27.36  ? 485  ASP A CB    1 
ATOM   4014  C  CG    . ASP C 3  485  ? 5.582   -43.568  42.889  1.00 34.60  ? 485  ASP A CG    1 
ATOM   4015  O  OD1   . ASP C 3  485  ? 5.415   -42.404  43.296  1.00 37.52  ? 485  ASP A OD1   1 
ATOM   4016  O  OD2   . ASP C 3  485  ? 5.588   -44.551  43.667  1.00 38.78  ? 485  ASP A OD2   1 
ATOM   4017  N  N     . GLU C 3  486  ? 7.100   -42.604  38.637  1.00 21.11  ? 486  GLU A N     1 
ATOM   4018  C  CA    . GLU C 3  486  ? 7.495   -42.977  37.281  1.00 20.50  ? 486  GLU A CA    1 
ATOM   4019  C  C     . GLU C 3  486  ? 8.551   -44.068  37.452  1.00 20.11  ? 486  GLU A C     1 
ATOM   4020  O  O     . GLU C 3  486  ? 9.208   -44.129  38.482  1.00 22.61  ? 486  GLU A O     1 
ATOM   4021  C  CB    . GLU C 3  486  ? 8.134   -41.813  36.534  1.00 21.40  ? 486  GLU A CB    1 
ATOM   4022  C  CG    . GLU C 3  486  ? 7.214   -40.762  35.982  1.00 26.72  ? 486  GLU A CG    1 
ATOM   4023  C  CD    . GLU C 3  486  ? 8.008   -39.670  35.282  1.00 34.74  ? 486  GLU A CD    1 
ATOM   4024  O  OE1   . GLU C 3  486  ? 8.185   -38.568  35.854  1.00 35.91  ? 486  GLU A OE1   1 
ATOM   4025  O  OE2   . GLU C 3  486  ? 8.480   -39.931  34.156  1.00 38.09  ? 486  GLU A OE2   1 
ATOM   4026  N  N     . MET C 3  487  ? 8.729   -44.926  36.459  1.00 20.42  ? 487  MET A N     1 
ATOM   4027  C  CA    . MET C 3  487  ? 9.740   -45.965  36.572  1.00 22.47  ? 487  MET A CA    1 
ATOM   4028  C  C     . MET C 3  487  ? 10.597  -46.146  35.328  1.00 26.10  ? 487  MET A C     1 
ATOM   4029  O  O     . MET C 3  487  ? 10.121  -45.938  34.202  1.00 30.40  ? 487  MET A O     1 
ATOM   4030  C  CB    . MET C 3  487  ? 9.098   -47.285  36.947  1.00 18.42  ? 487  MET A CB    1 
ATOM   4031  C  CG    . MET C 3  487  ? 8.890   -47.390  38.422  1.00 15.19  ? 487  MET A CG    1 
ATOM   4032  S  SD    . MET C 3  487  ? 8.634   -49.077  38.869  1.00 16.29  ? 487  MET A SD    1 
ATOM   4033  C  CE    . MET C 3  487  ? 7.538   -48.845  40.122  1.00 11.28  ? 487  MET A CE    1 
ATOM   4034  N  N     . ASN C 3  488  ? 11.860  -46.531  35.536  1.00 25.37  ? 488  ASN A N     1 
ATOM   4035  C  CA    . ASN C 3  488  ? 12.789  -46.723  34.435  1.00 24.94  ? 488  ASN A CA    1 
ATOM   4036  C  C     . ASN C 3  488  ? 12.973  -48.169  33.989  1.00 24.31  ? 488  ASN A C     1 
ATOM   4037  O  O     . ASN C 3  488  ? 13.044  -49.092  34.817  1.00 24.63  ? 488  ASN A O     1 
ATOM   4038  C  CB    . ASN C 3  488  ? 14.138  -46.122  34.796  1.00 30.00  ? 488  ASN A CB    1 
ATOM   4039  C  CG    . ASN C 3  488  ? 14.104  -44.612  34.828  1.00 36.94  ? 488  ASN A CG    1 
ATOM   4040  O  OD1   . ASN C 3  488  ? 13.349  -43.985  34.080  1.00 39.16  ? 488  ASN A OD1   1 
ATOM   4041  N  ND2   . ASN C 3  488  ? 14.939  -44.011  35.677  1.00 41.30  ? 488  ASN A ND2   1 
ATOM   4042  N  N     . LEU C 3  489  ? 13.063  -48.351  32.672  1.00 20.70  ? 489  LEU A N     1 
ATOM   4043  C  CA    . LEU C 3  489  ? 13.233  -49.669  32.063  1.00 20.24  ? 489  LEU A CA    1 
ATOM   4044  C  C     . LEU C 3  489  ? 14.477  -49.632  31.183  1.00 20.12  ? 489  LEU A C     1 
ATOM   4045  O  O     . LEU C 3  489  ? 14.703  -48.644  30.505  1.00 23.50  ? 489  LEU A O     1 
ATOM   4046  C  CB    . LEU C 3  489  ? 12.003  -50.000  31.206  1.00 16.54  ? 489  LEU A CB    1 
ATOM   4047  C  CG    . LEU C 3  489  ? 12.055  -51.163  30.215  1.00 11.61  ? 489  LEU A CG    1 
ATOM   4048  C  CD1   . LEU C 3  489  ? 11.640  -52.413  30.899  1.00 14.20  ? 489  LEU A CD1   1 
ATOM   4049  C  CD2   . LEU C 3  489  ? 11.122  -50.918  29.085  1.00 6.68   ? 489  LEU A CD2   1 
ATOM   4050  N  N     . HIS C 3  490  ? 15.271  -50.703  31.199  1.00 19.97  ? 490  HIS A N     1 
ATOM   4051  C  CA    . HIS C 3  490  ? 16.501  -50.815  30.396  1.00 18.86  ? 490  HIS A CA    1 
ATOM   4052  C  C     . HIS C 3  490  ? 16.458  -52.125  29.625  1.00 20.14  ? 490  HIS A C     1 
ATOM   4053  O  O     . HIS C 3  490  ? 16.045  -53.145  30.180  1.00 23.43  ? 490  HIS A O     1 
ATOM   4054  C  CB    . HIS C 3  490  ? 17.730  -50.852  31.301  1.00 15.91  ? 490  HIS A CB    1 
ATOM   4055  C  CG    . HIS C 3  490  ? 17.869  -49.656  32.183  1.00 12.81  ? 490  HIS A CG    1 
ATOM   4056  N  ND1   . HIS C 3  490  ? 18.438  -48.479  31.752  1.00 9.67   ? 490  HIS A ND1   1 
ATOM   4057  C  CD2   . HIS C 3  490  ? 17.476  -49.441  33.460  1.00 12.45  ? 490  HIS A CD2   1 
ATOM   4058  C  CE1   . HIS C 3  490  ? 18.387  -47.588  32.727  1.00 15.98  ? 490  HIS A CE1   1 
ATOM   4059  N  NE2   . HIS C 3  490  ? 17.807  -48.145  33.775  1.00 14.22  ? 490  HIS A NE2   1 
ATOM   4060  N  N     . VAL C 3  491  ? 16.893  -52.127  28.368  1.00 19.70  ? 491  VAL A N     1 
ATOM   4061  C  CA    . VAL C 3  491  ? 16.867  -53.376  27.602  1.00 18.39  ? 491  VAL A CA    1 
ATOM   4062  C  C     . VAL C 3  491  ? 18.238  -54.000  27.346  1.00 21.13  ? 491  VAL A C     1 
ATOM   4063  O  O     . VAL C 3  491  ? 19.154  -53.358  26.826  1.00 17.38  ? 491  VAL A O     1 
ATOM   4064  C  CB    . VAL C 3  491  ? 16.188  -53.220  26.232  1.00 16.14  ? 491  VAL A CB    1 
ATOM   4065  C  CG1   . VAL C 3  491  ? 15.911  -54.580  25.678  1.00 14.37  ? 491  VAL A CG1   1 
ATOM   4066  C  CG2   . VAL C 3  491  ? 14.906  -52.427  26.338  1.00 12.26  ? 491  VAL A CG2   1 
ATOM   4067  N  N     . PRO C 3  492  ? 18.391  -55.276  27.717  1.00 24.63  ? 492  PRO A N     1 
ATOM   4068  C  CA    . PRO C 3  492  ? 19.657  -55.981  27.514  1.00 27.43  ? 492  PRO A CA    1 
ATOM   4069  C  C     . PRO C 3  492  ? 19.929  -55.922  26.038  1.00 29.54  ? 492  PRO A C     1 
ATOM   4070  O  O     . PRO C 3  492  ? 18.997  -55.994  25.244  1.00 30.21  ? 492  PRO A O     1 
ATOM   4071  C  CB    . PRO C 3  492  ? 19.344  -57.400  27.975  1.00 30.25  ? 492  PRO A CB    1 
ATOM   4072  C  CG    . PRO C 3  492  ? 17.870  -57.540  27.690  1.00 32.00  ? 492  PRO A CG    1 
ATOM   4073  C  CD    . PRO C 3  492  ? 17.339  -56.203  28.169  1.00 28.50  ? 492  PRO A CD    1 
ATOM   4074  N  N     . GLN C 3  493  ? 21.192  -55.798  25.662  1.00 32.59  ? 493  GLN A N     1 
ATOM   4075  C  CA    . GLN C 3  493  ? 21.532  -55.704  24.252  1.00 34.28  ? 493  GLN A CA    1 
ATOM   4076  C  C     . GLN C 3  493  ? 22.294  -56.919  23.742  1.00 35.45  ? 493  GLN A C     1 
ATOM   4077  O  O     . GLN C 3  493  ? 22.304  -57.196  22.542  1.00 32.69  ? 493  GLN A O     1 
ATOM   4078  C  CB    . GLN C 3  493  ? 22.344  -54.428  24.011  1.00 34.24  ? 493  GLN A CB    1 
ATOM   4079  C  CG    . GLN C 3  493  ? 21.761  -53.526  22.940  1.00 37.30  ? 493  GLN A CG    1 
ATOM   4080  C  CD    . GLN C 3  493  ? 20.332  -53.097  23.242  1.00 39.94  ? 493  GLN A CD    1 
ATOM   4081  O  OE1   . GLN C 3  493  ? 19.642  -52.563  22.373  1.00 41.72  ? 493  GLN A OE1   1 
ATOM   4082  N  NE2   . GLN C 3  493  ? 19.884  -53.323  24.476  1.00 38.54  ? 493  GLN A NE2   1 
ATOM   4083  N  N     . SER C 3  494  ? 22.910  -57.655  24.661  1.00 38.00  ? 494  SER A N     1 
ATOM   4084  C  CA    . SER C 3  494  ? 23.698  -58.822  24.287  1.00 39.94  ? 494  SER A CA    1 
ATOM   4085  C  C     . SER C 3  494  ? 23.041  -60.110  24.749  1.00 37.17  ? 494  SER A C     1 
ATOM   4086  O  O     . SER C 3  494  ? 22.399  -60.149  25.789  1.00 37.43  ? 494  SER A O     1 
ATOM   4087  C  CB    . SER C 3  494  ? 25.114  -58.713  24.888  1.00 46.29  ? 494  SER A CB    1 
ATOM   4088  O  OG    . SER C 3  494  ? 25.734  -57.460  24.587  1.00 49.17  ? 494  SER A OG    1 
ATOM   4089  N  N     . GLU C 3  495  ? 23.214  -61.164  23.968  1.00 36.09  ? 495  GLU A N     1 
ATOM   4090  C  CA    . GLU C 3  495  ? 22.643  -62.460  24.294  1.00 37.09  ? 495  GLU A CA    1 
ATOM   4091  C  C     . GLU C 3  495  ? 23.034  -62.884  25.711  1.00 37.76  ? 495  GLU A C     1 
ATOM   4092  O  O     . GLU C 3  495  ? 22.253  -63.532  26.414  1.00 38.22  ? 495  GLU A O     1 
ATOM   4093  C  CB    . GLU C 3  495  ? 23.124  -63.498  23.280  1.00 38.49  ? 495  GLU A CB    1 
ATOM   4094  C  CG    . GLU C 3  495  ? 22.418  -64.814  23.376  1.00 42.98  ? 495  GLU A CG    1 
ATOM   4095  C  CD    . GLU C 3  495  ? 20.928  -64.660  23.222  1.00 48.10  ? 495  GLU A CD    1 
ATOM   4096  O  OE1   . GLU C 3  495  ? 20.475  -64.280  22.112  1.00 44.70  ? 495  GLU A OE1   1 
ATOM   4097  O  OE2   . GLU C 3  495  ? 20.217  -64.916  24.223  1.00 52.92  ? 495  GLU A OE2   1 
ATOM   4098  N  N     . GLU C 3  496  ? 24.249  -62.517  26.118  1.00 38.52  ? 496  GLU A N     1 
ATOM   4099  C  CA    . GLU C 3  496  ? 24.760  -62.837  27.448  1.00 38.09  ? 496  GLU A CA    1 
ATOM   4100  C  C     . GLU C 3  496  ? 23.950  -61.986  28.373  1.00 36.09  ? 496  GLU A C     1 
ATOM   4101  O  O     . GLU C 3  496  ? 23.221  -62.482  29.219  1.00 37.51  ? 496  GLU A O     1 
ATOM   4102  C  CB    . GLU C 3  496  ? 26.215  -62.421  27.573  1.00 42.10  ? 496  GLU A CB    1 
ATOM   4103  C  CG    . GLU C 3  496  ? 27.099  -62.949  26.475  1.00 51.41  ? 496  GLU A CG    1 
ATOM   4104  C  CD    . GLU C 3  496  ? 28.427  -62.238  26.435  1.00 56.95  ? 496  GLU A CD    1 
ATOM   4105  O  OE1   . GLU C 3  496  ? 28.424  -61.014  26.174  1.00 59.56  ? 496  GLU A OE1   1 
ATOM   4106  O  OE2   . GLU C 3  496  ? 29.463  -62.898  26.670  1.00 58.44  ? 496  GLU A OE2   1 
ATOM   4107  N  N     . THR C 3  497  ? 24.101  -60.683  28.187  1.00 33.86  ? 497  THR A N     1 
ATOM   4108  C  CA    . THR C 3  497  ? 23.384  -59.687  28.958  1.00 32.77  ? 497  THR A CA    1 
ATOM   4109  C  C     . THR C 3  497  ? 21.991  -60.191  29.337  1.00 30.92  ? 497  THR A C     1 
ATOM   4110  O  O     . THR C 3  497  ? 21.629  -60.187  30.509  1.00 30.36  ? 497  THR A O     1 
ATOM   4111  C  CB    . THR C 3  497  ? 23.225  -58.395  28.142  1.00 32.61  ? 497  THR A CB    1 
ATOM   4112  O  OG1   . THR C 3  497  ? 24.509  -57.913  27.748  1.00 33.89  ? 497  THR A OG1   1 
ATOM   4113  C  CG2   . THR C 3  497  ? 22.553  -57.336  28.962  1.00 37.66  ? 497  THR A CG2   1 
ATOM   4114  N  N     . ARG C 3  498  ? 21.213  -60.621  28.345  1.00 28.64  ? 498  ARG A N     1 
ATOM   4115  C  CA    . ARG C 3  498  ? 19.869  -61.117  28.604  1.00 27.32  ? 498  ARG A CA    1 
ATOM   4116  C  C     . ARG C 3  498  ? 19.936  -62.215  29.636  1.00 28.02  ? 498  ARG A C     1 
ATOM   4117  O  O     . ARG C 3  498  ? 19.240  -62.176  30.652  1.00 29.61  ? 498  ARG A O     1 
ATOM   4118  C  CB    . ARG C 3  498  ? 19.237  -61.728  27.364  1.00 26.57  ? 498  ARG A CB    1 
ATOM   4119  C  CG    . ARG C 3  498  ? 19.282  -60.918  26.120  1.00 25.82  ? 498  ARG A CG    1 
ATOM   4120  C  CD    . ARG C 3  498  ? 18.507  -61.669  25.064  1.00 28.83  ? 498  ARG A CD    1 
ATOM   4121  N  NE    . ARG C 3  498  ? 17.099  -61.281  25.051  1.00 37.08  ? 498  ARG A NE    1 
ATOM   4122  C  CZ    . ARG C 3  498  ? 16.097  -62.086  24.710  1.00 38.23  ? 498  ARG A CZ    1 
ATOM   4123  N  NH1   . ARG C 3  498  ? 16.342  -63.347  24.360  1.00 36.10  ? 498  ARG A NH1   1 
ATOM   4124  N  NH2   . ARG C 3  498  ? 14.851  -61.619  24.703  1.00 38.06  ? 498  ARG A NH2   1 
ATOM   4125  N  N     . ALA C 3  499  ? 20.765  -63.211  29.348  1.00 27.98  ? 499  ALA A N     1 
ATOM   4126  C  CA    . ALA C 3  499  ? 20.935  -64.361  30.231  1.00 30.64  ? 499  ALA A CA    1 
ATOM   4127  C  C     . ALA C 3  499  ? 21.215  -63.940  31.673  1.00 30.92  ? 499  ALA A C     1 
ATOM   4128  O  O     . ALA C 3  499  ? 20.678  -64.521  32.627  1.00 30.70  ? 499  ALA A O     1 
ATOM   4129  C  CB    . ALA C 3  499  ? 22.073  -65.254  29.712  1.00 31.11  ? 499  ALA A CB    1 
ATOM   4130  N  N     . GLU C 3  500  ? 22.056  -62.920  31.813  1.00 29.67  ? 500  GLU A N     1 
ATOM   4131  C  CA    . GLU C 3  500  ? 22.453  -62.405  33.108  1.00 29.53  ? 500  GLU A CA    1 
ATOM   4132  C  C     . GLU C 3  500  ? 21.266  -61.833  33.860  1.00 30.24  ? 500  GLU A C     1 
ATOM   4133  O  O     . GLU C 3  500  ? 21.258  -61.814  35.086  1.00 30.89  ? 500  GLU A O     1 
ATOM   4134  C  CB    . GLU C 3  500  ? 23.517  -61.336  32.913  1.00 30.47  ? 500  GLU A CB    1 
ATOM   4135  C  CG    . GLU C 3  500  ? 24.616  -61.376  33.937  1.00 35.27  ? 500  GLU A CG    1 
ATOM   4136  C  CD    . GLU C 3  500  ? 25.759  -60.445  33.589  1.00 39.68  ? 500  GLU A CD    1 
ATOM   4137  O  OE1   . GLU C 3  500  ? 25.586  -59.212  33.736  1.00 41.91  ? 500  GLU A OE1   1 
ATOM   4138  O  OE2   . GLU C 3  500  ? 26.825  -60.946  33.161  1.00 36.96  ? 500  GLU A OE2   1 
ATOM   4139  N  N     . LEU C 3  501  ? 20.266  -61.366  33.117  1.00 30.92  ? 501  LEU A N     1 
ATOM   4140  C  CA    . LEU C 3  501  ? 19.066  -60.794  33.715  1.00 29.66  ? 501  LEU A CA    1 
ATOM   4141  C  C     . LEU C 3  501  ? 18.076  -61.887  34.052  1.00 29.08  ? 501  LEU A C     1 
ATOM   4142  O  O     . LEU C 3  501  ? 17.521  -61.922  35.141  1.00 32.06  ? 501  LEU A O     1 
ATOM   4143  C  CB    . LEU C 3  501  ? 18.375  -59.808  32.764  1.00 28.82  ? 501  LEU A CB    1 
ATOM   4144  C  CG    . LEU C 3  501  ? 18.983  -58.469  32.317  1.00 32.18  ? 501  LEU A CG    1 
ATOM   4145  C  CD1   . LEU C 3  501  ? 17.854  -57.587  31.808  1.00 31.30  ? 501  LEU A CD1   1 
ATOM   4146  C  CD2   . LEU C 3  501  ? 19.675  -57.742  33.458  1.00 36.04  ? 501  LEU A CD2   1 
ATOM   4147  N  N     . SER C 3  502  ? 17.857  -62.784  33.109  1.00 26.20  ? 502  SER A N     1 
ATOM   4148  C  CA    . SER C 3  502  ? 16.901  -63.848  33.303  1.00 27.62  ? 502  SER A CA    1 
ATOM   4149  C  C     . SER C 3  502  ? 17.322  -64.960  34.244  1.00 28.98  ? 502  SER A C     1 
ATOM   4150  O  O     . SER C 3  502  ? 16.491  -65.779  34.652  1.00 30.59  ? 502  SER A O     1 
ATOM   4151  C  CB    . SER C 3  502  ? 16.555  -64.445  31.952  1.00 31.46  ? 502  SER A CB    1 
ATOM   4152  O  OG    . SER C 3  502  ? 17.736  -64.684  31.210  1.00 35.69  ? 502  SER A OG    1 
ATOM   4153  N  N     . GLN C 3  503  ? 18.601  -64.998  34.599  1.00 29.27  ? 503  GLN A N     1 
ATOM   4154  C  CA    . GLN C 3  503  ? 19.109  -66.059  35.476  1.00 27.17  ? 503  GLN A CA    1 
ATOM   4155  C  C     . GLN C 3  503  ? 19.556  -65.587  36.846  1.00 23.56  ? 503  GLN A C     1 
ATOM   4156  O  O     . GLN C 3  503  ? 19.728  -66.381  37.757  1.00 22.81  ? 503  GLN A O     1 
ATOM   4157  C  CB    . GLN C 3  503  ? 20.288  -66.760  34.803  1.00 30.60  ? 503  GLN A CB    1 
ATOM   4158  C  CG    . GLN C 3  503  ? 20.042  -68.205  34.441  1.00 36.31  ? 503  GLN A CG    1 
ATOM   4159  C  CD    . GLN C 3  503  ? 18.842  -68.362  33.553  1.00 38.62  ? 503  GLN A CD    1 
ATOM   4160  O  OE1   . GLN C 3  503  ? 18.615  -67.545  32.659  1.00 41.61  ? 503  GLN A OE1   1 
ATOM   4161  N  NE2   . GLN C 3  503  ? 18.068  -69.416  33.780  1.00 40.83  ? 503  GLN A NE2   1 
ATOM   4162  N  N     . LEU C 3  504  ? 19.755  -64.289  36.982  1.00 20.83  ? 504  LEU A N     1 
ATOM   4163  C  CA    . LEU C 3  504  ? 20.217  -63.739  38.228  1.00 19.04  ? 504  LEU A CA    1 
ATOM   4164  C  C     . LEU C 3  504  ? 19.293  -62.675  38.763  1.00 22.08  ? 504  LEU A C     1 
ATOM   4165  O  O     . LEU C 3  504  ? 18.973  -62.679  39.944  1.00 25.98  ? 504  LEU A O     1 
ATOM   4166  C  CB    . LEU C 3  504  ? 21.599  -63.129  38.028  1.00 19.26  ? 504  LEU A CB    1 
ATOM   4167  C  CG    . LEU C 3  504  ? 22.883  -63.946  38.202  1.00 16.87  ? 504  LEU A CG    1 
ATOM   4168  C  CD1   . LEU C 3  504  ? 22.691  -65.355  37.710  1.00 13.53  ? 504  LEU A CD1   1 
ATOM   4169  C  CD2   . LEU C 3  504  ? 24.019  -63.236  37.474  1.00 8.44   ? 504  LEU A CD2   1 
ATOM   4170  N  N     . CYS C 3  505  ? 18.846  -61.767  37.903  1.00 22.70  ? 505  CYS A N     1 
ATOM   4171  C  CA    . CYS C 3  505  ? 17.991  -60.663  38.345  1.00 23.91  ? 505  CYS A CA    1 
ATOM   4172  C  C     . CYS C 3  505  ? 16.479  -60.762  38.124  1.00 22.52  ? 505  CYS A C     1 
ATOM   4173  O  O     . CYS C 3  505  ? 15.764  -59.772  38.276  1.00 23.48  ? 505  CYS A O     1 
ATOM   4174  C  CB    . CYS C 3  505  ? 18.509  -59.389  37.702  1.00 28.01  ? 505  CYS A CB    1 
ATOM   4175  S  SG    . CYS C 3  505  ? 20.305  -59.355  37.681  1.00 35.48  ? 505  CYS A SG    1 
ATOM   4176  N  N     . ALA C 3  506  ? 15.999  -61.949  37.772  1.00 20.72  ? 506  ALA A N     1 
ATOM   4177  C  CA    . ALA C 3  506  ? 14.585  -62.177  37.524  1.00 16.96  ? 506  ALA A CA    1 
ATOM   4178  C  C     . ALA C 3  506  ? 13.782  -62.026  38.811  1.00 16.85  ? 506  ALA A C     1 
ATOM   4179  O  O     . ALA C 3  506  ? 14.226  -62.467  39.876  1.00 14.65  ? 506  ALA A O     1 
ATOM   4180  C  CB    . ALA C 3  506  ? 14.394  -63.559  36.951  1.00 14.93  ? 506  ALA A CB    1 
ATOM   4181  N  N     . VAL C 3  507  ? 12.603  -61.406  38.698  1.00 15.58  ? 507  VAL A N     1 
ATOM   4182  C  CA    . VAL C 3  507  ? 11.709  -61.177  39.839  1.00 15.45  ? 507  VAL A CA    1 
ATOM   4183  C  C     . VAL C 3  507  ? 11.431  -62.448  40.600  1.00 16.10  ? 507  VAL A C     1 
ATOM   4184  O  O     . VAL C 3  507  ? 11.322  -62.440  41.813  1.00 16.46  ? 507  VAL A O     1 
ATOM   4185  C  CB    . VAL C 3  507  ? 10.359  -60.586  39.405  1.00 16.02  ? 507  VAL A CB    1 
ATOM   4186  C  CG1   . VAL C 3  507  ? 9.431   -60.417  40.610  1.00 11.79  ? 507  VAL A CG1   1 
ATOM   4187  C  CG2   . VAL C 3  507  ? 10.589  -59.260  38.751  1.00 17.29  ? 507  VAL A CG2   1 
ATOM   4188  N  N     . PRO C 3  508  ? 11.276  -63.560  39.891  1.00 17.04  ? 508  PRO A N     1 
ATOM   4189  C  CA    . PRO C 3  508  ? 11.016  -64.813  40.599  1.00 20.05  ? 508  PRO A CA    1 
ATOM   4190  C  C     . PRO C 3  508  ? 12.109  -65.025  41.641  1.00 22.80  ? 508  PRO A C     1 
ATOM   4191  O  O     . PRO C 3  508  ? 11.850  -65.122  42.845  1.00 23.50  ? 508  PRO A O     1 
ATOM   4192  C  CB    . PRO C 3  508  ? 11.104  -65.847  39.494  1.00 19.12  ? 508  PRO A CB    1 
ATOM   4193  C  CG    . PRO C 3  508  ? 10.596  -65.093  38.299  1.00 22.47  ? 508  PRO A CG    1 
ATOM   4194  C  CD    . PRO C 3  508  ? 11.229  -63.743  38.431  1.00 17.82  ? 508  PRO A CD    1 
ATOM   4195  N  N     . LEU C 3  509  ? 13.338  -65.072  41.135  1.00 24.99  ? 509  LEU A N     1 
ATOM   4196  C  CA    . LEU C 3  509  ? 14.554  -65.283  41.914  1.00 25.96  ? 509  LEU A CA    1 
ATOM   4197  C  C     . LEU C 3  509  ? 14.705  -64.376  43.113  1.00 27.60  ? 509  LEU A C     1 
ATOM   4198  O  O     . LEU C 3  509  ? 15.470  -64.676  44.018  1.00 31.97  ? 509  LEU A O     1 
ATOM   4199  C  CB    . LEU C 3  509  ? 15.769  -65.080  41.017  1.00 21.74  ? 509  LEU A CB    1 
ATOM   4200  C  CG    . LEU C 3  509  ? 15.747  -65.902  39.739  1.00 19.93  ? 509  LEU A CG    1 
ATOM   4201  C  CD1   . LEU C 3  509  ? 16.851  -65.471  38.792  1.00 18.39  ? 509  LEU A CD1   1 
ATOM   4202  C  CD2   . LEU C 3  509  ? 15.872  -67.356  40.119  1.00 18.02  ? 509  LEU A CD2   1 
ATOM   4203  N  N     . GLN C 3  510  ? 13.987  -63.268  43.127  1.00 27.07  ? 510  GLN A N     1 
ATOM   4204  C  CA    . GLN C 3  510  ? 14.120  -62.334  44.224  1.00 29.65  ? 510  GLN A CA    1 
ATOM   4205  C  C     . GLN C 3  510  ? 13.045  -62.357  45.307  1.00 31.96  ? 510  GLN A C     1 
ATOM   4206  O  O     . GLN C 3  510  ? 13.096  -61.527  46.206  1.00 36.02  ? 510  GLN A O     1 
ATOM   4207  C  CB    . GLN C 3  510  ? 14.203  -60.924  43.655  1.00 29.22  ? 510  GLN A CB    1 
ATOM   4208  C  CG    . GLN C 3  510  ? 15.308  -60.742  42.634  1.00 35.12  ? 510  GLN A CG    1 
ATOM   4209  C  CD    . GLN C 3  510  ? 16.678  -60.670  43.271  1.00 35.84  ? 510  GLN A CD    1 
ATOM   4210  O  OE1   . GLN C 3  510  ? 16.863  -59.956  44.255  1.00 37.38  ? 510  GLN A OE1   1 
ATOM   4211  N  NE2   . GLN C 3  510  ? 17.650  -61.393  42.707  1.00 33.44  ? 510  GLN A NE2   1 
ATOM   4212  N  N     . ILE C 3  511  ? 12.087  -63.283  45.257  1.00 31.97  ? 511  ILE A N     1 
ATOM   4213  C  CA    . ILE C 3  511  ? 11.018  -63.279  46.264  1.00 30.05  ? 511  ILE A CA    1 
ATOM   4214  C  C     . ILE C 3  511  ? 11.522  -63.401  47.698  1.00 31.20  ? 511  ILE A C     1 
ATOM   4215  O  O     . ILE C 3  511  ? 11.074  -62.657  48.574  1.00 30.41  ? 511  ILE A O     1 
ATOM   4216  C  CB    . ILE C 3  511  ? 9.958   -64.362  45.974  1.00 28.63  ? 511  ILE A CB    1 
ATOM   4217  C  CG1   . ILE C 3  511  ? 9.386   -64.141  44.569  1.00 23.43  ? 511  ILE A CG1   1 
ATOM   4218  C  CG2   . ILE C 3  511  ? 8.843   -64.307  47.028  1.00 22.77  ? 511  ILE A CG2   1 
ATOM   4219  C  CD1   . ILE C 3  511  ? 8.163   -64.962  44.252  1.00 23.42  ? 511  ILE A CD1   1 
ATOM   4220  N  N     . VAL C 3  512  ? 12.446  -64.330  47.938  1.00 32.27  ? 512  VAL A N     1 
ATOM   4221  C  CA    . VAL C 3  512  ? 13.039  -64.490  49.268  1.00 34.95  ? 512  VAL A CA    1 
ATOM   4222  C  C     . VAL C 3  512  ? 14.345  -63.704  49.254  1.00 36.03  ? 512  VAL A C     1 
ATOM   4223  O  O     . VAL C 3  512  ? 15.345  -64.146  48.680  1.00 37.16  ? 512  VAL A O     1 
ATOM   4224  C  CB    . VAL C 3  512  ? 13.349  -65.955  49.593  1.00 34.40  ? 512  VAL A CB    1 
ATOM   4225  C  CG1   . VAL C 3  512  ? 14.402  -66.026  50.667  1.00 35.12  ? 512  VAL A CG1   1 
ATOM   4226  C  CG2   . VAL C 3  512  ? 12.091  -66.653  50.079  1.00 37.12  ? 512  VAL A CG2   1 
ATOM   4227  N  N     . SER C 3  513  ? 14.320  -62.531  49.878  1.00 36.44  ? 513  SER A N     1 
ATOM   4228  C  CA    . SER C 3  513  ? 15.479  -61.649  49.918  1.00 37.26  ? 513  SER A CA    1 
ATOM   4229  C  C     . SER C 3  513  ? 16.429  -61.997  51.052  1.00 36.47  ? 513  SER A C     1 
ATOM   4230  O  O     . SER C 3  513  ? 15.995  -62.318  52.164  1.00 35.95  ? 513  SER A O     1 
ATOM   4231  C  CB    . SER C 3  513  ? 15.042  -60.200  50.108  1.00 39.82  ? 513  SER A CB    1 
ATOM   4232  O  OG    . SER C 3  513  ? 14.835  -59.939  51.493  1.00 43.84  ? 513  SER A OG    1 
ATOM   4233  N  N     . PRO C 3  514  ? 17.744  -61.898  50.791  1.00 33.92  ? 514  PRO A N     1 
ATOM   4234  C  CA    . PRO C 3  514  ? 18.772  -62.197  51.775  1.00 29.64  ? 514  PRO A CA    1 
ATOM   4235  C  C     . PRO C 3  514  ? 18.889  -61.169  52.877  1.00 27.05  ? 514  PRO A C     1 
ATOM   4236  O  O     . PRO C 3  514  ? 19.355  -61.490  53.952  1.00 26.43  ? 514  PRO A O     1 
ATOM   4237  C  CB    . PRO C 3  514  ? 20.036  -62.257  50.930  1.00 31.67  ? 514  PRO A CB    1 
ATOM   4238  C  CG    . PRO C 3  514  ? 19.785  -61.235  49.899  1.00 30.46  ? 514  PRO A CG    1 
ATOM   4239  C  CD    . PRO C 3  514  ? 18.367  -61.560  49.498  1.00 34.04  ? 514  PRO A CD    1 
ATOM   4240  N  N     . GLN C 3  515  ? 18.464  -59.937  52.645  1.00 26.11  ? 515  GLN A N     1 
ATOM   4241  C  CA    . GLN C 3  515  ? 18.644  -58.954  53.701  1.00 28.24  ? 515  GLN A CA    1 
ATOM   4242  C  C     . GLN C 3  515  ? 17.904  -59.273  54.982  1.00 30.12  ? 515  GLN A C     1 
ATOM   4243  O  O     . GLN C 3  515  ? 18.513  -59.336  56.040  1.00 31.97  ? 515  GLN A O     1 
ATOM   4244  C  CB    . GLN C 3  515  ? 18.301  -57.536  53.220  1.00 27.39  ? 515  GLN A CB    1 
ATOM   4245  C  CG    . GLN C 3  515  ? 16.881  -57.086  53.412  1.00 25.87  ? 515  GLN A CG    1 
ATOM   4246  C  CD    . GLN C 3  515  ? 16.742  -55.588  53.262  1.00 28.53  ? 515  GLN A CD    1 
ATOM   4247  O  OE1   . GLN C 3  515  ? 17.135  -55.011  52.243  1.00 25.65  ? 515  GLN A OE1   1 
ATOM   4248  N  NE2   . GLN C 3  515  ? 16.179  -54.943  54.283  1.00 30.62  ? 515  GLN A NE2   1 
ATOM   4249  N  N     . SER C 3  516  ? 16.599  -59.491  54.889  1.00 34.80  ? 516  SER A N     1 
ATOM   4250  C  CA    . SER C 3  516  ? 15.763  -59.805  56.055  1.00 35.97  ? 516  SER A CA    1 
ATOM   4251  C  C     . SER C 3  516  ? 15.633  -61.317  56.172  1.00 33.72  ? 516  SER A C     1 
ATOM   4252  O  O     . SER C 3  516  ? 14.867  -61.828  56.982  1.00 33.96  ? 516  SER A O     1 
ATOM   4253  C  CB    . SER C 3  516  ? 14.374  -59.191  55.868  1.00 41.41  ? 516  SER A CB    1 
ATOM   4254  O  OG    . SER C 3  516  ? 13.831  -59.567  54.601  1.00 48.41  ? 516  SER A OG    1 
ATOM   4255  N  N     . ASN C 3  517  ? 16.395  -62.011  55.337  1.00 31.84  ? 517  ASN A N     1 
ATOM   4256  C  CA    . ASN C 3  517  ? 16.418  -63.468  55.253  1.00 29.62  ? 517  ASN A CA    1 
ATOM   4257  C  C     . ASN C 3  517  ? 15.033  -64.094  55.212  1.00 29.67  ? 517  ASN A C     1 
ATOM   4258  O  O     . ASN C 3  517  ? 14.869  -65.292  55.441  1.00 30.11  ? 517  ASN A O     1 
ATOM   4259  C  CB    . ASN C 3  517  ? 17.276  -64.072  56.371  1.00 25.47  ? 517  ASN A CB    1 
ATOM   4260  C  CG    . ASN C 3  517  ? 16.518  -64.310  57.635  1.00 21.05  ? 517  ASN A CG    1 
ATOM   4261  O  OD1   . ASN C 3  517  ? 15.560  -65.078  57.662  1.00 20.64  ? 517  ASN A OD1   1 
ATOM   4262  N  ND2   . ASN C 3  517  ? 16.958  -63.674  58.708  1.00 16.61  ? 517  ASN A ND2   1 
ATOM   4263  N  N     . LYS C 3  518  ? 14.048  -63.258  54.883  1.00 30.80  ? 518  LYS A N     1 
ATOM   4264  C  CA    . LYS C 3  518  ? 12.645  -63.655  54.741  1.00 30.38  ? 518  LYS A CA    1 
ATOM   4265  C  C     . LYS C 3  518  ? 12.242  -63.210  53.323  1.00 29.85  ? 518  LYS A C     1 
ATOM   4266  O  O     . LYS C 3  518  ? 13.076  -62.683  52.576  1.00 32.64  ? 518  LYS A O     1 
ATOM   4267  C  CB    . LYS C 3  518  ? 11.790  -62.927  55.778  1.00 31.29  ? 518  LYS A CB    1 
ATOM   4268  C  CG    . LYS C 3  518  ? 11.312  -61.529  55.365  1.00 30.90  ? 518  LYS A CG    1 
ATOM   4269  C  CD    . LYS C 3  518  ? 10.900  -60.721  56.598  1.00 35.35  ? 518  LYS A CD    1 
ATOM   4270  C  CE    . LYS C 3  518  ? 9.871   -59.647  56.281  1.00 37.57  ? 518  LYS A CE    1 
ATOM   4271  N  NZ    . LYS C 3  518  ? 10.279  -58.760  55.163  1.00 39.22  ? 518  LYS A NZ    1 
ATOM   4272  N  N     . PRO C 3  519  ? 10.983  -63.436  52.918  1.00 25.92  ? 519  PRO A N     1 
ATOM   4273  C  CA    . PRO C 3  519  ? 10.589  -63.008  51.577  1.00 23.91  ? 519  PRO A CA    1 
ATOM   4274  C  C     . PRO C 3  519  ? 10.432  -61.494  51.571  1.00 22.54  ? 519  PRO A C     1 
ATOM   4275  O  O     . PRO C 3  519  ? 10.305  -60.886  52.634  1.00 19.85  ? 519  PRO A O     1 
ATOM   4276  C  CB    . PRO C 3  519  ? 9.268   -63.730  51.371  1.00 23.36  ? 519  PRO A CB    1 
ATOM   4277  C  CG    . PRO C 3  519  ? 8.718   -63.782  52.723  1.00 25.09  ? 519  PRO A CG    1 
ATOM   4278  C  CD    . PRO C 3  519  ? 9.905   -64.217  53.533  1.00 26.09  ? 519  PRO A CD    1 
ATOM   4279  N  N     . CYS C 3  520  ? 10.457  -60.882  50.391  1.00 21.49  ? 520  CYS A N     1 
ATOM   4280  C  CA    . CYS C 3  520  ? 10.310  -59.432  50.312  1.00 23.90  ? 520  CYS A CA    1 
ATOM   4281  C  C     . CYS C 3  520  ? 9.138   -58.980  49.433  1.00 25.43  ? 520  CYS A C     1 
ATOM   4282  O  O     . CYS C 3  520  ? 9.100   -57.831  48.972  1.00 25.28  ? 520  CYS A O     1 
ATOM   4283  C  CB    . CYS C 3  520  ? 11.611  -58.792  49.809  1.00 25.81  ? 520  CYS A CB    1 
ATOM   4284  S  SG    . CYS C 3  520  ? 11.891  -58.805  48.026  1.00 23.42  ? 520  CYS A SG    1 
ATOM   4285  N  N     . MET C 3  521  ? 8.183   -59.888  49.221  1.00 25.16  ? 521  MET A N     1 
ATOM   4286  C  CA    . MET C 3  521  ? 6.998   -59.633  48.403  1.00 21.93  ? 521  MET A CA    1 
ATOM   4287  C  C     . MET C 3  521  ? 5.804   -60.387  48.964  1.00 21.25  ? 521  MET A C     1 
ATOM   4288  O  O     . MET C 3  521  ? 5.798   -61.610  48.980  1.00 21.98  ? 521  MET A O     1 
ATOM   4289  C  CB    . MET C 3  521  ? 7.222   -60.099  46.958  1.00 17.66  ? 521  MET A CB    1 
ATOM   4290  C  CG    . MET C 3  521  ? 8.363   -59.417  46.234  1.00 15.63  ? 521  MET A CG    1 
ATOM   4291  S  SD    . MET C 3  521  ? 8.286   -59.672  44.446  1.00 15.54  ? 521  MET A SD    1 
ATOM   4292  C  CE    . MET C 3  521  ? 9.567   -60.827  44.242  1.00 19.84  ? 521  MET A CE    1 
ATOM   4293  N  N     . GLY C 3  522  ? 4.785   -59.666  49.411  1.00 23.11  ? 522  GLY A N     1 
ATOM   4294  C  CA    . GLY C 3  522  ? 3.616   -60.343  49.944  1.00 22.14  ? 522  GLY A CA    1 
ATOM   4295  C  C     . GLY C 3  522  ? 2.383   -60.203  49.078  1.00 19.91  ? 522  GLY A C     1 
ATOM   4296  O  O     . GLY C 3  522  ? 2.471   -60.255  47.857  1.00 18.95  ? 522  GLY A O     1 
ATOM   4297  N  N     . ILE C 3  523  ? 1.235   -60.039  49.731  1.00 19.90  ? 523  ILE A N     1 
ATOM   4298  C  CA    . ILE C 3  523  ? -0.065  -59.865  49.077  1.00 17.91  ? 523  ILE A CA    1 
ATOM   4299  C  C     . ILE C 3  523  ? -0.745  -58.688  49.755  1.00 20.10  ? 523  ILE A C     1 
ATOM   4300  O  O     . ILE C 3  523  ? -0.999  -58.714  50.960  1.00 19.23  ? 523  ILE A O     1 
ATOM   4301  C  CB    . ILE C 3  523  ? -0.921  -61.133  49.195  1.00 10.32  ? 523  ILE A CB    1 
ATOM   4302  C  CG1   . ILE C 3  523  ? -0.447  -62.127  48.138  1.00 7.40   ? 523  ILE A CG1   1 
ATOM   4303  C  CG2   . ILE C 3  523  ? -2.383  -60.798  49.036  1.00 4.91   ? 523  ILE A CG2   1 
ATOM   4304  C  CD1   . ILE C 3  523  ? -1.160  -63.416  48.106  1.00 1.00   ? 523  ILE A CD1   1 
ATOM   4305  N  N     . VAL C 3  524  ? -1.059  -57.666  48.966  1.00 22.10  ? 524  VAL A N     1 
ATOM   4306  C  CA    . VAL C 3  524  ? -1.619  -56.437  49.519  1.00 24.70  ? 524  VAL A CA    1 
ATOM   4307  C  C     . VAL C 3  524  ? -3.004  -55.930  49.085  1.00 25.64  ? 524  VAL A C     1 
ATOM   4308  O  O     . VAL C 3  524  ? -3.712  -56.550  48.284  1.00 28.58  ? 524  VAL A O     1 
ATOM   4309  C  CB    . VAL C 3  524  ? -0.614  -55.298  49.275  1.00 24.18  ? 524  VAL A CB    1 
ATOM   4310  C  CG1   . VAL C 3  524  ? -0.466  -54.437  50.531  1.00 29.32  ? 524  VAL A CG1   1 
ATOM   4311  C  CG2   . VAL C 3  524  ? 0.721   -55.887  48.840  1.00 22.50  ? 524  VAL A CG2   1 
ATOM   4312  N  N     . GLN C 3  525  ? -3.374  -54.781  49.644  1.00 24.92  ? 525  GLN A N     1 
ATOM   4313  C  CA    . GLN C 3  525  ? -4.629  -54.116  49.318  1.00 25.22  ? 525  GLN A CA    1 
ATOM   4314  C  C     . GLN C 3  525  ? -5.848  -55.039  49.168  1.00 24.67  ? 525  GLN A C     1 
ATOM   4315  O  O     . GLN C 3  525  ? -6.225  -55.753  50.104  1.00 22.18  ? 525  GLN A O     1 
ATOM   4316  C  CB    . GLN C 3  525  ? -4.431  -53.309  48.037  1.00 24.16  ? 525  GLN A CB    1 
ATOM   4317  C  CG    . GLN C 3  525  ? -3.135  -52.500  48.009  1.00 26.09  ? 525  GLN A CG    1 
ATOM   4318  C  CD    . GLN C 3  525  ? -3.276  -51.108  48.586  1.00 29.24  ? 525  GLN A CD    1 
ATOM   4319  O  OE1   . GLN C 3  525  ? -3.801  -50.190  47.932  1.00 28.97  ? 525  GLN A OE1   1 
ATOM   4320  N  NE2   . GLN C 3  525  ? -2.810  -50.936  49.817  1.00 29.95  ? 525  GLN A NE2   1 
ATOM   4321  N  N     . ASP C 3  526  ? -6.469  -55.014  47.992  1.00 23.57  ? 526  ASP A N     1 
ATOM   4322  C  CA    . ASP C 3  526  ? -7.655  -55.835  47.745  1.00 23.21  ? 526  ASP A CA    1 
ATOM   4323  C  C     . ASP C 3  526  ? -7.416  -57.310  48.009  1.00 24.70  ? 526  ASP A C     1 
ATOM   4324  O  O     . ASP C 3  526  ? -8.084  -57.910  48.847  1.00 25.55  ? 526  ASP A O     1 
ATOM   4325  C  CB    . ASP C 3  526  ? -8.151  -55.657  46.307  1.00 15.68  ? 526  ASP A CB    1 
ATOM   4326  C  CG    . ASP C 3  526  ? -8.550  -54.236  46.009  1.00 14.29  ? 526  ASP A CG    1 
ATOM   4327  O  OD1   . ASP C 3  526  ? -8.345  -53.364  46.893  1.00 1.00   ? 526  ASP A OD1   1 
ATOM   4328  O  OD2   . ASP C 3  526  ? -9.068  -53.999  44.889  1.00 16.69  ? 526  ASP A OD2   1 
ATOM   4329  N  N     . THR C 3  527  ? -6.455  -57.896  47.308  1.00 23.77  ? 527  THR A N     1 
ATOM   4330  C  CA    . THR C 3  527  ? -6.191  -59.310  47.478  1.00 24.05  ? 527  THR A CA    1 
ATOM   4331  C  C     . THR C 3  527  ? -6.022  -59.706  48.928  1.00 24.11  ? 527  THR A C     1 
ATOM   4332  O  O     . THR C 3  527  ? -6.446  -60.787  49.333  1.00 27.61  ? 527  THR A O     1 
ATOM   4333  C  CB    . THR C 3  527  ? -4.950  -59.748  46.730  1.00 26.75  ? 527  THR A CB    1 
ATOM   4334  O  OG1   . THR C 3  527  ? -5.010  -59.247  45.389  1.00 34.16  ? 527  THR A OG1   1 
ATOM   4335  C  CG2   . THR C 3  527  ? -4.872  -61.286  46.700  1.00 26.92  ? 527  THR A CG2   1 
ATOM   4336  N  N     . LEU C 3  528  ? -5.399  -58.847  49.719  1.00 20.60  ? 528  LEU A N     1 
ATOM   4337  C  CA    . LEU C 3  528  ? -5.220  -59.188  51.110  1.00 16.91  ? 528  LEU A CA    1 
ATOM   4338  C  C     . LEU C 3  528  ? -6.531  -58.979  51.858  1.00 17.23  ? 528  LEU A C     1 
ATOM   4339  O  O     . LEU C 3  528  ? -7.083  -59.906  52.456  1.00 14.12  ? 528  LEU A O     1 
ATOM   4340  C  CB    . LEU C 3  528  ? -4.111  -58.349  51.730  1.00 13.19  ? 528  LEU A CB    1 
ATOM   4341  C  CG    . LEU C 3  528  ? -4.028  -58.720  53.208  1.00 18.19  ? 528  LEU A CG    1 
ATOM   4342  C  CD1   . LEU C 3  528  ? -3.903  -60.229  53.311  1.00 21.75  ? 528  LEU A CD1   1 
ATOM   4343  C  CD2   . LEU C 3  528  ? -2.866  -58.040  53.893  1.00 20.46  ? 528  LEU A CD2   1 
ATOM   4344  N  N     . CYS C 3  529  ? -7.035  -57.753  51.806  1.00 19.09  ? 529  CYS A N     1 
ATOM   4345  C  CA    . CYS C 3  529  ? -8.281  -57.410  52.475  1.00 18.34  ? 529  CYS A CA    1 
ATOM   4346  C  C     . CYS C 3  529  ? -9.352  -58.423  52.154  1.00 16.75  ? 529  CYS A C     1 
ATOM   4347  O  O     . CYS C 3  529  ? -10.123 -58.801  53.013  1.00 15.66  ? 529  CYS A O     1 
ATOM   4348  C  CB    . CYS C 3  529  ? -8.761  -56.032  52.036  1.00 19.55  ? 529  CYS A CB    1 
ATOM   4349  S  SG    . CYS C 3  529  ? -10.399 -55.638  52.656  1.00 22.95  ? 529  CYS A SG    1 
ATOM   4350  N  N     . GLY C 3  530  ? -9.387  -58.855  50.903  1.00 17.70  ? 530  GLY A N     1 
ATOM   4351  C  CA    . GLY C 3  530  ? -10.383 -59.817  50.474  1.00 19.25  ? 530  GLY A CA    1 
ATOM   4352  C  C     . GLY C 3  530  ? -10.131 -61.228  50.956  1.00 20.81  ? 530  GLY A C     1 
ATOM   4353  O  O     . GLY C 3  530  ? -10.944 -61.790  51.691  1.00 19.23  ? 530  GLY A O     1 
ATOM   4354  N  N     . ILE C 3  531  ? -9.006  -61.802  50.531  1.00 23.35  ? 531  ILE A N     1 
ATOM   4355  C  CA    . ILE C 3  531  ? -8.637  -63.161  50.908  1.00 22.98  ? 531  ILE A CA    1 
ATOM   4356  C  C     . ILE C 3  531  ? -9.139  -63.460  52.315  1.00 25.03  ? 531  ILE A C     1 
ATOM   4357  O  O     . ILE C 3  531  ? -9.626  -64.557  52.577  1.00 24.68  ? 531  ILE A O     1 
ATOM   4358  C  CB    . ILE C 3  531  ? -7.111  -63.368  50.855  1.00 17.99  ? 531  ILE A CB    1 
ATOM   4359  C  CG1   . ILE C 3  531  ? -6.795  -64.857  50.800  1.00 21.83  ? 531  ILE A CG1   1 
ATOM   4360  C  CG2   . ILE C 3  531  ? -6.465  -62.796  52.085  1.00 13.64  ? 531  ILE A CG2   1 
ATOM   4361  C  CD1   . ILE C 3  531  ? -5.321  -65.176  50.597  1.00 21.58  ? 531  ILE A CD1   1 
ATOM   4362  N  N     . ARG C 3  532  ? -9.047  -62.482  53.215  1.00 25.87  ? 532  ARG A N     1 
ATOM   4363  C  CA    . ARG C 3  532  ? -9.514  -62.699  54.585  1.00 28.73  ? 532  ARG A CA    1 
ATOM   4364  C  C     . ARG C 3  532  ? -11.004 -62.984  54.618  1.00 28.89  ? 532  ARG A C     1 
ATOM   4365  O  O     . ARG C 3  532  ? -11.433 -64.008  55.149  1.00 30.69  ? 532  ARG A O     1 
ATOM   4366  C  CB    . ARG C 3  532  ? -9.233  -61.492  55.475  1.00 29.30  ? 532  ARG A CB    1 
ATOM   4367  C  CG    . ARG C 3  532  ? -9.946  -61.586  56.806  1.00 31.05  ? 532  ARG A CG    1 
ATOM   4368  C  CD    . ARG C 3  532  ? -9.608  -60.434  57.718  1.00 39.19  ? 532  ARG A CD    1 
ATOM   4369  N  NE    . ARG C 3  532  ? -10.519 -60.405  58.853  1.00 46.89  ? 532  ARG A NE    1 
ATOM   4370  C  CZ    . ARG C 3  532  ? -11.764 -59.946  58.783  1.00 51.52  ? 532  ARG A CZ    1 
ATOM   4371  N  NH1   . ARG C 3  532  ? -12.231 -59.471  57.633  1.00 50.63  ? 532  ARG A NH1   1 
ATOM   4372  N  NH2   . ARG C 3  532  ? -12.550 -59.979  59.853  1.00 55.39  ? 532  ARG A NH2   1 
ATOM   4373  N  N     . LYS C 3  533  ? -11.788 -62.065  54.065  1.00 27.91  ? 533  LYS A N     1 
ATOM   4374  C  CA    . LYS C 3  533  ? -13.229 -62.232  54.023  1.00 25.46  ? 533  LYS A CA    1 
ATOM   4375  C  C     . LYS C 3  533  ? -13.467 -63.602  53.407  1.00 26.69  ? 533  LYS A C     1 
ATOM   4376  O  O     . LYS C 3  533  ? -13.967 -64.509  54.076  1.00 28.64  ? 533  LYS A O     1 
ATOM   4377  C  CB    . LYS C 3  533  ? -13.880 -61.150  53.149  1.00 23.71  ? 533  LYS A CB    1 
ATOM   4378  C  CG    . LYS C 3  533  ? -13.237 -59.771  53.267  1.00 21.30  ? 533  LYS A CG    1 
ATOM   4379  C  CD    . LYS C 3  533  ? -14.167 -58.681  52.802  1.00 17.34  ? 533  LYS A CD    1 
ATOM   4380  C  CE    . LYS C 3  533  ? -15.264 -58.477  53.829  1.00 23.59  ? 533  LYS A CE    1 
ATOM   4381  N  NZ    . LYS C 3  533  ? -16.480 -57.787  53.281  1.00 30.59  ? 533  LYS A NZ    1 
ATOM   4382  N  N     . LEU C 3  534  ? -13.065 -63.755  52.143  1.00 24.43  ? 534  LEU A N     1 
ATOM   4383  C  CA    . LEU C 3  534  ? -13.243 -65.004  51.404  1.00 22.80  ? 534  LEU A CA    1 
ATOM   4384  C  C     . LEU C 3  534  ? -12.955 -66.231  52.233  1.00 22.78  ? 534  LEU A C     1 
ATOM   4385  O  O     . LEU C 3  534  ? -13.352 -67.331  51.884  1.00 23.88  ? 534  LEU A O     1 
ATOM   4386  C  CB    . LEU C 3  534  ? -12.342 -65.036  50.168  1.00 23.01  ? 534  LEU A CB    1 
ATOM   4387  C  CG    . LEU C 3  534  ? -12.221 -66.404  49.478  1.00 23.22  ? 534  LEU A CG    1 
ATOM   4388  C  CD1   . LEU C 3  534  ? -13.549 -66.815  48.928  1.00 23.13  ? 534  LEU A CD1   1 
ATOM   4389  C  CD2   . LEU C 3  534  ? -11.216 -66.346  48.365  1.00 26.41  ? 534  LEU A CD2   1 
ATOM   4390  N  N     . THR C 3  535  ? -12.263 -66.037  53.338  1.00 23.88  ? 535  THR A N     1 
ATOM   4391  C  CA    . THR C 3  535  ? -11.889 -67.141  54.188  1.00 25.42  ? 535  THR A CA    1 
ATOM   4392  C  C     . THR C 3  535  ? -12.807 -67.397  55.384  1.00 28.46  ? 535  THR A C     1 
ATOM   4393  O  O     . THR C 3  535  ? -13.005 -68.556  55.765  1.00 30.64  ? 535  THR A O     1 
ATOM   4394  C  CB    . THR C 3  535  ? -10.431 -66.946  54.642  1.00 24.34  ? 535  THR A CB    1 
ATOM   4395  O  OG1   . THR C 3  535  ? -9.558  -67.421  53.615  1.00 18.97  ? 535  THR A OG1   1 
ATOM   4396  C  CG2   . THR C 3  535  ? -10.152 -67.686  55.913  1.00 29.15  ? 535  THR A CG2   1 
ATOM   4397  N  N     . LEU C 3  536  ? -13.365 -66.339  55.970  1.00 28.67  ? 536  LEU A N     1 
ATOM   4398  C  CA    . LEU C 3  536  ? -14.255 -66.479  57.120  1.00 32.99  ? 536  LEU A CA    1 
ATOM   4399  C  C     . LEU C 3  536  ? -15.096 -67.767  57.082  1.00 39.32  ? 536  LEU A C     1 
ATOM   4400  O  O     . LEU C 3  536  ? -15.592 -68.146  56.010  1.00 43.06  ? 536  LEU A O     1 
ATOM   4401  C  CB    . LEU C 3  536  ? -15.186 -65.276  57.192  1.00 29.13  ? 536  LEU A CB    1 
ATOM   4402  C  CG    . LEU C 3  536  ? -14.523 -63.920  57.407  1.00 28.37  ? 536  LEU A CG    1 
ATOM   4403  C  CD1   . LEU C 3  536  ? -15.583 -62.901  57.742  1.00 28.00  ? 536  LEU A CD1   1 
ATOM   4404  C  CD2   . LEU C 3  536  ? -13.536 -63.991  58.548  1.00 30.79  ? 536  LEU A CD2   1 
ATOM   4405  N  N     . ARG C 3  537  ? -15.255 -68.447  58.229  1.00 41.40  ? 537  ARG A N     1 
ATOM   4406  C  CA    . ARG C 3  537  ? -16.054 -69.683  58.268  1.00 41.63  ? 537  ARG A CA    1 
ATOM   4407  C  C     . ARG C 3  537  ? -17.398 -69.383  57.646  1.00 43.23  ? 537  ARG A C     1 
ATOM   4408  O  O     . ARG C 3  537  ? -17.914 -70.156  56.845  1.00 46.24  ? 537  ARG A O     1 
ATOM   4409  C  CB    . ARG C 3  537  ? -16.320 -70.154  59.691  1.00 39.82  ? 537  ARG A CB    1 
ATOM   4410  C  CG    . ARG C 3  537  ? -15.220 -70.922  60.369  1.00 42.49  ? 537  ARG A CG    1 
ATOM   4411  C  CD    . ARG C 3  537  ? -15.844 -71.780  61.459  1.00 46.84  ? 537  ARG A CD    1 
ATOM   4412  N  NE    . ARG C 3  537  ? -15.121 -71.795  62.731  1.00 50.45  ? 537  ARG A NE    1 
ATOM   4413  C  CZ    . ARG C 3  537  ? -13.911 -72.317  62.914  1.00 53.17  ? 537  ARG A CZ    1 
ATOM   4414  N  NH1   . ARG C 3  537  ? -13.248 -72.879  61.902  1.00 51.37  ? 537  ARG A NH1   1 
ATOM   4415  N  NH2   . ARG C 3  537  ? -13.374 -72.296  64.126  1.00 54.11  ? 537  ARG A NH2   1 
ATOM   4416  N  N     . ASP C 3  538  ? -17.953 -68.245  58.044  1.00 42.53  ? 538  ASP A N     1 
ATOM   4417  C  CA    . ASP C 3  538  ? -19.234 -67.756  57.569  1.00 42.98  ? 538  ASP A CA    1 
ATOM   4418  C  C     . ASP C 3  538  ? -19.284 -67.614  56.038  1.00 42.80  ? 538  ASP A C     1 
ATOM   4419  O  O     . ASP C 3  538  ? -20.351 -67.386  55.454  1.00 43.64  ? 538  ASP A O     1 
ATOM   4420  C  CB    . ASP C 3  538  ? -19.488 -66.390  58.193  1.00 48.13  ? 538  ASP A CB    1 
ATOM   4421  C  CG    . ASP C 3  538  ? -20.847 -66.284  58.821  1.00 55.55  ? 538  ASP A CG    1 
ATOM   4422  O  OD1   . ASP C 3  538  ? -21.816 -66.765  58.207  1.00 63.21  ? 538  ASP A OD1   1 
ATOM   4423  O  OD2   . ASP C 3  538  ? -20.951 -65.711  59.924  1.00 60.00  ? 538  ASP A OD2   1 
ATOM   4424  N  N     . THR C 3  539  ? -18.135 -67.744  55.383  1.00 40.64  ? 539  THR A N     1 
ATOM   4425  C  CA    . THR C 3  539  ? -18.086 -67.573  53.943  1.00 37.35  ? 539  THR A CA    1 
ATOM   4426  C  C     . THR C 3  539  ? -18.171 -68.845  53.119  1.00 39.10  ? 539  THR A C     1 
ATOM   4427  O  O     . THR C 3  539  ? -17.277 -69.705  53.163  1.00 37.36  ? 539  THR A O     1 
ATOM   4428  C  CB    . THR C 3  539  ? -16.830 -66.764  53.534  1.00 32.38  ? 539  THR A CB    1 
ATOM   4429  O  OG1   . THR C 3  539  ? -16.992 -65.403  53.946  1.00 27.74  ? 539  THR A OG1   1 
ATOM   4430  C  CG2   . THR C 3  539  ? -16.630 -66.785  52.036  1.00 29.43  ? 539  THR A CG2   1 
ATOM   4431  N  N     . PHE C 3  540  ? -19.272 -68.942  52.368  1.00 41.43  ? 540  PHE A N     1 
ATOM   4432  C  CA    . PHE C 3  540  ? -19.541 -70.070  51.475  1.00 42.92  ? 540  PHE A CA    1 
ATOM   4433  C  C     . PHE C 3  540  ? -19.843 -69.577  50.054  1.00 44.10  ? 540  PHE A C     1 
ATOM   4434  O  O     . PHE C 3  540  ? -20.354 -68.471  49.855  1.00 45.08  ? 540  PHE A O     1 
ATOM   4435  C  CB    . PHE C 3  540  ? -20.730 -70.896  51.971  1.00 41.87  ? 540  PHE A CB    1 
ATOM   4436  C  CG    . PHE C 3  540  ? -20.527 -71.513  53.329  1.00 38.50  ? 540  PHE A CG    1 
ATOM   4437  C  CD1   . PHE C 3  540  ? -20.893 -70.827  54.486  1.00 36.09  ? 540  PHE A CD1   1 
ATOM   4438  C  CD2   . PHE C 3  540  ? -19.978 -72.778  53.453  1.00 33.19  ? 540  PHE A CD2   1 
ATOM   4439  C  CE1   . PHE C 3  540  ? -20.719 -71.395  55.746  1.00 29.77  ? 540  PHE A CE1   1 
ATOM   4440  C  CE2   . PHE C 3  540  ? -19.803 -73.347  54.708  1.00 32.64  ? 540  PHE A CE2   1 
ATOM   4441  C  CZ    . PHE C 3  540  ? -20.175 -72.653  55.856  1.00 30.35  ? 540  PHE A CZ    1 
ATOM   4442  N  N     . ILE C 3  541  ? -19.522 -70.411  49.073  1.00 44.98  ? 541  ILE A N     1 
ATOM   4443  C  CA    . ILE C 3  541  ? -19.738 -70.085  47.671  1.00 46.04  ? 541  ILE A CA    1 
ATOM   4444  C  C     . ILE C 3  541  ? -20.475 -71.242  46.994  1.00 47.45  ? 541  ILE A C     1 
ATOM   4445  O  O     . ILE C 3  541  ? -20.349 -72.404  47.415  1.00 48.21  ? 541  ILE A O     1 
ATOM   4446  C  CB    . ILE C 3  541  ? -18.387 -69.866  46.939  1.00 45.56  ? 541  ILE A CB    1 
ATOM   4447  C  CG1   . ILE C 3  541  ? -17.696 -68.611  47.455  1.00 44.56  ? 541  ILE A CG1   1 
ATOM   4448  C  CG2   . ILE C 3  541  ? -18.610 -69.724  45.452  1.00 49.83  ? 541  ILE A CG2   1 
ATOM   4449  C  CD1   . ILE C 3  541  ? -16.992 -68.801  48.750  1.00 48.80  ? 541  ILE A CD1   1 
ATOM   4450  N  N     . GLU C 3  542  ? -21.232 -70.935  45.942  1.00 46.09  ? 542  GLU A N     1 
ATOM   4451  C  CA    . GLU C 3  542  ? -21.955 -71.979  45.241  1.00 46.12  ? 542  GLU A CA    1 
ATOM   4452  C  C     . GLU C 3  542  ? -21.683 -72.125  43.754  1.00 47.06  ? 542  GLU A C     1 
ATOM   4453  O  O     . GLU C 3  542  ? -21.237 -71.201  43.088  1.00 47.03  ? 542  GLU A O     1 
ATOM   4454  C  CB    . GLU C 3  542  ? -23.446 -71.824  45.479  1.00 46.15  ? 542  GLU A CB    1 
ATOM   4455  C  CG    . GLU C 3  542  ? -23.937 -70.416  45.473  1.00 42.78  ? 542  GLU A CG    1 
ATOM   4456  C  CD    . GLU C 3  542  ? -25.385 -70.378  45.837  1.00 42.63  ? 542  GLU A CD    1 
ATOM   4457  O  OE1   . GLU C 3  542  ? -26.131 -71.212  45.288  1.00 46.50  ? 542  GLU A OE1   1 
ATOM   4458  O  OE2   . GLU C 3  542  ? -25.781 -69.534  46.661  1.00 42.17  ? 542  GLU A OE2   1 
ATOM   4459  N  N     . LEU C 3  543  ? -21.981 -73.318  43.255  1.00 49.74  ? 543  LEU A N     1 
ATOM   4460  C  CA    . LEU C 3  543  ? -21.775 -73.707  41.864  1.00 52.05  ? 543  LEU A CA    1 
ATOM   4461  C  C     . LEU C 3  543  ? -21.320 -72.655  40.855  1.00 52.06  ? 543  LEU A C     1 
ATOM   4462  O  O     . LEU C 3  543  ? -20.124 -72.547  40.568  1.00 51.16  ? 543  LEU A O     1 
ATOM   4463  C  CB    . LEU C 3  543  ? -23.027 -74.401  41.330  1.00 53.80  ? 543  LEU A CB    1 
ATOM   4464  C  CG    . LEU C 3  543  ? -22.729 -75.296  40.119  1.00 58.07  ? 543  LEU A CG    1 
ATOM   4465  C  CD1   . LEU C 3  543  ? -21.657 -76.323  40.501  1.00 57.11  ? 543  LEU A CD1   1 
ATOM   4466  C  CD2   . LEU C 3  543  ? -24.006 -76.002  39.645  1.00 61.61  ? 543  LEU A CD2   1 
ATOM   4467  N  N     . ASP C 3  544  ? -22.265 -71.895  40.307  1.00 52.20  ? 544  ASP A N     1 
ATOM   4468  C  CA    . ASP C 3  544  ? -21.940 -70.882  39.303  1.00 53.15  ? 544  ASP A CA    1 
ATOM   4469  C  C     . ASP C 3  544  ? -20.610 -70.166  39.553  1.00 52.91  ? 544  ASP A C     1 
ATOM   4470  O  O     . ASP C 3  544  ? -19.755 -70.138  38.658  1.00 53.11  ? 544  ASP A O     1 
ATOM   4471  C  CB    . ASP C 3  544  ? -23.073 -69.865  39.185  1.00 52.99  ? 544  ASP A CB    1 
ATOM   4472  C  CG    . ASP C 3  544  ? -23.312 -69.136  40.467  1.00 56.61  ? 544  ASP A CG    1 
ATOM   4473  O  OD1   . ASP C 3  544  ? -23.407 -69.821  41.503  1.00 60.05  ? 544  ASP A OD1   1 
ATOM   4474  O  OD2   . ASP C 3  544  ? -23.407 -67.891  40.447  1.00 59.09  ? 544  ASP A OD2   1 
ATOM   4475  N  N     . GLN C 3  545  ? -20.426 -69.595  40.750  1.00 51.15  ? 545  GLN A N     1 
ATOM   4476  C  CA    . GLN C 3  545  ? -19.171 -68.904  41.075  1.00 49.19  ? 545  GLN A CA    1 
ATOM   4477  C  C     . GLN C 3  545  ? -18.020 -69.897  41.154  1.00 46.59  ? 545  GLN A C     1 
ATOM   4478  O  O     . GLN C 3  545  ? -17.032 -69.773  40.433  1.00 48.00  ? 545  GLN A O     1 
ATOM   4479  C  CB    . GLN C 3  545  ? -19.261 -68.138  42.402  1.00 49.38  ? 545  GLN A CB    1 
ATOM   4480  C  CG    . GLN C 3  545  ? -19.348 -66.614  42.230  1.00 58.66  ? 545  GLN A CG    1 
ATOM   4481  C  CD    . GLN C 3  545  ? -19.210 -65.837  43.546  1.00 64.82  ? 545  GLN A CD    1 
ATOM   4482  O  OE1   . GLN C 3  545  ? -18.166 -65.889  44.200  1.00 66.39  ? 545  GLN A OE1   1 
ATOM   4483  N  NE2   . GLN C 3  545  ? -20.267 -65.108  43.932  1.00 64.43  ? 545  GLN A NE2   1 
ATOM   4484  N  N     . VAL C 3  546  ? -18.152 -70.886  42.028  1.00 42.75  ? 546  VAL A N     1 
ATOM   4485  C  CA    . VAL C 3  546  ? -17.115 -71.893  42.182  1.00 38.16  ? 546  VAL A CA    1 
ATOM   4486  C  C     . VAL C 3  546  ? -16.552 -72.243  40.822  1.00 36.84  ? 546  VAL A C     1 
ATOM   4487  O  O     . VAL C 3  546  ? -15.349 -72.168  40.585  1.00 35.21  ? 546  VAL A O     1 
ATOM   4488  C  CB    . VAL C 3  546  ? -17.661 -73.184  42.776  1.00 36.47  ? 546  VAL A CB    1 
ATOM   4489  C  CG1   . VAL C 3  546  ? -16.506 -74.067  43.213  1.00 34.17  ? 546  VAL A CG1   1 
ATOM   4490  C  CG2   . VAL C 3  546  ? -18.596 -72.877  43.921  1.00 35.21  ? 546  VAL A CG2   1 
ATOM   4491  N  N     . LEU C 3  547  ? -17.435 -72.619  39.915  1.00 35.72  ? 547  LEU A N     1 
ATOM   4492  C  CA    . LEU C 3  547  ? -16.984 -72.984  38.595  1.00 36.90  ? 547  LEU A CA    1 
ATOM   4493  C  C     . LEU C 3  547  ? -16.184 -71.861  37.929  1.00 36.74  ? 547  LEU A C     1 
ATOM   4494  O  O     . LEU C 3  547  ? -15.243 -72.127  37.190  1.00 37.21  ? 547  LEU A O     1 
ATOM   4495  C  CB    . LEU C 3  547  ? -18.178 -73.412  37.738  1.00 37.40  ? 547  LEU A CB    1 
ATOM   4496  C  CG    . LEU C 3  547  ? -18.933 -74.645  38.264  1.00 35.57  ? 547  LEU A CG    1 
ATOM   4497  C  CD1   . LEU C 3  547  ? -19.890 -75.155  37.195  1.00 33.92  ? 547  LEU A CD1   1 
ATOM   4498  C  CD2   . LEU C 3  547  ? -17.946 -75.746  38.640  1.00 31.77  ? 547  LEU A CD2   1 
ATOM   4499  N  N     . ASN C 3  548  ? -16.533 -70.608  38.191  1.00 35.55  ? 548  ASN A N     1 
ATOM   4500  C  CA    . ASN C 3  548  ? -15.776 -69.520  37.588  1.00 33.92  ? 548  ASN A CA    1 
ATOM   4501  C  C     . ASN C 3  548  ? -14.447 -69.369  38.282  1.00 32.59  ? 548  ASN A C     1 
ATOM   4502  O  O     . ASN C 3  548  ? -13.408 -69.293  37.627  1.00 32.43  ? 548  ASN A O     1 
ATOM   4503  C  CB    . ASN C 3  548  ? -16.535 -68.208  37.673  1.00 37.84  ? 548  ASN A CB    1 
ATOM   4504  C  CG    . ASN C 3  548  ? -17.468 -68.007  36.500  1.00 46.86  ? 548  ASN A CG    1 
ATOM   4505  O  OD1   . ASN C 3  548  ? -17.072 -68.189  35.338  1.00 50.35  ? 548  ASN A OD1   1 
ATOM   4506  N  ND2   . ASN C 3  548  ? -18.712 -67.619  36.788  1.00 48.21  ? 548  ASN A ND2   1 
ATOM   4507  N  N     . MET C 3  549  ? -14.482 -69.326  39.611  1.00 30.62  ? 549  MET A N     1 
ATOM   4508  C  CA    . MET C 3  549  ? -13.265 -69.191  40.400  1.00 28.62  ? 549  MET A CA    1 
ATOM   4509  C  C     . MET C 3  549  ? -12.262 -70.261  40.004  1.00 27.93  ? 549  MET A C     1 
ATOM   4510  O  O     . MET C 3  549  ? -11.088 -69.982  39.758  1.00 26.71  ? 549  MET A O     1 
ATOM   4511  C  CB    . MET C 3  549  ? -13.580 -69.304  41.885  1.00 25.84  ? 549  MET A CB    1 
ATOM   4512  C  CG    . MET C 3  549  ? -14.349 -68.129  42.406  1.00 30.07  ? 549  MET A CG    1 
ATOM   4513  S  SD    . MET C 3  549  ? -14.311 -68.025  44.203  1.00 35.74  ? 549  MET A SD    1 
ATOM   4514  C  CE    . MET C 3  549  ? -16.031 -67.829  44.541  1.00 39.28  ? 549  MET A CE    1 
ATOM   4515  N  N     . LEU C 3  550  ? -12.731 -71.494  39.929  1.00 26.70  ? 550  LEU A N     1 
ATOM   4516  C  CA    . LEU C 3  550  ? -11.846 -72.575  39.551  1.00 26.11  ? 550  LEU A CA    1 
ATOM   4517  C  C     . LEU C 3  550  ? -11.233 -72.257  38.204  1.00 24.09  ? 550  LEU A C     1 
ATOM   4518  O  O     . LEU C 3  550  ? -10.016 -72.203  38.068  1.00 23.28  ? 550  LEU A O     1 
ATOM   4519  C  CB    . LEU C 3  550  ? -12.616 -73.898  39.490  1.00 26.66  ? 550  LEU A CB    1 
ATOM   4520  C  CG    . LEU C 3  550  ? -13.124 -74.382  40.850  1.00 25.72  ? 550  LEU A CG    1 
ATOM   4521  C  CD1   . LEU C 3  550  ? -14.000 -75.597  40.664  1.00 23.70  ? 550  LEU A CD1   1 
ATOM   4522  C  CD2   . LEU C 3  550  ? -11.934 -74.685  41.770  1.00 23.18  ? 550  LEU A CD2   1 
ATOM   4523  N  N     . TYR C 3  551  ? -12.082 -72.024  37.214  1.00 21.94  ? 551  TYR A N     1 
ATOM   4524  C  CA    . TYR C 3  551  ? -11.590 -71.728  35.889  1.00 22.72  ? 551  TYR A CA    1 
ATOM   4525  C  C     . TYR C 3  551  ? -10.619 -70.578  35.951  1.00 25.39  ? 551  TYR A C     1 
ATOM   4526  O  O     . TYR C 3  551  ? -9.580  -70.609  35.286  1.00 28.58  ? 551  TYR A O     1 
ATOM   4527  C  CB    . TYR C 3  551  ? -12.733 -71.369  34.948  1.00 22.31  ? 551  TYR A CB    1 
ATOM   4528  C  CG    . TYR C 3  551  ? -12.316 -71.278  33.493  1.00 18.35  ? 551  TYR A CG    1 
ATOM   4529  C  CD1   . TYR C 3  551  ? -11.423 -72.195  32.952  1.00 17.99  ? 551  TYR A CD1   1 
ATOM   4530  C  CD2   . TYR C 3  551  ? -12.839 -70.301  32.651  1.00 15.63  ? 551  TYR A CD2   1 
ATOM   4531  C  CE1   . TYR C 3  551  ? -11.056 -72.144  31.615  1.00 17.50  ? 551  TYR A CE1   1 
ATOM   4532  C  CE2   . TYR C 3  551  ? -12.479 -70.248  31.310  1.00 15.44  ? 551  TYR A CE2   1 
ATOM   4533  C  CZ    . TYR C 3  551  ? -11.582 -71.172  30.801  1.00 14.86  ? 551  TYR A CZ    1 
ATOM   4534  O  OH    . TYR C 3  551  ? -11.177 -71.118  29.486  1.00 14.25  ? 551  TYR A OH    1 
ATOM   4535  N  N     . TRP C 3  552  ? -10.953 -69.571  36.756  1.00 24.12  ? 552  TRP A N     1 
ATOM   4536  C  CA    . TRP C 3  552  ? -10.107 -68.397  36.902  1.00 24.14  ? 552  TRP A CA    1 
ATOM   4537  C  C     . TRP C 3  552  ? -8.649  -68.732  37.194  1.00 23.44  ? 552  TRP A C     1 
ATOM   4538  O  O     . TRP C 3  552  ? -7.742  -68.070  36.691  1.00 20.20  ? 552  TRP A O     1 
ATOM   4539  C  CB    . TRP C 3  552  ? -10.679 -67.491  37.974  1.00 25.86  ? 552  TRP A CB    1 
ATOM   4540  C  CG    . TRP C 3  552  ? -11.288 -66.246  37.386  1.00 31.52  ? 552  TRP A CG    1 
ATOM   4541  C  CD1   . TRP C 3  552  ? -12.569 -65.810  37.539  1.00 33.07  ? 552  TRP A CD1   1 
ATOM   4542  C  CD2   . TRP C 3  552  ? -10.627 -65.264  36.574  1.00 29.15  ? 552  TRP A CD2   1 
ATOM   4543  N  NE1   . TRP C 3  552  ? -12.742 -64.621  36.878  1.00 32.80  ? 552  TRP A NE1   1 
ATOM   4544  C  CE2   . TRP C 3  552  ? -11.562 -64.269  36.277  1.00 29.04  ? 552  TRP A CE2   1 
ATOM   4545  C  CE3   . TRP C 3  552  ? -9.332  -65.140  36.071  1.00 29.80  ? 552  TRP A CE3   1 
ATOM   4546  C  CZ2   . TRP C 3  552  ? -11.251 -63.162  35.505  1.00 31.34  ? 552  TRP A CZ2   1 
ATOM   4547  C  CZ3   . TRP C 3  552  ? -9.026  -64.040  35.304  1.00 31.50  ? 552  TRP A CZ3   1 
ATOM   4548  C  CH2   . TRP C 3  552  ? -9.979  -63.067  35.025  1.00 29.39  ? 552  TRP A CH2   1 
ATOM   4549  N  N     . VAL C 3  553  ? -8.430  -69.754  38.012  1.00 24.54  ? 553  VAL A N     1 
ATOM   4550  C  CA    . VAL C 3  553  ? -7.084  -70.220  38.290  1.00 26.77  ? 553  VAL A CA    1 
ATOM   4551  C  C     . VAL C 3  553  ? -6.666  -70.971  37.035  1.00 29.31  ? 553  VAL A C     1 
ATOM   4552  O  O     . VAL C 3  553  ? -7.204  -72.035  36.711  1.00 27.35  ? 553  VAL A O     1 
ATOM   4553  C  CB    . VAL C 3  553  ? -7.048  -71.210  39.401  1.00 28.44  ? 553  VAL A CB    1 
ATOM   4554  C  CG1   . VAL C 3  553  ? -5.635  -71.712  39.556  1.00 33.07  ? 553  VAL A CG1   1 
ATOM   4555  C  CG2   . VAL C 3  553  ? -7.559  -70.580  40.660  1.00 28.78  ? 553  VAL A CG2   1 
ATOM   4556  N  N     . PRO C 3  554  ? -5.675  -70.439  36.332  1.00 32.16  ? 554  PRO A N     1 
ATOM   4557  C  CA    . PRO C 3  554  ? -5.133  -70.982  35.092  1.00 36.21  ? 554  PRO A CA    1 
ATOM   4558  C  C     . PRO C 3  554  ? -4.579  -72.384  35.177  1.00 40.91  ? 554  PRO A C     1 
ATOM   4559  O  O     . PRO C 3  554  ? -4.692  -73.164  34.236  1.00 41.62  ? 554  PRO A O     1 
ATOM   4560  C  CB    . PRO C 3  554  ? -4.069  -69.970  34.736  1.00 33.86  ? 554  PRO A CB    1 
ATOM   4561  C  CG    . PRO C 3  554  ? -3.525  -69.643  36.076  1.00 33.91  ? 554  PRO A CG    1 
ATOM   4562  C  CD    . PRO C 3  554  ? -4.761  -69.435  36.893  1.00 31.39  ? 554  PRO A CD    1 
ATOM   4563  N  N     . ASP C 3  555  ? -3.978  -72.718  36.303  1.00 46.37  ? 555  ASP A N     1 
ATOM   4564  C  CA    . ASP C 3  555  ? -3.396  -74.039  36.426  1.00 55.02  ? 555  ASP A CA    1 
ATOM   4565  C  C     . ASP C 3  555  ? -4.376  -75.064  36.958  1.00 56.72  ? 555  ASP A C     1 
ATOM   4566  O  O     . ASP C 3  555  ? -3.984  -76.148  37.395  1.00 60.18  ? 555  ASP A O     1 
ATOM   4567  C  CB    . ASP C 3  555  ? -2.160  -73.965  37.319  1.00 61.04  ? 555  ASP A CB    1 
ATOM   4568  C  CG    . ASP C 3  555  ? -1.070  -73.112  36.711  1.00 66.92  ? 555  ASP A CG    1 
ATOM   4569  O  OD1   . ASP C 3  555  ? -0.618  -73.447  35.587  1.00 69.11  ? 555  ASP A OD1   1 
ATOM   4570  O  OD2   . ASP C 3  555  ? -0.679  -72.108  37.350  1.00 69.69  ? 555  ASP A OD2   1 
ATOM   4571  N  N     . TRP C 3  556  ? -5.656  -74.729  36.907  1.00 57.20  ? 556  TRP A N     1 
ATOM   4572  C  CA    . TRP C 3  556  ? -6.672  -75.632  37.411  1.00 57.38  ? 556  TRP A CA    1 
ATOM   4573  C  C     . TRP C 3  556  ? -6.618  -77.015  36.776  1.00 58.07  ? 556  TRP A C     1 
ATOM   4574  O  O     . TRP C 3  556  ? -6.433  -77.146  35.564  1.00 57.59  ? 556  TRP A O     1 
ATOM   4575  C  CB    . TRP C 3  556  ? -8.051  -75.022  37.204  1.00 57.76  ? 556  TRP A CB    1 
ATOM   4576  C  CG    . TRP C 3  556  ? -9.119  -75.831  37.819  1.00 57.29  ? 556  TRP A CG    1 
ATOM   4577  C  CD1   . TRP C 3  556  ? -9.070  -76.449  39.025  1.00 60.72  ? 556  TRP A CD1   1 
ATOM   4578  C  CD2   . TRP C 3  556  ? -10.418 -76.085  37.287  1.00 56.23  ? 556  TRP A CD2   1 
ATOM   4579  N  NE1   . TRP C 3  556  ? -10.259 -77.076  39.284  1.00 63.06  ? 556  TRP A NE1   1 
ATOM   4580  C  CE2   . TRP C 3  556  ? -11.107 -76.867  38.232  1.00 58.59  ? 556  TRP A CE2   1 
ATOM   4581  C  CE3   . TRP C 3  556  ? -11.068 -75.726  36.106  1.00 56.70  ? 556  TRP A CE3   1 
ATOM   4582  C  CZ2   . TRP C 3  556  ? -12.417 -77.299  38.034  1.00 58.48  ? 556  TRP A CZ2   1 
ATOM   4583  C  CZ3   . TRP C 3  556  ? -12.370 -76.155  35.908  1.00 56.89  ? 556  TRP A CZ3   1 
ATOM   4584  C  CH2   . TRP C 3  556  ? -13.031 -76.934  36.869  1.00 58.07  ? 556  TRP A CH2   1 
ATOM   4585  N  N     . ASP C 3  557  ? -6.769  -78.044  37.609  1.00 59.09  ? 557  ASP A N     1 
ATOM   4586  C  CA    . ASP C 3  557  ? -6.762  -79.427  37.141  1.00 60.43  ? 557  ASP A CA    1 
ATOM   4587  C  C     . ASP C 3  557  ? -8.174  -79.791  36.704  1.00 60.09  ? 557  ASP A C     1 
ATOM   4588  O  O     . ASP C 3  557  ? -8.529  -80.966  36.618  1.00 59.88  ? 557  ASP A O     1 
ATOM   4589  C  CB    . ASP C 3  557  ? -6.299  -80.381  38.252  1.00 65.19  ? 557  ASP A CB    1 
ATOM   4590  C  CG    . ASP C 3  557  ? -7.220  -80.367  39.466  1.00 70.37  ? 557  ASP A CG    1 
ATOM   4591  O  OD1   . ASP C 3  557  ? -7.439  -79.273  40.034  1.00 73.73  ? 557  ASP A OD1   1 
ATOM   4592  O  OD2   . ASP C 3  557  ? -7.718  -81.448  39.860  1.00 70.61  ? 557  ASP A OD2   1 
ATOM   4593  N  N     . GLY C 3  558  ? -8.978  -78.764  36.447  1.00 59.28  ? 558  GLY A N     1 
ATOM   4594  C  CA    . GLY C 3  558  ? -10.341 -78.969  35.992  1.00 57.02  ? 558  GLY A CA    1 
ATOM   4595  C  C     . GLY C 3  558  ? -11.167 -79.978  36.760  1.00 54.56  ? 558  GLY A C     1 
ATOM   4596  O  O     . GLY C 3  558  ? -12.244 -80.372  36.313  1.00 55.15  ? 558  GLY A O     1 
ATOM   4597  N  N     . VAL C 3  559  ? -10.676 -80.405  37.913  1.00 50.90  ? 559  VAL A N     1 
ATOM   4598  C  CA    . VAL C 3  559  ? -11.415 -81.369  38.699  1.00 48.67  ? 559  VAL A CA    1 
ATOM   4599  C  C     . VAL C 3  559  ? -12.148 -80.668  39.816  1.00 46.88  ? 559  VAL A C     1 
ATOM   4600  O  O     . VAL C 3  559  ? -11.556 -80.323  40.842  1.00 49.12  ? 559  VAL A O     1 
ATOM   4601  C  CB    . VAL C 3  559  ? -10.482 -82.434  39.273  1.00 48.35  ? 559  VAL A CB    1 
ATOM   4602  C  CG1   . VAL C 3  559  ? -11.194 -83.247  40.333  1.00 47.80  ? 559  VAL A CG1   1 
ATOM   4603  C  CG2   . VAL C 3  559  ? -10.031 -83.346  38.154  1.00 51.00  ? 559  VAL A CG2   1 
ATOM   4604  N  N     . ILE C 3  560  ? -13.438 -80.441  39.608  1.00 42.34  ? 560  ILE A N     1 
ATOM   4605  C  CA    . ILE C 3  560  ? -14.237 -79.778  40.619  1.00 38.61  ? 560  ILE A CA    1 
ATOM   4606  C  C     . ILE C 3  560  ? -14.117 -80.535  41.922  1.00 36.23  ? 560  ILE A C     1 
ATOM   4607  O  O     . ILE C 3  560  ? -14.376 -81.725  41.972  1.00 36.19  ? 560  ILE A O     1 
ATOM   4608  C  CB    . ILE C 3  560  ? -15.703 -79.760  40.238  1.00 38.83  ? 560  ILE A CB    1 
ATOM   4609  C  CG1   . ILE C 3  560  ? -15.871 -79.103  38.877  1.00 37.61  ? 560  ILE A CG1   1 
ATOM   4610  C  CG2   . ILE C 3  560  ? -16.499 -79.027  41.302  1.00 37.93  ? 560  ILE A CG2   1 
ATOM   4611  C  CD1   . ILE C 3  560  ? -17.296 -78.996  38.472  1.00 39.92  ? 560  ILE A CD1   1 
ATOM   4612  N  N     . PRO C 3  561  ? -13.708 -79.860  42.996  1.00 35.69  ? 561  PRO A N     1 
ATOM   4613  C  CA    . PRO C 3  561  ? -13.591 -80.572  44.266  1.00 34.92  ? 561  PRO A CA    1 
ATOM   4614  C  C     . PRO C 3  561  ? -14.948 -80.655  44.946  1.00 35.34  ? 561  PRO A C     1 
ATOM   4615  O  O     . PRO C 3  561  ? -15.781 -79.752  44.832  1.00 32.89  ? 561  PRO A O     1 
ATOM   4616  C  CB    . PRO C 3  561  ? -12.604 -79.720  45.039  1.00 33.41  ? 561  PRO A CB    1 
ATOM   4617  C  CG    . PRO C 3  561  ? -12.987 -78.349  44.606  1.00 33.44  ? 561  PRO A CG    1 
ATOM   4618  C  CD    . PRO C 3  561  ? -13.155 -78.501  43.107  1.00 34.97  ? 561  PRO A CD    1 
ATOM   4619  N  N     . THR C 3  562  ? -15.160 -81.755  45.647  1.00 36.43  ? 562  THR A N     1 
ATOM   4620  C  CA    . THR C 3  562  ? -16.403 -81.997  46.346  1.00 38.09  ? 562  THR A CA    1 
ATOM   4621  C  C     . THR C 3  562  ? -16.688 -80.951  47.397  1.00 39.21  ? 562  THR A C     1 
ATOM   4622  O  O     . THR C 3  562  ? -15.829 -80.670  48.227  1.00 38.70  ? 562  THR A O     1 
ATOM   4623  C  CB    . THR C 3  562  ? -16.339 -83.327  47.011  1.00 40.10  ? 562  THR A CB    1 
ATOM   4624  O  OG1   . THR C 3  562  ? -16.259 -84.333  45.993  1.00 43.97  ? 562  THR A OG1   1 
ATOM   4625  C  CG2   . THR C 3  562  ? -17.553 -83.532  47.910  1.00 40.24  ? 562  THR A CG2   1 
ATOM   4626  N  N     . PRO C 3  563  ? -17.916 -80.387  47.398  1.00 41.15  ? 563  PRO A N     1 
ATOM   4627  C  CA    . PRO C 3  563  ? -18.375 -79.350  48.336  1.00 41.22  ? 563  PRO A CA    1 
ATOM   4628  C  C     . PRO C 3  563  ? -18.140 -79.723  49.776  1.00 41.71  ? 563  PRO A C     1 
ATOM   4629  O  O     . PRO C 3  563  ? -18.118 -80.892  50.126  1.00 41.71  ? 563  PRO A O     1 
ATOM   4630  C  CB    . PRO C 3  563  ? -19.866 -79.223  48.040  1.00 38.11  ? 563  PRO A CB    1 
ATOM   4631  C  CG    . PRO C 3  563  ? -19.971 -79.609  46.641  1.00 41.81  ? 563  PRO A CG    1 
ATOM   4632  C  CD    . PRO C 3  563  ? -19.023 -80.794  46.518  1.00 42.32  ? 563  PRO A CD    1 
ATOM   4633  N  N     . ALA C 3  564  ? -17.951 -78.720  50.614  1.00 44.43  ? 564  ALA A N     1 
ATOM   4634  C  CA    . ALA C 3  564  ? -17.737 -78.984  52.019  1.00 48.66  ? 564  ALA A CA    1 
ATOM   4635  C  C     . ALA C 3  564  ? -19.094 -79.449  52.497  1.00 50.46  ? 564  ALA A C     1 
ATOM   4636  O  O     . ALA C 3  564  ? -19.215 -80.203  53.459  1.00 52.40  ? 564  ALA A O     1 
ATOM   4637  C  CB    . ALA C 3  564  ? -17.325 -77.710  52.740  1.00 50.20  ? 564  ALA A CB    1 
ATOM   4638  N  N     . ILE C 3  565  ? -20.118 -78.992  51.792  1.00 51.42  ? 565  ILE A N     1 
ATOM   4639  C  CA    . ILE C 3  565  ? -21.484 -79.337  52.117  1.00 52.50  ? 565  ILE A CA    1 
ATOM   4640  C  C     . ILE C 3  565  ? -22.157 -79.986  50.918  1.00 56.00  ? 565  ILE A C     1 
ATOM   4641  O  O     . ILE C 3  565  ? -21.927 -79.590  49.775  1.00 58.03  ? 565  ILE A O     1 
ATOM   4642  C  CB    . ILE C 3  565  ? -22.265 -78.085  52.522  1.00 49.11  ? 565  ILE A CB    1 
ATOM   4643  C  CG1   . ILE C 3  565  ? -21.825 -77.629  53.908  1.00 48.40  ? 565  ILE A CG1   1 
ATOM   4644  C  CG2   . ILE C 3  565  ? -23.742 -78.361  52.497  1.00 49.96  ? 565  ILE A CG2   1 
ATOM   4645  C  CD1   . ILE C 3  565  ? -22.655 -76.484  54.465  1.00 49.11  ? 565  ILE A CD1   1 
ATOM   4646  N  N     . ILE C 3  566  ? -22.987 -80.988  51.178  1.00 57.86  ? 566  ILE A N     1 
ATOM   4647  C  CA    . ILE C 3  566  ? -23.697 -81.670  50.106  1.00 58.74  ? 566  ILE A CA    1 
ATOM   4648  C  C     . ILE C 3  566  ? -25.187 -81.753  50.432  1.00 61.74  ? 566  ILE A C     1 
ATOM   4649  O  O     . ILE C 3  566  ? -25.992 -82.169  49.598  1.00 63.20  ? 566  ILE A O     1 
ATOM   4650  C  CB    . ILE C 3  566  ? -23.129 -83.076  49.904  1.00 53.90  ? 566  ILE A CB    1 
ATOM   4651  C  CG1   . ILE C 3  566  ? -21.612 -82.990  49.852  1.00 49.74  ? 566  ILE A CG1   1 
ATOM   4652  C  CG2   . ILE C 3  566  ? -23.657 -83.679  48.613  1.00 52.15  ? 566  ILE A CG2   1 
ATOM   4653  C  CD1   . ILE C 3  566  ? -20.954 -84.298  49.592  1.00 54.72  ? 566  ILE A CD1   1 
ATOM   4654  N  N     . LYS C 3  567  ? -25.536 -81.331  51.646  1.00 63.08  ? 567  LYS A N     1 
ATOM   4655  C  CA    . LYS C 3  567  ? -26.907 -81.334  52.153  1.00 63.88  ? 567  LYS A CA    1 
ATOM   4656  C  C     . LYS C 3  567  ? -27.865 -80.468  51.307  1.00 62.40  ? 567  LYS A C     1 
ATOM   4657  O  O     . LYS C 3  567  ? -27.610 -80.269  50.120  1.00 64.48  ? 567  LYS A O     1 
ATOM   4658  C  CB    . LYS C 3  567  ? -26.876 -80.863  53.595  1.00 68.02  ? 567  LYS A CB    1 
ATOM   4659  C  CG    . LYS C 3  567  ? -26.399 -79.449  53.734  1.00 76.57  ? 567  LYS A CG    1 
ATOM   4660  C  CD    . LYS C 3  567  ? -26.833 -78.866  55.056  1.00 86.36  ? 567  LYS A CD    1 
ATOM   4661  C  CE    . LYS C 3  567  ? -26.267 -77.465  55.246  1.00 93.15  ? 567  LYS A CE    1 
ATOM   4662  N  NZ    . LYS C 3  567  ? -26.741 -76.817  56.510  1.00 95.59  ? 567  LYS A NZ    1 
ATOM   4663  N  N     . PRO C 3  568  ? -28.967 -79.936  51.895  1.00 59.65  ? 568  PRO A N     1 
ATOM   4664  C  CA    . PRO C 3  568  ? -29.918 -79.112  51.135  1.00 58.62  ? 568  PRO A CA    1 
ATOM   4665  C  C     . PRO C 3  568  ? -29.428 -78.279  49.959  1.00 58.21  ? 568  PRO A C     1 
ATOM   4666  O  O     . PRO C 3  568  ? -30.219 -77.910  49.085  1.00 59.25  ? 568  PRO A O     1 
ATOM   4667  C  CB    . PRO C 3  568  ? -30.573 -78.245  52.217  1.00 55.96  ? 568  PRO A CB    1 
ATOM   4668  C  CG    . PRO C 3  568  ? -29.720 -78.444  53.439  1.00 55.15  ? 568  PRO A CG    1 
ATOM   4669  C  CD    . PRO C 3  568  ? -29.340 -79.871  53.314  1.00 57.87  ? 568  PRO A CD    1 
ATOM   4670  N  N     . LYS C 3  569  ? -28.132 -77.990  49.938  1.00 57.20  ? 569  LYS A N     1 
ATOM   4671  C  CA    . LYS C 3  569  ? -27.525 -77.194  48.882  1.00 53.04  ? 569  LYS A CA    1 
ATOM   4672  C  C     . LYS C 3  569  ? -26.049 -77.543  48.915  1.00 51.72  ? 569  LYS A C     1 
ATOM   4673  O  O     . LYS C 3  569  ? -25.470 -77.668  49.983  1.00 52.16  ? 569  LYS A O     1 
ATOM   4674  C  CB    . LYS C 3  569  ? -27.730 -75.707  49.193  1.00 51.50  ? 569  LYS A CB    1 
ATOM   4675  C  CG    . LYS C 3  569  ? -27.638 -74.778  48.007  1.00 49.68  ? 569  LYS A CG    1 
ATOM   4676  C  CD    . LYS C 3  569  ? -28.096 -73.373  48.378  1.00 48.52  ? 569  LYS A CD    1 
ATOM   4677  C  CE    . LYS C 3  569  ? -28.089 -72.477  47.149  1.00 51.07  ? 569  LYS A CE    1 
ATOM   4678  N  NZ    . LYS C 3  569  ? -28.712 -71.140  47.363  1.00 49.94  ? 569  LYS A NZ    1 
ATOM   4679  N  N     . PRO C 3  570  ? -25.427 -77.750  47.751  1.00 51.56  ? 570  PRO A N     1 
ATOM   4680  C  CA    . PRO C 3  570  ? -24.000 -78.080  47.758  1.00 51.60  ? 570  PRO A CA    1 
ATOM   4681  C  C     . PRO C 3  570  ? -23.190 -76.782  47.808  1.00 52.04  ? 570  PRO A C     1 
ATOM   4682  O  O     . PRO C 3  570  ? -23.037 -76.092  46.800  1.00 53.63  ? 570  PRO A O     1 
ATOM   4683  C  CB    . PRO C 3  570  ? -23.818 -78.827  46.446  1.00 48.96  ? 570  PRO A CB    1 
ATOM   4684  C  CG    . PRO C 3  570  ? -24.731 -78.075  45.532  1.00 49.34  ? 570  PRO A CG    1 
ATOM   4685  C  CD    . PRO C 3  570  ? -25.982 -77.855  46.390  1.00 52.40  ? 570  PRO A CD    1 
ATOM   4686  N  N     . LEU C 3  571  ? -22.692 -76.444  48.991  1.00 49.93  ? 571  LEU A N     1 
ATOM   4687  C  CA    . LEU C 3  571  ? -21.911 -75.234  49.171  1.00 47.41  ? 571  LEU A CA    1 
ATOM   4688  C  C     . LEU C 3  571  ? -20.452 -75.516  49.450  1.00 48.79  ? 571  LEU A C     1 
ATOM   4689  O  O     . LEU C 3  571  ? -20.114 -76.480  50.145  1.00 49.54  ? 571  LEU A O     1 
ATOM   4690  C  CB    . LEU C 3  571  ? -22.469 -74.420  50.331  1.00 43.86  ? 571  LEU A CB    1 
ATOM   4691  C  CG    . LEU C 3  571  ? -23.620 -73.482  50.011  1.00 42.42  ? 571  LEU A CG    1 
ATOM   4692  C  CD1   . LEU C 3  571  ? -24.632 -74.217  49.166  1.00 44.88  ? 571  LEU A CD1   1 
ATOM   4693  C  CD2   . LEU C 3  571  ? -24.236 -72.953  51.304  1.00 40.23  ? 571  LEU A CD2   1 
ATOM   4694  N  N     . TRP C 3  572  ? -19.587 -74.676  48.894  1.00 48.03  ? 572  TRP A N     1 
ATOM   4695  C  CA    . TRP C 3  572  ? -18.158 -74.795  49.141  1.00 46.73  ? 572  TRP A CA    1 
ATOM   4696  C  C     . TRP C 3  572  ? -17.813 -73.654  50.105  1.00 47.59  ? 572  TRP A C     1 
ATOM   4697  O  O     . TRP C 3  572  ? -18.571 -72.679  50.220  1.00 48.67  ? 572  TRP A O     1 
ATOM   4698  C  CB    . TRP C 3  572  ? -17.366 -74.621  47.850  1.00 43.60  ? 572  TRP A CB    1 
ATOM   4699  C  CG    . TRP C 3  572  ? -17.439 -75.768  46.904  1.00 40.11  ? 572  TRP A CG    1 
ATOM   4700  C  CD1   . TRP C 3  572  ? -16.434 -76.643  46.592  1.00 38.99  ? 572  TRP A CD1   1 
ATOM   4701  C  CD2   . TRP C 3  572  ? -18.547 -76.121  46.078  1.00 39.68  ? 572  TRP A CD2   1 
ATOM   4702  N  NE1   . TRP C 3  572  ? -16.846 -77.516  45.608  1.00 37.31  ? 572  TRP A NE1   1 
ATOM   4703  C  CE2   . TRP C 3  572  ? -18.139 -77.217  45.273  1.00 37.86  ? 572  TRP A CE2   1 
ATOM   4704  C  CE3   . TRP C 3  572  ? -19.844 -75.615  45.929  1.00 38.48  ? 572  TRP A CE3   1 
ATOM   4705  C  CZ2   . TRP C 3  572  ? -18.982 -77.814  44.341  1.00 35.13  ? 572  TRP A CZ2   1 
ATOM   4706  C  CZ3   . TRP C 3  572  ? -20.682 -76.212  45.001  1.00 39.45  ? 572  TRP A CZ3   1 
ATOM   4707  C  CH2   . TRP C 3  572  ? -20.245 -77.300  44.217  1.00 37.15  ? 572  TRP A CH2   1 
ATOM   4708  N  N     . SER C 3  573  ? -16.691 -73.770  50.809  1.00 44.83  ? 573  SER A N     1 
ATOM   4709  C  CA    . SER C 3  573  ? -16.289 -72.709  51.725  1.00 42.03  ? 573  SER A CA    1 
ATOM   4710  C  C     . SER C 3  573  ? -15.280 -71.866  50.980  1.00 41.81  ? 573  SER A C     1 
ATOM   4711  O  O     . SER C 3  573  ? -14.887 -72.208  49.861  1.00 43.27  ? 573  SER A O     1 
ATOM   4712  C  CB    . SER C 3  573  ? -15.602 -73.286  52.945  1.00 40.66  ? 573  SER A CB    1 
ATOM   4713  O  OG    . SER C 3  573  ? -14.319 -73.753  52.585  1.00 35.34  ? 573  SER A OG    1 
ATOM   4714  N  N     . GLY C 3  574  ? -14.851 -70.769  51.592  1.00 39.83  ? 574  GLY A N     1 
ATOM   4715  C  CA    . GLY C 3  574  ? -13.854 -69.939  50.941  1.00 36.94  ? 574  GLY A CA    1 
ATOM   4716  C  C     . GLY C 3  574  ? -12.570 -70.744  50.857  1.00 35.28  ? 574  GLY A C     1 
ATOM   4717  O  O     . GLY C 3  574  ? -12.039 -71.007  49.766  1.00 32.84  ? 574  GLY A O     1 
ATOM   4718  N  N     . LYS C 3  575  ? -12.085 -71.149  52.028  1.00 33.10  ? 575  LYS A N     1 
ATOM   4719  C  CA    . LYS C 3  575  ? -10.868 -71.942  52.136  1.00 32.83  ? 575  LYS A CA    1 
ATOM   4720  C  C     . LYS C 3  575  ? -10.852 -72.962  51.022  1.00 31.94  ? 575  LYS A C     1 
ATOM   4721  O  O     . LYS C 3  575  ? -9.898  -73.071  50.263  1.00 31.38  ? 575  LYS A O     1 
ATOM   4722  C  CB    . LYS C 3  575  ? -10.824 -72.628  53.503  1.00 31.50  ? 575  LYS A CB    1 
ATOM   4723  C  CG    . LYS C 3  575  ? -10.851 -71.612  54.618  1.00 35.76  ? 575  LYS A CG    1 
ATOM   4724  C  CD    . LYS C 3  575  ? -10.988 -72.159  56.025  1.00 35.78  ? 575  LYS A CD    1 
ATOM   4725  C  CE    . LYS C 3  575  ? -11.387 -70.980  56.926  1.00 39.96  ? 575  LYS A CE    1 
ATOM   4726  N  NZ    . LYS C 3  575  ? -11.368 -71.231  58.385  1.00 44.15  ? 575  LYS A NZ    1 
ATOM   4727  N  N     . GLN C 3  576  ? -11.945 -73.692  50.919  1.00 33.43  ? 576  GLN A N     1 
ATOM   4728  C  CA    . GLN C 3  576  ? -12.097 -74.704  49.897  1.00 34.81  ? 576  GLN A CA    1 
ATOM   4729  C  C     . GLN C 3  576  ? -11.489 -74.347  48.551  1.00 33.52  ? 576  GLN A C     1 
ATOM   4730  O  O     . GLN C 3  576  ? -10.571 -75.011  48.058  1.00 32.10  ? 576  GLN A O     1 
ATOM   4731  C  CB    . GLN C 3  576  ? -13.573 -74.982  49.686  1.00 37.48  ? 576  GLN A CB    1 
ATOM   4732  C  CG    . GLN C 3  576  ? -14.148 -75.910  50.686  1.00 39.73  ? 576  GLN A CG    1 
ATOM   4733  C  CD    . GLN C 3  576  ? -14.929 -76.996  50.014  1.00 42.30  ? 576  GLN A CD    1 
ATOM   4734  O  OE1   . GLN C 3  576  ? -15.987 -76.741  49.433  1.00 43.22  ? 576  GLN A OE1   1 
ATOM   4735  N  NE2   . GLN C 3  576  ? -14.407 -78.220  50.066  1.00 40.95  ? 576  GLN A NE2   1 
ATOM   4736  N  N     . ILE C 3  577  ? -12.012 -73.293  47.950  1.00 32.04  ? 577  ILE A N     1 
ATOM   4737  C  CA    . ILE C 3  577  ? -11.536 -72.918  46.643  1.00 33.72  ? 577  ILE A CA    1 
ATOM   4738  C  C     . ILE C 3  577  ? -10.165 -72.257  46.655  1.00 32.39  ? 577  ILE A C     1 
ATOM   4739  O  O     . ILE C 3  577  ? -9.318  -72.570  45.818  1.00 33.39  ? 577  ILE A O     1 
ATOM   4740  C  CB    . ILE C 3  577  ? -12.568 -72.050  45.972  1.00 33.41  ? 577  ILE A CB    1 
ATOM   4741  C  CG1   . ILE C 3  577  ? -12.687 -70.745  46.726  1.00 37.60  ? 577  ILE A CG1   1 
ATOM   4742  C  CG2   . ILE C 3  577  ? -13.921 -72.767  46.000  1.00 30.29  ? 577  ILE A CG2   1 
ATOM   4743  C  CD1   . ILE C 3  577  ? -13.869 -69.935  46.302  1.00 44.35  ? 577  ILE A CD1   1 
ATOM   4744  N  N     . LEU C 3  578  ? -9.922  -71.363  47.602  1.00 29.78  ? 578  LEU A N     1 
ATOM   4745  C  CA    . LEU C 3  578  ? -8.612  -70.736  47.664  1.00 26.66  ? 578  LEU A CA    1 
ATOM   4746  C  C     . LEU C 3  578  ? -7.538  -71.826  47.585  1.00 25.71  ? 578  LEU A C     1 
ATOM   4747  O  O     . LEU C 3  578  ? -6.561  -71.710  46.850  1.00 22.19  ? 578  LEU A O     1 
ATOM   4748  C  CB    . LEU C 3  578  ? -8.468  -69.971  48.966  1.00 24.20  ? 578  LEU A CB    1 
ATOM   4749  C  CG    . LEU C 3  578  ? -7.104  -69.335  49.186  1.00 24.24  ? 578  LEU A CG    1 
ATOM   4750  C  CD1   . LEU C 3  578  ? -6.825  -68.349  48.069  1.00 23.95  ? 578  LEU A CD1   1 
ATOM   4751  C  CD2   . LEU C 3  578  ? -7.072  -68.634  50.544  1.00 25.70  ? 578  LEU A CD2   1 
ATOM   4752  N  N     . SER C 3  579  ? -7.757  -72.902  48.336  1.00 27.13  ? 579  SER A N     1 
ATOM   4753  C  CA    . SER C 3  579  ? -6.828  -74.032  48.397  1.00 28.19  ? 579  SER A CA    1 
ATOM   4754  C  C     . SER C 3  579  ? -6.452  -74.539  47.033  1.00 27.14  ? 579  SER A C     1 
ATOM   4755  O  O     . SER C 3  579  ? -5.478  -75.297  46.884  1.00 26.68  ? 579  SER A O     1 
ATOM   4756  C  CB    . SER C 3  579  ? -7.435  -75.200  49.173  1.00 29.52  ? 579  SER A CB    1 
ATOM   4757  O  OG    . SER C 3  579  ? -7.733  -74.842  50.503  1.00 33.72  ? 579  SER A OG    1 
ATOM   4758  N  N     . VAL C 3  580  ? -7.246  -74.159  46.042  1.00 25.27  ? 580  VAL A N     1 
ATOM   4759  C  CA    . VAL C 3  580  ? -6.956  -74.613  44.708  1.00 26.30  ? 580  VAL A CA    1 
ATOM   4760  C  C     . VAL C 3  580  ? -5.707  -73.882  44.297  1.00 28.76  ? 580  VAL A C     1 
ATOM   4761  O  O     . VAL C 3  580  ? -4.841  -74.454  43.636  1.00 32.28  ? 580  VAL A O     1 
ATOM   4762  C  CB    . VAL C 3  580  ? -8.083  -74.293  43.717  1.00 24.89  ? 580  VAL A CB    1 
ATOM   4763  C  CG1   . VAL C 3  580  ? -7.746  -74.882  42.354  1.00 18.72  ? 580  VAL A CG1   1 
ATOM   4764  C  CG2   . VAL C 3  580  ? -9.408  -74.853  44.226  1.00 23.55  ? 580  VAL A CG2   1 
ATOM   4765  N  N     . ALA C 3  581  ? -5.595  -72.624  44.717  1.00 28.36  ? 581  ALA A N     1 
ATOM   4766  C  CA    . ALA C 3  581  ? -4.427  -71.816  44.367  1.00 27.10  ? 581  ALA A CA    1 
ATOM   4767  C  C     . ALA C 3  581  ? -3.170  -72.440  44.948  1.00 25.57  ? 581  ALA A C     1 
ATOM   4768  O  O     . ALA C 3  581  ? -2.153  -72.581  44.265  1.00 26.44  ? 581  ALA A O     1 
ATOM   4769  C  CB    . ALA C 3  581  ? -4.593  -70.407  44.882  1.00 27.89  ? 581  ALA A CB    1 
ATOM   4770  N  N     . ILE C 3  582  ? -3.244  -72.813  46.217  1.00 22.42  ? 582  ILE A N     1 
ATOM   4771  C  CA    . ILE C 3  582  ? -2.107  -73.430  46.861  1.00 21.47  ? 582  ILE A CA    1 
ATOM   4772  C  C     . ILE C 3  582  ? -1.834  -74.748  46.179  1.00 24.42  ? 582  ILE A C     1 
ATOM   4773  O  O     . ILE C 3  582  ? -2.741  -75.565  46.011  1.00 26.09  ? 582  ILE A O     1 
ATOM   4774  C  CB    . ILE C 3  582  ? -2.385  -73.725  48.317  1.00 17.11  ? 582  ILE A CB    1 
ATOM   4775  C  CG1   . ILE C 3  582  ? -2.887  -72.451  49.000  1.00 17.39  ? 582  ILE A CG1   1 
ATOM   4776  C  CG2   . ILE C 3  582  ? -1.130  -74.309  48.957  1.00 10.84  ? 582  ILE A CG2   1 
ATOM   4777  C  CD1   . ILE C 3  582  ? -3.292  -72.621  50.458  1.00 18.34  ? 582  ILE A CD1   1 
ATOM   4778  N  N     . PRO C 3  583  ? -0.583  -74.971  45.766  1.00 26.24  ? 583  PRO A N     1 
ATOM   4779  C  CA    . PRO C 3  583  ? -0.209  -76.218  45.100  1.00 30.99  ? 583  PRO A CA    1 
ATOM   4780  C  C     . PRO C 3  583  ? -0.133  -77.360  46.120  1.00 35.10  ? 583  PRO A C     1 
ATOM   4781  O  O     . PRO C 3  583  ? -0.353  -77.139  47.310  1.00 36.14  ? 583  PRO A O     1 
ATOM   4782  C  CB    . PRO C 3  583  ? 1.140   -75.876  44.476  1.00 29.77  ? 583  PRO A CB    1 
ATOM   4783  C  CG    . PRO C 3  583  ? 1.709   -74.902  45.441  1.00 26.62  ? 583  PRO A CG    1 
ATOM   4784  C  CD    . PRO C 3  583  ? 0.538   -74.019  45.767  1.00 25.70  ? 583  PRO A CD    1 
ATOM   4785  N  N     . ASN C 3  584  ? 0.161   -78.574  45.657  1.00 38.27  ? 584  ASN A N     1 
ATOM   4786  C  CA    . ASN C 3  584  ? 0.248   -79.736  46.545  1.00 41.04  ? 584  ASN A CA    1 
ATOM   4787  C  C     . ASN C 3  584  ? 1.611   -79.798  47.235  1.00 42.61  ? 584  ASN A C     1 
ATOM   4788  O  O     . ASN C 3  584  ? 2.578   -79.240  46.729  1.00 44.82  ? 584  ASN A O     1 
ATOM   4789  C  CB    . ASN C 3  584  ? 0.048   -81.037  45.754  1.00 41.68  ? 584  ASN A CB    1 
ATOM   4790  C  CG    . ASN C 3  584  ? -1.251  -81.064  44.981  1.00 40.94  ? 584  ASN A CG    1 
ATOM   4791  O  OD1   . ASN C 3  584  ? -2.326  -80.845  45.539  1.00 42.35  ? 584  ASN A OD1   1 
ATOM   4792  N  ND2   . ASN C 3  584  ? -1.158  -81.345  43.686  1.00 40.67  ? 584  ASN A ND2   1 
ATOM   4793  N  N     . GLY C 3  585  ? 1.680   -80.478  48.381  1.00 42.12  ? 585  GLY A N     1 
ATOM   4794  C  CA    . GLY C 3  585  ? 2.937   -80.616  49.098  1.00 40.83  ? 585  GLY A CA    1 
ATOM   4795  C  C     . GLY C 3  585  ? 3.314   -79.446  49.985  1.00 39.49  ? 585  GLY A C     1 
ATOM   4796  O  O     . GLY C 3  585  ? 4.413   -79.387  50.539  1.00 40.16  ? 585  GLY A O     1 
ATOM   4797  N  N     . ILE C 3  586  ? 2.412   -78.491  50.116  1.00 38.02  ? 586  ILE A N     1 
ATOM   4798  C  CA    . ILE C 3  586  ? 2.701   -77.349  50.957  1.00 37.24  ? 586  ILE A CA    1 
ATOM   4799  C  C     . ILE C 3  586  ? 2.061   -77.608  52.300  1.00 39.48  ? 586  ILE A C     1 
ATOM   4800  O  O     . ILE C 3  586  ? 0.876   -77.942  52.394  1.00 40.62  ? 586  ILE A O     1 
ATOM   4801  C  CB    . ILE C 3  586  ? 2.140   -76.055  50.362  1.00 33.44  ? 586  ILE A CB    1 
ATOM   4802  C  CG1   . ILE C 3  586  ? 2.757   -75.828  48.988  1.00 35.15  ? 586  ILE A CG1   1 
ATOM   4803  C  CG2   . ILE C 3  586  ? 2.460   -74.879  51.258  1.00 28.37  ? 586  ILE A CG2   1 
ATOM   4804  C  CD1   . ILE C 3  586  ? 4.251   -75.596  49.013  1.00 37.34  ? 586  ILE A CD1   1 
ATOM   4805  N  N     . HIS C 3  587  ? 2.856   -77.471  53.346  1.00 40.02  ? 587  HIS A N     1 
ATOM   4806  C  CA    . HIS C 3  587  ? 2.358   -77.695  54.682  1.00 41.60  ? 587  HIS A CA    1 
ATOM   4807  C  C     . HIS C 3  587  ? 2.649   -76.439  55.496  1.00 42.29  ? 587  HIS A C     1 
ATOM   4808  O  O     . HIS C 3  587  ? 3.630   -75.743  55.251  1.00 42.62  ? 587  HIS A O     1 
ATOM   4809  C  CB    . HIS C 3  587  ? 3.054   -78.923  55.267  1.00 44.56  ? 587  HIS A CB    1 
ATOM   4810  C  CG    . HIS C 3  587  ? 3.024   -80.114  54.357  1.00 46.47  ? 587  HIS A CG    1 
ATOM   4811  N  ND1   . HIS C 3  587  ? 1.965   -80.996  54.316  1.00 46.65  ? 587  HIS A ND1   1 
ATOM   4812  C  CD2   . HIS C 3  587  ? 3.900   -80.533  53.409  1.00 45.59  ? 587  HIS A CD2   1 
ATOM   4813  C  CE1   . HIS C 3  587  ? 2.190   -81.905  53.382  1.00 45.24  ? 587  HIS A CE1   1 
ATOM   4814  N  NE2   . HIS C 3  587  ? 3.356   -81.646  52.816  1.00 40.51  ? 587  HIS A NE2   1 
ATOM   4815  N  N     . LEU C 3  588  ? 1.792   -76.137  56.458  1.00 42.99  ? 588  LEU A N     1 
ATOM   4816  C  CA    . LEU C 3  588  ? 2.001   -74.950  57.254  1.00 43.57  ? 588  LEU A CA    1 
ATOM   4817  C  C     . LEU C 3  588  ? 1.169   -74.942  58.536  1.00 45.64  ? 588  LEU A C     1 
ATOM   4818  O  O     . LEU C 3  588  ? -0.067  -74.909  58.492  1.00 43.44  ? 588  LEU A O     1 
ATOM   4819  C  CB    . LEU C 3  588  ? 1.683   -73.727  56.389  1.00 42.59  ? 588  LEU A CB    1 
ATOM   4820  C  CG    . LEU C 3  588  ? 1.886   -72.317  56.936  1.00 42.48  ? 588  LEU A CG    1 
ATOM   4821  C  CD1   . LEU C 3  588  ? 3.308   -72.149  57.435  1.00 46.79  ? 588  LEU A CD1   1 
ATOM   4822  C  CD2   . LEU C 3  588  ? 1.599   -71.318  55.845  1.00 42.38  ? 588  LEU A CD2   1 
ATOM   4823  N  N     . GLN C 3  589  ? 1.866   -75.003  59.672  1.00 48.14  ? 589  GLN A N     1 
ATOM   4824  C  CA    . GLN C 3  589  ? 1.239   -74.958  60.989  1.00 51.48  ? 589  GLN A CA    1 
ATOM   4825  C  C     . GLN C 3  589  ? 1.488   -73.569  61.532  1.00 52.98  ? 589  GLN A C     1 
ATOM   4826  O  O     . GLN C 3  589  ? 2.497   -72.950  61.213  1.00 53.81  ? 589  GLN A O     1 
ATOM   4827  C  CB    . GLN C 3  589  ? 1.866   -75.969  61.944  1.00 55.50  ? 589  GLN A CB    1 
ATOM   4828  C  CG    . GLN C 3  589  ? 1.103   -77.278  62.062  1.00 63.21  ? 589  GLN A CG    1 
ATOM   4829  C  CD    . GLN C 3  589  ? 1.490   -78.058  63.304  1.00 66.62  ? 589  GLN A CD    1 
ATOM   4830  O  OE1   . GLN C 3  589  ? 1.250   -77.612  64.429  1.00 67.02  ? 589  GLN A OE1   1 
ATOM   4831  N  NE2   . GLN C 3  589  ? 2.099   -79.227  63.107  1.00 69.21  ? 589  GLN A NE2   1 
ATOM   4832  N  N     . ARG C 3  590  ? 0.593   -73.078  62.374  1.00 55.68  ? 590  ARG A N     1 
ATOM   4833  C  CA    . ARG C 3  590  ? 0.766   -71.738  62.900  1.00 59.07  ? 590  ARG A CA    1 
ATOM   4834  C  C     . ARG C 3  590  ? 0.619   -71.568  64.413  1.00 60.80  ? 590  ARG A C     1 
ATOM   4835  O  O     . ARG C 3  590  ? 1.607   -71.576  65.159  1.00 61.85  ? 590  ARG A O     1 
ATOM   4836  C  CB    . ARG C 3  590  ? -0.204  -70.815  62.180  1.00 63.79  ? 590  ARG A CB    1 
ATOM   4837  C  CG    . ARG C 3  590  ? -0.203  -69.409  62.694  1.00 69.82  ? 590  ARG A CG    1 
ATOM   4838  C  CD    . ARG C 3  590  ? -0.602  -68.423  61.615  1.00 74.60  ? 590  ARG A CD    1 
ATOM   4839  N  NE    . ARG C 3  590  ? -0.054  -67.136  61.974  1.00 79.14  ? 590  ARG A NE    1 
ATOM   4840  C  CZ    . ARG C 3  590  ? 1.206   -66.984  62.364  1.00 87.24  ? 590  ARG A CZ    1 
ATOM   4841  N  NH1   . ARG C 3  590  ? 2.012   -68.042  62.427  1.00 86.01  ? 590  ARG A NH1   1 
ATOM   4842  N  NH2   . ARG C 3  590  ? 1.659   -65.784  62.711  1.00 93.76  ? 590  ARG A NH2   1 
ATOM   4843  N  N     . PHE C 3  591  ? -0.624  -71.403  64.852  1.00 61.09  ? 591  PHE A N     1 
ATOM   4844  C  CA    . PHE C 3  591  ? -0.952  -71.201  66.259  1.00 60.63  ? 591  PHE A CA    1 
ATOM   4845  C  C     . PHE C 3  591  ? -0.701  -69.775  66.725  1.00 60.33  ? 591  PHE A C     1 
ATOM   4846  O  O     . PHE C 3  591  ? 0.433   -69.364  66.945  1.00 58.49  ? 591  PHE A O     1 
ATOM   4847  C  CB    . PHE C 3  591  ? -0.187  -72.177  67.165  1.00 59.74  ? 591  PHE A CB    1 
ATOM   4848  C  CG    . PHE C 3  591  ? -0.600  -73.610  66.994  1.00 59.19  ? 591  PHE A CG    1 
ATOM   4849  C  CD1   . PHE C 3  591  ? 0.049   -74.434  66.080  1.00 59.44  ? 591  PHE A CD1   1 
ATOM   4850  C  CD2   . PHE C 3  591  ? -1.673  -74.123  67.713  1.00 58.77  ? 591  PHE A CD2   1 
ATOM   4851  C  CE1   . PHE C 3  591  ? -0.367  -75.749  65.881  1.00 59.90  ? 591  PHE A CE1   1 
ATOM   4852  C  CE2   . PHE C 3  591  ? -2.098  -75.432  67.522  1.00 60.44  ? 591  PHE A CE2   1 
ATOM   4853  C  CZ    . PHE C 3  591  ? -1.442  -76.249  66.600  1.00 60.62  ? 591  PHE A CZ    1 
ATOM   4854  N  N     . ASP C 3  592  ? -1.781  -69.016  66.837  1.00 61.77  ? 592  ASP A N     1 
ATOM   4855  C  CA    . ASP C 3  592  ? -1.707  -67.654  67.321  1.00 65.33  ? 592  ASP A CA    1 
ATOM   4856  C  C     . ASP C 3  592  ? -2.084  -67.782  68.787  1.00 67.10  ? 592  ASP A C     1 
ATOM   4857  O  O     . ASP C 3  592  ? -2.071  -68.888  69.322  1.00 68.39  ? 592  ASP A O     1 
ATOM   4858  C  CB    . ASP C 3  592  ? -2.698  -66.749  66.587  1.00 66.45  ? 592  ASP A CB    1 
ATOM   4859  C  CG    . ASP C 3  592  ? -2.282  -66.470  65.161  1.00 65.16  ? 592  ASP A CG    1 
ATOM   4860  O  OD1   . ASP C 3  592  ? -1.125  -66.059  64.963  1.00 69.16  ? 592  ASP A OD1   1 
ATOM   4861  O  OD2   . ASP C 3  592  ? -3.105  -66.652  64.243  1.00 63.34  ? 592  ASP A OD2   1 
ATOM   4862  N  N     . GLU C 3  593  ? -2.434  -66.675  69.431  1.00 68.84  ? 593  GLU A N     1 
ATOM   4863  C  CA    . GLU C 3  593  ? -2.776  -66.718  70.846  1.00 71.33  ? 593  GLU A CA    1 
ATOM   4864  C  C     . GLU C 3  593  ? -3.656  -67.880  71.291  1.00 71.75  ? 593  GLU A C     1 
ATOM   4865  O  O     . GLU C 3  593  ? -3.186  -68.776  72.002  1.00 73.42  ? 593  GLU A O     1 
ATOM   4866  C  CB    . GLU C 3  593  ? -3.415  -65.398  71.300  1.00 74.49  ? 593  GLU A CB    1 
ATOM   4867  C  CG    . GLU C 3  593  ? -2.406  -64.305  71.656  1.00 77.75  ? 593  GLU A CG    1 
ATOM   4868  C  CD    . GLU C 3  593  ? -3.036  -63.134  72.398  1.00 78.66  ? 593  GLU A CD    1 
ATOM   4869  O  OE1   . GLU C 3  593  ? -3.564  -63.349  73.512  1.00 75.32  ? 593  GLU A OE1   1 
ATOM   4870  O  OE2   . GLU C 3  593  ? -3.001  -62.000  71.865  1.00 79.89  ? 593  GLU A OE2   1 
ATOM   4871  N  N     . GLY C 3  594  ? -4.918  -67.887  70.879  1.00 70.43  ? 594  GLY A N     1 
ATOM   4872  C  CA    . GLY C 3  594  ? -5.796  -68.954  71.327  1.00 71.92  ? 594  GLY A CA    1 
ATOM   4873  C  C     . GLY C 3  594  ? -6.009  -70.174  70.450  1.00 71.99  ? 594  GLY A C     1 
ATOM   4874  O  O     . GLY C 3  594  ? -7.066  -70.794  70.527  1.00 73.26  ? 594  GLY A O     1 
ATOM   4875  N  N     . THR C 3  595  ? -5.024  -70.545  69.641  1.00 71.53  ? 595  THR A N     1 
ATOM   4876  C  CA    . THR C 3  595  ? -5.186  -71.691  68.753  1.00 70.49  ? 595  THR A CA    1 
ATOM   4877  C  C     . THR C 3  595  ? -5.289  -72.996  69.515  1.00 68.74  ? 595  THR A C     1 
ATOM   4878  O  O     . THR C 3  595  ? -4.828  -73.081  70.647  1.00 69.16  ? 595  THR A O     1 
ATOM   4879  C  CB    . THR C 3  595  ? -4.026  -71.798  67.786  1.00 71.69  ? 595  THR A CB    1 
ATOM   4880  O  OG1   . THR C 3  595  ? -3.727  -70.500  67.263  1.00 72.90  ? 595  THR A OG1   1 
ATOM   4881  C  CG2   . THR C 3  595  ? -4.398  -72.723  66.640  1.00 73.22  ? 595  THR A CG2   1 
ATOM   4882  N  N     . THR C 3  596  ? -5.891  -74.008  68.891  1.00 66.22  ? 596  THR A N     1 
ATOM   4883  C  CA    . THR C 3  596  ? -6.060  -75.306  69.534  1.00 65.61  ? 596  THR A CA    1 
ATOM   4884  C  C     . THR C 3  596  ? -6.680  -76.364  68.643  1.00 65.68  ? 596  THR A C     1 
ATOM   4885  O  O     . THR C 3  596  ? -7.788  -76.821  68.934  1.00 67.65  ? 596  THR A O     1 
ATOM   4886  C  CB    . THR C 3  596  ? -6.982  -75.220  70.750  1.00 65.88  ? 596  THR A CB    1 
ATOM   4887  O  OG1   . THR C 3  596  ? -7.397  -73.868  70.953  1.00 67.66  ? 596  THR A OG1   1 
ATOM   4888  C  CG2   . THR C 3  596  ? -6.276  -75.737  71.979  1.00 71.00  ? 596  THR A CG2   1 
ATOM   4889  N  N     . LEU C 3  597  ? -5.981  -76.768  67.586  1.00 64.22  ? 597  LEU A N     1 
ATOM   4890  C  CA    . LEU C 3  597  ? -6.489  -77.787  66.657  1.00 62.50  ? 597  LEU A CA    1 
ATOM   4891  C  C     . LEU C 3  597  ? -8.007  -77.915  66.725  1.00 61.41  ? 597  LEU A C     1 
ATOM   4892  O  O     . LEU C 3  597  ? -8.548  -79.017  66.766  1.00 60.25  ? 597  LEU A O     1 
ATOM   4893  C  CB    . LEU C 3  597  ? -5.871  -79.143  66.968  1.00 61.66  ? 597  LEU A CB    1 
ATOM   4894  C  CG    . LEU C 3  597  ? -4.434  -79.104  67.467  1.00 63.72  ? 597  LEU A CG    1 
ATOM   4895  C  CD1   . LEU C 3  597  ? -4.423  -79.478  68.952  1.00 65.64  ? 597  LEU A CD1   1 
ATOM   4896  C  CD2   . LEU C 3  597  ? -3.573  -80.060  66.647  1.00 65.13  ? 597  LEU A CD2   1 
ATOM   4897  N  N     . LEU C 3  598  ? -8.676  -76.768  66.744  1.00 61.26  ? 598  LEU A N     1 
ATOM   4898  C  CA    . LEU C 3  598  ? -10.126 -76.681  66.824  1.00 60.86  ? 598  LEU A CA    1 
ATOM   4899  C  C     . LEU C 3  598  ? -10.396 -75.185  66.935  1.00 60.41  ? 598  LEU A C     1 
ATOM   4900  O  O     . LEU C 3  598  ? -11.523 -74.745  67.162  1.00 59.79  ? 598  LEU A O     1 
ATOM   4901  C  CB    . LEU C 3  598  ? -10.637 -77.407  68.072  1.00 60.34  ? 598  LEU A CB    1 
ATOM   4902  C  CG    . LEU C 3  598  ? -11.872 -78.298  67.892  1.00 61.57  ? 598  LEU A CG    1 
ATOM   4903  C  CD1   . LEU C 3  598  ? -12.290 -78.865  69.236  1.00 62.78  ? 598  LEU A CD1   1 
ATOM   4904  C  CD2   . LEU C 3  598  ? -13.007 -77.505  67.283  1.00 61.50  ? 598  LEU A CD2   1 
ATOM   4905  N  N     . SER C 3  599  ? -9.317  -74.426  66.765  1.00 60.45  ? 599  SER A N     1 
ATOM   4906  C  CA    . SER C 3  599  ? -9.311  -72.968  66.827  1.00 59.66  ? 599  SER A CA    1 
ATOM   4907  C  C     . SER C 3  599  ? -10.677 -72.321  66.825  1.00 58.21  ? 599  SER A C     1 
ATOM   4908  O  O     . SER C 3  599  ? -11.149 -71.858  65.796  1.00 58.07  ? 599  SER A O     1 
ATOM   4909  C  CB    . SER C 3  599  ? -8.475  -72.403  65.672  1.00 59.01  ? 599  SER A CB    1 
ATOM   4910  O  OG    . SER C 3  599  ? -8.598  -73.215  64.521  1.00 54.48  ? 599  SER A OG    1 
ATOM   4911  N  N     . PRO C 3  600  ? -11.325 -72.273  67.994  1.00 57.53  ? 600  PRO A N     1 
ATOM   4912  C  CA    . PRO C 3  600  ? -12.654 -71.670  68.120  1.00 58.05  ? 600  PRO A CA    1 
ATOM   4913  C  C     . PRO C 3  600  ? -12.737 -70.282  67.493  1.00 57.59  ? 600  PRO A C     1 
ATOM   4914  O  O     . PRO C 3  600  ? -13.821 -69.829  67.114  1.00 58.43  ? 600  PRO A O     1 
ATOM   4915  C  CB    . PRO C 3  600  ? -12.881 -71.641  69.634  1.00 59.92  ? 600  PRO A CB    1 
ATOM   4916  C  CG    . PRO C 3  600  ? -11.479 -71.632  70.201  1.00 59.70  ? 600  PRO A CG    1 
ATOM   4917  C  CD    . PRO C 3  600  ? -10.782 -72.626  69.314  1.00 57.02  ? 600  PRO A CD    1 
ATOM   4918  N  N     . LYS C 3  601  ? -11.590 -69.617  67.377  1.00 54.92  ? 601  LYS A N     1 
ATOM   4919  C  CA    . LYS C 3  601  ? -11.549 -68.281  66.799  1.00 52.56  ? 601  LYS A CA    1 
ATOM   4920  C  C     . LYS C 3  601  ? -11.094 -68.320  65.343  1.00 49.98  ? 601  LYS A C     1 
ATOM   4921  O  O     . LYS C 3  601  ? -10.730 -67.289  64.771  1.00 50.27  ? 601  LYS A O     1 
ATOM   4922  C  CB    . LYS C 3  601  ? -10.592 -67.402  67.599  1.00 54.56  ? 601  LYS A CB    1 
ATOM   4923  C  CG    . LYS C 3  601  ? -10.862 -67.392  69.088  1.00 62.10  ? 601  LYS A CG    1 
ATOM   4924  C  CD    . LYS C 3  601  ? -9.888  -66.477  69.834  1.00 68.54  ? 601  LYS A CD    1 
ATOM   4925  C  CE    . LYS C 3  601  ? -10.077 -66.570  71.352  1.00 73.14  ? 601  LYS A CE    1 
ATOM   4926  N  NZ    . LYS C 3  601  ? -9.155  -65.667  72.109  1.00 75.04  ? 601  LYS A NZ    1 
ATOM   4927  N  N     . ASP C 3  602  ? -11.132 -69.506  64.742  1.00 46.10  ? 602  ASP A N     1 
ATOM   4928  C  CA    . ASP C 3  602  ? -10.676 -69.680  63.369  1.00 41.93  ? 602  ASP A CA    1 
ATOM   4929  C  C     . ASP C 3  602  ? -9.323  -68.996  63.372  1.00 41.27  ? 602  ASP A C     1 
ATOM   4930  O  O     . ASP C 3  602  ? -9.048  -68.123  62.566  1.00 43.35  ? 602  ASP A O     1 
ATOM   4931  C  CB    . ASP C 3  602  ? -11.629 -68.998  62.386  1.00 37.57  ? 602  ASP A CB    1 
ATOM   4932  C  CG    . ASP C 3  602  ? -11.564 -69.611  60.989  1.00 37.38  ? 602  ASP A CG    1 
ATOM   4933  O  OD1   . ASP C 3  602  ? -10.886 -70.657  60.839  1.00 30.67  ? 602  ASP A OD1   1 
ATOM   4934  O  OD2   . ASP C 3  602  ? -12.195 -69.058  60.050  1.00 35.38  ? 602  ASP A OD2   1 
ATOM   4935  N  N     . ASN C 3  603  ? -8.488  -69.408  64.320  1.00 41.38  ? 603  ASN A N     1 
ATOM   4936  C  CA    . ASN C 3  603  ? -7.161  -68.837  64.527  1.00 39.08  ? 603  ASN A CA    1 
ATOM   4937  C  C     . ASN C 3  603  ? -6.028  -69.595  63.877  1.00 40.87  ? 603  ASN A C     1 
ATOM   4938  O  O     . ASN C 3  603  ? -6.241  -70.582  63.173  1.00 43.69  ? 603  ASN A O     1 
ATOM   4939  C  CB    . ASN C 3  603  ? -6.874  -68.771  66.018  1.00 32.90  ? 603  ASN A CB    1 
ATOM   4940  C  CG    . ASN C 3  603  ? -6.622  -67.388  66.479  1.00 28.46  ? 603  ASN A CG    1 
ATOM   4941  O  OD1   . ASN C 3  603  ? -6.513  -66.478  65.674  1.00 28.49  ? 603  ASN A OD1   1 
ATOM   4942  N  ND2   . ASN C 3  603  ? -6.520  -67.207  67.781  1.00 29.92  ? 603  ASN A ND2   1 
ATOM   4943  N  N     . GLY C 3  604  ? -4.813  -69.131  64.143  1.00 40.31  ? 604  GLY A N     1 
ATOM   4944  C  CA    . GLY C 3  604  ? -3.637  -69.792  63.617  1.00 40.75  ? 604  GLY A CA    1 
ATOM   4945  C  C     . GLY C 3  604  ? -3.817  -70.228  62.187  1.00 41.65  ? 604  GLY A C     1 
ATOM   4946  O  O     . GLY C 3  604  ? -4.567  -69.594  61.444  1.00 44.11  ? 604  GLY A O     1 
ATOM   4947  N  N     . MET C 3  605  ? -3.144  -71.304  61.795  1.00 39.86  ? 605  MET A N     1 
ATOM   4948  C  CA    . MET C 3  605  ? -3.249  -71.784  60.424  1.00 41.29  ? 605  MET A CA    1 
ATOM   4949  C  C     . MET C 3  605  ? -2.800  -73.231  60.344  1.00 43.40  ? 605  MET A C     1 
ATOM   4950  O  O     . MET C 3  605  ? -1.899  -73.652  61.069  1.00 45.60  ? 605  MET A O     1 
ATOM   4951  C  CB    . MET C 3  605  ? -2.370  -70.936  59.495  1.00 37.70  ? 605  MET A CB    1 
ATOM   4952  C  CG    . MET C 3  605  ? -2.587  -71.174  58.005  1.00 39.98  ? 605  MET A CG    1 
ATOM   4953  S  SD    . MET C 3  605  ? -4.155  -70.467  57.420  1.00 40.85  ? 605  MET A SD    1 
ATOM   4954  C  CE    . MET C 3  605  ? -5.169  -71.869  57.500  1.00 44.21  ? 605  MET A CE    1 
ATOM   4955  N  N     . LEU C 3  606  ? -3.434  -73.995  59.465  1.00 43.59  ? 606  LEU A N     1 
ATOM   4956  C  CA    . LEU C 3  606  ? -3.059  -75.379  59.284  1.00 44.18  ? 606  LEU A CA    1 
ATOM   4957  C  C     . LEU C 3  606  ? -3.283  -75.776  57.845  1.00 43.83  ? 606  LEU A C     1 
ATOM   4958  O  O     . LEU C 3  606  ? -4.418  -75.964  57.416  1.00 43.03  ? 606  LEU A O     1 
ATOM   4959  C  CB    . LEU C 3  606  ? -3.877  -76.284  60.188  1.00 48.71  ? 606  LEU A CB    1 
ATOM   4960  C  CG    . LEU C 3  606  ? -3.582  -77.775  59.985  1.00 53.84  ? 606  LEU A CG    1 
ATOM   4961  C  CD1   . LEU C 3  606  ? -2.121  -78.077  60.319  1.00 51.78  ? 606  LEU A CD1   1 
ATOM   4962  C  CD2   . LEU C 3  606  ? -4.519  -78.599  60.852  1.00 55.59  ? 606  LEU A CD2   1 
ATOM   4963  N  N     . ILE C 3  607  ? -2.194  -75.899  57.098  1.00 43.41  ? 607  ILE A N     1 
ATOM   4964  C  CA    . ILE C 3  607  ? -2.293  -76.270  55.700  1.00 44.00  ? 607  ILE A CA    1 
ATOM   4965  C  C     . ILE C 3  607  ? -1.573  -77.581  55.481  1.00 47.22  ? 607  ILE A C     1 
ATOM   4966  O  O     . ILE C 3  607  ? -0.392  -77.703  55.792  1.00 48.15  ? 607  ILE A O     1 
ATOM   4967  C  CB    . ILE C 3  607  ? -1.656  -75.204  54.777  1.00 41.00  ? 607  ILE A CB    1 
ATOM   4968  C  CG1   . ILE C 3  607  ? -2.361  -73.858  54.972  1.00 42.15  ? 607  ILE A CG1   1 
ATOM   4969  C  CG2   . ILE C 3  607  ? -1.736  -75.658  53.326  1.00 38.15  ? 607  ILE A CG2   1 
ATOM   4970  C  CD1   . ILE C 3  607  ? -1.847  -72.729  54.098  1.00 38.68  ? 607  ILE A CD1   1 
ATOM   4971  N  N     . ILE C 3  608  ? -2.287  -78.566  54.953  1.00 49.48  ? 608  ILE A N     1 
ATOM   4972  C  CA    . ILE C 3  608  ? -1.686  -79.860  54.682  1.00 49.92  ? 608  ILE A CA    1 
ATOM   4973  C  C     . ILE C 3  608  ? -1.984  -80.285  53.250  1.00 51.17  ? 608  ILE A C     1 
ATOM   4974  O  O     . ILE C 3  608  ? -3.076  -80.045  52.738  1.00 51.27  ? 608  ILE A O     1 
ATOM   4975  C  CB    . ILE C 3  608  ? -2.210  -80.929  55.651  1.00 49.60  ? 608  ILE A CB    1 
ATOM   4976  C  CG1   . ILE C 3  608  ? -2.067  -80.430  57.097  1.00 48.90  ? 608  ILE A CG1   1 
ATOM   4977  C  CG2   . ILE C 3  608  ? -1.423  -82.224  55.455  1.00 51.66  ? 608  ILE A CG2   1 
ATOM   4978  C  CD1   . ILE C 3  608  ? -2.568  -81.402  58.160  1.00 42.79  ? 608  ILE A CD1   1 
ATOM   4979  N  N     . ASP C 3  609  ? -0.996  -80.901  52.607  1.00 52.86  ? 609  ASP A N     1 
ATOM   4980  C  CA    . ASP C 3  609  ? -1.134  -81.370  51.235  1.00 53.69  ? 609  ASP A CA    1 
ATOM   4981  C  C     . ASP C 3  609  ? -1.760  -80.277  50.397  1.00 53.47  ? 609  ASP A C     1 
ATOM   4982  O  O     . ASP C 3  609  ? -2.629  -80.538  49.571  1.00 54.62  ? 609  ASP A O     1 
ATOM   4983  C  CB    . ASP C 3  609  ? -2.003  -82.636  51.195  1.00 58.19  ? 609  ASP A CB    1 
ATOM   4984  C  CG    . ASP C 3  609  ? -2.028  -83.300  49.820  1.00 63.15  ? 609  ASP A CG    1 
ATOM   4985  O  OD1   . ASP C 3  609  ? -1.143  -83.002  48.990  1.00 66.93  ? 609  ASP A OD1   1 
ATOM   4986  O  OD2   . ASP C 3  609  ? -2.925  -84.136  49.573  1.00 66.24  ? 609  ASP A OD2   1 
ATOM   4987  N  N     . GLY C 3  610  ? -1.328  -79.044  50.625  1.00 53.35  ? 610  GLY A N     1 
ATOM   4988  C  CA    . GLY C 3  610  ? -1.862  -77.932  49.859  1.00 53.26  ? 610  GLY A CA    1 
ATOM   4989  C  C     . GLY C 3  610  ? -3.363  -77.741  49.986  1.00 51.67  ? 610  GLY A C     1 
ATOM   4990  O  O     . GLY C 3  610  ? -4.045  -77.325  49.029  1.00 51.98  ? 610  GLY A O     1 
ATOM   4991  N  N     . GLN C 3  611  ? -3.874  -78.060  51.169  1.00 47.91  ? 611  GLN A N     1 
ATOM   4992  C  CA    . GLN C 3  611  ? -5.287  -77.915  51.472  1.00 46.96  ? 611  GLN A CA    1 
ATOM   4993  C  C     . GLN C 3  611  ? -5.374  -77.203  52.802  1.00 45.54  ? 611  GLN A C     1 
ATOM   4994  O  O     . GLN C 3  611  ? -4.827  -77.655  53.803  1.00 48.57  ? 611  GLN A O     1 
ATOM   4995  C  CB    . GLN C 3  611  ? -5.969  -79.276  51.562  1.00 49.13  ? 611  GLN A CB    1 
ATOM   4996  C  CG    . GLN C 3  611  ? -6.678  -79.708  50.289  1.00 53.12  ? 611  GLN A CG    1 
ATOM   4997  C  CD    . GLN C 3  611  ? -7.848  -78.800  49.935  1.00 56.48  ? 611  GLN A CD    1 
ATOM   4998  O  OE1   . GLN C 3  611  ? -8.637  -78.418  50.809  1.00 54.74  ? 611  GLN A OE1   1 
ATOM   4999  N  NE2   . GLN C 3  611  ? -7.976  -78.462  48.646  1.00 56.03  ? 611  GLN A NE2   1 
ATOM   5000  N  N     . ILE C 3  612  ? -6.065  -76.081  52.806  1.00 43.11  ? 612  ILE A N     1 
ATOM   5001  C  CA    . ILE C 3  612  ? -6.208  -75.277  54.001  1.00 41.08  ? 612  ILE A CA    1 
ATOM   5002  C  C     . ILE C 3  612  ? -7.252  -75.915  54.940  1.00 40.24  ? 612  ILE A C     1 
ATOM   5003  O  O     . ILE C 3  612  ? -8.443  -75.976  54.643  1.00 39.01  ? 612  ILE A O     1 
ATOM   5004  C  CB    . ILE C 3  612  ? -6.554  -73.849  53.552  1.00 41.35  ? 612  ILE A CB    1 
ATOM   5005  C  CG1   . ILE C 3  612  ? -6.298  -72.854  54.649  1.00 41.47  ? 612  ILE A CG1   1 
ATOM   5006  C  CG2   . ILE C 3  612  ? -7.984  -73.766  53.120  1.00 47.88  ? 612  ILE A CG2   1 
ATOM   5007  C  CD1   . ILE C 3  612  ? -6.378  -71.462  54.108  1.00 43.36  ? 612  ILE A CD1   1 
ATOM   5008  N  N     . ILE C 3  613  ? -6.775  -76.414  56.076  1.00 40.97  ? 613  ILE A N     1 
ATOM   5009  C  CA    . ILE C 3  613  ? -7.615  -77.104  57.059  1.00 39.44  ? 613  ILE A CA    1 
ATOM   5010  C  C     . ILE C 3  613  ? -8.325  -76.211  58.069  1.00 39.41  ? 613  ILE A C     1 
ATOM   5011  O  O     . ILE C 3  613  ? -9.510  -76.410  58.360  1.00 38.51  ? 613  ILE A O     1 
ATOM   5012  C  CB    . ILE C 3  613  ? -6.775  -78.151  57.808  1.00 37.79  ? 613  ILE A CB    1 
ATOM   5013  C  CG1   . ILE C 3  613  ? -6.212  -79.144  56.793  1.00 36.97  ? 613  ILE A CG1   1 
ATOM   5014  C  CG2   . ILE C 3  613  ? -7.609  -78.859  58.852  1.00 35.63  ? 613  ILE A CG2   1 
ATOM   5015  C  CD1   . ILE C 3  613  ? -5.340  -80.185  57.390  1.00 40.60  ? 613  ILE A CD1   1 
ATOM   5016  N  N     . PHE C 3  614  ? -7.602  -75.242  58.620  1.00 39.37  ? 614  PHE A N     1 
ATOM   5017  C  CA    . PHE C 3  614  ? -8.213  -74.326  59.570  1.00 39.02  ? 614  PHE A CA    1 
ATOM   5018  C  C     . PHE C 3  614  ? -7.438  -73.024  59.739  1.00 38.54  ? 614  PHE A C     1 
ATOM   5019  O  O     . PHE C 3  614  ? -6.210  -72.997  59.647  1.00 38.69  ? 614  PHE A O     1 
ATOM   5020  C  CB    . PHE C 3  614  ? -8.403  -75.012  60.933  1.00 39.61  ? 614  PHE A CB    1 
ATOM   5021  C  CG    . PHE C 3  614  ? -7.190  -74.954  61.843  1.00 40.07  ? 614  PHE A CG    1 
ATOM   5022  C  CD1   . PHE C 3  614  ? -6.837  -73.773  62.493  1.00 37.64  ? 614  PHE A CD1   1 
ATOM   5023  C  CD2   . PHE C 3  614  ? -6.432  -76.095  62.085  1.00 40.01  ? 614  PHE A CD2   1 
ATOM   5024  C  CE1   . PHE C 3  614  ? -5.768  -73.733  63.360  1.00 36.90  ? 614  PHE A CE1   1 
ATOM   5025  C  CE2   . PHE C 3  614  ? -5.351  -76.062  62.958  1.00 35.98  ? 614  PHE A CE2   1 
ATOM   5026  C  CZ    . PHE C 3  614  ? -5.023  -74.883  63.593  1.00 38.40  ? 614  PHE A CZ    1 
ATOM   5027  N  N     . GLY C 3  615  ? -8.184  -71.953  59.995  1.00 37.28  ? 615  GLY A N     1 
ATOM   5028  C  CA    . GLY C 3  615  ? -7.593  -70.652  60.204  1.00 33.14  ? 615  GLY A CA    1 
ATOM   5029  C  C     . GLY C 3  615  ? -7.957  -69.689  59.106  1.00 33.55  ? 615  GLY A C     1 
ATOM   5030  O  O     . GLY C 3  615  ? -7.954  -70.060  57.932  1.00 33.18  ? 615  GLY A O     1 
ATOM   5031  N  N     . VAL C 3  616  ? -8.296  -68.459  59.487  1.00 32.22  ? 616  VAL A N     1 
ATOM   5032  C  CA    . VAL C 3  616  ? -8.620  -67.421  58.523  1.00 30.58  ? 616  VAL A CA    1 
ATOM   5033  C  C     . VAL C 3  616  ? -7.302  -67.056  57.852  1.00 34.87  ? 616  VAL A C     1 
ATOM   5034  O  O     . VAL C 3  616  ? -6.245  -67.081  58.497  1.00 38.63  ? 616  VAL A O     1 
ATOM   5035  C  CB    . VAL C 3  616  ? -9.155  -66.157  59.190  1.00 23.61  ? 616  VAL A CB    1 
ATOM   5036  C  CG1   . VAL C 3  616  ? -9.331  -65.072  58.152  1.00 28.36  ? 616  VAL A CG1   1 
ATOM   5037  C  CG2   . VAL C 3  616  ? -10.469 -66.429  59.851  1.00 26.02  ? 616  VAL A CG2   1 
ATOM   5038  N  N     . VAL C 3  617  ? -7.353  -66.722  56.565  1.00 35.33  ? 617  VAL A N     1 
ATOM   5039  C  CA    . VAL C 3  617  ? -6.150  -66.342  55.834  1.00 34.06  ? 617  VAL A CA    1 
ATOM   5040  C  C     . VAL C 3  617  ? -5.974  -64.834  55.777  1.00 34.29  ? 617  VAL A C     1 
ATOM   5041  O  O     . VAL C 3  617  ? -6.788  -64.141  55.186  1.00 34.49  ? 617  VAL A O     1 
ATOM   5042  C  CB    . VAL C 3  617  ? -6.182  -66.859  54.391  1.00 33.17  ? 617  VAL A CB    1 
ATOM   5043  C  CG1   . VAL C 3  617  ? -5.134  -66.154  53.554  1.00 30.77  ? 617  VAL A CG1   1 
ATOM   5044  C  CG2   . VAL C 3  617  ? -5.929  -68.335  54.384  1.00 34.74  ? 617  VAL A CG2   1 
ATOM   5045  N  N     . GLU C 3  618  ? -4.912  -64.334  56.399  1.00 34.28  ? 618  GLU A N     1 
ATOM   5046  C  CA    . GLU C 3  618  ? -4.618  -62.911  56.376  1.00 35.35  ? 618  GLU A CA    1 
ATOM   5047  C  C     . GLU C 3  618  ? -3.106  -62.701  56.352  1.00 36.09  ? 618  GLU A C     1 
ATOM   5048  O  O     . GLU C 3  618  ? -2.362  -63.627  56.043  1.00 36.26  ? 618  GLU A O     1 
ATOM   5049  C  CB    . GLU C 3  618  ? -5.258  -62.213  57.573  1.00 37.64  ? 618  GLU A CB    1 
ATOM   5050  C  CG    . GLU C 3  618  ? -5.068  -62.950  58.866  1.00 41.58  ? 618  GLU A CG    1 
ATOM   5051  C  CD    . GLU C 3  618  ? -3.618  -63.020  59.262  1.00 42.41  ? 618  GLU A CD    1 
ATOM   5052  O  OE1   . GLU C 3  618  ? -3.179  -62.127  60.028  1.00 40.79  ? 618  GLU A OE1   1 
ATOM   5053  O  OE2   . GLU C 3  618  ? -2.929  -63.958  58.790  1.00 37.57  ? 618  GLU A OE2   1 
ATOM   5054  N  N     . LYS C 3  619  ? -2.657  -61.495  56.688  1.00 37.21  ? 619  LYS A N     1 
ATOM   5055  C  CA    . LYS C 3  619  ? -1.231  -61.138  56.667  1.00 37.31  ? 619  LYS A CA    1 
ATOM   5056  C  C     . LYS C 3  619  ? -0.204  -62.150  57.187  1.00 37.70  ? 619  LYS A C     1 
ATOM   5057  O  O     . LYS C 3  619  ? 0.801   -62.417  56.531  1.00 36.77  ? 619  LYS A O     1 
ATOM   5058  C  CB    . LYS C 3  619  ? -1.026  -59.819  57.400  1.00 36.13  ? 619  LYS A CB    1 
ATOM   5059  C  CG    . LYS C 3  619  ? -0.147  -58.848  56.651  1.00 36.71  ? 619  LYS A CG    1 
ATOM   5060  C  CD    . LYS C 3  619  ? 0.041   -57.582  57.458  1.00 42.36  ? 619  LYS A CD    1 
ATOM   5061  C  CE    . LYS C 3  619  ? 0.878   -56.550  56.722  1.00 46.83  ? 619  LYS A CE    1 
ATOM   5062  N  NZ    . LYS C 3  619  ? 1.014   -55.292  57.527  1.00 52.12  ? 619  LYS A NZ    1 
ATOM   5063  N  N     . LYS C 3  620  ? -0.440  -62.701  58.368  1.00 37.70  ? 620  LYS A N     1 
ATOM   5064  C  CA    . LYS C 3  620  ? 0.493   -63.664  58.938  1.00 39.40  ? 620  LYS A CA    1 
ATOM   5065  C  C     . LYS C 3  620  ? 0.711   -64.872  58.019  1.00 41.12  ? 620  LYS A C     1 
ATOM   5066  O  O     . LYS C 3  620  ? 1.822   -65.398  57.908  1.00 43.65  ? 620  LYS A O     1 
ATOM   5067  C  CB    . LYS C 3  620  ? -0.018  -64.132  60.307  1.00 39.76  ? 620  LYS A CB    1 
ATOM   5068  C  CG    . LYS C 3  620  ? -0.186  -63.007  61.317  1.00 44.00  ? 620  LYS A CG    1 
ATOM   5069  C  CD    . LYS C 3  620  ? -1.013  -63.407  62.524  1.00 45.06  ? 620  LYS A CD    1 
ATOM   5070  C  CE    . LYS C 3  620  ? -1.377  -62.173  63.336  1.00 51.20  ? 620  LYS A CE    1 
ATOM   5071  N  NZ    . LYS C 3  620  ? -2.303  -62.465  64.471  1.00 60.04  ? 620  LYS A NZ    1 
ATOM   5072  N  N     . THR C 3  621  ? -0.349  -65.310  57.351  1.00 41.42  ? 621  THR A N     1 
ATOM   5073  C  CA    . THR C 3  621  ? -0.265  -66.476  56.479  1.00 38.06  ? 621  THR A CA    1 
ATOM   5074  C  C     . THR C 3  621  ? 0.297   -66.145  55.115  1.00 39.60  ? 621  THR A C     1 
ATOM   5075  O  O     . THR C 3  621  ? 1.229   -66.791  54.627  1.00 39.75  ? 621  THR A O     1 
ATOM   5076  C  CB    . THR C 3  621  ? -1.654  -67.094  56.217  1.00 33.14  ? 621  THR A CB    1 
ATOM   5077  O  OG1   . THR C 3  621  ? -2.378  -67.214  57.445  1.00 29.92  ? 621  THR A OG1   1 
ATOM   5078  C  CG2   . THR C 3  621  ? -1.503  -68.452  55.568  1.00 28.97  ? 621  THR A CG2   1 
ATOM   5079  N  N     . VAL C 3  622  ? -0.298  -65.125  54.510  1.00 39.49  ? 622  VAL A N     1 
ATOM   5080  C  CA    . VAL C 3  622  ? 0.038   -64.724  53.164  1.00 38.25  ? 622  VAL A CA    1 
ATOM   5081  C  C     . VAL C 3  622  ? 0.827   -63.431  53.066  1.00 38.09  ? 622  VAL A C     1 
ATOM   5082  O  O     . VAL C 3  622  ? 1.213   -63.011  51.979  1.00 37.34  ? 622  VAL A O     1 
ATOM   5083  C  CB    . VAL C 3  622  ? -1.266  -64.636  52.331  1.00 37.25  ? 622  VAL A CB    1 
ATOM   5084  C  CG1   . VAL C 3  622  ? -1.992  -63.343  52.626  1.00 35.07  ? 622  VAL A CG1   1 
ATOM   5085  C  CG2   . VAL C 3  622  ? -0.959  -64.789  50.871  1.00 37.65  ? 622  VAL A CG2   1 
ATOM   5086  N  N     . GLY C 3  623  ? 1.068   -62.792  54.199  1.00 38.71  ? 623  GLY A N     1 
ATOM   5087  C  CA    . GLY C 3  623  ? 1.842   -61.569  54.163  1.00 40.78  ? 623  GLY A CA    1 
ATOM   5088  C  C     . GLY C 3  623  ? 3.230   -61.950  53.694  1.00 42.28  ? 623  GLY A C     1 
ATOM   5089  O  O     . GLY C 3  623  ? 3.435   -63.069  53.217  1.00 45.40  ? 623  GLY A O     1 
ATOM   5090  N  N     . SER C 3  624  ? 4.184   -61.037  53.816  1.00 41.20  ? 624  SER A N     1 
ATOM   5091  C  CA    . SER C 3  624  ? 5.553   -61.319  53.407  1.00 39.83  ? 624  SER A CA    1 
ATOM   5092  C  C     . SER C 3  624  ? 6.290   -61.598  54.688  1.00 39.95  ? 624  SER A C     1 
ATOM   5093  O  O     . SER C 3  624  ? 7.350   -61.041  54.935  1.00 39.62  ? 624  SER A O     1 
ATOM   5094  C  CB    . SER C 3  624  ? 6.171   -60.101  52.739  1.00 41.16  ? 624  SER A CB    1 
ATOM   5095  O  OG    . SER C 3  624  ? 6.289   -59.043  53.676  1.00 41.07  ? 624  SER A OG    1 
ATOM   5096  N  N     . SER C 3  625  ? 5.711   -62.456  55.513  1.00 41.83  ? 625  SER A N     1 
ATOM   5097  C  CA    . SER C 3  625  ? 6.313   -62.774  56.796  1.00 44.75  ? 625  SER A CA    1 
ATOM   5098  C  C     . SER C 3  625  ? 7.306   -63.914  56.681  1.00 44.99  ? 625  SER A C     1 
ATOM   5099  O  O     . SER C 3  625  ? 7.451   -64.509  55.618  1.00 44.59  ? 625  SER A O     1 
ATOM   5100  C  CB    . SER C 3  625  ? 5.219   -63.136  57.800  1.00 44.78  ? 625  SER A CB    1 
ATOM   5101  O  OG    . SER C 3  625  ? 4.480   -64.245  57.331  1.00 43.66  ? 625  SER A OG    1 
ATOM   5102  N  N     . ASN C 3  626  ? 7.977   -64.209  57.790  1.00 45.46  ? 626  ASN A N     1 
ATOM   5103  C  CA    . ASN C 3  626  ? 8.964   -65.275  57.856  1.00 46.45  ? 626  ASN A CA    1 
ATOM   5104  C  C     . ASN C 3  626  ? 8.343   -66.661  57.611  1.00 44.49  ? 626  ASN A C     1 
ATOM   5105  O  O     . ASN C 3  626  ? 8.713   -67.356  56.659  1.00 42.08  ? 626  ASN A O     1 
ATOM   5106  C  CB    . ASN C 3  626  ? 9.647   -65.239  59.232  1.00 53.60  ? 626  ASN A CB    1 
ATOM   5107  C  CG    . ASN C 3  626  ? 11.139  -65.581  59.171  1.00 60.06  ? 626  ASN A CG    1 
ATOM   5108  O  OD1   . ASN C 3  626  ? 11.531  -66.751  59.017  1.00 61.21  ? 626  ASN A OD1   1 
ATOM   5109  N  ND2   . ASN C 3  626  ? 11.980  -64.549  59.290  1.00 61.48  ? 626  ASN A ND2   1 
ATOM   5110  N  N     . GLY C 3  627  ? 7.402   -67.058  58.465  1.00 41.96  ? 627  GLY A N     1 
ATOM   5111  C  CA    . GLY C 3  627  ? 6.771   -68.362  58.317  1.00 41.41  ? 627  GLY A CA    1 
ATOM   5112  C  C     . GLY C 3  627  ? 5.972   -68.510  57.039  1.00 41.04  ? 627  GLY A C     1 
ATOM   5113  O  O     . GLY C 3  627  ? 5.898   -69.592  56.467  1.00 40.69  ? 627  GLY A O     1 
ATOM   5114  N  N     . GLY C 3  628  ? 5.380   -67.394  56.617  1.00 41.74  ? 628  GLY A N     1 
ATOM   5115  C  CA    . GLY C 3  628  ? 4.561   -67.282  55.410  1.00 38.94  ? 628  GLY A CA    1 
ATOM   5116  C  C     . GLY C 3  628  ? 4.398   -68.363  54.349  1.00 35.57  ? 628  GLY A C     1 
ATOM   5117  O  O     . GLY C 3  628  ? 5.339   -69.079  53.992  1.00 34.91  ? 628  GLY A O     1 
ATOM   5118  N  N     . LEU C 3  629  ? 3.174   -68.448  53.828  1.00 31.13  ? 629  LEU A N     1 
ATOM   5119  C  CA    . LEU C 3  629  ? 2.825   -69.408  52.793  1.00 26.35  ? 629  LEU A CA    1 
ATOM   5120  C  C     . LEU C 3  629  ? 3.752   -69.179  51.599  1.00 24.16  ? 629  LEU A C     1 
ATOM   5121  O  O     . LEU C 3  629  ? 3.963   -70.069  50.786  1.00 19.92  ? 629  LEU A O     1 
ATOM   5122  C  CB    . LEU C 3  629  ? 1.340   -69.220  52.397  1.00 22.53  ? 629  LEU A CB    1 
ATOM   5123  C  CG    . LEU C 3  629  ? 0.521   -70.215  51.532  1.00 19.76  ? 629  LEU A CG    1 
ATOM   5124  C  CD1   . LEU C 3  629  ? 0.342   -69.667  50.144  1.00 15.22  ? 629  LEU A CD1   1 
ATOM   5125  C  CD2   . LEU C 3  629  ? 1.176   -71.586  51.471  1.00 17.67  ? 629  LEU A CD2   1 
ATOM   5126  N  N     . ILE C 3  630  ? 4.320   -67.978  51.517  1.00 26.77  ? 630  ILE A N     1 
ATOM   5127  C  CA    . ILE C 3  630  ? 5.222   -67.617  50.424  1.00 27.61  ? 630  ILE A CA    1 
ATOM   5128  C  C     . ILE C 3  630  ? 6.647   -68.088  50.688  1.00 29.11  ? 630  ILE A C     1 
ATOM   5129  O  O     . ILE C 3  630  ? 7.292   -68.653  49.800  1.00 28.66  ? 630  ILE A O     1 
ATOM   5130  C  CB    . ILE C 3  630  ? 5.235   -66.098  50.192  1.00 24.33  ? 630  ILE A CB    1 
ATOM   5131  C  CG1   . ILE C 3  630  ? 3.851   -65.636  49.767  1.00 22.31  ? 630  ILE A CG1   1 
ATOM   5132  C  CG2   . ILE C 3  630  ? 6.209   -65.748  49.095  1.00 22.69  ? 630  ILE A CG2   1 
ATOM   5133  C  CD1   . ILE C 3  630  ? 3.731   -64.159  49.665  1.00 25.03  ? 630  ILE A CD1   1 
ATOM   5134  N  N     . HIS C 3  631  ? 7.139   -67.851  51.902  1.00 29.39  ? 631  HIS A N     1 
ATOM   5135  C  CA    . HIS C 3  631  ? 8.478   -68.288  52.258  1.00 29.92  ? 631  HIS A CA    1 
ATOM   5136  C  C     . HIS C 3  631  ? 8.534   -69.806  52.031  1.00 29.18  ? 631  HIS A C     1 
ATOM   5137  O  O     . HIS C 3  631  ? 9.479   -70.336  51.435  1.00 30.61  ? 631  HIS A O     1 
ATOM   5138  C  CB    . HIS C 3  631  ? 8.754   -67.987  53.728  1.00 33.93  ? 631  HIS A CB    1 
ATOM   5139  C  CG    . HIS C 3  631  ? 10.211  -67.898  54.061  1.00 42.26  ? 631  HIS A CG    1 
ATOM   5140  N  ND1   . HIS C 3  631  ? 11.165  -68.678  53.443  1.00 46.71  ? 631  HIS A ND1   1 
ATOM   5141  C  CD2   . HIS C 3  631  ? 10.878  -67.120  54.947  1.00 44.71  ? 631  HIS A CD2   1 
ATOM   5142  C  CE1   . HIS C 3  631  ? 12.358  -68.383  53.930  1.00 48.09  ? 631  HIS A CE1   1 
ATOM   5143  N  NE2   . HIS C 3  631  ? 12.211  -67.440  54.845  1.00 49.53  ? 631  HIS A NE2   1 
ATOM   5144  N  N     . VAL C 3  632  ? 7.503   -70.498  52.503  1.00 25.83  ? 632  VAL A N     1 
ATOM   5145  C  CA    . VAL C 3  632  ? 7.423   -71.950  52.374  1.00 23.76  ? 632  VAL A CA    1 
ATOM   5146  C  C     . VAL C 3  632  ? 7.275   -72.429  50.939  1.00 22.79  ? 632  VAL A C     1 
ATOM   5147  O  O     . VAL C 3  632  ? 7.948   -73.361  50.517  1.00 22.66  ? 632  VAL A O     1 
ATOM   5148  C  CB    . VAL C 3  632  ? 6.234   -72.526  53.194  1.00 23.68  ? 632  VAL A CB    1 
ATOM   5149  C  CG1   . VAL C 3  632  ? 5.942   -73.949  52.752  1.00 24.14  ? 632  VAL A CG1   1 
ATOM   5150  C  CG2   . VAL C 3  632  ? 6.562   -72.520  54.683  1.00 22.31  ? 632  VAL A CG2   1 
ATOM   5151  N  N     . VAL C 3  633  ? 6.372   -71.802  50.200  1.00 23.00  ? 633  VAL A N     1 
ATOM   5152  C  CA    . VAL C 3  633  ? 6.128   -72.185  48.820  1.00 20.86  ? 633  VAL A CA    1 
ATOM   5153  C  C     . VAL C 3  633  ? 7.306   -71.862  47.911  1.00 20.19  ? 633  VAL A C     1 
ATOM   5154  O  O     . VAL C 3  633  ? 7.460   -72.493  46.865  1.00 21.11  ? 633  VAL A O     1 
ATOM   5155  C  CB    . VAL C 3  633  ? 4.827   -71.521  48.287  1.00 21.96  ? 633  VAL A CB    1 
ATOM   5156  C  CG1   . VAL C 3  633  ? 4.739   -71.626  46.783  1.00 20.32  ? 633  VAL A CG1   1 
ATOM   5157  C  CG2   . VAL C 3  633  ? 3.629   -72.201  48.903  1.00 19.48  ? 633  VAL A CG2   1 
ATOM   5158  N  N     . THR C 3  634  ? 8.148   -70.902  48.290  1.00 17.86  ? 634  THR A N     1 
ATOM   5159  C  CA    . THR C 3  634  ? 9.293   -70.598  47.435  1.00 18.32  ? 634  THR A CA    1 
ATOM   5160  C  C     . THR C 3  634  ? 10.325  -71.665  47.635  1.00 20.18  ? 634  THR A C     1 
ATOM   5161  O  O     . THR C 3  634  ? 10.853  -72.221  46.674  1.00 19.89  ? 634  THR A O     1 
ATOM   5162  C  CB    . THR C 3  634  ? 9.980   -69.287  47.776  1.00 14.57  ? 634  THR A CB    1 
ATOM   5163  O  OG1   . THR C 3  634  ? 9.018   -68.233  47.787  1.00 18.46  ? 634  THR A OG1   1 
ATOM   5164  C  CG2   . THR C 3  634  ? 11.037  -68.978  46.733  1.00 9.76   ? 634  THR A CG2   1 
ATOM   5165  N  N     . ARG C 3  635  ? 10.605  -71.930  48.906  1.00 23.21  ? 635  ARG A N     1 
ATOM   5166  C  CA    . ARG C 3  635  ? 11.592  -72.922  49.312  1.00 28.30  ? 635  ARG A CA    1 
ATOM   5167  C  C     . ARG C 3  635  ? 11.267  -74.343  48.885  1.00 30.20  ? 635  ARG A C     1 
ATOM   5168  O  O     . ARG C 3  635  ? 12.165  -75.118  48.548  1.00 31.95  ? 635  ARG A O     1 
ATOM   5169  C  CB    . ARG C 3  635  ? 11.765  -72.892  50.838  1.00 27.62  ? 635  ARG A CB    1 
ATOM   5170  C  CG    . ARG C 3  635  ? 12.697  -71.808  51.336  1.00 34.12  ? 635  ARG A CG    1 
ATOM   5171  C  CD    . ARG C 3  635  ? 14.165  -72.121  51.008  1.00 37.05  ? 635  ARG A CD    1 
ATOM   5172  N  NE    . ARG C 3  635  ? 14.911  -70.913  50.658  1.00 41.61  ? 635  ARG A NE    1 
ATOM   5173  C  CZ    . ARG C 3  635  ? 15.158  -70.511  49.410  1.00 47.46  ? 635  ARG A CZ    1 
ATOM   5174  N  NH1   . ARG C 3  635  ? 14.732  -71.221  48.362  1.00 46.74  ? 635  ARG A NH1   1 
ATOM   5175  N  NH2   . ARG C 3  635  ? 15.814  -69.375  49.205  1.00 51.43  ? 635  ARG A NH2   1 
ATOM   5176  N  N     . GLU C 3  636  ? 9.980   -74.672  48.885  1.00 31.84  ? 636  GLU A N     1 
ATOM   5177  C  CA    . GLU C 3  636  ? 9.534   -76.014  48.575  1.00 34.15  ? 636  GLU A CA    1 
ATOM   5178  C  C     . GLU C 3  636  ? 9.267   -76.352  47.125  1.00 36.70  ? 636  GLU A C     1 
ATOM   5179  O  O     . GLU C 3  636  ? 9.773   -77.348  46.612  1.00 37.13  ? 636  GLU A O     1 
ATOM   5180  C  CB    . GLU C 3  636  ? 8.283   -76.323  49.383  1.00 34.02  ? 636  GLU A CB    1 
ATOM   5181  C  CG    . GLU C 3  636  ? 8.212   -77.758  49.833  1.00 38.32  ? 636  GLU A CG    1 
ATOM   5182  C  CD    . GLU C 3  636  ? 9.110   -78.028  51.020  1.00 42.26  ? 636  GLU A CD    1 
ATOM   5183  O  OE1   . GLU C 3  636  ? 9.466   -79.208  51.229  1.00 47.57  ? 636  GLU A OE1   1 
ATOM   5184  O  OE2   . GLU C 3  636  ? 9.450   -77.065  51.750  1.00 38.41  ? 636  GLU A OE2   1 
ATOM   5185  N  N     . LYS C 3  637  ? 8.465   -75.533  46.462  1.00 40.08  ? 637  LYS A N     1 
ATOM   5186  C  CA    . LYS C 3  637  ? 8.114   -75.804  45.078  1.00 43.54  ? 637  LYS A CA    1 
ATOM   5187  C  C     . LYS C 3  637  ? 8.975   -75.141  44.010  1.00 44.50  ? 637  LYS A C     1 
ATOM   5188  O  O     . LYS C 3  637  ? 8.954   -75.568  42.854  1.00 45.11  ? 637  LYS A O     1 
ATOM   5189  C  CB    . LYS C 3  637  ? 6.635   -75.474  44.864  1.00 46.77  ? 637  LYS A CB    1 
ATOM   5190  C  CG    . LYS C 3  637  ? 5.716   -76.421  45.636  1.00 51.38  ? 637  LYS A CG    1 
ATOM   5191  C  CD    . LYS C 3  637  ? 5.914   -77.860  45.158  1.00 56.15  ? 637  LYS A CD    1 
ATOM   5192  C  CE    . LYS C 3  637  ? 5.277   -78.882  46.091  1.00 59.40  ? 637  LYS A CE    1 
ATOM   5193  N  NZ    . LYS C 3  637  ? 5.442   -80.302  45.620  1.00 58.80  ? 637  LYS A NZ    1 
ATOM   5194  N  N     . GLY C 3  638  ? 9.735   -74.116  44.390  1.00 44.67  ? 638  GLY A N     1 
ATOM   5195  C  CA    . GLY C 3  638  ? 10.596  -73.439  43.434  1.00 44.86  ? 638  GLY A CA    1 
ATOM   5196  C  C     . GLY C 3  638  ? 10.247  -71.976  43.255  1.00 46.38  ? 638  GLY A C     1 
ATOM   5197  O  O     . GLY C 3  638  ? 9.091   -71.598  43.428  1.00 47.99  ? 638  GLY A O     1 
ATOM   5198  N  N     . PRO C 3  639  ? 11.215  -71.123  42.889  1.00 46.45  ? 639  PRO A N     1 
ATOM   5199  C  CA    . PRO C 3  639  ? 10.895  -69.705  42.712  1.00 45.93  ? 639  PRO A CA    1 
ATOM   5200  C  C     . PRO C 3  639  ? 9.713   -69.497  41.771  1.00 45.19  ? 639  PRO A C     1 
ATOM   5201  O  O     . PRO C 3  639  ? 8.737   -68.844  42.122  1.00 45.81  ? 639  PRO A O     1 
ATOM   5202  C  CB    . PRO C 3  639  ? 12.193  -69.127  42.149  1.00 45.13  ? 639  PRO A CB    1 
ATOM   5203  C  CG    . PRO C 3  639  ? 12.748  -70.270  41.359  1.00 46.26  ? 639  PRO A CG    1 
ATOM   5204  C  CD    . PRO C 3  639  ? 12.534  -71.432  42.309  1.00 47.65  ? 639  PRO A CD    1 
ATOM   5205  N  N     . GLN C 3  640  ? 9.795   -70.070  40.579  1.00 45.61  ? 640  GLN A N     1 
ATOM   5206  C  CA    . GLN C 3  640  ? 8.726   -69.904  39.613  1.00 45.74  ? 640  GLN A CA    1 
ATOM   5207  C  C     . GLN C 3  640  ? 7.374   -70.355  40.128  1.00 41.85  ? 640  GLN A C     1 
ATOM   5208  O  O     . GLN C 3  640  ? 6.410   -69.598  40.051  1.00 42.07  ? 640  GLN A O     1 
ATOM   5209  C  CB    . GLN C 3  640  ? 9.056   -70.643  38.328  1.00 53.62  ? 640  GLN A CB    1 
ATOM   5210  C  CG    . GLN C 3  640  ? 10.303  -70.134  37.649  1.00 67.12  ? 640  GLN A CG    1 
ATOM   5211  C  CD    . GLN C 3  640  ? 10.502  -70.758  36.280  1.00 79.36  ? 640  GLN A CD    1 
ATOM   5212  O  OE1   . GLN C 3  640  ? 9.663   -70.600  35.384  1.00 84.95  ? 640  GLN A OE1   1 
ATOM   5213  N  NE2   . GLN C 3  640  ? 11.614  -71.476  36.109  1.00 83.21  ? 640  GLN A NE2   1 
ATOM   5214  N  N     . VAL C 3  641  ? 7.286   -71.574  40.653  1.00 36.36  ? 641  VAL A N     1 
ATOM   5215  C  CA    . VAL C 3  641  ? 6.000   -72.040  41.148  1.00 31.41  ? 641  VAL A CA    1 
ATOM   5216  C  C     . VAL C 3  641  ? 5.472   -70.994  42.089  1.00 29.05  ? 641  VAL A C     1 
ATOM   5217  O  O     . VAL C 3  641  ? 4.300   -70.645  42.043  1.00 30.51  ? 641  VAL A O     1 
ATOM   5218  C  CB    . VAL C 3  641  ? 6.097   -73.367  41.921  1.00 32.00  ? 641  VAL A CB    1 
ATOM   5219  C  CG1   . VAL C 3  641  ? 4.736   -73.727  42.535  1.00 26.17  ? 641  VAL A CG1   1 
ATOM   5220  C  CG2   . VAL C 3  641  ? 6.554   -74.464  40.992  1.00 34.94  ? 641  VAL A CG2   1 
ATOM   5221  N  N     . CYS C 3  642  ? 6.345   -70.473  42.935  1.00 25.08  ? 642  CYS A N     1 
ATOM   5222  C  CA    . CYS C 3  642  ? 5.903   -69.477  43.883  1.00 24.75  ? 642  CYS A CA    1 
ATOM   5223  C  C     . CYS C 3  642  ? 5.621   -68.165  43.205  1.00 24.44  ? 642  CYS A C     1 
ATOM   5224  O  O     . CYS C 3  642  ? 4.836   -67.366  43.696  1.00 25.56  ? 642  CYS A O     1 
ATOM   5225  C  CB    . CYS C 3  642  ? 6.938   -69.262  44.967  1.00 27.13  ? 642  CYS A CB    1 
ATOM   5226  S  SG    . CYS C 3  642  ? 6.461   -67.998  46.140  1.00 30.32  ? 642  CYS A SG    1 
ATOM   5227  N  N     . ALA C 3  643  ? 6.274   -67.917  42.083  1.00 24.10  ? 643  ALA A N     1 
ATOM   5228  C  CA    . ALA C 3  643  ? 6.009   -66.676  41.391  1.00 23.89  ? 643  ALA A CA    1 
ATOM   5229  C  C     . ALA C 3  643  ? 4.524   -66.762  41.017  1.00 23.50  ? 643  ALA A C     1 
ATOM   5230  O  O     . ALA C 3  643  ? 3.736   -65.859  41.329  1.00 21.49  ? 643  ALA A O     1 
ATOM   5231  C  CB    . ALA C 3  643  ? 6.892   -66.563  40.157  1.00 24.19  ? 643  ALA A CB    1 
ATOM   5232  N  N     . LYS C 3  644  ? 4.149   -67.875  40.388  1.00 22.54  ? 644  LYS A N     1 
ATOM   5233  C  CA    . LYS C 3  644  ? 2.769   -68.108  39.985  1.00 24.97  ? 644  LYS A CA    1 
ATOM   5234  C  C     . LYS C 3  644  ? 1.802   -68.011  41.163  1.00 25.24  ? 644  LYS A C     1 
ATOM   5235  O  O     . LYS C 3  644  ? 0.729   -67.423  41.048  1.00 26.68  ? 644  LYS A O     1 
ATOM   5236  C  CB    . LYS C 3  644  ? 2.625   -69.485  39.348  1.00 29.06  ? 644  LYS A CB    1 
ATOM   5237  C  CG    . LYS C 3  644  ? 2.498   -69.491  37.828  1.00 42.23  ? 644  LYS A CG    1 
ATOM   5238  C  CD    . LYS C 3  644  ? 2.426   -70.936  37.303  1.00 52.11  ? 644  LYS A CD    1 
ATOM   5239  C  CE    . LYS C 3  644  ? 2.349   -71.018  35.775  1.00 57.37  ? 644  LYS A CE    1 
ATOM   5240  N  NZ    . LYS C 3  644  ? 2.469   -72.437  35.288  1.00 59.00  ? 644  LYS A NZ    1 
ATOM   5241  N  N     . LEU C 3  645  ? 2.169   -68.593  42.296  1.00 23.83  ? 645  LEU A N     1 
ATOM   5242  C  CA    . LEU C 3  645  ? 1.292   -68.552  43.454  1.00 21.77  ? 645  LEU A CA    1 
ATOM   5243  C  C     . LEU C 3  645  ? 0.625   -67.193  43.584  1.00 21.48  ? 645  LEU A C     1 
ATOM   5244  O  O     . LEU C 3  645  ? -0.556  -67.098  43.887  1.00 23.07  ? 645  LEU A O     1 
ATOM   5245  C  CB    . LEU C 3  645  ? 2.068   -68.858  44.731  1.00 19.78  ? 645  LEU A CB    1 
ATOM   5246  C  CG    . LEU C 3  645  ? 1.221   -68.774  45.999  1.00 18.63  ? 645  LEU A CG    1 
ATOM   5247  C  CD1   . LEU C 3  645  ? -0.036  -69.604  45.820  1.00 19.25  ? 645  LEU A CD1   1 
ATOM   5248  C  CD2   . LEU C 3  645  ? 2.021   -69.276  47.186  1.00 21.68  ? 645  LEU A CD2   1 
ATOM   5249  N  N     . PHE C 3  646  ? 1.374   -66.135  43.332  1.00 21.17  ? 646  PHE A N     1 
ATOM   5250  C  CA    . PHE C 3  646  ? 0.814   -64.801  43.454  1.00 21.47  ? 646  PHE A CA    1 
ATOM   5251  C  C     . PHE C 3  646  ? -0.376  -64.530  42.556  1.00 21.51  ? 646  PHE A C     1 
ATOM   5252  O  O     . PHE C 3  646  ? -1.472  -64.244  43.032  1.00 20.03  ? 646  PHE A O     1 
ATOM   5253  C  CB    . PHE C 3  646  ? 1.899   -63.764  43.209  1.00 19.88  ? 646  PHE A CB    1 
ATOM   5254  C  CG    . PHE C 3  646  ? 2.898   -63.696  44.307  1.00 14.83  ? 646  PHE A CG    1 
ATOM   5255  C  CD1   . PHE C 3  646  ? 3.999   -64.535  44.306  1.00 14.06  ? 646  PHE A CD1   1 
ATOM   5256  C  CD2   . PHE C 3  646  ? 2.696   -62.841  45.384  1.00 11.99  ? 646  PHE A CD2   1 
ATOM   5257  C  CE1   . PHE C 3  646  ? 4.889   -64.528  45.366  1.00 17.15  ? 646  PHE A CE1   1 
ATOM   5258  C  CE2   . PHE C 3  646  ? 3.578   -62.822  46.456  1.00 14.68  ? 646  PHE A CE2   1 
ATOM   5259  C  CZ    . PHE C 3  646  ? 4.679   -63.669  46.450  1.00 17.02  ? 646  PHE A CZ    1 
ATOM   5260  N  N     . GLY C 3  647  ? -0.154  -64.602  41.254  1.00 23.58  ? 647  GLY A N     1 
ATOM   5261  C  CA    . GLY C 3  647  ? -1.239  -64.361  40.324  1.00 28.04  ? 647  GLY A CA    1 
ATOM   5262  C  C     . GLY C 3  647  ? -2.462  -65.198  40.657  1.00 29.02  ? 647  GLY A C     1 
ATOM   5263  O  O     . GLY C 3  647  ? -3.575  -64.673  40.773  1.00 30.51  ? 647  GLY A O     1 
ATOM   5264  N  N     . ASN C 3  648  ? -2.262  -66.506  40.805  1.00 27.07  ? 648  ASN A N     1 
ATOM   5265  C  CA    . ASN C 3  648  ? -3.362  -67.391  41.135  1.00 23.35  ? 648  ASN A CA    1 
ATOM   5266  C  C     . ASN C 3  648  ? -4.134  -66.828  42.316  1.00 20.30  ? 648  ASN A C     1 
ATOM   5267  O  O     . ASN C 3  648  ? -5.264  -66.372  42.154  1.00 19.06  ? 648  ASN A O     1 
ATOM   5268  C  CB    . ASN C 3  648  ? -2.845  -68.790  41.462  1.00 25.97  ? 648  ASN A CB    1 
ATOM   5269  C  CG    . ASN C 3  648  ? -2.369  -69.536  40.231  1.00 28.54  ? 648  ASN A CG    1 
ATOM   5270  O  OD1   . ASN C 3  648  ? -2.569  -69.088  39.100  1.00 28.37  ? 648  ASN A OD1   1 
ATOM   5271  N  ND2   . ASN C 3  648  ? -1.745  -70.689  40.444  1.00 31.55  ? 648  ASN A ND2   1 
ATOM   5272  N  N     . ILE C 3  649  ? -3.516  -66.837  43.495  1.00 17.66  ? 649  ILE A N     1 
ATOM   5273  C  CA    . ILE C 3  649  ? -4.178  -66.328  44.687  1.00 17.29  ? 649  ILE A CA    1 
ATOM   5274  C  C     . ILE C 3  649  ? -4.913  -65.043  44.355  1.00 20.19  ? 649  ILE A C     1 
ATOM   5275  O  O     . ILE C 3  649  ? -6.068  -64.841  44.752  1.00 21.89  ? 649  ILE A O     1 
ATOM   5276  C  CB    . ILE C 3  649  ? -3.193  -66.030  45.827  1.00 11.80  ? 649  ILE A CB    1 
ATOM   5277  C  CG1   . ILE C 3  649  ? -2.470  -67.307  46.248  1.00 7.85   ? 649  ILE A CG1   1 
ATOM   5278  C  CG2   . ILE C 3  649  ? -3.954  -65.472  47.014  1.00 13.63  ? 649  ILE A CG2   1 
ATOM   5279  C  CD1   . ILE C 3  649  ? -1.722  -67.196  47.543  1.00 1.00   ? 649  ILE A CD1   1 
ATOM   5280  N  N     . GLN C 3  650  ? -4.238  -64.176  43.612  1.00 21.57  ? 650  GLN A N     1 
ATOM   5281  C  CA    . GLN C 3  650  ? -4.821  -62.908  43.213  1.00 22.05  ? 650  GLN A CA    1 
ATOM   5282  C  C     . GLN C 3  650  ? -6.032  -63.119  42.323  1.00 22.96  ? 650  GLN A C     1 
ATOM   5283  O  O     . GLN C 3  650  ? -7.152  -62.787  42.694  1.00 23.55  ? 650  GLN A O     1 
ATOM   5284  C  CB    . GLN C 3  650  ? -3.796  -62.074  42.467  1.00 18.54  ? 650  GLN A CB    1 
ATOM   5285  C  CG    . GLN C 3  650  ? -2.654  -61.631  43.304  1.00 16.61  ? 650  GLN A CG    1 
ATOM   5286  C  CD    . GLN C 3  650  ? -1.701  -60.808  42.506  1.00 22.56  ? 650  GLN A CD    1 
ATOM   5287  O  OE1   . GLN C 3  650  ? -1.040  -61.310  41.604  1.00 24.52  ? 650  GLN A OE1   1 
ATOM   5288  N  NE2   . GLN C 3  650  ? -1.633  -59.524  42.811  1.00 28.86  ? 650  GLN A NE2   1 
ATOM   5289  N  N     . LYS C 3  651  ? -5.809  -63.675  41.143  1.00 23.46  ? 651  LYS A N     1 
ATOM   5290  C  CA    . LYS C 3  651  ? -6.912  -63.888  40.237  1.00 24.05  ? 651  LYS A CA    1 
ATOM   5291  C  C     . LYS C 3  651  ? -8.149  -64.421  40.959  1.00 24.90  ? 651  LYS A C     1 
ATOM   5292  O  O     . LYS C 3  651  ? -9.243  -63.872  40.794  1.00 27.60  ? 651  LYS A O     1 
ATOM   5293  C  CB    . LYS C 3  651  ? -6.482  -64.795  39.082  1.00 19.11  ? 651  LYS A CB    1 
ATOM   5294  C  CG    . LYS C 3  651  ? -5.926  -63.987  37.920  1.00 20.52  ? 651  LYS A CG    1 
ATOM   5295  C  CD    . LYS C 3  651  ? -5.347  -64.830  36.783  1.00 23.85  ? 651  LYS A CD    1 
ATOM   5296  C  CE    . LYS C 3  651  ? -3.892  -65.228  37.045  1.00 25.41  ? 651  LYS A CE    1 
ATOM   5297  N  NZ    . LYS C 3  651  ? -2.997  -64.044  37.217  1.00 27.79  ? 651  LYS A NZ    1 
ATOM   5298  N  N     . VAL C 3  652  ? -7.986  -65.439  41.798  1.00 23.67  ? 652  VAL A N     1 
ATOM   5299  C  CA    . VAL C 3  652  ? -9.140  -65.995  42.501  1.00 21.40  ? 652  VAL A CA    1 
ATOM   5300  C  C     . VAL C 3  652  ? -9.756  -65.021  43.469  1.00 21.09  ? 652  VAL A C     1 
ATOM   5301  O  O     . VAL C 3  652  ? -10.923 -64.648  43.325  1.00 20.67  ? 652  VAL A O     1 
ATOM   5302  C  CB    . VAL C 3  652  ? -8.797  -67.227  43.321  1.00 21.35  ? 652  VAL A CB    1 
ATOM   5303  C  CG1   . VAL C 3  652  ? -10.080 -67.903  43.746  1.00 20.45  ? 652  VAL A CG1   1 
ATOM   5304  C  CG2   . VAL C 3  652  ? -7.922  -68.160  42.528  1.00 18.89  ? 652  VAL A CG2   1 
ATOM   5305  N  N     . VAL C 3  653  ? -8.967  -64.631  44.468  1.00 20.88  ? 653  VAL A N     1 
ATOM   5306  C  CA    . VAL C 3  653  ? -9.422  -63.703  45.498  1.00 20.89  ? 653  VAL A CA    1 
ATOM   5307  C  C     . VAL C 3  653  ? -9.950  -62.393  44.944  1.00 21.35  ? 653  VAL A C     1 
ATOM   5308  O  O     . VAL C 3  653  ? -10.981 -61.894  45.383  1.00 20.19  ? 653  VAL A O     1 
ATOM   5309  C  CB    . VAL C 3  653  ? -8.311  -63.412  46.480  1.00 17.80  ? 653  VAL A CB    1 
ATOM   5310  C  CG1   . VAL C 3  653  ? -8.823  -62.526  47.601  1.00 13.00  ? 653  VAL A CG1   1 
ATOM   5311  C  CG2   . VAL C 3  653  ? -7.791  -64.722  47.020  1.00 18.93  ? 653  VAL A CG2   1 
ATOM   5312  N  N     . ASN C 3  654  ? -9.250  -61.844  43.967  1.00 23.77  ? 654  ASN A N     1 
ATOM   5313  C  CA    . ASN C 3  654  ? -9.679  -60.602  43.356  1.00 26.10  ? 654  ASN A CA    1 
ATOM   5314  C  C     . ASN C 3  654  ? -11.055 -60.747  42.760  1.00 27.52  ? 654  ASN A C     1 
ATOM   5315  O  O     . ASN C 3  654  ? -11.938 -59.918  43.010  1.00 26.95  ? 654  ASN A O     1 
ATOM   5316  C  CB    . ASN C 3  654  ? -8.703  -60.185  42.274  1.00 27.99  ? 654  ASN A CB    1 
ATOM   5317  C  CG    . ASN C 3  654  ? -7.513  -59.485  42.838  1.00 29.08  ? 654  ASN A CG    1 
ATOM   5318  O  OD1   . ASN C 3  654  ? -7.659  -58.585  43.676  1.00 27.95  ? 654  ASN A OD1   1 
ATOM   5319  N  ND2   . ASN C 3  654  ? -6.324  -59.878  42.391  1.00 27.48  ? 654  ASN A ND2   1 
ATOM   5320  N  N     . PHE C 3  655  ? -11.229 -61.798  41.962  1.00 27.99  ? 655  PHE A N     1 
ATOM   5321  C  CA    . PHE C 3  655  ? -12.522 -62.061  41.333  1.00 27.84  ? 655  PHE A CA    1 
ATOM   5322  C  C     . PHE C 3  655  ? -13.589 -62.133  42.418  1.00 25.50  ? 655  PHE A C     1 
ATOM   5323  O  O     . PHE C 3  655  ? -14.573 -61.391  42.384  1.00 22.57  ? 655  PHE A O     1 
ATOM   5324  C  CB    . PHE C 3  655  ? -12.495 -63.384  40.570  1.00 29.02  ? 655  PHE A CB    1 
ATOM   5325  C  CG    . PHE C 3  655  ? -13.818 -63.764  39.975  1.00 28.76  ? 655  PHE A CG    1 
ATOM   5326  C  CD1   . PHE C 3  655  ? -14.226 -63.234  38.760  1.00 32.20  ? 655  PHE A CD1   1 
ATOM   5327  C  CD2   . PHE C 3  655  ? -14.661 -64.640  40.635  1.00 29.80  ? 655  PHE A CD2   1 
ATOM   5328  C  CE1   . PHE C 3  655  ? -15.458 -63.574  38.208  1.00 32.40  ? 655  PHE A CE1   1 
ATOM   5329  C  CE2   . PHE C 3  655  ? -15.889 -64.981  40.095  1.00 33.60  ? 655  PHE A CE2   1 
ATOM   5330  C  CZ    . PHE C 3  655  ? -16.288 -64.447  38.877  1.00 32.29  ? 655  PHE A CZ    1 
ATOM   5331  N  N     . TRP C 3  656  ? -13.369 -63.023  43.385  1.00 22.05  ? 656  TRP A N     1 
ATOM   5332  C  CA    . TRP C 3  656  ? -14.307 -63.195  44.472  1.00 22.03  ? 656  TRP A CA    1 
ATOM   5333  C  C     . TRP C 3  656  ? -14.701 -61.876  45.081  1.00 22.65  ? 656  TRP A C     1 
ATOM   5334  O  O     . TRP C 3  656  ? -15.877 -61.659  45.396  1.00 24.92  ? 656  TRP A O     1 
ATOM   5335  C  CB    . TRP C 3  656  ? -13.730 -64.043  45.591  1.00 23.24  ? 656  TRP A CB    1 
ATOM   5336  C  CG    . TRP C 3  656  ? -14.759 -64.294  46.646  1.00 22.65  ? 656  TRP A CG    1 
ATOM   5337  C  CD1   . TRP C 3  656  ? -15.638 -65.323  46.685  1.00 23.23  ? 656  TRP A CD1   1 
ATOM   5338  C  CD2   . TRP C 3  656  ? -15.072 -63.458  47.763  1.00 21.69  ? 656  TRP A CD2   1 
ATOM   5339  N  NE1   . TRP C 3  656  ? -16.480 -65.188  47.751  1.00 23.04  ? 656  TRP A NE1   1 
ATOM   5340  C  CE2   . TRP C 3  656  ? -16.154 -64.047  48.432  1.00 23.22  ? 656  TRP A CE2   1 
ATOM   5341  C  CE3   . TRP C 3  656  ? -14.543 -62.264  48.262  1.00 27.49  ? 656  TRP A CE3   1 
ATOM   5342  C  CZ2   . TRP C 3  656  ? -16.727 -63.487  49.584  1.00 27.93  ? 656  TRP A CZ2   1 
ATOM   5343  C  CZ3   . TRP C 3  656  ? -15.113 -61.702  49.414  1.00 30.02  ? 656  TRP A CZ3   1 
ATOM   5344  C  CH2   . TRP C 3  656  ? -16.193 -62.318  50.058  1.00 27.50  ? 656  TRP A CH2   1 
ATOM   5345  N  N     . LEU C 3  657  ? -13.714 -61.007  45.284  1.00 20.76  ? 657  LEU A N     1 
ATOM   5346  C  CA    . LEU C 3  657  ? -13.994 -59.716  45.885  1.00 19.44  ? 657  LEU A CA    1 
ATOM   5347  C  C     . LEU C 3  657  ? -14.685 -58.812  44.882  1.00 20.31  ? 657  LEU A C     1 
ATOM   5348  O  O     . LEU C 3  657  ? -15.570 -58.039  45.251  1.00 18.50  ? 657  LEU A O     1 
ATOM   5349  C  CB    . LEU C 3  657  ? -12.713 -59.048  46.406  1.00 16.12  ? 657  LEU A CB    1 
ATOM   5350  C  CG    . LEU C 3  657  ? -12.949 -57.669  47.044  1.00 17.16  ? 657  LEU A CG    1 
ATOM   5351  C  CD1   . LEU C 3  657  ? -13.995 -57.827  48.122  1.00 20.26  ? 657  LEU A CD1   1 
ATOM   5352  C  CD2   . LEU C 3  657  ? -11.682 -57.060  47.625  1.00 12.11  ? 657  LEU A CD2   1 
ATOM   5353  N  N     . LEU C 3  658  ? -14.295 -58.915  43.613  1.00 20.52  ? 658  LEU A N     1 
ATOM   5354  C  CA    . LEU C 3  658  ? -14.910 -58.081  42.586  1.00 21.94  ? 658  LEU A CA    1 
ATOM   5355  C  C     . LEU C 3  658  ? -16.416 -58.232  42.655  1.00 24.71  ? 658  LEU A C     1 
ATOM   5356  O  O     . LEU C 3  658  ? -17.159 -57.341  42.248  1.00 26.22  ? 658  LEU A O     1 
ATOM   5357  C  CB    . LEU C 3  658  ? -14.450 -58.486  41.186  1.00 17.21  ? 658  LEU A CB    1 
ATOM   5358  C  CG    . LEU C 3  658  ? -15.349 -57.918  40.075  1.00 14.00  ? 658  LEU A CG    1 
ATOM   5359  C  CD1   . LEU C 3  658  ? -15.156 -56.421  39.935  1.00 3.64   ? 658  LEU A CD1   1 
ATOM   5360  C  CD2   . LEU C 3  658  ? -15.057 -58.637  38.756  1.00 17.18  ? 658  LEU A CD2   1 
ATOM   5361  N  N     . HIS C 3  659  ? -16.859 -59.372  43.174  1.00 26.14  ? 659  HIS A N     1 
ATOM   5362  C  CA    . HIS C 3  659  ? -18.275 -59.653  43.280  1.00 26.14  ? 659  HIS A CA    1 
ATOM   5363  C  C     . HIS C 3  659  ? -18.839 -59.581  44.690  1.00 28.78  ? 659  HIS A C     1 
ATOM   5364  O  O     . HIS C 3  659  ? -20.045 -59.708  44.886  1.00 32.64  ? 659  HIS A O     1 
ATOM   5365  C  CB    . HIS C 3  659  ? -18.565 -61.006  42.660  1.00 23.75  ? 659  HIS A CB    1 
ATOM   5366  C  CG    . HIS C 3  659  ? -18.386 -61.020  41.178  1.00 22.37  ? 659  HIS A CG    1 
ATOM   5367  N  ND1   . HIS C 3  659  ? -18.886 -60.025  40.367  1.00 17.79  ? 659  HIS A ND1   1 
ATOM   5368  C  CD2   . HIS C 3  659  ? -17.766 -61.902  40.360  1.00 22.61  ? 659  HIS A CD2   1 
ATOM   5369  C  CE1   . HIS C 3  659  ? -18.579 -60.293  39.111  1.00 21.02  ? 659  HIS A CE1   1 
ATOM   5370  N  NE2   . HIS C 3  659  ? -17.900 -61.426  39.078  1.00 24.40  ? 659  HIS A NE2   1 
ATOM   5371  N  N     . ASN C 3  660  ? -17.986 -59.383  45.683  1.00 29.11  ? 660  ASN A N     1 
ATOM   5372  C  CA    . ASN C 3  660  ? -18.511 -59.261  47.022  1.00 28.14  ? 660  ASN A CA    1 
ATOM   5373  C  C     . ASN C 3  660  ? -18.578 -57.792  47.354  1.00 27.19  ? 660  ASN A C     1 
ATOM   5374  O  O     . ASN C 3  660  ? -19.458 -57.343  48.074  1.00 26.29  ? 660  ASN A O     1 
ATOM   5375  C  CB    . ASN C 3  660  ? -17.624 -59.923  48.039  1.00 30.51  ? 660  ASN A CB    1 
ATOM   5376  C  CG    . ASN C 3  660  ? -18.196 -59.807  49.417  1.00 34.92  ? 660  ASN A CG    1 
ATOM   5377  O  OD1   . ASN C 3  660  ? -18.948 -60.675  49.858  1.00 40.67  ? 660  ASN A OD1   1 
ATOM   5378  N  ND2   . ASN C 3  660  ? -17.884 -58.709  50.100  1.00 31.32  ? 660  ASN A ND2   1 
ATOM   5379  N  N     . GLY C 3  661  ? -17.618 -57.049  46.824  1.00 28.24  ? 661  GLY A N     1 
ATOM   5380  C  CA    . GLY C 3  661  ? -17.566 -55.619  47.061  1.00 28.24  ? 661  GLY A CA    1 
ATOM   5381  C  C     . GLY C 3  661  ? -16.995 -55.320  48.426  1.00 26.47  ? 661  GLY A C     1 
ATOM   5382  O  O     . GLY C 3  661  ? -16.946 -56.190  49.284  1.00 28.41  ? 661  GLY A O     1 
ATOM   5383  N  N     . PHE C 3  662  ? -16.532 -54.096  48.616  1.00 24.79  ? 662  PHE A N     1 
ATOM   5384  C  CA    . PHE C 3  662  ? -15.989 -53.680  49.896  1.00 24.83  ? 662  PHE A CA    1 
ATOM   5385  C  C     . PHE C 3  662  ? -15.816 -52.173  49.851  1.00 26.23  ? 662  PHE A C     1 
ATOM   5386  O  O     . PHE C 3  662  ? -15.437 -51.617  48.811  1.00 27.23  ? 662  PHE A O     1 
ATOM   5387  C  CB    . PHE C 3  662  ? -14.650 -54.335  50.174  1.00 24.54  ? 662  PHE A CB    1 
ATOM   5388  C  CG    . PHE C 3  662  ? -14.056 -53.906  51.469  1.00 25.96  ? 662  PHE A CG    1 
ATOM   5389  C  CD1   . PHE C 3  662  ? -14.659 -54.251  52.665  1.00 28.76  ? 662  PHE A CD1   1 
ATOM   5390  C  CD2   . PHE C 3  662  ? -12.936 -53.106  51.500  1.00 27.38  ? 662  PHE A CD2   1 
ATOM   5391  C  CE1   . PHE C 3  662  ? -14.158 -53.801  53.875  1.00 27.49  ? 662  PHE A CE1   1 
ATOM   5392  C  CE2   . PHE C 3  662  ? -12.430 -52.654  52.705  1.00 30.60  ? 662  PHE A CE2   1 
ATOM   5393  C  CZ    . PHE C 3  662  ? -13.045 -53.004  53.894  1.00 27.84  ? 662  PHE A CZ    1 
ATOM   5394  N  N     . SER C 3  663  ? -16.082 -51.506  50.970  1.00 23.98  ? 663  SER A N     1 
ATOM   5395  C  CA    . SER C 3  663  ? -15.987 -50.053  50.993  1.00 23.26  ? 663  SER A CA    1 
ATOM   5396  C  C     . SER C 3  663  ? -15.812 -49.487  52.391  1.00 24.52  ? 663  SER A C     1 
ATOM   5397  O  O     . SER C 3  663  ? -15.610 -50.248  53.331  1.00 26.44  ? 663  SER A O     1 
ATOM   5398  C  CB    . SER C 3  663  ? -17.231 -49.465  50.341  1.00 19.03  ? 663  SER A CB    1 
ATOM   5399  O  OG    . SER C 3  663  ? -17.461 -48.155  50.800  1.00 19.25  ? 663  SER A OG    1 
ATOM   5400  N  N     . THR C 3  664  ? -15.870 -48.157  52.514  1.00 24.04  ? 664  THR A N     1 
ATOM   5401  C  CA    . THR C 3  664  ? -15.720 -47.453  53.794  1.00 25.71  ? 664  THR A CA    1 
ATOM   5402  C  C     . THR C 3  664  ? -16.304 -46.053  53.695  1.00 27.09  ? 664  THR A C     1 
ATOM   5403  O  O     . THR C 3  664  ? -16.255 -45.437  52.636  1.00 29.76  ? 664  THR A O     1 
ATOM   5404  C  CB    . THR C 3  664  ? -14.237 -47.295  54.203  1.00 26.77  ? 664  THR A CB    1 
ATOM   5405  O  OG1   . THR C 3  664  ? -13.716 -48.560  54.626  1.00 30.91  ? 664  THR A OG1   1 
ATOM   5406  C  CG2   . THR C 3  664  ? -14.102 -46.290  55.351  1.00 25.79  ? 664  THR A CG2   1 
ATOM   5407  N  N     . GLY C 3  665  ? -16.835 -45.539  54.801  1.00 27.13  ? 665  GLY A N     1 
ATOM   5408  C  CA    . GLY C 3  665  ? -17.423 -44.205  54.793  1.00 27.56  ? 665  GLY A CA    1 
ATOM   5409  C  C     . GLY C 3  665  ? -17.314 -43.589  56.166  1.00 28.03  ? 665  GLY A C     1 
ATOM   5410  O  O     . GLY C 3  665  ? -16.737 -44.220  57.046  1.00 30.67  ? 665  GLY A O     1 
ATOM   5411  N  N     . ILE C 3  666  ? -17.847 -42.387  56.379  1.00 25.77  ? 666  ILE A N     1 
ATOM   5412  C  CA    . ILE C 3  666  ? -17.725 -41.789  57.706  1.00 25.80  ? 666  ILE A CA    1 
ATOM   5413  C  C     . ILE C 3  666  ? -18.299 -42.768  58.688  1.00 28.00  ? 666  ILE A C     1 
ATOM   5414  O  O     . ILE C 3  666  ? -17.685 -43.069  59.709  1.00 28.43  ? 666  ILE A O     1 
ATOM   5415  C  CB    . ILE C 3  666  ? -18.543 -40.532  57.885  1.00 25.31  ? 666  ILE A CB    1 
ATOM   5416  C  CG1   . ILE C 3  666  ? -19.036 -40.054  56.535  1.00 30.46  ? 666  ILE A CG1   1 
ATOM   5417  C  CG2   . ILE C 3  666  ? -17.737 -39.483  58.637  1.00 22.55  ? 666  ILE A CG2   1 
ATOM   5418  C  CD1   . ILE C 3  666  ? -20.536 -39.937  56.510  1.00 32.28  ? 666  ILE A CD1   1 
ATOM   5419  N  N     . GLY C 3  667  ? -19.489 -43.259  58.364  1.00 29.18  ? 667  GLY A N     1 
ATOM   5420  C  CA    . GLY C 3  667  ? -20.160 -44.204  59.231  1.00 31.46  ? 667  GLY A CA    1 
ATOM   5421  C  C     . GLY C 3  667  ? -19.183 -45.095  59.971  1.00 33.86  ? 667  GLY A C     1 
ATOM   5422  O  O     . GLY C 3  667  ? -19.289 -45.274  61.190  1.00 38.08  ? 667  GLY A O     1 
ATOM   5423  N  N     . ASP C 3  668  ? -18.219 -45.643  59.235  1.00 31.69  ? 668  ASP A N     1 
ATOM   5424  C  CA    . ASP C 3  668  ? -17.220 -46.525  59.814  1.00 28.51  ? 668  ASP A CA    1 
ATOM   5425  C  C     . ASP C 3  668  ? -16.356 -45.892  60.881  1.00 28.29  ? 668  ASP A C     1 
ATOM   5426  O  O     . ASP C 3  668  ? -15.529 -46.570  61.460  1.00 29.34  ? 668  ASP A O     1 
ATOM   5427  C  CB    . ASP C 3  668  ? -16.302 -47.060  58.735  1.00 27.36  ? 668  ASP A CB    1 
ATOM   5428  C  CG    . ASP C 3  668  ? -16.824 -48.310  58.101  1.00 30.57  ? 668  ASP A CG    1 
ATOM   5429  O  OD1   . ASP C 3  668  ? -17.055 -49.292  58.841  1.00 28.83  ? 668  ASP A OD1   1 
ATOM   5430  O  OD2   . ASP C 3  668  ? -16.988 -48.313  56.860  1.00 31.02  ? 668  ASP A OD2   1 
ATOM   5431  N  N     . THR C 3  669  ? -16.517 -44.601  61.135  1.00 26.68  ? 669  THR A N     1 
ATOM   5432  C  CA    . THR C 3  669  ? -15.701 -43.954  62.145  1.00 27.53  ? 669  THR A CA    1 
ATOM   5433  C  C     . THR C 3  669  ? -16.533 -43.509  63.330  1.00 29.49  ? 669  THR A C     1 
ATOM   5434  O  O     . THR C 3  669  ? -16.011 -42.898  64.267  1.00 31.31  ? 669  THR A O     1 
ATOM   5435  C  CB    . THR C 3  669  ? -14.987 -42.712  61.592  1.00 28.31  ? 669  THR A CB    1 
ATOM   5436  O  OG1   . THR C 3  669  ? -15.962 -41.738  61.208  1.00 26.67  ? 669  THR A OG1   1 
ATOM   5437  C  CG2   . THR C 3  669  ? -14.121 -43.074  60.405  1.00 24.23  ? 669  THR A CG2   1 
ATOM   5438  N  N     . ILE C 3  670  ? -17.823 -43.825  63.296  1.00 30.94  ? 670  ILE A N     1 
ATOM   5439  C  CA    . ILE C 3  670  ? -18.739 -43.428  64.365  1.00 29.95  ? 670  ILE A CA    1 
ATOM   5440  C  C     . ILE C 3  670  ? -18.836 -44.452  65.480  1.00 32.10  ? 670  ILE A C     1 
ATOM   5441  O  O     . ILE C 3  670  ? -19.022 -45.641  65.243  1.00 31.83  ? 670  ILE A O     1 
ATOM   5442  C  CB    . ILE C 3  670  ? -20.114 -43.146  63.792  1.00 23.61  ? 670  ILE A CB    1 
ATOM   5443  C  CG1   . ILE C 3  670  ? -19.987 -42.055  62.736  1.00 19.80  ? 670  ILE A CG1   1 
ATOM   5444  C  CG2   . ILE C 3  670  ? -21.031 -42.671  64.875  1.00 25.78  ? 670  ILE A CG2   1 
ATOM   5445  C  CD1   . ILE C 3  670  ? -20.998 -42.117  61.678  1.00 17.81  ? 670  ILE A CD1   1 
ATOM   5446  N  N     . ALA C 3  671  ? -18.706 -43.978  66.709  1.00 35.31  ? 671  ALA A N     1 
ATOM   5447  C  CA    . ALA C 3  671  ? -18.742 -44.877  67.846  1.00 39.96  ? 671  ALA A CA    1 
ATOM   5448  C  C     . ALA C 3  671  ? -20.033 -44.837  68.655  1.00 42.93  ? 671  ALA A C     1 
ATOM   5449  O  O     . ALA C 3  671  ? -20.679 -43.793  68.794  1.00 42.32  ? 671  ALA A O     1 
ATOM   5450  C  CB    . ALA C 3  671  ? -17.556 -44.595  68.752  1.00 41.60  ? 671  ALA A CB    1 
ATOM   5451  N  N     . ASP C 3  672  ? -20.384 -46.004  69.187  1.00 45.90  ? 672  ASP A N     1 
ATOM   5452  C  CA    . ASP C 3  672  ? -21.568 -46.207  70.009  1.00 48.49  ? 672  ASP A CA    1 
ATOM   5453  C  C     . ASP C 3  672  ? -21.831 -44.977  70.880  1.00 49.40  ? 672  ASP A C     1 
ATOM   5454  O  O     . ASP C 3  672  ? -20.924 -44.475  71.549  1.00 49.61  ? 672  ASP A O     1 
ATOM   5455  C  CB    . ASP C 3  672  ? -21.336 -47.431  70.895  1.00 53.25  ? 672  ASP A CB    1 
ATOM   5456  C  CG    . ASP C 3  672  ? -22.619 -48.077  71.374  1.00 60.29  ? 672  ASP A CG    1 
ATOM   5457  O  OD1   . ASP C 3  672  ? -23.698 -47.466  71.225  1.00 66.39  ? 672  ASP A OD1   1 
ATOM   5458  O  OD2   . ASP C 3  672  ? -22.543 -49.206  71.912  1.00 65.33  ? 672  ASP A OD2   1 
ATOM   5459  N  N     . GLY C 3  673  ? -23.073 -44.500  70.869  1.00 49.92  ? 673  GLY A N     1 
ATOM   5460  C  CA    . GLY C 3  673  ? -23.443 -43.339  71.663  1.00 50.41  ? 673  GLY A CA    1 
ATOM   5461  C  C     . GLY C 3  673  ? -22.967 -43.380  73.108  1.00 50.90  ? 673  GLY A C     1 
ATOM   5462  O  O     . GLY C 3  673  ? -22.351 -42.419  73.587  1.00 50.00  ? 673  GLY A O     1 
ATOM   5463  N  N     . PRO C 3  674  ? -23.255 -44.470  73.842  1.00 51.44  ? 674  PRO A N     1 
ATOM   5464  C  CA    . PRO C 3  674  ? -22.815 -44.561  75.232  1.00 52.25  ? 674  PRO A CA    1 
ATOM   5465  C  C     . PRO C 3  674  ? -21.287 -44.608  75.297  1.00 53.23  ? 674  PRO A C     1 
ATOM   5466  O  O     . PRO C 3  674  ? -20.678 -44.233  76.312  1.00 55.52  ? 674  PRO A O     1 
ATOM   5467  C  CB    . PRO C 3  674  ? -23.461 -45.859  75.708  1.00 50.24  ? 674  PRO A CB    1 
ATOM   5468  C  CG    . PRO C 3  674  ? -23.454 -46.687  74.477  1.00 49.32  ? 674  PRO A CG    1 
ATOM   5469  C  CD    . PRO C 3  674  ? -23.965 -45.699  73.455  1.00 50.80  ? 674  PRO A CD    1 
ATOM   5470  N  N     . THR C 3  675  ? -20.666 -45.061  74.209  1.00 50.36  ? 675  THR A N     1 
ATOM   5471  C  CA    . THR C 3  675  ? -19.217 -45.137  74.176  1.00 46.48  ? 675  THR A CA    1 
ATOM   5472  C  C     . THR C 3  675  ? -18.611 -43.749  74.216  1.00 45.87  ? 675  THR A C     1 
ATOM   5473  O  O     . THR C 3  675  ? -17.834 -43.441  75.116  1.00 46.19  ? 675  THR A O     1 
ATOM   5474  C  CB    . THR C 3  675  ? -18.720 -45.869  72.939  1.00 43.04  ? 675  THR A CB    1 
ATOM   5475  O  OG1   . THR C 3  675  ? -19.217 -47.207  72.966  1.00 43.67  ? 675  THR A OG1   1 
ATOM   5476  C  CG2   . THR C 3  675  ? -17.206 -45.917  72.925  1.00 41.42  ? 675  THR A CG2   1 
ATOM   5477  N  N     . MET C 3  676  ? -18.969 -42.899  73.262  1.00 44.99  ? 676  MET A N     1 
ATOM   5478  C  CA    . MET C 3  676  ? -18.412 -41.558  73.262  1.00 45.52  ? 676  MET A CA    1 
ATOM   5479  C  C     . MET C 3  676  ? -18.582 -40.958  74.644  1.00 47.23  ? 676  MET A C     1 
ATOM   5480  O  O     . MET C 3  676  ? -17.783 -40.141  75.086  1.00 47.14  ? 676  MET A O     1 
ATOM   5481  C  CB    . MET C 3  676  ? -19.093 -40.695  72.212  1.00 44.71  ? 676  MET A CB    1 
ATOM   5482  C  CG    . MET C 3  676  ? -18.704 -41.064  70.797  1.00 46.85  ? 676  MET A CG    1 
ATOM   5483  S  SD    . MET C 3  676  ? -16.911 -41.088  70.575  1.00 47.84  ? 676  MET A SD    1 
ATOM   5484  C  CE    . MET C 3  676  ? -16.564 -39.324  70.395  1.00 50.50  ? 676  MET A CE    1 
ATOM   5485  N  N     . ARG C 3  677  ? -19.621 -41.390  75.339  1.00 50.58  ? 677  ARG A N     1 
ATOM   5486  C  CA    . ARG C 3  677  ? -19.872 -40.898  76.679  1.00 53.13  ? 677  ARG A CA    1 
ATOM   5487  C  C     . ARG C 3  677  ? -18.732 -41.388  77.554  1.00 51.65  ? 677  ARG A C     1 
ATOM   5488  O  O     . ARG C 3  677  ? -18.021 -40.606  78.173  1.00 50.95  ? 677  ARG A O     1 
ATOM   5489  C  CB    . ARG C 3  677  ? -21.203 -41.445  77.187  1.00 57.69  ? 677  ARG A CB    1 
ATOM   5490  C  CG    . ARG C 3  677  ? -21.694 -40.816  78.474  1.00 67.44  ? 677  ARG A CG    1 
ATOM   5491  C  CD    . ARG C 3  677  ? -23.135 -41.212  78.700  1.00 76.98  ? 677  ARG A CD    1 
ATOM   5492  N  NE    . ARG C 3  677  ? -23.964 -40.802  77.569  1.00 85.20  ? 677  ARG A NE    1 
ATOM   5493  C  CZ    . ARG C 3  677  ? -25.032 -41.468  77.143  1.00 89.35  ? 677  ARG A CZ    1 
ATOM   5494  N  NH1   . ARG C 3  677  ? -25.406 -42.582  77.756  1.00 90.88  ? 677  ARG A NH1   1 
ATOM   5495  N  NH2   . ARG C 3  677  ? -25.720 -41.031  76.095  1.00 91.47  ? 677  ARG A NH2   1 
ATOM   5496  N  N     . GLU C 3  678  ? -18.557 -42.699  77.583  1.00 51.96  ? 678  GLU A N     1 
ATOM   5497  C  CA    . GLU C 3  678  ? -17.508 -43.312  78.378  1.00 54.70  ? 678  GLU A CA    1 
ATOM   5498  C  C     . GLU C 3  678  ? -16.124 -42.772  77.993  1.00 54.39  ? 678  GLU A C     1 
ATOM   5499  O  O     . GLU C 3  678  ? -15.229 -42.682  78.830  1.00 56.88  ? 678  GLU A O     1 
ATOM   5500  C  CB    . GLU C 3  678  ? -17.566 -44.827  78.192  1.00 56.29  ? 678  GLU A CB    1 
ATOM   5501  C  CG    . GLU C 3  678  ? -16.734 -45.627  79.154  1.00 61.37  ? 678  GLU A CG    1 
ATOM   5502  C  CD    . GLU C 3  678  ? -16.988 -47.106  78.987  1.00 67.92  ? 678  GLU A CD    1 
ATOM   5503  O  OE1   . GLU C 3  678  ? -16.321 -47.919  79.665  1.00 73.61  ? 678  GLU A OE1   1 
ATOM   5504  O  OE2   . GLU C 3  678  ? -17.867 -47.455  78.172  1.00 69.80  ? 678  GLU A OE2   1 
ATOM   5505  N  N     . ILE C 3  679  ? -15.954 -42.406  76.727  1.00 52.62  ? 679  ILE A N     1 
ATOM   5506  C  CA    . ILE C 3  679  ? -14.688 -41.869  76.247  1.00 48.89  ? 679  ILE A CA    1 
ATOM   5507  C  C     . ILE C 3  679  ? -14.492 -40.448  76.737  1.00 51.17  ? 679  ILE A C     1 
ATOM   5508  O  O     . ILE C 3  679  ? -13.515 -40.143  77.414  1.00 52.87  ? 679  ILE A O     1 
ATOM   5509  C  CB    . ILE C 3  679  ? -14.650 -41.835  74.731  1.00 44.82  ? 679  ILE A CB    1 
ATOM   5510  C  CG1   . ILE C 3  679  ? -14.745 -43.255  74.193  1.00 42.22  ? 679  ILE A CG1   1 
ATOM   5511  C  CG2   . ILE C 3  679  ? -13.398 -41.138  74.261  1.00 41.30  ? 679  ILE A CG2   1 
ATOM   5512  C  CD1   . ILE C 3  679  ? -14.811 -43.312  72.707  1.00 41.71  ? 679  ILE A CD1   1 
ATOM   5513  N  N     . THR C 3  680  ? -15.424 -39.573  76.385  1.00 51.69  ? 680  THR A N     1 
ATOM   5514  C  CA    . THR C 3  680  ? -15.331 -38.187  76.801  1.00 53.47  ? 680  THR A CA    1 
ATOM   5515  C  C     . THR C 3  680  ? -15.011 -38.065  78.274  1.00 54.06  ? 680  THR A C     1 
ATOM   5516  O  O     . THR C 3  680  ? -14.249 -37.195  78.667  1.00 55.49  ? 680  THR A O     1 
ATOM   5517  C  CB    . THR C 3  680  ? -16.625 -37.430  76.539  1.00 56.02  ? 680  THR A CB    1 
ATOM   5518  O  OG1   . THR C 3  680  ? -16.795 -37.253  75.128  1.00 60.13  ? 680  THR A OG1   1 
ATOM   5519  C  CG2   . THR C 3  680  ? -16.582 -36.062  77.219  1.00 60.81  ? 680  THR A CG2   1 
ATOM   5520  N  N     . GLU C 3  681  ? -15.594 -38.921  79.101  1.00 55.56  ? 681  GLU A N     1 
ATOM   5521  C  CA    . GLU C 3  681  ? -15.298 -38.823  80.515  1.00 56.66  ? 681  GLU A CA    1 
ATOM   5522  C  C     . GLU C 3  681  ? -13.988 -39.525  80.819  1.00 54.19  ? 681  GLU A C     1 
ATOM   5523  O  O     . GLU C 3  681  ? -13.314 -39.173  81.779  1.00 56.26  ? 681  GLU A O     1 
ATOM   5524  C  CB    . GLU C 3  681  ? -16.443 -39.373  81.374  1.00 62.88  ? 681  GLU A CB    1 
ATOM   5525  C  CG    . GLU C 3  681  ? -16.652 -40.869  81.350  1.00 71.81  ? 681  GLU A CG    1 
ATOM   5526  C  CD    . GLU C 3  681  ? -17.732 -41.290  82.338  1.00 78.49  ? 681  GLU A CD    1 
ATOM   5527  O  OE1   . GLU C 3  681  ? -18.889 -40.834  82.180  1.00 80.26  ? 681  GLU A OE1   1 
ATOM   5528  O  OE2   . GLU C 3  681  ? -17.422 -42.065  83.274  1.00 82.91  ? 681  GLU A OE2   1 
ATOM   5529  N  N     . THR C 3  682  ? -13.616 -40.506  80.001  1.00 51.10  ? 682  THR A N     1 
ATOM   5530  C  CA    . THR C 3  682  ? -12.337 -41.193  80.197  1.00 48.47  ? 682  THR A CA    1 
ATOM   5531  C  C     . THR C 3  682  ? -11.272 -40.104  80.208  1.00 46.82  ? 682  THR A C     1 
ATOM   5532  O  O     . THR C 3  682  ? -10.319 -40.141  80.991  1.00 45.27  ? 682  THR A O     1 
ATOM   5533  C  CB    . THR C 3  682  ? -12.020 -42.174  79.046  1.00 47.97  ? 682  THR A CB    1 
ATOM   5534  O  OG1   . THR C 3  682  ? -12.463 -43.490  79.397  1.00 49.77  ? 682  THR A OG1   1 
ATOM   5535  C  CG2   . THR C 3  682  ? -10.524 -42.202  78.762  1.00 46.39  ? 682  THR A CG2   1 
ATOM   5536  N  N     . ILE C 3  683  ? -11.448 -39.135  79.320  1.00 43.99  ? 683  ILE A N     1 
ATOM   5537  C  CA    . ILE C 3  683  ? -10.531 -38.024  79.243  1.00 43.11  ? 683  ILE A CA    1 
ATOM   5538  C  C     . ILE C 3  683  ? -10.761 -37.143  80.463  1.00 44.97  ? 683  ILE A C     1 
ATOM   5539  O  O     . ILE C 3  683  ? -9.815  -36.804  81.166  1.00 46.49  ? 683  ILE A O     1 
ATOM   5540  C  CB    . ILE C 3  683  ? -10.746 -37.219  77.942  1.00 41.40  ? 683  ILE A CB    1 
ATOM   5541  C  CG1   . ILE C 3  683  ? -10.240 -38.039  76.755  1.00 42.52  ? 683  ILE A CG1   1 
ATOM   5542  C  CG2   . ILE C 3  683  ? -10.033 -35.870  78.013  1.00 35.82  ? 683  ILE A CG2   1 
ATOM   5543  C  CD1   . ILE C 3  683  ? -10.324 -37.316  75.427  1.00 44.41  ? 683  ILE A CD1   1 
ATOM   5544  N  N     . ALA C 3  684  ? -12.025 -36.806  80.724  1.00 46.84  ? 684  ALA A N     1 
ATOM   5545  C  CA    . ALA C 3  684  ? -12.411 -35.951  81.854  1.00 46.36  ? 684  ALA A CA    1 
ATOM   5546  C  C     . ALA C 3  684  ? -11.652 -36.256  83.139  1.00 47.09  ? 684  ALA A C     1 
ATOM   5547  O  O     . ALA C 3  684  ? -11.373 -35.345  83.924  1.00 46.60  ? 684  ALA A O     1 
ATOM   5548  C  CB    . ALA C 3  684  ? -13.908 -36.053  82.103  1.00 46.48  ? 684  ALA A CB    1 
ATOM   5549  N  N     . GLU C 3  685  ? -11.331 -37.529  83.366  1.00 46.70  ? 685  GLU A N     1 
ATOM   5550  C  CA    . GLU C 3  685  ? -10.581 -37.889  84.557  1.00 47.15  ? 685  GLU A CA    1 
ATOM   5551  C  C     . GLU C 3  685  ? -9.094  -37.665  84.311  1.00 45.42  ? 685  GLU A C     1 
ATOM   5552  O  O     . GLU C 3  685  ? -8.387  -37.250  85.220  1.00 47.69  ? 685  GLU A O     1 
ATOM   5553  C  CB    . GLU C 3  685  ? -10.851 -39.340  84.980  1.00 51.09  ? 685  GLU A CB    1 
ATOM   5554  C  CG    . GLU C 3  685  ? -10.704 -40.381  83.883  1.00 60.73  ? 685  GLU A CG    1 
ATOM   5555  C  CD    . GLU C 3  685  ? -10.953 -41.808  84.381  1.00 67.14  ? 685  GLU A CD    1 
ATOM   5556  O  OE1   . GLU C 3  685  ? -11.816 -41.986  85.272  1.00 70.14  ? 685  GLU A OE1   1 
ATOM   5557  O  OE2   . GLU C 3  685  ? -10.298 -42.751  83.871  1.00 69.20  ? 685  GLU A OE2   1 
ATOM   5558  N  N     . ALA C 3  686  ? -8.613  -37.919  83.094  1.00 42.67  ? 686  ALA A N     1 
ATOM   5559  C  CA    . ALA C 3  686  ? -7.200  -37.691  82.800  1.00 38.64  ? 686  ALA A CA    1 
ATOM   5560  C  C     . ALA C 3  686  ? -6.909  -36.235  83.121  1.00 38.39  ? 686  ALA A C     1 
ATOM   5561  O  O     . ALA C 3  686  ? -5.931  -35.932  83.792  1.00 39.96  ? 686  ALA A O     1 
ATOM   5562  C  CB    . ALA C 3  686  ? -6.894  -37.966  81.348  1.00 33.86  ? 686  ALA A CB    1 
ATOM   5563  N  N     . LYS C 3  687  ? -7.765  -35.329  82.659  1.00 37.38  ? 687  LYS A N     1 
ATOM   5564  C  CA    . LYS C 3  687  ? -7.563  -33.912  82.934  1.00 39.34  ? 687  LYS A CA    1 
ATOM   5565  C  C     . LYS C 3  687  ? -7.513  -33.614  84.432  1.00 42.40  ? 687  LYS A C     1 
ATOM   5566  O  O     . LYS C 3  687  ? -6.663  -32.834  84.884  1.00 41.34  ? 687  LYS A O     1 
ATOM   5567  C  CB    . LYS C 3  687  ? -8.654  -33.061  82.273  1.00 37.03  ? 687  LYS A CB    1 
ATOM   5568  C  CG    . LYS C 3  687  ? -8.404  -32.770  80.810  1.00 35.32  ? 687  LYS A CG    1 
ATOM   5569  C  CD    . LYS C 3  687  ? -9.196  -31.561  80.332  1.00 38.86  ? 687  LYS A CD    1 
ATOM   5570  C  CE    . LYS C 3  687  ? -8.744  -31.128  78.937  1.00 38.96  ? 687  LYS A CE    1 
ATOM   5571  N  NZ    . LYS C 3  687  ? -9.675  -30.149  78.307  1.00 42.60  ? 687  LYS A NZ    1 
ATOM   5572  N  N     . LYS C 3  688  ? -8.423  -34.230  85.194  1.00 46.65  ? 688  LYS A N     1 
ATOM   5573  C  CA    . LYS C 3  688  ? -8.481  -34.043  86.650  1.00 49.95  ? 688  LYS A CA    1 
ATOM   5574  C  C     . LYS C 3  688  ? -7.203  -34.554  87.293  1.00 47.65  ? 688  LYS A C     1 
ATOM   5575  O  O     . LYS C 3  688  ? -6.735  -33.976  88.266  1.00 48.56  ? 688  LYS A O     1 
ATOM   5576  C  CB    . LYS C 3  688  ? -9.676  -34.776  87.271  1.00 55.38  ? 688  LYS A CB    1 
ATOM   5577  C  CG    . LYS C 3  688  ? -11.048 -34.159  86.983  1.00 64.45  ? 688  LYS A CG    1 
ATOM   5578  C  CD    . LYS C 3  688  ? -12.152 -35.096  87.499  1.00 72.70  ? 688  LYS A CD    1 
ATOM   5579  C  CE    . LYS C 3  688  ? -13.535 -34.760  86.930  1.00 75.52  ? 688  LYS A CE    1 
ATOM   5580  N  NZ    . LYS C 3  688  ? -14.469 -35.939  86.991  1.00 76.10  ? 688  LYS A NZ    1 
ATOM   5581  N  N     . LYS C 3  689  ? -6.649  -35.639  86.759  1.00 45.09  ? 689  LYS A N     1 
ATOM   5582  C  CA    . LYS C 3  689  ? -5.407  -36.176  87.293  1.00 43.30  ? 689  LYS A CA    1 
ATOM   5583  C  C     . LYS C 3  689  ? -4.334  -35.123  87.095  1.00 41.91  ? 689  LYS A C     1 
ATOM   5584  O  O     . LYS C 3  689  ? -3.669  -34.719  88.048  1.00 42.86  ? 689  LYS A O     1 
ATOM   5585  C  CB    . LYS C 3  689  ? -4.997  -37.463  86.577  1.00 45.74  ? 689  LYS A CB    1 
ATOM   5586  C  CG    . LYS C 3  689  ? -5.837  -38.678  86.939  1.00 52.22  ? 689  LYS A CG    1 
ATOM   5587  C  CD    . LYS C 3  689  ? -5.269  -39.963  86.334  1.00 56.78  ? 689  LYS A CD    1 
ATOM   5588  C  CE    . LYS C 3  689  ? -6.138  -41.170  86.693  1.00 61.07  ? 689  LYS A CE    1 
ATOM   5589  N  NZ    . LYS C 3  689  ? -5.523  -42.471  86.298  1.00 62.80  ? 689  LYS A NZ    1 
ATOM   5590  N  N     . VAL C 3  690  ? -4.170  -34.671  85.856  1.00 39.61  ? 690  VAL A N     1 
ATOM   5591  C  CA    . VAL C 3  690  ? -3.175  -33.647  85.557  1.00 37.38  ? 690  VAL A CA    1 
ATOM   5592  C  C     . VAL C 3  690  ? -3.380  -32.472  86.503  1.00 37.40  ? 690  VAL A C     1 
ATOM   5593  O  O     . VAL C 3  690  ? -2.430  -31.956  87.101  1.00 36.88  ? 690  VAL A O     1 
ATOM   5594  C  CB    . VAL C 3  690  ? -3.309  -33.138  84.119  1.00 34.33  ? 690  VAL A CB    1 
ATOM   5595  C  CG1   . VAL C 3  690  ? -2.294  -32.063  83.873  1.00 33.94  ? 690  VAL A CG1   1 
ATOM   5596  C  CG2   . VAL C 3  690  ? -3.102  -34.274  83.147  1.00 34.79  ? 690  VAL A CG2   1 
ATOM   5597  N  N     . LEU C 3  691  ? -4.635  -32.055  86.631  1.00 36.43  ? 691  LEU A N     1 
ATOM   5598  C  CA    . LEU C 3  691  ? -4.968  -30.955  87.509  1.00 35.29  ? 691  LEU A CA    1 
ATOM   5599  C  C     . LEU C 3  691  ? -4.558  -31.275  88.937  1.00 35.86  ? 691  LEU A C     1 
ATOM   5600  O  O     . LEU C 3  691  ? -3.949  -30.445  89.593  1.00 37.50  ? 691  LEU A O     1 
ATOM   5601  C  CB    . LEU C 3  691  ? -6.462  -30.656  87.440  1.00 34.40  ? 691  LEU A CB    1 
ATOM   5602  C  CG    . LEU C 3  691  ? -7.027  -29.675  88.469  1.00 33.71  ? 691  LEU A CG    1 
ATOM   5603  C  CD1   . LEU C 3  691  ? -6.172  -28.445  88.566  1.00 33.08  ? 691  LEU A CD1   1 
ATOM   5604  C  CD2   . LEU C 3  691  ? -8.428  -29.294  88.054  1.00 38.65  ? 691  LEU A CD2   1 
ATOM   5605  N  N     . ASP C 3  692  ? -4.873  -32.476  89.417  1.00 36.44  ? 692  ASP A N     1 
ATOM   5606  C  CA    . ASP C 3  692  ? -4.522  -32.861  90.786  1.00 36.09  ? 692  ASP A CA    1 
ATOM   5607  C  C     . ASP C 3  692  ? -3.041  -32.994  91.017  1.00 34.81  ? 692  ASP A C     1 
ATOM   5608  O  O     . ASP C 3  692  ? -2.583  -32.877  92.144  1.00 35.71  ? 692  ASP A O     1 
ATOM   5609  C  CB    . ASP C 3  692  ? -5.212  -34.155  91.187  1.00 39.58  ? 692  ASP A CB    1 
ATOM   5610  C  CG    . ASP C 3  692  ? -6.648  -33.927  91.602  1.00 46.66  ? 692  ASP A CG    1 
ATOM   5611  O  OD1   . ASP C 3  692  ? -7.106  -32.764  91.502  1.00 50.55  ? 692  ASP A OD1   1 
ATOM   5612  O  OD2   . ASP C 3  692  ? -7.314  -34.901  92.022  1.00 47.96  ? 692  ASP A OD2   1 
ATOM   5613  N  N     . VAL C 3  693  ? -2.293  -33.255  89.955  1.00 33.43  ? 693  VAL A N     1 
ATOM   5614  C  CA    . VAL C 3  693  ? -0.849  -33.341  90.072  1.00 31.99  ? 693  VAL A CA    1 
ATOM   5615  C  C     . VAL C 3  693  ? -0.418  -31.905  90.198  1.00 32.77  ? 693  VAL A C     1 
ATOM   5616  O  O     . VAL C 3  693  ? 0.258   -31.511  91.144  1.00 34.26  ? 693  VAL A O     1 
ATOM   5617  C  CB    . VAL C 3  693  ? -0.185  -33.842  88.802  1.00 30.12  ? 693  VAL A CB    1 
ATOM   5618  C  CG1   . VAL C 3  693  ? 1.313   -33.937  89.013  1.00 28.34  ? 693  VAL A CG1   1 
ATOM   5619  C  CG2   . VAL C 3  693  ? -0.761  -35.156  88.409  1.00 32.15  ? 693  VAL A CG2   1 
ATOM   5620  N  N     . THR C 3  694  ? -0.833  -31.123  89.215  1.00 33.21  ? 694  THR A N     1 
ATOM   5621  C  CA    . THR C 3  694  ? -0.484  -29.722  89.170  1.00 34.88  ? 694  THR A CA    1 
ATOM   5622  C  C     . THR C 3  694  ? -0.604  -29.021  90.518  1.00 36.29  ? 694  THR A C     1 
ATOM   5623  O  O     . THR C 3  694  ? 0.354   -28.411  90.977  1.00 36.78  ? 694  THR A O     1 
ATOM   5624  C  CB    . THR C 3  694  ? -1.335  -28.970  88.140  1.00 33.72  ? 694  THR A CB    1 
ATOM   5625  O  OG1   . THR C 3  694  ? -1.097  -29.494  86.822  1.00 27.33  ? 694  THR A OG1   1 
ATOM   5626  C  CG2   . THR C 3  694  ? -0.980  -27.499  88.174  1.00 34.58  ? 694  THR A CG2   1 
ATOM   5627  N  N     . LYS C 3  695  ? -1.768  -29.108  91.156  1.00 39.04  ? 695  LYS A N     1 
ATOM   5628  C  CA    . LYS C 3  695  ? -1.969  -28.450  92.451  1.00 40.04  ? 695  LYS A CA    1 
ATOM   5629  C  C     . LYS C 3  695  ? -0.988  -29.001  93.465  1.00 37.57  ? 695  LYS A C     1 
ATOM   5630  O  O     . LYS C 3  695  ? -0.443  -28.253  94.281  1.00 34.32  ? 695  LYS A O     1 
ATOM   5631  C  CB    . LYS C 3  695  ? -3.410  -28.639  92.957  1.00 43.66  ? 695  LYS A CB    1 
ATOM   5632  C  CG    . LYS C 3  695  ? -4.450  -27.763  92.269  1.00 47.23  ? 695  LYS A CG    1 
ATOM   5633  C  CD    . LYS C 3  695  ? -5.852  -28.172  92.680  1.00 56.61  ? 695  LYS A CD    1 
ATOM   5634  C  CE    . LYS C 3  695  ? -6.914  -27.460  91.841  1.00 64.03  ? 695  LYS A CE    1 
ATOM   5635  N  NZ    . LYS C 3  695  ? -8.299  -27.980  92.104  1.00 68.60  ? 695  LYS A NZ    1 
ATOM   5636  N  N     . GLU C 3  696  ? -0.770  -30.310  93.407  1.00 37.16  ? 696  GLU A N     1 
ATOM   5637  C  CA    . GLU C 3  696  ? 0.162   -30.953  94.315  1.00 39.96  ? 696  GLU A CA    1 
ATOM   5638  C  C     . GLU C 3  696  ? 1.493   -30.242  94.099  1.00 39.69  ? 696  GLU A C     1 
ATOM   5639  O  O     . GLU C 3  696  ? 2.031   -29.601  95.005  1.00 40.57  ? 696  GLU A O     1 
ATOM   5640  C  CB    . GLU C 3  696  ? 0.276   -32.445  93.984  1.00 43.20  ? 696  GLU A CB    1 
ATOM   5641  C  CG    . GLU C 3  696  ? 1.091   -33.285  94.967  1.00 52.10  ? 696  GLU A CG    1 
ATOM   5642  C  CD    . GLU C 3  696  ? 1.109   -34.787  94.618  1.00 58.59  ? 696  GLU A CD    1 
ATOM   5643  O  OE1   . GLU C 3  696  ? 0.057   -35.456  94.746  1.00 64.60  ? 696  GLU A OE1   1 
ATOM   5644  O  OE2   . GLU C 3  696  ? 2.174   -35.304  94.213  1.00 56.64  ? 696  GLU A OE2   1 
ATOM   5645  N  N     . ALA C 3  697  ? 2.003   -30.320  92.878  1.00 39.07  ? 697  ALA A N     1 
ATOM   5646  C  CA    . ALA C 3  697  ? 3.270   -29.684  92.542  1.00 38.33  ? 697  ALA A CA    1 
ATOM   5647  C  C     . ALA C 3  697  ? 3.384   -28.237  93.003  1.00 37.52  ? 697  ALA A C     1 
ATOM   5648  O  O     . ALA C 3  697  ? 4.402   -27.846  93.548  1.00 37.61  ? 697  ALA A O     1 
ATOM   5649  C  CB    . ALA C 3  697  ? 3.506   -29.763  91.045  1.00 37.46  ? 697  ALA A CB    1 
ATOM   5650  N  N     . GLN C 3  698  ? 2.341   -27.446  92.788  1.00 38.53  ? 698  GLN A N     1 
ATOM   5651  C  CA    . GLN C 3  698  ? 2.373   -26.037  93.161  1.00 41.67  ? 698  GLN A CA    1 
ATOM   5652  C  C     . GLN C 3  698  ? 2.412   -25.825  94.665  1.00 42.83  ? 698  GLN A C     1 
ATOM   5653  O  O     . GLN C 3  698  ? 2.674   -24.712  95.125  1.00 43.03  ? 698  GLN A O     1 
ATOM   5654  C  CB    . GLN C 3  698  ? 1.153   -25.290  92.601  1.00 46.13  ? 698  GLN A CB    1 
ATOM   5655  C  CG    . GLN C 3  698  ? 0.829   -25.551  91.130  1.00 51.13  ? 698  GLN A CG    1 
ATOM   5656  C  CD    . GLN C 3  698  ? -0.378  -24.757  90.634  1.00 54.24  ? 698  GLN A CD    1 
ATOM   5657  O  OE1   . GLN C 3  698  ? -1.465  -24.792  91.232  1.00 54.21  ? 698  GLN A OE1   1 
ATOM   5658  N  NE2   . GLN C 3  698  ? -0.192  -24.040  89.526  1.00 57.64  ? 698  GLN A NE2   1 
ATOM   5659  N  N     . ALA C 3  699  ? 2.135   -26.879  95.427  1.00 44.36  ? 699  ALA A N     1 
ATOM   5660  C  CA    . ALA C 3  699  ? 2.132   -26.785  96.889  1.00 46.24  ? 699  ALA A CA    1 
ATOM   5661  C  C     . ALA C 3  699  ? 3.498   -27.172  97.410  1.00 47.17  ? 699  ALA A C     1 
ATOM   5662  O  O     . ALA C 3  699  ? 3.774   -27.126  98.608  1.00 44.85  ? 699  ALA A O     1 
ATOM   5663  C  CB    . ALA C 3  699  ? 1.073   -27.700  97.473  1.00 47.19  ? 699  ALA A CB    1 
ATOM   5664  N  N     . ASN C 3  700  ? 4.349   -27.562  96.475  1.00 50.32  ? 700  ASN A N     1 
ATOM   5665  C  CA    . ASN C 3  700  ? 5.705   -27.961  96.782  1.00 54.26  ? 700  ASN A CA    1 
ATOM   5666  C  C     . ASN C 3  700  ? 5.713   -29.267  97.541  1.00 57.64  ? 700  ASN A C     1 
ATOM   5667  O  O     . ASN C 3  700  ? 6.728   -29.652  98.110  1.00 58.43  ? 700  ASN A O     1 
ATOM   5668  C  CB    . ASN C 3  700  ? 6.402   -26.875  97.592  1.00 50.86  ? 700  ASN A CB    1 
ATOM   5669  C  CG    . ASN C 3  700  ? 7.899   -26.965  97.499  1.00 48.86  ? 700  ASN A CG    1 
ATOM   5670  O  OD1   . ASN C 3  700  ? 8.454   -27.308  96.456  1.00 46.36  ? 700  ASN A OD1   1 
ATOM   5671  N  ND2   . ASN C 3  700  ? 8.567   -26.640  98.585  1.00 49.58  ? 700  ASN A ND2   1 
ATOM   5672  N  N     . LEU C 3  701  ? 4.577   -29.955  97.538  1.00 62.85  ? 701  LEU A N     1 
ATOM   5673  C  CA    . LEU C 3  701  ? 4.474   -31.235  98.223  1.00 68.48  ? 701  LEU A CA    1 
ATOM   5674  C  C     . LEU C 3  701  ? 5.178   -32.331  97.425  1.00 72.61  ? 701  LEU A C     1 
ATOM   5675  O  O     . LEU C 3  701  ? 5.756   -33.253  98.003  1.00 75.32  ? 701  LEU A O     1 
ATOM   5676  C  CB    . LEU C 3  701  ? 3.007   -31.612  98.440  1.00 67.14  ? 701  LEU A CB    1 
ATOM   5677  C  CG    . LEU C 3  701  ? 2.187   -30.666  99.321  1.00 66.86  ? 701  LEU A CG    1 
ATOM   5678  C  CD1   . LEU C 3  701  ? 0.821   -31.287  99.601  1.00 67.86  ? 701  LEU A CD1   1 
ATOM   5679  C  CD2   . LEU C 3  701  ? 2.928   -30.405  100.626 1.00 65.84  ? 701  LEU A CD2   1 
ATOM   5680  N  N     . LEU C 3  702  ? 5.137   -32.221  96.099  1.00 75.78  ? 702  LEU A N     1 
ATOM   5681  C  CA    . LEU C 3  702  ? 5.767   -33.211  95.231  1.00 79.19  ? 702  LEU A CA    1 
ATOM   5682  C  C     . LEU C 3  702  ? 7.146   -33.639  95.695  1.00 81.24  ? 702  LEU A C     1 
ATOM   5683  O  O     . LEU C 3  702  ? 7.919   -32.845  96.234  1.00 80.86  ? 702  LEU A O     1 
ATOM   5684  C  CB    . LEU C 3  702  ? 5.893   -32.691  93.792  1.00 81.53  ? 702  LEU A CB    1 
ATOM   5685  C  CG    . LEU C 3  702  ? 4.781   -32.955  92.769  1.00 83.41  ? 702  LEU A CG    1 
ATOM   5686  C  CD1   . LEU C 3  702  ? 5.283   -32.576  91.378  1.00 83.87  ? 702  LEU A CD1   1 
ATOM   5687  C  CD2   . LEU C 3  702  ? 4.393   -34.419  92.787  1.00 84.46  ? 702  LEU A CD2   1 
ATOM   5688  N  N     . THR C 3  703  ? 7.438   -34.914  95.478  1.00 84.11  ? 703  THR A N     1 
ATOM   5689  C  CA    . THR C 3  703  ? 8.731   -35.472  95.820  1.00 87.53  ? 703  THR A CA    1 
ATOM   5690  C  C     . THR C 3  703  ? 9.420   -35.719  94.483  1.00 89.79  ? 703  THR A C     1 
ATOM   5691  O  O     . THR C 3  703  ? 8.974   -36.556  93.693  1.00 89.86  ? 703  THR A O     1 
ATOM   5692  C  CB    . THR C 3  703  ? 8.598   -36.812  96.556  1.00 87.57  ? 703  THR A CB    1 
ATOM   5693  O  OG1   . THR C 3  703  ? 7.582   -36.709  97.562  1.00 86.57  ? 703  THR A OG1   1 
ATOM   5694  C  CG2   . THR C 3  703  ? 9.933   -37.184  97.212  1.00 88.13  ? 703  THR A CG2   1 
ATOM   5695  N  N     . ALA C 3  704  ? 10.489  -34.976  94.218  1.00 91.73  ? 704  ALA A N     1 
ATOM   5696  C  CA    . ALA C 3  704  ? 11.213  -35.139  92.968  1.00 93.05  ? 704  ALA A CA    1 
ATOM   5697  C  C     . ALA C 3  704  ? 11.968  -36.457  92.967  1.00 93.76  ? 704  ALA A C     1 
ATOM   5698  O  O     . ALA C 3  704  ? 12.713  -36.772  93.902  1.00 93.99  ? 704  ALA A O     1 
ATOM   5699  C  CB    . ALA C 3  704  ? 12.180  -33.991  92.766  1.00 94.77  ? 704  ALA A CB    1 
ATOM   5700  N  N     . LYS C 3  705  ? 11.756  -37.230  91.911  1.00 93.68  ? 705  LYS A N     1 
ATOM   5701  C  CA    . LYS C 3  705  ? 12.414  -38.515  91.748  1.00 93.04  ? 705  LYS A CA    1 
ATOM   5702  C  C     . LYS C 3  705  ? 13.898  -38.177  91.592  1.00 91.34  ? 705  LYS A C     1 
ATOM   5703  O  O     . LYS C 3  705  ? 14.245  -37.019  91.354  1.00 91.88  ? 705  LYS A O     1 
ATOM   5704  C  CB    . LYS C 3  705  ? 11.867  -39.187  90.487  1.00 96.87  ? 705  LYS A CB    1 
ATOM   5705  C  CG    . LYS C 3  705  ? 10.357  -38.971  90.295  1.00 99.87  ? 705  LYS A CG    1 
ATOM   5706  C  CD    . LYS C 3  705  ? 9.905   -39.253  88.866  1.00 101.34 ? 705  LYS A CD    1 
ATOM   5707  C  CE    . LYS C 3  705  ? 8.434   -38.894  88.665  1.00 101.30 ? 705  LYS A CE    1 
ATOM   5708  N  NZ    . LYS C 3  705  ? 7.993   -39.113  87.255  1.00 102.82 ? 705  LYS A NZ    1 
ATOM   5709  N  N     . HIS C 3  706  ? 14.778  -39.163  91.726  1.00 88.21  ? 706  HIS A N     1 
ATOM   5710  C  CA    . HIS C 3  706  ? 16.206  -38.886  91.592  1.00 84.37  ? 706  HIS A CA    1 
ATOM   5711  C  C     . HIS C 3  706  ? 16.587  -38.550  90.156  1.00 83.51  ? 706  HIS A C     1 
ATOM   5712  O  O     . HIS C 3  706  ? 16.009  -39.077  89.209  1.00 82.99  ? 706  HIS A O     1 
ATOM   5713  C  CB    . HIS C 3  706  ? 17.029  -40.082  92.061  1.00 82.03  ? 706  HIS A CB    1 
ATOM   5714  C  CG    . HIS C 3  706  ? 18.477  -39.769  92.276  1.00 77.49  ? 706  HIS A CG    1 
ATOM   5715  N  ND1   . HIS C 3  706  ? 18.907  -38.832  93.190  1.00 76.87  ? 706  HIS A ND1   1 
ATOM   5716  C  CD2   . HIS C 3  706  ? 19.595  -40.287  91.717  1.00 75.95  ? 706  HIS A CD2   1 
ATOM   5717  C  CE1   . HIS C 3  706  ? 20.227  -38.788  93.187  1.00 74.82  ? 706  HIS A CE1   1 
ATOM   5718  N  NE2   . HIS C 3  706  ? 20.669  -39.662  92.302  1.00 73.36  ? 706  HIS A NE2   1 
ATOM   5719  N  N     . GLY C 3  707  ? 17.559  -37.660  89.999  1.00 83.67  ? 707  GLY A N     1 
ATOM   5720  C  CA    . GLY C 3  707  ? 18.012  -37.283  88.669  1.00 84.01  ? 707  GLY A CA    1 
ATOM   5721  C  C     . GLY C 3  707  ? 17.100  -36.403  87.823  1.00 83.36  ? 707  GLY A C     1 
ATOM   5722  O  O     . GLY C 3  707  ? 17.482  -35.999  86.723  1.00 84.30  ? 707  GLY A O     1 
ATOM   5723  N  N     . MET C 3  708  ? 15.907  -36.091  88.318  1.00 81.36  ? 708  MET A N     1 
ATOM   5724  C  CA    . MET C 3  708  ? 14.978  -35.259  87.563  1.00 78.48  ? 708  MET A CA    1 
ATOM   5725  C  C     . MET C 3  708  ? 14.522  -34.013  88.315  1.00 74.93  ? 708  MET A C     1 
ATOM   5726  O  O     . MET C 3  708  ? 14.368  -34.034  89.537  1.00 74.05  ? 708  MET A O     1 
ATOM   5727  C  CB    . MET C 3  708  ? 13.742  -36.071  87.190  1.00 83.83  ? 708  MET A CB    1 
ATOM   5728  C  CG    . MET C 3  708  ? 13.981  -37.174  86.188  1.00 90.60  ? 708  MET A CG    1 
ATOM   5729  S  SD    . MET C 3  708  ? 12.483  -38.158  85.937  1.00 97.91  ? 708  MET A SD    1 
ATOM   5730  C  CE    . MET C 3  708  ? 12.939  -39.700  86.762  1.00 97.10  ? 708  MET A CE    1 
ATOM   5731  N  N     . THR C 3  709  ? 14.295  -32.930  87.579  1.00 70.41  ? 709  THR A N     1 
ATOM   5732  C  CA    . THR C 3  709  ? 13.821  -31.701  88.194  1.00 65.61  ? 709  THR A CA    1 
ATOM   5733  C  C     . THR C 3  709  ? 12.393  -31.970  88.624  1.00 64.55  ? 709  THR A C     1 
ATOM   5734  O  O     . THR C 3  709  ? 11.654  -32.666  87.925  1.00 64.17  ? 709  THR A O     1 
ATOM   5735  C  CB    . THR C 3  709  ? 13.726  -30.538  87.205  1.00 64.47  ? 709  THR A CB    1 
ATOM   5736  O  OG1   . THR C 3  709  ? 14.792  -30.602  86.255  1.00 63.51  ? 709  THR A OG1   1 
ATOM   5737  C  CG2   . THR C 3  709  ? 13.782  -29.232  87.957  1.00 63.09  ? 709  THR A CG2   1 
ATOM   5738  N  N     . LEU C 3  710  ? 11.991  -31.414  89.760  1.00 62.54  ? 710  LEU A N     1 
ATOM   5739  C  CA    . LEU C 3  710  ? 10.622  -31.592  90.217  1.00 60.26  ? 710  LEU A CA    1 
ATOM   5740  C  C     . LEU C 3  710  ? 9.772   -31.144  89.042  1.00 58.43  ? 710  LEU A C     1 
ATOM   5741  O  O     . LEU C 3  710  ? 8.633   -31.569  88.865  1.00 59.50  ? 710  LEU A O     1 
ATOM   5742  C  CB    . LEU C 3  710  ? 10.340  -30.704  91.423  1.00 62.04  ? 710  LEU A CB    1 
ATOM   5743  C  CG    . LEU C 3  710  ? 11.181  -30.987  92.669  1.00 67.14  ? 710  LEU A CG    1 
ATOM   5744  C  CD1   . LEU C 3  710  ? 12.643  -30.605  92.433  1.00 70.45  ? 710  LEU A CD1   1 
ATOM   5745  C  CD2   . LEU C 3  710  ? 10.616  -30.203  93.839  1.00 71.52  ? 710  LEU A CD2   1 
ATOM   5746  N  N     . ARG C 3  711  ? 10.363  -30.279  88.232  1.00 55.00  ? 711  ARG A N     1 
ATOM   5747  C  CA    . ARG C 3  711  ? 9.716   -29.746  87.056  1.00 51.64  ? 711  ARG A CA    1 
ATOM   5748  C  C     . ARG C 3  711  ? 9.685   -30.848  86.010  1.00 50.41  ? 711  ARG A C     1 
ATOM   5749  O  O     . ARG C 3  711  ? 8.668   -31.084  85.371  1.00 52.02  ? 711  ARG A O     1 
ATOM   5750  C  CB    . ARG C 3  711  ? 10.522  -28.555  86.547  1.00 51.87  ? 711  ARG A CB    1 
ATOM   5751  C  CG    . ARG C 3  711  ? 9.729   -27.513  85.810  1.00 52.97  ? 711  ARG A CG    1 
ATOM   5752  C  CD    . ARG C 3  711  ? 10.110  -26.142  86.319  1.00 52.20  ? 711  ARG A CD    1 
ATOM   5753  N  NE    . ARG C 3  711  ? 9.128   -25.147  85.923  1.00 57.86  ? 711  ARG A NE    1 
ATOM   5754  C  CZ    . ARG C 3  711  ? 8.860   -24.055  86.627  1.00 60.86  ? 711  ARG A CZ    1 
ATOM   5755  N  NH1   . ARG C 3  711  ? 9.509   -23.834  87.762  1.00 62.92  ? 711  ARG A NH1   1 
ATOM   5756  N  NH2   . ARG C 3  711  ? 7.947   -23.189  86.200  1.00 61.86  ? 711  ARG A NH2   1 
ATOM   5757  N  N     . GLU C 3  712  ? 10.805  -31.534  85.840  1.00 48.87  ? 712  GLU A N     1 
ATOM   5758  C  CA    . GLU C 3  712  ? 10.862  -32.590  84.855  1.00 47.69  ? 712  GLU A CA    1 
ATOM   5759  C  C     . GLU C 3  712  ? 9.859   -33.645  85.223  1.00 47.35  ? 712  GLU A C     1 
ATOM   5760  O  O     . GLU C 3  712  ? 9.026   -34.034  84.403  1.00 48.48  ? 712  GLU A O     1 
ATOM   5761  C  CB    . GLU C 3  712  ? 12.256  -33.193  84.785  1.00 48.52  ? 712  GLU A CB    1 
ATOM   5762  C  CG    . GLU C 3  712  ? 13.303  -32.209  84.322  1.00 51.92  ? 712  GLU A CG    1 
ATOM   5763  C  CD    . GLU C 3  712  ? 14.519  -32.897  83.761  1.00 56.48  ? 712  GLU A CD    1 
ATOM   5764  O  OE1   . GLU C 3  712  ? 15.096  -33.758  84.468  1.00 57.92  ? 712  GLU A OE1   1 
ATOM   5765  O  OE2   . GLU C 3  712  ? 14.894  -32.575  82.611  1.00 57.67  ? 712  GLU A OE2   1 
ATOM   5766  N  N     . SER C 3  713  ? 9.921   -34.109  86.462  1.00 46.85  ? 713  SER A N     1 
ATOM   5767  C  CA    . SER C 3  713  ? 8.977   -35.128  86.894  1.00 47.14  ? 713  SER A CA    1 
ATOM   5768  C  C     . SER C 3  713  ? 7.536   -34.668  86.651  1.00 44.66  ? 713  SER A C     1 
ATOM   5769  O  O     . SER C 3  713  ? 6.718   -35.437  86.158  1.00 45.29  ? 713  SER A O     1 
ATOM   5770  C  CB    . SER C 3  713  ? 9.202   -35.485  88.369  1.00 48.72  ? 713  SER A CB    1 
ATOM   5771  O  OG    . SER C 3  713  ? 9.467   -34.332  89.147  1.00 55.48  ? 713  SER A OG    1 
ATOM   5772  N  N     . PHE C 3  714  ? 7.225   -33.417  86.971  1.00 41.68  ? 714  PHE A N     1 
ATOM   5773  C  CA    . PHE C 3  714  ? 5.875   -32.921  86.746  1.00 39.02  ? 714  PHE A CA    1 
ATOM   5774  C  C     . PHE C 3  714  ? 5.432   -33.198  85.312  1.00 40.11  ? 714  PHE A C     1 
ATOM   5775  O  O     . PHE C 3  714  ? 4.458   -33.920  85.079  1.00 39.11  ? 714  PHE A O     1 
ATOM   5776  C  CB    . PHE C 3  714  ? 5.799   -31.421  86.987  1.00 35.63  ? 714  PHE A CB    1 
ATOM   5777  C  CG    . PHE C 3  714  ? 4.510   -30.817  86.531  1.00 34.98  ? 714  PHE A CG    1 
ATOM   5778  C  CD1   . PHE C 3  714  ? 3.370   -30.918  87.314  1.00 35.18  ? 714  PHE A CD1   1 
ATOM   5779  C  CD2   . PHE C 3  714  ? 4.418   -30.208  85.287  1.00 33.19  ? 714  PHE A CD2   1 
ATOM   5780  C  CE1   . PHE C 3  714  ? 2.158   -30.425  86.868  1.00 33.72  ? 714  PHE A CE1   1 
ATOM   5781  C  CE2   . PHE C 3  714  ? 3.213   -29.715  84.833  1.00 32.31  ? 714  PHE A CE2   1 
ATOM   5782  C  CZ    . PHE C 3  714  ? 2.079   -29.825  85.627  1.00 33.77  ? 714  PHE A CZ    1 
ATOM   5783  N  N     . GLU C 3  715  ? 6.150   -32.601  84.359  1.00 40.17  ? 715  GLU A N     1 
ATOM   5784  C  CA    . GLU C 3  715  ? 5.864   -32.762  82.931  1.00 39.95  ? 715  GLU A CA    1 
ATOM   5785  C  C     . GLU C 3  715  ? 5.670   -34.219  82.560  1.00 39.61  ? 715  GLU A C     1 
ATOM   5786  O  O     . GLU C 3  715  ? 4.617   -34.618  82.061  1.00 38.59  ? 715  GLU A O     1 
ATOM   5787  C  CB    . GLU C 3  715  ? 7.009   -32.205  82.078  1.00 38.84  ? 715  GLU A CB    1 
ATOM   5788  C  CG    . GLU C 3  715  ? 6.888   -30.740  81.719  1.00 41.29  ? 715  GLU A CG    1 
ATOM   5789  C  CD    . GLU C 3  715  ? 5.769   -30.467  80.734  1.00 38.99  ? 715  GLU A CD    1 
ATOM   5790  O  OE1   . GLU C 3  715  ? 5.809   -31.000  79.611  1.00 37.06  ? 715  GLU A OE1   1 
ATOM   5791  O  OE2   . GLU C 3  715  ? 4.846   -29.712  81.083  1.00 41.64  ? 715  GLU A OE2   1 
ATOM   5792  N  N     . ASP C 3  716  ? 6.700   -35.015  82.802  1.00 38.50  ? 716  ASP A N     1 
ATOM   5793  C  CA    . ASP C 3  716  ? 6.619   -36.407  82.459  1.00 37.77  ? 716  ASP A CA    1 
ATOM   5794  C  C     . ASP C 3  716  ? 5.313   -37.040  82.923  1.00 34.82  ? 716  ASP A C     1 
ATOM   5795  O  O     . ASP C 3  716  ? 4.716   -37.819  82.193  1.00 34.90  ? 716  ASP A O     1 
ATOM   5796  C  CB    . ASP C 3  716  ? 7.813   -37.159  83.023  1.00 42.99  ? 716  ASP A CB    1 
ATOM   5797  C  CG    . ASP C 3  716  ? 8.112   -38.413  82.236  1.00 51.19  ? 716  ASP A CG    1 
ATOM   5798  O  OD1   . ASP C 3  716  ? 7.723   -39.519  82.683  1.00 50.79  ? 716  ASP A OD1   1 
ATOM   5799  O  OD2   . ASP C 3  716  ? 8.720   -38.278  81.146  1.00 57.34  ? 716  ASP A OD2   1 
ATOM   5800  N  N     . ASN C 3  717  ? 4.851   -36.703  84.120  1.00 31.83  ? 717  ASN A N     1 
ATOM   5801  C  CA    . ASN C 3  717  ? 3.607   -37.279  84.609  1.00 29.12  ? 717  ASN A CA    1 
ATOM   5802  C  C     . ASN C 3  717  ? 2.473   -36.950  83.655  1.00 26.32  ? 717  ASN A C     1 
ATOM   5803  O  O     . ASN C 3  717  ? 1.920   -37.815  82.991  1.00 24.05  ? 717  ASN A O     1 
ATOM   5804  C  CB    . ASN C 3  717  ? 3.265   -36.742  86.000  1.00 32.31  ? 717  ASN A CB    1 
ATOM   5805  C  CG    . ASN C 3  717  ? 4.020   -37.457  87.112  1.00 39.11  ? 717  ASN A CG    1 
ATOM   5806  O  OD1   . ASN C 3  717  ? 4.239   -38.672  87.051  1.00 40.28  ? 717  ASN A OD1   1 
ATOM   5807  N  ND2   . ASN C 3  717  ? 4.399   -36.709  88.152  1.00 41.74  ? 717  ASN A ND2   1 
ATOM   5808  N  N     . VAL C 3  718  ? 2.139   -35.674  83.591  1.00 26.21  ? 718  VAL A N     1 
ATOM   5809  C  CA    . VAL C 3  718  ? 1.071   -35.198  82.732  1.00 24.60  ? 718  VAL A CA    1 
ATOM   5810  C  C     . VAL C 3  718  ? 1.112   -35.834  81.356  1.00 25.20  ? 718  VAL A C     1 
ATOM   5811  O  O     . VAL C 3  718  ? 0.089   -36.245  80.828  1.00 27.02  ? 718  VAL A O     1 
ATOM   5812  C  CB    . VAL C 3  718  ? 1.162   -33.685  82.533  1.00 23.91  ? 718  VAL A CB    1 
ATOM   5813  C  CG1   . VAL C 3  718  ? -0.030  -33.214  81.740  1.00 19.21  ? 718  VAL A CG1   1 
ATOM   5814  C  CG2   . VAL C 3  718  ? 1.282   -32.970  83.887  1.00 22.23  ? 718  VAL A CG2   1 
ATOM   5815  N  N     . VAL C 3  719  ? 2.297   -35.907  80.768  1.00 26.45  ? 719  VAL A N     1 
ATOM   5816  C  CA    . VAL C 3  719  ? 2.433   -36.477  79.433  1.00 26.74  ? 719  VAL A CA    1 
ATOM   5817  C  C     . VAL C 3  719  ? 2.013   -37.927  79.411  1.00 27.82  ? 719  VAL A C     1 
ATOM   5818  O  O     . VAL C 3  719  ? 1.410   -38.395  78.450  1.00 26.38  ? 719  VAL A O     1 
ATOM   5819  C  CB    . VAL C 3  719  ? 3.865   -36.410  78.942  1.00 23.17  ? 719  VAL A CB    1 
ATOM   5820  C  CG1   . VAL C 3  719  ? 3.899   -36.757  77.494  1.00 22.61  ? 719  VAL A CG1   1 
ATOM   5821  C  CG2   . VAL C 3  719  ? 4.426   -35.039  79.174  1.00 21.80  ? 719  VAL A CG2   1 
ATOM   5822  N  N     . ARG C 3  720  ? 2.361   -38.630  80.482  1.00 32.33  ? 720  ARG A N     1 
ATOM   5823  C  CA    . ARG C 3  720  ? 2.038   -40.041  80.647  1.00 35.12  ? 720  ARG A CA    1 
ATOM   5824  C  C     . ARG C 3  720  ? 0.524   -40.108  80.825  1.00 31.99  ? 720  ARG A C     1 
ATOM   5825  O  O     . ARG C 3  720  ? -0.158  -40.860  80.135  1.00 31.52  ? 720  ARG A O     1 
ATOM   5826  C  CB    . ARG C 3  720  ? 2.749   -40.582  81.892  1.00 43.77  ? 720  ARG A CB    1 
ATOM   5827  C  CG    . ARG C 3  720  ? 3.284   -42.009  81.779  1.00 58.56  ? 720  ARG A CG    1 
ATOM   5828  C  CD    . ARG C 3  720  ? 3.916   -42.446  83.101  1.00 68.58  ? 720  ARG A CD    1 
ATOM   5829  N  NE    . ARG C 3  720  ? 2.940   -42.401  84.188  1.00 79.44  ? 720  ARG A NE    1 
ATOM   5830  C  CZ    . ARG C 3  720  ? 3.252   -42.271  85.475  1.00 85.52  ? 720  ARG A CZ    1 
ATOM   5831  N  NH1   . ARG C 3  720  ? 4.526   -42.172  85.842  1.00 88.66  ? 720  ARG A NH1   1 
ATOM   5832  N  NH2   . ARG C 3  720  ? 2.290   -42.226  86.394  1.00 86.95  ? 720  ARG A NH2   1 
ATOM   5833  N  N     . PHE C 3  721  ? 0.014   -39.302  81.750  1.00 28.70  ? 721  PHE A N     1 
ATOM   5834  C  CA    . PHE C 3  721  ? -1.412  -39.233  82.020  1.00 27.79  ? 721  PHE A CA    1 
ATOM   5835  C  C     . PHE C 3  721  ? -2.198  -39.023  80.744  1.00 28.56  ? 721  PHE A C     1 
ATOM   5836  O  O     . PHE C 3  721  ? -3.197  -39.684  80.510  1.00 32.17  ? 721  PHE A O     1 
ATOM   5837  C  CB    . PHE C 3  721  ? -1.732  -38.063  82.946  1.00 27.31  ? 721  PHE A CB    1 
ATOM   5838  C  CG    . PHE C 3  721  ? -1.463  -38.334  84.382  1.00 29.67  ? 721  PHE A CG    1 
ATOM   5839  C  CD1   . PHE C 3  721  ? -1.262  -37.285  85.261  1.00 32.66  ? 721  PHE A CD1   1 
ATOM   5840  C  CD2   . PHE C 3  721  ? -1.411  -39.632  84.865  1.00 33.57  ? 721  PHE A CD2   1 
ATOM   5841  C  CE1   . PHE C 3  721  ? -1.008  -37.523  86.591  1.00 33.94  ? 721  PHE A CE1   1 
ATOM   5842  C  CE2   . PHE C 3  721  ? -1.159  -39.878  86.197  1.00 34.01  ? 721  PHE A CE2   1 
ATOM   5843  C  CZ    . PHE C 3  721  ? -0.955  -38.817  87.064  1.00 35.81  ? 721  PHE A CZ    1 
ATOM   5844  N  N     . LEU C 3  722  ? -1.759  -38.084  79.924  1.00 26.90  ? 722  LEU A N     1 
ATOM   5845  C  CA    . LEU C 3  722  ? -2.479  -37.806  78.710  1.00 27.81  ? 722  LEU A CA    1 
ATOM   5846  C  C     . LEU C 3  722  ? -2.324  -38.888  77.672  1.00 31.08  ? 722  LEU A C     1 
ATOM   5847  O  O     . LEU C 3  722  ? -3.265  -39.190  76.946  1.00 32.98  ? 722  LEU A O     1 
ATOM   5848  C  CB    . LEU C 3  722  ? -2.047  -36.466  78.142  1.00 26.63  ? 722  LEU A CB    1 
ATOM   5849  C  CG    . LEU C 3  722  ? -2.474  -35.275  78.992  1.00 28.41  ? 722  LEU A CG    1 
ATOM   5850  C  CD1   . LEU C 3  722  ? -2.169  -34.008  78.242  1.00 28.71  ? 722  LEU A CD1   1 
ATOM   5851  C  CD2   . LEU C 3  722  ? -3.962  -35.350  79.298  1.00 30.67  ? 722  LEU A CD2   1 
ATOM   5852  N  N     . ASN C 3  723  ? -1.146  -39.481  77.581  1.00 34.03  ? 723  ASN A N     1 
ATOM   5853  C  CA    . ASN C 3  723  ? -0.985  -40.527  76.594  1.00 37.96  ? 723  ASN A CA    1 
ATOM   5854  C  C     . ASN C 3  723  ? -1.943  -41.657  76.919  1.00 40.20  ? 723  ASN A C     1 
ATOM   5855  O  O     . ASN C 3  723  ? -2.741  -42.056  76.069  1.00 41.85  ? 723  ASN A O     1 
ATOM   5856  C  CB    . ASN C 3  723  ? 0.462   -41.010  76.539  1.00 39.58  ? 723  ASN A CB    1 
ATOM   5857  C  CG    . ASN C 3  723  ? 1.341   -40.068  75.741  1.00 43.47  ? 723  ASN A CG    1 
ATOM   5858  O  OD1   . ASN C 3  723  ? 0.986   -39.668  74.630  1.00 46.58  ? 723  ASN A OD1   1 
ATOM   5859  N  ND2   . ASN C 3  723  ? 2.487   -39.707  76.295  1.00 45.05  ? 723  ASN A ND2   1 
ATOM   5860  N  N     . GLU C 3  724  ? -1.889  -42.158  78.151  1.00 42.01  ? 724  GLU A N     1 
ATOM   5861  C  CA    . GLU C 3  724  ? -2.790  -43.233  78.565  1.00 42.46  ? 724  GLU A CA    1 
ATOM   5862  C  C     . GLU C 3  724  ? -4.222  -42.869  78.189  1.00 39.75  ? 724  GLU A C     1 
ATOM   5863  O  O     . GLU C 3  724  ? -4.911  -43.661  77.556  1.00 39.21  ? 724  GLU A O     1 
ATOM   5864  C  CB    . GLU C 3  724  ? -2.695  -43.470  80.074  1.00 48.56  ? 724  GLU A CB    1 
ATOM   5865  C  CG    . GLU C 3  724  ? -1.431  -44.208  80.525  1.00 58.15  ? 724  GLU A CG    1 
ATOM   5866  C  CD    . GLU C 3  724  ? -1.289  -44.261  82.048  1.00 66.88  ? 724  GLU A CD    1 
ATOM   5867  O  OE1   . GLU C 3  724  ? -2.312  -44.481  82.748  1.00 68.53  ? 724  GLU A OE1   1 
ATOM   5868  O  OE2   . GLU C 3  724  ? -0.147  -44.091  82.541  1.00 70.60  ? 724  GLU A OE2   1 
ATOM   5869  N  N     . ALA C 3  725  ? -4.651  -41.664  78.567  1.00 37.16  ? 725  ALA A N     1 
ATOM   5870  C  CA    . ALA C 3  725  ? -5.993  -41.181  78.265  1.00 35.05  ? 725  ALA A CA    1 
ATOM   5871  C  C     . ALA C 3  725  ? -6.306  -41.468  76.818  1.00 37.04  ? 725  ALA A C     1 
ATOM   5872  O  O     . ALA C 3  725  ? -7.279  -42.157  76.520  1.00 38.94  ? 725  ALA A O     1 
ATOM   5873  C  CB    . ALA C 3  725  ? -6.096  -39.697  78.516  1.00 32.57  ? 725  ALA A CB    1 
ATOM   5874  N  N     . ARG C 3  726  ? -5.476  -40.949  75.916  1.00 37.83  ? 726  ARG A N     1 
ATOM   5875  C  CA    . ARG C 3  726  ? -5.685  -41.161  74.486  1.00 37.96  ? 726  ARG A CA    1 
ATOM   5876  C  C     . ARG C 3  726  ? -5.822  -42.632  74.165  1.00 39.01  ? 726  ARG A C     1 
ATOM   5877  O  O     . ARG C 3  726  ? -6.776  -43.056  73.519  1.00 39.68  ? 726  ARG A O     1 
ATOM   5878  C  CB    . ARG C 3  726  ? -4.520  -40.620  73.667  1.00 35.62  ? 726  ARG A CB    1 
ATOM   5879  C  CG    . ARG C 3  726  ? -4.651  -40.929  72.180  1.00 37.45  ? 726  ARG A CG    1 
ATOM   5880  C  CD    . ARG C 3  726  ? -3.355  -40.656  71.436  1.00 43.59  ? 726  ARG A CD    1 
ATOM   5881  N  NE    . ARG C 3  726  ? -2.336  -41.664  71.722  1.00 48.41  ? 726  ARG A NE    1 
ATOM   5882  C  CZ    . ARG C 3  726  ? -1.027  -41.429  71.739  1.00 49.14  ? 726  ARG A CZ    1 
ATOM   5883  N  NH1   . ARG C 3  726  ? -0.555  -40.213  71.490  1.00 46.07  ? 726  ARG A NH1   1 
ATOM   5884  N  NH2   . ARG C 3  726  ? -0.188  -42.415  72.014  1.00 52.69  ? 726  ARG A NH2   1 
ATOM   5885  N  N     . ASP C 3  727  ? -4.850  -43.407  74.623  1.00 40.12  ? 727  ASP A N     1 
ATOM   5886  C  CA    . ASP C 3  727  ? -4.842  -44.825  74.351  1.00 41.76  ? 727  ASP A CA    1 
ATOM   5887  C  C     . ASP C 3  727  ? -6.064  -45.557  74.873  1.00 42.21  ? 727  ASP A C     1 
ATOM   5888  O  O     . ASP C 3  727  ? -6.536  -46.475  74.215  1.00 42.62  ? 727  ASP A O     1 
ATOM   5889  C  CB    . ASP C 3  727  ? -3.540  -45.444  74.873  1.00 44.97  ? 727  ASP A CB    1 
ATOM   5890  C  CG    . ASP C 3  727  ? -2.344  -45.199  73.928  1.00 47.55  ? 727  ASP A CG    1 
ATOM   5891  O  OD1   . ASP C 3  727  ? -2.403  -44.278  73.085  1.00 48.24  ? 727  ASP A OD1   1 
ATOM   5892  O  OD2   . ASP C 3  727  ? -1.332  -45.924  74.032  1.00 51.02  ? 727  ASP A OD2   1 
ATOM   5893  N  N     . LYS C 3  728  ? -6.604  -45.165  76.027  1.00 44.08  ? 728  LYS A N     1 
ATOM   5894  C  CA    . LYS C 3  728  ? -7.798  -45.861  76.523  1.00 45.86  ? 728  LYS A CA    1 
ATOM   5895  C  C     . LYS C 3  728  ? -9.066  -45.406  75.815  1.00 42.53  ? 728  LYS A C     1 
ATOM   5896  O  O     . LYS C 3  728  ? -9.911  -46.240  75.484  1.00 42.98  ? 728  LYS A O     1 
ATOM   5897  C  CB    . LYS C 3  728  ? -7.952  -45.766  78.059  1.00 51.65  ? 728  LYS A CB    1 
ATOM   5898  C  CG    . LYS C 3  728  ? -7.804  -44.400  78.700  1.00 64.49  ? 728  LYS A CG    1 
ATOM   5899  C  CD    . LYS C 3  728  ? -7.601  -44.547  80.230  1.00 75.21  ? 728  LYS A CD    1 
ATOM   5900  C  CE    . LYS C 3  728  ? -7.299  -43.196  80.925  1.00 81.75  ? 728  LYS A CE    1 
ATOM   5901  N  NZ    . LYS C 3  728  ? -7.028  -43.306  82.403  1.00 83.32  ? 728  LYS A NZ    1 
ATOM   5902  N  N     . ALA C 3  729  ? -9.208  -44.105  75.569  1.00 39.11  ? 729  ALA A N     1 
ATOM   5903  C  CA    . ALA C 3  729  ? -10.379 -43.623  74.839  1.00 35.89  ? 729  ALA A CA    1 
ATOM   5904  C  C     . ALA C 3  729  ? -10.324 -44.362  73.505  1.00 36.72  ? 729  ALA A C     1 
ATOM   5905  O  O     . ALA C 3  729  ? -11.343 -44.828  72.983  1.00 35.46  ? 729  ALA A O     1 
ATOM   5906  C  CB    . ALA C 3  729  ? -10.288 -42.145  74.607  1.00 29.30  ? 729  ALA A CB    1 
ATOM   5907  N  N     . GLY C 3  730  ? -9.109  -44.475  72.971  1.00 37.06  ? 730  GLY A N     1 
ATOM   5908  C  CA    . GLY C 3  730  ? -8.904  -45.175  71.722  1.00 36.27  ? 730  GLY A CA    1 
ATOM   5909  C  C     . GLY C 3  730  ? -9.345  -46.621  71.861  1.00 37.52  ? 730  GLY A C     1 
ATOM   5910  O  O     . GLY C 3  730  ? -10.195 -47.092  71.108  1.00 38.18  ? 730  GLY A O     1 
ATOM   5911  N  N     . ARG C 3  731  ? -8.776  -47.341  72.820  1.00 38.05  ? 731  ARG A N     1 
ATOM   5912  C  CA    . ARG C 3  731  ? -9.164  -48.732  73.003  1.00 38.31  ? 731  ARG A CA    1 
ATOM   5913  C  C     . ARG C 3  731  ? -10.671 -48.767  73.153  1.00 34.21  ? 731  ARG A C     1 
ATOM   5914  O  O     . ARG C 3  731  ? -11.352 -49.535  72.482  1.00 32.22  ? 731  ARG A O     1 
ATOM   5915  C  CB    . ARG C 3  731  ? -8.471  -49.321  74.228  1.00 44.33  ? 731  ARG A CB    1 
ATOM   5916  C  CG    . ARG C 3  731  ? -6.985  -49.566  74.005  1.00 56.08  ? 731  ARG A CG    1 
ATOM   5917  C  CD    . ARG C 3  731  ? -6.258  -49.771  75.327  1.00 70.55  ? 731  ARG A CD    1 
ATOM   5918  N  NE    . ARG C 3  731  ? -4.804  -49.778  75.172  1.00 81.45  ? 731  ARG A NE    1 
ATOM   5919  C  CZ    . ARG C 3  731  ? -3.944  -49.767  76.188  1.00 86.81  ? 731  ARG A CZ    1 
ATOM   5920  N  NH1   . ARG C 3  731  ? -4.389  -49.747  77.442  1.00 88.92  ? 731  ARG A NH1   1 
ATOM   5921  N  NH2   . ARG C 3  731  ? -2.636  -49.773  75.953  1.00 89.90  ? 731  ARG A NH2   1 
ATOM   5922  N  N     . LEU C 3  732  ? -11.190 -47.910  74.017  1.00 32.15  ? 732  LEU A N     1 
ATOM   5923  C  CA    . LEU C 3  732  ? -12.621 -47.831  74.216  1.00 31.37  ? 732  LEU A CA    1 
ATOM   5924  C  C     . LEU C 3  732  ? -13.347 -47.828  72.878  1.00 33.85  ? 732  LEU A C     1 
ATOM   5925  O  O     . LEU C 3  732  ? -14.369 -48.493  72.720  1.00 35.93  ? 732  LEU A O     1 
ATOM   5926  C  CB    . LEU C 3  732  ? -12.986 -46.559  74.968  1.00 27.03  ? 732  LEU A CB    1 
ATOM   5927  C  CG    . LEU C 3  732  ? -12.916 -46.561  76.486  1.00 24.14  ? 732  LEU A CG    1 
ATOM   5928  C  CD1   . LEU C 3  732  ? -13.482 -45.242  77.008  1.00 26.49  ? 732  LEU A CD1   1 
ATOM   5929  C  CD2   . LEU C 3  732  ? -13.719 -47.715  77.027  1.00 23.00  ? 732  LEU A CD2   1 
ATOM   5930  N  N     . ALA C 3  733  ? -12.829 -47.069  71.915  1.00 35.28  ? 733  ALA A N     1 
ATOM   5931  C  CA    . ALA C 3  733  ? -13.454 -46.992  70.595  1.00 35.31  ? 733  ALA A CA    1 
ATOM   5932  C  C     . ALA C 3  733  ? -13.293 -48.294  69.816  1.00 37.28  ? 733  ALA A C     1 
ATOM   5933  O  O     . ALA C 3  733  ? -14.254 -48.810  69.253  1.00 34.67  ? 733  ALA A O     1 
ATOM   5934  C  CB    . ALA C 3  733  ? -12.857 -45.841  69.809  1.00 30.20  ? 733  ALA A CB    1 
ATOM   5935  N  N     . GLU C 3  734  ? -12.076 -48.831  69.798  1.00 41.26  ? 734  GLU A N     1 
ATOM   5936  C  CA    . GLU C 3  734  ? -11.808 -50.061  69.073  1.00 45.86  ? 734  GLU A CA    1 
ATOM   5937  C  C     . GLU C 3  734  ? -12.744 -51.216  69.389  1.00 46.62  ? 734  GLU A C     1 
ATOM   5938  O  O     . GLU C 3  734  ? -12.992 -52.057  68.524  1.00 49.28  ? 734  GLU A O     1 
ATOM   5939  C  CB    . GLU C 3  734  ? -10.371 -50.531  69.293  1.00 50.84  ? 734  GLU A CB    1 
ATOM   5940  C  CG    . GLU C 3  734  ? -10.164 -51.973  68.822  1.00 59.05  ? 734  GLU A CG    1 
ATOM   5941  C  CD    . GLU C 3  734  ? -8.716  -52.338  68.582  1.00 63.39  ? 734  GLU A CD    1 
ATOM   5942  O  OE1   . GLU C 3  734  ? -7.909  -52.245  69.534  1.00 65.56  ? 734  GLU A OE1   1 
ATOM   5943  O  OE2   . GLU C 3  734  ? -8.393  -52.724  67.435  1.00 65.65  ? 734  GLU A OE2   1 
ATOM   5944  N  N     . VAL C 3  735  ? -13.258 -51.275  70.613  1.00 46.89  ? 735  VAL A N     1 
ATOM   5945  C  CA    . VAL C 3  735  ? -14.158 -52.368  70.976  1.00 47.08  ? 735  VAL A CA    1 
ATOM   5946  C  C     . VAL C 3  735  ? -15.532 -52.269  70.322  1.00 47.71  ? 735  VAL A C     1 
ATOM   5947  O  O     . VAL C 3  735  ? -16.110 -53.298  69.967  1.00 49.53  ? 735  VAL A O     1 
ATOM   5948  C  CB    . VAL C 3  735  ? -14.361 -52.480  72.492  1.00 45.13  ? 735  VAL A CB    1 
ATOM   5949  C  CG1   . VAL C 3  735  ? -15.235 -53.680  72.793  1.00 46.08  ? 735  VAL A CG1   1 
ATOM   5950  C  CG2   . VAL C 3  735  ? -13.026 -52.629  73.188  1.00 45.26  ? 735  VAL A CG2   1 
ATOM   5951  N  N     . ASN C 3  736  ? -16.063 -51.056  70.173  1.00 46.47  ? 736  ASN A N     1 
ATOM   5952  C  CA    . ASN C 3  736  ? -17.362 -50.899  69.527  1.00 47.28  ? 736  ASN A CA    1 
ATOM   5953  C  C     . ASN C 3  736  ? -17.260 -51.535  68.179  1.00 47.45  ? 736  ASN A C     1 
ATOM   5954  O  O     . ASN C 3  736  ? -17.913 -52.531  67.884  1.00 51.97  ? 736  ASN A O     1 
ATOM   5955  C  CB    . ASN C 3  736  ? -17.717 -49.446  69.290  1.00 48.73  ? 736  ASN A CB    1 
ATOM   5956  C  CG    . ASN C 3  736  ? -18.439 -48.848  70.434  1.00 52.85  ? 736  ASN A CG    1 
ATOM   5957  O  OD1   . ASN C 3  736  ? -19.475 -49.356  70.855  1.00 53.29  ? 736  ASN A OD1   1 
ATOM   5958  N  ND2   . ASN C 3  736  ? -17.903 -47.755  70.962  1.00 57.35  ? 736  ASN A ND2   1 
ATOM   5959  N  N     . LEU C 3  737  ? -16.434 -50.922  67.353  1.00 44.66  ? 737  LEU A N     1 
ATOM   5960  C  CA    . LEU C 3  737  ? -16.214 -51.400  66.013  1.00 42.99  ? 737  LEU A CA    1 
ATOM   5961  C  C     . LEU C 3  737  ? -16.666 -52.856  65.883  1.00 39.51  ? 737  LEU A C     1 
ATOM   5962  O  O     . LEU C 3  737  ? -16.044 -53.761  66.440  1.00 37.05  ? 737  LEU A O     1 
ATOM   5963  C  CB    . LEU C 3  737  ? -14.728 -51.247  65.675  1.00 46.92  ? 737  LEU A CB    1 
ATOM   5964  C  CG    . LEU C 3  737  ? -14.163 -49.863  66.037  1.00 45.90  ? 737  LEU A CG    1 
ATOM   5965  C  CD1   . LEU C 3  737  ? -12.728 -49.769  65.566  1.00 47.36  ? 737  LEU A CD1   1 
ATOM   5966  C  CD2   . LEU C 3  737  ? -15.005 -48.767  65.409  1.00 40.54  ? 737  LEU A CD2   1 
ATOM   5967  N  N     . LYS C 3  738  ? -17.780 -53.049  65.178  1.00 36.18  ? 738  LYS A N     1 
ATOM   5968  C  CA    . LYS C 3  738  ? -18.352 -54.369  64.937  1.00 34.18  ? 738  LYS A CA    1 
ATOM   5969  C  C     . LYS C 3  738  ? -17.555 -55.006  63.819  1.00 32.97  ? 738  LYS A C     1 
ATOM   5970  O  O     . LYS C 3  738  ? -17.049 -54.307  62.953  1.00 33.81  ? 738  LYS A O     1 
ATOM   5971  C  CB    . LYS C 3  738  ? -19.805 -54.245  64.481  1.00 35.94  ? 738  LYS A CB    1 
ATOM   5972  C  CG    . LYS C 3  738  ? -20.645 -53.325  65.335  1.00 40.55  ? 738  LYS A CG    1 
ATOM   5973  C  CD    . LYS C 3  738  ? -21.989 -53.036  64.694  1.00 39.64  ? 738  LYS A CD    1 
ATOM   5974  C  CE    . LYS C 3  738  ? -22.746 -52.003  65.518  1.00 40.23  ? 738  LYS A CE    1 
ATOM   5975  N  NZ    . LYS C 3  738  ? -23.915 -51.434  64.798  1.00 36.57  ? 738  LYS A NZ    1 
ATOM   5976  N  N     . ASP C 3  739  ? -17.458 -56.329  63.823  1.00 32.55  ? 739  ASP A N     1 
ATOM   5977  C  CA    . ASP C 3  739  ? -16.714 -57.035  62.793  1.00 30.54  ? 739  ASP A CA    1 
ATOM   5978  C  C     . ASP C 3  739  ? -17.134 -56.589  61.406  1.00 29.80  ? 739  ASP A C     1 
ATOM   5979  O  O     . ASP C 3  739  ? -16.407 -56.800  60.443  1.00 31.29  ? 739  ASP A O     1 
ATOM   5980  C  CB    . ASP C 3  739  ? -16.905 -58.541  62.943  1.00 33.49  ? 739  ASP A CB    1 
ATOM   5981  C  CG    . ASP C 3  739  ? -16.243 -59.083  64.197  1.00 39.93  ? 739  ASP A CG    1 
ATOM   5982  O  OD1   . ASP C 3  739  ? -15.866 -58.263  65.063  1.00 42.57  ? 739  ASP A OD1   1 
ATOM   5983  O  OD2   . ASP C 3  739  ? -16.102 -60.321  64.330  1.00 43.62  ? 739  ASP A OD2   1 
ATOM   5984  N  N     . LEU C 3  740  ? -18.297 -55.960  61.298  1.00 28.07  ? 740  LEU A N     1 
ATOM   5985  C  CA    . LEU C 3  740  ? -18.764 -55.490  60.006  1.00 29.78  ? 740  LEU A CA    1 
ATOM   5986  C  C     . LEU C 3  740  ? -18.162 -54.144  59.629  1.00 32.46  ? 740  LEU A C     1 
ATOM   5987  O  O     . LEU C 3  740  ? -18.248 -53.743  58.460  1.00 34.99  ? 740  LEU A O     1 
ATOM   5988  C  CB    . LEU C 3  740  ? -20.290 -55.387  59.986  1.00 31.99  ? 740  LEU A CB    1 
ATOM   5989  C  CG    . LEU C 3  740  ? -21.022 -55.049  61.287  1.00 35.65  ? 740  LEU A CG    1 
ATOM   5990  C  CD1   . LEU C 3  740  ? -22.081 -53.954  61.058  1.00 26.38  ? 740  LEU A CD1   1 
ATOM   5991  C  CD2   . LEU C 3  740  ? -21.635 -56.355  61.834  1.00 38.57  ? 740  LEU A CD2   1 
ATOM   5992  N  N     . ASN C 3  741  ? -17.564 -53.453  60.610  1.00 32.57  ? 741  ASN A N     1 
ATOM   5993  C  CA    . ASN C 3  741  ? -16.930 -52.139  60.396  1.00 30.17  ? 741  ASN A CA    1 
ATOM   5994  C  C     . ASN C 3  741  ? -15.723 -52.258  59.490  1.00 30.07  ? 741  ASN A C     1 
ATOM   5995  O  O     . ASN C 3  741  ? -14.688 -52.809  59.862  1.00 27.93  ? 741  ASN A O     1 
ATOM   5996  C  CB    . ASN C 3  741  ? -16.478 -51.513  61.711  1.00 28.73  ? 741  ASN A CB    1 
ATOM   5997  C  CG    . ASN C 3  741  ? -15.838 -50.146  61.514  1.00 28.53  ? 741  ASN A CG    1 
ATOM   5998  O  OD1   . ASN C 3  741  ? -16.220 -49.181  62.169  1.00 26.43  ? 741  ASN A OD1   1 
ATOM   5999  N  ND2   . ASN C 3  741  ? -14.857 -50.060  60.616  1.00 27.74  ? 741  ASN A ND2   1 
ATOM   6000  N  N     . ASN C 3  742  ? -15.868 -51.694  58.303  1.00 29.72  ? 742  ASN A N     1 
ATOM   6001  C  CA    . ASN C 3  742  ? -14.846 -51.750  57.286  1.00 30.32  ? 742  ASN A CA    1 
ATOM   6002  C  C     . ASN C 3  742  ? -13.460 -51.323  57.732  1.00 29.39  ? 742  ASN A C     1 
ATOM   6003  O  O     . ASN C 3  742  ? -12.482 -51.973  57.395  1.00 29.74  ? 742  ASN A O     1 
ATOM   6004  C  CB    . ASN C 3  742  ? -15.339 -50.949  56.095  1.00 32.33  ? 742  ASN A CB    1 
ATOM   6005  C  CG    . ASN C 3  742  ? -16.781 -51.297  55.745  1.00 37.91  ? 742  ASN A CG    1 
ATOM   6006  O  OD1   . ASN C 3  742  ? -17.089 -52.444  55.395  1.00 43.86  ? 742  ASN A OD1   1 
ATOM   6007  N  ND2   . ASN C 3  742  ? -17.675 -50.322  55.861  1.00 34.27  ? 742  ASN A ND2   1 
ATOM   6008  N  N     . VAL C 3  743  ? -13.348 -50.255  58.502  1.00 28.80  ? 743  VAL A N     1 
ATOM   6009  C  CA    . VAL C 3  743  ? -12.020 -49.866  58.918  1.00 29.96  ? 743  VAL A CA    1 
ATOM   6010  C  C     . VAL C 3  743  ? -11.429 -51.027  59.685  1.00 28.21  ? 743  VAL A C     1 
ATOM   6011  O  O     . VAL C 3  743  ? -10.425 -51.612  59.277  1.00 28.56  ? 743  VAL A O     1 
ATOM   6012  C  CB    . VAL C 3  743  ? -12.025 -48.619  59.808  1.00 32.00  ? 743  VAL A CB    1 
ATOM   6013  C  CG1   . VAL C 3  743  ? -10.609 -48.352  60.305  1.00 35.84  ? 743  VAL A CG1   1 
ATOM   6014  C  CG2   . VAL C 3  743  ? -12.509 -47.409  59.012  1.00 32.32  ? 743  VAL A CG2   1 
ATOM   6015  N  N     . LYS C 3  744  ? -12.065 -51.361  60.797  1.00 27.67  ? 744  LYS A N     1 
ATOM   6016  C  CA    . LYS C 3  744  ? -11.615 -52.470  61.632  1.00 28.54  ? 744  LYS A CA    1 
ATOM   6017  C  C     . LYS C 3  744  ? -11.377 -53.662  60.715  1.00 25.79  ? 744  LYS A C     1 
ATOM   6018  O  O     . LYS C 3  744  ? -10.439 -54.438  60.874  1.00 23.69  ? 744  LYS A O     1 
ATOM   6019  C  CB    . LYS C 3  744  ? -12.706 -52.825  62.643  1.00 30.66  ? 744  LYS A CB    1 
ATOM   6020  C  CG    . LYS C 3  744  ? -12.243 -53.792  63.690  1.00 38.34  ? 744  LYS A CG    1 
ATOM   6021  C  CD    . LYS C 3  744  ? -13.387 -54.410  64.468  1.00 41.85  ? 744  LYS A CD    1 
ATOM   6022  C  CE    . LYS C 3  744  ? -12.836 -55.281  65.594  1.00 44.37  ? 744  LYS A CE    1 
ATOM   6023  N  NZ    . LYS C 3  744  ? -13.782 -56.347  66.010  1.00 46.71  ? 744  LYS A NZ    1 
ATOM   6024  N  N     . GLN C 3  745  ? -12.264 -53.770  59.739  1.00 25.06  ? 745  GLN A N     1 
ATOM   6025  C  CA    . GLN C 3  745  ? -12.261 -54.833  58.757  1.00 22.82  ? 745  GLN A CA    1 
ATOM   6026  C  C     . GLN C 3  745  ? -10.992 -54.945  57.943  1.00 20.16  ? 745  GLN A C     1 
ATOM   6027  O  O     . GLN C 3  745  ? -10.667 -56.020  57.450  1.00 19.23  ? 745  GLN A O     1 
ATOM   6028  C  CB    . GLN C 3  745  ? -13.448 -54.640  57.818  1.00 23.28  ? 745  GLN A CB    1 
ATOM   6029  C  CG    . GLN C 3  745  ? -14.678 -55.412  58.194  1.00 18.81  ? 745  GLN A CG    1 
ATOM   6030  C  CD    . GLN C 3  745  ? -15.012 -56.420  57.126  1.00 22.43  ? 745  GLN A CD    1 
ATOM   6031  O  OE1   . GLN C 3  745  ? -15.296 -56.047  55.987  1.00 20.55  ? 745  GLN A OE1   1 
ATOM   6032  N  NE2   . GLN C 3  745  ? -14.962 -57.711  57.477  1.00 23.54  ? 745  GLN A NE2   1 
ATOM   6033  N  N     . MET C 3  746  ? -10.298 -53.827  57.767  1.00 21.15  ? 746  MET A N     1 
ATOM   6034  C  CA    . MET C 3  746  ? -9.050  -53.820  57.002  1.00 21.37  ? 746  MET A CA    1 
ATOM   6035  C  C     . MET C 3  746  ? -7.908  -54.094  57.973  1.00 19.78  ? 746  MET A C     1 
ATOM   6036  O  O     . MET C 3  746  ? -6.972  -54.838  57.676  1.00 15.35  ? 746  MET A O     1 
ATOM   6037  C  CB    . MET C 3  746  ? -8.865  -52.471  56.282  1.00 18.86  ? 746  MET A CB    1 
ATOM   6038  C  CG    . MET C 3  746  ? -9.743  -52.320  55.033  1.00 16.12  ? 746  MET A CG    1 
ATOM   6039  S  SD    . MET C 3  746  ? -9.690  -50.670  54.262  1.00 18.14  ? 746  MET A SD    1 
ATOM   6040  C  CE    . MET C 3  746  ? -10.523 -49.768  55.451  1.00 20.10  ? 746  MET A CE    1 
ATOM   6041  N  N     . VAL C 3  747  ? -8.026  -53.498  59.152  1.00 20.57  ? 747  VAL A N     1 
ATOM   6042  C  CA    . VAL C 3  747  ? -7.050  -53.672  60.202  1.00 22.30  ? 747  VAL A CA    1 
ATOM   6043  C  C     . VAL C 3  747  ? -6.888  -55.152  60.516  1.00 23.43  ? 747  VAL A C     1 
ATOM   6044  O  O     . VAL C 3  747  ? -5.792  -55.612  60.789  1.00 23.97  ? 747  VAL A O     1 
ATOM   6045  C  CB    . VAL C 3  747  ? -7.509  -52.967  61.469  1.00 22.58  ? 747  VAL A CB    1 
ATOM   6046  C  CG1   . VAL C 3  747  ? -6.473  -53.143  62.557  1.00 24.60  ? 747  VAL A CG1   1 
ATOM   6047  C  CG2   . VAL C 3  747  ? -7.781  -51.497  61.172  1.00 21.61  ? 747  VAL A CG2   1 
ATOM   6048  N  N     . MET C 3  748  ? -7.983  -55.901  60.476  1.00 26.36  ? 748  MET A N     1 
ATOM   6049  C  CA    . MET C 3  748  ? -7.931  -57.327  60.787  1.00 28.75  ? 748  MET A CA    1 
ATOM   6050  C  C     . MET C 3  748  ? -7.229  -58.122  59.726  1.00 26.99  ? 748  MET A C     1 
ATOM   6051  O  O     . MET C 3  748  ? -6.586  -59.130  60.010  1.00 26.27  ? 748  MET A O     1 
ATOM   6052  C  CB    . MET C 3  748  ? -9.334  -57.898  60.986  1.00 33.95  ? 748  MET A CB    1 
ATOM   6053  C  CG    . MET C 3  748  ? -9.768  -57.966  62.440  1.00 38.71  ? 748  MET A CG    1 
ATOM   6054  S  SD    . MET C 3  748  ? -11.361 -58.778  62.578  1.00 49.86  ? 748  MET A SD    1 
ATOM   6055  C  CE    . MET C 3  748  ? -12.443 -57.318  62.515  1.00 43.32  ? 748  MET A CE    1 
ATOM   6056  N  N     . ALA C 3  749  ? -7.374  -57.686  58.491  1.00 26.79  ? 749  ALA A N     1 
ATOM   6057  C  CA    . ALA C 3  749  ? -6.708  -58.380  57.413  1.00 29.45  ? 749  ALA A CA    1 
ATOM   6058  C  C     . ALA C 3  749  ? -5.235  -58.039  57.576  1.00 30.81  ? 749  ALA A C     1 
ATOM   6059  O  O     . ALA C 3  749  ? -4.354  -58.908  57.498  1.00 29.89  ? 749  ALA A O     1 
ATOM   6060  C  CB    . ALA C 3  749  ? -7.218  -57.871  56.064  1.00 29.06  ? 749  ALA A CB    1 
ATOM   6061  N  N     . GLY C 3  750  ? -5.010  -56.755  57.856  1.00 30.42  ? 750  GLY A N     1 
ATOM   6062  C  CA    . GLY C 3  750  ? -3.678  -56.210  57.982  1.00 27.21  ? 750  GLY A CA    1 
ATOM   6063  C  C     . GLY C 3  750  ? -3.464  -55.704  56.574  1.00 25.85  ? 750  GLY A C     1 
ATOM   6064  O  O     . GLY C 3  750  ? -2.523  -56.084  55.903  1.00 25.61  ? 750  GLY A O     1 
ATOM   6065  N  N     . SER C 3  751  ? -4.375  -54.863  56.112  1.00 26.23  ? 751  SER A N     1 
ATOM   6066  C  CA    . SER C 3  751  ? -4.290  -54.347  54.757  1.00 29.39  ? 751  SER A CA    1 
ATOM   6067  C  C     . SER C 3  751  ? -4.204  -52.837  54.750  1.00 29.83  ? 751  SER A C     1 
ATOM   6068  O  O     . SER C 3  751  ? -4.125  -52.215  53.695  1.00 31.26  ? 751  SER A O     1 
ATOM   6069  C  CB    . SER C 3  751  ? -5.515  -54.793  53.949  1.00 32.45  ? 751  SER A CB    1 
ATOM   6070  O  OG    . SER C 3  751  ? -6.710  -54.212  54.446  1.00 32.23  ? 751  SER A OG    1 
ATOM   6071  N  N     . LYS C 3  752  ? -4.228  -52.268  55.945  1.00 29.60  ? 752  LYS A N     1 
ATOM   6072  C  CA    . LYS C 3  752  ? -4.150  -50.833  56.164  1.00 28.36  ? 752  LYS A CA    1 
ATOM   6073  C  C     . LYS C 3  752  ? -4.793  -50.561  57.508  1.00 28.11  ? 752  LYS A C     1 
ATOM   6074  O  O     . LYS C 3  752  ? -5.750  -51.227  57.897  1.00 30.42  ? 752  LYS A O     1 
ATOM   6075  C  CB    . LYS C 3  752  ? -4.891  -50.058  55.070  1.00 25.01  ? 752  LYS A CB    1 
ATOM   6076  C  CG    . LYS C 3  752  ? -4.017  -49.639  53.917  1.00 27.35  ? 752  LYS A CG    1 
ATOM   6077  C  CD    . LYS C 3  752  ? -3.156  -48.444  54.280  1.00 37.43  ? 752  LYS A CD    1 
ATOM   6078  C  CE    . LYS C 3  752  ? -1.968  -48.271  53.329  1.00 41.87  ? 752  LYS A CE    1 
ATOM   6079  N  NZ    . LYS C 3  752  ? -0.911  -49.306  53.603  1.00 49.47  ? 752  LYS A NZ    1 
ATOM   6080  N  N     . GLY C 3  753  ? -4.245  -49.604  58.234  1.00 27.43  ? 753  GLY A N     1 
ATOM   6081  C  CA    . GLY C 3  753  ? -4.818  -49.262  59.513  1.00 28.10  ? 753  GLY A CA    1 
ATOM   6082  C  C     . GLY C 3  753  ? -4.153  -49.942  60.677  1.00 28.09  ? 753  GLY A C     1 
ATOM   6083  O  O     . GLY C 3  753  ? -3.540  -50.998  60.532  1.00 27.90  ? 753  GLY A O     1 
ATOM   6084  N  N     . SER C 3  754  ? -4.301  -49.318  61.840  1.00 28.96  ? 754  SER A N     1 
ATOM   6085  C  CA    . SER C 3  754  ? -3.741  -49.808  63.084  1.00 30.08  ? 754  SER A CA    1 
ATOM   6086  C  C     . SER C 3  754  ? -4.489  -49.111  64.204  1.00 28.34  ? 754  SER A C     1 
ATOM   6087  O  O     . SER C 3  754  ? -5.186  -48.125  63.970  1.00 23.23  ? 754  SER A O     1 
ATOM   6088  C  CB    . SER C 3  754  ? -2.251  -49.477  63.153  1.00 35.90  ? 754  SER A CB    1 
ATOM   6089  O  OG    . SER C 3  754  ? -1.993  -48.168  62.648  1.00 43.46  ? 754  SER A OG    1 
ATOM   6090  N  N     . PHE C 3  755  ? -4.346  -49.627  65.417  1.00 28.53  ? 755  PHE A N     1 
ATOM   6091  C  CA    . PHE C 3  755  ? -5.031  -49.043  66.548  1.00 28.55  ? 755  PHE A CA    1 
ATOM   6092  C  C     . PHE C 3  755  ? -5.073  -47.554  66.382  1.00 29.67  ? 755  PHE A C     1 
ATOM   6093  O  O     . PHE C 3  755  ? -6.135  -46.988  66.167  1.00 30.01  ? 755  PHE A O     1 
ATOM   6094  C  CB    . PHE C 3  755  ? -4.321  -49.364  67.854  1.00 28.09  ? 755  PHE A CB    1 
ATOM   6095  C  CG    . PHE C 3  755  ? -4.908  -48.657  69.039  1.00 29.01  ? 755  PHE A CG    1 
ATOM   6096  C  CD1   . PHE C 3  755  ? -6.239  -48.867  69.401  1.00 31.58  ? 755  PHE A CD1   1 
ATOM   6097  C  CD2   . PHE C 3  755  ? -4.141  -47.782  69.791  1.00 29.64  ? 755  PHE A CD2   1 
ATOM   6098  C  CE1   . PHE C 3  755  ? -6.801  -48.216  70.493  1.00 29.33  ? 755  PHE A CE1   1 
ATOM   6099  C  CE2   . PHE C 3  755  ? -4.695  -47.123  70.891  1.00 32.63  ? 755  PHE A CE2   1 
ATOM   6100  C  CZ    . PHE C 3  755  ? -6.027  -47.343  71.241  1.00 30.99  ? 755  PHE A CZ    1 
ATOM   6101  N  N     . ILE C 3  756  ? -3.897  -46.936  66.458  1.00 32.08  ? 756  ILE A N     1 
ATOM   6102  C  CA    . ILE C 3  756  ? -3.757  -45.489  66.354  1.00 32.73  ? 756  ILE A CA    1 
ATOM   6103  C  C     . ILE C 3  756  ? -4.726  -44.813  65.405  1.00 32.41  ? 756  ILE A C     1 
ATOM   6104  O  O     . ILE C 3  756  ? -5.446  -43.899  65.813  1.00 31.72  ? 756  ILE A O     1 
ATOM   6105  C  CB    . ILE C 3  756  ? -2.311  -45.092  65.980  1.00 33.39  ? 756  ILE A CB    1 
ATOM   6106  C  CG1   . ILE C 3  756  ? -1.663  -44.397  67.171  1.00 37.40  ? 756  ILE A CG1   1 
ATOM   6107  C  CG2   . ILE C 3  756  ? -2.292  -44.110  64.833  1.00 38.17  ? 756  ILE A CG2   1 
ATOM   6108  C  CD1   . ILE C 3  756  ? -2.450  -43.186  67.678  1.00 34.09  ? 756  ILE A CD1   1 
ATOM   6109  N  N     . ASN C 3  757  ? -4.752  -45.254  64.148  1.00 31.14  ? 757  ASN A N     1 
ATOM   6110  C  CA    . ASN C 3  757  ? -5.650  -44.659  63.167  1.00 30.26  ? 757  ASN A CA    1 
ATOM   6111  C  C     . ASN C 3  757  ? -7.066  -44.609  63.735  1.00 28.70  ? 757  ASN A C     1 
ATOM   6112  O  O     . ASN C 3  757  ? -7.664  -43.540  63.844  1.00 30.12  ? 757  ASN A O     1 
ATOM   6113  C  CB    . ASN C 3  757  ? -5.606  -45.450  61.858  1.00 33.06  ? 757  ASN A CB    1 
ATOM   6114  C  CG    . ASN C 3  757  ? -4.236  -45.397  61.196  1.00 37.28  ? 757  ASN A CG    1 
ATOM   6115  O  OD1   . ASN C 3  757  ? -3.647  -44.325  61.045  1.00 37.71  ? 757  ASN A OD1   1 
ATOM   6116  N  ND2   . ASN C 3  757  ? -3.723  -46.555  60.798  1.00 39.56  ? 757  ASN A ND2   1 
ATOM   6117  N  N     . ILE C 3  758  ? -7.598  -45.762  64.119  1.00 26.49  ? 758  ILE A N     1 
ATOM   6118  C  CA    . ILE C 3  758  ? -8.929  -45.810  64.702  1.00 23.12  ? 758  ILE A CA    1 
ATOM   6119  C  C     . ILE C 3  758  ? -9.034  -44.814  65.852  1.00 21.82  ? 758  ILE A C     1 
ATOM   6120  O  O     . ILE C 3  758  ? -9.826  -43.876  65.818  1.00 19.67  ? 758  ILE A O     1 
ATOM   6121  C  CB    . ILE C 3  758  ? -9.231  -47.186  65.267  1.00 19.83  ? 758  ILE A CB    1 
ATOM   6122  C  CG1   . ILE C 3  758  ? -9.261  -48.214  64.150  1.00 16.59  ? 758  ILE A CG1   1 
ATOM   6123  C  CG2   . ILE C 3  758  ? -10.550 -47.152  65.986  1.00 22.30  ? 758  ILE A CG2   1 
ATOM   6124  C  CD1   . ILE C 3  758  ? -9.386  -49.621  64.666  1.00 21.94  ? 758  ILE A CD1   1 
ATOM   6125  N  N     . ALA C 3  759  ? -8.209  -45.039  66.864  1.00 22.47  ? 759  ALA A N     1 
ATOM   6126  C  CA    . ALA C 3  759  ? -8.172  -44.214  68.066  1.00 25.32  ? 759  ALA A CA    1 
ATOM   6127  C  C     . ALA C 3  759  ? -8.230  -42.731  67.826  1.00 26.14  ? 759  ALA A C     1 
ATOM   6128  O  O     . ALA C 3  759  ? -8.841  -42.001  68.597  1.00 24.93  ? 759  ALA A O     1 
ATOM   6129  C  CB    . ALA C 3  759  ? -6.931  -44.531  68.870  1.00 30.56  ? 759  ALA A CB    1 
ATOM   6130  N  N     . GLN C 3  760  ? -7.570  -42.276  66.774  1.00 27.79  ? 760  GLN A N     1 
ATOM   6131  C  CA    . GLN C 3  760  ? -7.565  -40.857  66.489  1.00 30.08  ? 760  GLN A CA    1 
ATOM   6132  C  C     . GLN C 3  760  ? -8.768  -40.464  65.676  1.00 31.21  ? 760  GLN A C     1 
ATOM   6133  O  O     . GLN C 3  760  ? -9.402  -39.458  65.966  1.00 32.91  ? 760  GLN A O     1 
ATOM   6134  C  CB    . GLN C 3  760  ? -6.269  -40.452  65.781  1.00 28.71  ? 760  GLN A CB    1 
ATOM   6135  C  CG    . GLN C 3  760  ? -5.080  -40.453  66.731  1.00 25.51  ? 760  GLN A CG    1 
ATOM   6136  C  CD    . GLN C 3  760  ? -3.843  -39.875  66.120  1.00 21.96  ? 760  GLN A CD    1 
ATOM   6137  O  OE1   . GLN C 3  760  ? -3.251  -40.465  65.230  1.00 22.11  ? 760  GLN A OE1   1 
ATOM   6138  N  NE2   . GLN C 3  760  ? -3.442  -38.707  66.593  1.00 25.03  ? 760  GLN A NE2   1 
ATOM   6139  N  N     . MET C 3  761  ? -9.099  -41.260  64.668  1.00 31.66  ? 761  MET A N     1 
ATOM   6140  C  CA    . MET C 3  761  ? -10.255 -40.944  63.849  1.00 32.79  ? 761  MET A CA    1 
ATOM   6141  C  C     . MET C 3  761  ? -11.556 -41.011  64.662  1.00 33.51  ? 761  MET A C     1 
ATOM   6142  O  O     . MET C 3  761  ? -12.478 -40.212  64.443  1.00 32.21  ? 761  MET A O     1 
ATOM   6143  C  CB    . MET C 3  761  ? -10.354 -41.897  62.646  1.00 32.82  ? 761  MET A CB    1 
ATOM   6144  C  CG    . MET C 3  761  ? -9.556  -41.482  61.415  1.00 31.56  ? 761  MET A CG    1 
ATOM   6145  S  SD    . MET C 3  761  ? -10.138 -42.307  59.892  1.00 37.19  ? 761  MET A SD    1 
ATOM   6146  C  CE    . MET C 3  761  ? -9.783  -44.024  60.255  1.00 28.08  ? 761  MET A CE    1 
ATOM   6147  N  N     . SER C 3  762  ? -11.615 -41.939  65.618  1.00 32.63  ? 762  SER A N     1 
ATOM   6148  C  CA    . SER C 3  762  ? -12.825 -42.132  66.409  1.00 30.72  ? 762  SER A CA    1 
ATOM   6149  C  C     . SER C 3  762  ? -12.906 -41.469  67.771  1.00 28.36  ? 762  SER A C     1 
ATOM   6150  O  O     . SER C 3  762  ? -13.916 -40.855  68.080  1.00 29.61  ? 762  SER A O     1 
ATOM   6151  C  CB    . SER C 3  762  ? -13.110 -43.626  66.560  1.00 32.64  ? 762  SER A CB    1 
ATOM   6152  O  OG    . SER C 3  762  ? -13.260 -44.249  65.294  1.00 34.78  ? 762  SER A OG    1 
ATOM   6153  N  N     . ALA C 3  763  ? -11.876 -41.596  68.596  1.00 26.88  ? 763  ALA A N     1 
ATOM   6154  C  CA    . ALA C 3  763  ? -11.904 -40.973  69.921  1.00 29.20  ? 763  ALA A CA    1 
ATOM   6155  C  C     . ALA C 3  763  ? -10.937 -39.806  69.950  1.00 31.30  ? 763  ALA A C     1 
ATOM   6156  O  O     . ALA C 3  763  ? -10.712 -39.182  68.931  1.00 36.02  ? 763  ALA A O     1 
ATOM   6157  C  CB    . ALA C 3  763  ? -11.521 -41.978  70.969  1.00 30.16  ? 763  ALA A CB    1 
ATOM   6158  N  N     . CYS C 3  764  ? -10.354 -39.506  71.103  1.00 31.59  ? 764  CYS A N     1 
ATOM   6159  C  CA    . CYS C 3  764  ? -9.378  -38.410  71.202  1.00 34.00  ? 764  CYS A CA    1 
ATOM   6160  C  C     . CYS C 3  764  ? -8.109  -38.532  70.314  1.00 33.50  ? 764  CYS A C     1 
ATOM   6161  O  O     . CYS C 3  764  ? -7.440  -39.565  70.306  1.00 32.31  ? 764  CYS A O     1 
ATOM   6162  C  CB    . CYS C 3  764  ? -8.926  -38.253  72.653  1.00 35.79  ? 764  CYS A CB    1 
ATOM   6163  S  SG    . CYS C 3  764  ? -7.409  -37.304  72.815  1.00 35.89  ? 764  CYS A SG    1 
ATOM   6164  N  N     . VAL C 3  765  ? -7.774  -37.463  69.590  1.00 34.10  ? 765  VAL A N     1 
ATOM   6165  C  CA    . VAL C 3  765  ? -6.594  -37.452  68.724  1.00 34.16  ? 765  VAL A CA    1 
ATOM   6166  C  C     . VAL C 3  765  ? -5.304  -37.597  69.517  1.00 36.88  ? 765  VAL A C     1 
ATOM   6167  O  O     . VAL C 3  765  ? -4.549  -38.552  69.302  1.00 37.89  ? 765  VAL A O     1 
ATOM   6168  C  CB    . VAL C 3  765  ? -6.508  -36.173  67.900  1.00 32.35  ? 765  VAL A CB    1 
ATOM   6169  C  CG1   . VAL C 3  765  ? -5.082  -35.932  67.473  1.00 29.59  ? 765  VAL A CG1   1 
ATOM   6170  C  CG2   . VAL C 3  765  ? -7.397  -36.301  66.682  1.00 33.57  ? 765  VAL A CG2   1 
ATOM   6171  N  N     . GLY C 3  766  ? -5.026  -36.647  70.411  1.00 36.56  ? 766  GLY A N     1 
ATOM   6172  C  CA    . GLY C 3  766  ? -3.827  -36.780  71.222  1.00 35.79  ? 766  GLY A CA    1 
ATOM   6173  C  C     . GLY C 3  766  ? -3.017  -35.551  71.564  1.00 34.82  ? 766  GLY A C     1 
ATOM   6174  O  O     . GLY C 3  766  ? -3.344  -34.442  71.155  1.00 36.87  ? 766  GLY A O     1 
ATOM   6175  N  N     . GLN C 3  767  ? -1.956  -35.771  72.338  1.00 33.18  ? 767  GLN A N     1 
ATOM   6176  C  CA    . GLN C 3  767  ? -1.044  -34.713  72.752  1.00 30.40  ? 767  GLN A CA    1 
ATOM   6177  C  C     . GLN C 3  767  ? -0.026  -34.478  71.645  1.00 31.65  ? 767  GLN A C     1 
ATOM   6178  O  O     . GLN C 3  767  ? 0.737   -35.379  71.257  1.00 29.76  ? 767  GLN A O     1 
ATOM   6179  C  CB    . GLN C 3  767  ? -0.320  -35.102  74.036  1.00 26.26  ? 767  GLN A CB    1 
ATOM   6180  C  CG    . GLN C 3  767  ? 0.837   -34.206  74.425  1.00 25.11  ? 767  GLN A CG    1 
ATOM   6181  C  CD    . GLN C 3  767  ? 0.417   -32.812  74.849  1.00 30.64  ? 767  GLN A CD    1 
ATOM   6182  O  OE1   . GLN C 3  767  ? -0.379  -32.633  75.770  1.00 31.99  ? 767  GLN A OE1   1 
ATOM   6183  N  NE2   . GLN C 3  767  ? 0.969   -31.808  74.182  1.00 35.72  ? 767  GLN A NE2   1 
ATOM   6184  N  N     . GLN C 3  768  ? -0.049  -33.251  71.136  1.00 31.44  ? 768  GLN A N     1 
ATOM   6185  C  CA    . GLN C 3  768  ? 0.837   -32.810  70.078  1.00 29.30  ? 768  GLN A CA    1 
ATOM   6186  C  C     . GLN C 3  768  ? 2.209   -32.668  70.666  1.00 27.55  ? 768  GLN A C     1 
ATOM   6187  O  O     . GLN C 3  768  ? 2.343   -32.462  71.865  1.00 25.51  ? 768  GLN A O     1 
ATOM   6188  C  CB    . GLN C 3  768  ? 0.359   -31.463  69.557  1.00 30.77  ? 768  GLN A CB    1 
ATOM   6189  C  CG    . GLN C 3  768  ? -0.247  -31.526  68.174  1.00 33.57  ? 768  GLN A CG    1 
ATOM   6190  C  CD    . GLN C 3  768  ? -1.036  -32.800  67.944  1.00 37.92  ? 768  GLN A CD    1 
ATOM   6191  O  OE1   . GLN C 3  768  ? -1.921  -33.143  68.732  1.00 39.33  ? 768  GLN A OE1   1 
ATOM   6192  N  NE2   . GLN C 3  768  ? -0.720  -33.512  66.860  1.00 36.57  ? 768  GLN A NE2   1 
ATOM   6193  N  N     . SER C 3  769  ? 3.235   -32.783  69.839  1.00 27.67  ? 769  SER A N     1 
ATOM   6194  C  CA    . SER C 3  769  ? 4.579   -32.634  70.367  1.00 29.95  ? 769  SER A CA    1 
ATOM   6195  C  C     . SER C 3  769  ? 5.618   -32.189  69.347  1.00 30.15  ? 769  SER A C     1 
ATOM   6196  O  O     . SER C 3  769  ? 5.670   -32.686  68.213  1.00 29.06  ? 769  SER A O     1 
ATOM   6197  C  CB    . SER C 3  769  ? 5.030   -33.932  71.039  1.00 32.01  ? 769  SER A CB    1 
ATOM   6198  O  OG    . SER C 3  769  ? 5.268   -34.948  70.080  1.00 36.17  ? 769  SER A OG    1 
ATOM   6199  N  N     . VAL C 3  770  ? 6.432   -31.235  69.789  1.00 30.79  ? 770  VAL A N     1 
ATOM   6200  C  CA    . VAL C 3  770  ? 7.518   -30.647  69.016  1.00 31.17  ? 770  VAL A CA    1 
ATOM   6201  C  C     . VAL C 3  770  ? 8.815   -30.792  69.806  1.00 34.49  ? 770  VAL A C     1 
ATOM   6202  O  O     . VAL C 3  770  ? 8.920   -30.325  70.948  1.00 36.15  ? 770  VAL A O     1 
ATOM   6203  C  CB    . VAL C 3  770  ? 7.279   -29.171  68.783  1.00 26.35  ? 770  VAL A CB    1 
ATOM   6204  C  CG1   . VAL C 3  770  ? 8.541   -28.519  68.339  1.00 28.53  ? 770  VAL A CG1   1 
ATOM   6205  C  CG2   . VAL C 3  770  ? 6.233   -28.990  67.745  1.00 29.95  ? 770  VAL A CG2   1 
ATOM   6206  N  N     . GLU C 3  771  ? 9.805   -31.421  69.190  1.00 34.83  ? 771  GLU A N     1 
ATOM   6207  C  CA    . GLU C 3  771  ? 11.078  -31.640  69.849  1.00 36.88  ? 771  GLU A CA    1 
ATOM   6208  C  C     . GLU C 3  771  ? 10.916  -32.469  71.114  1.00 36.33  ? 771  GLU A C     1 
ATOM   6209  O  O     . GLU C 3  771  ? 11.499  -32.164  72.154  1.00 38.04  ? 771  GLU A O     1 
ATOM   6210  C  CB    . GLU C 3  771  ? 11.750  -30.317  70.186  1.00 37.32  ? 771  GLU A CB    1 
ATOM   6211  C  CG    . GLU C 3  771  ? 12.545  -29.747  69.040  1.00 45.51  ? 771  GLU A CG    1 
ATOM   6212  C  CD    . GLU C 3  771  ? 13.208  -28.439  69.415  1.00 53.09  ? 771  GLU A CD    1 
ATOM   6213  O  OE1   . GLU C 3  771  ? 13.925  -28.402  70.450  1.00 53.15  ? 771  GLU A OE1   1 
ATOM   6214  O  OE2   . GLU C 3  771  ? 13.003  -27.450  68.675  1.00 56.68  ? 771  GLU A OE2   1 
ATOM   6215  N  N     . GLY C 3  772  ? 10.116  -33.523  71.016  1.00 34.30  ? 772  GLY A N     1 
ATOM   6216  C  CA    . GLY C 3  772  ? 9.928   -34.392  72.157  1.00 31.85  ? 772  GLY A CA    1 
ATOM   6217  C  C     . GLY C 3  772  ? 9.291   -33.761  73.374  1.00 29.04  ? 772  GLY A C     1 
ATOM   6218  O  O     . GLY C 3  772  ? 9.212   -34.388  74.416  1.00 29.21  ? 772  GLY A O     1 
ATOM   6219  N  N     . LYS C 3  773  ? 8.841   -32.524  73.265  1.00 27.09  ? 773  LYS A N     1 
ATOM   6220  C  CA    . LYS C 3  773  ? 8.199   -31.905  74.406  1.00 28.94  ? 773  LYS A CA    1 
ATOM   6221  C  C     . LYS C 3  773  ? 6.823   -31.420  73.992  1.00 27.52  ? 773  LYS A C     1 
ATOM   6222  O  O     . LYS C 3  773  ? 6.577   -31.201  72.805  1.00 26.33  ? 773  LYS A O     1 
ATOM   6223  C  CB    . LYS C 3  773  ? 9.001   -30.706  74.907  1.00 34.36  ? 773  LYS A CB    1 
ATOM   6224  C  CG    . LYS C 3  773  ? 10.372  -30.994  75.494  1.00 41.59  ? 773  LYS A CG    1 
ATOM   6225  C  CD    . LYS C 3  773  ? 10.867  -29.742  76.224  1.00 46.90  ? 773  LYS A CD    1 
ATOM   6226  C  CE    . LYS C 3  773  ? 12.230  -29.926  76.873  1.00 51.52  ? 773  LYS A CE    1 
ATOM   6227  N  NZ    . LYS C 3  773  ? 12.501  -28.841  77.873  1.00 52.62  ? 773  LYS A NZ    1 
ATOM   6228  N  N     . ARG C 3  774  ? 5.923   -31.256  74.961  1.00 24.46  ? 774  ARG A N     1 
ATOM   6229  C  CA    . ARG C 3  774  ? 4.608   -30.738  74.627  1.00 22.24  ? 774  ARG A CA    1 
ATOM   6230  C  C     . ARG C 3  774  ? 4.745   -29.248  74.251  1.00 18.97  ? 774  ARG A C     1 
ATOM   6231  O  O     . ARG C 3  774  ? 5.567   -28.519  74.805  1.00 16.30  ? 774  ARG A O     1 
ATOM   6232  C  CB    . ARG C 3  774  ? 3.612   -30.975  75.777  1.00 22.77  ? 774  ARG A CB    1 
ATOM   6233  C  CG    . ARG C 3  774  ? 4.205   -31.080  77.166  1.00 21.19  ? 774  ARG A CG    1 
ATOM   6234  C  CD    . ARG C 3  774  ? 3.285   -31.882  78.090  1.00 23.59  ? 774  ARG A CD    1 
ATOM   6235  N  NE    . ARG C 3  774  ? 1.961   -31.304  78.351  1.00 22.87  ? 774  ARG A NE    1 
ATOM   6236  C  CZ    . ARG C 3  774  ? 1.674   -30.504  79.375  1.00 23.02  ? 774  ARG A CZ    1 
ATOM   6237  N  NH1   . ARG C 3  774  ? 2.610   -30.156  80.242  1.00 19.81  ? 774  ARG A NH1   1 
ATOM   6238  N  NH2   . ARG C 3  774  ? 0.430   -30.097  79.565  1.00 23.58  ? 774  ARG A NH2   1 
ATOM   6239  N  N     . ILE C 3  775  ? 3.944   -28.815  73.290  1.00 17.67  ? 775  ILE A N     1 
ATOM   6240  C  CA    . ILE C 3  775  ? 4.015   -27.459  72.783  1.00 20.37  ? 775  ILE A CA    1 
ATOM   6241  C  C     . ILE C 3  775  ? 4.550   -26.410  73.744  1.00 21.58  ? 775  ILE A C     1 
ATOM   6242  O  O     . ILE C 3  775  ? 4.140   -26.331  74.897  1.00 19.03  ? 775  ILE A O     1 
ATOM   6243  C  CB    . ILE C 3  775  ? 2.670   -27.058  72.176  1.00 21.19  ? 775  ILE A CB    1 
ATOM   6244  C  CG1   . ILE C 3  775  ? 2.443   -27.929  70.941  1.00 21.15  ? 775  ILE A CG1   1 
ATOM   6245  C  CG2   . ILE C 3  775  ? 2.658   -25.581  71.779  1.00 20.82  ? 775  ILE A CG2   1 
ATOM   6246  C  CD1   . ILE C 3  775  ? 1.470   -27.359  69.970  1.00 28.98  ? 775  ILE A CD1   1 
ATOM   6247  N  N     . ALA C 3  776  ? 5.489   -25.614  73.227  1.00 25.22  ? 776  ALA A N     1 
ATOM   6248  C  CA    . ALA C 3  776  ? 6.188   -24.567  73.980  1.00 29.24  ? 776  ALA A CA    1 
ATOM   6249  C  C     . ALA C 3  776  ? 5.536   -23.192  74.118  1.00 30.41  ? 776  ALA A C     1 
ATOM   6250  O  O     . ALA C 3  776  ? 4.461   -22.918  73.580  1.00 33.08  ? 776  ALA A O     1 
ATOM   6251  C  CB    . ALA C 3  776  ? 7.587   -24.389  73.403  1.00 31.11  ? 776  ALA A CB    1 
ATOM   6252  N  N     . PHE C 3  777  ? 6.212   -22.323  74.858  1.00 29.44  ? 777  PHE A N     1 
ATOM   6253  C  CA    . PHE C 3  777  ? 5.722   -20.971  75.060  1.00 28.78  ? 777  PHE A CA    1 
ATOM   6254  C  C     . PHE C 3  777  ? 6.418   -20.046  74.064  1.00 27.01  ? 777  PHE A C     1 
ATOM   6255  O  O     . PHE C 3  777  ? 7.419   -19.403  74.388  1.00 26.55  ? 777  PHE A O     1 
ATOM   6256  C  CB    . PHE C 3  777  ? 6.001   -20.523  76.502  1.00 31.76  ? 777  PHE A CB    1 
ATOM   6257  C  CG    . PHE C 3  777  ? 5.050   -21.108  77.530  1.00 28.79  ? 777  PHE A CG    1 
ATOM   6258  C  CD1   . PHE C 3  777  ? 5.396   -21.141  78.874  1.00 26.24  ? 777  PHE A CD1   1 
ATOM   6259  C  CD2   . PHE C 3  777  ? 3.802   -21.579  77.164  1.00 26.33  ? 777  PHE A CD2   1 
ATOM   6260  C  CE1   . PHE C 3  777  ? 4.515   -21.632  79.831  1.00 22.57  ? 777  PHE A CE1   1 
ATOM   6261  C  CE2   . PHE C 3  777  ? 2.925   -22.068  78.127  1.00 26.69  ? 777  PHE A CE2   1 
ATOM   6262  C  CZ    . PHE C 3  777  ? 3.289   -22.092  79.461  1.00 19.63  ? 777  PHE A CZ    1 
ATOM   6263  N  N     . GLY C 3  778  ? 5.891   -20.008  72.844  1.00 25.60  ? 778  GLY A N     1 
ATOM   6264  C  CA    . GLY C 3  778  ? 6.457   -19.161  71.809  1.00 24.82  ? 778  GLY A CA    1 
ATOM   6265  C  C     . GLY C 3  778  ? 6.257   -17.731  72.240  1.00 23.72  ? 778  GLY A C     1 
ATOM   6266  O  O     . GLY C 3  778  ? 7.087   -16.858  71.983  1.00 25.97  ? 778  GLY A O     1 
ATOM   6267  N  N     . PHE C 3  779  ? 5.130   -17.498  72.903  1.00 21.43  ? 779  PHE A N     1 
ATOM   6268  C  CA    . PHE C 3  779  ? 4.807   -16.182  73.429  1.00 17.59  ? 779  PHE A CA    1 
ATOM   6269  C  C     . PHE C 3  779  ? 5.351   -16.181  74.843  1.00 18.57  ? 779  PHE A C     1 
ATOM   6270  O  O     . PHE C 3  779  ? 5.760   -17.226  75.359  1.00 17.65  ? 779  PHE A O     1 
ATOM   6271  C  CB    . PHE C 3  779  ? 3.289   -15.948  73.456  1.00 12.55  ? 779  PHE A CB    1 
ATOM   6272  C  CG    . PHE C 3  779  ? 2.690   -15.709  72.105  1.00 4.19   ? 779  PHE A CG    1 
ATOM   6273  C  CD1   . PHE C 3  779  ? 2.321   -16.773  71.293  1.00 4.17   ? 779  PHE A CD1   1 
ATOM   6274  C  CD2   . PHE C 3  779  ? 2.571   -14.420  71.613  1.00 1.00   ? 779  PHE A CD2   1 
ATOM   6275  C  CE1   . PHE C 3  779  ? 1.849   -16.553  70.005  1.00 1.98   ? 779  PHE A CE1   1 
ATOM   6276  C  CE2   . PHE C 3  779  ? 2.106   -14.188  70.338  1.00 1.00   ? 779  PHE A CE2   1 
ATOM   6277  C  CZ    . PHE C 3  779  ? 1.745   -15.254  69.528  1.00 3.95   ? 779  PHE A CZ    1 
ATOM   6278  N  N     . VAL C 3  780  ? 5.353   -15.022  75.480  1.00 20.43  ? 780  VAL A N     1 
ATOM   6279  C  CA    . VAL C 3  780  ? 5.869   -14.957  76.836  1.00 23.79  ? 780  VAL A CA    1 
ATOM   6280  C  C     . VAL C 3  780  ? 5.006   -15.721  77.841  1.00 26.56  ? 780  VAL A C     1 
ATOM   6281  O  O     . VAL C 3  780  ? 3.871   -15.333  78.132  1.00 29.21  ? 780  VAL A O     1 
ATOM   6282  C  CB    . VAL C 3  780  ? 5.998   -13.519  77.312  1.00 21.15  ? 780  VAL A CB    1 
ATOM   6283  C  CG1   . VAL C 3  780  ? 6.637   -13.501  78.670  1.00 24.24  ? 780  VAL A CG1   1 
ATOM   6284  C  CG2   . VAL C 3  780  ? 6.824   -12.721  76.333  1.00 22.40  ? 780  VAL A CG2   1 
ATOM   6285  N  N     . ASP C 3  781  ? 5.552   -16.811  78.365  1.00 26.38  ? 781  ASP A N     1 
ATOM   6286  C  CA    . ASP C 3  781  ? 4.852   -17.614  79.347  1.00 27.42  ? 781  ASP A CA    1 
ATOM   6287  C  C     . ASP C 3  781  ? 3.525   -18.166  78.886  1.00 26.58  ? 781  ASP A C     1 
ATOM   6288  O  O     . ASP C 3  781  ? 2.750   -18.678  79.691  1.00 28.55  ? 781  ASP A O     1 
ATOM   6289  C  CB    . ASP C 3  781  ? 4.647   -16.825  80.635  1.00 31.90  ? 781  ASP A CB    1 
ATOM   6290  C  CG    . ASP C 3  781  ? 5.956   -16.515  81.340  1.00 38.58  ? 781  ASP A CG    1 
ATOM   6291  O  OD1   . ASP C 3  781  ? 6.906   -17.324  81.203  1.00 38.36  ? 781  ASP A OD1   1 
ATOM   6292  O  OD2   . ASP C 3  781  ? 6.026   -15.472  82.037  1.00 44.07  ? 781  ASP A OD2   1 
ATOM   6293  N  N     . ARG C 3  782  ? 3.232   -18.050  77.601  1.00 25.08  ? 782  ARG A N     1 
ATOM   6294  C  CA    . ARG C 3  782  ? 2.002   -18.635  77.113  1.00 25.10  ? 782  ARG A CA    1 
ATOM   6295  C  C     . ARG C 3  782  ? 2.138   -19.227  75.730  1.00 24.78  ? 782  ARG A C     1 
ATOM   6296  O  O     . ARG C 3  782  ? 3.091   -18.960  75.011  1.00 24.97  ? 782  ARG A O     1 
ATOM   6297  C  CB    . ARG C 3  782  ? 0.834   -17.656  77.185  1.00 23.69  ? 782  ARG A CB    1 
ATOM   6298  C  CG    . ARG C 3  782  ? 1.072   -16.294  76.663  1.00 23.51  ? 782  ARG A CG    1 
ATOM   6299  C  CD    . ARG C 3  782  ? -0.240  -15.555  76.682  1.00 26.35  ? 782  ARG A CD    1 
ATOM   6300  N  NE    . ARG C 3  782  ? -0.091  -14.163  76.275  1.00 35.72  ? 782  ARG A NE    1 
ATOM   6301  C  CZ    . ARG C 3  782  ? -1.106  -13.377  75.921  1.00 38.57  ? 782  ARG A CZ    1 
ATOM   6302  N  NH1   . ARG C 3  782  ? -2.351  -13.847  75.920  1.00 38.49  ? 782  ARG A NH1   1 
ATOM   6303  N  NH2   . ARG C 3  782  ? -0.875  -12.118  75.570  1.00 40.03  ? 782  ARG A NH2   1 
ATOM   6304  N  N     . THR C 3  783  ? 1.172   -20.064  75.383  1.00 26.16  ? 783  THR A N     1 
ATOM   6305  C  CA    . THR C 3  783  ? 1.154   -20.776  74.110  1.00 25.00  ? 783  THR A CA    1 
ATOM   6306  C  C     . THR C 3  783  ? 0.653   -19.968  72.924  1.00 22.56  ? 783  THR A C     1 
ATOM   6307  O  O     . THR C 3  783  ? 1.180   -20.060  71.809  1.00 17.48  ? 783  THR A O     1 
ATOM   6308  C  CB    . THR C 3  783  ? 0.279   -22.013  74.237  1.00 26.47  ? 783  THR A CB    1 
ATOM   6309  O  OG1   . THR C 3  783  ? 0.974   -23.014  74.991  1.00 29.49  ? 783  THR A OG1   1 
ATOM   6310  C  CG2   . THR C 3  783  ? -0.071  -22.529  72.882  1.00 24.37  ? 783  THR A CG2   1 
ATOM   6311  N  N     . LEU C 3  784  ? -0.399  -19.205  73.182  1.00 20.58  ? 784  LEU A N     1 
ATOM   6312  C  CA    . LEU C 3  784  ? -1.016  -18.362  72.179  1.00 18.71  ? 784  LEU A CA    1 
ATOM   6313  C  C     . LEU C 3  784  ? -1.524  -17.171  72.925  1.00 17.68  ? 784  LEU A C     1 
ATOM   6314  O  O     . LEU C 3  784  ? -1.536  -17.161  74.151  1.00 19.06  ? 784  LEU A O     1 
ATOM   6315  C  CB    . LEU C 3  784  ? -2.190  -19.075  71.541  1.00 16.56  ? 784  LEU A CB    1 
ATOM   6316  C  CG    . LEU C 3  784  ? -1.766  -20.362  70.864  1.00 17.60  ? 784  LEU A CG    1 
ATOM   6317  C  CD1   . LEU C 3  784  ? -2.964  -21.207  70.503  1.00 17.49  ? 784  LEU A CD1   1 
ATOM   6318  C  CD2   . LEU C 3  784  ? -0.960  -19.988  69.645  1.00 22.78  ? 784  LEU A CD2   1 
ATOM   6319  N  N     . PRO C 3  785  ? -1.925  -16.136  72.203  1.00 15.54  ? 785  PRO A N     1 
ATOM   6320  C  CA    . PRO C 3  785  ? -2.434  -14.965  72.904  1.00 18.12  ? 785  PRO A CA    1 
ATOM   6321  C  C     . PRO C 3  785  ? -3.870  -15.184  73.426  1.00 19.02  ? 785  PRO A C     1 
ATOM   6322  O  O     . PRO C 3  785  ? -4.521  -14.271  73.928  1.00 20.06  ? 785  PRO A O     1 
ATOM   6323  C  CB    . PRO C 3  785  ? -2.314  -13.861  71.847  1.00 20.10  ? 785  PRO A CB    1 
ATOM   6324  C  CG    . PRO C 3  785  ? -2.364  -14.604  70.544  1.00 16.11  ? 785  PRO A CG    1 
ATOM   6325  C  CD    . PRO C 3  785  ? -1.529  -15.804  70.829  1.00 13.70  ? 785  PRO A CD    1 
ATOM   6326  N  N     . HIS C 3  786  ? -4.343  -16.415  73.339  1.00 18.62  ? 786  HIS A N     1 
ATOM   6327  C  CA    . HIS C 3  786  ? -5.684  -16.733  73.795  1.00 22.79  ? 786  HIS A CA    1 
ATOM   6328  C  C     . HIS C 3  786  ? -5.731  -17.392  75.177  1.00 24.18  ? 786  HIS A C     1 
ATOM   6329  O  O     . HIS C 3  786  ? -6.806  -17.756  75.683  1.00 26.85  ? 786  HIS A O     1 
ATOM   6330  C  CB    . HIS C 3  786  ? -6.322  -17.637  72.771  1.00 22.68  ? 786  HIS A CB    1 
ATOM   6331  C  CG    . HIS C 3  786  ? -6.130  -17.157  71.376  1.00 26.02  ? 786  HIS A CG    1 
ATOM   6332  N  ND1   . HIS C 3  786  ? -7.151  -16.617  70.628  1.00 32.11  ? 786  HIS A ND1   1 
ATOM   6333  C  CD2   . HIS C 3  786  ? -5.028  -17.125  70.593  1.00 31.08  ? 786  HIS A CD2   1 
ATOM   6334  C  CE1   . HIS C 3  786  ? -6.688  -16.279  69.438  1.00 35.99  ? 786  HIS A CE1   1 
ATOM   6335  N  NE2   . HIS C 3  786  ? -5.403  -16.577  69.390  1.00 35.78  ? 786  HIS A NE2   1 
ATOM   6336  N  N     . PHE C 3  787  ? -4.558  -17.530  75.778  1.00 22.81  ? 787  PHE A N     1 
ATOM   6337  C  CA    . PHE C 3  787  ? -4.413  -18.147  77.081  1.00 23.02  ? 787  PHE A CA    1 
ATOM   6338  C  C     . PHE C 3  787  ? -3.766  -17.145  78.020  1.00 24.39  ? 787  PHE A C     1 
ATOM   6339  O  O     . PHE C 3  787  ? -3.170  -16.169  77.566  1.00 25.55  ? 787  PHE A O     1 
ATOM   6340  C  CB    . PHE C 3  787  ? -3.493  -19.356  76.965  1.00 22.83  ? 787  PHE A CB    1 
ATOM   6341  C  CG    . PHE C 3  787  ? -4.075  -20.501  76.204  1.00 26.21  ? 787  PHE A CG    1 
ATOM   6342  C  CD1   . PHE C 3  787  ? -3.376  -21.074  75.153  1.00 30.47  ? 787  PHE A CD1   1 
ATOM   6343  C  CD2   . PHE C 3  787  ? -5.293  -21.053  76.574  1.00 27.58  ? 787  PHE A CD2   1 
ATOM   6344  C  CE1   . PHE C 3  787  ? -3.883  -22.185  74.487  1.00 29.63  ? 787  PHE A CE1   1 
ATOM   6345  C  CE2   . PHE C 3  787  ? -5.803  -22.152  75.920  1.00 26.21  ? 787  PHE A CE2   1 
ATOM   6346  C  CZ    . PHE C 3  787  ? -5.097  -22.721  74.873  1.00 28.74  ? 787  PHE A CZ    1 
ATOM   6347  N  N     . SER C 3  788  ? -3.869  -17.381  79.324  1.00 23.65  ? 788  SER A N     1 
ATOM   6348  C  CA    . SER C 3  788  ? -3.224  -16.493  80.278  1.00 24.91  ? 788  SER A CA    1 
ATOM   6349  C  C     . SER C 3  788  ? -1.804  -16.977  80.535  1.00 26.80  ? 788  SER A C     1 
ATOM   6350  O  O     . SER C 3  788  ? -1.519  -18.165  80.421  1.00 30.25  ? 788  SER A O     1 
ATOM   6351  C  CB    . SER C 3  788  ? -4.000  -16.466  81.581  1.00 25.57  ? 788  SER A CB    1 
ATOM   6352  O  OG    . SER C 3  788  ? -4.969  -15.440  81.542  1.00 30.17  ? 788  SER A OG    1 
ATOM   6353  N  N     . LYS C 3  789  ? -0.902  -16.068  80.875  1.00 27.21  ? 789  LYS A N     1 
ATOM   6354  C  CA    . LYS C 3  789  ? 0.471   -16.466  81.143  1.00 28.26  ? 789  LYS A CA    1 
ATOM   6355  C  C     . LYS C 3  789  ? 0.465   -17.610  82.148  1.00 30.67  ? 789  LYS A C     1 
ATOM   6356  O  O     . LYS C 3  789  ? -0.524  -17.809  82.865  1.00 31.28  ? 789  LYS A O     1 
ATOM   6357  C  CB    . LYS C 3  789  ? 1.272   -15.282  81.688  1.00 26.73  ? 789  LYS A CB    1 
ATOM   6358  C  CG    . LYS C 3  789  ? 1.455   -14.190  80.667  1.00 28.86  ? 789  LYS A CG    1 
ATOM   6359  C  CD    . LYS C 3  789  ? 2.305   -13.033  81.130  1.00 31.36  ? 789  LYS A CD    1 
ATOM   6360  C  CE    . LYS C 3  789  ? 2.621   -12.141  79.930  1.00 37.36  ? 789  LYS A CE    1 
ATOM   6361  N  NZ    . LYS C 3  789  ? 3.255   -10.834  80.292  1.00 44.20  ? 789  LYS A NZ    1 
ATOM   6362  N  N     . ASP C 3  790  ? 1.560   -18.366  82.183  1.00 31.41  ? 790  ASP A N     1 
ATOM   6363  C  CA    . ASP C 3  790  ? 1.694   -19.495  83.094  1.00 32.12  ? 790  ASP A CA    1 
ATOM   6364  C  C     . ASP C 3  790  ? 0.402   -20.320  83.106  1.00 32.40  ? 790  ASP A C     1 
ATOM   6365  O  O     . ASP C 3  790  ? -0.514  -20.034  83.874  1.00 34.01  ? 790  ASP A O     1 
ATOM   6366  C  CB    . ASP C 3  790  ? 2.008   -18.983  84.502  1.00 34.68  ? 790  ASP A CB    1 
ATOM   6367  C  CG    . ASP C 3  790  ? 3.339   -18.228  84.585  1.00 39.82  ? 790  ASP A CG    1 
ATOM   6368  O  OD1   . ASP C 3  790  ? 3.521   -17.479  85.566  1.00 42.90  ? 790  ASP A OD1   1 
ATOM   6369  O  OD2   . ASP C 3  790  ? 4.209   -18.386  83.698  1.00 42.65  ? 790  ASP A OD2   1 
ATOM   6370  N  N     . ASP C 3  791  ? 0.328   -21.331  82.240  1.00 33.63  ? 791  ASP A N     1 
ATOM   6371  C  CA    . ASP C 3  791  ? -0.849  -22.207  82.129  1.00 32.65  ? 791  ASP A CA    1 
ATOM   6372  C  C     . ASP C 3  791  ? -0.417  -23.546  81.541  1.00 31.87  ? 791  ASP A C     1 
ATOM   6373  O  O     . ASP C 3  791  ? -0.484  -23.732  80.327  1.00 29.10  ? 791  ASP A O     1 
ATOM   6374  C  CB    . ASP C 3  791  ? -1.891  -21.578  81.201  1.00 32.89  ? 791  ASP A CB    1 
ATOM   6375  C  CG    . ASP C 3  791  ? -3.166  -22.398  81.110  1.00 31.70  ? 791  ASP A CG    1 
ATOM   6376  O  OD1   . ASP C 3  791  ? -3.112  -23.616  81.348  1.00 30.44  ? 791  ASP A OD1   1 
ATOM   6377  O  OD2   . ASP C 3  791  ? -4.225  -21.827  80.784  1.00 32.56  ? 791  ASP A OD2   1 
ATOM   6378  N  N     . TYR C 3  792  ? 0.002   -24.481  82.392  1.00 32.77  ? 792  TYR A N     1 
ATOM   6379  C  CA    . TYR C 3  792  ? 0.474   -25.776  81.909  1.00 36.36  ? 792  TYR A CA    1 
ATOM   6380  C  C     . TYR C 3  792  ? -0.595  -26.852  81.723  1.00 37.57  ? 792  TYR A C     1 
ATOM   6381  O  O     . TYR C 3  792  ? -0.275  -28.022  81.484  1.00 36.54  ? 792  TYR A O     1 
ATOM   6382  C  CB    . TYR C 3  792  ? 1.583   -26.293  82.822  1.00 37.02  ? 792  TYR A CB    1 
ATOM   6383  C  CG    . TYR C 3  792  ? 2.766   -25.355  82.918  1.00 42.16  ? 792  TYR A CG    1 
ATOM   6384  C  CD1   . TYR C 3  792  ? 2.701   -24.188  83.681  1.00 43.49  ? 792  TYR A CD1   1 
ATOM   6385  C  CD2   . TYR C 3  792  ? 3.956   -25.631  82.239  1.00 46.55  ? 792  TYR A CD2   1 
ATOM   6386  C  CE1   . TYR C 3  792  ? 3.795   -23.320  83.770  1.00 45.63  ? 792  TYR A CE1   1 
ATOM   6387  C  CE2   . TYR C 3  792  ? 5.060   -24.769  82.318  1.00 47.62  ? 792  TYR A CE2   1 
ATOM   6388  C  CZ    . TYR C 3  792  ? 4.971   -23.618  83.088  1.00 49.05  ? 792  TYR A CZ    1 
ATOM   6389  O  OH    . TYR C 3  792  ? 6.062   -22.779  83.195  1.00 52.11  ? 792  TYR A OH    1 
ATOM   6390  N  N     . SER C 3  793  ? -1.861  -26.447  81.823  1.00 39.35  ? 793  SER A N     1 
ATOM   6391  C  CA    . SER C 3  793  ? -2.995  -27.357  81.647  1.00 38.64  ? 793  SER A CA    1 
ATOM   6392  C  C     . SER C 3  793  ? -2.898  -27.978  80.271  1.00 37.37  ? 793  SER A C     1 
ATOM   6393  O  O     . SER C 3  793  ? -2.362  -27.376  79.353  1.00 37.01  ? 793  SER A O     1 
ATOM   6394  C  CB    . SER C 3  793  ? -4.328  -26.607  81.753  1.00 41.18  ? 793  SER A CB    1 
ATOM   6395  O  OG    . SER C 3  793  ? -4.600  -25.855  80.578  1.00 40.19  ? 793  SER A OG    1 
ATOM   6396  N  N     . PRO C 3  794  ? -3.447  -29.181  80.099  1.00 37.16  ? 794  PRO A N     1 
ATOM   6397  C  CA    . PRO C 3  794  ? -3.388  -29.850  78.803  1.00 39.68  ? 794  PRO A CA    1 
ATOM   6398  C  C     . PRO C 3  794  ? -3.850  -29.049  77.577  1.00 41.47  ? 794  PRO A C     1 
ATOM   6399  O  O     . PRO C 3  794  ? -3.111  -28.962  76.593  1.00 44.26  ? 794  PRO A O     1 
ATOM   6400  C  CB    . PRO C 3  794  ? -4.204  -31.122  79.043  1.00 38.11  ? 794  PRO A CB    1 
ATOM   6401  C  CG    . PRO C 3  794  ? -5.149  -30.721  80.108  1.00 38.47  ? 794  PRO A CG    1 
ATOM   6402  C  CD    . PRO C 3  794  ? -4.279  -29.945  81.038  1.00 37.11  ? 794  PRO A CD    1 
ATOM   6403  N  N     . GLU C 3  795  ? -5.045  -28.460  77.621  1.00 41.78  ? 795  GLU A N     1 
ATOM   6404  C  CA    . GLU C 3  795  ? -5.547  -27.697  76.468  1.00 41.81  ? 795  GLU A CA    1 
ATOM   6405  C  C     . GLU C 3  795  ? -4.496  -26.707  75.978  1.00 39.06  ? 795  GLU A C     1 
ATOM   6406  O  O     . GLU C 3  795  ? -4.171  -26.645  74.796  1.00 37.57  ? 795  GLU A O     1 
ATOM   6407  C  CB    . GLU C 3  795  ? -6.817  -26.905  76.824  1.00 43.69  ? 795  GLU A CB    1 
ATOM   6408  C  CG    . GLU C 3  795  ? -7.746  -27.553  77.855  1.00 53.77  ? 795  GLU A CG    1 
ATOM   6409  C  CD    . GLU C 3  795  ? -7.359  -27.263  79.320  1.00 57.40  ? 795  GLU A CD    1 
ATOM   6410  O  OE1   . GLU C 3  795  ? -7.192  -26.073  79.685  1.00 56.24  ? 795  GLU A OE1   1 
ATOM   6411  O  OE2   . GLU C 3  795  ? -7.244  -28.231  80.111  1.00 57.90  ? 795  GLU A OE2   1 
ATOM   6412  N  N     . SER C 3  796  ? -3.967  -25.945  76.923  1.00 38.30  ? 796  SER A N     1 
ATOM   6413  C  CA    . SER C 3  796  ? -2.982  -24.915  76.658  1.00 36.52  ? 796  SER A CA    1 
ATOM   6414  C  C     . SER C 3  796  ? -1.726  -25.364  75.976  1.00 33.49  ? 796  SER A C     1 
ATOM   6415  O  O     . SER C 3  796  ? -1.229  -24.659  75.112  1.00 36.31  ? 796  SER A O     1 
ATOM   6416  C  CB    . SER C 3  796  ? -2.589  -24.208  77.961  1.00 40.24  ? 796  SER A CB    1 
ATOM   6417  O  OG    . SER C 3  796  ? -1.470  -23.350  77.769  1.00 42.81  ? 796  SER A OG    1 
ATOM   6418  N  N     . LYS C 3  797  ? -1.201  -26.521  76.345  1.00 28.41  ? 797  LYS A N     1 
ATOM   6419  C  CA    . LYS C 3  797  ? 0.047   -26.949  75.745  1.00 27.68  ? 797  LYS A CA    1 
ATOM   6420  C  C     . LYS C 3  797  ? 0.042   -27.997  74.644  1.00 26.11  ? 797  LYS A C     1 
ATOM   6421  O  O     . LYS C 3  797  ? 1.031   -28.704  74.458  1.00 24.67  ? 797  LYS A O     1 
ATOM   6422  C  CB    . LYS C 3  797  ? 1.017   -27.385  76.836  1.00 33.93  ? 797  LYS A CB    1 
ATOM   6423  C  CG    . LYS C 3  797  ? 1.658   -26.243  77.602  1.00 36.63  ? 797  LYS A CG    1 
ATOM   6424  C  CD    . LYS C 3  797  ? 2.830   -26.758  78.422  1.00 40.27  ? 797  LYS A CD    1 
ATOM   6425  C  CE    . LYS C 3  797  ? 3.841   -25.644  78.650  1.00 49.90  ? 797  LYS A CE    1 
ATOM   6426  N  NZ    . LYS C 3  797  ? 5.234   -26.138  78.901  1.00 56.65  ? 797  LYS A NZ    1 
ATOM   6427  N  N     . GLY C 3  798  ? -1.054  -28.108  73.908  1.00 25.32  ? 798  GLY A N     1 
ATOM   6428  C  CA    . GLY C 3  798  ? -1.073  -29.063  72.816  1.00 25.13  ? 798  GLY A CA    1 
ATOM   6429  C  C     . GLY C 3  798  ? -1.818  -30.386  72.919  1.00 25.51  ? 798  GLY A C     1 
ATOM   6430  O  O     . GLY C 3  798  ? -1.558  -31.289  72.117  1.00 23.89  ? 798  GLY A O     1 
ATOM   6431  N  N     . PHE C 3  799  ? -2.730  -30.530  73.875  1.00 25.26  ? 799  PHE A N     1 
ATOM   6432  C  CA    . PHE C 3  799  ? -3.471  -31.775  73.971  1.00 27.15  ? 799  PHE A CA    1 
ATOM   6433  C  C     . PHE C 3  799  ? -4.761  -31.669  73.169  1.00 28.97  ? 799  PHE A C     1 
ATOM   6434  O  O     . PHE C 3  799  ? -5.721  -31.031  73.605  1.00 31.68  ? 799  PHE A O     1 
ATOM   6435  C  CB    . PHE C 3  799  ? -3.821  -32.100  75.415  1.00 27.81  ? 799  PHE A CB    1 
ATOM   6436  C  CG    . PHE C 3  799  ? -4.622  -33.370  75.570  1.00 32.32  ? 799  PHE A CG    1 
ATOM   6437  C  CD1   . PHE C 3  799  ? -4.048  -34.607  75.318  1.00 33.85  ? 799  PHE A CD1   1 
ATOM   6438  C  CD2   . PHE C 3  799  ? -5.951  -33.330  75.970  1.00 35.39  ? 799  PHE A CD2   1 
ATOM   6439  C  CE1   . PHE C 3  799  ? -4.781  -35.785  75.463  1.00 31.74  ? 799  PHE A CE1   1 
ATOM   6440  C  CE2   . PHE C 3  799  ? -6.689  -34.508  76.116  1.00 34.52  ? 799  PHE A CE2   1 
ATOM   6441  C  CZ    . PHE C 3  799  ? -6.099  -35.732  75.863  1.00 31.30  ? 799  PHE A CZ    1 
ATOM   6442  N  N     . VAL C 3  800  ? -4.782  -32.286  71.993  1.00 27.81  ? 800  VAL A N     1 
ATOM   6443  C  CA    . VAL C 3  800  ? -5.968  -32.269  71.160  1.00 26.94  ? 800  VAL A CA    1 
ATOM   6444  C  C     . VAL C 3  800  ? -6.915  -33.337  71.669  1.00 28.05  ? 800  VAL A C     1 
ATOM   6445  O  O     . VAL C 3  800  ? -6.753  -34.521  71.361  1.00 28.06  ? 800  VAL A O     1 
ATOM   6446  C  CB    . VAL C 3  800  ? -5.627  -32.570  69.706  1.00 28.09  ? 800  VAL A CB    1 
ATOM   6447  C  CG1   . VAL C 3  800  ? -6.906  -32.655  68.875  1.00 31.62  ? 800  VAL A CG1   1 
ATOM   6448  C  CG2   . VAL C 3  800  ? -4.723  -31.490  69.165  1.00 26.59  ? 800  VAL A CG2   1 
ATOM   6449  N  N     . GLU C 3  801  ? -7.899  -32.905  72.455  1.00 29.11  ? 801  GLU A N     1 
ATOM   6450  C  CA    . GLU C 3  801  ? -8.897  -33.801  73.037  1.00 29.18  ? 801  GLU A CA    1 
ATOM   6451  C  C     . GLU C 3  801  ? -9.847  -34.400  72.013  1.00 28.14  ? 801  GLU A C     1 
ATOM   6452  O  O     . GLU C 3  801  ? -10.201 -35.574  72.089  1.00 28.12  ? 801  GLU A O     1 
ATOM   6453  C  CB    . GLU C 3  801  ? -9.728  -33.059  74.089  1.00 30.13  ? 801  GLU A CB    1 
ATOM   6454  C  CG    . GLU C 3  801  ? -10.991 -33.810  74.513  1.00 30.24  ? 801  GLU A CG    1 
ATOM   6455  C  CD    . GLU C 3  801  ? -11.794 -33.089  75.585  1.00 33.40  ? 801  GLU A CD    1 
ATOM   6456  O  OE1   . GLU C 3  801  ? -12.791 -33.688  76.049  1.00 35.02  ? 801  GLU A OE1   1 
ATOM   6457  O  OE2   . GLU C 3  801  ? -11.437 -31.940  75.963  1.00 28.42  ? 801  GLU A OE2   1 
ATOM   6458  N  N     . ASN C 3  802  ? -10.270 -33.584  71.060  1.00 28.07  ? 802  ASN A N     1 
ATOM   6459  C  CA    . ASN C 3  802  ? -11.209 -34.037  70.052  1.00 28.82  ? 802  ASN A CA    1 
ATOM   6460  C  C     . ASN C 3  802  ? -10.653 -35.095  69.122  1.00 27.53  ? 802  ASN A C     1 
ATOM   6461  O  O     . ASN C 3  802  ? -9.486  -35.457  69.205  1.00 27.86  ? 802  ASN A O     1 
ATOM   6462  C  CB    . ASN C 3  802  ? -11.718 -32.842  69.246  1.00 29.88  ? 802  ASN A CB    1 
ATOM   6463  C  CG    . ASN C 3  802  ? -12.673 -31.977  70.041  1.00 31.73  ? 802  ASN A CG    1 
ATOM   6464  O  OD1   . ASN C 3  802  ? -13.726 -32.443  70.472  1.00 38.38  ? 802  ASN A OD1   1 
ATOM   6465  N  ND2   . ASN C 3  802  ? -12.312 -30.719  70.246  1.00 30.43  ? 802  ASN A ND2   1 
ATOM   6466  N  N     . SER C 3  803  ? -11.519 -35.586  68.244  1.00 27.21  ? 803  SER A N     1 
ATOM   6467  C  CA    . SER C 3  803  ? -11.188 -36.604  67.256  1.00 27.03  ? 803  SER A CA    1 
ATOM   6468  C  C     . SER C 3  803  ? -11.217 -35.970  65.887  1.00 25.52  ? 803  SER A C     1 
ATOM   6469  O  O     . SER C 3  803  ? -11.774 -34.893  65.717  1.00 26.76  ? 803  SER A O     1 
ATOM   6470  C  CB    . SER C 3  803  ? -12.231 -37.719  67.284  1.00 32.02  ? 803  SER A CB    1 
ATOM   6471  O  OG    . SER C 3  803  ? -13.547 -37.204  67.148  1.00 36.22  ? 803  SER A OG    1 
ATOM   6472  N  N     . TYR C 3  804  ? -10.636 -36.630  64.899  1.00 23.71  ? 804  TYR A N     1 
ATOM   6473  C  CA    . TYR C 3  804  ? -10.666 -36.066  63.569  1.00 24.75  ? 804  TYR A CA    1 
ATOM   6474  C  C     . TYR C 3  804  ? -12.110 -36.015  63.124  1.00 26.14  ? 804  TYR A C     1 
ATOM   6475  O  O     . TYR C 3  804  ? -12.483 -35.207  62.273  1.00 28.63  ? 804  TYR A O     1 
ATOM   6476  C  CB    . TYR C 3  804  ? -9.840  -36.906  62.621  1.00 24.49  ? 804  TYR A CB    1 
ATOM   6477  C  CG    . TYR C 3  804  ? -8.361  -36.636  62.747  1.00 24.68  ? 804  TYR A CG    1 
ATOM   6478  C  CD1   . TYR C 3  804  ? -7.460  -37.679  62.956  1.00 26.52  ? 804  TYR A CD1   1 
ATOM   6479  C  CD2   . TYR C 3  804  ? -7.859  -35.346  62.622  1.00 20.45  ? 804  TYR A CD2   1 
ATOM   6480  C  CE1   . TYR C 3  804  ? -6.102  -37.443  63.035  1.00 27.99  ? 804  TYR A CE1   1 
ATOM   6481  C  CE2   . TYR C 3  804  ? -6.503  -35.102  62.696  1.00 23.61  ? 804  TYR A CE2   1 
ATOM   6482  C  CZ    . TYR C 3  804  ? -5.630  -36.155  62.902  1.00 27.44  ? 804  TYR A CZ    1 
ATOM   6483  O  OH    . TYR C 3  804  ? -4.278  -35.934  62.968  1.00 29.99  ? 804  TYR A OH    1 
ATOM   6484  N  N     . LEU C 3  805  ? -12.930 -36.869  63.726  1.00 25.97  ? 805  LEU A N     1 
ATOM   6485  C  CA    . LEU C 3  805  ? -14.353 -36.901  63.406  1.00 24.12  ? 805  LEU A CA    1 
ATOM   6486  C  C     . LEU C 3  805  ? -15.071 -35.680  63.941  1.00 22.24  ? 805  LEU A C     1 
ATOM   6487  O  O     . LEU C 3  805  ? -15.680 -34.944  63.184  1.00 22.20  ? 805  LEU A O     1 
ATOM   6488  C  CB    . LEU C 3  805  ? -15.011 -38.149  63.985  1.00 24.41  ? 805  LEU A CB    1 
ATOM   6489  C  CG    . LEU C 3  805  ? -16.538 -38.167  63.896  1.00 20.88  ? 805  LEU A CG    1 
ATOM   6490  C  CD1   . LEU C 3  805  ? -16.972 -37.712  62.518  1.00 20.75  ? 805  LEU A CD1   1 
ATOM   6491  C  CD2   . LEU C 3  805  ? -17.049 -39.568  64.198  1.00 20.40  ? 805  LEU A CD2   1 
ATOM   6492  N  N     . ARG C 3  806  ? -15.007 -35.493  65.255  1.00 22.52  ? 806  ARG A N     1 
ATOM   6493  C  CA    . ARG C 3  806  ? -15.640 -34.363  65.931  1.00 24.37  ? 806  ARG A CA    1 
ATOM   6494  C  C     . ARG C 3  806  ? -15.106 -33.058  65.390  1.00 24.37  ? 806  ARG A C     1 
ATOM   6495  O  O     . ARG C 3  806  ? -15.845 -32.086  65.244  1.00 22.78  ? 806  ARG A O     1 
ATOM   6496  C  CB    . ARG C 3  806  ? -15.358 -34.408  67.434  1.00 27.80  ? 806  ARG A CB    1 
ATOM   6497  C  CG    . ARG C 3  806  ? -16.291 -35.277  68.251  1.00 38.63  ? 806  ARG A CG    1 
ATOM   6498  C  CD    . ARG C 3  806  ? -15.795 -35.390  69.688  1.00 48.97  ? 806  ARG A CD    1 
ATOM   6499  N  NE    . ARG C 3  806  ? -16.885 -35.607  70.641  1.00 57.03  ? 806  ARG A NE    1 
ATOM   6500  C  CZ    . ARG C 3  806  ? -16.706 -35.963  71.912  1.00 57.31  ? 806  ARG A CZ    1 
ATOM   6501  N  NH1   . ARG C 3  806  ? -15.473 -36.148  72.377  1.00 57.39  ? 806  ARG A NH1   1 
ATOM   6502  N  NH2   . ARG C 3  806  ? -17.753 -36.118  72.718  1.00 52.67  ? 806  ARG A NH2   1 
ATOM   6503  N  N     . GLY C 3  807  ? -13.808 -33.050  65.106  1.00 25.91  ? 807  GLY A N     1 
ATOM   6504  C  CA    . GLY C 3  807  ? -13.155 -31.858  64.598  1.00 27.58  ? 807  GLY A CA    1 
ATOM   6505  C  C     . GLY C 3  807  ? -12.358 -31.109  65.658  1.00 27.27  ? 807  GLY A C     1 
ATOM   6506  O  O     . GLY C 3  807  ? -12.752 -31.038  66.821  1.00 27.81  ? 807  GLY A O     1 
ATOM   6507  N  N     . LEU C 3  808  ? -11.230 -30.540  65.256  1.00 26.78  ? 808  LEU A N     1 
ATOM   6508  C  CA    . LEU C 3  808  ? -10.391 -29.797  66.179  1.00 26.37  ? 808  LEU A CA    1 
ATOM   6509  C  C     . LEU C 3  808  ? -10.836 -28.355  66.347  1.00 27.40  ? 808  LEU A C     1 
ATOM   6510  O  O     . LEU C 3  808  ? -11.578 -27.822  65.529  1.00 29.11  ? 808  LEU A O     1 
ATOM   6511  C  CB    . LEU C 3  808  ? -8.940  -29.801  65.701  1.00 20.77  ? 808  LEU A CB    1 
ATOM   6512  C  CG    . LEU C 3  808  ? -8.171  -31.087  65.932  1.00 15.71  ? 808  LEU A CG    1 
ATOM   6513  C  CD1   . LEU C 3  808  ? -8.702  -32.135  65.000  1.00 11.33  ? 808  LEU A CD1   1 
ATOM   6514  C  CD2   . LEU C 3  808  ? -6.692  -30.848  65.695  1.00 14.74  ? 808  LEU A CD2   1 
ATOM   6515  N  N     . THR C 3  809  ? -10.361 -27.729  67.417  1.00 27.81  ? 809  THR A N     1 
ATOM   6516  C  CA    . THR C 3  809  ? -10.654 -26.332  67.698  1.00 28.76  ? 809  THR A CA    1 
ATOM   6517  C  C     . THR C 3  809  ? -9.464  -25.501  67.207  1.00 27.76  ? 809  THR A C     1 
ATOM   6518  O  O     . THR C 3  809  ? -8.334  -25.990  67.158  1.00 28.94  ? 809  THR A O     1 
ATOM   6519  C  CB    . THR C 3  809  ? -10.800 -26.101  69.196  1.00 30.84  ? 809  THR A CB    1 
ATOM   6520  O  OG1   . THR C 3  809  ? -9.499  -26.061  69.806  1.00 30.41  ? 809  THR A OG1   1 
ATOM   6521  C  CG2   . THR C 3  809  ? -11.621 -27.224  69.807  1.00 29.71  ? 809  THR A CG2   1 
ATOM   6522  N  N     . PRO C 3  810  ? -9.693  -24.227  66.873  1.00 24.69  ? 810  PRO A N     1 
ATOM   6523  C  CA    . PRO C 3  810  ? -8.572  -23.412  66.398  1.00 24.11  ? 810  PRO A CA    1 
ATOM   6524  C  C     . PRO C 3  810  ? -7.252  -23.786  67.087  1.00 23.68  ? 810  PRO A C     1 
ATOM   6525  O  O     . PRO C 3  810  ? -6.350  -24.321  66.452  1.00 21.49  ? 810  PRO A O     1 
ATOM   6526  C  CB    . PRO C 3  810  ? -9.020  -21.996  66.736  1.00 23.17  ? 810  PRO A CB    1 
ATOM   6527  C  CG    . PRO C 3  810  ? -10.480 -22.078  66.620  1.00 21.24  ? 810  PRO A CG    1 
ATOM   6528  C  CD    . PRO C 3  810  ? -10.797 -23.366  67.322  1.00 22.25  ? 810  PRO A CD    1 
ATOM   6529  N  N     . GLN C 3  811  ? -7.155  -23.515  68.391  1.00 24.70  ? 811  GLN A N     1 
ATOM   6530  C  CA    . GLN C 3  811  ? -5.950  -23.830  69.151  1.00 22.30  ? 811  GLN A CA    1 
ATOM   6531  C  C     . GLN C 3  811  ? -5.538  -25.246  68.834  1.00 21.17  ? 811  GLN A C     1 
ATOM   6532  O  O     . GLN C 3  811  ? -4.422  -25.464  68.385  1.00 24.11  ? 811  GLN A O     1 
ATOM   6533  C  CB    . GLN C 3  811  ? -6.167  -23.718  70.665  1.00 22.06  ? 811  GLN A CB    1 
ATOM   6534  C  CG    . GLN C 3  811  ? -6.685  -22.398  71.148  1.00 21.20  ? 811  GLN A CG    1 
ATOM   6535  C  CD    . GLN C 3  811  ? -8.196  -22.343  71.141  1.00 27.19  ? 811  GLN A CD    1 
ATOM   6536  O  OE1   . GLN C 3  811  ? -8.863  -23.158  70.493  1.00 31.13  ? 811  GLN A OE1   1 
ATOM   6537  N  NE2   . GLN C 3  811  ? -8.751  -21.374  71.857  1.00 26.94  ? 811  GLN A NE2   1 
ATOM   6538  N  N     . GLU C 3  812  ? -6.426  -26.212  69.054  1.00 18.17  ? 812  GLU A N     1 
ATOM   6539  C  CA    . GLU C 3  812  ? -6.062  -27.594  68.758  1.00 20.87  ? 812  GLU A CA    1 
ATOM   6540  C  C     . GLU C 3  812  ? -5.432  -27.653  67.373  1.00 21.34  ? 812  GLU A C     1 
ATOM   6541  O  O     . GLU C 3  812  ? -4.312  -28.158  67.187  1.00 18.31  ? 812  GLU A O     1 
ATOM   6542  C  CB    . GLU C 3  812  ? -7.285  -28.510  68.790  1.00 19.16  ? 812  GLU A CB    1 
ATOM   6543  C  CG    . GLU C 3  812  ? -7.809  -28.781  70.177  1.00 29.07  ? 812  GLU A CG    1 
ATOM   6544  C  CD    . GLU C 3  812  ? -8.903  -29.825  70.185  1.00 33.65  ? 812  GLU A CD    1 
ATOM   6545  O  OE1   . GLU C 3  812  ? -9.725  -29.791  69.248  1.00 39.13  ? 812  GLU A OE1   1 
ATOM   6546  O  OE2   . GLU C 3  812  ? -8.952  -30.661  71.120  1.00 30.89  ? 812  GLU A OE2   1 
ATOM   6547  N  N     . PHE C 3  813  ? -6.173  -27.111  66.408  1.00 21.15  ? 813  PHE A N     1 
ATOM   6548  C  CA    . PHE C 3  813  ? -5.745  -27.076  65.026  1.00 18.41  ? 813  PHE A CA    1 
ATOM   6549  C  C     . PHE C 3  813  ? -4.320  -26.592  65.003  1.00 16.86  ? 813  PHE A C     1 
ATOM   6550  O  O     . PHE C 3  813  ? -3.412  -27.373  64.762  1.00 17.40  ? 813  PHE A O     1 
ATOM   6551  C  CB    . PHE C 3  813  ? -6.628  -26.123  64.213  1.00 19.62  ? 813  PHE A CB    1 
ATOM   6552  C  CG    . PHE C 3  813  ? -6.330  -26.126  62.742  1.00 17.79  ? 813  PHE A CG    1 
ATOM   6553  C  CD1   . PHE C 3  813  ? -6.696  -27.202  61.952  1.00 18.61  ? 813  PHE A CD1   1 
ATOM   6554  C  CD2   . PHE C 3  813  ? -5.665  -25.069  62.154  1.00 19.32  ? 813  PHE A CD2   1 
ATOM   6555  C  CE1   . PHE C 3  813  ? -6.404  -27.233  60.595  1.00 20.81  ? 813  PHE A CE1   1 
ATOM   6556  C  CE2   . PHE C 3  813  ? -5.365  -25.087  60.785  1.00 24.80  ? 813  PHE A CE2   1 
ATOM   6557  C  CZ    . PHE C 3  813  ? -5.736  -26.174  60.006  1.00 20.89  ? 813  PHE A CZ    1 
ATOM   6558  N  N     . PHE C 3  814  ? -4.122  -25.312  65.302  1.00 14.32  ? 814  PHE A N     1 
ATOM   6559  C  CA    . PHE C 3  814  ? -2.791  -24.741  65.264  1.00 11.80  ? 814  PHE A CA    1 
ATOM   6560  C  C     . PHE C 3  814  ? -1.729  -25.646  65.865  1.00 12.02  ? 814  PHE A C     1 
ATOM   6561  O  O     . PHE C 3  814  ? -0.691  -25.899  65.254  1.00 10.61  ? 814  PHE A O     1 
ATOM   6562  C  CB    . PHE C 3  814  ? -2.750  -23.396  65.952  1.00 8.65   ? 814  PHE A CB    1 
ATOM   6563  C  CG    . PHE C 3  814  ? -1.605  -22.555  65.503  1.00 10.80  ? 814  PHE A CG    1 
ATOM   6564  C  CD1   . PHE C 3  814  ? -1.707  -21.780  64.372  1.00 10.86  ? 814  PHE A CD1   1 
ATOM   6565  C  CD2   . PHE C 3  814  ? -0.389  -22.600  66.164  1.00 14.74  ? 814  PHE A CD2   1 
ATOM   6566  C  CE1   . PHE C 3  814  ? -0.614  -21.064  63.902  1.00 12.96  ? 814  PHE A CE1   1 
ATOM   6567  C  CE2   . PHE C 3  814  ? 0.705   -21.888  65.698  1.00 13.61  ? 814  PHE A CE2   1 
ATOM   6568  C  CZ    . PHE C 3  814  ? 0.590   -21.120  64.564  1.00 12.07  ? 814  PHE A CZ    1 
ATOM   6569  N  N     . PHE C 3  815  ? -1.989  -26.135  67.063  1.00 11.05  ? 815  PHE A N     1 
ATOM   6570  C  CA    . PHE C 3  815  ? -1.052  -27.023  67.724  1.00 11.84  ? 815  PHE A CA    1 
ATOM   6571  C  C     . PHE C 3  815  ? -0.753  -28.226  66.853  1.00 11.65  ? 815  PHE A C     1 
ATOM   6572  O  O     . PHE C 3  815  ? 0.358   -28.409  66.368  1.00 12.29  ? 815  PHE A O     1 
ATOM   6573  C  CB    . PHE C 3  815  ? -1.648  -27.496  69.037  1.00 12.64  ? 815  PHE A CB    1 
ATOM   6574  C  CG    . PHE C 3  815  ? -1.827  -26.407  70.022  1.00 15.09  ? 815  PHE A CG    1 
ATOM   6575  C  CD1   . PHE C 3  815  ? -2.687  -26.569  71.103  1.00 15.53  ? 815  PHE A CD1   1 
ATOM   6576  C  CD2   . PHE C 3  815  ? -1.151  -25.202  69.860  1.00 15.28  ? 815  PHE A CD2   1 
ATOM   6577  C  CE1   . PHE C 3  815  ? -2.877  -25.547  72.009  1.00 19.06  ? 815  PHE A CE1   1 
ATOM   6578  C  CE2   . PHE C 3  815  ? -1.332  -24.175  70.756  1.00 18.93  ? 815  PHE A CE2   1 
ATOM   6579  C  CZ    . PHE C 3  815  ? -2.199  -24.341  71.839  1.00 19.20  ? 815  PHE A CZ    1 
ATOM   6580  N  N     . HIS C 3  816  ? -1.760  -29.062  66.685  1.00 11.08  ? 816  HIS A N     1 
ATOM   6581  C  CA    . HIS C 3  816  ? -1.636  -30.243  65.863  1.00 11.21  ? 816  HIS A CA    1 
ATOM   6582  C  C     . HIS C 3  816  ? -0.894  -29.897  64.593  1.00 8.95   ? 816  HIS A C     1 
ATOM   6583  O  O     . HIS C 3  816  ? -0.257  -30.748  64.004  1.00 7.39   ? 816  HIS A O     1 
ATOM   6584  C  CB    . HIS C 3  816  ? -3.040  -30.775  65.544  1.00 18.64  ? 816  HIS A CB    1 
ATOM   6585  C  CG    . HIS C 3  816  ? -3.062  -31.916  64.578  1.00 19.96  ? 816  HIS A CG    1 
ATOM   6586  N  ND1   . HIS C 3  816  ? -1.957  -32.697  64.322  1.00 21.12  ? 816  HIS A ND1   1 
ATOM   6587  C  CD2   . HIS C 3  816  ? -4.064  -32.420  63.820  1.00 22.89  ? 816  HIS A CD2   1 
ATOM   6588  C  CE1   . HIS C 3  816  ? -2.277  -33.632  63.446  1.00 23.31  ? 816  HIS A CE1   1 
ATOM   6589  N  NE2   . HIS C 3  816  ? -3.550  -33.487  63.125  1.00 22.69  ? 816  HIS A NE2   1 
ATOM   6590  N  N     . ALA C 3  817  ? -0.985  -28.636  64.179  1.00 9.18   ? 817  ALA A N     1 
ATOM   6591  C  CA    . ALA C 3  817  ? -0.328  -28.166  62.970  1.00 11.74  ? 817  ALA A CA    1 
ATOM   6592  C  C     . ALA C 3  817  ? 1.179   -28.092  63.190  1.00 15.79  ? 817  ALA A C     1 
ATOM   6593  O  O     . ALA C 3  817  ? 1.974   -28.502  62.340  1.00 15.24  ? 817  ALA A O     1 
ATOM   6594  C  CB    . ALA C 3  817  ? -0.860  -26.819  62.604  1.00 7.85   ? 817  ALA A CB    1 
ATOM   6595  N  N     . MET C 3  818  ? 1.558   -27.557  64.346  1.00 20.67  ? 818  MET A N     1 
ATOM   6596  C  CA    . MET C 3  818  ? 2.958   -27.424  64.732  1.00 21.53  ? 818  MET A CA    1 
ATOM   6597  C  C     . MET C 3  818  ? 3.628   -28.784  64.665  1.00 20.32  ? 818  MET A C     1 
ATOM   6598  O  O     . MET C 3  818  ? 4.685   -28.953  64.057  1.00 22.01  ? 818  MET A O     1 
ATOM   6599  C  CB    . MET C 3  818  ? 3.050   -26.846  66.147  1.00 20.41  ? 818  MET A CB    1 
ATOM   6600  C  CG    . MET C 3  818  ? 2.671   -25.364  66.196  1.00 22.67  ? 818  MET A CG    1 
ATOM   6601  S  SD    . MET C 3  818  ? 2.677   -24.675  67.853  1.00 26.16  ? 818  MET A SD    1 
ATOM   6602  C  CE    . MET C 3  818  ? 4.323   -24.949  68.328  1.00 30.71  ? 818  MET A CE    1 
ATOM   6603  N  N     . GLY C 3  819  ? 3.004   -29.763  65.286  1.00 19.14  ? 819  GLY A N     1 
ATOM   6604  C  CA    . GLY C 3  819  ? 3.579   -31.088  65.251  1.00 22.11  ? 819  GLY A CA    1 
ATOM   6605  C  C     . GLY C 3  819  ? 3.577   -31.539  63.814  1.00 22.70  ? 819  GLY A C     1 
ATOM   6606  O  O     . GLY C 3  819  ? 4.557   -32.069  63.292  1.00 23.12  ? 819  GLY A O     1 
ATOM   6607  N  N     . GLY C 3  820  ? 2.456   -31.316  63.159  1.00 23.73  ? 820  GLY A N     1 
ATOM   6608  C  CA    . GLY C 3  820  ? 2.375   -31.724  61.784  1.00 28.22  ? 820  GLY A CA    1 
ATOM   6609  C  C     . GLY C 3  820  ? 3.650   -31.284  61.111  1.00 29.74  ? 820  GLY A C     1 
ATOM   6610  O  O     . GLY C 3  820  ? 4.372   -32.089  60.528  1.00 33.74  ? 820  GLY A O     1 
ATOM   6611  N  N     . ARG C 3  821  ? 3.954   -30.003  61.229  1.00 29.27  ? 821  ARG A N     1 
ATOM   6612  C  CA    . ARG C 3  821  ? 5.140   -29.480  60.590  1.00 29.86  ? 821  ARG A CA    1 
ATOM   6613  C  C     . ARG C 3  821  ? 6.397   -30.182  61.051  1.00 30.43  ? 821  ARG A C     1 
ATOM   6614  O  O     . ARG C 3  821  ? 7.135   -30.716  60.220  1.00 28.83  ? 821  ARG A O     1 
ATOM   6615  C  CB    . ARG C 3  821  ? 5.275   -27.987  60.842  1.00 31.83  ? 821  ARG A CB    1 
ATOM   6616  C  CG    . ARG C 3  821  ? 6.476   -27.379  60.168  1.00 29.38  ? 821  ARG A CG    1 
ATOM   6617  C  CD    . ARG C 3  821  ? 6.171   -26.908  58.774  1.00 26.26  ? 821  ARG A CD    1 
ATOM   6618  N  NE    . ARG C 3  821  ? 6.321   -25.466  58.723  1.00 25.97  ? 821  ARG A NE    1 
ATOM   6619  C  CZ    . ARG C 3  821  ? 5.316   -24.644  58.473  1.00 32.65  ? 821  ARG A CZ    1 
ATOM   6620  N  NH1   . ARG C 3  821  ? 4.109   -25.149  58.246  1.00 35.69  ? 821  ARG A NH1   1 
ATOM   6621  N  NH2   . ARG C 3  821  ? 5.506   -23.330  58.474  1.00 35.03  ? 821  ARG A NH2   1 
ATOM   6622  N  N     . GLU C 3  822  ? 6.658   -30.192  62.357  1.00 29.95  ? 822  GLU A N     1 
ATOM   6623  C  CA    . GLU C 3  822  ? 7.871   -30.858  62.821  1.00 32.22  ? 822  GLU A CA    1 
ATOM   6624  C  C     . GLU C 3  822  ? 8.060   -32.126  62.009  1.00 32.10  ? 822  GLU A C     1 
ATOM   6625  O  O     . GLU C 3  822  ? 9.162   -32.444  61.565  1.00 31.97  ? 822  GLU A O     1 
ATOM   6626  C  CB    . GLU C 3  822  ? 7.819   -31.215  64.310  1.00 32.17  ? 822  GLU A CB    1 
ATOM   6627  C  CG    . GLU C 3  822  ? 8.986   -32.118  64.723  1.00 36.52  ? 822  GLU A CG    1 
ATOM   6628  C  CD    . GLU C 3  822  ? 9.322   -32.059  66.207  1.00 44.75  ? 822  GLU A CD    1 
ATOM   6629  O  OE1   . GLU C 3  822  ? 9.683   -30.966  66.705  1.00 45.45  ? 822  GLU A OE1   1 
ATOM   6630  O  OE2   . GLU C 3  822  ? 9.235   -33.115  66.876  1.00 46.65  ? 822  GLU A OE2   1 
ATOM   6631  N  N     . GLY C 3  823  ? 6.961   -32.830  61.787  1.00 32.71  ? 823  GLY A N     1 
ATOM   6632  C  CA    . GLY C 3  823  ? 7.031   -34.061  61.026  1.00 33.92  ? 823  GLY A CA    1 
ATOM   6633  C  C     . GLY C 3  823  ? 7.540   -33.888  59.612  1.00 32.56  ? 823  GLY A C     1 
ATOM   6634  O  O     . GLY C 3  823  ? 8.570   -34.443  59.242  1.00 30.62  ? 823  GLY A O     1 
ATOM   6635  N  N     . LEU C 3  824  ? 6.804   -33.115  58.821  1.00 34.25  ? 824  LEU A N     1 
ATOM   6636  C  CA    . LEU C 3  824  ? 7.163   -32.869  57.431  1.00 33.60  ? 824  LEU A CA    1 
ATOM   6637  C  C     . LEU C 3  824  ? 8.607   -32.448  57.271  1.00 32.33  ? 824  LEU A C     1 
ATOM   6638  O  O     . LEU C 3  824  ? 9.257   -32.792  56.287  1.00 27.53  ? 824  LEU A O     1 
ATOM   6639  C  CB    . LEU C 3  824  ? 6.257   -31.788  56.828  1.00 34.73  ? 824  LEU A CB    1 
ATOM   6640  C  CG    . LEU C 3  824  ? 4.838   -32.181  56.414  1.00 34.48  ? 824  LEU A CG    1 
ATOM   6641  C  CD1   . LEU C 3  824  ? 4.211   -31.029  55.640  1.00 33.12  ? 824  LEU A CD1   1 
ATOM   6642  C  CD2   . LEU C 3  824  ? 4.878   -33.437  55.535  1.00 34.12  ? 824  LEU A CD2   1 
ATOM   6643  N  N     . ILE C 3  825  ? 9.102   -31.705  58.252  1.00 34.39  ? 825  ILE A N     1 
ATOM   6644  C  CA    . ILE C 3  825  ? 10.462  -31.211  58.203  1.00 36.44  ? 825  ILE A CA    1 
ATOM   6645  C  C     . ILE C 3  825  ? 11.484  -32.305  58.392  1.00 38.89  ? 825  ILE A C     1 
ATOM   6646  O  O     . ILE C 3  825  ? 12.236  -32.600  57.471  1.00 40.55  ? 825  ILE A O     1 
ATOM   6647  C  CB    . ILE C 3  825  ? 10.680  -30.123  59.237  1.00 34.56  ? 825  ILE A CB    1 
ATOM   6648  C  CG1   . ILE C 3  825  ? 9.592   -29.058  59.080  1.00 30.56  ? 825  ILE A CG1   1 
ATOM   6649  C  CG2   . ILE C 3  825  ? 12.063  -29.517  59.051  1.00 32.32  ? 825  ILE A CG2   1 
ATOM   6650  C  CD1   . ILE C 3  825  ? 9.593   -28.025  60.155  1.00 29.33  ? 825  ILE A CD1   1 
ATOM   6651  N  N     . ASP C 3  826  ? 11.538  -32.918  59.567  1.00 41.58  ? 826  ASP A N     1 
ATOM   6652  C  CA    . ASP C 3  826  ? 12.513  -33.983  59.717  1.00 46.60  ? 826  ASP A CA    1 
ATOM   6653  C  C     . ASP C 3  826  ? 12.240  -35.028  58.644  1.00 44.78  ? 826  ASP A C     1 
ATOM   6654  O  O     . ASP C 3  826  ? 13.065  -35.890  58.385  1.00 44.45  ? 826  ASP A O     1 
ATOM   6655  C  CB    . ASP C 3  826  ? 12.477  -34.612  61.118  1.00 55.53  ? 826  ASP A CB    1 
ATOM   6656  C  CG    . ASP C 3  826  ? 11.077  -34.789  61.649  1.00 64.63  ? 826  ASP A CG    1 
ATOM   6657  O  OD1   . ASP C 3  826  ? 10.240  -35.397  60.942  1.00 70.40  ? 826  ASP A OD1   1 
ATOM   6658  O  OD2   . ASP C 3  826  ? 10.821  -34.325  62.784  1.00 70.98  ? 826  ASP A OD2   1 
ATOM   6659  N  N     . THR C 3  827  ? 11.080  -34.947  58.007  1.00 45.16  ? 827  THR A N     1 
ATOM   6660  C  CA    . THR C 3  827  ? 10.780  -35.895  56.951  1.00 46.63  ? 827  THR A CA    1 
ATOM   6661  C  C     . THR C 3  827  ? 11.778  -35.594  55.851  1.00 47.83  ? 827  THR A C     1 
ATOM   6662  O  O     . THR C 3  827  ? 12.475  -36.480  55.376  1.00 48.44  ? 827  THR A O     1 
ATOM   6663  C  CB    . THR C 3  827  ? 9.342   -35.730  56.378  1.00 46.25  ? 827  THR A CB    1 
ATOM   6664  O  OG1   . THR C 3  827  ? 8.375   -36.167  57.341  1.00 46.22  ? 827  THR A OG1   1 
ATOM   6665  C  CG2   . THR C 3  827  ? 9.180   -36.558  55.110  1.00 41.84  ? 827  THR A CG2   1 
ATOM   6666  N  N     . ALA C 3  828  ? 11.853  -34.328  55.460  1.00 50.73  ? 828  ALA A N     1 
ATOM   6667  C  CA    . ALA C 3  828  ? 12.767  -33.904  54.407  1.00 54.79  ? 828  ALA A CA    1 
ATOM   6668  C  C     . ALA C 3  828  ? 14.229  -34.159  54.787  1.00 58.34  ? 828  ALA A C     1 
ATOM   6669  O  O     . ALA C 3  828  ? 15.082  -34.407  53.930  1.00 60.91  ? 828  ALA A O     1 
ATOM   6670  C  CB    . ALA C 3  828  ? 12.551  -32.430  54.106  1.00 51.14  ? 828  ALA A CB    1 
ATOM   6671  N  N     . VAL C 3  829  ? 14.517  -34.108  56.080  1.00 60.37  ? 829  VAL A N     1 
ATOM   6672  C  CA    . VAL C 3  829  ? 15.870  -34.331  56.557  1.00 61.29  ? 829  VAL A CA    1 
ATOM   6673  C  C     . VAL C 3  829  ? 16.239  -35.815  56.615  1.00 63.13  ? 829  VAL A C     1 
ATOM   6674  O  O     . VAL C 3  829  ? 17.194  -36.240  55.963  1.00 60.54  ? 829  VAL A O     1 
ATOM   6675  C  CB    . VAL C 3  829  ? 16.036  -33.667  57.927  1.00 60.07  ? 829  VAL A CB    1 
ATOM   6676  C  CG1   . VAL C 3  829  ? 17.290  -34.168  58.625  1.00 61.41  ? 829  VAL A CG1   1 
ATOM   6677  C  CG2   . VAL C 3  829  ? 16.087  -32.154  57.730  1.00 60.45  ? 829  VAL A CG2   1 
ATOM   6678  N  N     . LYS C 3  830  ? 15.469  -36.591  57.381  1.00 67.75  ? 830  LYS A N     1 
ATOM   6679  C  CA    . LYS C 3  830  ? 15.684  -38.037  57.552  1.00 71.84  ? 830  LYS A CA    1 
ATOM   6680  C  C     . LYS C 3  830  ? 15.870  -38.744  56.231  1.00 72.58  ? 830  LYS A C     1 
ATOM   6681  O  O     . LYS C 3  830  ? 16.172  -39.934  56.202  1.00 74.04  ? 830  LYS A O     1 
ATOM   6682  C  CB    . LYS C 3  830  ? 14.498  -38.699  58.272  1.00 75.90  ? 830  LYS A CB    1 
ATOM   6683  C  CG    . LYS C 3  830  ? 14.776  -39.199  59.700  1.00 82.17  ? 830  LYS A CG    1 
ATOM   6684  C  CD    . LYS C 3  830  ? 14.923  -38.051  60.711  1.00 85.69  ? 830  LYS A CD    1 
ATOM   6685  C  CE    . LYS C 3  830  ? 15.074  -38.575  62.138  1.00 88.07  ? 830  LYS A CE    1 
ATOM   6686  N  NZ    . LYS C 3  830  ? 15.235  -37.473  63.136  1.00 89.34  ? 830  LYS A NZ    1 
ATOM   6687  N  N     . THR C 3  831  ? 15.666  -38.010  55.142  1.00 73.86  ? 831  THR A N     1 
ATOM   6688  C  CA    . THR C 3  831  ? 15.806  -38.560  53.801  1.00 74.22  ? 831  THR A CA    1 
ATOM   6689  C  C     . THR C 3  831  ? 17.207  -38.339  53.248  1.00 73.16  ? 831  THR A C     1 
ATOM   6690  O  O     . THR C 3  831  ? 17.843  -39.282  52.773  1.00 73.39  ? 831  THR A O     1 
ATOM   6691  C  CB    . THR C 3  831  ? 14.769  -37.938  52.858  1.00 74.51  ? 831  THR A CB    1 
ATOM   6692  O  OG1   . THR C 3  831  ? 13.472  -38.412  53.231  1.00 77.57  ? 831  THR A OG1   1 
ATOM   6693  C  CG2   . THR C 3  831  ? 15.049  -38.310  51.407  1.00 74.67  ? 831  THR A CG2   1 
ATOM   6694  N  N     . ALA C 3  832  ? 17.688  -37.100  53.320  1.00 70.97  ? 832  ALA A N     1 
ATOM   6695  C  CA    . ALA C 3  832  ? 19.020  -36.771  52.829  1.00 68.32  ? 832  ALA A CA    1 
ATOM   6696  C  C     . ALA C 3  832  ? 20.077  -37.425  53.699  1.00 67.14  ? 832  ALA A C     1 
ATOM   6697  O  O     . ALA C 3  832  ? 20.945  -38.139  53.201  1.00 67.02  ? 832  ALA A O     1 
ATOM   6698  C  CB    . ALA C 3  832  ? 19.219  -35.273  52.821  1.00 68.81  ? 832  ALA A CB    1 
ATOM   6699  N  N     . GLU C 3  833  ? 20.007  -37.179  55.002  1.00 65.71  ? 833  GLU A N     1 
ATOM   6700  C  CA    . GLU C 3  833  ? 20.975  -37.760  55.916  1.00 65.26  ? 833  GLU A CA    1 
ATOM   6701  C  C     . GLU C 3  833  ? 21.093  -39.267  55.660  1.00 63.58  ? 833  GLU A C     1 
ATOM   6702  O  O     . GLU C 3  833  ? 22.198  -39.809  55.589  1.00 62.87  ? 833  GLU A O     1 
ATOM   6703  C  CB    . GLU C 3  833  ? 20.566  -37.475  57.366  1.00 67.80  ? 833  GLU A CB    1 
ATOM   6704  C  CG    . GLU C 3  833  ? 21.588  -36.645  58.163  1.00 76.09  ? 833  GLU A CG    1 
ATOM   6705  C  CD    . GLU C 3  833  ? 21.082  -36.216  59.553  1.00 82.99  ? 833  GLU A CD    1 
ATOM   6706  O  OE1   . GLU C 3  833  ? 20.702  -37.089  60.369  1.00 84.05  ? 833  GLU A OE1   1 
ATOM   6707  O  OE2   . GLU C 3  833  ? 21.071  -34.996  59.835  1.00 86.71  ? 833  GLU A OE2   1 
ATOM   6708  N  N     . THR C 3  834  ? 19.960  -39.945  55.499  1.00 60.82  ? 834  THR A N     1 
ATOM   6709  C  CA    . THR C 3  834  ? 19.995  -41.379  55.243  1.00 58.66  ? 834  THR A CA    1 
ATOM   6710  C  C     . THR C 3  834  ? 20.560  -41.678  53.870  1.00 57.31  ? 834  THR A C     1 
ATOM   6711  O  O     . THR C 3  834  ? 21.336  -42.607  53.700  1.00 57.59  ? 834  THR A O     1 
ATOM   6712  C  CB    . THR C 3  834  ? 18.609  -42.007  55.326  1.00 58.64  ? 834  THR A CB    1 
ATOM   6713  O  OG1   . THR C 3  834  ? 18.175  -42.006  56.688  1.00 60.62  ? 834  THR A OG1   1 
ATOM   6714  C  CG2   . THR C 3  834  ? 18.645  -43.440  54.817  1.00 59.07  ? 834  THR A CG2   1 
ATOM   6715  N  N     . GLY C 3  835  ? 20.154  -40.895  52.882  1.00 56.21  ? 835  GLY A N     1 
ATOM   6716  C  CA    . GLY C 3  835  ? 20.655  -41.113  51.541  1.00 53.58  ? 835  GLY A CA    1 
ATOM   6717  C  C     . GLY C 3  835  ? 22.167  -41.131  51.528  1.00 51.02  ? 835  GLY A C     1 
ATOM   6718  O  O     . GLY C 3  835  ? 22.785  -41.939  50.832  1.00 52.12  ? 835  GLY A O     1 
ATOM   6719  N  N     . TYR C 3  836  ? 22.758  -40.239  52.310  1.00 48.28  ? 836  TYR A N     1 
ATOM   6720  C  CA    . TYR C 3  836  ? 24.204  -40.130  52.412  1.00 48.01  ? 836  TYR A CA    1 
ATOM   6721  C  C     . TYR C 3  836  ? 24.794  -41.398  53.035  1.00 45.94  ? 836  TYR A C     1 
ATOM   6722  O  O     . TYR C 3  836  ? 25.720  -42.003  52.500  1.00 45.06  ? 836  TYR A O     1 
ATOM   6723  C  CB    . TYR C 3  836  ? 24.533  -38.928  53.275  1.00 51.02  ? 836  TYR A CB    1 
ATOM   6724  C  CG    . TYR C 3  836  ? 25.981  -38.505  53.290  1.00 54.85  ? 836  TYR A CG    1 
ATOM   6725  C  CD1   . TYR C 3  836  ? 26.611  -38.039  52.135  1.00 54.93  ? 836  TYR A CD1   1 
ATOM   6726  C  CD2   . TYR C 3  836  ? 26.696  -38.484  54.485  1.00 58.64  ? 836  TYR A CD2   1 
ATOM   6727  C  CE1   . TYR C 3  836  ? 27.923  -37.551  52.176  1.00 59.15  ? 836  TYR A CE1   1 
ATOM   6728  C  CE2   . TYR C 3  836  ? 28.000  -37.999  54.537  1.00 62.30  ? 836  TYR A CE2   1 
ATOM   6729  C  CZ    . TYR C 3  836  ? 28.611  -37.530  53.385  1.00 60.70  ? 836  TYR A CZ    1 
ATOM   6730  O  OH    . TYR C 3  836  ? 29.891  -37.016  53.460  1.00 58.91  ? 836  TYR A OH    1 
ATOM   6731  N  N     . ILE C 3  837  ? 24.252  -41.791  54.179  1.00 44.22  ? 837  ILE A N     1 
ATOM   6732  C  CA    . ILE C 3  837  ? 24.707  -42.984  54.879  1.00 41.61  ? 837  ILE A CA    1 
ATOM   6733  C  C     . ILE C 3  837  ? 24.677  -44.186  53.945  1.00 41.36  ? 837  ILE A C     1 
ATOM   6734  O  O     . ILE C 3  837  ? 25.589  -45.007  53.938  1.00 40.11  ? 837  ILE A O     1 
ATOM   6735  C  CB    . ILE C 3  837  ? 23.782  -43.288  56.076  1.00 37.48  ? 837  ILE A CB    1 
ATOM   6736  C  CG1   . ILE C 3  837  ? 23.861  -42.149  57.090  1.00 37.06  ? 837  ILE A CG1   1 
ATOM   6737  C  CG2   . ILE C 3  837  ? 24.121  -44.634  56.676  1.00 33.05  ? 837  ILE A CG2   1 
ATOM   6738  C  CD1   . ILE C 3  837  ? 23.050  -42.383  58.349  1.00 37.42  ? 837  ILE A CD1   1 
ATOM   6739  N  N     . GLN C 3  838  ? 23.608  -44.269  53.160  1.00 43.38  ? 838  GLN A N     1 
ATOM   6740  C  CA    . GLN C 3  838  ? 23.381  -45.370  52.235  1.00 45.18  ? 838  GLN A CA    1 
ATOM   6741  C  C     . GLN C 3  838  ? 24.562  -45.519  51.305  1.00 45.68  ? 838  GLN A C     1 
ATOM   6742  O  O     . GLN C 3  838  ? 24.875  -46.619  50.861  1.00 47.71  ? 838  GLN A O     1 
ATOM   6743  C  CB    . GLN C 3  838  ? 22.096  -45.114  51.436  1.00 45.59  ? 838  GLN A CB    1 
ATOM   6744  C  CG    . GLN C 3  838  ? 21.380  -46.354  50.927  1.00 45.23  ? 838  GLN A CG    1 
ATOM   6745  C  CD    . GLN C 3  838  ? 22.128  -47.070  49.817  1.00 47.46  ? 838  GLN A CD    1 
ATOM   6746  O  OE1   . GLN C 3  838  ? 22.538  -46.461  48.826  1.00 47.64  ? 838  GLN A OE1   1 
ATOM   6747  N  NE2   . GLN C 3  838  ? 22.295  -48.376  49.972  1.00 50.00  ? 838  GLN A NE2   1 
ATOM   6748  N  N     . ARG C 3  839  ? 25.238  -44.411  51.036  1.00 45.97  ? 839  ARG A N     1 
ATOM   6749  C  CA    . ARG C 3  839  ? 26.384  -44.418  50.136  1.00 46.12  ? 839  ARG A CA    1 
ATOM   6750  C  C     . ARG C 3  839  ? 27.710  -44.766  50.791  1.00 44.49  ? 839  ARG A C     1 
ATOM   6751  O  O     . ARG C 3  839  ? 28.453  -45.622  50.308  1.00 42.62  ? 839  ARG A O     1 
ATOM   6752  C  CB    . ARG C 3  839  ? 26.505  -43.062  49.471  1.00 49.72  ? 839  ARG A CB    1 
ATOM   6753  C  CG    . ARG C 3  839  ? 27.771  -42.899  48.696  1.00 55.20  ? 839  ARG A CG    1 
ATOM   6754  C  CD    . ARG C 3  839  ? 27.709  -41.640  47.881  1.00 62.77  ? 839  ARG A CD    1 
ATOM   6755  N  NE    . ARG C 3  839  ? 28.839  -41.541  46.969  1.00 68.66  ? 839  ARG A NE    1 
ATOM   6756  C  CZ    . ARG C 3  839  ? 28.877  -40.707  45.940  1.00 74.63  ? 839  ARG A CZ    1 
ATOM   6757  N  NH1   . ARG C 3  839  ? 27.844  -39.907  45.703  1.00 78.92  ? 839  ARG A NH1   1 
ATOM   6758  N  NH2   . ARG C 3  839  ? 29.936  -40.680  45.146  1.00 75.98  ? 839  ARG A NH2   1 
ATOM   6759  N  N     . ARG C 3  840  ? 28.006  -44.076  51.885  1.00 44.76  ? 840  ARG A N     1 
ATOM   6760  C  CA    . ARG C 3  840  ? 29.233  -44.302  52.632  1.00 43.34  ? 840  ARG A CA    1 
ATOM   6761  C  C     . ARG C 3  840  ? 29.348  -45.795  52.938  1.00 40.34  ? 840  ARG A C     1 
ATOM   6762  O  O     . ARG C 3  840  ? 30.434  -46.369  52.916  1.00 39.21  ? 840  ARG A O     1 
ATOM   6763  C  CB    . ARG C 3  840  ? 29.211  -43.464  53.912  1.00 46.05  ? 840  ARG A CB    1 
ATOM   6764  C  CG    . ARG C 3  840  ? 29.134  -41.951  53.650  1.00 52.46  ? 840  ARG A CG    1 
ATOM   6765  C  CD    . ARG C 3  840  ? 28.917  -41.177  54.942  1.00 59.94  ? 840  ARG A CD    1 
ATOM   6766  N  NE    . ARG C 3  840  ? 29.878  -41.573  55.968  1.00 66.54  ? 840  ARG A NE    1 
ATOM   6767  C  CZ    . ARG C 3  840  ? 29.862  -41.142  57.225  1.00 69.50  ? 840  ARG A CZ    1 
ATOM   6768  N  NH1   . ARG C 3  840  ? 28.929  -40.287  57.631  1.00 72.20  ? 840  ARG A NH1   1 
ATOM   6769  N  NH2   . ARG C 3  840  ? 30.777  -41.581  58.081  1.00 71.27  ? 840  ARG A NH2   1 
ATOM   6770  N  N     . LEU C 3  841  ? 28.215  -46.425  53.209  1.00 37.28  ? 841  LEU A N     1 
ATOM   6771  C  CA    . LEU C 3  841  ? 28.203  -47.847  53.469  1.00 33.89  ? 841  LEU A CA    1 
ATOM   6772  C  C     . LEU C 3  841  ? 28.577  -48.546  52.172  1.00 33.78  ? 841  LEU A C     1 
ATOM   6773  O  O     . LEU C 3  841  ? 29.470  -49.393  52.141  1.00 34.42  ? 841  LEU A O     1 
ATOM   6774  C  CB    . LEU C 3  841  ? 26.816  -48.277  53.911  1.00 31.12  ? 841  LEU A CB    1 
ATOM   6775  C  CG    . LEU C 3  841  ? 26.440  -47.847  55.324  1.00 33.67  ? 841  LEU A CG    1 
ATOM   6776  C  CD1   . LEU C 3  841  ? 24.945  -48.035  55.580  1.00 33.96  ? 841  LEU A CD1   1 
ATOM   6777  C  CD2   . LEU C 3  841  ? 27.258  -48.677  56.302  1.00 35.36  ? 841  LEU A CD2   1 
ATOM   6778  N  N     . VAL C 3  842  ? 27.904  -48.165  51.092  1.00 32.88  ? 842  VAL A N     1 
ATOM   6779  C  CA    . VAL C 3  842  ? 28.146  -48.772  49.791  1.00 33.58  ? 842  VAL A CA    1 
ATOM   6780  C  C     . VAL C 3  842  ? 29.565  -48.601  49.264  1.00 35.62  ? 842  VAL A C     1 
ATOM   6781  O  O     . VAL C 3  842  ? 30.108  -49.494  48.616  1.00 37.86  ? 842  VAL A O     1 
ATOM   6782  C  CB    . VAL C 3  842  ? 27.160  -48.240  48.745  1.00 30.40  ? 842  VAL A CB    1 
ATOM   6783  C  CG1   . VAL C 3  842  ? 27.510  -48.764  47.367  1.00 29.24  ? 842  VAL A CG1   1 
ATOM   6784  C  CG2   . VAL C 3  842  ? 25.785  -48.689  49.095  1.00 30.38  ? 842  VAL A CG2   1 
ATOM   6785  N  N     . LYS C 3  843  ? 30.176  -47.459  49.525  1.00 36.30  ? 843  LYS A N     1 
ATOM   6786  C  CA    . LYS C 3  843  ? 31.530  -47.260  49.045  1.00 35.32  ? 843  LYS A CA    1 
ATOM   6787  C  C     . LYS C 3  843  ? 32.478  -48.062  49.897  1.00 34.85  ? 843  LYS A C     1 
ATOM   6788  O  O     . LYS C 3  843  ? 33.345  -48.772  49.390  1.00 33.41  ? 843  LYS A O     1 
ATOM   6789  C  CB    . LYS C 3  843  ? 31.901  -45.791  49.118  1.00 35.54  ? 843  LYS A CB    1 
ATOM   6790  C  CG    . LYS C 3  843  ? 31.280  -44.975  48.022  1.00 36.44  ? 843  LYS A CG    1 
ATOM   6791  C  CD    . LYS C 3  843  ? 31.685  -45.525  46.667  1.00 38.49  ? 843  LYS A CD    1 
ATOM   6792  C  CE    . LYS C 3  843  ? 31.081  -44.711  45.541  1.00 43.40  ? 843  LYS A CE    1 
ATOM   6793  N  NZ    . LYS C 3  843  ? 31.284  -45.381  44.221  1.00 43.35  ? 843  LYS A NZ    1 
ATOM   6794  N  N     . ALA C 3  844  ? 32.287  -47.947  51.205  1.00 34.06  ? 844  ALA A N     1 
ATOM   6795  C  CA    . ALA C 3  844  ? 33.117  -48.637  52.180  1.00 33.00  ? 844  ALA A CA    1 
ATOM   6796  C  C     . ALA C 3  844  ? 33.267  -50.130  51.929  1.00 32.31  ? 844  ALA A C     1 
ATOM   6797  O  O     . ALA C 3  844  ? 34.380  -50.655  52.025  1.00 32.89  ? 844  ALA A O     1 
ATOM   6798  C  CB    . ALA C 3  844  ? 32.566  -48.411  53.579  1.00 31.65  ? 844  ALA A CB    1 
ATOM   6799  N  N     . LEU C 3  845  ? 32.161  -50.806  51.603  1.00 29.73  ? 845  LEU A N     1 
ATOM   6800  C  CA    . LEU C 3  845  ? 32.178  -52.257  51.385  1.00 26.94  ? 845  LEU A CA    1 
ATOM   6801  C  C     . LEU C 3  845  ? 32.214  -52.653  49.918  1.00 25.37  ? 845  LEU A C     1 
ATOM   6802  O  O     . LEU C 3  845  ? 32.631  -53.756  49.565  1.00 22.14  ? 845  LEU A O     1 
ATOM   6803  C  CB    . LEU C 3  845  ? 30.955  -52.901  52.037  1.00 27.55  ? 845  LEU A CB    1 
ATOM   6804  C  CG    . LEU C 3  845  ? 30.301  -52.237  53.248  1.00 26.80  ? 845  LEU A CG    1 
ATOM   6805  C  CD1   . LEU C 3  845  ? 29.391  -53.239  53.927  1.00 28.85  ? 845  LEU A CD1   1 
ATOM   6806  C  CD2   . LEU C 3  845  ? 31.344  -51.782  54.221  1.00 28.09  ? 845  LEU A CD2   1 
ATOM   6807  N  N     . GLU C 3  846  ? 31.737  -51.741  49.083  1.00 24.83  ? 846  GLU A N     1 
ATOM   6808  C  CA    . GLU C 3  846  ? 31.678  -51.894  47.634  1.00 25.18  ? 846  GLU A CA    1 
ATOM   6809  C  C     . GLU C 3  846  ? 32.326  -53.169  47.086  1.00 26.34  ? 846  GLU A C     1 
ATOM   6810  O  O     . GLU C 3  846  ? 31.644  -54.097  46.650  1.00 27.98  ? 846  GLU A O     1 
ATOM   6811  C  CB    . GLU C 3  846  ? 32.335  -50.660  47.024  1.00 25.63  ? 846  GLU A CB    1 
ATOM   6812  C  CG    . GLU C 3  846  ? 31.958  -50.300  45.624  1.00 29.31  ? 846  GLU A CG    1 
ATOM   6813  C  CD    . GLU C 3  846  ? 32.483  -48.922  45.256  1.00 34.71  ? 846  GLU A CD    1 
ATOM   6814  O  OE1   . GLU C 3  846  ? 32.316  -48.506  44.085  1.00 37.95  ? 846  GLU A OE1   1 
ATOM   6815  O  OE2   . GLU C 3  846  ? 33.060  -48.253  46.147  1.00 33.61  ? 846  GLU A OE2   1 
ATOM   6816  N  N     . ASP C 3  847  ? 33.651  -53.209  47.149  1.00 28.37  ? 847  ASP A N     1 
ATOM   6817  C  CA    . ASP C 3  847  ? 34.468  -54.310  46.634  1.00 28.89  ? 847  ASP A CA    1 
ATOM   6818  C  C     . ASP C 3  847  ? 34.613  -55.589  47.458  1.00 28.41  ? 847  ASP A C     1 
ATOM   6819  O  O     . ASP C 3  847  ? 35.473  -56.407  47.144  1.00 29.74  ? 847  ASP A O     1 
ATOM   6820  C  CB    . ASP C 3  847  ? 35.871  -53.789  46.366  1.00 33.35  ? 847  ASP A CB    1 
ATOM   6821  C  CG    . ASP C 3  847  ? 36.586  -53.383  47.655  1.00 42.73  ? 847  ASP A CG    1 
ATOM   6822  O  OD1   . ASP C 3  847  ? 36.071  -52.501  48.384  1.00 42.43  ? 847  ASP A OD1   1 
ATOM   6823  O  OD2   . ASP C 3  847  ? 37.662  -53.953  47.951  1.00 51.82  ? 847  ASP A OD2   1 
ATOM   6824  N  N     . ILE C 3  848  ? 33.814  -55.791  48.499  1.00 27.48  ? 848  ILE A N     1 
ATOM   6825  C  CA    . ILE C 3  848  ? 33.973  -57.010  49.290  1.00 27.76  ? 848  ILE A CA    1 
ATOM   6826  C  C     . ILE C 3  848  ? 33.120  -58.135  48.727  1.00 28.97  ? 848  ILE A C     1 
ATOM   6827  O  O     . ILE C 3  848  ? 31.940  -57.939  48.470  1.00 30.92  ? 848  ILE A O     1 
ATOM   6828  C  CB    . ILE C 3  848  ? 33.594  -56.765  50.763  1.00 26.55  ? 848  ILE A CB    1 
ATOM   6829  C  CG1   . ILE C 3  848  ? 34.364  -55.555  51.287  1.00 26.92  ? 848  ILE A CG1   1 
ATOM   6830  C  CG2   . ILE C 3  848  ? 33.935  -57.982  51.607  1.00 22.10  ? 848  ILE A CG2   1 
ATOM   6831  C  CD1   . ILE C 3  848  ? 34.104  -55.232  52.729  1.00 27.15  ? 848  ILE A CD1   1 
ATOM   6832  N  N     . MET C 3  849  ? 33.716  -59.306  48.518  1.00 30.48  ? 849  MET A N     1 
ATOM   6833  C  CA    . MET C 3  849  ? 32.972  -60.451  47.979  1.00 33.80  ? 849  MET A CA    1 
ATOM   6834  C  C     . MET C 3  849  ? 33.511  -61.805  48.461  1.00 33.57  ? 849  MET A C     1 
ATOM   6835  O  O     . MET C 3  849  ? 34.680  -61.928  48.818  1.00 35.49  ? 849  MET A O     1 
ATOM   6836  C  CB    . MET C 3  849  ? 32.975  -60.422  46.441  1.00 33.99  ? 849  MET A CB    1 
ATOM   6837  C  CG    . MET C 3  849  ? 33.860  -61.480  45.802  1.00 38.11  ? 849  MET A CG    1 
ATOM   6838  S  SD    . MET C 3  849  ? 33.948  -61.444  43.997  1.00 43.60  ? 849  MET A SD    1 
ATOM   6839  C  CE    . MET C 3  849  ? 34.026  -63.175  43.653  1.00 36.29  ? 849  MET A CE    1 
ATOM   6840  N  N     . VAL C 3  850  ? 32.647  -62.817  48.456  1.00 31.60  ? 850  VAL A N     1 
ATOM   6841  C  CA    . VAL C 3  850  ? 33.006  -64.160  48.890  1.00 30.20  ? 850  VAL A CA    1 
ATOM   6842  C  C     . VAL C 3  850  ? 33.843  -64.844  47.813  1.00 33.27  ? 850  VAL A C     1 
ATOM   6843  O  O     . VAL C 3  850  ? 33.311  -65.241  46.780  1.00 36.45  ? 850  VAL A O     1 
ATOM   6844  C  CB    . VAL C 3  850  ? 31.728  -64.988  49.157  1.00 27.26  ? 850  VAL A CB    1 
ATOM   6845  C  CG1   . VAL C 3  850  ? 32.064  -66.430  49.453  1.00 25.89  ? 850  VAL A CG1   1 
ATOM   6846  C  CG2   . VAL C 3  850  ? 30.971  -64.391  50.315  1.00 26.50  ? 850  VAL A CG2   1 
ATOM   6847  N  N     . HIS C 3  851  ? 35.148  -64.985  48.049  1.00 34.08  ? 851  HIS A N     1 
ATOM   6848  C  CA    . HIS C 3  851  ? 36.039  -65.619  47.074  1.00 33.80  ? 851  HIS A CA    1 
ATOM   6849  C  C     . HIS C 3  851  ? 35.893  -67.125  46.972  1.00 36.01  ? 851  HIS A C     1 
ATOM   6850  O  O     . HIS C 3  851  ? 35.096  -67.738  47.686  1.00 34.33  ? 851  HIS A O     1 
ATOM   6851  C  CB    . HIS C 3  851  ? 37.492  -65.258  47.358  1.00 28.11  ? 851  HIS A CB    1 
ATOM   6852  C  CG    . HIS C 3  851  ? 37.863  -63.899  46.867  1.00 28.13  ? 851  HIS A CG    1 
ATOM   6853  N  ND1   . HIS C 3  851  ? 38.421  -63.686  45.627  1.00 29.51  ? 851  HIS A ND1   1 
ATOM   6854  C  CD2   . HIS C 3  851  ? 37.708  -62.676  47.425  1.00 28.57  ? 851  HIS A CD2   1 
ATOM   6855  C  CE1   . HIS C 3  851  ? 38.597  -62.390  45.442  1.00 29.02  ? 851  HIS A CE1   1 
ATOM   6856  N  NE2   . HIS C 3  851  ? 38.171  -61.755  46.518  1.00 28.91  ? 851  HIS A NE2   1 
ATOM   6857  N  N     . TYR C 3  852  ? 36.677  -67.716  46.075  1.00 38.71  ? 852  TYR A N     1 
ATOM   6858  C  CA    . TYR C 3  852  ? 36.606  -69.146  45.842  1.00 40.15  ? 852  TYR A CA    1 
ATOM   6859  C  C     . TYR C 3  852  ? 37.114  -70.094  46.929  1.00 41.87  ? 852  TYR A C     1 
ATOM   6860  O  O     . TYR C 3  852  ? 37.026  -71.307  46.758  1.00 42.67  ? 852  TYR A O     1 
ATOM   6861  C  CB    . TYR C 3  852  ? 37.258  -69.475  44.506  1.00 39.75  ? 852  TYR A CB    1 
ATOM   6862  C  CG    . TYR C 3  852  ? 36.285  -69.425  43.348  1.00 40.99  ? 852  TYR A CG    1 
ATOM   6863  C  CD1   . TYR C 3  852  ? 36.200  -68.305  42.519  1.00 42.18  ? 852  TYR A CD1   1 
ATOM   6864  C  CD2   . TYR C 3  852  ? 35.441  -70.501  43.085  1.00 40.31  ? 852  TYR A CD2   1 
ATOM   6865  C  CE1   . TYR C 3  852  ? 35.297  -68.266  41.453  1.00 41.00  ? 852  TYR A CE1   1 
ATOM   6866  C  CE2   . TYR C 3  852  ? 34.541  -70.473  42.032  1.00 40.01  ? 852  TYR A CE2   1 
ATOM   6867  C  CZ    . TYR C 3  852  ? 34.473  -69.361  41.221  1.00 41.95  ? 852  TYR A CZ    1 
ATOM   6868  O  OH    . TYR C 3  852  ? 33.580  -69.362  40.180  1.00 43.17  ? 852  TYR A OH    1 
ATOM   6869  N  N     . ASP C 3  853  ? 37.646  -69.558  48.031  1.00 43.95  ? 853  ASP A N     1 
ATOM   6870  C  CA    . ASP C 3  853  ? 38.098  -70.392  49.152  1.00 45.98  ? 853  ASP A CA    1 
ATOM   6871  C  C     . ASP C 3  853  ? 37.150  -70.149  50.330  1.00 47.93  ? 853  ASP A C     1 
ATOM   6872  O  O     . ASP C 3  853  ? 37.515  -70.300  51.498  1.00 49.03  ? 853  ASP A O     1 
ATOM   6873  C  CB    . ASP C 3  853  ? 39.562  -70.100  49.561  1.00 47.75  ? 853  ASP A CB    1 
ATOM   6874  C  CG    . ASP C 3  853  ? 39.831  -68.627  49.878  1.00 51.50  ? 853  ASP A CG    1 
ATOM   6875  O  OD1   . ASP C 3  853  ? 38.870  -67.850  50.031  1.00 54.17  ? 853  ASP A OD1   1 
ATOM   6876  O  OD2   . ASP C 3  853  ? 41.023  -68.248  49.983  1.00 51.17  ? 853  ASP A OD2   1 
ATOM   6877  N  N     . ASN C 3  854  ? 35.923  -69.761  49.990  1.00 48.41  ? 854  ASN A N     1 
ATOM   6878  C  CA    . ASN C 3  854  ? 34.878  -69.495  50.964  1.00 48.43  ? 854  ASN A CA    1 
ATOM   6879  C  C     . ASN C 3  854  ? 35.217  -68.383  51.936  1.00 47.16  ? 854  ASN A C     1 
ATOM   6880  O  O     . ASN C 3  854  ? 34.527  -68.175  52.939  1.00 47.60  ? 854  ASN A O     1 
ATOM   6881  C  CB    . ASN C 3  854  ? 34.552  -70.774  51.715  1.00 53.19  ? 854  ASN A CB    1 
ATOM   6882  C  CG    . ASN C 3  854  ? 33.201  -71.318  51.335  1.00 61.84  ? 854  ASN A CG    1 
ATOM   6883  O  OD1   . ASN C 3  854  ? 32.170  -70.800  51.778  1.00 66.41  ? 854  ASN A OD1   1 
ATOM   6884  N  ND2   . ASN C 3  854  ? 33.187  -72.347  50.484  1.00 64.84  ? 854  ASN A ND2   1 
ATOM   6885  N  N     . THR C 3  855  ? 36.272  -67.655  51.602  1.00 43.77  ? 855  THR A N     1 
ATOM   6886  C  CA    . THR C 3  855  ? 36.763  -66.555  52.400  1.00 42.12  ? 855  THR A CA    1 
ATOM   6887  C  C     . THR C 3  855  ? 36.049  -65.267  51.975  1.00 39.28  ? 855  THR A C     1 
ATOM   6888  O  O     . THR C 3  855  ? 35.351  -65.253  50.975  1.00 39.54  ? 855  THR A O     1 
ATOM   6889  C  CB    . THR C 3  855  ? 38.292  -66.443  52.189  1.00 45.26  ? 855  THR A CB    1 
ATOM   6890  O  OG1   . THR C 3  855  ? 38.937  -66.226  53.446  1.00 54.56  ? 855  THR A OG1   1 
ATOM   6891  C  CG2   . THR C 3  855  ? 38.637  -65.318  51.238  1.00 46.21  ? 855  THR A CG2   1 
ATOM   6892  N  N     . THR C 3  856  ? 36.211  -64.190  52.733  1.00 37.79  ? 856  THR A N     1 
ATOM   6893  C  CA    . THR C 3  856  ? 35.582  -62.919  52.392  1.00 35.88  ? 856  THR A CA    1 
ATOM   6894  C  C     . THR C 3  856  ? 36.624  -61.821  52.449  1.00 36.88  ? 856  THR A C     1 
ATOM   6895  O  O     . THR C 3  856  ? 36.933  -61.306  53.521  1.00 34.75  ? 856  THR A O     1 
ATOM   6896  C  CB    . THR C 3  856  ? 34.471  -62.565  53.369  1.00 35.83  ? 856  THR A CB    1 
ATOM   6897  O  OG1   . THR C 3  856  ? 33.472  -63.587  53.346  1.00 36.66  ? 856  THR A OG1   1 
ATOM   6898  C  CG2   . THR C 3  856  ? 33.841  -61.255  52.989  1.00 36.97  ? 856  THR A CG2   1 
ATOM   6899  N  N     . ARG C 3  857  ? 37.148  -61.459  51.283  1.00 39.74  ? 857  ARG A N     1 
ATOM   6900  C  CA    . ARG C 3  857  ? 38.191  -60.439  51.177  1.00 42.21  ? 857  ARG A CA    1 
ATOM   6901  C  C     . ARG C 3  857  ? 37.831  -59.294  50.232  1.00 42.41  ? 857  ARG A C     1 
ATOM   6902  O  O     . ARG C 3  857  ? 37.014  -59.458  49.324  1.00 45.12  ? 857  ARG A O     1 
ATOM   6903  C  CB    . ARG C 3  857  ? 39.482  -61.077  50.658  1.00 44.84  ? 857  ARG A CB    1 
ATOM   6904  C  CG    . ARG C 3  857  ? 39.780  -62.472  51.181  1.00 47.44  ? 857  ARG A CG    1 
ATOM   6905  C  CD    . ARG C 3  857  ? 41.087  -62.985  50.602  1.00 49.56  ? 857  ARG A CD    1 
ATOM   6906  N  NE    . ARG C 3  857  ? 41.323  -64.395  50.887  1.00 52.26  ? 857  ARG A NE    1 
ATOM   6907  C  CZ    . ARG C 3  857  ? 42.516  -64.977  50.808  1.00 54.19  ? 857  ARG A CZ    1 
ATOM   6908  N  NH1   . ARG C 3  857  ? 43.581  -64.265  50.461  1.00 53.48  ? 857  ARG A NH1   1 
ATOM   6909  N  NH2   . ARG C 3  857  ? 42.646  -66.275  51.055  1.00 54.49  ? 857  ARG A NH2   1 
ATOM   6910  N  N     . ASN C 3  858  ? 38.456  -58.138  50.433  1.00 41.18  ? 858  ASN A N     1 
ATOM   6911  C  CA    . ASN C 3  858  ? 38.210  -57.002  49.557  1.00 42.26  ? 858  ASN A CA    1 
ATOM   6912  C  C     . ASN C 3  858  ? 39.282  -57.023  48.485  1.00 42.91  ? 858  ASN A C     1 
ATOM   6913  O  O     . ASN C 3  858  ? 40.156  -57.883  48.506  1.00 42.89  ? 858  ASN A O     1 
ATOM   6914  C  CB    . ASN C 3  858  ? 38.257  -55.697  50.341  1.00 43.17  ? 858  ASN A CB    1 
ATOM   6915  C  CG    . ASN C 3  858  ? 39.525  -55.548  51.137  1.00 47.39  ? 858  ASN A CG    1 
ATOM   6916  O  OD1   . ASN C 3  858  ? 39.554  -54.865  52.169  1.00 49.48  ? 858  ASN A OD1   1 
ATOM   6917  N  ND2   . ASN C 3  858  ? 40.592  -56.179  50.662  1.00 47.46  ? 858  ASN A ND2   1 
ATOM   6918  N  N     . SER C 3  859  ? 39.215  -56.085  47.550  1.00 45.10  ? 859  SER A N     1 
ATOM   6919  C  CA    . SER C 3  859  ? 40.175  -56.017  46.448  1.00 48.32  ? 859  SER A CA    1 
ATOM   6920  C  C     . SER C 3  859  ? 41.621  -56.385  46.824  1.00 50.12  ? 859  SER A C     1 
ATOM   6921  O  O     . SER C 3  859  ? 42.225  -57.270  46.207  1.00 52.78  ? 859  SER A O     1 
ATOM   6922  C  CB    . SER C 3  859  ? 40.129  -54.623  45.806  1.00 47.44  ? 859  SER A CB    1 
ATOM   6923  O  OG    . SER C 3  859  ? 40.121  -53.601  46.788  1.00 47.32  ? 859  SER A OG    1 
ATOM   6924  N  N     . LEU C 3  860  ? 42.169  -55.718  47.834  1.00 49.08  ? 860  LEU A N     1 
ATOM   6925  C  CA    . LEU C 3  860  ? 43.531  -55.984  48.282  1.00 46.43  ? 860  LEU A CA    1 
ATOM   6926  C  C     . LEU C 3  860  ? 43.804  -57.460  48.525  1.00 46.70  ? 860  LEU A C     1 
ATOM   6927  O  O     . LEU C 3  860  ? 44.927  -57.931  48.330  1.00 50.00  ? 860  LEU A O     1 
ATOM   6928  C  CB    . LEU C 3  860  ? 43.808  -55.223  49.567  1.00 43.37  ? 860  LEU A CB    1 
ATOM   6929  C  CG    . LEU C 3  860  ? 43.816  -53.718  49.362  1.00 43.15  ? 860  LEU A CG    1 
ATOM   6930  C  CD1   . LEU C 3  860  ? 43.780  -53.017  50.715  1.00 43.80  ? 860  LEU A CD1   1 
ATOM   6931  C  CD2   . LEU C 3  860  ? 45.041  -53.332  48.540  1.00 40.03  ? 860  LEU A CD2   1 
ATOM   6932  N  N     . GLY C 3  861  ? 42.777  -58.185  48.951  1.00 44.03  ? 861  GLY A N     1 
ATOM   6933  C  CA    . GLY C 3  861  ? 42.939  -59.595  49.236  1.00 40.28  ? 861  GLY A CA    1 
ATOM   6934  C  C     . GLY C 3  861  ? 42.895  -59.760  50.740  1.00 39.39  ? 861  GLY A C     1 
ATOM   6935  O  O     . GLY C 3  861  ? 42.766  -60.866  51.265  1.00 38.04  ? 861  GLY A O     1 
ATOM   6936  N  N     . ASN C 3  862  ? 42.996  -58.640  51.442  1.00 37.93  ? 862  ASN A N     1 
ATOM   6937  C  CA    . ASN C 3  862  ? 42.959  -58.670  52.890  1.00 40.12  ? 862  ASN A CA    1 
ATOM   6938  C  C     . ASN C 3  862  ? 41.697  -59.369  53.402  1.00 38.74  ? 862  ASN A C     1 
ATOM   6939  O  O     . ASN C 3  862  ? 40.593  -58.861  53.250  1.00 40.11  ? 862  ASN A O     1 
ATOM   6940  C  CB    . ASN C 3  862  ? 43.021  -57.241  53.453  1.00 46.90  ? 862  ASN A CB    1 
ATOM   6941  C  CG    . ASN C 3  862  ? 44.243  -56.464  52.963  1.00 53.18  ? 862  ASN A CG    1 
ATOM   6942  O  OD1   . ASN C 3  862  ? 45.201  -57.045  52.444  1.00 56.82  ? 862  ASN A OD1   1 
ATOM   6943  N  ND2   . ASN C 3  862  ? 44.216  -55.143  53.143  1.00 53.65  ? 862  ASN A ND2   1 
ATOM   6944  N  N     . VAL C 3  863  ? 41.865  -60.541  53.999  1.00 37.66  ? 863  VAL A N     1 
ATOM   6945  C  CA    . VAL C 3  863  ? 40.742  -61.285  54.564  1.00 37.54  ? 863  VAL A CA    1 
ATOM   6946  C  C     . VAL C 3  863  ? 39.943  -60.417  55.542  1.00 38.36  ? 863  VAL A C     1 
ATOM   6947  O  O     . VAL C 3  863  ? 40.517  -59.699  56.369  1.00 37.10  ? 863  VAL A O     1 
ATOM   6948  C  CB    . VAL C 3  863  ? 41.237  -62.552  55.311  1.00 38.09  ? 863  VAL A CB    1 
ATOM   6949  C  CG1   . VAL C 3  863  ? 40.189  -63.047  56.300  1.00 33.95  ? 863  VAL A CG1   1 
ATOM   6950  C  CG2   . VAL C 3  863  ? 41.553  -63.641  54.303  1.00 40.30  ? 863  VAL A CG2   1 
ATOM   6951  N  N     . ILE C 3  864  ? 38.616  -60.494  55.435  1.00 38.67  ? 864  ILE A N     1 
ATOM   6952  C  CA    . ILE C 3  864  ? 37.716  -59.737  56.298  1.00 35.79  ? 864  ILE A CA    1 
ATOM   6953  C  C     . ILE C 3  864  ? 36.923  -60.680  57.177  1.00 35.39  ? 864  ILE A C     1 
ATOM   6954  O  O     . ILE C 3  864  ? 36.634  -60.367  58.323  1.00 35.65  ? 864  ILE A O     1 
ATOM   6955  C  CB    . ILE C 3  864  ? 36.759  -58.911  55.486  1.00 34.10  ? 864  ILE A CB    1 
ATOM   6956  C  CG1   . ILE C 3  864  ? 37.548  -57.959  54.594  1.00 33.50  ? 864  ILE A CG1   1 
ATOM   6957  C  CG2   . ILE C 3  864  ? 35.860  -58.140  56.408  1.00 35.00  ? 864  ILE A CG2   1 
ATOM   6958  C  CD1   . ILE C 3  864  ? 36.703  -57.237  53.590  1.00 38.33  ? 864  ILE A CD1   1 
ATOM   6959  N  N     . GLN C 3  865  ? 36.564  -61.830  56.621  1.00 36.51  ? 865  GLN A N     1 
ATOM   6960  C  CA    . GLN C 3  865  ? 35.850  -62.874  57.353  1.00 39.63  ? 865  GLN A CA    1 
ATOM   6961  C  C     . GLN C 3  865  ? 36.402  -64.183  56.798  1.00 40.94  ? 865  GLN A C     1 
ATOM   6962  O  O     . GLN C 3  865  ? 36.474  -64.362  55.585  1.00 41.35  ? 865  GLN A O     1 
ATOM   6963  C  CB    . GLN C 3  865  ? 34.338  -62.821  57.098  1.00 44.08  ? 865  GLN A CB    1 
ATOM   6964  C  CG    . GLN C 3  865  ? 33.660  -61.479  57.357  1.00 46.20  ? 865  GLN A CG    1 
ATOM   6965  C  CD    . GLN C 3  865  ? 32.181  -61.635  57.662  1.00 45.26  ? 865  GLN A CD    1 
ATOM   6966  O  OE1   . GLN C 3  865  ? 31.454  -62.316  56.941  1.00 46.79  ? 865  GLN A OE1   1 
ATOM   6967  N  NE2   . GLN C 3  865  ? 31.731  -61.005  58.739  1.00 45.01  ? 865  GLN A NE2   1 
ATOM   6968  N  N     . PHE C 3  866  ? 36.798  -65.100  57.667  1.00 42.72  ? 866  PHE A N     1 
ATOM   6969  C  CA    . PHE C 3  866  ? 37.346  -66.362  57.185  1.00 45.34  ? 866  PHE A CA    1 
ATOM   6970  C  C     . PHE C 3  866  ? 36.291  -67.286  56.593  1.00 45.84  ? 866  PHE A C     1 
ATOM   6971  O  O     . PHE C 3  866  ? 36.614  -68.245  55.887  1.00 46.79  ? 866  PHE A O     1 
ATOM   6972  C  CB    . PHE C 3  866  ? 38.115  -67.051  58.308  1.00 48.01  ? 866  PHE A CB    1 
ATOM   6973  C  CG    . PHE C 3  866  ? 39.370  -66.325  58.686  1.00 52.21  ? 866  PHE A CG    1 
ATOM   6974  C  CD1   . PHE C 3  866  ? 39.361  -65.363  59.693  1.00 51.76  ? 866  PHE A CD1   1 
ATOM   6975  C  CD2   . PHE C 3  866  ? 40.549  -66.542  57.973  1.00 52.77  ? 866  PHE A CD2   1 
ATOM   6976  C  CE1   . PHE C 3  866  ? 40.510  -64.625  59.980  1.00 53.09  ? 866  PHE A CE1   1 
ATOM   6977  C  CE2   . PHE C 3  866  ? 41.697  -65.813  58.250  1.00 53.14  ? 866  PHE A CE2   1 
ATOM   6978  C  CZ    . PHE C 3  866  ? 41.680  -64.850  59.255  1.00 53.53  ? 866  PHE A CZ    1 
ATOM   6979  N  N     . ILE C 3  867  ? 35.031  -66.979  56.897  1.00 45.03  ? 867  ILE A N     1 
ATOM   6980  C  CA    . ILE C 3  867  ? 33.858  -67.709  56.414  1.00 41.72  ? 867  ILE A CA    1 
ATOM   6981  C  C     . ILE C 3  867  ? 32.787  -66.633  56.454  1.00 40.92  ? 867  ILE A C     1 
ATOM   6982  O  O     . ILE C 3  867  ? 32.605  -65.989  57.485  1.00 41.41  ? 867  ILE A O     1 
ATOM   6983  C  CB    . ILE C 3  867  ? 33.447  -68.836  57.364  1.00 39.88  ? 867  ILE A CB    1 
ATOM   6984  C  CG1   . ILE C 3  867  ? 34.636  -69.761  57.628  1.00 46.25  ? 867  ILE A CG1   1 
ATOM   6985  C  CG2   . ILE C 3  867  ? 32.344  -69.636  56.747  1.00 35.88  ? 867  ILE A CG2   1 
ATOM   6986  C  CD1   . ILE C 3  867  ? 34.480  -70.664  58.869  1.00 50.82  ? 867  ILE A CD1   1 
ATOM   6987  N  N     . TYR C 3  868  ? 32.097  -66.418  55.337  1.00 38.86  ? 868  TYR A N     1 
ATOM   6988  C  CA    . TYR C 3  868  ? 31.063  -65.383  55.268  1.00 33.07  ? 868  TYR A CA    1 
ATOM   6989  C  C     . TYR C 3  868  ? 29.939  -65.597  56.267  1.00 30.28  ? 868  TYR A C     1 
ATOM   6990  O  O     . TYR C 3  868  ? 29.465  -66.717  56.473  1.00 26.42  ? 868  TYR A O     1 
ATOM   6991  C  CB    . TYR C 3  868  ? 30.498  -65.293  53.843  1.00 33.81  ? 868  TYR A CB    1 
ATOM   6992  C  CG    . TYR C 3  868  ? 29.282  -64.401  53.689  1.00 30.67  ? 868  TYR A CG    1 
ATOM   6993  C  CD1   . TYR C 3  868  ? 29.244  -63.144  54.264  1.00 28.17  ? 868  TYR A CD1   1 
ATOM   6994  C  CD2   . TYR C 3  868  ? 28.158  -64.834  52.978  1.00 31.70  ? 868  TYR A CD2   1 
ATOM   6995  C  CE1   . TYR C 3  868  ? 28.118  -62.338  54.148  1.00 31.17  ? 868  TYR A CE1   1 
ATOM   6996  C  CE2   . TYR C 3  868  ? 27.020  -64.030  52.850  1.00 30.25  ? 868  TYR A CE2   1 
ATOM   6997  C  CZ    . TYR C 3  868  ? 27.004  -62.778  53.441  1.00 30.47  ? 868  TYR A CZ    1 
ATOM   6998  O  OH    . TYR C 3  868  ? 25.887  -61.958  53.341  1.00 25.50  ? 868  TYR A OH    1 
ATOM   6999  N  N     . GLY C 3  869  ? 29.523  -64.503  56.893  1.00 29.30  ? 869  GLY A N     1 
ATOM   7000  C  CA    . GLY C 3  869  ? 28.461  -64.580  57.873  1.00 29.53  ? 869  GLY A CA    1 
ATOM   7001  C  C     . GLY C 3  869  ? 28.808  -65.614  58.918  1.00 28.58  ? 869  GLY A C     1 
ATOM   7002  O  O     . GLY C 3  869  ? 27.952  -66.126  59.621  1.00 30.06  ? 869  GLY A O     1 
ATOM   7003  N  N     . GLU C 3  870  ? 30.089  -65.925  59.005  1.00 28.46  ? 870  GLU A N     1 
ATOM   7004  C  CA    . GLU C 3  870  ? 30.589  -66.891  59.961  1.00 28.21  ? 870  GLU A CA    1 
ATOM   7005  C  C     . GLU C 3  870  ? 30.119  -68.329  59.787  1.00 30.43  ? 870  GLU A C     1 
ATOM   7006  O  O     . GLU C 3  870  ? 30.467  -69.183  60.599  1.00 33.90  ? 870  GLU A O     1 
ATOM   7007  C  CB    . GLU C 3  870  ? 30.309  -66.389  61.368  1.00 19.46  ? 870  GLU A CB    1 
ATOM   7008  C  CG    . GLU C 3  870  ? 31.001  -65.069  61.592  1.00 19.94  ? 870  GLU A CG    1 
ATOM   7009  C  CD    . GLU C 3  870  ? 30.900  -64.591  63.013  1.00 23.44  ? 870  GLU A CD    1 
ATOM   7010  O  OE1   . GLU C 3  870  ? 30.855  -65.469  63.900  1.00 24.53  ? 870  GLU A OE1   1 
ATOM   7011  O  OE2   . GLU C 3  870  ? 30.884  -63.354  63.245  1.00 20.32  ? 870  GLU A OE2   1 
ATOM   7012  N  N     . ASP C 3  871  ? 29.343  -68.605  58.737  1.00 30.65  ? 871  ASP A N     1 
ATOM   7013  C  CA    . ASP C 3  871  ? 28.889  -69.971  58.469  1.00 31.91  ? 871  ASP A CA    1 
ATOM   7014  C  C     . ASP C 3  871  ? 28.915  -70.235  56.996  1.00 31.97  ? 871  ASP A C     1 
ATOM   7015  O  O     . ASP C 3  871  ? 28.480  -71.291  56.558  1.00 32.66  ? 871  ASP A O     1 
ATOM   7016  C  CB    . ASP C 3  871  ? 27.463  -70.233  58.948  1.00 36.33  ? 871  ASP A CB    1 
ATOM   7017  C  CG    . ASP C 3  871  ? 26.459  -69.265  58.356  1.00 41.07  ? 871  ASP A CG    1 
ATOM   7018  O  OD1   . ASP C 3  871  ? 26.803  -68.622  57.340  1.00 43.68  ? 871  ASP A OD1   1 
ATOM   7019  O  OD2   . ASP C 3  871  ? 25.332  -69.152  58.907  1.00 42.36  ? 871  ASP A OD2   1 
ATOM   7020  N  N     . GLY C 3  872  ? 29.397  -69.262  56.233  1.00 31.27  ? 872  GLY A N     1 
ATOM   7021  C  CA    . GLY C 3  872  ? 29.469  -69.422  54.792  1.00 30.80  ? 872  GLY A CA    1 
ATOM   7022  C  C     . GLY C 3  872  ? 28.172  -69.931  54.205  1.00 30.22  ? 872  GLY A C     1 
ATOM   7023  O  O     . GLY C 3  872  ? 28.170  -70.724  53.270  1.00 31.11  ? 872  GLY A O     1 
ATOM   7024  N  N     . MET C 3  873  ? 27.069  -69.458  54.773  1.00 31.09  ? 873  MET A N     1 
ATOM   7025  C  CA    . MET C 3  873  ? 25.715  -69.815  54.366  1.00 29.72  ? 873  MET A CA    1 
ATOM   7026  C  C     . MET C 3  873  ? 25.084  -68.556  53.722  1.00 32.17  ? 873  MET A C     1 
ATOM   7027  O  O     . MET C 3  873  ? 25.280  -67.439  54.228  1.00 32.11  ? 873  MET A O     1 
ATOM   7028  C  CB    . MET C 3  873  ? 24.935  -70.218  55.620  1.00 26.32  ? 873  MET A CB    1 
ATOM   7029  C  CG    . MET C 3  873  ? 23.938  -71.312  55.439  1.00 27.31  ? 873  MET A CG    1 
ATOM   7030  S  SD    . MET C 3  873  ? 24.768  -72.787  54.906  1.00 34.63  ? 873  MET A SD    1 
ATOM   7031  C  CE    . MET C 3  873  ? 25.550  -73.268  56.433  1.00 40.22  ? 873  MET A CE    1 
ATOM   7032  N  N     . ASP C 3  874  ? 24.355  -68.721  52.610  1.00 32.37  ? 874  ASP A N     1 
ATOM   7033  C  CA    . ASP C 3  874  ? 23.694  -67.588  51.931  1.00 31.59  ? 874  ASP A CA    1 
ATOM   7034  C  C     . ASP C 3  874  ? 22.407  -67.165  52.662  1.00 29.94  ? 874  ASP A C     1 
ATOM   7035  O  O     . ASP C 3  874  ? 21.514  -67.982  52.914  1.00 27.05  ? 874  ASP A O     1 
ATOM   7036  C  CB    . ASP C 3  874  ? 23.388  -67.950  50.469  1.00 34.81  ? 874  ASP A CB    1 
ATOM   7037  C  CG    . ASP C 3  874  ? 22.504  -66.913  49.769  1.00 40.24  ? 874  ASP A CG    1 
ATOM   7038  O  OD1   . ASP C 3  874  ? 21.327  -66.767  50.161  1.00 43.70  ? 874  ASP A OD1   1 
ATOM   7039  O  OD2   . ASP C 3  874  ? 22.977  -66.245  48.823  1.00 43.28  ? 874  ASP A OD2   1 
ATOM   7040  N  N     . ALA C 3  875  ? 22.328  -65.876  52.986  1.00 29.87  ? 875  ALA A N     1 
ATOM   7041  C  CA    . ALA C 3  875  ? 21.205  -65.290  53.732  1.00 30.97  ? 875  ALA A CA    1 
ATOM   7042  C  C     . ALA C 3  875  ? 19.781  -65.675  53.329  1.00 30.95  ? 875  ALA A C     1 
ATOM   7043  O  O     . ALA C 3  875  ? 18.901  -65.798  54.186  1.00 30.08  ? 875  ALA A O     1 
ATOM   7044  C  CB    . ALA C 3  875  ? 21.336  -63.778  53.727  1.00 30.22  ? 875  ALA A CB    1 
ATOM   7045  N  N     . ALA C 3  876  ? 19.559  -65.852  52.033  1.00 30.70  ? 876  ALA A N     1 
ATOM   7046  C  CA    . ALA C 3  876  ? 18.247  -66.200  51.517  1.00 32.84  ? 876  ALA A CA    1 
ATOM   7047  C  C     . ALA C 3  876  ? 17.834  -67.612  51.891  1.00 35.47  ? 876  ALA A C     1 
ATOM   7048  O  O     . ALA C 3  876  ? 16.665  -67.886  52.166  1.00 36.76  ? 876  ALA A O     1 
ATOM   7049  C  CB    . ALA C 3  876  ? 18.241  -66.051  50.023  1.00 33.53  ? 876  ALA A CB    1 
ATOM   7050  N  N     . HIS C 3  877  ? 18.804  -68.508  51.908  1.00 38.56  ? 877  HIS A N     1 
ATOM   7051  C  CA    . HIS C 3  877  ? 18.540  -69.895  52.230  1.00 43.19  ? 877  HIS A CA    1 
ATOM   7052  C  C     . HIS C 3  877  ? 18.540  -70.166  53.729  1.00 45.28  ? 877  HIS A C     1 
ATOM   7053  O  O     . HIS C 3  877  ? 18.977  -71.223  54.169  1.00 48.11  ? 877  HIS A O     1 
ATOM   7054  C  CB    . HIS C 3  877  ? 19.580  -70.766  51.530  1.00 44.42  ? 877  HIS A CB    1 
ATOM   7055  C  CG    . HIS C 3  877  ? 19.524  -70.674  50.036  1.00 46.42  ? 877  HIS A CG    1 
ATOM   7056  N  ND1   . HIS C 3  877  ? 18.517  -71.252  49.293  1.00 44.84  ? 877  HIS A ND1   1 
ATOM   7057  C  CD2   . HIS C 3  877  ? 20.325  -70.036  49.151  1.00 47.33  ? 877  HIS A CD2   1 
ATOM   7058  C  CE1   . HIS C 3  877  ? 18.699  -70.973  48.016  1.00 46.49  ? 877  HIS A CE1   1 
ATOM   7059  N  NE2   . HIS C 3  877  ? 19.789  -70.235  47.902  1.00 49.30  ? 877  HIS A NE2   1 
ATOM   7060  N  N     . ILE C 3  878  ? 18.024  -69.224  54.509  1.00 45.88  ? 878  ILE A N     1 
ATOM   7061  C  CA    . ILE C 3  878  ? 17.997  -69.371  55.959  1.00 46.28  ? 878  ILE A CA    1 
ATOM   7062  C  C     . ILE C 3  878  ? 16.604  -69.114  56.536  1.00 45.76  ? 878  ILE A C     1 
ATOM   7063  O  O     . ILE C 3  878  ? 15.786  -68.433  55.913  1.00 48.30  ? 878  ILE A O     1 
ATOM   7064  C  CB    . ILE C 3  878  ? 19.008  -68.396  56.588  1.00 50.02  ? 878  ILE A CB    1 
ATOM   7065  C  CG1   . ILE C 3  878  ? 20.428  -68.842  56.240  1.00 52.38  ? 878  ILE A CG1   1 
ATOM   7066  C  CG2   . ILE C 3  878  ? 18.824  -68.325  58.089  1.00 53.73  ? 878  ILE A CG2   1 
ATOM   7067  C  CD1   . ILE C 3  878  ? 21.505  -67.956  56.831  1.00 55.63  ? 878  ILE A CD1   1 
ATOM   7068  N  N     . GLU C 3  879  ? 16.330  -69.667  57.717  1.00 42.23  ? 879  GLU A N     1 
ATOM   7069  C  CA    . GLU C 3  879  ? 15.032  -69.484  58.362  1.00 38.80  ? 879  GLU A CA    1 
ATOM   7070  C  C     . GLU C 3  879  ? 15.117  -69.710  59.870  1.00 36.16  ? 879  GLU A C     1 
ATOM   7071  O  O     . GLU C 3  879  ? 15.867  -70.566  60.334  1.00 34.60  ? 879  GLU A O     1 
ATOM   7072  C  CB    . GLU C 3  879  ? 14.018  -70.465  57.788  1.00 42.36  ? 879  GLU A CB    1 
ATOM   7073  C  CG    . GLU C 3  879  ? 14.224  -70.822  56.333  1.00 42.66  ? 879  GLU A CG    1 
ATOM   7074  C  CD    . GLU C 3  879  ? 13.289  -71.911  55.910  1.00 44.46  ? 879  GLU A CD    1 
ATOM   7075  O  OE1   . GLU C 3  879  ? 13.487  -72.482  54.814  1.00 45.93  ? 879  GLU A OE1   1 
ATOM   7076  O  OE2   . GLU C 3  879  ? 12.351  -72.186  56.692  1.00 43.57  ? 879  GLU A OE2   1 
ATOM   7077  N  N     . LYS C 3  880  ? 14.317  -68.963  60.623  1.00 32.85  ? 880  LYS A N     1 
ATOM   7078  C  CA    . LYS C 3  880  ? 14.297  -69.052  62.080  1.00 31.24  ? 880  LYS A CA    1 
ATOM   7079  C  C     . LYS C 3  880  ? 13.822  -70.408  62.550  1.00 30.37  ? 880  LYS A C     1 
ATOM   7080  O  O     . LYS C 3  880  ? 12.651  -70.728  62.434  1.00 28.90  ? 880  LYS A O     1 
ATOM   7081  C  CB    . LYS C 3  880  ? 13.368  -67.984  62.647  1.00 34.56  ? 880  LYS A CB    1 
ATOM   7082  C  CG    . LYS C 3  880  ? 13.868  -67.228  63.864  1.00 38.76  ? 880  LYS A CG    1 
ATOM   7083  C  CD    . LYS C 3  880  ? 13.052  -65.940  64.020  1.00 48.00  ? 880  LYS A CD    1 
ATOM   7084  C  CE    . LYS C 3  880  ? 13.875  -64.784  64.619  1.00 57.53  ? 880  LYS A CE    1 
ATOM   7085  N  NZ    . LYS C 3  880  ? 13.212  -63.422  64.533  1.00 57.90  ? 880  LYS A NZ    1 
ATOM   7086  N  N     . GLN C 3  881  ? 14.733  -71.208  63.086  1.00 33.15  ? 881  GLN A N     1 
ATOM   7087  C  CA    . GLN C 3  881  ? 14.382  -72.536  63.594  1.00 34.06  ? 881  GLN A CA    1 
ATOM   7088  C  C     . GLN C 3  881  ? 14.597  -72.556  65.112  1.00 35.94  ? 881  GLN A C     1 
ATOM   7089  O  O     . GLN C 3  881  ? 15.340  -71.728  65.647  1.00 35.04  ? 881  GLN A O     1 
ATOM   7090  C  CB    . GLN C 3  881  ? 15.233  -73.607  62.905  1.00 28.58  ? 881  GLN A CB    1 
ATOM   7091  C  CG    . GLN C 3  881  ? 15.271  -73.429  61.408  1.00 25.01  ? 881  GLN A CG    1 
ATOM   7092  C  CD    . GLN C 3  881  ? 15.707  -74.668  60.668  1.00 25.37  ? 881  GLN A CD    1 
ATOM   7093  O  OE1   . GLN C 3  881  ? 15.054  -75.715  60.741  1.00 24.33  ? 881  GLN A OE1   1 
ATOM   7094  N  NE2   . GLN C 3  881  ? 16.809  -74.559  59.935  1.00 24.88  ? 881  GLN A NE2   1 
ATOM   7095  N  N     . SER C 3  882  ? 13.936  -73.479  65.807  1.00 37.92  ? 882  SER A N     1 
ATOM   7096  C  CA    . SER C 3  882  ? 14.075  -73.542  67.256  1.00 39.23  ? 882  SER A CA    1 
ATOM   7097  C  C     . SER C 3  882  ? 15.001  -74.652  67.693  1.00 40.18  ? 882  SER A C     1 
ATOM   7098  O  O     . SER C 3  882  ? 14.844  -75.807  67.287  1.00 40.13  ? 882  SER A O     1 
ATOM   7099  C  CB    . SER C 3  882  ? 12.713  -73.725  67.941  1.00 40.58  ? 882  SER A CB    1 
ATOM   7100  O  OG    . SER C 3  882  ? 12.372  -75.091  68.071  1.00 40.25  ? 882  SER A OG    1 
ATOM   7101  N  N     . LEU C 3  883  ? 15.970  -74.275  68.519  1.00 39.86  ? 883  LEU A N     1 
ATOM   7102  C  CA    . LEU C 3  883  ? 16.944  -75.196  69.069  1.00 41.07  ? 883  LEU A CA    1 
ATOM   7103  C  C     . LEU C 3  883  ? 16.272  -75.821  70.294  1.00 44.62  ? 883  LEU A C     1 
ATOM   7104  O  O     . LEU C 3  883  ? 16.339  -75.298  71.412  1.00 44.53  ? 883  LEU A O     1 
ATOM   7105  C  CB    . LEU C 3  883  ? 18.195  -74.412  69.436  1.00 37.32  ? 883  LEU A CB    1 
ATOM   7106  C  CG    . LEU C 3  883  ? 18.687  -73.612  68.226  1.00 35.90  ? 883  LEU A CG    1 
ATOM   7107  C  CD1   . LEU C 3  883  ? 19.612  -72.507  68.682  1.00 39.71  ? 883  LEU A CD1   1 
ATOM   7108  C  CD2   . LEU C 3  883  ? 19.376  -74.533  67.228  1.00 30.46  ? 883  LEU A CD2   1 
ATOM   7109  N  N     . ASP C 3  884  ? 15.604  -76.943  70.044  1.00 48.35  ? 884  ASP A N     1 
ATOM   7110  C  CA    . ASP C 3  884  ? 14.849  -77.680  71.052  1.00 52.39  ? 884  ASP A CA    1 
ATOM   7111  C  C     . ASP C 3  884  ? 15.608  -78.155  72.291  1.00 53.03  ? 884  ASP A C     1 
ATOM   7112  O  O     . ASP C 3  884  ? 15.008  -78.742  73.205  1.00 53.92  ? 884  ASP A O     1 
ATOM   7113  C  CB    . ASP C 3  884  ? 14.171  -78.889  70.393  1.00 57.09  ? 884  ASP A CB    1 
ATOM   7114  C  CG    . ASP C 3  884  ? 13.112  -78.489  69.377  1.00 61.98  ? 884  ASP A CG    1 
ATOM   7115  O  OD1   . ASP C 3  884  ? 12.215  -77.692  69.736  1.00 66.47  ? 884  ASP A OD1   1 
ATOM   7116  O  OD2   . ASP C 3  884  ? 13.168  -78.977  68.225  1.00 62.63  ? 884  ASP A OD2   1 
ATOM   7117  N  N     . THR C 3  885  ? 16.911  -77.899  72.339  1.00 50.42  ? 885  THR A N     1 
ATOM   7118  C  CA    . THR C 3  885  ? 17.702  -78.344  73.470  1.00 47.22  ? 885  THR A CA    1 
ATOM   7119  C  C     . THR C 3  885  ? 18.018  -77.286  74.532  1.00 47.53  ? 885  THR A C     1 
ATOM   7120  O  O     . THR C 3  885  ? 18.593  -77.610  75.568  1.00 48.75  ? 885  THR A O     1 
ATOM   7121  C  CB    . THR C 3  885  ? 18.995  -78.945  72.978  1.00 44.99  ? 885  THR A CB    1 
ATOM   7122  O  OG1   . THR C 3  885  ? 18.696  -79.933  72.001  1.00 44.50  ? 885  THR A OG1   1 
ATOM   7123  C  CG2   . THR C 3  885  ? 19.729  -79.613  74.098  1.00 49.53  ? 885  THR A CG2   1 
ATOM   7124  N  N     . ILE C 3  886  ? 17.641  -76.032  74.305  1.00 45.21  ? 886  ILE A N     1 
ATOM   7125  C  CA    . ILE C 3  886  ? 17.934  -75.001  75.291  1.00 42.69  ? 886  ILE A CA    1 
ATOM   7126  C  C     . ILE C 3  886  ? 16.901  -74.824  76.410  1.00 43.84  ? 886  ILE A C     1 
ATOM   7127  O  O     . ILE C 3  886  ? 17.257  -74.761  77.588  1.00 42.85  ? 886  ILE A O     1 
ATOM   7128  C  CB    . ILE C 3  886  ? 18.144  -73.632  74.620  1.00 39.72  ? 886  ILE A CB    1 
ATOM   7129  C  CG1   . ILE C 3  886  ? 19.506  -73.581  73.959  1.00 39.41  ? 886  ILE A CG1   1 
ATOM   7130  C  CG2   . ILE C 3  886  ? 18.103  -72.524  75.650  1.00 40.94  ? 886  ILE A CG2   1 
ATOM   7131  C  CD1   . ILE C 3  886  ? 19.928  -72.178  73.591  1.00 42.70  ? 886  ILE A CD1   1 
ATOM   7132  N  N     . GLY C 3  887  ? 15.626  -74.743  76.047  1.00 45.37  ? 887  GLY A N     1 
ATOM   7133  C  CA    . GLY C 3  887  ? 14.589  -74.520  77.041  1.00 45.99  ? 887  GLY A CA    1 
ATOM   7134  C  C     . GLY C 3  887  ? 13.997  -75.742  77.703  1.00 47.37  ? 887  GLY A C     1 
ATOM   7135  O  O     . GLY C 3  887  ? 14.483  -76.858  77.514  1.00 48.61  ? 887  GLY A O     1 
ATOM   7136  N  N     . GLY C 3  888  ? 12.941  -75.517  78.484  1.00 48.34  ? 888  GLY A N     1 
ATOM   7137  C  CA    . GLY C 3  888  ? 12.264  -76.593  79.188  1.00 49.40  ? 888  GLY A CA    1 
ATOM   7138  C  C     . GLY C 3  888  ? 12.959  -76.979  80.482  1.00 51.01  ? 888  GLY A C     1 
ATOM   7139  O  O     . GLY C 3  888  ? 14.179  -76.868  80.593  1.00 50.01  ? 888  GLY A O     1 
ATOM   7140  N  N     . SER C 3  889  ? 12.187  -77.423  81.471  1.00 53.56  ? 889  SER A N     1 
ATOM   7141  C  CA    . SER C 3  889  ? 12.765  -77.842  82.750  1.00 54.76  ? 889  SER A CA    1 
ATOM   7142  C  C     . SER C 3  889  ? 13.776  -78.967  82.508  1.00 54.98  ? 889  SER A C     1 
ATOM   7143  O  O     . SER C 3  889  ? 13.804  -79.569  81.431  1.00 54.64  ? 889  SER A O     1 
ATOM   7144  C  CB    . SER C 3  889  ? 11.658  -78.321  83.709  1.00 55.18  ? 889  SER A CB    1 
ATOM   7145  O  OG    . SER C 3  889  ? 10.760  -79.237  83.089  1.00 53.79  ? 889  SER A OG    1 
ATOM   7146  N  N     . ASP C 3  890  ? 14.622  -79.244  83.492  1.00 54.85  ? 890  ASP A N     1 
ATOM   7147  C  CA    . ASP C 3  890  ? 15.590  -80.316  83.324  1.00 55.71  ? 890  ASP A CA    1 
ATOM   7148  C  C     . ASP C 3  890  ? 14.841  -81.629  83.143  1.00 55.21  ? 890  ASP A C     1 
ATOM   7149  O  O     . ASP C 3  890  ? 15.285  -82.512  82.412  1.00 54.66  ? 890  ASP A O     1 
ATOM   7150  C  CB    . ASP C 3  890  ? 16.523  -80.401  84.534  1.00 57.52  ? 890  ASP A CB    1 
ATOM   7151  C  CG    . ASP C 3  890  ? 17.702  -79.455  84.422  1.00 59.47  ? 890  ASP A CG    1 
ATOM   7152  O  OD1   . ASP C 3  890  ? 18.499  -79.623  83.473  1.00 61.01  ? 890  ASP A OD1   1 
ATOM   7153  O  OD2   . ASP C 3  890  ? 17.831  -78.548  85.275  1.00 58.86  ? 890  ASP A OD2   1 
ATOM   7154  N  N     . ALA C 3  891  ? 13.689  -81.735  83.798  1.00 54.97  ? 891  ALA A N     1 
ATOM   7155  C  CA    . ALA C 3  891  ? 12.861  -82.935  83.730  1.00 54.34  ? 891  ALA A CA    1 
ATOM   7156  C  C     . ALA C 3  891  ? 12.308  -83.153  82.335  1.00 53.70  ? 891  ALA A C     1 
ATOM   7157  O  O     . ALA C 3  891  ? 12.297  -84.276  81.827  1.00 54.81  ? 891  ALA A O     1 
ATOM   7158  C  CB    . ALA C 3  891  ? 11.714  -82.831  84.718  1.00 55.99  ? 891  ALA A CB    1 
ATOM   7159  N  N     . ALA C 3  892  ? 11.843  -82.073  81.721  1.00 51.75  ? 892  ALA A N     1 
ATOM   7160  C  CA    . ALA C 3  892  ? 11.277  -82.157  80.389  1.00 48.35  ? 892  ALA A CA    1 
ATOM   7161  C  C     . ALA C 3  892  ? 12.338  -82.476  79.355  1.00 46.41  ? 892  ALA A C     1 
ATOM   7162  O  O     . ALA C 3  892  ? 12.049  -83.156  78.379  1.00 44.87  ? 892  ALA A O     1 
ATOM   7163  C  CB    . ALA C 3  892  ? 10.580  -80.871  80.045  1.00 50.63  ? 892  ALA A CB    1 
ATOM   7164  N  N     . PHE C 3  893  ? 13.562  -81.991  79.567  1.00 45.48  ? 893  PHE A N     1 
ATOM   7165  C  CA    . PHE C 3  893  ? 14.654  -82.262  78.628  1.00 45.67  ? 893  PHE A CA    1 
ATOM   7166  C  C     . PHE C 3  893  ? 14.931  -83.747  78.622  1.00 48.25  ? 893  PHE A C     1 
ATOM   7167  O  O     . PHE C 3  893  ? 15.373  -84.300  77.610  1.00 48.12  ? 893  PHE A O     1 
ATOM   7168  C  CB    . PHE C 3  893  ? 15.939  -81.548  79.038  1.00 40.04  ? 893  PHE A CB    1 
ATOM   7169  C  CG    . PHE C 3  893  ? 17.152  -81.953  78.225  1.00 33.65  ? 893  PHE A CG    1 
ATOM   7170  C  CD1   . PHE C 3  893  ? 17.562  -81.205  77.141  1.00 33.19  ? 893  PHE A CD1   1 
ATOM   7171  C  CD2   . PHE C 3  893  ? 17.906  -83.066  78.573  1.00 33.31  ? 893  PHE A CD2   1 
ATOM   7172  C  CE1   . PHE C 3  893  ? 18.707  -81.555  76.422  1.00 30.11  ? 893  PHE A CE1   1 
ATOM   7173  C  CE2   . PHE C 3  893  ? 19.051  -83.418  77.856  1.00 28.47  ? 893  PHE A CE2   1 
ATOM   7174  C  CZ    . PHE C 3  893  ? 19.448  -82.660  76.784  1.00 26.34  ? 893  PHE A CZ    1 
ATOM   7175  N  N     . GLU C 3  894  ? 14.679  -84.368  79.773  1.00 50.24  ? 894  GLU A N     1 
ATOM   7176  C  CA    . GLU C 3  894  ? 14.891  -85.793  79.984  1.00 52.26  ? 894  GLU A CA    1 
ATOM   7177  C  C     . GLU C 3  894  ? 13.696  -86.587  79.480  1.00 53.26  ? 894  GLU A C     1 
ATOM   7178  O  O     . GLU C 3  894  ? 13.860  -87.538  78.712  1.00 53.09  ? 894  GLU A O     1 
ATOM   7179  C  CB    . GLU C 3  894  ? 15.103  -86.064  81.474  1.00 54.54  ? 894  GLU A CB    1 
ATOM   7180  C  CG    . GLU C 3  894  ? 15.525  -87.483  81.823  1.00 60.75  ? 894  GLU A CG    1 
ATOM   7181  C  CD    . GLU C 3  894  ? 15.694  -87.697  83.327  1.00 64.03  ? 894  GLU A CD    1 
ATOM   7182  O  OE1   . GLU C 3  894  ? 14.676  -87.694  84.063  1.00 63.79  ? 894  GLU A OE1   1 
ATOM   7183  O  OE2   . GLU C 3  894  ? 16.853  -87.864  83.769  1.00 65.70  ? 894  GLU A OE2   1 
ATOM   7184  N  N     . LYS C 3  895  ? 12.494  -86.197  79.910  1.00 54.55  ? 895  LYS A N     1 
ATOM   7185  C  CA    . LYS C 3  895  ? 11.279  -86.895  79.488  1.00 56.04  ? 895  LYS A CA    1 
ATOM   7186  C  C     . LYS C 3  895  ? 11.240  -86.957  77.983  1.00 54.47  ? 895  LYS A C     1 
ATOM   7187  O  O     . LYS C 3  895  ? 10.510  -87.753  77.408  1.00 54.37  ? 895  LYS A O     1 
ATOM   7188  C  CB    . LYS C 3  895  ? 10.004  -86.177  79.956  1.00 59.04  ? 895  LYS A CB    1 
ATOM   7189  C  CG    . LYS C 3  895  ? 9.667   -86.301  81.436  1.00 68.19  ? 895  LYS A CG    1 
ATOM   7190  C  CD    . LYS C 3  895  ? 8.205   -85.903  81.689  1.00 73.74  ? 895  LYS A CD    1 
ATOM   7191  C  CE    . LYS C 3  895  ? 7.833   -85.972  83.171  1.00 77.89  ? 895  LYS A CE    1 
ATOM   7192  N  NZ    . LYS C 3  895  ? 6.366   -85.779  83.380  1.00 78.74  ? 895  LYS A NZ    1 
ATOM   7193  N  N     . ARG C 3  896  ? 12.044  -86.116  77.349  1.00 53.95  ? 896  ARG A N     1 
ATOM   7194  C  CA    . ARG C 3  896  ? 12.064  -86.040  75.905  1.00 53.77  ? 896  ARG A CA    1 
ATOM   7195  C  C     . ARG C 3  896  ? 13.140  -86.805  75.166  1.00 54.33  ? 896  ARG A C     1 
ATOM   7196  O  O     . ARG C 3  896  ? 12.826  -87.535  74.238  1.00 55.16  ? 896  ARG A O     1 
ATOM   7197  C  CB    . ARG C 3  896  ? 12.132  -84.589  75.486  1.00 54.14  ? 896  ARG A CB    1 
ATOM   7198  C  CG    . ARG C 3  896  ? 12.021  -84.380  74.006  1.00 58.35  ? 896  ARG A CG    1 
ATOM   7199  C  CD    . ARG C 3  896  ? 12.011  -82.900  73.719  1.00 64.74  ? 896  ARG A CD    1 
ATOM   7200  N  NE    . ARG C 3  896  ? 11.129  -82.550  72.617  1.00 69.57  ? 896  ARG A NE    1 
ATOM   7201  C  CZ    . ARG C 3  896  ? 10.884  -81.302  72.250  1.00 72.43  ? 896  ARG A CZ    1 
ATOM   7202  N  NH1   . ARG C 3  896  ? 11.465  -80.302  72.906  1.00 73.25  ? 896  ARG A NH1   1 
ATOM   7203  N  NH2   . ARG C 3  896  ? 10.052  -81.056  71.246  1.00 74.87  ? 896  ARG A NH2   1 
ATOM   7204  N  N     . TYR C 3  897  ? 14.402  -86.644  75.561  1.00 55.43  ? 897  TYR A N     1 
ATOM   7205  C  CA    . TYR C 3  897  ? 15.509  -87.311  74.865  1.00 56.02  ? 897  TYR A CA    1 
ATOM   7206  C  C     . TYR C 3  897  ? 16.102  -88.580  75.470  1.00 57.74  ? 897  TYR A C     1 
ATOM   7207  O  O     . TYR C 3  897  ? 16.711  -89.382  74.757  1.00 59.04  ? 897  TYR A O     1 
ATOM   7208  C  CB    . TYR C 3  897  ? 16.657  -86.327  74.647  1.00 53.55  ? 897  TYR A CB    1 
ATOM   7209  C  CG    . TYR C 3  897  ? 16.281  -85.124  73.837  1.00 52.68  ? 897  TYR A CG    1 
ATOM   7210  C  CD1   . TYR C 3  897  ? 15.431  -84.154  74.356  1.00 55.06  ? 897  TYR A CD1   1 
ATOM   7211  C  CD2   . TYR C 3  897  ? 16.767  -84.953  72.546  1.00 50.38  ? 897  TYR A CD2   1 
ATOM   7212  C  CE1   . TYR C 3  897  ? 15.074  -83.038  73.607  1.00 56.91  ? 897  TYR A CE1   1 
ATOM   7213  C  CE2   . TYR C 3  897  ? 16.416  -83.840  71.788  1.00 53.56  ? 897  TYR A CE2   1 
ATOM   7214  C  CZ    . TYR C 3  897  ? 15.567  -82.886  72.324  1.00 54.97  ? 897  TYR A CZ    1 
ATOM   7215  O  OH    . TYR C 3  897  ? 15.203  -81.786  71.582  1.00 53.84  ? 897  TYR A OH    1 
ATOM   7216  N  N     . ARG C 3  898  ? 15.942  -88.765  76.774  1.00 59.24  ? 898  ARG A N     1 
ATOM   7217  C  CA    . ARG C 3  898  ? 16.509  -89.935  77.431  1.00 59.28  ? 898  ARG A CA    1 
ATOM   7218  C  C     . ARG C 3  898  ? 15.831  -91.257  77.095  1.00 56.62  ? 898  ARG A C     1 
ATOM   7219  O  O     . ARG C 3  898  ? 14.604  -91.375  77.111  1.00 56.67  ? 898  ARG A O     1 
ATOM   7220  C  CB    . ARG C 3  898  ? 16.521  -89.733  78.953  1.00 64.82  ? 898  ARG A CB    1 
ATOM   7221  C  CG    . ARG C 3  898  ? 17.241  -90.838  79.735  1.00 71.94  ? 898  ARG A CG    1 
ATOM   7222  C  CD    . ARG C 3  898  ? 18.539  -91.268  79.044  1.00 77.99  ? 898  ARG A CD    1 
ATOM   7223  N  NE    . ARG C 3  898  ? 19.402  -92.088  79.898  1.00 80.99  ? 898  ARG A NE    1 
ATOM   7224  C  CZ    . ARG C 3  898  ? 20.442  -92.794  79.456  1.00 82.77  ? 898  ARG A CZ    1 
ATOM   7225  N  NH1   . ARG C 3  898  ? 20.753  -92.794  78.164  1.00 83.76  ? 898  ARG A NH1   1 
ATOM   7226  N  NH2   . ARG C 3  898  ? 21.182  -93.493  80.307  1.00 84.21  ? 898  ARG A NH2   1 
ATOM   7227  N  N     . VAL C 3  899  ? 16.662  -92.246  76.788  1.00 53.45  ? 899  VAL A N     1 
ATOM   7228  C  CA    . VAL C 3  899  ? 16.219  -93.594  76.466  1.00 49.94  ? 899  VAL A CA    1 
ATOM   7229  C  C     . VAL C 3  899  ? 17.133  -94.498  77.268  1.00 49.48  ? 899  VAL A C     1 
ATOM   7230  O  O     . VAL C 3  899  ? 18.328  -94.568  76.980  1.00 50.50  ? 899  VAL A O     1 
ATOM   7231  C  CB    . VAL C 3  899  ? 16.418  -93.909  74.980  1.00 45.92  ? 899  VAL A CB    1 
ATOM   7232  C  CG1   . VAL C 3  899  ? 16.094  -95.349  74.706  1.00 45.28  ? 899  VAL A CG1   1 
ATOM   7233  C  CG2   . VAL C 3  899  ? 15.543  -93.022  74.147  1.00 46.77  ? 899  VAL A CG2   1 
ATOM   7234  N  N     . ASP C 3  900  ? 16.589  -95.179  78.273  1.00 48.80  ? 900  ASP A N     1 
ATOM   7235  C  CA    . ASP C 3  900  ? 17.404  -96.064  79.103  1.00 49.54  ? 900  ASP A CA    1 
ATOM   7236  C  C     . ASP C 3  900  ? 16.953  -97.516  79.055  1.00 47.01  ? 900  ASP A C     1 
ATOM   7237  O  O     . ASP C 3  900  ? 16.309  -97.998  79.974  1.00 46.26  ? 900  ASP A O     1 
ATOM   7238  C  CB    . ASP C 3  900  ? 17.409  -95.563  80.555  1.00 54.88  ? 900  ASP A CB    1 
ATOM   7239  C  CG    . ASP C 3  900  ? 18.345  -96.367  81.463  1.00 60.38  ? 900  ASP A CG    1 
ATOM   7240  O  OD1   . ASP C 3  900  ? 19.490  -96.680  81.052  1.00 64.58  ? 900  ASP A OD1   1 
ATOM   7241  O  OD2   . ASP C 3  900  ? 17.940  -96.671  82.606  1.00 62.99  ? 900  ASP A OD2   1 
ATOM   7242  N  N     . LEU C 3  901  ? 17.313  -98.207  77.981  1.00 46.61  ? 901  LEU A N     1 
ATOM   7243  C  CA    . LEU C 3  901  ? 16.957  -99.603  77.790  1.00 49.76  ? 901  LEU A CA    1 
ATOM   7244  C  C     . LEU C 3  901  ? 17.174  -100.417 79.065  1.00 53.57  ? 901  LEU A C     1 
ATOM   7245  O  O     . LEU C 3  901  ? 16.558  -101.473 79.264  1.00 53.45  ? 901  LEU A O     1 
ATOM   7246  C  CB    . LEU C 3  901  ? 17.791  -100.185 76.657  1.00 47.52  ? 901  LEU A CB    1 
ATOM   7247  C  CG    . LEU C 3  901  ? 17.814  -99.310  75.411  1.00 47.07  ? 901  LEU A CG    1 
ATOM   7248  C  CD1   . LEU C 3  901  ? 18.681  -99.949  74.336  1.00 45.11  ? 901  LEU A CD1   1 
ATOM   7249  C  CD2   . LEU C 3  901  ? 16.381  -99.099  74.935  1.00 46.99  ? 901  LEU A CD2   1 
ATOM   7250  N  N     . LEU C 3  902  ? 18.062  -99.926  79.921  1.00 56.25  ? 902  LEU A N     1 
ATOM   7251  C  CA    . LEU C 3  902  ? 18.352  -100.588 81.182  1.00 58.97  ? 902  LEU A CA    1 
ATOM   7252  C  C     . LEU C 3  902  ? 17.438  -99.972  82.230  1.00 62.92  ? 902  LEU A C     1 
ATOM   7253  O  O     . LEU C 3  902  ? 17.907  -99.522  83.277  1.00 62.83  ? 902  LEU A O     1 
ATOM   7254  C  CB    . LEU C 3  902  ? 19.804  -100.350 81.589  1.00 57.00  ? 902  LEU A CB    1 
ATOM   7255  C  CG    . LEU C 3  902  ? 20.902  -100.667 80.578  1.00 58.60  ? 902  LEU A CG    1 
ATOM   7256  C  CD1   . LEU C 3  902  ? 22.253  -100.494 81.260  1.00 61.09  ? 902  LEU A CD1   1 
ATOM   7257  C  CD2   . LEU C 3  902  ? 20.743  -102.082 80.043  1.00 58.70  ? 902  LEU A CD2   1 
ATOM   7258  N  N     . ASN C 3  903  ? 16.137  -99.943  81.945  1.00 67.56  ? 903  ASN A N     1 
ATOM   7259  C  CA    . ASN C 3  903  ? 15.166  -99.352  82.869  1.00 72.07  ? 903  ASN A CA    1 
ATOM   7260  C  C     . ASN C 3  903  ? 13.732  -99.523  82.366  1.00 73.02  ? 903  ASN A C     1 
ATOM   7261  O  O     . ASN C 3  903  ? 13.234  -98.690  81.616  1.00 73.48  ? 903  ASN A O     1 
ATOM   7262  C  CB    . ASN C 3  903  ? 15.459  -97.857  83.032  1.00 74.81  ? 903  ASN A CB    1 
ATOM   7263  C  CG    . ASN C 3  903  ? 14.865  -97.278  84.295  1.00 77.97  ? 903  ASN A CG    1 
ATOM   7264  O  OD1   . ASN C 3  903  ? 15.363  -97.517  85.397  1.00 82.89  ? 903  ASN A OD1   1 
ATOM   7265  N  ND2   . ASN C 3  903  ? 13.794  -96.512  84.145  1.00 78.88  ? 903  ASN A ND2   1 
ATOM   7266  N  N     . THR C 3  904  ? 13.069  -100.592 82.794  1.00 74.80  ? 904  THR A N     1 
ATOM   7267  C  CA    . THR C 3  904  ? 11.698  -100.870 82.379  1.00 76.37  ? 904  THR A CA    1 
ATOM   7268  C  C     . THR C 3  904  ? 10.759  -99.673  82.297  1.00 76.21  ? 904  THR A C     1 
ATOM   7269  O  O     . THR C 3  904  ? 9.842   -99.679  81.485  1.00 76.87  ? 904  THR A O     1 
ATOM   7270  C  CB    . THR C 3  904  ? 11.034  -101.933 83.291  1.00 78.78  ? 904  THR A CB    1 
ATOM   7271  O  OG1   . THR C 3  904  ? 11.431  -103.243 82.862  1.00 79.44  ? 904  THR A OG1   1 
ATOM   7272  C  CG2   . THR C 3  904  ? 9.503   -101.820 83.241  1.00 78.57  ? 904  THR A CG2   1 
ATOM   7273  N  N     . ASP C 3  905  ? 10.955  -98.652  83.124  1.00 76.17  ? 905  ASP A N     1 
ATOM   7274  C  CA    . ASP C 3  905  ? 10.056  -97.502  83.053  1.00 76.88  ? 905  ASP A CA    1 
ATOM   7275  C  C     . ASP C 3  905  ? 10.425  -96.421  82.042  1.00 76.57  ? 905  ASP A C     1 
ATOM   7276  O  O     . ASP C 3  905  ? 9.575   -95.636  81.629  1.00 76.40  ? 905  ASP A O     1 
ATOM   7277  C  CB    . ASP C 3  905  ? 9.885   -96.866  84.427  1.00 77.69  ? 905  ASP A CB    1 
ATOM   7278  C  CG    . ASP C 3  905  ? 8.982   -97.674  85.322  1.00 79.12  ? 905  ASP A CG    1 
ATOM   7279  O  OD1   . ASP C 3  905  ? 8.017   -98.276  84.802  1.00 79.39  ? 905  ASP A OD1   1 
ATOM   7280  O  OD2   . ASP C 3  905  ? 9.226   -97.696  86.543  1.00 80.87  ? 905  ASP A OD2   1 
ATOM   7281  N  N     . HIS C 3  906  ? 11.686  -96.375  81.637  1.00 76.82  ? 906  HIS A N     1 
ATOM   7282  C  CA    . HIS C 3  906  ? 12.108  -95.370  80.678  1.00 76.65  ? 906  HIS A CA    1 
ATOM   7283  C  C     . HIS C 3  906  ? 12.769  -95.984  79.448  1.00 75.31  ? 906  HIS A C     1 
ATOM   7284  O  O     . HIS C 3  906  ? 13.806  -95.514  78.979  1.00 74.73  ? 906  HIS A O     1 
ATOM   7285  C  CB    . HIS C 3  906  ? 13.050  -94.359  81.344  1.00 79.59  ? 906  HIS A CB    1 
ATOM   7286  C  CG    . HIS C 3  906  ? 12.430  -93.616  82.489  1.00 83.81  ? 906  HIS A CG    1 
ATOM   7287  N  ND1   . HIS C 3  906  ? 11.148  -93.110  82.443  1.00 85.38  ? 906  HIS A ND1   1 
ATOM   7288  C  CD2   . HIS C 3  906  ? 12.927  -93.270  83.701  1.00 87.12  ? 906  HIS A CD2   1 
ATOM   7289  C  CE1   . HIS C 3  906  ? 10.882  -92.485  83.577  1.00 87.20  ? 906  HIS A CE1   1 
ATOM   7290  N  NE2   . HIS C 3  906  ? 11.945  -92.567  84.357  1.00 88.16  ? 906  HIS A NE2   1 
ATOM   7291  N  N     . THR C 3  907  ? 12.162  -97.041  78.927  1.00 74.16  ? 907  THR A N     1 
ATOM   7292  C  CA    . THR C 3  907  ? 12.683  -97.689  77.732  1.00 75.14  ? 907  THR A CA    1 
ATOM   7293  C  C     . THR C 3  907  ? 11.698  -97.427  76.600  1.00 75.23  ? 907  THR A C     1 
ATOM   7294  O  O     . THR C 3  907  ? 10.563  -97.009  76.838  1.00 77.08  ? 907  THR A O     1 
ATOM   7295  C  CB    . THR C 3  907  ? 12.808  -99.210  77.908  1.00 76.12  ? 907  THR A CB    1 
ATOM   7296  O  OG1   . THR C 3  907  ? 13.503  -99.495  79.127  1.00 79.73  ? 907  THR A OG1   1 
ATOM   7297  C  CG2   . THR C 3  907  ? 13.572  -99.816  76.733  1.00 73.02  ? 907  THR A CG2   1 
ATOM   7298  N  N     . LEU C 3  908  ? 12.125  -97.676  75.369  1.00 73.16  ? 908  LEU A N     1 
ATOM   7299  C  CA    . LEU C 3  908  ? 11.264  -97.457  74.219  1.00 70.64  ? 908  LEU A CA    1 
ATOM   7300  C  C     . LEU C 3  908  ? 10.176  -98.503  74.168  1.00 70.62  ? 908  LEU A C     1 
ATOM   7301  O  O     . LEU C 3  908  ? 10.437  -99.626  73.767  1.00 70.97  ? 908  LEU A O     1 
ATOM   7302  C  CB    . LEU C 3  908  ? 12.075  -97.549  72.939  1.00 68.50  ? 908  LEU A CB    1 
ATOM   7303  C  CG    . LEU C 3  908  ? 13.296  -96.645  72.870  1.00 67.60  ? 908  LEU A CG    1 
ATOM   7304  C  CD1   . LEU C 3  908  ? 14.058  -96.931  71.593  1.00 66.79  ? 908  LEU A CD1   1 
ATOM   7305  C  CD2   . LEU C 3  908  ? 12.854  -95.195  72.931  1.00 68.68  ? 908  LEU A CD2   1 
ATOM   7306  N  N     . ASP C 3  909  ? 8.963   -98.139  74.566  1.00 72.06  ? 909  ASP A N     1 
ATOM   7307  C  CA    . ASP C 3  909  ? 7.831   -99.066  74.541  1.00 73.90  ? 909  ASP A CA    1 
ATOM   7308  C  C     . ASP C 3  909  ? 7.921   -99.910  73.260  1.00 74.22  ? 909  ASP A C     1 
ATOM   7309  O  O     . ASP C 3  909  ? 8.386   -99.422  72.237  1.00 74.66  ? 909  ASP A O     1 
ATOM   7310  C  CB    . ASP C 3  909  ? 6.534   -98.263  74.572  1.00 77.60  ? 909  ASP A CB    1 
ATOM   7311  C  CG    . ASP C 3  909  ? 5.321   -99.121  74.838  1.00 82.80  ? 909  ASP A CG    1 
ATOM   7312  O  OD1   . ASP C 3  909  ? 5.004   -99.982  73.982  1.00 81.85  ? 909  ASP A OD1   1 
ATOM   7313  O  OD2   . ASP C 3  909  ? 4.687   -98.926  75.905  1.00 85.86  ? 909  ASP A OD2   1 
ATOM   7314  N  N     . PRO C 3  910  ? 7.491   -101.188 73.300  1.00 74.62  ? 910  PRO A N     1 
ATOM   7315  C  CA    . PRO C 3  910  ? 7.555   -102.058 72.114  1.00 75.26  ? 910  PRO A CA    1 
ATOM   7316  C  C     . PRO C 3  910  ? 6.554   -101.793 70.983  1.00 76.05  ? 910  PRO A C     1 
ATOM   7317  O  O     . PRO C 3  910  ? 6.511   -102.543 70.000  1.00 75.66  ? 910  PRO A O     1 
ATOM   7318  C  CB    . PRO C 3  910  ? 7.388   -103.452 72.706  1.00 74.26  ? 910  PRO A CB    1 
ATOM   7319  C  CG    . PRO C 3  910  ? 6.440   -103.202 73.823  1.00 75.31  ? 910  PRO A CG    1 
ATOM   7320  C  CD    . PRO C 3  910  ? 7.008   -101.947 74.466  1.00 74.77  ? 910  PRO A CD    1 
ATOM   7321  N  N     . SER C 3  911  ? 5.750   -100.739 71.120  1.00 75.68  ? 911  SER A N     1 
ATOM   7322  C  CA    . SER C 3  911  ? 4.774   -100.399 70.089  1.00 73.08  ? 911  SER A CA    1 
ATOM   7323  C  C     . SER C 3  911  ? 5.431   -99.489  69.061  1.00 71.06  ? 911  SER A C     1 
ATOM   7324  O  O     . SER C 3  911  ? 5.126   -99.565  67.874  1.00 70.85  ? 911  SER A O     1 
ATOM   7325  C  CB    . SER C 3  911  ? 3.553   -99.700  70.704  1.00 73.94  ? 911  SER A CB    1 
ATOM   7326  O  OG    . SER C 3  911  ? 3.889   -98.437  71.254  1.00 74.96  ? 911  SER A OG    1 
ATOM   7327  N  N     . LEU C 3  912  ? 6.344   -98.641  69.526  1.00 68.72  ? 912  LEU A N     1 
ATOM   7328  C  CA    . LEU C 3  912  ? 7.050   -97.707  68.657  1.00 68.84  ? 912  LEU A CA    1 
ATOM   7329  C  C     . LEU C 3  912  ? 8.025   -98.450  67.772  1.00 68.07  ? 912  LEU A C     1 
ATOM   7330  O  O     . LEU C 3  912  ? 7.856   -98.553  66.565  1.00 68.76  ? 912  LEU A O     1 
ATOM   7331  C  CB    . LEU C 3  912  ? 7.839   -96.690  69.481  1.00 69.97  ? 912  LEU A CB    1 
ATOM   7332  C  CG    . LEU C 3  912  ? 7.157   -96.025  70.677  1.00 73.25  ? 912  LEU A CG    1 
ATOM   7333  C  CD1   . LEU C 3  912  ? 8.164   -95.102  71.354  1.00 73.61  ? 912  LEU A CD1   1 
ATOM   7334  C  CD2   . LEU C 3  912  ? 5.914   -95.259  70.239  1.00 73.37  ? 912  LEU A CD2   1 
ATOM   7335  N  N     . LEU C 3  913  ? 9.065   -98.965  68.395  1.00 68.94  ? 913  LEU A N     1 
ATOM   7336  C  CA    . LEU C 3  913  ? 10.085  -99.695  67.680  1.00 71.12  ? 913  LEU A CA    1 
ATOM   7337  C  C     . LEU C 3  913  ? 9.625   -101.119 67.335  1.00 72.53  ? 913  LEU A C     1 
ATOM   7338  O  O     . LEU C 3  913  ? 8.695   -101.657 67.940  1.00 72.95  ? 913  LEU A O     1 
ATOM   7339  C  CB    . LEU C 3  913  ? 11.355  -99.705  68.533  1.00 69.50  ? 913  LEU A CB    1 
ATOM   7340  C  CG    . LEU C 3  913  ? 12.643  -100.328 68.014  1.00 69.15  ? 913  LEU A CG    1 
ATOM   7341  C  CD1   . LEU C 3  913  ? 12.721  -100.237 66.506  1.00 71.38  ? 913  LEU A CD1   1 
ATOM   7342  C  CD2   . LEU C 3  913  ? 13.806  -99.605  68.663  1.00 67.54  ? 913  LEU A CD2   1 
ATOM   7343  N  N     . GLU C 3  914  ? 10.272  -101.712 66.340  1.00 73.87  ? 914  GLU A N     1 
ATOM   7344  C  CA    . GLU C 3  914  ? 9.950   -103.062 65.905  1.00 76.23  ? 914  GLU A CA    1 
ATOM   7345  C  C     . GLU C 3  914  ? 10.667  -103.999 66.854  1.00 76.51  ? 914  GLU A C     1 
ATOM   7346  O  O     . GLU C 3  914  ? 10.091  -104.970 67.356  1.00 77.42  ? 914  GLU A O     1 
ATOM   7347  C  CB    . GLU C 3  914  ? 10.460  -103.282 64.478  1.00 79.35  ? 914  GLU A CB    1 
ATOM   7348  C  CG    . GLU C 3  914  ? 9.879   -104.489 63.751  1.00 81.55  ? 914  GLU A CG    1 
ATOM   7349  C  CD    . GLU C 3  914  ? 10.147  -104.439 62.251  1.00 83.08  ? 914  GLU A CD    1 
ATOM   7350  O  OE1   . GLU C 3  914  ? 11.325  -104.559 61.848  1.00 81.68  ? 914  GLU A OE1   1 
ATOM   7351  O  OE2   . GLU C 3  914  ? 9.176   -104.268 61.477  1.00 84.36  ? 914  GLU A OE2   1 
ATOM   7352  N  N     . SER C 3  915  ? 11.937  -103.685 67.091  1.00 75.46  ? 915  SER A N     1 
ATOM   7353  C  CA    . SER C 3  915  ? 12.779  -104.467 67.981  1.00 74.35  ? 915  SER A CA    1 
ATOM   7354  C  C     . SER C 3  915  ? 12.591  -104.003 69.420  1.00 72.45  ? 915  SER A C     1 
ATOM   7355  O  O     . SER C 3  915  ? 13.510  -104.054 70.230  1.00 72.02  ? 915  SER A O     1 
ATOM   7356  C  CB    . SER C 3  915  ? 14.246  -104.335 67.554  1.00 74.55  ? 915  SER A CB    1 
ATOM   7357  O  OG    . SER C 3  915  ? 14.553  -103.006 67.171  1.00 76.09  ? 915  SER A OG    1 
ATOM   7358  N  N     . GLY C 3  916  ? 11.376  -103.567 69.730  1.00 71.77  ? 916  GLY A N     1 
ATOM   7359  C  CA    . GLY C 3  916  ? 11.074  -103.086 71.065  1.00 72.19  ? 916  GLY A CA    1 
ATOM   7360  C  C     . GLY C 3  916  ? 11.423  -104.024 72.208  1.00 71.52  ? 916  GLY A C     1 
ATOM   7361  O  O     . GLY C 3  916  ? 12.187  -103.664 73.114  1.00 72.26  ? 916  GLY A O     1 
ATOM   7362  N  N     . SER C 3  917  ? 10.861  -105.229 72.171  1.00 69.17  ? 917  SER A N     1 
ATOM   7363  C  CA    . SER C 3  917  ? 11.102  -106.209 73.218  1.00 65.80  ? 917  SER A CA    1 
ATOM   7364  C  C     . SER C 3  917  ? 12.516  -106.774 73.203  1.00 63.78  ? 917  SER A C     1 
ATOM   7365  O  O     . SER C 3  917  ? 13.137  -106.907 74.253  1.00 64.03  ? 917  SER A O     1 
ATOM   7366  C  CB    . SER C 3  917  ? 10.090  -107.348 73.107  1.00 65.36  ? 917  SER A CB    1 
ATOM   7367  O  OG    . SER C 3  917  ? 10.166  -107.971 71.839  1.00 65.61  ? 917  SER A OG    1 
ATOM   7368  N  N     . GLU C 3  918  ? 13.036  -107.100 72.025  1.00 61.60  ? 918  GLU A N     1 
ATOM   7369  C  CA    . GLU C 3  918  ? 14.377  -107.658 71.961  1.00 60.55  ? 918  GLU A CA    1 
ATOM   7370  C  C     . GLU C 3  918  ? 15.462  -106.603 72.082  1.00 59.49  ? 918  GLU A C     1 
ATOM   7371  O  O     . GLU C 3  918  ? 16.545  -106.754 71.511  1.00 61.43  ? 918  GLU A O     1 
ATOM   7372  C  CB    . GLU C 3  918  ? 14.592  -108.457 70.670  1.00 63.43  ? 918  GLU A CB    1 
ATOM   7373  C  CG    . GLU C 3  918  ? 14.918  -107.625 69.439  1.00 68.67  ? 918  GLU A CG    1 
ATOM   7374  C  CD    . GLU C 3  918  ? 15.682  -108.414 68.384  1.00 72.05  ? 918  GLU A CD    1 
ATOM   7375  O  OE1   . GLU C 3  918  ? 16.802  -108.898 68.690  1.00 70.57  ? 918  GLU A OE1   1 
ATOM   7376  O  OE2   . GLU C 3  918  ? 15.159  -108.544 67.251  1.00 73.00  ? 918  GLU A OE2   1 
ATOM   7377  N  N     . ILE C 3  919  ? 15.179  -105.532 72.815  1.00 56.40  ? 919  ILE A N     1 
ATOM   7378  C  CA    . ILE C 3  919  ? 16.175  -104.489 73.018  1.00 55.12  ? 919  ILE A CA    1 
ATOM   7379  C  C     . ILE C 3  919  ? 16.331  -104.200 74.510  1.00 53.87  ? 919  ILE A C     1 
ATOM   7380  O  O     . ILE C 3  919  ? 17.433  -103.939 75.003  1.00 53.22  ? 919  ILE A O     1 
ATOM   7381  C  CB    . ILE C 3  919  ? 15.805  -103.193 72.255  1.00 55.55  ? 919  ILE A CB    1 
ATOM   7382  C  CG1   . ILE C 3  919  ? 16.083  -103.381 70.766  1.00 58.15  ? 919  ILE A CG1   1 
ATOM   7383  C  CG2   . ILE C 3  919  ? 16.652  -102.031 72.735  1.00 56.26  ? 919  ILE A CG2   1 
ATOM   7384  C  CD1   . ILE C 3  919  ? 15.890  -102.127 69.941  1.00 60.78  ? 919  ILE A CD1   1 
ATOM   7385  N  N     . LEU C 3  920  ? 15.216  -104.282 75.222  1.00 52.75  ? 920  LEU A N     1 
ATOM   7386  C  CA    . LEU C 3  920  ? 15.174  -104.030 76.654  1.00 51.28  ? 920  LEU A CA    1 
ATOM   7387  C  C     . LEU C 3  920  ? 16.335  -104.675 77.383  1.00 50.75  ? 920  LEU A C     1 
ATOM   7388  O  O     . LEU C 3  920  ? 16.291  -105.856 77.676  1.00 52.21  ? 920  LEU A O     1 
ATOM   7389  C  CB    . LEU C 3  920  ? 13.882  -104.590 77.222  1.00 52.85  ? 920  LEU A CB    1 
ATOM   7390  C  CG    . LEU C 3  920  ? 13.368  -103.927 78.491  1.00 59.95  ? 920  LEU A CG    1 
ATOM   7391  C  CD1   . LEU C 3  920  ? 12.228  -104.780 79.055  1.00 61.75  ? 920  LEU A CD1   1 
ATOM   7392  C  CD2   . LEU C 3  920  ? 14.492  -103.769 79.508  1.00 62.18  ? 920  LEU A CD2   1 
ATOM   7393  N  N     . GLY C 3  921  ? 17.371  -103.912 77.694  1.00 50.07  ? 921  GLY A N     1 
ATOM   7394  C  CA    . GLY C 3  921  ? 18.488  -104.497 78.408  1.00 48.22  ? 921  GLY A CA    1 
ATOM   7395  C  C     . GLY C 3  921  ? 19.788  -104.449 77.648  1.00 48.18  ? 921  GLY A C     1 
ATOM   7396  O  O     . GLY C 3  921  ? 20.842  -104.268 78.239  1.00 48.58  ? 921  GLY A O     1 
ATOM   7397  N  N     . ASP C 3  922  ? 19.724  -104.601 76.336  1.00 49.35  ? 922  ASP A N     1 
ATOM   7398  C  CA    . ASP C 3  922  ? 20.935  -104.572 75.528  1.00 53.41  ? 922  ASP A CA    1 
ATOM   7399  C  C     . ASP C 3  922  ? 21.931  -103.517 76.011  1.00 53.74  ? 922  ASP A C     1 
ATOM   7400  O  O     . ASP C 3  922  ? 21.725  -102.324 75.826  1.00 54.22  ? 922  ASP A O     1 
ATOM   7401  C  CB    . ASP C 3  922  ? 20.584  -104.308 74.071  1.00 56.72  ? 922  ASP A CB    1 
ATOM   7402  C  CG    . ASP C 3  922  ? 21.726  -104.625 73.144  1.00 61.71  ? 922  ASP A CG    1 
ATOM   7403  O  OD1   . ASP C 3  922  ? 22.836  -104.086 73.381  1.00 63.88  ? 922  ASP A OD1   1 
ATOM   7404  O  OD2   . ASP C 3  922  ? 21.510  -105.411 72.189  1.00 64.64  ? 922  ASP A OD2   1 
ATOM   7405  N  N     . LEU C 3  923  ? 23.019  -103.967 76.620  1.00 55.37  ? 923  LEU A N     1 
ATOM   7406  C  CA    . LEU C 3  923  ? 24.029  -103.056 77.144  1.00 56.97  ? 923  LEU A CA    1 
ATOM   7407  C  C     . LEU C 3  923  ? 24.836  -102.377 76.050  1.00 57.91  ? 923  LEU A C     1 
ATOM   7408  O  O     . LEU C 3  923  ? 25.256  -101.229 76.206  1.00 57.71  ? 923  LEU A O     1 
ATOM   7409  C  CB    . LEU C 3  923  ? 24.980  -103.809 78.069  1.00 56.99  ? 923  LEU A CB    1 
ATOM   7410  C  CG    . LEU C 3  923  ? 24.340  -104.590 79.215  1.00 55.01  ? 923  LEU A CG    1 
ATOM   7411  C  CD1   . LEU C 3  923  ? 25.393  -105.508 79.800  1.00 59.60  ? 923  LEU A CD1   1 
ATOM   7412  C  CD2   . LEU C 3  923  ? 23.771  -103.655 80.269  1.00 48.41  ? 923  LEU A CD2   1 
ATOM   7413  N  N     . LYS C 3  924  ? 25.069  -103.089 74.953  1.00 58.57  ? 924  LYS A N     1 
ATOM   7414  C  CA    . LYS C 3  924  ? 25.829  -102.514 73.854  1.00 60.03  ? 924  LYS A CA    1 
ATOM   7415  C  C     . LYS C 3  924  ? 25.051  -101.364 73.218  1.00 57.76  ? 924  LYS A C     1 
ATOM   7416  O  O     . LYS C 3  924  ? 25.650  -100.450 72.645  1.00 58.02  ? 924  LYS A O     1 
ATOM   7417  C  CB    . LYS C 3  924  ? 26.153  -103.578 72.799  1.00 64.69  ? 924  LYS A CB    1 
ATOM   7418  C  CG    . LYS C 3  924  ? 27.229  -104.576 73.208  1.00 69.68  ? 924  LYS A CG    1 
ATOM   7419  C  CD    . LYS C 3  924  ? 27.437  -105.626 72.114  1.00 75.85  ? 924  LYS A CD    1 
ATOM   7420  C  CE    . LYS C 3  924  ? 28.299  -106.798 72.592  1.00 80.53  ? 924  LYS A CE    1 
ATOM   7421  N  NZ    . LYS C 3  924  ? 28.398  -107.895 71.577  1.00 79.37  ? 924  LYS A NZ    1 
ATOM   7422  N  N     . LEU C 3  925  ? 23.724  -101.408 73.327  1.00 54.34  ? 925  LEU A N     1 
ATOM   7423  C  CA    . LEU C 3  925  ? 22.889  -100.352 72.765  1.00 52.13  ? 925  LEU A CA    1 
ATOM   7424  C  C     . LEU C 3  925  ? 22.837  -99.156  73.695  1.00 50.77  ? 925  LEU A C     1 
ATOM   7425  O  O     . LEU C 3  925  ? 22.872  -98.011  73.249  1.00 52.55  ? 925  LEU A O     1 
ATOM   7426  C  CB    . LEU C 3  925  ? 21.472  -100.851 72.500  1.00 51.97  ? 925  LEU A CB    1 
ATOM   7427  C  CG    . LEU C 3  925  ? 21.362  -101.895 71.389  1.00 54.00  ? 925  LEU A CG    1 
ATOM   7428  C  CD1   . LEU C 3  925  ? 19.893  -102.252 71.147  1.00 51.48  ? 925  LEU A CD1   1 
ATOM   7429  C  CD2   . LEU C 3  925  ? 22.015  -101.351 70.125  1.00 54.12  ? 925  LEU A CD2   1 
ATOM   7430  N  N     . GLN C 3  926  ? 22.753  -99.413  74.991  1.00 47.67  ? 926  GLN A N     1 
ATOM   7431  C  CA    . GLN C 3  926  ? 22.724  -98.326  75.951  1.00 44.90  ? 926  GLN A CA    1 
ATOM   7432  C  C     . GLN C 3  926  ? 23.990  -97.505  75.852  1.00 44.02  ? 926  GLN A C     1 
ATOM   7433  O  O     . GLN C 3  926  ? 23.978  -96.310  76.094  1.00 41.54  ? 926  GLN A O     1 
ATOM   7434  C  CB    . GLN C 3  926  ? 22.592  -98.865  77.365  1.00 45.67  ? 926  GLN A CB    1 
ATOM   7435  C  CG    . GLN C 3  926  ? 21.185  -98.851  77.874  1.00 41.72  ? 926  GLN A CG    1 
ATOM   7436  C  CD    . GLN C 3  926  ? 20.610  -97.471  77.839  1.00 39.43  ? 926  GLN A CD    1 
ATOM   7437  O  OE1   . GLN C 3  926  ? 21.156  -96.531  78.422  1.00 35.48  ? 926  GLN A OE1   1 
ATOM   7438  N  NE2   . GLN C 3  926  ? 19.501  -97.330  77.146  1.00 41.91  ? 926  GLN A NE2   1 
ATOM   7439  N  N     . VAL C 3  927  ? 25.091  -98.154  75.501  1.00 45.83  ? 927  VAL A N     1 
ATOM   7440  C  CA    . VAL C 3  927  ? 26.353  -97.450  75.377  1.00 49.33  ? 927  VAL A CA    1 
ATOM   7441  C  C     . VAL C 3  927  ? 26.233  -96.346  74.343  1.00 51.11  ? 927  VAL A C     1 
ATOM   7442  O  O     . VAL C 3  927  ? 26.895  -95.307  74.447  1.00 52.84  ? 927  VAL A O     1 
ATOM   7443  C  CB    . VAL C 3  927  ? 27.469  -98.398  74.971  1.00 49.66  ? 927  VAL A CB    1 
ATOM   7444  C  CG1   . VAL C 3  927  ? 28.730  -97.615  74.652  1.00 51.79  ? 927  VAL A CG1   1 
ATOM   7445  C  CG2   . VAL C 3  927  ? 27.726  -99.371  76.099  1.00 52.21  ? 927  VAL A CG2   1 
ATOM   7446  N  N     . LEU C 3  928  ? 25.384  -96.575  73.346  1.00 51.37  ? 928  LEU A N     1 
ATOM   7447  C  CA    . LEU C 3  928  ? 25.161  -95.592  72.297  1.00 50.15  ? 928  LEU A CA    1 
ATOM   7448  C  C     . LEU C 3  928  ? 24.197  -94.532  72.792  1.00 49.45  ? 928  LEU A C     1 
ATOM   7449  O  O     . LEU C 3  928  ? 24.564  -93.364  72.884  1.00 48.92  ? 928  LEU A O     1 
ATOM   7450  C  CB    . LEU C 3  928  ? 24.601  -96.261  71.050  1.00 49.31  ? 928  LEU A CB    1 
ATOM   7451  C  CG    . LEU C 3  928  ? 25.599  -97.113  70.277  1.00 50.47  ? 928  LEU A CG    1 
ATOM   7452  C  CD1   . LEU C 3  928  ? 24.889  -97.711  69.087  1.00 51.50  ? 928  LEU A CD1   1 
ATOM   7453  C  CD2   . LEU C 3  928  ? 26.793  -96.266  69.827  1.00 51.06  ? 928  LEU A CD2   1 
ATOM   7454  N  N     . LEU C 3  929  ? 22.967  -94.940  73.108  1.00 49.06  ? 929  LEU A N     1 
ATOM   7455  C  CA    . LEU C 3  929  ? 21.961  -94.007  73.618  1.00 50.38  ? 929  LEU A CA    1 
ATOM   7456  C  C     . LEU C 3  929  ? 22.664  -93.107  74.627  1.00 53.19  ? 929  LEU A C     1 
ATOM   7457  O  O     . LEU C 3  929  ? 22.464  -91.892  74.646  1.00 53.90  ? 929  LEU A O     1 
ATOM   7458  C  CB    . LEU C 3  929  ? 20.825  -94.748  74.331  1.00 46.05  ? 929  LEU A CB    1 
ATOM   7459  C  CG    . LEU C 3  929  ? 19.868  -95.641  73.551  1.00 41.57  ? 929  LEU A CG    1 
ATOM   7460  C  CD1   . LEU C 3  929  ? 18.855  -94.803  72.831  1.00 42.27  ? 929  LEU A CD1   1 
ATOM   7461  C  CD2   . LEU C 3  929  ? 20.637  -96.488  72.587  1.00 41.51  ? 929  LEU A CD2   1 
ATOM   7462  N  N     . ASP C 3  930  ? 23.490  -93.723  75.468  1.00 54.69  ? 930  ASP A N     1 
ATOM   7463  C  CA    . ASP C 3  930  ? 24.234  -92.985  76.464  1.00 56.44  ? 930  ASP A CA    1 
ATOM   7464  C  C     . ASP C 3  930  ? 25.098  -91.992  75.722  1.00 56.85  ? 930  ASP A C     1 
ATOM   7465  O  O     . ASP C 3  930  ? 25.086  -90.808  76.029  1.00 58.87  ? 930  ASP A O     1 
ATOM   7466  C  CB    . ASP C 3  930  ? 25.112  -93.923  77.295  1.00 61.73  ? 930  ASP A CB    1 
ATOM   7467  C  CG    . ASP C 3  930  ? 24.355  -94.581  78.445  1.00 66.07  ? 930  ASP A CG    1 
ATOM   7468  O  OD1   . ASP C 3  930  ? 23.117  -94.409  78.525  1.00 69.00  ? 930  ASP A OD1   1 
ATOM   7469  O  OD2   . ASP C 3  930  ? 25.004  -95.271  79.266  1.00 66.08  ? 930  ASP A OD2   1 
ATOM   7470  N  N     . GLU C 3  931  ? 25.846  -92.462  74.734  1.00 56.49  ? 931  GLU A N     1 
ATOM   7471  C  CA    . GLU C 3  931  ? 26.691  -91.546  73.988  1.00 57.58  ? 931  GLU A CA    1 
ATOM   7472  C  C     . GLU C 3  931  ? 25.876  -90.435  73.330  1.00 54.94  ? 931  GLU A C     1 
ATOM   7473  O  O     . GLU C 3  931  ? 26.300  -89.280  73.332  1.00 53.21  ? 931  GLU A O     1 
ATOM   7474  C  CB    . GLU C 3  931  ? 27.544  -92.304  72.958  1.00 63.48  ? 931  GLU A CB    1 
ATOM   7475  C  CG    . GLU C 3  931  ? 28.885  -92.791  73.545  1.00 73.10  ? 931  GLU A CG    1 
ATOM   7476  C  CD    . GLU C 3  931  ? 29.790  -93.503  72.536  1.00 79.56  ? 931  GLU A CD    1 
ATOM   7477  O  OE1   . GLU C 3  931  ? 29.533  -94.693  72.221  1.00 81.42  ? 931  GLU A OE1   1 
ATOM   7478  O  OE2   . GLU C 3  931  ? 30.760  -92.864  72.062  1.00 80.32  ? 931  GLU A OE2   1 
ATOM   7479  N  N     . GLU C 3  932  ? 24.705  -90.776  72.789  1.00 53.54  ? 932  GLU A N     1 
ATOM   7480  C  CA    . GLU C 3  932  ? 23.838  -89.779  72.157  1.00 51.48  ? 932  GLU A CA    1 
ATOM   7481  C  C     . GLU C 3  932  ? 23.324  -88.791  73.208  1.00 50.44  ? 932  GLU A C     1 
ATOM   7482  O  O     . GLU C 3  932  ? 23.413  -87.575  73.027  1.00 51.90  ? 932  GLU A O     1 
ATOM   7483  C  CB    . GLU C 3  932  ? 22.632  -90.437  71.460  1.00 50.01  ? 932  GLU A CB    1 
ATOM   7484  C  CG    . GLU C 3  932  ? 21.429  -89.474  71.301  1.00 52.72  ? 932  GLU A CG    1 
ATOM   7485  C  CD    . GLU C 3  932  ? 20.166  -90.106  70.699  1.00 52.97  ? 932  GLU A CD    1 
ATOM   7486  O  OE1   . GLU C 3  932  ? 20.177  -90.429  69.489  1.00 51.61  ? 932  GLU A OE1   1 
ATOM   7487  O  OE2   . GLU C 3  932  ? 19.158  -90.265  71.438  1.00 49.28  ? 932  GLU A OE2   1 
ATOM   7488  N  N     . TYR C 3  933  ? 22.792  -89.319  74.305  1.00 47.30  ? 933  TYR A N     1 
ATOM   7489  C  CA    . TYR C 3  933  ? 22.256  -88.487  75.371  1.00 45.08  ? 933  TYR A CA    1 
ATOM   7490  C  C     . TYR C 3  933  ? 23.287  -87.593  76.042  1.00 45.18  ? 933  TYR A C     1 
ATOM   7491  O  O     . TYR C 3  933  ? 22.939  -86.533  76.544  1.00 44.26  ? 933  TYR A O     1 
ATOM   7492  C  CB    . TYR C 3  933  ? 21.603  -89.357  76.432  1.00 43.47  ? 933  TYR A CB    1 
ATOM   7493  C  CG    . TYR C 3  933  ? 20.853  -88.585  77.487  1.00 41.48  ? 933  TYR A CG    1 
ATOM   7494  C  CD1   . TYR C 3  933  ? 19.487  -88.351  77.366  1.00 41.58  ? 933  TYR A CD1   1 
ATOM   7495  C  CD2   . TYR C 3  933  ? 21.502  -88.113  78.623  1.00 41.11  ? 933  TYR A CD2   1 
ATOM   7496  C  CE1   . TYR C 3  933  ? 18.787  -87.670  78.358  1.00 43.69  ? 933  TYR A CE1   1 
ATOM   7497  C  CE2   . TYR C 3  933  ? 20.809  -87.431  79.624  1.00 42.82  ? 933  TYR A CE2   1 
ATOM   7498  C  CZ    . TYR C 3  933  ? 19.452  -87.214  79.484  1.00 44.35  ? 933  TYR A CZ    1 
ATOM   7499  O  OH    . TYR C 3  933  ? 18.761  -86.547  80.471  1.00 47.34  ? 933  TYR A OH    1 
ATOM   7500  N  N     . LYS C 3  934  ? 24.549  -88.017  76.066  1.00 48.19  ? 934  LYS A N     1 
ATOM   7501  C  CA    . LYS C 3  934  ? 25.610  -87.221  76.697  1.00 50.72  ? 934  LYS A CA    1 
ATOM   7502  C  C     . LYS C 3  934  ? 25.957  -86.020  75.845  1.00 49.38  ? 934  LYS A C     1 
ATOM   7503  O  O     . LYS C 3  934  ? 26.411  -84.985  76.345  1.00 48.78  ? 934  LYS A O     1 
ATOM   7504  C  CB    . LYS C 3  934  ? 26.879  -88.056  76.924  1.00 54.27  ? 934  LYS A CB    1 
ATOM   7505  C  CG    . LYS C 3  934  ? 26.962  -88.704  78.307  1.00 61.90  ? 934  LYS A CG    1 
ATOM   7506  C  CD    . LYS C 3  934  ? 28.325  -89.354  78.554  1.00 68.68  ? 934  LYS A CD    1 
ATOM   7507  C  CE    . LYS C 3  934  ? 28.417  -89.932  79.971  1.00 72.82  ? 934  LYS A CE    1 
ATOM   7508  N  NZ    . LYS C 3  934  ? 29.789  -90.408  80.338  1.00 74.89  ? 934  LYS A NZ    1 
ATOM   7509  N  N     . GLN C 3  935  ? 25.738  -86.176  74.548  1.00 48.80  ? 935  GLN A N     1 
ATOM   7510  C  CA    . GLN C 3  935  ? 26.018  -85.124  73.590  1.00 46.72  ? 935  GLN A CA    1 
ATOM   7511  C  C     . GLN C 3  935  ? 24.919  -84.076  73.688  1.00 45.77  ? 935  GLN A C     1 
ATOM   7512  O  O     . GLN C 3  935  ? 25.203  -82.883  73.830  1.00 45.74  ? 935  GLN A O     1 
ATOM   7513  C  CB    . GLN C 3  935  ? 26.082  -85.718  72.181  1.00 45.38  ? 935  GLN A CB    1 
ATOM   7514  C  CG    . GLN C 3  935  ? 26.607  -84.774  71.133  1.00 44.46  ? 935  GLN A CG    1 
ATOM   7515  C  CD    . GLN C 3  935  ? 27.882  -84.099  71.557  1.00 43.62  ? 935  GLN A CD    1 
ATOM   7516  O  OE1   . GLN C 3  935  ? 28.851  -84.758  71.928  1.00 46.32  ? 935  GLN A OE1   1 
ATOM   7517  N  NE2   . GLN C 3  935  ? 27.893  -82.774  71.505  1.00 44.09  ? 935  GLN A NE2   1 
ATOM   7518  N  N     . LEU C 3  936  ? 23.664  -84.527  73.631  1.00 43.76  ? 936  LEU A N     1 
ATOM   7519  C  CA    . LEU C 3  936  ? 22.528  -83.615  73.714  1.00 40.85  ? 936  LEU A CA    1 
ATOM   7520  C  C     . LEU C 3  936  ? 22.697  -82.753  74.960  1.00 41.76  ? 936  LEU A C     1 
ATOM   7521  O  O     . LEU C 3  936  ? 22.384  -81.566  74.942  1.00 43.41  ? 936  LEU A O     1 
ATOM   7522  C  CB    . LEU C 3  936  ? 21.204  -84.392  73.764  1.00 35.29  ? 936  LEU A CB    1 
ATOM   7523  C  CG    . LEU C 3  936  ? 20.956  -85.417  72.647  1.00 33.47  ? 936  LEU A CG    1 
ATOM   7524  C  CD1   . LEU C 3  936  ? 19.693  -86.192  72.918  1.00 31.18  ? 936  LEU A CD1   1 
ATOM   7525  C  CD2   . LEU C 3  936  ? 20.851  -84.732  71.317  1.00 34.32  ? 936  LEU A CD2   1 
ATOM   7526  N  N     . VAL C 3  937  ? 23.221  -83.337  76.033  1.00 41.03  ? 937  VAL A N     1 
ATOM   7527  C  CA    . VAL C 3  937  ? 23.424  -82.571  77.255  1.00 41.75  ? 937  VAL A CA    1 
ATOM   7528  C  C     . VAL C 3  937  ? 24.620  -81.623  77.165  1.00 42.95  ? 937  VAL A C     1 
ATOM   7529  O  O     . VAL C 3  937  ? 24.672  -80.609  77.866  1.00 40.88  ? 937  VAL A O     1 
ATOM   7530  C  CB    . VAL C 3  937  ? 23.590  -83.485  78.470  1.00 40.80  ? 937  VAL A CB    1 
ATOM   7531  C  CG1   . VAL C 3  937  ? 23.856  -82.648  79.719  1.00 41.09  ? 937  VAL A CG1   1 
ATOM   7532  C  CG2   . VAL C 3  937  ? 22.329  -84.304  78.656  1.00 40.69  ? 937  VAL A CG2   1 
ATOM   7533  N  N     . LYS C 3  938  ? 25.591  -81.954  76.322  1.00 45.56  ? 938  LYS A N     1 
ATOM   7534  C  CA    . LYS C 3  938  ? 26.726  -81.061  76.155  1.00 49.64  ? 938  LYS A CA    1 
ATOM   7535  C  C     . LYS C 3  938  ? 26.163  -79.853  75.426  1.00 49.83  ? 938  LYS A C     1 
ATOM   7536  O  O     . LYS C 3  938  ? 26.449  -78.703  75.782  1.00 49.15  ? 938  LYS A O     1 
ATOM   7537  C  CB    . LYS C 3  938  ? 27.824  -81.691  75.296  1.00 55.28  ? 938  LYS A CB    1 
ATOM   7538  C  CG    . LYS C 3  938  ? 28.933  -82.379  76.071  1.00 63.59  ? 938  LYS A CG    1 
ATOM   7539  C  CD    . LYS C 3  938  ? 30.109  -82.715  75.146  1.00 71.23  ? 938  LYS A CD    1 
ATOM   7540  C  CE    . LYS C 3  938  ? 31.149  -83.585  75.859  1.00 76.86  ? 938  LYS A CE    1 
ATOM   7541  N  NZ    . LYS C 3  938  ? 32.255  -84.037  74.962  1.00 77.90  ? 938  LYS A NZ    1 
ATOM   7542  N  N     . ASP C 3  939  ? 25.346  -80.139  74.407  1.00 50.20  ? 939  ASP A N     1 
ATOM   7543  C  CA    . ASP C 3  939  ? 24.715  -79.106  73.588  1.00 49.45  ? 939  ASP A CA    1 
ATOM   7544  C  C     . ASP C 3  939  ? 23.873  -78.163  74.432  1.00 47.96  ? 939  ASP A C     1 
ATOM   7545  O  O     . ASP C 3  939  ? 23.956  -76.947  74.279  1.00 48.25  ? 939  ASP A O     1 
ATOM   7546  C  CB    . ASP C 3  939  ? 23.854  -79.736  72.488  1.00 51.33  ? 939  ASP A CB    1 
ATOM   7547  C  CG    . ASP C 3  939  ? 24.689  -80.442  71.423  1.00 56.99  ? 939  ASP A CG    1 
ATOM   7548  O  OD1   . ASP C 3  939  ? 25.802  -79.952  71.106  1.00 58.43  ? 939  ASP A OD1   1 
ATOM   7549  O  OD2   . ASP C 3  939  ? 24.228  -81.476  70.887  1.00 57.84  ? 939  ASP A OD2   1 
ATOM   7550  N  N     . ARG C 3  940  ? 23.072  -78.713  75.333  1.00 45.23  ? 940  ARG A N     1 
ATOM   7551  C  CA    . ARG C 3  940  ? 22.260  -77.865  76.180  1.00 44.04  ? 940  ARG A CA    1 
ATOM   7552  C  C     . ARG C 3  940  ? 23.161  -76.844  76.860  1.00 45.54  ? 940  ARG A C     1 
ATOM   7553  O  O     . ARG C 3  940  ? 22.887  -75.646  76.825  1.00 46.14  ? 940  ARG A O     1 
ATOM   7554  C  CB    . ARG C 3  940  ? 21.538  -78.697  77.229  1.00 40.76  ? 940  ARG A CB    1 
ATOM   7555  C  CG    . ARG C 3  940  ? 20.352  -78.001  77.886  1.00 37.44  ? 940  ARG A CG    1 
ATOM   7556  C  CD    . ARG C 3  940  ? 19.479  -79.046  78.568  1.00 36.61  ? 940  ARG A CD    1 
ATOM   7557  N  NE    . ARG C 3  940  ? 18.108  -78.606  78.776  1.00 32.81  ? 940  ARG A NE    1 
ATOM   7558  C  CZ    . ARG C 3  940  ? 17.698  -77.923  79.834  1.00 34.40  ? 940  ARG A CZ    1 
ATOM   7559  N  NH1   . ARG C 3  940  ? 18.554  -77.603  80.785  1.00 38.45  ? 940  ARG A NH1   1 
ATOM   7560  N  NH2   . ARG C 3  940  ? 16.431  -77.562  79.948  1.00 36.59  ? 940  ARG A NH2   1 
ATOM   7561  N  N     . LYS C 3  941  ? 24.251  -77.310  77.460  1.00 46.77  ? 941  LYS A N     1 
ATOM   7562  C  CA    . LYS C 3  941  ? 25.161  -76.402  78.154  1.00 50.57  ? 941  LYS A CA    1 
ATOM   7563  C  C     . LYS C 3  941  ? 25.748  -75.395  77.177  1.00 48.86  ? 941  LYS A C     1 
ATOM   7564  O  O     . LYS C 3  941  ? 25.693  -74.180  77.400  1.00 48.30  ? 941  LYS A O     1 
ATOM   7565  C  CB    . LYS C 3  941  ? 26.311  -77.174  78.810  1.00 57.97  ? 941  LYS A CB    1 
ATOM   7566  C  CG    . LYS C 3  941  ? 25.903  -78.393  79.646  1.00 69.38  ? 941  LYS A CG    1 
ATOM   7567  C  CD    . LYS C 3  941  ? 25.440  -78.045  81.070  1.00 77.41  ? 941  LYS A CD    1 
ATOM   7568  C  CE    . LYS C 3  941  ? 25.193  -79.326  81.895  1.00 80.26  ? 941  LYS A CE    1 
ATOM   7569  N  NZ    . LYS C 3  941  ? 24.671  -79.073  83.277  1.00 81.62  ? 941  LYS A NZ    1 
ATOM   7570  N  N     . PHE C 3  942  ? 26.317  -75.919  76.098  1.00 46.16  ? 942  PHE A N     1 
ATOM   7571  C  CA    . PHE C 3  942  ? 26.940  -75.096  75.077  1.00 43.35  ? 942  PHE A CA    1 
ATOM   7572  C  C     . PHE C 3  942  ? 26.037  -73.970  74.586  1.00 43.13  ? 942  PHE A C     1 
ATOM   7573  O  O     . PHE C 3  942  ? 26.464  -72.817  74.487  1.00 43.49  ? 942  PHE A O     1 
ATOM   7574  C  CB    . PHE C 3  942  ? 27.355  -75.965  73.899  1.00 39.15  ? 942  PHE A CB    1 
ATOM   7575  C  CG    . PHE C 3  942  ? 27.822  -75.184  72.726  1.00 39.14  ? 942  PHE A CG    1 
ATOM   7576  C  CD1   . PHE C 3  942  ? 28.844  -74.258  72.859  1.00 40.88  ? 942  PHE A CD1   1 
ATOM   7577  C  CD2   . PHE C 3  942  ? 27.249  -75.372  71.482  1.00 43.55  ? 942  PHE A CD2   1 
ATOM   7578  C  CE1   . PHE C 3  942  ? 29.292  -73.527  71.763  1.00 44.55  ? 942  PHE A CE1   1 
ATOM   7579  C  CE2   . PHE C 3  942  ? 27.688  -74.646  70.375  1.00 45.08  ? 942  PHE A CE2   1 
ATOM   7580  C  CZ    . PHE C 3  942  ? 28.713  -73.723  70.516  1.00 44.41  ? 942  PHE A CZ    1 
ATOM   7581  N  N     . LEU C 3  943  ? 24.790  -74.308  74.277  1.00 41.14  ? 943  LEU A N     1 
ATOM   7582  C  CA    . LEU C 3  943  ? 23.836  -73.324  73.796  1.00 38.18  ? 943  LEU A CA    1 
ATOM   7583  C  C     . LEU C 3  943  ? 23.501  -72.304  74.855  1.00 38.47  ? 943  LEU A C     1 
ATOM   7584  O  O     . LEU C 3  943  ? 23.558  -71.100  74.604  1.00 39.66  ? 943  LEU A O     1 
ATOM   7585  C  CB    . LEU C 3  943  ? 22.556  -73.998  73.345  1.00 35.38  ? 943  LEU A CB    1 
ATOM   7586  C  CG    . LEU C 3  943  ? 22.686  -74.884  72.116  1.00 35.28  ? 943  LEU A CG    1 
ATOM   7587  C  CD1   . LEU C 3  943  ? 21.301  -75.191  71.582  1.00 30.94  ? 943  LEU A CD1   1 
ATOM   7588  C  CD2   . LEU C 3  943  ? 23.528  -74.180  71.058  1.00 35.53  ? 943  LEU A CD2   1 
ATOM   7589  N  N     . ARG C 3  944  ? 23.140  -72.782  76.040  1.00 37.74  ? 944  ARG A N     1 
ATOM   7590  C  CA    . ARG C 3  944  ? 22.801  -71.877  77.126  1.00 37.51  ? 944  ARG A CA    1 
ATOM   7591  C  C     . ARG C 3  944  ? 23.959  -70.952  77.415  1.00 38.58  ? 944  ARG A C     1 
ATOM   7592  O  O     . ARG C 3  944  ? 23.786  -69.922  78.065  1.00 38.95  ? 944  ARG A O     1 
ATOM   7593  C  CB    . ARG C 3  944  ? 22.435  -72.648  78.386  1.00 36.62  ? 944  ARG A CB    1 
ATOM   7594  C  CG    . ARG C 3  944  ? 21.136  -73.397  78.273  1.00 35.19  ? 944  ARG A CG    1 
ATOM   7595  C  CD    . ARG C 3  944  ? 20.537  -73.611  79.631  1.00 37.85  ? 944  ARG A CD    1 
ATOM   7596  N  NE    . ARG C 3  944  ? 19.153  -74.057  79.546  1.00 41.71  ? 944  ARG A NE    1 
ATOM   7597  C  CZ    . ARG C 3  944  ? 18.396  -74.337  80.602  1.00 44.47  ? 944  ARG A CZ    1 
ATOM   7598  N  NH1   . ARG C 3  944  ? 18.892  -74.216  81.832  1.00 46.35  ? 944  ARG A NH1   1 
ATOM   7599  N  NH2   . ARG C 3  944  ? 17.148  -74.748  80.432  1.00 43.40  ? 944  ARG A NH2   1 
ATOM   7600  N  N     . GLU C 3  945  ? 25.139  -71.331  76.931  1.00 39.76  ? 945  GLU A N     1 
ATOM   7601  C  CA    . GLU C 3  945  ? 26.348  -70.536  77.114  1.00 40.42  ? 945  GLU A CA    1 
ATOM   7602  C  C     . GLU C 3  945  ? 26.377  -69.427  76.064  1.00 38.55  ? 945  GLU A C     1 
ATOM   7603  O  O     . GLU C 3  945  ? 26.686  -68.273  76.371  1.00 38.50  ? 945  GLU A O     1 
ATOM   7604  C  CB    . GLU C 3  945  ? 27.588  -71.430  76.982  1.00 45.48  ? 945  GLU A CB    1 
ATOM   7605  C  CG    . GLU C 3  945  ? 28.394  -71.616  78.285  1.00 52.56  ? 945  GLU A CG    1 
ATOM   7606  C  CD    . GLU C 3  945  ? 29.448  -72.724  78.181  1.00 56.77  ? 945  GLU A CD    1 
ATOM   7607  O  OE1   . GLU C 3  945  ? 30.186  -72.772  77.168  1.00 57.82  ? 945  GLU A OE1   1 
ATOM   7608  O  OE2   . GLU C 3  945  ? 29.544  -73.547  79.116  1.00 58.17  ? 945  GLU A OE2   1 
ATOM   7609  N  N     . VAL C 3  946  ? 26.038  -69.784  74.828  1.00 36.78  ? 946  VAL A N     1 
ATOM   7610  C  CA    . VAL C 3  946  ? 26.015  -68.833  73.721  1.00 34.38  ? 946  VAL A CA    1 
ATOM   7611  C  C     . VAL C 3  946  ? 24.809  -67.917  73.820  1.00 35.59  ? 946  VAL A C     1 
ATOM   7612  O  O     . VAL C 3  946  ? 24.938  -66.694  73.859  1.00 36.18  ? 946  VAL A O     1 
ATOM   7613  C  CB    . VAL C 3  946  ? 25.923  -69.548  72.378  1.00 30.63  ? 946  VAL A CB    1 
ATOM   7614  C  CG1   . VAL C 3  946  ? 25.920  -68.540  71.262  1.00 27.10  ? 946  VAL A CG1   1 
ATOM   7615  C  CG2   . VAL C 3  946  ? 27.066  -70.509  72.227  1.00 31.53  ? 946  VAL A CG2   1 
ATOM   7616  N  N     . PHE C 3  947  ? 23.628  -68.520  73.856  1.00 36.13  ? 947  PHE A N     1 
ATOM   7617  C  CA    . PHE C 3  947  ? 22.396  -67.755  73.933  1.00 37.45  ? 947  PHE A CA    1 
ATOM   7618  C  C     . PHE C 3  947  ? 21.875  -67.632  75.361  1.00 38.34  ? 947  PHE A C     1 
ATOM   7619  O  O     . PHE C 3  947  ? 20.823  -68.183  75.700  1.00 38.85  ? 947  PHE A O     1 
ATOM   7620  C  CB    . PHE C 3  947  ? 21.349  -68.399  73.023  1.00 35.75  ? 947  PHE A CB    1 
ATOM   7621  C  CG    . PHE C 3  947  ? 21.805  -68.535  71.601  1.00 31.81  ? 947  PHE A CG    1 
ATOM   7622  C  CD1   . PHE C 3  947  ? 22.230  -69.758  71.108  1.00 31.43  ? 947  PHE A CD1   1 
ATOM   7623  C  CD2   . PHE C 3  947  ? 21.867  -67.422  70.770  1.00 29.47  ? 947  PHE A CD2   1 
ATOM   7624  C  CE1   . PHE C 3  947  ? 22.717  -69.870  69.804  1.00 31.86  ? 947  PHE A CE1   1 
ATOM   7625  C  CE2   . PHE C 3  947  ? 22.353  -67.522  69.467  1.00 29.35  ? 947  PHE A CE2   1 
ATOM   7626  C  CZ    . PHE C 3  947  ? 22.778  -68.745  68.983  1.00 30.84  ? 947  PHE A CZ    1 
ATOM   7627  N  N     . VAL C 3  948  ? 22.623  -66.891  76.177  1.00 37.92  ? 948  VAL A N     1 
ATOM   7628  C  CA    . VAL C 3  948  ? 22.309  -66.650  77.588  1.00 37.93  ? 948  VAL A CA    1 
ATOM   7629  C  C     . VAL C 3  948  ? 20.810  -66.392  77.800  1.00 39.63  ? 948  VAL A C     1 
ATOM   7630  O  O     . VAL C 3  948  ? 20.200  -66.890  78.755  1.00 35.53  ? 948  VAL A O     1 
ATOM   7631  C  CB    . VAL C 3  948  ? 23.099  -65.423  78.099  1.00 37.65  ? 948  VAL A CB    1 
ATOM   7632  C  CG1   . VAL C 3  948  ? 23.418  -65.571  79.576  1.00 40.91  ? 948  VAL A CG1   1 
ATOM   7633  C  CG2   . VAL C 3  948  ? 24.363  -65.253  77.295  1.00 36.75  ? 948  VAL A CG2   1 
ATOM   7634  N  N     . ASP C 3  949  ? 20.253  -65.589  76.891  1.00 42.22  ? 949  ASP A N     1 
ATOM   7635  C  CA    . ASP C 3  949  ? 18.847  -65.192  76.863  1.00 41.99  ? 949  ASP A CA    1 
ATOM   7636  C  C     . ASP C 3  949  ? 17.943  -66.361  77.147  1.00 42.26  ? 949  ASP A C     1 
ATOM   7637  O  O     . ASP C 3  949  ? 16.982  -66.254  77.898  1.00 40.83  ? 949  ASP A O     1 
ATOM   7638  C  CB    . ASP C 3  949  ? 18.488  -64.676  75.471  1.00 45.38  ? 949  ASP A CB    1 
ATOM   7639  C  CG    . ASP C 3  949  ? 18.216  -63.183  75.439  1.00 53.98  ? 949  ASP A CG    1 
ATOM   7640  O  OD1   . ASP C 3  949  ? 18.305  -62.516  76.496  1.00 55.35  ? 949  ASP A OD1   1 
ATOM   7641  O  OD2   . ASP C 3  949  ? 17.912  -62.674  74.336  1.00 58.63  ? 949  ASP A OD2   1 
ATOM   7642  N  N     . GLY C 3  950  ? 18.267  -67.479  76.513  1.00 43.06  ? 950  GLY A N     1 
ATOM   7643  C  CA    . GLY C 3  950  ? 17.459  -68.671  76.633  1.00 43.95  ? 950  GLY A CA    1 
ATOM   7644  C  C     . GLY C 3  950  ? 16.676  -68.734  75.333  1.00 44.29  ? 950  GLY A C     1 
ATOM   7645  O  O     . GLY C 3  950  ? 15.820  -69.595  75.131  1.00 44.58  ? 950  GLY A O     1 
ATOM   7646  N  N     . GLU C 3  951  ? 16.986  -67.797  74.440  1.00 44.60  ? 951  GLU A N     1 
ATOM   7647  C  CA    . GLU C 3  951  ? 16.325  -67.707  73.144  1.00 43.03  ? 951  GLU A CA    1 
ATOM   7648  C  C     . GLU C 3  951  ? 16.669  -68.909  72.308  1.00 40.39  ? 951  GLU A C     1 
ATOM   7649  O  O     . GLU C 3  951  ? 17.838  -69.173  72.022  1.00 40.05  ? 951  GLU A O     1 
ATOM   7650  C  CB    . GLU C 3  951  ? 16.742  -66.434  72.405  1.00 47.06  ? 951  GLU A CB    1 
ATOM   7651  C  CG    . GLU C 3  951  ? 16.095  -66.282  71.039  1.00 52.23  ? 951  GLU A CG    1 
ATOM   7652  C  CD    . GLU C 3  951  ? 14.588  -66.493  71.071  1.00 58.24  ? 951  GLU A CD    1 
ATOM   7653  O  OE1   . GLU C 3  951  ? 13.899  -65.853  71.897  1.00 60.51  ? 951  GLU A OE1   1 
ATOM   7654  O  OE2   . GLU C 3  951  ? 14.090  -67.300  70.258  1.00 62.08  ? 951  GLU A OE2   1 
ATOM   7655  N  N     . ALA C 3  952  ? 15.634  -69.624  71.895  1.00 37.96  ? 952  ALA A N     1 
ATOM   7656  C  CA    . ALA C 3  952  ? 15.826  -70.829  71.120  1.00 36.89  ? 952  ALA A CA    1 
ATOM   7657  C  C     . ALA C 3  952  ? 15.476  -70.730  69.644  1.00 34.60  ? 952  ALA A C     1 
ATOM   7658  O  O     . ALA C 3  952  ? 15.597  -71.712  68.914  1.00 35.99  ? 952  ALA A O     1 
ATOM   7659  C  CB    . ALA C 3  952  ? 15.041  -71.961  71.762  1.00 39.91  ? 952  ALA A CB    1 
ATOM   7660  N  N     . ASN C 3  953  ? 15.064  -69.557  69.188  1.00 31.29  ? 953  ASN A N     1 
ATOM   7661  C  CA    . ASN C 3  953  ? 14.691  -69.416  67.790  1.00 28.99  ? 953  ASN A CA    1 
ATOM   7662  C  C     . ASN C 3  953  ? 15.721  -68.649  66.998  1.00 27.25  ? 953  ASN A C     1 
ATOM   7663  O  O     . ASN C 3  953  ? 15.752  -67.429  67.042  1.00 27.30  ? 953  ASN A O     1 
ATOM   7664  C  CB    . ASN C 3  953  ? 13.341  -68.722  67.692  1.00 29.90  ? 953  ASN A CB    1 
ATOM   7665  C  CG    . ASN C 3  953  ? 12.292  -69.367  68.579  1.00 28.55  ? 953  ASN A CG    1 
ATOM   7666  O  OD1   . ASN C 3  953  ? 11.946  -70.537  68.412  1.00 24.32  ? 953  ASN A OD1   1 
ATOM   7667  N  ND2   . ASN C 3  953  ? 11.781  -68.602  69.534  1.00 33.48  ? 953  ASN A ND2   1 
ATOM   7668  N  N     . TRP C 3  954  ? 16.553  -69.373  66.260  1.00 27.42  ? 954  TRP A N     1 
ATOM   7669  C  CA    . TRP C 3  954  ? 17.605  -68.754  65.461  1.00 27.03  ? 954  TRP A CA    1 
ATOM   7670  C  C     . TRP C 3  954  ? 17.677  -69.195  64.007  1.00 27.59  ? 954  TRP A C     1 
ATOM   7671  O  O     . TRP C 3  954  ? 17.675  -70.392  63.693  1.00 25.72  ? 954  TRP A O     1 
ATOM   7672  C  CB    . TRP C 3  954  ? 18.953  -69.003  66.109  1.00 26.77  ? 954  TRP A CB    1 
ATOM   7673  C  CG    . TRP C 3  954  ? 18.989  -68.465  67.446  1.00 29.09  ? 954  TRP A CG    1 
ATOM   7674  C  CD1   . TRP C 3  954  ? 18.658  -69.105  68.612  1.00 32.12  ? 954  TRP A CD1   1 
ATOM   7675  C  CD2   . TRP C 3  954  ? 19.287  -67.123  67.788  1.00 29.15  ? 954  TRP A CD2   1 
ATOM   7676  N  NE1   . TRP C 3  954  ? 18.732  -68.224  69.669  1.00 33.30  ? 954  TRP A NE1   1 
ATOM   7677  C  CE2   . TRP C 3  954  ? 19.116  -66.993  69.185  1.00 31.16  ? 954  TRP A CE2   1 
ATOM   7678  C  CE3   . TRP C 3  954  ? 19.681  -66.001  67.049  1.00 27.12  ? 954  TRP A CE3   1 
ATOM   7679  C  CZ2   . TRP C 3  954  ? 19.324  -65.797  69.854  1.00 30.03  ? 954  TRP A CZ2   1 
ATOM   7680  C  CZ3   . TRP C 3  954  ? 19.888  -64.812  67.708  1.00 27.18  ? 954  TRP A CZ3   1 
ATOM   7681  C  CH2   . TRP C 3  954  ? 19.709  -64.717  69.099  1.00 31.92  ? 954  TRP A CH2   1 
ATOM   7682  N  N     . PRO C 3  955  ? 17.757  -68.221  63.096  1.00 27.01  ? 955  PRO A N     1 
ATOM   7683  C  CA    . PRO C 3  955  ? 17.837  -68.486  61.661  1.00 29.58  ? 955  PRO A CA    1 
ATOM   7684  C  C     . PRO C 3  955  ? 18.996  -69.405  61.272  1.00 31.96  ? 955  PRO A C     1 
ATOM   7685  O  O     . PRO C 3  955  ? 20.171  -69.046  61.406  1.00 33.01  ? 955  PRO A O     1 
ATOM   7686  C  CB    . PRO C 3  955  ? 17.958  -67.084  61.053  1.00 27.95  ? 955  PRO A CB    1 
ATOM   7687  C  CG    . PRO C 3  955  ? 18.505  -66.264  62.163  1.00 29.92  ? 955  PRO A CG    1 
ATOM   7688  C  CD    . PRO C 3  955  ? 17.758  -66.777  63.356  1.00 26.05  ? 955  PRO A CD    1 
ATOM   7689  N  N     . LEU C 3  956  ? 18.640  -70.594  60.788  1.00 33.26  ? 956  LEU A N     1 
ATOM   7690  C  CA    . LEU C 3  956  ? 19.602  -71.603  60.364  1.00 32.94  ? 956  LEU A CA    1 
ATOM   7691  C  C     . LEU C 3  956  ? 19.132  -72.232  59.053  1.00 33.46  ? 956  LEU A C     1 
ATOM   7692  O  O     . LEU C 3  956  ? 17.937  -72.407  58.834  1.00 33.76  ? 956  LEU A O     1 
ATOM   7693  C  CB    . LEU C 3  956  ? 19.707  -72.681  61.434  1.00 32.62  ? 956  LEU A CB    1 
ATOM   7694  C  CG    . LEU C 3  956  ? 20.014  -72.165  62.837  1.00 31.80  ? 956  LEU A CG    1 
ATOM   7695  C  CD1   . LEU C 3  956  ? 19.749  -73.245  63.869  1.00 33.62  ? 956  LEU A CD1   1 
ATOM   7696  C  CD2   . LEU C 3  956  ? 21.459  -71.709  62.879  1.00 33.06  ? 956  LEU A CD2   1 
ATOM   7697  N  N     . PRO C 3  957  ? 20.071  -72.580  58.164  1.00 34.44  ? 957  PRO A N     1 
ATOM   7698  C  CA    . PRO C 3  957  ? 19.735  -73.193  56.878  1.00 34.43  ? 957  PRO A CA    1 
ATOM   7699  C  C     . PRO C 3  957  ? 19.013  -74.525  57.059  1.00 33.77  ? 957  PRO A C     1 
ATOM   7700  O  O     . PRO C 3  957  ? 19.194  -75.196  58.066  1.00 35.04  ? 957  PRO A O     1 
ATOM   7701  C  CB    . PRO C 3  957  ? 21.097  -73.357  56.217  1.00 34.36  ? 957  PRO A CB    1 
ATOM   7702  C  CG    . PRO C 3  957  ? 21.999  -73.583  57.380  1.00 35.79  ? 957  PRO A CG    1 
ATOM   7703  C  CD    . PRO C 3  957  ? 21.530  -72.541  58.355  1.00 36.60  ? 957  PRO A CD    1 
ATOM   7704  N  N     . VAL C 3  958  ? 18.190  -74.894  56.085  1.00 33.96  ? 958  VAL A N     1 
ATOM   7705  C  CA    . VAL C 3  958  ? 17.440  -76.145  56.136  1.00 34.19  ? 958  VAL A CA    1 
ATOM   7706  C  C     . VAL C 3  958  ? 16.395  -76.210  57.243  1.00 34.23  ? 958  VAL A C     1 
ATOM   7707  O  O     . VAL C 3  958  ? 16.717  -76.473  58.391  1.00 34.55  ? 958  VAL A O     1 
ATOM   7708  C  CB    . VAL C 3  958  ? 18.376  -77.343  56.320  1.00 33.37  ? 958  VAL A CB    1 
ATOM   7709  C  CG1   . VAL C 3  958  ? 17.561  -78.610  56.464  1.00 32.26  ? 958  VAL A CG1   1 
ATOM   7710  C  CG2   . VAL C 3  958  ? 19.325  -77.440  55.148  1.00 33.79  ? 958  VAL A CG2   1 
ATOM   7711  N  N     . ASN C 3  959  ? 15.138  -75.983  56.895  1.00 35.87  ? 959  ASN A N     1 
ATOM   7712  C  CA    . ASN C 3  959  ? 14.075  -76.048  57.886  1.00 37.11  ? 959  ASN A CA    1 
ATOM   7713  C  C     . ASN C 3  959  ? 13.781  -77.526  58.101  1.00 38.61  ? 959  ASN A C     1 
ATOM   7714  O  O     . ASN C 3  959  ? 12.916  -78.102  57.450  1.00 40.03  ? 959  ASN A O     1 
ATOM   7715  C  CB    . ASN C 3  959  ? 12.824  -75.325  57.372  1.00 36.19  ? 959  ASN A CB    1 
ATOM   7716  C  CG    . ASN C 3  959  ? 11.694  -75.308  58.387  1.00 34.94  ? 959  ASN A CG    1 
ATOM   7717  O  OD1   . ASN C 3  959  ? 11.227  -76.353  58.832  1.00 36.79  ? 959  ASN A OD1   1 
ATOM   7718  N  ND2   . ASN C 3  959  ? 11.247  -74.117  58.753  1.00 35.71  ? 959  ASN A ND2   1 
ATOM   7719  N  N     . ILE C 3  960  ? 14.518  -78.147  59.008  1.00 40.04  ? 960  ILE A N     1 
ATOM   7720  C  CA    . ILE C 3  960  ? 14.328  -79.562  59.277  1.00 40.87  ? 960  ILE A CA    1 
ATOM   7721  C  C     . ILE C 3  960  ? 12.876  -79.925  59.542  1.00 41.78  ? 960  ILE A C     1 
ATOM   7722  O  O     . ILE C 3  960  ? 12.358  -80.860  58.944  1.00 42.08  ? 960  ILE A O     1 
ATOM   7723  C  CB    . ILE C 3  960  ? 15.191  -80.010  60.462  1.00 40.18  ? 960  ILE A CB    1 
ATOM   7724  C  CG1   . ILE C 3  960  ? 16.664  -79.919  60.074  1.00 37.87  ? 960  ILE A CG1   1 
ATOM   7725  C  CG2   . ILE C 3  960  ? 14.839  -81.423  60.859  1.00 38.76  ? 960  ILE A CG2   1 
ATOM   7726  C  CD1   . ILE C 3  960  ? 17.531  -79.381  61.166  1.00 37.81  ? 960  ILE A CD1   1 
ATOM   7727  N  N     . ARG C 3  961  ? 12.213  -79.191  60.429  1.00 43.52  ? 961  ARG A N     1 
ATOM   7728  C  CA    . ARG C 3  961  ? 10.813  -79.485  60.727  1.00 46.50  ? 961  ARG A CA    1 
ATOM   7729  C  C     . ARG C 3  961  ? 10.050  -79.848  59.462  1.00 46.12  ? 961  ARG A C     1 
ATOM   7730  O  O     . ARG C 3  961  ? 9.321   -80.843  59.413  1.00 46.28  ? 961  ARG A O     1 
ATOM   7731  C  CB    . ARG C 3  961  ? 10.142  -78.284  61.384  1.00 50.19  ? 961  ARG A CB    1 
ATOM   7732  C  CG    . ARG C 3  961  ? 8.646   -78.440  61.616  1.00 54.97  ? 961  ARG A CG    1 
ATOM   7733  C  CD    . ARG C 3  961  ? 8.184   -77.351  62.563  1.00 66.40  ? 961  ARG A CD    1 
ATOM   7734  N  NE    . ARG C 3  961  ? 6.738   -77.296  62.735  1.00 76.04  ? 961  ARG A NE    1 
ATOM   7735  C  CZ    . ARG C 3  961  ? 6.129   -76.519  63.629  1.00 82.50  ? 961  ARG A CZ    1 
ATOM   7736  N  NH1   . ARG C 3  961  ? 6.849   -75.738  64.431  1.00 83.68  ? 961  ARG A NH1   1 
ATOM   7737  N  NH2   . ARG C 3  961  ? 4.802   -76.518  63.723  1.00 86.37  ? 961  ARG A NH2   1 
ATOM   7738  N  N     . ARG C 3  962  ? 10.234  -79.038  58.429  1.00 44.88  ? 962  ARG A N     1 
ATOM   7739  C  CA    . ARG C 3  962  ? 9.553   -79.284  57.176  1.00 43.10  ? 962  ARG A CA    1 
ATOM   7740  C  C     . ARG C 3  962  ? 9.912   -80.632  56.582  1.00 41.20  ? 962  ARG A C     1 
ATOM   7741  O  O     . ARG C 3  962  ? 9.027   -81.454  56.383  1.00 43.62  ? 962  ARG A O     1 
ATOM   7742  C  CB    . ARG C 3  962  ? 9.846   -78.171  56.171  1.00 44.32  ? 962  ARG A CB    1 
ATOM   7743  C  CG    . ARG C 3  962  ? 8.601   -77.377  55.784  1.00 48.54  ? 962  ARG A CG    1 
ATOM   7744  C  CD    . ARG C 3  962  ? 8.891   -76.355  54.699  1.00 48.41  ? 962  ARG A CD    1 
ATOM   7745  N  NE    . ARG C 3  962  ? 9.485   -75.135  55.231  1.00 48.60  ? 962  ARG A NE    1 
ATOM   7746  C  CZ    . ARG C 3  962  ? 10.493  -74.497  54.650  1.00 49.82  ? 962  ARG A CZ    1 
ATOM   7747  N  NH1   . ARG C 3  962  ? 11.017  -74.969  53.528  1.00 53.39  ? 962  ARG A NH1   1 
ATOM   7748  N  NH2   . ARG C 3  962  ? 10.972  -73.386  55.181  1.00 48.90  ? 962  ARG A NH2   1 
ATOM   7749  N  N     . ILE C 3  963  ? 11.194  -80.874  56.316  1.00 38.45  ? 963  ILE A N     1 
ATOM   7750  C  CA    . ILE C 3  963  ? 11.599  -82.146  55.722  1.00 36.25  ? 963  ILE A CA    1 
ATOM   7751  C  C     . ILE C 3  963  ? 10.830  -83.289  56.347  1.00 38.53  ? 963  ILE A C     1 
ATOM   7752  O  O     . ILE C 3  963  ? 10.331  -84.178  55.657  1.00 38.59  ? 963  ILE A O     1 
ATOM   7753  C  CB    . ILE C 3  963  ? 13.085  -82.463  55.918  1.00 32.76  ? 963  ILE A CB    1 
ATOM   7754  C  CG1   . ILE C 3  963  ? 13.967  -81.332  55.394  1.00 30.74  ? 963  ILE A CG1   1 
ATOM   7755  C  CG2   . ILE C 3  963  ? 13.416  -83.742  55.170  1.00 33.32  ? 963  ILE A CG2   1 
ATOM   7756  C  CD1   . ILE C 3  963  ? 15.422  -81.746  55.181  1.00 26.66  ? 963  ILE A CD1   1 
ATOM   7757  N  N     . ILE C 3  964  ? 10.741  -83.260  57.667  1.00 41.04  ? 964  ILE A N     1 
ATOM   7758  C  CA    . ILE C 3  964  ? 10.033  -84.288  58.396  1.00 44.56  ? 964  ILE A CA    1 
ATOM   7759  C  C     . ILE C 3  964  ? 8.592   -84.388  57.915  1.00 46.54  ? 964  ILE A C     1 
ATOM   7760  O  O     . ILE C 3  964  ? 8.163   -85.449  57.453  1.00 46.50  ? 964  ILE A O     1 
ATOM   7761  C  CB    . ILE C 3  964  ? 10.077  -83.987  59.890  1.00 46.49  ? 964  ILE A CB    1 
ATOM   7762  C  CG1   . ILE C 3  964  ? 11.498  -84.225  60.396  1.00 49.14  ? 964  ILE A CG1   1 
ATOM   7763  C  CG2   . ILE C 3  964  ? 9.077   -84.847  60.641  1.00 46.65  ? 964  ILE A CG2   1 
ATOM   7764  C  CD1   . ILE C 3  964  ? 11.695  -83.869  61.847  1.00 54.58  ? 964  ILE A CD1   1 
ATOM   7765  N  N     . GLN C 3  965  ? 7.852   -83.284  58.015  1.00 48.35  ? 965  GLN A N     1 
ATOM   7766  C  CA    . GLN C 3  965  ? 6.454   -83.248  57.582  1.00 51.07  ? 965  GLN A CA    1 
ATOM   7767  C  C     . GLN C 3  965  ? 6.337   -83.737  56.143  1.00 51.61  ? 965  GLN A C     1 
ATOM   7768  O  O     . GLN C 3  965  ? 5.332   -84.335  55.744  1.00 50.23  ? 965  GLN A O     1 
ATOM   7769  C  CB    . GLN C 3  965  ? 5.925   -81.825  57.651  1.00 54.74  ? 965  GLN A CB    1 
ATOM   7770  C  CG    . GLN C 3  965  ? 6.484   -81.002  58.788  1.00 61.11  ? 965  GLN A CG    1 
ATOM   7771  C  CD    . GLN C 3  965  ? 5.909   -79.605  58.800  1.00 65.39  ? 965  GLN A CD    1 
ATOM   7772  O  OE1   . GLN C 3  965  ? 4.823   -79.371  59.337  1.00 69.64  ? 965  GLN A OE1   1 
ATOM   7773  N  NE2   . GLN C 3  965  ? 6.622   -78.669  58.184  1.00 65.00  ? 965  GLN A NE2   1 
ATOM   7774  N  N     . ASN C 3  966  ? 7.382   -83.462  55.372  1.00 53.41  ? 966  ASN A N     1 
ATOM   7775  C  CA    . ASN C 3  966  ? 7.449   -83.847  53.973  1.00 55.92  ? 966  ASN A CA    1 
ATOM   7776  C  C     . ASN C 3  966  ? 7.847   -85.303  53.802  1.00 57.28  ? 966  ASN A C     1 
ATOM   7777  O  O     . ASN C 3  966  ? 8.209   -85.734  52.716  1.00 59.18  ? 966  ASN A O     1 
ATOM   7778  C  CB    . ASN C 3  966  ? 8.429   -82.936  53.230  1.00 57.22  ? 966  ASN A CB    1 
ATOM   7779  C  CG    . ASN C 3  966  ? 7.842   -81.565  52.936  1.00 58.12  ? 966  ASN A CG    1 
ATOM   7780  O  OD1   . ASN C 3  966  ? 7.048   -81.404  52.010  1.00 60.04  ? 966  ASN A OD1   1 
ATOM   7781  N  ND2   . ASN C 3  966  ? 8.221   -80.575  53.732  1.00 59.18  ? 966  ASN A ND2   1 
ATOM   7782  N  N     . ALA C 3  967  ? 7.797   -86.057  54.885  1.00 59.20  ? 967  ALA A N     1 
ATOM   7783  C  CA    . ALA C 3  967  ? 8.106   -87.476  54.834  1.00 60.26  ? 967  ALA A CA    1 
ATOM   7784  C  C     . ALA C 3  967  ? 6.882   -88.079  55.479  1.00 61.86  ? 967  ALA A C     1 
ATOM   7785  O  O     . ALA C 3  967  ? 6.437   -89.163  55.121  1.00 60.64  ? 967  ALA A O     1 
ATOM   7786  C  CB    . ALA C 3  967  ? 9.335   -87.780  55.644  1.00 60.96  ? 967  ALA A CB    1 
ATOM   7787  N  N     . GLN C 3  968  ? 6.337   -87.327  56.428  1.00 65.10  ? 968  GLN A N     1 
ATOM   7788  C  CA    . GLN C 3  968  ? 5.145   -87.717  57.156  1.00 69.97  ? 968  GLN A CA    1 
ATOM   7789  C  C     . GLN C 3  968  ? 4.024   -88.099  56.213  1.00 72.77  ? 968  GLN A C     1 
ATOM   7790  O  O     . GLN C 3  968  ? 3.189   -88.940  56.551  1.00 74.05  ? 968  GLN A O     1 
ATOM   7791  C  CB    . GLN C 3  968  ? 4.669   -86.571  58.041  1.00 73.03  ? 968  GLN A CB    1 
ATOM   7792  C  CG    . GLN C 3  968  ? 5.386   -86.453  59.367  1.00 77.17  ? 968  GLN A CG    1 
ATOM   7793  C  CD    . GLN C 3  968  ? 5.134   -87.649  60.248  1.00 81.12  ? 968  GLN A CD    1 
ATOM   7794  O  OE1   . GLN C 3  968  ? 4.062   -88.254  60.199  1.00 85.69  ? 968  GLN A OE1   1 
ATOM   7795  N  NE2   . GLN C 3  968  ? 6.112   -87.994  61.069  1.00 83.32  ? 968  GLN A NE2   1 
ATOM   7796  N  N     . GLN C 3  969  ? 3.983   -87.479  55.036  1.00 74.68  ? 969  GLN A N     1 
ATOM   7797  C  CA    . GLN C 3  969  ? 2.925   -87.812  54.097  1.00 76.58  ? 969  GLN A CA    1 
ATOM   7798  C  C     . GLN C 3  969  ? 3.402   -88.220  52.700  1.00 75.77  ? 969  GLN A C     1 
ATOM   7799  O  O     . GLN C 3  969  ? 2.589   -88.518  51.830  1.00 76.31  ? 969  GLN A O     1 
ATOM   7800  C  CB    . GLN C 3  969  ? 1.893   -86.670  54.034  1.00 78.94  ? 969  GLN A CB    1 
ATOM   7801  C  CG    . GLN C 3  969  ? 2.380   -85.381  53.422  1.00 83.79  ? 969  GLN A CG    1 
ATOM   7802  C  CD    . GLN C 3  969  ? 2.192   -85.347  51.916  1.00 86.79  ? 969  GLN A CD    1 
ATOM   7803  O  OE1   . GLN C 3  969  ? 1.076   -85.510  51.414  1.00 86.01  ? 969  GLN A OE1   1 
ATOM   7804  N  NE2   . GLN C 3  969  ? 3.283   -85.129  51.187  1.00 89.36  ? 969  GLN A NE2   1 
ATOM   7805  N  N     . THR C 3  970  ? 4.713   -88.251  52.481  1.00 75.20  ? 970  THR A N     1 
ATOM   7806  C  CA    . THR C 3  970  ? 5.239   -88.677  51.184  1.00 74.86  ? 970  THR A CA    1 
ATOM   7807  C  C     . THR C 3  970  ? 5.354   -90.195  51.191  1.00 75.84  ? 970  THR A C     1 
ATOM   7808  O  O     . THR C 3  970  ? 5.384   -90.829  50.136  1.00 75.61  ? 970  THR A O     1 
ATOM   7809  C  CB    . THR C 3  970  ? 6.634   -88.074  50.887  1.00 73.88  ? 970  THR A CB    1 
ATOM   7810  O  OG1   . THR C 3  970  ? 6.485   -86.713  50.472  1.00 77.22  ? 970  THR A OG1   1 
ATOM   7811  C  CG2   . THR C 3  970  ? 7.339   -88.844  49.782  1.00 70.22  ? 970  THR A CG2   1 
ATOM   7812  N  N     . PHE C 3  971  ? 5.420   -90.766  52.394  1.00 77.59  ? 971  PHE A N     1 
ATOM   7813  C  CA    . PHE C 3  971  ? 5.525   -92.213  52.576  1.00 78.41  ? 971  PHE A CA    1 
ATOM   7814  C  C     . PHE C 3  971  ? 4.326   -92.739  53.358  1.00 81.30  ? 971  PHE A C     1 
ATOM   7815  O  O     . PHE C 3  971  ? 4.310   -93.898  53.776  1.00 80.62  ? 971  PHE A O     1 
ATOM   7816  C  CB    . PHE C 3  971  ? 6.813   -92.575  53.323  1.00 73.00  ? 971  PHE A CB    1 
ATOM   7817  C  CG    . PHE C 3  971  ? 8.063   -92.125  52.632  1.00 66.84  ? 971  PHE A CG    1 
ATOM   7818  C  CD1   . PHE C 3  971  ? 8.440   -90.789  52.644  1.00 66.85  ? 971  PHE A CD1   1 
ATOM   7819  C  CD2   . PHE C 3  971  ? 8.856   -93.033  51.951  1.00 64.83  ? 971  PHE A CD2   1 
ATOM   7820  C  CE1   . PHE C 3  971  ? 9.594   -90.363  51.983  1.00 65.63  ? 971  PHE A CE1   1 
ATOM   7821  C  CE2   . PHE C 3  971  ? 10.008  -92.620  51.289  1.00 63.84  ? 971  PHE A CE2   1 
ATOM   7822  C  CZ    . PHE C 3  971  ? 10.377  -91.281  51.304  1.00 63.09  ? 971  PHE A CZ    1 
ATOM   7823  N  N     . HIS C 3  972  ? 3.328   -91.876  53.542  1.00 85.32  ? 972  HIS A N     1 
ATOM   7824  C  CA    . HIS C 3  972  ? 2.110   -92.222  54.269  1.00 90.75  ? 972  HIS A CA    1 
ATOM   7825  C  C     . HIS C 3  972  ? 2.506   -93.036  55.493  1.00 92.43  ? 972  HIS A C     1 
ATOM   7826  O  O     . HIS C 3  972  ? 2.418   -94.262  55.497  1.00 93.47  ? 972  HIS A O     1 
ATOM   7827  C  CB    . HIS C 3  972  ? 1.162   -93.036  53.376  1.00 94.99  ? 972  HIS A CB    1 
ATOM   7828  C  CG    . HIS C 3  972  ? 0.826   -92.374  52.071  1.00 100.25 ? 972  HIS A CG    1 
ATOM   7829  N  ND1   . HIS C 3  972  ? 0.049   -91.237  51.985  1.00 101.58 ? 972  HIS A ND1   1 
ATOM   7830  C  CD2   . HIS C 3  972  ? 1.161   -92.696  50.797  1.00 101.85 ? 972  HIS A CD2   1 
ATOM   7831  C  CE1   . HIS C 3  972  ? -0.079  -90.887  50.716  1.00 102.48 ? 972  HIS A CE1   1 
ATOM   7832  N  NE2   . HIS C 3  972  ? 0.586   -91.756  49.975  1.00 102.45 ? 972  HIS A NE2   1 
ATOM   7833  N  N     . ILE C 3  973  ? 2.953   -92.342  56.531  1.00 94.00  ? 973  ILE A N     1 
ATOM   7834  C  CA    . ILE C 3  973  ? 3.390   -92.993  57.755  1.00 95.14  ? 973  ILE A CA    1 
ATOM   7835  C  C     . ILE C 3  973  ? 2.292   -93.101  58.807  1.00 96.37  ? 973  ILE A C     1 
ATOM   7836  O  O     . ILE C 3  973  ? 1.823   -92.091  59.334  1.00 96.58  ? 973  ILE A O     1 
ATOM   7837  C  CB    . ILE C 3  973  ? 4.593   -92.244  58.345  1.00 93.73  ? 973  ILE A CB    1 
ATOM   7838  C  CG1   . ILE C 3  973  ? 5.789   -92.392  57.404  1.00 92.41  ? 973  ILE A CG1   1 
ATOM   7839  C  CG2   . ILE C 3  973  ? 4.913   -92.773  59.725  1.00 96.71  ? 973  ILE A CG2   1 
ATOM   7840  C  CD1   . ILE C 3  973  ? 7.047   -91.725  57.892  1.00 90.51  ? 973  ILE A CD1   1 
ATOM   7841  N  N     . ASP C 3  974  ? 1.897   -94.334  59.118  1.00 97.42  ? 974  ASP A N     1 
ATOM   7842  C  CA    . ASP C 3  974  ? 0.852   -94.576  60.106  1.00 98.42  ? 974  ASP A CA    1 
ATOM   7843  C  C     . ASP C 3  974  ? 1.360   -94.658  61.543  1.00 99.44  ? 974  ASP A C     1 
ATOM   7844  O  O     . ASP C 3  974  ? 2.231   -95.463  61.868  1.00 99.21  ? 974  ASP A O     1 
ATOM   7845  C  CB    . ASP C 3  974  ? 0.062   -95.845  59.746  1.00 96.96  ? 974  ASP A CB    1 
ATOM   7846  C  CG    . ASP C 3  974  ? 0.952   -97.036  59.437  1.00 95.71  ? 974  ASP A CG    1 
ATOM   7847  O  OD1   . ASP C 3  974  ? 1.857   -96.901  58.585  1.00 94.09  ? 974  ASP A OD1   1 
ATOM   7848  O  OD2   . ASP C 3  974  ? 0.733   -98.112  60.035  1.00 93.83  ? 974  ASP A OD2   1 
ATOM   7849  N  N     . HIS C 3  975  ? 0.802   -93.805  62.397  1.00 101.37 ? 975  HIS A N     1 
ATOM   7850  C  CA    . HIS C 3  975  ? 1.175   -93.750  63.808  1.00 103.57 ? 975  HIS A CA    1 
ATOM   7851  C  C     . HIS C 3  975  ? 0.541   -94.891  64.609  1.00 102.57 ? 975  HIS A C     1 
ATOM   7852  O  O     . HIS C 3  975  ? 0.292   -94.747  65.811  1.00 103.03 ? 975  HIS A O     1 
ATOM   7853  C  CB    . HIS C 3  975  ? 0.744   -92.405  64.414  1.00 107.91 ? 975  HIS A CB    1 
ATOM   7854  C  CG    . HIS C 3  975  ? 1.503   -91.224  63.886  1.00 112.98 ? 975  HIS A CG    1 
ATOM   7855  N  ND1   . HIS C 3  975  ? 2.785   -90.919  64.294  1.00 116.16 ? 975  HIS A ND1   1 
ATOM   7856  C  CD2   . HIS C 3  975  ? 1.161   -90.275  62.982  1.00 114.37 ? 975  HIS A CD2   1 
ATOM   7857  C  CE1   . HIS C 3  975  ? 3.198   -89.833  63.664  1.00 116.88 ? 975  HIS A CE1   1 
ATOM   7858  N  NE2   . HIS C 3  975  ? 2.232   -89.422  62.862  1.00 115.31 ? 975  HIS A NE2   1 
ATOM   7859  N  N     . THR C 3  976  ? 0.283   -96.019  63.948  1.00 100.45 ? 976  THR A N     1 
ATOM   7860  C  CA    . THR C 3  976  ? -0.320  -97.172  64.618  1.00 97.55  ? 976  THR A CA    1 
ATOM   7861  C  C     . THR C 3  976  ? 0.576   -98.422  64.641  1.00 93.92  ? 976  THR A C     1 
ATOM   7862  O  O     . THR C 3  976  ? 0.566   -99.178  65.616  1.00 93.27  ? 976  THR A O     1 
ATOM   7863  C  CB    . THR C 3  976  ? -1.686  -97.528  63.983  1.00 99.54  ? 976  THR A CB    1 
ATOM   7864  O  OG1   . THR C 3  976  ? -1.522  -97.758  62.577  1.00 101.31 ? 976  THR A OG1   1 
ATOM   7865  C  CG2   . THR C 3  976  ? -2.682  -96.390  64.201  1.00 98.95  ? 976  THR A CG2   1 
ATOM   7866  N  N     . LYS C 3  977  ? 1.345   -98.640  63.576  1.00 89.57  ? 977  LYS A N     1 
ATOM   7867  C  CA    . LYS C 3  977  ? 2.248   -99.786  63.513  1.00 84.93  ? 977  LYS A CA    1 
ATOM   7868  C  C     . LYS C 3  977  ? 3.656   -99.351  63.906  1.00 80.94  ? 977  LYS A C     1 
ATOM   7869  O  O     . LYS C 3  977  ? 3.976   -98.165  63.880  1.00 81.64  ? 977  LYS A O     1 
ATOM   7870  C  CB    . LYS C 3  977  ? 2.253   -100.398 62.106  1.00 86.24  ? 977  LYS A CB    1 
ATOM   7871  C  CG    . LYS C 3  977  ? 0.960   -101.138 61.764  1.00 90.35  ? 977  LYS A CG    1 
ATOM   7872  C  CD    . LYS C 3  977  ? 1.033   -101.893 60.432  1.00 91.57  ? 977  LYS A CD    1 
ATOM   7873  C  CE    . LYS C 3  977  ? -0.250  -102.698 60.194  1.00 92.34  ? 977  LYS A CE    1 
ATOM   7874  N  NZ    . LYS C 3  977  ? -0.230  -103.491 58.933  1.00 90.57  ? 977  LYS A NZ    1 
ATOM   7875  N  N     . PRO C 3  978  ? 4.513   -100.305 64.289  1.00 76.91  ? 978  PRO A N     1 
ATOM   7876  C  CA    . PRO C 3  978  ? 5.884   -99.991  64.690  1.00 72.18  ? 978  PRO A CA    1 
ATOM   7877  C  C     . PRO C 3  978  ? 6.825   -99.783  63.516  1.00 66.92  ? 978  PRO A C     1 
ATOM   7878  O  O     . PRO C 3  978  ? 6.659   -100.377 62.455  1.00 65.57  ? 978  PRO A O     1 
ATOM   7879  C  CB    . PRO C 3  978  ? 6.275   -101.202 65.518  1.00 75.58  ? 978  PRO A CB    1 
ATOM   7880  C  CG    . PRO C 3  978  ? 5.634   -102.309 64.741  1.00 78.17  ? 978  PRO A CG    1 
ATOM   7881  C  CD    . PRO C 3  978  ? 4.243   -101.742 64.463  1.00 78.44  ? 978  PRO A CD    1 
ATOM   7882  N  N     . SER C 3  979  ? 7.823   -98.940  63.734  1.00 61.65  ? 979  SER A N     1 
ATOM   7883  C  CA    . SER C 3  979  ? 8.811   -98.631  62.722  1.00 58.14  ? 979  SER A CA    1 
ATOM   7884  C  C     . SER C 3  979  ? 9.745   -99.800  62.478  1.00 55.60  ? 979  SER A C     1 
ATOM   7885  O  O     . SER C 3  979  ? 9.739   -100.756 63.226  1.00 55.97  ? 979  SER A O     1 
ATOM   7886  C  CB    . SER C 3  979  ? 9.626   -97.429  63.167  1.00 57.82  ? 979  SER A CB    1 
ATOM   7887  O  OG    . SER C 3  979  ? 10.962  -97.563  62.725  1.00 62.42  ? 979  SER A OG    1 
ATOM   7888  N  N     . ASP C 3  980  ? 10.547  -99.715  61.425  1.00 54.62  ? 980  ASP A N     1 
ATOM   7889  C  CA    . ASP C 3  980  ? 11.500  -100.764 61.106  1.00 55.07  ? 980  ASP A CA    1 
ATOM   7890  C  C     . ASP C 3  980  ? 12.911  -100.228 61.333  1.00 54.33  ? 980  ASP A C     1 
ATOM   7891  O  O     . ASP C 3  980  ? 13.895  -100.747 60.803  1.00 54.49  ? 980  ASP A O     1 
ATOM   7892  C  CB    . ASP C 3  980  ? 11.304  -101.245 59.653  1.00 60.53  ? 980  ASP A CB    1 
ATOM   7893  C  CG    . ASP C 3  980  ? 11.558  -100.154 58.606  1.00 64.21  ? 980  ASP A CG    1 
ATOM   7894  O  OD1   . ASP C 3  980  ? 11.140  -98.996  58.818  1.00 67.20  ? 980  ASP A OD1   1 
ATOM   7895  O  OD2   . ASP C 3  980  ? 12.160  -100.469 57.550  1.00 64.36  ? 980  ASP A OD2   1 
ATOM   7896  N  N     . LEU C 3  981  ? 12.988  -99.189  62.156  1.00 53.48  ? 981  LEU A N     1 
ATOM   7897  C  CA    . LEU C 3  981  ? 14.245  -98.532  62.486  1.00 52.49  ? 981  LEU A CA    1 
ATOM   7898  C  C     . LEU C 3  981  ? 15.050  -99.209  63.579  1.00 52.60  ? 981  LEU A C     1 
ATOM   7899  O  O     . LEU C 3  981  ? 14.518  -99.584  64.618  1.00 51.46  ? 981  LEU A O     1 
ATOM   7900  C  CB    . LEU C 3  981  ? 13.972  -97.094  62.905  1.00 52.52  ? 981  LEU A CB    1 
ATOM   7901  C  CG    . LEU C 3  981  ? 13.739  -96.135  61.744  1.00 53.87  ? 981  LEU A CG    1 
ATOM   7902  C  CD1   . LEU C 3  981  ? 13.126  -94.835  62.227  1.00 54.35  ? 981  LEU A CD1   1 
ATOM   7903  C  CD2   . LEU C 3  981  ? 15.072  -95.884  61.065  1.00 58.18  ? 981  LEU A CD2   1 
ATOM   7904  N  N     . THR C 3  982  ? 16.347  -99.349  63.335  1.00 52.41  ? 982  THR A N     1 
ATOM   7905  C  CA    . THR C 3  982  ? 17.254  -99.954  64.303  1.00 52.56  ? 982  THR A CA    1 
ATOM   7906  C  C     . THR C 3  982  ? 17.859  -98.809  65.098  1.00 50.20  ? 982  THR A C     1 
ATOM   7907  O  O     . THR C 3  982  ? 18.229  -97.786  64.518  1.00 49.72  ? 982  THR A O     1 
ATOM   7908  C  CB    . THR C 3  982  ? 18.403  -100.709 63.599  1.00 55.62  ? 982  THR A CB    1 
ATOM   7909  O  OG1   . THR C 3  982  ? 17.855  -101.737 62.765  1.00 59.85  ? 982  THR A OG1   1 
ATOM   7910  C  CG2   . THR C 3  982  ? 19.359  -101.333 64.626  1.00 59.35  ? 982  THR A CG2   1 
ATOM   7911  N  N     . ILE C 3  983  ? 17.962  -98.956  66.415  1.00 47.38  ? 983  ILE A N     1 
ATOM   7912  C  CA    . ILE C 3  983  ? 18.548  -97.877  67.189  1.00 44.56  ? 983  ILE A CA    1 
ATOM   7913  C  C     . ILE C 3  983  ? 19.881  -97.499  66.568  1.00 46.08  ? 983  ILE A C     1 
ATOM   7914  O  O     . ILE C 3  983  ? 20.279  -96.340  66.613  1.00 46.60  ? 983  ILE A O     1 
ATOM   7915  C  CB    . ILE C 3  983  ? 18.760  -98.259  68.658  1.00 39.67  ? 983  ILE A CB    1 
ATOM   7916  C  CG1   . ILE C 3  983  ? 17.430  -98.187  69.398  1.00 35.52  ? 983  ILE A CG1   1 
ATOM   7917  C  CG2   . ILE C 3  983  ? 19.765  -97.320  69.299  1.00 35.37  ? 983  ILE A CG2   1 
ATOM   7918  C  CD1   . ILE C 3  983  ? 17.561  -98.328  70.885  1.00 35.07  ? 983  ILE A CD1   1 
ATOM   7919  N  N     . LYS C 3  984  ? 20.565  -98.480  65.982  1.00 48.45  ? 984  LYS A N     1 
ATOM   7920  C  CA    . LYS C 3  984  ? 21.847  -98.229  65.328  1.00 50.45  ? 984  LYS A CA    1 
ATOM   7921  C  C     . LYS C 3  984  ? 21.605  -97.330  64.128  1.00 50.43  ? 984  LYS A C     1 
ATOM   7922  O  O     . LYS C 3  984  ? 22.320  -96.354  63.921  1.00 49.86  ? 984  LYS A O     1 
ATOM   7923  C  CB    . LYS C 3  984  ? 22.489  -99.528  64.836  1.00 53.78  ? 984  LYS A CB    1 
ATOM   7924  C  CG    . LYS C 3  984  ? 23.104  -100.420 65.900  1.00 58.53  ? 984  LYS A CG    1 
ATOM   7925  C  CD    . LYS C 3  984  ? 24.086  -101.381 65.230  1.00 65.38  ? 984  LYS A CD    1 
ATOM   7926  C  CE    . LYS C 3  984  ? 24.741  -102.351 66.208  1.00 69.62  ? 984  LYS A CE    1 
ATOM   7927  N  NZ    . LYS C 3  984  ? 25.692  -103.280 65.514  1.00 69.80  ? 984  LYS A NZ    1 
ATOM   7928  N  N     . ASP C 3  985  ? 20.594  -97.678  63.338  1.00 51.76  ? 985  ASP A N     1 
ATOM   7929  C  CA    . ASP C 3  985  ? 20.235  -96.909  62.150  1.00 52.91  ? 985  ASP A CA    1 
ATOM   7930  C  C     . ASP C 3  985  ? 20.188  -95.418  62.477  1.00 50.95  ? 985  ASP A C     1 
ATOM   7931  O  O     . ASP C 3  985  ? 21.019  -94.634  62.013  1.00 51.21  ? 985  ASP A O     1 
ATOM   7932  C  CB    . ASP C 3  985  ? 18.858  -97.339  61.615  1.00 58.13  ? 985  ASP A CB    1 
ATOM   7933  C  CG    . ASP C 3  985  ? 18.850  -98.756  61.056  1.00 64.14  ? 985  ASP A CG    1 
ATOM   7934  O  OD1   . ASP C 3  985  ? 19.946  -99.303  60.770  1.00 67.70  ? 985  ASP A OD1   1 
ATOM   7935  O  OD2   . ASP C 3  985  ? 17.735  -99.312  60.888  1.00 65.46  ? 985  ASP A OD2   1 
ATOM   7936  N  N     . ILE C 3  986  ? 19.199  -95.037  63.276  1.00 47.36  ? 986  ILE A N     1 
ATOM   7937  C  CA    . ILE C 3  986  ? 19.029  -93.655  63.672  1.00 44.26  ? 986  ILE A CA    1 
ATOM   7938  C  C     . ILE C 3  986  ? 20.342  -93.050  64.157  1.00 43.35  ? 986  ILE A C     1 
ATOM   7939  O  O     . ILE C 3  986  ? 21.017  -92.331  63.421  1.00 42.61  ? 986  ILE A O     1 
ATOM   7940  C  CB    . ILE C 3  986  ? 17.998  -93.543  64.796  1.00 43.77  ? 986  ILE A CB    1 
ATOM   7941  C  CG1   . ILE C 3  986  ? 16.693  -94.209  64.372  1.00 42.26  ? 986  ILE A CG1   1 
ATOM   7942  C  CG2   . ILE C 3  986  ? 17.761  -92.087  65.136  1.00 45.51  ? 986  ILE A CG2   1 
ATOM   7943  C  CD1   . ILE C 3  986  ? 15.584  -94.074  65.395  1.00 41.33  ? 986  ILE A CD1   1 
ATOM   7944  N  N     . VAL C 3  987  ? 20.693  -93.356  65.403  1.00 42.60  ? 987  VAL A N     1 
ATOM   7945  C  CA    . VAL C 3  987  ? 21.907  -92.853  66.040  1.00 42.96  ? 987  VAL A CA    1 
ATOM   7946  C  C     . VAL C 3  987  ? 23.133  -92.764  65.134  1.00 45.71  ? 987  VAL A C     1 
ATOM   7947  O  O     . VAL C 3  987  ? 23.756  -91.707  65.035  1.00 47.32  ? 987  VAL A O     1 
ATOM   7948  C  CB    . VAL C 3  987  ? 22.270  -93.708  67.261  1.00 39.47  ? 987  VAL A CB    1 
ATOM   7949  C  CG1   . VAL C 3  987  ? 23.505  -93.155  67.941  1.00 36.64  ? 987  VAL A CG1   1 
ATOM   7950  C  CG2   . VAL C 3  987  ? 21.104  -93.744  68.214  1.00 36.07  ? 987  VAL A CG2   1 
ATOM   7951  N  N     . LEU C 3  988  ? 23.490  -93.868  64.486  1.00 47.00  ? 988  LEU A N     1 
ATOM   7952  C  CA    . LEU C 3  988  ? 24.647  -93.871  63.599  1.00 49.02  ? 988  LEU A CA    1 
ATOM   7953  C  C     . LEU C 3  988  ? 24.377  -93.086  62.333  1.00 48.96  ? 988  LEU A C     1 
ATOM   7954  O  O     . LEU C 3  988  ? 25.296  -92.508  61.747  1.00 50.09  ? 988  LEU A O     1 
ATOM   7955  C  CB    . LEU C 3  988  ? 25.041  -95.300  63.240  1.00 53.16  ? 988  LEU A CB    1 
ATOM   7956  C  CG    . LEU C 3  988  ? 25.792  -96.029  64.353  1.00 57.13  ? 988  LEU A CG    1 
ATOM   7957  C  CD1   . LEU C 3  988  ? 25.980  -97.503  63.999  1.00 58.19  ? 988  LEU A CD1   1 
ATOM   7958  C  CD2   . LEU C 3  988  ? 27.131  -95.335  64.565  1.00 58.75  ? 988  LEU A CD2   1 
ATOM   7959  N  N     . GLY C 3  989  ? 23.113  -93.071  61.915  1.00 48.33  ? 989  GLY A N     1 
ATOM   7960  C  CA    . GLY C 3  989  ? 22.732  -92.339  60.723  1.00 46.91  ? 989  GLY A CA    1 
ATOM   7961  C  C     . GLY C 3  989  ? 22.863  -90.851  60.971  1.00 46.38  ? 989  GLY A C     1 
ATOM   7962  O  O     . GLY C 3  989  ? 23.545  -90.144  60.225  1.00 45.41  ? 989  GLY A O     1 
ATOM   7963  N  N     . VAL C 3  990  ? 22.213  -90.371  62.025  1.00 45.66  ? 990  VAL A N     1 
ATOM   7964  C  CA    . VAL C 3  990  ? 22.281  -88.959  62.352  1.00 47.89  ? 990  VAL A CA    1 
ATOM   7965  C  C     . VAL C 3  990  ? 23.740  -88.564  62.382  1.00 50.48  ? 990  VAL A C     1 
ATOM   7966  O  O     . VAL C 3  990  ? 24.139  -87.574  61.777  1.00 50.79  ? 990  VAL A O     1 
ATOM   7967  C  CB    . VAL C 3  990  ? 21.675  -88.655  63.731  1.00 47.28  ? 990  VAL A CB    1 
ATOM   7968  C  CG1   . VAL C 3  990  ? 21.786  -87.172  64.028  1.00 46.41  ? 990  VAL A CG1   1 
ATOM   7969  C  CG2   . VAL C 3  990  ? 20.229  -89.078  63.768  1.00 47.86  ? 990  VAL A CG2   1 
ATOM   7970  N  N     . LYS C 3  991  ? 24.539  -89.359  63.081  1.00 53.90  ? 991  LYS A N     1 
ATOM   7971  C  CA    . LYS C 3  991  ? 25.956  -89.074  63.200  1.00 58.86  ? 991  LYS A CA    1 
ATOM   7972  C  C     . LYS C 3  991  ? 26.556  -88.947  61.818  1.00 61.48  ? 991  LYS A C     1 
ATOM   7973  O  O     . LYS C 3  991  ? 27.075  -87.891  61.452  1.00 62.89  ? 991  LYS A O     1 
ATOM   7974  C  CB    . LYS C 3  991  ? 26.666  -90.180  63.986  1.00 61.48  ? 991  LYS A CB    1 
ATOM   7975  C  CG    . LYS C 3  991  ? 27.845  -89.689  64.850  1.00 64.21  ? 991  LYS A CG    1 
ATOM   7976  C  CD    . LYS C 3  991  ? 28.167  -90.691  65.965  1.00 65.82  ? 991  LYS A CD    1 
ATOM   7977  C  CE    . LYS C 3  991  ? 29.108  -90.117  67.014  1.00 65.16  ? 991  LYS A CE    1 
ATOM   7978  N  NZ    . LYS C 3  991  ? 29.232  -91.060  68.165  1.00 64.63  ? 991  LYS A NZ    1 
ATOM   7979  N  N     . ASP C 3  992  ? 26.474  -90.013  61.037  1.00 63.48  ? 992  ASP A N     1 
ATOM   7980  C  CA    . ASP C 3  992  ? 27.032  -89.960  59.702  1.00 67.68  ? 992  ASP A CA    1 
ATOM   7981  C  C     . ASP C 3  992  ? 26.595  -88.726  58.928  1.00 67.46  ? 992  ASP A C     1 
ATOM   7982  O  O     . ASP C 3  992  ? 27.420  -88.084  58.277  1.00 69.74  ? 992  ASP A O     1 
ATOM   7983  C  CB    . ASP C 3  992  ? 26.675  -91.218  58.915  1.00 74.06  ? 992  ASP A CB    1 
ATOM   7984  C  CG    . ASP C 3  992  ? 27.744  -92.281  59.021  1.00 81.12  ? 992  ASP A CG    1 
ATOM   7985  O  OD1   . ASP C 3  992  ? 28.891  -92.006  58.602  1.00 84.02  ? 992  ASP A OD1   1 
ATOM   7986  O  OD2   . ASP C 3  992  ? 27.442  -93.386  59.525  1.00 88.33  ? 992  ASP A OD2   1 
ATOM   7987  N  N     . LEU C 3  993  ? 25.314  -88.379  58.996  1.00 65.41  ? 993  LEU A N     1 
ATOM   7988  C  CA    . LEU C 3  993  ? 24.847  -87.211  58.261  1.00 63.69  ? 993  LEU A CA    1 
ATOM   7989  C  C     . LEU C 3  993  ? 25.772  -86.037  58.503  1.00 64.66  ? 993  LEU A C     1 
ATOM   7990  O  O     . LEU C 3  993  ? 26.161  -85.340  57.566  1.00 63.80  ? 993  LEU A O     1 
ATOM   7991  C  CB    . LEU C 3  993  ? 23.428  -86.832  58.675  1.00 60.80  ? 993  LEU A CB    1 
ATOM   7992  C  CG    . LEU C 3  993  ? 22.924  -85.481  58.162  1.00 56.74  ? 993  LEU A CG    1 
ATOM   7993  C  CD1   . LEU C 3  993  ? 23.123  -85.353  56.674  1.00 55.14  ? 993  LEU A CD1   1 
ATOM   7994  C  CD2   . LEU C 3  993  ? 21.467  -85.351  58.505  1.00 58.94  ? 993  LEU A CD2   1 
ATOM   7995  N  N     . GLN C 3  994  ? 26.138  -85.845  59.767  1.00 66.28  ? 994  GLN A N     1 
ATOM   7996  C  CA    . GLN C 3  994  ? 27.006  -84.749  60.175  1.00 69.05  ? 994  GLN A CA    1 
ATOM   7997  C  C     . GLN C 3  994  ? 28.382  -84.742  59.520  1.00 71.92  ? 994  GLN A C     1 
ATOM   7998  O  O     . GLN C 3  994  ? 29.134  -83.774  59.634  1.00 72.95  ? 994  GLN A O     1 
ATOM   7999  C  CB    . GLN C 3  994  ? 27.139  -84.746  61.697  1.00 66.52  ? 994  GLN A CB    1 
ATOM   8000  C  CG    . GLN C 3  994  ? 25.912  -84.180  62.394  1.00 65.43  ? 994  GLN A CG    1 
ATOM   8001  C  CD    . GLN C 3  994  ? 25.952  -84.348  63.899  1.00 66.17  ? 994  GLN A CD    1 
ATOM   8002  O  OE1   . GLN C 3  994  ? 25.896  -85.464  64.410  1.00 66.61  ? 994  GLN A OE1   1 
ATOM   8003  N  NE2   . GLN C 3  994  ? 26.048  -83.238  64.618  1.00 65.26  ? 994  GLN A NE2   1 
ATOM   8004  N  N     . GLU C 3  995  ? 28.711  -85.814  58.820  1.00 75.20  ? 995  GLU A N     1 
ATOM   8005  C  CA    . GLU C 3  995  ? 29.995  -85.884  58.156  1.00 78.74  ? 995  GLU A CA    1 
ATOM   8006  C  C     . GLU C 3  995  ? 29.929  -85.374  56.735  1.00 80.27  ? 995  GLU A C     1 
ATOM   8007  O  O     . GLU C 3  995  ? 30.930  -84.926  56.185  1.00 80.65  ? 995  GLU A O     1 
ATOM   8008  C  CB    . GLU C 3  995  ? 30.503  -87.319  58.157  1.00 81.43  ? 995  GLU A CB    1 
ATOM   8009  C  CG    . GLU C 3  995  ? 31.190  -87.671  59.438  1.00 87.50  ? 995  GLU A CG    1 
ATOM   8010  C  CD    . GLU C 3  995  ? 32.295  -86.682  59.752  1.00 91.70  ? 995  GLU A CD    1 
ATOM   8011  O  OE1   . GLU C 3  995  ? 33.276  -86.621  58.974  1.00 92.14  ? 995  GLU A OE1   1 
ATOM   8012  O  OE2   . GLU C 3  995  ? 32.177  -85.959  60.766  1.00 94.29  ? 995  GLU A OE2   1 
ATOM   8013  N  N     . ASN C 3  996  ? 28.741  -85.422  56.148  1.00 82.72  ? 996  ASN A N     1 
ATOM   8014  C  CA    . ASN C 3  996  ? 28.575  -84.998  54.767  1.00 86.20  ? 996  ASN A CA    1 
ATOM   8015  C  C     . ASN C 3  996  ? 27.936  -83.631  54.529  1.00 87.29  ? 996  ASN A C     1 
ATOM   8016  O  O     . ASN C 3  996  ? 27.415  -83.370  53.438  1.00 87.21  ? 996  ASN A O     1 
ATOM   8017  C  CB    . ASN C 3  996  ? 27.797  -86.071  54.012  1.00 88.39  ? 996  ASN A CB    1 
ATOM   8018  C  CG    . ASN C 3  996  ? 28.445  -87.435  54.128  1.00 91.56  ? 996  ASN A CG    1 
ATOM   8019  O  OD1   . ASN C 3  996  ? 29.585  -87.634  53.704  1.00 94.53  ? 996  ASN A OD1   1 
ATOM   8020  N  ND2   . ASN C 3  996  ? 27.723  -88.383  54.712  1.00 93.57  ? 996  ASN A ND2   1 
ATOM   8021  N  N     . LEU C 3  997  ? 27.977  -82.756  55.532  1.00 87.45  ? 997  LEU A N     1 
ATOM   8022  C  CA    . LEU C 3  997  ? 27.408  -81.425  55.367  1.00 87.44  ? 997  LEU A CA    1 
ATOM   8023  C  C     . LEU C 3  997  ? 28.414  -80.562  54.607  1.00 88.97  ? 997  LEU A C     1 
ATOM   8024  O  O     . LEU C 3  997  ? 28.122  -80.063  53.523  1.00 91.35  ? 997  LEU A O     1 
ATOM   8025  C  CB    . LEU C 3  997  ? 27.062  -80.817  56.727  1.00 83.84  ? 997  LEU A CB    1 
ATOM   8026  C  CG    . LEU C 3  997  ? 25.953  -81.589  57.452  1.00 81.13  ? 997  LEU A CG    1 
ATOM   8027  C  CD1   . LEU C 3  997  ? 25.638  -80.920  58.760  1.00 81.30  ? 997  LEU A CD1   1 
ATOM   8028  C  CD2   . LEU C 3  997  ? 24.707  -81.652  56.596  1.00 79.11  ? 997  LEU A CD2   1 
ATOM   8029  N  N     . LEU C 3  998  ? 29.602  -80.396  55.170  1.00 89.01  ? 998  LEU A N     1 
ATOM   8030  C  CA    . LEU C 3  998  ? 30.659  -79.631  54.513  1.00 88.17  ? 998  LEU A CA    1 
ATOM   8031  C  C     . LEU C 3  998  ? 30.329  -78.220  54.001  1.00 86.75  ? 998  LEU A C     1 
ATOM   8032  O  O     . LEU C 3  998  ? 29.227  -77.925  53.538  1.00 84.61  ? 998  LEU A O     1 
ATOM   8033  C  CB    . LEU C 3  998  ? 31.234  -80.453  53.351  1.00 88.35  ? 998  LEU A CB    1 
ATOM   8034  C  CG    . LEU C 3  998  ? 31.698  -81.883  53.653  1.00 91.15  ? 998  LEU A CG    1 
ATOM   8035  C  CD1   . LEU C 3  998  ? 32.345  -82.467  52.403  1.00 92.11  ? 998  LEU A CD1   1 
ATOM   8036  C  CD2   . LEU C 3  998  ? 32.687  -81.898  54.824  1.00 93.54  ? 998  LEU A CD2   1 
ATOM   8037  N  N     . VAL C 3  999  ? 31.336  -77.361  54.092  1.00 85.88  ? 999  VAL A N     1 
ATOM   8038  C  CA    . VAL C 3  999  ? 31.271  -75.979  53.650  1.00 85.08  ? 999  VAL A CA    1 
ATOM   8039  C  C     . VAL C 3  999  ? 32.668  -75.663  53.129  1.00 87.18  ? 999  VAL A C     1 
ATOM   8040  O  O     . VAL C 3  999  ? 32.880  -74.660  52.455  1.00 89.27  ? 999  VAL A O     1 
ATOM   8041  C  CB    . VAL C 3  999  ? 30.911  -75.034  54.813  1.00 82.76  ? 999  VAL A CB    1 
ATOM   8042  C  CG1   . VAL C 3  999  ? 31.280  -73.601  54.474  1.00 80.81  ? 999  VAL A CG1   1 
ATOM   8043  C  CG2   . VAL C 3  999  ? 29.428  -75.127  55.097  1.00 80.96  ? 999  VAL A CG2   1 
ATOM   8044  N  N     . LEU C 3  1000 ? 33.613  -76.544  53.448  1.00 87.46  ? 1000 LEU A N     1 
ATOM   8045  C  CA    . LEU C 3  1000 ? 35.003  -76.413  53.017  1.00 87.90  ? 1000 LEU A CA    1 
ATOM   8046  C  C     . LEU C 3  1000 ? 35.515  -77.813  52.712  1.00 89.65  ? 1000 LEU A C     1 
ATOM   8047  O  O     . LEU C 3  1000 ? 35.010  -78.784  53.273  1.00 90.26  ? 1000 LEU A O     1 
ATOM   8048  C  CB    . LEU C 3  1000 ? 35.837  -75.778  54.124  1.00 85.62  ? 1000 LEU A CB    1 
ATOM   8049  C  CG    . LEU C 3  1000 ? 35.521  -74.317  54.427  1.00 82.61  ? 1000 LEU A CG    1 
ATOM   8050  C  CD1   . LEU C 3  1000 ? 36.213  -73.915  55.707  1.00 81.64  ? 1000 LEU A CD1   1 
ATOM   8051  C  CD2   . LEU C 3  1000 ? 35.968  -73.444  53.264  1.00 81.75  ? 1000 LEU A CD2   1 
ATOM   8052  N  N     . ARG C 3  1001 ? 36.514  -77.933  51.840  1.00 91.80  ? 1001 ARG A N     1 
ATOM   8053  C  CA    . ARG C 3  1001 ? 37.018  -79.259  51.491  1.00 94.20  ? 1001 ARG A CA    1 
ATOM   8054  C  C     . ARG C 3  1001 ? 38.522  -79.488  51.509  1.00 96.02  ? 1001 ARG A C     1 
ATOM   8055  O  O     . ARG C 3  1001 ? 39.016  -80.420  50.869  1.00 96.96  ? 1001 ARG A O     1 
ATOM   8056  C  CB    . ARG C 3  1001 ? 36.453  -79.675  50.134  1.00 93.35  ? 1001 ARG A CB    1 
ATOM   8057  C  CG    . ARG C 3  1001 ? 34.969  -79.958  50.194  1.00 91.96  ? 1001 ARG A CG    1 
ATOM   8058  C  CD    . ARG C 3  1001 ? 34.247  -79.452  48.965  1.00 90.56  ? 1001 ARG A CD    1 
ATOM   8059  N  NE    . ARG C 3  1001 ? 32.800  -79.544  49.133  1.00 86.35  ? 1001 ARG A NE    1 
ATOM   8060  C  CZ    . ARG C 3  1001 ? 32.148  -80.680  49.346  1.00 84.45  ? 1001 ARG A CZ    1 
ATOM   8061  N  NH1   . ARG C 3  1001 ? 32.808  -81.826  49.414  1.00 84.20  ? 1001 ARG A NH1   1 
ATOM   8062  N  NH2   . ARG C 3  1001 ? 30.834  -80.673  49.493  1.00 84.76  ? 1001 ARG A NH2   1 
ATOM   8063  N  N     . GLY C 3  1002 ? 39.253  -78.649  52.232  1.00 97.70  ? 1002 GLY A N     1 
ATOM   8064  C  CA    . GLY C 3  1002 ? 40.688  -78.846  52.328  1.00 99.42  ? 1002 GLY A CA    1 
ATOM   8065  C  C     . GLY C 3  1002 ? 40.893  -80.107  53.154  1.00 100.41 ? 1002 GLY A C     1 
ATOM   8066  O  O     . GLY C 3  1002 ? 40.050  -80.446  53.994  1.00 101.06 ? 1002 GLY A O     1 
ATOM   8067  N  N     . LYS C 3  1003 ? 41.997  -80.812  52.934  1.00 99.57  ? 1003 LYS A N     1 
ATOM   8068  C  CA    . LYS C 3  1003 ? 42.235  -82.038  53.679  1.00 98.23  ? 1003 LYS A CA    1 
ATOM   8069  C  C     . LYS C 3  1003 ? 43.122  -81.803  54.902  1.00 96.22  ? 1003 LYS A C     1 
ATOM   8070  O  O     . LYS C 3  1003 ? 43.429  -82.745  55.638  1.00 96.96  ? 1003 LYS A O     1 
ATOM   8071  C  CB    . LYS C 3  1003 ? 42.862  -83.086  52.749  1.00 100.20 ? 1003 LYS A CB    1 
ATOM   8072  C  CG    . LYS C 3  1003 ? 42.489  -84.528  53.083  1.00 103.26 ? 1003 LYS A CG    1 
ATOM   8073  C  CD    . LYS C 3  1003 ? 42.845  -85.481  51.936  1.00 105.57 ? 1003 LYS A CD    1 
ATOM   8074  C  CE    . LYS C 3  1003 ? 42.299  -86.891  52.179  1.00 106.13 ? 1003 LYS A CE    1 
ATOM   8075  N  NZ    . LYS C 3  1003 ? 42.535  -87.823  51.035  1.00 104.44 ? 1003 LYS A NZ    1 
ATOM   8076  N  N     . ASN C 3  1004 ? 43.507  -80.547  55.135  1.00 92.21  ? 1004 ASN A N     1 
ATOM   8077  C  CA    . ASN C 3  1004 ? 44.380  -80.219  56.260  1.00 88.86  ? 1004 ASN A CA    1 
ATOM   8078  C  C     . ASN C 3  1004 ? 43.685  -79.921  57.591  1.00 87.07  ? 1004 ASN A C     1 
ATOM   8079  O  O     . ASN C 3  1004 ? 42.477  -79.714  57.645  1.00 86.31  ? 1004 ASN A O     1 
ATOM   8080  C  CB    . ASN C 3  1004 ? 45.299  -79.054  55.883  1.00 87.19  ? 1004 ASN A CB    1 
ATOM   8081  C  CG    . ASN C 3  1004 ? 44.553  -77.754  55.706  1.00 85.78  ? 1004 ASN A CG    1 
ATOM   8082  O  OD1   . ASN C 3  1004 ? 43.956  -77.237  56.646  1.00 85.48  ? 1004 ASN A OD1   1 
ATOM   8083  N  ND2   . ASN C 3  1004 ? 44.591  -77.210  54.497  1.00 86.11  ? 1004 ASN A ND2   1 
ATOM   8084  N  N     . GLU C 3  1005 ? 44.480  -79.910  58.660  1.00 86.14  ? 1005 GLU A N     1 
ATOM   8085  C  CA    . GLU C 3  1005 ? 44.018  -79.659  60.027  1.00 85.02  ? 1005 GLU A CA    1 
ATOM   8086  C  C     . GLU C 3  1005 ? 43.235  -78.355  60.177  1.00 83.01  ? 1005 GLU A C     1 
ATOM   8087  O  O     . GLU C 3  1005 ? 42.035  -78.373  60.466  1.00 83.18  ? 1005 GLU A O     1 
ATOM   8088  C  CB    . GLU C 3  1005 ? 45.224  -79.638  60.979  1.00 88.16  ? 1005 GLU A CB    1 
ATOM   8089  C  CG    . GLU C 3  1005 ? 44.893  -79.390  62.452  1.00 93.24  ? 1005 GLU A CG    1 
ATOM   8090  C  CD    . GLU C 3  1005 ? 44.394  -80.636  63.175  1.00 96.42  ? 1005 GLU A CD    1 
ATOM   8091  O  OE1   . GLU C 3  1005 ? 43.505  -81.326  62.626  1.00 97.85  ? 1005 GLU A OE1   1 
ATOM   8092  O  OE2   . GLU C 3  1005 ? 44.884  -80.918  64.295  1.00 96.07  ? 1005 GLU A OE2   1 
ATOM   8093  N  N     . ILE C 3  1006 ? 43.930  -77.232  59.991  1.00 80.49  ? 1006 ILE A N     1 
ATOM   8094  C  CA    . ILE C 3  1006 ? 43.344  -75.893  60.104  1.00 76.44  ? 1006 ILE A CA    1 
ATOM   8095  C  C     . ILE C 3  1006 ? 41.954  -75.761  59.496  1.00 74.16  ? 1006 ILE A C     1 
ATOM   8096  O  O     . ILE C 3  1006 ? 40.991  -75.438  60.196  1.00 74.48  ? 1006 ILE A O     1 
ATOM   8097  C  CB    . ILE C 3  1006 ? 44.257  -74.828  59.453  1.00 75.23  ? 1006 ILE A CB    1 
ATOM   8098  C  CG1   . ILE C 3  1006 ? 45.404  -74.481  60.406  1.00 77.46  ? 1006 ILE A CG1   1 
ATOM   8099  C  CG2   . ILE C 3  1006 ? 43.456  -73.594  59.108  1.00 74.62  ? 1006 ILE A CG2   1 
ATOM   8100  C  CD1   . ILE C 3  1006 ? 46.245  -73.285  59.976  1.00 78.67  ? 1006 ILE A CD1   1 
ATOM   8101  N  N     . ILE C 3  1007 ? 41.863  -75.996  58.189  1.00 71.02  ? 1007 ILE A N     1 
ATOM   8102  C  CA    . ILE C 3  1007 ? 40.597  -75.906  57.472  1.00 66.16  ? 1007 ILE A CA    1 
ATOM   8103  C  C     . ILE C 3  1007 ? 39.608  -76.953  57.951  1.00 64.99  ? 1007 ILE A C     1 
ATOM   8104  O  O     . ILE C 3  1007 ? 38.421  -76.673  58.059  1.00 65.29  ? 1007 ILE A O     1 
ATOM   8105  C  CB    . ILE C 3  1007 ? 40.791  -76.089  55.960  1.00 63.21  ? 1007 ILE A CB    1 
ATOM   8106  C  CG1   . ILE C 3  1007 ? 41.628  -74.941  55.384  1.00 62.78  ? 1007 ILE A CG1   1 
ATOM   8107  C  CG2   . ILE C 3  1007 ? 39.454  -76.158  55.285  1.00 61.12  ? 1007 ILE A CG2   1 
ATOM   8108  C  CD1   . ILE C 3  1007 ? 40.971  -73.583  55.443  1.00 59.29  ? 1007 ILE A CD1   1 
ATOM   8109  N  N     . GLN C 3  1008 ? 40.087  -78.159  58.230  1.00 64.62  ? 1008 GLN A N     1 
ATOM   8110  C  CA    . GLN C 3  1008 ? 39.192  -79.203  58.704  1.00 65.67  ? 1008 GLN A CA    1 
ATOM   8111  C  C     . GLN C 3  1008 ? 38.583  -78.803  60.031  1.00 63.95  ? 1008 GLN A C     1 
ATOM   8112  O  O     . GLN C 3  1008 ? 37.546  -79.332  60.424  1.00 63.83  ? 1008 GLN A O     1 
ATOM   8113  C  CB    . GLN C 3  1008 ? 39.917  -80.545  58.854  1.00 70.87  ? 1008 GLN A CB    1 
ATOM   8114  C  CG    . GLN C 3  1008 ? 39.713  -81.491  57.669  1.00 76.05  ? 1008 GLN A CG    1 
ATOM   8115  C  CD    . GLN C 3  1008 ? 38.243  -81.631  57.283  1.00 79.61  ? 1008 GLN A CD    1 
ATOM   8116  O  OE1   . GLN C 3  1008 ? 37.407  -82.006  58.107  1.00 82.01  ? 1008 GLN A OE1   1 
ATOM   8117  N  NE2   . GLN C 3  1008 ? 37.924  -81.325  56.024  1.00 79.04  ? 1008 GLN A NE2   1 
ATOM   8118  N  N     . ASN C 3  1009 ? 39.229  -77.868  60.719  1.00 62.44  ? 1009 ASN A N     1 
ATOM   8119  C  CA    . ASN C 3  1009 ? 38.717  -77.395  61.995  1.00 62.16  ? 1009 ASN A CA    1 
ATOM   8120  C  C     . ASN C 3  1009 ? 37.770  -76.217  61.813  1.00 59.20  ? 1009 ASN A C     1 
ATOM   8121  O  O     . ASN C 3  1009 ? 36.864  -76.006  62.613  1.00 58.80  ? 1009 ASN A O     1 
ATOM   8122  C  CB    . ASN C 3  1009 ? 39.868  -77.031  62.931  1.00 66.66  ? 1009 ASN A CB    1 
ATOM   8123  C  CG    . ASN C 3  1009 ? 40.333  -78.220  63.765  1.00 71.15  ? 1009 ASN A CG    1 
ATOM   8124  O  OD1   . ASN C 3  1009 ? 39.589  -78.734  64.614  1.00 72.08  ? 1009 ASN A OD1   1 
ATOM   8125  N  ND2   . ASN C 3  1009 ? 41.559  -78.668  63.522  1.00 73.52  ? 1009 ASN A ND2   1 
ATOM   8126  N  N     . ALA C 3  1010 ? 37.978  -75.445  60.757  1.00 57.01  ? 1010 ALA A N     1 
ATOM   8127  C  CA    . ALA C 3  1010 ? 37.089  -74.330  60.486  1.00 55.31  ? 1010 ALA A CA    1 
ATOM   8128  C  C     . ALA C 3  1010 ? 35.768  -74.988  60.152  1.00 53.84  ? 1010 ALA A C     1 
ATOM   8129  O  O     . ALA C 3  1010 ? 34.749  -74.728  60.783  1.00 54.60  ? 1010 ALA A O     1 
ATOM   8130  C  CB    . ALA C 3  1010 ? 37.585  -73.532  59.300  1.00 56.60  ? 1010 ALA A CB    1 
ATOM   8131  N  N     . GLN C 3  1011 ? 35.812  -75.862  59.154  1.00 51.79  ? 1011 GLN A N     1 
ATOM   8132  C  CA    . GLN C 3  1011 ? 34.645  -76.596  58.705  1.00 49.61  ? 1011 GLN A CA    1 
ATOM   8133  C  C     . GLN C 3  1011 ? 33.825  -77.112  59.876  1.00 49.07  ? 1011 GLN A C     1 
ATOM   8134  O  O     . GLN C 3  1011 ? 32.606  -77.042  59.847  1.00 48.47  ? 1011 GLN A O     1 
ATOM   8135  C  CB    . GLN C 3  1011 ? 35.092  -77.742  57.797  1.00 49.37  ? 1011 GLN A CB    1 
ATOM   8136  C  CG    . GLN C 3  1011 ? 34.173  -78.950  57.761  1.00 53.32  ? 1011 GLN A CG    1 
ATOM   8137  C  CD    . GLN C 3  1011 ? 32.737  -78.585  57.472  1.00 52.64  ? 1011 GLN A CD    1 
ATOM   8138  O  OE1   . GLN C 3  1011 ? 32.474  -77.603  56.793  1.00 53.12  ? 1011 GLN A OE1   1 
ATOM   8139  N  NE2   . GLN C 3  1011 ? 31.798  -79.387  57.974  1.00 52.32  ? 1011 GLN A NE2   1 
ATOM   8140  N  N     . ARG C 3  1012 ? 34.481  -77.616  60.914  1.00 50.43  ? 1012 ARG A N     1 
ATOM   8141  C  CA    . ARG C 3  1012 ? 33.741  -78.114  62.068  1.00 54.49  ? 1012 ARG A CA    1 
ATOM   8142  C  C     . ARG C 3  1012 ? 33.012  -76.979  62.767  1.00 53.47  ? 1012 ARG A C     1 
ATOM   8143  O  O     . ARG C 3  1012 ? 31.861  -77.126  63.190  1.00 52.91  ? 1012 ARG A O     1 
ATOM   8144  C  CB    . ARG C 3  1012 ? 34.664  -78.808  63.081  1.00 61.92  ? 1012 ARG A CB    1 
ATOM   8145  C  CG    . ARG C 3  1012 ? 35.137  -80.193  62.662  1.00 71.43  ? 1012 ARG A CG    1 
ATOM   8146  C  CD    . ARG C 3  1012 ? 35.544  -81.063  63.857  1.00 78.93  ? 1012 ARG A CD    1 
ATOM   8147  N  NE    . ARG C 3  1012 ? 36.378  -82.178  63.411  1.00 85.88  ? 1012 ARG A NE    1 
ATOM   8148  C  CZ    . ARG C 3  1012 ? 37.657  -82.054  63.061  1.00 89.28  ? 1012 ARG A CZ    1 
ATOM   8149  N  NH1   . ARG C 3  1012 ? 38.252  -80.866  63.119  1.00 91.76  ? 1012 ARG A NH1   1 
ATOM   8150  N  NH2   . ARG C 3  1012 ? 38.337  -83.108  62.623  1.00 88.29  ? 1012 ARG A NH2   1 
ATOM   8151  N  N     . ASP C 3  1013 ? 33.693  -75.847  62.892  1.00 52.41  ? 1013 ASP A N     1 
ATOM   8152  C  CA    . ASP C 3  1013 ? 33.111  -74.689  63.545  1.00 52.72  ? 1013 ASP A CA    1 
ATOM   8153  C  C     . ASP C 3  1013 ? 31.846  -74.226  62.835  1.00 50.92  ? 1013 ASP A C     1 
ATOM   8154  O  O     . ASP C 3  1013 ? 30.768  -74.170  63.434  1.00 52.54  ? 1013 ASP A O     1 
ATOM   8155  C  CB    . ASP C 3  1013 ? 34.117  -73.535  63.588  1.00 57.81  ? 1013 ASP A CB    1 
ATOM   8156  C  CG    . ASP C 3  1013 ? 35.365  -73.874  64.385  1.00 62.69  ? 1013 ASP A CG    1 
ATOM   8157  O  OD1   . ASP C 3  1013 ? 35.229  -74.478  65.478  1.00 65.34  ? 1013 ASP A OD1   1 
ATOM   8158  O  OD2   . ASP C 3  1013 ? 36.478  -73.524  63.923  1.00 65.01  ? 1013 ASP A OD2   1 
ATOM   8159  N  N     . ALA C 3  1014 ? 31.981  -73.907  61.553  1.00 46.67  ? 1014 ALA A N     1 
ATOM   8160  C  CA    . ALA C 3  1014 ? 30.864  -73.422  60.761  1.00 42.61  ? 1014 ALA A CA    1 
ATOM   8161  C  C     . ALA C 3  1014 ? 29.655  -74.345  60.705  1.00 39.93  ? 1014 ALA A C     1 
ATOM   8162  O  O     . ALA C 3  1014 ? 28.654  -74.012  60.081  1.00 42.02  ? 1014 ALA A O     1 
ATOM   8163  C  CB    . ALA C 3  1014 ? 31.332  -73.114  59.362  1.00 43.35  ? 1014 ALA A CB    1 
ATOM   8164  N  N     . VAL C 3  1015 ? 29.721  -75.490  61.363  1.00 36.30  ? 1015 VAL A N     1 
ATOM   8165  C  CA    . VAL C 3  1015 ? 28.596  -76.410  61.323  1.00 34.08  ? 1015 VAL A CA    1 
ATOM   8166  C  C     . VAL C 3  1015 ? 28.066  -76.778  62.697  1.00 33.14  ? 1015 VAL A C     1 
ATOM   8167  O  O     . VAL C 3  1015 ? 26.944  -77.269  62.840  1.00 32.01  ? 1015 VAL A O     1 
ATOM   8168  C  CB    . VAL C 3  1015 ? 28.991  -77.684  60.597  1.00 33.56  ? 1015 VAL A CB    1 
ATOM   8169  C  CG1   . VAL C 3  1015 ? 27.838  -78.653  60.589  1.00 32.58  ? 1015 VAL A CG1   1 
ATOM   8170  C  CG2   . VAL C 3  1015 ? 29.420  -77.344  59.186  1.00 32.89  ? 1015 VAL A CG2   1 
ATOM   8171  N  N     . THR C 3  1016 ? 28.895  -76.549  63.703  1.00 31.12  ? 1016 THR A N     1 
ATOM   8172  C  CA    . THR C 3  1016 ? 28.544  -76.836  65.083  1.00 28.77  ? 1016 THR A CA    1 
ATOM   8173  C  C     . THR C 3  1016 ? 27.077  -76.590  65.418  1.00 28.27  ? 1016 THR A C     1 
ATOM   8174  O  O     . THR C 3  1016 ? 26.338  -77.526  65.716  1.00 27.56  ? 1016 THR A O     1 
ATOM   8175  C  CB    . THR C 3  1016 ? 29.387  -75.984  66.016  1.00 28.95  ? 1016 THR A CB    1 
ATOM   8176  O  OG1   . THR C 3  1016 ? 30.768  -76.349  65.869  1.00 29.95  ? 1016 THR A OG1   1 
ATOM   8177  C  CG2   . THR C 3  1016 ? 28.912  -76.147  67.461  1.00 24.05  ? 1016 THR A CG2   1 
ATOM   8178  N  N     . LEU C 3  1017 ? 26.671  -75.322  65.370  1.00 28.69  ? 1017 LEU A N     1 
ATOM   8179  C  CA    . LEU C 3  1017 ? 25.302  -74.912  65.676  1.00 26.27  ? 1017 LEU A CA    1 
ATOM   8180  C  C     . LEU C 3  1017 ? 24.263  -75.714  64.897  1.00 26.87  ? 1017 LEU A C     1 
ATOM   8181  O  O     . LEU C 3  1017 ? 23.496  -76.469  65.486  1.00 24.92  ? 1017 LEU A O     1 
ATOM   8182  C  CB    . LEU C 3  1017 ? 25.139  -73.413  65.408  1.00 19.90  ? 1017 LEU A CB    1 
ATOM   8183  C  CG    . LEU C 3  1017 ? 23.805  -72.746  65.772  1.00 19.18  ? 1017 LEU A CG    1 
ATOM   8184  C  CD1   . LEU C 3  1017 ? 23.335  -73.123  67.199  1.00 9.74   ? 1017 LEU A CD1   1 
ATOM   8185  C  CD2   . LEU C 3  1017 ? 23.979  -71.230  65.623  1.00 13.33  ? 1017 LEU A CD2   1 
ATOM   8186  N  N     . PHE C 3  1018 ? 24.234  -75.563  63.580  1.00 29.39  ? 1018 PHE A N     1 
ATOM   8187  C  CA    . PHE C 3  1018 ? 23.274  -76.314  62.779  1.00 32.48  ? 1018 PHE A CA    1 
ATOM   8188  C  C     . PHE C 3  1018 ? 23.219  -77.733  63.315  1.00 33.08  ? 1018 PHE A C     1 
ATOM   8189  O  O     . PHE C 3  1018 ? 22.160  -78.210  63.694  1.00 35.32  ? 1018 PHE A O     1 
ATOM   8190  C  CB    . PHE C 3  1018 ? 23.689  -76.327  61.305  1.00 36.81  ? 1018 PHE A CB    1 
ATOM   8191  C  CG    . PHE C 3  1018 ? 22.796  -77.158  60.418  1.00 37.93  ? 1018 PHE A CG    1 
ATOM   8192  C  CD1   . PHE C 3  1018 ? 21.437  -76.883  60.314  1.00 40.65  ? 1018 PHE A CD1   1 
ATOM   8193  C  CD2   . PHE C 3  1018 ? 23.323  -78.205  59.672  1.00 37.78  ? 1018 PHE A CD2   1 
ATOM   8194  C  CE1   . PHE C 3  1018 ? 20.619  -77.641  59.475  1.00 41.47  ? 1018 PHE A CE1   1 
ATOM   8195  C  CE2   . PHE C 3  1018 ? 22.518  -78.965  58.832  1.00 39.08  ? 1018 PHE A CE2   1 
ATOM   8196  C  CZ    . PHE C 3  1018 ? 21.166  -78.685  58.733  1.00 40.79  ? 1018 PHE A CZ    1 
ATOM   8197  N  N     . CYS C 3  1019 ? 24.361  -78.405  63.368  1.00 33.49  ? 1019 CYS A N     1 
ATOM   8198  C  CA    . CYS C 3  1019 ? 24.387  -79.765  63.891  1.00 34.13  ? 1019 CYS A CA    1 
ATOM   8199  C  C     . CYS C 3  1019 ? 23.612  -79.868  65.204  1.00 33.51  ? 1019 CYS A C     1 
ATOM   8200  O  O     . CYS C 3  1019 ? 22.832  -80.795  65.387  1.00 32.97  ? 1019 CYS A O     1 
ATOM   8201  C  CB    . CYS C 3  1019 ? 25.826  -80.228  64.113  1.00 36.75  ? 1019 CYS A CB    1 
ATOM   8202  S  SG    . CYS C 3  1019 ? 26.713  -80.698  62.618  1.00 36.61  ? 1019 CYS A SG    1 
ATOM   8203  N  N     . CYS C 3  1020 ? 23.823  -78.927  66.120  1.00 32.90  ? 1020 CYS A N     1 
ATOM   8204  C  CA    . CYS C 3  1020 ? 23.102  -78.958  67.394  1.00 35.38  ? 1020 CYS A CA    1 
ATOM   8205  C  C     . CYS C 3  1020 ? 21.621  -79.046  67.102  1.00 34.67  ? 1020 CYS A C     1 
ATOM   8206  O  O     . CYS C 3  1020 ? 20.888  -79.839  67.693  1.00 34.79  ? 1020 CYS A O     1 
ATOM   8207  C  CB    . CYS C 3  1020 ? 23.344  -77.689  68.201  1.00 36.48  ? 1020 CYS A CB    1 
ATOM   8208  S  SG    . CYS C 3  1020 ? 25.043  -77.408  68.608  1.00 48.03  ? 1020 CYS A SG    1 
ATOM   8209  N  N     . LEU C 3  1021 ? 21.184  -78.187  66.196  1.00 33.67  ? 1021 LEU A N     1 
ATOM   8210  C  CA    . LEU C 3  1021 ? 19.799  -78.172  65.807  1.00 31.34  ? 1021 LEU A CA    1 
ATOM   8211  C  C     . LEU C 3  1021 ? 19.530  -79.596  65.407  1.00 30.90  ? 1021 LEU A C     1 
ATOM   8212  O  O     . LEU C 3  1021 ? 18.737  -80.288  66.030  1.00 33.06  ? 1021 LEU A O     1 
ATOM   8213  C  CB    . LEU C 3  1021 ? 19.605  -77.248  64.613  1.00 30.77  ? 1021 LEU A CB    1 
ATOM   8214  C  CG    . LEU C 3  1021 ? 18.266  -77.401  63.907  1.00 30.55  ? 1021 LEU A CG    1 
ATOM   8215  C  CD1   . LEU C 3  1021 ? 17.154  -76.984  64.859  1.00 29.80  ? 1021 LEU A CD1   1 
ATOM   8216  C  CD2   . LEU C 3  1021 ? 18.267  -76.565  62.628  1.00 29.37  ? 1021 LEU A CD2   1 
ATOM   8217  N  N     . LEU C 3  1022 ? 20.250  -80.030  64.380  1.00 30.69  ? 1022 LEU A N     1 
ATOM   8218  C  CA    . LEU C 3  1022 ? 20.138  -81.370  63.817  1.00 30.96  ? 1022 LEU A CA    1 
ATOM   8219  C  C     . LEU C 3  1022 ? 20.036  -82.526  64.819  1.00 30.87  ? 1022 LEU A C     1 
ATOM   8220  O  O     . LEU C 3  1022 ? 19.176  -83.402  64.670  1.00 30.95  ? 1022 LEU A O     1 
ATOM   8221  C  CB    . LEU C 3  1022 ? 21.316  -81.614  62.876  1.00 32.80  ? 1022 LEU A CB    1 
ATOM   8222  C  CG    . LEU C 3  1022 ? 21.371  -83.025  62.312  1.00 35.32  ? 1022 LEU A CG    1 
ATOM   8223  C  CD1   . LEU C 3  1022 ? 20.110  -83.265  61.509  1.00 37.67  ? 1022 LEU A CD1   1 
ATOM   8224  C  CD2   . LEU C 3  1022 ? 22.613  -83.206  61.453  1.00 38.00  ? 1022 LEU A CD2   1 
ATOM   8225  N  N     . ARG C 3  1023 ? 20.908  -82.531  65.826  1.00 29.36  ? 1023 ARG A N     1 
ATOM   8226  C  CA    . ARG C 3  1023 ? 20.917  -83.588  66.832  1.00 28.81  ? 1023 ARG A CA    1 
ATOM   8227  C  C     . ARG C 3  1023 ? 19.708  -83.566  67.727  1.00 28.56  ? 1023 ARG A C     1 
ATOM   8228  O  O     . ARG C 3  1023 ? 19.160  -84.609  68.050  1.00 30.17  ? 1023 ARG A O     1 
ATOM   8229  C  CB    . ARG C 3  1023 ? 22.135  -83.474  67.733  1.00 31.73  ? 1023 ARG A CB    1 
ATOM   8230  C  CG    . ARG C 3  1023 ? 23.441  -83.880  67.131  1.00 32.35  ? 1023 ARG A CG    1 
ATOM   8231  C  CD    . ARG C 3  1023 ? 24.514  -83.515  68.095  1.00 29.30  ? 1023 ARG A CD    1 
ATOM   8232  N  NE    . ARG C 3  1023 ? 25.767  -83.316  67.402  1.00 34.47  ? 1023 ARG A NE    1 
ATOM   8233  C  CZ    . ARG C 3  1023 ? 26.646  -82.381  67.733  1.00 39.36  ? 1023 ARG A CZ    1 
ATOM   8234  N  NH1   . ARG C 3  1023 ? 26.391  -81.559  68.751  1.00 34.96  ? 1023 ARG A NH1   1 
ATOM   8235  N  NH2   . ARG C 3  1023 ? 27.781  -82.279  67.049  1.00 43.35  ? 1023 ARG A NH2   1 
ATOM   8236  N  N     . SER C 3  1024 ? 19.323  -82.375  68.162  1.00 28.58  ? 1024 SER A N     1 
ATOM   8237  C  CA    . SER C 3  1024 ? 18.176  -82.213  69.039  1.00 29.95  ? 1024 SER A CA    1 
ATOM   8238  C  C     . SER C 3  1024 ? 16.913  -82.612  68.313  1.00 30.88  ? 1024 SER A C     1 
ATOM   8239  O  O     . SER C 3  1024 ? 15.952  -83.060  68.927  1.00 31.54  ? 1024 SER A O     1 
ATOM   8240  C  CB    . SER C 3  1024 ? 18.039  -80.754  69.475  1.00 34.71  ? 1024 SER A CB    1 
ATOM   8241  O  OG    . SER C 3  1024 ? 17.523  -79.929  68.434  1.00 38.13  ? 1024 SER A OG    1 
ATOM   8242  N  N     . ARG C 3  1025 ? 16.909  -82.430  66.999  1.00 30.85  ? 1025 ARG A N     1 
ATOM   8243  C  CA    . ARG C 3  1025 ? 15.741  -82.765  66.218  1.00 31.34  ? 1025 ARG A CA    1 
ATOM   8244  C  C     . ARG C 3  1025 ? 15.727  -84.241  65.878  1.00 33.05  ? 1025 ARG A C     1 
ATOM   8245  O  O     . ARG C 3  1025 ? 14.741  -84.919  66.127  1.00 34.88  ? 1025 ARG A O     1 
ATOM   8246  C  CB    . ARG C 3  1025 ? 15.697  -81.940  64.935  1.00 29.71  ? 1025 ARG A CB    1 
ATOM   8247  C  CG    . ARG C 3  1025 ? 15.922  -80.449  65.116  1.00 30.98  ? 1025 ARG A CG    1 
ATOM   8248  C  CD    . ARG C 3  1025 ? 14.962  -79.806  66.099  1.00 36.92  ? 1025 ARG A CD    1 
ATOM   8249  N  NE    . ARG C 3  1025 ? 14.509  -78.492  65.634  1.00 40.48  ? 1025 ARG A NE    1 
ATOM   8250  C  CZ    . ARG C 3  1025 ? 13.428  -78.306  64.882  1.00 39.65  ? 1025 ARG A CZ    1 
ATOM   8251  N  NH1   . ARG C 3  1025 ? 12.697  -79.351  64.529  1.00 41.15  ? 1025 ARG A NH1   1 
ATOM   8252  N  NH2   . ARG C 3  1025 ? 13.089  -77.091  64.462  1.00 39.71  ? 1025 ARG A NH2   1 
ATOM   8253  N  N     . LEU C 3  1026 ? 16.819  -84.748  65.321  1.00 33.87  ? 1026 LEU A N     1 
ATOM   8254  C  CA    . LEU C 3  1026 ? 16.865  -86.156  64.951  1.00 37.21  ? 1026 LEU A CA    1 
ATOM   8255  C  C     . LEU C 3  1026 ? 17.334  -87.118  66.044  1.00 40.10  ? 1026 LEU A C     1 
ATOM   8256  O  O     . LEU C 3  1026 ? 18.227  -87.943  65.823  1.00 42.06  ? 1026 LEU A O     1 
ATOM   8257  C  CB    . LEU C 3  1026 ? 17.720  -86.328  63.699  1.00 34.48  ? 1026 LEU A CB    1 
ATOM   8258  C  CG    . LEU C 3  1026 ? 17.048  -85.737  62.458  1.00 34.19  ? 1026 LEU A CG    1 
ATOM   8259  C  CD1   . LEU C 3  1026 ? 17.863  -86.101  61.220  1.00 31.47  ? 1026 LEU A CD1   1 
ATOM   8260  C  CD2   . LEU C 3  1026 ? 15.602  -86.262  62.342  1.00 30.15  ? 1026 LEU A CD2   1 
ATOM   8261  N  N     . ALA C 3  1027 ? 16.705  -87.024  67.214  1.00 41.68  ? 1027 ALA A N     1 
ATOM   8262  C  CA    . ALA C 3  1027 ? 17.045  -87.872  68.355  1.00 41.71  ? 1027 ALA A CA    1 
ATOM   8263  C  C     . ALA C 3  1027 ? 16.173  -89.118  68.432  1.00 42.32  ? 1027 ALA A C     1 
ATOM   8264  O  O     . ALA C 3  1027 ? 14.961  -89.071  68.178  1.00 39.74  ? 1027 ALA A O     1 
ATOM   8265  C  CB    . ALA C 3  1027 ? 16.925  -87.080  69.642  1.00 42.11  ? 1027 ALA A CB    1 
ATOM   8266  N  N     . THR C 3  1028 ? 16.810  -90.222  68.814  1.00 43.35  ? 1028 THR A N     1 
ATOM   8267  C  CA    . THR C 3  1028 ? 16.168  -91.525  68.926  1.00 44.02  ? 1028 THR A CA    1 
ATOM   8268  C  C     . THR C 3  1028 ? 14.703  -91.519  69.374  1.00 45.28  ? 1028 THR A C     1 
ATOM   8269  O  O     . THR C 3  1028 ? 13.839  -91.968  68.622  1.00 45.76  ? 1028 THR A O     1 
ATOM   8270  C  CB    . THR C 3  1028 ? 16.985  -92.423  69.831  1.00 42.39  ? 1028 THR A CB    1 
ATOM   8271  O  OG1   . THR C 3  1028 ? 18.353  -92.354  69.423  1.00 40.08  ? 1028 THR A OG1   1 
ATOM   8272  C  CG2   . THR C 3  1028 ? 16.519  -93.852  69.707  1.00 41.01  ? 1028 THR A CG2   1 
ATOM   8273  N  N     . ARG C 3  1029 ? 14.404  -91.045  70.582  1.00 44.55  ? 1029 ARG A N     1 
ATOM   8274  C  CA    . ARG C 3  1029 ? 12.997  -90.999  70.996  1.00 44.55  ? 1029 ARG A CA    1 
ATOM   8275  C  C     . ARG C 3  1029 ? 12.228  -90.332  69.860  1.00 44.77  ? 1029 ARG A C     1 
ATOM   8276  O  O     . ARG C 3  1029 ? 11.483  -90.980  69.129  1.00 44.54  ? 1029 ARG A O     1 
ATOM   8277  C  CB    . ARG C 3  1029 ? 12.814  -90.144  72.249  1.00 45.42  ? 1029 ARG A CB    1 
ATOM   8278  C  CG    . ARG C 3  1029 ? 12.608  -90.906  73.520  1.00 45.25  ? 1029 ARG A CG    1 
ATOM   8279  C  CD    . ARG C 3  1029 ? 11.311  -91.680  73.518  1.00 45.22  ? 1029 ARG A CD    1 
ATOM   8280  N  NE    . ARG C 3  1029 ? 11.396  -92.757  74.493  1.00 47.09  ? 1029 ARG A NE    1 
ATOM   8281  C  CZ    . ARG C 3  1029 ? 11.642  -92.568  75.784  1.00 49.72  ? 1029 ARG A CZ    1 
ATOM   8282  N  NH1   . ARG C 3  1029 ? 11.813  -91.340  76.263  1.00 50.63  ? 1029 ARG A NH1   1 
ATOM   8283  N  NH2   . ARG C 3  1029 ? 11.758  -93.611  76.591  1.00 52.83  ? 1029 ARG A NH2   1 
ATOM   8284  N  N     . ARG C 3  1030 ? 12.442  -89.021  69.737  1.00 44.51  ? 1030 ARG A N     1 
ATOM   8285  C  CA    . ARG C 3  1030 ? 11.829  -88.172  68.724  1.00 41.93  ? 1030 ARG A CA    1 
ATOM   8286  C  C     . ARG C 3  1030 ? 11.524  -88.904  67.427  1.00 41.36  ? 1030 ARG A C     1 
ATOM   8287  O  O     . ARG C 3  1030 ? 10.368  -89.028  67.012  1.00 39.63  ? 1030 ARG A O     1 
ATOM   8288  C  CB    . ARG C 3  1030 ? 12.756  -87.003  68.412  1.00 40.51  ? 1030 ARG A CB    1 
ATOM   8289  C  CG    . ARG C 3  1030 ? 12.612  -85.813  69.316  1.00 39.10  ? 1030 ARG A CG    1 
ATOM   8290  C  CD    . ARG C 3  1030 ? 13.075  -84.565  68.583  1.00 38.17  ? 1030 ARG A CD    1 
ATOM   8291  N  NE    . ARG C 3  1030 ? 12.419  -83.365  69.088  1.00 44.12  ? 1030 ARG A NE    1 
ATOM   8292  C  CZ    . ARG C 3  1030 ? 12.161  -82.293  68.344  1.00 49.75  ? 1030 ARG A CZ    1 
ATOM   8293  N  NH1   . ARG C 3  1030 ? 12.507  -82.276  67.060  1.00 53.74  ? 1030 ARG A NH1   1 
ATOM   8294  N  NH2   . ARG C 3  1030 ? 11.543  -81.242  68.874  1.00 49.73  ? 1030 ARG A NH2   1 
ATOM   8295  N  N     . VAL C 3  1031 ? 12.581  -89.366  66.778  1.00 40.52  ? 1031 VAL A N     1 
ATOM   8296  C  CA    . VAL C 3  1031 ? 12.430  -90.078  65.531  1.00 42.37  ? 1031 VAL A CA    1 
ATOM   8297  C  C     . VAL C 3  1031 ? 11.375  -91.161  65.672  1.00 45.54  ? 1031 VAL A C     1 
ATOM   8298  O  O     . VAL C 3  1031 ? 10.495  -91.286  64.826  1.00 47.76  ? 1031 VAL A O     1 
ATOM   8299  C  CB    . VAL C 3  1031 ? 13.762  -90.709  65.107  1.00 39.33  ? 1031 VAL A CB    1 
ATOM   8300  C  CG1   . VAL C 3  1031 ? 13.575  -91.578  63.884  1.00 31.13  ? 1031 VAL A CG1   1 
ATOM   8301  C  CG2   . VAL C 3  1031 ? 14.769  -89.607  64.831  1.00 40.54  ? 1031 VAL A CG2   1 
ATOM   8302  N  N     . LEU C 3  1032 ? 11.442  -91.919  66.761  1.00 48.19  ? 1032 LEU A N     1 
ATOM   8303  C  CA    . LEU C 3  1032 ? 10.508  -93.019  66.989  1.00 50.18  ? 1032 LEU A CA    1 
ATOM   8304  C  C     . LEU C 3  1032 ? 9.192   -92.653  67.655  1.00 51.43  ? 1032 LEU A C     1 
ATOM   8305  O  O     . LEU C 3  1032 ? 8.126   -93.017  67.171  1.00 52.49  ? 1032 LEU A O     1 
ATOM   8306  C  CB    . LEU C 3  1032 ? 11.194  -94.111  67.813  1.00 49.33  ? 1032 LEU A CB    1 
ATOM   8307  C  CG    . LEU C 3  1032 ? 12.515  -94.624  67.230  1.00 49.95  ? 1032 LEU A CG    1 
ATOM   8308  C  CD1   . LEU C 3  1032 ? 13.264  -95.434  68.265  1.00 51.89  ? 1032 LEU A CD1   1 
ATOM   8309  C  CD2   . LEU C 3  1032 ? 12.248  -95.455  66.000  1.00 49.60  ? 1032 LEU A CD2   1 
ATOM   8310  N  N     . GLN C 3  1033 ? 9.265   -91.931  68.764  1.00 53.20  ? 1033 GLN A N     1 
ATOM   8311  C  CA    . GLN C 3  1033 ? 8.068   -91.563  69.509  1.00 54.82  ? 1033 GLN A CA    1 
ATOM   8312  C  C     . GLN C 3  1033 ? 7.352   -90.316  69.008  1.00 55.95  ? 1033 GLN A C     1 
ATOM   8313  O  O     . GLN C 3  1033 ? 6.124   -90.278  68.995  1.00 57.77  ? 1033 GLN A O     1 
ATOM   8314  C  CB    . GLN C 3  1033 ? 8.422   -91.387  70.985  1.00 55.88  ? 1033 GLN A CB    1 
ATOM   8315  C  CG    . GLN C 3  1033 ? 7.238   -91.372  71.934  1.00 59.55  ? 1033 GLN A CG    1 
ATOM   8316  C  CD    . GLN C 3  1033 ? 7.679   -91.366  73.388  1.00 65.66  ? 1033 GLN A CD    1 
ATOM   8317  O  OE1   . GLN C 3  1033 ? 8.259   -92.339  73.880  1.00 68.81  ? 1033 GLN A OE1   1 
ATOM   8318  N  NE2   . GLN C 3  1033 ? 7.418   -90.262  74.081  1.00 69.77  ? 1033 GLN A NE2   1 
ATOM   8319  N  N     . GLU C 3  1034 ? 8.104   -89.298  68.599  1.00 55.54  ? 1034 GLU A N     1 
ATOM   8320  C  CA    . GLU C 3  1034 ? 7.480   -88.069  68.129  1.00 54.15  ? 1034 GLU A CA    1 
ATOM   8321  C  C     . GLU C 3  1034 ? 6.934   -88.148  66.710  1.00 54.54  ? 1034 GLU A C     1 
ATOM   8322  O  O     . GLU C 3  1034 ? 5.811   -87.715  66.452  1.00 55.73  ? 1034 GLU A O     1 
ATOM   8323  C  CB    . GLU C 3  1034 ? 8.446   -86.890  68.272  1.00 53.98  ? 1034 GLU A CB    1 
ATOM   8324  C  CG    . GLU C 3  1034 ? 8.462   -86.310  69.686  1.00 54.27  ? 1034 GLU A CG    1 
ATOM   8325  C  CD    . GLU C 3  1034 ? 8.989   -84.891  69.744  1.00 53.09  ? 1034 GLU A CD    1 
ATOM   8326  O  OE1   . GLU C 3  1034 ? 8.658   -84.098  68.836  1.00 54.89  ? 1034 GLU A OE1   1 
ATOM   8327  O  OE2   . GLU C 3  1034 ? 9.715   -84.561  70.705  1.00 49.29  ? 1034 GLU A OE2   1 
ATOM   8328  N  N     . TYR C 3  1035 ? 7.704   -88.694  65.780  1.00 53.59  ? 1035 TYR A N     1 
ATOM   8329  C  CA    . TYR C 3  1035 ? 7.189   -88.801  64.427  1.00 53.65  ? 1035 TYR A CA    1 
ATOM   8330  C  C     . TYR C 3  1035 ? 7.480   -90.112  63.712  1.00 54.65  ? 1035 TYR A C     1 
ATOM   8331  O  O     . TYR C 3  1035 ? 8.218   -90.149  62.723  1.00 55.74  ? 1035 TYR A O     1 
ATOM   8332  C  CB    . TYR C 3  1035 ? 7.657   -87.624  63.581  1.00 55.12  ? 1035 TYR A CB    1 
ATOM   8333  C  CG    . TYR C 3  1035 ? 8.919   -86.917  64.029  1.00 54.53  ? 1035 TYR A CG    1 
ATOM   8334  C  CD1   . TYR C 3  1035 ? 10.184  -87.395  63.684  1.00 51.93  ? 1035 TYR A CD1   1 
ATOM   8335  C  CD2   . TYR C 3  1035 ? 8.837   -85.700  64.710  1.00 55.02  ? 1035 TYR A CD2   1 
ATOM   8336  C  CE1   . TYR C 3  1035 ? 11.332  -86.662  64.000  1.00 52.72  ? 1035 TYR A CE1   1 
ATOM   8337  C  CE2   . TYR C 3  1035 ? 9.973   -84.968  65.029  1.00 52.36  ? 1035 TYR A CE2   1 
ATOM   8338  C  CZ    . TYR C 3  1035 ? 11.212  -85.447  64.670  1.00 51.15  ? 1035 TYR A CZ    1 
ATOM   8339  O  OH    . TYR C 3  1035 ? 12.316  -84.686  64.966  1.00 48.92  ? 1035 TYR A OH    1 
ATOM   8340  N  N     . ARG C 3  1036 ? 6.861   -91.171  64.232  1.00 52.80  ? 1036 ARG A N     1 
ATOM   8341  C  CA    . ARG C 3  1036 ? 6.964   -92.544  63.745  1.00 50.68  ? 1036 ARG A CA    1 
ATOM   8342  C  C     . ARG C 3  1036 ? 7.601   -92.786  62.373  1.00 48.49  ? 1036 ARG A C     1 
ATOM   8343  O  O     . ARG C 3  1036 ? 7.001   -93.451  61.529  1.00 48.84  ? 1036 ARG A O     1 
ATOM   8344  C  CB    . ARG C 3  1036 ? 5.568   -93.160  63.737  1.00 54.00  ? 1036 ARG A CB    1 
ATOM   8345  C  CG    . ARG C 3  1036 ? 4.828   -93.048  65.047  1.00 57.79  ? 1036 ARG A CG    1 
ATOM   8346  C  CD    . ARG C 3  1036 ? 4.935   -94.322  65.868  1.00 62.21  ? 1036 ARG A CD    1 
ATOM   8347  N  NE    . ARG C 3  1036 ? 4.120   -94.224  67.075  1.00 66.69  ? 1036 ARG A NE    1 
ATOM   8348  C  CZ    . ARG C 3  1036 ? 4.338   -93.354  68.059  1.00 67.02  ? 1036 ARG A CZ    1 
ATOM   8349  N  NH1   . ARG C 3  1036 ? 5.355   -92.504  67.989  1.00 63.05  ? 1036 ARG A NH1   1 
ATOM   8350  N  NH2   . ARG C 3  1036 ? 3.524   -93.321  69.107  1.00 69.01  ? 1036 ARG A NH2   1 
ATOM   8351  N  N     . LEU C 3  1037 ? 8.812   -92.293  62.144  1.00 45.25  ? 1037 LEU A N     1 
ATOM   8352  C  CA    . LEU C 3  1037 ? 9.435   -92.504  60.848  1.00 43.51  ? 1037 LEU A CA    1 
ATOM   8353  C  C     . LEU C 3  1037 ? 9.661   -93.970  60.589  1.00 42.31  ? 1037 LEU A C     1 
ATOM   8354  O  O     . LEU C 3  1037 ? 9.391   -94.809  61.437  1.00 42.17  ? 1037 LEU A O     1 
ATOM   8355  C  CB    . LEU C 3  1037 ? 10.775  -91.783  60.748  1.00 44.28  ? 1037 LEU A CB    1 
ATOM   8356  C  CG    . LEU C 3  1037 ? 10.750  -90.260  60.661  1.00 45.72  ? 1037 LEU A CG    1 
ATOM   8357  C  CD1   . LEU C 3  1037 ? 12.108  -89.796  60.178  1.00 47.40  ? 1037 LEU A CD1   1 
ATOM   8358  C  CD2   . LEU C 3  1037 ? 9.685   -89.800  59.685  1.00 45.62  ? 1037 LEU A CD2   1 
ATOM   8359  N  N     . THR C 3  1038 ? 10.150  -94.277  59.401  1.00 42.25  ? 1038 THR A N     1 
ATOM   8360  C  CA    . THR C 3  1038 ? 10.441  -95.649  59.053  1.00 44.52  ? 1038 THR A CA    1 
ATOM   8361  C  C     . THR C 3  1038 ? 11.810  -95.619  58.397  1.00 45.40  ? 1038 THR A C     1 
ATOM   8362  O  O     . THR C 3  1038 ? 12.246  -94.577  57.919  1.00 43.78  ? 1038 THR A O     1 
ATOM   8363  C  CB    . THR C 3  1038 ? 9.399   -96.214  58.087  1.00 44.87  ? 1038 THR A CB    1 
ATOM   8364  O  OG1   . THR C 3  1038 ? 9.622   -95.687  56.774  1.00 49.28  ? 1038 THR A OG1   1 
ATOM   8365  C  CG2   . THR C 3  1038 ? 8.000   -95.840  58.557  1.00 43.04  ? 1038 THR A CG2   1 
ATOM   8366  N  N     . LYS C 3  1039 ? 12.499  -96.750  58.394  1.00 48.24  ? 1039 LYS A N     1 
ATOM   8367  C  CA    . LYS C 3  1039 ? 13.824  -96.802  57.806  1.00 53.08  ? 1039 LYS A CA    1 
ATOM   8368  C  C     . LYS C 3  1039 ? 13.846  -96.076  56.475  1.00 55.03  ? 1039 LYS A C     1 
ATOM   8369  O  O     . LYS C 3  1039 ? 14.817  -95.394  56.150  1.00 55.78  ? 1039 LYS A O     1 
ATOM   8370  C  CB    . LYS C 3  1039 ? 14.269  -98.257  57.616  1.00 55.60  ? 1039 LYS A CB    1 
ATOM   8371  C  CG    . LYS C 3  1039 ? 15.487  -98.439  56.710  1.00 57.38  ? 1039 LYS A CG    1 
ATOM   8372  C  CD    . LYS C 3  1039 ? 16.704  -97.683  57.210  1.00 59.86  ? 1039 LYS A CD    1 
ATOM   8373  C  CE    . LYS C 3  1039 ? 17.831  -97.753  56.191  1.00 63.79  ? 1039 LYS A CE    1 
ATOM   8374  N  NZ    . LYS C 3  1039 ? 19.061  -97.046  56.652  1.00 65.73  ? 1039 LYS A NZ    1 
ATOM   8375  N  N     . GLN C 3  1040 ? 12.761  -96.215  55.718  1.00 56.79  ? 1040 GLN A N     1 
ATOM   8376  C  CA    . GLN C 3  1040 ? 12.646  -95.591  54.401  1.00 58.53  ? 1040 GLN A CA    1 
ATOM   8377  C  C     . GLN C 3  1040 ? 12.501  -94.071  54.462  1.00 57.27  ? 1040 GLN A C     1 
ATOM   8378  O  O     . GLN C 3  1040 ? 13.278  -93.339  53.839  1.00 56.88  ? 1040 GLN A O     1 
ATOM   8379  C  CB    . GLN C 3  1040 ? 11.457  -96.194  53.649  1.00 62.01  ? 1040 GLN A CB    1 
ATOM   8380  C  CG    . GLN C 3  1040 ? 11.282  -95.673  52.233  1.00 64.68  ? 1040 GLN A CG    1 
ATOM   8381  C  CD    . GLN C 3  1040 ? 10.093  -96.302  51.538  1.00 66.83  ? 1040 GLN A CD    1 
ATOM   8382  O  OE1   . GLN C 3  1040 ? 8.985   -96.326  52.078  1.00 65.78  ? 1040 GLN A OE1   1 
ATOM   8383  N  NE2   . GLN C 3  1040 ? 10.313  -96.814  50.332  1.00 70.71  ? 1040 GLN A NE2   1 
ATOM   8384  N  N     . ALA C 3  1041 ? 11.497  -93.604  55.198  1.00 55.37  ? 1041 ALA A N     1 
ATOM   8385  C  CA    . ALA C 3  1041 ? 11.265  -92.175  55.349  1.00 53.86  ? 1041 ALA A CA    1 
ATOM   8386  C  C     . ALA C 3  1041 ? 12.526  -91.564  55.930  1.00 52.90  ? 1041 ALA A C     1 
ATOM   8387  O  O     . ALA C 3  1041 ? 13.197  -90.762  55.287  1.00 51.31  ? 1041 ALA A O     1 
ATOM   8388  C  CB    . ALA C 3  1041 ? 10.088  -91.928  56.283  1.00 55.10  ? 1041 ALA A CB    1 
ATOM   8389  N  N     . PHE C 3  1042 ? 12.840  -91.962  57.158  1.00 53.04  ? 1042 PHE A N     1 
ATOM   8390  C  CA    . PHE C 3  1042 ? 14.029  -91.481  57.846  1.00 52.18  ? 1042 PHE A CA    1 
ATOM   8391  C  C     . PHE C 3  1042 ? 15.218  -91.436  56.879  1.00 50.74  ? 1042 PHE A C     1 
ATOM   8392  O  O     . PHE C 3  1042 ? 15.780  -90.377  56.627  1.00 50.47  ? 1042 PHE A O     1 
ATOM   8393  C  CB    . PHE C 3  1042 ? 14.351  -92.400  59.032  1.00 51.95  ? 1042 PHE A CB    1 
ATOM   8394  C  CG    . PHE C 3  1042 ? 15.517  -91.936  59.856  1.00 50.57  ? 1042 PHE A CG    1 
ATOM   8395  C  CD1   . PHE C 3  1042 ? 15.315  -91.201  61.016  1.00 49.25  ? 1042 PHE A CD1   1 
ATOM   8396  C  CD2   . PHE C 3  1042 ? 16.823  -92.191  59.444  1.00 49.90  ? 1042 PHE A CD2   1 
ATOM   8397  C  CE1   . PHE C 3  1042 ? 16.399  -90.725  61.750  1.00 49.20  ? 1042 PHE A CE1   1 
ATOM   8398  C  CE2   . PHE C 3  1042 ? 17.910  -91.717  60.172  1.00 47.07  ? 1042 PHE A CE2   1 
ATOM   8399  C  CZ    . PHE C 3  1042 ? 17.699  -90.985  61.322  1.00 48.16  ? 1042 PHE A CZ    1 
ATOM   8400  N  N     . ASP C 3  1043 ? 15.590  -92.590  56.341  1.00 49.41  ? 1043 ASP A N     1 
ATOM   8401  C  CA    . ASP C 3  1043 ? 16.704  -92.680  55.408  1.00 51.19  ? 1043 ASP A CA    1 
ATOM   8402  C  C     . ASP C 3  1043 ? 16.631  -91.575  54.342  1.00 52.65  ? 1043 ASP A C     1 
ATOM   8403  O  O     . ASP C 3  1043 ? 17.662  -91.052  53.899  1.00 52.46  ? 1043 ASP A O     1 
ATOM   8404  C  CB    . ASP C 3  1043 ? 16.702  -94.067  54.743  1.00 51.98  ? 1043 ASP A CB    1 
ATOM   8405  C  CG    . ASP C 3  1043 ? 17.999  -94.834  54.966  1.00 53.39  ? 1043 ASP A CG    1 
ATOM   8406  O  OD1   . ASP C 3  1043 ? 18.598  -94.695  56.051  1.00 56.87  ? 1043 ASP A OD1   1 
ATOM   8407  O  OD2   . ASP C 3  1043 ? 18.415  -95.590  54.063  1.00 52.81  ? 1043 ASP A OD2   1 
ATOM   8408  N  N     . TRP C 3  1044 ? 15.410  -91.228  53.936  1.00 53.04  ? 1044 TRP A N     1 
ATOM   8409  C  CA    . TRP C 3  1044 ? 15.181  -90.190  52.926  1.00 53.68  ? 1044 TRP A CA    1 
ATOM   8410  C  C     . TRP C 3  1044 ? 15.500  -88.816  53.515  1.00 51.64  ? 1044 TRP A C     1 
ATOM   8411  O  O     . TRP C 3  1044 ? 16.290  -88.054  52.954  1.00 50.57  ? 1044 TRP A O     1 
ATOM   8412  C  CB    . TRP C 3  1044 ? 13.714  -90.237  52.447  1.00 60.13  ? 1044 TRP A CB    1 
ATOM   8413  C  CG    . TRP C 3  1044 ? 13.315  -89.160  51.443  1.00 66.53  ? 1044 TRP A CG    1 
ATOM   8414  C  CD1   . TRP C 3  1044 ? 13.754  -89.026  50.150  1.00 69.70  ? 1044 TRP A CD1   1 
ATOM   8415  C  CD2   . TRP C 3  1044 ? 12.429  -88.056  51.677  1.00 68.17  ? 1044 TRP A CD2   1 
ATOM   8416  N  NE1   . TRP C 3  1044 ? 13.200  -87.905  49.572  1.00 69.75  ? 1044 TRP A NE1   1 
ATOM   8417  C  CE2   . TRP C 3  1044 ? 12.385  -87.293  50.487  1.00 68.42  ? 1044 TRP A CE2   1 
ATOM   8418  C  CE3   . TRP C 3  1044 ? 11.672  -87.635  52.779  1.00 68.34  ? 1044 TRP A CE3   1 
ATOM   8419  C  CZ2   . TRP C 3  1044 ? 11.616  -86.136  50.369  1.00 68.41  ? 1044 TRP A CZ2   1 
ATOM   8420  C  CZ3   . TRP C 3  1044 ? 10.909  -86.484  52.660  1.00 69.33  ? 1044 TRP A CZ3   1 
ATOM   8421  C  CH2   . TRP C 3  1044 ? 10.887  -85.747  51.462  1.00 68.51  ? 1044 TRP A CH2   1 
ATOM   8422  N  N     . VAL C 3  1045 ? 14.873  -88.519  54.653  1.00 49.59  ? 1045 VAL A N     1 
ATOM   8423  C  CA    . VAL C 3  1045 ? 15.059  -87.258  55.362  1.00 45.62  ? 1045 VAL A CA    1 
ATOM   8424  C  C     . VAL C 3  1045 ? 16.520  -86.859  55.447  1.00 45.09  ? 1045 VAL A C     1 
ATOM   8425  O  O     . VAL C 3  1045 ? 16.858  -85.687  55.327  1.00 45.35  ? 1045 VAL A O     1 
ATOM   8426  C  CB    . VAL C 3  1045 ? 14.504  -87.352  56.777  1.00 42.94  ? 1045 VAL A CB    1 
ATOM   8427  C  CG1   . VAL C 3  1045 ? 14.818  -86.088  57.541  1.00 44.22  ? 1045 VAL A CG1   1 
ATOM   8428  C  CG2   . VAL C 3  1045 ? 13.012  -87.573  56.718  1.00 43.17  ? 1045 VAL A CG2   1 
ATOM   8429  N  N     . LEU C 3  1046 ? 17.385  -87.840  55.658  1.00 45.35  ? 1046 LEU A N     1 
ATOM   8430  C  CA    . LEU C 3  1046 ? 18.815  -87.586  55.745  1.00 46.05  ? 1046 LEU A CA    1 
ATOM   8431  C  C     . LEU C 3  1046 ? 19.333  -87.137  54.389  1.00 47.45  ? 1046 LEU A C     1 
ATOM   8432  O  O     . LEU C 3  1046 ? 19.710  -85.983  54.212  1.00 47.40  ? 1046 LEU A O     1 
ATOM   8433  C  CB    . LEU C 3  1046 ? 19.550  -88.849  56.197  1.00 43.72  ? 1046 LEU A CB    1 
ATOM   8434  C  CG    . LEU C 3  1046 ? 19.115  -89.431  57.547  1.00 41.39  ? 1046 LEU A CG    1 
ATOM   8435  C  CD1   . LEU C 3  1046 ? 19.738  -90.784  57.708  1.00 43.15  ? 1046 LEU A CD1   1 
ATOM   8436  C  CD2   . LEU C 3  1046 ? 19.515  -88.522  58.691  1.00 37.57  ? 1046 LEU A CD2   1 
ATOM   8437  N  N     . SER C 3  1047 ? 19.350  -88.051  53.428  1.00 51.09  ? 1047 SER A N     1 
ATOM   8438  C  CA    . SER C 3  1047 ? 19.815  -87.722  52.085  1.00 55.74  ? 1047 SER A CA    1 
ATOM   8439  C  C     . SER C 3  1047 ? 19.327  -86.323  51.710  1.00 55.60  ? 1047 SER A C     1 
ATOM   8440  O  O     . SER C 3  1047 ? 20.022  -85.566  51.023  1.00 54.29  ? 1047 SER A O     1 
ATOM   8441  C  CB    . SER C 3  1047 ? 19.277  -88.753  51.079  1.00 60.50  ? 1047 SER A CB    1 
ATOM   8442  O  OG    . SER C 3  1047 ? 19.404  -88.296  49.738  1.00 66.79  ? 1047 SER A OG    1 
ATOM   8443  N  N     . ASN C 3  1048 ? 18.132  -85.994  52.196  1.00 55.99  ? 1048 ASN A N     1 
ATOM   8444  C  CA    . ASN C 3  1048 ? 17.491  -84.712  51.934  1.00 56.45  ? 1048 ASN A CA    1 
ATOM   8445  C  C     . ASN C 3  1048 ? 18.252  -83.557  52.581  1.00 54.21  ? 1048 ASN A C     1 
ATOM   8446  O  O     . ASN C 3  1048 ? 18.760  -82.677  51.890  1.00 53.87  ? 1048 ASN A O     1 
ATOM   8447  C  CB    . ASN C 3  1048 ? 16.045  -84.758  52.437  1.00 60.95  ? 1048 ASN A CB    1 
ATOM   8448  C  CG    . ASN C 3  1048 ? 15.157  -83.735  51.760  1.00 64.73  ? 1048 ASN A CG    1 
ATOM   8449  O  OD1   . ASN C 3  1048 ? 15.274  -82.534  52.007  1.00 68.54  ? 1048 ASN A OD1   1 
ATOM   8450  N  ND2   . ASN C 3  1048 ? 14.263  -84.208  50.891  1.00 63.96  ? 1048 ASN A ND2   1 
ATOM   8451  N  N     . ILE C 3  1049 ? 18.334  -83.553  53.904  1.00 52.48  ? 1049 ILE A N     1 
ATOM   8452  C  CA    . ILE C 3  1049 ? 19.063  -82.496  54.587  1.00 50.06  ? 1049 ILE A CA    1 
ATOM   8453  C  C     . ILE C 3  1049 ? 20.386  -82.228  53.877  1.00 49.80  ? 1049 ILE A C     1 
ATOM   8454  O  O     . ILE C 3  1049 ? 20.626  -81.111  53.433  1.00 49.55  ? 1049 ILE A O     1 
ATOM   8455  C  CB    . ILE C 3  1049 ? 19.362  -82.862  56.054  1.00 47.41  ? 1049 ILE A CB    1 
ATOM   8456  C  CG1   . ILE C 3  1049 ? 18.053  -83.053  56.816  1.00 44.69  ? 1049 ILE A CG1   1 
ATOM   8457  C  CG2   . ILE C 3  1049 ? 20.194  -81.772  56.703  1.00 45.91  ? 1049 ILE A CG2   1 
ATOM   8458  C  CD1   . ILE C 3  1049 ? 18.241  -83.391  58.269  1.00 41.84  ? 1049 ILE A CD1   1 
ATOM   8459  N  N     . GLU C 3  1050 ? 21.234  -83.247  53.751  1.00 49.11  ? 1050 GLU A N     1 
ATOM   8460  C  CA    . GLU C 3  1050 ? 22.519  -83.051  53.093  1.00 51.04  ? 1050 GLU A CA    1 
ATOM   8461  C  C     . GLU C 3  1050 ? 22.410  -82.123  51.903  1.00 49.49  ? 1050 GLU A C     1 
ATOM   8462  O  O     . GLU C 3  1050 ? 22.964  -81.027  51.900  1.00 48.07  ? 1050 GLU A O     1 
ATOM   8463  C  CB    . GLU C 3  1050 ? 23.135  -84.376  52.617  1.00 56.81  ? 1050 GLU A CB    1 
ATOM   8464  C  CG    . GLU C 3  1050 ? 24.213  -84.168  51.517  1.00 65.61  ? 1050 GLU A CG    1 
ATOM   8465  C  CD    . GLU C 3  1050 ? 25.134  -85.367  51.284  1.00 69.65  ? 1050 GLU A CD    1 
ATOM   8466  O  OE1   . GLU C 3  1050 ? 24.648  -86.522  51.346  1.00 72.74  ? 1050 GLU A OE1   1 
ATOM   8467  O  OE2   . GLU C 3  1050 ? 26.342  -85.145  51.019  1.00 67.88  ? 1050 GLU A OE2   1 
ATOM   8468  N  N     . ALA C 3  1051 ? 21.691  -82.573  50.886  1.00 49.86  ? 1051 ALA A N     1 
ATOM   8469  C  CA    . ALA C 3  1051 ? 21.528  -81.784  49.678  1.00 50.10  ? 1051 ALA A CA    1 
ATOM   8470  C  C     . ALA C 3  1051 ? 21.131  -80.345  49.988  1.00 48.90  ? 1051 ALA A C     1 
ATOM   8471  O  O     . ALA C 3  1051 ? 21.832  -79.406  49.603  1.00 50.30  ? 1051 ALA A O     1 
ATOM   8472  C  CB    . ALA C 3  1051 ? 20.498  -82.433  48.766  1.00 51.86  ? 1051 ALA A CB    1 
ATOM   8473  N  N     . GLN C 3  1052 ? 20.016  -80.164  50.687  1.00 46.42  ? 1052 GLN A N     1 
ATOM   8474  C  CA    . GLN C 3  1052 ? 19.576  -78.817  51.009  1.00 43.62  ? 1052 GLN A CA    1 
ATOM   8475  C  C     . GLN C 3  1052 ? 20.711  -77.987  51.597  1.00 41.31  ? 1052 GLN A C     1 
ATOM   8476  O  O     . GLN C 3  1052 ? 20.994  -76.881  51.125  1.00 39.37  ? 1052 GLN A O     1 
ATOM   8477  C  CB    . GLN C 3  1052 ? 18.385  -78.858  51.964  1.00 42.17  ? 1052 GLN A CB    1 
ATOM   8478  C  CG    . GLN C 3  1052 ? 17.080  -79.067  51.241  1.00 43.43  ? 1052 GLN A CG    1 
ATOM   8479  C  CD    . GLN C 3  1052 ? 15.903  -78.558  52.036  1.00 51.23  ? 1052 GLN A CD    1 
ATOM   8480  O  OE1   . GLN C 3  1052 ? 15.919  -77.427  52.536  1.00 54.96  ? 1052 GLN A OE1   1 
ATOM   8481  N  NE2   . GLN C 3  1052 ? 14.864  -79.382  52.153  1.00 54.49  ? 1052 GLN A NE2   1 
ATOM   8482  N  N     . PHE C 3  1053 ? 21.372  -78.533  52.614  1.00 39.74  ? 1053 PHE A N     1 
ATOM   8483  C  CA    . PHE C 3  1053 ? 22.479  -77.840  53.259  1.00 36.76  ? 1053 PHE A CA    1 
ATOM   8484  C  C     . PHE C 3  1053 ? 23.389  -77.309  52.174  1.00 36.25  ? 1053 PHE A C     1 
ATOM   8485  O  O     . PHE C 3  1053 ? 23.543  -76.102  51.988  1.00 36.05  ? 1053 PHE A O     1 
ATOM   8486  C  CB    . PHE C 3  1053 ? 23.268  -78.792  54.145  1.00 31.31  ? 1053 PHE A CB    1 
ATOM   8487  C  CG    . PHE C 3  1053 ? 24.297  -78.108  54.964  1.00 31.02  ? 1053 PHE A CG    1 
ATOM   8488  C  CD1   . PHE C 3  1053 ? 23.970  -77.568  56.198  1.00 32.74  ? 1053 PHE A CD1   1 
ATOM   8489  C  CD2   . PHE C 3  1053 ? 25.582  -77.929  54.475  1.00 32.23  ? 1053 PHE A CD2   1 
ATOM   8490  C  CE1   . PHE C 3  1053 ? 24.913  -76.850  56.936  1.00 31.79  ? 1053 PHE A CE1   1 
ATOM   8491  C  CE2   . PHE C 3  1053 ? 26.534  -77.214  55.205  1.00 33.09  ? 1053 PHE A CE2   1 
ATOM   8492  C  CZ    . PHE C 3  1053 ? 26.195  -76.672  56.436  1.00 31.12  ? 1053 PHE A CZ    1 
ATOM   8493  N  N     . LEU C 3  1054 ? 23.976  -78.242  51.446  1.00 36.61  ? 1054 LEU A N     1 
ATOM   8494  C  CA    . LEU C 3  1054 ? 24.869  -77.923  50.350  1.00 38.38  ? 1054 LEU A CA    1 
ATOM   8495  C  C     . LEU C 3  1054 ? 24.297  -76.818  49.456  1.00 38.68  ? 1054 LEU A C     1 
ATOM   8496  O  O     . LEU C 3  1054 ? 25.055  -76.084  48.808  1.00 38.69  ? 1054 LEU A O     1 
ATOM   8497  C  CB    . LEU C 3  1054 ? 25.123  -79.194  49.533  1.00 39.63  ? 1054 LEU A CB    1 
ATOM   8498  C  CG    . LEU C 3  1054 ? 25.717  -80.333  50.366  1.00 38.77  ? 1054 LEU A CG    1 
ATOM   8499  C  CD1   . LEU C 3  1054 ? 25.581  -81.647  49.646  1.00 42.53  ? 1054 LEU A CD1   1 
ATOM   8500  C  CD2   . LEU C 3  1054 ? 27.164  -80.025  50.655  1.00 39.54  ? 1054 LEU A CD2   1 
ATOM   8501  N  N     . ARG C 3  1055 ? 22.967  -76.697  49.425  1.00 37.65  ? 1055 ARG A N     1 
ATOM   8502  C  CA    . ARG C 3  1055 ? 22.316  -75.678  48.597  1.00 35.34  ? 1055 ARG A CA    1 
ATOM   8503  C  C     . ARG C 3  1055 ? 22.241  -74.351  49.321  1.00 32.21  ? 1055 ARG A C     1 
ATOM   8504  O  O     . ARG C 3  1055 ? 22.045  -73.304  48.708  1.00 31.01  ? 1055 ARG A O     1 
ATOM   8505  C  CB    . ARG C 3  1055 ? 20.890  -76.087  48.211  1.00 35.81  ? 1055 ARG A CB    1 
ATOM   8506  C  CG    . ARG C 3  1055 ? 20.753  -77.390  47.457  1.00 41.54  ? 1055 ARG A CG    1 
ATOM   8507  C  CD    . ARG C 3  1055 ? 19.593  -77.298  46.472  1.00 47.92  ? 1055 ARG A CD    1 
ATOM   8508  N  NE    . ARG C 3  1055 ? 18.584  -78.348  46.623  1.00 50.51  ? 1055 ARG A NE    1 
ATOM   8509  C  CZ    . ARG C 3  1055 ? 17.465  -78.220  47.332  1.00 52.36  ? 1055 ARG A CZ    1 
ATOM   8510  N  NH1   . ARG C 3  1055 ? 17.200  -77.082  47.968  1.00 49.58  ? 1055 ARG A NH1   1 
ATOM   8511  N  NH2   . ARG C 3  1055 ? 16.599  -79.227  47.389  1.00 53.33  ? 1055 ARG A NH2   1 
ATOM   8512  N  N     . SER C 3  1056 ? 22.400  -74.387  50.630  1.00 28.11  ? 1056 SER A N     1 
ATOM   8513  C  CA    . SER C 3  1056 ? 22.304  -73.165  51.379  1.00 29.75  ? 1056 SER A CA    1 
ATOM   8514  C  C     . SER C 3  1056 ? 23.623  -72.438  51.508  1.00 30.91  ? 1056 SER A C     1 
ATOM   8515  O  O     . SER C 3  1056 ? 23.688  -71.367  52.109  1.00 31.76  ? 1056 SER A O     1 
ATOM   8516  C  CB    . SER C 3  1056 ? 21.704  -73.456  52.750  1.00 32.76  ? 1056 SER A CB    1 
ATOM   8517  O  OG    . SER C 3  1056 ? 20.362  -73.920  52.625  1.00 38.05  ? 1056 SER A OG    1 
ATOM   8518  N  N     . VAL C 3  1057 ? 24.677  -72.997  50.922  1.00 32.43  ? 1057 VAL A N     1 
ATOM   8519  C  CA    . VAL C 3  1057 ? 26.000  -72.364  50.995  1.00 31.74  ? 1057 VAL A CA    1 
ATOM   8520  C  C     . VAL C 3  1057 ? 26.080  -71.159  50.067  1.00 31.99  ? 1057 VAL A C     1 
ATOM   8521  O  O     . VAL C 3  1057 ? 25.437  -71.142  49.018  1.00 33.64  ? 1057 VAL A O     1 
ATOM   8522  C  CB    . VAL C 3  1057 ? 27.130  -73.325  50.575  1.00 29.41  ? 1057 VAL A CB    1 
ATOM   8523  C  CG1   . VAL C 3  1057 ? 28.371  -73.032  51.384  1.00 27.27  ? 1057 VAL A CG1   1 
ATOM   8524  C  CG2   . VAL C 3  1057 ? 26.694  -74.760  50.733  1.00 29.82  ? 1057 VAL A CG2   1 
ATOM   8525  N  N     . VAL C 3  1058 ? 26.874  -70.161  50.446  1.00 31.91  ? 1058 VAL A N     1 
ATOM   8526  C  CA    . VAL C 3  1058 ? 27.041  -68.965  49.619  1.00 32.85  ? 1058 VAL A CA    1 
ATOM   8527  C  C     . VAL C 3  1058 ? 27.840  -69.305  48.361  1.00 32.35  ? 1058 VAL A C     1 
ATOM   8528  O  O     . VAL C 3  1058 ? 28.672  -70.218  48.368  1.00 32.54  ? 1058 VAL A O     1 
ATOM   8529  C  CB    . VAL C 3  1058 ? 27.786  -67.852  50.384  1.00 32.42  ? 1058 VAL A CB    1 
ATOM   8530  C  CG1   . VAL C 3  1058 ? 27.975  -66.649  49.497  1.00 32.16  ? 1058 VAL A CG1   1 
ATOM   8531  C  CG2   . VAL C 3  1058 ? 27.007  -67.459  51.608  1.00 31.89  ? 1058 VAL A CG2   1 
ATOM   8532  N  N     . HIS C 3  1059 ? 27.591  -68.586  47.274  1.00 30.13  ? 1059 HIS A N     1 
ATOM   8533  C  CA    . HIS C 3  1059 ? 28.328  -68.870  46.057  1.00 31.11  ? 1059 HIS A CA    1 
ATOM   8534  C  C     . HIS C 3  1059 ? 29.471  -67.881  45.870  1.00 30.65  ? 1059 HIS A C     1 
ATOM   8535  O  O     . HIS C 3  1059 ? 29.270  -66.682  45.994  1.00 30.78  ? 1059 HIS A O     1 
ATOM   8536  C  CB    . HIS C 3  1059 ? 27.411  -68.799  44.834  1.00 33.09  ? 1059 HIS A CB    1 
ATOM   8537  C  CG    . HIS C 3  1059 ? 26.338  -69.847  44.800  1.00 36.74  ? 1059 HIS A CG    1 
ATOM   8538  N  ND1   . HIS C 3  1059 ? 25.836  -70.354  43.618  1.00 36.70  ? 1059 HIS A ND1   1 
ATOM   8539  C  CD2   . HIS C 3  1059 ? 25.648  -70.460  45.793  1.00 38.52  ? 1059 HIS A CD2   1 
ATOM   8540  C  CE1   . HIS C 3  1059 ? 24.887  -71.234  43.885  1.00 39.29  ? 1059 HIS A CE1   1 
ATOM   8541  N  NE2   . HIS C 3  1059 ? 24.753  -71.317  45.197  1.00 40.18  ? 1059 HIS A NE2   1 
ATOM   8542  N  N     . PRO C 3  1060 ? 30.692  -68.372  45.586  1.00 30.09  ? 1060 PRO A N     1 
ATOM   8543  C  CA    . PRO C 3  1060 ? 31.827  -67.471  45.385  1.00 29.79  ? 1060 PRO A CA    1 
ATOM   8544  C  C     . PRO C 3  1060 ? 31.419  -66.570  44.247  1.00 30.79  ? 1060 PRO A C     1 
ATOM   8545  O  O     . PRO C 3  1060 ? 31.094  -67.059  43.160  1.00 31.27  ? 1060 PRO A O     1 
ATOM   8546  C  CB    . PRO C 3  1060 ? 32.955  -68.405  44.965  1.00 29.55  ? 1060 PRO A CB    1 
ATOM   8547  C  CG    . PRO C 3  1060 ? 32.627  -69.658  45.657  1.00 32.95  ? 1060 PRO A CG    1 
ATOM   8548  C  CD    . PRO C 3  1060 ? 31.122  -69.772  45.470  1.00 31.52  ? 1060 PRO A CD    1 
ATOM   8549  N  N     . GLY C 3  1061 ? 31.433  -65.266  44.500  1.00 30.62  ? 1061 GLY A N     1 
ATOM   8550  C  CA    . GLY C 3  1061 ? 31.035  -64.293  43.499  1.00 28.87  ? 1061 GLY A CA    1 
ATOM   8551  C  C     . GLY C 3  1061 ? 30.081  -63.338  44.174  1.00 28.50  ? 1061 GLY A C     1 
ATOM   8552  O  O     . GLY C 3  1061 ? 30.104  -62.134  43.918  1.00 26.40  ? 1061 GLY A O     1 
ATOM   8553  N  N     . GLU C 3  1062 ? 29.249  -63.899  45.053  1.00 29.07  ? 1062 GLU A N     1 
ATOM   8554  C  CA    . GLU C 3  1062 ? 28.266  -63.140  45.806  1.00 28.27  ? 1062 GLU A CA    1 
ATOM   8555  C  C     . GLU C 3  1062 ? 28.958  -61.923  46.322  1.00 27.71  ? 1062 GLU A C     1 
ATOM   8556  O  O     . GLU C 3  1062 ? 29.890  -62.025  47.103  1.00 29.98  ? 1062 GLU A O     1 
ATOM   8557  C  CB    . GLU C 3  1062 ? 27.741  -63.943  46.980  1.00 28.89  ? 1062 GLU A CB    1 
ATOM   8558  C  CG    . GLU C 3  1062 ? 26.403  -64.594  46.730  1.00 36.65  ? 1062 GLU A CG    1 
ATOM   8559  C  CD    . GLU C 3  1062 ? 25.298  -63.580  46.500  1.00 40.64  ? 1062 GLU A CD    1 
ATOM   8560  O  OE1   . GLU C 3  1062 ? 25.321  -62.499  47.128  1.00 42.24  ? 1062 GLU A OE1   1 
ATOM   8561  O  OE2   . GLU C 3  1062 ? 24.389  -63.872  45.702  1.00 45.52  ? 1062 GLU A OE2   1 
ATOM   8562  N  N     . MET C 3  1063 ? 28.500  -60.771  45.863  1.00 26.22  ? 1063 MET A N     1 
ATOM   8563  C  CA    . MET C 3  1063 ? 29.071  -59.512  46.260  1.00 24.60  ? 1063 MET A CA    1 
ATOM   8564  C  C     . MET C 3  1063 ? 28.512  -59.043  47.587  1.00 23.53  ? 1063 MET A C     1 
ATOM   8565  O  O     . MET C 3  1063 ? 27.698  -58.129  47.630  1.00 25.12  ? 1063 MET A O     1 
ATOM   8566  C  CB    . MET C 3  1063 ? 28.794  -58.495  45.170  1.00 27.83  ? 1063 MET A CB    1 
ATOM   8567  C  CG    . MET C 3  1063 ? 29.534  -58.814  43.887  1.00 36.95  ? 1063 MET A CG    1 
ATOM   8568  S  SD    . MET C 3  1063 ? 31.313  -59.046  44.196  1.00 46.57  ? 1063 MET A SD    1 
ATOM   8569  C  CE    . MET C 3  1063 ? 31.749  -57.416  44.907  1.00 41.84  ? 1063 MET A CE    1 
ATOM   8570  N  N     . VAL C 3  1064 ? 28.970  -59.647  48.677  1.00 21.31  ? 1064 VAL A N     1 
ATOM   8571  C  CA    . VAL C 3  1064 ? 28.468  -59.275  49.988  1.00 22.34  ? 1064 VAL A CA    1 
ATOM   8572  C  C     . VAL C 3  1064 ? 28.737  -57.849  50.420  1.00 21.14  ? 1064 VAL A C     1 
ATOM   8573  O  O     . VAL C 3  1064 ? 27.981  -57.283  51.203  1.00 19.77  ? 1064 VAL A O     1 
ATOM   8574  C  CB    . VAL C 3  1064 ? 29.025  -60.137  51.087  1.00 25.11  ? 1064 VAL A CB    1 
ATOM   8575  C  CG1   . VAL C 3  1064 ? 28.133  -59.963  52.307  1.00 27.76  ? 1064 VAL A CG1   1 
ATOM   8576  C  CG2   . VAL C 3  1064 ? 29.127  -61.589  50.642  1.00 26.58  ? 1064 VAL A CG2   1 
ATOM   8577  N  N     . GLY C 3  1065 ? 29.832  -57.279  49.944  1.00 21.60  ? 1065 GLY A N     1 
ATOM   8578  C  CA    . GLY C 3  1065 ? 30.139  -55.916  50.309  1.00 21.78  ? 1065 GLY A CA    1 
ATOM   8579  C  C     . GLY C 3  1065 ? 28.900  -55.071  50.114  1.00 21.86  ? 1065 GLY A C     1 
ATOM   8580  O  O     . GLY C 3  1065 ? 28.300  -54.575  51.070  1.00 21.03  ? 1065 GLY A O     1 
ATOM   8581  N  N     . VAL C 3  1066 ? 28.498  -54.911  48.864  1.00 20.88  ? 1066 VAL A N     1 
ATOM   8582  C  CA    . VAL C 3  1066 ? 27.319  -54.120  48.597  1.00 21.86  ? 1066 VAL A CA    1 
ATOM   8583  C  C     . VAL C 3  1066 ? 26.102  -54.745  49.275  1.00 23.69  ? 1066 VAL A C     1 
ATOM   8584  O  O     . VAL C 3  1066 ? 25.454  -54.117  50.119  1.00 23.78  ? 1066 VAL A O     1 
ATOM   8585  C  CB    . VAL C 3  1066 ? 27.074  -54.021  47.100  1.00 17.92  ? 1066 VAL A CB    1 
ATOM   8586  C  CG1   . VAL C 3  1066 ? 25.764  -53.351  46.834  1.00 19.20  ? 1066 VAL A CG1   1 
ATOM   8587  C  CG2   . VAL C 3  1066 ? 28.172  -53.238  46.472  1.00 16.15  ? 1066 VAL A CG2   1 
ATOM   8588  N  N     . LEU C 3  1067 ? 25.810  -55.994  48.930  1.00 23.53  ? 1067 LEU A N     1 
ATOM   8589  C  CA    . LEU C 3  1067 ? 24.649  -56.663  49.495  1.00 27.16  ? 1067 LEU A CA    1 
ATOM   8590  C  C     . LEU C 3  1067 ? 24.396  -56.292  50.940  1.00 29.73  ? 1067 LEU A C     1 
ATOM   8591  O  O     . LEU C 3  1067 ? 23.251  -56.267  51.387  1.00 32.63  ? 1067 LEU A O     1 
ATOM   8592  C  CB    . LEU C 3  1067 ? 24.777  -58.180  49.411  1.00 26.79  ? 1067 LEU A CB    1 
ATOM   8593  C  CG    . LEU C 3  1067 ? 23.542  -58.869  50.003  1.00 27.39  ? 1067 LEU A CG    1 
ATOM   8594  C  CD1   . LEU C 3  1067 ? 22.403  -58.772  49.035  1.00 28.09  ? 1067 LEU A CD1   1 
ATOM   8595  C  CD2   . LEU C 3  1067 ? 23.836  -60.319  50.275  1.00 36.11  ? 1067 LEU A CD2   1 
ATOM   8596  N  N     . ALA C 3  1068 ? 25.460  -56.016  51.679  1.00 29.55  ? 1068 ALA A N     1 
ATOM   8597  C  CA    . ALA C 3  1068 ? 25.292  -55.672  53.073  1.00 29.83  ? 1068 ALA A CA    1 
ATOM   8598  C  C     . ALA C 3  1068 ? 25.030  -54.195  53.185  1.00 29.61  ? 1068 ALA A C     1 
ATOM   8599  O  O     . ALA C 3  1068 ? 24.030  -53.773  53.750  1.00 30.26  ? 1068 ALA A O     1 
ATOM   8600  C  CB    . ALA C 3  1068 ? 26.525  -56.050  53.857  1.00 30.86  ? 1068 ALA A CB    1 
ATOM   8601  N  N     . ALA C 3  1069 ? 25.936  -53.405  52.641  1.00 29.89  ? 1069 ALA A N     1 
ATOM   8602  C  CA    . ALA C 3  1069 ? 25.786  -51.965  52.691  1.00 33.67  ? 1069 ALA A CA    1 
ATOM   8603  C  C     . ALA C 3  1069 ? 24.322  -51.567  52.495  1.00 35.67  ? 1069 ALA A C     1 
ATOM   8604  O  O     . ALA C 3  1069 ? 23.754  -50.804  53.287  1.00 34.47  ? 1069 ALA A O     1 
ATOM   8605  C  CB    . ALA C 3  1069 ? 26.650  -51.329  51.613  1.00 36.44  ? 1069 ALA A CB    1 
ATOM   8606  N  N     . GLN C 3  1070 ? 23.716  -52.103  51.436  1.00 37.02  ? 1070 GLN A N     1 
ATOM   8607  C  CA    . GLN C 3  1070 ? 22.327  -51.804  51.102  1.00 35.76  ? 1070 GLN A CA    1 
ATOM   8608  C  C     . GLN C 3  1070 ? 21.357  -52.377  52.120  1.00 35.94  ? 1070 GLN A C     1 
ATOM   8609  O  O     . GLN C 3  1070 ? 20.418  -51.698  52.531  1.00 36.91  ? 1070 GLN A O     1 
ATOM   8610  C  CB    . GLN C 3  1070 ? 21.990  -52.336  49.712  1.00 34.25  ? 1070 GLN A CB    1 
ATOM   8611  C  CG    . GLN C 3  1070 ? 22.919  -51.827  48.640  1.00 33.99  ? 1070 GLN A CG    1 
ATOM   8612  C  CD    . GLN C 3  1070 ? 22.478  -52.233  47.259  1.00 37.25  ? 1070 GLN A CD    1 
ATOM   8613  O  OE1   . GLN C 3  1070 ? 22.257  -53.408  46.995  1.00 41.55  ? 1070 GLN A OE1   1 
ATOM   8614  N  NE2   . GLN C 3  1070 ? 22.349  -51.261  46.363  1.00 36.60  ? 1070 GLN A NE2   1 
ATOM   8615  N  N     . SER C 3  1071 ? 21.583  -53.624  52.528  1.00 34.57  ? 1071 SER A N     1 
ATOM   8616  C  CA    . SER C 3  1071 ? 20.716  -54.260  53.509  1.00 32.40  ? 1071 SER A CA    1 
ATOM   8617  C  C     . SER C 3  1071 ? 20.614  -53.418  54.782  1.00 33.32  ? 1071 SER A C     1 
ATOM   8618  O  O     . SER C 3  1071 ? 19.690  -53.597  55.573  1.00 33.82  ? 1071 SER A O     1 
ATOM   8619  C  CB    . SER C 3  1071 ? 21.230  -55.658  53.837  1.00 28.42  ? 1071 SER A CB    1 
ATOM   8620  O  OG    . SER C 3  1071 ? 21.180  -56.468  52.682  1.00 26.77  ? 1071 SER A OG    1 
ATOM   8621  N  N     . ILE C 3  1072 ? 21.557  -52.499  54.986  1.00 33.37  ? 1072 ILE A N     1 
ATOM   8622  C  CA    . ILE C 3  1072 ? 21.507  -51.639  56.163  1.00 33.23  ? 1072 ILE A CA    1 
ATOM   8623  C  C     . ILE C 3  1072 ? 20.998  -50.259  55.782  1.00 34.38  ? 1072 ILE A C     1 
ATOM   8624  O  O     . ILE C 3  1072 ? 20.252  -49.629  56.526  1.00 33.38  ? 1072 ILE A O     1 
ATOM   8625  C  CB    . ILE C 3  1072 ? 22.875  -51.469  56.818  1.00 31.25  ? 1072 ILE A CB    1 
ATOM   8626  C  CG1   . ILE C 3  1072 ? 23.420  -52.832  57.241  1.00 30.17  ? 1072 ILE A CG1   1 
ATOM   8627  C  CG2   . ILE C 3  1072 ? 22.743  -50.541  58.017  1.00 26.89  ? 1072 ILE A CG2   1 
ATOM   8628  C  CD1   . ILE C 3  1072 ? 24.750  -52.773  57.964  1.00 32.01  ? 1072 ILE A CD1   1 
ATOM   8629  N  N     . GLY C 3  1073 ? 21.405  -49.787  54.614  1.00 36.51  ? 1073 GLY A N     1 
ATOM   8630  C  CA    . GLY C 3  1073 ? 20.962  -48.479  54.176  1.00 39.75  ? 1073 GLY A CA    1 
ATOM   8631  C  C     . GLY C 3  1073 ? 19.457  -48.385  53.982  1.00 40.80  ? 1073 GLY A C     1 
ATOM   8632  O  O     . GLY C 3  1073 ? 18.837  -47.397  54.380  1.00 42.73  ? 1073 GLY A O     1 
ATOM   8633  N  N     . GLU C 3  1074 ? 18.870  -49.410  53.369  1.00 39.68  ? 1074 GLU A N     1 
ATOM   8634  C  CA    . GLU C 3  1074 ? 17.439  -49.431  53.108  1.00 38.29  ? 1074 GLU A CA    1 
ATOM   8635  C  C     . GLU C 3  1074 ? 16.633  -49.312  54.394  1.00 37.92  ? 1074 GLU A C     1 
ATOM   8636  O  O     . GLU C 3  1074 ? 16.100  -48.254  54.694  1.00 35.21  ? 1074 GLU A O     1 
ATOM   8637  C  CB    . GLU C 3  1074 ? 17.062  -50.714  52.365  1.00 39.23  ? 1074 GLU A CB    1 
ATOM   8638  C  CG    . GLU C 3  1074 ? 15.796  -50.639  51.518  1.00 45.27  ? 1074 GLU A CG    1 
ATOM   8639  C  CD    . GLU C 3  1074 ? 14.497  -50.866  52.285  1.00 50.93  ? 1074 GLU A CD    1 
ATOM   8640  O  OE1   . GLU C 3  1074 ? 14.484  -51.659  53.257  1.00 53.19  ? 1074 GLU A OE1   1 
ATOM   8641  O  OE2   . GLU C 3  1074 ? 13.471  -50.264  51.884  1.00 53.38  ? 1074 GLU A OE2   1 
ATOM   8642  N  N     . PRO C 3  1075 ? 16.564  -50.384  55.197  1.00 39.98  ? 1075 PRO A N     1 
ATOM   8643  C  CA    . PRO C 3  1075 ? 15.776  -50.242  56.418  1.00 40.98  ? 1075 PRO A CA    1 
ATOM   8644  C  C     . PRO C 3  1075 ? 16.121  -49.007  57.213  1.00 41.65  ? 1075 PRO A C     1 
ATOM   8645  O  O     . PRO C 3  1075 ? 15.439  -48.688  58.173  1.00 43.59  ? 1075 PRO A O     1 
ATOM   8646  C  CB    . PRO C 3  1075 ? 16.058  -51.540  57.170  1.00 39.99  ? 1075 PRO A CB    1 
ATOM   8647  C  CG    . PRO C 3  1075 ? 17.431  -51.887  56.734  1.00 41.34  ? 1075 PRO A CG    1 
ATOM   8648  C  CD    . PRO C 3  1075 ? 17.386  -51.607  55.255  1.00 41.83  ? 1075 PRO A CD    1 
ATOM   8649  N  N     . ALA C 3  1076 ? 17.171  -48.308  56.809  1.00 43.37  ? 1076 ALA A N     1 
ATOM   8650  C  CA    . ALA C 3  1076 ? 17.565  -47.093  57.502  1.00 48.42  ? 1076 ALA A CA    1 
ATOM   8651  C  C     . ALA C 3  1076 ? 16.699  -45.941  57.012  1.00 51.70  ? 1076 ALA A C     1 
ATOM   8652  O  O     . ALA C 3  1076 ? 16.292  -45.081  57.785  1.00 50.52  ? 1076 ALA A O     1 
ATOM   8653  C  CB    . ALA C 3  1076 ? 19.033  -46.797  57.244  1.00 48.29  ? 1076 ALA A CB    1 
ATOM   8654  N  N     . THR C 3  1077 ? 16.415  -45.944  55.717  1.00 58.18  ? 1077 THR A N     1 
ATOM   8655  C  CA    . THR C 3  1077 ? 15.598  -44.911  55.096  1.00 64.96  ? 1077 THR A CA    1 
ATOM   8656  C  C     . THR C 3  1077 ? 14.119  -45.165  55.361  1.00 69.27  ? 1077 THR A C     1 
ATOM   8657  O  O     . THR C 3  1077 ? 13.249  -44.623  54.684  1.00 69.29  ? 1077 THR A O     1 
ATOM   8658  C  CB    . THR C 3  1077 ? 15.810  -44.885  53.585  1.00 66.03  ? 1077 THR A CB    1 
ATOM   8659  O  OG1   . THR C 3  1077 ? 17.084  -45.464  53.271  1.00 65.64  ? 1077 THR A OG1   1 
ATOM   8660  C  CG2   . THR C 3  1077 ? 15.773  -43.444  53.083  1.00 70.80  ? 1077 THR A CG2   1 
ATOM   8661  N  N     . GLN C 3  1078 ? 13.849  -46.013  56.344  1.00 74.71  ? 1078 GLN A N     1 
ATOM   8662  C  CA    . GLN C 3  1078 ? 12.489  -46.351  56.724  1.00 80.30  ? 1078 GLN A CA    1 
ATOM   8663  C  C     . GLN C 3  1078 ? 12.308  -45.833  58.134  1.00 83.70  ? 1078 GLN A C     1 
ATOM   8664  O  O     . GLN C 3  1078 ? 11.233  -45.937  58.716  1.00 85.29  ? 1078 GLN A O     1 
ATOM   8665  C  CB    . GLN C 3  1078 ? 12.294  -47.867  56.710  1.00 82.39  ? 1078 GLN A CB    1 
ATOM   8666  C  CG    . GLN C 3  1078 ? 12.601  -48.514  55.380  1.00 86.38  ? 1078 GLN A CG    1 
ATOM   8667  C  CD    . GLN C 3  1078 ? 11.658  -48.059  54.299  1.00 90.39  ? 1078 GLN A CD    1 
ATOM   8668  O  OE1   . GLN C 3  1078 ? 10.500  -48.481  54.257  1.00 94.14  ? 1078 GLN A OE1   1 
ATOM   8669  N  NE2   . GLN C 3  1078 ? 12.138  -47.179  53.421  1.00 91.41  ? 1078 GLN A NE2   1 
ATOM   8670  N  N     . MET C 3  1079 ? 13.377  -45.272  58.680  1.00 87.13  ? 1079 MET A N     1 
ATOM   8671  C  CA    . MET C 3  1079 ? 13.337  -44.757  60.034  1.00 92.83  ? 1079 MET A CA    1 
ATOM   8672  C  C     . MET C 3  1079 ? 12.974  -43.275  60.092  1.00 98.72  ? 1079 MET A C     1 
ATOM   8673  O  O     . MET C 3  1079 ? 13.591  -42.442  59.422  1.00 99.90  ? 1079 MET A O     1 
ATOM   8674  C  CB    . MET C 3  1079 ? 14.685  -44.999  60.724  1.00 90.32  ? 1079 MET A CB    1 
ATOM   8675  C  CG    . MET C 3  1079 ? 15.111  -46.468  60.767  1.00 86.08  ? 1079 MET A CG    1 
ATOM   8676  S  SD    . MET C 3  1079 ? 16.586  -46.787  61.770  1.00 78.13  ? 1079 MET A SD    1 
ATOM   8677  C  CE    . MET C 3  1079 ? 17.861  -46.085  60.759  1.00 77.62  ? 1079 MET A CE    1 
ATOM   8678  N  N     . THR C 3  1080 ? 11.956  -42.970  60.898  1.00 104.81 ? 1080 THR A N     1 
ATOM   8679  C  CA    . THR C 3  1080 ? 11.456  -41.608  61.112  1.00 109.73 ? 1080 THR A CA    1 
ATOM   8680  C  C     . THR C 3  1080 ? 10.511  -41.656  62.322  1.00 111.88 ? 1080 THR A C     1 
ATOM   8681  O  O     . THR C 3  1080 ? 9.551   -42.432  62.332  1.00 111.74 ? 1080 THR A O     1 
ATOM   8682  C  CB    . THR C 3  1080 ? 10.656  -41.065  59.875  1.00 111.50 ? 1080 THR A CB    1 
ATOM   8683  O  OG1   . THR C 3  1080 ? 11.482  -41.082  58.702  1.00 110.92 ? 1080 THR A OG1   1 
ATOM   8684  C  CG2   . THR C 3  1080 ? 10.189  -39.630  60.128  1.00 111.29 ? 1080 THR A CG2   1 
ATOM   8685  N  N     . LEU C 3  1081 ? 10.791  -40.844  63.340  1.00 114.61 ? 1081 LEU A N     1 
ATOM   8686  C  CA    . LEU C 3  1081 ? 9.950   -40.802  64.541  1.00 118.16 ? 1081 LEU A CA    1 
ATOM   8687  C  C     . LEU C 3  1081 ? 9.129   -39.515  64.621  1.00 118.85 ? 1081 LEU A C     1 
ATOM   8688  O  O     . LEU C 3  1081 ? 8.264   -39.368  65.491  1.00 119.59 ? 1081 LEU A O     1 
ATOM   8689  C  CB    . LEU C 3  1081 ? 10.804  -40.942  65.815  1.00 120.64 ? 1081 LEU A CB    1 
ATOM   8690  C  CG    . LEU C 3  1081 ? 10.891  -42.318  66.499  1.00 122.74 ? 1081 LEU A CG    1 
ATOM   8691  C  CD1   . LEU C 3  1081 ? 11.846  -42.231  67.685  1.00 123.30 ? 1081 LEU A CD1   1 
ATOM   8692  C  CD2   . LEU C 3  1081 ? 9.501   -42.775  66.962  1.00 122.98 ? 1081 LEU A CD2   1 
ATOM   8693  N  N     . LYS C 3  1092 ? 13.070  -43.829  78.228  1.00 115.93 ? 1092 LYS A N     1 
ATOM   8694  C  CA    . LYS C 3  1092 ? 12.890  -43.655  76.789  1.00 116.05 ? 1092 LYS A CA    1 
ATOM   8695  C  C     . LYS C 3  1092 ? 13.524  -42.338  76.312  1.00 114.18 ? 1092 LYS A C     1 
ATOM   8696  O  O     . LYS C 3  1092 ? 12.938  -41.611  75.504  1.00 114.04 ? 1092 LYS A O     1 
ATOM   8697  C  CB    . LYS C 3  1092 ? 11.391  -43.675  76.448  1.00 118.34 ? 1092 LYS A CB    1 
ATOM   8698  C  CG    . LYS C 3  1092 ? 10.652  -44.916  76.959  1.00 121.40 ? 1092 LYS A CG    1 
ATOM   8699  C  CD    . LYS C 3  1092 ? 9.203   -44.962  76.475  1.00 124.34 ? 1092 LYS A CD    1 
ATOM   8700  C  CE    . LYS C 3  1092 ? 8.483   -46.222  76.962  1.00 124.80 ? 1092 LYS A CE    1 
ATOM   8701  N  NZ    . LYS C 3  1092 ? 7.131   -46.386  76.343  1.00 124.16 ? 1092 LYS A NZ    1 
ATOM   8702  N  N     . LYS C 3  1093 ? 14.730  -42.048  76.806  1.00 111.58 ? 1093 LYS A N     1 
ATOM   8703  C  CA    . LYS C 3  1093 ? 15.433  -40.812  76.457  1.00 107.41 ? 1093 LYS A CA    1 
ATOM   8704  C  C     . LYS C 3  1093 ? 16.913  -41.003  76.082  1.00 103.82 ? 1093 LYS A C     1 
ATOM   8705  O  O     . LYS C 3  1093 ? 17.822  -40.518  76.764  1.00 101.18 ? 1093 LYS A O     1 
ATOM   8706  C  CB    . LYS C 3  1093 ? 15.302  -39.819  77.617  1.00 109.08 ? 1093 LYS A CB    1 
ATOM   8707  C  CG    . LYS C 3  1093 ? 13.852  -39.581  78.037  1.00 110.03 ? 1093 LYS A CG    1 
ATOM   8708  C  CD    . LYS C 3  1093 ? 13.734  -38.639  79.227  1.00 111.89 ? 1093 LYS A CD    1 
ATOM   8709  C  CE    . LYS C 3  1093 ? 12.272  -38.392  79.591  1.00 111.32 ? 1093 LYS A CE    1 
ATOM   8710  N  NZ    . LYS C 3  1093 ? 12.119  -37.395  80.689  1.00 111.31 ? 1093 LYS A NZ    1 
ATOM   8711  N  N     . VAL C 3  1094 ? 17.132  -41.708  74.976  1.00 100.61 ? 1094 VAL A N     1 
ATOM   8712  C  CA    . VAL C 3  1094 ? 18.470  -41.983  74.461  1.00 95.65  ? 1094 VAL A CA    1 
ATOM   8713  C  C     . VAL C 3  1094 ? 18.524  -41.561  72.985  1.00 92.09  ? 1094 VAL A C     1 
ATOM   8714  O  O     . VAL C 3  1094 ? 17.482  -41.357  72.341  1.00 92.70  ? 1094 VAL A O     1 
ATOM   8715  C  CB    . VAL C 3  1094 ? 18.796  -43.495  74.560  1.00 95.56  ? 1094 VAL A CB    1 
ATOM   8716  C  CG1   . VAL C 3  1094 ? 20.261  -43.739  74.264  1.00 94.46  ? 1094 VAL A CG1   1 
ATOM   8717  C  CG2   . VAL C 3  1094 ? 18.428  -44.017  75.938  1.00 96.39  ? 1094 VAL A CG2   1 
ATOM   8718  N  N     . THR C 3  1095 ? 19.732  -41.426  72.451  1.00 85.81  ? 1095 THR A N     1 
ATOM   8719  C  CA    . THR C 3  1095 ? 19.891  -41.041  71.057  1.00 79.89  ? 1095 THR A CA    1 
ATOM   8720  C  C     . THR C 3  1095 ? 19.789  -42.256  70.134  1.00 77.58  ? 1095 THR A C     1 
ATOM   8721  O  O     . THR C 3  1095 ? 20.674  -43.112  70.116  1.00 78.27  ? 1095 THR A O     1 
ATOM   8722  C  CB    . THR C 3  1095 ? 21.242  -40.354  70.831  1.00 78.08  ? 1095 THR A CB    1 
ATOM   8723  O  OG1   . THR C 3  1095 ? 21.225  -39.059  71.441  1.00 72.96  ? 1095 THR A OG1   1 
ATOM   8724  C  CG2   . THR C 3  1095 ? 21.521  -40.209  69.349  1.00 79.26  ? 1095 THR A CG2   1 
ATOM   8725  N  N     . SER C 3  1096 ? 18.706  -42.333  69.370  1.00 73.43  ? 1096 SER A N     1 
ATOM   8726  C  CA    . SER C 3  1096 ? 18.518  -43.451  68.461  1.00 69.00  ? 1096 SER A CA    1 
ATOM   8727  C  C     . SER C 3  1096 ? 18.291  -42.946  67.058  1.00 65.50  ? 1096 SER A C     1 
ATOM   8728  O  O     . SER C 3  1096 ? 18.545  -41.781  66.759  1.00 62.17  ? 1096 SER A O     1 
ATOM   8729  C  CB    . SER C 3  1096 ? 17.325  -44.315  68.901  1.00 70.45  ? 1096 SER A CB    1 
ATOM   8730  O  OG    . SER C 3  1096 ? 16.143  -43.545  69.075  1.00 71.69  ? 1096 SER A OG    1 
ATOM   8731  N  N     . GLY C 3  1097 ? 17.816  -43.842  66.202  1.00 63.77  ? 1097 GLY A N     1 
ATOM   8732  C  CA    . GLY C 3  1097 ? 17.535  -43.487  64.828  1.00 62.25  ? 1097 GLY A CA    1 
ATOM   8733  C  C     . GLY C 3  1097 ? 18.682  -42.807  64.117  1.00 60.10  ? 1097 GLY A C     1 
ATOM   8734  O  O     . GLY C 3  1097 ? 19.706  -42.508  64.724  1.00 59.43  ? 1097 GLY A O     1 
ATOM   8735  N  N     . VAL C 3  1098 ? 18.483  -42.554  62.827  1.00 58.46  ? 1098 VAL A N     1 
ATOM   8736  C  CA    . VAL C 3  1098 ? 19.475  -41.923  61.963  1.00 57.23  ? 1098 VAL A CA    1 
ATOM   8737  C  C     . VAL C 3  1098 ? 20.606  -41.177  62.676  1.00 56.65  ? 1098 VAL A C     1 
ATOM   8738  O  O     . VAL C 3  1098 ? 21.781  -41.538  62.542  1.00 55.67  ? 1098 VAL A O     1 
ATOM   8739  C  CB    . VAL C 3  1098 ? 18.798  -40.966  60.973  1.00 55.44  ? 1098 VAL A CB    1 
ATOM   8740  C  CG1   . VAL C 3  1098 ? 19.828  -40.394  60.031  1.00 55.66  ? 1098 VAL A CG1   1 
ATOM   8741  C  CG2   . VAL C 3  1098 ? 17.731  -41.703  60.195  1.00 56.11  ? 1098 VAL A CG2   1 
ATOM   8742  N  N     . PRO C 3  1099 ? 20.271  -40.127  63.444  1.00 55.92  ? 1099 PRO A N     1 
ATOM   8743  C  CA    . PRO C 3  1099 ? 21.339  -39.397  64.137  1.00 54.01  ? 1099 PRO A CA    1 
ATOM   8744  C  C     . PRO C 3  1099 ? 22.364  -40.342  64.767  1.00 51.82  ? 1099 PRO A C     1 
ATOM   8745  O  O     . PRO C 3  1099 ? 23.552  -40.283  64.463  1.00 51.45  ? 1099 PRO A O     1 
ATOM   8746  C  CB    . PRO C 3  1099 ? 20.573  -38.564  65.173  1.00 54.46  ? 1099 PRO A CB    1 
ATOM   8747  C  CG    . PRO C 3  1099 ? 19.278  -39.327  65.362  1.00 54.92  ? 1099 PRO A CG    1 
ATOM   8748  C  CD    . PRO C 3  1099 ? 18.949  -39.729  63.954  1.00 55.02  ? 1099 PRO A CD    1 
ATOM   8749  N  N     . ARG C 3  1100 ? 21.889  -41.226  65.632  1.00 49.83  ? 1100 ARG A N     1 
ATOM   8750  C  CA    . ARG C 3  1100 ? 22.752  -42.187  66.295  1.00 45.68  ? 1100 ARG A CA    1 
ATOM   8751  C  C     . ARG C 3  1100 ? 23.506  -43.050  65.294  1.00 43.19  ? 1100 ARG A C     1 
ATOM   8752  O  O     . ARG C 3  1100 ? 24.720  -43.164  65.370  1.00 43.25  ? 1100 ARG A O     1 
ATOM   8753  C  CB    . ARG C 3  1100 ? 21.922  -43.068  67.219  1.00 45.07  ? 1100 ARG A CB    1 
ATOM   8754  C  CG    . ARG C 3  1100 ? 22.647  -44.284  67.738  1.00 46.76  ? 1100 ARG A CG    1 
ATOM   8755  C  CD    . ARG C 3  1100 ? 23.897  -43.925  68.513  1.00 49.64  ? 1100 ARG A CD    1 
ATOM   8756  N  NE    . ARG C 3  1100 ? 24.225  -44.976  69.475  1.00 54.58  ? 1100 ARG A NE    1 
ATOM   8757  C  CZ    . ARG C 3  1100 ? 25.401  -45.110  70.085  1.00 54.66  ? 1100 ARG A CZ    1 
ATOM   8758  N  NH1   . ARG C 3  1100 ? 26.388  -44.253  69.839  1.00 52.72  ? 1100 ARG A NH1   1 
ATOM   8759  N  NH2   . ARG C 3  1100 ? 25.592  -46.110  70.937  1.00 51.95  ? 1100 ARG A NH2   1 
ATOM   8760  N  N     . LEU C 3  1101 ? 22.792  -43.665  64.361  1.00 40.77  ? 1101 LEU A N     1 
ATOM   8761  C  CA    . LEU C 3  1101 ? 23.447  -44.501  63.368  1.00 39.55  ? 1101 LEU A CA    1 
ATOM   8762  C  C     . LEU C 3  1101 ? 24.566  -43.679  62.762  1.00 40.59  ? 1101 LEU A C     1 
ATOM   8763  O  O     . LEU C 3  1101 ? 25.640  -44.195  62.458  1.00 39.79  ? 1101 LEU A O     1 
ATOM   8764  C  CB    . LEU C 3  1101 ? 22.470  -44.920  62.263  1.00 36.67  ? 1101 LEU A CB    1 
ATOM   8765  C  CG    . LEU C 3  1101 ? 23.072  -45.630  61.041  1.00 31.88  ? 1101 LEU A CG    1 
ATOM   8766  C  CD1   . LEU C 3  1101 ? 23.530  -46.997  61.441  1.00 27.61  ? 1101 LEU A CD1   1 
ATOM   8767  C  CD2   . LEU C 3  1101 ? 22.048  -45.744  59.926  1.00 29.11  ? 1101 LEU A CD2   1 
ATOM   8768  N  N     . LYS C 3  1102 ? 24.306  -42.388  62.591  1.00 42.62  ? 1102 LYS A N     1 
ATOM   8769  C  CA    . LYS C 3  1102 ? 25.299  -41.489  62.013  1.00 44.74  ? 1102 LYS A CA    1 
ATOM   8770  C  C     . LYS C 3  1102 ? 26.431  -41.369  63.008  1.00 42.56  ? 1102 LYS A C     1 
ATOM   8771  O  O     . LYS C 3  1102 ? 27.606  -41.486  62.666  1.00 40.88  ? 1102 LYS A O     1 
ATOM   8772  C  CB    . LYS C 3  1102 ? 24.685  -40.113  61.753  1.00 48.76  ? 1102 LYS A CB    1 
ATOM   8773  C  CG    . LYS C 3  1102 ? 25.606  -39.144  61.041  1.00 55.29  ? 1102 LYS A CG    1 
ATOM   8774  C  CD    . LYS C 3  1102 ? 24.928  -37.792  60.857  1.00 65.49  ? 1102 LYS A CD    1 
ATOM   8775  C  CE    . LYS C 3  1102 ? 25.887  -36.746  60.294  1.00 71.05  ? 1102 LYS A CE    1 
ATOM   8776  N  NZ    . LYS C 3  1102 ? 25.245  -35.403  60.192  1.00 72.34  ? 1102 LYS A NZ    1 
ATOM   8777  N  N     . GLU C 3  1103 ? 26.056  -41.142  64.255  1.00 41.98  ? 1103 GLU A N     1 
ATOM   8778  C  CA    . GLU C 3  1103 ? 27.028  -41.022  65.316  1.00 42.15  ? 1103 GLU A CA    1 
ATOM   8779  C  C     . GLU C 3  1103 ? 27.986  -42.203  65.169  1.00 41.52  ? 1103 GLU A C     1 
ATOM   8780  O  O     . GLU C 3  1103 ? 29.195  -42.029  65.043  1.00 42.66  ? 1103 GLU A O     1 
ATOM   8781  C  CB    . GLU C 3  1103 ? 26.307  -41.068  66.661  1.00 41.02  ? 1103 GLU A CB    1 
ATOM   8782  C  CG    . GLU C 3  1103 ? 27.003  -40.314  67.758  1.00 45.26  ? 1103 GLU A CG    1 
ATOM   8783  C  CD    . GLU C 3  1103 ? 26.022  -39.659  68.721  1.00 52.50  ? 1103 GLU A CD    1 
ATOM   8784  O  OE1   . GLU C 3  1103 ? 25.351  -40.386  69.502  1.00 53.86  ? 1103 GLU A OE1   1 
ATOM   8785  O  OE2   . GLU C 3  1103 ? 25.920  -38.407  68.684  1.00 56.03  ? 1103 GLU A OE2   1 
ATOM   8786  N  N     . ILE C 3  1104 ? 27.422  -43.404  65.146  1.00 39.89  ? 1104 ILE A N     1 
ATOM   8787  C  CA    . ILE C 3  1104 ? 28.198  -44.624  65.024  1.00 36.65  ? 1104 ILE A CA    1 
ATOM   8788  C  C     . ILE C 3  1104 ? 29.114  -44.667  63.804  1.00 37.86  ? 1104 ILE A C     1 
ATOM   8789  O  O     . ILE C 3  1104 ? 30.325  -44.571  63.942  1.00 36.91  ? 1104 ILE A O     1 
ATOM   8790  C  CB    . ILE C 3  1104 ? 27.268  -45.833  64.989  1.00 32.72  ? 1104 ILE A CB    1 
ATOM   8791  C  CG1   . ILE C 3  1104 ? 26.511  -45.924  66.301  1.00 27.88  ? 1104 ILE A CG1   1 
ATOM   8792  C  CG2   . ILE C 3  1104 ? 28.052  -47.101  64.744  1.00 34.10  ? 1104 ILE A CG2   1 
ATOM   8793  C  CD1   . ILE C 3  1104 ? 25.647  -47.148  66.399  1.00 31.52  ? 1104 ILE A CD1   1 
ATOM   8794  N  N     . LEU C 3  1105 ? 28.539  -44.821  62.615  1.00 39.60  ? 1105 LEU A N     1 
ATOM   8795  C  CA    . LEU C 3  1105 ? 29.325  -44.900  61.381  1.00 41.26  ? 1105 LEU A CA    1 
ATOM   8796  C  C     . LEU C 3  1105 ? 30.470  -43.904  61.281  1.00 43.65  ? 1105 LEU A C     1 
ATOM   8797  O  O     . LEU C 3  1105 ? 31.520  -44.222  60.735  1.00 43.91  ? 1105 LEU A O     1 
ATOM   8798  C  CB    . LEU C 3  1105 ? 28.421  -44.734  60.162  1.00 38.53  ? 1105 LEU A CB    1 
ATOM   8799  C  CG    . LEU C 3  1105 ? 27.425  -45.862  59.957  1.00 34.43  ? 1105 LEU A CG    1 
ATOM   8800  C  CD1   . LEU C 3  1105 ? 26.541  -45.533  58.803  1.00 35.70  ? 1105 LEU A CD1   1 
ATOM   8801  C  CD2   . LEU C 3  1105 ? 28.159  -47.138  59.694  1.00 34.58  ? 1105 LEU A CD2   1 
ATOM   8802  N  N     . ASN C 3  1106 ? 30.265  -42.695  61.787  1.00 46.45  ? 1106 ASN A N     1 
ATOM   8803  C  CA    . ASN C 3  1106 ? 31.310  -41.679  61.744  1.00 49.88  ? 1106 ASN A CA    1 
ATOM   8804  C  C     . ASN C 3  1106 ? 32.392  -41.965  62.788  1.00 50.18  ? 1106 ASN A C     1 
ATOM   8805  O  O     . ASN C 3  1106 ? 33.518  -41.487  62.672  1.00 50.70  ? 1106 ASN A O     1 
ATOM   8806  C  CB    . ASN C 3  1106 ? 30.721  -40.289  62.012  1.00 55.63  ? 1106 ASN A CB    1 
ATOM   8807  C  CG    . ASN C 3  1106 ? 29.967  -39.724  60.823  1.00 61.15  ? 1106 ASN A CG    1 
ATOM   8808  O  OD1   . ASN C 3  1106 ? 30.518  -39.580  59.735  1.00 64.07  ? 1106 ASN A OD1   1 
ATOM   8809  N  ND2   . ASN C 3  1106 ? 28.701  -39.387  61.032  1.00 66.87  ? 1106 ASN A ND2   1 
ATOM   8810  N  N     . VAL C 3  1107 ? 32.033  -42.753  63.799  1.00 49.47  ? 1107 VAL A N     1 
ATOM   8811  C  CA    . VAL C 3  1107 ? 32.922  -43.106  64.907  1.00 47.38  ? 1107 VAL A CA    1 
ATOM   8812  C  C     . VAL C 3  1107 ? 33.177  -41.850  65.700  1.00 49.59  ? 1107 VAL A C     1 
ATOM   8813  O  O     . VAL C 3  1107 ? 34.304  -41.545  66.065  1.00 50.40  ? 1107 VAL A O     1 
ATOM   8814  C  CB    . VAL C 3  1107 ? 34.270  -43.646  64.444  1.00 43.54  ? 1107 VAL A CB    1 
ATOM   8815  C  CG1   . VAL C 3  1107 ? 34.993  -44.282  65.622  1.00 40.31  ? 1107 VAL A CG1   1 
ATOM   8816  C  CG2   . VAL C 3  1107 ? 34.072  -44.637  63.327  1.00 43.60  ? 1107 VAL A CG2   1 
ATOM   8817  N  N     . ALA C 3  1108 ? 32.109  -41.116  65.954  1.00 52.68  ? 1108 ALA A N     1 
ATOM   8818  C  CA    . ALA C 3  1108 ? 32.194  -39.876  66.697  1.00 56.85  ? 1108 ALA A CA    1 
ATOM   8819  C  C     . ALA C 3  1108 ? 32.702  -40.112  68.110  1.00 58.98  ? 1108 ALA A C     1 
ATOM   8820  O  O     . ALA C 3  1108 ? 32.629  -41.225  68.624  1.00 60.35  ? 1108 ALA A O     1 
ATOM   8821  C  CB    . ALA C 3  1108 ? 30.826  -39.217  66.737  1.00 59.47  ? 1108 ALA A CB    1 
ATOM   8822  N  N     . LYS C 3  1109 ? 33.213  -39.057  68.735  1.00 60.62  ? 1109 LYS A N     1 
ATOM   8823  C  CA    . LYS C 3  1109 ? 33.720  -39.150  70.091  1.00 63.12  ? 1109 LYS A CA    1 
ATOM   8824  C  C     . LYS C 3  1109 ? 32.848  -38.294  70.991  1.00 63.64  ? 1109 LYS A C     1 
ATOM   8825  O  O     . LYS C 3  1109 ? 32.861  -38.444  72.206  1.00 63.24  ? 1109 LYS A O     1 
ATOM   8826  C  CB    . LYS C 3  1109 ? 35.172  -38.665  70.139  1.00 65.90  ? 1109 LYS A CB    1 
ATOM   8827  C  CG    . LYS C 3  1109 ? 35.824  -38.744  71.523  1.00 73.87  ? 1109 LYS A CG    1 
ATOM   8828  C  CD    . LYS C 3  1109 ? 35.840  -40.174  72.101  1.00 79.58  ? 1109 LYS A CD    1 
ATOM   8829  C  CE    . LYS C 3  1109 ? 36.422  -40.210  73.533  1.00 83.55  ? 1109 LYS A CE    1 
ATOM   8830  N  NZ    . LYS C 3  1109 ? 36.474  -41.570  74.177  1.00 82.79  ? 1109 LYS A NZ    1 
ATOM   8831  N  N     . ASN C 3  1110 ? 32.069  -37.416  70.371  1.00 66.53  ? 1110 ASN A N     1 
ATOM   8832  C  CA    . ASN C 3  1110 ? 31.185  -36.489  71.083  1.00 70.51  ? 1110 ASN A CA    1 
ATOM   8833  C  C     . ASN C 3  1110 ? 29.727  -36.959  71.168  1.00 69.56  ? 1110 ASN A C     1 
ATOM   8834  O  O     . ASN C 3  1110 ? 28.799  -36.144  71.100  1.00 69.59  ? 1110 ASN A O     1 
ATOM   8835  C  CB    . ASN C 3  1110 ? 31.209  -35.130  70.380  1.00 76.25  ? 1110 ASN A CB    1 
ATOM   8836  C  CG    . ASN C 3  1110 ? 32.578  -34.780  69.839  1.00 81.16  ? 1110 ASN A CG    1 
ATOM   8837  O  OD1   . ASN C 3  1110 ? 33.487  -34.427  70.596  1.00 85.15  ? 1110 ASN A OD1   1 
ATOM   8838  N  ND2   . ASN C 3  1110 ? 32.740  -34.890  68.520  1.00 82.73  ? 1110 ASN A ND2   1 
ATOM   8839  N  N     . MET C 3  1111 ? 29.518  -38.259  71.317  1.00 67.60  ? 1111 MET A N     1 
ATOM   8840  C  CA    . MET C 3  1111 ? 28.165  -38.774  71.388  1.00 66.16  ? 1111 MET A CA    1 
ATOM   8841  C  C     . MET C 3  1111 ? 27.320  -38.045  72.414  1.00 66.38  ? 1111 MET A C     1 
ATOM   8842  O  O     . MET C 3  1111 ? 27.766  -37.767  73.520  1.00 68.00  ? 1111 MET A O     1 
ATOM   8843  C  CB    . MET C 3  1111 ? 28.189  -40.260  71.685  1.00 65.50  ? 1111 MET A CB    1 
ATOM   8844  C  CG    . MET C 3  1111 ? 28.981  -40.648  72.893  1.00 63.73  ? 1111 MET A CG    1 
ATOM   8845  S  SD    . MET C 3  1111 ? 29.096  -42.426  72.892  1.00 62.86  ? 1111 MET A SD    1 
ATOM   8846  C  CE    . MET C 3  1111 ? 27.528  -42.824  73.515  1.00 58.02  ? 1111 MET A CE    1 
ATOM   8847  N  N     . LYS C 3  1112 ? 26.087  -37.745  72.028  1.00 66.29  ? 1112 LYS A N     1 
ATOM   8848  C  CA    . LYS C 3  1112 ? 25.157  -37.020  72.876  1.00 65.21  ? 1112 LYS A CA    1 
ATOM   8849  C  C     . LYS C 3  1112 ? 24.630  -37.843  74.037  1.00 64.25  ? 1112 LYS A C     1 
ATOM   8850  O  O     . LYS C 3  1112 ? 24.516  -37.334  75.141  1.00 65.30  ? 1112 LYS A O     1 
ATOM   8851  C  CB    . LYS C 3  1112 ? 23.992  -36.490  72.029  1.00 67.64  ? 1112 LYS A CB    1 
ATOM   8852  C  CG    . LYS C 3  1112 ? 24.418  -35.561  70.884  1.00 67.86  ? 1112 LYS A CG    1 
ATOM   8853  C  CD    . LYS C 3  1112 ? 23.340  -35.467  69.816  1.00 67.89  ? 1112 LYS A CD    1 
ATOM   8854  C  CE    . LYS C 3  1112 ? 23.833  -34.729  68.587  1.00 69.80  ? 1112 LYS A CE    1 
ATOM   8855  N  NZ    . LYS C 3  1112 ? 22.794  -34.680  67.516  1.00 70.79  ? 1112 LYS A NZ    1 
ATOM   8856  N  N     . THR C 3  1113 ? 24.299  -39.107  73.811  1.00 63.71  ? 1113 THR A N     1 
ATOM   8857  C  CA    . THR C 3  1113 ? 23.794  -39.914  74.913  1.00 64.44  ? 1113 THR A CA    1 
ATOM   8858  C  C     . THR C 3  1113 ? 24.763  -41.032  75.240  1.00 64.24  ? 1113 THR A C     1 
ATOM   8859  O  O     . THR C 3  1113 ? 24.598  -42.163  74.783  1.00 65.28  ? 1113 THR A O     1 
ATOM   8860  C  CB    . THR C 3  1113 ? 22.415  -40.538  74.606  1.00 66.42  ? 1113 THR A CB    1 
ATOM   8861  O  OG1   . THR C 3  1113 ? 21.450  -39.503  74.375  1.00 69.02  ? 1113 THR A OG1   1 
ATOM   8862  C  CG2   . THR C 3  1113 ? 21.951  -41.380  75.782  1.00 67.29  ? 1113 THR A CG2   1 
ATOM   8863  N  N     . PRO C 3  1114 ? 25.797  -40.722  76.038  1.00 63.31  ? 1114 PRO A N     1 
ATOM   8864  C  CA    . PRO C 3  1114 ? 26.853  -41.637  76.486  1.00 62.07  ? 1114 PRO A CA    1 
ATOM   8865  C  C     . PRO C 3  1114 ? 26.398  -42.833  77.343  1.00 60.01  ? 1114 PRO A C     1 
ATOM   8866  O  O     . PRO C 3  1114 ? 26.221  -43.933  76.828  1.00 62.32  ? 1114 PRO A O     1 
ATOM   8867  C  CB    . PRO C 3  1114 ? 27.810  -40.707  77.223  1.00 61.77  ? 1114 PRO A CB    1 
ATOM   8868  C  CG    . PRO C 3  1114 ? 26.911  -39.632  77.717  1.00 62.73  ? 1114 PRO A CG    1 
ATOM   8869  C  CD    . PRO C 3  1114 ? 26.073  -39.360  76.512  1.00 61.88  ? 1114 PRO A CD    1 
ATOM   8870  N  N     . SER C 3  1115 ? 26.232  -42.630  78.644  1.00 57.12  ? 1115 SER A N     1 
ATOM   8871  C  CA    . SER C 3  1115 ? 25.783  -43.700  79.549  1.00 54.94  ? 1115 SER A CA    1 
ATOM   8872  C  C     . SER C 3  1115 ? 26.665  -44.932  79.732  1.00 52.75  ? 1115 SER A C     1 
ATOM   8873  O  O     . SER C 3  1115 ? 27.374  -45.378  78.821  1.00 51.28  ? 1115 SER A O     1 
ATOM   8874  C  CB    . SER C 3  1115 ? 24.385  -44.196  79.162  1.00 56.12  ? 1115 SER A CB    1 
ATOM   8875  O  OG    . SER C 3  1115 ? 23.998  -45.288  79.989  1.00 55.68  ? 1115 SER A OG    1 
ATOM   8876  N  N     . LEU C 3  1116 ? 26.563  -45.482  80.937  1.00 49.41  ? 1116 LEU A N     1 
ATOM   8877  C  CA    . LEU C 3  1116 ? 27.292  -46.666  81.361  1.00 47.51  ? 1116 LEU A CA    1 
ATOM   8878  C  C     . LEU C 3  1116 ? 26.209  -47.479  82.051  1.00 45.37  ? 1116 LEU A C     1 
ATOM   8879  O  O     . LEU C 3  1116 ? 25.475  -46.953  82.871  1.00 47.59  ? 1116 LEU A O     1 
ATOM   8880  C  CB    . LEU C 3  1116 ? 28.369  -46.271  82.375  1.00 49.78  ? 1116 LEU A CB    1 
ATOM   8881  C  CG    . LEU C 3  1116 ? 29.623  -47.116  82.618  1.00 48.75  ? 1116 LEU A CG    1 
ATOM   8882  C  CD1   . LEU C 3  1116 ? 30.577  -46.998  81.456  1.00 46.28  ? 1116 LEU A CD1   1 
ATOM   8883  C  CD2   . LEU C 3  1116 ? 30.318  -46.601  83.863  1.00 50.53  ? 1116 LEU A CD2   1 
ATOM   8884  N  N     . THR C 3  1117 ? 26.103  -48.754  81.728  1.00 42.01  ? 1117 THR A N     1 
ATOM   8885  C  CA    . THR C 3  1117 ? 25.074  -49.584  82.321  1.00 38.85  ? 1117 THR A CA    1 
ATOM   8886  C  C     . THR C 3  1117 ? 25.721  -50.597  83.251  1.00 38.68  ? 1117 THR A C     1 
ATOM   8887  O  O     . THR C 3  1117 ? 26.315  -51.554  82.779  1.00 40.38  ? 1117 THR A O     1 
ATOM   8888  C  CB    . THR C 3  1117 ? 24.320  -50.302  81.200  1.00 38.47  ? 1117 THR A CB    1 
ATOM   8889  O  OG1   . THR C 3  1117 ? 23.955  -49.341  80.203  1.00 37.38  ? 1117 THR A OG1   1 
ATOM   8890  C  CG2   . THR C 3  1117 ? 23.077  -50.983  81.726  1.00 37.90  ? 1117 THR A CG2   1 
ATOM   8891  N  N     . VAL C 3  1118 ? 25.609  -50.406  84.564  1.00 38.17  ? 1118 VAL A N     1 
ATOM   8892  C  CA    . VAL C 3  1118 ? 26.239  -51.336  85.510  1.00 41.23  ? 1118 VAL A CA    1 
ATOM   8893  C  C     . VAL C 3  1118 ? 25.308  -52.384  86.108  1.00 43.86  ? 1118 VAL A C     1 
ATOM   8894  O  O     . VAL C 3  1118 ? 24.118  -52.133  86.281  1.00 44.81  ? 1118 VAL A O     1 
ATOM   8895  C  CB    . VAL C 3  1118 ? 26.892  -50.585  86.689  1.00 41.63  ? 1118 VAL A CB    1 
ATOM   8896  C  CG1   . VAL C 3  1118 ? 27.938  -49.610  86.190  1.00 42.07  ? 1118 VAL A CG1   1 
ATOM   8897  C  CG2   . VAL C 3  1118 ? 25.840  -49.856  87.467  1.00 42.61  ? 1118 VAL A CG2   1 
ATOM   8898  N  N     . TYR C 3  1119 ? 25.860  -53.552  86.438  1.00 47.09  ? 1119 TYR A N     1 
ATOM   8899  C  CA    . TYR C 3  1119 ? 25.082  -54.642  87.034  1.00 51.90  ? 1119 TYR A CA    1 
ATOM   8900  C  C     . TYR C 3  1119 ? 25.717  -55.063  88.349  1.00 54.89  ? 1119 TYR A C     1 
ATOM   8901  O  O     . TYR C 3  1119 ? 26.914  -54.902  88.535  1.00 55.10  ? 1119 TYR A O     1 
ATOM   8902  C  CB    . TYR C 3  1119 ? 25.032  -55.865  86.110  1.00 52.28  ? 1119 TYR A CB    1 
ATOM   8903  C  CG    . TYR C 3  1119 ? 24.489  -55.585  84.733  1.00 52.34  ? 1119 TYR A CG    1 
ATOM   8904  C  CD1   . TYR C 3  1119 ? 25.240  -54.875  83.806  1.00 53.86  ? 1119 TYR A CD1   1 
ATOM   8905  C  CD2   . TYR C 3  1119 ? 23.214  -56.000  84.366  1.00 53.81  ? 1119 TYR A CD2   1 
ATOM   8906  C  CE1   . TYR C 3  1119 ? 24.738  -54.578  82.550  1.00 54.87  ? 1119 TYR A CE1   1 
ATOM   8907  C  CE2   . TYR C 3  1119 ? 22.697  -55.706  83.106  1.00 54.76  ? 1119 TYR A CE2   1 
ATOM   8908  C  CZ    . TYR C 3  1119 ? 23.468  -54.991  82.205  1.00 54.76  ? 1119 TYR A CZ    1 
ATOM   8909  O  OH    . TYR C 3  1119 ? 22.978  -54.661  80.964  1.00 54.76  ? 1119 TYR A OH    1 
ATOM   8910  N  N     . LEU C 3  1120 ? 24.912  -55.627  89.244  1.00 59.61  ? 1120 LEU A N     1 
ATOM   8911  C  CA    . LEU C 3  1120 ? 25.379  -56.073  90.558  1.00 64.19  ? 1120 LEU A CA    1 
ATOM   8912  C  C     . LEU C 3  1120 ? 26.086  -57.426  90.569  1.00 67.62  ? 1120 LEU A C     1 
ATOM   8913  O  O     . LEU C 3  1120 ? 25.926  -58.234  89.658  1.00 69.06  ? 1120 LEU A O     1 
ATOM   8914  C  CB    . LEU C 3  1120 ? 24.197  -56.134  91.521  1.00 64.86  ? 1120 LEU A CB    1 
ATOM   8915  C  CG    . LEU C 3  1120 ? 23.689  -54.844  92.174  1.00 66.25  ? 1120 LEU A CG    1 
ATOM   8916  C  CD1   . LEU C 3  1120 ? 23.671  -53.687  91.183  1.00 64.67  ? 1120 LEU A CD1   1 
ATOM   8917  C  CD2   . LEU C 3  1120 ? 22.299  -55.117  92.743  1.00 66.77  ? 1120 LEU A CD2   1 
ATOM   8918  N  N     . GLU C 3  1121 ? 26.866  -57.666  91.615  1.00 71.86  ? 1121 GLU A N     1 
ATOM   8919  C  CA    . GLU C 3  1121 ? 27.580  -58.924  91.757  1.00 78.28  ? 1121 GLU A CA    1 
ATOM   8920  C  C     . GLU C 3  1121 ? 26.554  -60.041  91.719  1.00 80.45  ? 1121 GLU A C     1 
ATOM   8921  O  O     . GLU C 3  1121 ? 25.511  -59.946  92.359  1.00 77.75  ? 1121 GLU A O     1 
ATOM   8922  C  CB    . GLU C 3  1121 ? 28.343  -58.963  93.087  1.00 84.36  ? 1121 GLU A CB    1 
ATOM   8923  C  CG    . GLU C 3  1121 ? 29.871  -58.909  92.935  1.00 93.85  ? 1121 GLU A CG    1 
ATOM   8924  C  CD    . GLU C 3  1121 ? 30.617  -58.912  94.271  1.00 97.84  ? 1121 GLU A CD    1 
ATOM   8925  O  OE1   . GLU C 3  1121 ? 30.371  -59.827  95.094  1.00 99.29  ? 1121 GLU A OE1   1 
ATOM   8926  O  OE2   . GLU C 3  1121 ? 31.455  -58.002  94.488  1.00 98.85  ? 1121 GLU A OE2   1 
ATOM   8927  N  N     . PRO C 3  1122 ? 26.846  -61.122  90.974  1.00 85.47  ? 1122 PRO A N     1 
ATOM   8928  C  CA    . PRO C 3  1122 ? 25.928  -62.258  90.858  1.00 90.58  ? 1122 PRO A CA    1 
ATOM   8929  C  C     . PRO C 3  1122 ? 24.948  -62.419  92.027  1.00 94.91  ? 1122 PRO A C     1 
ATOM   8930  O  O     . PRO C 3  1122 ? 23.748  -62.164  91.884  1.00 94.97  ? 1122 PRO A O     1 
ATOM   8931  C  CB    . PRO C 3  1122 ? 26.883  -63.440  90.707  1.00 89.40  ? 1122 PRO A CB    1 
ATOM   8932  C  CG    . PRO C 3  1122 ? 27.947  -62.864  89.833  1.00 86.21  ? 1122 PRO A CG    1 
ATOM   8933  C  CD    . PRO C 3  1122 ? 28.175  -61.474  90.430  1.00 85.95  ? 1122 PRO A CD    1 
ATOM   8934  N  N     . GLY C 3  1123 ? 25.468  -62.827  93.180  1.00 99.87  ? 1123 GLY A N     1 
ATOM   8935  C  CA    . GLY C 3  1123 ? 24.631  -63.038  94.352  1.00 106.03 ? 1123 GLY A CA    1 
ATOM   8936  C  C     . GLY C 3  1123 ? 23.674  -61.913  94.712  1.00 108.80 ? 1123 GLY A C     1 
ATOM   8937  O  O     . GLY C 3  1123 ? 22.450  -62.082  94.678  1.00 110.12 ? 1123 GLY A O     1 
ATOM   8938  N  N     . HIS C 3  1124 ? 24.235  -60.765  95.072  1.00 110.18 ? 1124 HIS A N     1 
ATOM   8939  C  CA    . HIS C 3  1124 ? 23.443  -59.604  95.447  1.00 111.52 ? 1124 HIS A CA    1 
ATOM   8940  C  C     . HIS C 3  1124 ? 22.701  -59.084  94.216  1.00 111.68 ? 1124 HIS A C     1 
ATOM   8941  O  O     . HIS C 3  1124 ? 23.069  -58.064  93.639  1.00 112.21 ? 1124 HIS A O     1 
ATOM   8942  C  CB    . HIS C 3  1124 ? 24.377  -58.537  96.012  1.00 114.26 ? 1124 HIS A CB    1 
ATOM   8943  C  CG    . HIS C 3  1124 ? 25.310  -59.057  97.062  1.00 118.90 ? 1124 HIS A CG    1 
ATOM   8944  N  ND1   . HIS C 3  1124 ? 24.895  -59.366  98.341  1.00 121.72 ? 1124 HIS A ND1   1 
ATOM   8945  C  CD2   . HIS C 3  1124 ? 26.630  -59.360  97.013  1.00 120.52 ? 1124 HIS A CD2   1 
ATOM   8946  C  CE1   . HIS C 3  1124 ? 25.918  -59.835  99.033  1.00 122.77 ? 1124 HIS A CE1   1 
ATOM   8947  N  NE2   . HIS C 3  1124 ? 26.983  -59.842  98.251  1.00 122.89 ? 1124 HIS A NE2   1 
ATOM   8948  N  N     . ALA C 3  1125 ? 21.649  -59.794  93.821  1.00 111.17 ? 1125 ALA A N     1 
ATOM   8949  C  CA    . ALA C 3  1125 ? 20.873  -59.418  92.647  1.00 110.85 ? 1125 ALA A CA    1 
ATOM   8950  C  C     . ALA C 3  1125 ? 19.462  -58.946  92.986  1.00 111.09 ? 1125 ALA A C     1 
ATOM   8951  O  O     . ALA C 3  1125 ? 18.694  -58.565  92.104  1.00 110.57 ? 1125 ALA A O     1 
ATOM   8952  C  CB    . ALA C 3  1125 ? 20.812  -60.595  91.685  1.00 111.00 ? 1125 ALA A CB    1 
ATOM   8953  N  N     . ALA C 3  1126 ? 19.118  -58.972  94.265  1.00 111.50 ? 1126 ALA A N     1 
ATOM   8954  C  CA    . ALA C 3  1126 ? 17.793  -58.546  94.679  1.00 112.05 ? 1126 ALA A CA    1 
ATOM   8955  C  C     . ALA C 3  1126 ? 17.873  -57.432  95.713  1.00 112.70 ? 1126 ALA A C     1 
ATOM   8956  O  O     . ALA C 3  1126 ? 16.949  -56.625  95.828  1.00 113.16 ? 1126 ALA A O     1 
ATOM   8957  C  CB    . ALA C 3  1126 ? 17.018  -59.733  95.240  1.00 113.10 ? 1126 ALA A CB    1 
ATOM   8958  N  N     . ASP C 3  1127 ? 18.978  -57.389  96.459  1.00 112.99 ? 1127 ASP A N     1 
ATOM   8959  C  CA    . ASP C 3  1127 ? 19.171  -56.372  97.491  1.00 112.35 ? 1127 ASP A CA    1 
ATOM   8960  C  C     . ASP C 3  1127 ? 18.930  -54.971  96.949  1.00 111.42 ? 1127 ASP A C     1 
ATOM   8961  O  O     . ASP C 3  1127 ? 19.842  -54.316  96.444  1.00 111.05 ? 1127 ASP A O     1 
ATOM   8962  C  CB    . ASP C 3  1127 ? 20.582  -56.457  98.093  1.00 113.76 ? 1127 ASP A CB    1 
ATOM   8963  C  CG    . ASP C 3  1127 ? 20.747  -57.639  99.043  1.00 116.23 ? 1127 ASP A CG    1 
ATOM   8964  O  OD1   . ASP C 3  1127 ? 19.900  -57.807  99.947  1.00 117.60 ? 1127 ASP A OD1   1 
ATOM   8965  O  OD2   . ASP C 3  1127 ? 21.731  -58.395  98.895  1.00 116.87 ? 1127 ASP A OD2   1 
ATOM   8966  N  N     . GLN C 3  1128 ? 17.679  -54.533  97.053  1.00 110.22 ? 1128 GLN A N     1 
ATOM   8967  C  CA    . GLN C 3  1128 ? 17.257  -53.213  96.605  1.00 108.00 ? 1128 GLN A CA    1 
ATOM   8968  C  C     . GLN C 3  1128 ? 18.231  -52.174  97.151  1.00 106.37 ? 1128 GLN A C     1 
ATOM   8969  O  O     . GLN C 3  1128 ? 18.456  -51.133  96.541  1.00 105.18 ? 1128 GLN A O     1 
ATOM   8970  C  CB    . GLN C 3  1128 ? 15.834  -52.955  97.122  1.00 108.87 ? 1128 GLN A CB    1 
ATOM   8971  C  CG    . GLN C 3  1128 ? 15.494  -51.508  97.445  1.00 111.24 ? 1128 GLN A CG    1 
ATOM   8972  C  CD    . GLN C 3  1128 ? 15.195  -50.683  96.217  1.00 113.18 ? 1128 GLN A CD    1 
ATOM   8973  O  OE1   . GLN C 3  1128 ? 15.989  -50.640  95.281  1.00 115.83 ? 1128 GLN A OE1   1 
ATOM   8974  N  NE2   . GLN C 3  1128 ? 14.044  -50.014  96.216  1.00 112.86 ? 1128 GLN A NE2   1 
ATOM   8975  N  N     . GLU C 3  1129 ? 18.820  -52.492  98.300  1.00 105.74 ? 1129 GLU A N     1 
ATOM   8976  C  CA    . GLU C 3  1129 ? 19.767  -51.617  98.990  1.00 104.10 ? 1129 GLU A CA    1 
ATOM   8977  C  C     . GLU C 3  1129 ? 21.147  -51.582  98.329  1.00 99.98  ? 1129 GLU A C     1 
ATOM   8978  O  O     . GLU C 3  1129 ? 21.608  -50.521  97.901  1.00 98.66  ? 1129 GLU A O     1 
ATOM   8979  C  CB    . GLU C 3  1129 ? 19.894  -52.072  100.454 1.00 108.77 ? 1129 GLU A CB    1 
ATOM   8980  C  CG    . GLU C 3  1129 ? 20.689  -51.136  101.369 1.00 115.10 ? 1129 GLU A CG    1 
ATOM   8981  C  CD    . GLU C 3  1129 ? 20.567  -51.510  102.851 1.00 117.42 ? 1129 GLU A CD    1 
ATOM   8982  O  OE1   . GLU C 3  1129 ? 20.860  -52.678  103.199 1.00 116.30 ? 1129 GLU A OE1   1 
ATOM   8983  O  OE2   . GLU C 3  1129 ? 20.180  -50.633  103.662 1.00 117.37 ? 1129 GLU A OE2   1 
ATOM   8984  N  N     . GLN C 3  1130 ? 21.796  -52.743  98.264  1.00 95.66  ? 1130 GLN A N     1 
ATOM   8985  C  CA    . GLN C 3  1130 ? 23.122  -52.884  97.660  1.00 90.23  ? 1130 GLN A CA    1 
ATOM   8986  C  C     . GLN C 3  1130 ? 23.314  -51.914  96.495  1.00 85.88  ? 1130 GLN A C     1 
ATOM   8987  O  O     . GLN C 3  1130 ? 24.386  -51.330  96.327  1.00 85.15  ? 1130 GLN A O     1 
ATOM   8988  C  CB    . GLN C 3  1130 ? 23.323  -54.338  97.186  1.00 91.44  ? 1130 GLN A CB    1 
ATOM   8989  C  CG    . GLN C 3  1130 ? 24.468  -54.576  96.176  1.00 92.11  ? 1130 GLN A CG    1 
ATOM   8990  C  CD    . GLN C 3  1130 ? 25.786  -55.027  96.810  1.00 91.77  ? 1130 GLN A CD    1 
ATOM   8991  O  OE1   . GLN C 3  1130 ? 25.832  -56.005  97.559  1.00 91.87  ? 1130 GLN A OE1   1 
ATOM   8992  N  NE2   . GLN C 3  1130 ? 26.866  -54.321  96.491  1.00 89.11  ? 1130 GLN A NE2   1 
ATOM   8993  N  N     . ALA C 3  1131 ? 22.266  -51.729  95.702  1.00 80.88  ? 1131 ALA A N     1 
ATOM   8994  C  CA    . ALA C 3  1131 ? 22.347  -50.837  94.556  1.00 75.92  ? 1131 ALA A CA    1 
ATOM   8995  C  C     . ALA C 3  1131 ? 22.425  -49.376  94.953  1.00 72.00  ? 1131 ALA A C     1 
ATOM   8996  O  O     . ALA C 3  1131 ? 23.279  -48.651  94.457  1.00 71.64  ? 1131 ALA A O     1 
ATOM   8997  C  CB    . ALA C 3  1131 ? 21.166  -51.059  93.644  1.00 77.77  ? 1131 ALA A CB    1 
ATOM   8998  N  N     . LYS C 3  1132 ? 21.529  -48.943  95.835  1.00 68.37  ? 1132 LYS A N     1 
ATOM   8999  C  CA    . LYS C 3  1132 ? 21.515  -47.556  96.282  1.00 65.21  ? 1132 LYS A CA    1 
ATOM   9000  C  C     . LYS C 3  1132 ? 22.935  -47.108  96.588  1.00 62.39  ? 1132 LYS A C     1 
ATOM   9001  O  O     . LYS C 3  1132 ? 23.373  -46.041  96.157  1.00 61.88  ? 1132 LYS A O     1 
ATOM   9002  C  CB    . LYS C 3  1132 ? 20.676  -47.400  97.550  1.00 68.15  ? 1132 LYS A CB    1 
ATOM   9003  C  CG    . LYS C 3  1132 ? 19.170  -47.483  97.381  1.00 73.19  ? 1132 LYS A CG    1 
ATOM   9004  C  CD    . LYS C 3  1132 ? 18.483  -47.489  98.762  1.00 78.11  ? 1132 LYS A CD    1 
ATOM   9005  C  CE    . LYS C 3  1132 ? 16.962  -47.673  98.672  1.00 79.03  ? 1132 LYS A CE    1 
ATOM   9006  N  NZ    . LYS C 3  1132 ? 16.356  -48.017  99.995  1.00 77.23  ? 1132 LYS A NZ    1 
ATOM   9007  N  N     . LEU C 3  1133 ? 23.653  -47.932  97.344  1.00 59.29  ? 1133 LEU A N     1 
ATOM   9008  C  CA    . LEU C 3  1133 ? 25.024  -47.610  97.714  1.00 55.58  ? 1133 LEU A CA    1 
ATOM   9009  C  C     . LEU C 3  1133 ? 25.827  -47.349  96.451  1.00 52.81  ? 1133 LEU A C     1 
ATOM   9010  O  O     . LEU C 3  1133 ? 26.231  -46.220  96.183  1.00 52.27  ? 1133 LEU A O     1 
ATOM   9011  C  CB    . LEU C 3  1133 ? 25.654  -48.762  98.508  1.00 56.01  ? 1133 LEU A CB    1 
ATOM   9012  C  CG    . LEU C 3  1133 ? 24.947  -49.221  99.793  1.00 55.59  ? 1133 LEU A CG    1 
ATOM   9013  C  CD1   . LEU C 3  1133 ? 25.696  -50.405  100.383 1.00 55.39  ? 1133 LEU A CD1   1 
ATOM   9014  C  CD2   . LEU C 3  1133 ? 24.875  -48.087  100.801 1.00 54.23  ? 1133 LEU A CD2   1 
ATOM   9015  N  N     . ILE C 3  1134 ? 26.031  -48.396  95.662  1.00 49.90  ? 1134 ILE A N     1 
ATOM   9016  C  CA    . ILE C 3  1134 ? 26.795  -48.269  94.433  1.00 47.13  ? 1134 ILE A CA    1 
ATOM   9017  C  C     . ILE C 3  1134 ? 26.335  -47.091  93.571  1.00 48.03  ? 1134 ILE A C     1 
ATOM   9018  O  O     . ILE C 3  1134 ? 27.079  -46.609  92.720  1.00 47.01  ? 1134 ILE A O     1 
ATOM   9019  C  CB    . ILE C 3  1134 ? 26.757  -49.587  93.635  1.00 41.87  ? 1134 ILE A CB    1 
ATOM   9020  C  CG1   . ILE C 3  1134 ? 27.270  -50.720  94.529  1.00 38.01  ? 1134 ILE A CG1   1 
ATOM   9021  C  CG2   . ILE C 3  1134 ? 27.626  -49.477  92.395  1.00 37.91  ? 1134 ILE A CG2   1 
ATOM   9022  C  CD1   . ILE C 3  1134 ? 27.440  -52.039  93.842  1.00 37.70  ? 1134 ILE A CD1   1 
ATOM   9023  N  N     . ARG C 3  1135 ? 25.116  -46.616  93.796  1.00 50.00  ? 1135 ARG A N     1 
ATOM   9024  C  CA    . ARG C 3  1135 ? 24.619  -45.472  93.040  1.00 52.97  ? 1135 ARG A CA    1 
ATOM   9025  C  C     . ARG C 3  1135 ? 25.462  -44.288  93.481  1.00 53.21  ? 1135 ARG A C     1 
ATOM   9026  O  O     . ARG C 3  1135 ? 26.200  -43.699  92.686  1.00 51.47  ? 1135 ARG A O     1 
ATOM   9027  C  CB    . ARG C 3  1135 ? 23.136  -45.197  93.358  1.00 57.72  ? 1135 ARG A CB    1 
ATOM   9028  C  CG    . ARG C 3  1135 ? 22.679  -43.752  93.078  1.00 64.06  ? 1135 ARG A CG    1 
ATOM   9029  C  CD    . ARG C 3  1135 ? 21.309  -43.425  93.701  1.00 72.01  ? 1135 ARG A CD    1 
ATOM   9030  N  NE    . ARG C 3  1135 ? 20.213  -43.552  92.735  1.00 83.07  ? 1135 ARG A NE    1 
ATOM   9031  C  CZ    . ARG C 3  1135 ? 18.927  -43.300  92.995  1.00 84.91  ? 1135 ARG A CZ    1 
ATOM   9032  N  NH1   . ARG C 3  1135 ? 18.558  -42.906  94.211  1.00 84.86  ? 1135 ARG A NH1   1 
ATOM   9033  N  NH2   . ARG C 3  1135 ? 18.010  -43.430  92.031  1.00 81.15  ? 1135 ARG A NH2   1 
ATOM   9034  N  N     . SER C 3  1136 ? 25.351  -43.963  94.766  1.00 53.70  ? 1136 SER A N     1 
ATOM   9035  C  CA    . SER C 3  1136 ? 26.074  -42.848  95.362  1.00 54.31  ? 1136 SER A CA    1 
ATOM   9036  C  C     . SER C 3  1136 ? 27.586  -43.036  95.322  1.00 55.63  ? 1136 SER A C     1 
ATOM   9037  O  O     . SER C 3  1136 ? 28.325  -42.068  95.149  1.00 56.99  ? 1136 SER A O     1 
ATOM   9038  C  CB    . SER C 3  1136 ? 25.603  -42.663  96.793  1.00 52.68  ? 1136 SER A CB    1 
ATOM   9039  O  OG    . SER C 3  1136 ? 25.262  -43.921  97.333  1.00 53.02  ? 1136 SER A OG    1 
ATOM   9040  N  N     . ALA C 3  1137 ? 28.039  -44.280  95.474  1.00 55.94  ? 1137 ALA A N     1 
ATOM   9041  C  CA    . ALA C 3  1137 ? 29.467  -44.607  95.437  1.00 55.22  ? 1137 ALA A CA    1 
ATOM   9042  C  C     . ALA C 3  1137 ? 30.090  -44.227  94.097  1.00 56.40  ? 1137 ALA A C     1 
ATOM   9043  O  O     . ALA C 3  1137 ? 31.258  -43.839  94.031  1.00 56.93  ? 1137 ALA A O     1 
ATOM   9044  C  CB    . ALA C 3  1137 ? 29.664  -46.089  95.686  1.00 50.63  ? 1137 ALA A CB    1 
ATOM   9045  N  N     . ILE C 3  1138 ? 29.294  -44.342  93.036  1.00 58.11  ? 1138 ILE A N     1 
ATOM   9046  C  CA    . ILE C 3  1138 ? 29.724  -44.034  91.671  1.00 58.09  ? 1138 ILE A CA    1 
ATOM   9047  C  C     . ILE C 3  1138 ? 29.397  -42.601  91.281  1.00 58.59  ? 1138 ILE A C     1 
ATOM   9048  O  O     . ILE C 3  1138 ? 30.279  -41.836  90.895  1.00 57.50  ? 1138 ILE A O     1 
ATOM   9049  C  CB    . ILE C 3  1138 ? 29.020  -44.957  90.643  1.00 57.72  ? 1138 ILE A CB    1 
ATOM   9050  C  CG1   . ILE C 3  1138 ? 29.297  -46.423  90.971  1.00 57.29  ? 1138 ILE A CG1   1 
ATOM   9051  C  CG2   . ILE C 3  1138 ? 29.489  -44.625  89.235  1.00 55.61  ? 1138 ILE A CG2   1 
ATOM   9052  C  CD1   . ILE C 3  1138 ? 28.590  -47.382  90.057  1.00 57.32  ? 1138 ILE A CD1   1 
ATOM   9053  N  N     . GLU C 3  1139 ? 28.112  -42.262  91.379  1.00 59.84  ? 1139 GLU A N     1 
ATOM   9054  C  CA    . GLU C 3  1139 ? 27.607  -40.942  91.018  1.00 61.02  ? 1139 GLU A CA    1 
ATOM   9055  C  C     . GLU C 3  1139 ? 28.459  -39.812  91.564  1.00 59.86  ? 1139 GLU A C     1 
ATOM   9056  O  O     . GLU C 3  1139 ? 28.496  -39.570  92.769  1.00 61.38  ? 1139 GLU A O     1 
ATOM   9057  C  CB    . GLU C 3  1139 ? 26.159  -40.775  91.496  1.00 64.15  ? 1139 GLU A CB    1 
ATOM   9058  C  CG    . GLU C 3  1139 ? 25.520  -39.447  91.085  1.00 70.39  ? 1139 GLU A CG    1 
ATOM   9059  C  CD    . GLU C 3  1139 ? 24.027  -39.374  91.387  1.00 75.27  ? 1139 GLU A CD    1 
ATOM   9060  O  OE1   . GLU C 3  1139 ? 23.650  -39.285  92.579  1.00 77.87  ? 1139 GLU A OE1   1 
ATOM   9061  O  OE2   . GLU C 3  1139 ? 23.228  -39.408  90.423  1.00 76.74  ? 1139 GLU A OE2   1 
ATOM   9062  N  N     . HIS C 3  1140 ? 29.144  -39.124  90.660  1.00 57.35  ? 1140 HIS A N     1 
ATOM   9063  C  CA    . HIS C 3  1140 ? 30.001  -38.007  91.017  1.00 55.97  ? 1140 HIS A CA    1 
ATOM   9064  C  C     . HIS C 3  1140 ? 29.251  -37.026  91.904  1.00 56.47  ? 1140 HIS A C     1 
ATOM   9065  O  O     . HIS C 3  1140 ? 28.034  -36.898  91.805  1.00 58.16  ? 1140 HIS A O     1 
ATOM   9066  C  CB    . HIS C 3  1140 ? 30.450  -37.302  89.752  1.00 54.82  ? 1140 HIS A CB    1 
ATOM   9067  C  CG    . HIS C 3  1140 ? 31.368  -36.155  89.997  1.00 54.16  ? 1140 HIS A CG    1 
ATOM   9068  N  ND1   . HIS C 3  1140 ? 32.625  -36.316  90.535  1.00 54.89  ? 1140 HIS A ND1   1 
ATOM   9069  C  CD2   . HIS C 3  1140 ? 31.232  -34.835  89.741  1.00 55.84  ? 1140 HIS A CD2   1 
ATOM   9070  C  CE1   . HIS C 3  1140 ? 33.230  -35.144  90.597  1.00 55.27  ? 1140 HIS A CE1   1 
ATOM   9071  N  NE2   . HIS C 3  1140 ? 32.406  -34.229  90.120  1.00 59.69  ? 1140 HIS A NE2   1 
ATOM   9072  N  N     . THR C 3  1141 ? 29.975  -36.330  92.771  1.00 56.66  ? 1141 THR A N     1 
ATOM   9073  C  CA    . THR C 3  1141 ? 29.352  -35.366  93.671  1.00 55.74  ? 1141 THR A CA    1 
ATOM   9074  C  C     . THR C 3  1141 ? 30.365  -34.375  94.241  1.00 57.48  ? 1141 THR A C     1 
ATOM   9075  O  O     . THR C 3  1141 ? 31.241  -34.746  95.022  1.00 59.13  ? 1141 THR A O     1 
ATOM   9076  C  CB    . THR C 3  1141 ? 28.666  -36.073  94.834  1.00 51.66  ? 1141 THR A CB    1 
ATOM   9077  O  OG1   . THR C 3  1141 ? 27.714  -37.010  94.329  1.00 51.62  ? 1141 THR A OG1   1 
ATOM   9078  C  CG2   . THR C 3  1141 ? 27.943  -35.081  95.685  1.00 52.86  ? 1141 THR A CG2   1 
ATOM   9079  N  N     . THR C 3  1142 ? 30.236  -33.111  93.849  1.00 57.47  ? 1142 THR A N     1 
ATOM   9080  C  CA    . THR C 3  1142 ? 31.136  -32.061  94.309  1.00 55.77  ? 1142 THR A CA    1 
ATOM   9081  C  C     . THR C 3  1142 ? 30.504  -31.299  95.463  1.00 54.14  ? 1142 THR A C     1 
ATOM   9082  O  O     . THR C 3  1142 ? 29.369  -31.561  95.850  1.00 52.96  ? 1142 THR A O     1 
ATOM   9083  C  CB    . THR C 3  1142 ? 31.432  -31.063  93.192  1.00 57.15  ? 1142 THR A CB    1 
ATOM   9084  O  OG1   . THR C 3  1142 ? 30.237  -30.342  92.879  1.00 61.55  ? 1142 THR A OG1   1 
ATOM   9085  C  CG2   . THR C 3  1142 ? 31.898  -31.786  91.944  1.00 57.14  ? 1142 THR A CG2   1 
ATOM   9086  N  N     . LEU C 3  1143 ? 31.239  -30.338  96.002  1.00 53.13  ? 1143 LEU A N     1 
ATOM   9087  C  CA    . LEU C 3  1143 ? 30.735  -29.553  97.120  1.00 51.99  ? 1143 LEU A CA    1 
ATOM   9088  C  C     . LEU C 3  1143 ? 29.566  -28.676  96.670  1.00 49.54  ? 1143 LEU A C     1 
ATOM   9089  O  O     . LEU C 3  1143 ? 28.553  -28.566  97.354  1.00 46.98  ? 1143 LEU A O     1 
ATOM   9090  C  CB    . LEU C 3  1143 ? 31.878  -28.705  97.699  1.00 52.24  ? 1143 LEU A CB    1 
ATOM   9091  C  CG    . LEU C 3  1143 ? 31.661  -27.974  99.022  1.00 50.37  ? 1143 LEU A CG    1 
ATOM   9092  C  CD1   . LEU C 3  1143 ? 30.924  -28.862  100.022 1.00 47.59  ? 1143 LEU A CD1   1 
ATOM   9093  C  CD2   . LEU C 3  1143 ? 33.011  -27.555  99.555  1.00 48.42  ? 1143 LEU A CD2   1 
ATOM   9094  N  N     . LYS C 3  1144 ? 29.730  -28.075  95.499  1.00 48.20  ? 1144 LYS A N     1 
ATOM   9095  C  CA    . LYS C 3  1144 ? 28.738  -27.205  94.883  1.00 49.17  ? 1144 LYS A CA    1 
ATOM   9096  C  C     . LYS C 3  1144 ? 27.355  -27.859  94.896  1.00 49.70  ? 1144 LYS A C     1 
ATOM   9097  O  O     . LYS C 3  1144 ? 26.354  -27.243  95.270  1.00 50.77  ? 1144 LYS A O     1 
ATOM   9098  C  CB    . LYS C 3  1144 ? 29.171  -26.940  93.441  1.00 49.38  ? 1144 LYS A CB    1 
ATOM   9099  C  CG    . LYS C 3  1144 ? 28.519  -25.770  92.738  1.00 54.22  ? 1144 LYS A CG    1 
ATOM   9100  C  CD    . LYS C 3  1144 ? 29.060  -25.683  91.306  1.00 61.60  ? 1144 LYS A CD    1 
ATOM   9101  C  CE    . LYS C 3  1144 ? 28.616  -24.419  90.569  1.00 63.18  ? 1144 LYS A CE    1 
ATOM   9102  N  NZ    . LYS C 3  1144 ? 29.143  -24.415  89.171  1.00 64.92  ? 1144 LYS A NZ    1 
ATOM   9103  N  N     . SER C 3  1145 ? 27.322  -29.121  94.486  1.00 49.25  ? 1145 SER A N     1 
ATOM   9104  C  CA    . SER C 3  1145 ? 26.094  -29.901  94.403  1.00 47.97  ? 1145 SER A CA    1 
ATOM   9105  C  C     . SER C 3  1145 ? 25.383  -30.104  95.728  1.00 46.70  ? 1145 SER A C     1 
ATOM   9106  O  O     . SER C 3  1145 ? 24.335  -30.738  95.781  1.00 46.81  ? 1145 SER A O     1 
ATOM   9107  C  CB    . SER C 3  1145 ? 26.404  -31.273  93.817  1.00 50.30  ? 1145 SER A CB    1 
ATOM   9108  O  OG    . SER C 3  1145 ? 27.111  -32.055  94.760  1.00 48.90  ? 1145 SER A OG    1 
ATOM   9109  N  N     . VAL C 3  1146 ? 25.948  -29.577  96.800  1.00 46.49  ? 1146 VAL A N     1 
ATOM   9110  C  CA    . VAL C 3  1146 ? 25.341  -29.750  98.108  1.00 46.27  ? 1146 VAL A CA    1 
ATOM   9111  C  C     . VAL C 3  1146 ? 25.275  -28.423  98.841  1.00 46.61  ? 1146 VAL A C     1 
ATOM   9112  O  O     . VAL C 3  1146 ? 24.571  -28.272  99.844  1.00 47.01  ? 1146 VAL A O     1 
ATOM   9113  C  CB    . VAL C 3  1146 ? 26.163  -30.719  98.953  1.00 45.03  ? 1146 VAL A CB    1 
ATOM   9114  C  CG1   . VAL C 3  1146 ? 25.364  -31.154  100.135 1.00 47.99  ? 1146 VAL A CG1   1 
ATOM   9115  C  CG2   . VAL C 3  1146 ? 26.576  -31.905  98.128  1.00 45.38  ? 1146 VAL A CG2   1 
ATOM   9116  N  N     . THR C 3  1147 ? 26.019  -27.461  98.312  1.00 46.85  ? 1147 THR A N     1 
ATOM   9117  C  CA    . THR C 3  1147 ? 26.121  -26.132  98.887  1.00 45.39  ? 1147 THR A CA    1 
ATOM   9118  C  C     . THR C 3  1147 ? 24.955  -25.238  98.546  1.00 44.39  ? 1147 THR A C     1 
ATOM   9119  O  O     . THR C 3  1147 ? 24.616  -25.091  97.374  1.00 46.22  ? 1147 THR A O     1 
ATOM   9120  C  CB    . THR C 3  1147 ? 27.360  -25.440  98.368  1.00 45.14  ? 1147 THR A CB    1 
ATOM   9121  O  OG1   . THR C 3  1147 ? 28.462  -26.353  98.416  1.00 48.18  ? 1147 THR A OG1   1 
ATOM   9122  C  CG2   . THR C 3  1147 ? 27.656  -24.208  99.194  1.00 45.82  ? 1147 THR A CG2   1 
ATOM   9123  N  N     . ILE C 3  1148 ? 24.345  -24.634  99.561  1.00 42.00  ? 1148 ILE A N     1 
ATOM   9124  C  CA    . ILE C 3  1148 ? 23.243  -23.716  99.315  1.00 41.46  ? 1148 ILE A CA    1 
ATOM   9125  C  C     . ILE C 3  1148 ? 23.894  -22.417  98.883  1.00 40.19  ? 1148 ILE A C     1 
ATOM   9126  O  O     . ILE C 3  1148 ? 23.740  -21.985  97.746  1.00 39.81  ? 1148 ILE A O     1 
ATOM   9127  C  CB    . ILE C 3  1148 ? 22.406  -23.442  100.582 1.00 43.52  ? 1148 ILE A CB    1 
ATOM   9128  C  CG1   . ILE C 3  1148 ? 21.870  -24.759  101.143 1.00 46.58  ? 1148 ILE A CG1   1 
ATOM   9129  C  CG2   . ILE C 3  1148 ? 21.247  -22.491  100.255 1.00 38.50  ? 1148 ILE A CG2   1 
ATOM   9130  C  CD1   . ILE C 3  1148 ? 21.140  -24.602  102.465 1.00 49.76  ? 1148 ILE A CD1   1 
ATOM   9131  N  N     . ALA C 3  1149 ? 24.638  -21.813  99.803  1.00 40.10  ? 1149 ALA A N     1 
ATOM   9132  C  CA    . ALA C 3  1149 ? 25.340  -20.562  99.547  1.00 42.17  ? 1149 ALA A CA    1 
ATOM   9133  C  C     . ALA C 3  1149 ? 26.607  -20.517  100.373 1.00 44.15  ? 1149 ALA A C     1 
ATOM   9134  O  O     . ALA C 3  1149 ? 26.826  -21.357  101.244 1.00 45.56  ? 1149 ALA A O     1 
ATOM   9135  C  CB    . ALA C 3  1149 ? 24.468  -19.392  99.918  1.00 41.04  ? 1149 ALA A CB    1 
ATOM   9136  N  N     . SER C 3  1150 ? 27.454  -19.540  100.099 1.00 45.00  ? 1150 SER A N     1 
ATOM   9137  C  CA    . SER C 3  1150 ? 28.665  -19.412  100.882 1.00 46.63  ? 1150 SER A CA    1 
ATOM   9138  C  C     . SER C 3  1150 ? 28.785  -17.946  101.247 1.00 49.48  ? 1150 SER A C     1 
ATOM   9139  O  O     . SER C 3  1150 ? 28.233  -17.081  100.560 1.00 50.44  ? 1150 SER A O     1 
ATOM   9140  C  CB    . SER C 3  1150 ? 29.887  -19.881  100.091 1.00 43.26  ? 1150 SER A CB    1 
ATOM   9141  O  OG    . SER C 3  1150 ? 30.259  -18.954  99.096  1.00 43.87  ? 1150 SER A OG    1 
ATOM   9142  N  N     . GLU C 3  1151 ? 29.490  -17.671  102.338 1.00 52.14  ? 1151 GLU A N     1 
ATOM   9143  C  CA    . GLU C 3  1151 ? 29.683  -16.304  102.804 1.00 54.09  ? 1151 GLU A CA    1 
ATOM   9144  C  C     . GLU C 3  1151 ? 31.109  -16.067  103.321 1.00 54.24  ? 1151 GLU A C     1 
ATOM   9145  O  O     . GLU C 3  1151 ? 31.865  -17.013  103.559 1.00 54.39  ? 1151 GLU A O     1 
ATOM   9146  C  CB    . GLU C 3  1151 ? 28.678  -16.009  103.916 1.00 55.24  ? 1151 GLU A CB    1 
ATOM   9147  C  CG    . GLU C 3  1151 ? 27.233  -16.195  103.515 1.00 57.45  ? 1151 GLU A CG    1 
ATOM   9148  C  CD    . GLU C 3  1151 ? 26.297  -16.166  104.706 1.00 62.13  ? 1151 GLU A CD    1 
ATOM   9149  O  OE1   . GLU C 3  1151 ? 26.363  -17.097  105.537 1.00 65.54  ? 1151 GLU A OE1   1 
ATOM   9150  O  OE2   . GLU C 3  1151 ? 25.495  -15.214  104.817 1.00 62.09  ? 1151 GLU A OE2   1 
ATOM   9151  N  N     . ILE C 3  1152 ? 31.474  -14.799  103.479 1.00 54.07  ? 1152 ILE A N     1 
ATOM   9152  C  CA    . ILE C 3  1152 ? 32.787  -14.441  104.006 1.00 55.46  ? 1152 ILE A CA    1 
ATOM   9153  C  C     . ILE C 3  1152 ? 32.633  -13.295  104.990 1.00 56.44  ? 1152 ILE A C     1 
ATOM   9154  O  O     . ILE C 3  1152 ? 32.623  -12.129  104.600 1.00 56.62  ? 1152 ILE A O     1 
ATOM   9155  C  CB    . ILE C 3  1152 ? 33.754  -13.971  102.917 1.00 55.64  ? 1152 ILE A CB    1 
ATOM   9156  C  CG1   . ILE C 3  1152 ? 33.932  -15.056  101.859 1.00 55.25  ? 1152 ILE A CG1   1 
ATOM   9157  C  CG2   . ILE C 3  1152 ? 35.092  -13.622  103.550 1.00 50.70  ? 1152 ILE A CG2   1 
ATOM   9158  C  CD1   . ILE C 3  1152 ? 34.889  -14.650  100.756 1.00 55.31  ? 1152 ILE A CD1   1 
ATOM   9159  N  N     . TYR C 3  1153 ? 32.513  -13.629  106.267 1.00 57.97  ? 1153 TYR A N     1 
ATOM   9160  C  CA    . TYR C 3  1153 ? 32.350  -12.623  107.304 1.00 59.60  ? 1153 TYR A CA    1 
ATOM   9161  C  C     . TYR C 3  1153 ? 33.687  -12.204  107.885 1.00 62.42  ? 1153 TYR A C     1 
ATOM   9162  O  O     . TYR C 3  1153 ? 34.717  -12.843  107.664 1.00 61.80  ? 1153 TYR A O     1 
ATOM   9163  C  CB    . TYR C 3  1153 ? 31.510  -13.167  108.462 1.00 56.69  ? 1153 TYR A CB    1 
ATOM   9164  C  CG    . TYR C 3  1153 ? 30.081  -13.514  108.153 1.00 52.79  ? 1153 TYR A CG    1 
ATOM   9165  C  CD1   . TYR C 3  1153 ? 29.764  -14.435  107.165 1.00 52.79  ? 1153 TYR A CD1   1 
ATOM   9166  C  CD2   . TYR C 3  1153 ? 29.047  -12.962  108.894 1.00 51.99  ? 1153 TYR A CD2   1 
ATOM   9167  C  CE1   . TYR C 3  1153 ? 28.450  -14.803  106.924 1.00 53.45  ? 1153 TYR A CE1   1 
ATOM   9168  C  CE2   . TYR C 3  1153 ? 27.730  -13.322  108.665 1.00 54.42  ? 1153 TYR A CE2   1 
ATOM   9169  C  CZ    . TYR C 3  1153 ? 27.435  -14.247  107.677 1.00 55.09  ? 1153 TYR A CZ    1 
ATOM   9170  O  OH    . TYR C 3  1153 ? 26.129  -14.627  107.453 1.00 57.25  ? 1153 TYR A OH    1 
ATOM   9171  N  N     . TYR C 3  1154 ? 33.662  -11.113  108.637 1.00 66.02  ? 1154 TYR A N     1 
ATOM   9172  C  CA    . TYR C 3  1154 ? 34.856  -10.665  109.312 1.00 70.71  ? 1154 TYR A CA    1 
ATOM   9173  C  C     . TYR C 3  1154 ? 34.654  -11.120  110.755 1.00 75.00  ? 1154 TYR A C     1 
ATOM   9174  O  O     . TYR C 3  1154 ? 33.932  -10.474  111.519 1.00 75.50  ? 1154 TYR A O     1 
ATOM   9175  C  CB    . TYR C 3  1154 ? 35.004  -9.142   109.282 1.00 70.18  ? 1154 TYR A CB    1 
ATOM   9176  C  CG    . TYR C 3  1154 ? 36.281  -8.696   109.966 1.00 72.15  ? 1154 TYR A CG    1 
ATOM   9177  C  CD1   . TYR C 3  1154 ? 37.521  -8.895   109.356 1.00 73.10  ? 1154 TYR A CD1   1 
ATOM   9178  C  CD2   . TYR C 3  1154 ? 36.265  -8.189   111.272 1.00 72.25  ? 1154 TYR A CD2   1 
ATOM   9179  C  CE1   . TYR C 3  1154 ? 38.716  -8.612   110.029 1.00 73.31  ? 1154 TYR A CE1   1 
ATOM   9180  C  CE2   . TYR C 3  1154 ? 37.459  -7.905   111.956 1.00 71.34  ? 1154 TYR A CE2   1 
ATOM   9181  C  CZ    . TYR C 3  1154 ? 38.678  -8.123   111.325 1.00 72.17  ? 1154 TYR A CZ    1 
ATOM   9182  O  OH    . TYR C 3  1154 ? 39.864  -7.867   111.977 1.00 70.29  ? 1154 TYR A OH    1 
ATOM   9183  N  N     . ASP C 3  1155 ? 35.255  -12.253  111.114 1.00 79.39  ? 1155 ASP A N     1 
ATOM   9184  C  CA    . ASP C 3  1155 ? 35.160  -12.769  112.474 1.00 83.33  ? 1155 ASP A CA    1 
ATOM   9185  C  C     . ASP C 3  1155 ? 36.580  -12.969  113.005 1.00 86.21  ? 1155 ASP A C     1 
ATOM   9186  O  O     . ASP C 3  1155 ? 37.275  -13.923  112.643 1.00 85.75  ? 1155 ASP A O     1 
ATOM   9187  C  CB    . ASP C 3  1155 ? 34.388  -14.087  112.511 1.00 85.68  ? 1155 ASP A CB    1 
ATOM   9188  C  CG    . ASP C 3  1155 ? 33.440  -14.163  113.691 1.00 88.54  ? 1155 ASP A CG    1 
ATOM   9189  O  OD1   . ASP C 3  1155 ? 33.884  -13.883  114.825 1.00 92.94  ? 1155 ASP A OD1   1 
ATOM   9190  O  OD2   . ASP C 3  1155 ? 32.254  -14.496  113.489 1.00 87.98  ? 1155 ASP A OD2   1 
ATOM   9191  N  N     . PRO C 3  1156 ? 37.026  -12.050  113.871 1.00 89.16  ? 1156 PRO A N     1 
ATOM   9192  C  CA    . PRO C 3  1156 ? 38.354  -12.045  114.491 1.00 91.11  ? 1156 PRO A CA    1 
ATOM   9193  C  C     . PRO C 3  1156 ? 38.555  -12.855  115.786 1.00 91.68  ? 1156 PRO A C     1 
ATOM   9194  O  O     . PRO C 3  1156 ? 39.670  -13.302  116.065 1.00 91.41  ? 1156 PRO A O     1 
ATOM   9195  C  CB    . PRO C 3  1156 ? 38.604  -10.560  114.699 1.00 93.20  ? 1156 PRO A CB    1 
ATOM   9196  C  CG    . PRO C 3  1156 ? 37.235  -10.077  115.112 1.00 92.22  ? 1156 PRO A CG    1 
ATOM   9197  C  CD    . PRO C 3  1156 ? 36.308  -10.789  114.154 1.00 90.11  ? 1156 PRO A CD    1 
ATOM   9198  N  N     . ASP C 3  1157 ? 37.498  -13.036  116.576 1.00 91.71  ? 1157 ASP A N     1 
ATOM   9199  C  CA    . ASP C 3  1157 ? 37.621  -13.788  117.824 1.00 93.64  ? 1157 ASP A CA    1 
ATOM   9200  C  C     . ASP C 3  1157 ? 37.184  -15.245  117.699 1.00 93.39  ? 1157 ASP A C     1 
ATOM   9201  O  O     . ASP C 3  1157 ? 36.014  -15.576  117.907 1.00 92.07  ? 1157 ASP A O     1 
ATOM   9202  C  CB    . ASP C 3  1157 ? 36.809  -13.116  118.933 1.00 97.56  ? 1157 ASP A CB    1 
ATOM   9203  C  CG    . ASP C 3  1157 ? 36.903  -13.861  120.261 1.00 101.06 ? 1157 ASP A CG    1 
ATOM   9204  O  OD1   . ASP C 3  1157 ? 38.019  -13.960  120.822 1.00 103.49 ? 1157 ASP A OD1   1 
ATOM   9205  O  OD2   . ASP C 3  1157 ? 35.859  -14.349  120.742 1.00 102.24 ? 1157 ASP A OD2   1 
ATOM   9206  N  N     . PRO C 3  1158 ? 38.130  -16.142  117.376 1.00 93.21  ? 1158 PRO A N     1 
ATOM   9207  C  CA    . PRO C 3  1158 ? 37.781  -17.556  117.236 1.00 94.39  ? 1158 PRO A CA    1 
ATOM   9208  C  C     . PRO C 3  1158 ? 37.146  -18.211  118.463 1.00 95.69  ? 1158 PRO A C     1 
ATOM   9209  O  O     . PRO C 3  1158 ? 36.671  -19.341  118.378 1.00 96.91  ? 1158 PRO A O     1 
ATOM   9210  C  CB    . PRO C 3  1158 ? 39.107  -18.201  116.823 1.00 92.81  ? 1158 PRO A CB    1 
ATOM   9211  C  CG    . PRO C 3  1158 ? 40.135  -17.279  117.387 1.00 92.21  ? 1158 PRO A CG    1 
ATOM   9212  C  CD    . PRO C 3  1158 ? 39.560  -15.928  117.100 1.00 91.45  ? 1158 PRO A CD    1 
ATOM   9213  N  N     . ARG C 3  1159 ? 37.123  -17.519  119.597 1.00 96.38  ? 1159 ARG A N     1 
ATOM   9214  C  CA    . ARG C 3  1159 ? 36.511  -18.104  120.790 1.00 98.24  ? 1159 ARG A CA    1 
ATOM   9215  C  C     . ARG C 3  1159 ? 35.013  -17.796  120.875 1.00 97.32  ? 1159 ARG A C     1 
ATOM   9216  O  O     . ARG C 3  1159 ? 34.277  -18.449  121.619 1.00 96.27  ? 1159 ARG A O     1 
ATOM   9217  C  CB    . ARG C 3  1159 ? 37.210  -17.624  122.074 1.00 102.59 ? 1159 ARG A CB    1 
ATOM   9218  C  CG    . ARG C 3  1159 ? 38.483  -18.392  122.468 1.00 105.78 ? 1159 ARG A CG    1 
ATOM   9219  C  CD    . ARG C 3  1159 ? 38.738  -18.258  123.976 1.00 110.75 ? 1159 ARG A CD    1 
ATOM   9220  N  NE    . ARG C 3  1159 ? 40.089  -18.652  124.380 1.00 115.75 ? 1159 ARG A NE    1 
ATOM   9221  C  CZ    . ARG C 3  1159 ? 40.582  -18.498  125.610 1.00 117.92 ? 1159 ARG A CZ    1 
ATOM   9222  N  NH1   . ARG C 3  1159 ? 39.835  -17.960  126.569 1.00 118.63 ? 1159 ARG A NH1   1 
ATOM   9223  N  NH2   . ARG C 3  1159 ? 41.829  -18.868  125.883 1.00 117.75 ? 1159 ARG A NH2   1 
ATOM   9224  N  N     . SER C 3  1160 ? 34.571  -16.793  120.122 1.00 96.90  ? 1160 SER A N     1 
ATOM   9225  C  CA    . SER C 3  1160 ? 33.157  -16.416  120.094 1.00 97.12  ? 1160 SER A CA    1 
ATOM   9226  C  C     . SER C 3  1160 ? 32.849  -15.710  118.775 1.00 97.27  ? 1160 SER A C     1 
ATOM   9227  O  O     . SER C 3  1160 ? 33.455  -14.690  118.444 1.00 97.42  ? 1160 SER A O     1 
ATOM   9228  C  CB    . SER C 3  1160 ? 32.793  -15.512  121.282 1.00 96.30  ? 1160 SER A CB    1 
ATOM   9229  O  OG    . SER C 3  1160 ? 33.335  -14.212  121.147 1.00 95.13  ? 1160 SER A OG    1 
ATOM   9230  N  N     . THR C 3  1161 ? 31.903  -16.275  118.027 1.00 97.54  ? 1161 THR A N     1 
ATOM   9231  C  CA    . THR C 3  1161 ? 31.500  -15.748  116.723 1.00 96.75  ? 1161 THR A CA    1 
ATOM   9232  C  C     . THR C 3  1161 ? 30.694  -14.460  116.817 1.00 95.10  ? 1161 THR A C     1 
ATOM   9233  O  O     . THR C 3  1161 ? 30.101  -14.144  117.847 1.00 94.21  ? 1161 THR A O     1 
ATOM   9234  C  CB    . THR C 3  1161 ? 30.647  -16.784  115.928 1.00 97.40  ? 1161 THR A CB    1 
ATOM   9235  O  OG1   . THR C 3  1161 ? 31.352  -18.027  115.835 1.00 101.13 ? 1161 THR A OG1   1 
ATOM   9236  C  CG2   . THR C 3  1161 ? 30.372  -16.289  114.517 1.00 97.11  ? 1161 THR A CG2   1 
ATOM   9237  N  N     . VAL C 3  1162 ? 30.689  -13.717  115.722 1.00 93.71  ? 1162 VAL A N     1 
ATOM   9238  C  CA    . VAL C 3  1162 ? 29.948  -12.481  115.645 1.00 92.98  ? 1162 VAL A CA    1 
ATOM   9239  C  C     . VAL C 3  1162 ? 28.525  -12.881  115.301 1.00 93.71  ? 1162 VAL A C     1 
ATOM   9240  O  O     . VAL C 3  1162 ? 27.598  -12.078  115.389 1.00 93.61  ? 1162 VAL A O     1 
ATOM   9241  C  CB    . VAL C 3  1162 ? 30.501  -11.598  114.537 1.00 92.51  ? 1162 VAL A CB    1 
ATOM   9242  C  CG1   . VAL C 3  1162 ? 29.781  -10.267  114.530 1.00 93.86  ? 1162 VAL A CG1   1 
ATOM   9243  C  CG2   . VAL C 3  1162 ? 31.995  -11.412  114.733 1.00 94.05  ? 1162 VAL A CG2   1 
ATOM   9244  N  N     . ILE C 3  1163 ? 28.374  -14.145  114.912 1.00 94.91  ? 1163 ILE A N     1 
ATOM   9245  C  CA    . ILE C 3  1163 ? 27.085  -14.724  114.535 1.00 95.00  ? 1163 ILE A CA    1 
ATOM   9246  C  C     . ILE C 3  1163 ? 26.457  -15.443  115.726 1.00 96.47  ? 1163 ILE A C     1 
ATOM   9247  O  O     . ILE C 3  1163 ? 27.105  -16.258  116.382 1.00 97.83  ? 1163 ILE A O     1 
ATOM   9248  C  CB    . ILE C 3  1163 ? 27.251  -15.759  113.410 1.00 92.75  ? 1163 ILE A CB    1 
ATOM   9249  C  CG1   . ILE C 3  1163 ? 28.057  -15.159  112.256 1.00 90.80  ? 1163 ILE A CG1   1 
ATOM   9250  C  CG2   . ILE C 3  1163 ? 25.881  -16.228  112.947 1.00 93.90  ? 1163 ILE A CG2   1 
ATOM   9251  C  CD1   . ILE C 3  1163 ? 28.602  -16.189  111.285 1.00 88.79  ? 1163 ILE A CD1   1 
ATOM   9252  N  N     . PRO C 3  1164 ? 25.180  -15.164  116.013 1.00 97.31  ? 1164 PRO A N     1 
ATOM   9253  C  CA    . PRO C 3  1164 ? 24.529  -15.823  117.145 1.00 98.81  ? 1164 PRO A CA    1 
ATOM   9254  C  C     . PRO C 3  1164 ? 24.247  -17.314  116.936 1.00 100.20 ? 1164 PRO A C     1 
ATOM   9255  O  O     . PRO C 3  1164 ? 24.270  -18.092  117.886 1.00 100.91 ? 1164 PRO A O     1 
ATOM   9256  C  CB    . PRO C 3  1164 ? 23.253  -15.007  117.321 1.00 98.74  ? 1164 PRO A CB    1 
ATOM   9257  C  CG    . PRO C 3  1164 ? 22.925  -14.620  115.917 1.00 98.54  ? 1164 PRO A CG    1 
ATOM   9258  C  CD    . PRO C 3  1164 ? 24.271  -14.198  115.375 1.00 97.29  ? 1164 PRO A CD    1 
ATOM   9259  N  N     . GLU C 3  1165 ? 23.997  -17.714  115.695 1.00 101.37 ? 1165 GLU A N     1 
ATOM   9260  C  CA    . GLU C 3  1165 ? 23.684  -19.108  115.396 1.00 102.39 ? 1165 GLU A CA    1 
ATOM   9261  C  C     . GLU C 3  1165 ? 24.823  -20.114  115.475 1.00 101.69 ? 1165 GLU A C     1 
ATOM   9262  O  O     . GLU C 3  1165 ? 24.586  -21.317  115.413 1.00 101.76 ? 1165 GLU A O     1 
ATOM   9263  C  CB    . GLU C 3  1165 ? 23.056  -19.206  114.017 1.00 105.38 ? 1165 GLU A CB    1 
ATOM   9264  C  CG    . GLU C 3  1165 ? 21.781  -18.427  113.886 1.00 112.38 ? 1165 GLU A CG    1 
ATOM   9265  C  CD    . GLU C 3  1165 ? 20.988  -18.853  112.672 1.00 117.30 ? 1165 GLU A CD    1 
ATOM   9266  O  OE1   . GLU C 3  1165 ? 21.528  -18.739  111.546 1.00 117.85 ? 1165 GLU A OE1   1 
ATOM   9267  O  OE2   . GLU C 3  1165 ? 19.831  -19.307  112.850 1.00 118.08 ? 1165 GLU A OE2   1 
ATOM   9268  N  N     . ASP C 3  1166 ? 26.054  -19.636  115.604 1.00 101.15 ? 1166 ASP A N     1 
ATOM   9269  C  CA    . ASP C 3  1166 ? 27.194  -20.537  115.672 1.00 100.67 ? 1166 ASP A CA    1 
ATOM   9270  C  C     . ASP C 3  1166 ? 27.810  -20.606  117.061 1.00 102.31 ? 1166 ASP A C     1 
ATOM   9271  O  O     . ASP C 3  1166 ? 28.857  -21.225  117.250 1.00 103.21 ? 1166 ASP A O     1 
ATOM   9272  C  CB    . ASP C 3  1166 ? 28.261  -20.115  114.658 1.00 97.72  ? 1166 ASP A CB    1 
ATOM   9273  C  CG    . ASP C 3  1166 ? 27.785  -20.236  113.222 1.00 93.64  ? 1166 ASP A CG    1 
ATOM   9274  O  OD1   . ASP C 3  1166 ? 26.629  -20.657  113.006 1.00 88.56  ? 1166 ASP A OD1   1 
ATOM   9275  O  OD2   . ASP C 3  1166 ? 28.575  -19.910  112.312 1.00 91.33  ? 1166 ASP A OD2   1 
ATOM   9276  N  N     . GLU C 3  1167 ? 27.169  -19.971  118.035 1.00 104.01 ? 1167 GLU A N     1 
ATOM   9277  C  CA    . GLU C 3  1167 ? 27.694  -19.994  119.392 1.00 106.13 ? 1167 GLU A CA    1 
ATOM   9278  C  C     . GLU C 3  1167 ? 27.889  -21.439  119.836 1.00 107.37 ? 1167 GLU A C     1 
ATOM   9279  O  O     . GLU C 3  1167 ? 28.992  -21.828  120.230 1.00 106.73 ? 1167 GLU A O     1 
ATOM   9280  C  CB    . GLU C 3  1167 ? 26.748  -19.261  120.362 1.00 107.17 ? 1167 GLU A CB    1 
ATOM   9281  C  CG    . GLU C 3  1167 ? 26.800  -17.719  120.269 1.00 108.01 ? 1167 GLU A CG    1 
ATOM   9282  C  CD    . GLU C 3  1167 ? 25.901  -17.000  121.290 1.00 107.63 ? 1167 GLU A CD    1 
ATOM   9283  O  OE1   . GLU C 3  1167 ? 26.011  -17.285  122.505 1.00 108.08 ? 1167 GLU A OE1   1 
ATOM   9284  O  OE2   . GLU C 3  1167 ? 25.092  -16.136  120.877 1.00 103.68 ? 1167 GLU A OE2   1 
ATOM   9285  N  N     . GLU C 3  1168 ? 26.825  -22.236  119.737 1.00 109.12 ? 1168 GLU A N     1 
ATOM   9286  C  CA    . GLU C 3  1168 ? 26.873  -23.636  120.154 1.00 111.47 ? 1168 GLU A CA    1 
ATOM   9287  C  C     . GLU C 3  1168 ? 28.035  -24.381  119.516 1.00 111.91 ? 1168 GLU A C     1 
ATOM   9288  O  O     . GLU C 3  1168 ? 28.879  -24.940  120.213 1.00 112.85 ? 1168 GLU A O     1 
ATOM   9289  C  CB    . GLU C 3  1168 ? 25.558  -24.353  119.817 1.00 112.85 ? 1168 GLU A CB    1 
ATOM   9290  C  CG    . GLU C 3  1168 ? 25.187  -25.447  120.829 1.00 116.14 ? 1168 GLU A CG    1 
ATOM   9291  C  CD    . GLU C 3  1168 ? 23.971  -26.270  120.421 1.00 118.08 ? 1168 GLU A CD    1 
ATOM   9292  O  OE1   . GLU C 3  1168 ? 24.094  -27.100  119.494 1.00 119.04 ? 1168 GLU A OE1   1 
ATOM   9293  O  OE2   . GLU C 3  1168 ? 22.893  -26.085  121.027 1.00 118.26 ? 1168 GLU A OE2   1 
ATOM   9294  N  N     . ILE C 3  1169 ? 28.076  -24.379  118.189 1.00 112.59 ? 1169 ILE A N     1 
ATOM   9295  C  CA    . ILE C 3  1169 ? 29.128  -25.058  117.437 1.00 113.28 ? 1169 ILE A CA    1 
ATOM   9296  C  C     . ILE C 3  1169 ? 30.536  -24.832  117.967 1.00 114.35 ? 1169 ILE A C     1 
ATOM   9297  O  O     . ILE C 3  1169 ? 31.324  -25.769  118.058 1.00 114.20 ? 1169 ILE A O     1 
ATOM   9298  C  CB    . ILE C 3  1169 ? 29.117  -24.625  115.961 1.00 112.67 ? 1169 ILE A CB    1 
ATOM   9299  C  CG1   . ILE C 3  1169 ? 27.787  -25.026  115.322 1.00 113.37 ? 1169 ILE A CG1   1 
ATOM   9300  C  CG2   . ILE C 3  1169 ? 30.298  -25.246  115.224 1.00 110.12 ? 1169 ILE A CG2   1 
ATOM   9301  C  CD1   . ILE C 3  1169 ? 27.580  -24.460  113.936 1.00 114.35 ? 1169 ILE A CD1   1 
ATOM   9302  N  N     . ILE C 3  1170 ? 30.852  -23.591  118.317 1.00 116.09 ? 1170 ILE A N     1 
ATOM   9303  C  CA    . ILE C 3  1170 ? 32.185  -23.271  118.802 1.00 118.61 ? 1170 ILE A CA    1 
ATOM   9304  C  C     . ILE C 3  1170 ? 32.580  -23.895  120.138 1.00 121.03 ? 1170 ILE A C     1 
ATOM   9305  O  O     . ILE C 3  1170 ? 33.677  -24.440  120.269 1.00 121.92 ? 1170 ILE A O     1 
ATOM   9306  C  CB    . ILE C 3  1170 ? 32.384  -21.751  118.873 1.00 117.39 ? 1170 ILE A CB    1 
ATOM   9307  C  CG1   . ILE C 3  1170 ? 32.308  -21.173  117.458 1.00 116.26 ? 1170 ILE A CG1   1 
ATOM   9308  C  CG2   . ILE C 3  1170 ? 33.722  -21.427  119.528 1.00 118.48 ? 1170 ILE A CG2   1 
ATOM   9309  C  CD1   . ILE C 3  1170 ? 32.951  -19.823  117.304 1.00 115.64 ? 1170 ILE A CD1   1 
ATOM   9310  N  N     . GLN C 3  1171 ? 31.698  -23.817  121.126 1.00 123.51 ? 1171 GLN A N     1 
ATOM   9311  C  CA    . GLN C 3  1171 ? 31.987  -24.386  122.439 1.00 126.83 ? 1171 GLN A CA    1 
ATOM   9312  C  C     . GLN C 3  1171 ? 32.188  -25.891  122.343 1.00 128.99 ? 1171 GLN A C     1 
ATOM   9313  O  O     . GLN C 3  1171 ? 33.116  -26.453  122.926 1.00 128.92 ? 1171 GLN A O     1 
ATOM   9314  C  CB    . GLN C 3  1171 ? 30.831  -24.115  123.398 1.00 127.22 ? 1171 GLN A CB    1 
ATOM   9315  C  CG    . GLN C 3  1171 ? 30.424  -22.661  123.488 1.00 128.70 ? 1171 GLN A CG    1 
ATOM   9316  C  CD    . GLN C 3  1171 ? 29.227  -22.458  124.392 1.00 128.60 ? 1171 GLN A CD    1 
ATOM   9317  O  OE1   . GLN C 3  1171 ? 28.157  -23.026  124.162 1.00 128.22 ? 1171 GLN A OE1   1 
ATOM   9318  N  NE2   . GLN C 3  1171 ? 29.400  -21.646  125.429 1.00 128.46 ? 1171 GLN A NE2   1 
ATOM   9319  N  N     . LEU C 3  1172 ? 31.300  -26.530  121.593 1.00 131.90 ? 1172 LEU A N     1 
ATOM   9320  C  CA    . LEU C 3  1172 ? 31.316  -27.972  121.418 1.00 135.18 ? 1172 LEU A CA    1 
ATOM   9321  C  C     . LEU C 3  1172 ? 32.501  -28.526  120.643 1.00 137.80 ? 1172 LEU A C     1 
ATOM   9322  O  O     . LEU C 3  1172 ? 32.466  -29.682  120.225 1.00 138.53 ? 1172 LEU A O     1 
ATOM   9323  C  CB    . LEU C 3  1172 ? 30.023  -28.423  120.732 1.00 134.95 ? 1172 LEU A CB    1 
ATOM   9324  C  CG    . LEU C 3  1172 ? 28.701  -27.876  121.278 1.00 135.27 ? 1172 LEU A CG    1 
ATOM   9325  C  CD1   . LEU C 3  1172 ? 27.542  -28.557  120.553 1.00 135.28 ? 1172 LEU A CD1   1 
ATOM   9326  C  CD2   . LEU C 3  1172 ? 28.611  -28.111  122.783 1.00 135.13 ? 1172 LEU A CD2   1 
ATOM   9327  N  N     . HIS C 3  1173 ? 33.549  -27.731  120.442 1.00 141.17 ? 1173 HIS A N     1 
ATOM   9328  C  CA    . HIS C 3  1173 ? 34.705  -28.236  119.702 1.00 145.51 ? 1173 HIS A CA    1 
ATOM   9329  C  C     . HIS C 3  1173 ? 36.020  -28.330  120.479 1.00 147.66 ? 1173 HIS A C     1 
ATOM   9330  O  O     . HIS C 3  1173 ? 37.039  -27.781  120.052 1.00 148.17 ? 1173 HIS A O     1 
ATOM   9331  C  CB    . HIS C 3  1173 ? 34.916  -27.425  118.416 1.00 145.71 ? 1173 HIS A CB    1 
ATOM   9332  C  CG    . HIS C 3  1173 ? 34.076  -27.895  117.267 1.00 147.35 ? 1173 HIS A CG    1 
ATOM   9333  N  ND1   . HIS C 3  1173 ? 34.120  -29.190  116.792 1.00 147.70 ? 1173 HIS A ND1   1 
ATOM   9334  C  CD2   . HIS C 3  1173 ? 33.165  -27.247  116.503 1.00 147.94 ? 1173 HIS A CD2   1 
ATOM   9335  C  CE1   . HIS C 3  1173 ? 33.273  -29.318  115.786 1.00 147.48 ? 1173 HIS A CE1   1 
ATOM   9336  N  NE2   . HIS C 3  1173 ? 32.681  -28.154  115.590 1.00 148.27 ? 1173 HIS A NE2   1 
ATOM   9337  N  N     . PHE C 3  1174 ? 35.984  -29.040  121.610 1.00 149.81 ? 1174 PHE A N     1 
ATOM   9338  C  CA    . PHE C 3  1174 ? 37.157  -29.251  122.467 1.00 151.44 ? 1174 PHE A CA    1 
ATOM   9339  C  C     . PHE C 3  1174 ? 36.961  -30.487  123.345 1.00 153.16 ? 1174 PHE A C     1 
ATOM   9340  O  O     . PHE C 3  1174 ? 37.684  -30.677  124.325 1.00 152.99 ? 1174 PHE A O     1 
ATOM   9341  C  CB    . PHE C 3  1174 ? 37.403  -28.038  123.375 1.00 150.19 ? 1174 PHE A CB    1 
ATOM   9342  C  CG    . PHE C 3  1174 ? 37.539  -26.744  122.633 1.00 149.08 ? 1174 PHE A CG    1 
ATOM   9343  C  CD1   . PHE C 3  1174 ? 36.421  -25.955  122.370 1.00 148.05 ? 1174 PHE A CD1   1 
ATOM   9344  C  CD2   . PHE C 3  1174 ? 38.776  -26.338  122.145 1.00 149.33 ? 1174 PHE A CD2   1 
ATOM   9345  C  CE1   . PHE C 3  1174 ? 36.532  -24.784  121.627 1.00 147.74 ? 1174 PHE A CE1   1 
ATOM   9346  C  CE2   . PHE C 3  1174 ? 38.901  -25.168  121.400 1.00 149.48 ? 1174 PHE A CE2   1 
ATOM   9347  C  CZ    . PHE C 3  1174 ? 37.775  -24.388  121.141 1.00 149.01 ? 1174 PHE A CZ    1 
ATOM   9348  N  N     . SER C 3  1175 ? 35.991  -31.324  122.981 1.00 155.41 ? 1175 SER A N     1 
ATOM   9349  C  CA    . SER C 3  1175 ? 35.668  -32.530  123.748 1.00 157.95 ? 1175 SER A CA    1 
ATOM   9350  C  C     . SER C 3  1175 ? 36.276  -33.842  123.235 1.00 159.30 ? 1175 SER A C     1 
ATOM   9351  O  O     . SER C 3  1175 ? 36.879  -33.888  122.160 1.00 159.26 ? 1175 SER A O     1 
ATOM   9352  C  CB    . SER C 3  1175 ? 34.141  -32.685  123.845 1.00 157.92 ? 1175 SER A CB    1 
ATOM   9353  O  OG    . SER C 3  1175 ? 33.545  -32.813  122.563 1.00 156.62 ? 1175 SER A OG    1 
ATOM   9354  N  N     . LEU C 3  1176 ? 36.107  -34.903  124.028 1.00 160.75 ? 1176 LEU A N     1 
ATOM   9355  C  CA    . LEU C 3  1176 ? 36.604  -36.243  123.698 1.00 161.73 ? 1176 LEU A CA    1 
ATOM   9356  C  C     . LEU C 3  1176 ? 35.455  -37.143  123.237 1.00 162.29 ? 1176 LEU A C     1 
ATOM   9357  O  O     . LEU C 3  1176 ? 35.591  -37.904  122.276 1.00 162.44 ? 1176 LEU A O     1 
ATOM   9358  C  CB    . LEU C 3  1176 ? 37.290  -36.882  124.920 1.00 161.57 ? 1176 LEU A CB    1 
ATOM   9359  C  CG    . LEU C 3  1176 ? 38.790  -36.656  125.162 1.00 160.35 ? 1176 LEU A CG    1 
ATOM   9360  C  CD1   . LEU C 3  1176 ? 39.163  -37.123  126.565 1.00 159.19 ? 1176 LEU A CD1   1 
ATOM   9361  C  CD2   . LEU C 3  1176 ? 39.602  -37.411  124.115 1.00 158.29 ? 1176 LEU A CD2   1 
ATOM   9362  N  N     . GLN C 3  1187 ? 48.989  -18.610  112.962 1.00 111.96 ? 1187 GLN A N     1 
ATOM   9363  C  CA    . GLN C 3  1187 ? 47.796  -19.444  113.048 1.00 111.30 ? 1187 GLN A CA    1 
ATOM   9364  C  C     . GLN C 3  1187 ? 46.580  -18.847  112.329 1.00 109.61 ? 1187 GLN A C     1 
ATOM   9365  O  O     . GLN C 3  1187 ? 46.708  -18.240  111.260 1.00 109.02 ? 1187 GLN A O     1 
ATOM   9366  C  CB    . GLN C 3  1187 ? 47.437  -19.713  114.516 1.00 113.41 ? 1187 GLN A CB    1 
ATOM   9367  C  CG    . GLN C 3  1187 ? 47.286  -18.457  115.361 1.00 114.82 ? 1187 GLN A CG    1 
ATOM   9368  C  CD    . GLN C 3  1187 ? 46.301  -18.638  116.498 1.00 116.22 ? 1187 GLN A CD    1 
ATOM   9369  O  OE1   . GLN C 3  1187 ? 46.372  -19.610  117.254 1.00 116.64 ? 1187 GLN A OE1   1 
ATOM   9370  N  NE2   . GLN C 3  1187 ? 45.375  -17.695  116.627 1.00 116.38 ? 1187 GLN A NE2   1 
ATOM   9371  N  N     . GLN C 3  1188 ? 45.409  -19.027  112.943 1.00 107.08 ? 1188 GLN A N     1 
ATOM   9372  C  CA    . GLN C 3  1188 ? 44.116  -18.571  112.422 1.00 103.64 ? 1188 GLN A CA    1 
ATOM   9373  C  C     . GLN C 3  1188 ? 43.975  -17.097  112.054 1.00 100.32 ? 1188 GLN A C     1 
ATOM   9374  O  O     . GLN C 3  1188 ? 44.369  -16.216  112.817 1.00 101.47 ? 1188 GLN A O     1 
ATOM   9375  C  CB    . GLN C 3  1188 ? 43.011  -18.916  113.423 1.00 104.31 ? 1188 GLN A CB    1 
ATOM   9376  C  CG    . GLN C 3  1188 ? 42.961  -20.380  113.809 1.00 107.60 ? 1188 GLN A CG    1 
ATOM   9377  C  CD    . GLN C 3  1188 ? 41.865  -20.677  114.813 1.00 109.16 ? 1188 GLN A CD    1 
ATOM   9378  O  OE1   . GLN C 3  1188 ? 40.688  -20.410  114.560 1.00 108.29 ? 1188 GLN A OE1   1 
ATOM   9379  N  NE2   . GLN C 3  1188 ? 42.248  -21.233  115.962 1.00 109.65 ? 1188 GLN A NE2   1 
ATOM   9380  N  N     . SER C 3  1189 ? 43.384  -16.850  110.885 1.00 95.99  ? 1189 SER A N     1 
ATOM   9381  C  CA    . SER C 3  1189 ? 43.128  -15.500  110.374 1.00 90.76  ? 1189 SER A CA    1 
ATOM   9382  C  C     . SER C 3  1189 ? 41.756  -15.042  110.882 1.00 88.17  ? 1189 SER A C     1 
ATOM   9383  O  O     . SER C 3  1189 ? 40.988  -15.846  111.410 1.00 87.47  ? 1189 SER A O     1 
ATOM   9384  C  CB    . SER C 3  1189 ? 43.149  -15.507  108.841 1.00 89.18  ? 1189 SER A CB    1 
ATOM   9385  O  OG    . SER C 3  1189 ? 42.310  -14.495  108.302 1.00 84.59  ? 1189 SER A OG    1 
ATOM   9386  N  N     . PRO C 3  1190 ? 41.429  -13.746  110.732 1.00 85.70  ? 1190 PRO A N     1 
ATOM   9387  C  CA    . PRO C 3  1190 ? 40.130  -13.250  111.205 1.00 83.04  ? 1190 PRO A CA    1 
ATOM   9388  C  C     . PRO C 3  1190 ? 39.003  -13.357  110.182 1.00 81.01  ? 1190 PRO A C     1 
ATOM   9389  O  O     . PRO C 3  1190 ? 37.849  -13.091  110.502 1.00 81.44  ? 1190 PRO A O     1 
ATOM   9390  C  CB    . PRO C 3  1190 ? 40.435  -11.807  111.561 1.00 83.68  ? 1190 PRO A CB    1 
ATOM   9391  C  CG    . PRO C 3  1190 ? 41.373  -11.422  110.455 1.00 85.24  ? 1190 PRO A CG    1 
ATOM   9392  C  CD    . PRO C 3  1190 ? 42.302  -12.624  110.338 1.00 85.58  ? 1190 PRO A CD    1 
ATOM   9393  N  N     . TRP C 3  1191 ? 39.344  -13.728  108.951 1.00 77.89  ? 1191 TRP A N     1 
ATOM   9394  C  CA    . TRP C 3  1191 ? 38.353  -13.877  107.888 1.00 72.26  ? 1191 TRP A CA    1 
ATOM   9395  C  C     . TRP C 3  1191 ? 37.753  -15.277  107.890 1.00 69.68  ? 1191 TRP A C     1 
ATOM   9396  O  O     . TRP C 3  1191 ? 38.461  -16.271  107.726 1.00 68.59  ? 1191 TRP A O     1 
ATOM   9397  C  CB    . TRP C 3  1191 ? 38.992  -13.631  106.529 1.00 71.66  ? 1191 TRP A CB    1 
ATOM   9398  C  CG    . TRP C 3  1191 ? 39.514  -12.263  106.341 1.00 70.87  ? 1191 TRP A CG    1 
ATOM   9399  C  CD1   . TRP C 3  1191 ? 40.824  -11.887  106.278 1.00 71.70  ? 1191 TRP A CD1   1 
ATOM   9400  C  CD2   . TRP C 3  1191 ? 38.744  -11.082  106.117 1.00 69.90  ? 1191 TRP A CD2   1 
ATOM   9401  N  NE1   . TRP C 3  1191 ? 40.918  -10.543  106.016 1.00 71.20  ? 1191 TRP A NE1   1 
ATOM   9402  C  CE2   . TRP C 3  1191 ? 39.654  -10.024  105.912 1.00 70.58  ? 1191 TRP A CE2   1 
ATOM   9403  C  CE3   . TRP C 3  1191 ? 37.372  -10.815  106.064 1.00 68.82  ? 1191 TRP A CE3   1 
ATOM   9404  C  CZ2   . TRP C 3  1191 ? 39.233  -8.717   105.657 1.00 70.64  ? 1191 TRP A CZ2   1 
ATOM   9405  C  CZ3   . TRP C 3  1191 ? 36.956  -9.515   105.811 1.00 68.77  ? 1191 TRP A CZ3   1 
ATOM   9406  C  CH2   . TRP C 3  1191 ? 37.883  -8.484   105.609 1.00 68.83  ? 1191 TRP A CH2   1 
ATOM   9407  N  N     . LEU C 3  1192 ? 36.441  -15.351  108.053 1.00 67.19  ? 1192 LEU A N     1 
ATOM   9408  C  CA    . LEU C 3  1192 ? 35.757  -16.635  108.080 1.00 64.56  ? 1192 LEU A CA    1 
ATOM   9409  C  C     . LEU C 3  1192 ? 35.020  -16.972  106.780 1.00 63.37  ? 1192 LEU A C     1 
ATOM   9410  O  O     . LEU C 3  1192 ? 34.248  -16.161  106.265 1.00 64.62  ? 1192 LEU A O     1 
ATOM   9411  C  CB    . LEU C 3  1192 ? 34.759  -16.653  109.236 1.00 62.49  ? 1192 LEU A CB    1 
ATOM   9412  C  CG    . LEU C 3  1192 ? 33.849  -17.875  109.304 1.00 60.24  ? 1192 LEU A CG    1 
ATOM   9413  C  CD1   . LEU C 3  1192 ? 34.644  -19.090  109.727 1.00 59.26  ? 1192 LEU A CD1   1 
ATOM   9414  C  CD2   . LEU C 3  1192 ? 32.740  -17.611  110.287 1.00 63.23  ? 1192 LEU A CD2   1 
ATOM   9415  N  N     . LEU C 3  1193 ? 35.277  -18.164  106.244 1.00 60.54  ? 1193 LEU A N     1 
ATOM   9416  C  CA    . LEU C 3  1193 ? 34.597  -18.628  105.037 1.00 56.37  ? 1193 LEU A CA    1 
ATOM   9417  C  C     . LEU C 3  1193 ? 33.479  -19.505  105.580 1.00 54.85  ? 1193 LEU A C     1 
ATOM   9418  O  O     . LEU C 3  1193 ? 33.745  -20.438  106.333 1.00 57.20  ? 1193 LEU A O     1 
ATOM   9419  C  CB    . LEU C 3  1193 ? 35.530  -19.465  104.161 1.00 51.67  ? 1193 LEU A CB    1 
ATOM   9420  C  CG    . LEU C 3  1193 ? 34.811  -20.044  102.944 1.00 47.85  ? 1193 LEU A CG    1 
ATOM   9421  C  CD1   . LEU C 3  1193 ? 34.054  -18.936  102.246 1.00 47.51  ? 1193 LEU A CD1   1 
ATOM   9422  C  CD2   . LEU C 3  1193 ? 35.799  -20.681  102.004 1.00 46.45  ? 1193 LEU A CD2   1 
ATOM   9423  N  N     . ARG C 3  1194 ? 32.238  -19.232  105.204 1.00 50.84  ? 1194 ARG A N     1 
ATOM   9424  C  CA    . ARG C 3  1194 ? 31.138  -20.007  105.755 1.00 48.54  ? 1194 ARG A CA    1 
ATOM   9425  C  C     . ARG C 3  1194 ? 30.172  -20.574  104.730 1.00 49.27  ? 1194 ARG A C     1 
ATOM   9426  O  O     . ARG C 3  1194 ? 29.509  -19.816  104.018 1.00 52.43  ? 1194 ARG A O     1 
ATOM   9427  C  CB    . ARG C 3  1194 ? 30.384  -19.118  106.718 1.00 45.87  ? 1194 ARG A CB    1 
ATOM   9428  C  CG    . ARG C 3  1194 ? 29.310  -19.773  107.513 1.00 43.64  ? 1194 ARG A CG    1 
ATOM   9429  C  CD    . ARG C 3  119