data_1I6P
# 
_entry.id   1I6P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I6P         
RCSB  RCSB012972   
WWPDB D_1000012972 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1I6O 
_pdbx_database_related.details        
'CRYSTAL STRUCTURE OF E. COLI BETA CARBONIC ANHYDRASE (ECCA) IN A DIFFERENT SPACE GROUP, P4322, SOLVED TO 2.2A RESOLUTION' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I6P 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cronk, J.D.'    1 
'Endrizzi, J.A.' 2 
'Cronk, M.R.'    3 
;O'Neill, J.W.
;
4 
'Zhang, K.Y.J.'  5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of E. coli beta-carbonic anhydrase, an enzyme with an unusual pH-dependent activity.'       
'Protein Sci.'             10 911  922  2001 PRCIEI US 0961-8368 0795 ? 11316870 10.1110/ps.46301          
1       'Cloning, crystallization and preliminary characterization of a beta carbonic anhydrase from Escherichia coli' 
'Acta Crystallogr.,Sect.D' 52 1176 1179 2000 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900008519 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cronk, J.D.'    1  
primary 'Endrizzi, J.A.' 2  
primary 'Cronk, M.R.'    3  
primary 
;O'neill, J.W.
;
4  
primary 'Zhang, K.Y.'    5  
1       'Cronk, J.D.'    6  
1       
;O'Neill, J.W.
;
7  
1       'Cronk, M.R.'    8  
1       'Endrizzi, J.A.' 9  
1       'Zhang, K.Y.J.'  10 
# 
_cell.entry_id           1I6P 
_cell.length_a           68.535 
_cell.length_b           68.535 
_cell.length_c           85.877 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I6P 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CARBONIC ANHYDRASE' 25130.779 1  4.2.1.1 ? ? ? 
2 non-polymer syn 'ZINC ION'           65.409    1  ?       ? ? ? 
3 water       nat water                18.015    62 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV
VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH
STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV
VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH
STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ASP n 
1 4   ILE n 
1 5   ASP n 
1 6   THR n 
1 7   LEU n 
1 8   ILE n 
1 9   SER n 
1 10  ASN n 
1 11  ASN n 
1 12  ALA n 
1 13  LEU n 
1 14  TRP n 
1 15  SER n 
1 16  LYS n 
1 17  MET n 
1 18  LEU n 
1 19  VAL n 
1 20  GLU n 
1 21  GLU n 
1 22  ASP n 
1 23  PRO n 
1 24  GLY n 
1 25  PHE n 
1 26  PHE n 
1 27  GLU n 
1 28  LYS n 
1 29  LEU n 
1 30  ALA n 
1 31  GLN n 
1 32  ALA n 
1 33  GLN n 
1 34  LYS n 
1 35  PRO n 
1 36  ARG n 
1 37  PHE n 
1 38  LEU n 
1 39  TRP n 
1 40  ILE n 
1 41  GLY n 
1 42  CYS n 
1 43  SER n 
1 44  ASP n 
1 45  SER n 
1 46  ARG n 
1 47  VAL n 
1 48  PRO n 
1 49  ALA n 
1 50  GLU n 
1 51  ARG n 
1 52  LEU n 
1 53  THR n 
1 54  GLY n 
1 55  LEU n 
1 56  GLU n 
1 57  PRO n 
1 58  GLY n 
1 59  GLU n 
1 60  LEU n 
1 61  PHE n 
1 62  VAL n 
1 63  HIS n 
1 64  ARG n 
1 65  ASN n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  LEU n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  THR n 
1 74  ASP n 
1 75  LEU n 
1 76  ASN n 
1 77  CYS n 
1 78  LEU n 
1 79  SER n 
1 80  VAL n 
1 81  VAL n 
1 82  GLN n 
1 83  TYR n 
1 84  ALA n 
1 85  VAL n 
1 86  ASP n 
1 87  VAL n 
1 88  LEU n 
1 89  GLU n 
1 90  VAL n 
1 91  GLU n 
1 92  HIS n 
1 93  ILE n 
1 94  ILE n 
1 95  ILE n 
1 96  CYS n 
1 97  GLY n 
1 98  HIS n 
1 99  TYR n 
1 100 GLY n 
1 101 CYS n 
1 102 GLY n 
1 103 GLY n 
1 104 VAL n 
1 105 GLN n 
1 106 ALA n 
1 107 ALA n 
1 108 VAL n 
1 109 GLU n 
1 110 ASN n 
1 111 PRO n 
1 112 GLU n 
1 113 LEU n 
1 114 GLY n 
1 115 LEU n 
1 116 ILE n 
1 117 ASN n 
1 118 ASN n 
1 119 TRP n 
1 120 LEU n 
1 121 LEU n 
1 122 HIS n 
1 123 ILE n 
1 124 ARG n 
1 125 ASP n 
1 126 ILE n 
1 127 TRP n 
1 128 PHE n 
1 129 LYS n 
1 130 HIS n 
1 131 SER n 
1 132 SER n 
1 133 LEU n 
1 134 LEU n 
1 135 GLY n 
1 136 GLU n 
1 137 MET n 
1 138 PRO n 
1 139 GLN n 
1 140 GLU n 
1 141 ARG n 
1 142 ARG n 
1 143 LEU n 
1 144 ASP n 
1 145 THR n 
1 146 LEU n 
1 147 CYS n 
1 148 GLU n 
1 149 LEU n 
1 150 ASN n 
1 151 VAL n 
1 152 MET n 
1 153 GLU n 
1 154 GLN n 
1 155 VAL n 
1 156 TYR n 
1 157 ASN n 
1 158 LEU n 
1 159 GLY n 
1 160 HIS n 
1 161 SER n 
1 162 THR n 
1 163 ILE n 
1 164 MET n 
1 165 GLN n 
1 166 SER n 
1 167 ALA n 
1 168 TRP n 
1 169 LYS n 
1 170 ARG n 
1 171 GLY n 
1 172 GLN n 
1 173 LYS n 
1 174 VAL n 
1 175 THR n 
1 176 ILE n 
1 177 HIS n 
1 178 GLY n 
1 179 TRP n 
1 180 ALA n 
1 181 TYR n 
1 182 GLY n 
1 183 ILE n 
1 184 HIS n 
1 185 ASP n 
1 186 GLY n 
1 187 LEU n 
1 188 LEU n 
1 189 ARG n 
1 190 ASP n 
1 191 LEU n 
1 192 ASP n 
1 193 VAL n 
1 194 THR n 
1 195 ALA n 
1 196 THR n 
1 197 ASN n 
1 198 ARG n 
1 199 GLU n 
1 200 THR n 
1 201 LEU n 
1 202 GLU n 
1 203 GLN n 
1 204 ARG n 
1 205 TYR n 
1 206 ARG n 
1 207 HIS n 
1 208 GLY n 
1 209 ILE n 
1 210 SER n 
1 211 ASN n 
1 212 LEU n 
1 213 LYS n 
1 214 LEU n 
1 215 LYS n 
1 216 HIS n 
1 217 ALA n 
1 218 ASN n 
1 219 HIS n 
1 220 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 YADF 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CAN_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV
VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH
STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P61517 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1I6P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 220 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P61517 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  220 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       220 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1I6P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.009 
_exptl_crystal.density_percent_sol   36.4 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.3 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate, MES pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1999-04-08 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1I6P 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   13974 
_reflns.number_all                   90500 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.0650000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        20.4 
_reflns.B_iso_Wilson_estimate        15.6 
_reflns.pdbx_redundancy              6.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           0.3090000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.4 
_reflns_shell.pdbx_redundancy        3.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1I6P 
_refine.ls_number_reflns_obs                     13653 
_refine.ls_number_reflns_all                     13958 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               334555.69 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             42.21 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    94.7 
_refine.ls_R_factor_obs                          0.1760000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1760000 
_refine.ls_R_factor_R_free                       0.2020000 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_number_reflns_R_free                  1379 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.8 
_refine.aniso_B[1][1]                            -0.34 
_refine.aniso_B[2][2]                            -0.34 
_refine.aniso_B[3][3]                            0.69 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.338 
_refine.solvent_model_param_bsol                 44.43 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1I6O' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I6P 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.24 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1715 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             62 
_refine_hist.number_atoms_total               1778 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        42.21 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.004 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 20.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.62  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             1955 
_refine_ls_shell.R_factor_R_work                  0.1910000 
_refine_ls_shell.percent_reflns_obs               92.6 
_refine_ls_shell.R_factor_R_free                  0.2150000 
_refine_ls_shell.R_factor_R_free_error            0.014 
_refine_ls_shell.percent_reflns_R_free            10.2 
_refine_ls_shell.number_reflns_R_free             223 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   ?           'X-RAY DIFFRACTION' 
3 ION.PARAM         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1I6P 
_struct.title                     'CRYSTAL STRUCTURE OF E. COLI BETA CARBONIC ANHYDRASE (ECCA)' 
_struct.pdbx_descriptor           'PUTATIVE CARBONIC ANHYDRASE (E.C.4.2.1.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I6P 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'carbonic anhydrase, metalloenzyme, zinc coordination, pH-dependent activity, MAD phasing, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;A tetramer constructed from the operations -y, -x, -z;  y, x, -z; -1-x, 1-y, z is thought to exist in solution under physiological conditions.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 3   ? GLU A 20  ? ASP A 3   GLU A 20  1 ? 18 
HELX_P HELX_P2  2  PHE A 26  ? GLN A 31  ? PHE A 26  GLN A 31  1 ? 6  
HELX_P HELX_P3  3  PRO A 48  ? GLY A 54  ? PRO A 48  GLY A 54  1 ? 7  
HELX_P HELX_P4  4  ASP A 74  ? VAL A 87  ? ASP A 74  VAL A 87  1 ? 14 
HELX_P HELX_P5  5  CYS A 101 ? ASN A 110 ? CYS A 101 ASN A 110 1 ? 10 
HELX_P HELX_P6  6  LEU A 115 ? HIS A 130 ? LEU A 115 HIS A 130 1 ? 16 
HELX_P HELX_P7  7  HIS A 130 ? GLY A 135 ? HIS A 130 GLY A 135 1 ? 6  
HELX_P HELX_P8  8  GLU A 136 ? MET A 137 ? GLU A 136 MET A 137 5 ? 2  
HELX_P HELX_P9  9  PRO A 138 ? GLU A 140 ? PRO A 138 GLU A 140 5 ? 3  
HELX_P HELX_P10 10 ARG A 141 ? SER A 161 ? ARG A 141 SER A 161 1 ? 21 
HELX_P HELX_P11 11 SER A 161 ? ARG A 170 ? SER A 161 ARG A 170 1 ? 10 
HELX_P HELX_P12 12 ASN A 197 ? LYS A 215 ? ASN A 197 LYS A 215 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 101 SG  ? ? A ZN 301 A CYS 101 1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A ASP 44  OD2 ? ? A ZN 301 A ASP 44  1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 98  NE2 ? ? A ZN 301 A HIS 98  1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 42  SG  ? ? A ZN 301 A CYS 42  1_555 ? ? ? ? ? ? ? 2.337 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 60  ? ASN A 65  ? LEU A 60  ASN A 65  
A 2 PHE A 37  ? CYS A 42  ? PHE A 37  CYS A 42  
A 3 HIS A 92  ? HIS A 98  ? HIS A 92  HIS A 98  
A 4 THR A 175 ? TYR A 181 ? THR A 175 TYR A 181 
A 5 LEU A 188 ? ASP A 190 ? LEU A 188 ASP A 190 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 61  ? N PHE A 61  O PHE A 37  ? O PHE A 37  
A 2 3 N LEU A 38  ? N LEU A 38  O HIS A 92  ? O HIS A 92  
A 3 4 N ILE A 93  ? N ILE A 93  O THR A 175 ? O THR A 175 
A 4 5 O ALA A 180 ? O ALA A 180 N ARG A 189 ? N ARG A 189 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 42  ? CYS A 42  . ? 1_555 ? 
2 AC1 4 ASP A 44  ? ASP A 44  . ? 1_555 ? 
3 AC1 4 HIS A 98  ? HIS A 98  . ? 1_555 ? 
4 AC1 4 CYS A 101 ? CYS A 101 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I6P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I6P 
_atom_sites.fract_transf_matrix[1][1]   0.014591 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014591 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011645 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 2   ? 9.247   34.953 48.157 1.00 49.26 ? 2   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 2   ? 9.868   35.615 49.342 1.00 48.06 ? 2   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 2   ? 8.827   36.354 50.178 1.00 47.02 ? 2   LYS A C   1 
ATOM   4    O  O   . LYS A 1 2   ? 7.901   36.963 49.639 1.00 47.58 ? 2   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 2   ? 10.941  36.608 48.891 1.00 48.68 ? 2   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 2   ? 12.059  35.987 48.076 1.00 49.96 ? 2   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 2   ? 13.073  37.032 47.656 1.00 50.98 ? 2   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 2   ? 14.153  36.423 46.781 1.00 51.28 ? 2   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 2   ? 15.137  37.443 46.339 1.00 52.15 ? 2   LYS A NZ  1 
ATOM   10   N  N   . ASP A 1 3   ? 8.986   36.294 51.496 1.00 44.10 ? 3   ASP A N   1 
ATOM   11   C  CA  . ASP A 1 3   ? 8.073   36.969 52.411 1.00 41.70 ? 3   ASP A CA  1 
ATOM   12   C  C   . ASP A 1 3   ? 8.854   38.019 53.192 1.00 38.82 ? 3   ASP A C   1 
ATOM   13   O  O   . ASP A 1 3   ? 10.069  38.142 53.035 1.00 36.62 ? 3   ASP A O   1 
ATOM   14   C  CB  . ASP A 1 3   ? 7.440   35.964 53.379 1.00 43.81 ? 3   ASP A CB  1 
ATOM   15   C  CG  . ASP A 1 3   ? 8.446   35.379 54.352 1.00 45.65 ? 3   ASP A CG  1 
ATOM   16   O  OD1 . ASP A 1 3   ? 9.512   34.918 53.896 1.00 46.17 ? 3   ASP A OD1 1 
ATOM   17   O  OD2 . ASP A 1 3   ? 8.168   35.376 55.571 1.00 48.53 ? 3   ASP A OD2 1 
ATOM   18   N  N   . ILE A 1 4   ? 8.152   38.770 54.035 1.00 36.64 ? 4   ILE A N   1 
ATOM   19   C  CA  . ILE A 1 4   ? 8.772   39.822 54.833 1.00 34.15 ? 4   ILE A CA  1 
ATOM   20   C  C   . ILE A 1 4   ? 9.892   39.329 55.750 1.00 34.01 ? 4   ILE A C   1 
ATOM   21   O  O   . ILE A 1 4   ? 10.976  39.913 55.781 1.00 32.72 ? 4   ILE A O   1 
ATOM   22   C  CB  . ILE A 1 4   ? 7.706   40.569 55.675 1.00 32.33 ? 4   ILE A CB  1 
ATOM   23   C  CG1 . ILE A 1 4   ? 6.878   41.476 54.763 1.00 32.90 ? 4   ILE A CG1 1 
ATOM   24   C  CG2 . ILE A 1 4   ? 8.364   41.393 56.765 1.00 32.28 ? 4   ILE A CG2 1 
ATOM   25   C  CD1 . ILE A 1 4   ? 7.693   42.555 54.062 1.00 31.36 ? 4   ILE A CD1 1 
ATOM   26   N  N   . ASP A 1 5   ? 9.639   38.259 56.496 1.00 33.90 ? 5   ASP A N   1 
ATOM   27   C  CA  . ASP A 1 5   ? 10.656  37.738 57.402 1.00 35.62 ? 5   ASP A CA  1 
ATOM   28   C  C   . ASP A 1 5   ? 11.951  37.404 56.673 1.00 33.18 ? 5   ASP A C   1 
ATOM   29   O  O   . ASP A 1 5   ? 13.039  37.573 57.222 1.00 34.58 ? 5   ASP A O   1 
ATOM   30   C  CB  . ASP A 1 5   ? 10.138  36.500 58.138 1.00 39.50 ? 5   ASP A CB  1 
ATOM   31   C  CG  . ASP A 1 5   ? 8.995   36.822 59.081 1.00 42.98 ? 5   ASP A CG  1 
ATOM   32   O  OD1 . ASP A 1 5   ? 9.110   37.809 59.844 1.00 44.10 ? 5   ASP A OD1 1 
ATOM   33   O  OD2 . ASP A 1 5   ? 7.987   36.085 59.065 1.00 45.42 ? 5   ASP A OD2 1 
ATOM   34   N  N   . THR A 1 6   ? 11.831  36.940 55.433 1.00 30.95 ? 6   THR A N   1 
ATOM   35   C  CA  . THR A 1 6   ? 13.002  36.587 54.638 1.00 29.34 ? 6   THR A CA  1 
ATOM   36   C  C   . THR A 1 6   ? 13.844  37.811 54.269 1.00 28.62 ? 6   THR A C   1 
ATOM   37   O  O   . THR A 1 6   ? 15.072  37.719 54.179 1.00 28.36 ? 6   THR A O   1 
ATOM   38   C  CB  . THR A 1 6   ? 12.591  35.837 53.349 1.00 30.09 ? 6   THR A CB  1 
ATOM   39   O  OG1 . THR A 1 6   ? 11.997  34.579 53.697 1.00 29.75 ? 6   THR A OG1 1 
ATOM   40   C  CG2 . THR A 1 6   ? 13.805  35.582 52.464 1.00 28.62 ? 6   THR A CG2 1 
ATOM   41   N  N   . LEU A 1 7   ? 13.194  38.955 54.061 1.00 25.96 ? 7   LEU A N   1 
ATOM   42   C  CA  . LEU A 1 7   ? 13.918  40.176 53.707 1.00 25.11 ? 7   LEU A CA  1 
ATOM   43   C  C   . LEU A 1 7   ? 14.695  40.713 54.900 1.00 24.37 ? 7   LEU A C   1 
ATOM   44   O  O   . LEU A 1 7   ? 15.845  41.136 54.765 1.00 25.79 ? 7   LEU A O   1 
ATOM   45   C  CB  . LEU A 1 7   ? 12.953  41.255 53.206 1.00 25.42 ? 7   LEU A CB  1 
ATOM   46   C  CG  . LEU A 1 7   ? 12.081  40.900 52.001 1.00 27.95 ? 7   LEU A CG  1 
ATOM   47   C  CD1 . LEU A 1 7   ? 11.334  42.149 51.554 1.00 28.82 ? 7   LEU A CD1 1 
ATOM   48   C  CD2 . LEU A 1 7   ? 12.936  40.349 50.864 1.00 29.03 ? 7   LEU A CD2 1 
ATOM   49   N  N   . ILE A 1 8   ? 14.058  40.705 56.067 1.00 24.58 ? 8   ILE A N   1 
ATOM   50   C  CA  . ILE A 1 8   ? 14.691  41.184 57.292 1.00 25.24 ? 8   ILE A CA  1 
ATOM   51   C  C   . ILE A 1 8   ? 15.857  40.272 57.668 1.00 24.85 ? 8   ILE A C   1 
ATOM   52   O  O   . ILE A 1 8   ? 16.929  40.743 58.052 1.00 26.05 ? 8   ILE A O   1 
ATOM   53   C  CB  . ILE A 1 8   ? 13.686  41.217 58.474 1.00 26.81 ? 8   ILE A CB  1 
ATOM   54   C  CG1 . ILE A 1 8   ? 12.655  42.333 58.266 1.00 27.41 ? 8   ILE A CG1 1 
ATOM   55   C  CG2 . ILE A 1 8   ? 14.435  41.417 59.795 1.00 24.92 ? 8   ILE A CG2 1 
ATOM   56   C  CD1 . ILE A 1 8   ? 13.238  43.743 58.360 1.00 30.12 ? 8   ILE A CD1 1 
ATOM   57   N  N   . SER A 1 9   ? 15.645  38.966 57.550 1.00 24.49 ? 9   SER A N   1 
ATOM   58   C  CA  . SER A 1 9   ? 16.679  37.996 57.886 1.00 24.73 ? 9   SER A CA  1 
ATOM   59   C  C   . SER A 1 9   ? 17.857  38.093 56.919 1.00 24.60 ? 9   SER A C   1 
ATOM   60   O  O   . SER A 1 9   ? 19.010  38.087 57.345 1.00 23.40 ? 9   SER A O   1 
ATOM   61   C  CB  . SER A 1 9   ? 16.100  36.580 57.872 1.00 26.61 ? 9   SER A CB  1 
ATOM   62   O  OG  . SER A 1 9   ? 17.052  35.640 58.339 1.00 28.54 ? 9   SER A OG  1 
ATOM   63   N  N   . ASN A 1 10  ? 17.573  38.190 55.621 1.00 24.33 ? 10  ASN A N   1 
ATOM   64   C  CA  . ASN A 1 10  ? 18.645  38.305 54.631 1.00 25.08 ? 10  ASN A CA  1 
ATOM   65   C  C   . ASN A 1 10  ? 19.442  39.589 54.844 1.00 24.08 ? 10  ASN A C   1 
ATOM   66   O  O   . ASN A 1 10  ? 20.658  39.614 54.646 1.00 25.41 ? 10  ASN A O   1 
ATOM   67   C  CB  . ASN A 1 10  ? 18.087  38.293 53.203 1.00 27.80 ? 10  ASN A CB  1 
ATOM   68   C  CG  . ASN A 1 10  ? 17.490  36.955 52.818 1.00 32.05 ? 10  ASN A CG  1 
ATOM   69   O  OD1 . ASN A 1 10  ? 17.919  35.909 53.301 1.00 34.87 ? 10  ASN A OD1 1 
ATOM   70   N  ND2 . ASN A 1 10  ? 16.506  36.981 51.925 1.00 35.59 ? 10  ASN A ND2 1 
ATOM   71   N  N   . ASN A 1 11  ? 18.756  40.658 55.240 1.00 22.08 ? 11  ASN A N   1 
ATOM   72   C  CA  . ASN A 1 11  ? 19.420  41.934 55.484 1.00 22.14 ? 11  ASN A CA  1 
ATOM   73   C  C   . ASN A 1 11  ? 20.383  41.809 56.658 1.00 21.74 ? 11  ASN A C   1 
ATOM   74   O  O   . ASN A 1 11  ? 21.518  42.277 56.598 1.00 23.36 ? 11  ASN A O   1 
ATOM   75   C  CB  . ASN A 1 11  ? 18.390  43.036 55.774 1.00 20.29 ? 11  ASN A CB  1 
ATOM   76   C  CG  . ASN A 1 11  ? 19.032  44.303 56.322 1.00 22.32 ? 11  ASN A CG  1 
ATOM   77   O  OD1 . ASN A 1 11  ? 19.042  44.538 57.534 1.00 21.35 ? 11  ASN A OD1 1 
ATOM   78   N  ND2 . ASN A 1 11  ? 19.585  45.118 55.432 1.00 19.49 ? 11  ASN A ND2 1 
ATOM   79   N  N   . ALA A 1 12  ? 19.922  41.174 57.728 1.00 22.44 ? 12  ALA A N   1 
ATOM   80   C  CA  . ALA A 1 12  ? 20.754  40.986 58.907 1.00 22.68 ? 12  ALA A CA  1 
ATOM   81   C  C   . ALA A 1 12  ? 22.002  40.185 58.540 1.00 23.55 ? 12  ALA A C   1 
ATOM   82   O  O   . ALA A 1 12  ? 23.107  40.540 58.937 1.00 24.02 ? 12  ALA A O   1 
ATOM   83   C  CB  . ALA A 1 12  ? 19.966  40.271 59.991 1.00 22.49 ? 12  ALA A CB  1 
ATOM   84   N  N   . LEU A 1 13  ? 21.829  39.115 57.768 1.00 23.71 ? 13  LEU A N   1 
ATOM   85   C  CA  . LEU A 1 13  ? 22.964  38.284 57.370 1.00 25.23 ? 13  LEU A CA  1 
ATOM   86   C  C   . LEU A 1 13  ? 23.866  39.010 56.377 1.00 27.66 ? 13  LEU A C   1 
ATOM   87   O  O   . LEU A 1 13  ? 25.090  38.866 56.411 1.00 26.51 ? 13  LEU A O   1 
ATOM   88   C  CB  . LEU A 1 13  ? 22.467  36.963 56.773 1.00 26.69 ? 13  LEU A CB  1 
ATOM   89   C  CG  . LEU A 1 13  ? 21.705  36.069 57.762 1.00 28.37 ? 13  LEU A CG  1 
ATOM   90   C  CD1 . LEU A 1 13  ? 21.143  34.847 57.048 1.00 30.58 ? 13  LEU A CD1 1 
ATOM   91   C  CD2 . LEU A 1 13  ? 22.646  35.646 58.888 1.00 28.98 ? 13  LEU A CD2 1 
ATOM   92   N  N   . TRP A 1 14  ? 23.255  39.792 55.493 1.00 27.95 ? 14  TRP A N   1 
ATOM   93   C  CA  . TRP A 1 14  ? 23.996  40.559 54.497 1.00 27.91 ? 14  TRP A CA  1 
ATOM   94   C  C   . TRP A 1 14  ? 24.933  41.543 55.190 1.00 28.65 ? 14  TRP A C   1 
ATOM   95   O  O   . TRP A 1 14  ? 26.108  41.653 54.839 1.00 29.64 ? 14  TRP A O   1 
ATOM   96   C  CB  . TRP A 1 14  ? 23.024  41.334 53.609 1.00 28.70 ? 14  TRP A CB  1 
ATOM   97   C  CG  . TRP A 1 14  ? 23.676  42.370 52.748 1.00 29.75 ? 14  TRP A CG  1 
ATOM   98   C  CD1 . TRP A 1 14  ? 24.474  42.154 51.662 1.00 30.73 ? 14  TRP A CD1 1 
ATOM   99   C  CD2 . TRP A 1 14  ? 23.591  43.792 52.909 1.00 31.12 ? 14  TRP A CD2 1 
ATOM   100  N  NE1 . TRP A 1 14  ? 24.891  43.357 51.133 1.00 31.84 ? 14  TRP A NE1 1 
ATOM   101  C  CE2 . TRP A 1 14  ? 24.364  44.377 51.880 1.00 30.25 ? 14  TRP A CE2 1 
ATOM   102  C  CE3 . TRP A 1 14  ? 22.937  44.629 53.823 1.00 30.14 ? 14  TRP A CE3 1 
ATOM   103  C  CZ2 . TRP A 1 14  ? 24.501  45.760 51.741 1.00 31.12 ? 14  TRP A CZ2 1 
ATOM   104  C  CZ3 . TRP A 1 14  ? 23.073  46.006 53.685 1.00 29.49 ? 14  TRP A CZ3 1 
ATOM   105  C  CH2 . TRP A 1 14  ? 23.850  46.557 52.651 1.00 30.80 ? 14  TRP A CH2 1 
ATOM   106  N  N   . SER A 1 15  ? 24.396  42.260 56.171 1.00 28.39 ? 15  SER A N   1 
ATOM   107  C  CA  . SER A 1 15  ? 25.162  43.244 56.921 1.00 30.12 ? 15  SER A CA  1 
ATOM   108  C  C   . SER A 1 15  ? 26.387  42.627 57.591 1.00 30.23 ? 15  SER A C   1 
ATOM   109  O  O   . SER A 1 15  ? 27.481  43.186 57.535 1.00 29.83 ? 15  SER A O   1 
ATOM   110  C  CB  . SER A 1 15  ? 24.273  43.901 57.979 1.00 31.24 ? 15  SER A CB  1 
ATOM   111  O  OG  . SER A 1 15  ? 25.019  44.797 58.783 1.00 33.48 ? 15  SER A OG  1 
ATOM   112  N  N   . LYS A 1 16  ? 26.197  41.474 58.225 1.00 31.33 ? 16  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 16  ? 27.290  40.781 58.902 1.00 33.30 ? 16  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 16  ? 28.367  40.319 57.924 1.00 33.67 ? 16  LYS A C   1 
ATOM   115  O  O   . LYS A 1 16  ? 29.557  40.509 58.169 1.00 32.65 ? 16  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 16  ? 26.760  39.566 59.672 1.00 34.53 ? 16  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 16  ? 26.163  39.871 61.042 1.00 38.85 ? 16  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 16  ? 24.979  40.817 60.960 1.00 41.23 ? 16  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 16  ? 24.302  40.975 62.314 1.00 44.17 ? 16  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 16  ? 23.132  41.901 62.249 1.00 43.53 ? 16  LYS A NZ  1 
ATOM   121  N  N   . MET A 1 17  ? 27.943  39.708 56.822 1.00 35.75 ? 17  MET A N   1 
ATOM   122  C  CA  . MET A 1 17  ? 28.868  39.206 55.810 1.00 37.67 ? 17  MET A CA  1 
ATOM   123  C  C   . MET A 1 17  ? 29.778  40.276 55.214 1.00 39.01 ? 17  MET A C   1 
ATOM   124  O  O   . MET A 1 17  ? 30.907  39.980 54.817 1.00 37.42 ? 17  MET A O   1 
ATOM   125  C  CB  . MET A 1 17  ? 28.098  38.521 54.679 1.00 40.58 ? 17  MET A CB  1 
ATOM   126  C  CG  . MET A 1 17  ? 27.427  37.218 55.076 1.00 43.66 ? 17  MET A CG  1 
ATOM   127  S  SD  . MET A 1 17  ? 26.737  36.350 53.650 1.00 48.04 ? 17  MET A SD  1 
ATOM   128  C  CE  . MET A 1 17  ? 25.025  36.887 53.718 1.00 46.78 ? 17  MET A CE  1 
ATOM   129  N  N   . LEU A 1 18  ? 29.285  41.511 55.145 1.00 39.86 ? 18  LEU A N   1 
ATOM   130  C  CA  . LEU A 1 18  ? 30.056  42.623 54.588 1.00 41.64 ? 18  LEU A CA  1 
ATOM   131  C  C   . LEU A 1 18  ? 31.334  42.920 55.363 1.00 42.91 ? 18  LEU A C   1 
ATOM   132  O  O   . LEU A 1 18  ? 32.325  43.366 54.785 1.00 41.88 ? 18  LEU A O   1 
ATOM   133  C  CB  . LEU A 1 18  ? 29.200  43.891 54.533 1.00 41.17 ? 18  LEU A CB  1 
ATOM   134  C  CG  . LEU A 1 18  ? 28.120  43.956 53.453 1.00 42.17 ? 18  LEU A CG  1 
ATOM   135  C  CD1 . LEU A 1 18  ? 27.356  45.265 53.580 1.00 42.80 ? 18  LEU A CD1 1 
ATOM   136  C  CD2 . LEU A 1 18  ? 28.764  43.845 52.077 1.00 43.41 ? 18  LEU A CD2 1 
ATOM   137  N  N   . VAL A 1 19  ? 31.305  42.680 56.669 1.00 44.80 ? 19  VAL A N   1 
ATOM   138  C  CA  . VAL A 1 19  ? 32.464  42.927 57.518 1.00 47.60 ? 19  VAL A CA  1 
ATOM   139  C  C   . VAL A 1 19  ? 33.679  42.134 57.053 1.00 50.13 ? 19  VAL A C   1 
ATOM   140  O  O   . VAL A 1 19  ? 34.788  42.663 56.985 1.00 49.04 ? 19  VAL A O   1 
ATOM   141  C  CB  . VAL A 1 19  ? 32.170  42.549 58.988 1.00 47.48 ? 19  VAL A CB  1 
ATOM   142  C  CG1 . VAL A 1 19  ? 33.443  42.640 59.816 1.00 48.39 ? 19  VAL A CG1 1 
ATOM   143  C  CG2 . VAL A 1 19  ? 31.101  43.471 59.559 1.00 47.71 ? 19  VAL A CG2 1 
ATOM   144  N  N   . GLU A 1 20  ? 33.460  40.865 56.724 1.00 53.02 ? 20  GLU A N   1 
ATOM   145  C  CA  . GLU A 1 20  ? 34.539  39.987 56.292 1.00 56.62 ? 20  GLU A CA  1 
ATOM   146  C  C   . GLU A 1 20  ? 34.461  39.633 54.809 1.00 57.60 ? 20  GLU A C   1 
ATOM   147  O  O   . GLU A 1 20  ? 34.765  38.507 54.414 1.00 59.12 ? 20  GLU A O   1 
ATOM   148  C  CB  . GLU A 1 20  ? 34.515  38.716 57.142 1.00 58.82 ? 20  GLU A CB  1 
ATOM   149  C  CG  . GLU A 1 20  ? 34.597  39.001 58.639 1.00 61.81 ? 20  GLU A CG  1 
ATOM   150  C  CD  . GLU A 1 20  ? 34.174  37.820 59.491 1.00 63.90 ? 20  GLU A CD  1 
ATOM   151  O  OE1 . GLU A 1 20  ? 34.840  36.764 59.422 1.00 64.20 ? 20  GLU A OE1 1 
ATOM   152  O  OE2 . GLU A 1 20  ? 33.172  37.953 60.230 1.00 63.80 ? 20  GLU A OE2 1 
ATOM   153  N  N   . GLU A 1 21  ? 34.058  40.605 53.996 1.00 57.39 ? 21  GLU A N   1 
ATOM   154  C  CA  . GLU A 1 21  ? 33.936  40.412 52.555 1.00 57.14 ? 21  GLU A CA  1 
ATOM   155  C  C   . GLU A 1 21  ? 34.159  41.738 51.832 1.00 55.90 ? 21  GLU A C   1 
ATOM   156  O  O   . GLU A 1 21  ? 34.658  41.773 50.707 1.00 55.95 ? 21  GLU A O   1 
ATOM   157  C  CB  . GLU A 1 21  ? 32.547  39.872 52.214 1.00 59.29 ? 21  GLU A CB  1 
ATOM   158  C  CG  . GLU A 1 21  ? 32.342  39.568 50.743 1.00 62.75 ? 21  GLU A CG  1 
ATOM   159  C  CD  . GLU A 1 21  ? 30.917  39.155 50.431 1.00 64.87 ? 21  GLU A CD  1 
ATOM   160  O  OE1 . GLU A 1 21  ? 30.006  39.998 50.580 1.00 66.44 ? 21  GLU A OE1 1 
ATOM   161  O  OE2 . GLU A 1 21  ? 30.707  37.988 50.041 1.00 66.25 ? 21  GLU A OE2 1 
ATOM   162  N  N   . ASP A 1 22  ? 33.779  42.825 52.494 1.00 54.16 ? 22  ASP A N   1 
ATOM   163  C  CA  . ASP A 1 22  ? 33.925  44.169 51.948 1.00 52.02 ? 22  ASP A CA  1 
ATOM   164  C  C   . ASP A 1 22  ? 33.669  45.163 53.080 1.00 50.65 ? 22  ASP A C   1 
ATOM   165  O  O   . ASP A 1 22  ? 32.683  45.900 53.070 1.00 49.87 ? 22  ASP A O   1 
ATOM   166  C  CB  . ASP A 1 22  ? 32.929  44.376 50.803 1.00 52.66 ? 22  ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 22  ? 32.956  45.786 50.252 1.00 53.30 ? 22  ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 22  ? 34.057  46.297 49.954 1.00 53.00 ? 22  ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 22  ? 31.869  46.381 50.112 1.00 56.02 ? 22  ASP A OD2 1 
ATOM   170  N  N   . PRO A 1 23  ? 34.570  45.192 54.076 1.00 49.20 ? 23  PRO A N   1 
ATOM   171  C  CA  . PRO A 1 23  ? 34.494  46.069 55.250 1.00 48.15 ? 23  PRO A CA  1 
ATOM   172  C  C   . PRO A 1 23  ? 34.355  47.559 54.960 1.00 46.51 ? 23  PRO A C   1 
ATOM   173  O  O   . PRO A 1 23  ? 33.751  48.290 55.744 1.00 46.05 ? 23  PRO A O   1 
ATOM   174  C  CB  . PRO A 1 23  ? 35.783  45.744 56.006 1.00 48.59 ? 23  PRO A CB  1 
ATOM   175  C  CG  . PRO A 1 23  ? 36.728  45.367 54.906 1.00 49.36 ? 23  PRO A CG  1 
ATOM   176  C  CD  . PRO A 1 23  ? 35.862  44.483 54.046 1.00 49.50 ? 23  PRO A CD  1 
ATOM   177  N  N   . GLY A 1 24  ? 34.909  48.004 53.837 1.00 46.16 ? 24  GLY A N   1 
ATOM   178  C  CA  . GLY A 1 24  ? 34.831  49.412 53.489 1.00 44.35 ? 24  GLY A CA  1 
ATOM   179  C  C   . GLY A 1 24  ? 33.613  49.789 52.663 1.00 43.53 ? 24  GLY A C   1 
ATOM   180  O  O   . GLY A 1 24  ? 33.542  50.894 52.125 1.00 41.90 ? 24  GLY A O   1 
ATOM   181  N  N   . PHE A 1 25  ? 32.649  48.880 52.572 1.00 42.88 ? 25  PHE A N   1 
ATOM   182  C  CA  . PHE A 1 25  ? 31.436  49.119 51.796 1.00 42.24 ? 25  PHE A CA  1 
ATOM   183  C  C   . PHE A 1 25  ? 30.772  50.461 52.086 1.00 42.89 ? 25  PHE A C   1 
ATOM   184  O  O   . PHE A 1 25  ? 30.347  51.160 51.164 1.00 42.02 ? 25  PHE A O   1 
ATOM   185  C  CB  . PHE A 1 25  ? 30.415  48.008 52.047 1.00 42.67 ? 25  PHE A CB  1 
ATOM   186  C  CG  . PHE A 1 25  ? 29.153  48.154 51.240 1.00 43.22 ? 25  PHE A CG  1 
ATOM   187  C  CD1 . PHE A 1 25  ? 29.149  47.884 49.875 1.00 42.73 ? 25  PHE A CD1 1 
ATOM   188  C  CD2 . PHE A 1 25  ? 27.975  48.588 51.840 1.00 42.52 ? 25  PHE A CD2 1 
ATOM   189  C  CE1 . PHE A 1 25  ? 27.990  48.043 49.119 1.00 42.12 ? 25  PHE A CE1 1 
ATOM   190  C  CE2 . PHE A 1 25  ? 26.810  48.750 51.091 1.00 42.71 ? 25  PHE A CE2 1 
ATOM   191  C  CZ  . PHE A 1 25  ? 26.820  48.477 49.728 1.00 41.24 ? 25  PHE A CZ  1 
ATOM   192  N  N   . PHE A 1 26  ? 30.678  50.821 53.362 1.00 42.48 ? 26  PHE A N   1 
ATOM   193  C  CA  . PHE A 1 26  ? 30.031  52.074 53.735 1.00 44.29 ? 26  PHE A CA  1 
ATOM   194  C  C   . PHE A 1 26  ? 30.981  53.257 53.861 1.00 45.39 ? 26  PHE A C   1 
ATOM   195  O  O   . PHE A 1 26  ? 30.548  54.377 54.140 1.00 44.34 ? 26  PHE A O   1 
ATOM   196  C  CB  . PHE A 1 26  ? 29.258  51.901 55.044 1.00 43.63 ? 26  PHE A CB  1 
ATOM   197  C  CG  . PHE A 1 26  ? 28.302  50.740 55.036 1.00 43.92 ? 26  PHE A CG  1 
ATOM   198  C  CD1 . PHE A 1 26  ? 28.688  49.499 55.541 1.00 43.02 ? 26  PHE A CD1 1 
ATOM   199  C  CD2 . PHE A 1 26  ? 27.019  50.881 54.508 1.00 42.83 ? 26  PHE A CD2 1 
ATOM   200  C  CE1 . PHE A 1 26  ? 27.811  48.412 55.523 1.00 42.36 ? 26  PHE A CE1 1 
ATOM   201  C  CE2 . PHE A 1 26  ? 26.133  49.800 54.484 1.00 43.16 ? 26  PHE A CE2 1 
ATOM   202  C  CZ  . PHE A 1 26  ? 26.531  48.563 54.993 1.00 42.26 ? 26  PHE A CZ  1 
ATOM   203  N  N   . GLU A 1 27  ? 32.271  53.012 53.653 1.00 47.40 ? 27  GLU A N   1 
ATOM   204  C  CA  . GLU A 1 27  ? 33.267  54.073 53.745 1.00 49.66 ? 27  GLU A CA  1 
ATOM   205  C  C   . GLU A 1 27  ? 32.875  55.266 52.881 1.00 51.63 ? 27  GLU A C   1 
ATOM   206  O  O   . GLU A 1 27  ? 32.900  56.409 53.340 1.00 52.38 ? 27  GLU A O   1 
ATOM   207  C  CB  . GLU A 1 27  ? 34.639  53.544 53.323 1.00 49.37 ? 27  GLU A CB  1 
ATOM   208  C  CG  . GLU A 1 27  ? 35.210  52.535 54.298 1.00 49.21 ? 27  GLU A CG  1 
ATOM   209  C  CD  . GLU A 1 27  ? 35.476  53.142 55.662 1.00 49.78 ? 27  GLU A CD  1 
ATOM   210  O  OE1 . GLU A 1 27  ? 36.509  53.828 55.816 1.00 47.08 ? 27  GLU A OE1 1 
ATOM   211  O  OE2 . GLU A 1 27  ? 34.645  52.944 56.575 1.00 49.04 ? 27  GLU A OE2 1 
ATOM   212  N  N   . LYS A 1 28  ? 32.509  55.000 51.633 1.00 53.71 ? 28  LYS A N   1 
ATOM   213  C  CA  . LYS A 1 28  ? 32.098  56.064 50.726 1.00 56.60 ? 28  LYS A CA  1 
ATOM   214  C  C   . LYS A 1 28  ? 30.886  56.801 51.290 1.00 58.00 ? 28  LYS A C   1 
ATOM   215  O  O   . LYS A 1 28  ? 30.883  58.030 51.393 1.00 58.10 ? 28  LYS A O   1 
ATOM   216  C  CB  . LYS A 1 28  ? 31.754  55.486 49.351 1.00 57.12 ? 28  LYS A CB  1 
ATOM   217  C  CG  . LYS A 1 28  ? 32.959  55.176 48.486 1.00 59.07 ? 28  LYS A CG  1 
ATOM   218  C  CD  . LYS A 1 28  ? 33.685  56.455 48.095 1.00 59.93 ? 28  LYS A CD  1 
ATOM   219  C  CE  . LYS A 1 28  ? 34.851  56.173 47.161 1.00 61.56 ? 28  LYS A CE  1 
ATOM   220  N  NZ  . LYS A 1 28  ? 35.542  57.427 46.747 1.00 62.81 ? 28  LYS A NZ  1 
ATOM   221  N  N   . LEU A 1 29  ? 29.862  56.035 51.657 1.00 58.67 ? 29  LEU A N   1 
ATOM   222  C  CA  . LEU A 1 29  ? 28.634  56.593 52.208 1.00 59.50 ? 29  LEU A CA  1 
ATOM   223  C  C   . LEU A 1 29  ? 28.913  57.445 53.439 1.00 60.39 ? 29  LEU A C   1 
ATOM   224  O  O   . LEU A 1 29  ? 28.465  58.589 53.527 1.00 59.43 ? 29  LEU A O   1 
ATOM   225  C  CB  . LEU A 1 29  ? 27.670  55.463 52.573 1.00 59.46 ? 29  LEU A CB  1 
ATOM   226  C  CG  . LEU A 1 29  ? 27.273  54.530 51.426 1.00 59.37 ? 29  LEU A CG  1 
ATOM   227  C  CD1 . LEU A 1 29  ? 26.442  53.379 51.966 1.00 58.93 ? 29  LEU A CD1 1 
ATOM   228  C  CD2 . LEU A 1 29  ? 26.498  55.313 50.374 1.00 59.30 ? 29  LEU A CD2 1 
ATOM   229  N  N   . ALA A 1 30  ? 29.655  56.880 54.387 1.00 61.96 ? 30  ALA A N   1 
ATOM   230  C  CA  . ALA A 1 30  ? 29.999  57.584 55.617 1.00 63.77 ? 30  ALA A CA  1 
ATOM   231  C  C   . ALA A 1 30  ? 30.521  58.982 55.302 1.00 65.24 ? 30  ALA A C   1 
ATOM   232  O  O   . ALA A 1 30  ? 30.200  59.946 55.998 1.00 65.95 ? 30  ALA A O   1 
ATOM   233  C  CB  . ALA A 1 30  ? 31.045  56.796 56.393 1.00 63.05 ? 30  ALA A CB  1 
ATOM   234  N  N   . GLN A 1 31  ? 31.327  59.087 54.250 1.00 66.48 ? 31  GLN A N   1 
ATOM   235  C  CA  . GLN A 1 31  ? 31.882  60.371 53.840 1.00 67.88 ? 31  GLN A CA  1 
ATOM   236  C  C   . GLN A 1 31  ? 30.840  61.139 53.036 1.00 68.29 ? 31  GLN A C   1 
ATOM   237  O  O   . GLN A 1 31  ? 30.433  60.704 51.958 1.00 69.16 ? 31  GLN A O   1 
ATOM   238  C  CB  . GLN A 1 31  ? 33.142  60.156 52.999 1.00 68.59 ? 31  GLN A CB  1 
ATOM   239  C  CG  . GLN A 1 31  ? 34.257  59.435 53.745 1.00 70.34 ? 31  GLN A CG  1 
ATOM   240  C  CD  . GLN A 1 31  ? 35.494  59.225 52.894 1.00 71.06 ? 31  GLN A CD  1 
ATOM   241  O  OE1 . GLN A 1 31  ? 36.108  60.182 52.421 1.00 72.15 ? 31  GLN A OE1 1 
ATOM   242  N  NE2 . GLN A 1 31  ? 35.869  57.966 52.697 1.00 71.29 ? 31  GLN A NE2 1 
ATOM   243  N  N   . ALA A 1 32  ? 30.406  62.277 53.571 1.00 67.88 ? 32  ALA A N   1 
ATOM   244  C  CA  . ALA A 1 32  ? 29.400  63.106 52.914 1.00 67.11 ? 32  ALA A CA  1 
ATOM   245  C  C   . ALA A 1 32  ? 29.782  63.433 51.474 1.00 66.04 ? 32  ALA A C   1 
ATOM   246  O  O   . ALA A 1 32  ? 30.401  64.464 51.204 1.00 66.63 ? 32  ALA A O   1 
ATOM   247  C  CB  . ALA A 1 32  ? 29.190  64.394 53.705 1.00 67.37 ? 32  ALA A CB  1 
ATOM   248  N  N   . GLN A 1 33  ? 29.408  62.551 50.552 1.00 63.89 ? 33  GLN A N   1 
ATOM   249  C  CA  . GLN A 1 33  ? 29.708  62.748 49.140 1.00 61.01 ? 33  GLN A CA  1 
ATOM   250  C  C   . GLN A 1 33  ? 28.422  62.954 48.352 1.00 57.41 ? 33  GLN A C   1 
ATOM   251  O  O   . GLN A 1 33  ? 27.633  62.023 48.179 1.00 57.97 ? 33  GLN A O   1 
ATOM   252  C  CB  . GLN A 1 33  ? 30.467  61.541 48.584 1.00 63.24 ? 33  GLN A CB  1 
ATOM   253  C  CG  . GLN A 1 33  ? 31.808  61.296 49.255 1.00 66.63 ? 33  GLN A CG  1 
ATOM   254  C  CD  . GLN A 1 33  ? 32.570  60.141 48.635 1.00 67.98 ? 33  GLN A CD  1 
ATOM   255  O  OE1 . GLN A 1 33  ? 32.884  60.159 47.443 1.00 69.07 ? 33  GLN A OE1 1 
ATOM   256  N  NE2 . GLN A 1 33  ? 32.876  59.131 49.443 1.00 68.55 ? 33  GLN A NE2 1 
ATOM   257  N  N   . LYS A 1 34  ? 28.214  64.179 47.882 1.00 52.44 ? 34  LYS A N   1 
ATOM   258  C  CA  . LYS A 1 34  ? 27.021  64.505 47.115 1.00 47.10 ? 34  LYS A CA  1 
ATOM   259  C  C   . LYS A 1 34  ? 27.012  63.772 45.777 1.00 42.21 ? 34  LYS A C   1 
ATOM   260  O  O   . LYS A 1 34  ? 28.048  63.625 45.127 1.00 40.36 ? 34  LYS A O   1 
ATOM   261  C  CB  . LYS A 1 34  ? 26.943  66.012 46.871 1.00 49.63 ? 34  LYS A CB  1 
ATOM   262  C  CG  . LYS A 1 34  ? 26.799  66.851 48.133 1.00 52.13 ? 34  LYS A CG  1 
ATOM   263  C  CD  . LYS A 1 34  ? 26.682  68.331 47.784 1.00 54.12 ? 34  LYS A CD  1 
ATOM   264  C  CE  . LYS A 1 34  ? 26.461  69.187 49.021 1.00 55.20 ? 34  LYS A CE  1 
ATOM   265  N  NZ  . LYS A 1 34  ? 26.266  70.621 48.664 1.00 55.51 ? 34  LYS A NZ  1 
ATOM   266  N  N   . PRO A 1 35  ? 25.834  63.294 45.352 1.00 37.49 ? 35  PRO A N   1 
ATOM   267  C  CA  . PRO A 1 35  ? 25.726  62.580 44.080 1.00 33.43 ? 35  PRO A CA  1 
ATOM   268  C  C   . PRO A 1 35  ? 25.996  63.527 42.917 1.00 29.68 ? 35  PRO A C   1 
ATOM   269  O  O   . PRO A 1 35  ? 25.740  64.725 43.012 1.00 26.64 ? 35  PRO A O   1 
ATOM   270  C  CB  . PRO A 1 35  ? 24.281  62.083 44.081 1.00 34.27 ? 35  PRO A CB  1 
ATOM   271  C  CG  . PRO A 1 35  ? 23.921  62.034 45.531 1.00 37.18 ? 35  PRO A CG  1 
ATOM   272  C  CD  . PRO A 1 35  ? 24.546  63.284 46.065 1.00 36.62 ? 35  PRO A CD  1 
ATOM   273  N  N   . ARG A 1 36  ? 26.517  62.981 41.826 1.00 28.63 ? 36  ARG A N   1 
ATOM   274  C  CA  . ARG A 1 36  ? 26.808  63.767 40.633 1.00 28.09 ? 36  ARG A CA  1 
ATOM   275  C  C   . ARG A 1 36  ? 25.709  63.582 39.594 1.00 24.95 ? 36  ARG A C   1 
ATOM   276  O  O   . ARG A 1 36  ? 25.600  64.364 38.648 1.00 24.37 ? 36  ARG A O   1 
ATOM   277  C  CB  . ARG A 1 36  ? 28.147  63.336 40.026 1.00 32.17 ? 36  ARG A CB  1 
ATOM   278  C  CG  . ARG A 1 36  ? 29.370  64.009 40.638 1.00 38.41 ? 36  ARG A CG  1 
ATOM   279  C  CD  . ARG A 1 36  ? 30.657  63.293 40.231 1.00 44.31 ? 36  ARG A CD  1 
ATOM   280  N  NE  . ARG A 1 36  ? 30.730  63.019 38.794 1.00 48.51 ? 36  ARG A NE  1 
ATOM   281  C  CZ  . ARG A 1 36  ? 30.808  63.954 37.851 1.00 50.45 ? 36  ARG A CZ  1 
ATOM   282  N  NH1 . ARG A 1 36  ? 30.825  65.236 38.184 1.00 52.05 ? 36  ARG A NH1 1 
ATOM   283  N  NH2 . ARG A 1 36  ? 30.867  63.605 36.571 1.00 51.41 ? 36  ARG A NH2 1 
ATOM   284  N  N   . PHE A 1 37  ? 24.895  62.548 39.779 1.00 21.83 ? 37  PHE A N   1 
ATOM   285  C  CA  . PHE A 1 37  ? 23.826  62.249 38.836 1.00 20.86 ? 37  PHE A CA  1 
ATOM   286  C  C   . PHE A 1 37  ? 22.440  62.184 39.459 1.00 19.45 ? 37  PHE A C   1 
ATOM   287  O  O   . PHE A 1 37  ? 22.267  61.688 40.570 1.00 16.91 ? 37  PHE A O   1 
ATOM   288  C  CB  . PHE A 1 37  ? 24.061  60.898 38.148 1.00 20.52 ? 37  PHE A CB  1 
ATOM   289  C  CG  . PHE A 1 37  ? 25.415  60.745 37.527 1.00 24.27 ? 37  PHE A CG  1 
ATOM   290  C  CD1 . PHE A 1 37  ? 26.508  60.354 38.295 1.00 26.71 ? 37  PHE A CD1 1 
ATOM   291  C  CD2 . PHE A 1 37  ? 25.595  60.958 36.167 1.00 26.12 ? 37  PHE A CD2 1 
ATOM   292  C  CE1 . PHE A 1 37  ? 27.764  60.173 37.713 1.00 26.47 ? 37  PHE A CE1 1 
ATOM   293  C  CE2 . PHE A 1 37  ? 26.844  60.780 35.575 1.00 26.98 ? 37  PHE A CE2 1 
ATOM   294  C  CZ  . PHE A 1 37  ? 27.930  60.385 36.352 1.00 26.80 ? 37  PHE A CZ  1 
ATOM   295  N  N   . LEU A 1 38  ? 21.456  62.691 38.728 1.00 18.34 ? 38  LEU A N   1 
ATOM   296  C  CA  . LEU A 1 38  ? 20.068  62.618 39.158 1.00 18.09 ? 38  LEU A CA  1 
ATOM   297  C  C   . LEU A 1 38  ? 19.436  61.666 38.150 1.00 17.41 ? 38  LEU A C   1 
ATOM   298  O  O   . LEU A 1 38  ? 19.539  61.883 36.942 1.00 17.39 ? 38  LEU A O   1 
ATOM   299  C  CB  . LEU A 1 38  ? 19.369  63.983 39.083 1.00 17.65 ? 38  LEU A CB  1 
ATOM   300  C  CG  . LEU A 1 38  ? 17.825  63.909 39.096 1.00 21.78 ? 38  LEU A CG  1 
ATOM   301  C  CD1 . LEU A 1 38  ? 17.346  63.093 40.290 1.00 19.38 ? 38  LEU A CD1 1 
ATOM   302  C  CD2 . LEU A 1 38  ? 17.226  65.307 39.138 1.00 19.15 ? 38  LEU A CD2 1 
ATOM   303  N  N   . TRP A 1 39  ? 18.804  60.607 38.639 1.00 17.14 ? 39  TRP A N   1 
ATOM   304  C  CA  . TRP A 1 39  ? 18.159  59.642 37.762 1.00 17.35 ? 39  TRP A CA  1 
ATOM   305  C  C   . TRP A 1 39  ? 16.651  59.695 37.950 1.00 17.83 ? 39  TRP A C   1 
ATOM   306  O  O   . TRP A 1 39  ? 16.154  59.536 39.063 1.00 17.60 ? 39  TRP A O   1 
ATOM   307  C  CB  . TRP A 1 39  ? 18.672  58.228 38.068 1.00 18.81 ? 39  TRP A CB  1 
ATOM   308  C  CG  . TRP A 1 39  ? 18.166  57.147 37.133 1.00 19.95 ? 39  TRP A CG  1 
ATOM   309  C  CD1 . TRP A 1 39  ? 16.911  56.615 37.094 1.00 21.05 ? 39  TRP A CD1 1 
ATOM   310  C  CD2 . TRP A 1 39  ? 18.927  56.451 36.131 1.00 20.80 ? 39  TRP A CD2 1 
ATOM   311  N  NE1 . TRP A 1 39  ? 16.842  55.628 36.134 1.00 20.19 ? 39  TRP A NE1 1 
ATOM   312  C  CE2 . TRP A 1 39  ? 18.065  55.508 35.530 1.00 19.93 ? 39  TRP A CE2 1 
ATOM   313  C  CE3 . TRP A 1 39  ? 20.253  56.534 35.686 1.00 21.44 ? 39  TRP A CE3 1 
ATOM   314  C  CZ2 . TRP A 1 39  ? 18.486  54.649 34.504 1.00 20.18 ? 39  TRP A CZ2 1 
ATOM   315  C  CZ3 . TRP A 1 39  ? 20.675  55.676 34.664 1.00 22.10 ? 39  TRP A CZ3 1 
ATOM   316  C  CH2 . TRP A 1 39  ? 19.789  54.747 34.088 1.00 21.41 ? 39  TRP A CH2 1 
ATOM   317  N  N   . ILE A 1 40  ? 15.933  59.949 36.861 1.00 16.18 ? 40  ILE A N   1 
ATOM   318  C  CA  . ILE A 1 40  ? 14.474  59.989 36.884 1.00 17.23 ? 40  ILE A CA  1 
ATOM   319  C  C   . ILE A 1 40  ? 14.030  58.797 36.044 1.00 17.12 ? 40  ILE A C   1 
ATOM   320  O  O   . ILE A 1 40  ? 14.230  58.770 34.823 1.00 17.99 ? 40  ILE A O   1 
ATOM   321  C  CB  . ILE A 1 40  ? 13.927  61.294 36.262 1.00 16.74 ? 40  ILE A CB  1 
ATOM   322  C  CG1 . ILE A 1 40  ? 14.341  62.489 37.123 1.00 17.88 ? 40  ILE A CG1 1 
ATOM   323  C  CG2 . ILE A 1 40  ? 12.400  61.220 36.141 1.00 17.12 ? 40  ILE A CG2 1 
ATOM   324  C  CD1 . ILE A 1 40  ? 13.946  63.837 36.547 1.00 17.63 ? 40  ILE A CD1 1 
ATOM   325  N  N   . GLY A 1 41  ? 13.447  57.804 36.705 1.00 15.58 ? 41  GLY A N   1 
ATOM   326  C  CA  . GLY A 1 41  ? 13.024  56.610 36.005 1.00 14.05 ? 41  GLY A CA  1 
ATOM   327  C  C   . GLY A 1 41  ? 11.619  56.174 36.345 1.00 16.93 ? 41  GLY A C   1 
ATOM   328  O  O   . GLY A 1 41  ? 10.891  56.864 37.055 1.00 16.95 ? 41  GLY A O   1 
ATOM   329  N  N   . CYS A 1 42  ? 11.235  55.012 35.838 1.00 15.83 ? 42  CYS A N   1 
ATOM   330  C  CA  . CYS A 1 42  ? 9.899   54.508 36.080 1.00 16.72 ? 42  CYS A CA  1 
ATOM   331  C  C   . CYS A 1 42  ? 9.822   53.661 37.335 1.00 17.05 ? 42  CYS A C   1 
ATOM   332  O  O   . CYS A 1 42  ? 10.775  52.968 37.697 1.00 16.02 ? 42  CYS A O   1 
ATOM   333  C  CB  . CYS A 1 42  ? 9.425   53.683 34.892 1.00 17.17 ? 42  CYS A CB  1 
ATOM   334  S  SG  . CYS A 1 42  ? 7.744   53.082 35.105 1.00 16.68 ? 42  CYS A SG  1 
ATOM   335  N  N   . SER A 1 43  ? 8.673   53.717 37.996 1.00 16.73 ? 43  SER A N   1 
ATOM   336  C  CA  . SER A 1 43  ? 8.468   52.936 39.198 1.00 16.14 ? 43  SER A CA  1 
ATOM   337  C  C   . SER A 1 43  ? 8.600   51.438 38.898 1.00 16.18 ? 43  SER A C   1 
ATOM   338  O  O   . SER A 1 43  ? 8.869   50.653 39.804 1.00 16.02 ? 43  SER A O   1 
ATOM   339  C  CB  . SER A 1 43  ? 7.095   53.252 39.796 1.00 16.73 ? 43  SER A CB  1 
ATOM   340  O  OG  . SER A 1 43  ? 7.066   54.584 40.286 1.00 18.28 ? 43  SER A OG  1 
ATOM   341  N  N   . ASP A 1 44  ? 8.408   51.041 37.638 1.00 16.49 ? 44  ASP A N   1 
ATOM   342  C  CA  . ASP A 1 44  ? 8.538   49.627 37.268 1.00 18.80 ? 44  ASP A CA  1 
ATOM   343  C  C   . ASP A 1 44  ? 9.922   49.105 37.667 1.00 18.72 ? 44  ASP A C   1 
ATOM   344  O  O   . ASP A 1 44  ? 10.065  47.958 38.089 1.00 18.29 ? 44  ASP A O   1 
ATOM   345  C  CB  . ASP A 1 44  ? 8.346   49.413 35.757 1.00 17.94 ? 44  ASP A CB  1 
ATOM   346  C  CG  . ASP A 1 44  ? 6.878   49.420 35.331 1.00 19.18 ? 44  ASP A CG  1 
ATOM   347  O  OD1 . ASP A 1 44  ? 6.038   48.818 36.028 1.00 19.51 ? 44  ASP A OD1 1 
ATOM   348  O  OD2 . ASP A 1 44  ? 6.563   50.010 34.276 1.00 15.63 ? 44  ASP A OD2 1 
ATOM   349  N  N   . SER A 1 45  ? 10.937  49.950 37.515 1.00 19.65 ? 45  SER A N   1 
ATOM   350  C  CA  . SER A 1 45  ? 12.310  49.590 37.873 1.00 19.72 ? 45  SER A CA  1 
ATOM   351  C  C   . SER A 1 45  ? 12.646  48.146 37.488 1.00 21.57 ? 45  SER A C   1 
ATOM   352  O  O   . SER A 1 45  ? 13.098  47.361 38.328 1.00 20.92 ? 45  SER A O   1 
ATOM   353  C  CB  . SER A 1 45  ? 12.514  49.790 39.382 1.00 18.28 ? 45  SER A CB  1 
ATOM   354  O  OG  . SER A 1 45  ? 13.868  49.593 39.759 1.00 19.94 ? 45  SER A OG  1 
ATOM   355  N  N   . ARG A 1 46  ? 12.419  47.802 36.220 1.00 22.09 ? 46  ARG A N   1 
ATOM   356  C  CA  . ARG A 1 46  ? 12.682  46.448 35.723 1.00 23.32 ? 46  ARG A CA  1 
ATOM   357  C  C   . ARG A 1 46  ? 14.121  46.013 36.008 1.00 23.11 ? 46  ARG A C   1 
ATOM   358  O  O   . ARG A 1 46  ? 14.357  44.905 36.492 1.00 25.22 ? 46  ARG A O   1 
ATOM   359  C  CB  . ARG A 1 46  ? 12.372  46.368 34.225 1.00 24.65 ? 46  ARG A CB  1 
ATOM   360  C  CG  . ARG A 1 46  ? 10.923  46.708 33.891 1.00 28.51 ? 46  ARG A CG  1 
ATOM   361  C  CD  . ARG A 1 46  ? 9.944   45.868 34.712 1.00 32.77 ? 46  ARG A CD  1 
ATOM   362  N  NE  . ARG A 1 46  ? 9.931   44.465 34.302 1.00 36.47 ? 46  ARG A NE  1 
ATOM   363  C  CZ  . ARG A 1 46  ? 9.294   43.498 34.953 1.00 39.13 ? 46  ARG A CZ  1 
ATOM   364  N  NH1 . ARG A 1 46  ? 8.614   43.773 36.060 1.00 40.84 ? 46  ARG A NH1 1 
ATOM   365  N  NH2 . ARG A 1 46  ? 9.326   42.253 34.492 1.00 40.45 ? 46  ARG A NH2 1 
ATOM   366  N  N   . VAL A 1 47  ? 15.074  46.883 35.692 1.00 22.51 ? 47  VAL A N   1 
ATOM   367  C  CA  . VAL A 1 47  ? 16.483  46.627 35.979 1.00 22.12 ? 47  VAL A CA  1 
ATOM   368  C  C   . VAL A 1 47  ? 16.974  47.866 36.724 1.00 21.68 ? 47  VAL A C   1 
ATOM   369  O  O   . VAL A 1 47  ? 16.893  48.978 36.206 1.00 22.40 ? 47  VAL A O   1 
ATOM   370  C  CB  . VAL A 1 47  ? 17.336  46.454 34.699 1.00 21.63 ? 47  VAL A CB  1 
ATOM   371  C  CG1 . VAL A 1 47  ? 18.789  46.172 35.086 1.00 21.95 ? 47  VAL A CG1 1 
ATOM   372  C  CG2 . VAL A 1 47  ? 16.788  45.317 33.849 1.00 22.66 ? 47  VAL A CG2 1 
ATOM   373  N  N   . PRO A 1 48  ? 17.470  47.693 37.957 1.00 22.27 ? 48  PRO A N   1 
ATOM   374  C  CA  . PRO A 1 48  ? 17.967  48.818 38.756 1.00 22.29 ? 48  PRO A CA  1 
ATOM   375  C  C   . PRO A 1 48  ? 18.982  49.672 38.001 1.00 22.16 ? 48  PRO A C   1 
ATOM   376  O  O   . PRO A 1 48  ? 19.815  49.150 37.255 1.00 19.97 ? 48  PRO A O   1 
ATOM   377  C  CB  . PRO A 1 48  ? 18.583  48.128 39.969 1.00 23.76 ? 48  PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 48  ? 17.706  46.932 40.136 1.00 23.94 ? 48  PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 48  ? 17.564  46.435 38.717 1.00 23.07 ? 48  PRO A CD  1 
ATOM   380  N  N   . ALA A 1 49  ? 18.905  50.985 38.201 1.00 21.35 ? 49  ALA A N   1 
ATOM   381  C  CA  . ALA A 1 49  ? 19.816  51.915 37.544 1.00 22.37 ? 49  ALA A CA  1 
ATOM   382  C  C   . ALA A 1 49  ? 21.259  51.612 37.926 1.00 24.01 ? 49  ALA A C   1 
ATOM   383  O  O   . ALA A 1 49  ? 22.167  51.733 37.101 1.00 24.59 ? 49  ALA A O   1 
ATOM   384  C  CB  . ALA A 1 49  ? 19.468  53.346 37.928 1.00 21.40 ? 49  ALA A CB  1 
ATOM   385  N  N   . GLU A 1 50  ? 21.464  51.219 39.180 1.00 23.21 ? 50  GLU A N   1 
ATOM   386  C  CA  . GLU A 1 50  ? 22.799  50.906 39.674 1.00 24.98 ? 50  GLU A CA  1 
ATOM   387  C  C   . GLU A 1 50  ? 23.413  49.730 38.920 1.00 26.96 ? 50  GLU A C   1 
ATOM   388  O  O   . GLU A 1 50  ? 24.612  49.720 38.635 1.00 27.43 ? 50  GLU A O   1 
ATOM   389  C  CB  . GLU A 1 50  ? 22.751  50.581 41.170 1.00 23.83 ? 50  GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 50  ? 22.324  51.733 42.075 1.00 21.25 ? 50  GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 50  ? 20.824  51.976 42.091 1.00 21.74 ? 50  GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 50  ? 20.052  51.100 41.641 1.00 20.60 ? 50  GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 50  ? 20.411  53.050 42.577 1.00 21.96 ? 50  GLU A OE2 1 
ATOM   394  N  N   . ARG A 1 51  ? 22.585  48.743 38.599 1.00 26.49 ? 51  ARG A N   1 
ATOM   395  C  CA  . ARG A 1 51  ? 23.048  47.561 37.883 1.00 29.32 ? 51  ARG A CA  1 
ATOM   396  C  C   . ARG A 1 51  ? 23.289  47.877 36.408 1.00 27.71 ? 51  ARG A C   1 
ATOM   397  O  O   . ARG A 1 51  ? 24.249  47.392 35.808 1.00 26.84 ? 51  ARG A O   1 
ATOM   398  C  CB  . ARG A 1 51  ? 22.016  46.436 38.017 1.00 32.50 ? 51  ARG A CB  1 
ATOM   399  C  CG  . ARG A 1 51  ? 22.554  45.051 37.680 1.00 41.14 ? 51  ARG A CG  1 
ATOM   400  C  CD  . ARG A 1 51  ? 23.781  44.727 38.525 1.00 46.28 ? 51  ARG A CD  1 
ATOM   401  N  NE  . ARG A 1 51  ? 24.181  43.325 38.416 1.00 52.13 ? 51  ARG A NE  1 
ATOM   402  C  CZ  . ARG A 1 51  ? 23.461  42.306 38.877 1.00 54.53 ? 51  ARG A CZ  1 
ATOM   403  N  NH1 . ARG A 1 51  ? 22.301  42.529 39.483 1.00 55.32 ? 51  ARG A NH1 1 
ATOM   404  N  NH2 . ARG A 1 51  ? 23.900  41.061 38.732 1.00 55.93 ? 51  ARG A NH2 1 
ATOM   405  N  N   . LEU A 1 52  ? 22.410  48.692 35.832 1.00 25.91 ? 52  LEU A N   1 
ATOM   406  C  CA  . LEU A 1 52  ? 22.519  49.087 34.432 1.00 25.00 ? 52  LEU A CA  1 
ATOM   407  C  C   . LEU A 1 52  ? 23.796  49.860 34.128 1.00 26.09 ? 52  LEU A C   1 
ATOM   408  O  O   . LEU A 1 52  ? 24.426  49.656 33.093 1.00 24.97 ? 52  LEU A O   1 
ATOM   409  C  CB  . LEU A 1 52  ? 21.335  49.972 34.035 1.00 23.33 ? 52  LEU A CB  1 
ATOM   410  C  CG  . LEU A 1 52  ? 19.967  49.331 33.812 1.00 24.33 ? 52  LEU A CG  1 
ATOM   411  C  CD1 . LEU A 1 52  ? 18.937  50.420 33.538 1.00 24.51 ? 52  LEU A CD1 1 
ATOM   412  C  CD2 . LEU A 1 52  ? 20.044  48.353 32.646 1.00 25.15 ? 52  LEU A CD2 1 
ATOM   413  N  N   . THR A 1 53  ? 24.170  50.749 35.041 1.00 26.54 ? 53  THR A N   1 
ATOM   414  C  CA  . THR A 1 53  ? 25.335  51.603 34.846 1.00 27.89 ? 53  THR A CA  1 
ATOM   415  C  C   . THR A 1 53  ? 26.596  51.234 35.614 1.00 29.29 ? 53  THR A C   1 
ATOM   416  O  O   . THR A 1 53  ? 27.690  51.650 35.240 1.00 30.21 ? 53  THR A O   1 
ATOM   417  C  CB  . THR A 1 53  ? 24.990  53.045 35.213 1.00 28.63 ? 53  THR A CB  1 
ATOM   418  O  OG1 . THR A 1 53  ? 24.651  53.102 36.605 1.00 27.39 ? 53  THR A OG1 1 
ATOM   419  C  CG2 . THR A 1 53  ? 23.807  53.540 34.387 1.00 29.47 ? 53  THR A CG2 1 
ATOM   420  N  N   . GLY A 1 54  ? 26.449  50.477 36.693 1.00 31.11 ? 54  GLY A N   1 
ATOM   421  C  CA  . GLY A 1 54  ? 27.611  50.108 37.479 1.00 33.30 ? 54  GLY A CA  1 
ATOM   422  C  C   . GLY A 1 54  ? 27.971  51.169 38.506 1.00 35.83 ? 54  GLY A C   1 
ATOM   423  O  O   . GLY A 1 54  ? 29.058  51.141 39.083 1.00 37.30 ? 54  GLY A O   1 
ATOM   424  N  N   . LEU A 1 55  ? 27.067  52.117 38.731 1.00 36.73 ? 55  LEU A N   1 
ATOM   425  C  CA  . LEU A 1 55  ? 27.303  53.170 39.711 1.00 38.21 ? 55  LEU A CA  1 
ATOM   426  C  C   . LEU A 1 55  ? 27.222  52.593 41.121 1.00 39.43 ? 55  LEU A C   1 
ATOM   427  O  O   . LEU A 1 55  ? 26.476  51.646 41.371 1.00 40.14 ? 55  LEU A O   1 
ATOM   428  C  CB  . LEU A 1 55  ? 26.270  54.287 39.553 1.00 37.86 ? 55  LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 55  ? 26.400  55.131 38.286 1.00 38.84 ? 55  LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 55  ? 25.215  56.068 38.169 1.00 39.26 ? 55  LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 55  ? 27.706  55.912 38.330 1.00 40.06 ? 55  LEU A CD2 1 
ATOM   432  N  N   . GLU A 1 56  ? 27.998  53.165 42.034 1.00 40.27 ? 56  GLU A N   1 
ATOM   433  C  CA  . GLU A 1 56  ? 28.026  52.716 43.422 1.00 41.63 ? 56  GLU A CA  1 
ATOM   434  C  C   . GLU A 1 56  ? 26.988  53.481 44.236 1.00 40.77 ? 56  GLU A C   1 
ATOM   435  O  O   . GLU A 1 56  ? 26.562  54.568 43.847 1.00 39.00 ? 56  GLU A O   1 
ATOM   436  C  CB  . GLU A 1 56  ? 29.414  52.961 44.021 1.00 44.62 ? 56  GLU A CB  1 
ATOM   437  C  CG  . GLU A 1 56  ? 30.544  52.228 43.322 1.00 49.72 ? 56  GLU A CG  1 
ATOM   438  C  CD  . GLU A 1 56  ? 30.647  50.776 43.743 1.00 53.04 ? 56  GLU A CD  1 
ATOM   439  O  OE1 . GLU A 1 56  ? 29.643  50.039 43.621 1.00 55.89 ? 56  GLU A OE1 1 
ATOM   440  O  OE2 . GLU A 1 56  ? 31.738  50.370 44.197 1.00 55.05 ? 56  GLU A OE2 1 
ATOM   441  N  N   . PRO A 1 57  ? 26.570  52.925 45.384 1.00 40.37 ? 57  PRO A N   1 
ATOM   442  C  CA  . PRO A 1 57  ? 25.578  53.632 46.195 1.00 39.30 ? 57  PRO A CA  1 
ATOM   443  C  C   . PRO A 1 57  ? 26.105  55.001 46.619 1.00 38.37 ? 57  PRO A C   1 
ATOM   444  O  O   . PRO A 1 57  ? 27.282  55.149 46.956 1.00 37.84 ? 57  PRO A O   1 
ATOM   445  C  CB  . PRO A 1 57  ? 25.360  52.685 47.374 1.00 39.89 ? 57  PRO A CB  1 
ATOM   446  C  CG  . PRO A 1 57  ? 26.673  51.984 47.496 1.00 41.70 ? 57  PRO A CG  1 
ATOM   447  C  CD  . PRO A 1 57  ? 27.014  51.692 46.057 1.00 41.22 ? 57  PRO A CD  1 
ATOM   448  N  N   . GLY A 1 58  ? 25.233  56.002 46.580 1.00 37.06 ? 58  GLY A N   1 
ATOM   449  C  CA  . GLY A 1 58  ? 25.634  57.343 46.958 1.00 35.58 ? 58  GLY A CA  1 
ATOM   450  C  C   . GLY A 1 58  ? 26.024  58.210 45.774 1.00 33.63 ? 58  GLY A C   1 
ATOM   451  O  O   . GLY A 1 58  ? 26.138  59.428 45.910 1.00 33.35 ? 58  GLY A O   1 
ATOM   452  N  N   . GLU A 1 59  ? 26.227  57.596 44.612 1.00 31.92 ? 59  GLU A N   1 
ATOM   453  C  CA  . GLU A 1 59  ? 26.615  58.353 43.426 1.00 31.48 ? 59  GLU A CA  1 
ATOM   454  C  C   . GLU A 1 59  ? 25.430  58.936 42.670 1.00 31.37 ? 59  GLU A C   1 
ATOM   455  O  O   . GLU A 1 59  ? 25.601  59.812 41.825 1.00 31.36 ? 59  GLU A O   1 
ATOM   456  C  CB  . GLU A 1 59  ? 27.443  57.483 42.477 1.00 33.45 ? 59  GLU A CB  1 
ATOM   457  C  CG  . GLU A 1 59  ? 28.822  57.125 43.009 1.00 37.69 ? 59  GLU A CG  1 
ATOM   458  C  CD  . GLU A 1 59  ? 29.689  56.434 41.968 1.00 40.81 ? 59  GLU A CD  1 
ATOM   459  O  OE1 . GLU A 1 59  ? 29.288  55.361 41.468 1.00 40.06 ? 59  GLU A OE1 1 
ATOM   460  O  OE2 . GLU A 1 59  ? 30.775  56.969 41.649 1.00 43.44 ? 59  GLU A OE2 1 
ATOM   461  N  N   . LEU A 1 60  ? 24.228  58.458 42.968 1.00 29.41 ? 60  LEU A N   1 
ATOM   462  C  CA  . LEU A 1 60  ? 23.053  58.973 42.283 1.00 28.52 ? 60  LEU A CA  1 
ATOM   463  C  C   . LEU A 1 60  ? 21.880  59.326 43.187 1.00 25.48 ? 60  LEU A C   1 
ATOM   464  O  O   . LEU A 1 60  ? 21.638  58.685 44.213 1.00 27.43 ? 60  LEU A O   1 
ATOM   465  C  CB  . LEU A 1 60  ? 22.590  57.984 41.209 1.00 31.67 ? 60  LEU A CB  1 
ATOM   466  C  CG  . LEU A 1 60  ? 22.138  56.585 41.621 1.00 34.04 ? 60  LEU A CG  1 
ATOM   467  C  CD1 . LEU A 1 60  ? 21.624  55.853 40.386 1.00 36.88 ? 60  LEU A CD1 1 
ATOM   468  C  CD2 . LEU A 1 60  ? 23.292  55.815 42.259 1.00 36.92 ? 60  LEU A CD2 1 
ATOM   469  N  N   . PHE A 1 61  ? 21.170  60.375 42.795 1.00 20.62 ? 61  PHE A N   1 
ATOM   470  C  CA  . PHE A 1 61  ? 19.990  60.844 43.504 1.00 19.47 ? 61  PHE A CA  1 
ATOM   471  C  C   . PHE A 1 61  ? 18.887  60.263 42.618 1.00 19.22 ? 61  PHE A C   1 
ATOM   472  O  O   . PHE A 1 61  ? 19.016  60.278 41.392 1.00 20.02 ? 61  PHE A O   1 
ATOM   473  C  CB  . PHE A 1 61  ? 19.967  62.371 43.501 1.00 17.86 ? 61  PHE A CB  1 
ATOM   474  C  CG  . PHE A 1 61  ? 19.101  62.967 44.565 1.00 18.21 ? 61  PHE A CG  1 
ATOM   475  C  CD1 . PHE A 1 61  ? 19.346  62.700 45.908 1.00 16.28 ? 61  PHE A CD1 1 
ATOM   476  C  CD2 . PHE A 1 61  ? 18.050  63.813 44.228 1.00 16.97 ? 61  PHE A CD2 1 
ATOM   477  C  CE1 . PHE A 1 61  ? 18.558  63.269 46.904 1.00 16.97 ? 61  PHE A CE1 1 
ATOM   478  C  CE2 . PHE A 1 61  ? 17.255  64.388 45.217 1.00 18.08 ? 61  PHE A CE2 1 
ATOM   479  C  CZ  . PHE A 1 61  ? 17.510  64.115 46.558 1.00 17.66 ? 61  PHE A CZ  1 
ATOM   480  N  N   . VAL A 1 62  ? 17.809  59.753 43.209 1.00 17.78 ? 62  VAL A N   1 
ATOM   481  C  CA  . VAL A 1 62  ? 16.785  59.105 42.391 1.00 17.55 ? 62  VAL A CA  1 
ATOM   482  C  C   . VAL A 1 62  ? 15.322  59.461 42.625 1.00 17.22 ? 62  VAL A C   1 
ATOM   483  O  O   . VAL A 1 62  ? 14.878  59.597 43.764 1.00 15.80 ? 62  VAL A O   1 
ATOM   484  C  CB  . VAL A 1 62  ? 16.893  57.557 42.537 1.00 18.47 ? 62  VAL A CB  1 
ATOM   485  C  CG1 . VAL A 1 62  ? 15.879  56.867 41.635 1.00 19.12 ? 62  VAL A CG1 1 
ATOM   486  C  CG2 . VAL A 1 62  ? 18.310  57.092 42.226 1.00 21.87 ? 62  VAL A CG2 1 
ATOM   487  N  N   . HIS A 1 63  ? 14.580  59.598 41.527 1.00 15.37 ? 63  HIS A N   1 
ATOM   488  C  CA  . HIS A 1 63  ? 13.141  59.840 41.595 1.00 15.23 ? 63  HIS A CA  1 
ATOM   489  C  C   . HIS A 1 63  ? 12.511  58.845 40.631 1.00 13.95 ? 63  HIS A C   1 
ATOM   490  O  O   . HIS A 1 63  ? 13.001  58.649 39.516 1.00 12.47 ? 63  HIS A O   1 
ATOM   491  C  CB  . HIS A 1 63  ? 12.748  61.261 41.158 1.00 13.92 ? 63  HIS A CB  1 
ATOM   492  C  CG  . HIS A 1 63  ? 11.263  61.484 41.119 1.00 14.00 ? 63  HIS A CG  1 
ATOM   493  N  ND1 . HIS A 1 63  ? 10.474  61.441 42.249 1.00 14.76 ? 63  HIS A ND1 1 
ATOM   494  C  CD2 . HIS A 1 63  ? 10.418  61.703 40.081 1.00 15.59 ? 63  HIS A CD2 1 
ATOM   495  C  CE1 . HIS A 1 63  ? 9.208   61.619 41.910 1.00 14.68 ? 63  HIS A CE1 1 
ATOM   496  N  NE2 . HIS A 1 63  ? 9.146   61.779 40.599 1.00 15.50 ? 63  HIS A NE2 1 
ATOM   497  N  N   . ARG A 1 64  ? 11.437  58.203 41.068 1.00 13.90 ? 64  ARG A N   1 
ATOM   498  C  CA  . ARG A 1 64  ? 10.736  57.254 40.220 1.00 14.37 ? 64  ARG A CA  1 
ATOM   499  C  C   . ARG A 1 64  ? 9.236   57.464 40.360 1.00 14.27 ? 64  ARG A C   1 
ATOM   500  O  O   . ARG A 1 64  ? 8.725   57.616 41.468 1.00 14.96 ? 64  ARG A O   1 
ATOM   501  C  CB  . ARG A 1 64  ? 11.089  55.807 40.603 1.00 13.57 ? 64  ARG A CB  1 
ATOM   502  C  CG  . ARG A 1 64  ? 12.505  55.361 40.217 1.00 15.19 ? 64  ARG A CG  1 
ATOM   503  C  CD  . ARG A 1 64  ? 12.763  53.905 40.614 1.00 14.63 ? 64  ARG A CD  1 
ATOM   504  N  NE  . ARG A 1 64  ? 14.114  53.470 40.259 1.00 15.55 ? 64  ARG A NE  1 
ATOM   505  C  CZ  . ARG A 1 64  ? 14.506  53.126 39.034 1.00 17.08 ? 64  ARG A CZ  1 
ATOM   506  N  NH1 . ARG A 1 64  ? 13.652  53.149 38.013 1.00 12.81 ? 64  ARG A NH1 1 
ATOM   507  N  NH2 . ARG A 1 64  ? 15.767  52.777 38.825 1.00 16.53 ? 64  ARG A NH2 1 
ATOM   508  N  N   . ASN A 1 65  ? 8.541   57.500 39.228 1.00 14.48 ? 65  ASN A N   1 
ATOM   509  C  CA  . ASN A 1 65  ? 7.089   57.647 39.221 1.00 13.67 ? 65  ASN A CA  1 
ATOM   510  C  C   . ASN A 1 65  ? 6.577   56.803 38.055 1.00 14.71 ? 65  ASN A C   1 
ATOM   511  O  O   . ASN A 1 65  ? 7.376   56.237 37.309 1.00 13.01 ? 65  ASN A O   1 
ATOM   512  C  CB  . ASN A 1 65  ? 6.671   59.124 39.082 1.00 12.97 ? 65  ASN A CB  1 
ATOM   513  C  CG  . ASN A 1 65  ? 7.118   59.754 37.774 1.00 13.59 ? 65  ASN A CG  1 
ATOM   514  O  OD1 . ASN A 1 65  ? 6.837   59.238 36.697 1.00 16.14 ? 65  ASN A OD1 1 
ATOM   515  N  ND2 . ASN A 1 65  ? 7.796   60.895 37.867 1.00 13.78 ? 65  ASN A ND2 1 
ATOM   516  N  N   . VAL A 1 66  ? 5.262   56.693 37.898 1.00 14.03 ? 66  VAL A N   1 
ATOM   517  C  CA  . VAL A 1 66  ? 4.735   55.877 36.813 1.00 15.56 ? 66  VAL A CA  1 
ATOM   518  C  C   . VAL A 1 66  ? 5.006   56.468 35.431 1.00 12.86 ? 66  VAL A C   1 
ATOM   519  O  O   . VAL A 1 66  ? 4.537   57.556 35.100 1.00 13.41 ? 66  VAL A O   1 
ATOM   520  C  CB  . VAL A 1 66  ? 3.219   55.627 36.979 1.00 16.54 ? 66  VAL A CB  1 
ATOM   521  C  CG1 . VAL A 1 66  ? 2.708   54.752 35.833 1.00 16.80 ? 66  VAL A CG1 1 
ATOM   522  C  CG2 . VAL A 1 66  ? 2.951   54.940 38.319 1.00 15.81 ? 66  VAL A CG2 1 
ATOM   523  N  N   . ALA A 1 67  ? 5.782   55.729 34.642 1.00 14.53 ? 67  ALA A N   1 
ATOM   524  C  CA  . ALA A 1 67  ? 6.161   56.104 33.283 1.00 14.96 ? 67  ALA A CA  1 
ATOM   525  C  C   . ALA A 1 67  ? 7.179   57.235 33.207 1.00 15.89 ? 67  ALA A C   1 
ATOM   526  O  O   . ALA A 1 67  ? 7.271   57.928 32.193 1.00 16.12 ? 67  ALA A O   1 
ATOM   527  C  CB  . ALA A 1 67  ? 4.923   56.454 32.465 1.00 17.34 ? 67  ALA A CB  1 
ATOM   528  N  N   . ASN A 1 68  ? 7.949   57.413 34.278 1.00 15.45 ? 68  ASN A N   1 
ATOM   529  C  CA  . ASN A 1 68  ? 8.988   58.443 34.330 1.00 16.50 ? 68  ASN A CA  1 
ATOM   530  C  C   . ASN A 1 68  ? 8.591   59.785 33.699 1.00 17.50 ? 68  ASN A C   1 
ATOM   531  O  O   . ASN A 1 68  ? 9.242   60.268 32.766 1.00 18.04 ? 68  ASN A O   1 
ATOM   532  C  CB  . ASN A 1 68  ? 10.277  57.918 33.667 1.00 16.31 ? 68  ASN A CB  1 
ATOM   533  C  CG  . ASN A 1 68  ? 10.024  57.275 32.304 1.00 19.80 ? 68  ASN A CG  1 
ATOM   534  O  OD1 . ASN A 1 68  ? 9.680   56.095 32.213 1.00 19.93 ? 68  ASN A OD1 1 
ATOM   535  N  ND2 . ASN A 1 68  ? 10.182  58.058 31.239 1.00 17.65 ? 68  ASN A ND2 1 
ATOM   536  N  N   . LEU A 1 69  ? 7.533   60.396 34.226 1.00 16.20 ? 69  LEU A N   1 
ATOM   537  C  CA  . LEU A 1 69  ? 7.054   61.669 33.707 1.00 15.83 ? 69  LEU A CA  1 
ATOM   538  C  C   . LEU A 1 69  ? 7.599   62.889 34.439 1.00 15.40 ? 69  LEU A C   1 
ATOM   539  O  O   . LEU A 1 69  ? 7.913   62.833 35.631 1.00 14.44 ? 69  LEU A O   1 
ATOM   540  C  CB  . LEU A 1 69  ? 5.524   61.727 33.775 1.00 16.95 ? 69  LEU A CB  1 
ATOM   541  C  CG  . LEU A 1 69  ? 4.734   60.673 32.998 1.00 18.79 ? 69  LEU A CG  1 
ATOM   542  C  CD1 . LEU A 1 69  ? 3.244   60.949 33.139 1.00 19.71 ? 69  LEU A CD1 1 
ATOM   543  C  CD2 . LEU A 1 69  ? 5.140   60.709 31.542 1.00 19.67 ? 69  LEU A CD2 1 
ATOM   544  N  N   . VAL A 1 70  ? 7.710   63.991 33.703 1.00 13.92 ? 70  VAL A N   1 
ATOM   545  C  CA  . VAL A 1 70  ? 8.134   65.271 34.260 1.00 13.79 ? 70  VAL A CA  1 
ATOM   546  C  C   . VAL A 1 70  ? 7.015   66.225 33.857 1.00 15.60 ? 70  VAL A C   1 
ATOM   547  O  O   . VAL A 1 70  ? 7.108   66.940 32.853 1.00 15.88 ? 70  VAL A O   1 
ATOM   548  C  CB  . VAL A 1 70  ? 9.482   65.768 33.678 1.00 14.56 ? 70  VAL A CB  1 
ATOM   549  C  CG1 . VAL A 1 70  ? 9.811   67.145 34.250 1.00 17.37 ? 70  VAL A CG1 1 
ATOM   550  C  CG2 . VAL A 1 70  ? 10.607  64.782 34.025 1.00 14.86 ? 70  VAL A CG2 1 
ATOM   551  N  N   . ILE A 1 71  ? 5.933   66.193 34.628 1.00 15.54 ? 71  ILE A N   1 
ATOM   552  C  CA  . ILE A 1 71  ? 4.771   67.038 34.373 1.00 14.87 ? 71  ILE A CA  1 
ATOM   553  C  C   . ILE A 1 71  ? 5.119   68.469 34.782 1.00 14.94 ? 71  ILE A C   1 
ATOM   554  O  O   . ILE A 1 71  ? 5.709   68.681 35.837 1.00 15.38 ? 71  ILE A O   1 
ATOM   555  C  CB  . ILE A 1 71  ? 3.557   66.495 35.163 1.00 16.08 ? 71  ILE A CB  1 
ATOM   556  C  CG1 . ILE A 1 71  ? 3.265   65.065 34.693 1.00 16.26 ? 71  ILE A CG1 1 
ATOM   557  C  CG2 . ILE A 1 71  ? 2.334   67.388 34.962 1.00 16.13 ? 71  ILE A CG2 1 
ATOM   558  C  CD1 . ILE A 1 71  ? 2.279   64.302 35.558 1.00 18.17 ? 71  ILE A CD1 1 
ATOM   559  N  N   . HIS A 1 72  ? 4.768   69.441 33.938 1.00 16.20 ? 72  HIS A N   1 
ATOM   560  C  CA  . HIS A 1 72  ? 5.080   70.854 34.196 1.00 15.99 ? 72  HIS A CA  1 
ATOM   561  C  C   . HIS A 1 72  ? 4.752   71.293 35.619 1.00 16.72 ? 72  HIS A C   1 
ATOM   562  O  O   . HIS A 1 72  ? 5.479   72.079 36.227 1.00 16.38 ? 72  HIS A O   1 
ATOM   563  C  CB  . HIS A 1 72  ? 4.293   71.789 33.262 1.00 14.93 ? 72  HIS A CB  1 
ATOM   564  C  CG  . HIS A 1 72  ? 4.471   71.516 31.800 1.00 15.92 ? 72  HIS A CG  1 
ATOM   565  N  ND1 . HIS A 1 72  ? 5.707   71.465 31.192 1.00 16.68 ? 72  HIS A ND1 1 
ATOM   566  C  CD2 . HIS A 1 72  ? 3.559   71.364 30.809 1.00 15.46 ? 72  HIS A CD2 1 
ATOM   567  C  CE1 . HIS A 1 72  ? 5.550   71.297 29.890 1.00 18.01 ? 72  HIS A CE1 1 
ATOM   568  N  NE2 . HIS A 1 72  ? 4.256   71.234 29.632 1.00 17.20 ? 72  HIS A NE2 1 
ATOM   569  N  N   . THR A 1 73  ? 3.648   70.779 36.143 1.00 14.64 ? 73  THR A N   1 
ATOM   570  C  CA  . THR A 1 73  ? 3.177   71.183 37.456 1.00 14.22 ? 73  THR A CA  1 
ATOM   571  C  C   . THR A 1 73  ? 3.206   70.134 38.568 1.00 16.01 ? 73  THR A C   1 
ATOM   572  O  O   . THR A 1 73  ? 2.422   70.215 39.510 1.00 16.65 ? 73  THR A O   1 
ATOM   573  C  CB  . THR A 1 73  ? 1.751   71.723 37.315 1.00 11.37 ? 73  THR A CB  1 
ATOM   574  O  OG1 . THR A 1 73  ? 0.972   70.787 36.560 1.00 13.88 ? 73  THR A OG1 1 
ATOM   575  C  CG2 . THR A 1 73  ? 1.757   73.052 36.577 1.00 14.52 ? 73  THR A CG2 1 
ATOM   576  N  N   . ASP A 1 74  ? 4.091   69.150 38.461 1.00 14.67 ? 74  ASP A N   1 
ATOM   577  C  CA  . ASP A 1 74  ? 4.195   68.137 39.505 1.00 16.54 ? 74  ASP A CA  1 
ATOM   578  C  C   . ASP A 1 74  ? 5.272   68.561 40.490 1.00 17.26 ? 74  ASP A C   1 
ATOM   579  O  O   . ASP A 1 74  ? 6.470   68.416 40.224 1.00 14.83 ? 74  ASP A O   1 
ATOM   580  C  CB  . ASP A 1 74  ? 4.547   66.765 38.921 1.00 15.36 ? 74  ASP A CB  1 
ATOM   581  C  CG  . ASP A 1 74  ? 4.848   65.746 40.002 1.00 17.47 ? 74  ASP A CG  1 
ATOM   582  O  OD1 . ASP A 1 74  ? 4.257   65.863 41.093 1.00 18.09 ? 74  ASP A OD1 1 
ATOM   583  O  OD2 . ASP A 1 74  ? 5.663   64.835 39.772 1.00 15.80 ? 74  ASP A OD2 1 
ATOM   584  N  N   . LEU A 1 75  ? 4.839   69.081 41.633 1.00 16.51 ? 75  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 75  ? 5.764   69.552 42.650 1.00 15.34 ? 75  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 75  ? 6.625   68.454 43.275 1.00 15.05 ? 75  LEU A C   1 
ATOM   587  O  O   . LEU A 1 75  ? 7.710   68.731 43.778 1.00 14.26 ? 75  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 75  ? 4.998   70.303 43.740 1.00 16.02 ? 75  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 75  ? 5.891   71.139 44.660 1.00 18.49 ? 75  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 75  ? 6.674   72.148 43.822 1.00 18.48 ? 75  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 75  ? 5.041   71.851 45.698 1.00 20.82 ? 75  LEU A CD2 1 
ATOM   592  N  N   . ASN A 1 76  ? 6.153   67.210 43.254 1.00 14.62 ? 76  ASN A N   1 
ATOM   593  C  CA  . ASN A 1 76  ? 6.942   66.116 43.817 1.00 14.87 ? 76  ASN A CA  1 
ATOM   594  C  C   . ASN A 1 76  ? 8.237   66.028 43.001 1.00 16.25 ? 76  ASN A C   1 
ATOM   595  O  O   . ASN A 1 76  ? 9.342   66.156 43.542 1.00 14.32 ? 76  ASN A O   1 
ATOM   596  C  CB  . ASN A 1 76  ? 6.168   64.791 43.734 1.00 13.21 ? 76  ASN A CB  1 
ATOM   597  C  CG  . ASN A 1 76  ? 6.960   63.606 44.291 1.00 14.51 ? 76  ASN A CG  1 
ATOM   598  O  OD1 . ASN A 1 76  ? 8.174   63.521 44.120 1.00 16.48 ? 76  ASN A OD1 1 
ATOM   599  N  ND2 . ASN A 1 76  ? 6.266   62.682 44.945 1.00 12.58 ? 76  ASN A ND2 1 
ATOM   600  N  N   . CYS A 1 77  ? 8.092   65.832 41.694 1.00 15.96 ? 77  CYS A N   1 
ATOM   601  C  CA  . CYS A 1 77  ? 9.243   65.733 40.798 1.00 17.10 ? 77  CYS A CA  1 
ATOM   602  C  C   . CYS A 1 77  ? 10.050  67.029 40.736 1.00 16.44 ? 77  CYS A C   1 
ATOM   603  O  O   . CYS A 1 77  ? 11.278  66.994 40.753 1.00 18.73 ? 77  CYS A O   1 
ATOM   604  C  CB  . CYS A 1 77  ? 8.787   65.361 39.387 1.00 18.67 ? 77  CYS A CB  1 
ATOM   605  S  SG  . CYS A 1 77  ? 10.154  65.141 38.231 1.00 18.56 ? 77  CYS A SG  1 
ATOM   606  N  N   . LEU A 1 78  ? 9.369   68.170 40.660 1.00 15.52 ? 78  LEU A N   1 
ATOM   607  C  CA  . LEU A 1 78  ? 10.070  69.450 40.600 1.00 16.92 ? 78  LEU A CA  1 
ATOM   608  C  C   . LEU A 1 78  ? 10.899  69.697 41.859 1.00 17.24 ? 78  LEU A C   1 
ATOM   609  O  O   . LEU A 1 78  ? 11.969  70.306 41.790 1.00 16.83 ? 78  LEU A O   1 
ATOM   610  C  CB  . LEU A 1 78  ? 9.085   70.607 40.414 1.00 18.19 ? 78  LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 78  ? 8.317   70.678 39.092 1.00 21.95 ? 78  LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 78  ? 7.512   71.966 39.056 1.00 22.49 ? 78  LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 78  ? 9.288   70.627 37.917 1.00 22.80 ? 78  LEU A CD2 1 
ATOM   614  N  N   . SER A 1 79  ? 10.402  69.236 43.007 1.00 15.45 ? 79  SER A N   1 
ATOM   615  C  CA  . SER A 1 79  ? 11.121  69.420 44.266 1.00 16.09 ? 79  SER A CA  1 
ATOM   616  C  C   . SER A 1 79  ? 12.405  68.598 44.255 1.00 15.59 ? 79  SER A C   1 
ATOM   617  O  O   . SER A 1 79  ? 13.435  69.049 44.746 1.00 16.18 ? 79  SER A O   1 
ATOM   618  C  CB  . SER A 1 79  ? 10.241  69.024 45.461 1.00 14.09 ? 79  SER A CB  1 
ATOM   619  O  OG  . SER A 1 79  ? 9.177   69.954 45.619 1.00 14.58 ? 79  SER A OG  1 
ATOM   620  N  N   . VAL A 1 80  ? 12.341  67.393 43.694 1.00 14.82 ? 80  VAL A N   1 
ATOM   621  C  CA  . VAL A 1 80  ? 13.526  66.540 43.605 1.00 14.78 ? 80  VAL A CA  1 
ATOM   622  C  C   . VAL A 1 80  ? 14.567  67.214 42.705 1.00 16.14 ? 80  VAL A C   1 
ATOM   623  O  O   . VAL A 1 80  ? 15.747  67.269 43.033 1.00 14.46 ? 80  VAL A O   1 
ATOM   624  C  CB  . VAL A 1 80  ? 13.191  65.160 42.999 1.00 14.91 ? 80  VAL A CB  1 
ATOM   625  C  CG1 . VAL A 1 80  ? 14.483  64.402 42.687 1.00 16.59 ? 80  VAL A CG1 1 
ATOM   626  C  CG2 . VAL A 1 80  ? 12.323  64.350 43.980 1.00 14.45 ? 80  VAL A CG2 1 
ATOM   627  N  N   . VAL A 1 81  ? 14.113  67.726 41.566 1.00 16.27 ? 81  VAL A N   1 
ATOM   628  C  CA  . VAL A 1 81  ? 15.001  68.384 40.621 1.00 17.74 ? 81  VAL A CA  1 
ATOM   629  C  C   . VAL A 1 81  ? 15.645  69.651 41.189 1.00 17.12 ? 81  VAL A C   1 
ATOM   630  O  O   . VAL A 1 81  ? 16.855  69.836 41.078 1.00 17.47 ? 81  VAL A O   1 
ATOM   631  C  CB  . VAL A 1 81  ? 14.243  68.733 39.315 1.00 19.32 ? 81  VAL A CB  1 
ATOM   632  C  CG1 . VAL A 1 81  ? 15.170  69.450 38.340 1.00 17.90 ? 81  VAL A CG1 1 
ATOM   633  C  CG2 . VAL A 1 81  ? 13.696  67.460 38.687 1.00 16.69 ? 81  VAL A CG2 1 
ATOM   634  N  N   . GLN A 1 82  ? 14.842  70.517 41.800 1.00 15.68 ? 82  GLN A N   1 
ATOM   635  C  CA  . GLN A 1 82  ? 15.360  71.763 42.358 1.00 16.76 ? 82  GLN A CA  1 
ATOM   636  C  C   . GLN A 1 82  ? 16.407  71.467 43.428 1.00 17.91 ? 82  GLN A C   1 
ATOM   637  O  O   . GLN A 1 82  ? 17.480  72.078 43.449 1.00 18.07 ? 82  GLN A O   1 
ATOM   638  C  CB  . GLN A 1 82  ? 14.209  72.598 42.928 1.00 17.79 ? 82  GLN A CB  1 
ATOM   639  C  CG  . GLN A 1 82  ? 14.581  74.024 43.343 1.00 18.34 ? 82  GLN A CG  1 
ATOM   640  C  CD  . GLN A 1 82  ? 15.089  74.098 44.769 1.00 18.08 ? 82  GLN A CD  1 
ATOM   641  O  OE1 . GLN A 1 82  ? 14.597  73.391 45.647 1.00 19.52 ? 82  GLN A OE1 1 
ATOM   642  N  NE2 . GLN A 1 82  ? 16.063  74.966 45.012 1.00 18.17 ? 82  GLN A NE2 1 
ATOM   643  N  N   . TYR A 1 83  ? 16.107  70.511 44.299 1.00 16.52 ? 83  TYR A N   1 
ATOM   644  C  CA  . TYR A 1 83  ? 17.039  70.124 45.349 1.00 17.66 ? 83  TYR A CA  1 
ATOM   645  C  C   . TYR A 1 83  ? 18.337  69.599 44.718 1.00 17.71 ? 83  TYR A C   1 
ATOM   646  O  O   . TYR A 1 83  ? 19.438  70.002 45.100 1.00 16.93 ? 83  TYR A O   1 
ATOM   647  C  CB  . TYR A 1 83  ? 16.412  69.038 46.225 1.00 19.32 ? 83  TYR A CB  1 
ATOM   648  C  CG  . TYR A 1 83  ? 17.239  68.652 47.433 1.00 22.31 ? 83  TYR A CG  1 
ATOM   649  C  CD1 . TYR A 1 83  ? 17.326  69.490 48.546 1.00 21.75 ? 83  TYR A CD1 1 
ATOM   650  C  CD2 . TYR A 1 83  ? 17.933  67.442 47.466 1.00 24.32 ? 83  TYR A CD2 1 
ATOM   651  C  CE1 . TYR A 1 83  ? 18.085  69.129 49.665 1.00 22.09 ? 83  TYR A CE1 1 
ATOM   652  C  CE2 . TYR A 1 83  ? 18.694  67.072 48.577 1.00 22.94 ? 83  TYR A CE2 1 
ATOM   653  C  CZ  . TYR A 1 83  ? 18.764  67.919 49.669 1.00 23.12 ? 83  TYR A CZ  1 
ATOM   654  O  OH  . TYR A 1 83  ? 19.519  67.551 50.759 1.00 23.32 ? 83  TYR A OH  1 
ATOM   655  N  N   . ALA A 1 84  ? 18.202  68.709 43.740 1.00 15.54 ? 84  ALA A N   1 
ATOM   656  C  CA  . ALA A 1 84  ? 19.363  68.131 43.065 1.00 15.79 ? 84  ALA A CA  1 
ATOM   657  C  C   . ALA A 1 84  ? 20.221  69.170 42.333 1.00 16.13 ? 84  ALA A C   1 
ATOM   658  O  O   . ALA A 1 84  ? 21.451  69.160 42.440 1.00 14.99 ? 84  ALA A O   1 
ATOM   659  C  CB  . ALA A 1 84  ? 18.907  67.051 42.080 1.00 15.90 ? 84  ALA A CB  1 
ATOM   660  N  N   . VAL A 1 85  ? 19.573  70.064 41.595 1.00 15.46 ? 85  VAL A N   1 
ATOM   661  C  CA  . VAL A 1 85  ? 20.280  71.086 40.829 1.00 16.66 ? 85  VAL A CA  1 
ATOM   662  C  C   . VAL A 1 85  ? 20.860  72.230 41.662 1.00 20.33 ? 85  VAL A C   1 
ATOM   663  O  O   . VAL A 1 85  ? 22.054  72.527 41.574 1.00 19.30 ? 85  VAL A O   1 
ATOM   664  C  CB  . VAL A 1 85  ? 19.358  71.705 39.741 1.00 19.26 ? 85  VAL A CB  1 
ATOM   665  C  CG1 . VAL A 1 85  ? 20.098  72.815 38.999 1.00 19.70 ? 85  VAL A CG1 1 
ATOM   666  C  CG2 . VAL A 1 85  ? 18.897  70.626 38.764 1.00 18.20 ? 85  VAL A CG2 1 
ATOM   667  N  N   . ASP A 1 86  ? 20.017  72.868 42.470 1.00 18.82 ? 86  ASP A N   1 
ATOM   668  C  CA  . ASP A 1 86  ? 20.454  73.999 43.280 1.00 20.92 ? 86  ASP A CA  1 
ATOM   669  C  C   . ASP A 1 86  ? 21.219  73.667 44.551 1.00 21.63 ? 86  ASP A C   1 
ATOM   670  O  O   . ASP A 1 86  ? 22.132  74.403 44.922 1.00 22.06 ? 86  ASP A O   1 
ATOM   671  C  CB  . ASP A 1 86  ? 19.265  74.884 43.659 1.00 21.62 ? 86  ASP A CB  1 
ATOM   672  C  CG  . ASP A 1 86  ? 18.566  75.484 42.453 1.00 20.81 ? 86  ASP A CG  1 
ATOM   673  O  OD1 . ASP A 1 86  ? 19.081  75.357 41.326 1.00 22.91 ? 86  ASP A OD1 1 
ATOM   674  O  OD2 . ASP A 1 86  ? 17.493  76.093 42.640 1.00 23.26 ? 86  ASP A OD2 1 
ATOM   675  N  N   . VAL A 1 87  ? 20.858  72.581 45.228 1.00 20.33 ? 87  VAL A N   1 
ATOM   676  C  CA  . VAL A 1 87  ? 21.538  72.239 46.474 1.00 21.40 ? 87  VAL A CA  1 
ATOM   677  C  C   . VAL A 1 87  ? 22.660  71.219 46.331 1.00 22.64 ? 87  VAL A C   1 
ATOM   678  O  O   . VAL A 1 87  ? 23.783  71.468 46.774 1.00 23.12 ? 87  VAL A O   1 
ATOM   679  C  CB  . VAL A 1 87  ? 20.532  71.746 47.542 1.00 20.92 ? 87  VAL A CB  1 
ATOM   680  C  CG1 . VAL A 1 87  ? 21.246  71.506 48.867 1.00 22.22 ? 87  VAL A CG1 1 
ATOM   681  C  CG2 . VAL A 1 87  ? 19.430  72.781 47.727 1.00 19.75 ? 87  VAL A CG2 1 
ATOM   682  N  N   . LEU A 1 88  ? 22.372  70.075 45.718 1.00 21.67 ? 88  LEU A N   1 
ATOM   683  C  CA  . LEU A 1 88  ? 23.397  69.049 45.537 1.00 22.74 ? 88  LEU A CA  1 
ATOM   684  C  C   . LEU A 1 88  ? 24.290  69.386 44.346 1.00 23.89 ? 88  LEU A C   1 
ATOM   685  O  O   . LEU A 1 88  ? 25.408  68.884 44.224 1.00 24.42 ? 88  LEU A O   1 
ATOM   686  C  CB  . LEU A 1 88  ? 22.745  67.680 45.317 1.00 24.54 ? 88  LEU A CB  1 
ATOM   687  C  CG  . LEU A 1 88  ? 21.767  67.216 46.402 1.00 25.93 ? 88  LEU A CG  1 
ATOM   688  C  CD1 . LEU A 1 88  ? 21.221  65.845 46.042 1.00 24.00 ? 88  LEU A CD1 1 
ATOM   689  C  CD2 . LEU A 1 88  ? 22.470  67.180 47.756 1.00 25.73 ? 88  LEU A CD2 1 
ATOM   690  N  N   . GLU A 1 89  ? 23.782  70.238 43.468 1.00 23.29 ? 89  GLU A N   1 
ATOM   691  C  CA  . GLU A 1 89  ? 24.509  70.651 42.279 1.00 26.21 ? 89  GLU A CA  1 
ATOM   692  C  C   . GLU A 1 89  ? 24.946  69.471 41.413 1.00 25.15 ? 89  GLU A C   1 
ATOM   693  O  O   . GLU A 1 89  ? 26.109  69.380 41.015 1.00 23.46 ? 89  GLU A O   1 
ATOM   694  C  CB  . GLU A 1 89  ? 25.731  71.487 42.678 1.00 29.16 ? 89  GLU A CB  1 
ATOM   695  C  CG  . GLU A 1 89  ? 25.392  72.641 43.604 1.00 36.03 ? 89  GLU A CG  1 
ATOM   696  C  CD  . GLU A 1 89  ? 26.568  73.564 43.844 1.00 40.03 ? 89  GLU A CD  1 
ATOM   697  O  OE1 . GLU A 1 89  ? 26.958  74.274 42.896 1.00 42.34 ? 89  GLU A OE1 1 
ATOM   698  O  OE2 . GLU A 1 89  ? 27.103  73.573 44.975 1.00 42.81 ? 89  GLU A OE2 1 
ATOM   699  N  N   . VAL A 1 90  ? 24.019  68.562 41.125 1.00 22.72 ? 90  VAL A N   1 
ATOM   700  C  CA  . VAL A 1 90  ? 24.346  67.420 40.278 1.00 20.28 ? 90  VAL A CA  1 
ATOM   701  C  C   . VAL A 1 90  ? 24.769  67.988 38.927 1.00 20.53 ? 90  VAL A C   1 
ATOM   702  O  O   . VAL A 1 90  ? 24.358  69.089 38.556 1.00 18.05 ? 90  VAL A O   1 
ATOM   703  C  CB  . VAL A 1 90  ? 23.130  66.481 40.074 1.00 22.57 ? 90  VAL A CB  1 
ATOM   704  C  CG1 . VAL A 1 90  ? 22.709  65.876 41.409 1.00 21.38 ? 90  VAL A CG1 1 
ATOM   705  C  CG2 . VAL A 1 90  ? 21.973  67.247 39.441 1.00 21.31 ? 90  VAL A CG2 1 
ATOM   706  N  N   . GLU A 1 91  ? 25.586  67.245 38.193 1.00 18.97 ? 91  GLU A N   1 
ATOM   707  C  CA  . GLU A 1 91  ? 26.061  67.703 36.894 1.00 22.11 ? 91  GLU A CA  1 
ATOM   708  C  C   . GLU A 1 91  ? 25.332  67.064 35.720 1.00 21.55 ? 91  GLU A C   1 
ATOM   709  O  O   . GLU A 1 91  ? 25.351  67.593 34.607 1.00 21.67 ? 91  GLU A O   1 
ATOM   710  C  CB  . GLU A 1 91  ? 27.561  67.437 36.772 1.00 26.75 ? 91  GLU A CB  1 
ATOM   711  C  CG  . GLU A 1 91  ? 28.400  68.286 37.712 1.00 33.78 ? 91  GLU A CG  1 
ATOM   712  C  CD  . GLU A 1 91  ? 29.862  67.907 37.684 1.00 38.68 ? 91  GLU A CD  1 
ATOM   713  O  OE1 . GLU A 1 91  ? 30.444  67.868 36.580 1.00 43.07 ? 91  GLU A OE1 1 
ATOM   714  O  OE2 . GLU A 1 91  ? 30.429  67.647 38.766 1.00 43.36 ? 91  GLU A OE2 1 
ATOM   715  N  N   . HIS A 1 92  ? 24.688  65.930 35.973 1.00 20.21 ? 92  HIS A N   1 
ATOM   716  C  CA  . HIS A 1 92  ? 23.964  65.218 34.929 1.00 20.40 ? 92  HIS A CA  1 
ATOM   717  C  C   . HIS A 1 92  ? 22.605  64.742 35.415 1.00 20.61 ? 92  HIS A C   1 
ATOM   718  O  O   . HIS A 1 92  ? 22.478  64.227 36.526 1.00 20.81 ? 92  HIS A O   1 
ATOM   719  C  CB  . HIS A 1 92  ? 24.764  63.996 34.471 1.00 21.67 ? 92  HIS A CB  1 
ATOM   720  C  CG  . HIS A 1 92  ? 26.055  64.332 33.793 1.00 22.50 ? 92  HIS A CG  1 
ATOM   721  N  ND1 . HIS A 1 92  ? 26.125  64.715 32.471 1.00 23.32 ? 92  HIS A ND1 1 
ATOM   722  C  CD2 . HIS A 1 92  ? 27.326  64.358 34.260 1.00 23.23 ? 92  HIS A CD2 1 
ATOM   723  C  CE1 . HIS A 1 92  ? 27.384  64.960 32.153 1.00 24.53 ? 92  HIS A CE1 1 
ATOM   724  N  NE2 . HIS A 1 92  ? 28.132  64.752 33.221 1.00 22.49 ? 92  HIS A NE2 1 
ATOM   725  N  N   . ILE A 1 93  ? 21.589  64.924 34.581 1.00 19.22 ? 93  ILE A N   1 
ATOM   726  C  CA  . ILE A 1 93  ? 20.253  64.455 34.907 1.00 18.95 ? 93  ILE A CA  1 
ATOM   727  C  C   . ILE A 1 93  ? 19.893  63.473 33.803 1.00 19.59 ? 93  ILE A C   1 
ATOM   728  O  O   . ILE A 1 93  ? 19.977  63.795 32.617 1.00 19.96 ? 93  ILE A O   1 
ATOM   729  C  CB  . ILE A 1 93  ? 19.220  65.597 34.944 1.00 18.59 ? 93  ILE A CB  1 
ATOM   730  C  CG1 . ILE A 1 93  ? 19.551  66.555 36.091 1.00 18.44 ? 93  ILE A CG1 1 
ATOM   731  C  CG2 . ILE A 1 93  ? 17.815  65.018 35.146 1.00 18.34 ? 93  ILE A CG2 1 
ATOM   732  C  CD1 . ILE A 1 93  ? 18.721  67.830 36.089 1.00 22.67 ? 93  ILE A CD1 1 
ATOM   733  N  N   . ILE A 1 94  ? 19.518  62.267 34.199 1.00 18.59 ? 94  ILE A N   1 
ATOM   734  C  CA  . ILE A 1 94  ? 19.166  61.232 33.246 1.00 18.73 ? 94  ILE A CA  1 
ATOM   735  C  C   . ILE A 1 94  ? 17.710  60.819 33.383 1.00 18.64 ? 94  ILE A C   1 
ATOM   736  O  O   . ILE A 1 94  ? 17.278  60.409 34.457 1.00 19.13 ? 94  ILE A O   1 
ATOM   737  C  CB  . ILE A 1 94  ? 20.039  59.977 33.458 1.00 20.79 ? 94  ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 94  ? 21.521  60.349 33.355 1.00 21.29 ? 94  ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 94  ? 19.679  58.907 32.435 1.00 21.00 ? 94  ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 94  ? 22.457  59.229 33.754 1.00 24.40 ? 94  ILE A CD1 1 
ATOM   741  N  N   . ILE A 1 95  ? 16.950  60.963 32.303 1.00 16.74 ? 95  ILE A N   1 
ATOM   742  C  CA  . ILE A 1 95  ? 15.562  60.531 32.298 1.00 16.29 ? 95  ILE A CA  1 
ATOM   743  C  C   . ILE A 1 95  ? 15.626  59.239 31.492 1.00 17.60 ? 95  ILE A C   1 
ATOM   744  O  O   . ILE A 1 95  ? 15.984  59.248 30.315 1.00 17.53 ? 95  ILE A O   1 
ATOM   745  C  CB  . ILE A 1 95  ? 14.635  61.550 31.600 1.00 16.80 ? 95  ILE A CB  1 
ATOM   746  C  CG1 . ILE A 1 95  ? 14.515  62.815 32.462 1.00 17.20 ? 95  ILE A CG1 1 
ATOM   747  C  CG2 . ILE A 1 95  ? 13.264  60.930 31.366 1.00 17.47 ? 95  ILE A CG2 1 
ATOM   748  C  CD1 . ILE A 1 95  ? 13.586  63.875 31.895 1.00 20.59 ? 95  ILE A CD1 1 
ATOM   749  N  N   . CYS A 1 96  ? 15.302  58.123 32.132 1.00 16.80 ? 96  CYS A N   1 
ATOM   750  C  CA  . CYS A 1 96  ? 15.382  56.840 31.456 1.00 17.04 ? 96  CYS A CA  1 
ATOM   751  C  C   . CYS A 1 96  ? 14.065  56.076 31.407 1.00 16.70 ? 96  CYS A C   1 
ATOM   752  O  O   . CYS A 1 96  ? 13.473  55.770 32.440 1.00 18.25 ? 96  CYS A O   1 
ATOM   753  C  CB  . CYS A 1 96  ? 16.457  55.985 32.132 1.00 19.67 ? 96  CYS A CB  1 
ATOM   754  S  SG  . CYS A 1 96  ? 16.834  54.438 31.289 1.00 21.11 ? 96  CYS A SG  1 
ATOM   755  N  N   . GLY A 1 97  ? 13.603  55.785 30.194 1.00 14.74 ? 97  GLY A N   1 
ATOM   756  C  CA  . GLY A 1 97  ? 12.376  55.030 30.037 1.00 15.13 ? 97  GLY A CA  1 
ATOM   757  C  C   . GLY A 1 97  ? 12.762  53.607 29.697 1.00 17.20 ? 97  GLY A C   1 
ATOM   758  O  O   . GLY A 1 97  ? 13.950  53.287 29.641 1.00 18.67 ? 97  GLY A O   1 
ATOM   759  N  N   . HIS A 1 98  ? 11.781  52.740 29.479 1.00 17.98 ? 98  HIS A N   1 
ATOM   760  C  CA  . HIS A 1 98  ? 12.090  51.360 29.124 1.00 18.98 ? 98  HIS A CA  1 
ATOM   761  C  C   . HIS A 1 98  ? 10.996  50.773 28.248 1.00 20.39 ? 98  HIS A C   1 
ATOM   762  O  O   . HIS A 1 98  ? 9.809   51.053 28.438 1.00 20.60 ? 98  HIS A O   1 
ATOM   763  C  CB  . HIS A 1 98  ? 12.302  50.507 30.383 1.00 16.96 ? 98  HIS A CB  1 
ATOM   764  C  CG  . HIS A 1 98  ? 11.074  50.327 31.219 1.00 16.75 ? 98  HIS A CG  1 
ATOM   765  N  ND1 . HIS A 1 98  ? 10.447  49.108 31.361 1.00 16.28 ? 98  HIS A ND1 1 
ATOM   766  C  CD2 . HIS A 1 98  ? 10.354  51.207 31.952 1.00 15.20 ? 98  HIS A CD2 1 
ATOM   767  C  CE1 . HIS A 1 98  ? 9.393   49.244 32.145 1.00 16.73 ? 98  HIS A CE1 1 
ATOM   768  N  NE2 . HIS A 1 98  ? 9.314   50.509 32.516 1.00 15.66 ? 98  HIS A NE2 1 
ATOM   769  N  N   . TYR A 1 99  ? 11.407  49.975 27.269 1.00 20.52 ? 99  TYR A N   1 
ATOM   770  C  CA  . TYR A 1 99  ? 10.468  49.350 26.350 1.00 21.59 ? 99  TYR A CA  1 
ATOM   771  C  C   . TYR A 1 99  ? 9.578   48.365 27.087 1.00 21.11 ? 99  TYR A C   1 
ATOM   772  O  O   . TYR A 1 99  ? 10.047  47.623 27.945 1.00 22.91 ? 99  TYR A O   1 
ATOM   773  C  CB  . TYR A 1 99  ? 11.236  48.641 25.230 1.00 22.08 ? 99  TYR A CB  1 
ATOM   774  C  CG  . TYR A 1 99  ? 12.184  49.565 24.505 1.00 23.06 ? 99  TYR A CG  1 
ATOM   775  C  CD1 . TYR A 1 99  ? 13.562  49.478 24.699 1.00 23.51 ? 99  TYR A CD1 1 
ATOM   776  C  CD2 . TYR A 1 99  ? 11.698  50.561 23.661 1.00 21.38 ? 99  TYR A CD2 1 
ATOM   777  C  CE1 . TYR A 1 99  ? 14.435  50.367 24.070 1.00 25.31 ? 99  TYR A CE1 1 
ATOM   778  C  CE2 . TYR A 1 99  ? 12.558  51.453 23.029 1.00 24.63 ? 99  TYR A CE2 1 
ATOM   779  C  CZ  . TYR A 1 99  ? 13.924  51.352 23.237 1.00 24.78 ? 99  TYR A CZ  1 
ATOM   780  O  OH  . TYR A 1 99  ? 14.772  52.240 22.615 1.00 24.56 ? 99  TYR A OH  1 
ATOM   781  N  N   . GLY A 1 100 ? 8.293   48.361 26.749 1.00 21.84 ? 100 GLY A N   1 
ATOM   782  C  CA  . GLY A 1 100 ? 7.357   47.461 27.404 1.00 21.89 ? 100 GLY A CA  1 
ATOM   783  C  C   . GLY A 1 100 ? 6.816   48.030 28.706 1.00 21.27 ? 100 GLY A C   1 
ATOM   784  O  O   . GLY A 1 100 ? 6.186   47.321 29.490 1.00 22.55 ? 100 GLY A O   1 
ATOM   785  N  N   . CYS A 1 101 ? 7.072   49.312 28.944 1.00 20.60 ? 101 CYS A N   1 
ATOM   786  C  CA  . CYS A 1 101 ? 6.598   49.979 30.156 1.00 18.84 ? 101 CYS A CA  1 
ATOM   787  C  C   . CYS A 1 101 ? 5.081   49.801 30.296 1.00 18.42 ? 101 CYS A C   1 
ATOM   788  O  O   . CYS A 1 101 ? 4.325   50.098 29.372 1.00 17.55 ? 101 CYS A O   1 
ATOM   789  C  CB  . CYS A 1 101 ? 6.941   51.471 30.092 1.00 16.97 ? 101 CYS A CB  1 
ATOM   790  S  SG  . CYS A 1 101 ? 6.328   52.451 31.493 1.00 18.80 ? 101 CYS A SG  1 
ATOM   791  N  N   . GLY A 1 102 ? 4.642   49.315 31.451 1.00 19.08 ? 102 GLY A N   1 
ATOM   792  C  CA  . GLY A 1 102 ? 3.218   49.116 31.677 1.00 19.60 ? 102 GLY A CA  1 
ATOM   793  C  C   . GLY A 1 102 ? 2.418   50.406 31.591 1.00 20.24 ? 102 GLY A C   1 
ATOM   794  O  O   . GLY A 1 102 ? 1.276   50.411 31.129 1.00 20.74 ? 102 GLY A O   1 
ATOM   795  N  N   . GLY A 1 103 ? 3.023   51.506 32.034 1.00 18.06 ? 103 GLY A N   1 
ATOM   796  C  CA  . GLY A 1 103 ? 2.344   52.790 32.007 1.00 18.30 ? 103 GLY A CA  1 
ATOM   797  C  C   . GLY A 1 103 ? 2.089   53.272 30.595 1.00 19.56 ? 103 GLY A C   1 
ATOM   798  O  O   . GLY A 1 103 ? 0.984   53.718 30.270 1.00 17.86 ? 103 GLY A O   1 
ATOM   799  N  N   . VAL A 1 104 ? 3.117   53.190 29.755 1.00 18.14 ? 104 VAL A N   1 
ATOM   800  C  CA  . VAL A 1 104 ? 2.999   53.611 28.367 1.00 20.18 ? 104 VAL A CA  1 
ATOM   801  C  C   . VAL A 1 104 ? 1.926   52.790 27.653 1.00 19.75 ? 104 VAL A C   1 
ATOM   802  O  O   . VAL A 1 104 ? 1.080   53.339 26.948 1.00 19.91 ? 104 VAL A O   1 
ATOM   803  C  CB  . VAL A 1 104 ? 4.352   53.455 27.627 1.00 21.47 ? 104 VAL A CB  1 
ATOM   804  C  CG1 . VAL A 1 104 ? 4.175   53.695 26.129 1.00 22.76 ? 104 VAL A CG1 1 
ATOM   805  C  CG2 . VAL A 1 104 ? 5.365   54.446 28.198 1.00 21.98 ? 104 VAL A CG2 1 
ATOM   806  N  N   . GLN A 1 105 ? 1.958   51.476 27.847 1.00 21.55 ? 105 GLN A N   1 
ATOM   807  C  CA  . GLN A 1 105 ? 0.991   50.588 27.209 1.00 23.24 ? 105 GLN A CA  1 
ATOM   808  C  C   . GLN A 1 105 ? -0.437  50.891 27.671 1.00 23.21 ? 105 GLN A C   1 
ATOM   809  O  O   . GLN A 1 105 ? -1.358  50.993 26.858 1.00 23.20 ? 105 GLN A O   1 
ATOM   810  C  CB  . GLN A 1 105 ? 1.349   49.127 27.507 1.00 24.91 ? 105 GLN A CB  1 
ATOM   811  C  CG  . GLN A 1 105 ? 0.574   48.122 26.674 1.00 32.60 ? 105 GLN A CG  1 
ATOM   812  C  CD  . GLN A 1 105 ? 1.022   46.693 26.917 1.00 35.96 ? 105 GLN A CD  1 
ATOM   813  O  OE1 . GLN A 1 105 ? 2.196   46.358 26.740 1.00 39.28 ? 105 GLN A OE1 1 
ATOM   814  N  NE2 . GLN A 1 105 ? 0.089   45.842 27.325 1.00 38.44 ? 105 GLN A NE2 1 
ATOM   815  N  N   . ALA A 1 106 ? -0.616  51.047 28.979 1.00 22.40 ? 106 ALA A N   1 
ATOM   816  C  CA  . ALA A 1 106 ? -1.934  51.346 29.524 1.00 23.33 ? 106 ALA A CA  1 
ATOM   817  C  C   . ALA A 1 106 ? -2.486  52.655 28.958 1.00 24.37 ? 106 ALA A C   1 
ATOM   818  O  O   . ALA A 1 106 ? -3.692  52.793 28.764 1.00 24.34 ? 106 ALA A O   1 
ATOM   819  C  CB  . ALA A 1 106 ? -1.866  51.418 31.047 1.00 22.38 ? 106 ALA A CB  1 
ATOM   820  N  N   . ALA A 1 107 ? -1.604  53.612 28.682 1.00 24.08 ? 107 ALA A N   1 
ATOM   821  C  CA  . ALA A 1 107 ? -2.035  54.897 28.144 1.00 25.97 ? 107 ALA A CA  1 
ATOM   822  C  C   . ALA A 1 107 ? -2.598  54.742 26.736 1.00 26.98 ? 107 ALA A C   1 
ATOM   823  O  O   . ALA A 1 107 ? -3.472  55.501 26.323 1.00 28.15 ? 107 ALA A O   1 
ATOM   824  C  CB  . ALA A 1 107 ? -0.872  55.885 28.139 1.00 24.16 ? 107 ALA A CB  1 
ATOM   825  N  N   . VAL A 1 108 ? -2.094  53.757 26.002 1.00 27.65 ? 108 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 108 ? -2.552  53.511 24.641 1.00 27.76 ? 108 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 108 ? -3.817  52.657 24.620 1.00 28.07 ? 108 VAL A C   1 
ATOM   828  O  O   . VAL A 1 108 ? -4.783  52.993 23.938 1.00 27.97 ? 108 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 108 ? -1.459  52.806 23.808 1.00 28.00 ? 108 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 108 ? -1.995  52.448 22.424 1.00 27.83 ? 108 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 108 ? -0.245  53.712 23.687 1.00 28.70 ? 108 VAL A CG2 1 
ATOM   832  N  N   . GLU A 1 109 ? -3.809  51.558 25.369 1.00 28.64 ? 109 GLU A N   1 
ATOM   833  C  CA  . GLU A 1 109 ? -4.964  50.664 25.420 1.00 30.88 ? 109 GLU A CA  1 
ATOM   834  C  C   . GLU A 1 109 ? -6.137  51.306 26.149 1.00 31.40 ? 109 GLU A C   1 
ATOM   835  O  O   . GLU A 1 109 ? -7.293  50.949 25.926 1.00 29.51 ? 109 GLU A O   1 
ATOM   836  C  CB  . GLU A 1 109 ? -4.584  49.351 26.099 1.00 32.76 ? 109 GLU A CB  1 
ATOM   837  C  CG  . GLU A 1 109 ? -3.546  48.554 25.328 1.00 38.97 ? 109 GLU A CG  1 
ATOM   838  C  CD  . GLU A 1 109 ? -3.225  47.232 25.990 1.00 42.83 ? 109 GLU A CD  1 
ATOM   839  O  OE1 . GLU A 1 109 ? -4.154  46.422 26.194 1.00 47.25 ? 109 GLU A OE1 1 
ATOM   840  O  OE2 . GLU A 1 109 ? -2.044  47.000 26.305 1.00 45.90 ? 109 GLU A OE2 1 
ATOM   841  N  N   . ASN A 1 110 ? -5.824  52.245 27.034 1.00 30.66 ? 110 ASN A N   1 
ATOM   842  C  CA  . ASN A 1 110 ? -6.834  52.975 27.788 1.00 30.91 ? 110 ASN A CA  1 
ATOM   843  C  C   . ASN A 1 110 ? -7.814  52.135 28.617 1.00 31.17 ? 110 ASN A C   1 
ATOM   844  O  O   . ASN A 1 110 ? -9.023  52.369 28.579 1.00 27.57 ? 110 ASN A O   1 
ATOM   845  C  CB  . ASN A 1 110 ? -7.630  53.872 26.836 1.00 33.09 ? 110 ASN A CB  1 
ATOM   846  C  CG  . ASN A 1 110 ? -8.353  54.993 27.558 1.00 36.26 ? 110 ASN A CG  1 
ATOM   847  O  OD1 . ASN A 1 110 ? -9.257  55.621 27.007 1.00 37.66 ? 110 ASN A OD1 1 
ATOM   848  N  ND2 . ASN A 1 110 ? -7.947  55.258 28.795 1.00 36.45 ? 110 ASN A ND2 1 
ATOM   849  N  N   . PRO A 1 111 ? -7.315  51.137 29.366 1.00 29.24 ? 111 PRO A N   1 
ATOM   850  C  CA  . PRO A 1 111 ? -8.263  50.351 30.164 1.00 30.27 ? 111 PRO A CA  1 
ATOM   851  C  C   . PRO A 1 111 ? -8.717  51.187 31.364 1.00 29.77 ? 111 PRO A C   1 
ATOM   852  O  O   . PRO A 1 111 ? -8.086  52.191 31.692 1.00 29.68 ? 111 PRO A O   1 
ATOM   853  C  CB  . PRO A 1 111 ? -7.436  49.137 30.580 1.00 30.10 ? 111 PRO A CB  1 
ATOM   854  C  CG  . PRO A 1 111 ? -6.042  49.698 30.668 1.00 29.74 ? 111 PRO A CG  1 
ATOM   855  C  CD  . PRO A 1 111 ? -5.958  50.571 29.442 1.00 29.92 ? 111 PRO A CD  1 
ATOM   856  N  N   . GLU A 1 112 ? -9.810  50.791 32.007 1.00 29.89 ? 112 GLU A N   1 
ATOM   857  C  CA  . GLU A 1 112 ? -10.300 51.520 33.177 1.00 30.83 ? 112 GLU A CA  1 
ATOM   858  C  C   . GLU A 1 112 ? -9.567  50.990 34.402 1.00 27.75 ? 112 GLU A C   1 
ATOM   859  O  O   . GLU A 1 112 ? -9.932  49.955 34.953 1.00 28.24 ? 112 GLU A O   1 
ATOM   860  C  CB  . GLU A 1 112 ? -11.809 51.322 33.340 1.00 33.66 ? 112 GLU A CB  1 
ATOM   861  C  CG  . GLU A 1 112 ? -12.627 51.955 32.229 1.00 41.70 ? 112 GLU A CG  1 
ATOM   862  C  CD  . GLU A 1 112 ? -14.117 51.731 32.399 1.00 46.22 ? 112 GLU A CD  1 
ATOM   863  O  OE1 . GLU A 1 112 ? -14.668 52.151 33.440 1.00 48.33 ? 112 GLU A OE1 1 
ATOM   864  O  OE2 . GLU A 1 112 ? -14.734 51.134 31.490 1.00 49.71 ? 112 GLU A OE2 1 
ATOM   865  N  N   . LEU A 1 113 ? -8.533  51.711 34.823 1.00 24.66 ? 113 LEU A N   1 
ATOM   866  C  CA  . LEU A 1 113 ? -7.707  51.303 35.955 1.00 22.38 ? 113 LEU A CA  1 
ATOM   867  C  C   . LEU A 1 113 ? -7.944  52.084 37.242 1.00 21.98 ? 113 LEU A C   1 
ATOM   868  O  O   . LEU A 1 113 ? -7.459  51.694 38.304 1.00 23.73 ? 113 LEU A O   1 
ATOM   869  C  CB  . LEU A 1 113 ? -6.228  51.420 35.573 1.00 22.05 ? 113 LEU A CB  1 
ATOM   870  C  CG  . LEU A 1 113 ? -5.795  50.614 34.349 1.00 22.84 ? 113 LEU A CG  1 
ATOM   871  C  CD1 . LEU A 1 113 ? -4.316  50.851 34.084 1.00 25.21 ? 113 LEU A CD1 1 
ATOM   872  C  CD2 . LEU A 1 113 ? -6.073  49.135 34.583 1.00 23.14 ? 113 LEU A CD2 1 
ATOM   873  N  N   . GLY A 1 114 ? -8.675  53.188 37.150 1.00 21.24 ? 114 GLY A N   1 
ATOM   874  C  CA  . GLY A 1 114 ? -8.926  53.994 38.329 1.00 20.31 ? 114 GLY A CA  1 
ATOM   875  C  C   . GLY A 1 114 ? -8.158  55.305 38.304 1.00 18.30 ? 114 GLY A C   1 
ATOM   876  O  O   . GLY A 1 114 ? -7.882  55.851 37.234 1.00 16.53 ? 114 GLY A O   1 
ATOM   877  N  N   . LEU A 1 115 ? -7.796  55.795 39.486 1.00 16.30 ? 115 LEU A N   1 
ATOM   878  C  CA  . LEU A 1 115 ? -7.083  57.061 39.631 1.00 16.82 ? 115 LEU A CA  1 
ATOM   879  C  C   . LEU A 1 115 ? -5.886  57.258 38.706 1.00 16.16 ? 115 LEU A C   1 
ATOM   880  O  O   . LEU A 1 115 ? -5.667  58.361 38.205 1.00 15.68 ? 115 LEU A O   1 
ATOM   881  C  CB  . LEU A 1 115 ? -6.620  57.235 41.079 1.00 16.54 ? 115 LEU A CB  1 
ATOM   882  C  CG  . LEU A 1 115 ? -5.991  58.588 41.433 1.00 18.41 ? 115 LEU A CG  1 
ATOM   883  C  CD1 . LEU A 1 115 ? -7.056  59.678 41.383 1.00 18.85 ? 115 LEU A CD1 1 
ATOM   884  C  CD2 . LEU A 1 115 ? -5.384  58.524 42.833 1.00 18.31 ? 115 LEU A CD2 1 
ATOM   885  N  N   . ILE A 1 116 ? -5.109  56.199 38.491 1.00 16.02 ? 116 ILE A N   1 
ATOM   886  C  CA  . ILE A 1 116 ? -3.918  56.275 37.643 1.00 15.69 ? 116 ILE A CA  1 
ATOM   887  C  C   . ILE A 1 116 ? -4.217  56.768 36.221 1.00 14.25 ? 116 ILE A C   1 
ATOM   888  O  O   . ILE A 1 116 ? -3.348  57.345 35.570 1.00 16.49 ? 116 ILE A O   1 
ATOM   889  C  CB  . ILE A 1 116 ? -3.193  54.892 37.569 1.00 14.99 ? 116 ILE A CB  1 
ATOM   890  C  CG1 . ILE A 1 116 ? -1.897  55.008 36.758 1.00 14.97 ? 116 ILE A CG1 1 
ATOM   891  C  CG2 . ILE A 1 116 ? -4.111  53.852 36.946 1.00 15.82 ? 116 ILE A CG2 1 
ATOM   892  C  CD1 . ILE A 1 116 ? -0.808  55.832 37.439 1.00 14.03 ? 116 ILE A CD1 1 
ATOM   893  N  N   . ASN A 1 117 ? -5.440  56.553 35.740 1.00 15.76 ? 117 ASN A N   1 
ATOM   894  C  CA  . ASN A 1 117 ? -5.803  56.993 34.390 1.00 16.57 ? 117 ASN A CA  1 
ATOM   895  C  C   . ASN A 1 117 ? -5.607  58.496 34.189 1.00 16.77 ? 117 ASN A C   1 
ATOM   896  O  O   . ASN A 1 117 ? -5.324  58.944 33.082 1.00 17.79 ? 117 ASN A O   1 
ATOM   897  C  CB  . ASN A 1 117 ? -7.250  56.614 34.069 1.00 18.56 ? 117 ASN A CB  1 
ATOM   898  C  CG  . ASN A 1 117 ? -7.411  55.131 33.757 1.00 23.44 ? 117 ASN A CG  1 
ATOM   899  O  OD1 . ASN A 1 117 ? -8.223  54.444 34.365 1.00 27.64 ? 117 ASN A OD1 1 
ATOM   900  N  ND2 . ASN A 1 117 ? -6.634  54.639 32.802 1.00 26.45 ? 117 ASN A ND2 1 
ATOM   901  N  N   . ASN A 1 118 ? -5.753  59.274 35.255 1.00 14.27 ? 118 ASN A N   1 
ATOM   902  C  CA  . ASN A 1 118 ? -5.575  60.722 35.152 1.00 15.43 ? 118 ASN A CA  1 
ATOM   903  C  C   . ASN A 1 118 ? -4.111  61.063 34.888 1.00 15.04 ? 118 ASN A C   1 
ATOM   904  O  O   . ASN A 1 118 ? -3.794  61.951 34.096 1.00 12.73 ? 118 ASN A O   1 
ATOM   905  C  CB  . ASN A 1 118 ? -6.043  61.401 36.442 1.00 15.55 ? 118 ASN A CB  1 
ATOM   906  C  CG  . ASN A 1 118 ? -7.529  61.203 36.690 1.00 18.65 ? 118 ASN A CG  1 
ATOM   907  O  OD1 . ASN A 1 118 ? -8.367  61.673 35.918 1.00 18.97 ? 118 ASN A OD1 1 
ATOM   908  N  ND2 . ASN A 1 118 ? -7.860  60.501 37.767 1.00 15.79 ? 118 ASN A ND2 1 
ATOM   909  N  N   . TRP A 1 119 ? -3.223  60.353 35.574 1.00 15.28 ? 119 TRP A N   1 
ATOM   910  C  CA  . TRP A 1 119 ? -1.787  60.544 35.420 1.00 15.37 ? 119 TRP A CA  1 
ATOM   911  C  C   . TRP A 1 119 ? -1.389  60.163 33.993 1.00 16.68 ? 119 TRP A C   1 
ATOM   912  O  O   . TRP A 1 119 ? -0.617  60.866 33.341 1.00 15.95 ? 119 TRP A O   1 
ATOM   913  C  CB  . TRP A 1 119 ? -1.054  59.661 36.437 1.00 14.81 ? 119 TRP A CB  1 
ATOM   914  C  CG  . TRP A 1 119 ? 0.446   59.752 36.427 1.00 15.56 ? 119 TRP A CG  1 
ATOM   915  C  CD1 . TRP A 1 119 ? 1.319   58.950 35.739 1.00 16.83 ? 119 TRP A CD1 1 
ATOM   916  C  CD2 . TRP A 1 119 ? 1.250   60.675 37.169 1.00 15.35 ? 119 TRP A CD2 1 
ATOM   917  N  NE1 . TRP A 1 119 ? 2.619   59.317 36.016 1.00 15.83 ? 119 TRP A NE1 1 
ATOM   918  C  CE2 . TRP A 1 119 ? 2.604   60.374 36.888 1.00 15.25 ? 119 TRP A CE2 1 
ATOM   919  C  CE3 . TRP A 1 119 ? 0.960   61.728 38.047 1.00 15.57 ? 119 TRP A CE3 1 
ATOM   920  C  CZ2 . TRP A 1 119 ? 3.663   61.092 37.453 1.00 15.90 ? 119 TRP A CZ2 1 
ATOM   921  C  CZ3 . TRP A 1 119 ? 2.022   62.443 38.610 1.00 15.58 ? 119 TRP A CZ3 1 
ATOM   922  C  CH2 . TRP A 1 119 ? 3.353   62.118 38.307 1.00 13.94 ? 119 TRP A CH2 1 
ATOM   923  N  N   . LEU A 1 120 ? -1.943  59.055 33.508 1.00 16.45 ? 120 LEU A N   1 
ATOM   924  C  CA  . LEU A 1 120 ? -1.636  58.556 32.171 1.00 17.18 ? 120 LEU A CA  1 
ATOM   925  C  C   . LEU A 1 120 ? -2.125  59.407 30.998 1.00 16.44 ? 120 LEU A C   1 
ATOM   926  O  O   . LEU A 1 120 ? -1.663  59.224 29.874 1.00 14.69 ? 120 LEU A O   1 
ATOM   927  C  CB  . LEU A 1 120 ? -2.172  57.130 32.014 1.00 19.51 ? 120 LEU A CB  1 
ATOM   928  C  CG  . LEU A 1 120 ? -1.565  56.102 32.969 1.00 20.61 ? 120 LEU A CG  1 
ATOM   929  C  CD1 . LEU A 1 120 ? -2.191  54.740 32.705 1.00 22.92 ? 120 LEU A CD1 1 
ATOM   930  C  CD2 . LEU A 1 120 ? -0.059  56.044 32.777 1.00 20.10 ? 120 LEU A CD2 1 
ATOM   931  N  N   . LEU A 1 121 ? -3.056  60.326 31.242 1.00 14.05 ? 121 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 121 ? -3.555  61.176 30.157 1.00 14.88 ? 121 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 121 ? -2.436  62.048 29.590 1.00 16.59 ? 121 LEU A C   1 
ATOM   934  O  O   . LEU A 1 121 ? -2.510  62.495 28.446 1.00 17.20 ? 121 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 121 ? -4.707  62.067 30.645 1.00 15.07 ? 121 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 121 ? -6.045  61.363 30.902 1.00 18.02 ? 121 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 121 ? -7.031  62.333 31.538 1.00 17.89 ? 121 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 121 ? -6.600  60.828 29.585 1.00 18.68 ? 121 LEU A CD2 1 
ATOM   939  N  N   . HIS A 1 122 ? -1.403  62.298 30.391 1.00 15.55 ? 122 HIS A N   1 
ATOM   940  C  CA  . HIS A 1 122 ? -0.278  63.108 29.928 1.00 15.81 ? 122 HIS A CA  1 
ATOM   941  C  C   . HIS A 1 122 ? 0.448   62.368 28.809 1.00 16.92 ? 122 HIS A C   1 
ATOM   942  O  O   . HIS A 1 122 ? 1.019   62.981 27.904 1.00 17.36 ? 122 HIS A O   1 
ATOM   943  C  CB  . HIS A 1 122 ? 0.679   63.391 31.084 1.00 16.30 ? 122 HIS A CB  1 
ATOM   944  C  CG  . HIS A 1 122 ? 0.170   64.423 32.044 1.00 15.43 ? 122 HIS A CG  1 
ATOM   945  N  ND1 . HIS A 1 122 ? 0.059   65.756 31.712 1.00 14.54 ? 122 HIS A ND1 1 
ATOM   946  C  CD2 . HIS A 1 122 ? -0.259  64.316 33.324 1.00 15.58 ? 122 HIS A CD2 1 
ATOM   947  C  CE1 . HIS A 1 122 ? -0.415  66.427 32.748 1.00 15.28 ? 122 HIS A CE1 1 
ATOM   948  N  NE2 . HIS A 1 122 ? -0.617  65.577 33.739 1.00 15.02 ? 122 HIS A NE2 1 
ATOM   949  N  N   . ILE A 1 123 ? 0.417   61.042 28.870 1.00 16.10 ? 123 ILE A N   1 
ATOM   950  C  CA  . ILE A 1 123 ? 1.057   60.228 27.849 1.00 17.46 ? 123 ILE A CA  1 
ATOM   951  C  C   . ILE A 1 123 ? 0.179   60.200 26.600 1.00 17.64 ? 123 ILE A C   1 
ATOM   952  O  O   . ILE A 1 123 ? 0.685   60.236 25.482 1.00 18.10 ? 123 ILE A O   1 
ATOM   953  C  CB  . ILE A 1 123 ? 1.311   58.795 28.367 1.00 17.23 ? 123 ILE A CB  1 
ATOM   954  C  CG1 . ILE A 1 123 ? 2.303   58.847 29.533 1.00 19.57 ? 123 ILE A CG1 1 
ATOM   955  C  CG2 . ILE A 1 123 ? 1.857   57.925 27.255 1.00 16.50 ? 123 ILE A CG2 1 
ATOM   956  C  CD1 . ILE A 1 123 ? 2.470   57.538 30.265 1.00 20.90 ? 123 ILE A CD1 1 
ATOM   957  N  N   . ARG A 1 124 ? -1.138  60.142 26.785 1.00 18.33 ? 124 ARG A N   1 
ATOM   958  C  CA  . ARG A 1 124 ? -2.038  60.141 25.639 1.00 20.23 ? 124 ARG A CA  1 
ATOM   959  C  C   . ARG A 1 124 ? -1.881  61.457 24.876 1.00 20.59 ? 124 ARG A C   1 
ATOM   960  O  O   . ARG A 1 124 ? -2.002  61.485 23.649 1.00 21.48 ? 124 ARG A O   1 
ATOM   961  C  CB  . ARG A 1 124 ? -3.489  59.943 26.087 1.00 21.38 ? 124 ARG A CB  1 
ATOM   962  C  CG  . ARG A 1 124 ? -3.769  58.532 26.601 1.00 27.09 ? 124 ARG A CG  1 
ATOM   963  C  CD  . ARG A 1 124 ? -5.192  58.372 27.117 1.00 29.92 ? 124 ARG A CD  1 
ATOM   964  N  NE  . ARG A 1 124 ? -6.199  58.503 26.066 1.00 35.80 ? 124 ARG A NE  1 
ATOM   965  C  CZ  . ARG A 1 124 ? -6.447  57.579 25.141 1.00 36.90 ? 124 ARG A CZ  1 
ATOM   966  N  NH1 . ARG A 1 124 ? -5.762  56.445 25.127 1.00 36.67 ? 124 ARG A NH1 1 
ATOM   967  N  NH2 . ARG A 1 124 ? -7.390  57.788 24.233 1.00 39.30 ? 124 ARG A NH2 1 
ATOM   968  N  N   . ASP A 1 125 ? -1.612  62.548 25.592 1.00 18.73 ? 125 ASP A N   1 
ATOM   969  C  CA  . ASP A 1 125 ? -1.406  63.834 24.926 1.00 19.42 ? 125 ASP A CA  1 
ATOM   970  C  C   . ASP A 1 125 ? -0.215  63.724 23.971 1.00 19.50 ? 125 ASP A C   1 
ATOM   971  O  O   . ASP A 1 125 ? -0.221  64.290 22.879 1.00 19.61 ? 125 ASP A O   1 
ATOM   972  C  CB  . ASP A 1 125 ? -1.119  64.949 25.940 1.00 20.92 ? 125 ASP A CB  1 
ATOM   973  C  CG  . ASP A 1 125 ? -2.346  65.346 26.748 1.00 23.27 ? 125 ASP A CG  1 
ATOM   974  O  OD1 . ASP A 1 125 ? -3.477  65.153 26.257 1.00 21.94 ? 125 ASP A OD1 1 
ATOM   975  O  OD2 . ASP A 1 125 ? -2.172  65.868 27.866 1.00 22.96 ? 125 ASP A OD2 1 
ATOM   976  N  N   . ILE A 1 126 ? 0.810   62.991 24.398 1.00 19.21 ? 126 ILE A N   1 
ATOM   977  C  CA  . ILE A 1 126 ? 2.017   62.801 23.596 1.00 21.20 ? 126 ILE A CA  1 
ATOM   978  C  C   . ILE A 1 126 ? 1.716   61.947 22.370 1.00 21.16 ? 126 ILE A C   1 
ATOM   979  O  O   . ILE A 1 126 ? 2.208   62.215 21.272 1.00 20.88 ? 126 ILE A O   1 
ATOM   980  C  CB  . ILE A 1 126 ? 3.128   62.121 24.430 1.00 21.63 ? 126 ILE A CB  1 
ATOM   981  C  CG1 . ILE A 1 126 ? 3.556   63.050 25.570 1.00 23.09 ? 126 ILE A CG1 1 
ATOM   982  C  CG2 . ILE A 1 126 ? 4.316   61.779 23.550 1.00 21.86 ? 126 ILE A CG2 1 
ATOM   983  C  CD1 . ILE A 1 126 ? 4.524   62.411 26.545 1.00 25.98 ? 126 ILE A CD1 1 
ATOM   984  N  N   . TRP A 1 127 ? 0.900   60.919 22.576 1.00 22.59 ? 127 TRP A N   1 
ATOM   985  C  CA  . TRP A 1 127 ? 0.505   60.009 21.513 1.00 25.55 ? 127 TRP A CA  1 
ATOM   986  C  C   . TRP A 1 127 ? -0.255  60.772 20.424 1.00 26.27 ? 127 TRP A C   1 
ATOM   987  O  O   . TRP A 1 127 ? -0.046  60.542 19.232 1.00 26.30 ? 127 TRP A O   1 
ATOM   988  C  CB  . TRP A 1 127 ? -0.352  58.891 22.113 1.00 29.38 ? 127 TRP A CB  1 
ATOM   989  C  CG  . TRP A 1 127 ? -0.837  57.884 21.138 1.00 34.66 ? 127 TRP A CG  1 
ATOM   990  C  CD1 . TRP A 1 127 ? -0.119  57.295 20.142 1.00 37.89 ? 127 TRP A CD1 1 
ATOM   991  C  CD2 . TRP A 1 127 ? -2.144  57.307 21.089 1.00 38.19 ? 127 TRP A CD2 1 
ATOM   992  N  NE1 . TRP A 1 127 ? -0.898  56.383 19.471 1.00 40.11 ? 127 TRP A NE1 1 
ATOM   993  C  CE2 . TRP A 1 127 ? -2.147  56.370 20.032 1.00 39.80 ? 127 TRP A CE2 1 
ATOM   994  C  CE3 . TRP A 1 127 ? -3.315  57.489 21.836 1.00 39.90 ? 127 TRP A CE3 1 
ATOM   995  C  CZ2 . TRP A 1 127 ? -3.278  55.615 19.701 1.00 41.97 ? 127 TRP A CZ2 1 
ATOM   996  C  CZ3 . TRP A 1 127 ? -4.443  56.737 21.508 1.00 43.17 ? 127 TRP A CZ3 1 
ATOM   997  C  CH2 . TRP A 1 127 ? -4.414  55.811 20.448 1.00 42.81 ? 127 TRP A CH2 1 
ATOM   998  N  N   . PHE A 1 128 ? -1.126  61.691 20.832 1.00 25.86 ? 128 PHE A N   1 
ATOM   999  C  CA  . PHE A 1 128 ? -1.885  62.489 19.874 1.00 27.60 ? 128 PHE A CA  1 
ATOM   1000 C  C   . PHE A 1 128 ? -0.938  63.423 19.128 1.00 27.16 ? 128 PHE A C   1 
ATOM   1001 O  O   . PHE A 1 128 ? -1.011  63.570 17.906 1.00 26.66 ? 128 PHE A O   1 
ATOM   1002 C  CB  . PHE A 1 128 ? -2.943  63.339 20.583 1.00 30.91 ? 128 PHE A CB  1 
ATOM   1003 C  CG  . PHE A 1 128 ? -3.942  62.544 21.378 1.00 36.36 ? 128 PHE A CG  1 
ATOM   1004 C  CD1 . PHE A 1 128 ? -4.140  61.188 21.130 1.00 36.91 ? 128 PHE A CD1 1 
ATOM   1005 C  CD2 . PHE A 1 128 ? -4.717  63.166 22.354 1.00 38.50 ? 128 PHE A CD2 1 
ATOM   1006 C  CE1 . PHE A 1 128 ? -5.096  60.465 21.840 1.00 39.23 ? 128 PHE A CE1 1 
ATOM   1007 C  CE2 . PHE A 1 128 ? -5.678  62.452 23.070 1.00 39.23 ? 128 PHE A CE2 1 
ATOM   1008 C  CZ  . PHE A 1 128 ? -5.867  61.100 22.812 1.00 40.07 ? 128 PHE A CZ  1 
ATOM   1009 N  N   . LYS A 1 129 ? -0.050  64.052 19.887 1.00 24.44 ? 129 LYS A N   1 
ATOM   1010 C  CA  . LYS A 1 129 ? 0.921   64.992 19.348 1.00 25.61 ? 129 LYS A CA  1 
ATOM   1011 C  C   . LYS A 1 129 ? 1.748   64.423 18.193 1.00 25.60 ? 129 LYS A C   1 
ATOM   1012 O  O   . LYS A 1 129 ? 1.983   65.103 17.192 1.00 26.11 ? 129 LYS A O   1 
ATOM   1013 C  CB  . LYS A 1 129 ? 1.848   65.461 20.476 1.00 23.11 ? 129 LYS A CB  1 
ATOM   1014 C  CG  . LYS A 1 129 ? 2.918   66.452 20.060 1.00 23.86 ? 129 LYS A CG  1 
ATOM   1015 C  CD  . LYS A 1 129 ? 3.695   66.963 21.273 1.00 22.89 ? 129 LYS A CD  1 
ATOM   1016 C  CE  . LYS A 1 129 ? 4.824   67.896 20.855 1.00 25.70 ? 129 LYS A CE  1 
ATOM   1017 N  NZ  . LYS A 1 129 ? 5.503   68.520 22.025 1.00 25.25 ? 129 LYS A NZ  1 
ATOM   1018 N  N   . HIS A 1 130 ? 2.184   63.176 18.325 1.00 24.31 ? 130 HIS A N   1 
ATOM   1019 C  CA  . HIS A 1 130 ? 3.001   62.560 17.286 1.00 23.92 ? 130 HIS A CA  1 
ATOM   1020 C  C   . HIS A 1 130 ? 2.253   61.527 16.452 1.00 25.35 ? 130 HIS A C   1 
ATOM   1021 O  O   . HIS A 1 130 ? 2.850   60.575 15.944 1.00 24.47 ? 130 HIS A O   1 
ATOM   1022 C  CB  . HIS A 1 130 ? 4.232   61.929 17.932 1.00 23.88 ? 130 HIS A CB  1 
ATOM   1023 C  CG  . HIS A 1 130 ? 5.094   62.918 18.652 1.00 23.73 ? 130 HIS A CG  1 
ATOM   1024 N  ND1 . HIS A 1 130 ? 5.893   63.826 17.992 1.00 23.15 ? 130 HIS A ND1 1 
ATOM   1025 C  CD2 . HIS A 1 130 ? 5.252   63.168 19.974 1.00 21.02 ? 130 HIS A CD2 1 
ATOM   1026 C  CE1 . HIS A 1 130 ? 6.509   64.592 18.875 1.00 24.00 ? 130 HIS A CE1 1 
ATOM   1027 N  NE2 . HIS A 1 130 ? 6.137   64.214 20.085 1.00 22.70 ? 130 HIS A NE2 1 
ATOM   1028 N  N   . SER A 1 131 ? 0.947   61.725 16.303 1.00 25.92 ? 131 SER A N   1 
ATOM   1029 C  CA  . SER A 1 131 ? 0.112   60.807 15.532 1.00 28.92 ? 131 SER A CA  1 
ATOM   1030 C  C   . SER A 1 131 ? 0.635   60.540 14.124 1.00 28.07 ? 131 SER A C   1 
ATOM   1031 O  O   . SER A 1 131 ? 0.801   59.387 13.733 1.00 27.55 ? 131 SER A O   1 
ATOM   1032 C  CB  . SER A 1 131 ? -1.319  61.340 15.443 1.00 28.50 ? 131 SER A CB  1 
ATOM   1033 O  OG  . SER A 1 131 ? -1.985  61.186 16.680 1.00 38.64 ? 131 SER A OG  1 
ATOM   1034 N  N   . SER A 1 132 ? 0.889   61.602 13.366 1.00 28.11 ? 132 SER A N   1 
ATOM   1035 C  CA  . SER A 1 132 ? 1.383   61.459 11.999 1.00 31.36 ? 132 SER A CA  1 
ATOM   1036 C  C   . SER A 1 132 ? 2.689   60.676 11.939 1.00 30.74 ? 132 SER A C   1 
ATOM   1037 O  O   . SER A 1 132 ? 2.843   59.761 11.125 1.00 31.14 ? 132 SER A O   1 
ATOM   1038 C  CB  . SER A 1 132 ? 1.582   62.834 11.360 1.00 32.14 ? 132 SER A CB  1 
ATOM   1039 O  OG  . SER A 1 132 ? 0.345   63.516 11.258 1.00 38.80 ? 132 SER A OG  1 
ATOM   1040 N  N   . LEU A 1 133 ? 3.629   61.039 12.803 1.00 29.29 ? 133 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 133 ? 4.922   60.369 12.850 1.00 29.26 ? 133 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 133 ? 4.762   58.868 13.099 1.00 29.61 ? 133 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 133 ? 5.379   58.049 12.416 1.00 30.85 ? 133 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 133 ? 5.795   61.010 13.940 1.00 29.97 ? 133 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 133 ? 7.198   60.466 14.215 1.00 30.84 ? 133 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 133 ? 8.020   61.519 14.940 1.00 32.53 ? 133 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 133 ? 7.112   59.198 15.048 1.00 33.68 ? 133 LEU A CD2 1 
ATOM   1048 N  N   . LEU A 1 134 ? 3.928   58.505 14.069 1.00 27.84 ? 134 LEU A N   1 
ATOM   1049 C  CA  . LEU A 1 134 ? 3.715   57.100 14.395 1.00 28.32 ? 134 LEU A CA  1 
ATOM   1050 C  C   . LEU A 1 134 ? 3.043   56.316 13.268 1.00 29.37 ? 134 LEU A C   1 
ATOM   1051 O  O   . LEU A 1 134 ? 3.372   55.154 13.032 1.00 27.86 ? 134 LEU A O   1 
ATOM   1052 C  CB  . LEU A 1 134 ? 2.886   56.976 15.676 1.00 27.24 ? 134 LEU A CB  1 
ATOM   1053 C  CG  . LEU A 1 134 ? 3.587   57.419 16.964 1.00 29.17 ? 134 LEU A CG  1 
ATOM   1054 C  CD1 . LEU A 1 134 ? 2.609   57.402 18.125 1.00 30.00 ? 134 LEU A CD1 1 
ATOM   1055 C  CD2 . LEU A 1 134 ? 4.767   56.496 17.241 1.00 28.32 ? 134 LEU A CD2 1 
ATOM   1056 N  N   . GLY A 1 135 ? 2.106   56.949 12.572 1.00 30.39 ? 135 GLY A N   1 
ATOM   1057 C  CA  . GLY A 1 135 ? 1.417   56.263 11.493 1.00 36.31 ? 135 GLY A CA  1 
ATOM   1058 C  C   . GLY A 1 135 ? 2.301   56.067 10.278 1.00 39.81 ? 135 GLY A C   1 
ATOM   1059 O  O   . GLY A 1 135 ? 1.905   55.434 9.300  1.00 41.42 ? 135 GLY A O   1 
ATOM   1060 N  N   . GLU A 1 136 ? 3.511   56.606 10.349 1.00 42.20 ? 136 GLU A N   1 
ATOM   1061 C  CA  . GLU A 1 136 ? 4.460   56.518 9.253  1.00 45.06 ? 136 GLU A CA  1 
ATOM   1062 C  C   . GLU A 1 136 ? 5.436   55.367 9.468  1.00 45.78 ? 136 GLU A C   1 
ATOM   1063 O  O   . GLU A 1 136 ? 6.372   55.179 8.693  1.00 47.83 ? 136 GLU A O   1 
ATOM   1064 C  CB  . GLU A 1 136 ? 5.215   57.842 9.148  1.00 47.66 ? 136 GLU A CB  1 
ATOM   1065 C  CG  . GLU A 1 136 ? 5.953   58.073 7.848  1.00 51.69 ? 136 GLU A CG  1 
ATOM   1066 C  CD  . GLU A 1 136 ? 6.515   59.480 7.764  1.00 53.79 ? 136 GLU A CD  1 
ATOM   1067 O  OE1 . GLU A 1 136 ? 5.717   60.440 7.846  1.00 54.45 ? 136 GLU A OE1 1 
ATOM   1068 O  OE2 . GLU A 1 136 ? 7.749   59.625 7.621  1.00 54.27 ? 136 GLU A OE2 1 
ATOM   1069 N  N   . MET A 1 137 ? 5.211   54.591 10.521 1.00 45.62 ? 137 MET A N   1 
ATOM   1070 C  CA  . MET A 1 137 ? 6.082   53.465 10.831 1.00 45.10 ? 137 MET A CA  1 
ATOM   1071 C  C   . MET A 1 137 ? 5.325   52.160 11.016 1.00 43.06 ? 137 MET A C   1 
ATOM   1072 O  O   . MET A 1 137 ? 4.126   52.161 11.293 1.00 41.56 ? 137 MET A O   1 
ATOM   1073 C  CB  . MET A 1 137 ? 6.889   53.767 12.090 1.00 48.12 ? 137 MET A CB  1 
ATOM   1074 C  CG  . MET A 1 137 ? 8.058   54.698 11.844 1.00 52.60 ? 137 MET A CG  1 
ATOM   1075 S  SD  . MET A 1 137 ? 8.890   55.164 13.361 1.00 55.32 ? 137 MET A SD  1 
ATOM   1076 C  CE  . MET A 1 137 ? 8.729   56.940 13.286 1.00 55.39 ? 137 MET A CE  1 
ATOM   1077 N  N   . PRO A 1 138 ? 6.023   51.023 10.867 1.00 41.61 ? 138 PRO A N   1 
ATOM   1078 C  CA  . PRO A 1 138 ? 5.377   49.719 11.031 1.00 40.30 ? 138 PRO A CA  1 
ATOM   1079 C  C   . PRO A 1 138 ? 4.697   49.620 12.388 1.00 39.06 ? 138 PRO A C   1 
ATOM   1080 O  O   . PRO A 1 138 ? 5.231   50.086 13.397 1.00 36.63 ? 138 PRO A O   1 
ATOM   1081 C  CB  . PRO A 1 138 ? 6.534   48.731 10.868 1.00 41.00 ? 138 PRO A CB  1 
ATOM   1082 C  CG  . PRO A 1 138 ? 7.735   49.529 11.303 1.00 41.50 ? 138 PRO A CG  1 
ATOM   1083 C  CD  . PRO A 1 138 ? 7.473   50.864 10.657 1.00 42.08 ? 138 PRO A CD  1 
ATOM   1084 N  N   . GLN A 1 139 ? 3.517   49.007 12.393 1.00 37.16 ? 139 GLN A N   1 
ATOM   1085 C  CA  . GLN A 1 139 ? 2.705   48.843 13.593 1.00 36.50 ? 139 GLN A CA  1 
ATOM   1086 C  C   . GLN A 1 139 ? 3.432   48.222 14.786 1.00 36.16 ? 139 GLN A C   1 
ATOM   1087 O  O   . GLN A 1 139 ? 3.317   48.710 15.910 1.00 34.00 ? 139 GLN A O   1 
ATOM   1088 C  CB  . GLN A 1 139 ? 1.465   48.010 13.243 1.00 36.09 ? 139 GLN A CB  1 
ATOM   1089 C  CG  . GLN A 1 139 ? 0.397   47.930 14.326 1.00 35.58 ? 139 GLN A CG  1 
ATOM   1090 C  CD  . GLN A 1 139 ? 0.772   47.013 15.472 1.00 35.48 ? 139 GLN A CD  1 
ATOM   1091 O  OE1 . GLN A 1 139 ? 1.310   45.926 15.262 1.00 32.98 ? 139 GLN A OE1 1 
ATOM   1092 N  NE2 . GLN A 1 139 ? 0.468   47.438 16.694 1.00 36.79 ? 139 GLN A NE2 1 
ATOM   1093 N  N   . GLU A 1 140 ? 4.182   47.153 14.542 1.00 36.54 ? 140 GLU A N   1 
ATOM   1094 C  CA  . GLU A 1 140 ? 4.895   46.466 15.614 1.00 38.06 ? 140 GLU A CA  1 
ATOM   1095 C  C   . GLU A 1 140 ? 5.916   47.340 16.341 1.00 36.62 ? 140 GLU A C   1 
ATOM   1096 O  O   . GLU A 1 140 ? 6.344   47.009 17.445 1.00 36.31 ? 140 GLU A O   1 
ATOM   1097 C  CB  . GLU A 1 140 ? 5.589   45.213 15.064 1.00 42.63 ? 140 GLU A CB  1 
ATOM   1098 C  CG  . GLU A 1 140 ? 6.282   44.367 16.132 1.00 49.05 ? 140 GLU A CG  1 
ATOM   1099 C  CD  . GLU A 1 140 ? 6.946   43.122 15.563 1.00 53.35 ? 140 GLU A CD  1 
ATOM   1100 O  OE1 . GLU A 1 140 ? 6.229   42.273 14.988 1.00 56.07 ? 140 GLU A OE1 1 
ATOM   1101 O  OE2 . GLU A 1 140 ? 8.184   42.991 15.691 1.00 54.51 ? 140 GLU A OE2 1 
ATOM   1102 N  N   . ARG A 1 141 ? 6.296   48.458 15.732 1.00 35.62 ? 141 ARG A N   1 
ATOM   1103 C  CA  . ARG A 1 141 ? 7.276   49.351 16.341 1.00 36.51 ? 141 ARG A CA  1 
ATOM   1104 C  C   . ARG A 1 141 ? 6.702   50.624 16.960 1.00 33.59 ? 141 ARG A C   1 
ATOM   1105 O  O   . ARG A 1 141 ? 7.436   51.407 17.559 1.00 31.73 ? 141 ARG A O   1 
ATOM   1106 C  CB  . ARG A 1 141 ? 8.331   49.741 15.309 1.00 40.93 ? 141 ARG A CB  1 
ATOM   1107 C  CG  . ARG A 1 141 ? 9.174   48.582 14.823 1.00 47.84 ? 141 ARG A CG  1 
ATOM   1108 C  CD  . ARG A 1 141 ? 10.330  49.090 13.993 1.00 52.83 ? 141 ARG A CD  1 
ATOM   1109 N  NE  . ARG A 1 141 ? 11.307  48.045 13.719 1.00 57.68 ? 141 ARG A NE  1 
ATOM   1110 C  CZ  . ARG A 1 141 ? 12.522  48.277 13.236 1.00 60.43 ? 141 ARG A CZ  1 
ATOM   1111 N  NH1 . ARG A 1 141 ? 12.903  49.523 12.973 1.00 61.18 ? 141 ARG A NH1 1 
ATOM   1112 N  NH2 . ARG A 1 141 ? 13.360  47.268 13.028 1.00 61.10 ? 141 ARG A NH2 1 
ATOM   1113 N  N   . ARG A 1 142 ? 5.397   50.826 16.832 1.00 30.93 ? 142 ARG A N   1 
ATOM   1114 C  CA  . ARG A 1 142 ? 4.770   52.030 17.362 1.00 29.33 ? 142 ARG A CA  1 
ATOM   1115 C  C   . ARG A 1 142 ? 4.805   52.194 18.879 1.00 28.17 ? 142 ARG A C   1 
ATOM   1116 O  O   . ARG A 1 142 ? 5.061   53.294 19.370 1.00 29.57 ? 142 ARG A O   1 
ATOM   1117 C  CB  . ARG A 1 142 ? 3.333   52.131 16.840 1.00 30.01 ? 142 ARG A CB  1 
ATOM   1118 C  CG  . ARG A 1 142 ? 3.293   52.377 15.341 1.00 29.71 ? 142 ARG A CG  1 
ATOM   1119 C  CD  . ARG A 1 142 ? 1.897   52.266 14.760 1.00 30.61 ? 142 ARG A CD  1 
ATOM   1120 N  NE  . ARG A 1 142 ? 1.932   52.448 13.311 1.00 30.85 ? 142 ARG A NE  1 
ATOM   1121 C  CZ  . ARG A 1 142 ? 0.887   52.288 12.506 1.00 31.34 ? 142 ARG A CZ  1 
ATOM   1122 N  NH1 . ARG A 1 142 ? -0.294  51.939 13.005 1.00 28.63 ? 142 ARG A NH1 1 
ATOM   1123 N  NH2 . ARG A 1 142 ? 1.025   52.476 11.200 1.00 30.36 ? 142 ARG A NH2 1 
ATOM   1124 N  N   . LEU A 1 143 ? 4.562   51.122 19.627 1.00 26.42 ? 143 LEU A N   1 
ATOM   1125 C  CA  . LEU A 1 143 ? 4.579   51.225 21.083 1.00 25.63 ? 143 LEU A CA  1 
ATOM   1126 C  C   . LEU A 1 143 ? 5.989   51.534 21.598 1.00 24.37 ? 143 LEU A C   1 
ATOM   1127 O  O   . LEU A 1 143 ? 6.162   52.347 22.509 1.00 22.19 ? 143 LEU A O   1 
ATOM   1128 C  CB  . LEU A 1 143 ? 4.053   49.935 21.717 1.00 27.61 ? 143 LEU A CB  1 
ATOM   1129 C  CG  . LEU A 1 143 ? 3.617   50.029 23.187 1.00 30.77 ? 143 LEU A CG  1 
ATOM   1130 C  CD1 . LEU A 1 143 ? 2.609   51.161 23.368 1.00 29.58 ? 143 LEU A CD1 1 
ATOM   1131 C  CD2 . LEU A 1 143 ? 2.998   48.707 23.619 1.00 31.43 ? 143 LEU A CD2 1 
ATOM   1132 N  N   . ASP A 1 144 ? 6.995   50.888 21.018 1.00 21.97 ? 144 ASP A N   1 
ATOM   1133 C  CA  . ASP A 1 144 ? 8.372   51.136 21.429 1.00 22.69 ? 144 ASP A CA  1 
ATOM   1134 C  C   . ASP A 1 144 ? 8.764   52.566 21.075 1.00 22.18 ? 144 ASP A C   1 
ATOM   1135 O  O   . ASP A 1 144 ? 9.497   53.218 21.814 1.00 22.84 ? 144 ASP A O   1 
ATOM   1136 C  CB  . ASP A 1 144 ? 9.326   50.151 20.750 1.00 23.54 ? 144 ASP A CB  1 
ATOM   1137 C  CG  . ASP A 1 144 ? 9.389   48.815 21.466 1.00 26.11 ? 144 ASP A CG  1 
ATOM   1138 O  OD1 . ASP A 1 144 ? 10.182  47.949 21.044 1.00 30.08 ? 144 ASP A OD1 1 
ATOM   1139 O  OD2 . ASP A 1 144 ? 8.650   48.627 22.455 1.00 28.41 ? 144 ASP A OD2 1 
ATOM   1140 N  N   . THR A 1 145 ? 8.270   53.052 19.942 1.00 21.52 ? 145 THR A N   1 
ATOM   1141 C  CA  . THR A 1 145 ? 8.573   54.409 19.515 1.00 20.67 ? 145 THR A CA  1 
ATOM   1142 C  C   . THR A 1 145 ? 7.930   55.415 20.464 1.00 19.99 ? 145 THR A C   1 
ATOM   1143 O  O   . THR A 1 145 ? 8.521   56.447 20.773 1.00 20.35 ? 145 THR A O   1 
ATOM   1144 C  CB  . THR A 1 145 ? 8.063   54.672 18.090 1.00 23.09 ? 145 THR A CB  1 
ATOM   1145 O  OG1 . THR A 1 145 ? 8.699   53.759 17.183 1.00 24.03 ? 145 THR A OG1 1 
ATOM   1146 C  CG2 . THR A 1 145 ? 8.377   56.104 17.671 1.00 21.41 ? 145 THR A CG2 1 
ATOM   1147 N  N   . LEU A 1 146 ? 6.717   55.117 20.925 1.00 18.71 ? 146 LEU A N   1 
ATOM   1148 C  CA  . LEU A 1 146 ? 6.027   56.012 21.846 1.00 19.68 ? 146 LEU A CA  1 
ATOM   1149 C  C   . LEU A 1 146 ? 6.845   56.091 23.124 1.00 19.51 ? 146 LEU A C   1 
ATOM   1150 O  O   . LEU A 1 146 ? 6.979   57.155 23.733 1.00 19.19 ? 146 LEU A O   1 
ATOM   1151 C  CB  . LEU A 1 146 ? 4.618   55.493 22.163 1.00 21.17 ? 146 LEU A CB  1 
ATOM   1152 C  CG  . LEU A 1 146 ? 3.837   56.350 23.171 1.00 24.25 ? 146 LEU A CG  1 
ATOM   1153 C  CD1 . LEU A 1 146 ? 3.746   57.792 22.672 1.00 25.82 ? 146 LEU A CD1 1 
ATOM   1154 C  CD2 . LEU A 1 146 ? 2.446   55.764 23.372 1.00 23.13 ? 146 LEU A CD2 1 
ATOM   1155 N  N   . CYS A 1 147 ? 7.396   54.952 23.524 1.00 19.26 ? 147 CYS A N   1 
ATOM   1156 C  CA  . CYS A 1 147 ? 8.222   54.895 24.718 1.00 20.10 ? 147 CYS A CA  1 
ATOM   1157 C  C   . CYS A 1 147 ? 9.390   55.869 24.587 1.00 19.28 ? 147 CYS A C   1 
ATOM   1158 O  O   . CYS A 1 147 ? 9.757   56.538 25.554 1.00 17.00 ? 147 CYS A O   1 
ATOM   1159 C  CB  . CYS A 1 147 ? 8.757   53.483 24.924 1.00 23.28 ? 147 CYS A CB  1 
ATOM   1160 S  SG  . CYS A 1 147 ? 9.862   53.352 26.327 1.00 33.76 ? 147 CYS A SG  1 
ATOM   1161 N  N   . GLU A 1 148 ? 9.975   55.945 23.393 1.00 17.54 ? 148 GLU A N   1 
ATOM   1162 C  CA  . GLU A 1 148 ? 11.100  56.850 23.160 1.00 16.79 ? 148 GLU A CA  1 
ATOM   1163 C  C   . GLU A 1 148 ? 10.615  58.298 23.095 1.00 17.14 ? 148 GLU A C   1 
ATOM   1164 O  O   . GLU A 1 148 ? 11.242  59.199 23.653 1.00 16.84 ? 148 GLU A O   1 
ATOM   1165 C  CB  . GLU A 1 148 ? 11.827  56.477 21.862 1.00 20.02 ? 148 GLU A CB  1 
ATOM   1166 C  CG  . GLU A 1 148 ? 12.332  55.039 21.837 1.00 22.07 ? 148 GLU A CG  1 
ATOM   1167 C  CD  . GLU A 1 148 ? 13.049  54.677 20.546 1.00 26.46 ? 148 GLU A CD  1 
ATOM   1168 O  OE1 . GLU A 1 148 ? 12.727  55.271 19.498 1.00 28.09 ? 148 GLU A OE1 1 
ATOM   1169 O  OE2 . GLU A 1 148 ? 13.925  53.786 20.580 1.00 25.81 ? 148 GLU A OE2 1 
ATOM   1170 N  N   . LEU A 1 149 ? 9.502   58.522 22.406 1.00 16.07 ? 149 LEU A N   1 
ATOM   1171 C  CA  . LEU A 1 149 ? 8.947   59.864 22.301 1.00 16.40 ? 149 LEU A CA  1 
ATOM   1172 C  C   . LEU A 1 149 ? 8.619   60.414 23.687 1.00 16.96 ? 149 LEU A C   1 
ATOM   1173 O  O   . LEU A 1 149 ? 8.837   61.594 23.968 1.00 17.91 ? 149 LEU A O   1 
ATOM   1174 C  CB  . LEU A 1 149 ? 7.692   59.847 21.430 1.00 16.50 ? 149 LEU A CB  1 
ATOM   1175 C  CG  . LEU A 1 149 ? 7.990   59.759 19.929 1.00 16.77 ? 149 LEU A CG  1 
ATOM   1176 C  CD1 . LEU A 1 149 ? 6.717   59.480 19.157 1.00 21.03 ? 149 LEU A CD1 1 
ATOM   1177 C  CD2 . LEU A 1 149 ? 8.622   61.059 19.472 1.00 20.09 ? 149 LEU A CD2 1 
ATOM   1178 N  N   . ASN A 1 150 ? 8.103   59.554 24.556 1.00 15.07 ? 150 ASN A N   1 
ATOM   1179 C  CA  . ASN A 1 150 ? 7.763   59.976 25.908 1.00 16.40 ? 150 ASN A CA  1 
ATOM   1180 C  C   . ASN A 1 150 ? 8.995   60.528 26.622 1.00 15.21 ? 150 ASN A C   1 
ATOM   1181 O  O   . ASN A 1 150 ? 8.952   61.607 27.211 1.00 16.21 ? 150 ASN A O   1 
ATOM   1182 C  CB  . ASN A 1 150 ? 7.179   58.808 26.704 1.00 16.74 ? 150 ASN A CB  1 
ATOM   1183 C  CG  . ASN A 1 150 ? 6.792   59.210 28.115 1.00 19.38 ? 150 ASN A CG  1 
ATOM   1184 O  OD1 . ASN A 1 150 ? 6.155   60.246 28.320 1.00 19.79 ? 150 ASN A OD1 1 
ATOM   1185 N  ND2 . ASN A 1 150 ? 7.167   58.390 29.094 1.00 16.72 ? 150 ASN A ND2 1 
ATOM   1186 N  N   . VAL A 1 151 ? 10.098  59.791 26.562 1.00 15.71 ? 151 VAL A N   1 
ATOM   1187 C  CA  . VAL A 1 151 ? 11.337  60.238 27.194 1.00 15.49 ? 151 VAL A CA  1 
ATOM   1188 C  C   . VAL A 1 151 ? 11.776  61.591 26.634 1.00 16.76 ? 151 VAL A C   1 
ATOM   1189 O  O   . VAL A 1 151 ? 12.122  62.492 27.391 1.00 17.77 ? 151 VAL A O   1 
ATOM   1190 C  CB  . VAL A 1 151 ? 12.481  59.221 26.972 1.00 16.69 ? 151 VAL A CB  1 
ATOM   1191 C  CG1 . VAL A 1 151 ? 13.807  59.812 27.435 1.00 15.51 ? 151 VAL A CG1 1 
ATOM   1192 C  CG2 . VAL A 1 151 ? 12.183  57.932 27.731 1.00 13.70 ? 151 VAL A CG2 1 
ATOM   1193 N  N   . MET A 1 152 ? 11.767  61.728 25.309 1.00 17.00 ? 152 MET A N   1 
ATOM   1194 C  CA  . MET A 1 152 ? 12.174  62.980 24.673 1.00 18.20 ? 152 MET A CA  1 
ATOM   1195 C  C   . MET A 1 152 ? 11.307  64.150 25.128 1.00 18.00 ? 152 MET A C   1 
ATOM   1196 O  O   . MET A 1 152 ? 11.816  65.245 25.367 1.00 16.11 ? 152 MET A O   1 
ATOM   1197 C  CB  . MET A 1 152 ? 12.103  62.866 23.145 1.00 20.01 ? 152 MET A CB  1 
ATOM   1198 C  CG  . MET A 1 152 ? 12.984  61.778 22.541 1.00 23.02 ? 152 MET A CG  1 
ATOM   1199 S  SD  . MET A 1 152 ? 12.903  61.753 20.723 1.00 28.78 ? 152 MET A SD  1 
ATOM   1200 C  CE  . MET A 1 152 ? 14.517  61.089 20.329 1.00 32.15 ? 152 MET A CE  1 
ATOM   1201 N  N   . GLU A 1 153 ? 10.000  63.924 25.246 1.00 16.03 ? 153 GLU A N   1 
ATOM   1202 C  CA  . GLU A 1 153 ? 9.099   64.988 25.681 1.00 17.33 ? 153 GLU A CA  1 
ATOM   1203 C  C   . GLU A 1 153 ? 9.354   65.375 27.142 1.00 15.27 ? 153 GLU A C   1 
ATOM   1204 O  O   . GLU A 1 153 ? 9.231   66.543 27.504 1.00 15.16 ? 153 GLU A O   1 
ATOM   1205 C  CB  . GLU A 1 153 ? 7.635   64.568 25.511 1.00 17.49 ? 153 GLU A CB  1 
ATOM   1206 C  CG  . GLU A 1 153 ? 7.167   64.377 24.061 1.00 20.10 ? 153 GLU A CG  1 
ATOM   1207 C  CD  . GLU A 1 153 ? 7.114   65.674 23.256 1.00 22.08 ? 153 GLU A CD  1 
ATOM   1208 O  OE1 . GLU A 1 153 ? 6.905   66.751 23.852 1.00 20.22 ? 153 GLU A OE1 1 
ATOM   1209 O  OE2 . GLU A 1 153 ? 7.259   65.614 22.016 1.00 22.59 ? 153 GLU A OE2 1 
ATOM   1210 N  N   . GLN A 1 154 ? 9.711   64.405 27.982 1.00 16.56 ? 154 GLN A N   1 
ATOM   1211 C  CA  . GLN A 1 154 ? 9.974   64.710 29.390 1.00 15.46 ? 154 GLN A CA  1 
ATOM   1212 C  C   . GLN A 1 154 ? 11.282  65.488 29.523 1.00 15.29 ? 154 GLN A C   1 
ATOM   1213 O  O   . GLN A 1 154 ? 11.414  66.352 30.391 1.00 16.38 ? 154 GLN A O   1 
ATOM   1214 C  CB  . GLN A 1 154 ? 10.026  63.432 30.231 1.00 16.31 ? 154 GLN A CB  1 
ATOM   1215 C  CG  . GLN A 1 154 ? 8.774   62.551 30.127 1.00 15.57 ? 154 GLN A CG  1 
ATOM   1216 C  CD  . GLN A 1 154 ? 7.471   63.338 30.177 1.00 18.52 ? 154 GLN A CD  1 
ATOM   1217 O  OE1 . GLN A 1 154 ? 7.240   64.131 31.092 1.00 15.21 ? 154 GLN A OE1 1 
ATOM   1218 N  NE2 . GLN A 1 154 ? 6.607   63.110 29.189 1.00 16.32 ? 154 GLN A NE2 1 
ATOM   1219 N  N   . VAL A 1 155 ? 12.253  65.174 28.670 1.00 14.60 ? 155 VAL A N   1 
ATOM   1220 C  CA  . VAL A 1 155 ? 13.523  65.895 28.681 1.00 15.60 ? 155 VAL A CA  1 
ATOM   1221 C  C   . VAL A 1 155 ? 13.211  67.345 28.322 1.00 15.85 ? 155 VAL A C   1 
ATOM   1222 O  O   . VAL A 1 155 ? 13.733  68.283 28.931 1.00 14.34 ? 155 VAL A O   1 
ATOM   1223 C  CB  . VAL A 1 155 ? 14.514  65.332 27.631 1.00 17.20 ? 155 VAL A CB  1 
ATOM   1224 C  CG1 . VAL A 1 155 ? 15.670  66.316 27.422 1.00 17.39 ? 155 VAL A CG1 1 
ATOM   1225 C  CG2 . VAL A 1 155 ? 15.054  63.978 28.097 1.00 15.37 ? 155 VAL A CG2 1 
ATOM   1226 N  N   . TYR A 1 156 ? 12.346  67.510 27.324 1.00 16.74 ? 156 TYR A N   1 
ATOM   1227 C  CA  . TYR A 1 156 ? 11.934  68.828 26.852 1.00 16.95 ? 156 TYR A CA  1 
ATOM   1228 C  C   . TYR A 1 156 ? 11.215  69.567 27.983 1.00 15.88 ? 156 TYR A C   1 
ATOM   1229 O  O   . TYR A 1 156 ? 11.481  70.741 28.235 1.00 14.55 ? 156 TYR A O   1 
ATOM   1230 C  CB  . TYR A 1 156 ? 11.002  68.681 25.644 1.00 19.49 ? 156 TYR A CB  1 
ATOM   1231 C  CG  . TYR A 1 156 ? 10.881  69.927 24.790 1.00 20.88 ? 156 TYR A CG  1 
ATOM   1232 C  CD1 . TYR A 1 156 ? 12.008  70.513 24.217 1.00 23.06 ? 156 TYR A CD1 1 
ATOM   1233 C  CD2 . TYR A 1 156 ? 9.638   70.504 24.535 1.00 25.54 ? 156 TYR A CD2 1 
ATOM   1234 C  CE1 . TYR A 1 156 ? 11.901  71.642 23.410 1.00 22.72 ? 156 TYR A CE1 1 
ATOM   1235 C  CE2 . TYR A 1 156 ? 9.519   71.631 23.729 1.00 24.90 ? 156 TYR A CE2 1 
ATOM   1236 C  CZ  . TYR A 1 156 ? 10.655  72.192 23.170 1.00 25.21 ? 156 TYR A CZ  1 
ATOM   1237 O  OH  . TYR A 1 156 ? 10.544  73.304 22.369 1.00 28.16 ? 156 TYR A OH  1 
ATOM   1238 N  N   . ASN A 1 157 ? 10.305  68.871 28.661 1.00 13.35 ? 157 ASN A N   1 
ATOM   1239 C  CA  . ASN A 1 157 ? 9.570   69.466 29.775 1.00 15.06 ? 157 ASN A CA  1 
ATOM   1240 C  C   . ASN A 1 157 ? 10.516  69.914 30.886 1.00 14.34 ? 157 ASN A C   1 
ATOM   1241 O  O   . ASN A 1 157 ? 10.407  71.026 31.396 1.00 15.20 ? 157 ASN A O   1 
ATOM   1242 C  CB  . ASN A 1 157 ? 8.565   68.467 30.365 1.00 15.87 ? 157 ASN A CB  1 
ATOM   1243 C  CG  . ASN A 1 157 ? 7.380   68.214 29.453 1.00 18.38 ? 157 ASN A CG  1 
ATOM   1244 O  OD1 . ASN A 1 157 ? 7.164   68.929 28.476 1.00 17.00 ? 157 ASN A OD1 1 
ATOM   1245 N  ND2 . ASN A 1 157 ? 6.590   67.199 29.785 1.00 17.61 ? 157 ASN A ND2 1 
ATOM   1246 N  N   . LEU A 1 158 ? 11.443  69.042 31.269 1.00 15.40 ? 158 LEU A N   1 
ATOM   1247 C  CA  . LEU A 1 158 ? 12.381  69.383 32.328 1.00 16.45 ? 158 LEU A CA  1 
ATOM   1248 C  C   . LEU A 1 158 ? 13.223  70.598 31.948 1.00 17.78 ? 158 LEU A C   1 
ATOM   1249 O  O   . LEU A 1 158 ? 13.465  71.481 32.775 1.00 17.21 ? 158 LEU A O   1 
ATOM   1250 C  CB  . LEU A 1 158 ? 13.307  68.197 32.635 1.00 17.96 ? 158 LEU A CB  1 
ATOM   1251 C  CG  . LEU A 1 158 ? 14.369  68.473 33.706 1.00 17.25 ? 158 LEU A CG  1 
ATOM   1252 C  CD1 . LEU A 1 158 ? 13.698  68.935 34.988 1.00 21.24 ? 158 LEU A CD1 1 
ATOM   1253 C  CD2 . LEU A 1 158 ? 15.193  67.218 33.951 1.00 20.81 ? 158 LEU A CD2 1 
ATOM   1254 N  N   . GLY A 1 159 ? 13.664  70.632 30.694 1.00 16.74 ? 159 GLY A N   1 
ATOM   1255 C  CA  . GLY A 1 159 ? 14.478  71.735 30.220 1.00 17.41 ? 159 GLY A CA  1 
ATOM   1256 C  C   . GLY A 1 159 ? 13.742  73.058 30.261 1.00 18.57 ? 159 GLY A C   1 
ATOM   1257 O  O   . GLY A 1 159 ? 14.362  74.106 30.418 1.00 17.96 ? 159 GLY A O   1 
ATOM   1258 N  N   . HIS A 1 160 ? 12.420  73.020 30.120 1.00 18.77 ? 160 HIS A N   1 
ATOM   1259 C  CA  . HIS A 1 160 ? 11.636  74.249 30.152 1.00 18.43 ? 160 HIS A CA  1 
ATOM   1260 C  C   . HIS A 1 160 ? 11.143  74.671 31.532 1.00 17.93 ? 160 HIS A C   1 
ATOM   1261 O  O   . HIS A 1 160 ? 10.540  75.734 31.679 1.00 16.46 ? 160 HIS A O   1 
ATOM   1262 C  CB  . HIS A 1 160 ? 10.455  74.156 29.190 1.00 20.43 ? 160 HIS A CB  1 
ATOM   1263 C  CG  . HIS A 1 160 ? 10.830  74.434 27.770 1.00 23.86 ? 160 HIS A CG  1 
ATOM   1264 N  ND1 . HIS A 1 160 ? 11.215  73.445 26.893 1.00 27.11 ? 160 HIS A ND1 1 
ATOM   1265 C  CD2 . HIS A 1 160 ? 10.959  75.603 27.098 1.00 24.25 ? 160 HIS A CD2 1 
ATOM   1266 C  CE1 . HIS A 1 160 ? 11.565  73.991 25.742 1.00 23.80 ? 160 HIS A CE1 1 
ATOM   1267 N  NE2 . HIS A 1 160 ? 11.420  75.299 25.841 1.00 26.32 ? 160 HIS A NE2 1 
ATOM   1268 N  N   . SER A 1 161 ? 11.393  73.850 32.544 1.00 16.68 ? 161 SER A N   1 
ATOM   1269 C  CA  . SER A 1 161 ? 10.971  74.208 33.894 1.00 16.34 ? 161 SER A CA  1 
ATOM   1270 C  C   . SER A 1 161 ? 11.768  75.449 34.280 1.00 16.33 ? 161 SER A C   1 
ATOM   1271 O  O   . SER A 1 161 ? 12.842  75.686 33.732 1.00 14.90 ? 161 SER A O   1 
ATOM   1272 C  CB  . SER A 1 161 ? 11.271  73.073 34.877 1.00 17.00 ? 161 SER A CB  1 
ATOM   1273 O  OG  . SER A 1 161 ? 12.665  72.854 35.003 1.00 17.75 ? 161 SER A OG  1 
ATOM   1274 N  N   . THR A 1 162 ? 11.239  76.246 35.204 1.00 16.59 ? 162 THR A N   1 
ATOM   1275 C  CA  . THR A 1 162 ? 11.933  77.455 35.640 1.00 18.14 ? 162 THR A CA  1 
ATOM   1276 C  C   . THR A 1 162 ? 13.249  77.079 36.320 1.00 18.58 ? 162 THR A C   1 
ATOM   1277 O  O   . THR A 1 162 ? 14.217  77.838 36.291 1.00 18.03 ? 162 THR A O   1 
ATOM   1278 C  CB  . THR A 1 162 ? 11.077  78.262 36.630 1.00 19.17 ? 162 THR A CB  1 
ATOM   1279 O  OG1 . THR A 1 162 ? 10.679  77.416 37.716 1.00 19.05 ? 162 THR A OG1 1 
ATOM   1280 C  CG2 . THR A 1 162 ? 9.835   78.814 35.939 1.00 22.91 ? 162 THR A CG2 1 
ATOM   1281 N  N   . ILE A 1 163 ? 13.276  75.894 36.922 1.00 19.10 ? 163 ILE A N   1 
ATOM   1282 C  CA  . ILE A 1 163 ? 14.461  75.395 37.614 1.00 19.32 ? 163 ILE A CA  1 
ATOM   1283 C  C   . ILE A 1 163 ? 15.654  75.261 36.665 1.00 19.83 ? 163 ILE A C   1 
ATOM   1284 O  O   . ILE A 1 163 ? 16.734  75.789 36.939 1.00 18.91 ? 163 ILE A O   1 
ATOM   1285 C  CB  . ILE A 1 163 ? 14.177  74.027 38.245 1.00 21.81 ? 163 ILE A CB  1 
ATOM   1286 C  CG1 . ILE A 1 163 ? 12.995  74.147 39.211 1.00 24.76 ? 163 ILE A CG1 1 
ATOM   1287 C  CG2 . ILE A 1 163 ? 15.418  73.517 38.962 1.00 23.49 ? 163 ILE A CG2 1 
ATOM   1288 C  CD1 . ILE A 1 163 ? 12.369  72.821 39.582 1.00 30.05 ? 163 ILE A CD1 1 
ATOM   1289 N  N   . MET A 1 164 ? 15.459  74.560 35.552 1.00 18.60 ? 164 MET A N   1 
ATOM   1290 C  CA  . MET A 1 164 ? 16.536  74.375 34.578 1.00 19.40 ? 164 MET A CA  1 
ATOM   1291 C  C   . MET A 1 164 ? 16.865  75.662 33.826 1.00 21.58 ? 164 MET A C   1 
ATOM   1292 O  O   . MET A 1 164 ? 18.032  75.946 33.554 1.00 21.07 ? 164 MET A O   1 
ATOM   1293 C  CB  . MET A 1 164 ? 16.173  73.279 33.569 1.00 18.50 ? 164 MET A CB  1 
ATOM   1294 C  CG  . MET A 1 164 ? 16.221  71.875 34.139 1.00 18.10 ? 164 MET A CG  1 
ATOM   1295 S  SD  . MET A 1 164 ? 17.764  71.546 35.048 1.00 23.46 ? 164 MET A SD  1 
ATOM   1296 C  CE  . MET A 1 164 ? 18.971  71.647 33.733 1.00 21.13 ? 164 MET A CE  1 
ATOM   1297 N  N   . GLN A 1 165 ? 15.838  76.434 33.485 1.00 22.21 ? 165 GLN A N   1 
ATOM   1298 C  CA  . GLN A 1 165 ? 16.045  77.685 32.768 1.00 24.76 ? 165 GLN A CA  1 
ATOM   1299 C  C   . GLN A 1 165 ? 16.918  78.640 33.583 1.00 25.50 ? 165 GLN A C   1 
ATOM   1300 O  O   . GLN A 1 165 ? 17.846  79.246 33.049 1.00 25.12 ? 165 GLN A O   1 
ATOM   1301 C  CB  . GLN A 1 165 ? 14.698  78.344 32.446 1.00 25.33 ? 165 GLN A CB  1 
ATOM   1302 C  CG  . GLN A 1 165 ? 13.840  77.573 31.433 1.00 26.31 ? 165 GLN A CG  1 
ATOM   1303 C  CD  . GLN A 1 165 ? 14.379  77.648 30.013 1.00 29.05 ? 165 GLN A CD  1 
ATOM   1304 O  OE1 . GLN A 1 165 ? 14.542  78.736 29.462 1.00 31.17 ? 165 GLN A OE1 1 
ATOM   1305 N  NE2 . GLN A 1 165 ? 14.651  76.491 29.410 1.00 27.08 ? 165 GLN A NE2 1 
ATOM   1306 N  N   . SER A 1 166 ? 16.639  78.763 34.878 1.00 25.96 ? 166 SER A N   1 
ATOM   1307 C  CA  . SER A 1 166 ? 17.425  79.662 35.720 1.00 28.60 ? 166 SER A CA  1 
ATOM   1308 C  C   . SER A 1 166 ? 18.849  79.145 35.946 1.00 27.65 ? 166 SER A C   1 
ATOM   1309 O  O   . SER A 1 166 ? 19.801  79.931 35.984 1.00 25.01 ? 166 SER A O   1 
ATOM   1310 C  CB  . SER A 1 166 ? 16.725  79.890 37.066 1.00 30.30 ? 166 SER A CB  1 
ATOM   1311 O  OG  . SER A 1 166 ? 16.665  78.695 37.821 1.00 38.70 ? 166 SER A OG  1 
ATOM   1312 N  N   . ALA A 1 167 ? 18.995  77.829 36.088 1.00 26.20 ? 167 ALA A N   1 
ATOM   1313 C  CA  . ALA A 1 167 ? 20.310  77.224 36.295 1.00 26.36 ? 167 ALA A CA  1 
ATOM   1314 C  C   . ALA A 1 167 ? 21.211  77.492 35.095 1.00 27.07 ? 167 ALA A C   1 
ATOM   1315 O  O   . ALA A 1 167 ? 22.359  77.919 35.251 1.00 28.30 ? 167 ALA A O   1 
ATOM   1316 C  CB  . ALA A 1 167 ? 20.173  75.725 36.515 1.00 26.78 ? 167 ALA A CB  1 
ATOM   1317 N  N   . TRP A 1 168 ? 20.698  77.236 33.897 1.00 26.13 ? 168 TRP A N   1 
ATOM   1318 C  CA  . TRP A 1 168 ? 21.478  77.475 32.691 1.00 28.44 ? 168 TRP A CA  1 
ATOM   1319 C  C   . TRP A 1 168 ? 21.729  78.965 32.499 1.00 29.70 ? 168 TRP A C   1 
ATOM   1320 O  O   . TRP A 1 168 ? 22.778  79.363 31.991 1.00 29.95 ? 168 TRP A O   1 
ATOM   1321 C  CB  . TRP A 1 168 ? 20.768  76.925 31.453 1.00 26.25 ? 168 TRP A CB  1 
ATOM   1322 C  CG  . TRP A 1 168 ? 20.820  75.437 31.325 1.00 24.69 ? 168 TRP A CG  1 
ATOM   1323 C  CD1 . TRP A 1 168 ? 21.821  74.606 31.752 1.00 26.49 ? 168 TRP A CD1 1 
ATOM   1324 C  CD2 . TRP A 1 168 ? 19.871  74.609 30.652 1.00 24.48 ? 168 TRP A CD2 1 
ATOM   1325 N  NE1 . TRP A 1 168 ? 21.552  73.310 31.381 1.00 27.03 ? 168 TRP A NE1 1 
ATOM   1326 C  CE2 . TRP A 1 168 ? 20.360  73.283 30.704 1.00 24.98 ? 168 TRP A CE2 1 
ATOM   1327 C  CE3 . TRP A 1 168 ? 18.653  74.857 30.005 1.00 23.95 ? 168 TRP A CE3 1 
ATOM   1328 C  CZ2 . TRP A 1 168 ? 19.672  72.209 30.133 1.00 25.59 ? 168 TRP A CZ2 1 
ATOM   1329 C  CZ3 . TRP A 1 168 ? 17.969  73.786 29.436 1.00 25.66 ? 168 TRP A CZ3 1 
ATOM   1330 C  CH2 . TRP A 1 168 ? 18.483  72.479 29.505 1.00 24.45 ? 168 TRP A CH2 1 
ATOM   1331 N  N   . LYS A 1 169 ? 20.764  79.784 32.906 1.00 30.84 ? 169 LYS A N   1 
ATOM   1332 C  CA  . LYS A 1 169 ? 20.891  81.231 32.770 1.00 33.75 ? 169 LYS A CA  1 
ATOM   1333 C  C   . LYS A 1 169 ? 22.043  81.786 33.604 1.00 33.75 ? 169 LYS A C   1 
ATOM   1334 O  O   . LYS A 1 169 ? 22.780  82.660 33.144 1.00 34.06 ? 169 LYS A O   1 
ATOM   1335 C  CB  . LYS A 1 169 ? 19.584  81.921 33.168 1.00 34.93 ? 169 LYS A CB  1 
ATOM   1336 C  CG  . LYS A 1 169 ? 19.590  83.417 32.917 1.00 40.28 ? 169 LYS A CG  1 
ATOM   1337 C  CD  . LYS A 1 169 ? 18.249  84.053 33.250 1.00 43.38 ? 169 LYS A CD  1 
ATOM   1338 C  CE  . LYS A 1 169 ? 18.265  85.538 32.925 1.00 45.66 ? 169 LYS A CE  1 
ATOM   1339 N  NZ  . LYS A 1 169 ? 16.953  86.193 33.189 1.00 47.42 ? 169 LYS A NZ  1 
ATOM   1340 N  N   . ARG A 1 170 ? 22.202  81.287 34.828 1.00 33.15 ? 170 ARG A N   1 
ATOM   1341 C  CA  . ARG A 1 170 ? 23.284  81.762 35.682 1.00 33.99 ? 170 ARG A CA  1 
ATOM   1342 C  C   . ARG A 1 170 ? 24.598  81.052 35.364 1.00 34.18 ? 170 ARG A C   1 
ATOM   1343 O  O   . ARG A 1 170 ? 25.585  81.194 36.087 1.00 34.26 ? 170 ARG A O   1 
ATOM   1344 C  CB  . ARG A 1 170 ? 22.934  81.594 37.166 1.00 32.55 ? 170 ARG A CB  1 
ATOM   1345 C  CG  . ARG A 1 170 ? 22.689  80.170 37.627 1.00 35.61 ? 170 ARG A CG  1 
ATOM   1346 C  CD  . ARG A 1 170 ? 22.524  80.128 39.144 1.00 34.91 ? 170 ARG A CD  1 
ATOM   1347 N  NE  . ARG A 1 170 ? 22.259  78.781 39.642 1.00 35.82 ? 170 ARG A NE  1 
ATOM   1348 C  CZ  . ARG A 1 170 ? 21.049  78.242 39.766 1.00 35.66 ? 170 ARG A CZ  1 
ATOM   1349 N  NH1 . ARG A 1 170 ? 19.965  78.933 39.431 1.00 34.11 ? 170 ARG A NH1 1 
ATOM   1350 N  NH2 . ARG A 1 170 ? 20.924  77.002 40.226 1.00 34.53 ? 170 ARG A NH2 1 
ATOM   1351 N  N   . GLY A 1 171 ? 24.597  80.287 34.276 1.00 32.95 ? 171 GLY A N   1 
ATOM   1352 C  CA  . GLY A 1 171 ? 25.794  79.586 33.845 1.00 33.90 ? 171 GLY A CA  1 
ATOM   1353 C  C   . GLY A 1 171 ? 26.194  78.314 34.571 1.00 34.27 ? 171 GLY A C   1 
ATOM   1354 O  O   . GLY A 1 171 ? 27.365  77.942 34.547 1.00 34.93 ? 171 GLY A O   1 
ATOM   1355 N  N   . GLN A 1 172 ? 25.250  77.635 35.213 1.00 32.30 ? 172 GLN A N   1 
ATOM   1356 C  CA  . GLN A 1 172 ? 25.589  76.403 35.912 1.00 31.43 ? 172 GLN A CA  1 
ATOM   1357 C  C   . GLN A 1 172 ? 25.738  75.272 34.909 1.00 29.82 ? 172 GLN A C   1 
ATOM   1358 O  O   . GLN A 1 172 ? 25.036  75.226 33.902 1.00 29.69 ? 172 GLN A O   1 
ATOM   1359 C  CB  . GLN A 1 172 ? 24.515  76.037 36.936 1.00 31.77 ? 172 GLN A CB  1 
ATOM   1360 C  CG  . GLN A 1 172 ? 24.939  74.916 37.865 1.00 32.92 ? 172 GLN A CG  1 
ATOM   1361 C  CD  . GLN A 1 172 ? 23.915  74.626 38.941 1.00 34.79 ? 172 GLN A CD  1 
ATOM   1362 O  OE1 . GLN A 1 172 ? 23.337  75.542 39.524 1.00 36.33 ? 172 GLN A OE1 1 
ATOM   1363 N  NE2 . GLN A 1 172 ? 23.696  73.346 39.224 1.00 35.02 ? 172 GLN A NE2 1 
ATOM   1364 N  N   . LYS A 1 173 ? 26.661  74.361 35.186 1.00 30.42 ? 173 LYS A N   1 
ATOM   1365 C  CA  . LYS A 1 173 ? 26.900  73.227 34.305 1.00 30.16 ? 173 LYS A CA  1 
ATOM   1366 C  C   . LYS A 1 173 ? 26.020  72.042 34.692 1.00 28.27 ? 173 LYS A C   1 
ATOM   1367 O  O   . LYS A 1 173 ? 26.293  71.345 35.667 1.00 28.44 ? 173 LYS A O   1 
ATOM   1368 C  CB  . LYS A 1 173 ? 28.372  72.812 34.369 1.00 32.68 ? 173 LYS A CB  1 
ATOM   1369 C  CG  . LYS A 1 173 ? 29.353  73.920 34.001 1.00 39.53 ? 173 LYS A CG  1 
ATOM   1370 C  CD  . LYS A 1 173 ? 29.170  74.382 32.560 1.00 42.33 ? 173 LYS A CD  1 
ATOM   1371 C  CE  . LYS A 1 173 ? 30.179  75.459 32.193 1.00 44.96 ? 173 LYS A CE  1 
ATOM   1372 N  NZ  . LYS A 1 173 ? 30.076  75.831 30.754 1.00 47.11 ? 173 LYS A NZ  1 
ATOM   1373 N  N   . VAL A 1 174 ? 24.957  71.826 33.927 1.00 26.30 ? 174 VAL A N   1 
ATOM   1374 C  CA  . VAL A 1 174 ? 24.046  70.717 34.183 1.00 22.85 ? 174 VAL A CA  1 
ATOM   1375 C  C   . VAL A 1 174 ? 23.596  70.182 32.838 1.00 19.97 ? 174 VAL A C   1 
ATOM   1376 O  O   . VAL A 1 174 ? 23.111  70.936 32.005 1.00 20.27 ? 174 VAL A O   1 
ATOM   1377 C  CB  . VAL A 1 174 ? 22.797  71.168 34.967 1.00 23.83 ? 174 VAL A CB  1 
ATOM   1378 C  CG1 . VAL A 1 174 ? 21.977  69.949 35.376 1.00 23.88 ? 174 VAL A CG1 1 
ATOM   1379 C  CG2 . VAL A 1 174 ? 23.203  71.969 36.183 1.00 26.22 ? 174 VAL A CG2 1 
ATOM   1380 N  N   . THR A 1 175 ? 23.759  68.884 32.620 1.00 18.88 ? 175 THR A N   1 
ATOM   1381 C  CA  . THR A 1 175 ? 23.360  68.287 31.351 1.00 19.61 ? 175 THR A CA  1 
ATOM   1382 C  C   . THR A 1 175 ? 22.202  67.310 31.523 1.00 19.56 ? 175 THR A C   1 
ATOM   1383 O  O   . THR A 1 175 ? 22.172  66.551 32.485 1.00 17.78 ? 175 THR A O   1 
ATOM   1384 C  CB  . THR A 1 175 ? 24.545  67.537 30.703 1.00 19.88 ? 175 THR A CB  1 
ATOM   1385 O  OG1 . THR A 1 175 ? 25.644  68.446 30.524 1.00 19.88 ? 175 THR A OG1 1 
ATOM   1386 C  CG2 . THR A 1 175 ? 24.143  66.968 29.353 1.00 19.19 ? 175 THR A CG2 1 
ATOM   1387 N  N   . ILE A 1 176 ? 21.253  67.334 30.587 1.00 20.14 ? 176 ILE A N   1 
ATOM   1388 C  CA  . ILE A 1 176 ? 20.106  66.424 30.634 1.00 20.07 ? 176 ILE A CA  1 
ATOM   1389 C  C   . ILE A 1 176 ? 20.264  65.397 29.520 1.00 19.94 ? 176 ILE A C   1 
ATOM   1390 O  O   . ILE A 1 176 ? 20.628  65.750 28.397 1.00 19.00 ? 176 ILE A O   1 
ATOM   1391 C  CB  . ILE A 1 176 ? 18.764  67.158 30.403 1.00 20.95 ? 176 ILE A CB  1 
ATOM   1392 C  CG1 . ILE A 1 176 ? 18.639  68.355 31.342 1.00 21.95 ? 176 ILE A CG1 1 
ATOM   1393 C  CG2 . ILE A 1 176 ? 17.607  66.195 30.643 1.00 20.68 ? 176 ILE A CG2 1 
ATOM   1394 C  CD1 . ILE A 1 176 ? 17.376  69.181 31.086 1.00 24.52 ? 176 ILE A CD1 1 
ATOM   1395 N  N   . HIS A 1 177 ? 19.987  64.133 29.833 1.00 18.38 ? 177 HIS A N   1 
ATOM   1396 C  CA  . HIS A 1 177 ? 20.103  63.045 28.859 1.00 19.32 ? 177 HIS A CA  1 
ATOM   1397 C  C   . HIS A 1 177 ? 18.792  62.276 28.762 1.00 19.21 ? 177 HIS A C   1 
ATOM   1398 O  O   . HIS A 1 177 ? 18.065  62.145 29.746 1.00 18.96 ? 177 HIS A O   1 
ATOM   1399 C  CB  . HIS A 1 177 ? 21.199  62.066 29.286 1.00 18.64 ? 177 HIS A CB  1 
ATOM   1400 C  CG  . HIS A 1 177 ? 22.507  62.721 29.600 1.00 22.25 ? 177 HIS A CG  1 
ATOM   1401 N  ND1 . HIS A 1 177 ? 23.493  62.907 28.656 1.00 22.34 ? 177 HIS A ND1 1 
ATOM   1402 C  CD2 . HIS A 1 177 ? 22.976  63.265 30.748 1.00 20.55 ? 177 HIS A CD2 1 
ATOM   1403 C  CE1 . HIS A 1 177 ? 24.514  63.538 29.209 1.00 23.44 ? 177 HIS A CE1 1 
ATOM   1404 N  NE2 . HIS A 1 177 ? 24.225  63.767 30.478 1.00 23.19 ? 177 HIS A NE2 1 
ATOM   1405 N  N   . GLY A 1 178 ? 18.501  61.761 27.574 1.00 18.34 ? 178 GLY A N   1 
ATOM   1406 C  CA  . GLY A 1 178 ? 17.290  60.987 27.382 1.00 18.80 ? 178 GLY A CA  1 
ATOM   1407 C  C   . GLY A 1 178 ? 17.686  59.596 26.932 1.00 19.08 ? 178 GLY A C   1 
ATOM   1408 O  O   . GLY A 1 178 ? 18.162  59.427 25.809 1.00 18.04 ? 178 GLY A O   1 
ATOM   1409 N  N   . TRP A 1 179 ? 17.504  58.609 27.809 1.00 17.33 ? 179 TRP A N   1 
ATOM   1410 C  CA  . TRP A 1 179 ? 17.859  57.221 27.515 1.00 17.59 ? 179 TRP A CA  1 
ATOM   1411 C  C   . TRP A 1 179 ? 16.664  56.270 27.611 1.00 18.95 ? 179 TRP A C   1 
ATOM   1412 O  O   . TRP A 1 179 ? 15.594  56.638 28.092 1.00 18.59 ? 179 TRP A O   1 
ATOM   1413 C  CB  . TRP A 1 179 ? 18.930  56.715 28.493 1.00 17.62 ? 179 TRP A CB  1 
ATOM   1414 C  CG  . TRP A 1 179 ? 20.260  57.429 28.453 1.00 17.37 ? 179 TRP A CG  1 
ATOM   1415 C  CD1 . TRP A 1 179 ? 20.686  58.329 27.522 1.00 18.38 ? 179 TRP A CD1 1 
ATOM   1416 C  CD2 . TRP A 1 179 ? 21.345  57.264 29.377 1.00 18.90 ? 179 TRP A CD2 1 
ATOM   1417 N  NE1 . TRP A 1 179 ? 21.968  58.734 27.805 1.00 17.98 ? 179 TRP A NE1 1 
ATOM   1418 C  CE2 . TRP A 1 179 ? 22.397  58.095 28.938 1.00 20.10 ? 179 TRP A CE2 1 
ATOM   1419 C  CE3 . TRP A 1 179 ? 21.531  56.492 30.533 1.00 19.74 ? 179 TRP A CE3 1 
ATOM   1420 C  CZ2 . TRP A 1 179 ? 23.623  58.178 29.614 1.00 21.50 ? 179 TRP A CZ2 1 
ATOM   1421 C  CZ3 . TRP A 1 179 ? 22.754  56.574 31.206 1.00 20.49 ? 179 TRP A CZ3 1 
ATOM   1422 C  CH2 . TRP A 1 179 ? 23.780  57.410 30.742 1.00 18.25 ? 179 TRP A CH2 1 
ATOM   1423 N  N   . ALA A 1 180 ? 16.874  55.037 27.160 1.00 18.00 ? 180 ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 180 ? 15.860  53.991 27.211 1.00 18.84 ? 180 ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 180 ? 16.582  52.656 27.129 1.00 20.31 ? 180 ALA A C   1 
ATOM   1426 O  O   . ALA A 1 180 ? 17.646  52.562 26.515 1.00 21.36 ? 180 ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 180 ? 14.886  54.128 26.041 1.00 19.09 ? 180 ALA A CB  1 
ATOM   1428 N  N   . TYR A 1 181 ? 16.018  51.628 27.752 1.00 20.53 ? 181 TYR A N   1 
ATOM   1429 C  CA  . TYR A 1 181 ? 16.623  50.300 27.707 1.00 20.69 ? 181 TYR A CA  1 
ATOM   1430 C  C   . TYR A 1 181 ? 15.525  49.258 27.572 1.00 21.11 ? 181 TYR A C   1 
ATOM   1431 O  O   . TYR A 1 181 ? 14.357  49.536 27.853 1.00 19.30 ? 181 TYR A O   1 
ATOM   1432 C  CB  . TYR A 1 181 ? 17.454  50.037 28.971 1.00 20.66 ? 181 TYR A CB  1 
ATOM   1433 C  CG  . TYR A 1 181 ? 16.642  49.788 30.218 1.00 21.26 ? 181 TYR A CG  1 
ATOM   1434 C  CD1 . TYR A 1 181 ? 16.225  48.502 30.557 1.00 21.45 ? 181 TYR A CD1 1 
ATOM   1435 C  CD2 . TYR A 1 181 ? 16.259  50.843 31.044 1.00 22.81 ? 181 TYR A CD2 1 
ATOM   1436 C  CE1 . TYR A 1 181 ? 15.443  48.274 31.687 1.00 22.00 ? 181 TYR A CE1 1 
ATOM   1437 C  CE2 . TYR A 1 181 ? 15.476  50.627 32.176 1.00 22.52 ? 181 TYR A CE2 1 
ATOM   1438 C  CZ  . TYR A 1 181 ? 15.072  49.340 32.489 1.00 23.94 ? 181 TYR A CZ  1 
ATOM   1439 O  OH  . TYR A 1 181 ? 14.291  49.123 33.600 1.00 23.99 ? 181 TYR A OH  1 
ATOM   1440 N  N   . GLY A 1 182 ? 15.902  48.065 27.126 1.00 21.44 ? 182 GLY A N   1 
ATOM   1441 C  CA  . GLY A 1 182 ? 14.939  46.991 26.967 1.00 21.54 ? 182 GLY A CA  1 
ATOM   1442 C  C   . GLY A 1 182 ? 15.330  45.789 27.805 1.00 23.36 ? 182 GLY A C   1 
ATOM   1443 O  O   . GLY A 1 182 ? 16.500  45.618 28.144 1.00 23.51 ? 182 GLY A O   1 
ATOM   1444 N  N   . ILE A 1 183 ? 14.352  44.954 28.132 1.00 22.08 ? 183 ILE A N   1 
ATOM   1445 C  CA  . ILE A 1 183 ? 14.584  43.763 28.941 1.00 26.69 ? 183 ILE A CA  1 
ATOM   1446 C  C   . ILE A 1 183 ? 15.198  42.598 28.151 1.00 27.47 ? 183 ILE A C   1 
ATOM   1447 O  O   . ILE A 1 183 ? 15.567  41.572 28.726 1.00 27.83 ? 183 ILE A O   1 
ATOM   1448 C  CB  . ILE A 1 183 ? 13.243  43.332 29.630 1.00 29.37 ? 183 ILE A CB  1 
ATOM   1449 C  CG1 . ILE A 1 183 ? 13.318  43.657 31.118 1.00 31.24 ? 183 ILE A CG1 1 
ATOM   1450 C  CG2 . ILE A 1 183 ? 12.941  41.866 29.400 1.00 30.99 ? 183 ILE A CG2 1 
ATOM   1451 C  CD1 . ILE A 1 183 ? 13.646  45.103 31.397 1.00 33.35 ? 183 ILE A CD1 1 
ATOM   1452 N  N   . HIS A 1 184 ? 15.322  42.758 26.838 1.00 27.06 ? 184 HIS A N   1 
ATOM   1453 C  CA  . HIS A 1 184 ? 15.899  41.700 26.014 1.00 28.18 ? 184 HIS A CA  1 
ATOM   1454 C  C   . HIS A 1 184 ? 17.417  41.608 26.162 1.00 28.63 ? 184 HIS A C   1 
ATOM   1455 O  O   . HIS A 1 184 ? 18.002  40.542 25.957 1.00 28.31 ? 184 HIS A O   1 
ATOM   1456 C  CB  . HIS A 1 184 ? 15.528  41.904 24.538 1.00 29.11 ? 184 HIS A CB  1 
ATOM   1457 C  CG  . HIS A 1 184 ? 15.866  43.263 24.004 1.00 33.39 ? 184 HIS A CG  1 
ATOM   1458 N  ND1 . HIS A 1 184 ? 15.229  44.411 24.425 1.00 32.65 ? 184 HIS A ND1 1 
ATOM   1459 C  CD2 . HIS A 1 184 ? 16.768  43.656 23.071 1.00 32.94 ? 184 HIS A CD2 1 
ATOM   1460 C  CE1 . HIS A 1 184 ? 15.722  45.451 23.775 1.00 34.14 ? 184 HIS A CE1 1 
ATOM   1461 N  NE2 . HIS A 1 184 ? 16.658  45.020 22.948 1.00 33.50 ? 184 HIS A NE2 1 
ATOM   1462 N  N   . ASP A 1 185 ? 18.056  42.718 26.526 1.00 27.36 ? 185 ASP A N   1 
ATOM   1463 C  CA  . ASP A 1 185 ? 19.508  42.726 26.688 1.00 27.69 ? 185 ASP A CA  1 
ATOM   1464 C  C   . ASP A 1 185 ? 20.048  43.714 27.721 1.00 26.24 ? 185 ASP A C   1 
ATOM   1465 O  O   . ASP A 1 185 ? 21.253  43.752 27.960 1.00 27.81 ? 185 ASP A O   1 
ATOM   1466 C  CB  . ASP A 1 185 ? 20.192  42.990 25.341 1.00 27.14 ? 185 ASP A CB  1 
ATOM   1467 C  CG  . ASP A 1 185 ? 19.718  44.270 24.685 1.00 28.46 ? 185 ASP A CG  1 
ATOM   1468 O  OD1 . ASP A 1 185 ? 19.152  45.138 25.387 1.00 27.00 ? 185 ASP A OD1 1 
ATOM   1469 O  OD2 . ASP A 1 185 ? 19.921  44.411 23.464 1.00 30.43 ? 185 ASP A OD2 1 
ATOM   1470 N  N   . GLY A 1 186 ? 19.168  44.508 28.327 1.00 23.96 ? 186 GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 186 ? 19.602  45.478 29.324 1.00 23.24 ? 186 GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 186 ? 20.553  46.536 28.785 1.00 23.11 ? 186 GLY A C   1 
ATOM   1473 O  O   . GLY A 1 186 ? 21.288  47.174 29.543 1.00 22.08 ? 186 GLY A O   1 
ATOM   1474 N  N   . LEU A 1 187 ? 20.523  46.737 27.473 1.00 23.15 ? 187 LEU A N   1 
ATOM   1475 C  CA  . LEU A 1 187 ? 21.399  47.700 26.815 1.00 24.96 ? 187 LEU A CA  1 
ATOM   1476 C  C   . LEU A 1 187 ? 20.818  49.116 26.788 1.00 26.10 ? 187 LEU A C   1 
ATOM   1477 O  O   . LEU A 1 187 ? 19.718  49.340 26.276 1.00 25.75 ? 187 LEU A O   1 
ATOM   1478 C  CB  . LEU A 1 187 ? 21.674  47.231 25.384 1.00 26.49 ? 187 LEU A CB  1 
ATOM   1479 C  CG  . LEU A 1 187 ? 22.854  47.841 24.631 1.00 29.74 ? 187 LEU A CG  1 
ATOM   1480 C  CD1 . LEU A 1 187 ? 24.149  47.545 25.384 1.00 27.73 ? 187 LEU A CD1 1 
ATOM   1481 C  CD2 . LEU A 1 187 ? 22.906  47.258 23.223 1.00 29.35 ? 187 LEU A CD2 1 
ATOM   1482 N  N   . LEU A 1 188 ? 21.562  50.069 27.340 1.00 25.37 ? 188 LEU A N   1 
ATOM   1483 C  CA  . LEU A 1 188 ? 21.119  51.456 27.355 1.00 25.71 ? 188 LEU A CA  1 
ATOM   1484 C  C   . LEU A 1 188 ? 21.177  52.028 25.949 1.00 27.58 ? 188 LEU A C   1 
ATOM   1485 O  O   . LEU A 1 188 ? 22.122  51.777 25.203 1.00 27.25 ? 188 LEU A O   1 
ATOM   1486 C  CB  . LEU A 1 188 ? 21.996  52.294 28.292 1.00 26.07 ? 188 LEU A CB  1 
ATOM   1487 C  CG  . LEU A 1 188 ? 21.698  52.125 29.783 1.00 26.35 ? 188 LEU A CG  1 
ATOM   1488 C  CD1 . LEU A 1 188 ? 22.740  52.855 30.613 1.00 24.10 ? 188 LEU A CD1 1 
ATOM   1489 C  CD2 . LEU A 1 188 ? 20.298  52.662 30.073 1.00 26.81 ? 188 LEU A CD2 1 
ATOM   1490 N  N   . ARG A 1 189 ? 20.157  52.796 25.592 1.00 28.01 ? 189 ARG A N   1 
ATOM   1491 C  CA  . ARG A 1 189 ? 20.082  53.405 24.274 1.00 29.21 ? 189 ARG A CA  1 
ATOM   1492 C  C   . ARG A 1 189 ? 19.945  54.918 24.426 1.00 27.49 ? 189 ARG A C   1 
ATOM   1493 O  O   . ARG A 1 189 ? 18.976  55.407 25.006 1.00 25.88 ? 189 ARG A O   1 
ATOM   1494 C  CB  . ARG A 1 189 ? 18.881  52.831 23.527 1.00 33.12 ? 189 ARG A CB  1 
ATOM   1495 C  CG  . ARG A 1 189 ? 18.848  53.112 22.041 1.00 40.89 ? 189 ARG A CG  1 
ATOM   1496 C  CD  . ARG A 1 189 ? 17.849  52.174 21.387 1.00 47.12 ? 189 ARG A CD  1 
ATOM   1497 N  NE  . ARG A 1 189 ? 17.767  52.340 19.941 1.00 51.88 ? 189 ARG A NE  1 
ATOM   1498 C  CZ  . ARG A 1 189 ? 17.037  51.560 19.149 1.00 55.10 ? 189 ARG A CZ  1 
ATOM   1499 N  NH1 . ARG A 1 189 ? 16.331  50.563 19.671 1.00 55.72 ? 189 ARG A NH1 1 
ATOM   1500 N  NH2 . ARG A 1 189 ? 17.011  51.774 17.839 1.00 56.40 ? 189 ARG A NH2 1 
ATOM   1501 N  N   . ASP A 1 190 ? 20.923  55.655 23.910 1.00 26.19 ? 190 ASP A N   1 
ATOM   1502 C  CA  . ASP A 1 190 ? 20.908  57.113 23.994 1.00 26.20 ? 190 ASP A CA  1 
ATOM   1503 C  C   . ASP A 1 190 ? 20.026  57.679 22.886 1.00 25.87 ? 190 ASP A C   1 
ATOM   1504 O  O   . ASP A 1 190 ? 20.332  57.525 21.702 1.00 24.79 ? 190 ASP A O   1 
ATOM   1505 C  CB  . ASP A 1 190 ? 22.326  57.659 23.841 1.00 28.71 ? 190 ASP A CB  1 
ATOM   1506 C  CG  . ASP A 1 190 ? 22.447  59.098 24.290 1.00 30.38 ? 190 ASP A CG  1 
ATOM   1507 O  OD1 . ASP A 1 190 ? 21.467  59.860 24.145 1.00 30.22 ? 190 ASP A OD1 1 
ATOM   1508 O  OD2 . ASP A 1 190 ? 23.531  59.470 24.779 1.00 34.45 ? 190 ASP A OD2 1 
ATOM   1509 N  N   . LEU A 1 191 ? 18.937  58.340 23.266 1.00 23.21 ? 191 LEU A N   1 
ATOM   1510 C  CA  . LEU A 1 191 ? 18.022  58.908 22.286 1.00 25.72 ? 191 LEU A CA  1 
ATOM   1511 C  C   . LEU A 1 191 ? 18.583  60.173 21.646 1.00 24.55 ? 191 LEU A C   1 
ATOM   1512 O  O   . LEU A 1 191 ? 17.926  60.817 20.831 1.00 26.29 ? 191 LEU A O   1 
ATOM   1513 C  CB  . LEU A 1 191 ? 16.662  59.178 22.936 1.00 25.94 ? 191 LEU A CB  1 
ATOM   1514 C  CG  . LEU A 1 191 ? 16.004  57.921 23.525 1.00 26.92 ? 191 LEU A CG  1 
ATOM   1515 C  CD1 . LEU A 1 191 ? 14.643  58.271 24.104 1.00 26.81 ? 191 LEU A CD1 1 
ATOM   1516 C  CD2 . LEU A 1 191 ? 15.861  56.856 22.442 1.00 26.84 ? 191 LEU A CD2 1 
ATOM   1517 N  N   . ASP A 1 192 ? 19.805  60.517 22.037 1.00 26.39 ? 192 ASP A N   1 
ATOM   1518 C  CA  . ASP A 1 192 ? 20.533  61.662 21.493 1.00 27.49 ? 192 ASP A CA  1 
ATOM   1519 C  C   . ASP A 1 192 ? 19.831  63.023 21.545 1.00 26.23 ? 192 ASP A C   1 
ATOM   1520 O  O   . ASP A 1 192 ? 19.844  63.778 20.568 1.00 26.06 ? 192 ASP A O   1 
ATOM   1521 C  CB  . ASP A 1 192 ? 20.951  61.331 20.051 1.00 30.19 ? 192 ASP A CB  1 
ATOM   1522 C  CG  . ASP A 1 192 ? 22.039  62.252 19.525 1.00 33.86 ? 192 ASP A CG  1 
ATOM   1523 O  OD1 . ASP A 1 192 ? 22.937  62.634 20.305 1.00 34.95 ? 192 ASP A OD1 1 
ATOM   1524 O  OD2 . ASP A 1 192 ? 22.006  62.577 18.321 1.00 37.98 ? 192 ASP A OD2 1 
ATOM   1525 N  N   . VAL A 1 193 ? 19.236  63.343 22.690 1.00 24.78 ? 193 VAL A N   1 
ATOM   1526 C  CA  . VAL A 1 193 ? 18.553  64.625 22.868 1.00 22.72 ? 193 VAL A CA  1 
ATOM   1527 C  C   . VAL A 1 193 ? 19.260  65.430 23.956 1.00 23.27 ? 193 VAL A C   1 
ATOM   1528 O  O   . VAL A 1 193 ? 18.694  66.358 24.529 1.00 23.16 ? 193 VAL A O   1 
ATOM   1529 C  CB  . VAL A 1 193 ? 17.079  64.423 23.278 1.00 22.73 ? 193 VAL A CB  1 
ATOM   1530 C  CG1 . VAL A 1 193 ? 16.304  63.790 22.137 1.00 21.75 ? 193 VAL A CG1 1 
ATOM   1531 C  CG2 . VAL A 1 193 ? 16.999  63.549 24.519 1.00 21.08 ? 193 VAL A CG2 1 
ATOM   1532 N  N   . THR A 1 194 ? 20.511  65.066 24.219 1.00 22.96 ? 194 THR A N   1 
ATOM   1533 C  CA  . THR A 1 194 ? 21.330  65.702 25.248 1.00 21.69 ? 194 THR A CA  1 
ATOM   1534 C  C   . THR A 1 194 ? 21.343  67.223 25.180 1.00 22.11 ? 194 THR A C   1 
ATOM   1535 O  O   . THR A 1 194 ? 21.732  67.806 24.169 1.00 20.93 ? 194 THR A O   1 
ATOM   1536 C  CB  . THR A 1 194 ? 22.762  65.169 25.166 1.00 23.48 ? 194 THR A CB  1 
ATOM   1537 O  OG1 . THR A 1 194 ? 22.721  63.739 25.243 1.00 24.03 ? 194 THR A OG1 1 
ATOM   1538 C  CG2 . THR A 1 194 ? 23.613  65.715 26.304 1.00 23.60 ? 194 THR A CG2 1 
ATOM   1539 N  N   . ALA A 1 195 ? 20.922  67.860 26.271 1.00 20.71 ? 195 ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 195 ? 20.860  69.316 26.341 1.00 22.43 ? 195 ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 195 ? 21.754  69.879 27.441 1.00 22.08 ? 195 ALA A C   1 
ATOM   1542 O  O   . ALA A 1 195 ? 21.695  69.434 28.587 1.00 18.64 ? 195 ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 195 ? 19.422  69.758 26.566 1.00 22.62 ? 195 ALA A CB  1 
ATOM   1544 N  N   . THR A 1 196 ? 22.570  70.868 27.081 1.00 22.74 ? 196 THR A N   1 
ATOM   1545 C  CA  . THR A 1 196 ? 23.488  71.513 28.017 1.00 24.78 ? 196 THR A CA  1 
ATOM   1546 C  C   . THR A 1 196 ? 23.113  72.972 28.272 1.00 25.23 ? 196 THR A C   1 
ATOM   1547 O  O   . THR A 1 196 ? 23.684  73.623 29.146 1.00 26.51 ? 196 THR A O   1 
ATOM   1548 C  CB  . THR A 1 196 ? 24.934  71.479 27.489 1.00 27.48 ? 196 THR A CB  1 
ATOM   1549 O  OG1 . THR A 1 196 ? 24.984  72.110 26.204 1.00 28.45 ? 196 THR A OG1 1 
ATOM   1550 C  CG2 . THR A 1 196 ? 25.426  70.045 27.366 1.00 28.02 ? 196 THR A CG2 1 
ATOM   1551 N  N   . ASN A 1 197 ? 22.164  73.483 27.494 1.00 25.43 ? 197 ASN A N   1 
ATOM   1552 C  CA  . ASN A 1 197 ? 21.694  74.857 27.637 1.00 25.63 ? 197 ASN A CA  1 
ATOM   1553 C  C   . ASN A 1 197 ? 20.399  75.054 26.850 1.00 25.56 ? 197 ASN A C   1 
ATOM   1554 O  O   . ASN A 1 197 ? 19.934  74.143 26.171 1.00 22.99 ? 197 ASN A O   1 
ATOM   1555 C  CB  . ASN A 1 197 ? 22.760  75.854 27.148 1.00 26.80 ? 197 ASN A CB  1 
ATOM   1556 C  CG  . ASN A 1 197 ? 23.175  75.617 25.702 1.00 29.48 ? 197 ASN A CG  1 
ATOM   1557 O  OD1 . ASN A 1 197 ? 22.332  75.437 24.821 1.00 28.22 ? 197 ASN A OD1 1 
ATOM   1558 N  ND2 . ASN A 1 197 ? 24.483  75.632 25.450 1.00 30.32 ? 197 ASN A ND2 1 
ATOM   1559 N  N   . ARG A 1 198 ? 19.822  76.247 26.944 1.00 28.33 ? 198 ARG A N   1 
ATOM   1560 C  CA  . ARG A 1 198 ? 18.577  76.560 26.251 1.00 29.54 ? 198 ARG A CA  1 
ATOM   1561 C  C   . ARG A 1 198 ? 18.609  76.291 24.750 1.00 28.54 ? 198 ARG A C   1 
ATOM   1562 O  O   . ARG A 1 198 ? 17.629  75.812 24.184 1.00 26.38 ? 198 ARG A O   1 
ATOM   1563 C  CB  . ARG A 1 198 ? 18.201  78.027 26.464 1.00 35.17 ? 198 ARG A CB  1 
ATOM   1564 C  CG  . ARG A 1 198 ? 17.573  78.357 27.807 1.00 42.79 ? 198 ARG A CG  1 
ATOM   1565 C  CD  . ARG A 1 198 ? 18.554  78.246 28.959 1.00 47.81 ? 198 ARG A CD  1 
ATOM   1566 N  NE  . ARG A 1 198 ? 18.070  78.987 30.121 1.00 53.63 ? 198 ARG A NE  1 
ATOM   1567 C  CZ  . ARG A 1 198 ? 17.918  80.308 30.148 1.00 56.17 ? 198 ARG A CZ  1 
ATOM   1568 N  NH1 . ARG A 1 198 ? 18.220  81.033 29.077 1.00 58.84 ? 198 ARG A NH1 1 
ATOM   1569 N  NH2 . ARG A 1 198 ? 17.453  80.906 31.237 1.00 58.04 ? 198 ARG A NH2 1 
ATOM   1570 N  N   . GLU A 1 199 ? 19.726  76.620 24.105 1.00 26.78 ? 199 GLU A N   1 
ATOM   1571 C  CA  . GLU A 1 199 ? 19.860  76.425 22.664 1.00 27.06 ? 199 GLU A CA  1 
ATOM   1572 C  C   . GLU A 1 199 ? 19.910  74.953 22.253 1.00 25.48 ? 199 GLU A C   1 
ATOM   1573 O  O   . GLU A 1 199 ? 19.170  74.532 21.359 1.00 24.20 ? 199 GLU A O   1 
ATOM   1574 C  CB  . GLU A 1 199 ? 21.108  77.153 22.138 1.00 31.62 ? 199 GLU A CB  1 
ATOM   1575 C  CG  . GLU A 1 199 ? 21.333  76.982 20.634 1.00 40.03 ? 199 GLU A CG  1 
ATOM   1576 C  CD  . GLU A 1 199 ? 22.483  77.825 20.092 1.00 45.38 ? 199 GLU A CD  1 
ATOM   1577 O  OE1 . GLU A 1 199 ? 23.633  77.639 20.550 1.00 47.45 ? 199 GLU A OE1 1 
ATOM   1578 O  OE2 . GLU A 1 199 ? 22.235  78.674 19.201 1.00 47.97 ? 199 GLU A OE2 1 
ATOM   1579 N  N   . THR A 1 200 ? 20.777  74.171 22.893 1.00 21.87 ? 200 THR A N   1 
ATOM   1580 C  CA  . THR A 1 200 ? 20.885  72.757 22.554 1.00 22.67 ? 200 THR A CA  1 
ATOM   1581 C  C   . THR A 1 200 ? 19.614  71.995 22.922 1.00 23.05 ? 200 THR A C   1 
ATOM   1582 O  O   . THR A 1 200 ? 19.306  70.971 22.314 1.00 23.09 ? 200 THR A O   1 
ATOM   1583 C  CB  . THR A 1 200 ? 22.110  72.093 23.230 1.00 22.01 ? 200 THR A CB  1 
ATOM   1584 O  OG1 . THR A 1 200 ? 22.044  72.267 24.651 1.00 22.28 ? 200 THR A OG1 1 
ATOM   1585 C  CG2 . THR A 1 200 ? 23.401  72.721 22.703 1.00 25.48 ? 200 THR A CG2 1 
ATOM   1586 N  N   . LEU A 1 201 ? 18.874  72.491 23.913 1.00 21.70 ? 201 LEU A N   1 
ATOM   1587 C  CA  . LEU A 1 201 ? 17.622  71.841 24.303 1.00 22.12 ? 201 LEU A CA  1 
ATOM   1588 C  C   . LEU A 1 201 ? 16.696  71.817 23.086 1.00 22.48 ? 201 LEU A C   1 
ATOM   1589 O  O   . LEU A 1 201 ? 16.184  70.767 22.696 1.00 21.08 ? 201 LEU A O   1 
ATOM   1590 C  CB  . LEU A 1 201 ? 16.933  72.613 25.437 1.00 20.87 ? 201 LEU A CB  1 
ATOM   1591 C  CG  . LEU A 1 201 ? 15.521  72.116 25.796 1.00 21.57 ? 201 LEU A CG  1 
ATOM   1592 C  CD1 . LEU A 1 201 ? 15.611  70.709 26.358 1.00 22.85 ? 201 LEU A CD1 1 
ATOM   1593 C  CD2 . LEU A 1 201 ? 14.861  73.057 26.804 1.00 19.50 ? 201 LEU A CD2 1 
ATOM   1594 N  N   . GLU A 1 202 ? 16.494  72.990 22.492 1.00 21.49 ? 202 GLU A N   1 
ATOM   1595 C  CA  . GLU A 1 202 ? 15.625  73.137 21.325 1.00 21.50 ? 202 GLU A CA  1 
ATOM   1596 C  C   . GLU A 1 202 ? 16.171  72.407 20.105 1.00 22.44 ? 202 GLU A C   1 
ATOM   1597 O  O   . GLU A 1 202 ? 15.430  71.755 19.370 1.00 22.03 ? 202 GLU A O   1 
ATOM   1598 C  CB  . GLU A 1 202 ? 15.457  74.615 20.969 1.00 22.34 ? 202 GLU A CB  1 
ATOM   1599 C  CG  . GLU A 1 202 ? 14.846  75.480 22.060 1.00 24.81 ? 202 GLU A CG  1 
ATOM   1600 C  CD  . GLU A 1 202 ? 13.472  74.998 22.492 1.00 27.37 ? 202 GLU A CD  1 
ATOM   1601 O  OE1 . GLU A 1 202 ? 12.705  74.508 21.629 1.00 24.16 ? 202 GLU A OE1 1 
ATOM   1602 O  OE2 . GLU A 1 202 ? 13.159  75.127 23.695 1.00 28.09 ? 202 GLU A OE2 1 
ATOM   1603 N  N   . GLN A 1 203 ? 17.474  72.518 19.891 1.00 22.58 ? 203 GLN A N   1 
ATOM   1604 C  CA  . GLN A 1 203 ? 18.094  71.879 18.742 1.00 25.67 ? 203 GLN A CA  1 
ATOM   1605 C  C   . GLN A 1 203 ? 18.064  70.357 18.796 1.00 24.48 ? 203 GLN A C   1 
ATOM   1606 O  O   . GLN A 1 203 ? 17.644  69.707 17.838 1.00 24.25 ? 203 GLN A O   1 
ATOM   1607 C  CB  . GLN A 1 203 ? 19.538  72.355 18.602 1.00 27.72 ? 203 GLN A CB  1 
ATOM   1608 C  CG  . GLN A 1 203 ? 20.249  71.790 17.394 1.00 34.89 ? 203 GLN A CG  1 
ATOM   1609 C  CD  . GLN A 1 203 ? 21.685  72.251 17.315 1.00 39.03 ? 203 GLN A CD  1 
ATOM   1610 O  OE1 . GLN A 1 203 ? 22.492  71.957 18.202 1.00 41.49 ? 203 GLN A OE1 1 
ATOM   1611 N  NE2 . GLN A 1 203 ? 22.015  72.982 16.257 1.00 40.60 ? 203 GLN A NE2 1 
ATOM   1612 N  N   . ARG A 1 204 ? 18.509  69.788 19.913 1.00 24.14 ? 204 ARG A N   1 
ATOM   1613 C  CA  . ARG A 1 204 ? 18.547  68.337 20.060 1.00 24.64 ? 204 ARG A CA  1 
ATOM   1614 C  C   . ARG A 1 204 ? 17.161  67.706 20.103 1.00 23.29 ? 204 ARG A C   1 
ATOM   1615 O  O   . ARG A 1 204 ? 16.991  66.555 19.709 1.00 22.14 ? 204 ARG A O   1 
ATOM   1616 C  CB  . ARG A 1 204 ? 19.337  67.957 21.314 1.00 27.48 ? 204 ARG A CB  1 
ATOM   1617 C  CG  . ARG A 1 204 ? 20.710  68.615 21.395 1.00 34.10 ? 204 ARG A CG  1 
ATOM   1618 C  CD  . ARG A 1 204 ? 21.547  68.341 20.159 1.00 39.37 ? 204 ARG A CD  1 
ATOM   1619 N  NE  . ARG A 1 204 ? 21.844  66.922 19.993 1.00 46.75 ? 204 ARG A NE  1 
ATOM   1620 C  CZ  . ARG A 1 204 ? 22.571  66.424 18.997 1.00 50.50 ? 204 ARG A CZ  1 
ATOM   1621 N  NH1 . ARG A 1 204 ? 23.080  67.232 18.074 1.00 52.52 ? 204 ARG A NH1 1 
ATOM   1622 N  NH2 . ARG A 1 204 ? 22.792  65.118 18.921 1.00 52.55 ? 204 ARG A NH2 1 
ATOM   1623 N  N   . TYR A 1 205 ? 16.174  68.455 20.586 1.00 22.22 ? 205 TYR A N   1 
ATOM   1624 C  CA  . TYR A 1 205 ? 14.806  67.951 20.643 1.00 22.40 ? 205 TYR A CA  1 
ATOM   1625 C  C   . TYR A 1 205 ? 14.340  67.663 19.217 1.00 22.79 ? 205 TYR A C   1 
ATOM   1626 O  O   . TYR A 1 205 ? 13.889  66.563 18.909 1.00 21.68 ? 205 TYR A O   1 
ATOM   1627 C  CB  . TYR A 1 205 ? 13.885  68.988 21.290 1.00 22.61 ? 205 TYR A CB  1 
ATOM   1628 C  CG  . TYR A 1 205 ? 12.418  68.651 21.189 1.00 22.81 ? 205 TYR A CG  1 
ATOM   1629 C  CD1 . TYR A 1 205 ? 11.884  67.542 21.851 1.00 22.29 ? 205 TYR A CD1 1 
ATOM   1630 C  CD2 . TYR A 1 205 ? 11.561  69.434 20.414 1.00 23.02 ? 205 TYR A CD2 1 
ATOM   1631 C  CE1 . TYR A 1 205 ? 10.526  67.222 21.739 1.00 23.45 ? 205 TYR A CE1 1 
ATOM   1632 C  CE2 . TYR A 1 205 ? 10.208  69.121 20.296 1.00 24.32 ? 205 TYR A CE2 1 
ATOM   1633 C  CZ  . TYR A 1 205 ? 9.698   68.016 20.959 1.00 23.57 ? 205 TYR A CZ  1 
ATOM   1634 O  OH  . TYR A 1 205 ? 8.363   67.714 20.828 1.00 24.79 ? 205 TYR A OH  1 
ATOM   1635 N  N   . ARG A 1 206 ? 14.456  68.665 18.351 1.00 23.15 ? 206 ARG A N   1 
ATOM   1636 C  CA  . ARG A 1 206 ? 14.065  68.522 16.953 1.00 26.11 ? 206 ARG A CA  1 
ATOM   1637 C  C   . ARG A 1 206 ? 14.901  67.415 16.306 1.00 27.59 ? 206 ARG A C   1 
ATOM   1638 O  O   . ARG A 1 206 ? 14.401  66.637 15.492 1.00 27.26 ? 206 ARG A O   1 
ATOM   1639 C  CB  . ARG A 1 206 ? 14.273  69.852 16.221 1.00 27.43 ? 206 ARG A CB  1 
ATOM   1640 C  CG  . ARG A 1 206 ? 13.308  70.947 16.671 1.00 29.16 ? 206 ARG A CG  1 
ATOM   1641 C  CD  . ARG A 1 206 ? 13.702  72.305 16.116 1.00 32.86 ? 206 ARG A CD  1 
ATOM   1642 N  NE  . ARG A 1 206 ? 12.636  73.298 16.232 1.00 34.92 ? 206 ARG A NE  1 
ATOM   1643 C  CZ  . ARG A 1 206 ? 12.208  73.828 17.374 1.00 37.94 ? 206 ARG A CZ  1 
ATOM   1644 N  NH1 . ARG A 1 206 ? 12.750  73.471 18.534 1.00 40.23 ? 206 ARG A NH1 1 
ATOM   1645 N  NH2 . ARG A 1 206 ? 11.230  74.723 17.354 1.00 38.11 ? 206 ARG A NH2 1 
ATOM   1646 N  N   . HIS A 1 207 ? 16.173  67.349 16.689 1.00 29.01 ? 207 HIS A N   1 
ATOM   1647 C  CA  . HIS A 1 207 ? 17.094  66.337 16.174 1.00 31.85 ? 207 HIS A CA  1 
ATOM   1648 C  C   . HIS A 1 207 ? 16.560  64.941 16.497 1.00 32.30 ? 207 HIS A C   1 
ATOM   1649 O  O   . HIS A 1 207 ? 16.489  64.073 15.627 1.00 32.64 ? 207 HIS A O   1 
ATOM   1650 C  CB  . HIS A 1 207 ? 18.477  66.516 16.813 1.00 32.72 ? 207 HIS A CB  1 
ATOM   1651 C  CG  . HIS A 1 207 ? 19.456  65.440 16.456 1.00 35.47 ? 207 HIS A CG  1 
ATOM   1652 N  ND1 . HIS A 1 207 ? 19.936  65.264 15.177 1.00 35.96 ? 207 HIS A ND1 1 
ATOM   1653 C  CD2 . HIS A 1 207 ? 20.031  64.473 17.209 1.00 36.61 ? 207 HIS A CD2 1 
ATOM   1654 C  CE1 . HIS A 1 207 ? 20.765  64.235 15.156 1.00 37.46 ? 207 HIS A CE1 1 
ATOM   1655 N  NE2 . HIS A 1 207 ? 20.840  63.737 16.377 1.00 39.02 ? 207 HIS A NE2 1 
ATOM   1656 N  N   . GLY A 1 208 ? 16.186  64.736 17.755 1.00 31.51 ? 208 GLY A N   1 
ATOM   1657 C  CA  . GLY A 1 208 ? 15.662  63.449 18.170 1.00 31.55 ? 208 GLY A CA  1 
ATOM   1658 C  C   . GLY A 1 208 ? 14.426  63.038 17.392 1.00 30.60 ? 208 GLY A C   1 
ATOM   1659 O  O   . GLY A 1 208 ? 14.304  61.885 16.976 1.00 29.96 ? 208 GLY A O   1 
ATOM   1660 N  N   . ILE A 1 209 ? 13.506  63.977 17.195 1.00 30.98 ? 209 ILE A N   1 
ATOM   1661 C  CA  . ILE A 1 209 ? 12.275  63.700 16.462 1.00 33.05 ? 209 ILE A CA  1 
ATOM   1662 C  C   . ILE A 1 209 ? 12.590  63.364 15.005 1.00 35.09 ? 209 ILE A C   1 
ATOM   1663 O  O   . ILE A 1 209 ? 11.962  62.482 14.408 1.00 34.38 ? 209 ILE A O   1 
ATOM   1664 C  CB  . ILE A 1 209 ? 11.314  64.915 16.495 1.00 33.40 ? 209 ILE A CB  1 
ATOM   1665 C  CG1 . ILE A 1 209 ? 10.968  65.275 17.943 1.00 33.59 ? 209 ILE A CG1 1 
ATOM   1666 C  CG2 . ILE A 1 209 ? 10.047  64.601 15.712 1.00 33.25 ? 209 ILE A CG2 1 
ATOM   1667 C  CD1 . ILE A 1 209 ? 10.312  64.151 18.717 1.00 35.47 ? 209 ILE A CD1 1 
ATOM   1668 N  N   . SER A 1 210 ? 13.568  64.070 14.443 1.00 35.97 ? 210 SER A N   1 
ATOM   1669 C  CA  . SER A 1 210 ? 13.981  63.861 13.058 1.00 38.19 ? 210 SER A CA  1 
ATOM   1670 C  C   . SER A 1 210 ? 14.579  62.469 12.846 1.00 39.46 ? 210 SER A C   1 
ATOM   1671 O  O   . SER A 1 210 ? 14.284  61.806 11.849 1.00 39.40 ? 210 SER A O   1 
ATOM   1672 C  CB  . SER A 1 210 ? 15.000  64.927 12.646 1.00 38.64 ? 210 SER A CB  1 
ATOM   1673 O  OG  . SER A 1 210 ? 15.360  64.787 11.282 1.00 40.29 ? 210 SER A OG  1 
ATOM   1674 N  N   . ASN A 1 211 ? 15.416  62.024 13.779 1.00 41.51 ? 211 ASN A N   1 
ATOM   1675 C  CA  . ASN A 1 211 ? 16.026  60.704 13.666 1.00 44.52 ? 211 ASN A CA  1 
ATOM   1676 C  C   . ASN A 1 211 ? 14.977  59.599 13.659 1.00 46.23 ? 211 ASN A C   1 
ATOM   1677 O  O   . ASN A 1 211 ? 15.265  58.468 13.269 1.00 45.64 ? 211 ASN A O   1 
ATOM   1678 C  CB  . ASN A 1 211 ? 17.008  60.455 14.811 1.00 46.43 ? 211 ASN A CB  1 
ATOM   1679 C  CG  . ASN A 1 211 ? 18.274  61.271 14.677 1.00 49.38 ? 211 ASN A CG  1 
ATOM   1680 O  OD1 . ASN A 1 211 ? 18.892  61.308 13.612 1.00 50.53 ? 211 ASN A OD1 1 
ATOM   1681 N  ND2 . ASN A 1 211 ? 18.675  61.925 15.762 1.00 51.95 ? 211 ASN A ND2 1 
ATOM   1682 N  N   . LEU A 1 212 ? 13.766  59.923 14.104 1.00 47.54 ? 212 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 212 ? 12.681  58.950 14.125 1.00 50.07 ? 212 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 212 ? 11.974  58.939 12.774 1.00 52.61 ? 212 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 212 ? 11.541  57.887 12.303 1.00 53.25 ? 212 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 212 ? 11.678  59.276 15.237 1.00 48.31 ? 212 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 212 ? 12.162  59.118 16.680 1.00 47.02 ? 212 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 212 ? 11.000  59.357 17.626 1.00 46.58 ? 212 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 212 ? 12.727  57.725 16.892 1.00 48.01 ? 212 LEU A CD2 1 
ATOM   1690 N  N   . LYS A 1 213 ? 11.856  60.113 12.159 1.00 55.46 ? 213 LYS A N   1 
ATOM   1691 C  CA  . LYS A 1 213 ? 11.224  60.228 10.849 1.00 58.66 ? 213 LYS A CA  1 
ATOM   1692 C  C   . LYS A 1 213 ? 11.931  59.277 9.892  1.00 61.34 ? 213 LYS A C   1 
ATOM   1693 O  O   . LYS A 1 213 ? 11.318  58.714 8.983  1.00 61.69 ? 213 LYS A O   1 
ATOM   1694 C  CB  . LYS A 1 213 ? 11.341  61.660 10.323 1.00 59.03 ? 213 LYS A CB  1 
ATOM   1695 C  CG  . LYS A 1 213 ? 10.335  62.637 10.908 1.00 59.18 ? 213 LYS A CG  1 
ATOM   1696 C  CD  . LYS A 1 213 ? 8.934   62.348 10.396 1.00 60.33 ? 213 LYS A CD  1 
ATOM   1697 C  CE  . LYS A 1 213 ? 7.945   63.414 10.844 1.00 61.82 ? 213 LYS A CE  1 
ATOM   1698 N  NZ  . LYS A 1 213 ? 6.571   63.160 10.318 1.00 62.09 ? 213 LYS A NZ  1 
ATOM   1699 N  N   . LEU A 1 214 ? 13.231  59.104 10.110 1.00 63.93 ? 214 LEU A N   1 
ATOM   1700 C  CA  . LEU A 1 214 ? 14.042  58.217 9.286  1.00 66.31 ? 214 LEU A CA  1 
ATOM   1701 C  C   . LEU A 1 214 ? 13.785  56.771 9.707  1.00 67.88 ? 214 LEU A C   1 
ATOM   1702 O  O   . LEU A 1 214 ? 13.248  55.975 8.934  1.00 68.62 ? 214 LEU A O   1 
ATOM   1703 C  CB  . LEU A 1 214 ? 15.527  58.550 9.461  1.00 65.92 ? 214 LEU A CB  1 
ATOM   1704 C  CG  . LEU A 1 214 ? 15.925  60.029 9.394  1.00 66.06 ? 214 LEU A CG  1 
ATOM   1705 C  CD1 . LEU A 1 214 ? 17.431  60.149 9.575  1.00 65.20 ? 214 LEU A CD1 1 
ATOM   1706 C  CD2 . LEU A 1 214 ? 15.493  60.637 8.067  1.00 65.89 ? 214 LEU A CD2 1 
ATOM   1707 N  N   . LYS A 1 215 ? 14.171  56.446 10.938 1.00 69.56 ? 215 LYS A N   1 
ATOM   1708 C  CA  . LYS A 1 215 ? 13.995  55.108 11.502 1.00 71.11 ? 215 LYS A CA  1 
ATOM   1709 C  C   . LYS A 1 215 ? 12.745  54.408 10.971 1.00 72.14 ? 215 LYS A C   1 
ATOM   1710 O  O   . LYS A 1 215 ? 12.884  53.292 10.426 1.00 73.21 ? 215 LYS A O   1 
ATOM   1711 C  CB  . LYS A 1 215 ? 13.924  55.197 13.030 1.00 71.07 ? 215 LYS A CB  1 
ATOM   1712 C  CG  . LYS A 1 215 ? 13.595  53.887 13.730 1.00 70.97 ? 215 LYS A CG  1 
ATOM   1713 C  CD  . LYS A 1 215 ? 13.314  54.124 15.206 1.00 70.26 ? 215 LYS A CD  1 
ATOM   1714 C  CE  . LYS A 1 215 ? 12.840  52.857 15.898 1.00 70.97 ? 215 LYS A CE  1 
ATOM   1715 N  NZ  . LYS A 1 215 ? 12.463  53.114 17.319 1.00 70.21 ? 215 LYS A NZ  1 
HETATM 1716 ZN ZN  . ZN  B 2 .   ? 7.562   51.585 33.320 1.00 20.29 ? 301 ZN  A ZN  1 
HETATM 1717 O  O   . HOH C 3 .   ? 12.863  51.362 34.845 1.00 14.29 ? 302 HOH A O   1 
HETATM 1718 O  O   . HOH C 3 .   ? 8.006   71.511 32.461 1.00 16.31 ? 303 HOH A O   1 
HETATM 1719 O  O   . HOH C 3 .   ? 6.283   64.558 37.064 1.00 13.91 ? 304 HOH A O   1 
HETATM 1720 O  O   . HOH C 3 .   ? 17.285  51.849 40.876 1.00 25.93 ? 305 HOH A O   1 
HETATM 1721 O  O   . HOH C 3 .   ? 20.176  62.176 25.265 1.00 21.86 ? 306 HOH A O   1 
HETATM 1722 O  O   . HOH C 3 .   ? 9.033   54.253 30.344 1.00 17.81 ? 307 HOH A O   1 
HETATM 1723 O  O   . HOH C 3 .   ? 7.804   72.849 34.832 1.00 16.87 ? 308 HOH A O   1 
HETATM 1724 O  O   . HOH C 3 .   ? 18.019  53.354 43.983 1.00 18.82 ? 309 HOH A O   1 
HETATM 1725 O  O   . HOH C 3 .   ? 10.042  65.279 46.285 1.00 15.06 ? 310 HOH A O   1 
HETATM 1726 O  O   . HOH C 3 .   ? 9.000   56.261 28.458 1.00 15.45 ? 311 HOH A O   1 
HETATM 1727 O  O   . HOH C 3 .   ? 4.400   65.288 31.200 1.00 23.92 ? 312 HOH A O   1 
HETATM 1728 O  O   . HOH C 3 .   ? 3.589   68.247 31.418 1.00 23.50 ? 313 HOH A O   1 
HETATM 1729 O  O   . HOH C 3 .   ? -5.591  57.668 30.781 1.00 25.47 ? 314 HOH A O   1 
HETATM 1730 O  O   . HOH C 3 .   ? 17.580  76.929 39.416 1.00 30.87 ? 315 HOH A O   1 
HETATM 1731 O  O   . HOH C 3 .   ? 16.155  51.691 36.271 1.00 25.71 ? 316 HOH A O   1 
HETATM 1732 O  O   . HOH C 3 .   ? 1.843   68.905 42.180 1.00 21.32 ? 317 HOH A O   1 
HETATM 1733 O  O   . HOH C 3 .   ? -3.569  59.962 38.622 1.00 23.33 ? 318 HOH A O   1 
HETATM 1734 O  O   . HOH C 3 .   ? 18.046  47.739 25.027 1.00 27.42 ? 319 HOH A O   1 
HETATM 1735 O  O   . HOH C 3 .   ? 11.854  45.309 27.314 1.00 34.88 ? 320 HOH A O   1 
HETATM 1736 O  O   . HOH C 3 .   ? 3.105   48.603 18.694 1.00 29.55 ? 321 HOH A O   1 
HETATM 1737 O  O   . HOH C 3 .   ? -0.130  50.286 18.241 1.00 36.99 ? 322 HOH A O   1 
HETATM 1738 O  O   . HOH C 3 .   ? 11.839  45.708 40.028 1.00 31.00 ? 323 HOH A O   1 
HETATM 1739 O  O   . HOH C 3 .   ? 14.703  53.840 34.702 1.00 30.90 ? 324 HOH A O   1 
HETATM 1740 O  O   . HOH C 3 .   ? 7.817   71.900 27.472 1.00 31.87 ? 325 HOH A O   1 
HETATM 1741 O  O   . HOH C 3 .   ? 0.336   66.875 29.148 1.00 41.17 ? 326 HOH A O   1 
HETATM 1742 O  O   . HOH C 3 .   ? 14.067  66.038 23.886 1.00 28.25 ? 327 HOH A O   1 
HETATM 1743 O  O   . HOH C 3 .   ? 10.410  77.542 29.353 1.00 41.98 ? 328 HOH A O   1 
HETATM 1744 O  O   . HOH C 3 .   ? 6.429   68.160 26.095 1.00 28.55 ? 329 HOH A O   1 
HETATM 1745 O  O   . HOH C 3 .   ? 25.734  71.546 38.351 1.00 31.70 ? 330 HOH A O   1 
HETATM 1746 O  O   . HOH C 3 .   ? 20.337  65.015 50.873 1.00 30.69 ? 331 HOH A O   1 
HETATM 1747 O  O   . HOH C 3 .   ? 21.879  54.155 45.063 1.00 41.52 ? 332 HOH A O   1 
HETATM 1748 O  O   . HOH C 3 .   ? 10.963  46.811 30.347 1.00 34.47 ? 333 HOH A O   1 
HETATM 1749 O  O   . HOH C 3 .   ? 16.515  68.009 24.122 1.00 22.36 ? 334 HOH A O   1 
HETATM 1750 O  O   . HOH C 3 .   ? 9.571   78.193 32.465 1.00 34.69 ? 335 HOH A O   1 
HETATM 1751 O  O   . HOH C 3 .   ? -1.239  66.654 22.425 1.00 33.40 ? 336 HOH A O   1 
HETATM 1752 O  O   . HOH C 3 .   ? 22.546  60.160 47.176 1.00 37.58 ? 337 HOH A O   1 
HETATM 1753 O  O   . HOH C 3 .   ? 6.668   48.370 19.681 1.00 30.72 ? 338 HOH A O   1 
HETATM 1754 O  O   . HOH C 3 .   ? 11.683  78.105 40.002 1.00 45.21 ? 339 HOH A O   1 
HETATM 1755 O  O   . HOH C 3 .   ? 15.156  77.075 41.260 1.00 42.29 ? 340 HOH A O   1 
HETATM 1756 O  O   . HOH C 3 .   ? 23.802  62.168 23.365 1.00 36.87 ? 341 HOH A O   1 
HETATM 1757 O  O   . HOH C 3 .   ? 26.665  46.196 36.900 1.00 53.50 ? 342 HOH A O   1 
HETATM 1758 O  O   . HOH C 3 .   ? 4.775   49.733 26.587 1.00 40.55 ? 343 HOH A O   1 
HETATM 1759 O  O   . HOH C 3 .   ? 22.252  43.416 22.018 1.00 53.34 ? 344 HOH A O   1 
HETATM 1760 O  O   . HOH C 3 .   ? 27.403  66.735 42.911 1.00 35.64 ? 345 HOH A O   1 
HETATM 1761 O  O   . HOH C 3 .   ? 21.995  37.533 53.286 1.00 41.31 ? 346 HOH A O   1 
HETATM 1762 O  O   . HOH C 3 .   ? 20.880  69.418 52.271 1.00 40.14 ? 347 HOH A O   1 
HETATM 1763 O  O   . HOH C 3 .   ? -9.280  54.757 41.880 1.00 25.16 ? 348 HOH A O   1 
HETATM 1764 O  O   . HOH C 3 .   ? 27.131  69.001 33.044 1.00 31.84 ? 349 HOH A O   1 
HETATM 1765 O  O   . HOH C 3 .   ? 17.599  43.173 59.492 1.00 33.84 ? 350 HOH A O   1 
HETATM 1766 O  O   . HOH C 3 .   ? 6.089   46.416 37.028 1.00 39.62 ? 351 HOH A O   1 
HETATM 1767 O  O   . HOH C 3 .   ? 12.547  53.468 33.403 1.00 38.30 ? 352 HOH A O   1 
HETATM 1768 O  O   . HOH C 3 .   ? 14.826  76.318 25.696 1.00 35.79 ? 353 HOH A O   1 
HETATM 1769 O  O   . HOH C 3 .   ? 32.305  52.068 57.789 1.00 34.50 ? 354 HOH A O   1 
HETATM 1770 O  O   . HOH C 3 .   ? 4.704   45.575 11.999 1.00 40.53 ? 355 HOH A O   1 
HETATM 1771 O  O   . HOH C 3 .   ? 6.888   46.831 32.632 1.00 38.21 ? 356 HOH A O   1 
HETATM 1772 O  O   . HOH C 3 .   ? 9.372   44.628 31.438 1.00 49.33 ? 357 HOH A O   1 
HETATM 1773 O  O   . HOH C 3 .   ? 31.976  50.320 55.632 1.00 40.59 ? 358 HOH A O   1 
HETATM 1774 O  O   . HOH C 3 .   ? 4.024   66.965 28.081 1.00 47.08 ? 359 HOH A O   1 
HETATM 1775 O  O   . HOH C 3 .   ? 2.274   47.526 10.227 1.00 45.34 ? 360 HOH A O   1 
HETATM 1776 O  O   . HOH C 3 .   ? -3.666  67.030 23.557 1.00 40.28 ? 361 HOH A O   1 
HETATM 1777 O  O   . HOH C 3 .   ? 19.216  46.702 21.893 1.00 45.88 ? 362 HOH A O   1 
HETATM 1778 O  O   . HOH C 3 .   ? 13.192  50.942 19.135 1.00 50.28 ? 363 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  MET 17  17  17  MET MET A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  HIS 63  63  63  HIS HIS A . n 
A 1 64  ARG 64  64  64  ARG ARG A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  VAL 81  81  81  VAL VAL A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  TYR 83  83  83  TYR TYR A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 TRP 127 127 127 TRP TRP A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 MET 137 137 137 MET MET A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 CYS 147 147 147 CYS CYS A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 GLN 154 154 154 GLN GLN A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 HIS 160 160 160 HIS HIS A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 TRP 168 168 168 TRP TRP A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 TYR 181 181 181 TYR TYR A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 HIS 184 184 184 HIS HIS A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 ASN 197 197 197 ASN ASN A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 GLN 203 203 203 GLN GLN A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 TYR 205 205 205 TYR TYR A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 ASN 211 211 211 ASN ASN A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 LYS 213 213 213 LYS LYS A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 LYS 215 215 215 LYS LYS A . n 
A 1 216 HIS 216 216 ?   ?   ?   A . n 
A 1 217 ALA 217 217 ?   ?   ?   A . n 
A 1 218 ASN 218 218 ?   ?   ?   A . n 
A 1 219 HIS 219 219 ?   ?   ?   A . n 
A 1 220 LYS 220 220 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 15570 ? 
1 MORE         -83   ? 
1 'SSA (A^2)'  33060 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_575 -x,-y+2,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 137.0700000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 7_466 y-1,x+1,-z+1   0.0000000000  1.0000000000  0.0000000000 -68.5350000000 1.0000000000  
0.0000000000  0.0000000000 68.5350000000  0.0000000000 0.0000000000 -1.0000000000 85.8770000000 
4 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+1 0.0000000000  -1.0000000000 0.0000000000 68.5350000000  -1.0000000000 
0.0000000000  0.0000000000 68.5350000000  0.0000000000 0.0000000000 -1.0000000000 85.8770000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 101 ? A CYS 101 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 44 ? A ASP 44 ? 1_555 112.2 ? 
2 SG  ? A CYS 101 ? A CYS 101 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 98 ? A HIS 98 ? 1_555 108.1 ? 
3 OD2 ? A ASP 44  ? A ASP 44  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 98 ? A HIS 98 ? 1_555 100.3 ? 
4 SG  ? A CYS 101 ? A CYS 101 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG  ? A CYS 42 ? A CYS 42 ? 1_555 113.3 ? 
5 OD2 ? A ASP 44  ? A ASP 44  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG  ? A CYS 42 ? A CYS 42 ? 1_555 99.8  ? 
6 NE2 ? A HIS 98  ? A HIS 98  ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG  ? A CYS 42 ? A CYS 42 ? 1_555 121.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-05-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
EPMR      phasing          .   ? 1 
CNS       refinement       1.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_database_remark.id     99 
_pdbx_database_remark.text   
;DENSITY FOR THE FOLLOWING ATOMS WITHIN THE MAIN CHAIN
IS RELATIVELY WEAK AND LIKELY REFLECTS INCREASED LOCAL
CONFORMATIONAL FLEXIBILITY OF THE MAIN CHAIN IN THIS
REGION.
GLN A 31 CA
ALA A 32 N
ALA A 32 CA

DENSITY FOR THE SIDE CHAINS OF THE LISTED RESIDUES IS   
RELATIVELY POORLY DEFINED.  THE MODEL REPRESENTS THE 
MOST PROBABLE CONFORMATIONS FOR THESE RESIDUES BASED 
ON THE OBSERVED DENSITY.
GLU A    20
GLU A    21
LYS A    28
LEU A    29
GLN A    31
ALA A    32
GLN A    33
LYS A    34
GLU A   112
GLU A   140
ARG A   141
LYS A   169
LYS A   173
ARG A   189
ARG A   198
GLU A   199
LYS A   213
LEU A   214
LYS A   215
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 21  ? ? -151.41 -31.31 
2 1 ASP A 22  ? ? -168.13 67.28  
3 1 ALA A 32  ? ? -52.75  87.51  
4 1 SER A 45  ? ? 39.78   53.28  
5 1 ASP A 185 ? ? -150.25 -2.91  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A HIS 216 ? A HIS 216 
3 1 Y 1 A ALA 217 ? A ALA 217 
4 1 Y 1 A ASN 218 ? A ASN 218 
5 1 Y 1 A HIS 219 ? A HIS 219 
6 1 Y 1 A LYS 220 ? A LYS 220 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  301 221 ZN  ZN2 A . 
C 3 HOH 1  302 1   HOH WAT A . 
C 3 HOH 2  303 2   HOH WAT A . 
C 3 HOH 3  304 3   HOH WAT A . 
C 3 HOH 4  305 4   HOH WAT A . 
C 3 HOH 5  306 5   HOH WAT A . 
C 3 HOH 6  307 6   HOH WAT A . 
C 3 HOH 7  308 7   HOH WAT A . 
C 3 HOH 8  309 8   HOH WAT A . 
C 3 HOH 9  310 9   HOH WAT A . 
C 3 HOH 10 311 10  HOH WAT A . 
C 3 HOH 11 312 11  HOH WAT A . 
C 3 HOH 12 313 12  HOH WAT A . 
C 3 HOH 13 314 13  HOH WAT A . 
C 3 HOH 14 315 14  HOH WAT A . 
C 3 HOH 15 316 15  HOH WAT A . 
C 3 HOH 16 317 16  HOH WAT A . 
C 3 HOH 17 318 17  HOH WAT A . 
C 3 HOH 18 319 18  HOH WAT A . 
C 3 HOH 19 320 19  HOH WAT A . 
C 3 HOH 20 321 20  HOH WAT A . 
C 3 HOH 21 322 21  HOH WAT A . 
C 3 HOH 22 323 22  HOH WAT A . 
C 3 HOH 23 324 23  HOH WAT A . 
C 3 HOH 24 325 24  HOH WAT A . 
C 3 HOH 25 326 25  HOH WAT A . 
C 3 HOH 26 327 26  HOH WAT A . 
C 3 HOH 27 328 27  HOH WAT A . 
C 3 HOH 28 329 28  HOH WAT A . 
C 3 HOH 29 330 29  HOH WAT A . 
C 3 HOH 30 331 30  HOH WAT A . 
C 3 HOH 31 332 31  HOH WAT A . 
C 3 HOH 32 333 32  HOH WAT A . 
C 3 HOH 33 334 33  HOH WAT A . 
C 3 HOH 34 335 34  HOH WAT A . 
C 3 HOH 35 336 35  HOH WAT A . 
C 3 HOH 36 337 36  HOH WAT A . 
C 3 HOH 37 338 37  HOH WAT A . 
C 3 HOH 38 339 38  HOH WAT A . 
C 3 HOH 39 340 39  HOH WAT A . 
C 3 HOH 40 341 40  HOH WAT A . 
C 3 HOH 41 342 41  HOH WAT A . 
C 3 HOH 42 343 42  HOH WAT A . 
C 3 HOH 43 344 43  HOH WAT A . 
C 3 HOH 44 345 44  HOH WAT A . 
C 3 HOH 45 346 45  HOH WAT A . 
C 3 HOH 46 347 46  HOH WAT A . 
C 3 HOH 47 348 47  HOH WAT A . 
C 3 HOH 48 349 48  HOH WAT A . 
C 3 HOH 49 350 49  HOH WAT A . 
C 3 HOH 50 351 50  HOH WAT A . 
C 3 HOH 51 352 51  HOH WAT A . 
C 3 HOH 52 353 52  HOH WAT A . 
C 3 HOH 53 354 53  HOH WAT A . 
C 3 HOH 54 355 54  HOH WAT A . 
C 3 HOH 55 356 55  HOH WAT A . 
C 3 HOH 56 357 56  HOH WAT A . 
C 3 HOH 57 358 57  HOH WAT A . 
C 3 HOH 58 359 58  HOH WAT A . 
C 3 HOH 59 360 59  HOH WAT A . 
C 3 HOH 60 361 60  HOH WAT A . 
C 3 HOH 61 362 61  HOH WAT A . 
C 3 HOH 62 363 62  HOH WAT A . 
#