data_1I7H
# 
_entry.id   1I7H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I7H         
RCSB  RCSB013000   
WWPDB D_1000013000 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I7H 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kakuta, Y.'    1 
'Horio, T.'     2 
'Takahashi, Y.' 3 
'Fukuyama, K.'  4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of Escherichia coli Fdx, an adrenodoxin-type ferredoxin involved in the assembly of iron-sulfur clusters.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                11007 
_citation.page_last                 11012 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11551196 
_citation.pdbx_database_id_DOI      10.1021/bi010544t 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kakuta, Y.'    1 
primary 'Horio, T.'     2 
primary 'Takahashi, Y.' 3 
primary 'Fukuyama, K.'  4 
# 
_cell.entry_id           1I7H 
_cell.length_a           107.501 
_cell.length_b           107.501 
_cell.length_c           85.682 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              27 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I7H 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man FERREDOXIN                   12344.811 3   ? ? ? ? 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820   3   ? ? ? ? 
3 water       nat water                        18.015    155 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE
PESRLSCQARVTDEDLVVEIPRYTINHAREH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE
PESRLSCQARVTDEDLVVEIPRYTINHAREH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   LYS n 
1 4   ILE n 
1 5   VAL n 
1 6   ILE n 
1 7   LEU n 
1 8   PRO n 
1 9   HIS n 
1 10  GLN n 
1 11  ASP n 
1 12  LEU n 
1 13  CYS n 
1 14  PRO n 
1 15  ASP n 
1 16  GLY n 
1 17  ALA n 
1 18  VAL n 
1 19  LEU n 
1 20  GLU n 
1 21  ALA n 
1 22  ASN n 
1 23  SER n 
1 24  GLY n 
1 25  GLU n 
1 26  THR n 
1 27  ILE n 
1 28  LEU n 
1 29  ASP n 
1 30  ALA n 
1 31  ALA n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  GLY n 
1 36  ILE n 
1 37  GLU n 
1 38  ILE n 
1 39  GLU n 
1 40  HIS n 
1 41  ALA n 
1 42  CYS n 
1 43  GLU n 
1 44  LYS n 
1 45  SER n 
1 46  CYS n 
1 47  ALA n 
1 48  CYS n 
1 49  THR n 
1 50  THR n 
1 51  CYS n 
1 52  HIS n 
1 53  CYS n 
1 54  ILE n 
1 55  VAL n 
1 56  ARG n 
1 57  GLU n 
1 58  GLY n 
1 59  PHE n 
1 60  ASP n 
1 61  SER n 
1 62  LEU n 
1 63  PRO n 
1 64  GLU n 
1 65  SER n 
1 66  SER n 
1 67  GLU n 
1 68  GLN n 
1 69  GLU n 
1 70  ASP n 
1 71  ASP n 
1 72  MET n 
1 73  LEU n 
1 74  ASP n 
1 75  LYS n 
1 76  ALA n 
1 77  TRP n 
1 78  GLY n 
1 79  LEU n 
1 80  GLU n 
1 81  PRO n 
1 82  GLU n 
1 83  SER n 
1 84  ARG n 
1 85  LEU n 
1 86  SER n 
1 87  CYS n 
1 88  GLN n 
1 89  ALA n 
1 90  ARG n 
1 91  VAL n 
1 92  THR n 
1 93  ASP n 
1 94  GLU n 
1 95  ASP n 
1 96  LEU n 
1 97  VAL n 
1 98  VAL n 
1 99  GLU n 
1 100 ILE n 
1 101 PRO n 
1 102 ARG n 
1 103 TYR n 
1 104 THR n 
1 105 ILE n 
1 106 ASN n 
1 107 HIS n 
1 108 ALA n 
1 109 ARG n 
1 110 GLU n 
1 111 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FER_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFDSLPESSEQEDDMLDKAWGLE
PESRLSCQARVTDEDLVVEIPRYTINHAREH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P0A9R4 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I7H A 1 ? 111 ? P0A9R4 1 ? 111 ? 1 111 
2 1 1I7H B 1 ? 111 ? P0A9R4 1 ? 111 ? 1 111 
3 1 1I7H C 1 ? 111 ? P0A9R4 1 ? 111 ? 1 111 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'   121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'         175.820 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I7H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.17 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           140 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    CRYSTAL 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1 
# 
_reflns.entry_id                     1I7H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.6 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   155486 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.0660000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.4 
_reflns.B_iso_Wilson_estimate        22.0 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.2730000 
_reflns_shell.pdbx_Rsym_value        0.2730000 
_reflns_shell.meanI_over_sigI_obs    1.2 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5936 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1I7H 
_refine.ls_number_reflns_obs                     71758 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               1247563.08 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             19.57 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    88.3 
_refine.ls_R_factor_obs                          0.2640000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2620000 
_refine.ls_R_factor_R_free                       0.2820000 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.5 
_refine.ls_number_reflns_R_free                  6834 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.0 
_refine.aniso_B[1][1]                            -3.82 
_refine.aniso_B[2][2]                            -3.82 
_refine.aniso_B[3][3]                            7.64 
_refine.aniso_B[1][2]                            -0.69 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.427 
_refine.solvent_model_param_bsol                 49.49 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I7H 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.30 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2498 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             155 
_refine_hist.number_atoms_total               2665 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        19.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.74  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.81 
_refine_ls_shell.number_reflns_R_work             9019 
_refine_ls_shell.R_factor_R_work                  0.3440000 
_refine_ls_shell.percent_reflns_obs               73.4 
_refine_ls_shell.R_factor_R_free                  0.3370000 
_refine_ls_shell.R_factor_R_free_error            0.011 
_refine_ls_shell.percent_reflns_R_free            9.1 
_refine_ls_shell.number_reflns_R_free             898 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 FES.PARAM         FES.TOP     'X-RAY DIFFRACTION' 
3 WATER.PARAM       ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1I7H 
_struct.title                     'CRYSTAL STURCUTURE OF FDX' 
_struct.pdbx_descriptor           'FERREDOXIN, FE2/S2 (INORGANIC) CLUSTER' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I7H 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            '2FE-2S, Electron transport' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 26 ? ASN A 34 ? THR A 26 ASN A 34 1 ? 9 
HELX_P HELX_P2 2 GLY A 58 ? LEU A 62 ? GLY A 58 LEU A 62 5 ? 5 
HELX_P HELX_P3 3 SER A 66 ? ASP A 74 ? SER A 66 ASP A 74 1 ? 9 
HELX_P HELX_P4 4 THR B 26 ? ARG B 33 ? THR B 26 ARG B 33 1 ? 8 
HELX_P HELX_P5 5 GLY B 58 ? LEU B 62 ? GLY B 58 LEU B 62 5 ? 5 
HELX_P HELX_P6 6 SER B 66 ? ASP B 74 ? SER B 66 ASP B 74 1 ? 9 
HELX_P HELX_P7 7 THR C 26 ? ASN C 34 ? THR C 26 ASN C 34 1 ? 9 
HELX_P HELX_P8 8 GLY C 58 ? LEU C 62 ? GLY C 58 LEU C 62 5 ? 5 
HELX_P HELX_P9 9 SER C 66 ? ASP C 74 ? SER C 66 ASP C 74 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D FES . FE1 ? ? ? 1_555 A CYS 42 SG ? ? A FES 1112 A CYS 42 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc2  metalc ? ? D FES . FE1 ? ? ? 1_555 A CYS 48 SG ? ? A FES 1112 A CYS 48 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc3  metalc ? ? D FES . FE2 ? ? ? 1_555 A CYS 51 SG ? ? A FES 1112 A CYS 51 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc4  metalc ? ? D FES . FE2 ? ? ? 1_555 A CYS 87 SG ? ? A FES 1112 A CYS 87 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc5  metalc ? ? E FES . FE1 ? ? ? 1_555 B CYS 42 SG ? ? B FES 2112 B CYS 42 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc6  metalc ? ? E FES . FE1 ? ? ? 1_555 B CYS 48 SG ? ? B FES 2112 B CYS 48 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc7  metalc ? ? E FES . FE2 ? ? ? 1_555 B CYS 87 SG ? ? B FES 2112 B CYS 87 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc8  metalc ? ? E FES . FE2 ? ? ? 1_555 B CYS 51 SG ? ? B FES 2112 B CYS 51 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc9  metalc ? ? F FES . FE1 ? ? ? 1_555 C CYS 48 SG ? ? C FES 3112 C CYS 48 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc10 metalc ? ? F FES . FE2 ? ? ? 1_555 C CYS 51 SG ? ? C FES 3112 C CYS 51 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc11 metalc ? ? F FES . FE2 ? ? ? 1_555 C CYS 87 SG ? ? C FES 3112 C CYS 87 1_555 ? ? ? ? ? ? ? 2.407 ? 
metalc12 metalc ? ? F FES . FE1 ? ? ? 1_555 C CYS 42 SG ? ? C FES 3112 C CYS 42 1_555 ? ? ? ? ? ? ? 2.425 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 17 ? GLU A 20 ? ALA A 17 GLU A 20 
A 2 LYS A 3  ? ILE A 6  ? LYS A 3  ILE A 6  
A 3 LEU A 96 ? GLU A 99 ? LEU A 96 GLU A 99 
A 4 HIS A 52 ? GLU A 57 ? HIS A 52 GLU A 57 
A 5 SER A 83 ? LEU A 85 ? SER A 83 LEU A 85 
B 1 ALA B 17 ? GLU B 20 ? ALA B 17 GLU B 20 
B 2 LYS B 3  ? ILE B 6  ? LYS B 3  ILE B 6  
B 3 LEU B 96 ? GLU B 99 ? LEU B 96 GLU B 99 
B 4 HIS B 52 ? GLU B 57 ? HIS B 52 GLU B 57 
B 5 SER B 83 ? LEU B 85 ? SER B 83 LEU B 85 
C 1 ALA C 17 ? GLU C 20 ? ALA C 17 GLU C 20 
C 2 LYS C 3  ? ILE C 6  ? LYS C 3  ILE C 6  
C 3 LEU C 96 ? GLU C 99 ? LEU C 96 GLU C 99 
C 4 HIS C 52 ? GLU C 57 ? HIS C 52 GLU C 57 
C 5 SER C 83 ? LEU C 85 ? SER C 83 LEU C 85 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 19 ? N LEU A 19 O ILE A 4  ? O ILE A 4  
A 2 3 N VAL A 5  ? N VAL A 5  O LEU A 96 ? O LEU A 96 
A 3 4 N GLU A 99 ? N GLU A 99 O ILE A 54 ? O ILE A 54 
A 4 5 O CYS A 53 ? O CYS A 53 N ARG A 84 ? N ARG A 84 
B 1 2 N LEU B 19 ? N LEU B 19 O ILE B 4  ? O ILE B 4  
B 2 3 O LYS B 3  ? O LYS B 3  N LEU B 96 ? N LEU B 96 
B 3 4 N GLU B 99 ? N GLU B 99 O ILE B 54 ? O ILE B 54 
B 4 5 O CYS B 53 ? O CYS B 53 N ARG B 84 ? N ARG B 84 
C 1 2 O LEU C 19 ? O LEU C 19 N ILE C 4  ? N ILE C 4  
C 2 3 O LYS C 3  ? O LYS C 3  N LEU C 96 ? N LEU C 96 
C 3 4 N GLU C 99 ? N GLU C 99 O ILE C 54 ? O ILE C 54 
C 4 5 O CYS C 53 ? O CYS C 53 N ARG C 84 ? N ARG C 84 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FES A 1112' 
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE FES B 2112' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE FES C 3112' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 HIS A 40 ? HIS A 40 . ? 1_555 ? 
2  AC1 8 CYS A 42 ? CYS A 42 . ? 1_555 ? 
3  AC1 8 LYS A 44 ? LYS A 44 . ? 1_555 ? 
4  AC1 8 CYS A 46 ? CYS A 46 . ? 1_555 ? 
5  AC1 8 ALA A 47 ? ALA A 47 . ? 1_555 ? 
6  AC1 8 CYS A 48 ? CYS A 48 . ? 1_555 ? 
7  AC1 8 CYS A 51 ? CYS A 51 . ? 1_555 ? 
8  AC1 8 CYS A 87 ? CYS A 87 . ? 1_555 ? 
9  AC2 9 HIS B 40 ? HIS B 40 . ? 1_555 ? 
10 AC2 9 CYS B 42 ? CYS B 42 . ? 1_555 ? 
11 AC2 9 LYS B 44 ? LYS B 44 . ? 1_555 ? 
12 AC2 9 CYS B 46 ? CYS B 46 . ? 1_555 ? 
13 AC2 9 ALA B 47 ? ALA B 47 . ? 1_555 ? 
14 AC2 9 CYS B 48 ? CYS B 48 . ? 1_555 ? 
15 AC2 9 CYS B 51 ? CYS B 51 . ? 1_555 ? 
16 AC2 9 LEU B 85 ? LEU B 85 . ? 1_555 ? 
17 AC2 9 CYS B 87 ? CYS B 87 . ? 1_555 ? 
18 AC3 7 HIS C 40 ? HIS C 40 . ? 1_555 ? 
19 AC3 7 CYS C 42 ? CYS C 42 . ? 1_555 ? 
20 AC3 7 LYS C 44 ? LYS C 44 . ? 1_555 ? 
21 AC3 7 CYS C 46 ? CYS C 46 . ? 1_555 ? 
22 AC3 7 CYS C 48 ? CYS C 48 . ? 1_555 ? 
23 AC3 7 CYS C 51 ? CYS C 51 . ? 1_555 ? 
24 AC3 7 CYS C 87 ? CYS C 87 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1I7H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I7H 
_atom_sites.fract_transf_matrix[1][1]   0.009302 
_atom_sites.fract_transf_matrix[1][2]   0.005371 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010741 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011671 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 2   ? 52.304 20.222 11.349  1.00 25.27 ? 2    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 2   ? 51.367 19.409 10.542  1.00 25.82 ? 2    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 2   ? 50.044 20.130 10.290  1.00 25.10 ? 2    PRO A C   1 
ATOM   4    O  O   . PRO A 1 2   ? 49.686 21.060 11.013  1.00 25.48 ? 2    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 2   ? 51.130 18.122 11.320  1.00 25.01 ? 2    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 2   ? 52.429 17.998 12.096  1.00 27.17 ? 2    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 2   ? 52.740 19.445 12.526  1.00 27.32 ? 2    PRO A CD  1 
ATOM   8    N  N   . LYS A 1 3   ? 49.323 19.692 9.262   1.00 23.25 ? 3    LYS A N   1 
ATOM   9    C  CA  . LYS A 1 3   ? 48.033 20.284 8.924   1.00 22.62 ? 3    LYS A CA  1 
ATOM   10   C  C   . LYS A 1 3   ? 46.893 19.659 9.731   1.00 22.57 ? 3    LYS A C   1 
ATOM   11   O  O   . LYS A 1 3   ? 46.851 18.444 9.926   1.00 21.24 ? 3    LYS A O   1 
ATOM   12   C  CB  . LYS A 1 3   ? 47.722 20.087 7.443   1.00 23.90 ? 3    LYS A CB  1 
ATOM   13   C  CG  . LYS A 1 3   ? 48.646 20.804 6.475   1.00 27.12 ? 3    LYS A CG  1 
ATOM   14   C  CD  . LYS A 1 3   ? 48.227 20.486 5.041   1.00 29.10 ? 3    LYS A CD  1 
ATOM   15   C  CE  . LYS A 1 3   ? 49.133 21.158 4.021   1.00 31.47 ? 3    LYS A CE  1 
ATOM   16   N  NZ  . LYS A 1 3   ? 48.984 22.631 4.027   1.00 34.48 ? 3    LYS A NZ  1 
ATOM   17   N  N   . ILE A 1 4   ? 45.972 20.500 10.191  1.00 22.40 ? 4    ILE A N   1 
ATOM   18   C  CA  . ILE A 1 4   ? 44.797 20.044 10.935  1.00 21.63 ? 4    ILE A CA  1 
ATOM   19   C  C   . ILE A 1 4   ? 43.587 20.509 10.155  1.00 22.45 ? 4    ILE A C   1 
ATOM   20   O  O   . ILE A 1 4   ? 43.403 21.709 9.940   1.00 23.61 ? 4    ILE A O   1 
ATOM   21   C  CB  . ILE A 1 4   ? 44.679 20.677 12.335  1.00 22.28 ? 4    ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 4   ? 45.841 20.248 13.222  1.00 21.62 ? 4    ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 4   ? 43.351 20.251 12.982  1.00 22.57 ? 4    ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 4   ? 45.764 20.839 14.622  1.00 22.30 ? 4    ILE A CD1 1 
ATOM   25   N  N   . VAL A 1 5   ? 42.765 19.568 9.716   1.00 21.18 ? 5    VAL A N   1 
ATOM   26   C  CA  . VAL A 1 5   ? 41.568 19.932 8.984   1.00 21.38 ? 5    VAL A CA  1 
ATOM   27   C  C   . VAL A 1 5   ? 40.415 19.938 9.971   1.00 21.12 ? 5    VAL A C   1 
ATOM   28   O  O   . VAL A 1 5   ? 40.211 18.967 10.690  1.00 20.12 ? 5    VAL A O   1 
ATOM   29   C  CB  . VAL A 1 5   ? 41.270 18.923 7.851   1.00 21.76 ? 5    VAL A CB  1 
ATOM   30   C  CG1 . VAL A 1 5   ? 39.868 19.162 7.280   1.00 23.23 ? 5    VAL A CG1 1 
ATOM   31   C  CG2 . VAL A 1 5   ? 42.312 19.070 6.751   1.00 23.55 ? 5    VAL A CG2 1 
ATOM   32   N  N   . ILE A 1 6   ? 39.693 21.051 10.033  1.00 21.41 ? 6    ILE A N   1 
ATOM   33   C  CA  . ILE A 1 6   ? 38.537 21.153 10.909  1.00 22.31 ? 6    ILE A CA  1 
ATOM   34   C  C   . ILE A 1 6   ? 37.361 20.916 9.972   1.00 21.80 ? 6    ILE A C   1 
ATOM   35   O  O   . ILE A 1 6   ? 37.175 21.659 9.008   1.00 22.02 ? 6    ILE A O   1 
ATOM   36   C  CB  . ILE A 1 6   ? 38.420 22.566 11.556  1.00 21.52 ? 6    ILE A CB  1 
ATOM   37   C  CG1 . ILE A 1 6   ? 39.699 22.899 12.328  1.00 22.92 ? 6    ILE A CG1 1 
ATOM   38   C  CG2 . ILE A 1 6   ? 37.225 22.607 12.516  1.00 19.93 ? 6    ILE A CG2 1 
ATOM   39   C  CD1 . ILE A 1 6   ? 39.990 21.989 13.531  1.00 21.36 ? 6    ILE A CD1 1 
ATOM   40   N  N   . LEU A 1 7   ? 36.602 19.852 10.221  1.00 21.15 ? 7    LEU A N   1 
ATOM   41   C  CA  . LEU A 1 7   ? 35.451 19.545 9.386   1.00 20.14 ? 7    LEU A CA  1 
ATOM   42   C  C   . LEU A 1 7   ? 34.406 20.643 9.502   1.00 21.98 ? 7    LEU A C   1 
ATOM   43   O  O   . LEU A 1 7   ? 34.341 21.359 10.503  1.00 20.66 ? 7    LEU A O   1 
ATOM   44   C  CB  . LEU A 1 7   ? 34.852 18.186 9.763   1.00 19.55 ? 7    LEU A CB  1 
ATOM   45   C  CG  . LEU A 1 7   ? 35.729 16.975 9.405   1.00 19.39 ? 7    LEU A CG  1 
ATOM   46   C  CD1 . LEU A 1 7   ? 35.046 15.678 9.820   1.00 17.39 ? 7    LEU A CD1 1 
ATOM   47   C  CD2 . LEU A 1 7   ? 35.995 16.964 7.907   1.00 20.03 ? 7    LEU A CD2 1 
ATOM   48   N  N   . PRO A 1 8   ? 33.584 20.803 8.460   1.00 22.59 ? 8    PRO A N   1 
ATOM   49   C  CA  . PRO A 1 8   ? 32.543 21.828 8.456   1.00 24.08 ? 8    PRO A CA  1 
ATOM   50   C  C   . PRO A 1 8   ? 31.674 21.751 9.701   1.00 24.19 ? 8    PRO A C   1 
ATOM   51   O  O   . PRO A 1 8   ? 31.161 20.684 10.056  1.00 23.66 ? 8    PRO A O   1 
ATOM   52   C  CB  . PRO A 1 8   ? 31.773 21.525 7.175   1.00 25.54 ? 8    PRO A CB  1 
ATOM   53   C  CG  . PRO A 1 8   ? 32.857 21.019 6.263   1.00 25.32 ? 8    PRO A CG  1 
ATOM   54   C  CD  . PRO A 1 8   ? 33.618 20.080 7.175   1.00 23.24 ? 8    PRO A CD  1 
ATOM   55   N  N   . HIS A 1 9   ? 31.531 22.893 10.359  1.00 24.70 ? 9    HIS A N   1 
ATOM   56   C  CA  . HIS A 1 9   ? 30.728 23.017 11.567  1.00 27.21 ? 9    HIS A CA  1 
ATOM   57   C  C   . HIS A 1 9   ? 29.822 24.230 11.362  1.00 28.72 ? 9    HIS A C   1 
ATOM   58   O  O   . HIS A 1 9   ? 30.299 25.356 11.271  1.00 27.73 ? 9    HIS A O   1 
ATOM   59   C  CB  . HIS A 1 9   ? 31.633 23.250 12.775  1.00 28.50 ? 9    HIS A CB  1 
ATOM   60   C  CG  . HIS A 1 9   ? 30.910 23.227 14.086  1.00 30.79 ? 9    HIS A CG  1 
ATOM   61   N  ND1 . HIS A 1 9   ? 30.618 22.056 14.753  1.00 31.74 ? 9    HIS A ND1 1 
ATOM   62   C  CD2 . HIS A 1 9   ? 30.401 24.228 14.842  1.00 30.37 ? 9    HIS A CD2 1 
ATOM   63   C  CE1 . HIS A 1 9   ? 29.958 22.338 15.863  1.00 32.18 ? 9    HIS A CE1 1 
ATOM   64   N  NE2 . HIS A 1 9   ? 29.813 23.648 15.940  1.00 33.17 ? 9    HIS A NE2 1 
ATOM   65   N  N   . GLN A 1 10  ? 28.518 23.984 11.276  1.00 32.03 ? 10   GLN A N   1 
ATOM   66   C  CA  . GLN A 1 10  ? 27.520 25.035 11.062  1.00 35.14 ? 10   GLN A CA  1 
ATOM   67   C  C   . GLN A 1 10  ? 27.743 26.326 11.847  1.00 36.33 ? 10   GLN A C   1 
ATOM   68   O  O   . GLN A 1 10  ? 27.623 27.423 11.296  1.00 37.12 ? 10   GLN A O   1 
ATOM   69   C  CB  . GLN A 1 10  ? 26.124 24.497 11.393  1.00 36.94 ? 10   GLN A CB  1 
ATOM   70   C  CG  . GLN A 1 10  ? 25.633 23.389 10.473  1.00 41.50 ? 10   GLN A CG  1 
ATOM   71   C  CD  . GLN A 1 10  ? 24.385 22.701 11.004  1.00 43.08 ? 10   GLN A CD  1 
ATOM   72   O  OE1 . GLN A 1 10  ? 23.439 23.357 11.446  1.00 44.85 ? 10   GLN A OE1 1 
ATOM   73   N  NE2 . GLN A 1 10  ? 24.376 21.371 10.958  1.00 44.37 ? 10   GLN A NE2 1 
ATOM   74   N  N   . ASP A 1 11  ? 28.071 26.199 13.128  1.00 36.95 ? 11   ASP A N   1 
ATOM   75   C  CA  . ASP A 1 11  ? 28.262 27.365 13.983  1.00 37.64 ? 11   ASP A CA  1 
ATOM   76   C  C   . ASP A 1 11  ? 29.664 27.945 14.137  1.00 37.51 ? 11   ASP A C   1 
ATOM   77   O  O   . ASP A 1 11  ? 29.817 29.161 14.267  1.00 37.79 ? 11   ASP A O   1 
ATOM   78   C  CB  . ASP A 1 11  ? 27.705 27.071 15.380  1.00 40.51 ? 11   ASP A CB  1 
ATOM   79   C  CG  . ASP A 1 11  ? 28.215 28.046 16.429  1.00 43.79 ? 11   ASP A CG  1 
ATOM   80   O  OD1 . ASP A 1 11  ? 28.076 29.273 16.228  1.00 45.44 ? 11   ASP A OD1 1 
ATOM   81   O  OD2 . ASP A 1 11  ? 28.756 27.585 17.458  1.00 46.95 ? 11   ASP A OD2 1 
ATOM   82   N  N   . LEU A 1 12  ? 30.687 27.098 14.121  1.00 36.39 ? 12   LEU A N   1 
ATOM   83   C  CA  . LEU A 1 12  ? 32.048 27.582 14.325  1.00 35.28 ? 12   LEU A CA  1 
ATOM   84   C  C   . LEU A 1 12  ? 32.983 27.537 13.122  1.00 34.11 ? 12   LEU A C   1 
ATOM   85   O  O   . LEU A 1 12  ? 34.073 28.112 13.161  1.00 35.46 ? 12   LEU A O   1 
ATOM   86   C  CB  . LEU A 1 12  ? 32.676 26.810 15.492  1.00 35.38 ? 12   LEU A CB  1 
ATOM   87   C  CG  . LEU A 1 12  ? 31.918 26.947 16.817  1.00 37.06 ? 12   LEU A CG  1 
ATOM   88   C  CD1 . LEU A 1 12  ? 32.311 25.840 17.780  1.00 37.68 ? 12   LEU A CD1 1 
ATOM   89   C  CD2 . LEU A 1 12  ? 32.206 28.315 17.414  1.00 37.16 ? 12   LEU A CD2 1 
ATOM   90   N  N   . CYS A 1 13  ? 32.566 26.878 12.049  1.00 32.94 ? 13   CYS A N   1 
ATOM   91   C  CA  . CYS A 1 13  ? 33.423 26.760 10.873  1.00 32.01 ? 13   CYS A CA  1 
ATOM   92   C  C   . CYS A 1 13  ? 32.584 26.206 9.718   1.00 30.82 ? 13   CYS A C   1 
ATOM   93   O  O   . CYS A 1 13  ? 32.793 25.077 9.270   1.00 27.98 ? 13   CYS A O   1 
ATOM   94   C  CB  . CYS A 1 13  ? 34.573 25.801 11.207  1.00 32.90 ? 13   CYS A CB  1 
ATOM   95   S  SG  . CYS A 1 13  ? 35.996 25.890 10.120  1.00 37.25 ? 13   CYS A SG  1 
ATOM   96   N  N   . PRO A 1 14  ? 31.629 27.009 9.214   1.00 29.46 ? 14   PRO A N   1 
ATOM   97   C  CA  . PRO A 1 14  ? 30.715 26.663 8.121   1.00 29.10 ? 14   PRO A CA  1 
ATOM   98   C  C   . PRO A 1 14  ? 31.267 25.848 6.953   1.00 28.88 ? 14   PRO A C   1 
ATOM   99   O  O   . PRO A 1 14  ? 30.667 24.848 6.560   1.00 28.61 ? 14   PRO A O   1 
ATOM   100  C  CB  . PRO A 1 14  ? 30.189 28.023 7.672   1.00 30.57 ? 14   PRO A CB  1 
ATOM   101  C  CG  . PRO A 1 14  ? 30.174 28.801 8.932   1.00 30.80 ? 14   PRO A CG  1 
ATOM   102  C  CD  . PRO A 1 14  ? 31.508 28.442 9.545   1.00 30.06 ? 14   PRO A CD  1 
ATOM   103  N  N   . ASP A 1 15  ? 32.393 26.272 6.390   1.00 27.94 ? 15   ASP A N   1 
ATOM   104  C  CA  . ASP A 1 15  ? 32.970 25.559 5.258   1.00 29.01 ? 15   ASP A CA  1 
ATOM   105  C  C   . ASP A 1 15  ? 34.171 24.697 5.635   1.00 28.41 ? 15   ASP A C   1 
ATOM   106  O  O   . ASP A 1 15  ? 34.824 24.114 4.766   1.00 29.42 ? 15   ASP A O   1 
ATOM   107  C  CB  . ASP A 1 15  ? 33.385 26.557 4.179   1.00 30.73 ? 15   ASP A CB  1 
ATOM   108  C  CG  . ASP A 1 15  ? 32.238 27.439 3.732   1.00 32.33 ? 15   ASP A CG  1 
ATOM   109  O  OD1 . ASP A 1 15  ? 31.181 26.895 3.347   1.00 34.39 ? 15   ASP A OD1 1 
ATOM   110  O  OD2 . ASP A 1 15  ? 32.395 28.678 3.761   1.00 32.85 ? 15   ASP A OD2 1 
ATOM   111  N  N   . GLY A 1 16  ? 34.452 24.597 6.930   1.00 27.45 ? 16   GLY A N   1 
ATOM   112  C  CA  . GLY A 1 16  ? 35.597 23.814 7.362   1.00 25.08 ? 16   GLY A CA  1 
ATOM   113  C  C   . GLY A 1 16  ? 36.840 24.678 7.246   1.00 25.74 ? 16   GLY A C   1 
ATOM   114  O  O   . GLY A 1 16  ? 36.754 25.844 6.849   1.00 24.26 ? 16   GLY A O   1 
ATOM   115  N  N   . ALA A 1 17  ? 38.002 24.132 7.589   1.00 24.65 ? 17   ALA A N   1 
ATOM   116  C  CA  . ALA A 1 17  ? 39.231 24.909 7.498   1.00 24.00 ? 17   ALA A CA  1 
ATOM   117  C  C   . ALA A 1 17  ? 40.464 24.027 7.559   1.00 24.68 ? 17   ALA A C   1 
ATOM   118  O  O   . ALA A 1 17  ? 40.411 22.906 8.062   1.00 23.22 ? 17   ALA A O   1 
ATOM   119  C  CB  . ALA A 1 17  ? 39.286 25.934 8.623   1.00 26.17 ? 17   ALA A CB  1 
ATOM   120  N  N   . VAL A 1 18  ? 41.571 24.552 7.044   1.00 24.78 ? 18   VAL A N   1 
ATOM   121  C  CA  . VAL A 1 18  ? 42.849 23.851 7.042   1.00 26.07 ? 18   VAL A CA  1 
ATOM   122  C  C   . VAL A 1 18  ? 43.808 24.691 7.873   1.00 26.34 ? 18   VAL A C   1 
ATOM   123  O  O   . VAL A 1 18  ? 44.109 25.826 7.512   1.00 28.38 ? 18   VAL A O   1 
ATOM   124  C  CB  . VAL A 1 18  ? 43.432 23.725 5.618   1.00 26.98 ? 18   VAL A CB  1 
ATOM   125  C  CG1 . VAL A 1 18  ? 44.757 22.987 5.663   1.00 27.62 ? 18   VAL A CG1 1 
ATOM   126  C  CG2 . VAL A 1 18  ? 42.452 23.004 4.720   1.00 26.45 ? 18   VAL A CG2 1 
ATOM   127  N  N   . LEU A 1 19  ? 44.276 24.138 8.984   1.00 25.79 ? 19   LEU A N   1 
ATOM   128  C  CA  . LEU A 1 19  ? 45.194 24.852 9.865   1.00 26.06 ? 19   LEU A CA  1 
ATOM   129  C  C   . LEU A 1 19  ? 46.618 24.310 9.757   1.00 25.57 ? 19   LEU A C   1 
ATOM   130  O  O   . LEU A 1 19  ? 46.827 23.100 9.716   1.00 24.89 ? 19   LEU A O   1 
ATOM   131  C  CB  . LEU A 1 19  ? 44.734 24.718 11.322  1.00 25.30 ? 19   LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 19  ? 43.239 24.858 11.614  1.00 26.08 ? 19   LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 19  ? 42.977 24.613 13.095  1.00 26.83 ? 19   LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 19  ? 42.772 26.234 11.213  1.00 28.30 ? 19   LEU A CD2 1 
ATOM   135  N  N   . GLU A 1 20  ? 47.599 25.205 9.701   1.00 26.41 ? 20   GLU A N   1 
ATOM   136  C  CA  . GLU A 1 20  ? 48.987 24.767 9.650   1.00 28.12 ? 20   GLU A CA  1 
ATOM   137  C  C   . GLU A 1 20  ? 49.448 24.836 11.102  1.00 27.89 ? 20   GLU A C   1 
ATOM   138  O  O   . GLU A 1 20  ? 49.822 25.902 11.591  1.00 29.13 ? 20   GLU A O   1 
ATOM   139  C  CB  . GLU A 1 20  ? 49.837 25.706 8.787   1.00 30.12 ? 20   GLU A CB  1 
ATOM   140  C  CG  . GLU A 1 20  ? 49.417 25.803 7.328   1.00 32.21 ? 20   GLU A CG  1 
ATOM   141  C  CD  . GLU A 1 20  ? 49.416 24.463 6.616   1.00 33.84 ? 20   GLU A CD  1 
ATOM   142  O  OE1 . GLU A 1 20  ? 50.403 23.710 6.741   1.00 36.26 ? 20   GLU A OE1 1 
ATOM   143  O  OE2 . GLU A 1 20  ? 48.425 24.167 5.919   1.00 35.94 ? 20   GLU A OE2 1 
ATOM   144  N  N   . ALA A 1 21  ? 49.409 23.698 11.789  1.00 25.95 ? 21   ALA A N   1 
ATOM   145  C  CA  . ALA A 1 21  ? 49.792 23.637 13.195  1.00 25.38 ? 21   ALA A CA  1 
ATOM   146  C  C   . ALA A 1 21  ? 51.258 23.295 13.400  1.00 26.36 ? 21   ALA A C   1 
ATOM   147  O  O   . ALA A 1 21  ? 51.888 22.683 12.544  1.00 27.12 ? 21   ALA A O   1 
ATOM   148  C  CB  . ALA A 1 21  ? 48.918 22.615 13.925  1.00 25.26 ? 21   ALA A CB  1 
ATOM   149  N  N   . ASN A 1 22  ? 51.788 23.702 14.547  1.00 26.80 ? 22   ASN A N   1 
ATOM   150  C  CA  . ASN A 1 22  ? 53.177 23.438 14.904  1.00 28.65 ? 22   ASN A CA  1 
ATOM   151  C  C   . ASN A 1 22  ? 53.253 22.147 15.699  1.00 27.95 ? 22   ASN A C   1 
ATOM   152  O  O   . ASN A 1 22  ? 52.311 21.788 16.400  1.00 28.16 ? 22   ASN A O   1 
ATOM   153  C  CB  . ASN A 1 22  ? 53.719 24.580 15.762  1.00 29.70 ? 22   ASN A CB  1 
ATOM   154  C  CG  . ASN A 1 22  ? 53.687 25.913 15.047  1.00 32.07 ? 22   ASN A CG  1 
ATOM   155  O  OD1 . ASN A 1 22  ? 54.401 26.122 14.067  1.00 34.99 ? 22   ASN A OD1 1 
ATOM   156  N  ND2 . ASN A 1 22  ? 52.850 26.825 15.530  1.00 33.88 ? 22   ASN A ND2 1 
ATOM   157  N  N   . SER A 1 23  ? 54.370 21.440 15.595  1.00 27.41 ? 23   SER A N   1 
ATOM   158  C  CA  . SER A 1 23  ? 54.518 20.217 16.358  1.00 26.58 ? 23   SER A CA  1 
ATOM   159  C  C   . SER A 1 23  ? 54.583 20.655 17.813  1.00 27.06 ? 23   SER A C   1 
ATOM   160  O  O   . SER A 1 23  ? 55.219 21.661 18.131  1.00 26.49 ? 23   SER A O   1 
ATOM   161  C  CB  . SER A 1 23  ? 55.798 19.481 15.960  1.00 26.73 ? 23   SER A CB  1 
ATOM   162  O  OG  . SER A 1 23  ? 55.648 18.879 14.684  1.00 29.61 ? 23   SER A OG  1 
ATOM   163  N  N   . GLY A 1 24  ? 53.902 19.918 18.686  1.00 25.96 ? 24   GLY A N   1 
ATOM   164  C  CA  . GLY A 1 24  ? 53.898 20.260 20.099  1.00 27.41 ? 24   GLY A CA  1 
ATOM   165  C  C   . GLY A 1 24  ? 52.764 21.195 20.481  1.00 28.32 ? 24   GLY A C   1 
ATOM   166  O  O   . GLY A 1 24  ? 52.478 21.397 21.666  1.00 30.25 ? 24   GLY A O   1 
ATOM   167  N  N   . GLU A 1 25  ? 52.110 21.768 19.478  1.00 28.23 ? 25   GLU A N   1 
ATOM   168  C  CA  . GLU A 1 25  ? 51.011 22.692 19.717  1.00 27.38 ? 25   GLU A CA  1 
ATOM   169  C  C   . GLU A 1 25  ? 49.701 21.941 19.930  1.00 27.46 ? 25   GLU A C   1 
ATOM   170  O  O   . GLU A 1 25  ? 49.464 20.903 19.311  1.00 26.84 ? 25   GLU A O   1 
ATOM   171  C  CB  . GLU A 1 25  ? 50.881 23.648 18.533  1.00 28.36 ? 25   GLU A CB  1 
ATOM   172  C  CG  . GLU A 1 25  ? 49.678 24.567 18.593  1.00 28.39 ? 25   GLU A CG  1 
ATOM   173  C  CD  . GLU A 1 25  ? 49.716 25.645 17.532  1.00 27.84 ? 25   GLU A CD  1 
ATOM   174  O  OE1 . GLU A 1 25  ? 49.949 25.325 16.347  1.00 28.53 ? 25   GLU A OE1 1 
ATOM   175  O  OE2 . GLU A 1 25  ? 49.503 26.819 17.885  1.00 30.83 ? 25   GLU A OE2 1 
ATOM   176  N  N   . THR A 1 26  ? 48.857 22.458 20.815  1.00 26.34 ? 26   THR A N   1 
ATOM   177  C  CA  . THR A 1 26  ? 47.575 21.817 21.075  1.00 26.28 ? 26   THR A CA  1 
ATOM   178  C  C   . THR A 1 26  ? 46.617 22.090 19.929  1.00 24.95 ? 26   THR A C   1 
ATOM   179  O  O   . THR A 1 26  ? 46.725 23.104 19.240  1.00 25.98 ? 26   THR A O   1 
ATOM   180  C  CB  . THR A 1 26  ? 46.920 22.325 22.369  1.00 26.81 ? 26   THR A CB  1 
ATOM   181  O  OG1 . THR A 1 26  ? 46.602 23.715 22.233  1.00 29.56 ? 26   THR A OG1 1 
ATOM   182  C  CG2 . THR A 1 26  ? 47.840 22.117 23.551  1.00 28.94 ? 26   THR A CG2 1 
ATOM   183  N  N   . ILE A 1 27  ? 45.682 21.172 19.724  1.00 23.06 ? 27   ILE A N   1 
ATOM   184  C  CA  . ILE A 1 27  ? 44.690 21.318 18.669  1.00 22.59 ? 27   ILE A CA  1 
ATOM   185  C  C   . ILE A 1 27  ? 43.931 22.626 18.886  1.00 21.30 ? 27   ILE A C   1 
ATOM   186  O  O   . ILE A 1 27  ? 43.658 23.350 17.934  1.00 19.75 ? 27   ILE A O   1 
ATOM   187  C  CB  . ILE A 1 27  ? 43.695 20.112 18.666  1.00 20.06 ? 27   ILE A CB  1 
ATOM   188  C  CG1 . ILE A 1 27  ? 44.441 18.832 18.264  1.00 20.59 ? 27   ILE A CG1 1 
ATOM   189  C  CG2 . ILE A 1 27  ? 42.534 20.372 17.715  1.00 19.35 ? 27   ILE A CG2 1 
ATOM   190  C  CD1 . ILE A 1 27  ? 43.547 17.592 18.104  1.00 19.60 ? 27   ILE A CD1 1 
ATOM   191  N  N   . LEU A 1 28  ? 43.625 22.936 20.144  1.00 21.87 ? 28   LEU A N   1 
ATOM   192  C  CA  . LEU A 1 28  ? 42.888 24.151 20.482  1.00 23.58 ? 28   LEU A CA  1 
ATOM   193  C  C   . LEU A 1 28  ? 43.643 25.442 20.179  1.00 24.15 ? 28   LEU A C   1 
ATOM   194  O  O   . LEU A 1 28  ? 43.091 26.363 19.574  1.00 25.51 ? 28   LEU A O   1 
ATOM   195  C  CB  . LEU A 1 28  ? 42.492 24.149 21.964  1.00 22.60 ? 28   LEU A CB  1 
ATOM   196  C  CG  . LEU A 1 28  ? 41.799 25.427 22.448  1.00 22.94 ? 28   LEU A CG  1 
ATOM   197  C  CD1 . LEU A 1 28  ? 40.489 25.605 21.689  1.00 19.65 ? 28   LEU A CD1 1 
ATOM   198  C  CD2 . LEU A 1 28  ? 41.534 25.350 23.948  1.00 21.45 ? 28   LEU A CD2 1 
ATOM   199  N  N   . ASP A 1 29  ? 44.898 25.526 20.604  1.00 25.49 ? 29   ASP A N   1 
ATOM   200  C  CA  . ASP A 1 29  ? 45.663 26.742 20.351  1.00 26.18 ? 29   ASP A CA  1 
ATOM   201  C  C   . ASP A 1 29  ? 45.802 27.004 18.858  1.00 24.99 ? 29   ASP A C   1 
ATOM   202  O  O   . ASP A 1 29  ? 45.744 28.153 18.423  1.00 25.78 ? 29   ASP A O   1 
ATOM   203  C  CB  . ASP A 1 29  ? 47.042 26.669 21.008  1.00 26.80 ? 29   ASP A CB  1 
ATOM   204  C  CG  . ASP A 1 29  ? 46.965 26.712 22.524  1.00 29.38 ? 29   ASP A CG  1 
ATOM   205  O  OD1 . ASP A 1 29  ? 45.916 27.137 23.060  1.00 29.52 ? 29   ASP A OD1 1 
ATOM   206  O  OD2 . ASP A 1 29  ? 47.955 26.333 23.180  1.00 29.62 ? 29   ASP A OD2 1 
ATOM   207  N  N   . ALA A 1 30  ? 45.966 25.937 18.081  1.00 23.92 ? 30   ALA A N   1 
ATOM   208  C  CA  . ALA A 1 30  ? 46.093 26.051 16.631  1.00 22.00 ? 30   ALA A CA  1 
ATOM   209  C  C   . ALA A 1 30  ? 44.787 26.589 16.057  1.00 22.74 ? 30   ALA A C   1 
ATOM   210  O  O   . ALA A 1 30  ? 44.776 27.423 15.147  1.00 23.09 ? 30   ALA A O   1 
ATOM   211  C  CB  . ALA A 1 30  ? 46.406 24.689 16.026  1.00 22.43 ? 30   ALA A CB  1 
ATOM   212  N  N   . ALA A 1 31  ? 43.679 26.109 16.608  1.00 22.91 ? 31   ALA A N   1 
ATOM   213  C  CA  . ALA A 1 31  ? 42.366 26.530 16.170  1.00 22.17 ? 31   ALA A CA  1 
ATOM   214  C  C   . ALA A 1 31  ? 42.115 27.992 16.523  1.00 22.42 ? 31   ALA A C   1 
ATOM   215  O  O   . ALA A 1 31  ? 41.651 28.766 15.691  1.00 22.29 ? 31   ALA A O   1 
ATOM   216  C  CB  . ALA A 1 31  ? 41.300 25.646 16.813  1.00 22.40 ? 31   ALA A CB  1 
ATOM   217  N  N   . LEU A 1 32  ? 42.438 28.370 17.753  1.00 22.64 ? 32   LEU A N   1 
ATOM   218  C  CA  . LEU A 1 32  ? 42.204 29.731 18.196  1.00 24.46 ? 32   LEU A CA  1 
ATOM   219  C  C   . LEU A 1 32  ? 43.023 30.768 17.429  1.00 26.17 ? 32   LEU A C   1 
ATOM   220  O  O   . LEU A 1 32  ? 42.525 31.865 17.152  1.00 25.98 ? 32   LEU A O   1 
ATOM   221  C  CB  . LEU A 1 32  ? 42.443 29.832 19.706  1.00 24.34 ? 32   LEU A CB  1 
ATOM   222  C  CG  . LEU A 1 32  ? 41.548 28.916 20.561  1.00 23.92 ? 32   LEU A CG  1 
ATOM   223  C  CD1 . LEU A 1 32  ? 41.926 29.049 22.029  1.00 24.96 ? 32   LEU A CD1 1 
ATOM   224  C  CD2 . LEU A 1 32  ? 40.076 29.266 20.357  1.00 23.99 ? 32   LEU A CD2 1 
ATOM   225  N  N   . ARG A 1 33  ? 44.260 30.430 17.062  1.00 27.47 ? 33   ARG A N   1 
ATOM   226  C  CA  . ARG A 1 33  ? 45.092 31.375 16.310  1.00 28.77 ? 33   ARG A CA  1 
ATOM   227  C  C   . ARG A 1 33  ? 44.416 31.686 14.977  1.00 28.06 ? 33   ARG A C   1 
ATOM   228  O  O   . ARG A 1 33  ? 44.553 32.785 14.436  1.00 28.29 ? 33   ARG A O   1 
ATOM   229  C  CB  . ARG A 1 33  ? 46.487 30.804 16.015  1.00 30.82 ? 33   ARG A CB  1 
ATOM   230  C  CG  . ARG A 1 33  ? 47.302 30.367 17.217  1.00 33.37 ? 33   ARG A CG  1 
ATOM   231  C  CD  . ARG A 1 33  ? 48.792 30.421 16.893  1.00 37.98 ? 33   ARG A CD  1 
ATOM   232  N  NE  . ARG A 1 33  ? 49.084 30.034 15.511  1.00 40.79 ? 33   ARG A NE  1 
ATOM   233  C  CZ  . ARG A 1 33  ? 48.999 28.796 15.033  1.00 41.36 ? 33   ARG A CZ  1 
ATOM   234  N  NH1 . ARG A 1 33  ? 48.630 27.797 15.820  1.00 43.41 ? 33   ARG A NH1 1 
ATOM   235  N  NH2 . ARG A 1 33  ? 49.277 28.558 13.759  1.00 42.94 ? 33   ARG A NH2 1 
ATOM   236  N  N   . ASN A 1 34  ? 43.679 30.712 14.450  1.00 28.49 ? 34   ASN A N   1 
ATOM   237  C  CA  . ASN A 1 34  ? 42.997 30.883 13.171  1.00 27.65 ? 34   ASN A CA  1 
ATOM   238  C  C   . ASN A 1 34  ? 41.564 31.367 13.299  1.00 28.12 ? 34   ASN A C   1 
ATOM   239  O  O   . ASN A 1 34  ? 40.778 31.286 12.350  1.00 28.30 ? 34   ASN A O   1 
ATOM   240  C  CB  . ASN A 1 34  ? 43.047 29.574 12.378  1.00 29.37 ? 34   ASN A CB  1 
ATOM   241  C  CG  . ASN A 1 34  ? 44.397 29.348 11.725  1.00 30.40 ? 34   ASN A CG  1 
ATOM   242  O  OD1 . ASN A 1 34  ? 44.697 29.929 10.677  1.00 29.18 ? 34   ASN A OD1 1 
ATOM   243  N  ND2 . ASN A 1 34  ? 45.228 28.520 12.351  1.00 30.21 ? 34   ASN A ND2 1 
ATOM   244  N  N   . GLY A 1 35  ? 41.222 31.871 14.477  1.00 27.04 ? 35   GLY A N   1 
ATOM   245  C  CA  . GLY A 1 35  ? 39.888 32.395 14.686  1.00 27.56 ? 35   GLY A CA  1 
ATOM   246  C  C   . GLY A 1 35  ? 38.757 31.391 14.806  1.00 28.02 ? 35   GLY A C   1 
ATOM   247  O  O   . GLY A 1 35  ? 37.596 31.761 14.661  1.00 28.49 ? 35   GLY A O   1 
ATOM   248  N  N   . ILE A 1 36  ? 39.079 30.125 15.051  1.00 27.85 ? 36   ILE A N   1 
ATOM   249  C  CA  . ILE A 1 36  ? 38.039 29.111 15.220  1.00 28.30 ? 36   ILE A CA  1 
ATOM   250  C  C   . ILE A 1 36  ? 37.779 29.052 16.719  1.00 28.71 ? 36   ILE A C   1 
ATOM   251  O  O   . ILE A 1 36  ? 38.555 28.468 17.477  1.00 28.32 ? 36   ILE A O   1 
ATOM   252  C  CB  . ILE A 1 36  ? 38.503 27.748 14.699  1.00 28.89 ? 36   ILE A CB  1 
ATOM   253  C  CG1 . ILE A 1 36  ? 38.766 27.851 13.193  1.00 29.77 ? 36   ILE A CG1 1 
ATOM   254  C  CG2 . ILE A 1 36  ? 37.441 26.693 14.979  1.00 28.70 ? 36   ILE A CG2 1 
ATOM   255  C  CD1 . ILE A 1 36  ? 39.381 26.617 12.591  1.00 31.93 ? 36   ILE A CD1 1 
ATOM   256  N  N   . GLU A 1 37  ? 36.678 29.670 17.132  1.00 29.47 ? 37   GLU A N   1 
ATOM   257  C  CA  . GLU A 1 37  ? 36.317 29.772 18.538  1.00 30.50 ? 37   GLU A CA  1 
ATOM   258  C  C   . GLU A 1 37  ? 35.789 28.540 19.260  1.00 29.89 ? 37   GLU A C   1 
ATOM   259  O  O   . GLU A 1 37  ? 34.600 28.452 19.575  1.00 31.07 ? 37   GLU A O   1 
ATOM   260  C  CB  . GLU A 1 37  ? 35.339 30.935 18.714  1.00 32.39 ? 37   GLU A CB  1 
ATOM   261  C  CG  . GLU A 1 37  ? 35.918 32.266 18.255  1.00 36.44 ? 37   GLU A CG  1 
ATOM   262  C  CD  . GLU A 1 37  ? 37.274 32.546 18.874  1.00 38.42 ? 37   GLU A CD  1 
ATOM   263  O  OE1 . GLU A 1 37  ? 37.355 32.621 20.117  1.00 41.05 ? 37   GLU A OE1 1 
ATOM   264  O  OE2 . GLU A 1 37  ? 38.266 32.688 18.124  1.00 40.00 ? 37   GLU A OE2 1 
ATOM   265  N  N   . ILE A 1 38  ? 36.685 27.598 19.538  1.00 28.79 ? 38   ILE A N   1 
ATOM   266  C  CA  . ILE A 1 38  ? 36.324 26.388 20.268  1.00 26.51 ? 38   ILE A CA  1 
ATOM   267  C  C   . ILE A 1 38  ? 36.221 26.784 21.732  1.00 28.28 ? 38   ILE A C   1 
ATOM   268  O  O   . ILE A 1 38  ? 37.170 27.326 22.308  1.00 28.72 ? 38   ILE A O   1 
ATOM   269  C  CB  . ILE A 1 38  ? 37.400 25.289 20.128  1.00 24.42 ? 38   ILE A CB  1 
ATOM   270  C  CG1 . ILE A 1 38  ? 37.428 24.772 18.691  1.00 23.93 ? 38   ILE A CG1 1 
ATOM   271  C  CG2 . ILE A 1 38  ? 37.124 24.151 21.112  1.00 21.84 ? 38   ILE A CG2 1 
ATOM   272  C  CD1 . ILE A 1 38  ? 38.449 23.680 18.459  1.00 22.48 ? 38   ILE A CD1 1 
ATOM   273  N  N   . GLU A 1 39  ? 35.067 26.524 22.330  1.00 26.96 ? 39   GLU A N   1 
ATOM   274  C  CA  . GLU A 1 39  ? 34.855 26.873 23.727  1.00 27.68 ? 39   GLU A CA  1 
ATOM   275  C  C   . GLU A 1 39  ? 35.918 26.245 24.629  1.00 28.52 ? 39   GLU A C   1 
ATOM   276  O  O   . GLU A 1 39  ? 36.351 25.116 24.407  1.00 25.18 ? 39   GLU A O   1 
ATOM   277  C  CB  . GLU A 1 39  ? 33.464 26.413 24.176  1.00 29.28 ? 39   GLU A CB  1 
ATOM   278  C  CG  . GLU A 1 39  ? 32.902 27.199 25.352  1.00 31.07 ? 39   GLU A CG  1 
ATOM   279  C  CD  . GLU A 1 39  ? 31.564 26.669 25.838  1.00 33.23 ? 39   GLU A CD  1 
ATOM   280  O  OE1 . GLU A 1 39  ? 30.741 26.251 24.996  1.00 32.34 ? 39   GLU A OE1 1 
ATOM   281  O  OE2 . GLU A 1 39  ? 31.327 26.686 27.066  1.00 36.16 ? 39   GLU A OE2 1 
ATOM   282  N  N   . HIS A 1 40  ? 36.347 26.999 25.635  1.00 28.97 ? 40   HIS A N   1 
ATOM   283  C  CA  . HIS A 1 40  ? 37.327 26.523 26.603  1.00 30.41 ? 40   HIS A CA  1 
ATOM   284  C  C   . HIS A 1 40  ? 36.992 27.172 27.940  1.00 31.73 ? 40   HIS A C   1 
ATOM   285  O  O   . HIS A 1 40  ? 37.728 28.021 28.450  1.00 31.67 ? 40   HIS A O   1 
ATOM   286  C  CB  . HIS A 1 40  ? 38.768 26.858 26.163  1.00 29.81 ? 40   HIS A CB  1 
ATOM   287  C  CG  . HIS A 1 40  ? 38.921 28.195 25.508  1.00 29.93 ? 40   HIS A CG  1 
ATOM   288  N  ND1 . HIS A 1 40  ? 38.310 28.514 24.314  1.00 30.48 ? 40   HIS A ND1 1 
ATOM   289  C  CD2 . HIS A 1 40  ? 39.653 29.280 25.856  1.00 30.34 ? 40   HIS A CD2 1 
ATOM   290  C  CE1 . HIS A 1 40  ? 38.660 29.736 23.954  1.00 29.40 ? 40   HIS A CE1 1 
ATOM   291  N  NE2 . HIS A 1 40  ? 39.475 30.223 24.873  1.00 30.33 ? 40   HIS A NE2 1 
ATOM   292  N  N   . ALA A 1 41  ? 35.859 26.746 28.492  1.00 31.06 ? 41   ALA A N   1 
ATOM   293  C  CA  . ALA A 1 41  ? 35.330 27.259 29.751  1.00 32.05 ? 41   ALA A CA  1 
ATOM   294  C  C   . ALA A 1 41  ? 36.282 27.313 30.938  1.00 32.91 ? 41   ALA A C   1 
ATOM   295  O  O   . ALA A 1 41  ? 36.332 28.330 31.633  1.00 34.08 ? 41   ALA A O   1 
ATOM   296  C  CB  . ALA A 1 41  ? 34.084 26.470 30.140  1.00 30.62 ? 41   ALA A CB  1 
ATOM   297  N  N   . CYS A 1 42  ? 37.018 26.233 31.191  1.00 33.45 ? 42   CYS A N   1 
ATOM   298  C  CA  . CYS A 1 42  ? 37.930 26.208 32.335  1.00 33.81 ? 42   CYS A CA  1 
ATOM   299  C  C   . CYS A 1 42  ? 39.322 26.742 32.022  1.00 35.06 ? 42   CYS A C   1 
ATOM   300  O  O   . CYS A 1 42  ? 40.265 26.516 32.780  1.00 35.73 ? 42   CYS A O   1 
ATOM   301  C  CB  . CYS A 1 42  ? 38.051 24.791 32.903  1.00 33.35 ? 42   CYS A CB  1 
ATOM   302  S  SG  . CYS A 1 42  ? 39.168 23.696 32.002  1.00 31.27 ? 42   CYS A SG  1 
ATOM   303  N  N   . GLU A 1 43  ? 39.446 27.444 30.902  1.00 35.20 ? 43   GLU A N   1 
ATOM   304  C  CA  . GLU A 1 43  ? 40.717 28.034 30.487  1.00 35.95 ? 43   GLU A CA  1 
ATOM   305  C  C   . GLU A 1 43  ? 41.887 27.061 30.318  1.00 35.48 ? 43   GLU A C   1 
ATOM   306  O  O   . GLU A 1 43  ? 42.987 27.302 30.823  1.00 35.72 ? 43   GLU A O   1 
ATOM   307  C  CB  . GLU A 1 43  ? 41.102 29.153 31.461  1.00 37.73 ? 43   GLU A CB  1 
ATOM   308  C  CG  . GLU A 1 43  ? 40.104 30.298 31.482  1.00 39.11 ? 43   GLU A CG  1 
ATOM   309  C  CD  . GLU A 1 43  ? 40.421 31.345 32.530  1.00 41.82 ? 43   GLU A CD  1 
ATOM   310  O  OE1 . GLU A 1 43  ? 40.460 30.997 33.730  1.00 41.67 ? 43   GLU A OE1 1 
ATOM   311  O  OE2 . GLU A 1 43  ? 40.626 32.517 32.151  1.00 42.59 ? 43   GLU A OE2 1 
ATOM   312  N  N   . LYS A 1 44  ? 41.643 25.964 29.604  1.00 34.39 ? 44   LYS A N   1 
ATOM   313  C  CA  . LYS A 1 44  ? 42.670 24.964 29.321  1.00 34.70 ? 44   LYS A CA  1 
ATOM   314  C  C   . LYS A 1 44  ? 43.266 24.296 30.562  1.00 35.54 ? 44   LYS A C   1 
ATOM   315  O  O   . LYS A 1 44  ? 44.463 24.001 30.599  1.00 34.79 ? 44   LYS A O   1 
ATOM   316  C  CB  . LYS A 1 44  ? 43.786 25.615 28.495  1.00 33.12 ? 44   LYS A CB  1 
ATOM   317  C  CG  . LYS A 1 44  ? 43.260 26.498 27.369  1.00 31.96 ? 44   LYS A CG  1 
ATOM   318  C  CD  . LYS A 1 44  ? 44.371 27.234 26.632  1.00 30.93 ? 44   LYS A CD  1 
ATOM   319  C  CE  . LYS A 1 44  ? 43.794 28.118 25.532  1.00 30.38 ? 44   LYS A CE  1 
ATOM   320  N  NZ  . LYS A 1 44  ? 44.853 28.777 24.708  1.00 30.88 ? 44   LYS A NZ  1 
ATOM   321  N  N   . SER A 1 45  ? 42.429 24.037 31.564  1.00 36.58 ? 45   SER A N   1 
ATOM   322  C  CA  . SER A 1 45  ? 42.888 23.412 32.806  1.00 37.72 ? 45   SER A CA  1 
ATOM   323  C  C   . SER A 1 45  ? 42.556 21.920 32.898  1.00 37.89 ? 45   SER A C   1 
ATOM   324  O  O   . SER A 1 45  ? 42.829 21.279 33.914  1.00 39.58 ? 45   SER A O   1 
ATOM   325  C  CB  . SER A 1 45  ? 42.274 24.138 34.003  1.00 38.33 ? 45   SER A CB  1 
ATOM   326  O  OG  . SER A 1 45  ? 42.479 25.535 33.899  1.00 41.18 ? 45   SER A OG  1 
ATOM   327  N  N   . CYS A 1 46  ? 41.975 21.371 31.836  1.00 36.20 ? 46   CYS A N   1 
ATOM   328  C  CA  . CYS A 1 46  ? 41.603 19.962 31.809  1.00 36.24 ? 46   CYS A CA  1 
ATOM   329  C  C   . CYS A 1 46  ? 40.571 19.698 32.909  1.00 34.88 ? 46   CYS A C   1 
ATOM   330  O  O   . CYS A 1 46  ? 40.628 18.679 33.596  1.00 34.72 ? 46   CYS A O   1 
ATOM   331  C  CB  . CYS A 1 46  ? 42.845 19.084 32.019  1.00 35.01 ? 46   CYS A CB  1 
ATOM   332  S  SG  . CYS A 1 46  ? 42.629 17.330 31.645  1.00 35.99 ? 46   CYS A SG  1 
ATOM   333  N  N   . ALA A 1 47  ? 39.629 20.627 33.068  1.00 34.03 ? 47   ALA A N   1 
ATOM   334  C  CA  . ALA A 1 47  ? 38.592 20.502 34.089  1.00 32.83 ? 47   ALA A CA  1 
ATOM   335  C  C   . ALA A 1 47  ? 37.167 20.646 33.548  1.00 32.63 ? 47   ALA A C   1 
ATOM   336  O  O   . ALA A 1 47  ? 36.225 20.835 34.321  1.00 31.63 ? 47   ALA A O   1 
ATOM   337  C  CB  . ALA A 1 47  ? 38.830 21.526 35.199  1.00 33.81 ? 47   ALA A CB  1 
ATOM   338  N  N   . CYS A 1 48  ? 37.009 20.574 32.228  1.00 30.53 ? 48   CYS A N   1 
ATOM   339  C  CA  . CYS A 1 48  ? 35.682 20.666 31.619  1.00 29.58 ? 48   CYS A CA  1 
ATOM   340  C  C   . CYS A 1 48  ? 35.668 19.826 30.344  1.00 28.34 ? 48   CYS A C   1 
ATOM   341  O  O   . CYS A 1 48  ? 36.573 19.025 30.120  1.00 28.53 ? 48   CYS A O   1 
ATOM   342  C  CB  . CYS A 1 48  ? 35.313 22.132 31.316  1.00 30.38 ? 48   CYS A CB  1 
ATOM   343  S  SG  . CYS A 1 48  ? 36.072 22.916 29.853  1.00 31.81 ? 48   CYS A SG  1 
ATOM   344  N  N   . THR A 1 49  ? 34.635 19.971 29.522  1.00 27.39 ? 49   THR A N   1 
ATOM   345  C  CA  . THR A 1 49  ? 34.587 19.220 28.271  1.00 25.23 ? 49   THR A CA  1 
ATOM   346  C  C   . THR A 1 49  ? 34.159 20.100 27.104  1.00 23.77 ? 49   THR A C   1 
ATOM   347  O  O   . THR A 1 49  ? 33.869 19.602 26.017  1.00 24.13 ? 49   THR A O   1 
ATOM   348  C  CB  . THR A 1 49  ? 33.636 17.985 28.351  1.00 26.43 ? 49   THR A CB  1 
ATOM   349  O  OG1 . THR A 1 49  ? 32.317 18.399 28.728  1.00 25.22 ? 49   THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 49  ? 34.161 16.962 29.351  1.00 25.13 ? 49   THR A CG2 1 
ATOM   351  N  N   . THR A 1 50  ? 34.147 21.413 27.314  1.00 21.97 ? 50   THR A N   1 
ATOM   352  C  CA  . THR A 1 50  ? 33.728 22.326 26.256  1.00 20.98 ? 50   THR A CA  1 
ATOM   353  C  C   . THR A 1 50  ? 34.681 22.398 25.074  1.00 19.48 ? 50   THR A C   1 
ATOM   354  O  O   . THR A 1 50  ? 34.280 22.817 23.990  1.00 17.75 ? 50   THR A O   1 
ATOM   355  C  CB  . THR A 1 50  ? 33.480 23.761 26.791  1.00 21.30 ? 50   THR A CB  1 
ATOM   356  O  OG1 . THR A 1 50  ? 34.708 24.322 27.274  1.00 20.95 ? 50   THR A OG1 1 
ATOM   357  C  CG2 . THR A 1 50  ? 32.449 23.738 27.913  1.00 21.35 ? 50   THR A CG2 1 
ATOM   358  N  N   . CYS A 1 51  ? 35.931 21.978 25.267  1.00 19.76 ? 51   CYS A N   1 
ATOM   359  C  CA  . CYS A 1 51  ? 36.918 21.995 24.183  1.00 18.32 ? 51   CYS A CA  1 
ATOM   360  C  C   . CYS A 1 51  ? 36.991 20.612 23.521  1.00 19.29 ? 51   CYS A C   1 
ATOM   361  O  O   . CYS A 1 51  ? 37.908 20.315 22.742  1.00 20.54 ? 51   CYS A O   1 
ATOM   362  C  CB  . CYS A 1 51  ? 38.299 22.369 24.723  1.00 19.01 ? 51   CYS A CB  1 
ATOM   363  S  SG  . CYS A 1 51  ? 39.035 21.095 25.736  1.00 20.23 ? 51   CYS A SG  1 
ATOM   364  N  N   . HIS A 1 52  ? 36.020 19.766 23.850  1.00 18.03 ? 52   HIS A N   1 
ATOM   365  C  CA  . HIS A 1 52  ? 35.940 18.412 23.305  1.00 17.43 ? 52   HIS A CA  1 
ATOM   366  C  C   . HIS A 1 52  ? 35.967 18.400 21.777  1.00 16.65 ? 52   HIS A C   1 
ATOM   367  O  O   . HIS A 1 52  ? 35.324 19.218 21.136  1.00 18.56 ? 52   HIS A O   1 
ATOM   368  C  CB  . HIS A 1 52  ? 34.640 17.773 23.805  1.00 16.86 ? 52   HIS A CB  1 
ATOM   369  C  CG  . HIS A 1 52  ? 34.357 16.414 23.251  1.00 18.08 ? 52   HIS A CG  1 
ATOM   370  N  ND1 . HIS A 1 52  ? 33.076 15.997 22.966  1.00 19.38 ? 52   HIS A ND1 1 
ATOM   371  C  CD2 . HIS A 1 52  ? 35.162 15.355 22.997  1.00 18.83 ? 52   HIS A CD2 1 
ATOM   372  C  CE1 . HIS A 1 52  ? 33.101 14.738 22.565  1.00 20.14 ? 52   HIS A CE1 1 
ATOM   373  N  NE2 . HIS A 1 52  ? 34.356 14.325 22.576  1.00 18.88 ? 52   HIS A NE2 1 
ATOM   374  N  N   . CYS A 1 53  ? 36.729 17.478 21.200  1.00 17.10 ? 53   CYS A N   1 
ATOM   375  C  CA  . CYS A 1 53  ? 36.787 17.337 19.746  1.00 16.53 ? 53   CYS A CA  1 
ATOM   376  C  C   . CYS A 1 53  ? 36.994 15.859 19.433  1.00 18.14 ? 53   CYS A C   1 
ATOM   377  O  O   . CYS A 1 53  ? 37.405 15.089 20.298  1.00 18.91 ? 53   CYS A O   1 
ATOM   378  C  CB  . CYS A 1 53  ? 37.926 18.168 19.144  1.00 17.94 ? 53   CYS A CB  1 
ATOM   379  S  SG  . CYS A 1 53  ? 39.573 17.551 19.451  1.00 20.78 ? 53   CYS A SG  1 
ATOM   380  N  N   . ILE A 1 54  ? 36.692 15.452 18.206  1.00 17.23 ? 54   ILE A N   1 
ATOM   381  C  CA  . ILE A 1 54  ? 36.867 14.060 17.821  1.00 18.60 ? 54   ILE A CA  1 
ATOM   382  C  C   . ILE A 1 54  ? 37.912 14.034 16.714  1.00 18.47 ? 54   ILE A C   1 
ATOM   383  O  O   . ILE A 1 54  ? 37.762 14.716 15.694  1.00 18.07 ? 54   ILE A O   1 
ATOM   384  C  CB  . ILE A 1 54  ? 35.523 13.443 17.339  1.00 19.36 ? 54   ILE A CB  1 
ATOM   385  C  CG1 . ILE A 1 54  ? 34.478 13.600 18.449  1.00 20.99 ? 54   ILE A CG1 1 
ATOM   386  C  CG2 . ILE A 1 54  ? 35.694 11.955 17.019  1.00 20.48 ? 54   ILE A CG2 1 
ATOM   387  C  CD1 . ILE A 1 54  ? 33.091 13.139 18.068  1.00 24.07 ? 54   ILE A CD1 1 
ATOM   388  N  N   . VAL A 1 55  ? 38.991 13.291 16.933  1.00 17.56 ? 55   VAL A N   1 
ATOM   389  C  CA  . VAL A 1 55  ? 40.055 13.216 15.933  1.00 19.59 ? 55   VAL A CA  1 
ATOM   390  C  C   . VAL A 1 55  ? 39.773 12.047 14.991  1.00 19.41 ? 55   VAL A C   1 
ATOM   391  O  O   . VAL A 1 55  ? 40.149 10.906 15.273  1.00 19.50 ? 55   VAL A O   1 
ATOM   392  C  CB  . VAL A 1 55  ? 41.441 13.038 16.608  1.00 18.90 ? 55   VAL A CB  1 
ATOM   393  C  CG1 . VAL A 1 55  ? 42.554 13.177 15.580  1.00 18.28 ? 55   VAL A CG1 1 
ATOM   394  C  CG2 . VAL A 1 55  ? 41.620 14.060 17.717  1.00 21.45 ? 55   VAL A CG2 1 
ATOM   395  N  N   . ARG A 1 56  ? 39.112 12.349 13.874  1.00 20.80 ? 56   ARG A N   1 
ATOM   396  C  CA  . ARG A 1 56  ? 38.729 11.359 12.867  1.00 23.00 ? 56   ARG A CA  1 
ATOM   397  C  C   . ARG A 1 56  ? 39.916 10.721 12.155  1.00 23.34 ? 56   ARG A C   1 
ATOM   398  O  O   . ARG A 1 56  ? 39.838 9.572  11.712  1.00 22.17 ? 56   ARG A O   1 
ATOM   399  C  CB  . ARG A 1 56  ? 37.796 11.998 11.829  1.00 24.09 ? 56   ARG A CB  1 
ATOM   400  C  CG  . ARG A 1 56  ? 36.491 12.553 12.393  1.00 27.80 ? 56   ARG A CG  1 
ATOM   401  C  CD  . ARG A 1 56  ? 35.665 11.466 13.045  1.00 29.11 ? 56   ARG A CD  1 
ATOM   402  N  NE  . ARG A 1 56  ? 34.338 11.932 13.445  1.00 27.89 ? 56   ARG A NE  1 
ATOM   403  C  CZ  . ARG A 1 56  ? 33.525 11.233 14.229  1.00 27.86 ? 56   ARG A CZ  1 
ATOM   404  N  NH1 . ARG A 1 56  ? 33.920 10.051 14.684  1.00 27.73 ? 56   ARG A NH1 1 
ATOM   405  N  NH2 . ARG A 1 56  ? 32.329 11.708 14.564  1.00 24.80 ? 56   ARG A NH2 1 
ATOM   406  N  N   . GLU A 1 57  ? 41.005 11.470 12.017  1.00 23.47 ? 57   GLU A N   1 
ATOM   407  C  CA  . GLU A 1 57  ? 42.213 10.945 11.378  1.00 25.03 ? 57   GLU A CA  1 
ATOM   408  C  C   . GLU A 1 57  ? 43.439 11.430 12.151  1.00 24.06 ? 57   GLU A C   1 
ATOM   409  O  O   . GLU A 1 57  ? 43.543 12.618 12.467  1.00 23.81 ? 57   GLU A O   1 
ATOM   410  C  CB  . GLU A 1 57  ? 42.316 11.418 9.918   1.00 25.77 ? 57   GLU A CB  1 
ATOM   411  C  CG  . GLU A 1 57  ? 41.172 11.005 8.993   1.00 30.18 ? 57   GLU A CG  1 
ATOM   412  C  CD  . GLU A 1 57  ? 41.017 9.496  8.854   1.00 28.65 ? 57   GLU A CD  1 
ATOM   413  O  OE1 . GLU A 1 57  ? 41.933 8.760  9.274   1.00 30.35 ? 57   GLU A OE1 1 
ATOM   414  O  OE2 . GLU A 1 57  ? 39.977 9.052  8.318   1.00 31.49 ? 57   GLU A OE2 1 
ATOM   415  N  N   . GLY A 1 58  ? 44.355 10.512 12.464  1.00 24.47 ? 58   GLY A N   1 
ATOM   416  C  CA  . GLY A 1 58  ? 45.566 10.873 13.186  1.00 23.51 ? 58   GLY A CA  1 
ATOM   417  C  C   . GLY A 1 58  ? 45.536 10.750 14.700  1.00 24.67 ? 58   GLY A C   1 
ATOM   418  O  O   . GLY A 1 58  ? 46.484 11.157 15.374  1.00 26.02 ? 58   GLY A O   1 
ATOM   419  N  N   . PHE A 1 59  ? 44.462 10.190 15.245  1.00 25.00 ? 59   PHE A N   1 
ATOM   420  C  CA  . PHE A 1 59  ? 44.339 10.032 16.694  1.00 25.93 ? 59   PHE A CA  1 
ATOM   421  C  C   . PHE A 1 59  ? 45.555 9.316  17.305  1.00 27.02 ? 59   PHE A C   1 
ATOM   422  O  O   . PHE A 1 59  ? 46.036 9.699  18.373  1.00 27.27 ? 59   PHE A O   1 
ATOM   423  C  CB  . PHE A 1 59  ? 43.063 9.243  17.014  1.00 25.88 ? 59   PHE A CB  1 
ATOM   424  C  CG  . PHE A 1 59  ? 42.871 8.944  18.480  1.00 26.90 ? 59   PHE A CG  1 
ATOM   425  C  CD1 . PHE A 1 59  ? 42.335 9.902  19.337  1.00 26.08 ? 59   PHE A CD1 1 
ATOM   426  C  CD2 . PHE A 1 59  ? 43.225 7.699  19.001  1.00 27.04 ? 59   PHE A CD2 1 
ATOM   427  C  CE1 . PHE A 1 59  ? 42.151 9.630  20.690  1.00 26.13 ? 59   PHE A CE1 1 
ATOM   428  C  CE2 . PHE A 1 59  ? 43.048 7.414  20.351  1.00 27.26 ? 59   PHE A CE2 1 
ATOM   429  C  CZ  . PHE A 1 59  ? 42.511 8.375  21.201  1.00 28.55 ? 59   PHE A CZ  1 
ATOM   430  N  N   . ASP A 1 60  ? 46.045 8.279  16.627  1.00 28.35 ? 60   ASP A N   1 
ATOM   431  C  CA  . ASP A 1 60  ? 47.184 7.500  17.119  1.00 31.03 ? 60   ASP A CA  1 
ATOM   432  C  C   . ASP A 1 60  ? 48.512 8.245  17.170  1.00 31.75 ? 60   ASP A C   1 
ATOM   433  O  O   . ASP A 1 60  ? 49.442 7.810  17.856  1.00 32.65 ? 60   ASP A O   1 
ATOM   434  C  CB  . ASP A 1 60  ? 47.377 6.232  16.280  1.00 33.01 ? 60   ASP A CB  1 
ATOM   435  C  CG  . ASP A 1 60  ? 46.154 5.348  16.271  1.00 36.79 ? 60   ASP A CG  1 
ATOM   436  O  OD1 . ASP A 1 60  ? 45.535 5.175  17.344  1.00 39.99 ? 60   ASP A OD1 1 
ATOM   437  O  OD2 . ASP A 1 60  ? 45.815 4.816  15.192  1.00 40.33 ? 60   ASP A OD2 1 
ATOM   438  N  N   . SER A 1 61  ? 48.611 9.355  16.449  1.00 31.45 ? 61   SER A N   1 
ATOM   439  C  CA  . SER A 1 61  ? 49.849 10.124 16.432  1.00 30.99 ? 61   SER A CA  1 
ATOM   440  C  C   . SER A 1 61  ? 49.988 11.003 17.671  1.00 31.77 ? 61   SER A C   1 
ATOM   441  O  O   . SER A 1 61  ? 51.099 11.328 18.083  1.00 31.56 ? 61   SER A O   1 
ATOM   442  C  CB  . SER A 1 61  ? 49.910 11.008 15.185  1.00 30.69 ? 61   SER A CB  1 
ATOM   443  O  OG  . SER A 1 61  ? 49.029 12.108 15.315  1.00 27.78 ? 61   SER A OG  1 
ATOM   444  N  N   . LEU A 1 62  ? 48.855 11.380 18.259  1.00 31.23 ? 62   LEU A N   1 
ATOM   445  C  CA  . LEU A 1 62  ? 48.829 12.241 19.441  1.00 30.93 ? 62   LEU A CA  1 
ATOM   446  C  C   . LEU A 1 62  ? 49.269 11.518 20.712  1.00 30.44 ? 62   LEU A C   1 
ATOM   447  O  O   . LEU A 1 62  ? 49.039 10.317 20.865  1.00 31.16 ? 62   LEU A O   1 
ATOM   448  C  CB  . LEU A 1 62  ? 47.414 12.784 19.664  1.00 31.18 ? 62   LEU A CB  1 
ATOM   449  C  CG  . LEU A 1 62  ? 46.638 13.341 18.465  1.00 31.96 ? 62   LEU A CG  1 
ATOM   450  C  CD1 . LEU A 1 62  ? 45.259 13.783 18.941  1.00 31.75 ? 62   LEU A CD1 1 
ATOM   451  C  CD2 . LEU A 1 62  ? 47.379 14.511 17.835  1.00 32.29 ? 62   LEU A CD2 1 
ATOM   452  N  N   . PRO A 1 63  ? 49.910 12.242 21.639  0.50 28.63 ? 63   PRO A N   1 
ATOM   453  C  CA  . PRO A 1 63  ? 50.348 11.607 22.883  0.50 29.46 ? 63   PRO A CA  1 
ATOM   454  C  C   . PRO A 1 63  ? 49.115 11.097 23.625  0.50 30.43 ? 63   PRO A C   1 
ATOM   455  O  O   . PRO A 1 63  ? 48.080 11.761 23.642  0.50 29.81 ? 63   PRO A O   1 
ATOM   456  C  CB  . PRO A 1 63  ? 51.040 12.745 23.628  0.50 28.28 ? 63   PRO A CB  1 
ATOM   457  C  CG  . PRO A 1 63  ? 51.566 13.604 22.515  0.50 28.71 ? 63   PRO A CG  1 
ATOM   458  C  CD  . PRO A 1 63  ? 50.404 13.627 21.553  0.50 28.62 ? 63   PRO A CD  1 
ATOM   459  N  N   . GLU A 1 64  ? 49.225 9.917  24.222  1.00 32.19 ? 64   GLU A N   1 
ATOM   460  C  CA  . GLU A 1 64  ? 48.118 9.309  24.958  1.00 34.57 ? 64   GLU A CA  1 
ATOM   461  C  C   . GLU A 1 64  ? 47.474 10.268 25.962  1.00 34.94 ? 64   GLU A C   1 
ATOM   462  O  O   . GLU A 1 64  ? 48.155 11.086 26.578  1.00 34.59 ? 64   GLU A O   1 
ATOM   463  C  CB  . GLU A 1 64  ? 48.623 8.054  25.674  1.00 36.81 ? 64   GLU A CB  1 
ATOM   464  C  CG  . GLU A 1 64  ? 47.631 7.407  26.612  1.00 40.41 ? 64   GLU A CG  1 
ATOM   465  C  CD  . GLU A 1 64  ? 48.199 6.159  27.250  1.00 42.88 ? 64   GLU A CD  1 
ATOM   466  O  OE1 . GLU A 1 64  ? 48.423 5.172  26.515  1.00 44.38 ? 64   GLU A OE1 1 
ATOM   467  O  OE2 . GLU A 1 64  ? 48.431 6.166  28.480  1.00 45.53 ? 64   GLU A OE2 1 
ATOM   468  N  N   . SER A 1 65  ? 46.156 10.167 26.121  1.00 35.08 ? 65   SER A N   1 
ATOM   469  C  CA  . SER A 1 65  ? 45.434 11.030 27.048  1.00 34.19 ? 65   SER A CA  1 
ATOM   470  C  C   . SER A 1 65  ? 45.759 10.704 28.506  1.00 34.82 ? 65   SER A C   1 
ATOM   471  O  O   . SER A 1 65  ? 45.907 9.537  28.877  1.00 33.93 ? 65   SER A O   1 
ATOM   472  C  CB  . SER A 1 65  ? 43.924 10.907 26.815  1.00 34.58 ? 65   SER A CB  1 
ATOM   473  O  OG  . SER A 1 65  ? 43.478 9.575  27.008  1.00 32.50 ? 65   SER A OG  1 
ATOM   474  N  N   . SER A 1 66  ? 45.858 11.742 29.333  1.00 35.43 ? 66   SER A N   1 
ATOM   475  C  CA  . SER A 1 66  ? 46.168 11.562 30.749  1.00 36.64 ? 66   SER A CA  1 
ATOM   476  C  C   . SER A 1 66  ? 44.993 10.972 31.523  1.00 38.08 ? 66   SER A C   1 
ATOM   477  O  O   . SER A 1 66  ? 43.891 10.812 30.991  1.00 36.74 ? 66   SER A O   1 
ATOM   478  C  CB  . SER A 1 66  ? 46.563 12.899 31.385  1.00 37.43 ? 66   SER A CB  1 
ATOM   479  O  OG  . SER A 1 66  ? 45.432 13.734 31.574  1.00 39.11 ? 66   SER A OG  1 
ATOM   480  N  N   . GLU A 1 67  ? 45.246 10.647 32.787  1.00 38.13 ? 67   GLU A N   1 
ATOM   481  C  CA  . GLU A 1 67  ? 44.227 10.087 33.664  1.00 38.50 ? 67   GLU A CA  1 
ATOM   482  C  C   . GLU A 1 67  ? 43.192 11.165 33.951  1.00 37.31 ? 67   GLU A C   1 
ATOM   483  O  O   . GLU A 1 67  ? 41.990 10.897 33.992  1.00 36.47 ? 67   GLU A O   1 
ATOM   484  C  CB  . GLU A 1 67  ? 44.863 9.614  34.978  1.00 40.36 ? 67   GLU A CB  1 
ATOM   485  C  CG  . GLU A 1 67  ? 45.522 10.717 35.797  1.00 42.95 ? 67   GLU A CG  1 
ATOM   486  C  CD  . GLU A 1 67  ? 46.640 11.427 35.048  1.00 44.67 ? 67   GLU A CD  1 
ATOM   487  O  OE1 . GLU A 1 67  ? 47.622 10.756 34.657  1.00 45.96 ? 67   GLU A OE1 1 
ATOM   488  O  OE2 . GLU A 1 67  ? 46.536 12.658 34.850  1.00 45.55 ? 67   GLU A OE2 1 
ATOM   489  N  N   . GLN A 1 68  ? 43.677 12.389 34.139  1.00 35.89 ? 68   GLN A N   1 
ATOM   490  C  CA  . GLN A 1 68  ? 42.817 13.526 34.419  1.00 35.56 ? 68   GLN A CA  1 
ATOM   491  C  C   . GLN A 1 68  ? 41.924 13.843 33.225  1.00 35.69 ? 68   GLN A C   1 
ATOM   492  O  O   . GLN A 1 68  ? 40.757 14.212 33.395  1.00 34.50 ? 68   GLN A O   1 
ATOM   493  C  CB  . GLN A 1 68  ? 43.661 14.752 34.770  1.00 36.79 ? 68   GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 68  ? 42.839 16.011 34.997  1.00 39.08 ? 68   GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 68  ? 43.681 17.199 35.412  1.00 40.92 ? 68   GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 68  ? 44.685 17.521 34.770  1.00 43.05 ? 68   GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 68  ? 43.272 17.868 36.485  1.00 41.23 ? 68   GLN A NE2 1 
ATOM   498  N  N   . GLU A 1 69  ? 42.469 13.706 32.018  1.00 34.01 ? 69   GLU A N   1 
ATOM   499  C  CA  . GLU A 1 69  ? 41.683 13.977 30.819  1.00 33.76 ? 69   GLU A CA  1 
ATOM   500  C  C   . GLU A 1 69  ? 40.603 12.905 30.679  1.00 33.35 ? 69   GLU A C   1 
ATOM   501  O  O   . GLU A 1 69  ? 39.442 13.221 30.409  1.00 33.98 ? 69   GLU A O   1 
ATOM   502  C  CB  . GLU A 1 69  ? 42.563 13.988 29.554  1.00 32.07 ? 69   GLU A CB  1 
ATOM   503  C  CG  . GLU A 1 69  ? 41.826 14.532 28.328  1.00 30.73 ? 69   GLU A CG  1 
ATOM   504  C  CD  . GLU A 1 69  ? 42.615 14.428 27.034  1.00 30.04 ? 69   GLU A CD  1 
ATOM   505  O  OE1 . GLU A 1 69  ? 43.860 14.524 27.073  1.00 29.38 ? 69   GLU A OE1 1 
ATOM   506  O  OE2 . GLU A 1 69  ? 41.983 14.269 25.966  1.00 28.50 ? 69   GLU A OE2 1 
ATOM   507  N  N   . ASP A 1 70  ? 40.985 11.643 30.870  1.00 33.56 ? 70   ASP A N   1 
ATOM   508  C  CA  . ASP A 1 70  ? 40.038 10.536 30.767  1.00 34.12 ? 70   ASP A CA  1 
ATOM   509  C  C   . ASP A 1 70  ? 38.829 10.745 31.673  1.00 34.15 ? 70   ASP A C   1 
ATOM   510  O  O   . ASP A 1 70  ? 37.696 10.521 31.258  1.00 33.55 ? 70   ASP A O   1 
ATOM   511  C  CB  . ASP A 1 70  ? 40.699 9.197  31.126  1.00 35.20 ? 70   ASP A CB  1 
ATOM   512  C  CG  . ASP A 1 70  ? 41.702 8.729  30.081  1.00 36.52 ? 70   ASP A CG  1 
ATOM   513  O  OD1 . ASP A 1 70  ? 41.543 9.062  28.888  1.00 35.55 ? 70   ASP A OD1 1 
ATOM   514  O  OD2 . ASP A 1 70  ? 42.646 8.000  30.455  1.00 37.80 ? 70   ASP A OD2 1 
ATOM   515  N  N   . ASP A 1 71  ? 39.066 11.178 32.909  1.00 34.37 ? 71   ASP A N   1 
ATOM   516  C  CA  . ASP A 1 71  ? 37.963 11.400 33.838  1.00 34.55 ? 71   ASP A CA  1 
ATOM   517  C  C   . ASP A 1 71  ? 37.007 12.470 33.323  1.00 34.54 ? 71   ASP A C   1 
ATOM   518  O  O   . ASP A 1 71  ? 35.791 12.351 33.487  1.00 33.71 ? 71   ASP A O   1 
ATOM   519  C  CB  . ASP A 1 71  ? 38.485 11.790 35.224  1.00 35.06 ? 71   ASP A CB  1 
ATOM   520  C  CG  . ASP A 1 71  ? 39.225 10.651 35.913  1.00 35.46 ? 71   ASP A CG  1 
ATOM   521  O  OD1 . ASP A 1 71  ? 38.796 9.483  35.779  1.00 34.64 ? 71   ASP A OD1 1 
ATOM   522  O  OD2 . ASP A 1 71  ? 40.229 10.925 36.603  1.00 36.77 ? 71   ASP A OD2 1 
ATOM   523  N  N   . MET A 1 72  ? 37.550 13.511 32.699  1.00 34.43 ? 72   MET A N   1 
ATOM   524  C  CA  . MET A 1 72  ? 36.712 14.580 32.159  1.00 34.74 ? 72   MET A CA  1 
ATOM   525  C  C   . MET A 1 72  ? 35.892 14.088 30.969  1.00 34.86 ? 72   MET A C   1 
ATOM   526  O  O   . MET A 1 72  ? 34.723 14.447 30.820  1.00 34.29 ? 72   MET A O   1 
ATOM   527  C  CB  . MET A 1 72  ? 37.562 15.778 31.721  1.00 36.01 ? 72   MET A CB  1 
ATOM   528  C  CG  . MET A 1 72  ? 38.159 16.586 32.859  1.00 37.34 ? 72   MET A CG  1 
ATOM   529  S  SD  . MET A 1 72  ? 36.931 17.067 34.090  1.00 40.06 ? 72   MET A SD  1 
ATOM   530  C  CE  . MET A 1 72  ? 35.664 17.767 33.078  1.00 41.09 ? 72   MET A CE  1 
ATOM   531  N  N   . LEU A 1 73  ? 36.509 13.267 30.125  1.00 33.51 ? 73   LEU A N   1 
ATOM   532  C  CA  . LEU A 1 73  ? 35.832 12.739 28.950  1.00 33.42 ? 73   LEU A CA  1 
ATOM   533  C  C   . LEU A 1 73  ? 34.611 11.895 29.304  1.00 33.05 ? 73   LEU A C   1 
ATOM   534  O  O   . LEU A 1 73  ? 33.653 11.828 28.533  1.00 31.02 ? 73   LEU A O   1 
ATOM   535  C  CB  . LEU A 1 73  ? 36.806 11.920 28.101  1.00 32.76 ? 73   LEU A CB  1 
ATOM   536  C  CG  . LEU A 1 73  ? 37.934 12.715 27.440  1.00 33.04 ? 73   LEU A CG  1 
ATOM   537  C  CD1 . LEU A 1 73  ? 38.798 11.769 26.624  1.00 33.16 ? 73   LEU A CD1 1 
ATOM   538  C  CD2 . LEU A 1 73  ? 37.355 13.814 26.549  1.00 31.92 ? 73   LEU A CD2 1 
ATOM   539  N  N   . ASP A 1 74  ? 34.640 11.249 30.468  1.00 33.92 ? 74   ASP A N   1 
ATOM   540  C  CA  . ASP A 1 74  ? 33.506 10.434 30.891  1.00 34.06 ? 74   ASP A CA  1 
ATOM   541  C  C   . ASP A 1 74  ? 32.291 11.320 31.118  1.00 32.52 ? 74   ASP A C   1 
ATOM   542  O  O   . ASP A 1 74  ? 31.182 10.833 31.309  1.00 34.35 ? 74   ASP A O   1 
ATOM   543  C  CB  . ASP A 1 74  ? 33.825 9.679  32.181  1.00 35.58 ? 74   ASP A CB  1 
ATOM   544  C  CG  . ASP A 1 74  ? 34.772 8.527  31.956  1.00 37.47 ? 74   ASP A CG  1 
ATOM   545  O  OD1 . ASP A 1 74  ? 34.484 7.692  31.073  1.00 38.12 ? 74   ASP A OD1 1 
ATOM   546  O  OD2 . ASP A 1 74  ? 35.797 8.454  32.664  1.00 41.00 ? 74   ASP A OD2 1 
ATOM   547  N  N   . LYS A 1 75  ? 32.516 12.626 31.097  1.00 30.39 ? 75   LYS A N   1 
ATOM   548  C  CA  . LYS A 1 75  ? 31.451 13.591 31.300  1.00 30.15 ? 75   LYS A CA  1 
ATOM   549  C  C   . LYS A 1 75  ? 31.052 14.237 29.983  1.00 27.46 ? 75   LYS A C   1 
ATOM   550  O  O   . LYS A 1 75  ? 30.041 14.925 29.905  1.00 27.17 ? 75   LYS A O   1 
ATOM   551  C  CB  . LYS A 1 75  ? 31.917 14.678 32.269  1.00 31.37 ? 75   LYS A CB  1 
ATOM   552  C  CG  . LYS A 1 75  ? 32.266 14.163 33.651  1.00 33.96 ? 75   LYS A CG  1 
ATOM   553  C  CD  . LYS A 1 75  ? 32.722 15.292 34.553  1.00 35.81 ? 75   LYS A CD  1 
ATOM   554  C  CE  . LYS A 1 75  ? 32.669 14.869 36.010  1.00 35.43 ? 75   LYS A CE  1 
ATOM   555  N  NZ  . LYS A 1 75  ? 31.281 14.485 36.401  1.00 37.02 ? 75   LYS A NZ  1 
ATOM   556  N  N   . ALA A 1 76  ? 31.854 14.002 28.949  1.00 25.36 ? 76   ALA A N   1 
ATOM   557  C  CA  . ALA A 1 76  ? 31.615 14.598 27.640  1.00 25.37 ? 76   ALA A CA  1 
ATOM   558  C  C   . ALA A 1 76  ? 30.396 14.082 26.888  1.00 22.72 ? 76   ALA A C   1 
ATOM   559  O  O   . ALA A 1 76  ? 30.134 12.880 26.856  1.00 24.61 ? 76   ALA A O   1 
ATOM   560  C  CB  . ALA A 1 76  ? 32.860 14.430 26.768  1.00 23.23 ? 76   ALA A CB  1 
ATOM   561  N  N   . TRP A 1 77  ? 29.662 15.005 26.272  1.00 22.64 ? 77   TRP A N   1 
ATOM   562  C  CA  . TRP A 1 77  ? 28.486 14.661 25.471  1.00 20.43 ? 77   TRP A CA  1 
ATOM   563  C  C   . TRP A 1 77  ? 29.009 14.205 24.103  1.00 20.25 ? 77   TRP A C   1 
ATOM   564  O  O   . TRP A 1 77  ? 29.909 14.827 23.544  1.00 18.86 ? 77   TRP A O   1 
ATOM   565  C  CB  . TRP A 1 77  ? 27.598 15.897 25.287  1.00 19.33 ? 77   TRP A CB  1 
ATOM   566  C  CG  . TRP A 1 77  ? 26.319 15.659 24.523  1.00 17.51 ? 77   TRP A CG  1 
ATOM   567  C  CD1 . TRP A 1 77  ? 25.082 15.388 25.046  1.00 18.05 ? 77   TRP A CD1 1 
ATOM   568  C  CD2 . TRP A 1 77  ? 26.154 15.686 23.100  1.00 17.14 ? 77   TRP A CD2 1 
ATOM   569  N  NE1 . TRP A 1 77  ? 24.159 15.249 24.035  1.00 17.91 ? 77   TRP A NE1 1 
ATOM   570  C  CE2 . TRP A 1 77  ? 24.789 15.425 22.831  1.00 16.14 ? 77   TRP A CE2 1 
ATOM   571  C  CE3 . TRP A 1 77  ? 27.027 15.905 22.024  1.00 15.47 ? 77   TRP A CE3 1 
ATOM   572  C  CZ2 . TRP A 1 77  ? 24.277 15.376 21.530  1.00 20.15 ? 77   TRP A CZ2 1 
ATOM   573  C  CZ3 . TRP A 1 77  ? 26.516 15.858 20.730  1.00 16.84 ? 77   TRP A CZ3 1 
ATOM   574  C  CH2 . TRP A 1 77  ? 25.152 15.595 20.495  1.00 20.44 ? 77   TRP A CH2 1 
ATOM   575  N  N   . GLY A 1 78  ? 28.457 13.123 23.568  1.00 18.38 ? 78   GLY A N   1 
ATOM   576  C  CA  . GLY A 1 78  ? 28.898 12.645 22.268  1.00 18.75 ? 78   GLY A CA  1 
ATOM   577  C  C   . GLY A 1 78  ? 30.293 12.036 22.255  1.00 19.46 ? 78   GLY A C   1 
ATOM   578  O  O   . GLY A 1 78  ? 31.037 12.174 21.282  1.00 17.90 ? 78   GLY A O   1 
ATOM   579  N  N   . LEU A 1 79  ? 30.641 11.345 23.333  1.00 18.85 ? 79   LEU A N   1 
ATOM   580  C  CA  . LEU A 1 79  ? 31.946 10.713 23.444  1.00 21.72 ? 79   LEU A CA  1 
ATOM   581  C  C   . LEU A 1 79  ? 32.152 9.611  22.407  1.00 21.03 ? 79   LEU A C   1 
ATOM   582  O  O   . LEU A 1 79  ? 31.250 8.817  22.125  1.00 21.79 ? 79   LEU A O   1 
ATOM   583  C  CB  . LEU A 1 79  ? 32.119 10.116 24.847  1.00 22.58 ? 79   LEU A CB  1 
ATOM   584  C  CG  . LEU A 1 79  ? 33.464 9.461  25.159  1.00 25.59 ? 79   LEU A CG  1 
ATOM   585  C  CD1 . LEU A 1 79  ? 34.553 10.523 25.168  1.00 27.36 ? 79   LEU A CD1 1 
ATOM   586  C  CD2 . LEU A 1 79  ? 33.393 8.764  26.512  1.00 25.22 ? 79   LEU A CD2 1 
ATOM   587  N  N   . GLU A 1 80  ? 33.346 9.585  21.831  1.00 21.76 ? 80   GLU A N   1 
ATOM   588  C  CA  . GLU A 1 80  ? 33.715 8.567  20.858  1.00 23.50 ? 80   GLU A CA  1 
ATOM   589  C  C   . GLU A 1 80  ? 35.118 8.069  21.201  1.00 22.33 ? 80   GLU A C   1 
ATOM   590  O  O   . GLU A 1 80  ? 35.849 8.714  21.955  1.00 21.69 ? 80   GLU A O   1 
ATOM   591  C  CB  . GLU A 1 80  ? 33.658 9.135  19.432  1.00 24.81 ? 80   GLU A CB  1 
ATOM   592  C  CG  . GLU A 1 80  ? 32.227 9.442  18.987  1.00 30.16 ? 80   GLU A CG  1 
ATOM   593  C  CD  . GLU A 1 80  ? 32.118 9.791  17.519  1.00 33.17 ? 80   GLU A CD  1 
ATOM   594  O  OE1 . GLU A 1 80  ? 32.720 9.073  16.693  1.00 35.67 ? 80   GLU A OE1 1 
ATOM   595  O  OE2 . GLU A 1 80  ? 31.420 10.772 17.189  1.00 34.17 ? 80   GLU A OE2 1 
ATOM   596  N  N   . PRO A 1 81  ? 35.506 6.902  20.673  0.50 20.42 ? 81   PRO A N   1 
ATOM   597  C  CA  . PRO A 1 81  ? 36.836 6.367  20.965  0.50 19.56 ? 81   PRO A CA  1 
ATOM   598  C  C   . PRO A 1 81  ? 37.952 7.347  20.635  0.50 19.44 ? 81   PRO A C   1 
ATOM   599  O  O   . PRO A 1 81  ? 38.991 7.355  21.286  0.50 16.90 ? 81   PRO A O   1 
ATOM   600  C  CB  . PRO A 1 81  ? 36.894 5.113  20.101  0.50 19.53 ? 81   PRO A CB  1 
ATOM   601  C  CG  . PRO A 1 81  ? 35.478 4.651  20.102  0.50 20.28 ? 81   PRO A CG  1 
ATOM   602  C  CD  . PRO A 1 81  ? 34.722 5.944  19.877  1.00 21.90 ? 81   PRO A CD  1 
ATOM   603  N  N   . GLU A 1 82  ? 37.719 8.190  19.634  1.00 20.63 ? 82   GLU A N   1 
ATOM   604  C  CA  . GLU A 1 82  ? 38.722 9.157  19.203  1.00 22.00 ? 82   GLU A CA  1 
ATOM   605  C  C   . GLU A 1 82  ? 38.557 10.563 19.781  1.00 22.12 ? 82   GLU A C   1 
ATOM   606  O  O   . GLU A 1 82  ? 39.139 11.521 19.267  1.00 21.55 ? 82   GLU A O   1 
ATOM   607  C  CB  . GLU A 1 82  ? 38.729 9.212  17.671  1.00 24.19 ? 82   GLU A CB  1 
ATOM   608  C  CG  . GLU A 1 82  ? 38.993 7.849  17.040  1.00 28.01 ? 82   GLU A CG  1 
ATOM   609  C  CD  . GLU A 1 82  ? 38.791 7.847  15.537  1.00 30.08 ? 82   GLU A CD  1 
ATOM   610  O  OE1 . GLU A 1 82  ? 37.738 8.338  15.079  1.00 32.80 ? 82   GLU A OE1 1 
ATOM   611  O  OE2 . GLU A 1 82  ? 39.680 7.342  14.815  1.00 33.37 ? 82   GLU A OE2 1 
ATOM   612  N  N   . SER A 1 83  ? 37.775 10.688 20.852  1.00 20.19 ? 83   SER A N   1 
ATOM   613  C  CA  . SER A 1 83  ? 37.570 11.990 21.496  1.00 19.99 ? 83   SER A CA  1 
ATOM   614  C  C   . SER A 1 83  ? 38.808 12.427 22.267  1.00 21.08 ? 83   SER A C   1 
ATOM   615  O  O   . SER A 1 83  ? 39.555 11.599 22.806  1.00 21.81 ? 83   SER A O   1 
ATOM   616  C  CB  . SER A 1 83  ? 36.387 11.945 22.480  1.00 18.56 ? 83   SER A CB  1 
ATOM   617  O  OG  . SER A 1 83  ? 35.149 11.777 21.819  1.00 21.12 ? 83   SER A OG  1 
ATOM   618  N  N   . ARG A 1 84  ? 39.017 13.736 22.317  1.00 21.28 ? 84   ARG A N   1 
ATOM   619  C  CA  . ARG A 1 84  ? 40.136 14.325 23.038  1.00 21.94 ? 84   ARG A CA  1 
ATOM   620  C  C   . ARG A 1 84  ? 39.735 15.722 23.487  1.00 21.74 ? 84   ARG A C   1 
ATOM   621  O  O   . ARG A 1 84  ? 38.851 16.340 22.903  1.00 21.04 ? 84   ARG A O   1 
ATOM   622  C  CB  . ARG A 1 84  ? 41.381 14.454 22.143  1.00 22.03 ? 84   ARG A CB  1 
ATOM   623  C  CG  . ARG A 1 84  ? 42.056 13.152 21.732  1.00 22.07 ? 84   ARG A CG  1 
ATOM   624  C  CD  . ARG A 1 84  ? 42.503 12.332 22.946  1.00 22.20 ? 84   ARG A CD  1 
ATOM   625  N  NE  . ARG A 1 84  ? 43.397 13.069 23.836  1.00 24.60 ? 84   ARG A NE  1 
ATOM   626  C  CZ  . ARG A 1 84  ? 44.712 13.190 23.669  1.00 26.78 ? 84   ARG A CZ  1 
ATOM   627  N  NH1 . ARG A 1 84  ? 45.320 12.621 22.634  1.00 26.95 ? 84   ARG A NH1 1 
ATOM   628  N  NH2 . ARG A 1 84  ? 45.426 13.883 24.548  1.00 27.13 ? 84   ARG A NH2 1 
ATOM   629  N  N   . LEU A 1 85  ? 40.360 16.210 24.548  1.00 21.90 ? 85   LEU A N   1 
ATOM   630  C  CA  . LEU A 1 85  ? 40.102 17.571 24.981  1.00 23.38 ? 85   LEU A CA  1 
ATOM   631  C  C   . LEU A 1 85  ? 41.123 18.290 24.108  1.00 23.83 ? 85   LEU A C   1 
ATOM   632  O  O   . LEU A 1 85  ? 42.317 17.979 24.172  1.00 23.35 ? 85   LEU A O   1 
ATOM   633  C  CB  . LEU A 1 85  ? 40.435 17.745 26.462  1.00 25.88 ? 85   LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 85  ? 39.578 16.900 27.405  1.00 26.78 ? 85   LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 85  ? 40.027 17.104 28.846  1.00 28.86 ? 85   LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 85  ? 38.123 17.291 27.241  1.00 26.99 ? 85   LEU A CD2 1 
ATOM   637  N  N   . SER A 1 86  ? 40.660 19.200 23.255  1.00 21.54 ? 86   SER A N   1 
ATOM   638  C  CA  . SER A 1 86  ? 41.567 19.911 22.359  1.00 23.09 ? 86   SER A CA  1 
ATOM   639  C  C   . SER A 1 86  ? 42.628 20.745 23.071  1.00 23.85 ? 86   SER A C   1 
ATOM   640  O  O   . SER A 1 86  ? 43.653 21.056 22.488  1.00 23.51 ? 86   SER A O   1 
ATOM   641  C  CB  . SER A 1 86  ? 40.781 20.794 21.378  1.00 21.55 ? 86   SER A CB  1 
ATOM   642  O  OG  . SER A 1 86  ? 40.005 21.774 22.042  1.00 23.84 ? 86   SER A OG  1 
ATOM   643  N  N   . CYS A 1 87  ? 42.399 21.104 24.329  1.00 26.60 ? 87   CYS A N   1 
ATOM   644  C  CA  . CYS A 1 87  ? 43.395 21.895 25.048  1.00 26.58 ? 87   CYS A CA  1 
ATOM   645  C  C   . CYS A 1 87  ? 44.506 21.002 25.607  1.00 28.38 ? 87   CYS A C   1 
ATOM   646  O  O   . CYS A 1 87  ? 45.512 21.495 26.127  1.00 29.11 ? 87   CYS A O   1 
ATOM   647  C  CB  . CYS A 1 87  ? 42.744 22.680 26.189  1.00 25.83 ? 87   CYS A CB  1 
ATOM   648  S  SG  . CYS A 1 87  ? 42.226 21.684 27.587  1.00 25.70 ? 87   CYS A SG  1 
ATOM   649  N  N   . GLN A 1 88  ? 44.325 19.691 25.495  1.00 27.79 ? 88   GLN A N   1 
ATOM   650  C  CA  . GLN A 1 88  ? 45.311 18.738 25.997  1.00 29.15 ? 88   GLN A CA  1 
ATOM   651  C  C   . GLN A 1 88  ? 46.013 17.975 24.881  1.00 28.83 ? 88   GLN A C   1 
ATOM   652  O  O   . GLN A 1 88  ? 47.163 17.579 25.033  1.00 28.57 ? 88   GLN A O   1 
ATOM   653  C  CB  . GLN A 1 88  ? 44.644 17.729 26.937  1.00 29.18 ? 88   GLN A CB  1 
ATOM   654  C  CG  . GLN A 1 88  ? 43.946 18.346 28.139  1.00 30.72 ? 88   GLN A CG  1 
ATOM   655  C  CD  . GLN A 1 88  ? 44.912 18.985 29.118  1.00 31.65 ? 88   GLN A CD  1 
ATOM   656  O  OE1 . GLN A 1 88  ? 45.855 18.344 29.580  1.00 34.44 ? 88   GLN A OE1 1 
ATOM   657  N  NE2 . GLN A 1 88  ? 44.678 20.249 29.447  1.00 30.86 ? 88   GLN A NE2 1 
ATOM   658  N  N   . ALA A 1 89  ? 45.321 17.762 23.765  1.00 27.83 ? 89   ALA A N   1 
ATOM   659  C  CA  . ALA A 1 89  ? 45.890 17.020 22.639  1.00 27.12 ? 89   ALA A CA  1 
ATOM   660  C  C   . ALA A 1 89  ? 46.907 17.850 21.864  1.00 27.69 ? 89   ALA A C   1 
ATOM   661  O  O   . ALA A 1 89  ? 46.573 18.895 21.318  1.00 26.04 ? 89   ALA A O   1 
ATOM   662  C  CB  . ALA A 1 89  ? 44.772 16.560 21.696  1.00 27.05 ? 89   ALA A CB  1 
ATOM   663  N  N   . ARG A 1 90  ? 48.149 17.376 21.808  1.00 26.57 ? 90   ARG A N   1 
ATOM   664  C  CA  . ARG A 1 90  ? 49.194 18.096 21.092  1.00 28.00 ? 90   ARG A CA  1 
ATOM   665  C  C   . ARG A 1 90  ? 49.604 17.381 19.815  1.00 28.05 ? 90   ARG A C   1 
ATOM   666  O  O   . ARG A 1 90  ? 49.870 16.179 19.816  1.00 28.16 ? 90   ARG A O   1 
ATOM   667  C  CB  . ARG A 1 90  ? 50.417 18.291 21.993  1.00 28.89 ? 90   ARG A CB  1 
ATOM   668  C  CG  . ARG A 1 90  ? 50.139 19.193 23.182  1.00 29.90 ? 90   ARG A CG  1 
ATOM   669  C  CD  . ARG A 1 90  ? 51.350 19.358 24.084  1.00 32.79 ? 90   ARG A CD  1 
ATOM   670  N  NE  . ARG A 1 90  ? 51.057 20.260 25.197  1.00 34.72 ? 90   ARG A NE  1 
ATOM   671  C  CZ  . ARG A 1 90  ? 50.975 21.584 25.097  1.00 34.55 ? 90   ARG A CZ  1 
ATOM   672  N  NH1 . ARG A 1 90  ? 51.169 22.183 23.930  1.00 35.82 ? 90   ARG A NH1 1 
ATOM   673  N  NH2 . ARG A 1 90  ? 50.683 22.311 26.168  1.00 37.24 ? 90   ARG A NH2 1 
ATOM   674  N  N   . VAL A 1 91  ? 49.652 18.138 18.726  1.00 28.18 ? 91   VAL A N   1 
ATOM   675  C  CA  . VAL A 1 91  ? 50.031 17.600 17.428  1.00 28.62 ? 91   VAL A CA  1 
ATOM   676  C  C   . VAL A 1 91  ? 51.494 17.184 17.463  1.00 29.38 ? 91   VAL A C   1 
ATOM   677  O  O   . VAL A 1 91  ? 52.303 17.800 18.157  1.00 29.66 ? 91   VAL A O   1 
ATOM   678  C  CB  . VAL A 1 91  ? 49.852 18.661 16.315  1.00 29.03 ? 91   VAL A CB  1 
ATOM   679  C  CG1 . VAL A 1 91  ? 50.260 18.094 14.969  1.00 29.76 ? 91   VAL A CG1 1 
ATOM   680  C  CG2 . VAL A 1 91  ? 48.407 19.118 16.266  1.00 27.14 ? 91   VAL A CG2 1 
ATOM   681  N  N   . THR A 1 92  ? 51.825 16.128 16.730  1.00 28.98 ? 92   THR A N   1 
ATOM   682  C  CA  . THR A 1 92  ? 53.202 15.667 16.660  1.00 29.57 ? 92   THR A CA  1 
ATOM   683  C  C   . THR A 1 92  ? 53.711 15.787 15.229  1.00 29.38 ? 92   THR A C   1 
ATOM   684  O  O   . THR A 1 92  ? 53.998 16.890 14.769  1.00 31.08 ? 92   THR A O   1 
ATOM   685  C  CB  . THR A 1 92  ? 53.355 14.212 17.164  1.00 28.33 ? 92   THR A CB  1 
ATOM   686  O  OG1 . THR A 1 92  ? 52.400 13.363 16.514  1.00 31.17 ? 92   THR A OG1 1 
ATOM   687  C  CG2 . THR A 1 92  ? 53.153 14.155 18.667  1.00 28.12 ? 92   THR A CG2 1 
ATOM   688  N  N   . ASP A 1 93  ? 53.785 14.674 14.510  1.00 30.37 ? 93   ASP A N   1 
ATOM   689  C  CA  . ASP A 1 93  ? 54.297 14.700 13.147  1.00 31.84 ? 93   ASP A CA  1 
ATOM   690  C  C   . ASP A 1 93  ? 53.322 14.203 12.088  1.00 31.81 ? 93   ASP A C   1 
ATOM   691  O  O   . ASP A 1 93  ? 53.723 13.881 10.972  1.00 32.41 ? 93   ASP A O   1 
ATOM   692  C  CB  . ASP A 1 93  ? 55.585 13.869 13.082  1.00 35.01 ? 93   ASP A CB  1 
ATOM   693  C  CG  . ASP A 1 93  ? 55.348 12.391 13.376  1.00 37.33 ? 93   ASP A CG  1 
ATOM   694  O  OD1 . ASP A 1 93  ? 54.466 12.074 14.202  1.00 38.71 ? 93   ASP A OD1 1 
ATOM   695  O  OD2 . ASP A 1 93  ? 56.058 11.542 12.792  1.00 38.32 ? 93   ASP A OD2 1 
ATOM   696  N  N   . GLU A 1 94  ? 52.037 14.154 12.414  1.00 30.76 ? 94   GLU A N   1 
ATOM   697  C  CA  . GLU A 1 94  ? 51.069 13.657 11.448  1.00 29.59 ? 94   GLU A CA  1 
ATOM   698  C  C   . GLU A 1 94  ? 49.878 14.596 11.270  1.00 28.10 ? 94   GLU A C   1 
ATOM   699  O  O   . GLU A 1 94  ? 49.434 15.232 12.225  1.00 27.66 ? 94   GLU A O   1 
ATOM   700  C  CB  . GLU A 1 94  ? 50.596 12.271 11.897  1.00 30.58 ? 94   GLU A CB  1 
ATOM   701  C  CG  . GLU A 1 94  ? 49.816 11.489 10.867  1.00 33.13 ? 94   GLU A CG  1 
ATOM   702  C  CD  . GLU A 1 94  ? 49.543 10.066 11.320  1.00 33.91 ? 94   GLU A CD  1 
ATOM   703  O  OE1 . GLU A 1 94  ? 50.515 9.309  11.524  1.00 36.71 ? 94   GLU A OE1 1 
ATOM   704  O  OE2 . GLU A 1 94  ? 48.359 9.707  11.474  1.00 34.20 ? 94   GLU A OE2 1 
ATOM   705  N  N   . ASP A 1 95  ? 49.384 14.694 10.039  1.00 25.01 ? 95   ASP A N   1 
ATOM   706  C  CA  . ASP A 1 95  ? 48.229 15.535 9.741   1.00 23.53 ? 95   ASP A CA  1 
ATOM   707  C  C   . ASP A 1 95  ? 46.991 14.919 10.387  1.00 23.29 ? 95   ASP A C   1 
ATOM   708  O  O   . ASP A 1 95  ? 46.864 13.694 10.485  1.00 23.26 ? 95   ASP A O   1 
ATOM   709  C  CB  . ASP A 1 95  ? 48.021 15.653 8.229   1.00 21.56 ? 95   ASP A CB  1 
ATOM   710  C  CG  . ASP A 1 95  ? 49.028 16.584 7.567   1.00 21.56 ? 95   ASP A CG  1 
ATOM   711  O  OD1 . ASP A 1 95  ? 50.018 16.976 8.223   1.00 22.79 ? 95   ASP A OD1 1 
ATOM   712  O  OD2 . ASP A 1 95  ? 48.823 16.922 6.380   1.00 21.51 ? 95   ASP A OD2 1 
ATOM   713  N  N   . LEU A 1 96  ? 46.080 15.779 10.830  1.00 22.80 ? 96   LEU A N   1 
ATOM   714  C  CA  . LEU A 1 96  ? 44.866 15.336 11.495  1.00 21.08 ? 96   LEU A CA  1 
ATOM   715  C  C   . LEU A 1 96  ? 43.606 15.841 10.820  1.00 20.80 ? 96   LEU A C   1 
ATOM   716  O  O   . LEU A 1 96  ? 43.642 16.811 10.070  1.00 20.79 ? 96   LEU A O   1 
ATOM   717  C  CB  . LEU A 1 96  ? 44.841 15.862 12.932  1.00 21.42 ? 96   LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 96  ? 46.064 15.715 13.829  1.00 22.77 ? 96   LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 96  ? 45.777 16.385 15.177  1.00 22.62 ? 96   LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 96  ? 46.388 14.248 14.002  1.00 20.90 ? 96   LEU A CD2 1 
ATOM   721  N  N   . VAL A 1 97  ? 42.494 15.161 11.088  1.00 19.48 ? 97   VAL A N   1 
ATOM   722  C  CA  . VAL A 1 97  ? 41.180 15.586 10.614  1.00 19.79 ? 97   VAL A CA  1 
ATOM   723  C  C   . VAL A 1 97  ? 40.434 15.637 11.937  1.00 19.58 ? 97   VAL A C   1 
ATOM   724  O  O   . VAL A 1 97  ? 40.379 14.642 12.661  1.00 17.79 ? 97   VAL A O   1 
ATOM   725  C  CB  . VAL A 1 97  ? 40.494 14.569 9.674   1.00 18.60 ? 97   VAL A CB  1 
ATOM   726  C  CG1 . VAL A 1 97  ? 39.021 14.959 9.469   1.00 18.37 ? 97   VAL A CG1 1 
ATOM   727  C  CG2 . VAL A 1 97  ? 41.197 14.563 8.314   1.00 20.16 ? 97   VAL A CG2 1 
ATOM   728  N  N   . VAL A 1 98  ? 39.883 16.797 12.265  1.00 18.01 ? 98   VAL A N   1 
ATOM   729  C  CA  . VAL A 1 98  ? 39.193 16.961 13.535  1.00 19.28 ? 98   VAL A CA  1 
ATOM   730  C  C   . VAL A 1 98  ? 37.760 17.429 13.366  1.00 19.36 ? 98   VAL A C   1 
ATOM   731  O  O   . VAL A 1 98  ? 37.464 18.258 12.512  1.00 19.57 ? 98   VAL A O   1 
ATOM   732  C  CB  . VAL A 1 98  ? 39.964 17.976 14.428  1.00 18.99 ? 98   VAL A CB  1 
ATOM   733  C  CG1 . VAL A 1 98  ? 39.173 18.291 15.688  1.00 20.06 ? 98   VAL A CG1 1 
ATOM   734  C  CG2 . VAL A 1 98  ? 41.346 17.413 14.778  1.00 18.90 ? 98   VAL A CG2 1 
ATOM   735  N  N   . GLU A 1 99  ? 36.863 16.874 14.174  1.00 17.72 ? 99   GLU A N   1 
ATOM   736  C  CA  . GLU A 1 99  ? 35.462 17.263 14.124  1.00 18.32 ? 99   GLU A CA  1 
ATOM   737  C  C   . GLU A 1 99  ? 35.068 17.881 15.459  1.00 18.12 ? 99   GLU A C   1 
ATOM   738  O  O   . GLU A 1 99  ? 35.379 17.334 16.518  1.00 18.02 ? 99   GLU A O   1 
ATOM   739  C  CB  . GLU A 1 99  ? 34.569 16.047 13.848  1.00 18.68 ? 99   GLU A CB  1 
ATOM   740  C  CG  . GLU A 1 99  ? 33.073 16.333 13.956  1.00 23.64 ? 99   GLU A CG  1 
ATOM   741  C  CD  . GLU A 1 99  ? 32.225 15.105 13.704  1.00 27.39 ? 99   GLU A CD  1 
ATOM   742  O  OE1 . GLU A 1 99  ? 32.267 14.573 12.575  1.00 29.40 ? 99   GLU A OE1 1 
ATOM   743  O  OE2 . GLU A 1 99  ? 31.519 14.668 14.637  1.00 31.08 ? 99   GLU A OE2 1 
ATOM   744  N  N   . ILE A 1 100 ? 34.400 19.027 15.402  1.00 18.12 ? 100  ILE A N   1 
ATOM   745  C  CA  . ILE A 1 100 ? 33.931 19.693 16.607  1.00 17.49 ? 100  ILE A CA  1 
ATOM   746  C  C   . ILE A 1 100 ? 32.515 19.151 16.815  1.00 18.06 ? 100  ILE A C   1 
ATOM   747  O  O   . ILE A 1 100 ? 31.703 19.167 15.895  1.00 18.54 ? 100  ILE A O   1 
ATOM   748  C  CB  . ILE A 1 100 ? 33.861 21.216 16.421  1.00 18.72 ? 100  ILE A CB  1 
ATOM   749  C  CG1 . ILE A 1 100 ? 35.266 21.778 16.169  1.00 20.07 ? 100  ILE A CG1 1 
ATOM   750  C  CG2 . ILE A 1 100 ? 33.250 21.857 17.662  1.00 18.82 ? 100  ILE A CG2 1 
ATOM   751  C  CD1 . ILE A 1 100 ? 35.282 23.273 15.883  1.00 23.53 ? 100  ILE A CD1 1 
ATOM   752  N  N   . PRO A 1 101 ? 32.203 18.666 18.025  1.00 19.13 ? 101  PRO A N   1 
ATOM   753  C  CA  . PRO A 1 101 ? 30.885 18.107 18.360  1.00 19.53 ? 101  PRO A CA  1 
ATOM   754  C  C   . PRO A 1 101 ? 29.729 19.084 18.158  1.00 19.75 ? 101  PRO A C   1 
ATOM   755  O  O   . PRO A 1 101 ? 29.914 20.296 18.172  1.00 20.28 ? 101  PRO A O   1 
ATOM   756  C  CB  . PRO A 1 101 ? 31.038 17.711 19.829  1.00 21.42 ? 101  PRO A CB  1 
ATOM   757  C  CG  . PRO A 1 101 ? 32.530 17.523 19.996  1.00 21.25 ? 101  PRO A CG  1 
ATOM   758  C  CD  . PRO A 1 101 ? 33.092 18.650 19.200  1.00 18.66 ? 101  PRO A CD  1 
ATOM   759  N  N   . ARG A 1 102 ? 28.530 18.538 17.978  1.00 19.17 ? 102  ARG A N   1 
ATOM   760  C  CA  . ARG A 1 102 ? 27.339 19.353 17.775  1.00 22.53 ? 102  ARG A CA  1 
ATOM   761  C  C   . ARG A 1 102 ? 26.943 20.083 19.047  1.00 20.92 ? 102  ARG A C   1 
ATOM   762  O  O   . ARG A 1 102 ? 26.255 21.106 19.004  1.00 23.09 ? 102  ARG A O   1 
ATOM   763  C  CB  . ARG A 1 102 ? 26.175 18.472 17.318  1.00 24.16 ? 102  ARG A CB  1 
ATOM   764  C  CG  . ARG A 1 102 ? 26.246 18.046 15.863  1.00 26.89 ? 102  ARG A CG  1 
ATOM   765  C  CD  . ARG A 1 102 ? 26.113 19.253 14.954  1.00 30.40 ? 102  ARG A CD  1 
ATOM   766  N  NE  . ARG A 1 102 ? 24.947 20.055 15.309  1.00 34.03 ? 102  ARG A NE  1 
ATOM   767  C  CZ  . ARG A 1 102 ? 24.573 21.156 14.670  1.00 38.20 ? 102  ARG A CZ  1 
ATOM   768  N  NH1 . ARG A 1 102 ? 25.274 21.593 13.632  1.00 39.55 ? 102  ARG A NH1 1 
ATOM   769  N  NH2 . ARG A 1 102 ? 23.500 21.827 15.073  1.00 38.46 ? 102  ARG A NH2 1 
ATOM   770  N  N   . TYR A 1 103 ? 27.405 19.560 20.176  1.00 20.79 ? 103  TYR A N   1 
ATOM   771  C  CA  . TYR A 1 103 ? 27.071 20.126 21.472  1.00 21.12 ? 103  TYR A CA  1 
ATOM   772  C  C   . TYR A 1 103 ? 28.102 19.750 22.540  1.00 21.87 ? 103  TYR A C   1 
ATOM   773  O  O   . TYR A 1 103 ? 28.801 18.745 22.416  1.00 21.89 ? 103  TYR A O   1 
ATOM   774  C  CB  . TYR A 1 103 ? 25.691 19.595 21.884  1.00 20.44 ? 103  TYR A CB  1 
ATOM   775  C  CG  . TYR A 1 103 ? 25.155 20.176 23.161  1.00 20.37 ? 103  TYR A CG  1 
ATOM   776  C  CD1 . TYR A 1 103 ? 24.482 21.399 23.162  1.00 21.59 ? 103  TYR A CD1 1 
ATOM   777  C  CD2 . TYR A 1 103 ? 25.350 19.525 24.379  1.00 19.93 ? 103  TYR A CD2 1 
ATOM   778  C  CE1 . TYR A 1 103 ? 24.023 21.960 24.344  1.00 22.14 ? 103  TYR A CE1 1 
ATOM   779  C  CE2 . TYR A 1 103 ? 24.892 20.085 25.572  1.00 19.17 ? 103  TYR A CE2 1 
ATOM   780  C  CZ  . TYR A 1 103 ? 24.233 21.302 25.540  1.00 19.55 ? 103  TYR A CZ  1 
ATOM   781  O  OH  . TYR A 1 103 ? 23.791 21.873 26.712  1.00 22.62 ? 103  TYR A OH  1 
ATOM   782  N  N   . THR A 1 104 ? 28.217 20.575 23.578  1.00 22.37 ? 104  THR A N   1 
ATOM   783  C  CA  . THR A 1 104 ? 29.116 20.274 24.694  1.00 22.29 ? 104  THR A CA  1 
ATOM   784  C  C   . THR A 1 104 ? 28.376 20.666 25.960  1.00 23.67 ? 104  THR A C   1 
ATOM   785  O  O   . THR A 1 104 ? 27.664 21.664 25.972  1.00 23.20 ? 104  THR A O   1 
ATOM   786  C  CB  . THR A 1 104 ? 30.459 21.061 24.649  1.00 23.00 ? 104  THR A CB  1 
ATOM   787  O  OG1 . THR A 1 104 ? 30.210 22.465 24.786  1.00 23.74 ? 104  THR A OG1 1 
ATOM   788  C  CG2 . THR A 1 104 ? 31.200 20.787 23.350  1.00 21.90 ? 104  THR A CG2 1 
ATOM   789  N  N   . ILE A 1 105 ? 28.529 19.876 27.015  1.00 25.90 ? 105  ILE A N   1 
ATOM   790  C  CA  . ILE A 1 105 ? 27.855 20.167 28.276  1.00 28.97 ? 105  ILE A CA  1 
ATOM   791  C  C   . ILE A 1 105 ? 28.606 21.231 29.067  1.00 32.15 ? 105  ILE A C   1 
ATOM   792  O  O   . ILE A 1 105 ? 29.820 21.146 29.226  1.00 32.39 ? 105  ILE A O   1 
ATOM   793  C  CB  . ILE A 1 105 ? 27.742 18.906 29.157  1.00 29.72 ? 105  ILE A CB  1 
ATOM   794  C  CG1 . ILE A 1 105 ? 26.870 17.861 28.463  1.00 28.49 ? 105  ILE A CG1 1 
ATOM   795  C  CG2 . ILE A 1 105 ? 27.141 19.272 30.516  1.00 29.36 ? 105  ILE A CG2 1 
ATOM   796  C  CD1 . ILE A 1 105 ? 26.891 16.504 29.134  1.00 29.72 ? 105  ILE A CD1 1 
ATOM   797  N  N   . ASN A 1 106 ? 27.875 22.232 29.553  1.00 34.74 ? 106  ASN A N   1 
ATOM   798  C  CA  . ASN A 1 106 ? 28.460 23.304 30.356  1.00 37.75 ? 106  ASN A CA  1 
ATOM   799  C  C   . ASN A 1 106 ? 27.398 23.883 31.282  1.00 39.22 ? 106  ASN A C   1 
ATOM   800  O  O   . ASN A 1 106 ? 26.700 24.829 30.925  1.00 39.37 ? 106  ASN A O   1 
ATOM   801  C  CB  . ASN A 1 106 ? 29.017 24.421 29.472  1.00 36.72 ? 106  ASN A CB  1 
ATOM   802  C  CG  . ASN A 1 106 ? 29.709 25.506 30.282  1.00 38.75 ? 106  ASN A CG  1 
ATOM   803  O  OD1 . ASN A 1 106 ? 29.738 25.451 31.516  1.00 38.34 ? 106  ASN A OD1 1 
ATOM   804  N  ND2 . ASN A 1 106 ? 30.269 26.497 29.595  1.00 36.92 ? 106  ASN A ND2 1 
ATOM   805  N  N   . HIS A 1 107 ? 27.294 23.309 32.477  1.00 42.43 ? 107  HIS A N   1 
ATOM   806  C  CA  . HIS A 1 107 ? 26.313 23.731 33.472  1.00 44.72 ? 107  HIS A CA  1 
ATOM   807  C  C   . HIS A 1 107 ? 26.329 25.221 33.803  1.00 45.76 ? 107  HIS A C   1 
ATOM   808  O  O   . HIS A 1 107 ? 25.380 25.736 34.399  1.00 45.92 ? 107  HIS A O   1 
ATOM   809  C  CB  . HIS A 1 107 ? 26.505 22.919 34.753  1.00 45.46 ? 107  HIS A CB  1 
ATOM   810  C  CG  . HIS A 1 107 ? 26.174 21.467 34.598  1.00 46.85 ? 107  HIS A CG  1 
ATOM   811  N  ND1 . HIS A 1 107 ? 24.884 21.014 34.424  1.00 47.05 ? 107  HIS A ND1 1 
ATOM   812  C  CD2 . HIS A 1 107 ? 26.967 20.370 34.563  1.00 47.27 ? 107  HIS A CD2 1 
ATOM   813  C  CE1 . HIS A 1 107 ? 24.896 19.700 34.288  1.00 47.79 ? 107  HIS A CE1 1 
ATOM   814  N  NE2 . HIS A 1 107 ? 26.148 19.284 34.368  1.00 47.56 ? 107  HIS A NE2 1 
ATOM   815  N  N   . ALA A 1 108 ? 27.397 25.909 33.414  1.00 46.51 ? 108  ALA A N   1 
ATOM   816  C  CA  . ALA A 1 108 ? 27.528 27.338 33.685  1.00 46.85 ? 108  ALA A CA  1 
ATOM   817  C  C   . ALA A 1 108 ? 27.077 28.218 32.517  1.00 46.59 ? 108  ALA A C   1 
ATOM   818  O  O   . ALA A 1 108 ? 26.984 29.437 32.652  1.00 47.06 ? 108  ALA A O   1 
ATOM   819  C  CB  . ALA A 1 108 ? 28.970 27.660 34.049  1.00 47.36 ? 108  ALA A CB  1 
ATOM   820  N  N   . ARG A 1 109 ? 26.800 27.603 31.372  1.00 45.76 ? 109  ARG A N   1 
ATOM   821  C  CA  . ARG A 1 109 ? 26.365 28.348 30.195  1.00 44.81 ? 109  ARG A CA  1 
ATOM   822  C  C   . ARG A 1 109 ? 25.055 29.080 30.479  1.00 45.57 ? 109  ARG A C   1 
ATOM   823  O  O   . ARG A 1 109 ? 24.206 28.584 31.220  1.00 44.81 ? 109  ARG A O   1 
ATOM   824  C  CB  . ARG A 1 109 ? 26.184 27.391 29.016  1.00 42.25 ? 109  ARG A CB  1 
ATOM   825  C  CG  . ARG A 1 109 ? 25.798 28.051 27.699  1.00 39.44 ? 109  ARG A CG  1 
ATOM   826  C  CD  . ARG A 1 109 ? 25.725 27.000 26.596  1.00 36.83 ? 109  ARG A CD  1 
ATOM   827  N  NE  . ARG A 1 109 ? 27.015 26.333 26.412  1.00 33.11 ? 109  ARG A NE  1 
ATOM   828  C  CZ  . ARG A 1 109 ? 27.158 25.034 26.160  1.00 31.48 ? 109  ARG A CZ  1 
ATOM   829  N  NH1 . ARG A 1 109 ? 26.090 24.256 26.061  1.00 26.28 ? 109  ARG A NH1 1 
ATOM   830  N  NH2 . ARG A 1 109 ? 28.371 24.509 26.013  1.00 29.01 ? 109  ARG A NH2 1 
ATOM   831  N  N   . GLU A 1 110 ? 24.889 30.258 29.887  1.00 47.06 ? 110  GLU A N   1 
ATOM   832  C  CA  . GLU A 1 110 ? 23.672 31.037 30.100  1.00 49.34 ? 110  GLU A CA  1 
ATOM   833  C  C   . GLU A 1 110 ? 22.648 30.829 28.990  1.00 50.22 ? 110  GLU A C   1 
ATOM   834  O  O   . GLU A 1 110 ? 22.998 30.110 28.031  1.00 28.04 ? 110  GLU A O   1 
ATOM   835  C  CB  . GLU A 1 110 ? 24.013 32.521 30.207  1.00 49.14 ? 110  GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 110 ? 25.241 32.785 31.047  1.00 16.26 ? 110  GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 110 ? 25.373 34.227 31.449  1.00 16.26 ? 110  GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 110 ? 25.302 35.127 30.576  1.00 16.26 ? 110  GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 110 ? 25.548 34.479 32.658  1.00 16.26 ? 110  GLU A OE2 1 
ATOM   840  N  N   . PRO B 1 2   ? 23.023 6.126  26.630  1.00 30.35 ? 2    PRO B N   1 
ATOM   841  C  CA  . PRO B 1 2   ? 23.596 7.426  26.218  1.00 29.60 ? 2    PRO B CA  1 
ATOM   842  C  C   . PRO B 1 2   ? 23.190 8.538  27.177  1.00 29.55 ? 2    PRO B C   1 
ATOM   843  O  O   . PRO B 1 2   ? 22.456 8.307  28.141  1.00 31.54 ? 2    PRO B O   1 
ATOM   844  C  CB  . PRO B 1 2   ? 23.070 7.719  24.820  1.00 29.64 ? 2    PRO B CB  1 
ATOM   845  C  CG  . PRO B 1 2   ? 22.760 6.324  24.306  1.00 31.14 ? 2    PRO B CG  1 
ATOM   846  C  CD  . PRO B 1 2   ? 22.211 5.576  25.531  1.00 31.19 ? 2    PRO B CD  1 
ATOM   847  N  N   . LYS B 1 3   ? 23.682 9.742  26.914  1.00 26.49 ? 3    LYS B N   1 
ATOM   848  C  CA  . LYS B 1 3   ? 23.349 10.891 27.739  1.00 25.82 ? 3    LYS B CA  1 
ATOM   849  C  C   . LYS B 1 3   ? 22.235 11.677 27.064  1.00 24.19 ? 3    LYS B C   1 
ATOM   850  O  O   . LYS B 1 3   ? 22.190 11.777 25.830  1.00 21.63 ? 3    LYS B O   1 
ATOM   851  C  CB  . LYS B 1 3   ? 24.561 11.809 27.909  1.00 26.80 ? 3    LYS B CB  1 
ATOM   852  C  CG  . LYS B 1 3   ? 25.722 11.208 28.678  1.00 29.36 ? 3    LYS B CG  1 
ATOM   853  C  CD  . LYS B 1 3   ? 26.905 12.170 28.666  1.00 30.73 ? 3    LYS B CD  1 
ATOM   854  C  CE  . LYS B 1 3   ? 28.077 11.629 29.468  1.00 32.95 ? 3    LYS B CE  1 
ATOM   855  N  NZ  . LYS B 1 3   ? 27.716 11.508 30.909  1.00 35.67 ? 3    LYS B NZ  1 
ATOM   856  N  N   . ILE B 1 4   ? 21.331 12.223 27.870  1.00 22.45 ? 4    ILE B N   1 
ATOM   857  C  CA  . ILE B 1 4   ? 20.247 13.033 27.335  1.00 22.16 ? 4    ILE B CA  1 
ATOM   858  C  C   . ILE B 1 4   ? 20.290 14.397 27.996  1.00 22.13 ? 4    ILE B C   1 
ATOM   859  O  O   . ILE B 1 4   ? 20.078 14.516 29.204  1.00 24.54 ? 4    ILE B O   1 
ATOM   860  C  CB  . ILE B 1 4   ? 18.857 12.437 27.612  1.00 22.64 ? 4    ILE B CB  1 
ATOM   861  C  CG1 . ILE B 1 4   ? 18.711 11.080 26.931  1.00 23.05 ? 4    ILE B CG1 1 
ATOM   862  C  CG2 . ILE B 1 4   ? 17.783 13.391 27.094  1.00 21.00 ? 4    ILE B CG2 1 
ATOM   863  C  CD1 . ILE B 1 4   ? 17.342 10.438 27.153  1.00 22.12 ? 4    ILE B CD1 1 
ATOM   864  N  N   . VAL B 1 5   ? 20.582 15.429 27.214  1.00 19.50 ? 5    VAL B N   1 
ATOM   865  C  CA  . VAL B 1 5   ? 20.611 16.775 27.766  1.00 17.12 ? 5    VAL B CA  1 
ATOM   866  C  C   . VAL B 1 5   ? 19.247 17.435 27.580  1.00 17.59 ? 5    VAL B C   1 
ATOM   867  O  O   . VAL B 1 5   ? 18.684 17.433 26.481  1.00 18.23 ? 5    VAL B O   1 
ATOM   868  C  CB  . VAL B 1 5   ? 21.690 17.664 27.085  1.00 17.01 ? 5    VAL B CB  1 
ATOM   869  C  CG1 . VAL B 1 5   ? 21.484 19.108 27.473  1.00 18.14 ? 5    VAL B CG1 1 
ATOM   870  C  CG2 . VAL B 1 5   ? 23.085 17.217 27.505  1.00 17.43 ? 5    VAL B CG2 1 
ATOM   871  N  N   . ILE B 1 6   ? 18.705 17.974 28.667  1.00 15.48 ? 6    ILE B N   1 
ATOM   872  C  CA  . ILE B 1 6   ? 17.431 18.680 28.622  1.00 15.04 ? 6    ILE B CA  1 
ATOM   873  C  C   . ILE B 1 6   ? 17.815 20.157 28.689  1.00 17.05 ? 6    ILE B C   1 
ATOM   874  O  O   . ILE B 1 6   ? 18.400 20.609 29.675  1.00 16.49 ? 6    ILE B O   1 
ATOM   875  C  CB  . ILE B 1 6   ? 16.525 18.347 29.843  1.00 15.36 ? 6    ILE B CB  1 
ATOM   876  C  CG1 . ILE B 1 6   ? 16.155 16.854 29.867  1.00 17.49 ? 6    ILE B CG1 1 
ATOM   877  C  CG2 . ILE B 1 6   ? 15.253 19.198 29.786  1.00 16.18 ? 6    ILE B CG2 1 
ATOM   878  C  CD1 . ILE B 1 6   ? 15.348 16.358 28.671  1.00 18.65 ? 6    ILE B CD1 1 
ATOM   879  N  N   . LEU B 1 7   ? 17.511 20.919 27.642  1.00 16.75 ? 7    LEU B N   1 
ATOM   880  C  CA  . LEU B 1 7   ? 17.852 22.342 27.646  1.00 16.66 ? 7    LEU B CA  1 
ATOM   881  C  C   . LEU B 1 7   ? 17.083 23.106 28.733  1.00 16.06 ? 7    LEU B C   1 
ATOM   882  O  O   . LEU B 1 7   ? 15.978 22.726 29.120  1.00 14.42 ? 7    LEU B O   1 
ATOM   883  C  CB  . LEU B 1 7   ? 17.602 22.948 26.258  1.00 16.76 ? 7    LEU B CB  1 
ATOM   884  C  CG  . LEU B 1 7   ? 18.518 22.391 25.153  1.00 17.90 ? 7    LEU B CG  1 
ATOM   885  C  CD1 . LEU B 1 7   ? 18.038 22.859 23.792  1.00 18.58 ? 7    LEU B CD1 1 
ATOM   886  C  CD2 . LEU B 1 7   ? 19.965 22.824 25.387  1.00 19.78 ? 7    LEU B CD2 1 
ATOM   887  N  N   . PRO B 1 8   ? 17.671 24.188 29.260  1.00 17.64 ? 8    PRO B N   1 
ATOM   888  C  CA  . PRO B 1 8   ? 16.987 24.958 30.302  1.00 19.24 ? 8    PRO B CA  1 
ATOM   889  C  C   . PRO B 1 8   ? 15.567 25.341 29.908  1.00 19.24 ? 8    PRO B C   1 
ATOM   890  O  O   . PRO B 1 8   ? 15.331 25.907 28.835  1.00 17.55 ? 8    PRO B O   1 
ATOM   891  C  CB  . PRO B 1 8   ? 17.896 26.172 30.481  1.00 20.84 ? 8    PRO B CB  1 
ATOM   892  C  CG  . PRO B 1 8   ? 19.253 25.588 30.227  1.00 18.93 ? 8    PRO B CG  1 
ATOM   893  C  CD  . PRO B 1 8   ? 18.990 24.770 28.972  1.00 17.53 ? 8    PRO B CD  1 
ATOM   894  N  N   . HIS B 1 9   ? 14.634 24.998 30.789  1.00 20.85 ? 9    HIS B N   1 
ATOM   895  C  CA  . HIS B 1 9   ? 13.208 25.258 30.621  1.00 22.99 ? 9    HIS B CA  1 
ATOM   896  C  C   . HIS B 1 9   ? 12.762 26.002 31.881  1.00 24.82 ? 9    HIS B C   1 
ATOM   897  O  O   . HIS B 1 9   ? 12.832 25.456 32.983  1.00 23.96 ? 9    HIS B O   1 
ATOM   898  C  CB  . HIS B 1 9   ? 12.457 23.934 30.522  1.00 22.78 ? 9    HIS B CB  1 
ATOM   899  C  CG  . HIS B 1 9   ? 11.000 24.081 30.232  1.00 26.06 ? 9    HIS B CG  1 
ATOM   900  N  ND1 . HIS B 1 9   ? 10.501 24.146 28.949  1.00 25.90 ? 9    HIS B ND1 1 
ATOM   901  C  CD2 . HIS B 1 9   ? 9.933  24.194 31.058  1.00 24.65 ? 9    HIS B CD2 1 
ATOM   902  C  CE1 . HIS B 1 9   ? 9.189  24.293 28.997  1.00 24.41 ? 9    HIS B CE1 1 
ATOM   903  N  NE2 . HIS B 1 9   ? 8.819  24.325 30.266  1.00 27.21 ? 9    HIS B NE2 1 
ATOM   904  N  N   . GLN B 1 10  ? 12.296 27.234 31.712  1.00 28.18 ? 10   GLN B N   1 
ATOM   905  C  CA  . GLN B 1 10  ? 11.865 28.070 32.832  1.00 31.41 ? 10   GLN B CA  1 
ATOM   906  C  C   . GLN B 1 10  ? 10.993 27.381 33.875  1.00 32.90 ? 10   GLN B C   1 
ATOM   907  O  O   . GLN B 1 10  ? 11.269 27.460 35.074  1.00 33.79 ? 10   GLN B O   1 
ATOM   908  C  CB  . GLN B 1 10  ? 11.121 29.300 32.304  1.00 35.48 ? 10   GLN B CB  1 
ATOM   909  C  CG  . GLN B 1 10  ? 11.936 30.159 31.345  1.00 39.79 ? 10   GLN B CG  1 
ATOM   910  C  CD  . GLN B 1 10  ? 11.141 31.322 30.777  1.00 42.16 ? 10   GLN B CD  1 
ATOM   911  O  OE1 . GLN B 1 10  ? 10.700 32.208 31.513  1.00 45.32 ? 10   GLN B OE1 1 
ATOM   912  N  NE2 . GLN B 1 10  ? 10.954 31.325 29.459  1.00 41.91 ? 10   GLN B NE2 1 
ATOM   913  N  N   . ASP B 1 11  ? 9.953  26.692 33.421  1.00 32.93 ? 11   ASP B N   1 
ATOM   914  C  CA  . ASP B 1 11  ? 9.018  26.042 34.330  1.00 33.28 ? 11   ASP B CA  1 
ATOM   915  C  C   . ASP B 1 11  ? 9.320  24.622 34.795  1.00 32.34 ? 11   ASP B C   1 
ATOM   916  O  O   . ASP B 1 11  ? 9.007  24.271 35.931  1.00 33.40 ? 11   ASP B O   1 
ATOM   917  C  CB  . ASP B 1 11  ? 7.617  26.066 33.711  1.00 36.62 ? 11   ASP B CB  1 
ATOM   918  C  CG  . ASP B 1 11  ? 7.238  27.436 33.179  1.00 40.14 ? 11   ASP B CG  1 
ATOM   919  O  OD1 . ASP B 1 11  ? 7.259  28.412 33.962  1.00 42.36 ? 11   ASP B OD1 1 
ATOM   920  O  OD2 . ASP B 1 11  ? 6.919  27.536 31.973  1.00 40.78 ? 11   ASP B OD2 1 
ATOM   921  N  N   . LEU B 1 12  ? 9.925  23.801 33.943  1.00 29.61 ? 12   LEU B N   1 
ATOM   922  C  CA  . LEU B 1 12  ? 10.187 22.414 34.324  1.00 27.42 ? 12   LEU B CA  1 
ATOM   923  C  C   . LEU B 1 12  ? 11.645 22.009 34.531  1.00 26.21 ? 12   LEU B C   1 
ATOM   924  O  O   . LEU B 1 12  ? 11.914 20.950 35.095  1.00 27.19 ? 12   LEU B O   1 
ATOM   925  C  CB  . LEU B 1 12  ? 9.554  21.478 33.290  1.00 27.83 ? 12   LEU B CB  1 
ATOM   926  C  CG  . LEU B 1 12  ? 8.075  21.727 32.978  1.00 29.45 ? 12   LEU B CG  1 
ATOM   927  C  CD1 . LEU B 1 12  ? 7.621  20.782 31.870  1.00 26.34 ? 12   LEU B CD1 1 
ATOM   928  C  CD2 . LEU B 1 12  ? 7.237  21.526 34.238  1.00 27.46 ? 12   LEU B CD2 1 
ATOM   929  N  N   . CYS B 1 13  ? 12.587 22.840 34.101  1.00 25.78 ? 13   CYS B N   1 
ATOM   930  C  CA  . CYS B 1 13  ? 14.000 22.491 34.242  1.00 25.09 ? 13   CYS B CA  1 
ATOM   931  C  C   . CYS B 1 13  ? 14.837 23.754 34.042  1.00 25.62 ? 13   CYS B C   1 
ATOM   932  O  O   . CYS B 1 13  ? 15.577 23.880 33.065  1.00 23.49 ? 13   CYS B O   1 
ATOM   933  C  CB  . CYS B 1 13  ? 14.351 21.434 33.185  1.00 26.13 ? 13   CYS B CB  1 
ATOM   934  S  SG  . CYS B 1 13  ? 15.893 20.549 33.451  1.00 29.06 ? 13   CYS B SG  1 
ATOM   935  N  N   . PRO B 1 14  ? 14.725 24.709 34.981  1.00 24.97 ? 14   PRO B N   1 
ATOM   936  C  CA  . PRO B 1 14  ? 15.412 26.003 35.002  1.00 24.70 ? 14   PRO B CA  1 
ATOM   937  C  C   . PRO B 1 14  ? 16.871 26.064 34.552  1.00 24.75 ? 14   PRO B C   1 
ATOM   938  O  O   . PRO B 1 14  ? 17.238 26.929 33.762  1.00 24.51 ? 14   PRO B O   1 
ATOM   939  C  CB  . PRO B 1 14  ? 15.236 26.453 36.452  1.00 25.67 ? 14   PRO B CB  1 
ATOM   940  C  CG  . PRO B 1 14  ? 13.889 25.925 36.785  1.00 23.56 ? 14   PRO B CG  1 
ATOM   941  C  CD  . PRO B 1 14  ? 13.967 24.512 36.232  1.00 26.28 ? 14   PRO B CD  1 
ATOM   942  N  N   . ASP B 1 15  ? 17.707 25.168 35.062  1.00 24.82 ? 15   ASP B N   1 
ATOM   943  C  CA  . ASP B 1 15  ? 19.119 25.179 34.697  1.00 27.00 ? 15   ASP B CA  1 
ATOM   944  C  C   . ASP B 1 15  ? 19.475 24.079 33.711  1.00 27.45 ? 15   ASP B C   1 
ATOM   945  O  O   . ASP B 1 15  ? 20.646 23.913 33.358  1.00 27.93 ? 15   ASP B O   1 
ATOM   946  C  CB  . ASP B 1 15  ? 19.987 25.026 35.947  1.00 28.96 ? 15   ASP B CB  1 
ATOM   947  C  CG  . ASP B 1 15  ? 19.711 26.098 36.971  1.00 32.09 ? 15   ASP B CG  1 
ATOM   948  O  OD1 . ASP B 1 15  ? 19.894 27.287 36.635  1.00 33.22 ? 15   ASP B OD1 1 
ATOM   949  O  OD2 . ASP B 1 15  ? 19.307 25.751 38.104  1.00 33.37 ? 15   ASP B OD2 1 
ATOM   950  N  N   . GLY B 1 16  ? 18.464 23.339 33.266  1.00 26.65 ? 16   GLY B N   1 
ATOM   951  C  CA  . GLY B 1 16  ? 18.706 22.247 32.340  1.00 26.42 ? 16   GLY B CA  1 
ATOM   952  C  C   . GLY B 1 16  ? 19.136 21.026 33.129  1.00 27.21 ? 16   GLY B C   1 
ATOM   953  O  O   . GLY B 1 16  ? 19.280 21.091 34.351  1.00 26.74 ? 16   GLY B O   1 
ATOM   954  N  N   . ALA B 1 17  ? 19.336 19.905 32.449  1.00 25.62 ? 17   ALA B N   1 
ATOM   955  C  CA  . ALA B 1 17  ? 19.749 18.695 33.141  1.00 24.96 ? 17   ALA B CA  1 
ATOM   956  C  C   . ALA B 1 17  ? 20.433 17.702 32.215  1.00 26.45 ? 17   ALA B C   1 
ATOM   957  O  O   . ALA B 1 17  ? 20.248 17.742 30.998  1.00 23.40 ? 17   ALA B O   1 
ATOM   958  C  CB  . ALA B 1 17  ? 18.540 18.041 33.807  1.00 27.27 ? 17   ALA B CB  1 
ATOM   959  N  N   . VAL B 1 18  ? 21.235 16.823 32.808  1.00 26.63 ? 18   VAL B N   1 
ATOM   960  C  CA  . VAL B 1 18  ? 21.936 15.780 32.073  1.00 26.86 ? 18   VAL B CA  1 
ATOM   961  C  C   . VAL B 1 18  ? 21.393 14.470 32.614  1.00 27.94 ? 18   VAL B C   1 
ATOM   962  O  O   . VAL B 1 18  ? 21.538 14.168 33.798  1.00 29.10 ? 18   VAL B O   1 
ATOM   963  C  CB  . VAL B 1 18  ? 23.456 15.839 32.298  1.00 27.08 ? 18   VAL B CB  1 
ATOM   964  C  CG1 . VAL B 1 18  ? 24.133 14.657 31.607  1.00 26.19 ? 18   VAL B CG1 1 
ATOM   965  C  CG2 . VAL B 1 18  ? 24.000 17.139 31.751  1.00 23.45 ? 18   VAL B CG2 1 
ATOM   966  N  N   . LEU B 1 19  ? 20.749 13.697 31.750  1.00 28.15 ? 19   LEU B N   1 
ATOM   967  C  CA  . LEU B 1 19  ? 20.160 12.436 32.177  1.00 28.58 ? 19   LEU B CA  1 
ATOM   968  C  C   . LEU B 1 19  ? 20.915 11.228 31.643  1.00 28.85 ? 19   LEU B C   1 
ATOM   969  O  O   . LEU B 1 19  ? 21.456 11.259 30.541  1.00 28.13 ? 19   LEU B O   1 
ATOM   970  C  CB  . LEU B 1 19  ? 18.703 12.361 31.708  1.00 26.41 ? 19   LEU B CB  1 
ATOM   971  C  CG  . LEU B 1 19  ? 17.874 13.649 31.701  1.00 28.27 ? 19   LEU B CG  1 
ATOM   972  C  CD1 . LEU B 1 19  ? 16.471 13.329 31.191  1.00 27.58 ? 19   LEU B CD1 1 
ATOM   973  C  CD2 . LEU B 1 19  ? 17.815 14.261 33.095  1.00 29.66 ? 19   LEU B CD2 1 
ATOM   974  N  N   . GLU B 1 20  ? 20.953 10.166 32.441  1.00 31.54 ? 20   GLU B N   1 
ATOM   975  C  CA  . GLU B 1 20  ? 21.604 8.922  32.043  1.00 33.05 ? 20   GLU B CA  1 
ATOM   976  C  C   . GLU B 1 20  ? 20.489 7.977  31.620  1.00 32.42 ? 20   GLU B C   1 
ATOM   977  O  O   . GLU B 1 20  ? 19.531 7.772  32.363  1.00 32.36 ? 20   GLU B O   1 
ATOM   978  C  CB  . GLU B 1 20  ? 22.376 8.317  33.216  1.00 35.68 ? 20   GLU B CB  1 
ATOM   979  C  CG  . GLU B 1 20  ? 23.759 8.906  33.431  1.00 39.19 ? 20   GLU B CG  1 
ATOM   980  C  CD  . GLU B 1 20  ? 24.683 8.659  32.249  1.00 41.72 ? 20   GLU B CD  1 
ATOM   981  O  OE1 . GLU B 1 20  ? 24.605 7.562  31.655  1.00 43.02 ? 20   GLU B OE1 1 
ATOM   982  O  OE2 . GLU B 1 20  ? 25.495 9.552  31.922  1.00 42.20 ? 20   GLU B OE2 1 
ATOM   983  N  N   . ALA B 1 21  ? 20.597 7.414  30.424  1.00 32.49 ? 21   ALA B N   1 
ATOM   984  C  CA  . ALA B 1 21  ? 19.567 6.504  29.936  1.00 34.77 ? 21   ALA B CA  1 
ATOM   985  C  C   . ALA B 1 21  ? 20.167 5.296  29.230  1.00 34.79 ? 21   ALA B C   1 
ATOM   986  O  O   . ALA B 1 21  ? 21.197 5.410  28.559  1.00 35.29 ? 21   ALA B O   1 
ATOM   987  C  CB  . ALA B 1 21  ? 18.627 7.245  28.990  1.00 35.02 ? 21   ALA B CB  1 
ATOM   988  N  N   . ASN B 1 22  ? 19.529 4.140  29.397  1.00 34.95 ? 22   ASN B N   1 
ATOM   989  C  CA  . ASN B 1 22  ? 19.984 2.913  28.751  1.00 35.03 ? 22   ASN B CA  1 
ATOM   990  C  C   . ASN B 1 22  ? 19.383 2.850  27.353  1.00 34.03 ? 22   ASN B C   1 
ATOM   991  O  O   . ASN B 1 22  ? 18.323 3.422  27.102  1.00 33.37 ? 22   ASN B O   1 
ATOM   992  C  CB  . ASN B 1 22  ? 19.524 1.672  29.528  1.00 36.69 ? 22   ASN B CB  1 
ATOM   993  C  CG  . ASN B 1 22  ? 20.252 1.496  30.844  1.00 38.77 ? 22   ASN B CG  1 
ATOM   994  O  OD1 . ASN B 1 22  ? 21.467 1.666  30.920  1.00 40.17 ? 22   ASN B OD1 1 
ATOM   995  N  ND2 . ASN B 1 22  ? 19.512 1.131  31.887  1.00 39.98 ? 22   ASN B ND2 1 
ATOM   996  N  N   . SER B 1 23  ? 20.059 2.159  26.443  1.00 32.01 ? 23   SER B N   1 
ATOM   997  C  CA  . SER B 1 23  ? 19.545 2.010  25.088  1.00 30.51 ? 23   SER B CA  1 
ATOM   998  C  C   . SER B 1 23  ? 18.193 1.328  25.253  1.00 30.53 ? 23   SER B C   1 
ATOM   999  O  O   . SER B 1 23  ? 18.067 0.390  26.039  1.00 30.30 ? 23   SER B O   1 
ATOM   1000 C  CB  . SER B 1 23  ? 20.484 1.122  24.264  1.00 29.52 ? 23   SER B CB  1 
ATOM   1001 O  OG  . SER B 1 23  ? 19.978 0.898  22.960  1.00 27.85 ? 23   SER B OG  1 
ATOM   1002 N  N   . GLY B 1 24  ? 17.179 1.811  24.545  1.00 31.19 ? 24   GLY B N   1 
ATOM   1003 C  CA  . GLY B 1 24  ? 15.865 1.204  24.660  1.00 31.84 ? 24   GLY B CA  1 
ATOM   1004 C  C   . GLY B 1 24  ? 14.873 1.929  25.559  1.00 32.29 ? 24   GLY B C   1 
ATOM   1005 O  O   . GLY B 1 24  ? 13.674 1.647  25.495  1.00 33.06 ? 24   GLY B O   1 
ATOM   1006 N  N   . GLU B 1 25  ? 15.348 2.844  26.404  1.00 30.96 ? 25   GLU B N   1 
ATOM   1007 C  CA  . GLU B 1 25  ? 14.448 3.587  27.287  1.00 30.86 ? 25   GLU B CA  1 
ATOM   1008 C  C   . GLU B 1 25  ? 13.848 4.770  26.528  1.00 28.70 ? 25   GLU B C   1 
ATOM   1009 O  O   . GLU B 1 25  ? 14.412 5.237  25.541  1.00 27.45 ? 25   GLU B O   1 
ATOM   1010 C  CB  . GLU B 1 25  ? 15.187 4.121  28.523  1.00 33.53 ? 25   GLU B CB  1 
ATOM   1011 C  CG  . GLU B 1 25  ? 15.982 3.095  29.314  1.00 37.76 ? 25   GLU B CG  1 
ATOM   1012 C  CD  . GLU B 1 25  ? 16.338 3.589  30.711  1.00 39.34 ? 25   GLU B CD  1 
ATOM   1013 O  OE1 . GLU B 1 25  ? 15.529 3.385  31.643  1.00 40.88 ? 25   GLU B OE1 1 
ATOM   1014 O  OE2 . GLU B 1 25  ? 17.419 4.194  30.878  1.00 41.08 ? 25   GLU B OE2 1 
ATOM   1015 N  N   . THR B 1 26  ? 12.700 5.256  26.986  1.00 25.83 ? 26   THR B N   1 
ATOM   1016 C  CA  . THR B 1 26  ? 12.068 6.390  26.326  1.00 23.27 ? 26   THR B CA  1 
ATOM   1017 C  C   . THR B 1 26  ? 12.607 7.674  26.922  1.00 21.10 ? 26   THR B C   1 
ATOM   1018 O  O   . THR B 1 26  ? 13.034 7.705  28.080  1.00 21.90 ? 26   THR B O   1 
ATOM   1019 C  CB  . THR B 1 26  ? 10.548 6.421  26.541  1.00 22.58 ? 26   THR B CB  1 
ATOM   1020 O  OG1 . THR B 1 26  ? 10.281 6.640  27.933  1.00 22.52 ? 26   THR B OG1 1 
ATOM   1021 C  CG2 . THR B 1 26  ? 9.904  5.126  26.087  1.00 24.33 ? 26   THR B CG2 1 
ATOM   1022 N  N   . ILE B 1 27  ? 12.562 8.737  26.129  1.00 19.96 ? 27   ILE B N   1 
ATOM   1023 C  CA  . ILE B 1 27  ? 13.015 10.038 26.581  1.00 19.32 ? 27   ILE B CA  1 
ATOM   1024 C  C   . ILE B 1 27  ? 12.210 10.440 27.818  1.00 18.90 ? 27   ILE B C   1 
ATOM   1025 O  O   . ILE B 1 27  ? 12.772 10.928 28.795  1.00 18.34 ? 27   ILE B O   1 
ATOM   1026 C  CB  . ILE B 1 27  ? 12.822 11.105 25.470  1.00 17.66 ? 27   ILE B CB  1 
ATOM   1027 C  CG1 . ILE B 1 27  ? 13.830 10.861 24.337  1.00 15.79 ? 27   ILE B CG1 1 
ATOM   1028 C  CG2 . ILE B 1 27  ? 12.959 12.502 26.050  1.00 19.47 ? 27   ILE B CG2 1 
ATOM   1029 C  CD1 . ILE B 1 27  ? 13.636 11.757 23.121  1.00 15.10 ? 27   ILE B CD1 1 
ATOM   1030 N  N   . LEU B 1 28  ? 10.897 10.213 27.779  1.00 17.95 ? 28   LEU B N   1 
ATOM   1031 C  CA  . LEU B 1 28  ? 10.033 10.580 28.900  1.00 19.97 ? 28   LEU B CA  1 
ATOM   1032 C  C   . LEU B 1 28  ? 10.375 9.891  30.221  1.00 21.09 ? 28   LEU B C   1 
ATOM   1033 O  O   . LEU B 1 28  ? 10.499 10.549 31.255  1.00 20.87 ? 28   LEU B O   1 
ATOM   1034 C  CB  . LEU B 1 28  ? 8.565  10.315 28.559  1.00 19.50 ? 28   LEU B CB  1 
ATOM   1035 C  CG  . LEU B 1 28  ? 7.612  10.507 29.744  1.00 20.27 ? 28   LEU B CG  1 
ATOM   1036 C  CD1 . LEU B 1 28  ? 7.668  11.949 30.218  1.00 19.13 ? 28   LEU B CD1 1 
ATOM   1037 C  CD2 . LEU B 1 28  ? 6.196  10.128 29.334  1.00 18.19 ? 28   LEU B CD2 1 
ATOM   1038 N  N   . ASP B 1 29  ? 10.523 8.571  30.197  1.00 23.01 ? 29   ASP B N   1 
ATOM   1039 C  CA  . ASP B 1 29  ? 10.841 7.843  31.424  1.00 23.84 ? 29   ASP B CA  1 
ATOM   1040 C  C   . ASP B 1 29  ? 12.129 8.339  32.065  1.00 24.20 ? 29   ASP B C   1 
ATOM   1041 O  O   . ASP B 1 29  ? 12.209 8.474  33.290  1.00 22.07 ? 29   ASP B O   1 
ATOM   1042 C  CB  . ASP B 1 29  ? 10.931 6.342  31.151  1.00 26.31 ? 29   ASP B CB  1 
ATOM   1043 C  CG  . ASP B 1 29  ? 9.572  5.713  30.913  1.00 27.28 ? 29   ASP B CG  1 
ATOM   1044 O  OD1 . ASP B 1 29  ? 8.554  6.387  31.180  1.00 27.84 ? 29   ASP B OD1 1 
ATOM   1045 O  OD2 . ASP B 1 29  ? 9.520  4.544  30.469  1.00 29.73 ? 29   ASP B OD2 1 
ATOM   1046 N  N   . ALA B 1 30  ? 13.128 8.634  31.238  1.00 24.28 ? 30   ALA B N   1 
ATOM   1047 C  CA  . ALA B 1 30  ? 14.403 9.134  31.738  1.00 24.09 ? 30   ALA B CA  1 
ATOM   1048 C  C   . ALA B 1 30  ? 14.212 10.497 32.407  1.00 24.80 ? 30   ALA B C   1 
ATOM   1049 O  O   . ALA B 1 30  ? 14.846 10.795 33.418  1.00 25.50 ? 30   ALA B O   1 
ATOM   1050 C  CB  . ALA B 1 30  ? 15.413 9.237  30.592  1.00 23.70 ? 30   ALA B CB  1 
ATOM   1051 N  N   . ALA B 1 31  ? 13.326 11.319 31.849  1.00 24.63 ? 31   ALA B N   1 
ATOM   1052 C  CA  . ALA B 1 31  ? 13.059 12.638 32.410  1.00 24.36 ? 31   ALA B CA  1 
ATOM   1053 C  C   . ALA B 1 31  ? 12.300 12.548 33.737  1.00 25.17 ? 31   ALA B C   1 
ATOM   1054 O  O   . ALA B 1 31  ? 12.672 13.195 34.717  1.00 26.90 ? 31   ALA B O   1 
ATOM   1055 C  CB  . ALA B 1 31  ? 12.257 13.476 31.415  1.00 20.75 ? 31   ALA B CB  1 
ATOM   1056 N  N   . LEU B 1 32  ? 11.232 11.757 33.764  1.00 27.15 ? 32   LEU B N   1 
ATOM   1057 C  CA  . LEU B 1 32  ? 10.427 11.615 34.974  1.00 28.12 ? 32   LEU B CA  1 
ATOM   1058 C  C   . LEU B 1 32  ? 11.261 11.061 36.124  1.00 31.19 ? 32   LEU B C   1 
ATOM   1059 O  O   . LEU B 1 32  ? 11.089 11.451 37.279  1.00 32.37 ? 32   LEU B O   1 
ATOM   1060 C  CB  . LEU B 1 32  ? 9.233  10.696 34.711  1.00 29.00 ? 32   LEU B CB  1 
ATOM   1061 C  CG  . LEU B 1 32  ? 8.243  11.138 33.626  1.00 27.33 ? 32   LEU B CG  1 
ATOM   1062 C  CD1 . LEU B 1 32  ? 7.159  10.078 33.468  1.00 28.23 ? 32   LEU B CD1 1 
ATOM   1063 C  CD2 . LEU B 1 32  ? 7.628  12.484 33.995  1.00 28.15 ? 32   LEU B CD2 1 
ATOM   1064 N  N   . ARG B 1 33  ? 12.173 10.158 35.794  1.00 31.78 ? 33   ARG B N   1 
ATOM   1065 C  CA  . ARG B 1 33  ? 13.047 9.538  36.782  1.00 34.72 ? 33   ARG B CA  1 
ATOM   1066 C  C   . ARG B 1 33  ? 14.013 10.551 37.394  1.00 35.20 ? 33   ARG B C   1 
ATOM   1067 O  O   . ARG B 1 33  ? 14.637 10.282 38.421  1.00 36.40 ? 33   ARG B O   1 
ATOM   1068 C  CB  . ARG B 1 33  ? 13.831 8.416  36.109  1.00 36.17 ? 33   ARG B CB  1 
ATOM   1069 C  CG  . ARG B 1 33  ? 14.659 7.559  37.033  1.00 37.96 ? 33   ARG B CG  1 
ATOM   1070 C  CD  . ARG B 1 33  ? 15.171 6.367  36.260  1.00 37.99 ? 33   ARG B CD  1 
ATOM   1071 N  NE  . ARG B 1 33  ? 16.016 6.778  35.146  1.00 39.95 ? 33   ARG B NE  1 
ATOM   1072 C  CZ  . ARG B 1 33  ? 16.115 6.111  34.003  1.00 39.45 ? 33   ARG B CZ  1 
ATOM   1073 N  NH1 . ARG B 1 33  ? 15.411 5.004  33.821  1.00 40.28 ? 33   ARG B NH1 1 
ATOM   1074 N  NH2 . ARG B 1 33  ? 16.928 6.541  33.049  1.00 40.70 ? 33   ARG B NH2 1 
ATOM   1075 N  N   . ASN B 1 34  ? 14.132 11.715 36.759  1.00 35.65 ? 34   ASN B N   1 
ATOM   1076 C  CA  . ASN B 1 34  ? 15.028 12.767 37.227  1.00 34.93 ? 34   ASN B CA  1 
ATOM   1077 C  C   . ASN B 1 34  ? 14.304 14.011 37.730  1.00 34.38 ? 34   ASN B C   1 
ATOM   1078 O  O   . ASN B 1 34  ? 14.881 15.094 37.781  1.00 32.88 ? 34   ASN B O   1 
ATOM   1079 C  CB  . ASN B 1 34  ? 16.007 13.153 36.114  1.00 36.95 ? 34   ASN B CB  1 
ATOM   1080 C  CG  . ASN B 1 34  ? 17.151 12.161 35.973  1.00 39.21 ? 34   ASN B CG  1 
ATOM   1081 O  OD1 . ASN B 1 34  ? 18.133 12.222 36.711  1.00 41.00 ? 34   ASN B OD1 1 
ATOM   1082 N  ND2 . ASN B 1 34  ? 17.022 11.235 35.030  1.00 39.30 ? 34   ASN B ND2 1 
ATOM   1083 N  N   . GLY B 1 35  ? 13.038 13.857 38.099  1.00 32.78 ? 35   GLY B N   1 
ATOM   1084 C  CA  . GLY B 1 35  ? 12.291 14.988 38.615  1.00 33.13 ? 35   GLY B CA  1 
ATOM   1085 C  C   . GLY B 1 35  ? 11.872 16.033 37.597  1.00 32.20 ? 35   GLY B C   1 
ATOM   1086 O  O   . GLY B 1 35  ? 11.557 17.164 37.967  1.00 33.14 ? 35   GLY B O   1 
ATOM   1087 N  N   . ILE B 1 36  ? 11.890 15.676 36.317  1.00 30.89 ? 36   ILE B N   1 
ATOM   1088 C  CA  . ILE B 1 36  ? 11.458 16.607 35.279  1.00 29.49 ? 36   ILE B CA  1 
ATOM   1089 C  C   . ILE B 1 36  ? 10.014 16.224 34.988  1.00 28.71 ? 36   ILE B C   1 
ATOM   1090 O  O   . ILE B 1 36  ? 9.739  15.249 34.283  1.00 28.35 ? 36   ILE B O   1 
ATOM   1091 C  CB  . ILE B 1 36  ? 12.329 16.485 34.016  1.00 29.50 ? 36   ILE B CB  1 
ATOM   1092 C  CG1 . ILE B 1 36  ? 13.788 16.772 34.378  1.00 29.93 ? 36   ILE B CG1 1 
ATOM   1093 C  CG2 . ILE B 1 36  ? 11.865 17.483 32.965  1.00 29.39 ? 36   ILE B CG2 1 
ATOM   1094 C  CD1 . ILE B 1 36  ? 14.751 16.678 33.212  1.00 32.78 ? 36   ILE B CD1 1 
ATOM   1095 N  N   . GLU B 1 37  ? 9.096  16.998 35.557  1.00 29.08 ? 37   GLU B N   1 
ATOM   1096 C  CA  . GLU B 1 37  ? 7.667  16.742 35.434  1.00 31.20 ? 37   GLU B CA  1 
ATOM   1097 C  C   . GLU B 1 37  ? 7.019  16.958 34.068  1.00 29.95 ? 37   GLU B C   1 
ATOM   1098 O  O   . GLU B 1 37  ? 6.118  17.787 33.930  1.00 30.13 ? 37   GLU B O   1 
ATOM   1099 C  CB  . GLU B 1 37  ? 6.909  17.562 36.488  1.00 34.13 ? 37   GLU B CB  1 
ATOM   1100 C  CG  . GLU B 1 37  ? 7.166  17.123 37.930  1.00 37.79 ? 37   GLU B CG  1 
ATOM   1101 C  CD  . GLU B 1 37  ? 6.526  18.056 38.951  1.00 40.94 ? 37   GLU B CD  1 
ATOM   1102 O  OE1 . GLU B 1 37  ? 6.971  19.216 39.057  1.00 42.12 ? 37   GLU B OE1 1 
ATOM   1103 O  OE2 . GLU B 1 37  ? 5.575  17.632 39.646  1.00 40.81 ? 37   GLU B OE2 1 
ATOM   1104 N  N   . ILE B 1 38  ? 7.466  16.214 33.061  1.00 29.70 ? 38   ILE B N   1 
ATOM   1105 C  CA  . ILE B 1 38  ? 6.865  16.324 31.733  1.00 28.54 ? 38   ILE B CA  1 
ATOM   1106 C  C   . ILE B 1 38  ? 5.491  15.667 31.817  1.00 29.35 ? 38   ILE B C   1 
ATOM   1107 O  O   . ILE B 1 38  ? 5.372  14.528 32.272  1.00 29.81 ? 38   ILE B O   1 
ATOM   1108 C  CB  . ILE B 1 38  ? 7.707  15.587 30.660  1.00 27.58 ? 38   ILE B CB  1 
ATOM   1109 C  CG1 . ILE B 1 38  ? 9.039  16.312 30.455  1.00 26.87 ? 38   ILE B CG1 1 
ATOM   1110 C  CG2 . ILE B 1 38  ? 6.939  15.513 29.340  1.00 26.29 ? 38   ILE B CG2 1 
ATOM   1111 C  CD1 . ILE B 1 38  ? 9.902  15.702 29.366  1.00 25.49 ? 38   ILE B CD1 1 
ATOM   1112 N  N   . GLU B 1 39  ? 4.455  16.386 31.393  1.00 28.67 ? 39   GLU B N   1 
ATOM   1113 C  CA  . GLU B 1 39  ? 3.099  15.848 31.424  1.00 28.69 ? 39   GLU B CA  1 
ATOM   1114 C  C   . GLU B 1 39  ? 2.941  14.669 30.467  1.00 27.34 ? 39   GLU B C   1 
ATOM   1115 O  O   . GLU B 1 39  ? 3.568  14.614 29.411  1.00 27.33 ? 39   GLU B O   1 
ATOM   1116 C  CB  . GLU B 1 39  ? 2.076  16.940 31.077  1.00 29.98 ? 39   GLU B CB  1 
ATOM   1117 C  CG  . GLU B 1 39  ? 1.758  17.879 32.238  1.00 35.03 ? 39   GLU B CG  1 
ATOM   1118 C  CD  . GLU B 1 39  ? 0.753  18.965 31.878  1.00 37.36 ? 39   GLU B CD  1 
ATOM   1119 O  OE1 . GLU B 1 39  ? 0.238  19.628 32.805  1.00 38.99 ? 39   GLU B OE1 1 
ATOM   1120 O  OE2 . GLU B 1 39  ? 0.483  19.165 30.675  1.00 37.40 ? 39   GLU B OE2 1 
ATOM   1121 N  N   . HIS B 1 40  ? 2.108  13.715 30.858  1.00 25.83 ? 40   HIS B N   1 
ATOM   1122 C  CA  . HIS B 1 40  ? 1.852  12.536 30.042  1.00 24.64 ? 40   HIS B CA  1 
ATOM   1123 C  C   . HIS B 1 40  ? 0.422  12.111 30.324  1.00 25.34 ? 40   HIS B C   1 
ATOM   1124 O  O   . HIS B 1 40  ? 0.162  11.026 30.846  1.00 24.77 ? 40   HIS B O   1 
ATOM   1125 C  CB  . HIS B 1 40  ? 2.844  11.418 30.394  1.00 25.09 ? 40   HIS B CB  1 
ATOM   1126 C  CG  . HIS B 1 40  ? 3.049  11.225 31.864  1.00 26.93 ? 40   HIS B CG  1 
ATOM   1127 N  ND1 . HIS B 1 40  ? 3.685  12.157 32.657  1.00 27.49 ? 40   HIS B ND1 1 
ATOM   1128 C  CD2 . HIS B 1 40  ? 2.691  10.211 32.688  1.00 27.55 ? 40   HIS B CD2 1 
ATOM   1129 C  CE1 . HIS B 1 40  ? 3.709  11.726 33.906  1.00 27.79 ? 40   HIS B CE1 1 
ATOM   1130 N  NE2 . HIS B 1 40  ? 3.111  10.548 33.952  1.00 26.48 ? 40   HIS B NE2 1 
ATOM   1131 N  N   . ALA B 1 41  ? -0.501 12.995 29.960  1.00 24.52 ? 41   ALA B N   1 
ATOM   1132 C  CA  . ALA B 1 41  ? -1.928 12.812 30.185  1.00 25.12 ? 41   ALA B CA  1 
ATOM   1133 C  C   . ALA B 1 41  ? -2.552 11.478 29.779  1.00 25.77 ? 41   ALA B C   1 
ATOM   1134 O  O   . ALA B 1 41  ? -3.270 10.867 30.573  1.00 26.38 ? 41   ALA B O   1 
ATOM   1135 C  CB  . ALA B 1 41  ? -2.687 13.955 29.525  1.00 23.55 ? 41   ALA B CB  1 
ATOM   1136 N  N   . CYS B 1 42  ? -2.295 11.020 28.557  1.00 24.73 ? 42   CYS B N   1 
ATOM   1137 C  CA  . CYS B 1 42  ? -2.895 9.767  28.107  1.00 24.75 ? 42   CYS B CA  1 
ATOM   1138 C  C   . CYS B 1 42  ? -2.210 8.540  28.697  1.00 25.49 ? 42   CYS B C   1 
ATOM   1139 O  O   . CYS B 1 42  ? -2.529 7.404  28.336  1.00 26.28 ? 42   CYS B O   1 
ATOM   1140 C  CB  . CYS B 1 42  ? -2.898 9.685  26.576  1.00 23.51 ? 42   CYS B CB  1 
ATOM   1141 S  SG  . CYS B 1 42  ? -1.327 9.228  25.833  1.00 22.16 ? 42   CYS B SG  1 
ATOM   1142 N  N   . GLU B 1 43  ? -1.276 8.778  29.610  1.00 25.46 ? 43   GLU B N   1 
ATOM   1143 C  CA  . GLU B 1 43  ? -0.546 7.702  30.272  1.00 27.71 ? 43   GLU B CA  1 
ATOM   1144 C  C   . GLU B 1 43  ? 0.359  6.901  29.342  1.00 28.52 ? 43   GLU B C   1 
ATOM   1145 O  O   . GLU B 1 43  ? 0.342  5.667  29.337  1.00 29.56 ? 43   GLU B O   1 
ATOM   1146 C  CB  . GLU B 1 43  ? -1.538 6.784  30.987  1.00 30.50 ? 43   GLU B CB  1 
ATOM   1147 C  CG  . GLU B 1 43  ? -2.145 7.418  32.229  1.00 33.05 ? 43   GLU B CG  1 
ATOM   1148 C  CD  . GLU B 1 43  ? -3.289 6.599  32.810  1.00 36.38 ? 43   GLU B CD  1 
ATOM   1149 O  OE1 . GLU B 1 43  ? -4.404 6.636  32.241  1.00 34.05 ? 43   GLU B OE1 1 
ATOM   1150 O  OE2 . GLU B 1 43  ? -3.067 5.913  33.832  1.00 37.22 ? 43   GLU B OE2 1 
ATOM   1151 N  N   . LYS B 1 44  ? 1.155  7.620  28.553  1.00 29.29 ? 44   LYS B N   1 
ATOM   1152 C  CA  . LYS B 1 44  ? 2.101  7.013  27.622  1.00 27.80 ? 44   LYS B CA  1 
ATOM   1153 C  C   . LYS B 1 44  ? 1.435  6.077  26.617  1.00 27.71 ? 44   LYS B C   1 
ATOM   1154 O  O   . LYS B 1 44  ? 1.955  4.999  26.320  1.00 26.07 ? 44   LYS B O   1 
ATOM   1155 C  CB  . LYS B 1 44  ? 3.168  6.252  28.408  1.00 26.59 ? 44   LYS B CB  1 
ATOM   1156 C  CG  . LYS B 1 44  ? 3.789  7.065  29.537  1.00 27.11 ? 44   LYS B CG  1 
ATOM   1157 C  CD  . LYS B 1 44  ? 4.745  6.217  30.368  1.00 24.70 ? 44   LYS B CD  1 
ATOM   1158 C  CE  . LYS B 1 44  ? 5.267  6.986  31.573  1.00 24.67 ? 44   LYS B CE  1 
ATOM   1159 N  NZ  . LYS B 1 44  ? 6.129  6.120  32.435  1.00 21.47 ? 44   LYS B NZ  1 
ATOM   1160 N  N   . SER B 1 45  ? 0.294  6.499  26.083  1.00 27.98 ? 45   SER B N   1 
ATOM   1161 C  CA  . SER B 1 45  ? -0.437 5.677  25.128  1.00 27.96 ? 45   SER B CA  1 
ATOM   1162 C  C   . SER B 1 45  ? -0.458 6.228  23.709  1.00 27.61 ? 45   SER B C   1 
ATOM   1163 O  O   . SER B 1 45  ? -1.342 5.885  22.928  1.00 26.32 ? 45   SER B O   1 
ATOM   1164 C  CB  . SER B 1 45  ? -1.870 5.471  25.621  1.00 29.21 ? 45   SER B CB  1 
ATOM   1165 O  OG  . SER B 1 45  ? -1.861 4.964  26.945  1.00 31.80 ? 45   SER B OG  1 
ATOM   1166 N  N   . CYS B 1 46  ? 0.517  7.069  23.371  1.00 26.17 ? 46   CYS B N   1 
ATOM   1167 C  CA  . CYS B 1 46  ? 0.589  7.638  22.029  1.00 26.24 ? 46   CYS B CA  1 
ATOM   1168 C  C   . CYS B 1 46  ? -0.795 8.175  21.632  1.00 26.72 ? 46   CYS B C   1 
ATOM   1169 O  O   . CYS B 1 46  ? -1.206 8.065  20.473  1.00 26.22 ? 46   CYS B O   1 
ATOM   1170 C  CB  . CYS B 1 46  ? 1.055  6.546  21.049  1.00 26.14 ? 46   CYS B CB  1 
ATOM   1171 S  SG  . CYS B 1 46  ? 1.611  7.093  19.399  1.00 26.23 ? 46   CYS B SG  1 
ATOM   1172 N  N   . ALA B 1 47  ? -1.495 8.773  22.600  1.00 26.20 ? 47   ALA B N   1 
ATOM   1173 C  CA  . ALA B 1 47  ? -2.842 9.311  22.388  1.00 25.15 ? 47   ALA B CA  1 
ATOM   1174 C  C   . ALA B 1 47  ? -3.051 10.790 22.722  1.00 24.16 ? 47   ALA B C   1 
ATOM   1175 O  O   . ALA B 1 47  ? -4.199 11.244 22.804  1.00 21.23 ? 47   ALA B O   1 
ATOM   1176 C  CB  . ALA B 1 47  ? -3.861 8.465  23.164  1.00 25.85 ? 47   ALA B CB  1 
ATOM   1177 N  N   . CYS B 1 48  ? -1.968 11.542 22.919  1.00 21.01 ? 48   CYS B N   1 
ATOM   1178 C  CA  . CYS B 1 48  ? -2.073 12.978 23.205  1.00 20.82 ? 48   CYS B CA  1 
ATOM   1179 C  C   . CYS B 1 48  ? -0.795 13.667 22.708  1.00 19.83 ? 48   CYS B C   1 
ATOM   1180 O  O   . CYS B 1 48  ? -0.064 13.088 21.906  1.00 19.64 ? 48   CYS B O   1 
ATOM   1181 C  CB  . CYS B 1 48  ? -2.264 13.223 24.712  1.00 21.31 ? 48   CYS B CB  1 
ATOM   1182 S  SG  . CYS B 1 48  ? -0.811 12.965 25.770  1.00 23.16 ? 48   CYS B SG  1 
ATOM   1183 N  N   . THR B 1 49  ? -0.545 14.904 23.136  1.00 19.66 ? 49   THR B N   1 
ATOM   1184 C  CA  . THR B 1 49  ? 0.684  15.588 22.739  1.00 18.68 ? 49   THR B CA  1 
ATOM   1185 C  C   . THR B 1 49  ? 1.330  16.290 23.936  1.00 16.89 ? 49   THR B C   1 
ATOM   1186 O  O   . THR B 1 49  ? 2.212  17.125 23.777  1.00 15.70 ? 49   THR B O   1 
ATOM   1187 C  CB  . THR B 1 49  ? 0.448  16.632 21.601  1.00 19.00 ? 49   THR B CB  1 
ATOM   1188 O  OG1 . THR B 1 49  ? -0.455 17.662 22.039  1.00 17.64 ? 49   THR B OG1 1 
ATOM   1189 C  CG2 . THR B 1 49  ? -0.143 15.961 20.382  1.00 21.12 ? 49   THR B CG2 1 
ATOM   1190 N  N   . THR B 1 50  ? 0.909  15.931 25.145  1.00 15.67 ? 50   THR B N   1 
ATOM   1191 C  CA  . THR B 1 50  ? 1.453  16.583 26.329  1.00 15.65 ? 50   THR B CA  1 
ATOM   1192 C  C   . THR B 1 50  ? 2.928  16.274 26.582  1.00 14.76 ? 50   THR B C   1 
ATOM   1193 O  O   . THR B 1 50  ? 3.621  17.062 27.211  1.00 15.45 ? 50   THR B O   1 
ATOM   1194 C  CB  . THR B 1 50  ? 0.613  16.226 27.610  1.00 15.09 ? 50   THR B CB  1 
ATOM   1195 O  OG1 . THR B 1 50  ? 0.659  14.816 27.863  1.00 15.55 ? 50   THR B OG1 1 
ATOM   1196 C  CG2 . THR B 1 50  ? -0.838 16.636 27.423  1.00 14.17 ? 50   THR B CG2 1 
ATOM   1197 N  N   . CYS B 1 51  ? 3.397  15.133 26.082  1.00 15.86 ? 51   CYS B N   1 
ATOM   1198 C  CA  . CYS B 1 51  ? 4.784  14.701 26.261  1.00 15.22 ? 51   CYS B CA  1 
ATOM   1199 C  C   . CYS B 1 51  ? 5.661  15.125 25.078  1.00 14.79 ? 51   CYS B C   1 
ATOM   1200 O  O   . CYS B 1 51  ? 6.805  14.683 24.942  1.00 13.74 ? 51   CYS B O   1 
ATOM   1201 C  CB  . CYS B 1 51  ? 4.829  13.177 26.421  1.00 12.63 ? 51   CYS B CB  1 
ATOM   1202 S  SG  . CYS B 1 51  ? 4.411  12.273 24.920  1.00 16.65 ? 51   CYS B SG  1 
ATOM   1203 N  N   . HIS B 1 52  ? 5.108  15.982 24.227  1.00 15.09 ? 52   HIS B N   1 
ATOM   1204 C  CA  . HIS B 1 52  ? 5.811  16.504 23.054  1.00 13.86 ? 52   HIS B CA  1 
ATOM   1205 C  C   . HIS B 1 52  ? 7.166  17.103 23.439  1.00 14.80 ? 52   HIS B C   1 
ATOM   1206 O  O   . HIS B 1 52  ? 7.284  17.800 24.453  1.00 11.25 ? 52   HIS B O   1 
ATOM   1207 C  CB  . HIS B 1 52  ? 4.955  17.597 22.402  1.00 14.16 ? 52   HIS B CB  1 
ATOM   1208 C  CG  . HIS B 1 52  ? 5.600  18.275 21.227  1.00 14.28 ? 52   HIS B CG  1 
ATOM   1209 N  ND1 . HIS B 1 52  ? 5.335  19.587 20.900  1.00 14.19 ? 52   HIS B ND1 1 
ATOM   1210 C  CD2 . HIS B 1 52  ? 6.466  17.824 20.287  1.00 15.00 ? 52   HIS B CD2 1 
ATOM   1211 C  CE1 . HIS B 1 52  ? 6.005  19.918 19.809  1.00 13.95 ? 52   HIS B CE1 1 
ATOM   1212 N  NE2 . HIS B 1 52  ? 6.700  18.863 19.416  1.00 15.34 ? 52   HIS B NE2 1 
ATOM   1213 N  N   . CYS B 1 53  ? 8.187  16.820 22.633  1.00 11.94 ? 53   CYS B N   1 
ATOM   1214 C  CA  . CYS B 1 53  ? 9.510  17.374 22.851  1.00 12.90 ? 53   CYS B CA  1 
ATOM   1215 C  C   . CYS B 1 53  ? 10.177 17.514 21.486  1.00 12.89 ? 53   CYS B C   1 
ATOM   1216 O  O   . CYS B 1 53  ? 9.723  16.921 20.496  1.00 14.22 ? 53   CYS B O   1 
ATOM   1217 C  CB  . CYS B 1 53  ? 10.353 16.473 23.758  1.00 11.65 ? 53   CYS B CB  1 
ATOM   1218 S  SG  . CYS B 1 53  ? 10.957 14.956 23.015  1.00 17.19 ? 53   CYS B SG  1 
ATOM   1219 N  N   . ILE B 1 54  ? 11.249 18.295 21.445  1.00 14.79 ? 54   ILE B N   1 
ATOM   1220 C  CA  . ILE B 1 54  ? 11.990 18.551 20.211  1.00 14.63 ? 54   ILE B CA  1 
ATOM   1221 C  C   . ILE B 1 54  ? 13.405 18.044 20.417  1.00 14.91 ? 54   ILE B C   1 
ATOM   1222 O  O   . ILE B 1 54  ? 14.119 18.517 21.308  1.00 12.45 ? 54   ILE B O   1 
ATOM   1223 C  CB  . ILE B 1 54  ? 11.996 20.057 19.901  1.00 16.99 ? 54   ILE B CB  1 
ATOM   1224 C  CG1 . ILE B 1 54  ? 10.551 20.535 19.764  1.00 19.79 ? 54   ILE B CG1 1 
ATOM   1225 C  CG2 . ILE B 1 54  ? 12.769 20.348 18.616  1.00 19.43 ? 54   ILE B CG2 1 
ATOM   1226 C  CD1 . ILE B 1 54  ? 10.399 22.032 19.763  1.00 23.18 ? 54   ILE B CD1 1 
ATOM   1227 N  N   . VAL B 1 55  ? 13.811 17.065 19.609  1.00 15.74 ? 55   VAL B N   1 
ATOM   1228 C  CA  . VAL B 1 55  ? 15.149 16.494 19.727  1.00 16.55 ? 55   VAL B CA  1 
ATOM   1229 C  C   . VAL B 1 55  ? 16.081 17.343 18.860  1.00 18.20 ? 55   VAL B C   1 
ATOM   1230 O  O   . VAL B 1 55  ? 16.213 17.109 17.654  1.00 20.58 ? 55   VAL B O   1 
ATOM   1231 C  CB  . VAL B 1 55  ? 15.179 14.998 19.263  1.00 16.65 ? 55   VAL B CB  1 
ATOM   1232 C  CG1 . VAL B 1 55  ? 16.499 14.363 19.653  1.00 15.44 ? 55   VAL B CG1 1 
ATOM   1233 C  CG2 . VAL B 1 55  ? 14.012 14.213 19.883  1.00 16.04 ? 55   VAL B CG2 1 
ATOM   1234 N  N   . ARG B 1 56  ? 16.705 18.340 19.492  1.00 17.38 ? 56   ARG B N   1 
ATOM   1235 C  CA  . ARG B 1 56  ? 17.606 19.298 18.835  1.00 17.21 ? 56   ARG B CA  1 
ATOM   1236 C  C   . ARG B 1 56  ? 18.882 18.676 18.289  1.00 17.85 ? 56   ARG B C   1 
ATOM   1237 O  O   . ARG B 1 56  ? 19.487 19.215 17.362  1.00 20.25 ? 56   ARG B O   1 
ATOM   1238 C  CB  . ARG B 1 56  ? 17.984 20.419 19.810  1.00 17.24 ? 56   ARG B CB  1 
ATOM   1239 C  CG  . ARG B 1 56  ? 16.828 21.317 20.235  1.00 22.13 ? 56   ARG B CG  1 
ATOM   1240 C  CD  . ARG B 1 56  ? 16.311 22.152 19.092  1.00 22.56 ? 56   ARG B CD  1 
ATOM   1241 N  NE  . ARG B 1 56  ? 15.168 22.968 19.486  1.00 25.51 ? 56   ARG B NE  1 
ATOM   1242 C  CZ  . ARG B 1 56  ? 14.316 23.507 18.622  1.00 24.69 ? 56   ARG B CZ  1 
ATOM   1243 N  NH1 . ARG B 1 56  ? 14.490 23.310 17.324  1.00 25.39 ? 56   ARG B NH1 1 
ATOM   1244 N  NH2 . ARG B 1 56  ? 13.286 24.227 19.050  1.00 26.40 ? 56   ARG B NH2 1 
ATOM   1245 N  N   . GLU B 1 57  ? 19.310 17.575 18.891  1.00 17.84 ? 57   GLU B N   1 
ATOM   1246 C  CA  . GLU B 1 57  ? 20.504 16.857 18.441  1.00 20.72 ? 57   GLU B CA  1 
ATOM   1247 C  C   . GLU B 1 57  ? 20.289 15.364 18.673  1.00 19.45 ? 57   GLU B C   1 
ATOM   1248 O  O   . GLU B 1 57  ? 19.861 14.950 19.758  1.00 19.80 ? 57   GLU B O   1 
ATOM   1249 C  CB  . GLU B 1 57  ? 21.753 17.311 19.209  1.00 21.09 ? 57   GLU B CB  1 
ATOM   1250 C  CG  . GLU B 1 57  ? 22.055 18.808 19.190  1.00 26.79 ? 57   GLU B CG  1 
ATOM   1251 C  CD  . GLU B 1 57  ? 22.410 19.342 17.815  1.00 25.62 ? 57   GLU B CD  1 
ATOM   1252 O  OE1 . GLU B 1 57  ? 22.781 18.541 16.930  1.00 26.21 ? 57   GLU B OE1 1 
ATOM   1253 O  OE2 . GLU B 1 57  ? 22.329 20.572 17.623  1.00 27.83 ? 57   GLU B OE2 1 
ATOM   1254 N  N   . GLY B 1 58  ? 20.586 14.554 17.658  1.00 20.81 ? 58   GLY B N   1 
ATOM   1255 C  CA  . GLY B 1 58  ? 20.430 13.114 17.772  1.00 22.15 ? 58   GLY B CA  1 
ATOM   1256 C  C   . GLY B 1 58  ? 19.087 12.552 17.315  1.00 23.27 ? 58   GLY B C   1 
ATOM   1257 O  O   . GLY B 1 58  ? 18.758 11.399 17.614  1.00 23.84 ? 58   GLY B O   1 
ATOM   1258 N  N   . PHE B 1 59  ? 18.314 13.360 16.598  1.00 25.04 ? 59   PHE B N   1 
ATOM   1259 C  CA  . PHE B 1 59  ? 17.005 12.946 16.096  1.00 26.39 ? 59   PHE B CA  1 
ATOM   1260 C  C   . PHE B 1 59  ? 17.126 11.740 15.155  1.00 28.10 ? 59   PHE B C   1 
ATOM   1261 O  O   . PHE B 1 59  ? 16.371 10.773 15.281  1.00 27.17 ? 59   PHE B O   1 
ATOM   1262 C  CB  . PHE B 1 59  ? 16.347 14.122 15.365  1.00 26.68 ? 59   PHE B CB  1 
ATOM   1263 C  CG  . PHE B 1 59  ? 14.991 13.816 14.772  1.00 25.72 ? 59   PHE B CG  1 
ATOM   1264 C  CD1 . PHE B 1 59  ? 13.843 13.836 15.560  1.00 23.95 ? 59   PHE B CD1 1 
ATOM   1265 C  CD2 . PHE B 1 59  ? 14.862 13.536 13.415  1.00 24.69 ? 59   PHE B CD2 1 
ATOM   1266 C  CE1 . PHE B 1 59  ? 12.589 13.586 15.004  1.00 24.51 ? 59   PHE B CE1 1 
ATOM   1267 C  CE2 . PHE B 1 59  ? 13.617 13.284 12.849  1.00 25.60 ? 59   PHE B CE2 1 
ATOM   1268 C  CZ  . PHE B 1 59  ? 12.474 13.308 13.642  1.00 25.98 ? 59   PHE B CZ  1 
ATOM   1269 N  N   . ASP B 1 60  ? 18.083 11.799 14.229  1.00 30.16 ? 60   ASP B N   1 
ATOM   1270 C  CA  . ASP B 1 60  ? 18.291 10.722 13.252  1.00 31.89 ? 60   ASP B CA  1 
ATOM   1271 C  C   . ASP B 1 60  ? 18.676 9.393  13.879  1.00 31.92 ? 60   ASP B C   1 
ATOM   1272 O  O   . ASP B 1 60  ? 18.575 8.346  13.234  1.00 32.92 ? 60   ASP B O   1 
ATOM   1273 C  CB  . ASP B 1 60  ? 19.383 11.093 12.242  1.00 34.76 ? 60   ASP B CB  1 
ATOM   1274 C  CG  . ASP B 1 60  ? 19.139 12.425 11.569  1.00 38.28 ? 60   ASP B CG  1 
ATOM   1275 O  OD1 . ASP B 1 60  ? 17.962 12.754 11.292  1.00 40.35 ? 60   ASP B OD1 1 
ATOM   1276 O  OD2 . ASP B 1 60  ? 20.135 13.137 11.303  1.00 39.88 ? 60   ASP B OD2 1 
ATOM   1277 N  N   . SER B 1 61  ? 19.132 9.431  15.125  1.00 31.49 ? 61   SER B N   1 
ATOM   1278 C  CA  . SER B 1 61  ? 19.545 8.217  15.817  1.00 30.21 ? 61   SER B CA  1 
ATOM   1279 C  C   . SER B 1 61  ? 18.360 7.432  16.369  1.00 29.52 ? 61   SER B C   1 
ATOM   1280 O  O   . SER B 1 61  ? 18.482 6.247  16.670  1.00 29.33 ? 61   SER B O   1 
ATOM   1281 C  CB  . SER B 1 61  ? 20.490 8.557  16.971  1.00 30.23 ? 61   SER B CB  1 
ATOM   1282 O  OG  . SER B 1 61  ? 19.770 9.039  18.097  1.00 30.65 ? 61   SER B OG  1 
ATOM   1283 N  N   . LEU B 1 62  ? 17.215 8.093  16.508  1.00 28.12 ? 62   LEU B N   1 
ATOM   1284 C  CA  . LEU B 1 62  ? 16.026 7.437  17.043  1.00 26.17 ? 62   LEU B CA  1 
ATOM   1285 C  C   . LEU B 1 62  ? 15.241 6.710  15.947  1.00 26.61 ? 62   LEU B C   1 
ATOM   1286 O  O   . LEU B 1 62  ? 15.321 7.073  14.765  1.00 27.59 ? 62   LEU B O   1 
ATOM   1287 C  CB  . LEU B 1 62  ? 15.120 8.475  17.714  1.00 26.64 ? 62   LEU B CB  1 
ATOM   1288 C  CG  . LEU B 1 62  ? 15.779 9.426  18.722  1.00 23.47 ? 62   LEU B CG  1 
ATOM   1289 C  CD1 . LEU B 1 62  ? 14.801 10.538 19.116  1.00 23.54 ? 62   LEU B CD1 1 
ATOM   1290 C  CD2 . LEU B 1 62  ? 16.222 8.633  19.946  1.00 23.89 ? 62   LEU B CD2 1 
ATOM   1291 N  N   . PRO B 1 63  ? 14.496 5.659  16.320  0.50 25.28 ? 63   PRO B N   1 
ATOM   1292 C  CA  . PRO B 1 63  ? 13.704 4.910  15.341  0.50 26.43 ? 63   PRO B CA  1 
ATOM   1293 C  C   . PRO B 1 63  ? 12.630 5.828  14.768  0.50 28.28 ? 63   PRO B C   1 
ATOM   1294 O  O   . PRO B 1 63  ? 12.067 6.650  15.486  0.50 27.22 ? 63   PRO B O   1 
ATOM   1295 C  CB  . PRO B 1 63  ? 13.109 3.780  16.174  0.50 24.90 ? 63   PRO B CB  1 
ATOM   1296 C  CG  . PRO B 1 63  ? 14.144 3.560  17.230  0.50 24.74 ? 63   PRO B CG  1 
ATOM   1297 C  CD  . PRO B 1 63  ? 14.509 4.966  17.620  0.50 24.16 ? 63   PRO B CD  1 
ATOM   1298 N  N   . GLU B 1 64  ? 12.350 5.684  13.478  1.00 30.72 ? 64   GLU B N   1 
ATOM   1299 C  CA  . GLU B 1 64  ? 11.352 6.511  12.809  1.00 32.69 ? 64   GLU B CA  1 
ATOM   1300 C  C   . GLU B 1 64  ? 10.003 6.458  13.536  1.00 32.19 ? 64   GLU B C   1 
ATOM   1301 O  O   . GLU B 1 64  ? 9.579  5.396  13.996  1.00 31.80 ? 64   GLU B O   1 
ATOM   1302 C  CB  . GLU B 1 64  ? 11.200 6.038  11.361  1.00 36.27 ? 64   GLU B CB  1 
ATOM   1303 C  CG  . GLU B 1 64  ? 10.546 7.039  10.426  1.00 40.35 ? 64   GLU B CG  1 
ATOM   1304 C  CD  . GLU B 1 64  ? 10.578 6.581  8.976   1.00 43.17 ? 64   GLU B CD  1 
ATOM   1305 O  OE1 . GLU B 1 64  ? 11.689 6.365  8.442   1.00 44.82 ? 64   GLU B OE1 1 
ATOM   1306 O  OE2 . GLU B 1 64  ? 9.494  6.438  8.370   1.00 44.44 ? 64   GLU B OE2 1 
ATOM   1307 N  N   . SER B 1 65  ? 9.337  7.605  13.647  1.00 31.35 ? 65   SER B N   1 
ATOM   1308 C  CA  . SER B 1 65  ? 8.039  7.668  14.320  1.00 30.92 ? 65   SER B CA  1 
ATOM   1309 C  C   . SER B 1 65  ? 7.000  6.827  13.587  1.00 30.66 ? 65   SER B C   1 
ATOM   1310 O  O   . SER B 1 65  ? 7.095  6.616  12.381  1.00 30.54 ? 65   SER B O   1 
ATOM   1311 C  CB  . SER B 1 65  ? 7.552  9.119  14.414  1.00 28.99 ? 65   SER B CB  1 
ATOM   1312 O  OG  . SER B 1 65  ? 7.487  9.726  13.137  1.00 29.43 ? 65   SER B OG  1 
ATOM   1313 N  N   . SER B 1 66  ? 6.006  6.350  14.321  1.00 30.88 ? 66   SER B N   1 
ATOM   1314 C  CA  . SER B 1 66  ? 4.951  5.533  13.735  1.00 31.13 ? 66   SER B CA  1 
ATOM   1315 C  C   . SER B 1 66  ? 3.842  6.405  13.167  1.00 31.96 ? 66   SER B C   1 
ATOM   1316 O  O   . SER B 1 66  ? 3.769  7.607  13.439  1.00 31.43 ? 66   SER B O   1 
ATOM   1317 C  CB  . SER B 1 66  ? 4.356  4.599  14.789  1.00 31.18 ? 66   SER B CB  1 
ATOM   1318 O  OG  . SER B 1 66  ? 3.604  5.330  15.745  1.00 30.74 ? 66   SER B OG  1 
ATOM   1319 N  N   . GLU B 1 67  ? 2.973  5.786  12.376  1.00 31.90 ? 67   GLU B N   1 
ATOM   1320 C  CA  . GLU B 1 67  ? 1.848  6.485  11.777  1.00 32.49 ? 67   GLU B CA  1 
ATOM   1321 C  C   . GLU B 1 67  ? 0.981  7.050  12.904  1.00 31.49 ? 67   GLU B C   1 
ATOM   1322 O  O   . GLU B 1 67  ? 0.427  8.148  12.797  1.00 30.05 ? 67   GLU B O   1 
ATOM   1323 C  CB  . GLU B 1 67  ? 1.034  5.507  10.921  1.00 34.62 ? 67   GLU B CB  1 
ATOM   1324 C  CG  . GLU B 1 67  ? 0.333  4.397  11.711  1.00 39.41 ? 67   GLU B CG  1 
ATOM   1325 C  CD  . GLU B 1 67  ? 1.267  3.641  12.651  1.00 42.24 ? 67   GLU B CD  1 
ATOM   1326 O  OE1 . GLU B 1 67  ? 2.313  3.134  12.184  1.00 44.62 ? 67   GLU B OE1 1 
ATOM   1327 O  OE2 . GLU B 1 67  ? 0.947  3.550  13.860  1.00 41.99 ? 67   GLU B OE2 1 
ATOM   1328 N  N   . GLN B 1 68  ? 0.889  6.285  13.988  1.00 30.57 ? 68   GLN B N   1 
ATOM   1329 C  CA  . GLN B 1 68  ? 0.106  6.662  15.157  1.00 30.83 ? 68   GLN B CA  1 
ATOM   1330 C  C   . GLN B 1 68  ? 0.691  7.904  15.833  1.00 29.48 ? 68   GLN B C   1 
ATOM   1331 O  O   . GLN B 1 68  ? -0.048 8.771  16.308  1.00 29.25 ? 68   GLN B O   1 
ATOM   1332 C  CB  . GLN B 1 68  ? 0.072  5.490  16.143  1.00 33.34 ? 68   GLN B CB  1 
ATOM   1333 C  CG  . GLN B 1 68  ? -0.886 5.675  17.311  1.00 37.73 ? 68   GLN B CG  1 
ATOM   1334 C  CD  . GLN B 1 68  ? -0.991 4.430  18.175  1.00 39.92 ? 68   GLN B CD  1 
ATOM   1335 O  OE1 . GLN B 1 68  ? 0.006  3.945  18.715  1.00 40.91 ? 68   GLN B OE1 1 
ATOM   1336 N  NE2 . GLN B 1 68  ? -2.206 3.904  18.310  1.00 41.06 ? 68   GLN B NE2 1 
ATOM   1337 N  N   . GLU B 1 69  ? 2.018  7.994  15.877  1.00 28.93 ? 69   GLU B N   1 
ATOM   1338 C  CA  . GLU B 1 69  ? 2.658  9.155  16.494  1.00 25.37 ? 69   GLU B CA  1 
ATOM   1339 C  C   . GLU B 1 69  ? 2.470  10.367 15.598  1.00 25.68 ? 69   GLU B C   1 
ATOM   1340 O  O   . GLU B 1 69  ? 2.155  11.463 16.076  1.00 22.44 ? 69   GLU B O   1 
ATOM   1341 C  CB  . GLU B 1 69  ? 4.153  8.914  16.730  1.00 26.00 ? 69   GLU B CB  1 
ATOM   1342 C  CG  . GLU B 1 69  ? 4.830  10.069 17.477  1.00 23.78 ? 69   GLU B CG  1 
ATOM   1343 C  CD  . GLU B 1 69  ? 6.289  9.807  17.807  1.00 25.80 ? 69   GLU B CD  1 
ATOM   1344 O  OE1 . GLU B 1 69  ? 6.701  8.628  17.784  1.00 23.59 ? 69   GLU B OE1 1 
ATOM   1345 O  OE2 . GLU B 1 69  ? 7.020  10.785 18.107  1.00 22.24 ? 69   GLU B OE2 1 
ATOM   1346 N  N   . ASP B 1 70  ? 2.656  10.177 14.295  1.00 24.84 ? 70   ASP B N   1 
ATOM   1347 C  CA  . ASP B 1 70  ? 2.487  11.280 13.366  1.00 25.89 ? 70   ASP B CA  1 
ATOM   1348 C  C   . ASP B 1 70  ? 1.076  11.839 13.478  1.00 25.52 ? 70   ASP B C   1 
ATOM   1349 O  O   . ASP B 1 70  ? 0.880  13.050 13.373  1.00 24.61 ? 70   ASP B O   1 
ATOM   1350 C  CB  . ASP B 1 70  ? 2.755  10.844 11.920  1.00 28.03 ? 70   ASP B CB  1 
ATOM   1351 C  CG  . ASP B 1 70  ? 4.197  10.427 11.688  1.00 30.31 ? 70   ASP B CG  1 
ATOM   1352 O  OD1 . ASP B 1 70  ? 5.102  10.989 12.339  1.00 30.54 ? 70   ASP B OD1 1 
ATOM   1353 O  OD2 . ASP B 1 70  ? 4.426  9.541  10.839  1.00 34.02 ? 70   ASP B OD2 1 
ATOM   1354 N  N   . ASP B 1 71  ? 0.093  10.964 13.693  1.00 26.07 ? 71   ASP B N   1 
ATOM   1355 C  CA  . ASP B 1 71  ? -1.293 11.412 13.823  1.00 26.13 ? 71   ASP B CA  1 
ATOM   1356 C  C   . ASP B 1 71  ? -1.426 12.404 14.977  1.00 25.52 ? 71   ASP B C   1 
ATOM   1357 O  O   . ASP B 1 71  ? -2.180 13.373 14.897  1.00 23.99 ? 71   ASP B O   1 
ATOM   1358 C  CB  . ASP B 1 71  ? -2.245 10.235 14.081  1.00 28.68 ? 71   ASP B CB  1 
ATOM   1359 C  CG  . ASP B 1 71  ? -2.440 9.348  12.864  1.00 30.94 ? 71   ASP B CG  1 
ATOM   1360 O  OD1 . ASP B 1 71  ? -2.386 9.857  11.722  1.00 31.40 ? 71   ASP B OD1 1 
ATOM   1361 O  OD2 . ASP B 1 71  ? -2.674 8.138  13.055  1.00 32.72 ? 71   ASP B OD2 1 
ATOM   1362 N  N   . MET B 1 72  ? -0.706 12.145 16.061  1.00 25.43 ? 72   MET B N   1 
ATOM   1363 C  CA  . MET B 1 72  ? -0.751 13.028 17.217  1.00 24.47 ? 72   MET B CA  1 
ATOM   1364 C  C   . MET B 1 72  ? 0.079  14.291 16.992  1.00 24.69 ? 72   MET B C   1 
ATOM   1365 O  O   . MET B 1 72  ? -0.392 15.400 17.241  1.00 22.51 ? 72   MET B O   1 
ATOM   1366 C  CB  . MET B 1 72  ? -0.244 12.296 18.465  1.00 25.90 ? 72   MET B CB  1 
ATOM   1367 C  CG  . MET B 1 72  ? -1.109 11.124 18.919  1.00 25.88 ? 72   MET B CG  1 
ATOM   1368 S  SD  . MET B 1 72  ? -2.837 11.533 19.263  1.00 27.50 ? 72   MET B SD  1 
ATOM   1369 C  CE  . MET B 1 72  ? -2.715 13.227 19.811  1.00 32.50 ? 72   MET B CE  1 
ATOM   1370 N  N   . LEU B 1 73  ? 1.315  14.125 16.526  1.00 24.94 ? 73   LEU B N   1 
ATOM   1371 C  CA  . LEU B 1 73  ? 2.195  15.265 16.288  1.00 24.71 ? 73   LEU B CA  1 
ATOM   1372 C  C   . LEU B 1 73  ? 1.519  16.300 15.393  1.00 25.73 ? 73   LEU B C   1 
ATOM   1373 O  O   . LEU B 1 73  ? 1.779  17.499 15.503  1.00 24.21 ? 73   LEU B O   1 
ATOM   1374 C  CB  . LEU B 1 73  ? 3.515  14.803 15.661  1.00 23.68 ? 73   LEU B CB  1 
ATOM   1375 C  CG  . LEU B 1 73  ? 4.345  13.841 16.517  1.00 24.70 ? 73   LEU B CG  1 
ATOM   1376 C  CD1 . LEU B 1 73  ? 5.666  13.555 15.813  1.00 26.30 ? 73   LEU B CD1 1 
ATOM   1377 C  CD2 . LEU B 1 73  ? 4.598  14.443 17.894  1.00 26.11 ? 73   LEU B CD2 1 
ATOM   1378 N  N   . ASP B 1 74  ? 0.639  15.833 14.512  1.00 26.63 ? 74   ASP B N   1 
ATOM   1379 C  CA  . ASP B 1 74  ? -0.076 16.738 13.626  1.00 28.15 ? 74   ASP B CA  1 
ATOM   1380 C  C   . ASP B 1 74  ? -0.897 17.751 14.421  1.00 26.84 ? 74   ASP B C   1 
ATOM   1381 O  O   . ASP B 1 74  ? -1.154 18.854 13.947  1.00 27.45 ? 74   ASP B O   1 
ATOM   1382 C  CB  . ASP B 1 74  ? -1.000 15.954 12.692  1.00 31.39 ? 74   ASP B CB  1 
ATOM   1383 C  CG  . ASP B 1 74  ? -0.242 15.220 11.606  1.00 35.67 ? 74   ASP B CG  1 
ATOM   1384 O  OD1 . ASP B 1 74  ? 0.558  15.873 10.901  1.00 38.83 ? 74   ASP B OD1 1 
ATOM   1385 O  OD2 . ASP B 1 74  ? -0.448 13.999 11.451  1.00 37.72 ? 74   ASP B OD2 1 
ATOM   1386 N  N   . LYS B 1 75  ? -1.296 17.376 15.634  1.00 26.06 ? 75   LYS B N   1 
ATOM   1387 C  CA  . LYS B 1 75  ? -2.091 18.259 16.488  1.00 25.83 ? 75   LYS B CA  1 
ATOM   1388 C  C   . LYS B 1 75  ? -1.268 19.010 17.531  1.00 23.85 ? 75   LYS B C   1 
ATOM   1389 O  O   . LYS B 1 75  ? -1.775 19.925 18.176  1.00 22.95 ? 75   LYS B O   1 
ATOM   1390 C  CB  . LYS B 1 75  ? -3.176 17.457 17.215  1.00 28.70 ? 75   LYS B CB  1 
ATOM   1391 C  CG  . LYS B 1 75  ? -4.196 16.807 16.297  1.00 31.08 ? 75   LYS B CG  1 
ATOM   1392 C  CD  . LYS B 1 75  ? -5.377 16.279 17.092  1.00 36.10 ? 75   LYS B CD  1 
ATOM   1393 C  CE  . LYS B 1 75  ? -6.483 15.799 16.162  1.00 37.29 ? 75   LYS B CE  1 
ATOM   1394 N  NZ  . LYS B 1 75  ? -6.985 16.901 15.284  1.00 37.19 ? 75   LYS B NZ  1 
ATOM   1395 N  N   . ALA B 1 76  ? -0.007 18.626 17.702  1.00 21.61 ? 76   ALA B N   1 
ATOM   1396 C  CA  . ALA B 1 76  ? 0.855  19.267 18.693  1.00 20.05 ? 76   ALA B CA  1 
ATOM   1397 C  C   . ALA B 1 76  ? 1.120  20.753 18.450  1.00 19.60 ? 76   ALA B C   1 
ATOM   1398 O  O   . ALA B 1 76  ? 1.280  21.199 17.307  1.00 20.08 ? 76   ALA B O   1 
ATOM   1399 C  CB  . ALA B 1 76  ? 2.187  18.518 18.786  1.00 21.31 ? 76   ALA B CB  1 
ATOM   1400 N  N   . TRP B 1 77  ? 1.169  21.521 19.536  1.00 16.86 ? 77   TRP B N   1 
ATOM   1401 C  CA  . TRP B 1 77  ? 1.448  22.952 19.476  1.00 15.74 ? 77   TRP B CA  1 
ATOM   1402 C  C   . TRP B 1 77  ? 2.958  23.115 19.281  1.00 16.05 ? 77   TRP B C   1 
ATOM   1403 O  O   . TRP B 1 77  ? 3.751  22.377 19.878  1.00 15.37 ? 77   TRP B O   1 
ATOM   1404 C  CB  . TRP B 1 77  ? 1.026  23.625 20.794  1.00 14.99 ? 77   TRP B CB  1 
ATOM   1405 C  CG  . TRP B 1 77  ? 1.164  25.132 20.826  1.00 14.29 ? 77   TRP B CG  1 
ATOM   1406 C  CD1 . TRP B 1 77  ? 0.200  26.056 20.525  1.00 13.89 ? 77   TRP B CD1 1 
ATOM   1407 C  CD2 . TRP B 1 77  ? 2.331  25.876 21.190  1.00 13.77 ? 77   TRP B CD2 1 
ATOM   1408 N  NE1 . TRP B 1 77  ? 0.698  27.326 20.681  1.00 13.95 ? 77   TRP B NE1 1 
ATOM   1409 C  CE2 . TRP B 1 77  ? 2.003  27.246 21.089  1.00 15.02 ? 77   TRP B CE2 1 
ATOM   1410 C  CE3 . TRP B 1 77  ? 3.627  25.518 21.594  1.00 16.03 ? 77   TRP B CE3 1 
ATOM   1411 C  CZ2 . TRP B 1 77  ? 2.926  28.266 21.377  1.00 16.18 ? 77   TRP B CZ2 1 
ATOM   1412 C  CZ3 . TRP B 1 77  ? 4.546  26.531 21.877  1.00 14.59 ? 77   TRP B CZ3 1 
ATOM   1413 C  CH2 . TRP B 1 77  ? 4.186  27.889 21.765  1.00 16.66 ? 77   TRP B CH2 1 
ATOM   1414 N  N   . GLY B 1 78  ? 3.360  24.068 18.443  1.00 15.90 ? 78   GLY B N   1 
ATOM   1415 C  CA  . GLY B 1 78  ? 4.777  24.299 18.212  1.00 16.54 ? 78   GLY B CA  1 
ATOM   1416 C  C   . GLY B 1 78  ? 5.512  23.114 17.610  1.00 17.82 ? 78   GLY B C   1 
ATOM   1417 O  O   . GLY B 1 78  ? 6.637  22.790 18.010  1.00 18.88 ? 78   GLY B O   1 
ATOM   1418 N  N   . LEU B 1 79  ? 4.880  22.461 16.640  1.00 18.71 ? 79   LEU B N   1 
ATOM   1419 C  CA  . LEU B 1 79  ? 5.483  21.304 15.990  1.00 20.24 ? 79   LEU B CA  1 
ATOM   1420 C  C   . LEU B 1 79  ? 6.703  21.705 15.169  1.00 21.20 ? 79   LEU B C   1 
ATOM   1421 O  O   . LEU B 1 79  ? 6.685  22.720 14.484  1.00 21.32 ? 79   LEU B O   1 
ATOM   1422 C  CB  . LEU B 1 79  ? 4.468  20.635 15.060  1.00 21.17 ? 79   LEU B CB  1 
ATOM   1423 C  CG  . LEU B 1 79  ? 4.984  19.450 14.237  1.00 22.70 ? 79   LEU B CG  1 
ATOM   1424 C  CD1 . LEU B 1 79  ? 5.196  18.247 15.140  1.00 23.07 ? 79   LEU B CD1 1 
ATOM   1425 C  CD2 . LEU B 1 79  ? 3.980  19.113 13.146  1.00 24.34 ? 79   LEU B CD2 1 
ATOM   1426 N  N   . GLU B 1 80  ? 7.756  20.901 15.242  1.00 20.34 ? 80   GLU B N   1 
ATOM   1427 C  CA  . GLU B 1 80  ? 8.965  21.156 14.463  1.00 21.58 ? 80   GLU B CA  1 
ATOM   1428 C  C   . GLU B 1 80  ? 9.372  19.857 13.779  1.00 20.17 ? 80   GLU B C   1 
ATOM   1429 O  O   . GLU B 1 80  ? 8.891  18.784 14.139  1.00 18.51 ? 80   GLU B O   1 
ATOM   1430 C  CB  . GLU B 1 80  ? 10.093 21.670 15.363  1.00 23.29 ? 80   GLU B CB  1 
ATOM   1431 C  CG  . GLU B 1 80  ? 9.960  23.149 15.686  1.00 28.48 ? 80   GLU B CG  1 
ATOM   1432 C  CD  . GLU B 1 80  ? 11.140 23.690 16.457  1.00 31.84 ? 80   GLU B CD  1 
ATOM   1433 O  OE1 . GLU B 1 80  ? 12.288 23.470 16.016  1.00 34.34 ? 80   GLU B OE1 1 
ATOM   1434 O  OE2 . GLU B 1 80  ? 10.920 24.343 17.500  1.00 32.63 ? 80   GLU B OE2 1 
ATOM   1435 N  N   . PRO B 1 81  ? 10.251 19.934 12.766  0.50 18.92 ? 81   PRO B N   1 
ATOM   1436 C  CA  . PRO B 1 81  ? 10.690 18.730 12.056  0.50 18.00 ? 81   PRO B CA  1 
ATOM   1437 C  C   . PRO B 1 81  ? 11.319 17.669 12.963  0.50 17.86 ? 81   PRO B C   1 
ATOM   1438 O  O   . PRO B 1 81  ? 11.266 16.475 12.665  0.50 15.20 ? 81   PRO B O   1 
ATOM   1439 C  CB  . PRO B 1 81  ? 11.679 19.281 11.029  0.50 18.72 ? 81   PRO B CB  1 
ATOM   1440 C  CG  . PRO B 1 81  ? 11.139 20.629 10.736  0.50 18.98 ? 81   PRO B CG  1 
ATOM   1441 C  CD  . PRO B 1 81  ? 10.791 21.141 12.122  1.00 21.87 ? 81   PRO B CD  1 
ATOM   1442 N  N   . GLU B 1 82  ? 11.909 18.107 14.073  1.00 18.69 ? 82   GLU B N   1 
ATOM   1443 C  CA  . GLU B 1 82  ? 12.541 17.176 15.004  1.00 19.52 ? 82   GLU B CA  1 
ATOM   1444 C  C   . GLU B 1 82  ? 11.675 16.848 16.224  1.00 18.30 ? 82   GLU B C   1 
ATOM   1445 O  O   . GLU B 1 82  ? 12.171 16.316 17.222  1.00 17.93 ? 82   GLU B O   1 
ATOM   1446 C  CB  . GLU B 1 82  ? 13.897 17.721 15.450  1.00 22.20 ? 82   GLU B CB  1 
ATOM   1447 C  CG  . GLU B 1 82  ? 14.890 17.883 14.292  1.00 27.74 ? 82   GLU B CG  1 
ATOM   1448 C  CD  . GLU B 1 82  ? 16.125 18.668 14.671  1.00 31.42 ? 82   GLU B CD  1 
ATOM   1449 O  OE1 . GLU B 1 82  ? 15.981 19.740 15.300  1.00 33.61 ? 82   GLU B OE1 1 
ATOM   1450 O  OE2 . GLU B 1 82  ? 17.242 18.223 14.331  1.00 34.32 ? 82   GLU B OE2 1 
ATOM   1451 N  N   . SER B 1 83  ? 10.382 17.155 16.135  1.00 18.27 ? 83   SER B N   1 
ATOM   1452 C  CA  . SER B 1 83  ? 9.435  16.864 17.216  1.00 18.30 ? 83   SER B CA  1 
ATOM   1453 C  C   . SER B 1 83  ? 9.197  15.367 17.380  1.00 19.07 ? 83   SER B C   1 
ATOM   1454 O  O   . SER B 1 83  ? 9.186  14.618 16.403  1.00 20.61 ? 83   SER B O   1 
ATOM   1455 C  CB  . SER B 1 83  ? 8.078  17.515 16.939  1.00 14.99 ? 83   SER B CB  1 
ATOM   1456 O  OG  . SER B 1 83  ? 8.115  18.915 17.082  1.00 16.43 ? 83   SER B OG  1 
ATOM   1457 N  N   . ARG B 1 84  ? 8.996  14.940 18.621  1.00 18.61 ? 84   ARG B N   1 
ATOM   1458 C  CA  . ARG B 1 84  ? 8.705  13.550 18.944  1.00 18.24 ? 84   ARG B CA  1 
ATOM   1459 C  C   . ARG B 1 84  ? 7.858  13.504 20.211  1.00 18.11 ? 84   ARG B C   1 
ATOM   1460 O  O   . ARG B 1 84  ? 7.872  14.442 21.019  1.00 15.51 ? 84   ARG B O   1 
ATOM   1461 C  CB  . ARG B 1 84  ? 9.987  12.738 19.201  1.00 19.82 ? 84   ARG B CB  1 
ATOM   1462 C  CG  . ARG B 1 84  ? 10.866 12.432 17.982  1.00 21.45 ? 84   ARG B CG  1 
ATOM   1463 C  CD  . ARG B 1 84  ? 10.115 11.672 16.885  1.00 22.96 ? 84   ARG B CD  1 
ATOM   1464 N  NE  . ARG B 1 84  ? 9.537  10.409 17.343  1.00 21.88 ? 84   ARG B NE  1 
ATOM   1465 C  CZ  . ARG B 1 84  ? 10.197 9.260  17.469  1.00 24.25 ? 84   ARG B CZ  1 
ATOM   1466 N  NH1 . ARG B 1 84  ? 11.489 9.177  17.164  1.00 23.12 ? 84   ARG B NH1 1 
ATOM   1467 N  NH2 . ARG B 1 84  ? 9.564  8.182  17.914  1.00 23.17 ? 84   ARG B NH2 1 
ATOM   1468 N  N   . LEU B 1 85  ? 7.085  12.438 20.368  1.00 18.23 ? 85   LEU B N   1 
ATOM   1469 C  CA  . LEU B 1 85  ? 6.311  12.270 21.594  1.00 17.82 ? 85   LEU B CA  1 
ATOM   1470 C  C   . LEU B 1 85  ? 7.362  11.590 22.456  1.00 18.54 ? 85   LEU B C   1 
ATOM   1471 O  O   . LEU B 1 85  ? 7.879  10.538 22.069  1.00 17.21 ? 85   LEU B O   1 
ATOM   1472 C  CB  . LEU B 1 85  ? 5.120  11.340 21.373  1.00 17.63 ? 85   LEU B CB  1 
ATOM   1473 C  CG  . LEU B 1 85  ? 3.991  11.854 20.481  1.00 18.82 ? 85   LEU B CG  1 
ATOM   1474 C  CD1 . LEU B 1 85  ? 2.914  10.787 20.403  1.00 18.56 ? 85   LEU B CD1 1 
ATOM   1475 C  CD2 . LEU B 1 85  ? 3.415  13.159 21.033  1.00 17.30 ? 85   LEU B CD2 1 
ATOM   1476 N  N   . SER B 1 86  ? 7.710  12.179 23.601  1.00 18.54 ? 86   SER B N   1 
ATOM   1477 C  CA  . SER B 1 86  ? 8.755  11.588 24.425  1.00 17.67 ? 86   SER B CA  1 
ATOM   1478 C  C   . SER B 1 86  ? 8.423  10.215 24.991  1.00 19.56 ? 86   SER B C   1 
ATOM   1479 O  O   . SER B 1 86  ? 9.324  9.482  25.381  1.00 19.67 ? 86   SER B O   1 
ATOM   1480 C  CB  . SER B 1 86  ? 9.173  12.533 25.565  1.00 19.33 ? 86   SER B CB  1 
ATOM   1481 O  OG  . SER B 1 86  ? 8.110  12.819 26.456  1.00 18.60 ? 86   SER B OG  1 
ATOM   1482 N  N   . CYS B 1 87  ? 7.142  9.860  25.034  1.00 21.51 ? 87   CYS B N   1 
ATOM   1483 C  CA  . CYS B 1 87  ? 6.772  8.546  25.550  1.00 21.69 ? 87   CYS B CA  1 
ATOM   1484 C  C   . CYS B 1 87  ? 6.923  7.481  24.465  1.00 23.34 ? 87   CYS B C   1 
ATOM   1485 O  O   . CYS B 1 87  ? 6.763  6.292  24.733  1.00 24.76 ? 87   CYS B O   1 
ATOM   1486 C  CB  . CYS B 1 87  ? 5.326  8.550  26.075  1.00 21.92 ? 87   CYS B CB  1 
ATOM   1487 S  SG  . CYS B 1 87  ? 4.058  8.634  24.814  1.00 19.96 ? 87   CYS B SG  1 
ATOM   1488 N  N   . GLN B 1 88  ? 7.230  7.910  23.244  1.00 22.43 ? 88   GLN B N   1 
ATOM   1489 C  CA  . GLN B 1 88  ? 7.411  6.990  22.122  1.00 23.90 ? 88   GLN B CA  1 
ATOM   1490 C  C   . GLN B 1 88  ? 8.862  6.924  21.656  1.00 25.17 ? 88   GLN B C   1 
ATOM   1491 O  O   . GLN B 1 88  ? 9.320  5.878  21.180  1.00 24.57 ? 88   GLN B O   1 
ATOM   1492 C  CB  . GLN B 1 88  ? 6.541  7.415  20.935  1.00 24.07 ? 88   GLN B CB  1 
ATOM   1493 C  CG  . GLN B 1 88  ? 5.053  7.392  21.208  1.00 27.17 ? 88   GLN B CG  1 
ATOM   1494 C  CD  . GLN B 1 88  ? 4.565  6.017  21.592  1.00 26.91 ? 88   GLN B CD  1 
ATOM   1495 O  OE1 . GLN B 1 88  ? 4.692  5.062  20.821  1.00 27.74 ? 88   GLN B OE1 1 
ATOM   1496 N  NE2 . GLN B 1 88  ? 4.005  5.901  22.788  1.00 27.02 ? 88   GLN B NE2 1 
ATOM   1497 N  N   . ALA B 1 89  ? 9.571  8.045  21.790  1.00 24.61 ? 89   ALA B N   1 
ATOM   1498 C  CA  . ALA B 1 89  ? 10.966 8.158  21.370  1.00 24.82 ? 89   ALA B CA  1 
ATOM   1499 C  C   . ALA B 1 89  ? 11.921 7.401  22.279  1.00 25.71 ? 89   ALA B C   1 
ATOM   1500 O  O   . ALA B 1 89  ? 12.085 7.742  23.451  1.00 26.57 ? 89   ALA B O   1 
ATOM   1501 C  CB  . ALA B 1 89  ? 11.372 9.636  21.305  1.00 24.73 ? 89   ALA B CB  1 
ATOM   1502 N  N   . ARG B 1 90  ? 12.563 6.377  21.731  1.00 26.94 ? 90   ARG B N   1 
ATOM   1503 C  CA  . ARG B 1 90  ? 13.499 5.578  22.504  1.00 27.91 ? 90   ARG B CA  1 
ATOM   1504 C  C   . ARG B 1 90  ? 14.934 5.815  22.070  1.00 28.10 ? 90   ARG B C   1 
ATOM   1505 O  O   . ARG B 1 90  ? 15.250 5.769  20.883  1.00 28.99 ? 90   ARG B O   1 
ATOM   1506 C  CB  . ARG B 1 90  ? 13.141 4.101  22.372  1.00 29.88 ? 90   ARG B CB  1 
ATOM   1507 C  CG  . ARG B 1 90  ? 11.800 3.798  23.006  1.00 29.56 ? 90   ARG B CG  1 
ATOM   1508 C  CD  . ARG B 1 90  ? 11.319 2.400  22.733  1.00 29.09 ? 90   ARG B CD  1 
ATOM   1509 N  NE  . ARG B 1 90  ? 10.014 2.204  23.350  1.00 26.71 ? 90   ARG B NE  1 
ATOM   1510 C  CZ  . ARG B 1 90  ? 9.825  1.911  24.633  1.00 27.01 ? 90   ARG B CZ  1 
ATOM   1511 N  NH1 . ARG B 1 90  ? 10.860 1.766  25.448  1.00 27.69 ? 90   ARG B NH1 1 
ATOM   1512 N  NH2 . ARG B 1 90  ? 8.598  1.772  25.104  1.00 24.40 ? 90   ARG B NH2 1 
ATOM   1513 N  N   . VAL B 1 91  ? 15.799 6.081  23.040  1.00 29.02 ? 91   VAL B N   1 
ATOM   1514 C  CA  . VAL B 1 91  ? 17.199 6.328  22.743  1.00 29.52 ? 91   VAL B CA  1 
ATOM   1515 C  C   . VAL B 1 91  ? 17.858 5.026  22.330  1.00 30.08 ? 91   VAL B C   1 
ATOM   1516 O  O   . VAL B 1 91  ? 17.391 3.943  22.695  1.00 29.85 ? 91   VAL B O   1 
ATOM   1517 C  CB  . VAL B 1 91  ? 17.940 6.895  23.967  1.00 31.57 ? 91   VAL B CB  1 
ATOM   1518 C  CG1 . VAL B 1 91  ? 17.339 8.232  24.361  1.00 32.61 ? 91   VAL B CG1 1 
ATOM   1519 C  CG2 . VAL B 1 91  ? 17.851 5.928  25.123  1.00 31.50 ? 91   VAL B CG2 1 
ATOM   1520 N  N   . THR B 1 92  ? 18.939 5.133  21.565  1.00 30.20 ? 92   THR B N   1 
ATOM   1521 C  CA  . THR B 1 92  ? 19.661 3.952  21.114  1.00 30.99 ? 92   THR B CA  1 
ATOM   1522 C  C   . THR B 1 92  ? 21.143 4.019  21.468  1.00 30.73 ? 92   THR B C   1 
ATOM   1523 O  O   . THR B 1 92  ? 21.541 3.636  22.569  1.00 31.12 ? 92   THR B O   1 
ATOM   1524 C  CB  . THR B 1 92  ? 19.501 3.750  19.592  1.00 30.73 ? 92   THR B CB  1 
ATOM   1525 O  OG1 . THR B 1 92  ? 20.012 4.891  18.894  1.00 31.88 ? 92   THR B OG1 1 
ATOM   1526 C  CG2 . THR B 1 92  ? 18.026 3.564  19.240  1.00 32.62 ? 92   THR B CG2 1 
ATOM   1527 N  N   . ASP B 1 93  ? 21.960 4.515  20.548  1.00 31.14 ? 93   ASP B N   1 
ATOM   1528 C  CA  . ASP B 1 93  ? 23.396 4.596  20.787  1.00 32.47 ? 93   ASP B CA  1 
ATOM   1529 C  C   . ASP B 1 93  ? 23.990 5.978  20.546  1.00 32.07 ? 93   ASP B C   1 
ATOM   1530 O  O   . ASP B 1 93  ? 25.170 6.100  20.221  1.00 32.61 ? 93   ASP B O   1 
ATOM   1531 C  CB  . ASP B 1 93  ? 24.118 3.593  19.893  1.00 33.79 ? 93   ASP B CB  1 
ATOM   1532 C  CG  . ASP B 1 93  ? 23.682 3.694  18.445  1.00 38.42 ? 93   ASP B CG  1 
ATOM   1533 O  OD1 . ASP B 1 93  ? 23.661 4.822  17.900  1.00 38.85 ? 93   ASP B OD1 1 
ATOM   1534 O  OD2 . ASP B 1 93  ? 23.363 2.641  17.850  1.00 41.29 ? 93   ASP B OD2 1 
ATOM   1535 N  N   . GLU B 1 94  ? 23.188 7.021  20.706  1.00 30.69 ? 94   GLU B N   1 
ATOM   1536 C  CA  . GLU B 1 94  ? 23.693 8.366  20.479  1.00 28.55 ? 94   GLU B CA  1 
ATOM   1537 C  C   . GLU B 1 94  ? 23.152 9.318  21.539  1.00 27.58 ? 94   GLU B C   1 
ATOM   1538 O  O   . GLU B 1 94  ? 21.970 9.273  21.878  1.00 24.93 ? 94   GLU B O   1 
ATOM   1539 C  CB  . GLU B 1 94  ? 23.281 8.824  19.075  1.00 31.92 ? 94   GLU B CB  1 
ATOM   1540 C  CG  . GLU B 1 94  ? 24.037 10.015 18.514  1.00 35.71 ? 94   GLU B CG  1 
ATOM   1541 C  CD  . GLU B 1 94  ? 23.749 10.230 17.034  1.00 36.30 ? 94   GLU B CD  1 
ATOM   1542 O  OE1 . GLU B 1 94  ? 23.945 9.279  16.250  1.00 37.88 ? 94   GLU B OE1 1 
ATOM   1543 O  OE2 . GLU B 1 94  ? 23.332 11.343 16.649  1.00 38.76 ? 94   GLU B OE2 1 
ATOM   1544 N  N   . ASP B 1 95  ? 24.027 10.160 22.079  1.00 24.29 ? 95   ASP B N   1 
ATOM   1545 C  CA  . ASP B 1 95  ? 23.614 11.138 23.082  1.00 22.10 ? 95   ASP B CA  1 
ATOM   1546 C  C   . ASP B 1 95  ? 22.629 12.103 22.430  1.00 20.41 ? 95   ASP B C   1 
ATOM   1547 O  O   . ASP B 1 95  ? 22.674 12.337 21.218  1.00 18.92 ? 95   ASP B O   1 
ATOM   1548 C  CB  . ASP B 1 95  ? 24.828 11.905 23.617  1.00 21.99 ? 95   ASP B CB  1 
ATOM   1549 C  CG  . ASP B 1 95  ? 25.656 11.088 24.598  1.00 22.24 ? 95   ASP B CG  1 
ATOM   1550 O  OD1 . ASP B 1 95  ? 25.302 9.919  24.866  1.00 20.78 ? 95   ASP B OD1 1 
ATOM   1551 O  OD2 . ASP B 1 95  ? 26.662 11.625 25.107  1.00 22.79 ? 95   ASP B OD2 1 
ATOM   1552 N  N   . LEU B 1 96  ? 21.736 12.674 23.233  1.00 19.04 ? 96   LEU B N   1 
ATOM   1553 C  CA  . LEU B 1 96  ? 20.735 13.589 22.701  1.00 17.50 ? 96   LEU B CA  1 
ATOM   1554 C  C   . LEU B 1 96  ? 20.721 14.926 23.423  1.00 17.67 ? 96   LEU B C   1 
ATOM   1555 O  O   . LEU B 1 96  ? 21.271 15.063 24.515  1.00 18.51 ? 96   LEU B O   1 
ATOM   1556 C  CB  . LEU B 1 96  ? 19.330 12.982 22.851  1.00 18.97 ? 96   LEU B CB  1 
ATOM   1557 C  CG  . LEU B 1 96  ? 19.034 11.551 22.411  1.00 16.39 ? 96   LEU B CG  1 
ATOM   1558 C  CD1 . LEU B 1 96  ? 17.591 11.195 22.773  1.00 16.94 ? 96   LEU B CD1 1 
ATOM   1559 C  CD2 . LEU B 1 96  ? 19.254 11.425 20.919  1.00 16.16 ? 96   LEU B CD2 1 
ATOM   1560 N  N   . VAL B 1 97  ? 20.093 15.901 22.776  1.00 18.02 ? 97   VAL B N   1 
ATOM   1561 C  CA  . VAL B 1 97  ? 19.865 17.231 23.325  1.00 16.83 ? 97   VAL B CA  1 
ATOM   1562 C  C   . VAL B 1 97  ? 18.379 17.380 23.032  1.00 15.88 ? 97   VAL B C   1 
ATOM   1563 O  O   . VAL B 1 97  ? 17.959 17.305 21.882  1.00 16.35 ? 97   VAL B O   1 
ATOM   1564 C  CB  . VAL B 1 97  ? 20.651 18.334 22.600  1.00 16.60 ? 97   VAL B CB  1 
ATOM   1565 C  CG1 . VAL B 1 97  ? 20.179 19.701 23.085  1.00 16.83 ? 97   VAL B CG1 1 
ATOM   1566 C  CG2 . VAL B 1 97  ? 22.139 18.164 22.861  1.00 18.11 ? 97   VAL B CG2 1 
ATOM   1567 N  N   . VAL B 1 98  ? 17.581 17.560 24.078  1.00 14.21 ? 98   VAL B N   1 
ATOM   1568 C  CA  . VAL B 1 98  ? 16.139 17.660 23.934  1.00 13.47 ? 98   VAL B CA  1 
ATOM   1569 C  C   . VAL B 1 98  ? 15.601 18.956 24.506  1.00 14.68 ? 98   VAL B C   1 
ATOM   1570 O  O   . VAL B 1 98  ? 16.045 19.418 25.557  1.00 15.04 ? 98   VAL B O   1 
ATOM   1571 C  CB  . VAL B 1 98  ? 15.433 16.483 24.658  1.00 11.55 ? 98   VAL B CB  1 
ATOM   1572 C  CG1 . VAL B 1 98  ? 13.911 16.664 24.583  1.00 12.06 ? 98   VAL B CG1 1 
ATOM   1573 C  CG2 . VAL B 1 98  ? 15.862 15.151 24.031  1.00 14.71 ? 98   VAL B CG2 1 
ATOM   1574 N  N   . GLU B 1 99  ? 14.649 19.550 23.800  1.00 13.92 ? 99   GLU B N   1 
ATOM   1575 C  CA  . GLU B 1 99  ? 14.023 20.769 24.260  1.00 15.15 ? 99   GLU B CA  1 
ATOM   1576 C  C   . GLU B 1 99  ? 12.571 20.482 24.576  1.00 15.36 ? 99   GLU B C   1 
ATOM   1577 O  O   . GLU B 1 99  ? 11.870 19.827 23.803  1.00 14.91 ? 99   GLU B O   1 
ATOM   1578 C  CB  . GLU B 1 99  ? 14.093 21.858 23.193  1.00 17.26 ? 99   GLU B CB  1 
ATOM   1579 C  CG  . GLU B 1 99  ? 13.320 23.119 23.565  1.00 20.89 ? 99   GLU B CG  1 
ATOM   1580 C  CD  . GLU B 1 99  ? 13.443 24.196 22.514  1.00 24.93 ? 99   GLU B CD  1 
ATOM   1581 O  OE1 . GLU B 1 99  ? 14.590 24.535 22.153  1.00 27.07 ? 99   GLU B OE1 1 
ATOM   1582 O  OE2 . GLU B 1 99  ? 12.393 24.700 22.054  1.00 28.22 ? 99   GLU B OE2 1 
ATOM   1583 N  N   . ILE B 1 100 ? 12.127 20.953 25.734  1.00 14.42 ? 100  ILE B N   1 
ATOM   1584 C  CA  . ILE B 1 100 ? 10.744 20.798 26.140  1.00 14.60 ? 100  ILE B CA  1 
ATOM   1585 C  C   . ILE B 1 100 ? 10.071 22.056 25.590  1.00 15.11 ? 100  ILE B C   1 
ATOM   1586 O  O   . ILE B 1 100 ? 10.616 23.156 25.715  1.00 16.47 ? 100  ILE B O   1 
ATOM   1587 C  CB  . ILE B 1 100 ? 10.642 20.751 27.677  1.00 15.94 ? 100  ILE B CB  1 
ATOM   1588 C  CG1 . ILE B 1 100 ? 11.390 19.523 28.193  1.00 17.04 ? 100  ILE B CG1 1 
ATOM   1589 C  CG2 . ILE B 1 100 ? 9.177  20.752 28.115  1.00 15.82 ? 100  ILE B CG2 1 
ATOM   1590 C  CD1 . ILE B 1 100 ? 11.389 19.396 29.711  1.00 19.69 ? 100  ILE B CD1 1 
ATOM   1591 N  N   . PRO B 1 101 ? 8.897  21.910 24.950  1.00 15.34 ? 101  PRO B N   1 
ATOM   1592 C  CA  . PRO B 1 101 ? 8.158  23.038 24.378  1.00 16.08 ? 101  PRO B CA  1 
ATOM   1593 C  C   . PRO B 1 101 ? 7.711  24.057 25.419  1.00 16.74 ? 101  PRO B C   1 
ATOM   1594 O  O   . PRO B 1 101 ? 7.537  23.727 26.591  1.00 15.30 ? 101  PRO B O   1 
ATOM   1595 C  CB  . PRO B 1 101 ? 6.965  22.367 23.686  1.00 17.88 ? 101  PRO B CB  1 
ATOM   1596 C  CG  . PRO B 1 101 ? 7.437  20.974 23.422  1.00 19.01 ? 101  PRO B CG  1 
ATOM   1597 C  CD  . PRO B 1 101 ? 8.219  20.635 24.657  1.00 16.77 ? 101  PRO B CD  1 
ATOM   1598 N  N   . ARG B 1 102 ? 7.533  25.298 24.980  1.00 18.26 ? 102  ARG B N   1 
ATOM   1599 C  CA  . ARG B 1 102 ? 7.086  26.386 25.846  1.00 20.30 ? 102  ARG B CA  1 
ATOM   1600 C  C   . ARG B 1 102 ? 5.645  26.172 26.288  1.00 20.21 ? 102  ARG B C   1 
ATOM   1601 O  O   . ARG B 1 102 ? 5.211  26.676 27.333  1.00 21.07 ? 102  ARG B O   1 
ATOM   1602 C  CB  . ARG B 1 102 ? 7.197  27.711 25.092  1.00 22.58 ? 102  ARG B CB  1 
ATOM   1603 C  CG  . ARG B 1 102 ? 8.622  28.211 24.958  1.00 26.07 ? 102  ARG B CG  1 
ATOM   1604 C  CD  . ARG B 1 102 ? 8.846  29.372 25.897  1.00 31.97 ? 102  ARG B CD  1 
ATOM   1605 N  NE  . ARG B 1 102 ? 8.205  29.136 27.187  1.00 36.71 ? 102  ARG B NE  1 
ATOM   1606 C  CZ  . ARG B 1 102 ? 8.136  30.034 28.160  1.00 39.13 ? 102  ARG B CZ  1 
ATOM   1607 N  NH1 . ARG B 1 102 ? 8.673  31.237 27.992  1.00 40.65 ? 102  ARG B NH1 1 
ATOM   1608 N  NH2 . ARG B 1 102 ? 7.528  29.731 29.300  1.00 41.42 ? 102  ARG B NH2 1 
ATOM   1609 N  N   . TYR B 1 103 ? 4.906  25.416 25.484  1.00 16.52 ? 103  TYR B N   1 
ATOM   1610 C  CA  . TYR B 1 103 ? 3.508  25.130 25.763  1.00 14.12 ? 103  TYR B CA  1 
ATOM   1611 C  C   . TYR B 1 103 ? 3.071  23.821 25.126  1.00 15.57 ? 103  TYR B C   1 
ATOM   1612 O  O   . TYR B 1 103 ? 3.563  23.459 24.054  1.00 15.06 ? 103  TYR B O   1 
ATOM   1613 C  CB  . TYR B 1 103 ? 2.617  26.253 25.209  1.00 13.11 ? 103  TYR B CB  1 
ATOM   1614 C  CG  . TYR B 1 103 ? 1.158  26.100 25.573  1.00 14.98 ? 103  TYR B CG  1 
ATOM   1615 C  CD1 . TYR B 1 103 ? 0.694  26.484 26.831  1.00 14.80 ? 103  TYR B CD1 1 
ATOM   1616 C  CD2 . TYR B 1 103 ? 0.241  25.528 24.680  1.00 15.26 ? 103  TYR B CD2 1 
ATOM   1617 C  CE1 . TYR B 1 103 ? -0.642 26.300 27.194  1.00 16.91 ? 103  TYR B CE1 1 
ATOM   1618 C  CE2 . TYR B 1 103 ? -1.093 25.341 25.034  1.00 16.49 ? 103  TYR B CE2 1 
ATOM   1619 C  CZ  . TYR B 1 103 ? -1.527 25.730 26.296  1.00 17.99 ? 103  TYR B CZ  1 
ATOM   1620 O  OH  . TYR B 1 103 ? -2.844 25.533 26.658  1.00 18.10 ? 103  TYR B OH  1 
ATOM   1621 N  N   . THR B 1 104 ? 2.156  23.111 25.790  1.00 15.66 ? 104  THR B N   1 
ATOM   1622 C  CA  . THR B 1 104 ? 1.582  21.873 25.261  1.00 17.50 ? 104  THR B CA  1 
ATOM   1623 C  C   . THR B 1 104 ? 0.074  21.920 25.470  1.00 18.91 ? 104  THR B C   1 
ATOM   1624 O  O   . THR B 1 104 ? -0.414 22.429 26.490  1.00 17.63 ? 104  THR B O   1 
ATOM   1625 C  CB  . THR B 1 104 ? 2.116  20.593 25.956  1.00 20.80 ? 104  THR B CB  1 
ATOM   1626 O  OG1 . THR B 1 104 ? 1.861  20.656 27.367  1.00 22.88 ? 104  THR B OG1 1 
ATOM   1627 C  CG2 . THR B 1 104 ? 3.601  20.430 25.703  1.00 20.71 ? 104  THR B CG2 1 
ATOM   1628 N  N   . ILE B 1 105 ? -0.665 21.418 24.489  1.00 17.28 ? 105  ILE B N   1 
ATOM   1629 C  CA  . ILE B 1 105 ? -2.113 21.367 24.574  1.00 17.48 ? 105  ILE B CA  1 
ATOM   1630 C  C   . ILE B 1 105 ? -2.435 20.227 25.528  1.00 18.71 ? 105  ILE B C   1 
ATOM   1631 O  O   . ILE B 1 105 ? -1.860 19.144 25.422  1.00 18.48 ? 105  ILE B O   1 
ATOM   1632 C  CB  . ILE B 1 105 ? -2.743 21.054 23.195  1.00 17.55 ? 105  ILE B CB  1 
ATOM   1633 C  CG1 . ILE B 1 105 ? -2.499 22.215 22.240  1.00 17.71 ? 105  ILE B CG1 1 
ATOM   1634 C  CG2 . ILE B 1 105 ? -4.233 20.802 23.331  1.00 19.07 ? 105  ILE B CG2 1 
ATOM   1635 C  CD1 . ILE B 1 105 ? -2.900 21.906 20.797  1.00 22.74 ? 105  ILE B CD1 1 
ATOM   1636 N  N   . ASN B 1 106 ? -3.339 20.463 26.472  1.00 17.89 ? 106  ASN B N   1 
ATOM   1637 C  CA  . ASN B 1 106 ? -3.712 19.414 27.419  1.00 19.66 ? 106  ASN B CA  1 
ATOM   1638 C  C   . ASN B 1 106 ? -5.144 19.666 27.869  1.00 22.16 ? 106  ASN B C   1 
ATOM   1639 O  O   . ASN B 1 106 ? -5.398 20.487 28.754  1.00 23.29 ? 106  ASN B O   1 
ATOM   1640 C  CB  . ASN B 1 106 ? -2.774 19.422 28.630  1.00 20.16 ? 106  ASN B CB  1 
ATOM   1641 C  CG  . ASN B 1 106 ? -3.019 18.251 29.558  1.00 21.84 ? 106  ASN B CG  1 
ATOM   1642 O  OD1 . ASN B 1 106 ? -4.018 17.542 29.426  1.00 23.85 ? 106  ASN B OD1 1 
ATOM   1643 N  ND2 . ASN B 1 106 ? -2.113 18.044 30.507  1.00 23.05 ? 106  ASN B ND2 1 
ATOM   1644 N  N   . HIS B 1 107 ? -6.077 18.948 27.257  1.00 23.99 ? 107  HIS B N   1 
ATOM   1645 C  CA  . HIS B 1 107 ? -7.490 19.113 27.560  1.00 27.30 ? 107  HIS B CA  1 
ATOM   1646 C  C   . HIS B 1 107 ? -7.880 18.706 28.976  1.00 29.17 ? 107  HIS B C   1 
ATOM   1647 O  O   . HIS B 1 107 ? -8.983 19.013 29.431  1.00 28.76 ? 107  HIS B O   1 
ATOM   1648 C  CB  . HIS B 1 107 ? -8.313 18.346 26.526  1.00 28.95 ? 107  HIS B CB  1 
ATOM   1649 C  CG  . HIS B 1 107 ? -8.107 18.836 25.127  1.00 31.97 ? 107  HIS B CG  1 
ATOM   1650 N  ND1 . HIS B 1 107 ? -8.535 20.077 24.705  1.00 30.97 ? 107  HIS B ND1 1 
ATOM   1651 C  CD2 . HIS B 1 107 ? -7.460 18.284 24.073  1.00 32.87 ? 107  HIS B CD2 1 
ATOM   1652 C  CE1 . HIS B 1 107 ? -8.158 20.270 23.454  1.00 31.83 ? 107  HIS B CE1 1 
ATOM   1653 N  NE2 . HIS B 1 107 ? -7.503 19.198 23.047  1.00 32.97 ? 107  HIS B NE2 1 
ATOM   1654 N  N   . ALA B 1 108 ? -6.963 18.044 29.674  1.00 29.97 ? 108  ALA B N   1 
ATOM   1655 C  CA  . ALA B 1 108 ? -7.210 17.597 31.039  1.00 33.01 ? 108  ALA B CA  1 
ATOM   1656 C  C   . ALA B 1 108 ? -6.662 18.518 32.134  1.00 34.27 ? 108  ALA B C   1 
ATOM   1657 O  O   . ALA B 1 108 ? -7.137 18.469 33.268  1.00 35.06 ? 108  ALA B O   1 
ATOM   1658 C  CB  . ALA B 1 108 ? -6.656 16.177 31.232  1.00 32.36 ? 108  ALA B CB  1 
ATOM   1659 N  N   . ARG B 1 109 ? -5.678 19.359 31.830  1.00 34.49 ? 109  ARG B N   1 
ATOM   1660 C  CA  . ARG B 1 109 ? -5.146 20.215 32.885  1.00 36.51 ? 109  ARG B CA  1 
ATOM   1661 C  C   . ARG B 1 109 ? -6.191 21.212 33.364  1.00 37.39 ? 109  ARG B C   1 
ATOM   1662 O  O   . ARG B 1 109 ? -6.111 21.721 34.481  1.00 36.43 ? 109  ARG B O   1 
ATOM   1663 C  CB  . ARG B 1 109 ? -3.869 20.946 32.435  1.00 36.41 ? 109  ARG B CB  1 
ATOM   1664 C  CG  . ARG B 1 109 ? -4.055 22.235 31.659  1.00 34.90 ? 109  ARG B CG  1 
ATOM   1665 C  CD  . ARG B 1 109 ? -2.739 23.031 31.630  1.00 33.07 ? 109  ARG B CD  1 
ATOM   1666 N  NE  . ARG B 1 109 ? -1.630 22.253 31.068  1.00 27.58 ? 109  ARG B NE  1 
ATOM   1667 C  CZ  . ARG B 1 109 ? -1.176 22.378 29.823  1.00 26.23 ? 109  ARG B CZ  1 
ATOM   1668 N  NH1 . ARG B 1 109 ? -1.721 23.259 28.996  1.00 20.42 ? 109  ARG B NH1 1 
ATOM   1669 N  NH2 . ARG B 1 109 ? -0.192 21.600 29.392  1.00 22.93 ? 109  ARG B NH2 1 
ATOM   1670 N  N   . GLU B 1 110 ? -7.184 21.467 32.522  1.00 39.42 ? 110  GLU B N   1 
ATOM   1671 C  CA  . GLU B 1 110 ? -8.255 22.398 32.851  1.00 40.93 ? 110  GLU B CA  1 
ATOM   1672 C  C   . GLU B 1 110 ? -9.621 21.770 32.570  1.00 41.54 ? 110  GLU B C   1 
ATOM   1673 O  O   . GLU B 1 110 ? -9.801 20.611 32.998  1.00 28.04 ? 110  GLU B O   1 
ATOM   1674 C  CB  . GLU B 1 110 ? -8.091 23.688 32.046  1.00 40.98 ? 110  GLU B CB  1 
ATOM   1675 N  N   . PRO C 1 2   ? 52.859 -1.814 -17.167 1.00 20.78 ? 2    PRO C N   1 
ATOM   1676 C  CA  . PRO C 1 2   ? 53.385 -2.174 -15.826 1.00 21.98 ? 2    PRO C CA  1 
ATOM   1677 C  C   . PRO C 1 2   ? 52.238 -2.467 -14.865 1.00 22.12 ? 2    PRO C C   1 
ATOM   1678 O  O   . PRO C 1 2   ? 51.114 -1.987 -15.054 1.00 22.26 ? 2    PRO C O   1 
ATOM   1679 C  CB  . PRO C 1 2   ? 54.179 -0.978 -15.322 1.00 21.11 ? 2    PRO C CB  1 
ATOM   1680 C  CG  . PRO C 1 2   ? 54.543 -0.276 -16.630 1.00 24.05 ? 2    PRO C CG  1 
ATOM   1681 C  CD  . PRO C 1 2   ? 53.317 -0.463 -17.531 1.00 19.88 ? 2    PRO C CD  1 
ATOM   1682 N  N   . LYS C 1 3   ? 52.528 -3.254 -13.836 1.00 20.86 ? 3    LYS C N   1 
ATOM   1683 C  CA  . LYS C 1 3   ? 51.527 -3.584 -12.826 1.00 21.10 ? 3    LYS C CA  1 
ATOM   1684 C  C   . LYS C 1 3   ? 51.454 -2.456 -11.803 1.00 18.94 ? 3    LYS C C   1 
ATOM   1685 O  O   . LYS C 1 3   ? 52.466 -1.827 -11.477 1.00 18.38 ? 3    LYS C O   1 
ATOM   1686 C  CB  . LYS C 1 3   ? 51.894 -4.872 -12.082 1.00 22.09 ? 3    LYS C CB  1 
ATOM   1687 C  CG  . LYS C 1 3   ? 51.819 -6.149 -12.894 1.00 26.81 ? 3    LYS C CG  1 
ATOM   1688 C  CD  . LYS C 1 3   ? 52.012 -7.367 -11.985 1.00 28.39 ? 3    LYS C CD  1 
ATOM   1689 C  CE  . LYS C 1 3   ? 51.893 -8.663 -12.764 1.00 30.33 ? 3    LYS C CE  1 
ATOM   1690 N  NZ  . LYS C 1 3   ? 50.577 -8.757 -13.457 1.00 32.47 ? 3    LYS C NZ  1 
ATOM   1691 N  N   . ILE C 1 4   ? 50.252 -2.197 -11.308 1.00 19.61 ? 4    ILE C N   1 
ATOM   1692 C  CA  . ILE C 1 4   ? 50.053 -1.177 -10.287 1.00 18.15 ? 4    ILE C CA  1 
ATOM   1693 C  C   . ILE C 1 4   ? 49.261 -1.794 -9.158  1.00 19.16 ? 4    ILE C C   1 
ATOM   1694 O  O   . ILE C 1 4   ? 48.093 -2.145 -9.323  1.00 20.02 ? 4    ILE C O   1 
ATOM   1695 C  CB  . ILE C 1 4   ? 49.264 0.042  -10.795 1.00 18.53 ? 4    ILE C CB  1 
ATOM   1696 C  CG1 . ILE C 1 4   ? 50.109 0.839  -11.780 1.00 19.40 ? 4    ILE C CG1 1 
ATOM   1697 C  CG2 . ILE C 1 4   ? 48.862 0.928  -9.617  1.00 21.46 ? 4    ILE C CG2 1 
ATOM   1698 C  CD1 . ILE C 1 4   ? 49.444 2.119  -12.252 1.00 21.25 ? 4    ILE C CD1 1 
ATOM   1699 N  N   . VAL C 1 5   ? 49.900 -1.937 -8.005  1.00 16.83 ? 5    VAL C N   1 
ATOM   1700 C  CA  . VAL C 1 5   ? 49.208 -2.499 -6.861  1.00 16.28 ? 5    VAL C CA  1 
ATOM   1701 C  C   . VAL C 1 5   ? 48.626 -1.338 -6.068  1.00 16.90 ? 5    VAL C C   1 
ATOM   1702 O  O   . VAL C 1 5   ? 49.329 -0.371 -5.775  1.00 17.83 ? 5    VAL C O   1 
ATOM   1703 C  CB  . VAL C 1 5   ? 50.181 -3.305 -5.974  1.00 15.24 ? 5    VAL C CB  1 
ATOM   1704 C  CG1 . VAL C 1 5   ? 49.513 -3.641 -4.654  1.00 17.99 ? 5    VAL C CG1 1 
ATOM   1705 C  CG2 . VAL C 1 5   ? 50.601 -4.578 -6.686  1.00 17.02 ? 5    VAL C CG2 1 
ATOM   1706 N  N   . ILE C 1 6   ? 47.330 -1.404 -5.769  1.00 17.92 ? 6    ILE C N   1 
ATOM   1707 C  CA  . ILE C 1 6   ? 46.676 -0.367 -4.976  1.00 17.83 ? 6    ILE C CA  1 
ATOM   1708 C  C   . ILE C 1 6   ? 46.497 -1.032 -3.617  1.00 17.31 ? 6    ILE C C   1 
ATOM   1709 O  O   . ILE C 1 6   ? 45.830 -2.064 -3.512  1.00 14.75 ? 6    ILE C O   1 
ATOM   1710 C  CB  . ILE C 1 6   ? 45.265 0.029  -5.516  1.00 17.75 ? 6    ILE C CB  1 
ATOM   1711 C  CG1 . ILE C 1 6   ? 45.363 0.696  -6.901  1.00 18.38 ? 6    ILE C CG1 1 
ATOM   1712 C  CG2 . ILE C 1 6   ? 44.592 0.987  -4.534  1.00 19.62 ? 6    ILE C CG2 1 
ATOM   1713 C  CD1 . ILE C 1 6   ? 46.180 1.958  -6.945  1.00 16.00 ? 6    ILE C CD1 1 
ATOM   1714 N  N   . LEU C 1 7   ? 47.112 -0.461 -2.586  1.00 17.74 ? 7    LEU C N   1 
ATOM   1715 C  CA  . LEU C 1 7   ? 47.018 -1.029 -1.244  1.00 17.56 ? 7    LEU C CA  1 
ATOM   1716 C  C   . LEU C 1 7   ? 45.588 -0.985 -0.727  1.00 19.15 ? 7    LEU C C   1 
ATOM   1717 O  O   . LEU C 1 7   ? 44.783 -0.135 -1.133  1.00 17.71 ? 7    LEU C O   1 
ATOM   1718 C  CB  . LEU C 1 7   ? 47.961 -0.285 -0.293  1.00 17.92 ? 7    LEU C CB  1 
ATOM   1719 C  CG  . LEU C 1 7   ? 49.441 -0.487 -0.643  1.00 17.42 ? 7    LEU C CG  1 
ATOM   1720 C  CD1 . LEU C 1 7   ? 50.302 0.393  0.249   1.00 19.81 ? 7    LEU C CD1 1 
ATOM   1721 C  CD2 . LEU C 1 7   ? 49.819 -1.952 -0.484  1.00 18.35 ? 7    LEU C CD2 1 
ATOM   1722 N  N   . PRO C 1 8   ? 45.243 -1.914 0.174   1.00 18.69 ? 8    PRO C N   1 
ATOM   1723 C  CA  . PRO C 1 8   ? 43.884 -1.943 0.717   1.00 22.28 ? 8    PRO C CA  1 
ATOM   1724 C  C   . PRO C 1 8   ? 43.459 -0.570 1.203   1.00 23.63 ? 8    PRO C C   1 
ATOM   1725 O  O   . PRO C 1 8   ? 44.178 0.088  1.953   1.00 23.55 ? 8    PRO C O   1 
ATOM   1726 C  CB  . PRO C 1 8   ? 43.984 -2.962 1.846   1.00 22.84 ? 8    PRO C CB  1 
ATOM   1727 C  CG  . PRO C 1 8   ? 45.022 -3.911 1.346   1.00 23.79 ? 8    PRO C CG  1 
ATOM   1728 C  CD  . PRO C 1 8   ? 46.072 -2.976 0.767   1.00 20.51 ? 8    PRO C CD  1 
ATOM   1729 N  N   . HIS C 1 9   ? 42.291 -0.141 0.741   1.00 24.18 ? 9    HIS C N   1 
ATOM   1730 C  CA  . HIS C 1 9   ? 41.723 1.148  1.103   1.00 26.28 ? 9    HIS C CA  1 
ATOM   1731 C  C   . HIS C 1 9   ? 40.281 0.861  1.521   1.00 28.72 ? 9    HIS C C   1 
ATOM   1732 O  O   . HIS C 1 9   ? 39.512 0.272  0.759   1.00 27.41 ? 9    HIS C O   1 
ATOM   1733 C  CB  . HIS C 1 9   ? 41.744 2.089  -0.104  1.00 25.67 ? 9    HIS C CB  1 
ATOM   1734 C  CG  . HIS C 1 9   ? 41.190 3.450  0.178   1.00 27.36 ? 9    HIS C CG  1 
ATOM   1735 N  ND1 . HIS C 1 9   ? 41.966 4.487  0.651   1.00 26.87 ? 9    HIS C ND1 1 
ATOM   1736 C  CD2 . HIS C 1 9   ? 39.932 3.940  0.069   1.00 26.92 ? 9    HIS C CD2 1 
ATOM   1737 C  CE1 . HIS C 1 9   ? 41.209 5.557  0.819   1.00 25.11 ? 9    HIS C CE1 1 
ATOM   1738 N  NE2 . HIS C 1 9   ? 39.971 5.251  0.472   1.00 28.64 ? 9    HIS C NE2 1 
ATOM   1739 N  N   . GLN C 1 10  ? 39.923 1.278  2.730   1.00 30.67 ? 10   GLN C N   1 
ATOM   1740 C  CA  . GLN C 1 10  ? 38.585 1.044  3.272   1.00 33.26 ? 10   GLN C CA  1 
ATOM   1741 C  C   . GLN C 1 10  ? 37.403 1.379  2.360   1.00 33.84 ? 10   GLN C C   1 
ATOM   1742 O  O   . GLN C 1 10  ? 36.385 0.685  2.379   1.00 33.78 ? 10   GLN C O   1 
ATOM   1743 C  CB  . GLN C 1 10  ? 38.431 1.805  4.591   1.00 37.10 ? 10   GLN C CB  1 
ATOM   1744 C  CG  . GLN C 1 10  ? 39.418 1.380  5.665   1.00 41.86 ? 10   GLN C CG  1 
ATOM   1745 C  CD  . GLN C 1 10  ? 39.386 2.294  6.872   1.00 44.41 ? 10   GLN C CD  1 
ATOM   1746 O  OE1 . GLN C 1 10  ? 39.747 3.470  6.782   1.00 46.79 ? 10   GLN C OE1 1 
ATOM   1747 N  NE2 . GLN C 1 10  ? 38.949 1.762  8.012   1.00 45.63 ? 10   GLN C NE2 1 
ATOM   1748 N  N   . ASP C 1 11  ? 37.524 2.432  1.560   1.00 33.97 ? 11   ASP C N   1 
ATOM   1749 C  CA  . ASP C 1 11  ? 36.415 2.814  0.695   1.00 34.89 ? 11   ASP C CA  1 
ATOM   1750 C  C   . ASP C 1 11  ? 36.519 2.376  -0.760  1.00 33.86 ? 11   ASP C C   1 
ATOM   1751 O  O   . ASP C 1 11  ? 35.605 1.746  -1.293  1.00 34.48 ? 11   ASP C O   1 
ATOM   1752 C  CB  . ASP C 1 11  ? 36.214 4.332  0.732   1.00 37.71 ? 11   ASP C CB  1 
ATOM   1753 C  CG  . ASP C 1 11  ? 36.089 4.873  2.142   1.00 40.72 ? 11   ASP C CG  1 
ATOM   1754 O  OD1 . ASP C 1 11  ? 35.361 4.266  2.960   1.00 42.57 ? 11   ASP C OD1 1 
ATOM   1755 O  OD2 . ASP C 1 11  ? 36.714 5.918  2.428   1.00 43.36 ? 11   ASP C OD2 1 
ATOM   1756 N  N   . LEU C 1 12  ? 37.635 2.698  -1.400  1.00 31.34 ? 12   LEU C N   1 
ATOM   1757 C  CA  . LEU C 1 12  ? 37.807 2.382  -2.809  1.00 30.29 ? 12   LEU C CA  1 
ATOM   1758 C  C   . LEU C 1 12  ? 38.324 0.999  -3.136  1.00 29.95 ? 12   LEU C C   1 
ATOM   1759 O  O   . LEU C 1 12  ? 38.132 0.513  -4.251  1.00 29.22 ? 12   LEU C O   1 
ATOM   1760 C  CB  . LEU C 1 12  ? 38.755 3.393  -3.455  1.00 31.38 ? 12   LEU C CB  1 
ATOM   1761 C  CG  . LEU C 1 12  ? 38.542 4.879  -3.177  1.00 30.83 ? 12   LEU C CG  1 
ATOM   1762 C  CD1 . LEU C 1 12  ? 39.589 5.672  -3.950  1.00 33.13 ? 12   LEU C CD1 1 
ATOM   1763 C  CD2 . LEU C 1 12  ? 37.138 5.303  -3.580  1.00 32.88 ? 12   LEU C CD2 1 
ATOM   1764 N  N   . CYS C 1 13  ? 38.970 0.352  -2.178  1.00 28.56 ? 13   CYS C N   1 
ATOM   1765 C  CA  . CYS C 1 13  ? 39.559 -0.940 -2.470  1.00 28.67 ? 13   CYS C CA  1 
ATOM   1766 C  C   . CYS C 1 13  ? 39.868 -1.711 -1.188  1.00 27.29 ? 13   CYS C C   1 
ATOM   1767 O  O   . CYS C 1 13  ? 41.028 -1.906 -0.838  1.00 25.03 ? 13   CYS C O   1 
ATOM   1768 C  CB  . CYS C 1 13  ? 40.842 -0.678 -3.267  1.00 31.97 ? 13   CYS C CB  1 
ATOM   1769 S  SG  . CYS C 1 13  ? 41.424 -2.046 -4.240  1.00 38.74 ? 13   CYS C SG  1 
ATOM   1770 N  N   . PRO C 1 14  ? 38.826 -2.172 -0.478  1.00 26.50 ? 14   PRO C N   1 
ATOM   1771 C  CA  . PRO C 1 14  ? 38.970 -2.920 0.774   1.00 26.13 ? 14   PRO C CA  1 
ATOM   1772 C  C   . PRO C 1 14  ? 40.066 -3.981 0.824   1.00 25.18 ? 14   PRO C C   1 
ATOM   1773 O  O   . PRO C 1 14  ? 40.824 -4.044 1.788   1.00 26.48 ? 14   PRO C O   1 
ATOM   1774 C  CB  . PRO C 1 14  ? 37.581 -3.523 0.969   1.00 27.31 ? 14   PRO C CB  1 
ATOM   1775 C  CG  . PRO C 1 14  ? 36.696 -2.450 0.430   1.00 28.38 ? 14   PRO C CG  1 
ATOM   1776 C  CD  . PRO C 1 14  ? 37.404 -2.071 -0.861  1.00 27.42 ? 14   PRO C CD  1 
ATOM   1777 N  N   . ASP C 1 15  ? 40.144 -4.814 -0.209  1.00 24.70 ? 15   ASP C N   1 
ATOM   1778 C  CA  . ASP C 1 15  ? 41.132 -5.890 -0.263  1.00 26.28 ? 15   ASP C CA  1 
ATOM   1779 C  C   . ASP C 1 15  ? 42.363 -5.526 -1.084  1.00 25.61 ? 15   ASP C C   1 
ATOM   1780 O  O   . ASP C 1 15  ? 43.275 -6.337 -1.234  1.00 26.82 ? 15   ASP C O   1 
ATOM   1781 C  CB  . ASP C 1 15  ? 40.508 -7.149 -0.869  1.00 28.09 ? 15   ASP C CB  1 
ATOM   1782 C  CG  . ASP C 1 15  ? 39.429 -7.759 0.010   1.00 30.82 ? 15   ASP C CG  1 
ATOM   1783 O  OD1 . ASP C 1 15  ? 38.597 -8.521 -0.528  1.00 33.77 ? 15   ASP C OD1 1 
ATOM   1784 O  OD2 . ASP C 1 15  ? 39.419 -7.497 1.231   1.00 32.59 ? 15   ASP C OD2 1 
ATOM   1785 N  N   . GLY C 1 16  ? 42.387 -4.308 -1.608  1.00 24.89 ? 16   GLY C N   1 
ATOM   1786 C  CA  . GLY C 1 16  ? 43.510 -3.894 -2.425  1.00 23.99 ? 16   GLY C CA  1 
ATOM   1787 C  C   . GLY C 1 16  ? 43.257 -4.399 -3.831  1.00 24.16 ? 16   GLY C C   1 
ATOM   1788 O  O   . GLY C 1 16  ? 42.253 -5.068 -4.076  1.00 23.14 ? 16   GLY C O   1 
ATOM   1789 N  N   . ALA C 1 17  ? 44.150 -4.086 -4.764  1.00 22.76 ? 17   ALA C N   1 
ATOM   1790 C  CA  . ALA C 1 17  ? 43.960 -4.540 -6.133  1.00 22.24 ? 17   ALA C CA  1 
ATOM   1791 C  C   . ALA C 1 17  ? 45.249 -4.512 -6.932  1.00 21.98 ? 17   ALA C C   1 
ATOM   1792 O  O   . ALA C 1 17  ? 46.166 -3.748 -6.628  1.00 19.30 ? 17   ALA C O   1 
ATOM   1793 C  CB  . ALA C 1 17  ? 42.906 -3.677 -6.822  1.00 23.59 ? 17   ALA C CB  1 
ATOM   1794 N  N   . VAL C 1 18  ? 45.304 -5.358 -7.954  1.00 22.54 ? 18   VAL C N   1 
ATOM   1795 C  CA  . VAL C 1 18  ? 46.446 -5.448 -8.855  1.00 22.73 ? 18   VAL C CA  1 
ATOM   1796 C  C   . VAL C 1 18  ? 45.875 -5.010 -10.198 1.00 24.92 ? 18   VAL C C   1 
ATOM   1797 O  O   . VAL C 1 18  ? 44.926 -5.622 -10.689 1.00 26.19 ? 18   VAL C O   1 
ATOM   1798 C  CB  . VAL C 1 18  ? 46.972 -6.904 -8.955  1.00 22.89 ? 18   VAL C CB  1 
ATOM   1799 C  CG1 . VAL C 1 18  ? 48.096 -6.999 -9.989  1.00 24.82 ? 18   VAL C CG1 1 
ATOM   1800 C  CG2 . VAL C 1 18  ? 47.492 -7.359 -7.602  1.00 22.88 ? 18   VAL C CG2 1 
ATOM   1801 N  N   . LEU C 1 19  ? 46.427 -3.944 -10.771 1.00 24.29 ? 19   LEU C N   1 
ATOM   1802 C  CA  . LEU C 1 19  ? 45.937 -3.422 -12.048 1.00 27.26 ? 19   LEU C CA  1 
ATOM   1803 C  C   . LEU C 1 19  ? 47.017 -3.435 -13.120 1.00 27.32 ? 19   LEU C C   1 
ATOM   1804 O  O   . LEU C 1 19  ? 48.205 -3.366 -12.817 1.00 27.04 ? 19   LEU C O   1 
ATOM   1805 C  CB  . LEU C 1 19  ? 45.456 -1.979 -11.878 1.00 27.76 ? 19   LEU C CB  1 
ATOM   1806 C  CG  . LEU C 1 19  ? 44.533 -1.621 -10.711 1.00 30.57 ? 19   LEU C CG  1 
ATOM   1807 C  CD1 . LEU C 1 19  ? 44.293 -0.128 -10.714 1.00 31.23 ? 19   LEU C CD1 1 
ATOM   1808 C  CD2 . LEU C 1 19  ? 43.225 -2.380 -10.818 1.00 30.86 ? 19   LEU C CD2 1 
ATOM   1809 N  N   . GLU C 1 20  ? 46.598 -3.523 -14.379 1.00 29.26 ? 20   GLU C N   1 
ATOM   1810 C  CA  . GLU C 1 20  ? 47.538 -3.496 -15.494 1.00 30.44 ? 20   GLU C CA  1 
ATOM   1811 C  C   . GLU C 1 20  ? 47.455 -2.114 -16.128 1.00 30.54 ? 20   GLU C C   1 
ATOM   1812 O  O   . GLU C 1 20  ? 46.423 -1.746 -16.687 1.00 31.45 ? 20   GLU C O   1 
ATOM   1813 C  CB  . GLU C 1 20  ? 47.175 -4.553 -16.537 1.00 33.48 ? 20   GLU C CB  1 
ATOM   1814 C  CG  . GLU C 1 20  ? 47.419 -5.976 -16.092 1.00 39.34 ? 20   GLU C CG  1 
ATOM   1815 C  CD  . GLU C 1 20  ? 48.854 -6.205 -15.665 1.00 42.72 ? 20   GLU C CD  1 
ATOM   1816 O  OE1 . GLU C 1 20  ? 49.770 -5.821 -16.428 1.00 43.76 ? 20   GLU C OE1 1 
ATOM   1817 O  OE2 . GLU C 1 20  ? 49.064 -6.773 -14.569 1.00 44.17 ? 20   GLU C OE2 1 
ATOM   1818 N  N   . ALA C 1 21  ? 48.537 -1.347 -16.037 1.00 29.21 ? 21   ALA C N   1 
ATOM   1819 C  CA  . ALA C 1 21  ? 48.570 -0.005 -16.600 1.00 30.00 ? 21   ALA C CA  1 
ATOM   1820 C  C   . ALA C 1 21  ? 49.382 0.024  -17.894 1.00 29.66 ? 21   ALA C C   1 
ATOM   1821 O  O   . ALA C 1 21  ? 50.153 -0.897 -18.170 1.00 29.34 ? 21   ALA C O   1 
ATOM   1822 C  CB  . ALA C 1 21  ? 49.161 0.973  -15.583 1.00 28.13 ? 21   ALA C CB  1 
ATOM   1823 N  N   . ASN C 1 22  ? 49.197 1.086  -18.678 1.00 30.84 ? 22   ASN C N   1 
ATOM   1824 C  CA  . ASN C 1 22  ? 49.906 1.254  -19.947 1.00 31.97 ? 22   ASN C CA  1 
ATOM   1825 C  C   . ASN C 1 22  ? 50.993 2.309  -19.836 1.00 31.80 ? 22   ASN C C   1 
ATOM   1826 O  O   . ASN C 1 22  ? 50.787 3.373  -19.244 1.00 32.94 ? 22   ASN C O   1 
ATOM   1827 C  CB  . ASN C 1 22  ? 48.935 1.665  -21.058 1.00 31.82 ? 22   ASN C CB  1 
ATOM   1828 C  CG  . ASN C 1 22  ? 47.832 0.652  -21.277 1.00 32.97 ? 22   ASN C CG  1 
ATOM   1829 O  OD1 . ASN C 1 22  ? 48.090 -0.542 -21.437 1.00 34.04 ? 22   ASN C OD1 1 
ATOM   1830 N  ND2 . ASN C 1 22  ? 46.591 1.126  -21.292 1.00 33.68 ? 22   ASN C ND2 1 
ATOM   1831 N  N   . SER C 1 23  ? 52.153 2.019  -20.413 1.00 32.41 ? 23   SER C N   1 
ATOM   1832 C  CA  . SER C 1 23  ? 53.265 2.958  -20.379 1.00 32.57 ? 23   SER C CA  1 
ATOM   1833 C  C   . SER C 1 23  ? 52.809 4.309  -20.927 1.00 32.10 ? 23   SER C C   1 
ATOM   1834 O  O   . SER C 1 23  ? 52.128 4.372  -21.951 1.00 34.34 ? 23   SER C O   1 
ATOM   1835 C  CB  . SER C 1 23  ? 54.431 2.423  -21.219 1.00 32.64 ? 23   SER C CB  1 
ATOM   1836 O  OG  . SER C 1 23  ? 54.878 1.161  -20.741 1.00 33.92 ? 23   SER C OG  1 
ATOM   1837 N  N   . GLY C 1 24  ? 53.170 5.386  -20.234 1.00 32.18 ? 24   GLY C N   1 
ATOM   1838 C  CA  . GLY C 1 24  ? 52.789 6.715  -20.679 1.00 32.22 ? 24   GLY C CA  1 
ATOM   1839 C  C   . GLY C 1 24  ? 51.469 7.188  -20.099 1.00 32.17 ? 24   GLY C C   1 
ATOM   1840 O  O   . GLY C 1 24  ? 51.183 8.386  -20.086 1.00 33.06 ? 24   GLY C O   1 
ATOM   1841 N  N   . GLU C 1 25  ? 50.669 6.241  -19.618 1.00 32.04 ? 25   GLU C N   1 
ATOM   1842 C  CA  . GLU C 1 25  ? 49.368 6.531  -19.024 1.00 31.91 ? 25   GLU C CA  1 
ATOM   1843 C  C   . GLU C 1 25  ? 49.533 7.002  -17.582 1.00 31.25 ? 25   GLU C C   1 
ATOM   1844 O  O   . GLU C 1 25  ? 50.510 6.644  -16.913 1.00 32.47 ? 25   GLU C O   1 
ATOM   1845 C  CB  . GLU C 1 25  ? 48.506 5.271  -19.069 1.00 33.33 ? 25   GLU C CB  1 
ATOM   1846 C  CG  . GLU C 1 25  ? 47.174 5.350  -18.347 1.00 35.11 ? 25   GLU C CG  1 
ATOM   1847 C  CD  . GLU C 1 25  ? 46.397 4.042  -18.444 1.00 35.93 ? 25   GLU C CD  1 
ATOM   1848 O  OE1 . GLU C 1 25  ? 46.901 2.999  -17.969 1.00 35.03 ? 25   GLU C OE1 1 
ATOM   1849 O  OE2 . GLU C 1 25  ? 45.283 4.055  -19.006 1.00 38.17 ? 25   GLU C OE2 1 
ATOM   1850 N  N   . THR C 1 26  ? 48.583 7.798  -17.101 1.00 29.92 ? 26   THR C N   1 
ATOM   1851 C  CA  . THR C 1 26  ? 48.648 8.299  -15.729 1.00 27.85 ? 26   THR C CA  1 
ATOM   1852 C  C   . THR C 1 26  ? 48.154 7.240  -14.746 1.00 27.13 ? 26   THR C C   1 
ATOM   1853 O  O   . THR C 1 26  ? 47.445 6.306  -15.123 1.00 26.65 ? 26   THR C O   1 
ATOM   1854 C  CB  . THR C 1 26  ? 47.797 9.580  -15.533 1.00 28.45 ? 26   THR C CB  1 
ATOM   1855 O  OG1 . THR C 1 26  ? 46.419 9.288  -15.787 1.00 27.96 ? 26   THR C OG1 1 
ATOM   1856 C  CG2 . THR C 1 26  ? 48.261 10.686 -16.473 1.00 27.74 ? 26   THR C CG2 1 
ATOM   1857 N  N   . ILE C 1 27  ? 48.543 7.390  -13.485 1.00 25.77 ? 27   ILE C N   1 
ATOM   1858 C  CA  . ILE C 1 27  ? 48.123 6.454  -12.453 1.00 24.90 ? 27   ILE C CA  1 
ATOM   1859 C  C   . ILE C 1 27  ? 46.613 6.542  -12.290 1.00 24.30 ? 27   ILE C C   1 
ATOM   1860 O  O   . ILE C 1 27  ? 45.927 5.524  -12.172 1.00 25.61 ? 27   ILE C O   1 
ATOM   1861 C  CB  . ILE C 1 27  ? 48.818 6.772  -11.120 1.00 23.21 ? 27   ILE C CB  1 
ATOM   1862 C  CG1 . ILE C 1 27  ? 50.297 6.392  -11.225 1.00 23.24 ? 27   ILE C CG1 1 
ATOM   1863 C  CG2 . ILE C 1 27  ? 48.150 6.008  -9.975  1.00 22.25 ? 27   ILE C CG2 1 
ATOM   1864 C  CD1 . ILE C 1 27  ? 51.106 6.686  -9.986  1.00 20.09 ? 27   ILE C CD1 1 
ATOM   1865 N  N   . LEU C 1 28  ? 46.093 7.764  -12.293 1.00 25.50 ? 28   LEU C N   1 
ATOM   1866 C  CA  . LEU C 1 28  ? 44.661 7.960  -12.150 1.00 27.19 ? 28   LEU C CA  1 
ATOM   1867 C  C   . LEU C 1 28  ? 43.891 7.285  -13.275 1.00 27.95 ? 28   LEU C C   1 
ATOM   1868 O  O   . LEU C 1 28  ? 42.883 6.619  -13.034 1.00 26.74 ? 28   LEU C O   1 
ATOM   1869 C  CB  . LEU C 1 28  ? 44.316 9.451  -12.126 1.00 27.80 ? 28   LEU C CB  1 
ATOM   1870 C  CG  . LEU C 1 28  ? 42.811 9.722  -12.017 1.00 29.04 ? 28   LEU C CG  1 
ATOM   1871 C  CD1 . LEU C 1 28  ? 42.275 9.126  -10.721 1.00 27.81 ? 28   LEU C CD1 1 
ATOM   1872 C  CD2 . LEU C 1 28  ? 42.550 11.214 -12.061 1.00 27.15 ? 28   LEU C CD2 1 
ATOM   1873 N  N   . ASP C 1 29  ? 44.354 7.460  -14.510 1.00 29.17 ? 29   ASP C N   1 
ATOM   1874 C  CA  . ASP C 1 29  ? 43.661 6.856  -15.642 1.00 30.59 ? 29   ASP C CA  1 
ATOM   1875 C  C   . ASP C 1 29  ? 43.608 5.337  -15.559 1.00 30.60 ? 29   ASP C C   1 
ATOM   1876 O  O   . ASP C 1 29  ? 42.564 4.738  -15.809 1.00 31.28 ? 29   ASP C O   1 
ATOM   1877 C  CB  . ASP C 1 29  ? 44.290 7.300  -16.969 1.00 33.41 ? 29   ASP C CB  1 
ATOM   1878 C  CG  . ASP C 1 29  ? 43.925 8.726  -17.329 1.00 35.62 ? 29   ASP C CG  1 
ATOM   1879 O  OD1 . ASP C 1 29  ? 42.801 9.146  -16.985 1.00 37.47 ? 29   ASP C OD1 1 
ATOM   1880 O  OD2 . ASP C 1 29  ? 44.747 9.427  -17.963 1.00 39.62 ? 29   ASP C OD2 1 
ATOM   1881 N  N   . ALA C 1 30  ? 44.721 4.710  -15.197 1.00 29.37 ? 30   ALA C N   1 
ATOM   1882 C  CA  . ALA C 1 30  ? 44.750 3.261  -15.073 1.00 28.64 ? 30   ALA C CA  1 
ATOM   1883 C  C   . ALA C 1 30  ? 43.774 2.818  -13.978 1.00 27.24 ? 30   ALA C C   1 
ATOM   1884 O  O   . ALA C 1 30  ? 43.073 1.819  -14.122 1.00 26.64 ? 30   ALA C O   1 
ATOM   1885 C  CB  . ALA C 1 30  ? 46.169 2.792  -14.742 1.00 28.00 ? 30   ALA C CB  1 
ATOM   1886 N  N   . ALA C 1 31  ? 43.727 3.574  -12.884 1.00 28.43 ? 31   ALA C N   1 
ATOM   1887 C  CA  . ALA C 1 31  ? 42.835 3.248  -11.773 1.00 28.46 ? 31   ALA C CA  1 
ATOM   1888 C  C   . ALA C 1 31  ? 41.367 3.378  -12.157 1.00 29.62 ? 31   ALA C C   1 
ATOM   1889 O  O   . ALA C 1 31  ? 40.576 2.460  -11.931 1.00 29.95 ? 31   ALA C O   1 
ATOM   1890 C  CB  . ALA C 1 31  ? 43.137 4.147  -10.577 1.00 29.41 ? 31   ALA C CB  1 
ATOM   1891 N  N   . LEU C 1 32  ? 41.002 4.522  -12.728 1.00 30.32 ? 32   LEU C N   1 
ATOM   1892 C  CA  . LEU C 1 32  ? 39.620 4.763  -13.135 1.00 31.07 ? 32   LEU C CA  1 
ATOM   1893 C  C   . LEU C 1 32  ? 39.124 3.670  -14.084 1.00 32.08 ? 32   LEU C C   1 
ATOM   1894 O  O   . LEU C 1 32  ? 37.980 3.221  -13.984 1.00 32.64 ? 32   LEU C O   1 
ATOM   1895 C  CB  . LEU C 1 32  ? 39.503 6.148  -13.787 1.00 29.14 ? 32   LEU C CB  1 
ATOM   1896 C  CG  . LEU C 1 32  ? 39.777 7.343  -12.856 1.00 27.98 ? 32   LEU C CG  1 
ATOM   1897 C  CD1 . LEU C 1 32  ? 39.725 8.656  -13.634 1.00 26.24 ? 32   LEU C CD1 1 
ATOM   1898 C  CD2 . LEU C 1 32  ? 38.741 7.358  -11.729 1.00 27.97 ? 32   LEU C CD2 1 
ATOM   1899 N  N   . ARG C 1 33  ? 39.993 3.233  -14.991 1.00 33.43 ? 33   ARG C N   1 
ATOM   1900 C  CA  . ARG C 1 33  ? 39.658 2.188  -15.959 1.00 35.65 ? 33   ARG C CA  1 
ATOM   1901 C  C   . ARG C 1 33  ? 39.259 0.882  -15.286 1.00 35.99 ? 33   ARG C C   1 
ATOM   1902 O  O   . ARG C 1 33  ? 38.401 0.155  -15.782 1.00 36.98 ? 33   ARG C O   1 
ATOM   1903 C  CB  . ARG C 1 33  ? 40.858 1.879  -16.859 1.00 38.40 ? 33   ARG C CB  1 
ATOM   1904 C  CG  . ARG C 1 33  ? 41.304 2.972  -17.813 1.00 41.79 ? 33   ARG C CG  1 
ATOM   1905 C  CD  . ARG C 1 33  ? 42.668 2.590  -18.381 1.00 43.47 ? 33   ARG C CD  1 
ATOM   1906 N  NE  . ARG C 1 33  ? 42.689 1.175  -18.743 1.00 45.53 ? 33   ARG C NE  1 
ATOM   1907 C  CZ  . ARG C 1 33  ? 43.750 0.385  -18.635 1.00 45.74 ? 33   ARG C CZ  1 
ATOM   1908 N  NH1 . ARG C 1 33  ? 44.898 0.863  -18.174 1.00 46.28 ? 33   ARG C NH1 1 
ATOM   1909 N  NH2 . ARG C 1 33  ? 43.655 -0.893 -18.971 1.00 46.46 ? 33   ARG C NH2 1 
ATOM   1910 N  N   . ASN C 1 34  ? 39.904 0.582  -14.163 1.00 35.95 ? 34   ASN C N   1 
ATOM   1911 C  CA  . ASN C 1 34  ? 39.661 -0.658 -13.437 1.00 35.67 ? 34   ASN C CA  1 
ATOM   1912 C  C   . ASN C 1 34  ? 38.696 -0.576 -12.256 1.00 35.86 ? 34   ASN C C   1 
ATOM   1913 O  O   . ASN C 1 34  ? 38.658 -1.482 -11.424 1.00 36.58 ? 34   ASN C O   1 
ATOM   1914 C  CB  . ASN C 1 34  ? 40.999 -1.225 -12.965 1.00 34.71 ? 34   ASN C CB  1 
ATOM   1915 C  CG  . ASN C 1 34  ? 41.911 -1.589 -14.117 1.00 34.19 ? 34   ASN C CG  1 
ATOM   1916 O  OD1 . ASN C 1 34  ? 41.843 -2.690 -14.650 1.00 34.71 ? 34   ASN C OD1 1 
ATOM   1917 N  ND2 . ASN C 1 34  ? 42.760 -0.653 -14.519 1.00 34.86 ? 34   ASN C ND2 1 
ATOM   1918 N  N   . GLY C 1 35  ? 37.928 0.502  -12.168 1.00 34.70 ? 35   GLY C N   1 
ATOM   1919 C  CA  . GLY C 1 35  ? 36.969 0.614  -11.082 1.00 34.89 ? 35   GLY C CA  1 
ATOM   1920 C  C   . GLY C 1 35  ? 37.427 1.239  -9.774  1.00 35.97 ? 35   GLY C C   1 
ATOM   1921 O  O   . GLY C 1 35  ? 36.626 1.349  -8.844  1.00 35.53 ? 35   GLY C O   1 
ATOM   1922 N  N   . ILE C 1 36  ? 38.695 1.635  -9.679  1.00 34.97 ? 36   ILE C N   1 
ATOM   1923 C  CA  . ILE C 1 36  ? 39.183 2.273  -8.456  1.00 34.37 ? 36   ILE C CA  1 
ATOM   1924 C  C   . ILE C 1 36  ? 38.913 3.765  -8.634  1.00 34.76 ? 36   ILE C C   1 
ATOM   1925 O  O   . ILE C 1 36  ? 39.703 4.489  -9.247  1.00 34.37 ? 36   ILE C O   1 
ATOM   1926 C  CB  . ILE C 1 36  ? 40.701 2.028  -8.235  1.00 34.68 ? 36   ILE C CB  1 
ATOM   1927 C  CG1 . ILE C 1 36  ? 40.979 0.539  -8.003  1.00 34.41 ? 36   ILE C CG1 1 
ATOM   1928 C  CG2 . ILE C 1 36  ? 41.178 2.794  -7.016  1.00 33.00 ? 36   ILE C CG2 1 
ATOM   1929 C  CD1 . ILE C 1 36  ? 40.807 -0.338 -9.219  1.00 36.03 ? 36   ILE C CD1 1 
ATOM   1930 N  N   . GLU C 1 37  ? 37.787 4.216  -8.088  1.00 33.52 ? 37   GLU C N   1 
ATOM   1931 C  CA  . GLU C 1 37  ? 37.351 5.601  -8.227  1.00 33.11 ? 37   GLU C CA  1 
ATOM   1932 C  C   . GLU C 1 37  ? 38.017 6.667  -7.372  1.00 31.72 ? 37   GLU C C   1 
ATOM   1933 O  O   . GLU C 1 37  ? 37.412 7.203  -6.443  1.00 30.40 ? 37   GLU C O   1 
ATOM   1934 C  CB  . GLU C 1 37  ? 35.833 5.680  -8.037  1.00 36.32 ? 37   GLU C CB  1 
ATOM   1935 C  CG  . GLU C 1 37  ? 35.047 4.822  -9.019  1.00 40.41 ? 37   GLU C CG  1 
ATOM   1936 C  CD  . GLU C 1 37  ? 35.315 5.190  -10.471 1.00 42.13 ? 37   GLU C CD  1 
ATOM   1937 O  OE1 . GLU C 1 37  ? 35.056 6.354  -10.851 1.00 43.83 ? 37   GLU C OE1 1 
ATOM   1938 O  OE2 . GLU C 1 37  ? 35.785 4.314  -11.232 1.00 42.57 ? 37   GLU C OE2 1 
ATOM   1939 N  N   . ILE C 1 38  ? 39.265 6.979  -7.703  1.00 29.52 ? 38   ILE C N   1 
ATOM   1940 C  CA  . ILE C 1 38  ? 40.002 8.020  -7.007  1.00 29.46 ? 38   ILE C CA  1 
ATOM   1941 C  C   . ILE C 1 38  ? 39.329 9.334  -7.397  1.00 30.28 ? 38   ILE C C   1 
ATOM   1942 O  O   . ILE C 1 38  ? 38.962 9.533  -8.561  1.00 31.46 ? 38   ILE C O   1 
ATOM   1943 C  CB  . ILE C 1 38  ? 41.473 8.053  -7.464  1.00 27.82 ? 38   ILE C CB  1 
ATOM   1944 C  CG1 . ILE C 1 38  ? 42.190 6.794  -6.984  1.00 26.27 ? 38   ILE C CG1 1 
ATOM   1945 C  CG2 . ILE C 1 38  ? 42.157 9.311  -6.951  1.00 26.59 ? 38   ILE C CG2 1 
ATOM   1946 C  CD1 . ILE C 1 38  ? 43.561 6.636  -7.568  1.00 28.14 ? 38   ILE C CD1 1 
ATOM   1947 N  N   . GLU C 1 39  ? 39.157 10.226 -6.430  1.00 31.45 ? 39   GLU C N   1 
ATOM   1948 C  CA  . GLU C 1 39  ? 38.521 11.507 -6.700  1.00 31.40 ? 39   GLU C CA  1 
ATOM   1949 C  C   . GLU C 1 39  ? 39.402 12.406 -7.556  1.00 32.57 ? 39   GLU C C   1 
ATOM   1950 O  O   . GLU C 1 39  ? 40.625 12.405 -7.422  1.00 30.34 ? 39   GLU C O   1 
ATOM   1951 C  CB  . GLU C 1 39  ? 38.171 12.206 -5.383  1.00 32.90 ? 39   GLU C CB  1 
ATOM   1952 C  CG  . GLU C 1 39  ? 37.632 13.614 -5.546  1.00 33.79 ? 39   GLU C CG  1 
ATOM   1953 C  CD  . GLU C 1 39  ? 36.977 14.133 -4.283  1.00 35.72 ? 39   GLU C CD  1 
ATOM   1954 O  OE1 . GLU C 1 39  ? 37.363 13.692 -3.178  1.00 37.08 ? 39   GLU C OE1 1 
ATOM   1955 O  OE2 . GLU C 1 39  ? 36.081 14.994 -4.394  1.00 36.20 ? 39   GLU C OE2 1 
ATOM   1956 N  N   . HIS C 1 40  ? 38.771 13.158 -8.454  1.00 33.36 ? 40   HIS C N   1 
ATOM   1957 C  CA  . HIS C 1 40  ? 39.488 14.074 -9.334  1.00 34.44 ? 40   HIS C CA  1 
ATOM   1958 C  C   . HIS C 1 40  ? 38.642 15.321 -9.566  1.00 36.41 ? 40   HIS C C   1 
ATOM   1959 O  O   . HIS C 1 40  ? 38.117 15.545 -10.660 1.00 37.25 ? 40   HIS C O   1 
ATOM   1960 C  CB  . HIS C 1 40  ? 39.821 13.393 -10.666 1.00 32.52 ? 40   HIS C CB  1 
ATOM   1961 C  CG  . HIS C 1 40  ? 38.696 12.593 -11.244 1.00 32.86 ? 40   HIS C CG  1 
ATOM   1962 N  ND1 . HIS C 1 40  ? 38.241 11.423 -10.673 1.00 33.09 ? 40   HIS C ND1 1 
ATOM   1963 C  CD2 . HIS C 1 40  ? 37.948 12.783 -12.357 1.00 33.03 ? 40   HIS C CD2 1 
ATOM   1964 C  CE1 . HIS C 1 40  ? 37.262 10.928 -11.409 1.00 32.48 ? 40   HIS C CE1 1 
ATOM   1965 N  NE2 . HIS C 1 40  ? 37.065 11.734 -12.437 1.00 32.66 ? 40   HIS C NE2 1 
ATOM   1966 N  N   . ALA C 1 41  ? 38.537 16.130 -8.515  1.00 38.08 ? 41   ALA C N   1 
ATOM   1967 C  CA  . ALA C 1 41  ? 37.745 17.354 -8.510  1.00 38.96 ? 41   ALA C CA  1 
ATOM   1968 C  C   . ALA C 1 41  ? 38.005 18.361 -9.626  1.00 39.75 ? 41   ALA C C   1 
ATOM   1969 O  O   . ALA C 1 41  ? 37.077 18.750 -10.334 1.00 40.88 ? 41   ALA C O   1 
ATOM   1970 C  CB  . ALA C 1 41  ? 37.890 18.041 -7.160  1.00 38.52 ? 41   ALA C CB  1 
ATOM   1971 N  N   . CYS C 1 42  ? 39.251 18.793 -9.788  1.00 39.32 ? 42   CYS C N   1 
ATOM   1972 C  CA  . CYS C 1 42  ? 39.560 19.782 -10.816 1.00 39.21 ? 42   CYS C CA  1 
ATOM   1973 C  C   . CYS C 1 42  ? 39.660 19.205 -12.228 1.00 39.22 ? 42   CYS C C   1 
ATOM   1974 O  O   . CYS C 1 42  ? 40.255 19.817 -13.116 1.00 39.59 ? 42   CYS C O   1 
ATOM   1975 C  CB  . CYS C 1 42  ? 40.855 20.516 -10.471 1.00 37.71 ? 42   CYS C CB  1 
ATOM   1976 S  SG  . CYS C 1 42  ? 42.352 19.676 -11.012 1.00 37.29 ? 42   CYS C SG  1 
ATOM   1977 N  N   . GLU C 1 43  ? 39.072 18.031 -12.434 1.00 39.10 ? 43   GLU C N   1 
ATOM   1978 C  CA  . GLU C 1 43  ? 39.085 17.377 -13.742 1.00 39.73 ? 43   GLU C CA  1 
ATOM   1979 C  C   . GLU C 1 43  ? 40.481 17.112 -14.300 1.00 39.47 ? 43   GLU C C   1 
ATOM   1980 O  O   . GLU C 1 43  ? 40.735 17.329 -15.488 1.00 39.87 ? 43   GLU C O   1 
ATOM   1981 C  CB  . GLU C 1 43  ? 38.292 18.201 -14.758 1.00 42.01 ? 43   GLU C CB  1 
ATOM   1982 C  CG  . GLU C 1 43  ? 36.793 18.214 -14.520 1.00 45.08 ? 43   GLU C CG  1 
ATOM   1983 C  CD  . GLU C 1 43  ? 36.036 18.937 -15.622 1.00 47.30 ? 43   GLU C CD  1 
ATOM   1984 O  OE1 . GLU C 1 43  ? 34.804 19.099 -15.488 1.00 48.48 ? 43   GLU C OE1 1 
ATOM   1985 O  OE2 . GLU C 1 43  ? 36.673 19.341 -16.622 1.00 48.66 ? 43   GLU C OE2 1 
ATOM   1986 N  N   . LYS C 1 44  ? 41.382 16.648 -13.442 1.00 37.68 ? 44   LYS C N   1 
ATOM   1987 C  CA  . LYS C 1 44  ? 42.741 16.327 -13.861 1.00 36.76 ? 44   LYS C CA  1 
ATOM   1988 C  C   . LYS C 1 44  ? 43.453 17.546 -14.446 1.00 37.31 ? 44   LYS C C   1 
ATOM   1989 O  O   . LYS C 1 44  ? 44.089 17.449 -15.498 1.00 36.60 ? 44   LYS C O   1 
ATOM   1990 C  CB  . LYS C 1 44  ? 42.702 15.220 -14.916 1.00 35.39 ? 44   LYS C CB  1 
ATOM   1991 C  CG  . LYS C 1 44  ? 41.656 14.148 -14.661 1.00 34.01 ? 44   LYS C CG  1 
ATOM   1992 C  CD  . LYS C 1 44  ? 41.627 13.140 -15.797 1.00 32.28 ? 44   LYS C CD  1 
ATOM   1993 C  CE  . LYS C 1 44  ? 40.563 12.076 -15.579 1.00 33.04 ? 44   LYS C CE  1 
ATOM   1994 N  NZ  . LYS C 1 44  ? 40.575 11.049 -16.659 1.00 30.32 ? 44   LYS C NZ  1 
ATOM   1995 N  N   . SER C 1 45  ? 43.361 18.684 -13.764 1.00 37.54 ? 45   SER C N   1 
ATOM   1996 C  CA  . SER C 1 45  ? 43.992 19.904 -14.253 1.00 37.91 ? 45   SER C CA  1 
ATOM   1997 C  C   . SER C 1 45  ? 45.119 20.421 -13.367 1.00 37.84 ? 45   SER C C   1 
ATOM   1998 O  O   . SER C 1 45  ? 45.559 21.562 -13.520 1.00 37.60 ? 45   SER C O   1 
ATOM   1999 C  CB  . SER C 1 45  ? 42.936 20.998 -14.426 1.00 38.78 ? 45   SER C CB  1 
ATOM   2000 O  OG  . SER C 1 45  ? 41.879 20.540 -15.252 1.00 40.72 ? 45   SER C OG  1 
ATOM   2001 N  N   . CYS C 1 46  ? 45.585 19.589 -12.441 1.00 36.92 ? 46   CYS C N   1 
ATOM   2002 C  CA  . CYS C 1 46  ? 46.672 19.990 -11.558 1.00 36.62 ? 46   CYS C CA  1 
ATOM   2003 C  C   . CYS C 1 46  ? 46.273 21.240 -10.770 1.00 35.52 ? 46   CYS C C   1 
ATOM   2004 O  O   . CYS C 1 46  ? 47.107 22.109 -10.501 1.00 36.31 ? 46   CYS C O   1 
ATOM   2005 C  CB  . CYS C 1 46  ? 47.925 20.262 -12.401 1.00 37.41 ? 46   CYS C CB  1 
ATOM   2006 S  SG  . CYS C 1 46  ? 49.503 20.169 -11.529 1.00 38.74 ? 46   CYS C SG  1 
ATOM   2007 N  N   . ALA C 1 47  ? 44.996 21.315 -10.393 1.00 35.06 ? 47   ALA C N   1 
ATOM   2008 C  CA  . ALA C 1 47  ? 44.465 22.456 -9.648  1.00 35.40 ? 47   ALA C CA  1 
ATOM   2009 C  C   . ALA C 1 47  ? 43.837 22.083 -8.305  1.00 35.55 ? 47   ALA C C   1 
ATOM   2010 O  O   . ALA C 1 47  ? 43.142 22.900 -7.694  1.00 35.71 ? 47   ALA C O   1 
ATOM   2011 C  CB  . ALA C 1 47  ? 43.439 23.200 -10.502 1.00 35.64 ? 47   ALA C CB  1 
ATOM   2012 N  N   . CYS C 1 48  ? 44.061 20.850 -7.855  1.00 34.20 ? 48   CYS C N   1 
ATOM   2013 C  CA  . CYS C 1 48  ? 43.527 20.405 -6.570  1.00 32.99 ? 48   CYS C CA  1 
ATOM   2014 C  C   . CYS C 1 48  ? 44.415 19.299 -6.008  1.00 32.05 ? 48   CYS C C   1 
ATOM   2015 O  O   . CYS C 1 48  ? 45.519 19.076 -6.505  1.00 30.48 ? 48   CYS C O   1 
ATOM   2016 C  CB  . CYS C 1 48  ? 42.083 19.908 -6.719  1.00 32.77 ? 48   CYS C CB  1 
ATOM   2017 S  SG  . CYS C 1 48  ? 41.867 18.230 -7.364  1.00 33.54 ? 48   CYS C SG  1 
ATOM   2018 N  N   . THR C 1 49  ? 43.946 18.612 -4.972  1.00 31.55 ? 49   THR C N   1 
ATOM   2019 C  CA  . THR C 1 49  ? 44.739 17.539 -4.375  1.00 30.55 ? 49   THR C CA  1 
ATOM   2020 C  C   . THR C 1 49  ? 43.909 16.301 -4.060  1.00 29.95 ? 49   THR C C   1 
ATOM   2021 O  O   . THR C 1 49  ? 44.345 15.432 -3.297  1.00 29.63 ? 49   THR C O   1 
ATOM   2022 C  CB  . THR C 1 49  ? 45.395 17.998 -3.069  1.00 30.72 ? 49   THR C CB  1 
ATOM   2023 O  OG1 . THR C 1 49  ? 44.371 18.301 -2.112  1.00 30.27 ? 49   THR C OG1 1 
ATOM   2024 C  CG2 . THR C 1 49  ? 46.262 19.230 -3.308  1.00 28.54 ? 49   THR C CG2 1 
ATOM   2025 N  N   . THR C 1 50  ? 42.722 16.213 -4.653  1.00 29.67 ? 50   THR C N   1 
ATOM   2026 C  CA  . THR C 1 50  ? 41.837 15.082 -4.417  1.00 27.33 ? 50   THR C CA  1 
ATOM   2027 C  C   . THR C 1 50  ? 42.283 13.789 -5.092  1.00 26.50 ? 50   THR C C   1 
ATOM   2028 O  O   . THR C 1 50  ? 41.810 12.715 -4.733  1.00 25.34 ? 50   THR C O   1 
ATOM   2029 C  CB  . THR C 1 50  ? 40.393 15.399 -4.862  1.00 27.82 ? 50   THR C CB  1 
ATOM   2030 O  OG1 . THR C 1 50  ? 40.369 15.694 -6.268  1.00 28.55 ? 50   THR C OG1 1 
ATOM   2031 C  CG2 . THR C 1 50  ? 39.856 16.588 -4.084  1.00 27.51 ? 50   THR C CG2 1 
ATOM   2032 N  N   . CYS C 1 51  ? 43.183 13.890 -6.066  1.00 26.31 ? 51   CYS C N   1 
ATOM   2033 C  CA  . CYS C 1 51  ? 43.679 12.707 -6.770  1.00 26.05 ? 51   CYS C CA  1 
ATOM   2034 C  C   . CYS C 1 51  ? 45.013 12.276 -6.161  1.00 24.40 ? 51   CYS C C   1 
ATOM   2035 O  O   . CYS C 1 51  ? 45.729 11.437 -6.711  1.00 24.20 ? 51   CYS C O   1 
ATOM   2036 C  CB  . CYS C 1 51  ? 43.886 13.018 -8.249  1.00 27.18 ? 51   CYS C CB  1 
ATOM   2037 S  SG  . CYS C 1 51  ? 45.236 14.158 -8.536  1.00 25.33 ? 51   CYS C SG  1 
ATOM   2038 N  N   . HIS C 1 52  ? 45.330 12.872 -5.021  1.00 23.93 ? 52   HIS C N   1 
ATOM   2039 C  CA  . HIS C 1 52  ? 46.562 12.602 -4.293  1.00 20.50 ? 52   HIS C CA  1 
ATOM   2040 C  C   . HIS C 1 52  ? 46.778 11.126 -3.984  1.00 21.03 ? 52   HIS C C   1 
ATOM   2041 O  O   . HIS C 1 52  ? 45.852 10.423 -3.587  1.00 19.68 ? 52   HIS C O   1 
ATOM   2042 C  CB  . HIS C 1 52  ? 46.547 13.385 -2.980  1.00 19.24 ? 52   HIS C CB  1 
ATOM   2043 C  CG  . HIS C 1 52  ? 47.776 13.206 -2.148  1.00 19.34 ? 52   HIS C CG  1 
ATOM   2044 N  ND1 . HIS C 1 52  ? 47.752 13.279 -0.773  1.00 19.57 ? 52   HIS C ND1 1 
ATOM   2045 C  CD2 . HIS C 1 52  ? 49.071 13.000 -2.492  1.00 20.20 ? 52   HIS C CD2 1 
ATOM   2046 C  CE1 . HIS C 1 52  ? 48.979 13.126 -0.305  1.00 20.90 ? 52   HIS C CE1 1 
ATOM   2047 N  NE2 . HIS C 1 52  ? 49.797 12.955 -1.328  1.00 18.51 ? 52   HIS C NE2 1 
ATOM   2048 N  N   . CYS C 1 53  ? 48.011 10.665 -4.174  1.00 20.02 ? 53   CYS C N   1 
ATOM   2049 C  CA  . CYS C 1 53  ? 48.374 9.286  -3.875  1.00 19.02 ? 53   CYS C CA  1 
ATOM   2050 C  C   . CYS C 1 53  ? 49.837 9.279  -3.458  1.00 18.63 ? 53   CYS C C   1 
ATOM   2051 O  O   . CYS C 1 53  ? 50.561 10.249 -3.687  1.00 19.80 ? 53   CYS C O   1 
ATOM   2052 C  CB  . CYS C 1 53  ? 48.151 8.359  -5.081  1.00 20.45 ? 53   CYS C CB  1 
ATOM   2053 S  SG  . CYS C 1 53  ? 49.349 8.480  -6.433  1.00 22.76 ? 53   CYS C SG  1 
ATOM   2054 N  N   . ILE C 1 54  ? 50.260 8.198  -2.814  1.00 16.76 ? 54   ILE C N   1 
ATOM   2055 C  CA  . ILE C 1 54  ? 51.634 8.061  -2.363  1.00 17.65 ? 54   ILE C CA  1 
ATOM   2056 C  C   . ILE C 1 54  ? 52.185 6.828  -3.053  1.00 18.94 ? 54   ILE C C   1 
ATOM   2057 O  O   . ILE C 1 54  ? 51.628 5.736  -2.923  1.00 18.77 ? 54   ILE C O   1 
ATOM   2058 C  CB  . ILE C 1 54  ? 51.693 7.894  -0.823  1.00 19.13 ? 54   ILE C CB  1 
ATOM   2059 C  CG1 . ILE C 1 54  ? 51.046 9.115  -0.160  1.00 23.06 ? 54   ILE C CG1 1 
ATOM   2060 C  CG2 . ILE C 1 54  ? 53.147 7.762  -0.353  1.00 19.67 ? 54   ILE C CG2 1 
ATOM   2061 C  CD1 . ILE C 1 54  ? 50.964 9.017  1.347   1.00 27.36 ? 54   ILE C CD1 1 
ATOM   2062 N  N   . VAL C 1 55  ? 53.259 7.006  -3.816  1.00 17.61 ? 55   VAL C N   1 
ATOM   2063 C  CA  . VAL C 1 55  ? 53.861 5.897  -4.544  1.00 17.70 ? 55   VAL C CA  1 
ATOM   2064 C  C   . VAL C 1 55  ? 54.895 5.203  -3.673  1.00 18.69 ? 55   VAL C C   1 
ATOM   2065 O  O   . VAL C 1 55  ? 56.072 5.583  -3.664  1.00 18.39 ? 55   VAL C O   1 
ATOM   2066 C  CB  . VAL C 1 55  ? 54.532 6.389  -5.839  1.00 17.19 ? 55   VAL C CB  1 
ATOM   2067 C  CG1 . VAL C 1 55  ? 54.942 5.208  -6.694  1.00 19.70 ? 55   VAL C CG1 1 
ATOM   2068 C  CG2 . VAL C 1 55  ? 53.579 7.284  -6.595  1.00 19.86 ? 55   VAL C CG2 1 
ATOM   2069 N  N   . ARG C 1 56  ? 54.439 4.181  -2.953  1.00 18.19 ? 56   ARG C N   1 
ATOM   2070 C  CA  . ARG C 1 56  ? 55.270 3.408  -2.032  1.00 19.07 ? 56   ARG C CA  1 
ATOM   2071 C  C   . ARG C 1 56  ? 56.434 2.692  -2.707  1.00 19.70 ? 56   ARG C C   1 
ATOM   2072 O  O   . ARG C 1 56  ? 57.491 2.520  -2.106  1.00 20.07 ? 56   ARG C O   1 
ATOM   2073 C  CB  . ARG C 1 56  ? 54.411 2.377  -1.292  1.00 21.05 ? 56   ARG C CB  1 
ATOM   2074 C  CG  . ARG C 1 56  ? 53.290 2.971  -0.444  1.00 26.77 ? 56   ARG C CG  1 
ATOM   2075 C  CD  . ARG C 1 56  ? 53.869 3.828  0.657   1.00 26.52 ? 56   ARG C CD  1 
ATOM   2076 N  NE  . ARG C 1 56  ? 52.855 4.443  1.507   1.00 29.51 ? 56   ARG C NE  1 
ATOM   2077 C  CZ  . ARG C 1 56  ? 53.135 5.386  2.396   1.00 26.99 ? 56   ARG C CZ  1 
ATOM   2078 N  NH1 . ARG C 1 56  ? 54.385 5.800  2.530   1.00 26.53 ? 56   ARG C NH1 1 
ATOM   2079 N  NH2 . ARG C 1 56  ? 52.175 5.921  3.139   1.00 27.41 ? 56   ARG C NH2 1 
ATOM   2080 N  N   . GLU C 1 57  ? 56.234 2.252  -3.944  1.00 17.85 ? 57   GLU C N   1 
ATOM   2081 C  CA  . GLU C 1 57  ? 57.294 1.570  -4.683  1.00 18.50 ? 57   GLU C CA  1 
ATOM   2082 C  C   . GLU C 1 57  ? 57.241 2.024  -6.137  1.00 19.19 ? 57   GLU C C   1 
ATOM   2083 O  O   . GLU C 1 57  ? 56.157 2.108  -6.727  1.00 17.67 ? 57   GLU C O   1 
ATOM   2084 C  CB  . GLU C 1 57  ? 57.118 0.046  -4.636  1.00 17.75 ? 57   GLU C CB  1 
ATOM   2085 C  CG  . GLU C 1 57  ? 57.179 -0.607 -3.257  1.00 19.34 ? 57   GLU C CG  1 
ATOM   2086 C  CD  . GLU C 1 57  ? 58.492 -0.372 -2.532  1.00 22.54 ? 57   GLU C CD  1 
ATOM   2087 O  OE1 . GLU C 1 57  ? 59.507 -0.102 -3.202  1.00 21.87 ? 57   GLU C OE1 1 
ATOM   2088 O  OE2 . GLU C 1 57  ? 58.506 -0.471 -1.286  1.00 23.16 ? 57   GLU C OE2 1 
ATOM   2089 N  N   . GLY C 1 58  ? 58.405 2.323  -6.706  1.00 22.11 ? 58   GLY C N   1 
ATOM   2090 C  CA  . GLY C 1 58  ? 58.463 2.748  -8.092  1.00 22.30 ? 58   GLY C CA  1 
ATOM   2091 C  C   . GLY C 1 58  ? 58.391 4.246  -8.328  1.00 21.88 ? 58   GLY C C   1 
ATOM   2092 O  O   . GLY C 1 58  ? 58.274 4.686  -9.472  1.00 22.60 ? 58   GLY C O   1 
ATOM   2093 N  N   . PHE C 1 59  ? 58.455 5.036  -7.261  1.00 21.59 ? 59   PHE C N   1 
ATOM   2094 C  CA  . PHE C 1 59  ? 58.402 6.491  -7.381  1.00 21.06 ? 59   PHE C CA  1 
ATOM   2095 C  C   . PHE C 1 59  ? 59.469 7.017  -8.347  1.00 21.35 ? 59   PHE C C   1 
ATOM   2096 O  O   . PHE C 1 59  ? 59.175 7.860  -9.190  1.00 22.22 ? 59   PHE C O   1 
ATOM   2097 C  CB  . PHE C 1 59  ? 58.593 7.135  -6.004  1.00 20.93 ? 59   PHE C CB  1 
ATOM   2098 C  CG  . PHE C 1 59  ? 58.608 8.634  -6.026  1.00 20.67 ? 59   PHE C CG  1 
ATOM   2099 C  CD1 . PHE C 1 59  ? 57.421 9.359  -5.981  1.00 21.70 ? 59   PHE C CD1 1 
ATOM   2100 C  CD2 . PHE C 1 59  ? 59.816 9.326  -6.100  1.00 22.68 ? 59   PHE C CD2 1 
ATOM   2101 C  CE1 . PHE C 1 59  ? 57.435 10.756 -6.006  1.00 21.29 ? 59   PHE C CE1 1 
ATOM   2102 C  CE2 . PHE C 1 59  ? 59.841 10.721 -6.127  1.00 21.87 ? 59   PHE C CE2 1 
ATOM   2103 C  CZ  . PHE C 1 59  ? 58.649 11.438 -6.079  1.00 22.45 ? 59   PHE C CZ  1 
ATOM   2104 N  N   . ASP C 1 60  ? 60.692 6.506  -8.236  1.00 24.49 ? 60   ASP C N   1 
ATOM   2105 C  CA  . ASP C 1 60  ? 61.796 6.951  -9.092  1.00 26.90 ? 60   ASP C CA  1 
ATOM   2106 C  C   . ASP C 1 60  ? 61.614 6.645  -10.576 1.00 27.66 ? 60   ASP C C   1 
ATOM   2107 O  O   . ASP C 1 60  ? 62.343 7.181  -11.413 1.00 28.99 ? 60   ASP C O   1 
ATOM   2108 C  CB  . ASP C 1 60  ? 63.122 6.330  -8.629  1.00 28.77 ? 60   ASP C CB  1 
ATOM   2109 C  CG  . ASP C 1 60  ? 63.481 6.701  -7.200  1.00 32.04 ? 60   ASP C CG  1 
ATOM   2110 O  OD1 . ASP C 1 60  ? 63.046 7.779  -6.728  1.00 33.42 ? 60   ASP C OD1 1 
ATOM   2111 O  OD2 . ASP C 1 60  ? 64.217 5.919  -6.553  1.00 32.99 ? 60   ASP C OD2 1 
ATOM   2112 N  N   . SER C 1 61  ? 60.654 5.784  -10.902 1.00 27.70 ? 61   SER C N   1 
ATOM   2113 C  CA  . SER C 1 61  ? 60.401 5.401  -12.290 1.00 26.90 ? 61   SER C CA  1 
ATOM   2114 C  C   . SER C 1 61  ? 59.487 6.389  -13.006 1.00 27.02 ? 61   SER C C   1 
ATOM   2115 O  O   . SER C 1 61  ? 59.360 6.348  -14.229 1.00 29.52 ? 61   SER C O   1 
ATOM   2116 C  CB  . SER C 1 61  ? 59.748 4.022  -12.342 1.00 25.63 ? 61   SER C CB  1 
ATOM   2117 O  OG  . SER C 1 61  ? 58.379 4.113  -11.965 1.00 24.44 ? 61   SER C OG  1 
ATOM   2118 N  N   . LEU C 1 62  ? 58.856 7.275  -12.247 1.00 26.24 ? 62   LEU C N   1 
ATOM   2119 C  CA  . LEU C 1 62  ? 57.922 8.242  -12.814 1.00 26.74 ? 62   LEU C CA  1 
ATOM   2120 C  C   . LEU C 1 62  ? 58.563 9.555  -13.253 1.00 27.16 ? 62   LEU C C   1 
ATOM   2121 O  O   . LEU C 1 62  ? 59.554 9.999  -12.675 1.00 28.60 ? 62   LEU C O   1 
ATOM   2122 C  CB  . LEU C 1 62  ? 56.819 8.554  -11.795 1.00 26.63 ? 62   LEU C CB  1 
ATOM   2123 C  CG  . LEU C 1 62  ? 56.062 7.381  -11.159 1.00 25.33 ? 62   LEU C CG  1 
ATOM   2124 C  CD1 . LEU C 1 62  ? 55.055 7.918  -10.137 1.00 24.84 ? 62   LEU C CD1 1 
ATOM   2125 C  CD2 . LEU C 1 62  ? 55.367 6.571  -12.231 1.00 25.99 ? 62   LEU C CD2 1 
ATOM   2126 N  N   . PRO C 1 63  ? 58.013 10.184 -14.300 0.50 26.61 ? 63   PRO C N   1 
ATOM   2127 C  CA  . PRO C 1 63  ? 58.579 11.454 -14.753 0.50 27.38 ? 63   PRO C CA  1 
ATOM   2128 C  C   . PRO C 1 63  ? 58.437 12.456 -13.610 0.50 28.52 ? 63   PRO C C   1 
ATOM   2129 O  O   . PRO C 1 63  ? 57.371 12.575 -13.007 0.50 27.13 ? 63   PRO C O   1 
ATOM   2130 C  CB  . PRO C 1 63  ? 57.706 11.810 -15.951 0.50 26.00 ? 63   PRO C CB  1 
ATOM   2131 C  CG  . PRO C 1 63  ? 57.352 10.468 -16.506 0.50 26.84 ? 63   PRO C CG  1 
ATOM   2132 C  CD  . PRO C 1 63  ? 57.016 9.682  -15.260 0.50 26.13 ? 63   PRO C CD  1 
ATOM   2133 N  N   . GLU C 1 64  ? 59.521 13.156 -13.306 1.00 31.21 ? 64   GLU C N   1 
ATOM   2134 C  CA  . GLU C 1 64  ? 59.544 14.144 -12.233 1.00 33.26 ? 64   GLU C CA  1 
ATOM   2135 C  C   . GLU C 1 64  ? 58.307 15.043 -12.231 1.00 33.08 ? 64   GLU C C   1 
ATOM   2136 O  O   . GLU C 1 64  ? 57.758 15.376 -13.284 1.00 32.96 ? 64   GLU C O   1 
ATOM   2137 C  CB  . GLU C 1 64  ? 60.803 15.006 -12.361 1.00 36.59 ? 64   GLU C CB  1 
ATOM   2138 C  CG  . GLU C 1 64  ? 61.005 16.012 -11.241 1.00 40.62 ? 64   GLU C CG  1 
ATOM   2139 C  CD  . GLU C 1 64  ? 62.224 16.894 -11.465 1.00 42.82 ? 64   GLU C CD  1 
ATOM   2140 O  OE1 . GLU C 1 64  ? 63.332 16.344 -11.642 1.00 43.15 ? 64   GLU C OE1 1 
ATOM   2141 O  OE2 . GLU C 1 64  ? 62.073 18.136 -11.464 1.00 44.06 ? 64   GLU C OE2 1 
ATOM   2142 N  N   . SER C 1 65  ? 57.874 15.432 -11.037 1.00 32.80 ? 65   SER C N   1 
ATOM   2143 C  CA  . SER C 1 65  ? 56.714 16.303 -10.881 1.00 33.34 ? 65   SER C CA  1 
ATOM   2144 C  C   . SER C 1 65  ? 57.079 17.723 -11.302 1.00 33.40 ? 65   SER C C   1 
ATOM   2145 O  O   . SER C 1 65  ? 58.202 18.173 -11.079 1.00 33.61 ? 65   SER C O   1 
ATOM   2146 C  CB  . SER C 1 65  ? 56.257 16.314 -9.421  1.00 32.78 ? 65   SER C CB  1 
ATOM   2147 O  OG  . SER C 1 65  ? 57.289 16.778 -8.562  1.00 31.79 ? 65   SER C OG  1 
ATOM   2148 N  N   . SER C 1 66  ? 56.122 18.424 -11.900 1.00 34.44 ? 66   SER C N   1 
ATOM   2149 C  CA  . SER C 1 66  ? 56.346 19.792 -12.350 1.00 35.46 ? 66   SER C CA  1 
ATOM   2150 C  C   . SER C 1 66  ? 56.250 20.765 -11.183 1.00 37.41 ? 66   SER C C   1 
ATOM   2151 O  O   . SER C 1 66  ? 55.746 20.422 -10.109 1.00 37.03 ? 66   SER C O   1 
ATOM   2152 C  CB  . SER C 1 66  ? 55.313 20.180 -13.406 1.00 34.83 ? 66   SER C CB  1 
ATOM   2153 O  OG  . SER C 1 66  ? 54.018 20.276 -12.834 1.00 35.87 ? 66   SER C OG  1 
ATOM   2154 N  N   . GLU C 1 67  ? 56.733 21.983 -11.403 1.00 37.37 ? 67   GLU C N   1 
ATOM   2155 C  CA  . GLU C 1 67  ? 56.693 23.013 -10.378 1.00 38.93 ? 67   GLU C CA  1 
ATOM   2156 C  C   . GLU C 1 67  ? 55.237 23.242 -9.988  1.00 37.86 ? 67   GLU C C   1 
ATOM   2157 O  O   . GLU C 1 67  ? 54.919 23.480 -8.821  1.00 38.42 ? 67   GLU C O   1 
ATOM   2158 C  CB  . GLU C 1 67  ? 57.306 24.315 -10.911 1.00 40.58 ? 67   GLU C CB  1 
ATOM   2159 C  CG  . GLU C 1 67  ? 56.519 24.981 -12.037 1.00 43.50 ? 67   GLU C CG  1 
ATOM   2160 C  CD  . GLU C 1 67  ? 56.301 24.072 -13.236 1.00 44.49 ? 67   GLU C CD  1 
ATOM   2161 O  OE1 . GLU C 1 67  ? 57.296 23.544 -13.780 1.00 46.29 ? 67   GLU C OE1 1 
ATOM   2162 O  OE2 . GLU C 1 67  ? 55.131 23.893 -13.639 1.00 45.68 ? 67   GLU C OE2 1 
ATOM   2163 N  N   . GLN C 1 68  ? 54.360 23.155 -10.980 1.00 36.57 ? 68   GLN C N   1 
ATOM   2164 C  CA  . GLN C 1 68  ? 52.936 23.350 -10.768 1.00 36.43 ? 68   GLN C CA  1 
ATOM   2165 C  C   . GLN C 1 68  ? 52.374 22.274 -9.843  1.00 36.75 ? 68   GLN C C   1 
ATOM   2166 O  O   . GLN C 1 68  ? 51.565 22.569 -8.961  1.00 37.70 ? 68   GLN C O   1 
ATOM   2167 C  CB  . GLN C 1 68  ? 52.198 23.320 -12.108 1.00 36.19 ? 68   GLN C CB  1 
ATOM   2168 C  CG  . GLN C 1 68  ? 50.698 23.538 -11.994 1.00 37.96 ? 68   GLN C CG  1 
ATOM   2169 C  CD  . GLN C 1 68  ? 50.012 23.558 -13.341 1.00 39.17 ? 68   GLN C CD  1 
ATOM   2170 O  OE1 . GLN C 1 68  ? 50.210 22.664 -14.167 1.00 40.55 ? 68   GLN C OE1 1 
ATOM   2171 N  NE2 . GLN C 1 68  ? 49.193 24.577 -13.572 1.00 40.57 ? 68   GLN C NE2 1 
ATOM   2172 N  N   . GLU C 1 69  ? 52.807 21.032 -10.043 1.00 34.87 ? 69   GLU C N   1 
ATOM   2173 C  CA  . GLU C 1 69  ? 52.328 19.933 -9.212  1.00 34.08 ? 69   GLU C CA  1 
ATOM   2174 C  C   . GLU C 1 69  ? 52.832 20.122 -7.788  1.00 34.73 ? 69   GLU C C   1 
ATOM   2175 O  O   . GLU C 1 69  ? 52.085 19.947 -6.825  1.00 34.91 ? 69   GLU C O   1 
ATOM   2176 C  CB  . GLU C 1 69  ? 52.816 18.580 -9.749  1.00 33.58 ? 69   GLU C CB  1 
ATOM   2177 C  CG  . GLU C 1 69  ? 51.949 17.401 -9.276  1.00 33.21 ? 69   GLU C CG  1 
ATOM   2178 C  CD  . GLU C 1 69  ? 52.517 16.035 -9.626  1.00 31.94 ? 69   GLU C CD  1 
ATOM   2179 O  OE1 . GLU C 1 69  ? 53.054 15.865 -10.741 1.00 31.46 ? 69   GLU C OE1 1 
ATOM   2180 O  OE2 . GLU C 1 69  ? 52.413 15.116 -8.782  1.00 31.34 ? 69   GLU C OE2 1 
ATOM   2181 N  N   . ASP C 1 70  ? 54.101 20.494 -7.660  1.00 34.69 ? 70   ASP C N   1 
ATOM   2182 C  CA  . ASP C 1 70  ? 54.702 20.696 -6.350  1.00 35.18 ? 70   ASP C CA  1 
ATOM   2183 C  C   . ASP C 1 70  ? 53.989 21.771 -5.539  1.00 35.02 ? 70   ASP C C   1 
ATOM   2184 O  O   . ASP C 1 70  ? 53.850 21.640 -4.321  1.00 35.60 ? 70   ASP C O   1 
ATOM   2185 C  CB  . ASP C 1 70  ? 56.181 21.056 -6.495  1.00 35.21 ? 70   ASP C CB  1 
ATOM   2186 C  CG  . ASP C 1 70  ? 56.966 20.001 -7.254  1.00 37.08 ? 70   ASP C CG  1 
ATOM   2187 O  OD1 . ASP C 1 70  ? 56.900 18.809 -6.878  1.00 35.20 ? 70   ASP C OD1 1 
ATOM   2188 O  OD2 . ASP C 1 70  ? 57.658 20.370 -8.226  1.00 39.19 ? 70   ASP C OD2 1 
ATOM   2189 N  N   . ASP C 1 71  ? 53.541 22.833 -6.204  1.00 35.35 ? 71   ASP C N   1 
ATOM   2190 C  CA  . ASP C 1 71  ? 52.846 23.910 -5.502  1.00 35.56 ? 71   ASP C CA  1 
ATOM   2191 C  C   . ASP C 1 71  ? 51.529 23.401 -4.932  1.00 34.45 ? 71   ASP C C   1 
ATOM   2192 O  O   . ASP C 1 71  ? 51.103 23.829 -3.858  1.00 34.15 ? 71   ASP C O   1 
ATOM   2193 C  CB  . ASP C 1 71  ? 52.565 25.096 -6.433  1.00 37.55 ? 71   ASP C CB  1 
ATOM   2194 C  CG  . ASP C 1 71  ? 53.830 25.792 -6.901  1.00 39.25 ? 71   ASP C CG  1 
ATOM   2195 O  OD1 . ASP C 1 71  ? 54.828 25.795 -6.146  1.00 39.71 ? 71   ASP C OD1 1 
ATOM   2196 O  OD2 . ASP C 1 71  ? 53.815 26.353 -8.021  1.00 40.32 ? 71   ASP C OD2 1 
ATOM   2197 N  N   . MET C 1 72  ? 50.883 22.496 -5.657  1.00 33.28 ? 72   MET C N   1 
ATOM   2198 C  CA  . MET C 1 72  ? 49.616 21.934 -5.199  1.00 33.64 ? 72   MET C CA  1 
ATOM   2199 C  C   . MET C 1 72  ? 49.854 20.937 -4.072  1.00 32.11 ? 72   MET C C   1 
ATOM   2200 O  O   . MET C 1 72  ? 49.123 20.926 -3.075  1.00 31.54 ? 72   MET C O   1 
ATOM   2201 C  CB  . MET C 1 72  ? 48.883 21.233 -6.346  1.00 33.97 ? 72   MET C CB  1 
ATOM   2202 C  CG  . MET C 1 72  ? 48.300 22.162 -7.402  1.00 36.98 ? 72   MET C CG  1 
ATOM   2203 S  SD  . MET C 1 72  ? 47.191 23.428 -6.727  1.00 38.52 ? 72   MET C SD  1 
ATOM   2204 C  CE  . MET C 1 72  ? 46.129 22.441 -5.663  1.00 36.16 ? 72   MET C CE  1 
ATOM   2205 N  N   . LEU C 1 73  ? 50.877 20.101 -4.232  1.00 30.61 ? 73   LEU C N   1 
ATOM   2206 C  CA  . LEU C 1 73  ? 51.199 19.095 -3.226  1.00 30.70 ? 73   LEU C CA  1 
ATOM   2207 C  C   . LEU C 1 73  ? 51.474 19.720 -1.865  1.00 31.44 ? 73   LEU C C   1 
ATOM   2208 O  O   . LEU C 1 73  ? 51.206 19.105 -0.833  1.00 30.50 ? 73   LEU C O   1 
ATOM   2209 C  CB  . LEU C 1 73  ? 52.403 18.249 -3.666  1.00 28.36 ? 73   LEU C CB  1 
ATOM   2210 C  CG  . LEU C 1 73  ? 52.179 17.253 -4.811  1.00 28.34 ? 73   LEU C CG  1 
ATOM   2211 C  CD1 . LEU C 1 73  ? 53.485 16.545 -5.124  1.00 28.03 ? 73   LEU C CD1 1 
ATOM   2212 C  CD2 . LEU C 1 73  ? 51.101 16.231 -4.422  1.00 28.05 ? 73   LEU C CD2 1 
ATOM   2213 N  N   . ASP C 1 74  ? 52.011 20.938 -1.856  1.00 30.84 ? 74   ASP C N   1 
ATOM   2214 C  CA  . ASP C 1 74  ? 52.293 21.604 -0.590  1.00 32.36 ? 74   ASP C CA  1 
ATOM   2215 C  C   . ASP C 1 74  ? 50.990 21.826 0.170   1.00 32.08 ? 74   ASP C C   1 
ATOM   2216 O  O   . ASP C 1 74  ? 50.994 22.029 1.384   1.00 33.84 ? 74   ASP C O   1 
ATOM   2217 C  CB  . ASP C 1 74  ? 52.977 22.960 -0.817  1.00 33.12 ? 74   ASP C CB  1 
ATOM   2218 C  CG  . ASP C 1 74  ? 54.432 22.822 -1.218  1.00 34.64 ? 74   ASP C CG  1 
ATOM   2219 O  OD1 . ASP C 1 74  ? 55.118 21.942 -0.658  1.00 34.26 ? 74   ASP C OD1 1 
ATOM   2220 O  OD2 . ASP C 1 74  ? 54.893 23.605 -2.081  1.00 37.12 ? 74   ASP C OD2 1 
ATOM   2221 N  N   . LYS C 1 75  ? 49.881 21.781 -0.557  1.00 31.86 ? 75   LYS C N   1 
ATOM   2222 C  CA  . LYS C 1 75  ? 48.560 21.992 0.030   1.00 31.22 ? 75   LYS C CA  1 
ATOM   2223 C  C   . LYS C 1 75  ? 47.814 20.688 0.296   1.00 29.27 ? 75   LYS C C   1 
ATOM   2224 O  O   . LYS C 1 75  ? 46.701 20.705 0.824   1.00 29.41 ? 75   LYS C O   1 
ATOM   2225 C  CB  . LYS C 1 75  ? 47.711 22.859 -0.897  1.00 33.35 ? 75   LYS C CB  1 
ATOM   2226 C  CG  . LYS C 1 75  ? 48.335 24.193 -1.268  1.00 33.97 ? 75   LYS C CG  1 
ATOM   2227 C  CD  . LYS C 1 75  ? 47.479 24.884 -2.312  1.00 36.62 ? 75   LYS C CD  1 
ATOM   2228 C  CE  . LYS C 1 75  ? 48.108 26.173 -2.805  1.00 36.70 ? 75   LYS C CE  1 
ATOM   2229 N  NZ  . LYS C 1 75  ? 47.280 26.768 -3.888  1.00 39.25 ? 75   LYS C NZ  1 
ATOM   2230 N  N   . ALA C 1 76  ? 48.419 19.560 -0.068  1.00 27.84 ? 76   ALA C N   1 
ATOM   2231 C  CA  . ALA C 1 76  ? 47.773 18.264 0.124   1.00 24.59 ? 76   ALA C CA  1 
ATOM   2232 C  C   . ALA C 1 76  ? 47.830 17.779 1.567   1.00 24.14 ? 76   ALA C C   1 
ATOM   2233 O  O   . ALA C 1 76  ? 48.777 18.073 2.293   1.00 25.31 ? 76   ALA C O   1 
ATOM   2234 C  CB  . ALA C 1 76  ? 48.411 17.231 -0.793  1.00 24.63 ? 76   ALA C CB  1 
ATOM   2235 N  N   . TRP C 1 77  ? 46.804 17.032 1.976   1.00 23.28 ? 77   TRP C N   1 
ATOM   2236 C  CA  . TRP C 1 77  ? 46.746 16.482 3.326   1.00 22.99 ? 77   TRP C CA  1 
ATOM   2237 C  C   . TRP C 1 77  ? 47.559 15.181 3.348   1.00 21.93 ? 77   TRP C C   1 
ATOM   2238 O  O   . TRP C 1 77  ? 47.489 14.388 2.412   1.00 23.48 ? 77   TRP C O   1 
ATOM   2239 C  CB  . TRP C 1 77  ? 45.290 16.191 3.712   1.00 22.01 ? 77   TRP C CB  1 
ATOM   2240 C  CG  . TRP C 1 77  ? 45.109 15.766 5.133   1.00 21.91 ? 77   TRP C CG  1 
ATOM   2241 C  CD1 . TRP C 1 77  ? 44.931 16.574 6.214   1.00 21.68 ? 77   TRP C CD1 1 
ATOM   2242 C  CD2 . TRP C 1 77  ? 45.107 14.422 5.629   1.00 21.03 ? 77   TRP C CD2 1 
ATOM   2243 N  NE1 . TRP C 1 77  ? 44.818 15.818 7.358   1.00 21.60 ? 77   TRP C NE1 1 
ATOM   2244 C  CE2 . TRP C 1 77  ? 44.924 14.493 7.026   1.00 22.08 ? 77   TRP C CE2 1 
ATOM   2245 C  CE3 . TRP C 1 77  ? 45.246 13.164 5.026   1.00 23.01 ? 77   TRP C CE3 1 
ATOM   2246 C  CZ2 . TRP C 1 77  ? 44.872 13.355 7.834   1.00 22.42 ? 77   TRP C CZ2 1 
ATOM   2247 C  CZ3 . TRP C 1 77  ? 45.195 12.030 5.826   1.00 22.88 ? 77   TRP C CZ3 1 
ATOM   2248 C  CH2 . TRP C 1 77  ? 45.010 12.134 7.218   1.00 22.17 ? 77   TRP C CH2 1 
ATOM   2249 N  N   . GLY C 1 78  ? 48.325 14.968 4.412   1.00 22.07 ? 78   GLY C N   1 
ATOM   2250 C  CA  . GLY C 1 78  ? 49.132 13.760 4.512   1.00 22.09 ? 78   GLY C CA  1 
ATOM   2251 C  C   . GLY C 1 78  ? 50.257 13.691 3.494   1.00 23.32 ? 78   GLY C C   1 
ATOM   2252 O  O   . GLY C 1 78  ? 50.627 12.607 3.032   1.00 22.44 ? 78   GLY C O   1 
ATOM   2253 N  N   . LEU C 1 79  ? 50.811 14.846 3.142   1.00 22.51 ? 79   LEU C N   1 
ATOM   2254 C  CA  . LEU C 1 79  ? 51.897 14.898 2.167   1.00 22.73 ? 79   LEU C CA  1 
ATOM   2255 C  C   . LEU C 1 79  ? 53.120 14.086 2.590   1.00 22.85 ? 79   LEU C C   1 
ATOM   2256 O  O   . LEU C 1 79  ? 53.540 14.115 3.748   1.00 23.09 ? 79   LEU C O   1 
ATOM   2257 C  CB  . LEU C 1 79  ? 52.308 16.353 1.914   1.00 24.19 ? 79   LEU C CB  1 
ATOM   2258 C  CG  . LEU C 1 79  ? 53.409 16.604 0.872   1.00 27.13 ? 79   LEU C CG  1 
ATOM   2259 C  CD1 . LEU C 1 79  ? 52.923 16.159 -0.506  1.00 25.61 ? 79   LEU C CD1 1 
ATOM   2260 C  CD2 . LEU C 1 79  ? 53.779 18.086 0.853   1.00 26.89 ? 79   LEU C CD2 1 
ATOM   2261 N  N   . GLU C 1 80  ? 53.688 13.356 1.634   1.00 21.23 ? 80   GLU C N   1 
ATOM   2262 C  CA  . GLU C 1 80  ? 54.877 12.550 1.874   1.00 21.53 ? 80   GLU C CA  1 
ATOM   2263 C  C   . GLU C 1 80  ? 55.845 12.763 0.716   1.00 21.63 ? 80   GLU C C   1 
ATOM   2264 O  O   . GLU C 1 80  ? 55.453 13.243 -0.348  1.00 22.18 ? 80   GLU C O   1 
ATOM   2265 C  CB  . GLU C 1 80  ? 54.519 11.062 1.978   1.00 22.00 ? 80   GLU C CB  1 
ATOM   2266 C  CG  . GLU C 1 80  ? 53.850 10.662 3.287   1.00 22.80 ? 80   GLU C CG  1 
ATOM   2267 C  CD  . GLU C 1 80  ? 53.721 9.161  3.435   1.00 24.57 ? 80   GLU C CD  1 
ATOM   2268 O  OE1 . GLU C 1 80  ? 54.690 8.452  3.100   1.00 26.81 ? 80   GLU C OE1 1 
ATOM   2269 O  OE2 . GLU C 1 80  ? 52.662 8.684  3.898   1.00 25.74 ? 80   GLU C OE2 1 
ATOM   2270 N  N   . PRO C 1 81  ? 57.124 12.409 0.908   0.50 20.03 ? 81   PRO C N   1 
ATOM   2271 C  CA  . PRO C 1 81  ? 58.132 12.572 -0.140  0.50 19.92 ? 81   PRO C CA  1 
ATOM   2272 C  C   . PRO C 1 81  ? 57.735 11.876 -1.438  0.50 19.34 ? 81   PRO C C   1 
ATOM   2273 O  O   . PRO C 1 81  ? 58.013 12.370 -2.529  0.50 17.67 ? 81   PRO C O   1 
ATOM   2274 C  CB  . PRO C 1 81  ? 59.377 11.954 0.485   0.50 19.57 ? 81   PRO C CB  1 
ATOM   2275 C  CG  . PRO C 1 81  ? 59.196 12.261 1.945   0.50 20.37 ? 81   PRO C CG  1 
ATOM   2276 C  CD  . PRO C 1 81  ? 57.735 11.926 2.156   1.00 20.88 ? 81   PRO C CD  1 
ATOM   2277 N  N   . GLU C 1 82  ? 57.076 10.730 -1.309  1.00 21.34 ? 82   GLU C N   1 
ATOM   2278 C  CA  . GLU C 1 82  ? 56.648 9.950  -2.469  1.00 20.71 ? 82   GLU C CA  1 
ATOM   2279 C  C   . GLU C 1 82  ? 55.264 10.318 -2.990  1.00 20.69 ? 82   GLU C C   1 
ATOM   2280 O  O   . GLU C 1 82  ? 54.709 9.608  -3.826  1.00 20.66 ? 82   GLU C O   1 
ATOM   2281 C  CB  . GLU C 1 82  ? 56.695 8.459  -2.130  1.00 21.43 ? 82   GLU C CB  1 
ATOM   2282 C  CG  . GLU C 1 82  ? 58.072 7.997  -1.660  1.00 24.79 ? 82   GLU C CG  1 
ATOM   2283 C  CD  . GLU C 1 82  ? 58.116 6.535  -1.252  1.00 27.88 ? 82   GLU C CD  1 
ATOM   2284 O  OE1 . GLU C 1 82  ? 57.291 6.117  -0.408  1.00 27.63 ? 82   GLU C OE1 1 
ATOM   2285 O  OE2 . GLU C 1 82  ? 58.989 5.802  -1.769  1.00 27.81 ? 82   GLU C OE2 1 
ATOM   2286 N  N   . SER C 1 83  ? 54.719 11.431 -2.504  1.00 22.36 ? 83   SER C N   1 
ATOM   2287 C  CA  . SER C 1 83  ? 53.400 11.892 -2.928  1.00 22.21 ? 83   SER C CA  1 
ATOM   2288 C  C   . SER C 1 83  ? 53.377 12.384 -4.369  1.00 23.08 ? 83   SER C C   1 
ATOM   2289 O  O   . SER C 1 83  ? 54.319 13.026 -4.837  1.00 22.87 ? 83   SER C O   1 
ATOM   2290 C  CB  . SER C 1 83  ? 52.907 13.026 -2.024  1.00 22.28 ? 83   SER C CB  1 
ATOM   2291 O  OG  . SER C 1 83  ? 52.584 12.565 -0.725  1.00 22.12 ? 83   SER C OG  1 
ATOM   2292 N  N   . ARG C 1 84  ? 52.282 12.087 -5.058  1.00 22.65 ? 84   ARG C N   1 
ATOM   2293 C  CA  . ARG C 1 84  ? 52.088 12.509 -6.441  1.00 22.93 ? 84   ARG C CA  1 
ATOM   2294 C  C   . ARG C 1 84  ? 50.609 12.765 -6.701  1.00 25.15 ? 84   ARG C C   1 
ATOM   2295 O  O   . ARG C 1 84  ? 49.736 12.255 -5.984  1.00 23.45 ? 84   ARG C O   1 
ATOM   2296 C  CB  . ARG C 1 84  ? 52.566 11.428 -7.422  1.00 23.54 ? 84   ARG C CB  1 
ATOM   2297 C  CG  . ARG C 1 84  ? 54.072 11.188 -7.480  1.00 22.37 ? 84   ARG C CG  1 
ATOM   2298 C  CD  . ARG C 1 84  ? 54.823 12.462 -7.852  1.00 25.11 ? 84   ARG C CD  1 
ATOM   2299 N  NE  . ARG C 1 84  ? 54.348 13.031 -9.112  1.00 27.20 ? 84   ARG C NE  1 
ATOM   2300 C  CZ  . ARG C 1 84  ? 54.868 12.769 -10.310 1.00 28.41 ? 84   ARG C CZ  1 
ATOM   2301 N  NH1 . ARG C 1 84  ? 55.901 11.941 -10.431 1.00 26.62 ? 84   ARG C NH1 1 
ATOM   2302 N  NH2 . ARG C 1 84  ? 54.348 13.337 -11.394 1.00 28.21 ? 84   ARG C NH2 1 
ATOM   2303 N  N   . LEU C 1 85  ? 50.325 13.580 -7.711  1.00 25.01 ? 85   LEU C N   1 
ATOM   2304 C  CA  . LEU C 1 85  ? 48.944 13.834 -8.089  1.00 25.87 ? 85   LEU C CA  1 
ATOM   2305 C  C   . LEU C 1 85  ? 48.744 12.766 -9.151  1.00 25.91 ? 85   LEU C C   1 
ATOM   2306 O  O   . LEU C 1 85  ? 49.354 12.824 -10.222 1.00 27.40 ? 85   LEU C O   1 
ATOM   2307 C  CB  . LEU C 1 85  ? 48.787 15.245 -8.675  1.00 26.60 ? 85   LEU C CB  1 
ATOM   2308 C  CG  . LEU C 1 85  ? 49.061 16.407 -7.713  1.00 27.43 ? 85   LEU C CG  1 
ATOM   2309 C  CD1 . LEU C 1 85  ? 48.785 17.738 -8.406  1.00 29.14 ? 85   LEU C CD1 1 
ATOM   2310 C  CD2 . LEU C 1 85  ? 48.175 16.275 -6.484  1.00 28.82 ? 85   LEU C CD2 1 
ATOM   2311 N  N   . SER C 1 86  ? 47.924 11.766 -8.844  1.00 25.19 ? 86   SER C N   1 
ATOM   2312 C  CA  . SER C 1 86  ? 47.702 10.665 -9.768  1.00 25.36 ? 86   SER C CA  1 
ATOM   2313 C  C   . SER C 1 86  ? 47.320 11.056 -11.194 1.00 26.23 ? 86   SER C C   1 
ATOM   2314 O  O   . SER C 1 86  ? 47.543 10.276 -12.120 1.00 24.94 ? 86   SER C O   1 
ATOM   2315 C  CB  . SER C 1 86  ? 46.667 9.688  -9.196  1.00 25.65 ? 86   SER C CB  1 
ATOM   2316 O  OG  . SER C 1 86  ? 45.436 10.332 -8.933  1.00 24.51 ? 86   SER C OG  1 
ATOM   2317 N  N   . CYS C 1 87  ? 46.763 12.251 -11.380 1.00 26.80 ? 87   CYS C N   1 
ATOM   2318 C  CA  . CYS C 1 87  ? 46.378 12.698 -12.726 1.00 28.95 ? 87   CYS C CA  1 
ATOM   2319 C  C   . CYS C 1 87  ? 47.591 13.259 -13.469 1.00 29.09 ? 87   CYS C C   1 
ATOM   2320 O  O   . CYS C 1 87  ? 47.525 13.536 -14.670 1.00 29.87 ? 87   CYS C O   1 
ATOM   2321 C  CB  . CYS C 1 87  ? 45.299 13.786 -12.655 1.00 26.94 ? 87   CYS C CB  1 
ATOM   2322 S  SG  . CYS C 1 87  ? 45.896 15.371 -12.025 1.00 30.46 ? 87   CYS C SG  1 
ATOM   2323 N  N   . GLN C 1 88  ? 48.698 13.422 -12.753 1.00 28.37 ? 88   GLN C N   1 
ATOM   2324 C  CA  . GLN C 1 88  ? 49.915 13.961 -13.346 1.00 28.53 ? 88   GLN C CA  1 
ATOM   2325 C  C   . GLN C 1 88  ? 51.047 12.936 -13.424 1.00 29.29 ? 88   GLN C C   1 
ATOM   2326 O  O   . GLN C 1 88  ? 51.923 13.041 -14.280 1.00 29.03 ? 88   GLN C O   1 
ATOM   2327 C  CB  . GLN C 1 88  ? 50.376 15.187 -12.552 1.00 29.11 ? 88   GLN C CB  1 
ATOM   2328 C  CG  . GLN C 1 88  ? 49.351 16.301 -12.494 1.00 30.34 ? 88   GLN C CG  1 
ATOM   2329 C  CD  . GLN C 1 88  ? 49.078 16.918 -13.859 1.00 31.42 ? 88   GLN C CD  1 
ATOM   2330 O  OE1 . GLN C 1 88  ? 49.941 17.580 -14.438 1.00 32.34 ? 88   GLN C OE1 1 
ATOM   2331 N  NE2 . GLN C 1 88  ? 47.877 16.697 -14.380 1.00 31.54 ? 88   GLN C NE2 1 
ATOM   2332 N  N   . ALA C 1 89  ? 51.033 11.949 -12.532 1.00 27.75 ? 89   ALA C N   1 
ATOM   2333 C  CA  . ALA C 1 89  ? 52.069 10.917 -12.513 1.00 27.19 ? 89   ALA C CA  1 
ATOM   2334 C  C   . ALA C 1 89  ? 51.880 9.929  -13.660 1.00 26.86 ? 89   ALA C C   1 
ATOM   2335 O  O   . ALA C 1 89  ? 50.808 9.341  -13.804 1.00 26.09 ? 89   ALA C O   1 
ATOM   2336 C  CB  . ALA C 1 89  ? 52.039 10.178 -11.179 1.00 27.41 ? 89   ALA C CB  1 
ATOM   2337 N  N   . ARG C 1 90  ? 52.923 9.734  -14.467 1.00 25.75 ? 90   ARG C N   1 
ATOM   2338 C  CA  . ARG C 1 90  ? 52.836 8.819  -15.599 1.00 27.02 ? 90   ARG C CA  1 
ATOM   2339 C  C   . ARG C 1 90  ? 53.687 7.560  -15.501 1.00 27.69 ? 90   ARG C C   1 
ATOM   2340 O  O   . ARG C 1 90  ? 54.903 7.607  -15.291 1.00 27.91 ? 90   ARG C O   1 
ATOM   2341 C  CB  . ARG C 1 90  ? 53.148 9.556  -16.902 1.00 28.91 ? 90   ARG C CB  1 
ATOM   2342 C  CG  . ARG C 1 90  ? 51.969 10.395 -17.387 1.00 30.29 ? 90   ARG C CG  1 
ATOM   2343 C  CD  . ARG C 1 90  ? 52.339 11.371 -18.482 1.00 30.07 ? 90   ARG C CD  1 
ATOM   2344 N  NE  . ARG C 1 90  ? 51.307 12.398 -18.604 1.00 29.43 ? 90   ARG C NE  1 
ATOM   2345 C  CZ  . ARG C 1 90  ? 50.121 12.211 -19.175 1.00 29.21 ? 90   ARG C CZ  1 
ATOM   2346 N  NH1 . ARG C 1 90  ? 49.806 11.031 -19.697 1.00 28.71 ? 90   ARG C NH1 1 
ATOM   2347 N  NH2 . ARG C 1 90  ? 49.235 13.200 -19.199 1.00 28.53 ? 90   ARG C NH2 1 
ATOM   2348 N  N   . VAL C 1 91  ? 53.015 6.428  -15.671 1.00 27.53 ? 91   VAL C N   1 
ATOM   2349 C  CA  . VAL C 1 91  ? 53.638 5.115  -15.607 1.00 29.36 ? 91   VAL C CA  1 
ATOM   2350 C  C   . VAL C 1 91  ? 54.618 4.910  -16.746 1.00 30.33 ? 91   VAL C C   1 
ATOM   2351 O  O   . VAL C 1 91  ? 54.329 5.253  -17.890 1.00 30.26 ? 91   VAL C O   1 
ATOM   2352 C  CB  . VAL C 1 91  ? 52.568 4.013  -15.688 1.00 28.27 ? 91   VAL C CB  1 
ATOM   2353 C  CG1 . VAL C 1 91  ? 53.212 2.647  -15.613 1.00 28.04 ? 91   VAL C CG1 1 
ATOM   2354 C  CG2 . VAL C 1 91  ? 51.565 4.196  -14.563 1.00 28.40 ? 91   VAL C CG2 1 
ATOM   2355 N  N   . THR C 1 92  ? 55.777 4.342  -16.438 1.00 31.51 ? 92   THR C N   1 
ATOM   2356 C  CA  . THR C 1 92  ? 56.759 4.093  -17.477 1.00 32.60 ? 92   THR C CA  1 
ATOM   2357 C  C   . THR C 1 92  ? 56.926 2.598  -17.707 1.00 31.82 ? 92   THR C C   1 
ATOM   2358 O  O   . THR C 1 92  ? 56.024 1.942  -18.227 1.00 31.79 ? 92   THR C O   1 
ATOM   2359 C  CB  . THR C 1 92  ? 58.121 4.743  -17.136 1.00 33.96 ? 92   THR C CB  1 
ATOM   2360 O  OG1 . THR C 1 92  ? 58.619 4.216  -15.900 1.00 37.41 ? 92   THR C OG1 1 
ATOM   2361 C  CG2 . THR C 1 92  ? 57.969 6.244  -17.016 1.00 34.73 ? 92   THR C CG2 1 
ATOM   2362 N  N   . ASP C 1 93  ? 58.070 2.053  -17.310 1.00 33.47 ? 93   ASP C N   1 
ATOM   2363 C  CA  . ASP C 1 93  ? 58.338 0.631  -17.504 1.00 32.59 ? 93   ASP C CA  1 
ATOM   2364 C  C   . ASP C 1 93  ? 58.634 -0.113 -16.201 1.00 32.06 ? 93   ASP C C   1 
ATOM   2365 O  O   . ASP C 1 93  ? 59.393 -1.081 -16.196 1.00 34.02 ? 93   ASP C O   1 
ATOM   2366 C  CB  . ASP C 1 93  ? 59.529 0.459  -18.451 1.00 35.66 ? 93   ASP C CB  1 
ATOM   2367 C  CG  . ASP C 1 93  ? 60.728 1.296  -18.033 1.00 37.90 ? 93   ASP C CG  1 
ATOM   2368 O  OD1 . ASP C 1 93  ? 60.949 1.463  -16.813 1.00 39.22 ? 93   ASP C OD1 1 
ATOM   2369 O  OD2 . ASP C 1 93  ? 61.459 1.783  -18.923 1.00 38.83 ? 93   ASP C OD2 1 
ATOM   2370 N  N   . GLU C 1 94  ? 58.026 0.317  -15.102 1.00 29.62 ? 94   GLU C N   1 
ATOM   2371 C  CA  . GLU C 1 94  ? 58.292 -0.323 -13.819 1.00 26.42 ? 94   GLU C CA  1 
ATOM   2372 C  C   . GLU C 1 94  ? 57.008 -0.481 -13.015 1.00 23.77 ? 94   GLU C C   1 
ATOM   2373 O  O   . GLU C 1 94  ? 56.165 0.413  -13.007 1.00 20.45 ? 94   GLU C O   1 
ATOM   2374 C  CB  . GLU C 1 94  ? 59.304 0.530  -13.046 1.00 28.35 ? 94   GLU C CB  1 
ATOM   2375 C  CG  . GLU C 1 94  ? 59.936 -0.134 -11.846 1.00 33.44 ? 94   GLU C CG  1 
ATOM   2376 C  CD  . GLU C 1 94  ? 61.125 0.654  -11.312 1.00 36.04 ? 94   GLU C CD  1 
ATOM   2377 O  OE1 . GLU C 1 94  ? 62.133 0.783  -12.045 1.00 36.94 ? 94   GLU C OE1 1 
ATOM   2378 O  OE2 . GLU C 1 94  ? 61.054 1.150  -10.165 1.00 35.81 ? 94   GLU C OE2 1 
ATOM   2379 N  N   . ASP C 1 95  ? 56.866 -1.619 -12.344 1.00 20.92 ? 95   ASP C N   1 
ATOM   2380 C  CA  . ASP C 1 95  ? 55.682 -1.873 -11.532 1.00 18.38 ? 95   ASP C CA  1 
ATOM   2381 C  C   . ASP C 1 95  ? 55.650 -0.904 -10.352 1.00 16.97 ? 95   ASP C C   1 
ATOM   2382 O  O   . ASP C 1 95  ? 56.689 -0.453 -9.868  1.00 16.97 ? 95   ASP C O   1 
ATOM   2383 C  CB  . ASP C 1 95  ? 55.690 -3.310 -11.016 1.00 17.96 ? 95   ASP C CB  1 
ATOM   2384 C  CG  . ASP C 1 95  ? 55.408 -4.331 -12.105 1.00 21.57 ? 95   ASP C CG  1 
ATOM   2385 O  OD1 . ASP C 1 95  ? 55.138 -3.929 -13.260 1.00 20.05 ? 95   ASP C OD1 1 
ATOM   2386 O  OD2 . ASP C 1 95  ? 55.449 -5.544 -11.799 1.00 19.40 ? 95   ASP C OD2 1 
ATOM   2387 N  N   . LEU C 1 96  ? 54.453 -0.599 -9.877  1.00 15.75 ? 96   LEU C N   1 
ATOM   2388 C  CA  . LEU C 1 96  ? 54.298 0.340  -8.775  1.00 16.48 ? 96   LEU C CA  1 
ATOM   2389 C  C   . LEU C 1 96  ? 53.478 -0.229 -7.636  1.00 14.24 ? 96   LEU C C   1 
ATOM   2390 O  O   . LEU C 1 96  ? 52.784 -1.231 -7.790  1.00 14.10 ? 96   LEU C O   1 
ATOM   2391 C  CB  . LEU C 1 96  ? 53.566 1.594  -9.255  1.00 16.33 ? 96   LEU C CB  1 
ATOM   2392 C  CG  . LEU C 1 96  ? 54.066 2.310  -10.506 1.00 18.63 ? 96   LEU C CG  1 
ATOM   2393 C  CD1 . LEU C 1 96  ? 53.196 3.544  -10.749 1.00 21.16 ? 96   LEU C CD1 1 
ATOM   2394 C  CD2 . LEU C 1 96  ? 55.532 2.693  -10.324 1.00 20.08 ? 96   LEU C CD2 1 
ATOM   2395 N  N   . VAL C 1 97  ? 53.573 0.436  -6.491  1.00 15.14 ? 97   VAL C N   1 
ATOM   2396 C  CA  . VAL C 1 97  ? 52.766 0.121  -5.320  1.00 15.03 ? 97   VAL C CA  1 
ATOM   2397 C  C   . VAL C 1 97  ? 52.268 1.513  -4.952  1.00 15.90 ? 97   VAL C C   1 
ATOM   2398 O  O   . VAL C 1 97  ? 53.066 2.433  -4.736  1.00 15.42 ? 97   VAL C O   1 
ATOM   2399 C  CB  . VAL C 1 97  ? 53.592 -0.474 -4.173  1.00 13.97 ? 97   VAL C CB  1 
ATOM   2400 C  CG1 . VAL C 1 97  ? 52.713 -0.594 -2.917  1.00 16.36 ? 97   VAL C CG1 1 
ATOM   2401 C  CG2 . VAL C 1 97  ? 54.122 -1.847 -4.590  1.00 14.90 ? 97   VAL C CG2 1 
ATOM   2402 N  N   . VAL C 1 98  ? 50.950 1.675  -4.922  1.00 16.00 ? 98   VAL C N   1 
ATOM   2403 C  CA  . VAL C 1 98  ? 50.329 2.968  -4.648  1.00 15.36 ? 98   VAL C CA  1 
ATOM   2404 C  C   . VAL C 1 98  ? 49.352 2.918  -3.487  1.00 15.34 ? 98   VAL C C   1 
ATOM   2405 O  O   . VAL C 1 98  ? 48.556 1.993  -3.379  1.00 13.62 ? 98   VAL C O   1 
ATOM   2406 C  CB  . VAL C 1 98  ? 49.545 3.468  -5.898  1.00 15.83 ? 98   VAL C CB  1 
ATOM   2407 C  CG1 . VAL C 1 98  ? 48.823 4.772  -5.586  1.00 16.53 ? 98   VAL C CG1 1 
ATOM   2408 C  CG2 . VAL C 1 98  ? 50.506 3.665  -7.072  1.00 16.78 ? 98   VAL C CG2 1 
ATOM   2409 N  N   . GLU C 1 99  ? 49.419 3.923  -2.628  1.00 15.75 ? 99   GLU C N   1 
ATOM   2410 C  CA  . GLU C 1 99  ? 48.507 4.021  -1.496  1.00 15.53 ? 99   GLU C CA  1 
ATOM   2411 C  C   . GLU C 1 99  ? 47.646 5.264  -1.674  1.00 16.35 ? 99   GLU C C   1 
ATOM   2412 O  O   . GLU C 1 99  ? 48.158 6.341  -1.996  1.00 15.91 ? 99   GLU C O   1 
ATOM   2413 C  CB  . GLU C 1 99  ? 49.292 4.148  -0.193  1.00 16.19 ? 99   GLU C CB  1 
ATOM   2414 C  CG  . GLU C 1 99  ? 48.444 4.464  1.025   1.00 22.02 ? 99   GLU C CG  1 
ATOM   2415 C  CD  . GLU C 1 99  ? 49.286 4.631  2.275   1.00 26.56 ? 99   GLU C CD  1 
ATOM   2416 O  OE1 . GLU C 1 99  ? 50.002 3.674  2.634   1.00 28.02 ? 99   GLU C OE1 1 
ATOM   2417 O  OE2 . GLU C 1 99  ? 49.236 5.718  2.893   1.00 28.64 ? 99   GLU C OE2 1 
ATOM   2418 N  N   . ILE C 1 100 ? 46.344 5.113  -1.465  1.00 17.16 ? 100  ILE C N   1 
ATOM   2419 C  CA  . ILE C 1 100 ? 45.414 6.227  -1.560  1.00 19.63 ? 100  ILE C CA  1 
ATOM   2420 C  C   . ILE C 1 100 ? 45.241 6.709  -0.124  1.00 21.27 ? 100  ILE C C   1 
ATOM   2421 O  O   . ILE C 1 100 ? 44.957 5.907  0.761   1.00 20.29 ? 100  ILE C O   1 
ATOM   2422 C  CB  . ILE C 1 100 ? 44.050 5.763  -2.105  1.00 21.17 ? 100  ILE C CB  1 
ATOM   2423 C  CG1 . ILE C 1 100 ? 44.251 5.035  -3.437  1.00 20.27 ? 100  ILE C CG1 1 
ATOM   2424 C  CG2 . ILE C 1 100 ? 43.123 6.961  -2.289  1.00 20.73 ? 100  ILE C CG2 1 
ATOM   2425 C  CD1 . ILE C 1 100 ? 42.962 4.562  -4.086  1.00 26.76 ? 100  ILE C CD1 1 
ATOM   2426 N  N   . PRO C 1 101 ? 45.427 8.015  0.128   1.00 23.00 ? 101  PRO C N   1 
ATOM   2427 C  CA  . PRO C 1 101 ? 45.294 8.606  1.467   1.00 23.71 ? 101  PRO C CA  1 
ATOM   2428 C  C   . PRO C 1 101 ? 43.913 8.392  2.097   1.00 24.46 ? 101  PRO C C   1 
ATOM   2429 O  O   . PRO C 1 101 ? 42.928 8.158  1.398   1.00 22.79 ? 101  PRO C O   1 
ATOM   2430 C  CB  . PRO C 1 101 ? 45.579 10.089 1.225   1.00 25.57 ? 101  PRO C CB  1 
ATOM   2431 C  CG  . PRO C 1 101 ? 46.469 10.081 0.016   1.00 27.57 ? 101  PRO C CG  1 
ATOM   2432 C  CD  . PRO C 1 101 ? 45.806 9.044  -0.856  1.00 26.04 ? 101  PRO C CD  1 
ATOM   2433 N  N   . ARG C 1 102 ? 43.847 8.480  3.423   1.00 23.97 ? 102  ARG C N   1 
ATOM   2434 C  CA  . ARG C 1 102 ? 42.583 8.293  4.127   1.00 26.56 ? 102  ARG C CA  1 
ATOM   2435 C  C   . ARG C 1 102 ? 41.697 9.523  4.014   1.00 26.25 ? 102  ARG C C   1 
ATOM   2436 O  O   . ARG C 1 102 ? 40.499 9.460  4.293   1.00 26.68 ? 102  ARG C O   1 
ATOM   2437 C  CB  . ARG C 1 102 ? 42.824 7.990  5.605   1.00 29.68 ? 102  ARG C CB  1 
ATOM   2438 C  CG  . ARG C 1 102 ? 43.431 6.629  5.875   1.00 34.62 ? 102  ARG C CG  1 
ATOM   2439 C  CD  . ARG C 1 102 ? 43.071 6.182  7.274   1.00 40.52 ? 102  ARG C CD  1 
ATOM   2440 N  NE  . ARG C 1 102 ? 41.620 6.124  7.439   1.00 45.30 ? 102  ARG C NE  1 
ATOM   2441 C  CZ  . ARG C 1 102 ? 41.007 5.872  8.591   1.00 47.67 ? 102  ARG C CZ  1 
ATOM   2442 N  NH1 . ARG C 1 102 ? 41.720 5.654  9.690   1.00 49.72 ? 102  ARG C NH1 1 
ATOM   2443 N  NH2 . ARG C 1 102 ? 39.681 5.842  8.647   1.00 48.61 ? 102  ARG C NH2 1 
ATOM   2444 N  N   . TYR C 1 103 ? 42.291 10.643 3.617   1.00 25.32 ? 103  TYR C N   1 
ATOM   2445 C  CA  . TYR C 1 103 ? 41.549 11.887 3.475   1.00 25.35 ? 103  TYR C CA  1 
ATOM   2446 C  C   . TYR C 1 103 ? 42.226 12.814 2.480   1.00 26.00 ? 103  TYR C C   1 
ATOM   2447 O  O   . TYR C 1 103 ? 43.442 12.760 2.291   1.00 27.14 ? 103  TYR C O   1 
ATOM   2448 C  CB  . TYR C 1 103 ? 41.454 12.607 4.827   1.00 24.14 ? 103  TYR C CB  1 
ATOM   2449 C  CG  . TYR C 1 103 ? 40.588 13.850 4.810   1.00 24.23 ? 103  TYR C CG  1 
ATOM   2450 C  CD1 . TYR C 1 103 ? 39.193 13.753 4.809   1.00 26.54 ? 103  TYR C CD1 1 
ATOM   2451 C  CD2 . TYR C 1 103 ? 41.159 15.122 4.764   1.00 25.17 ? 103  TYR C CD2 1 
ATOM   2452 C  CE1 . TYR C 1 103 ? 38.390 14.891 4.760   1.00 25.25 ? 103  TYR C CE1 1 
ATOM   2453 C  CE2 . TYR C 1 103 ? 40.364 16.269 4.711   1.00 26.40 ? 103  TYR C CE2 1 
ATOM   2454 C  CZ  . TYR C 1 103 ? 38.980 16.146 4.708   1.00 25.63 ? 103  TYR C CZ  1 
ATOM   2455 O  OH  . TYR C 1 103 ? 38.187 17.272 4.643   1.00 23.61 ? 103  TYR C OH  1 
ATOM   2456 N  N   . THR C 1 104 ? 41.428 13.651 1.829   1.00 26.67 ? 104  THR C N   1 
ATOM   2457 C  CA  . THR C 1 104 ? 41.959 14.642 0.898   1.00 27.39 ? 104  THR C CA  1 
ATOM   2458 C  C   . THR C 1 104 ? 41.152 15.916 1.077   1.00 27.51 ? 104  THR C C   1 
ATOM   2459 O  O   . THR C 1 104 ? 39.946 15.873 1.339   1.00 26.68 ? 104  THR C O   1 
ATOM   2460 C  CB  . THR C 1 104 ? 41.852 14.201 -0.579  1.00 26.79 ? 104  THR C CB  1 
ATOM   2461 O  OG1 . THR C 1 104 ? 40.482 14.230 -0.997  1.00 29.35 ? 104  THR C OG1 1 
ATOM   2462 C  CG2 . THR C 1 104 ? 42.405 12.793 -0.756  1.00 27.14 ? 104  THR C CG2 1 
ATOM   2463 N  N   . ILE C 1 105 ? 41.822 17.052 0.948   1.00 28.34 ? 105  ILE C N   1 
ATOM   2464 C  CA  . ILE C 1 105 ? 41.157 18.341 1.086   1.00 30.63 ? 105  ILE C CA  1 
ATOM   2465 C  C   . ILE C 1 105 ? 40.353 18.671 -0.173  1.00 32.06 ? 105  ILE C C   1 
ATOM   2466 O  O   . ILE C 1 105 ? 40.801 18.430 -1.295  1.00 32.47 ? 105  ILE C O   1 
ATOM   2467 C  CB  . ILE C 1 105 ? 42.191 19.457 1.357   1.00 29.67 ? 105  ILE C CB  1 
ATOM   2468 C  CG1 . ILE C 1 105 ? 42.843 19.226 2.723   1.00 29.72 ? 105  ILE C CG1 1 
ATOM   2469 C  CG2 . ILE C 1 105 ? 41.522 20.822 1.308   1.00 30.25 ? 105  ILE C CG2 1 
ATOM   2470 C  CD1 . ILE C 1 105 ? 44.050 20.099 2.985   1.00 31.46 ? 105  ILE C CD1 1 
ATOM   2471 N  N   . ASN C 1 106 ? 39.152 19.204 0.027   1.00 33.71 ? 106  ASN C N   1 
ATOM   2472 C  CA  . ASN C 1 106 ? 38.272 19.581 -1.074  1.00 35.41 ? 106  ASN C CA  1 
ATOM   2473 C  C   . ASN C 1 106 ? 37.333 20.662 -0.554  1.00 36.95 ? 106  ASN C C   1 
ATOM   2474 O  O   . ASN C 1 106 ? 36.325 20.366 0.090   1.00 35.58 ? 106  ASN C O   1 
ATOM   2475 C  CB  . ASN C 1 106 ? 37.453 18.378 -1.552  1.00 36.56 ? 106  ASN C CB  1 
ATOM   2476 C  CG  . ASN C 1 106 ? 36.719 18.649 -2.854  1.00 36.87 ? 106  ASN C CG  1 
ATOM   2477 O  OD1 . ASN C 1 106 ? 36.241 19.756 -3.095  1.00 38.58 ? 106  ASN C OD1 1 
ATOM   2478 N  ND2 . ASN C 1 106 ? 36.613 17.627 -3.695  1.00 37.95 ? 106  ASN C ND2 1 
ATOM   2479 N  N   . HIS C 1 107 ? 37.678 21.914 -0.831  1.00 39.70 ? 107  HIS C N   1 
ATOM   2480 C  CA  . HIS C 1 107 ? 36.885 23.054 -0.391  1.00 41.76 ? 107  HIS C CA  1 
ATOM   2481 C  C   . HIS C 1 107 ? 35.533 23.151 -1.090  1.00 42.71 ? 107  HIS C C   1 
ATOM   2482 O  O   . HIS C 1 107 ? 34.857 24.172 -0.983  1.00 44.08 ? 107  HIS C O   1 
ATOM   2483 C  CB  . HIS C 1 107 ? 37.665 24.349 -0.629  1.00 42.07 ? 107  HIS C CB  1 
ATOM   2484 C  CG  . HIS C 1 107 ? 38.937 24.443 0.154   1.00 42.17 ? 107  HIS C CG  1 
ATOM   2485 N  ND1 . HIS C 1 107 ? 38.959 24.646 1.517   1.00 42.55 ? 107  HIS C ND1 1 
ATOM   2486 C  CD2 . HIS C 1 107 ? 40.231 24.373 -0.237  1.00 42.69 ? 107  HIS C CD2 1 
ATOM   2487 C  CE1 . HIS C 1 107 ? 40.213 24.699 1.932   1.00 43.07 ? 107  HIS C CE1 1 
ATOM   2488 N  NE2 . HIS C 1 107 ? 41.004 24.536 0.887   1.00 43.02 ? 107  HIS C NE2 1 
ATOM   2489 N  N   . ALA C 1 108 ? 35.139 22.099 -1.802  1.00 44.09 ? 108  ALA C N   1 
ATOM   2490 C  CA  . ALA C 1 108 ? 33.863 22.100 -2.513  1.00 45.17 ? 108  ALA C CA  1 
ATOM   2491 C  C   . ALA C 1 108 ? 33.079 20.804 -2.322  1.00 46.19 ? 108  ALA C C   1 
ATOM   2492 O  O   . ALA C 1 108 ? 31.967 20.662 -2.833  1.00 46.10 ? 108  ALA C O   1 
ATOM   2493 C  CB  . ALA C 1 108 ? 34.096 22.351 -4.002  1.00 45.39 ? 108  ALA C CB  1 
ATOM   2494 N  N   . ARG C 1 109 ? 33.660 19.862 -1.587  1.00 46.67 ? 109  ARG C N   1 
ATOM   2495 C  CA  . ARG C 1 109 ? 33.006 18.583 -1.335  1.00 47.73 ? 109  ARG C CA  1 
ATOM   2496 C  C   . ARG C 1 109 ? 31.618 18.795 -0.741  1.00 48.25 ? 109  ARG C C   1 
ATOM   2497 O  O   . ARG C 1 109 ? 31.542 19.548 0.253   1.00 28.04 ? 109  ARG C O   1 
ATOM   2498 C  CB  . ARG C 1 109 ? 33.853 17.734 -0.393  1.00 47.15 ? 109  ARG C CB  1 
HETATM 2499 FE FE1 . FES D 2 .   ? 38.459 22.931 29.827  1.00 29.19 ? 1112 FES A FE1 1 
HETATM 2500 FE FE2 . FES D 2 .   ? 39.885 22.013 27.732  1.00 26.79 ? 1112 FES A FE2 1 
HETATM 2501 S  S1  . FES D 2 .   ? 39.246 20.885 29.537  1.00 28.67 ? 1112 FES A S1  1 
HETATM 2502 S  S2  . FES D 2 .   ? 39.111 24.077 28.019  1.00 26.50 ? 1112 FES A S2  1 
HETATM 2503 FE FE1 . FES E 2 .   ? 0.248  10.808 25.642  1.00 19.33 ? 2112 FES B FE1 1 
HETATM 2504 FE FE2 . FES E 2 .   ? 2.899  10.555 25.256  1.00 19.76 ? 2112 FES B FE2 1 
HETATM 2505 S  S1  . FES E 2 .   ? 1.337  10.608 23.706  1.00 20.97 ? 2112 FES B S1  1 
HETATM 2506 S  S2  . FES E 2 .   ? 1.838  10.726 27.213  1.00 21.48 ? 2112 FES B S2  1 
HETATM 2507 FE FE1 . FES F 2 .   ? 42.962 17.909 -9.467  1.00 33.38 ? 3112 FES C FE1 1 
HETATM 2508 FE FE2 . FES F 2 .   ? 44.508 15.794 -10.104 1.00 29.13 ? 3112 FES C FE2 1 
HETATM 2509 S  S1  . FES F 2 .   ? 45.178 17.746 -9.284  1.00 33.26 ? 3112 FES C S1  1 
HETATM 2510 S  S2  . FES F 2 .   ? 42.282 15.955 -10.303 1.00 32.55 ? 3112 FES C S2  1 
HETATM 2511 O  O   . HOH G 3 .   ? 33.688 20.016 12.813  1.00 17.79 ? 1113 HOH A O   1 
HETATM 2512 O  O   . HOH G 3 .   ? 30.763 17.298 23.631  1.00 19.39 ? 1114 HOH A O   1 
HETATM 2513 O  O   . HOH G 3 .   ? 42.103 8.979  14.122  1.00 23.16 ? 1115 HOH A O   1 
HETATM 2514 O  O   . HOH G 3 .   ? 34.157 21.699 21.380  1.00 22.56 ? 1116 HOH A O   1 
HETATM 2515 O  O   . HOH G 3 .   ? 30.340 17.936 26.412  1.00 20.20 ? 1117 HOH A O   1 
HETATM 2516 O  O   . HOH G 3 .   ? 27.801 20.930 12.453  1.00 28.05 ? 1118 HOH A O   1 
HETATM 2517 O  O   . HOH G 3 .   ? 47.521 28.102 10.497  1.00 28.93 ? 1119 HOH A O   1 
HETATM 2518 O  O   . HOH G 3 .   ? 39.642 9.031  23.579  1.00 32.05 ? 1120 HOH A O   1 
HETATM 2519 O  O   . HOH G 3 .   ? 24.980 21.923 29.153  1.00 29.83 ? 1121 HOH A O   1 
HETATM 2520 O  O   . HOH G 3 .   ? 23.223 24.586 26.175  1.00 27.00 ? 1122 HOH A O   1 
HETATM 2521 O  O   . HOH G 3 .   ? 49.932 24.777 22.241  1.00 31.47 ? 1123 HOH A O   1 
HETATM 2522 O  O   . HOH G 3 .   ? 50.044 14.600 14.812  1.00 26.04 ? 1124 HOH A O   1 
HETATM 2523 O  O   . HOH G 3 .   ? 45.282 24.700 24.510  1.00 33.42 ? 1125 HOH A O   1 
HETATM 2524 O  O   . HOH G 3 .   ? 50.819 17.495 4.604   1.00 29.67 ? 1126 HOH A O   1 
HETATM 2525 O  O   . HOH G 3 .   ? 46.569 11.025 9.705   1.00 28.99 ? 1127 HOH A O   1 
HETATM 2526 O  O   . HOH G 3 .   ? 30.076 12.624 18.844  1.00 25.30 ? 1128 HOH A O   1 
HETATM 2527 O  O   . HOH G 3 .   ? 29.892 22.470 20.267  1.00 37.46 ? 1129 HOH A O   1 
HETATM 2528 O  O   . HOH G 3 .   ? 46.182 30.152 20.492  1.00 30.18 ? 1130 HOH A O   1 
HETATM 2529 O  O   . HOH G 3 .   ? 30.718 24.250 22.843  1.00 36.16 ? 1131 HOH A O   1 
HETATM 2530 O  O   . HOH G 3 .   ? 50.422 13.387 7.759   1.00 28.53 ? 1132 HOH A O   1 
HETATM 2531 O  O   . HOH G 3 .   ? 36.012 8.258  12.928  1.00 39.05 ? 1133 HOH A O   1 
HETATM 2532 O  O   . HOH G 3 .   ? 33.194 24.532 20.782  1.00 33.84 ? 1134 HOH A O   1 
HETATM 2533 O  O   . HOH G 3 .   ? 32.928 22.501 2.824   1.00 37.66 ? 1135 HOH A O   1 
HETATM 2534 O  O   . HOH G 3 .   ? 53.064 23.444 9.911   1.00 38.35 ? 1136 HOH A O   1 
HETATM 2535 O  O   . HOH G 3 .   ? 48.246 13.706 26.337  1.00 37.31 ? 1137 HOH A O   1 
HETATM 2536 O  O   . HOH G 3 .   ? 49.345 18.964 27.060  1.00 36.08 ? 1138 HOH A O   1 
HETATM 2537 O  O   . HOH G 3 .   ? 35.644 29.715 26.204  1.00 32.25 ? 1139 HOH A O   1 
HETATM 2538 O  O   . HOH G 3 .   ? 41.809 32.142 25.365  1.00 42.70 ? 1140 HOH A O   1 
HETATM 2539 O  O   . HOH G 3 .   ? 29.853 18.536 14.097  1.00 35.03 ? 1141 HOH A O   1 
HETATM 2540 O  O   . HOH G 3 .   ? 28.251 15.870 17.507  1.00 31.02 ? 1142 HOH A O   1 
HETATM 2541 O  O   . HOH G 3 .   ? 32.099 21.159 30.744  1.00 34.34 ? 1143 HOH A O   1 
HETATM 2542 O  O   . HOH G 3 .   ? 35.702 7.884  16.973  1.00 37.69 ? 1144 HOH A O   1 
HETATM 2543 O  O   . HOH G 3 .   ? 29.492 21.664 33.305  1.00 41.50 ? 1145 HOH A O   1 
HETATM 2544 O  O   . HOH G 3 .   ? 53.730 26.253 18.934  1.00 37.71 ? 1146 HOH A O   1 
HETATM 2545 O  O   . HOH G 3 .   ? 28.759 28.537 26.144  1.00 38.77 ? 1147 HOH A O   1 
HETATM 2546 O  O   . HOH G 3 .   ? 34.460 30.109 14.776  1.00 36.18 ? 1148 HOH A O   1 
HETATM 2547 O  O   . HOH G 3 .   ? 48.608 15.259 23.692  1.00 39.22 ? 1149 HOH A O   1 
HETATM 2548 O  O   . HOH G 3 .   ? 31.611 18.157 31.400  1.00 38.74 ? 1150 HOH A O   1 
HETATM 2549 O  O   . HOH G 3 .   ? 40.928 26.976 5.597   1.00 44.62 ? 1151 HOH A O   1 
HETATM 2550 O  O   . HOH G 3 .   ? 46.102 14.594 28.512  1.00 43.08 ? 1152 HOH A O   1 
HETATM 2551 O  O   . HOH G 3 .   ? 36.715 30.460 21.657  1.00 35.66 ? 1153 HOH A O   1 
HETATM 2552 O  O   . HOH G 3 .   ? 39.752 6.867  11.875  1.00 42.82 ? 1154 HOH A O   1 
HETATM 2553 O  O   . HOH G 3 .   ? 34.665 11.773 35.918  1.00 43.63 ? 1155 HOH A O   1 
HETATM 2554 O  O   . HOH H 3 .   ? 13.922 22.386 27.270  1.00 18.37 ? 2113 HOH B O   1 
HETATM 2555 O  O   . HOH H 3 .   ? 3.543  21.290 22.187  1.00 15.28 ? 2114 HOH B O   1 
HETATM 2556 O  O   . HOH H 3 .   ? 0.830  20.197 22.176  1.00 16.58 ? 2115 HOH B O   1 
HETATM 2557 O  O   . HOH H 3 .   ? 8.265  25.932 22.381  1.00 23.34 ? 2116 HOH B O   1 
HETATM 2558 O  O   . HOH H 3 .   ? -3.380 25.793 29.159  1.00 23.60 ? 2117 HOH B O   1 
HETATM 2559 O  O   . HOH H 3 .   ? 7.567  6.880  28.487  1.00 21.30 ? 2118 HOH B O   1 
HETATM 2560 O  O   . HOH H 3 .   ? 6.134  18.280 26.886  1.00 20.12 ? 2119 HOH B O   1 
HETATM 2561 O  O   . HOH H 3 .   ? -2.616 16.774 24.167  1.00 18.82 ? 2120 HOH B O   1 
HETATM 2562 O  O   . HOH H 3 .   ? 18.554 16.366 16.045  1.00 26.78 ? 2121 HOH B O   1 
HETATM 2563 O  O   . HOH H 3 .   ? 11.766 3.781  29.314  1.00 25.92 ? 2122 HOH B O   1 
HETATM 2564 O  O   . HOH H 3 .   ? -4.205 20.804 17.557  1.00 25.65 ? 2123 HOH B O   1 
HETATM 2565 O  O   . HOH H 3 .   ? 26.642 10.071 21.296  1.00 25.57 ? 2124 HOH B O   1 
HETATM 2566 O  O   . HOH H 3 .   ? -5.048 16.491 25.846  1.00 23.19 ? 2125 HOH B O   1 
HETATM 2567 O  O   . HOH H 3 .   ? 7.591  3.101  29.332  1.00 27.76 ? 2126 HOH B O   1 
HETATM 2568 O  O   . HOH H 3 .   ? -3.021 17.569 21.330  1.00 23.72 ? 2127 HOH B O   1 
HETATM 2569 O  O   . HOH H 3 .   ? 17.518 -0.578 22.490  1.00 27.63 ? 2128 HOH B O   1 
HETATM 2570 O  O   . HOH H 3 .   ? 20.109 7.770  20.570  1.00 25.14 ? 2129 HOH B O   1 
HETATM 2571 O  O   . HOH H 3 .   ? 13.679 20.733 14.335  1.00 26.03 ? 2130 HOH B O   1 
HETATM 2572 O  O   . HOH H 3 .   ? 2.254  23.876 28.706  1.00 24.97 ? 2131 HOH B O   1 
HETATM 2573 O  O   . HOH H 3 .   ? 14.281 25.237 26.320  1.00 36.58 ? 2132 HOH B O   1 
HETATM 2574 O  O   . HOH H 3 .   ? 8.442  0.939  27.595  1.00 27.96 ? 2133 HOH B O   1 
HETATM 2575 O  O   . HOH H 3 .   ? 15.270 28.746 32.748  1.00 26.14 ? 2134 HOH B O   1 
HETATM 2576 O  O   . HOH H 3 .   ? 11.401 5.747  18.813  1.00 28.58 ? 2135 HOH B O   1 
HETATM 2577 O  O   . HOH H 3 .   ? 6.315  6.056  17.298  1.00 29.40 ? 2136 HOH B O   1 
HETATM 2578 O  O   . HOH H 3 .   ? 8.526  24.463 18.933  1.00 25.58 ? 2137 HOH B O   1 
HETATM 2579 O  O   . HOH H 3 .   ? -3.434 7.620  18.760  1.00 30.87 ? 2138 HOH B O   1 
HETATM 2580 O  O   . HOH H 3 .   ? 23.646 13.131 18.506  1.00 28.90 ? 2139 HOH B O   1 
HETATM 2581 O  O   . HOH H 3 .   ? 12.910 3.277  32.225  1.00 27.37 ? 2140 HOH B O   1 
HETATM 2582 O  O   . HOH H 3 .   ? 13.498 -1.068 24.980  1.00 23.56 ? 2141 HOH B O   1 
HETATM 2583 O  O   . HOH H 3 .   ? -4.562 23.097 26.369  1.00 23.27 ? 2142 HOH B O   1 
HETATM 2584 O  O   . HOH H 3 .   ? -5.249 8.750  30.737  1.00 29.34 ? 2143 HOH B O   1 
HETATM 2585 O  O   . HOH H 3 .   ? 11.609 28.119 28.450  1.00 38.59 ? 2144 HOH B O   1 
HETATM 2586 O  O   . HOH H 3 .   ? -5.878 18.417 20.626  1.00 31.54 ? 2145 HOH B O   1 
HETATM 2587 O  O   . HOH H 3 .   ? 20.296 14.865 36.283  1.00 31.90 ? 2146 HOH B O   1 
HETATM 2588 O  O   . HOH H 3 .   ? 5.249  14.662 35.271  1.00 29.39 ? 2147 HOH B O   1 
HETATM 2589 O  O   . HOH H 3 .   ? 21.538 17.485 35.757  1.00 28.21 ? 2148 HOH B O   1 
HETATM 2590 O  O   . HOH H 3 .   ? 5.632  22.723 28.191  1.00 33.72 ? 2149 HOH B O   1 
HETATM 2591 O  O   . HOH H 3 .   ? 6.205  4.560  26.912  1.00 29.91 ? 2150 HOH B O   1 
HETATM 2592 O  O   . HOH H 3 .   ? 0.723  13.829 33.538  1.00 31.93 ? 2151 HOH B O   1 
HETATM 2593 O  O   . HOH H 3 .   ? 15.863 1.762  21.144  1.00 33.15 ? 2152 HOH B O   1 
HETATM 2594 O  O   . HOH H 3 .   ? 10.665 6.628  34.799  1.00 32.04 ? 2153 HOH B O   1 
HETATM 2595 O  O   . HOH H 3 .   ? 12.212 26.629 16.628  1.00 39.60 ? 2154 HOH B O   1 
HETATM 2596 O  O   . HOH H 3 .   ? -5.317 15.272 28.476  1.00 33.53 ? 2155 HOH B O   1 
HETATM 2597 O  O   . HOH H 3 .   ? 4.181  19.705 35.140  1.00 36.78 ? 2156 HOH B O   1 
HETATM 2598 O  O   . HOH H 3 .   ? 25.849 0.842  18.419  1.00 41.12 ? 2157 HOH B O   1 
HETATM 2599 O  O   . HOH H 3 .   ? 5.281  24.987 14.384  1.00 33.41 ? 2158 HOH B O   1 
HETATM 2600 O  O   . HOH H 3 .   ? 9.134  14.692 13.782  1.00 27.18 ? 2159 HOH B O   1 
HETATM 2601 O  O   . HOH H 3 .   ? 9.618  19.530 36.782  1.00 34.79 ? 2160 HOH B O   1 
HETATM 2602 O  O   . HOH H 3 .   ? 22.994 15.977 16.192  1.00 46.33 ? 2161 HOH B O   1 
HETATM 2603 O  O   . HOH H 3 .   ? 26.594 7.695  24.227  1.00 36.91 ? 2162 HOH B O   1 
HETATM 2604 O  O   . HOH H 3 .   ? 22.810 1.370  27.190  1.00 38.95 ? 2163 HOH B O   1 
HETATM 2605 O  O   . HOH H 3 .   ? 2.346  3.610  23.890  1.00 42.22 ? 2164 HOH B O   1 
HETATM 2606 O  O   . HOH H 3 .   ? 11.355 25.963 26.000  1.00 38.13 ? 2165 HOH B O   1 
HETATM 2607 O  O   . HOH H 3 .   ? 17.077 22.432 36.050  1.00 37.57 ? 2166 HOH B O   1 
HETATM 2608 O  O   . HOH H 3 .   ? 3.093  28.208 28.676  1.00 40.27 ? 2167 HOH B O   1 
HETATM 2609 O  O   . HOH H 3 .   ? 10.178 2.752  13.570  1.00 38.66 ? 2168 HOH B O   1 
HETATM 2610 O  O   . HOH H 3 .   ? -1.521 18.224 10.795  1.00 39.24 ? 2169 HOH B O   1 
HETATM 2611 O  O   . HOH H 3 .   ? -0.530 10.907 33.524  1.00 41.57 ? 2170 HOH B O   1 
HETATM 2612 O  O   . HOH H 3 .   ? 8.306  3.156  21.233  1.00 38.54 ? 2171 HOH B O   1 
HETATM 2613 O  O   . HOH H 3 .   ? 4.637  19.265 30.611  1.00 38.65 ? 2172 HOH B O   1 
HETATM 2614 O  O   . HOH H 3 .   ? 2.952  14.377 11.682  1.00 31.51 ? 2173 HOH B O   1 
HETATM 2615 O  O   . HOH I 3 .   ? 45.534 2.555  -0.686  1.00 16.71 ? 3113 HOH C O   1 
HETATM 2616 O  O   . HOH I 3 .   ? 58.733 4.476  -4.492  1.00 20.56 ? 3114 HOH C O   1 
HETATM 2617 O  O   . HOH I 3 .   ? 43.099 10.446 -3.467  1.00 25.10 ? 3115 HOH C O   1 
HETATM 2618 O  O   . HOH I 3 .   ? 56.564 2.932  -13.963 1.00 22.52 ? 3116 HOH C O   1 
HETATM 2619 O  O   . HOH I 3 .   ? 44.605 16.813 0.189   1.00 24.18 ? 3117 HOH C O   1 
HETATM 2620 O  O   . HOH I 3 .   ? 59.395 -0.619 -8.846  1.00 25.74 ? 3118 HOH C O   1 
HETATM 2621 O  O   . HOH I 3 .   ? 45.471 13.925 0.807   1.00 24.74 ? 3119 HOH C O   1 
HETATM 2622 O  O   . HOH I 3 .   ? 50.317 10.145 4.061   1.00 21.94 ? 3120 HOH C O   1 
HETATM 2623 O  O   . HOH I 3 .   ? 36.805 15.500 1.330   1.00 33.35 ? 3121 HOH C O   1 
HETATM 2624 O  O   . HOH I 3 .   ? 56.952 4.399  1.569   1.00 28.49 ? 3122 HOH C O   1 
HETATM 2625 O  O   . HOH I 3 .   ? 59.067 -3.594 -12.469 1.00 24.15 ? 3123 HOH C O   1 
HETATM 2626 O  O   . HOH I 3 .   ? 40.298 9.468  -3.750  1.00 28.93 ? 3124 HOH C O   1 
HETATM 2627 O  O   . HOH I 3 .   ? 52.360 -0.527 -21.254 1.00 41.37 ? 3125 HOH C O   1 
HETATM 2628 O  O   . HOH I 3 .   ? 46.279 8.594  5.089   1.00 31.37 ? 3126 HOH C O   1 
HETATM 2629 O  O   . HOH I 3 .   ? 45.478 2.405  2.321   1.00 29.92 ? 3127 HOH C O   1 
HETATM 2630 O  O   . HOH I 3 .   ? 48.216 8.406  2.722   1.00 30.19 ? 3128 HOH C O   1 
HETATM 2631 O  O   . HOH I 3 .   ? 35.480 16.419 4.321   1.00 34.09 ? 3129 HOH C O   1 
HETATM 2632 O  O   . HOH I 3 .   ? 56.093 -7.751 -13.264 1.00 32.96 ? 3130 HOH C O   1 
HETATM 2633 O  O   . HOH I 3 .   ? 44.533 20.817 -0.918  1.00 33.26 ? 3131 HOH C O   1 
HETATM 2634 O  O   . HOH I 3 .   ? 36.174 8.824  -9.260  1.00 31.26 ? 3132 HOH C O   1 
HETATM 2635 O  O   . HOH I 3 .   ? 54.009 16.888 -12.956 1.00 31.80 ? 3133 HOH C O   1 
HETATM 2636 O  O   . HOH I 3 .   ? 60.835 4.470  -20.083 1.00 36.24 ? 3134 HOH C O   1 
HETATM 2637 O  O   . HOH I 3 .   ? 58.909 13.584 -8.823  1.00 29.31 ? 3135 HOH C O   1 
HETATM 2638 O  O   . HOH I 3 .   ? 38.247 19.895 3.125   1.00 36.18 ? 3136 HOH C O   1 
HETATM 2639 O  O   . HOH I 3 .   ? 60.189 14.069 -3.256  1.00 38.86 ? 3137 HOH C O   1 
HETATM 2640 O  O   . HOH I 3 .   ? 51.580 -4.371 -17.635 1.00 37.52 ? 3138 HOH C O   1 
HETATM 2641 O  O   . HOH I 3 .   ? 57.623 15.038 -6.262  1.00 39.91 ? 3139 HOH C O   1 
HETATM 2642 O  O   . HOH I 3 .   ? 43.727 24.349 1.065   1.00 33.75 ? 3140 HOH C O   1 
HETATM 2643 O  O   . HOH I 3 .   ? 45.799 13.904 -16.911 1.00 38.47 ? 3141 HOH C O   1 
HETATM 2644 O  O   . HOH I 3 .   ? 61.672 0.823  -21.858 1.00 37.68 ? 3142 HOH C O   1 
HETATM 2645 O  O   . HOH I 3 .   ? 39.393 -4.705 -2.882  1.00 40.40 ? 3143 HOH C O   1 
HETATM 2646 O  O   . HOH I 3 .   ? 52.945 21.270 3.093   1.00 39.72 ? 3144 HOH C O   1 
HETATM 2647 O  O   . HOH I 3 .   ? 46.135 22.700 2.640   1.00 36.25 ? 3145 HOH C O   1 
HETATM 2648 O  O   . HOH I 3 .   ? 52.557 14.874 6.163   1.00 41.10 ? 3146 HOH C O   1 
HETATM 2649 O  O   . HOH I 3 .   ? 43.549 -7.705 -7.817  1.00 38.84 ? 3147 HOH C O   1 
HETATM 2650 O  O   . HOH I 3 .   ? 54.885 11.703 -14.229 1.00 36.78 ? 3148 HOH C O   1 
HETATM 2651 O  O   . HOH I 3 .   ? 37.547 -1.836 -5.756  1.00 39.28 ? 3149 HOH C O   1 
HETATM 2652 O  O   . HOH I 3 .   ? 36.559 2.059  -6.169  1.00 29.39 ? 3150 HOH C O   1 
HETATM 2653 O  O   . HOH I 3 .   ? 35.905 13.338 -9.061  1.00 37.42 ? 3151 HOH C O   1 
HETATM 2654 O  O   . HOH I 3 .   ? 61.932 12.903 -14.783 1.00 33.71 ? 3152 HOH C O   1 
HETATM 2655 O  O   . HOH I 3 .   ? 38.713 12.762 1.106   1.00 36.59 ? 3153 HOH C O   1 
HETATM 2656 O  O   . HOH I 3 .   ? 51.974 14.317 -16.737 1.00 35.02 ? 3154 HOH C O   1 
HETATM 2657 O  O   . HOH I 3 .   ? 33.907 0.017  0.045   1.00 44.04 ? 3155 HOH C O   1 
HETATM 2658 O  O   . HOH I 3 .   ? 44.709 11.312 -15.451 1.00 30.32 ? 3156 HOH C O   1 
HETATM 2659 O  O   . HOH I 3 .   ? 39.137 11.855 -2.079  1.00 36.45 ? 3157 HOH C O   1 
HETATM 2660 O  O   . HOH I 3 .   ? 40.692 -1.727 3.850   1.00 28.72 ? 3158 HOH C O   1 
HETATM 2661 O  O   . HOH I 3 .   ? 34.703 15.031 -1.872  1.00 43.98 ? 3159 HOH C O   1 
HETATM 2662 O  O   . HOH I 3 .   ? 40.224 8.989  0.658   1.00 43.07 ? 3160 HOH C O   1 
HETATM 2663 O  O   . HOH I 3 .   ? 49.350 5.143  5.450   1.00 40.19 ? 3161 HOH C O   1 
HETATM 2664 O  O   . HOH I 3 .   ? 42.431 -5.663 3.904   1.00 44.99 ? 3162 HOH C O   1 
HETATM 2665 O  O   . HOH I 3 .   ? 35.363 -1.617 3.464   1.00 43.88 ? 3163 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   HIS 9   9   9   HIS HIS A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  CYS 13  13  13  CYS CYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  SER 23  23  23  SER SER A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ASP 29  29  29  ASP ASP A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  CYS 48  48  48  CYS CYS A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  CYS 51  51  51  CYS CYS A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  TRP 77  77  77  TRP TRP A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  CYS 87  87  87  CYS CYS A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 HIS 107 107 107 HIS HIS A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 HIS 111 111 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   ILE 4   4   4   ILE ILE B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   HIS 9   9   9   HIS HIS B . n 
B 1 10  GLN 10  10  10  GLN GLN B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  LEU 12  12  12  LEU LEU B . n 
B 1 13  CYS 13  13  13  CYS CYS B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  ASP 15  15  15  ASP ASP B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  ALA 17  17  17  ALA ALA B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  GLU 20  20  20  GLU GLU B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  ASN 22  22  22  ASN ASN B . n 
B 1 23  SER 23  23  23  SER SER B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  THR 26  26  26  THR THR B . n 
B 1 27  ILE 27  27  27  ILE ILE B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  ASP 29  29  29  ASP ASP B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  ARG 33  33  33  ARG ARG B . n 
B 1 34  ASN 34  34  34  ASN ASN B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  ILE 36  36  36  ILE ILE B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  ILE 38  38  38  ILE ILE B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  CYS 42  42  42  CYS CYS B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  CYS 46  46  46  CYS CYS B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  CYS 48  48  48  CYS CYS B . n 
B 1 49  THR 49  49  49  THR THR B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  CYS 51  51  51  CYS CYS B . n 
B 1 52  HIS 52  52  52  HIS HIS B . n 
B 1 53  CYS 53  53  53  CYS CYS B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  ARG 56  56  56  ARG ARG B . n 
B 1 57  GLU 57  57  57  GLU GLU B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  PHE 59  59  59  PHE PHE B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  MET 72  72  72  MET MET B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  TRP 77  77  77  TRP TRP B . n 
B 1 78  GLY 78  78  78  GLY GLY B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  GLU 80  80  80  GLU GLU B . n 
B 1 81  PRO 81  81  81  PRO PRO B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  ARG 84  84  84  ARG ARG B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  SER 86  86  86  SER SER B . n 
B 1 87  CYS 87  87  87  CYS CYS B . n 
B 1 88  GLN 88  88  88  GLN GLN B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  THR 92  92  92  THR THR B . n 
B 1 93  ASP 93  93  93  ASP ASP B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  GLU 99  99  99  GLU GLU B . n 
B 1 100 ILE 100 100 100 ILE ILE B . n 
B 1 101 PRO 101 101 101 PRO PRO B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 TYR 103 103 103 TYR TYR B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 HIS 107 107 107 HIS HIS B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 ARG 109 109 109 ARG ARG B . n 
B 1 110 GLU 110 110 110 GLU ALA B . n 
B 1 111 HIS 111 111 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   PRO 2   2   2   PRO PRO C . n 
C 1 3   LYS 3   3   3   LYS LYS C . n 
C 1 4   ILE 4   4   4   ILE ILE C . n 
C 1 5   VAL 5   5   5   VAL VAL C . n 
C 1 6   ILE 6   6   6   ILE ILE C . n 
C 1 7   LEU 7   7   7   LEU LEU C . n 
C 1 8   PRO 8   8   8   PRO PRO C . n 
C 1 9   HIS 9   9   9   HIS HIS C . n 
C 1 10  GLN 10  10  10  GLN GLN C . n 
C 1 11  ASP 11  11  11  ASP ASP C . n 
C 1 12  LEU 12  12  12  LEU LEU C . n 
C 1 13  CYS 13  13  13  CYS CYS C . n 
C 1 14  PRO 14  14  14  PRO PRO C . n 
C 1 15  ASP 15  15  15  ASP ASP C . n 
C 1 16  GLY 16  16  16  GLY GLY C . n 
C 1 17  ALA 17  17  17  ALA ALA C . n 
C 1 18  VAL 18  18  18  VAL VAL C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  GLU 20  20  20  GLU GLU C . n 
C 1 21  ALA 21  21  21  ALA ALA C . n 
C 1 22  ASN 22  22  22  ASN ASN C . n 
C 1 23  SER 23  23  23  SER SER C . n 
C 1 24  GLY 24  24  24  GLY GLY C . n 
C 1 25  GLU 25  25  25  GLU GLU C . n 
C 1 26  THR 26  26  26  THR THR C . n 
C 1 27  ILE 27  27  27  ILE ILE C . n 
C 1 28  LEU 28  28  28  LEU LEU C . n 
C 1 29  ASP 29  29  29  ASP ASP C . n 
C 1 30  ALA 30  30  30  ALA ALA C . n 
C 1 31  ALA 31  31  31  ALA ALA C . n 
C 1 32  LEU 32  32  32  LEU LEU C . n 
C 1 33  ARG 33  33  33  ARG ARG C . n 
C 1 34  ASN 34  34  34  ASN ASN C . n 
C 1 35  GLY 35  35  35  GLY GLY C . n 
C 1 36  ILE 36  36  36  ILE ILE C . n 
C 1 37  GLU 37  37  37  GLU GLU C . n 
C 1 38  ILE 38  38  38  ILE ILE C . n 
C 1 39  GLU 39  39  39  GLU GLU C . n 
C 1 40  HIS 40  40  40  HIS HIS C . n 
C 1 41  ALA 41  41  41  ALA ALA C . n 
C 1 42  CYS 42  42  42  CYS CYS C . n 
C 1 43  GLU 43  43  43  GLU GLU C . n 
C 1 44  LYS 44  44  44  LYS LYS C . n 
C 1 45  SER 45  45  45  SER SER C . n 
C 1 46  CYS 46  46  46  CYS CYS C . n 
C 1 47  ALA 47  47  47  ALA ALA C . n 
C 1 48  CYS 48  48  48  CYS CYS C . n 
C 1 49  THR 49  49  49  THR THR C . n 
C 1 50  THR 50  50  50  THR THR C . n 
C 1 51  CYS 51  51  51  CYS CYS C . n 
C 1 52  HIS 52  52  52  HIS HIS C . n 
C 1 53  CYS 53  53  53  CYS CYS C . n 
C 1 54  ILE 54  54  54  ILE ILE C . n 
C 1 55  VAL 55  55  55  VAL VAL C . n 
C 1 56  ARG 56  56  56  ARG ARG C . n 
C 1 57  GLU 57  57  57  GLU GLU C . n 
C 1 58  GLY 58  58  58  GLY GLY C . n 
C 1 59  PHE 59  59  59  PHE PHE C . n 
C 1 60  ASP 60  60  60  ASP ASP C . n 
C 1 61  SER 61  61  61  SER SER C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  PRO 63  63  63  PRO PRO C . n 
C 1 64  GLU 64  64  64  GLU GLU C . n 
C 1 65  SER 65  65  65  SER SER C . n 
C 1 66  SER 66  66  66  SER SER C . n 
C 1 67  GLU 67  67  67  GLU GLU C . n 
C 1 68  GLN 68  68  68  GLN GLN C . n 
C 1 69  GLU 69  69  69  GLU GLU C . n 
C 1 70  ASP 70  70  70  ASP ASP C . n 
C 1 71  ASP 71  71  71  ASP ASP C . n 
C 1 72  MET 72  72  72  MET MET C . n 
C 1 73  LEU 73  73  73  LEU LEU C . n 
C 1 74  ASP 74  74  74  ASP ASP C . n 
C 1 75  LYS 75  75  75  LYS LYS C . n 
C 1 76  ALA 76  76  76  ALA ALA C . n 
C 1 77  TRP 77  77  77  TRP TRP C . n 
C 1 78  GLY 78  78  78  GLY GLY C . n 
C 1 79  LEU 79  79  79  LEU LEU C . n 
C 1 80  GLU 80  80  80  GLU GLU C . n 
C 1 81  PRO 81  81  81  PRO PRO C . n 
C 1 82  GLU 82  82  82  GLU GLU C . n 
C 1 83  SER 83  83  83  SER SER C . n 
C 1 84  ARG 84  84  84  ARG ARG C . n 
C 1 85  LEU 85  85  85  LEU LEU C . n 
C 1 86  SER 86  86  86  SER SER C . n 
C 1 87  CYS 87  87  87  CYS CYS C . n 
C 1 88  GLN 88  88  88  GLN GLN C . n 
C 1 89  ALA 89  89  89  ALA ALA C . n 
C 1 90  ARG 90  90  90  ARG ARG C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  THR 92  92  92  THR THR C . n 
C 1 93  ASP 93  93  93  ASP ASP C . n 
C 1 94  GLU 94  94  94  GLU GLU C . n 
C 1 95  ASP 95  95  95  ASP ASP C . n 
C 1 96  LEU 96  96  96  LEU LEU C . n 
C 1 97  VAL 97  97  97  VAL VAL C . n 
C 1 98  VAL 98  98  98  VAL VAL C . n 
C 1 99  GLU 99  99  99  GLU GLU C . n 
C 1 100 ILE 100 100 100 ILE ILE C . n 
C 1 101 PRO 101 101 101 PRO PRO C . n 
C 1 102 ARG 102 102 102 ARG ARG C . n 
C 1 103 TYR 103 103 103 TYR TYR C . n 
C 1 104 THR 104 104 104 THR THR C . n 
C 1 105 ILE 105 105 105 ILE ILE C . n 
C 1 106 ASN 106 106 106 ASN ASN C . n 
C 1 107 HIS 107 107 107 HIS HIS C . n 
C 1 108 ALA 108 108 108 ALA ALA C . n 
C 1 109 ARG 109 109 109 ARG ALA C . n 
C 1 110 GLU 110 110 ?   ?   ?   C . n 
C 1 111 HIS 111 111 ?   ?   ?   C . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
3 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,G 
2 1 B,E,H 
3 1 C,F,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 42 ? A CYS 42   ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 S1 ? D FES .  ? A FES 1112 ? 1_555 107.9 ? 
2  SG ? A CYS 42 ? A CYS 42   ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 S2 ? D FES .  ? A FES 1112 ? 1_555 118.7 ? 
3  S1 ? D FES .  ? A FES 1112 ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 S2 ? D FES .  ? A FES 1112 ? 1_555 105.3 ? 
4  SG ? A CYS 42 ? A CYS 42   ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 48 ? A CYS 48   ? 1_555 106.6 ? 
5  S1 ? D FES .  ? A FES 1112 ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 48 ? A CYS 48   ? 1_555 110.6 ? 
6  S2 ? D FES .  ? A FES 1112 ? 1_555 FE1 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 48 ? A CYS 48   ? 1_555 107.7 ? 
7  SG ? A CYS 51 ? A CYS 51   ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 S1 ? D FES .  ? A FES 1112 ? 1_555 112.7 ? 
8  SG ? A CYS 51 ? A CYS 51   ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 S2 ? D FES .  ? A FES 1112 ? 1_555 110.2 ? 
9  S1 ? D FES .  ? A FES 1112 ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 S2 ? D FES .  ? A FES 1112 ? 1_555 105.4 ? 
10 SG ? A CYS 51 ? A CYS 51   ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 87 ? A CYS 87   ? 1_555 104.5 ? 
11 S1 ? D FES .  ? A FES 1112 ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 87 ? A CYS 87   ? 1_555 105.3 ? 
12 S2 ? D FES .  ? A FES 1112 ? 1_555 FE2 ? D FES . ? A FES 1112 ? 1_555 SG ? A CYS 87 ? A CYS 87   ? 1_555 118.8 ? 
13 SG ? B CYS 42 ? B CYS 42   ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 S1 ? E FES .  ? B FES 2112 ? 1_555 110.7 ? 
14 SG ? B CYS 42 ? B CYS 42   ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 S2 ? E FES .  ? B FES 2112 ? 1_555 114.5 ? 
15 S1 ? E FES .  ? B FES 2112 ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 S2 ? E FES .  ? B FES 2112 ? 1_555 105.0 ? 
16 SG ? B CYS 42 ? B CYS 42   ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 48 ? B CYS 48   ? 1_555 108.6 ? 
17 S1 ? E FES .  ? B FES 2112 ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 48 ? B CYS 48   ? 1_555 110.0 ? 
18 S2 ? E FES .  ? B FES 2112 ? 1_555 FE1 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 48 ? B CYS 48   ? 1_555 108.0 ? 
19 SG ? B CYS 87 ? B CYS 87   ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 S1 ? E FES .  ? B FES 2112 ? 1_555 104.1 ? 
20 SG ? B CYS 87 ? B CYS 87   ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 S2 ? E FES .  ? B FES 2112 ? 1_555 118.3 ? 
21 S1 ? E FES .  ? B FES 2112 ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 S2 ? E FES .  ? B FES 2112 ? 1_555 106.2 ? 
22 SG ? B CYS 87 ? B CYS 87   ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 51 ? B CYS 51   ? 1_555 105.3 ? 
23 S1 ? E FES .  ? B FES 2112 ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 51 ? B CYS 51   ? 1_555 110.1 ? 
24 S2 ? E FES .  ? B FES 2112 ? 1_555 FE2 ? E FES . ? B FES 2112 ? 1_555 SG ? B CYS 51 ? B CYS 51   ? 1_555 112.4 ? 
25 SG ? C CYS 48 ? C CYS 48   ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 S1 ? F FES .  ? C FES 3112 ? 1_555 113.1 ? 
26 SG ? C CYS 48 ? C CYS 48   ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 S2 ? F FES .  ? C FES 3112 ? 1_555 107.9 ? 
27 S1 ? F FES .  ? C FES 3112 ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 S2 ? F FES .  ? C FES 3112 ? 1_555 105.6 ? 
28 SG ? C CYS 48 ? C CYS 48   ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 42 ? C CYS 42   ? 1_555 110.3 ? 
29 S1 ? F FES .  ? C FES 3112 ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 42 ? C CYS 42   ? 1_555 110.8 ? 
30 S2 ? F FES .  ? C FES 3112 ? 1_555 FE1 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 42 ? C CYS 42   ? 1_555 108.8 ? 
31 SG ? C CYS 51 ? C CYS 51   ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 S1 ? F FES .  ? C FES 3112 ? 1_555 105.6 ? 
32 SG ? C CYS 51 ? C CYS 51   ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 S2 ? F FES .  ? C FES 3112 ? 1_555 114.3 ? 
33 S1 ? F FES .  ? C FES 3112 ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 S2 ? F FES .  ? C FES 3112 ? 1_555 105.6 ? 
34 SG ? C CYS 51 ? C CYS 51   ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 87 ? C CYS 87   ? 1_555 103.2 ? 
35 S1 ? F FES .  ? C FES 3112 ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 87 ? C CYS 87   ? 1_555 106.0 ? 
36 S2 ? F FES .  ? C FES 3112 ? 1_555 FE2 ? F FES . ? C FES 3112 ? 1_555 SG ? C CYS 87 ? C CYS 87   ? 1_555 121.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-03-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       .         ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
CNS    phasing          .         ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 13  ? ? -168.78 68.72   
2 1 THR A 92  ? ? -116.96 -103.11 
3 1 CYS B 13  ? ? -164.17 67.30   
4 1 GLU B 37  ? ? -69.64  61.12   
5 1 THR B 92  ? ? -126.04 -93.26  
6 1 CYS C 13  ? ? -162.40 70.01   
7 1 CYS C 42  ? ? -78.65  20.19   
8 1 THR C 92  ? ? -112.17 -109.63 
9 1 HIS C 107 ? ? -68.51  11.88   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B GLU 110 ? CG  ? B GLU 110 CG  
2  1 Y 1 B GLU 110 ? CD  ? B GLU 110 CD  
3  1 Y 1 B GLU 110 ? OE1 ? B GLU 110 OE1 
4  1 Y 1 B GLU 110 ? OE2 ? B GLU 110 OE2 
5  1 Y 1 C ARG 109 ? CG  ? C ARG 109 CG  
6  1 Y 1 C ARG 109 ? CD  ? C ARG 109 CD  
7  1 Y 1 C ARG 109 ? NE  ? C ARG 109 NE  
8  1 Y 1 C ARG 109 ? CZ  ? C ARG 109 CZ  
9  1 Y 1 C ARG 109 ? NH1 ? C ARG 109 NH1 
10 1 Y 1 C ARG 109 ? NH2 ? C ARG 109 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A HIS 111 ? A HIS 111 
3 1 Y 1 B MET 1   ? B MET 1   
4 1 Y 1 B HIS 111 ? B HIS 111 
5 1 Y 1 C MET 1   ? C MET 1   
6 1 Y 1 C GLU 110 ? C GLU 110 
7 1 Y 1 C HIS 111 ? C HIS 111 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE2/S2 (INORGANIC) CLUSTER' FES 
3 water                        HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 FES 1  1112 112 FES FES A . 
E 2 FES 1  2112 112 FES FES B . 
F 2 FES 1  3112 112 FES FES C . 
G 3 HOH 1  1113 7   HOH TIP A . 
G 3 HOH 2  1114 9   HOH TIP A . 
G 3 HOH 3  1115 12  HOH TIP A . 
G 3 HOH 4  1116 13  HOH TIP A . 
G 3 HOH 5  1117 17  HOH TIP A . 
G 3 HOH 6  1118 23  HOH TIP A . 
G 3 HOH 7  1119 24  HOH TIP A . 
G 3 HOH 8  1120 29  HOH TIP A . 
G 3 HOH 9  1121 32  HOH TIP A . 
G 3 HOH 10 1122 39  HOH TIP A . 
G 3 HOH 11 1123 40  HOH TIP A . 
G 3 HOH 12 1124 43  HOH TIP A . 
G 3 HOH 13 1125 51  HOH TIP A . 
G 3 HOH 14 1126 54  HOH TIP A . 
G 3 HOH 15 1127 60  HOH TIP A . 
G 3 HOH 16 1128 71  HOH TIP A . 
G 3 HOH 17 1129 72  HOH TIP A . 
G 3 HOH 18 1130 73  HOH TIP A . 
G 3 HOH 19 1131 76  HOH TIP A . 
G 3 HOH 20 1132 83  HOH TIP A . 
G 3 HOH 21 1133 88  HOH TIP A . 
G 3 HOH 22 1134 90  HOH TIP A . 
G 3 HOH 23 1135 93  HOH TIP A . 
G 3 HOH 24 1136 95  HOH TIP A . 
G 3 HOH 25 1137 98  HOH TIP A . 
G 3 HOH 26 1138 99  HOH TIP A . 
G 3 HOH 27 1139 104 HOH TIP A . 
G 3 HOH 28 1140 105 HOH TIP A . 
G 3 HOH 29 1141 107 HOH TIP A . 
G 3 HOH 30 1142 108 HOH TIP A . 
G 3 HOH 31 1143 111 HOH TIP A . 
G 3 HOH 32 1144 112 HOH TIP A . 
G 3 HOH 33 1145 120 HOH TIP A . 
G 3 HOH 34 1146 122 HOH TIP A . 
G 3 HOH 35 1147 124 HOH TIP A . 
G 3 HOH 36 1148 125 HOH TIP A . 
G 3 HOH 37 1149 136 HOH TIP A . 
G 3 HOH 38 1150 137 HOH TIP A . 
G 3 HOH 39 1151 139 HOH TIP A . 
G 3 HOH 40 1152 141 HOH TIP A . 
G 3 HOH 41 1153 143 HOH TIP A . 
G 3 HOH 42 1154 145 HOH TIP A . 
G 3 HOH 43 1155 155 HOH TIP A . 
H 3 HOH 1  2113 1   HOH TIP B . 
H 3 HOH 2  2114 2   HOH TIP B . 
H 3 HOH 3  2115 4   HOH TIP B . 
H 3 HOH 4  2116 5   HOH TIP B . 
H 3 HOH 5  2117 6   HOH TIP B . 
H 3 HOH 6  2118 10  HOH TIP B . 
H 3 HOH 7  2119 11  HOH TIP B . 
H 3 HOH 8  2120 15  HOH TIP B . 
H 3 HOH 9  2121 18  HOH TIP B . 
H 3 HOH 10 2122 19  HOH TIP B . 
H 3 HOH 11 2123 20  HOH TIP B . 
H 3 HOH 12 2124 21  HOH TIP B . 
H 3 HOH 13 2125 22  HOH TIP B . 
H 3 HOH 14 2126 26  HOH TIP B . 
H 3 HOH 15 2127 27  HOH TIP B . 
H 3 HOH 16 2128 28  HOH TIP B . 
H 3 HOH 17 2129 33  HOH TIP B . 
H 3 HOH 18 2130 34  HOH TIP B . 
H 3 HOH 19 2131 35  HOH TIP B . 
H 3 HOH 20 2132 41  HOH TIP B . 
H 3 HOH 21 2133 42  HOH TIP B . 
H 3 HOH 22 2134 44  HOH TIP B . 
H 3 HOH 23 2135 46  HOH TIP B . 
H 3 HOH 24 2136 49  HOH TIP B . 
H 3 HOH 25 2137 50  HOH TIP B . 
H 3 HOH 26 2138 52  HOH TIP B . 
H 3 HOH 27 2139 58  HOH TIP B . 
H 3 HOH 28 2140 59  HOH TIP B . 
H 3 HOH 29 2141 62  HOH TIP B . 
H 3 HOH 30 2142 63  HOH TIP B . 
H 3 HOH 31 2143 65  HOH TIP B . 
H 3 HOH 32 2144 66  HOH TIP B . 
H 3 HOH 33 2145 67  HOH TIP B . 
H 3 HOH 34 2146 68  HOH TIP B . 
H 3 HOH 35 2147 69  HOH TIP B . 
H 3 HOH 36 2148 77  HOH TIP B . 
H 3 HOH 37 2149 79  HOH TIP B . 
H 3 HOH 38 2150 80  HOH TIP B . 
H 3 HOH 39 2151 81  HOH TIP B . 
H 3 HOH 40 2152 84  HOH TIP B . 
H 3 HOH 41 2153 85  HOH TIP B . 
H 3 HOH 42 2154 87  HOH TIP B . 
H 3 HOH 43 2155 91  HOH TIP B . 
H 3 HOH 44 2156 92  HOH TIP B . 
H 3 HOH 45 2157 106 HOH TIP B . 
H 3 HOH 46 2158 110 HOH TIP B . 
H 3 HOH 47 2159 115 HOH TIP B . 
H 3 HOH 48 2160 121 HOH TIP B . 
H 3 HOH 49 2161 126 HOH TIP B . 
H 3 HOH 50 2162 127 HOH TIP B . 
H 3 HOH 51 2163 129 HOH TIP B . 
H 3 HOH 52 2164 130 HOH TIP B . 
H 3 HOH 53 2165 135 HOH TIP B . 
H 3 HOH 54 2166 138 HOH TIP B . 
H 3 HOH 55 2167 140 HOH TIP B . 
H 3 HOH 56 2168 144 HOH TIP B . 
H 3 HOH 57 2169 147 HOH TIP B . 
H 3 HOH 58 2170 149 HOH TIP B . 
H 3 HOH 59 2171 150 HOH TIP B . 
H 3 HOH 60 2172 151 HOH TIP B . 
H 3 HOH 61 2173 153 HOH TIP B . 
I 3 HOH 1  3113 3   HOH TIP C . 
I 3 HOH 2  3114 8   HOH TIP C . 
I 3 HOH 3  3115 14  HOH TIP C . 
I 3 HOH 4  3116 16  HOH TIP C . 
I 3 HOH 5  3117 25  HOH TIP C . 
I 3 HOH 6  3118 30  HOH TIP C . 
I 3 HOH 7  3119 31  HOH TIP C . 
I 3 HOH 8  3120 36  HOH TIP C . 
I 3 HOH 9  3121 37  HOH TIP C . 
I 3 HOH 10 3122 38  HOH TIP C . 
I 3 HOH 11 3123 45  HOH TIP C . 
I 3 HOH 12 3124 47  HOH TIP C . 
I 3 HOH 13 3125 48  HOH TIP C . 
I 3 HOH 14 3126 53  HOH TIP C . 
I 3 HOH 15 3127 55  HOH TIP C . 
I 3 HOH 16 3128 56  HOH TIP C . 
I 3 HOH 17 3129 57  HOH TIP C . 
I 3 HOH 18 3130 61  HOH TIP C . 
I 3 HOH 19 3131 64  HOH TIP C . 
I 3 HOH 20 3132 70  HOH TIP C . 
I 3 HOH 21 3133 74  HOH TIP C . 
I 3 HOH 22 3134 75  HOH TIP C . 
I 3 HOH 23 3135 78  HOH TIP C . 
I 3 HOH 24 3136 82  HOH TIP C . 
I 3 HOH 25 3137 86  HOH TIP C . 
I 3 HOH 26 3138 89  HOH TIP C . 
I 3 HOH 27 3139 94  HOH TIP C . 
I 3 HOH 28 3140 96  HOH TIP C . 
I 3 HOH 29 3141 97  HOH TIP C . 
I 3 HOH 30 3142 100 HOH TIP C . 
I 3 HOH 31 3143 101 HOH TIP C . 
I 3 HOH 32 3144 102 HOH TIP C . 
I 3 HOH 33 3145 103 HOH TIP C . 
I 3 HOH 34 3146 109 HOH TIP C . 
I 3 HOH 35 3147 113 HOH TIP C . 
I 3 HOH 36 3148 114 HOH TIP C . 
I 3 HOH 37 3149 116 HOH TIP C . 
I 3 HOH 38 3150 117 HOH TIP C . 
I 3 HOH 39 3151 118 HOH TIP C . 
I 3 HOH 40 3152 119 HOH TIP C . 
I 3 HOH 41 3153 123 HOH TIP C . 
I 3 HOH 42 3154 128 HOH TIP C . 
I 3 HOH 43 3155 131 HOH TIP C . 
I 3 HOH 44 3156 132 HOH TIP C . 
I 3 HOH 45 3157 133 HOH TIP C . 
I 3 HOH 46 3158 134 HOH TIP C . 
I 3 HOH 47 3159 142 HOH TIP C . 
I 3 HOH 48 3160 146 HOH TIP C . 
I 3 HOH 49 3161 148 HOH TIP C . 
I 3 HOH 50 3162 152 HOH TIP C . 
I 3 HOH 51 3163 154 HOH TIP C . 
#