data_1I84
# 
_entry.id   1I84 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I84         
RCSB  RCSB013023   
WWPDB D_1000013023 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2MYS 'Chicken skeletal muscle myosin subfragment 1, alpha carbon coordinates only for the two light chains'      unspecified 
PDB 1BR1 'Smooth muscle myosin motor domain essential light chain complex with MgADP.AlF4 bound at the active site.' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I84 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wendt, T.'    1 
'Taylor, D.'   2 
'Trybus, K.M.' 3 
'Taylor, K.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Three-dimensional image reconstruction of dephosphorylated smooth muscle heavy meromyosin reveals asymmetry in the interaction between myosin heads and placement of subfragment 2.
;
Proc.Natl.Acad.Sci.USA  98  4361 4366 2001 PNASA6 US 0027-8424 0040 ? 11287639 10.1073/pnas.071051098          
1       'Visualization of Head-head Interactions in the Inhibited State of Smooth Muscle Myosin' 'J.Cell Biol.'          147 1385 
1390 1999 JCLBA3 US 0021-9525 2019 ? ?        10.1083/jcb.147.7.1385          
2       
;Crystal Structure of a Vertebrate Smooth Muscle Myosin Motor Domain and its Complex with the Essential Light Chain: Visualization of the Pre-power Stroke State
;
'Cell(Cambridge,Mass.)' 94  559  571  1998 CELLB5 US 0092-8674 0998 ? ?        '10.1016/S0092-8674(00)81598-6' 
3       'Three-dimensional Structure of Myosin Subfragment-1: a Molecular Motor' Science                 261 50   58   1993 SCIEAS 
US 0036-8075 0038 ? ?        ?                               
4       'The Structure of the Head-tail Junction of the Myosin Molecule' J.Mol.Biol.             256 407  416  1996 JMOBAK UK 
0022-2836 0070 ? ?        10.1006/jmbi.1996.0096          
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wendt, T.'        1  
primary 'Taylor, D.'       2  
primary 'Trybus, K.M.'     3  
primary 'Taylor, K.'       4  
1       'Wendt, T.'        5  
1       'Taylor, D.'       6  
1       'Messier, T.'      7  
1       'Trybus, K.M.'     8  
1       'Taylor, K.A.'     9  
2       'Dominguez, R.'    10 
2       'Freyzon, Y.'      11 
2       'Trybus, K.M.'     12 
2       'Cohen, C.'        13 
3       'Rayment, I.'      14 
3       'Rypniewsky, W.R.' 15 
3       'Schmidt-Base, K.' 16 
3       'Smith, R.'        17 
3       'Tomchick, D.R.'   18 
3       'Benning, M.M.'    19 
3       'Winkelmann, D.A.' 20 
3       'Wesenberg, G.'    21 
3       'Holden, H.M.'     22 
4       'Offer, G.'        23 
4       'Knight, P.'       24 
# 
_cell.entry_id           1I84 
_cell.length_a           133.0 
_cell.length_b           304.0 
_cell.length_c           200.0 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        91.5 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1I84 
_symmetry.space_group_name_H-M             'P 1 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                3 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SMOOTH MUSCLE MYOSIN HEAVY CHAIN'            137072.938 2 3.6.1.32 ? 'MEROMYOSIN SUBFRAGMENT. S1 AND S2 FRAGMENTS.' 
? 
2 polymer man 'SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN'  16873.025  2 ?        ? 'S1 FRAGMENT'                                  
? 
3 polymer man 'SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN' 18329.598  2 ?        ? 'S1 FRAGMENT'                                  
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MYOSIN HEAVY CHAIN, GIZZARD SMOOTH MUSCLE'                   
2 'ELC, MYOSIN ALKALI LIGHT CHAIN'                              
3 'RLC, MYOSIN REGULATORY LIGHT CHAIN 2, SMOOTH MUSCLE (MAJOR)' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQENGKKVTLSKDDIQKMNPP
KFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAY
RSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQMRNDLLLEGFNNYTFLSNGHV
PIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRS
ILTPRIKVGRDVVQKAQTKEQADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALLDEECWFPKATDTSFVEKLIQ
EQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKNMDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMT
ESSLPSASKTKKGMFRTVGQLYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIIAFQA
QCRGYLARKAFAKRQQQLESIFCIQYNVRSFMNV(MLY)HWPWM(MLY)LFF(MLY)I(MLY)PLLKVTRQEEEMQAKDE
ELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQ
QLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEE
EKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARL
EDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDDK
;
;AQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQENGKKVTLSKDDIQKMNPP
KFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAY
RSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQMRNDLLLEGFNNYTFLSNGHV
PIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRS
ILTPRIKVGRDVVQKAQTKEQADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALLDEECWFPKATDTSFVEKLIQ
EQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKNMDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMT
ESSLPSASKTKKGMFRTVGQLYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIIAFQA
QCRGYLARKAFAKRQQQLESIFCIQYNVRSFMNVKHWPWMKLFFKIKPLLKVTRQEEEMQAKDEELQRTKERQQKAEAEL
KELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDL
EEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESM
ISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRE
LESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDDDDK
;
S,V ? 
2 'polypeptide(L)' no no  
;CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNK
DQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
;
;CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNK
DQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
;
T,W ? 
3 'polypeptide(L)' no no  
;PKKAKRRAAEGSSNVFSMFDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVF
LTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHG
EDAEGE
;
;PKKAKRRAAEGSSNVFSMFDETEIEDFKEAFTVIDQNADGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVF
LTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTGGGRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHG
EDAEGE
;
U,Z ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    ALA n 
1 2    GLN n 
1 3    LYS n 
1 4    PRO n 
1 5    LEU n 
1 6    SER n 
1 7    ASP n 
1 8    ASP n 
1 9    GLU n 
1 10   LYS n 
1 11   PHE n 
1 12   LEU n 
1 13   PHE n 
1 14   VAL n 
1 15   ASP n 
1 16   LYS n 
1 17   ASN n 
1 18   PHE n 
1 19   VAL n 
1 20   ASN n 
1 21   ASN n 
1 22   PRO n 
1 23   LEU n 
1 24   ALA n 
1 25   GLN n 
1 26   ALA n 
1 27   ASP n 
1 28   TRP n 
1 29   SER n 
1 30   ALA n 
1 31   LYS n 
1 32   LYS n 
1 33   LEU n 
1 34   VAL n 
1 35   TRP n 
1 36   VAL n 
1 37   PRO n 
1 38   SER n 
1 39   GLU n 
1 40   LYS n 
1 41   HIS n 
1 42   GLY n 
1 43   PHE n 
1 44   GLU n 
1 45   ALA n 
1 46   ALA n 
1 47   SER n 
1 48   ILE n 
1 49   LYS n 
1 50   GLU n 
1 51   GLU n 
1 52   LYS n 
1 53   GLY n 
1 54   ASP n 
1 55   GLU n 
1 56   VAL n 
1 57   THR n 
1 58   VAL n 
1 59   GLU n 
1 60   LEU n 
1 61   GLN n 
1 62   GLU n 
1 63   ASN n 
1 64   GLY n 
1 65   LYS n 
1 66   LYS n 
1 67   VAL n 
1 68   THR n 
1 69   LEU n 
1 70   SER n 
1 71   LYS n 
1 72   ASP n 
1 73   ASP n 
1 74   ILE n 
1 75   GLN n 
1 76   LYS n 
1 77   MET n 
1 78   ASN n 
1 79   PRO n 
1 80   PRO n 
1 81   LYS n 
1 82   PHE n 
1 83   SER n 
1 84   LYS n 
1 85   VAL n 
1 86   GLU n 
1 87   ASP n 
1 88   MET n 
1 89   ALA n 
1 90   GLU n 
1 91   LEU n 
1 92   THR n 
1 93   CYS n 
1 94   LEU n 
1 95   ASN n 
1 96   GLU n 
1 97   ALA n 
1 98   SER n 
1 99   VAL n 
1 100  LEU n 
1 101  HIS n 
1 102  ASN n 
1 103  LEU n 
1 104  ARG n 
1 105  GLU n 
1 106  ARG n 
1 107  TYR n 
1 108  PHE n 
1 109  SER n 
1 110  GLY n 
1 111  LEU n 
1 112  ILE n 
1 113  TYR n 
1 114  THR n 
1 115  TYR n 
1 116  SER n 
1 117  GLY n 
1 118  LEU n 
1 119  PHE n 
1 120  CYS n 
1 121  VAL n 
1 122  VAL n 
1 123  ILE n 
1 124  ASN n 
1 125  PRO n 
1 126  TYR n 
1 127  LYS n 
1 128  GLN n 
1 129  LEU n 
1 130  PRO n 
1 131  ILE n 
1 132  TYR n 
1 133  SER n 
1 134  GLU n 
1 135  LYS n 
1 136  ILE n 
1 137  ILE n 
1 138  ASP n 
1 139  MET n 
1 140  TYR n 
1 141  LYS n 
1 142  GLY n 
1 143  LYS n 
1 144  LYS n 
1 145  ARG n 
1 146  HIS n 
1 147  GLU n 
1 148  MET n 
1 149  PRO n 
1 150  PRO n 
1 151  HIS n 
1 152  ILE n 
1 153  TYR n 
1 154  ALA n 
1 155  ILE n 
1 156  ALA n 
1 157  ASP n 
1 158  THR n 
1 159  ALA n 
1 160  TYR n 
1 161  ARG n 
1 162  SER n 
1 163  MET n 
1 164  LEU n 
1 165  GLN n 
1 166  ASP n 
1 167  ARG n 
1 168  GLU n 
1 169  ASP n 
1 170  GLN n 
1 171  SER n 
1 172  ILE n 
1 173  LEU n 
1 174  CYS n 
1 175  THR n 
1 176  GLY n 
1 177  GLU n 
1 178  SER n 
1 179  GLY n 
1 180  ALA n 
1 181  GLY n 
1 182  LYS n 
1 183  THR n 
1 184  GLU n 
1 185  ASN n 
1 186  THR n 
1 187  LYS n 
1 188  LYS n 
1 189  VAL n 
1 190  ILE n 
1 191  GLN n 
1 192  TYR n 
1 193  LEU n 
1 194  ALA n 
1 195  VAL n 
1 196  VAL n 
1 197  ALA n 
1 198  SER n 
1 199  SER n 
1 200  HIS n 
1 201  LYS n 
1 202  GLY n 
1 203  LYS n 
1 204  LYS n 
1 205  ASP n 
1 206  THR n 
1 207  SER n 
1 208  ILE n 
1 209  THR n 
1 210  GLN n 
1 211  GLY n 
1 212  PRO n 
1 213  SER n 
1 214  PHE n 
1 215  SER n 
1 216  TYR n 
1 217  GLY n 
1 218  GLU n 
1 219  LEU n 
1 220  GLU n 
1 221  LYS n 
1 222  GLN n 
1 223  LEU n 
1 224  LEU n 
1 225  GLN n 
1 226  ALA n 
1 227  ASN n 
1 228  PRO n 
1 229  ILE n 
1 230  LEU n 
1 231  GLU n 
1 232  ALA n 
1 233  PHE n 
1 234  GLY n 
1 235  ASN n 
1 236  ALA n 
1 237  LYS n 
1 238  THR n 
1 239  VAL n 
1 240  LYS n 
1 241  ASN n 
1 242  ASP n 
1 243  ASN n 
1 244  SER n 
1 245  SER n 
1 246  ARG n 
1 247  PHE n 
1 248  GLY n 
1 249  LYS n 
1 250  PHE n 
1 251  ILE n 
1 252  ARG n 
1 253  ILE n 
1 254  ASN n 
1 255  PHE n 
1 256  ASP n 
1 257  VAL n 
1 258  THR n 
1 259  GLY n 
1 260  TYR n 
1 261  ILE n 
1 262  VAL n 
1 263  GLY n 
1 264  ALA n 
1 265  ASN n 
1 266  ILE n 
1 267  GLU n 
1 268  THR n 
1 269  TYR n 
1 270  LEU n 
1 271  LEU n 
1 272  GLU n 
1 273  LYS n 
1 274  SER n 
1 275  ARG n 
1 276  ALA n 
1 277  ILE n 
1 278  ARG n 
1 279  GLN n 
1 280  ALA n 
1 281  LYS n 
1 282  ASP n 
1 283  GLU n 
1 284  ARG n 
1 285  THR n 
1 286  PHE n 
1 287  HIS n 
1 288  ILE n 
1 289  PHE n 
1 290  TYR n 
1 291  TYR n 
1 292  LEU n 
1 293  ILE n 
1 294  ALA n 
1 295  GLY n 
1 296  ALA n 
1 297  SER n 
1 298  GLU n 
1 299  GLN n 
1 300  MET n 
1 301  ARG n 
1 302  ASN n 
1 303  ASP n 
1 304  LEU n 
1 305  LEU n 
1 306  LEU n 
1 307  GLU n 
1 308  GLY n 
1 309  PHE n 
1 310  ASN n 
1 311  ASN n 
1 312  TYR n 
1 313  THR n 
1 314  PHE n 
1 315  LEU n 
1 316  SER n 
1 317  ASN n 
1 318  GLY n 
1 319  HIS n 
1 320  VAL n 
1 321  PRO n 
1 322  ILE n 
1 323  PRO n 
1 324  ALA n 
1 325  GLN n 
1 326  GLN n 
1 327  ASP n 
1 328  ASP n 
1 329  GLU n 
1 330  MET n 
1 331  PHE n 
1 332  GLN n 
1 333  GLU n 
1 334  THR n 
1 335  LEU n 
1 336  GLU n 
1 337  ALA n 
1 338  MET n 
1 339  THR n 
1 340  ILE n 
1 341  MET n 
1 342  GLY n 
1 343  PHE n 
1 344  THR n 
1 345  GLU n 
1 346  GLU n 
1 347  GLU n 
1 348  GLN n 
1 349  THR n 
1 350  SER n 
1 351  ILE n 
1 352  LEU n 
1 353  ARG n 
1 354  VAL n 
1 355  VAL n 
1 356  SER n 
1 357  SER n 
1 358  VAL n 
1 359  LEU n 
1 360  GLN n 
1 361  LEU n 
1 362  GLY n 
1 363  ASN n 
1 364  ILE n 
1 365  VAL n 
1 366  PHE n 
1 367  LYS n 
1 368  LYS n 
1 369  GLU n 
1 370  ARG n 
1 371  ASN n 
1 372  THR n 
1 373  ASP n 
1 374  GLN n 
1 375  ALA n 
1 376  SER n 
1 377  MET n 
1 378  PRO n 
1 379  ASP n 
1 380  ASN n 
1 381  THR n 
1 382  ALA n 
1 383  ALA n 
1 384  GLN n 
1 385  LYS n 
1 386  VAL n 
1 387  CYS n 
1 388  HIS n 
1 389  LEU n 
1 390  MET n 
1 391  GLY n 
1 392  ILE n 
1 393  ASN n 
1 394  VAL n 
1 395  THR n 
1 396  ASP n 
1 397  PHE n 
1 398  THR n 
1 399  ARG n 
1 400  SER n 
1 401  ILE n 
1 402  LEU n 
1 403  THR n 
1 404  PRO n 
1 405  ARG n 
1 406  ILE n 
1 407  LYS n 
1 408  VAL n 
1 409  GLY n 
1 410  ARG n 
1 411  ASP n 
1 412  VAL n 
1 413  VAL n 
1 414  GLN n 
1 415  LYS n 
1 416  ALA n 
1 417  GLN n 
1 418  THR n 
1 419  LYS n 
1 420  GLU n 
1 421  GLN n 
1 422  ALA n 
1 423  ASP n 
1 424  PHE n 
1 425  ALA n 
1 426  ILE n 
1 427  GLU n 
1 428  ALA n 
1 429  LEU n 
1 430  ALA n 
1 431  LYS n 
1 432  ALA n 
1 433  LYS n 
1 434  PHE n 
1 435  GLU n 
1 436  ARG n 
1 437  LEU n 
1 438  PHE n 
1 439  ARG n 
1 440  TRP n 
1 441  ILE n 
1 442  LEU n 
1 443  THR n 
1 444  ARG n 
1 445  VAL n 
1 446  ASN n 
1 447  LYS n 
1 448  ALA n 
1 449  LEU n 
1 450  ASP n 
1 451  LYS n 
1 452  THR n 
1 453  LYS n 
1 454  ARG n 
1 455  GLN n 
1 456  GLY n 
1 457  ALA n 
1 458  SER n 
1 459  PHE n 
1 460  LEU n 
1 461  GLY n 
1 462  ILE n 
1 463  LEU n 
1 464  ASP n 
1 465  ILE n 
1 466  ALA n 
1 467  GLY n 
1 468  PHE n 
1 469  GLU n 
1 470  ILE n 
1 471  PHE n 
1 472  GLU n 
1 473  ILE n 
1 474  ASN n 
1 475  SER n 
1 476  PHE n 
1 477  GLU n 
1 478  GLN n 
1 479  LEU n 
1 480  CYS n 
1 481  ILE n 
1 482  ASN n 
1 483  TYR n 
1 484  THR n 
1 485  ASN n 
1 486  GLU n 
1 487  LYS n 
1 488  LEU n 
1 489  GLN n 
1 490  GLN n 
1 491  LEU n 
1 492  PHE n 
1 493  ASN n 
1 494  HIS n 
1 495  THR n 
1 496  MET n 
1 497  PHE n 
1 498  ILE n 
1 499  LEU n 
1 500  GLU n 
1 501  GLN n 
1 502  GLU n 
1 503  GLU n 
1 504  TYR n 
1 505  GLN n 
1 506  ARG n 
1 507  GLU n 
1 508  GLY n 
1 509  ILE n 
1 510  GLU n 
1 511  TRP n 
1 512  ASN n 
1 513  PHE n 
1 514  ILE n 
1 515  ASP n 
1 516  PHE n 
1 517  GLY n 
1 518  LEU n 
1 519  ASP n 
1 520  LEU n 
1 521  GLN n 
1 522  PRO n 
1 523  CYS n 
1 524  ILE n 
1 525  GLU n 
1 526  LEU n 
1 527  ILE n 
1 528  GLU n 
1 529  ARG n 
1 530  PRO n 
1 531  THR n 
1 532  ASN n 
1 533  PRO n 
1 534  PRO n 
1 535  GLY n 
1 536  VAL n 
1 537  LEU n 
1 538  ALA n 
1 539  LEU n 
1 540  LEU n 
1 541  ASP n 
1 542  GLU n 
1 543  GLU n 
1 544  CYS n 
1 545  TRP n 
1 546  PHE n 
1 547  PRO n 
1 548  LYS n 
1 549  ALA n 
1 550  THR n 
1 551  ASP n 
1 552  THR n 
1 553  SER n 
1 554  PHE n 
1 555  VAL n 
1 556  GLU n 
1 557  LYS n 
1 558  LEU n 
1 559  ILE n 
1 560  GLN n 
1 561  GLU n 
1 562  GLN n 
1 563  GLY n 
1 564  ASN n 
1 565  HIS n 
1 566  ALA n 
1 567  LYS n 
1 568  PHE n 
1 569  GLN n 
1 570  LYS n 
1 571  SER n 
1 572  LYS n 
1 573  GLN n 
1 574  LEU n 
1 575  LYS n 
1 576  ASP n 
1 577  LYS n 
1 578  THR n 
1 579  GLU n 
1 580  PHE n 
1 581  CYS n 
1 582  ILE n 
1 583  LEU n 
1 584  HIS n 
1 585  TYR n 
1 586  ALA n 
1 587  GLY n 
1 588  LYS n 
1 589  VAL n 
1 590  THR n 
1 591  TYR n 
1 592  ASN n 
1 593  ALA n 
1 594  SER n 
1 595  ALA n 
1 596  TRP n 
1 597  LEU n 
1 598  THR n 
1 599  LYS n 
1 600  ASN n 
1 601  MET n 
1 602  ASP n 
1 603  PRO n 
1 604  LEU n 
1 605  ASN n 
1 606  ASP n 
1 607  ASN n 
1 608  VAL n 
1 609  THR n 
1 610  SER n 
1 611  LEU n 
1 612  LEU n 
1 613  ASN n 
1 614  GLN n 
1 615  SER n 
1 616  SER n 
1 617  ASP n 
1 618  LYS n 
1 619  PHE n 
1 620  VAL n 
1 621  ALA n 
1 622  ASP n 
1 623  LEU n 
1 624  TRP n 
1 625  LYS n 
1 626  ASP n 
1 627  VAL n 
1 628  ASP n 
1 629  ARG n 
1 630  ILE n 
1 631  VAL n 
1 632  GLY n 
1 633  LEU n 
1 634  ASP n 
1 635  GLN n 
1 636  MET n 
1 637  ALA n 
1 638  LYS n 
1 639  MET n 
1 640  THR n 
1 641  GLU n 
1 642  SER n 
1 643  SER n 
1 644  LEU n 
1 645  PRO n 
1 646  SER n 
1 647  ALA n 
1 648  SER n 
1 649  LYS n 
1 650  THR n 
1 651  LYS n 
1 652  LYS n 
1 653  GLY n 
1 654  MET n 
1 655  PHE n 
1 656  ARG n 
1 657  THR n 
1 658  VAL n 
1 659  GLY n 
1 660  GLN n 
1 661  LEU n 
1 662  TYR n 
1 663  LYS n 
1 664  GLU n 
1 665  GLN n 
1 666  LEU n 
1 667  THR n 
1 668  LYS n 
1 669  LEU n 
1 670  MET n 
1 671  THR n 
1 672  THR n 
1 673  LEU n 
1 674  ARG n 
1 675  ASN n 
1 676  THR n 
1 677  ASN n 
1 678  PRO n 
1 679  ASN n 
1 680  PHE n 
1 681  VAL n 
1 682  ARG n 
1 683  CYS n 
1 684  ILE n 
1 685  ILE n 
1 686  PRO n 
1 687  ASN n 
1 688  HIS n 
1 689  GLU n 
1 690  LYS n 
1 691  ARG n 
1 692  ALA n 
1 693  GLY n 
1 694  LYS n 
1 695  LEU n 
1 696  ASP n 
1 697  ALA n 
1 698  HIS n 
1 699  LEU n 
1 700  VAL n 
1 701  LEU n 
1 702  GLU n 
1 703  GLN n 
1 704  LEU n 
1 705  ARG n 
1 706  CYS n 
1 707  ASN n 
1 708  GLY n 
1 709  VAL n 
1 710  LEU n 
1 711  GLU n 
1 712  GLY n 
1 713  ILE n 
1 714  ARG n 
1 715  ILE n 
1 716  CYS n 
1 717  ARG n 
1 718  GLN n 
1 719  GLY n 
1 720  PHE n 
1 721  PRO n 
1 722  ASN n 
1 723  ARG n 
1 724  ILE n 
1 725  VAL n 
1 726  PHE n 
1 727  GLN n 
1 728  GLU n 
1 729  PHE n 
1 730  ARG n 
1 731  GLN n 
1 732  ARG n 
1 733  TYR n 
1 734  GLU n 
1 735  ILE n 
1 736  LEU n 
1 737  ALA n 
1 738  ALA n 
1 739  ASN n 
1 740  ALA n 
1 741  ILE n 
1 742  PRO n 
1 743  LYS n 
1 744  GLY n 
1 745  PHE n 
1 746  MET n 
1 747  ASP n 
1 748  GLY n 
1 749  LYS n 
1 750  GLN n 
1 751  ALA n 
1 752  CYS n 
1 753  ILE n 
1 754  LEU n 
1 755  MET n 
1 756  ILE n 
1 757  LYS n 
1 758  ALA n 
1 759  LEU n 
1 760  GLU n 
1 761  LEU n 
1 762  ASP n 
1 763  PRO n 
1 764  ASN n 
1 765  LEU n 
1 766  TYR n 
1 767  ARG n 
1 768  ILE n 
1 769  GLY n 
1 770  GLN n 
1 771  SER n 
1 772  LYS n 
1 773  ILE n 
1 774  PHE n 
1 775  PHE n 
1 776  ARG n 
1 777  THR n 
1 778  GLY n 
1 779  VAL n 
1 780  LEU n 
1 781  ALA n 
1 782  HIS n 
1 783  LEU n 
1 784  GLU n 
1 785  GLU n 
1 786  GLU n 
1 787  ARG n 
1 788  ASP n 
1 789  LEU n 
1 790  LYS n 
1 791  ILE n 
1 792  THR n 
1 793  ASP n 
1 794  VAL n 
1 795  ILE n 
1 796  ILE n 
1 797  ALA n 
1 798  PHE n 
1 799  GLN n 
1 800  ALA n 
1 801  GLN n 
1 802  CYS n 
1 803  ARG n 
1 804  GLY n 
1 805  TYR n 
1 806  LEU n 
1 807  ALA n 
1 808  ARG n 
1 809  LYS n 
1 810  ALA n 
1 811  PHE n 
1 812  ALA n 
1 813  LYS n 
1 814  ARG n 
1 815  GLN n 
1 816  GLN n 
1 817  GLN n 
1 818  LEU n 
1 819  GLU n 
1 820  SER n 
1 821  ILE n 
1 822  PHE n 
1 823  CYS n 
1 824  ILE n 
1 825  GLN n 
1 826  TYR n 
1 827  ASN n 
1 828  VAL n 
1 829  ARG n 
1 830  SER n 
1 831  PHE n 
1 832  MET n 
1 833  ASN n 
1 834  VAL n 
1 835  MLY n 
1 836  HIS n 
1 837  TRP n 
1 838  PRO n 
1 839  TRP n 
1 840  MET n 
1 841  MLY n 
1 842  LEU n 
1 843  PHE n 
1 844  PHE n 
1 845  MLY n 
1 846  ILE n 
1 847  MLY n 
1 848  PRO n 
1 849  LEU n 
1 850  LEU n 
1 851  LYS n 
1 852  VAL n 
1 853  THR n 
1 854  ARG n 
1 855  GLN n 
1 856  GLU n 
1 857  GLU n 
1 858  GLU n 
1 859  MET n 
1 860  GLN n 
1 861  ALA n 
1 862  LYS n 
1 863  ASP n 
1 864  GLU n 
1 865  GLU n 
1 866  LEU n 
1 867  GLN n 
1 868  ARG n 
1 869  THR n 
1 870  LYS n 
1 871  GLU n 
1 872  ARG n 
1 873  GLN n 
1 874  GLN n 
1 875  LYS n 
1 876  ALA n 
1 877  GLU n 
1 878  ALA n 
1 879  GLU n 
1 880  LEU n 
1 881  LYS n 
1 882  GLU n 
1 883  LEU n 
1 884  GLU n 
1 885  GLN n 
1 886  LYS n 
1 887  HIS n 
1 888  THR n 
1 889  GLN n 
1 890  LEU n 
1 891  CYS n 
1 892  GLU n 
1 893  GLU n 
1 894  LYS n 
1 895  ASN n 
1 896  LEU n 
1 897  LEU n 
1 898  GLN n 
1 899  GLU n 
1 900  LYS n 
1 901  LEU n 
1 902  GLN n 
1 903  ALA n 
1 904  GLU n 
1 905  THR n 
1 906  GLU n 
1 907  LEU n 
1 908  TYR n 
1 909  ALA n 
1 910  GLU n 
1 911  ALA n 
1 912  GLU n 
1 913  GLU n 
1 914  MET n 
1 915  ARG n 
1 916  VAL n 
1 917  ARG n 
1 918  LEU n 
1 919  ALA n 
1 920  ALA n 
1 921  LYS n 
1 922  LYS n 
1 923  GLN n 
1 924  GLU n 
1 925  LEU n 
1 926  GLU n 
1 927  GLU n 
1 928  ILE n 
1 929  LEU n 
1 930  HIS n 
1 931  GLU n 
1 932  MET n 
1 933  GLU n 
1 934  ALA n 
1 935  ARG n 
1 936  ILE n 
1 937  GLU n 
1 938  GLU n 
1 939  GLU n 
1 940  GLU n 
1 941  GLU n 
1 942  ARG n 
1 943  SER n 
1 944  GLN n 
1 945  GLN n 
1 946  LEU n 
1 947  GLN n 
1 948  ALA n 
1 949  GLU n 
1 950  LYS n 
1 951  LYS n 
1 952  LYS n 
1 953  MET n 
1 954  GLN n 
1 955  GLN n 
1 956  GLN n 
1 957  MET n 
1 958  LEU n 
1 959  ASP n 
1 960  LEU n 
1 961  GLU n 
1 962  GLU n 
1 963  GLN n 
1 964  LEU n 
1 965  GLU n 
1 966  GLU n 
1 967  GLU n 
1 968  GLU n 
1 969  ALA n 
1 970  ALA n 
1 971  ARG n 
1 972  GLN n 
1 973  LYS n 
1 974  LEU n 
1 975  GLN n 
1 976  LEU n 
1 977  GLU n 
1 978  LYS n 
1 979  VAL n 
1 980  THR n 
1 981  ALA n 
1 982  ASP n 
1 983  GLY n 
1 984  LYS n 
1 985  ILE n 
1 986  LYS n 
1 987  LYS n 
1 988  MET n 
1 989  GLU n 
1 990  ASP n 
1 991  ASP n 
1 992  ILE n 
1 993  LEU n 
1 994  ILE n 
1 995  MET n 
1 996  GLU n 
1 997  ASP n 
1 998  GLN n 
1 999  ASN n 
1 1000 ASN n 
1 1001 LYS n 
1 1002 LEU n 
1 1003 THR n 
1 1004 LYS n 
1 1005 GLU n 
1 1006 ARG n 
1 1007 LYS n 
1 1008 LEU n 
1 1009 LEU n 
1 1010 GLU n 
1 1011 GLU n 
1 1012 ARG n 
1 1013 VAL n 
1 1014 SER n 
1 1015 ASP n 
1 1016 LEU n 
1 1017 THR n 
1 1018 THR n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 ALA n 
1 1022 GLU n 
1 1023 GLU n 
1 1024 GLU n 
1 1025 GLU n 
1 1026 LYS n 
1 1027 ALA n 
1 1028 LYS n 
1 1029 ASN n 
1 1030 LEU n 
1 1031 THR n 
1 1032 LYS n 
1 1033 LEU n 
1 1034 LYS n 
1 1035 ASN n 
1 1036 LYS n 
1 1037 HIS n 
1 1038 GLU n 
1 1039 SER n 
1 1040 MET n 
1 1041 ILE n 
1 1042 SER n 
1 1043 GLU n 
1 1044 LEU n 
1 1045 GLU n 
1 1046 VAL n 
1 1047 ARG n 
1 1048 LEU n 
1 1049 LYS n 
1 1050 LYS n 
1 1051 GLU n 
1 1052 GLU n 
1 1053 LYS n 
1 1054 SER n 
1 1055 ARG n 
1 1056 GLN n 
1 1057 GLU n 
1 1058 LEU n 
1 1059 GLU n 
1 1060 LYS n 
1 1061 ILE n 
1 1062 LYS n 
1 1063 ARG n 
1 1064 LYS n 
1 1065 LEU n 
1 1066 GLU n 
1 1067 GLY n 
1 1068 GLU n 
1 1069 SER n 
1 1070 SER n 
1 1071 ASP n 
1 1072 LEU n 
1 1073 HIS n 
1 1074 GLU n 
1 1075 GLN n 
1 1076 ILE n 
1 1077 ALA n 
1 1078 GLU n 
1 1079 LEU n 
1 1080 GLN n 
1 1081 ALA n 
1 1082 GLN n 
1 1083 ILE n 
1 1084 ALA n 
1 1085 GLU n 
1 1086 LEU n 
1 1087 LYS n 
1 1088 ALA n 
1 1089 GLN n 
1 1090 LEU n 
1 1091 ALA n 
1 1092 LYS n 
1 1093 LYS n 
1 1094 GLU n 
1 1095 GLU n 
1 1096 GLU n 
1 1097 LEU n 
1 1098 GLN n 
1 1099 ALA n 
1 1100 ALA n 
1 1101 LEU n 
1 1102 ALA n 
1 1103 ARG n 
1 1104 LEU n 
1 1105 GLU n 
1 1106 ASP n 
1 1107 GLU n 
1 1108 THR n 
1 1109 SER n 
1 1110 GLN n 
1 1111 LYS n 
1 1112 ASN n 
1 1113 ASN n 
1 1114 ALA n 
1 1115 LEU n 
1 1116 LYS n 
1 1117 LYS n 
1 1118 ILE n 
1 1119 ARG n 
1 1120 GLU n 
1 1121 LEU n 
1 1122 GLU n 
1 1123 SER n 
1 1124 HIS n 
1 1125 ILE n 
1 1126 SER n 
1 1127 ASP n 
1 1128 LEU n 
1 1129 GLN n 
1 1130 GLU n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 GLU n 
1 1134 SER n 
1 1135 GLU n 
1 1136 LYS n 
1 1137 ALA n 
1 1138 ALA n 
1 1139 ARG n 
1 1140 ASN n 
1 1141 LYS n 
1 1142 ALA n 
1 1143 GLU n 
1 1144 LYS n 
1 1145 GLN n 
1 1146 LYS n 
1 1147 ARG n 
1 1148 ASP n 
1 1149 LEU n 
1 1150 SER n 
1 1151 GLU n 
1 1152 GLU n 
1 1153 LEU n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 LEU n 
1 1157 LYS n 
1 1158 THR n 
1 1159 GLU n 
1 1160 LEU n 
1 1161 GLU n 
1 1162 ASP n 
1 1163 THR n 
1 1164 LEU n 
1 1165 ASP n 
1 1166 THR n 
1 1167 THR n 
1 1168 ALA n 
1 1169 THR n 
1 1170 GLN n 
1 1171 GLN n 
1 1172 GLU n 
1 1173 LEU n 
1 1174 ARG n 
1 1175 GLY n 
1 1176 SER n 
1 1177 ASP n 
1 1178 TYR n 
1 1179 LYS n 
1 1180 ASP n 
1 1181 ASP n 
1 1182 ASP n 
1 1183 ASP n 
1 1184 LYS n 
2 1    CYS n 
2 2    ASP n 
2 3    PHE n 
2 4    SER n 
2 5    GLU n 
2 6    GLU n 
2 7    GLN n 
2 8    THR n 
2 9    ALA n 
2 10   GLU n 
2 11   PHE n 
2 12   LYS n 
2 13   GLU n 
2 14   ALA n 
2 15   PHE n 
2 16   GLN n 
2 17   LEU n 
2 18   PHE n 
2 19   ASP n 
2 20   ARG n 
2 21   THR n 
2 22   GLY n 
2 23   ASP n 
2 24   GLY n 
2 25   LYS n 
2 26   ILE n 
2 27   LEU n 
2 28   TYR n 
2 29   SER n 
2 30   GLN n 
2 31   CYS n 
2 32   GLY n 
2 33   ASP n 
2 34   VAL n 
2 35   MET n 
2 36   ARG n 
2 37   ALA n 
2 38   LEU n 
2 39   GLY n 
2 40   GLN n 
2 41   ASN n 
2 42   PRO n 
2 43   THR n 
2 44   ASN n 
2 45   ALA n 
2 46   GLU n 
2 47   VAL n 
2 48   MET n 
2 49   LYS n 
2 50   VAL n 
2 51   LEU n 
2 52   GLY n 
2 53   ASN n 
2 54   PRO n 
2 55   LYS n 
2 56   SER n 
2 57   ASP n 
2 58   GLU n 
2 59   MET n 
2 60   ASN n 
2 61   LEU n 
2 62   LYS n 
2 63   THR n 
2 64   LEU n 
2 65   LYS n 
2 66   PHE n 
2 67   GLU n 
2 68   GLN n 
2 69   PHE n 
2 70   LEU n 
2 71   PRO n 
2 72   MET n 
2 73   MET n 
2 74   GLN n 
2 75   THR n 
2 76   ILE n 
2 77   ALA n 
2 78   LYS n 
2 79   ASN n 
2 80   LYS n 
2 81   ASP n 
2 82   GLN n 
2 83   GLY n 
2 84   CYS n 
2 85   PHE n 
2 86   GLU n 
2 87   ASP n 
2 88   TYR n 
2 89   VAL n 
2 90   GLU n 
2 91   GLY n 
2 92   LEU n 
2 93   ARG n 
2 94   VAL n 
2 95   PHE n 
2 96   ASP n 
2 97   LYS n 
2 98   GLU n 
2 99   GLY n 
2 100  ASN n 
2 101  GLY n 
2 102  THR n 
2 103  VAL n 
2 104  MET n 
2 105  GLY n 
2 106  ALA n 
2 107  GLU n 
2 108  ILE n 
2 109  ARG n 
2 110  HIS n 
2 111  VAL n 
2 112  LEU n 
2 113  VAL n 
2 114  THR n 
2 115  LEU n 
2 116  GLY n 
2 117  GLU n 
2 118  LYS n 
2 119  MET n 
2 120  THR n 
2 121  GLU n 
2 122  GLU n 
2 123  GLU n 
2 124  VAL n 
2 125  GLU n 
2 126  GLN n 
2 127  LEU n 
2 128  VAL n 
2 129  ALA n 
2 130  GLY n 
2 131  HIS n 
2 132  GLU n 
2 133  ASP n 
2 134  SER n 
2 135  ASN n 
2 136  GLY n 
2 137  CYS n 
2 138  ILE n 
2 139  ASN n 
2 140  TYR n 
2 141  GLU n 
2 142  GLU n 
2 143  LEU n 
2 144  VAL n 
2 145  ARG n 
2 146  MET n 
2 147  VAL n 
2 148  LEU n 
2 149  SER n 
2 150  GLY n 
3 1    PRO n 
3 2    LYS n 
3 3    LYS n 
3 4    ALA n 
3 5    LYS n 
3 6    ARG n 
3 7    ARG n 
3 8    ALA n 
3 9    ALA n 
3 10   GLU n 
3 11   GLY n 
3 12   SER n 
3 13   SER n 
3 14   ASN n 
3 15   VAL n 
3 16   PHE n 
3 17   SER n 
3 18   MET n 
3 19   PHE n 
3 20   ASP n 
3 21   GLU n 
3 22   THR n 
3 23   GLU n 
3 24   ILE n 
3 25   GLU n 
3 26   ASP n 
3 27   PHE n 
3 28   LYS n 
3 29   GLU n 
3 30   ALA n 
3 31   PHE n 
3 32   THR n 
3 33   VAL n 
3 34   ILE n 
3 35   ASP n 
3 36   GLN n 
3 37   ASN n 
3 38   ALA n 
3 39   ASP n 
3 40   GLY n 
3 41   ILE n 
3 42   ILE n 
3 43   ASP n 
3 44   LYS n 
3 45   ASP n 
3 46   ASP n 
3 47   LEU n 
3 48   ARG n 
3 49   GLU n 
3 50   THR n 
3 51   PHE n 
3 52   ALA n 
3 53   ALA n 
3 54   MET n 
3 55   GLY n 
3 56   ARG n 
3 57   LEU n 
3 58   ASN n 
3 59   VAL n 
3 60   LYS n 
3 61   ASN n 
3 62   GLU n 
3 63   GLU n 
3 64   LEU n 
3 65   ASP n 
3 66   ALA n 
3 67   MET n 
3 68   ILE n 
3 69   LYS n 
3 70   GLU n 
3 71   ALA n 
3 72   SER n 
3 73   GLY n 
3 74   PRO n 
3 75   ILE n 
3 76   ASN n 
3 77   PHE n 
3 78   THR n 
3 79   VAL n 
3 80   PHE n 
3 81   LEU n 
3 82   THR n 
3 83   MET n 
3 84   PHE n 
3 85   GLY n 
3 86   GLU n 
3 87   LYS n 
3 88   LEU n 
3 89   LYS n 
3 90   GLY n 
3 91   ALA n 
3 92   ASP n 
3 93   PRO n 
3 94   GLU n 
3 95   ASP n 
3 96   VAL n 
3 97   ILE n 
3 98   MET n 
3 99   GLY n 
3 100  ALA n 
3 101  PHE n 
3 102  LYS n 
3 103  VAL n 
3 104  LEU n 
3 105  ASP n 
3 106  PRO n 
3 107  ASP n 
3 108  GLY n 
3 109  LYS n 
3 110  GLY n 
3 111  SER n 
3 112  ILE n 
3 113  LYS n 
3 114  LYS n 
3 115  SER n 
3 116  PHE n 
3 117  LEU n 
3 118  GLU n 
3 119  GLU n 
3 120  LEU n 
3 121  LEU n 
3 122  THR n 
3 123  THR n 
3 124  GLY n 
3 125  GLY n 
3 126  GLY n 
3 127  ARG n 
3 128  PHE n 
3 129  THR n 
3 130  PRO n 
3 131  GLU n 
3 132  GLU n 
3 133  ILE n 
3 134  LYS n 
3 135  ASN n 
3 136  MET n 
3 137  TRP n 
3 138  ALA n 
3 139  ALA n 
3 140  PHE n 
3 141  PRO n 
3 142  PRO n 
3 143  ASP n 
3 144  VAL n 
3 145  ALA n 
3 146  GLY n 
3 147  ASN n 
3 148  VAL n 
3 149  ASP n 
3 150  TYR n 
3 151  LYS n 
3 152  ASN n 
3 153  ILE n 
3 154  CYS n 
3 155  TYR n 
3 156  VAL n 
3 157  ILE n 
3 158  THR n 
3 159  HIS n 
3 160  GLY n 
3 161  GLU n 
3 162  ASP n 
3 163  ALA n 
3 164  GLU n 
3 165  GLY n 
3 166  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? chicken Gallus ? ? ? ? ? ? ? 'Gallus gallus' 9031 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? SF9 ? ? ? ? ? ? ? BACULOVIRUS ? ? ? PVL1392 ? 'FLAG-TAG AT C-TERMINUS;' 
2 1 sample ? ? ? chicken Gallus ? ? ? ? ? ? ? 'Gallus gallus' 9031 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? SF9 ? ? ? ? ? ? ? BACULOVIRUS ? ? ? PVL1392 ? ?                         
3 1 sample ? ? ? chicken Gallus ? ? ? ? ? ? ? 'Gallus gallus' 9031 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera ? ? ? ? ? SF9 ? ? ? ? ? ? ? BACULOVIRUS ? ? ? PVL1392 ? ?                         
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MYSG_CHICK 1 
;SQKPLSDDEKFLFVDKNFVNNPLAQADWSAKKLVWVPSEKHGFEAASIKEEKGDEVTVELQENGKKVTLSKDDIQKMNPP
KFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVINPYKQLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAY
RSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFSYGELEKQLLQANPILEAFGNAKTVK
NDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLIAGASEQMRNDLLLEGFNNYTFLSNGHV
PIPAQQDDEMFQETLEAMTIMGFTEEEQTSILRVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRS
ILTPRIKVGRDVVQKAQTKEQADFAIEALAKAKFERLFRWILTRVNKALDKTKRQGASFLGILDIAGFEIFEINSFEQLC
INYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPTNPPGVLALLDEECWFPKATDTSFVEKLIQ
EQGNHAKFQKSKQLKDKTEFCILHYAGKVTYNASAWLTKNMDPLNDNVTSLLNQSSDKFVADLWKDVDRIVGLDQMAKMT
ESSLPSASKTKKGMFRTVGQLYKEQLTKLMTTLRNTNPNFVRCIIPNHEKRAGKLDAHLVLEQLRCNGVLEGIRICRQGF
PNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIIAFQA
QCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKDEELQRTKERQQKAEAEL
KELEQKHTQLCEEKNLLQEKLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKKKMQQQMLDL
EEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESM
ISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRE
LESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRA
;
1 P10587 ? 
2 GB  AAA48978   2 
;CDFSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNK
DQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEQLVAGHEDSNGCINYEELVRMVLSG
;
2 212393 ? 
3 UNP MLRS_CHICK 3 
;PKKAKRRAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKDDLRETFAAMGRLNVKNEELDAMIKEASGPINFTVF
LTMFGEKLKGADPEDVIMGAFKVLDPDGKGSIKKSFLEELLTTQCDRFTPEEIKNMWAAFPPDVAGNVDYKNICYVITHG
EDKEGE
;
1 P02609 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1I84 S 1 ? 1174 ? P10587 1 ? 1174 ? 2 1175 
2 1 1I84 V 1 ? 1174 ? P10587 1 ? 1174 ? 2 1175 
3 2 1I84 W 1 ? 150  ? 212393 2 ? 151  ? 1 150  
4 2 1I84 T 1 ? 150  ? 212393 2 ? 151  ? 1 150  
5 3 1I84 Z 1 ? 166  ? P02609 1 ? 166  ? 1 166  
6 3 1I84 U 1 ? 166  ? P02609 1 ? 166  ? 1 166  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1I84 ALA S 1    ? ?   P10587 SER 1   'SEE REMARK 999' 2    1  
1 1I84 GLU S 819  ? ?   P10587 THR 819 'SEE REMARK 999' 820  2  
1 1I84 SER S 820  ? ?   P10587 ALA 820 'SEE REMARK 999' 821  3  
1 1I84 ILE S 821  ? ?   P10587 MET 821 'SEE REMARK 999' 822  4  
1 1I84 PHE S 822  ? ?   P10587 LYS 822 'SEE REMARK 999' 823  5  
1 1I84 CYS S 823  ? ?   P10587 VAL 823 'SEE REMARK 999' 824  6  
1 1I84 TYR S 826  ? ?   P10587 ARG 826 'SEE REMARK 999' 827  7  
1 1I84 VAL S 828  ? ?   P10587 CYS 828 'SEE REMARK 999' 829  8  
1 1I84 ARG S 829  ? ?   P10587 ALA 829 'SEE REMARK 999' 830  9  
1 1I84 SER S 830  ? ?   P10587 ALA 830 'SEE REMARK 999' 831  10 
1 1I84 PHE S 831  ? ?   P10587 TYR 831 'SEE REMARK 999' 832  11 
1 1I84 MET S 832  ? ?   P10587 LEU 832 'SEE REMARK 999' 833  12 
1 1I84 ASN S 833  ? ?   P10587 LYS 833 'SEE REMARK 999' 834  13 
1 1I84 VAL S 834  ? ?   P10587 LEU 834 'SEE REMARK 999' 835  14 
1 1I84 MLY S 835  ? ?   P10587 ARG 835 'SEE REMARK 999' 836  15 
1 1I84 HIS S 836  ? ?   P10587 ASN 836 'SEE REMARK 999' 837  16 
1 1I84 PRO S 838  ? ?   P10587 GLN 838 'SEE REMARK 999' 839  17 
1 1I84 MET S 840  ? ?   P10587 TRP 840 'SEE REMARK 999' 841  18 
1 1I84 MLY S 841  ? ?   P10587 ARG 841 'SEE REMARK 999' 842  19 
1 1I84 PHE S 844  ? ?   P10587 THR 844 'SEE REMARK 999' 845  20 
1 1I84 MLY S 845  ? ?   P10587 LYS 845 'SEE REMARK 999' 846  21 
1 1I84 ILE S 846  ? ?   P10587 VAL 846 'SEE REMARK 999' 847  22 
1 1I84 MLY S 847  ? ?   P10587 LYS 847 'SEE REMARK 999' 848  23 
1 1I84 LYS S 851  ? ?   P10587 GLN 851 'SEE REMARK 999' 852  24 
1 1I84 GLY S 1175 ? ?   P10587 ?   ?   'FLAG TAG'       1176 25 
1 1I84 SER S 1176 ? ?   P10587 ?   ?   'FLAG TAG'       1177 26 
1 1I84 ASP S 1177 ? ?   P10587 ?   ?   'FLAG TAG'       1178 27 
1 1I84 TYR S 1178 ? ?   P10587 ?   ?   'FLAG TAG'       1179 28 
1 1I84 LYS S 1179 ? ?   P10587 ?   ?   'FLAG TAG'       1180 29 
1 1I84 ASP S 1180 ? ?   P10587 ?   ?   'FLAG TAG'       1181 30 
1 1I84 ASP S 1181 ? ?   P10587 ?   ?   'FLAG TAG'       1182 31 
1 1I84 ASP S 1182 ? ?   P10587 ?   ?   'FLAG TAG'       1183 32 
1 1I84 ASP S 1183 ? ?   P10587 ?   ?   'FLAG TAG'       1184 33 
1 1I84 LYS S 1184 ? ?   P10587 ?   ?   'FLAG TAG'       1185 34 
2 1I84 ALA V 1    ? ?   P10587 SER 1   'SEE REMARK 999' 2    35 
2 1I84 GLU V 819  ? ?   P10587 THR 819 'SEE REMARK 999' 820  36 
2 1I84 SER V 820  ? ?   P10587 ALA 820 'SEE REMARK 999' 821  37 
2 1I84 ILE V 821  ? ?   P10587 MET 821 'SEE REMARK 999' 822  38 
2 1I84 PHE V 822  ? ?   P10587 LYS 822 'SEE REMARK 999' 823  39 
2 1I84 CYS V 823  ? ?   P10587 VAL 823 'SEE REMARK 999' 824  40 
2 1I84 TYR V 826  ? ?   P10587 ARG 826 'SEE REMARK 999' 827  41 
2 1I84 VAL V 828  ? ?   P10587 CYS 828 'SEE REMARK 999' 829  42 
2 1I84 ARG V 829  ? ?   P10587 ALA 829 'SEE REMARK 999' 830  43 
2 1I84 SER V 830  ? ?   P10587 ALA 830 'SEE REMARK 999' 831  44 
2 1I84 PHE V 831  ? ?   P10587 TYR 831 'SEE REMARK 999' 832  45 
2 1I84 MET V 832  ? ?   P10587 LEU 832 'SEE REMARK 999' 833  46 
2 1I84 ASN V 833  ? ?   P10587 LYS 833 'SEE REMARK 999' 834  47 
2 1I84 VAL V 834  ? ?   P10587 LEU 834 'SEE REMARK 999' 835  48 
2 1I84 MLY V 835  ? ?   P10587 ARG 835 'SEE REMARK 999' 836  49 
2 1I84 HIS V 836  ? ?   P10587 ASN 836 'SEE REMARK 999' 837  50 
2 1I84 PRO V 838  ? ?   P10587 GLN 838 'SEE REMARK 999' 839  51 
2 1I84 MET V 840  ? ?   P10587 TRP 840 'SEE REMARK 999' 841  52 
2 1I84 MLY V 841  ? ?   P10587 ARG 841 'SEE REMARK 999' 842  53 
2 1I84 PHE V 844  ? ?   P10587 THR 844 'SEE REMARK 999' 845  54 
2 1I84 MLY V 845  ? ?   P10587 LYS 845 'SEE REMARK 999' 846  55 
2 1I84 ILE V 846  ? ?   P10587 VAL 846 'SEE REMARK 999' 847  56 
2 1I84 MLY V 847  ? ?   P10587 LYS 847 'SEE REMARK 999' 848  57 
2 1I84 LYS V 851  ? ?   P10587 GLN 851 'SEE REMARK 999' 852  58 
2 1I84 GLY V 1175 ? ?   P10587 ?   ?   'FLAG TAG'       1176 59 
2 1I84 SER V 1176 ? ?   P10587 ?   ?   'FLAG TAG'       1177 60 
2 1I84 ASP V 1177 ? ?   P10587 ?   ?   'FLAG TAG'       1178 61 
2 1I84 TYR V 1178 ? ?   P10587 ?   ?   'FLAG TAG'       1179 62 
2 1I84 LYS V 1179 ? ?   P10587 ?   ?   'FLAG TAG'       1180 63 
2 1I84 ASP V 1180 ? ?   P10587 ?   ?   'FLAG TAG'       1181 64 
2 1I84 ASP V 1181 ? ?   P10587 ?   ?   'FLAG TAG'       1182 65 
2 1I84 ASP V 1182 ? ?   P10587 ?   ?   'FLAG TAG'       1183 66 
2 1I84 ASP V 1183 ? ?   P10587 ?   ?   'FLAG TAG'       1184 67 
2 1I84 LYS V 1184 ? ?   P10587 ?   ?   'FLAG TAG'       1185 68 
5 1I84 GLU Z 21   ? UNP P02609 GLN 21  'SEE REMARK 999' 21   69 
5 1I84 GLU Z 23   ? UNP P02609 GLN 23  'SEE REMARK 999' 23   70 
5 1I84 GLU Z 25   ? UNP P02609 GLN 25  'SEE REMARK 999' 25   71 
5 1I84 ASP Z 26   ? UNP P02609 GLU 26  'SEE REMARK 999' 26   72 
5 1I84 ALA Z 38   ? UNP P02609 ARG 38  'SEE REMARK 999' 38   73 
5 1I84 GLY Z 124  ? UNP P02609 GLN 124 'SEE REMARK 999' 124  74 
5 1I84 GLY Z 125  ? UNP P02609 CYS 125 'SEE REMARK 999' 125  75 
5 1I84 GLY Z 126  ? UNP P02609 ASP 126 'SEE REMARK 999' 126  76 
5 1I84 ALA Z 163  ? UNP P02609 LYS 163 'SEE REMARK 999' 163  77 
6 1I84 GLU U 21   ? UNP P02609 GLN 21  'SEE REMARK 999' 21   78 
6 1I84 GLU U 23   ? UNP P02609 GLN 23  'SEE REMARK 999' 23   79 
6 1I84 GLU U 25   ? UNP P02609 GLN 25  'SEE REMARK 999' 25   80 
6 1I84 ASP U 26   ? UNP P02609 GLU 26  'SEE REMARK 999' 26   81 
6 1I84 ALA U 38   ? UNP P02609 ARG 38  'SEE REMARK 999' 38   82 
6 1I84 GLY U 124  ? UNP P02609 GLN 124 'SEE REMARK 999' 124  83 
6 1I84 GLY U 125  ? UNP P02609 CYS 125 'SEE REMARK 999' 125  84 
6 1I84 GLY U 126  ? UNP P02609 ASP 126 'SEE REMARK 999' 126  85 
6 1I84 ALA U 163  ? UNP P02609 LYS 163 'SEE REMARK 999' 163  86 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2'   174.241 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I84 
_exptl.method            'ELECTRON CRYSTALLOGRAPHY' 
_exptl.crystals_number   101 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'Lipid monolayer' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'MgCl, sodium phosphate, ATP, EGTA, PEG 6000, pH 7.5, Lipid monolayer, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1I84 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            20.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'ELECTRON CRYSTALLOGRAPHY' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON CRYSTALLOGRAPHY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16580 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16580 
_refine_hist.d_res_high                       20.0 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1I84 
_struct.title                     
;CRYO-EM STRUCTURE OF THE HEAVY MEROMYOSIN SUBFRAGMENT OF CHICKEN GIZZARD SMOOTH MUSCLE MYOSIN WITH REGULATORY LIGHT CHAIN IN THE DEPHOSPHORYLATED STATE. ONLY C ALPHAS PROVIDED FOR REGULATORY LIGHT CHAIN. ONLY BACKBONE ATOMS PROVIDED FOR S2 FRAGMENT.
;
_struct.pdbx_descriptor           
'SMOOTH MUSCLE MYOSIN HEAVY CHAIN/SMOOTH MUSCLE MYOSIN ESSENTIAL LIGHT CHAIN/SMOOTH MUSCLE MYOSIN REGULATORY LIGHT CHAIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I84 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            
;muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain, regulatory light chain, motor protein, coiled-coil, CONTRACTILE PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? LEU A 12  ? ASP S 9   LEU S 13  5 ? 5  
HELX_P HELX_P2  2  ASN A 21  ? TRP A 28  ? ASN S 22  TRP S 29  1 ? 8  
HELX_P HELX_P3  3  PRO A 79  ? SER A 83  ? PRO S 80  SER S 84  5 ? 5  
HELX_P HELX_P4  4  ALA A 97  ? GLY A 110 ? ALA S 98  GLY S 111 1 ? 14 
HELX_P HELX_P5  5  SER A 133 ? LYS A 141 ? SER S 134 LYS S 142 1 ? 9  
HELX_P HELX_P6  6  HIS A 151 ? ARG A 167 ? HIS S 152 ARG S 168 1 ? 17 
HELX_P HELX_P7  7  THR A 183 ? ALA A 197 ? THR S 184 ALA S 198 1 ? 15 
HELX_P HELX_P8  8  GLU A 218 ? GLU A 231 ? GLU S 219 GLU S 232 1 ? 14 
HELX_P HELX_P9  9  LYS A 273 ? ILE A 277 ? LYS S 274 ILE S 278 5 ? 5  
HELX_P HELX_P10 10 HIS A 287 ? ALA A 296 ? HIS S 288 ALA S 297 1 ? 10 
HELX_P HELX_P11 11 SER A 297 ? LEU A 304 ? SER S 298 LEU S 305 1 ? 8  
HELX_P HELX_P12 12 GLN A 326 ? GLY A 342 ? GLN S 327 GLY S 343 1 ? 17 
HELX_P HELX_P13 13 THR A 344 ? LEU A 361 ? THR S 345 LEU S 362 1 ? 18 
HELX_P HELX_P14 14 ASN A 380 ? MET A 390 ? ASN S 381 MET S 391 1 ? 11 
HELX_P HELX_P15 15 ASN A 393 ? THR A 403 ? ASN S 394 THR S 404 1 ? 11 
HELX_P HELX_P16 16 THR A 418 ? ASN A 446 ? THR S 419 ASN S 447 1 ? 29 
HELX_P HELX_P17 17 SER A 475 ? PHE A 497 ? SER S 476 PHE S 498 1 ? 23 
HELX_P HELX_P18 18 PHE A 497 ? GLY A 508 ? PHE S 498 GLY S 509 1 ? 12 
HELX_P HELX_P19 19 LEU A 520 ? LEU A 526 ? LEU S 521 LEU S 527 1 ? 7  
HELX_P HELX_P20 20 GLY A 535 ? GLU A 543 ? GLY S 536 GLU S 544 1 ? 9  
HELX_P HELX_P21 21 THR A 550 ? GLN A 562 ? THR S 551 GLN S 563 1 ? 13 
HELX_P HELX_P22 22 ALA A 595 ? ASP A 602 ? ALA S 596 ASP S 603 1 ? 8  
HELX_P HELX_P23 23 ASN A 605 ? GLN A 614 ? ASN S 606 GLN S 615 1 ? 10 
HELX_P HELX_P24 24 ASP A 617 ? LYS A 625 ? ASP S 618 LYS S 626 1 ? 9  
HELX_P HELX_P25 25 THR A 657 ? ARG A 674 ? THR S 658 ARG S 675 1 ? 18 
HELX_P HELX_P26 26 ASP A 696 ? ASN A 707 ? ASP S 697 ASN S 708 1 ? 12 
HELX_P HELX_P27 27 GLY A 708 ? GLY A 719 ? GLY S 709 GLY S 720 1 ? 12 
HELX_P HELX_P28 28 PHE A 726 ? TYR A 733 ? PHE S 727 TYR S 734 1 ? 8  
HELX_P HELX_P29 29 ASP A 747 ? ALA A 758 ? ASP S 748 ALA S 759 1 ? 12 
HELX_P HELX_P30 30 GLY A 778 ? ILE A 791 ? GLY S 779 ILE S 792 1 ? 14 
HELX_P HELX_P31 31 ILE A 791 ? VAL A 834 ? ILE S 792 VAL S 835 1 ? 44 
HELX_P HELX_P32 32 ARG A 854 ? MET A 859 ? ARG S 855 MET S 860 1 ? 6  
HELX_P HELX_P33 33 GLN A 860 ? GLN A 902 ? GLN S 861 GLN S 903 1 ? 43 
HELX_P HELX_P34 34 ALA A 903 ? ARG A 942 ? ALA S 904 ARG S 943 1 ? 40 
HELX_P HELX_P35 35 SER B 4   ? LEU B 17  ? SER T 4   LEU T 17  1 ? 14 
HELX_P HELX_P36 36 GLN B 30  ? LEU B 38  ? GLN T 30  LEU T 38  1 ? 9  
HELX_P HELX_P37 37 THR B 43  ? LYS B 49  ? THR T 43  LYS T 49  1 ? 7  
HELX_P HELX_P38 38 VAL B 50  ? GLY B 52  ? VAL T 50  GLY T 52  5 ? 3  
HELX_P HELX_P39 39 LYS B 55  ? ASN B 60  ? LYS T 55  ASN T 60  5 ? 6  
HELX_P HELX_P40 40 LYS B 65  ? LYS B 78  ? LYS T 65  LYS T 78  1 ? 14 
HELX_P HELX_P41 41 CYS B 84  ? ARG B 93  ? CYS T 84  ARG T 93  1 ? 10 
HELX_P HELX_P42 42 ALA B 106 ? LEU B 112 ? ALA T 106 LEU T 112 1 ? 7  
HELX_P HELX_P43 43 THR B 120 ? ALA B 129 ? THR T 120 ALA T 129 1 ? 10 
HELX_P HELX_P44 44 ASN B 139 ? GLY B 150 ? ASN T 139 GLY T 150 1 ? 12 
HELX_P HELX_P45 45 ASP D 8   ? LEU D 12  ? ASP V 9   LEU V 13  5 ? 5  
HELX_P HELX_P46 46 ASN D 21  ? TRP D 28  ? ASN V 22  TRP V 29  1 ? 8  
HELX_P HELX_P47 47 PRO D 79  ? SER D 83  ? PRO V 80  SER V 84  5 ? 5  
HELX_P HELX_P48 48 ALA D 97  ? GLY D 110 ? ALA V 98  GLY V 111 1 ? 14 
HELX_P HELX_P49 49 SER D 133 ? LYS D 141 ? SER V 134 LYS V 142 1 ? 9  
HELX_P HELX_P50 50 HIS D 151 ? ARG D 167 ? HIS V 152 ARG V 168 1 ? 17 
HELX_P HELX_P51 51 THR D 183 ? ALA D 197 ? THR V 184 ALA V 198 1 ? 15 
HELX_P HELX_P52 52 GLU D 218 ? GLU D 231 ? GLU V 219 GLU V 232 1 ? 14 
HELX_P HELX_P53 53 LYS D 273 ? ILE D 277 ? LYS V 274 ILE V 278 5 ? 5  
HELX_P HELX_P54 54 HIS D 287 ? ALA D 296 ? HIS V 288 ALA V 297 1 ? 10 
HELX_P HELX_P55 55 SER D 297 ? LEU D 304 ? SER V 298 LEU V 305 1 ? 8  
HELX_P HELX_P56 56 GLN D 326 ? GLY D 342 ? GLN V 327 GLY V 343 1 ? 17 
HELX_P HELX_P57 57 THR D 344 ? LEU D 361 ? THR V 345 LEU V 362 1 ? 18 
HELX_P HELX_P58 58 ASN D 380 ? MET D 390 ? ASN V 381 MET V 391 1 ? 11 
HELX_P HELX_P59 59 ASN D 393 ? THR D 403 ? ASN V 394 THR V 404 1 ? 11 
HELX_P HELX_P60 60 THR D 418 ? ASN D 446 ? THR V 419 ASN V 447 1 ? 29 
HELX_P HELX_P61 61 SER D 475 ? PHE D 497 ? SER V 476 PHE V 498 1 ? 23 
HELX_P HELX_P62 62 PHE D 497 ? GLY D 508 ? PHE V 498 GLY V 509 1 ? 12 
HELX_P HELX_P63 63 LEU D 520 ? LEU D 526 ? LEU V 521 LEU V 527 1 ? 7  
HELX_P HELX_P64 64 GLY D 535 ? GLU D 543 ? GLY V 536 GLU V 544 1 ? 9  
HELX_P HELX_P65 65 THR D 550 ? GLN D 562 ? THR V 551 GLN V 563 1 ? 13 
HELX_P HELX_P66 66 ALA D 595 ? ASP D 602 ? ALA V 596 ASP V 603 1 ? 8  
HELX_P HELX_P67 67 ASN D 605 ? GLN D 614 ? ASN V 606 GLN V 615 1 ? 10 
HELX_P HELX_P68 68 ASP D 617 ? LYS D 625 ? ASP V 618 LYS V 626 1 ? 9  
HELX_P HELX_P69 69 THR D 657 ? ARG D 674 ? THR V 658 ARG V 675 1 ? 18 
HELX_P HELX_P70 70 ASP D 696 ? ASN D 707 ? ASP V 697 ASN V 708 1 ? 12 
HELX_P HELX_P71 71 GLY D 708 ? GLY D 719 ? GLY V 709 GLY V 720 1 ? 12 
HELX_P HELX_P72 72 PHE D 726 ? TYR D 733 ? PHE V 727 TYR V 734 1 ? 8  
HELX_P HELX_P73 73 ASP D 747 ? ALA D 758 ? ASP V 748 ALA V 759 1 ? 12 
HELX_P HELX_P74 74 GLY D 778 ? ILE D 791 ? GLY V 779 ILE V 792 1 ? 14 
HELX_P HELX_P75 75 ILE D 791 ? VAL D 834 ? ILE V 792 VAL V 835 1 ? 44 
HELX_P HELX_P76 76 VAL D 852 ? GLN D 860 ? VAL V 853 GLN V 861 1 ? 9  
HELX_P HELX_P77 77 GLN D 860 ? GLN D 902 ? GLN V 861 GLN V 903 1 ? 43 
HELX_P HELX_P78 78 ALA D 903 ? ARG D 942 ? ALA V 904 ARG V 943 1 ? 40 
HELX_P HELX_P79 79 SER E 4   ? LEU E 17  ? SER W 4   LEU W 17  1 ? 14 
HELX_P HELX_P80 80 GLN E 30  ? LEU E 38  ? GLN W 30  LEU W 38  1 ? 9  
HELX_P HELX_P81 81 THR E 43  ? LYS E 49  ? THR W 43  LYS W 49  1 ? 7  
HELX_P HELX_P82 82 VAL E 50  ? GLY E 52  ? VAL W 50  GLY W 52  5 ? 3  
HELX_P HELX_P83 83 LYS E 55  ? ASN E 60  ? LYS W 55  ASN W 60  5 ? 6  
HELX_P HELX_P84 84 LYS E 65  ? LYS E 78  ? LYS W 65  LYS W 78  1 ? 14 
HELX_P HELX_P85 85 CYS E 84  ? ARG E 93  ? CYS W 84  ARG W 93  1 ? 10 
HELX_P HELX_P86 86 VAL E 94  ? ASP E 96  ? VAL W 94  ASP W 96  5 ? 3  
HELX_P HELX_P87 87 ALA E 106 ? LEU E 112 ? ALA W 106 LEU W 112 1 ? 7  
HELX_P HELX_P88 88 THR E 120 ? ALA E 129 ? THR W 120 ALA W 129 1 ? 10 
HELX_P HELX_P89 89 ASN E 139 ? GLY E 150 ? ASN W 139 GLY W 150 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A VAL 834 C ? ? ? 1_555 A MLY 835 N ? ? S VAL 835 S MLY 836 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale2  covale ? ? A MLY 835 C ? ? ? 1_555 A HIS 836 N ? ? S MLY 836 S HIS 837 1_555 ? ? ? ? ? ? ? 1.352 ? 
covale3  covale ? ? A MET 840 C ? ? ? 1_555 A MLY 841 N ? ? S MET 841 S MLY 842 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4  covale ? ? A MLY 841 C ? ? ? 1_555 A LEU 842 N ? ? S MLY 842 S LEU 843 1_555 ? ? ? ? ? ? ? 1.304 ? 
covale5  covale ? ? A PHE 844 C ? ? ? 1_555 A MLY 845 N ? ? S PHE 845 S MLY 846 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale6  covale ? ? A MLY 845 C ? ? ? 1_555 A ILE 846 N ? ? S MLY 846 S ILE 847 1_555 ? ? ? ? ? ? ? 1.300 ? 
covale7  covale ? ? A ILE 846 C ? ? ? 1_555 A MLY 847 N ? ? S ILE 847 S MLY 848 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale8  covale ? ? A MLY 847 C ? ? ? 1_555 A PRO 848 N ? ? S MLY 848 S PRO 849 1_555 ? ? ? ? ? ? ? 1.306 ? 
covale9  covale ? ? D VAL 834 C ? ? ? 1_555 D MLY 835 N ? ? V VAL 835 V MLY 836 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale10 covale ? ? D MLY 835 C ? ? ? 1_555 D HIS 836 N ? ? V MLY 836 V HIS 837 1_555 ? ? ? ? ? ? ? 1.354 ? 
covale11 covale ? ? D MET 840 C ? ? ? 1_555 D MLY 841 N ? ? V MET 841 V MLY 842 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale12 covale ? ? D MLY 841 C ? ? ? 1_555 D LEU 842 N ? ? V MLY 842 V LEU 843 1_555 ? ? ? ? ? ? ? 1.303 ? 
covale13 covale ? ? D PHE 844 C ? ? ? 1_555 D MLY 845 N ? ? V PHE 845 V MLY 846 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14 covale ? ? D MLY 845 C ? ? ? 1_555 D ILE 846 N ? ? V MLY 846 V ILE 847 1_555 ? ? ? ? ? ? ? 1.299 ? 
covale15 covale ? ? D ILE 846 C ? ? ? 1_555 D MLY 847 N ? ? V ILE 847 V MLY 848 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale16 covale ? ? D MLY 847 C ? ? ? 1_555 D PRO 848 N ? ? V MLY 848 V PRO 849 1_555 ? ? ? ? ? ? ? 1.306 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
D ? 2 ? 
E ? 3 ? 
F ? 2 ? 
G ? 2 ? 
H ? 5 ? 
I ? 3 ? 
J ? 5 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? parallel      
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 66  ? SER A 70  ? LYS S 67  SER S 71  
A 2 GLU A 55  ? LEU A 60  ? GLU S 56  LEU S 61  
A 3 GLU A 44  ? LYS A 52  ? GLU S 45  LYS S 53  
A 4 LEU A 33  ? VAL A 36  ? LEU S 34  VAL S 37  
A 5 GLN A 75  ? LYS A 76  ? GLN S 76  LYS S 77  
B 1 TYR A 113 ? SER A 116 ? TYR S 114 SER S 117 
B 2 PHE A 119 ? ILE A 123 ? PHE S 120 ILE S 124 
B 3 CYS A 683 ? ILE A 684 ? CYS S 684 ILE S 685 
C 1 ILE A 261 ? THR A 268 ? ILE S 262 THR S 269 
C 2 LYS A 249 ? PHE A 255 ? LYS S 250 PHE S 256 
C 3 SER A 458 ? ASP A 464 ? SER S 459 ASP S 465 
C 4 GLN A 170 ? LEU A 173 ? GLN S 171 LEU S 174 
C 5 ASN A 677 ? PHE A 680 ? ASN S 678 PHE S 681 
D 1 ASN A 235 ? THR A 238 ? ASN S 236 THR S 239 
D 2 ASN A 241 ? SER A 245 ? ASN S 242 SER S 246 
E 1 PHE A 568 ? LYS A 570 ? PHE S 569 LYS S 571 
E 2 GLU A 579 ? LEU A 583 ? GLU S 580 LEU S 584 
E 3 LYS A 588 ? ASN A 592 ? LYS S 589 ASN S 593 
F 1 ASN A 722 ? VAL A 725 ? ASN S 723 VAL S 726 
F 2 LYS A 772 ? PHE A 775 ? LYS S 773 PHE S 776 
G 1 VAL B 103 ? MET B 104 ? VAL T 103 MET T 104 
G 2 CYS B 137 ? ILE B 138 ? CYS T 137 ILE T 138 
H 1 LYS D 66  ? SER D 70  ? LYS V 67  SER V 71  
H 2 GLU D 55  ? LEU D 60  ? GLU V 56  LEU V 61  
H 3 GLU D 44  ? LYS D 52  ? GLU V 45  LYS V 53  
H 4 LEU D 33  ? VAL D 36  ? LEU V 34  VAL V 37  
H 5 GLN D 75  ? LYS D 76  ? GLN V 76  LYS V 77  
I 1 TYR D 113 ? SER D 116 ? TYR V 114 SER V 117 
I 2 PHE D 119 ? ILE D 123 ? PHE V 120 ILE V 124 
I 3 CYS D 683 ? ILE D 684 ? CYS V 684 ILE V 685 
J 1 ILE D 261 ? THR D 268 ? ILE V 262 THR V 269 
J 2 LYS D 249 ? PHE D 255 ? LYS V 250 PHE V 256 
J 3 SER D 458 ? ASP D 464 ? SER V 459 ASP V 465 
J 4 GLN D 170 ? LEU D 173 ? GLN V 171 LEU V 174 
J 5 ASN D 677 ? PHE D 680 ? ASN V 678 PHE V 681 
K 1 ASN D 235 ? THR D 238 ? ASN V 236 THR V 239 
K 2 ASN D 241 ? SER D 245 ? ASN V 242 SER V 246 
L 1 PHE D 568 ? LYS D 570 ? PHE V 569 LYS V 571 
L 2 GLU D 579 ? LEU D 583 ? GLU V 580 LEU V 584 
L 3 LYS D 588 ? ASN D 592 ? LYS V 589 ASN V 593 
M 1 ASN D 722 ? VAL D 725 ? ASN V 723 VAL V 726 
M 2 LYS D 772 ? PHE D 775 ? LYS V 773 PHE V 776 
N 1 VAL E 103 ? MET E 104 ? VAL W 103 MET W 104 
N 2 CYS E 137 ? ILE E 138 ? CYS W 137 ILE W 138 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 69  ? O LEU S 70  N VAL A 56  ? N VAL S 57  
A 2 3 O GLU A 59  ? O GLU S 60  N SER A 47  ? N SER S 48  
A 3 4 O ALA A 46  ? O ALA S 47  N VAL A 34  ? N VAL S 35  
A 4 5 O TRP A 35  ? O TRP S 36  N GLN A 75  ? N GLN S 76  
B 1 2 N SER A 116 ? N SER S 117 O PHE A 119 ? O PHE S 120 
B 2 3 O VAL A 122 ? O VAL S 123 N ILE A 684 ? N ILE S 685 
C 1 2 N GLU A 267 ? N GLU S 268 O PHE A 250 ? O PHE S 251 
C 2 3 N PHE A 255 ? N PHE S 256 O SER A 458 ? O SER S 459 
C 3 4 N GLY A 461 ? N GLY S 462 O GLN A 170 ? O GLN S 171 
C 4 5 N SER A 171 ? N SER S 172 O ASN A 677 ? O ASN S 678 
D 1 2 O THR A 238 ? O THR S 239 N ASN A 241 ? N ASN S 242 
E 1 2 O GLN A 569 ? O GLN S 570 N CYS A 581 ? N CYS S 582 
E 2 3 N ILE A 582 ? N ILE S 583 O VAL A 589 ? O VAL S 590 
F 1 2 O ILE A 724 ? O ILE S 725 N ILE A 773 ? N ILE S 774 
G 1 2 O VAL B 103 ? O VAL T 103 N ILE B 138 ? N ILE T 138 
H 1 2 O LEU D 69  ? O LEU V 70  N VAL D 56  ? N VAL V 57  
H 2 3 O GLU D 59  ? O GLU V 60  N SER D 47  ? N SER V 48  
H 3 4 O ALA D 46  ? O ALA V 47  N VAL D 34  ? N VAL V 35  
H 4 5 O TRP D 35  ? O TRP V 36  N GLN D 75  ? N GLN V 76  
I 1 2 N SER D 116 ? N SER V 117 O PHE D 119 ? O PHE V 120 
I 2 3 O VAL D 122 ? O VAL V 123 N ILE D 684 ? N ILE V 685 
J 1 2 N GLU D 267 ? N GLU V 268 O PHE D 250 ? O PHE V 251 
J 2 3 N PHE D 255 ? N PHE V 256 O SER D 458 ? O SER V 459 
J 3 4 N GLY D 461 ? N GLY V 462 O GLN D 170 ? O GLN V 171 
J 4 5 N SER D 171 ? N SER V 172 O ASN D 677 ? O ASN V 678 
K 1 2 O THR D 238 ? O THR V 239 N ASN D 241 ? N ASN V 242 
L 1 2 O GLN D 569 ? O GLN V 570 N CYS D 581 ? N CYS V 582 
L 2 3 N ILE D 582 ? N ILE V 583 O VAL D 589 ? O VAL V 590 
M 1 2 O ILE D 724 ? O ILE V 725 N ILE D 773 ? N ILE V 774 
N 1 2 O VAL E 103 ? O VAL W 103 N ILE E 138 ? N ILE W 138 
# 
_database_PDB_matrix.entry_id          1I84 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1I84 
_atom_sites.fract_transf_matrix[1][1]   0.007519 
_atom_sites.fract_transf_matrix[1][2]   0.000197 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003291 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011111 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ALA A 1 1   ? 39.314  125.779 -25.623 1.00 41.92  ? 2   ALA S N   1 
ATOM   2     C CA  . ALA A 1 1   ? 38.032  125.016 -25.571 1.00 41.92  ? 2   ALA S CA  1 
ATOM   3     C C   . ALA A 1 1   ? 38.149  123.944 -24.514 1.00 41.92  ? 2   ALA S C   1 
ATOM   4     O O   . ALA A 1 1   ? 37.711  122.809 -24.728 1.00 2.00   ? 2   ALA S O   1 
ATOM   5     C CB  . ALA A 1 1   ? 37.771  124.368 -26.902 1.00 2.00   ? 2   ALA S CB  1 
ATOM   6     N N   . GLN A 1 2   ? 38.731  124.303 -23.374 1.00 50.43  ? 3   GLN S N   1 
ATOM   7     C CA  . GLN A 1 2   ? 38.949  123.335 -22.310 1.00 50.43  ? 3   GLN S CA  1 
ATOM   8     C C   . GLN A 1 2   ? 38.211  123.529 -20.993 1.00 50.43  ? 3   GLN S C   1 
ATOM   9     O O   . GLN A 1 2   ? 37.609  124.575 -20.733 1.00 94.32  ? 3   GLN S O   1 
ATOM   10    C CB  . GLN A 1 2   ? 40.448  123.220 -22.028 1.00 94.32  ? 3   GLN S CB  1 
ATOM   11    C CG  . GLN A 1 2   ? 41.273  122.753 -23.224 1.00 94.32  ? 3   GLN S CG  1 
ATOM   12    C CD  . GLN A 1 2   ? 41.044  121.284 -23.573 1.00 94.32  ? 3   GLN S CD  1 
ATOM   13    O OE1 . GLN A 1 2   ? 40.118  120.946 -24.319 1.00 94.32  ? 3   GLN S OE1 1 
ATOM   14    N NE2 . GLN A 1 2   ? 41.888  120.407 -23.037 1.00 94.32  ? 3   GLN S NE2 1 
ATOM   15    N N   . LYS A 1 3   ? 38.276  122.482 -20.178 1.00 2.00   ? 4   LYS S N   1 
ATOM   16    C CA  . LYS A 1 3   ? 37.651  122.443 -18.874 1.00 2.00   ? 4   LYS S CA  1 
ATOM   17    C C   . LYS A 1 3   ? 37.860  123.751 -18.142 1.00 2.00   ? 4   LYS S C   1 
ATOM   18    O O   . LYS A 1 3   ? 38.608  124.621 -18.599 1.00 6.43   ? 4   LYS S O   1 
ATOM   19    C CB  . LYS A 1 3   ? 38.260  121.314 -18.053 1.00 6.43   ? 4   LYS S CB  1 
ATOM   20    C CG  . LYS A 1 3   ? 37.261  120.377 -17.436 1.00 6.43   ? 4   LYS S CG  1 
ATOM   21    C CD  . LYS A 1 3   ? 37.792  118.959 -17.419 1.00 6.43   ? 4   LYS S CD  1 
ATOM   22    C CE  . LYS A 1 3   ? 37.083  118.151 -16.343 1.00 6.43   ? 4   LYS S CE  1 
ATOM   23    N NZ  . LYS A 1 3   ? 37.529  116.726 -16.275 1.00 6.43   ? 4   LYS S NZ  1 
ATOM   24    N N   . PRO A 1 4   ? 37.177  123.930 -17.005 1.00 12.75  ? 5   PRO S N   1 
ATOM   25    C CA  . PRO A 1 4   ? 37.319  125.157 -16.222 1.00 12.75  ? 5   PRO S CA  1 
ATOM   26    C C   . PRO A 1 4   ? 38.271  124.937 -15.045 1.00 12.75  ? 5   PRO S C   1 
ATOM   27    O O   . PRO A 1 4   ? 38.326  123.849 -14.490 1.00 28.96  ? 5   PRO S O   1 
ATOM   28    C CB  . PRO A 1 4   ? 35.890  125.435 -15.773 1.00 28.96  ? 5   PRO S CB  1 
ATOM   29    C CG  . PRO A 1 4   ? 35.168  124.061 -15.881 1.00 28.96  ? 5   PRO S CG  1 
ATOM   30    C CD  . PRO A 1 4   ? 36.160  123.060 -16.407 1.00 28.96  ? 5   PRO S CD  1 
ATOM   31    N N   . LEU A 1 5   ? 39.007  125.967 -14.656 1.00 6.08   ? 6   LEU S N   1 
ATOM   32    C CA  . LEU A 1 5   ? 39.938  125.811 -13.553 1.00 6.08   ? 6   LEU S CA  1 
ATOM   33    C C   . LEU A 1 5   ? 39.587  126.459 -12.218 1.00 6.08   ? 6   LEU S C   1 
ATOM   34    O O   . LEU A 1 5   ? 39.299  127.659 -12.142 1.00 8.35   ? 6   LEU S O   1 
ATOM   35    C CB  . LEU A 1 5   ? 41.305  126.316 -13.970 1.00 8.35   ? 6   LEU S CB  1 
ATOM   36    C CG  . LEU A 1 5   ? 41.649  125.947 -15.394 1.00 8.35   ? 6   LEU S CG  1 
ATOM   37    C CD1 . LEU A 1 5   ? 42.910  126.731 -15.782 1.00 8.35   ? 6   LEU S CD1 1 
ATOM   38    C CD2 . LEU A 1 5   ? 41.831  124.413 -15.516 1.00 8.35   ? 6   LEU S CD2 1 
ATOM   39    N N   . SER A 1 6   ? 39.653  125.655 -11.162 1.00 2.00   ? 7   SER S N   1 
ATOM   40    C CA  . SER A 1 6   ? 39.386  126.135 -9.818  1.00 2.00   ? 7   SER S CA  1 
ATOM   41    C C   . SER A 1 6   ? 40.408  127.207 -9.506  1.00 2.00   ? 7   SER S C   1 
ATOM   42    O O   . SER A 1 6   ? 41.549  127.128 -9.938  1.00 12.34  ? 7   SER S O   1 
ATOM   43    C CB  . SER A 1 6   ? 39.504  124.983 -8.803  1.00 12.34  ? 7   SER S CB  1 
ATOM   44    O OG  . SER A 1 6   ? 40.283  125.340 -7.669  1.00 12.34  ? 7   SER S OG  1 
ATOM   45    N N   . ASP A 1 7   ? 39.986  128.205 -8.749  1.00 4.23   ? 8   ASP S N   1 
ATOM   46    C CA  . ASP A 1 7   ? 40.846  129.312 -8.352  1.00 4.23   ? 8   ASP S CA  1 
ATOM   47    C C   . ASP A 1 7   ? 42.238  128.834 -7.969  1.00 4.23   ? 8   ASP S C   1 
ATOM   48    O O   . ASP A 1 7   ? 43.228  129.546 -8.174  1.00 74.23  ? 8   ASP S O   1 
ATOM   49    C CB  . ASP A 1 7   ? 40.213  130.046 -7.179  1.00 74.23  ? 8   ASP S CB  1 
ATOM   50    C CG  . ASP A 1 7   ? 39.136  129.224 -6.508  1.00 74.23  ? 8   ASP S CG  1 
ATOM   51    O OD1 . ASP A 1 7   ? 39.371  128.013 -6.298  1.00 74.23  ? 8   ASP S OD1 1 
ATOM   52    O OD2 . ASP A 1 7   ? 38.063  129.779 -6.196  1.00 74.23  ? 8   ASP S OD2 1 
ATOM   53    N N   . ASP A 1 8   ? 42.313  127.626 -7.422  1.00 2.00   ? 9   ASP S N   1 
ATOM   54    C CA  . ASP A 1 8   ? 43.577  127.041 -7.003  1.00 2.00   ? 9   ASP S CA  1 
ATOM   55    C C   . ASP A 1 8   ? 44.380  126.518 -8.179  1.00 2.00   ? 9   ASP S C   1 
ATOM   56    O O   . ASP A 1 8   ? 45.554  126.845 -8.338  1.00 66.51  ? 9   ASP S O   1 
ATOM   57    C CB  . ASP A 1 8   ? 43.322  125.909 -6.006  1.00 66.51  ? 9   ASP S CB  1 
ATOM   58    C CG  . ASP A 1 8   ? 42.666  126.399 -4.725  1.00 66.51  ? 9   ASP S CG  1 
ATOM   59    O OD1 . ASP A 1 8   ? 42.333  127.605 -4.668  1.00 66.51  ? 9   ASP S OD1 1 
ATOM   60    O OD2 . ASP A 1 8   ? 42.487  125.591 -3.788  1.00 66.51  ? 9   ASP S OD2 1 
ATOM   61    N N   . GLU A 1 9   ? 43.744  125.700 -8.997  1.00 7.29   ? 10  GLU S N   1 
ATOM   62    C CA  . GLU A 1 9   ? 44.409  125.137 -10.159 1.00 7.29   ? 10  GLU S CA  1 
ATOM   63    C C   . GLU A 1 9   ? 45.040  126.224 -11.011 1.00 7.29   ? 10  GLU S C   1 
ATOM   64    O O   . GLU A 1 9   ? 45.934  125.970 -11.828 1.00 32.51  ? 10  GLU S O   1 
ATOM   65    C CB  . GLU A 1 9   ? 43.412  124.360 -11.002 1.00 32.51  ? 10  GLU S CB  1 
ATOM   66    C CG  . GLU A 1 9   ? 43.131  122.985 -10.474 1.00 32.51  ? 10  GLU S CG  1 
ATOM   67    C CD  . GLU A 1 9   ? 41.666  122.693 -10.457 1.00 32.51  ? 10  GLU S CD  1 
ATOM   68    O OE1 . GLU A 1 9   ? 40.890  123.588 -10.866 1.00 32.51  ? 10  GLU S OE1 1 
ATOM   69    O OE2 . GLU A 1 9   ? 41.291  121.574 -10.041 1.00 32.51  ? 10  GLU S OE2 1 
ATOM   70    N N   . LYS A 1 10  ? 44.561  127.442 -10.805 1.00 15.65  ? 11  LYS S N   1 
ATOM   71    C CA  . LYS A 1 10  ? 45.045  128.583 -11.555 1.00 15.65  ? 11  LYS S CA  1 
ATOM   72    C C   . LYS A 1 10  ? 46.435  128.962 -11.084 1.00 15.65  ? 11  LYS S C   1 
ATOM   73    O O   . LYS A 1 10  ? 47.053  129.906 -11.591 1.00 100.00 ? 11  LYS S O   1 
ATOM   74    C CB  . LYS A 1 10  ? 44.060  129.741 -11.396 1.00 100.00 ? 11  LYS S CB  1 
ATOM   75    C CG  . LYS A 1 10  ? 42.619  129.331 -11.688 1.00 100.00 ? 11  LYS S CG  1 
ATOM   76    C CD  . LYS A 1 10  ? 41.625  130.368 -11.202 1.00 100.00 ? 11  LYS S CD  1 
ATOM   77    C CE  . LYS A 1 10  ? 40.583  130.683 -12.267 1.00 100.00 ? 11  LYS S CE  1 
ATOM   78    N NZ  . LYS A 1 10  ? 40.832  132.011 -12.907 1.00 100.00 ? 11  LYS S NZ  1 
ATOM   79    N N   . PHE A 1 11  ? 46.925  128.195 -10.116 1.00 43.23  ? 12  PHE S N   1 
ATOM   80    C CA  . PHE A 1 11  ? 48.243  128.417 -9.540  1.00 43.23  ? 12  PHE S CA  1 
ATOM   81    C C   . PHE A 1 11  ? 49.301  127.456 -10.058 1.00 43.23  ? 12  PHE S C   1 
ATOM   82    O O   . PHE A 1 11  ? 50.493  127.599 -9.753  1.00 3.50   ? 12  PHE S O   1 
ATOM   83    C CB  . PHE A 1 11  ? 48.188  128.328 -8.016  1.00 3.50   ? 12  PHE S CB  1 
ATOM   84    C CG  . PHE A 1 11  ? 48.017  129.681 -7.358  1.00 3.50   ? 12  PHE S CG  1 
ATOM   85    C CD1 . PHE A 1 11  ? 48.652  130.797 -7.901  1.00 3.50   ? 12  PHE S CD1 1 
ATOM   86    C CD2 . PHE A 1 11  ? 47.229  129.791 -6.216  1.00 3.50   ? 12  PHE S CD2 1 
ATOM   87    C CE1 . PHE A 1 11  ? 48.489  132.045 -7.299  1.00 3.50   ? 12  PHE S CE1 1 
ATOM   88    C CE2 . PHE A 1 11  ? 47.062  131.039 -5.613  1.00 3.50   ? 12  PHE S CE2 1 
ATOM   89    C CZ  . PHE A 1 11  ? 47.692  132.168 -6.154  1.00 3.50   ? 12  PHE S CZ  1 
ATOM   90    N N   . LEU A 1 12  ? 48.870  126.499 -10.827 1.00 2.00   ? 13  LEU S N   1 
ATOM   91    C CA  . LEU A 1 12  ? 49.793  125.541 -11.440 1.00 2.00   ? 13  LEU S CA  1 
ATOM   92    C C   . LEU A 1 12  ? 49.362  125.286 -12.880 1.00 2.00   ? 13  LEU S C   1 
ATOM   93    O O   . LEU A 1 12  ? 50.089  124.663 -13.662 1.00 13.98  ? 13  LEU S O   1 
ATOM   94    C CB  . LEU A 1 12  ? 49.806  124.227 -10.664 1.00 13.98  ? 13  LEU S CB  1 
ATOM   95    C CG  . LEU A 1 12  ? 50.692  124.260 -9.413  1.00 13.98  ? 13  LEU S CG  1 
ATOM   96    C CD1 . LEU A 1 12  ? 50.789  122.897 -8.721  1.00 13.98  ? 13  LEU S CD1 1 
ATOM   97    C CD2 . LEU A 1 12  ? 52.133  124.689 -9.698  1.00 13.98  ? 13  LEU S CD2 1 
ATOM   98    N N   . PHE A 1 13  ? 48.176  125.780 -13.189 1.00 32.73  ? 14  PHE S N   1 
ATOM   99    C CA  . PHE A 1 13  ? 47.586  125.637 -14.526 1.00 32.73  ? 14  PHE S CA  1 
ATOM   100   C C   . PHE A 1 13  ? 47.437  127.008 -15.191 1.00 32.73  ? 14  PHE S C   1 
ATOM   101   O O   . PHE A 1 13  ? 47.135  128.011 -14.527 1.00 2.00   ? 14  PHE S O   1 
ATOM   102   C CB  . PHE A 1 13  ? 46.199  125.002 -14.428 1.00 2.00   ? 14  PHE S CB  1 
ATOM   103   C CG  . PHE A 1 13  ? 46.211  123.478 -14.576 1.00 2.00   ? 14  PHE S CG  1 
ATOM   104   C CD1 . PHE A 1 13  ? 46.543  122.891 -15.804 1.00 2.00   ? 14  PHE S CD1 1 
ATOM   105   C CD2 . PHE A 1 13  ? 45.884  122.672 -13.481 1.00 2.00   ? 14  PHE S CD2 1 
ATOM   106   C CE1 . PHE A 1 13  ? 46.539  121.497 -15.936 1.00 2.00   ? 14  PHE S CE1 1 
ATOM   107   C CE2 . PHE A 1 13  ? 45.882  121.279 -13.611 1.00 2.00   ? 14  PHE S CE2 1 
ATOM   108   C CZ  . PHE A 1 13  ? 46.208  120.690 -14.839 1.00 2.00   ? 14  PHE S CZ  1 
ATOM   109   N N   . VAL A 1 14  ? 47.650  127.011 -16.492 1.00 6.86   ? 15  VAL S N   1 
ATOM   110   C CA  . VAL A 1 14  ? 47.546  128.227 -17.312 1.00 6.86   ? 15  VAL S CA  1 
ATOM   111   C C   . VAL A 1 14  ? 46.100  128.437 -17.757 1.00 6.86   ? 15  VAL S C   1 
ATOM   112   O O   . VAL A 1 14  ? 45.417  127.496 -18.183 1.00 4.14   ? 15  VAL S O   1 
ATOM   113   C CB  . VAL A 1 14  ? 48.404  128.095 -18.574 1.00 4.14   ? 15  VAL S CB  1 
ATOM   114   C CG1 . VAL A 1 14  ? 49.762  128.789 -18.451 1.00 4.14   ? 15  VAL S CG1 1 
ATOM   115   C CG2 . VAL A 1 14  ? 48.714  126.642 -18.937 1.00 4.14   ? 15  VAL S CG2 1 
ATOM   116   N N   . ASP A 1 15  ? 45.673  129.674 -17.642 1.00 43.90  ? 16  ASP S N   1 
ATOM   117   C CA  . ASP A 1 15  ? 44.325  130.086 -18.045 1.00 43.90  ? 16  ASP S CA  1 
ATOM   118   C C   . ASP A 1 15  ? 44.338  130.364 -19.543 1.00 43.90  ? 16  ASP S C   1 
ATOM   119   O O   . ASP A 1 15  ? 44.890  131.374 -20.002 1.00 100.00 ? 16  ASP S O   1 
ATOM   120   C CB  . ASP A 1 15  ? 43.927  131.309 -17.235 1.00 100.00 ? 16  ASP S CB  1 
ATOM   121   C CG  . ASP A 1 15  ? 43.916  130.998 -15.744 1.00 100.00 ? 16  ASP S CG  1 
ATOM   122   O OD1 . ASP A 1 15  ? 43.791  129.773 -15.354 1.00 100.00 ? 16  ASP S OD1 1 
ATOM   123   O OD2 . ASP A 1 15  ? 44.034  131.944 -14.883 1.00 100.00 ? 16  ASP S OD2 1 
ATOM   124   N N   . LYS A 1 16  ? 43.724  129.444 -20.269 1.00 42.87  ? 17  LYS S N   1 
ATOM   125   C CA  . LYS A 1 16  ? 43.703  129.488 -21.735 1.00 42.87  ? 17  LYS S CA  1 
ATOM   126   C C   . LYS A 1 16  ? 42.291  129.624 -22.316 1.00 42.87  ? 17  LYS S C   1 
ATOM   127   O O   . LYS A 1 16  ? 42.112  129.928 -23.503 1.00 66.58  ? 17  LYS S O   1 
ATOM   128   C CB  . LYS A 1 16  ? 44.292  128.199 -22.309 1.00 66.58  ? 17  LYS S CB  1 
ATOM   129   C CG  . LYS A 1 16  ? 45.789  128.296 -22.600 1.00 66.58  ? 17  LYS S CG  1 
ATOM   130   C CD  . LYS A 1 16  ? 46.353  127.019 -23.230 1.00 66.58  ? 17  LYS S CD  1 
ATOM   131   C CE  . LYS A 1 16  ? 45.285  126.178 -23.932 1.00 66.58  ? 17  LYS S CE  1 
ATOM   132   N NZ  . LYS A 1 16  ? 45.304  124.766 -23.526 1.00 66.58  ? 17  LYS S NZ  1 
ATOM   133   N N   . ASN A 1 17  ? 41.289  129.392 -21.496 1.00 98.92  ? 18  ASN S N   1 
ATOM   134   C CA  . ASN A 1 17  ? 39.901  129.471 -21.971 1.00 98.92  ? 18  ASN S CA  1 
ATOM   135   C C   . ASN A 1 17  ? 39.445  130.931 -22.027 1.00 98.92  ? 18  ASN S C   1 
ATOM   136   O O   . ASN A 1 17  ? 38.935  131.480 -21.037 1.00 100.00 ? 18  ASN S O   1 
ATOM   137   C CB  . ASN A 1 17  ? 38.984  128.644 -21.078 1.00 100.00 ? 18  ASN S CB  1 
ATOM   138   C CG  . ASN A 1 17  ? 38.524  127.356 -21.771 1.00 100.00 ? 18  ASN S CG  1 
ATOM   139   O OD1 . ASN A 1 17  ? 39.336  126.671 -22.395 1.00 100.00 ? 18  ASN S OD1 1 
ATOM   140   N ND2 . ASN A 1 17  ? 37.262  126.982 -21.706 1.00 100.00 ? 18  ASN S ND2 1 
ATOM   141   N N   . PHE A 1 18  ? 39.664  131.482 -23.210 1.00 93.58  ? 19  PHE S N   1 
ATOM   142   C CA  . PHE A 1 18  ? 39.323  132.869 -23.560 1.00 93.58  ? 19  PHE S CA  1 
ATOM   143   C C   . PHE A 1 18  ? 38.956  132.940 -25.047 1.00 93.58  ? 19  PHE S C   1 
ATOM   144   O O   . PHE A 1 18  ? 38.904  131.913 -25.740 1.00 92.32  ? 19  PHE S O   1 
ATOM   145   C CB  . PHE A 1 18  ? 40.526  133.783 -23.304 1.00 92.32  ? 19  PHE S CB  1 
ATOM   146   C CG  . PHE A 1 18  ? 40.762  134.068 -21.819 1.00 92.32  ? 19  PHE S CG  1 
ATOM   147   C CD1 . PHE A 1 18  ? 39.776  133.748 -20.881 1.00 92.32  ? 19  PHE S CD1 1 
ATOM   148   C CD2 . PHE A 1 18  ? 41.965  134.650 -21.401 1.00 92.32  ? 19  PHE S CD2 1 
ATOM   149   C CE1 . PHE A 1 18  ? 39.989  134.012 -19.523 1.00 92.32  ? 19  PHE S CE1 1 
ATOM   150   C CE2 . PHE A 1 18  ? 42.179  134.914 -20.044 1.00 92.32  ? 19  PHE S CE2 1 
ATOM   151   C CZ  . PHE A 1 18  ? 41.192  134.596 -19.105 1.00 92.32  ? 19  PHE S CZ  1 
ATOM   152   N N   . VAL A 1 19  ? 38.708  134.156 -25.497 1.00 73.93  ? 20  VAL S N   1 
ATOM   153   C CA  . VAL A 1 19  ? 38.350  134.425 -26.901 1.00 73.93  ? 20  VAL S CA  1 
ATOM   154   C C   . VAL A 1 19  ? 39.614  134.611 -27.737 1.00 73.93  ? 20  VAL S C   1 
ATOM   155   O O   . VAL A 1 19  ? 40.641  135.094 -27.241 1.00 33.41  ? 20  VAL S O   1 
ATOM   156   C CB  . VAL A 1 19  ? 37.512  135.701 -27.002 1.00 33.41  ? 20  VAL S CB  1 
ATOM   157   C CG1 . VAL A 1 19  ? 38.312  136.967 -26.689 1.00 33.41  ? 20  VAL S CG1 1 
ATOM   158   C CG2 . VAL A 1 19  ? 36.924  135.919 -28.399 1.00 33.41  ? 20  VAL S CG2 1 
ATOM   159   N N   . ASN A 1 20  ? 39.498  134.219 -28.990 1.00 49.28  ? 21  ASN S N   1 
ATOM   160   C CA  . ASN A 1 20  ? 40.607  134.312 -29.942 1.00 49.28  ? 21  ASN S CA  1 
ATOM   161   C C   . ASN A 1 20  ? 40.754  135.746 -30.460 1.00 49.28  ? 21  ASN S C   1 
ATOM   162   O O   . ASN A 1 20  ? 40.732  135.992 -31.674 1.00 100.00 ? 21  ASN S O   1 
ATOM   163   C CB  . ASN A 1 20  ? 40.378  133.383 -31.138 1.00 100.00 ? 21  ASN S CB  1 
ATOM   164   C CG  . ASN A 1 20  ? 38.951  132.841 -31.224 1.00 100.00 ? 21  ASN S CG  1 
ATOM   165   O OD1 . ASN A 1 20  ? 38.535  132.071 -30.360 1.00 100.00 ? 21  ASN S OD1 1 
ATOM   166   N ND2 . ASN A 1 20  ? 38.169  133.195 -32.225 1.00 100.00 ? 21  ASN S ND2 1 
ATOM   167   N N   . ASN A 1 21  ? 40.907  136.683 -29.525 1.00 100.00 ? 22  ASN S N   1 
ATOM   168   C CA  . ASN A 1 21  ? 41.060  138.096 -29.858 1.00 100.00 ? 22  ASN S CA  1 
ATOM   169   C C   . ASN A 1 21  ? 42.137  138.332 -30.920 1.00 100.00 ? 22  ASN S C   1 
ATOM   170   O O   . ASN A 1 21  ? 43.257  137.820 -30.823 1.00 100.00 ? 22  ASN S O   1 
ATOM   171   C CB  . ASN A 1 21  ? 41.400  138.907 -28.601 1.00 100.00 ? 22  ASN S CB  1 
ATOM   172   C CG  . ASN A 1 21  ? 42.864  139.355 -28.568 1.00 100.00 ? 22  ASN S CG  1 
ATOM   173   O OD1 . ASN A 1 21  ? 43.165  140.546 -28.654 1.00 100.00 ? 22  ASN S OD1 1 
ATOM   174   N ND2 . ASN A 1 21  ? 43.777  138.397 -28.440 1.00 100.00 ? 22  ASN S ND2 1 
ATOM   175   N N   . PRO A 1 22  ? 41.792  139.091 -31.966 1.00 100.00 ? 23  PRO S N   1 
ATOM   176   C CA  . PRO A 1 22  ? 42.713  139.409 -33.053 1.00 100.00 ? 23  PRO S CA  1 
ATOM   177   C C   . PRO A 1 22  ? 43.414  140.727 -32.813 1.00 100.00 ? 23  PRO S C   1 
ATOM   178   O O   . PRO A 1 22  ? 44.098  141.242 -33.749 1.00 60.20  ? 23  PRO S O   1 
ATOM   179   C CB  . PRO A 1 22  ? 41.808  139.461 -34.288 1.00 60.20  ? 23  PRO S CB  1 
ATOM   180   C CG  . PRO A 1 22  ? 40.390  139.475 -33.763 1.00 60.20  ? 23  PRO S CG  1 
ATOM   181   C CD  . PRO A 1 22  ? 40.473  139.633 -32.275 1.00 60.20  ? 23  PRO S CD  1 
ATOM   182   N N   . LEU A 1 23  ? 43.255  141.264 -31.610 1.00 100.00 ? 24  LEU S N   1 
ATOM   183   C CA  . LEU A 1 23  ? 43.916  142.532 -31.236 1.00 100.00 ? 24  LEU S CA  1 
ATOM   184   C C   . LEU A 1 23  ? 45.434  142.347 -31.329 1.00 100.00 ? 24  LEU S C   1 
ATOM   185   O O   . LEU A 1 23  ? 46.145  143.124 -31.980 1.00 100.00 ? 24  LEU S O   1 
ATOM   186   C CB  . LEU A 1 23  ? 43.594  142.930 -29.790 1.00 100.00 ? 24  LEU S CB  1 
ATOM   187   C CG  . LEU A 1 23  ? 42.120  143.262 -29.513 1.00 100.00 ? 24  LEU S CG  1 
ATOM   188   C CD1 . LEU A 1 23  ? 41.935  144.625 -28.832 1.00 100.00 ? 24  LEU S CD1 1 
ATOM   189   C CD2 . LEU A 1 23  ? 41.248  143.298 -30.766 1.00 100.00 ? 24  LEU S CD2 1 
ATOM   190   N N   . ALA A 1 24  ? 45.888  141.306 -30.654 1.00 72.86  ? 25  ALA S N   1 
ATOM   191   C CA  . ALA A 1 24  ? 47.305  140.939 -30.637 1.00 72.86  ? 25  ALA S CA  1 
ATOM   192   C C   . ALA A 1 24  ? 47.667  140.311 -31.981 1.00 72.86  ? 25  ALA S C   1 
ATOM   193   O O   . ALA A 1 24  ? 48.738  140.568 -32.542 1.00 77.89  ? 25  ALA S O   1 
ATOM   194   C CB  . ALA A 1 24  ? 47.577  139.936 -29.514 1.00 77.89  ? 25  ALA S CB  1 
ATOM   195   N N   . GLN A 1 25  ? 46.742  139.506 -32.466 1.00 62.54  ? 26  GLN S N   1 
ATOM   196   C CA  . GLN A 1 25  ? 46.904  138.798 -33.741 1.00 62.54  ? 26  GLN S CA  1 
ATOM   197   C C   . GLN A 1 25  ? 46.890  139.788 -34.912 1.00 62.54  ? 26  GLN S C   1 
ATOM   198   O O   . GLN A 1 25  ? 47.180  139.429 -36.060 1.00 100.00 ? 26  GLN S O   1 
ATOM   199   C CB  . GLN A 1 25  ? 45.775  137.786 -33.936 1.00 100.00 ? 26  GLN S CB  1 
ATOM   200   C CG  . GLN A 1 25  ? 46.015  136.848 -35.121 1.00 100.00 ? 26  GLN S CG  1 
ATOM   201   C CD  . GLN A 1 25  ? 45.066  137.118 -36.288 1.00 100.00 ? 26  GLN S CD  1 
ATOM   202   O OE1 . GLN A 1 25  ? 44.451  136.188 -36.809 1.00 100.00 ? 26  GLN S OE1 1 
ATOM   203   N NE2 . GLN A 1 25  ? 44.908  138.350 -36.734 1.00 100.00 ? 26  GLN S NE2 1 
ATOM   204   N N   . ALA A 1 26  ? 46.550  141.026 -34.613 1.00 91.41  ? 27  ALA S N   1 
ATOM   205   C CA  . ALA A 1 26  ? 46.506  142.079 -35.637 1.00 91.41  ? 27  ALA S CA  1 
ATOM   206   C C   . ALA A 1 26  ? 47.688  143.033 -35.453 1.00 91.41  ? 27  ALA S C   1 
ATOM   207   O O   . ALA A 1 26  ? 48.304  143.491 -36.425 1.00 74.16  ? 27  ALA S O   1 
ATOM   208   C CB  . ALA A 1 26  ? 45.201  142.866 -35.539 1.00 74.16  ? 27  ALA S CB  1 
ATOM   209   N N   . ASP A 1 27  ? 47.978  143.307 -34.198 1.00 94.64  ? 28  ASP S N   1 
ATOM   210   C CA  . ASP A 1 27  ? 49.073  144.205 -33.821 1.00 94.64  ? 28  ASP S CA  1 
ATOM   211   C C   . ASP A 1 27  ? 50.409  143.684 -34.370 1.00 94.64  ? 28  ASP S C   1 
ATOM   212   O O   . ASP A 1 27  ? 51.386  144.434 -34.495 1.00 95.46  ? 28  ASP S O   1 
ATOM   213   C CB  . ASP A 1 27  ? 49.168  144.304 -32.300 1.00 95.46  ? 28  ASP S CB  1 
ATOM   214   C CG  . ASP A 1 27  ? 49.912  145.554 -31.840 1.00 95.46  ? 28  ASP S CG  1 
ATOM   215   O OD1 . ASP A 1 27  ? 50.828  146.066 -32.589 1.00 95.46  ? 28  ASP S OD1 1 
ATOM   216   O OD2 . ASP A 1 27  ? 49.622  146.093 -30.709 1.00 95.46  ? 28  ASP S OD2 1 
ATOM   217   N N   . TRP A 1 28  ? 50.408  142.400 -34.692 1.00 100.00 ? 29  TRP S N   1 
ATOM   218   C CA  . TRP A 1 28  ? 51.601  141.694 -35.202 1.00 100.00 ? 29  TRP S CA  1 
ATOM   219   C C   . TRP A 1 28  ? 52.257  142.458 -36.359 1.00 100.00 ? 29  TRP S C   1 
ATOM   220   O O   . TRP A 1 28  ? 53.458  142.302 -36.626 1.00 93.48  ? 29  TRP S O   1 
ATOM   221   C CB  . TRP A 1 28  ? 51.224  140.292 -35.694 1.00 93.48  ? 29  TRP S CB  1 
ATOM   222   C CG  . TRP A 1 28  ? 50.527  140.284 -37.058 1.00 93.48  ? 29  TRP S CG  1 
ATOM   223   C CD1 . TRP A 1 28  ? 49.342  140.833 -37.356 1.00 93.48  ? 29  TRP S CD1 1 
ATOM   224   C CD2 . TRP A 1 28  ? 51.044  139.685 -38.240 1.00 93.48  ? 29  TRP S CD2 1 
ATOM   225   N NE1 . TRP A 1 28  ? 49.091  140.565 -38.740 1.00 93.48  ? 29  TRP S NE1 1 
ATOM   226   C CE2 . TRP A 1 28  ? 50.097  139.887 -39.238 1.00 93.48  ? 29  TRP S CE2 1 
ATOM   227   C CE3 . TRP A 1 28  ? 52.217  138.986 -38.545 1.00 93.48  ? 29  TRP S CE3 1 
ATOM   228   C CZ2 . TRP A 1 28  ? 50.253  139.412 -40.548 1.00 93.48  ? 29  TRP S CZ2 1 
ATOM   229   C CZ3 . TRP A 1 28  ? 52.368  138.517 -39.869 1.00 93.48  ? 29  TRP S CZ3 1 
ATOM   230   C CH2 . TRP A 1 28  ? 51.429  138.721 -40.820 1.00 93.48  ? 29  TRP S CH2 1 
ATOM   231   N N   . SER A 1 29  ? 51.459  143.268 -37.029 1.00 68.50  ? 30  SER S N   1 
ATOM   232   C CA  . SER A 1 29  ? 51.932  144.061 -38.178 1.00 68.50  ? 30  SER S CA  1 
ATOM   233   C C   . SER A 1 29  ? 53.094  144.965 -37.750 1.00 68.50  ? 30  SER S C   1 
ATOM   234   O O   . SER A 1 29  ? 53.993  145.280 -38.543 1.00 80.26  ? 30  SER S O   1 
ATOM   235   C CB  . SER A 1 29  ? 50.788  144.901 -38.737 1.00 80.26  ? 30  SER S CB  1 
ATOM   236   O OG  . SER A 1 29  ? 49.752  144.047 -39.206 1.00 80.26  ? 30  SER S OG  1 
ATOM   237   N N   . ALA A 1 30  ? 53.045  145.373 -36.495 1.00 100.00 ? 31  ALA S N   1 
ATOM   238   C CA  . ALA A 1 30  ? 54.114  146.183 -35.907 1.00 100.00 ? 31  ALA S CA  1 
ATOM   239   C C   . ALA A 1 30  ? 55.326  145.275 -35.733 1.00 100.00 ? 31  ALA S C   1 
ATOM   240   O O   . ALA A 1 30  ? 56.087  145.398 -34.768 1.00 7.72   ? 31  ALA S O   1 
ATOM   241   C CB  . ALA A 1 30  ? 53.671  146.742 -34.552 1.00 7.72   ? 31  ALA S CB  1 
ATOM   242   N N   . LYS A 1 31  ? 55.436  144.378 -36.693 1.00 91.08  ? 32  LYS S N   1 
ATOM   243   C CA  . LYS A 1 31  ? 56.497  143.370 -36.738 1.00 91.08  ? 32  LYS S CA  1 
ATOM   244   C C   . LYS A 1 31  ? 57.791  143.919 -36.137 1.00 91.08  ? 32  LYS S C   1 
ATOM   245   O O   . LYS A 1 31  ? 58.575  143.185 -35.524 1.00 100.00 ? 32  LYS S O   1 
ATOM   246   C CB  . LYS A 1 31  ? 56.748  142.942 -38.182 1.00 100.00 ? 32  LYS S CB  1 
ATOM   247   C CG  . LYS A 1 31  ? 55.533  142.260 -38.814 1.00 100.00 ? 32  LYS S CG  1 
ATOM   248   C CD  . LYS A 1 31  ? 55.859  141.586 -40.144 1.00 100.00 ? 32  LYS S CD  1 
ATOM   249   C CE  . LYS A 1 31  ? 54.642  140.925 -40.788 1.00 100.00 ? 32  LYS S CE  1 
ATOM   250   N NZ  . LYS A 1 31  ? 54.954  140.283 -42.072 1.00 100.00 ? 32  LYS S NZ  1 
ATOM   251   N N   . LYS A 1 32  ? 57.990  145.207 -36.320 1.00 59.52  ? 33  LYS S N   1 
ATOM   252   C CA  . LYS A 1 32  ? 59.192  145.889 -35.825 1.00 59.52  ? 33  LYS S CA  1 
ATOM   253   C C   . LYS A 1 32  ? 59.278  145.802 -34.308 1.00 59.52  ? 33  LYS S C   1 
ATOM   254   O O   . LYS A 1 32  ? 60.145  146.421 -33.701 1.00 63.44  ? 33  LYS S O   1 
ATOM   255   C CB  . LYS A 1 32  ? 59.165  147.359 -36.240 1.00 63.44  ? 33  LYS S CB  1 
ATOM   256   C CG  . LYS A 1 32  ? 59.306  147.550 -37.751 1.00 63.44  ? 33  LYS S CG  1 
ATOM   257   C CD  . LYS A 1 32  ? 60.248  146.531 -38.395 1.00 63.44  ? 33  LYS S CD  1 
ATOM   258   C CE  . LYS A 1 32  ? 59.517  145.305 -38.942 1.00 63.44  ? 33  LYS S CE  1 
ATOM   259   N NZ  . LYS A 1 32  ? 60.191  144.040 -38.612 1.00 63.44  ? 33  LYS S NZ  1 
ATOM   260   N N   . LEU A 1 33  ? 58.382  145.029 -33.694 1.00 17.85  ? 34  LEU S N   1 
ATOM   261   C CA  . LEU A 1 33  ? 58.371  144.875 -32.251 1.00 17.85  ? 34  LEU S CA  1 
ATOM   262   C C   . LEU A 1 33  ? 59.572  144.067 -31.798 1.00 17.85  ? 34  LEU S C   1 
ATOM   263   O O   . LEU A 1 33  ? 59.817  142.957 -32.282 1.00 37.41  ? 34  LEU S O   1 
ATOM   264   C CB  . LEU A 1 33  ? 57.077  144.202 -31.820 1.00 37.41  ? 34  LEU S CB  1 
ATOM   265   C CG  . LEU A 1 33  ? 56.031  145.243 -31.446 1.00 37.41  ? 34  LEU S CG  1 
ATOM   266   C CD1 . LEU A 1 33  ? 54.680  144.581 -31.490 1.00 37.41  ? 34  LEU S CD1 1 
ATOM   267   C CD2 . LEU A 1 33  ? 56.325  145.836 -30.066 1.00 37.41  ? 34  LEU S CD2 1 
ATOM   268   N N   . VAL A 1 34  ? 60.332  144.642 -30.874 1.00 39.73  ? 35  VAL S N   1 
ATOM   269   C CA  . VAL A 1 34  ? 61.528  143.990 -30.359 1.00 39.73  ? 35  VAL S CA  1 
ATOM   270   C C   . VAL A 1 34  ? 61.679  144.208 -28.875 1.00 39.73  ? 35  VAL S C   1 
ATOM   271   O O   . VAL A 1 34  ? 60.824  144.779 -28.226 1.00 4.05   ? 35  VAL S O   1 
ATOM   272   C CB  . VAL A 1 34  ? 62.820  144.535 -31.031 1.00 4.05   ? 35  VAL S CB  1 
ATOM   273   C CG1 . VAL A 1 34  ? 62.679  144.470 -32.546 1.00 4.05   ? 35  VAL S CG1 1 
ATOM   274   C CG2 . VAL A 1 34  ? 63.096  145.965 -30.564 1.00 4.05   ? 35  VAL S CG2 1 
ATOM   275   N N   . TRP A 1 35  ? 62.798  143.752 -28.349 1.00 17.93  ? 36  TRP S N   1 
ATOM   276   C CA  . TRP A 1 35  ? 63.082  143.891 -26.941 1.00 17.93  ? 36  TRP S CA  1 
ATOM   277   C C   . TRP A 1 35  ? 64.271  144.811 -26.840 1.00 17.93  ? 36  TRP S C   1 
ATOM   278   O O   . TRP A 1 35  ? 65.107  144.823 -27.730 1.00 4.34   ? 36  TRP S O   1 
ATOM   279   C CB  . TRP A 1 35  ? 63.433  142.530 -26.350 1.00 4.34   ? 36  TRP S CB  1 
ATOM   280   C CG  . TRP A 1 35  ? 62.232  141.650 -26.197 1.00 4.34   ? 36  TRP S CG  1 
ATOM   281   C CD1 . TRP A 1 35  ? 61.870  140.585 -26.984 1.00 4.34   ? 36  TRP S CD1 1 
ATOM   282   C CD2 . TRP A 1 35  ? 61.231  141.753 -25.182 1.00 4.34   ? 36  TRP S CD2 1 
ATOM   283   N NE1 . TRP A 1 35  ? 60.708  140.022 -26.516 1.00 4.34   ? 36  TRP S NE1 1 
ATOM   284   C CE2 . TRP A 1 35  ? 60.296  140.721 -25.408 1.00 4.34   ? 36  TRP S CE2 1 
ATOM   285   C CE3 . TRP A 1 35  ? 61.033  142.619 -24.103 1.00 4.34   ? 36  TRP S CE3 1 
ATOM   286   C CZ2 . TRP A 1 35  ? 59.176  140.537 -24.590 1.00 4.34   ? 36  TRP S CZ2 1 
ATOM   287   C CZ3 . TRP A 1 35  ? 59.921  142.431 -23.295 1.00 4.34   ? 36  TRP S CZ3 1 
ATOM   288   C CH2 . TRP A 1 35  ? 59.010  141.396 -23.542 1.00 4.34   ? 36  TRP S CH2 1 
ATOM   289   N N   . VAL A 1 36  ? 64.349  145.596 -25.777 1.00 16.82  ? 37  VAL S N   1 
ATOM   290   C CA  . VAL A 1 36  ? 65.489  146.487 -25.618 1.00 16.82  ? 37  VAL S CA  1 
ATOM   291   C C   . VAL A 1 36  ? 65.727  146.913 -24.185 1.00 16.82  ? 37  VAL S C   1 
ATOM   292   O O   . VAL A 1 36  ? 64.838  146.865 -23.349 1.00 5.83   ? 37  VAL S O   1 
ATOM   293   C CB  . VAL A 1 36  ? 65.350  147.753 -26.473 1.00 5.83   ? 37  VAL S CB  1 
ATOM   294   C CG1 . VAL A 1 36  ? 66.319  147.691 -27.631 1.00 5.83   ? 37  VAL S CG1 1 
ATOM   295   C CG2 . VAL A 1 36  ? 63.948  147.875 -26.976 1.00 5.83   ? 37  VAL S CG2 1 
ATOM   296   N N   . PRO A 1 37  ? 66.958  147.321 -23.888 1.00 2.00   ? 38  PRO S N   1 
ATOM   297   C CA  . PRO A 1 37  ? 67.414  147.776 -22.579 1.00 2.00   ? 38  PRO S CA  1 
ATOM   298   C C   . PRO A 1 37  ? 66.363  148.463 -21.736 1.00 2.00   ? 38  PRO S C   1 
ATOM   299   O O   . PRO A 1 37  ? 65.357  148.947 -22.248 1.00 100.00 ? 38  PRO S O   1 
ATOM   300   C CB  . PRO A 1 37  ? 68.574  148.717 -22.912 1.00 100.00 ? 38  PRO S CB  1 
ATOM   301   C CG  . PRO A 1 37  ? 68.873  148.503 -24.404 1.00 100.00 ? 38  PRO S CG  1 
ATOM   302   C CD  . PRO A 1 37  ? 68.057  147.342 -24.865 1.00 100.00 ? 38  PRO S CD  1 
ATOM   303   N N   . SER A 1 38  ? 66.621  148.506 -20.434 1.00 39.27  ? 39  SER S N   1 
ATOM   304   C CA  . SER A 1 38  ? 65.717  149.134 -19.478 1.00 39.27  ? 39  SER S CA  1 
ATOM   305   C C   . SER A 1 38  ? 66.327  149.097 -18.083 1.00 39.27  ? 39  SER S C   1 
ATOM   306   O O   . SER A 1 38  ? 66.431  148.039 -17.464 1.00 53.47  ? 39  SER S O   1 
ATOM   307   C CB  . SER A 1 38  ? 64.372  148.406 -19.465 1.00 53.47  ? 39  SER S CB  1 
ATOM   308   O OG  . SER A 1 38  ? 63.533  148.921 -18.447 1.00 53.47  ? 39  SER S OG  1 
ATOM   309   N N   . GLU A 1 39  ? 66.734  150.258 -17.588 1.00 67.42  ? 40  GLU S N   1 
ATOM   310   C CA  . GLU A 1 39  ? 67.338  150.338 -16.266 1.00 67.42  ? 40  GLU S CA  1 
ATOM   311   C C   . GLU A 1 39  ? 66.309  150.062 -15.176 1.00 67.42  ? 40  GLU S C   1 
ATOM   312   O O   . GLU A 1 39  ? 66.581  150.266 -13.994 1.00 98.94  ? 40  GLU S O   1 
ATOM   313   C CB  . GLU A 1 39  ? 67.958  151.724 -16.056 1.00 98.94  ? 40  GLU S CB  1 
ATOM   314   C CG  . GLU A 1 39  ? 69.480  151.719 -15.969 1.00 98.94  ? 40  GLU S CG  1 
ATOM   315   C CD  . GLU A 1 39  ? 70.057  153.111 -15.788 1.00 98.94  ? 40  GLU S CD  1 
ATOM   316   O OE1 . GLU A 1 39  ? 70.337  153.787 -16.808 1.00 98.94  ? 40  GLU S OE1 1 
ATOM   317   O OE2 . GLU A 1 39  ? 70.228  153.528 -14.623 1.00 98.94  ? 40  GLU S OE2 1 
ATOM   318   N N   . LYS A 1 40  ? 65.133  149.591 -15.575 1.00 62.88  ? 41  LYS S N   1 
ATOM   319   C CA  . LYS A 1 40  ? 64.070  149.304 -14.620 1.00 62.88  ? 41  LYS S CA  1 
ATOM   320   C C   . LYS A 1 40  ? 63.216  148.077 -14.972 1.00 62.88  ? 41  LYS S C   1 
ATOM   321   O O   . LYS A 1 40  ? 62.425  147.604 -14.146 1.00 100.00 ? 41  LYS S O   1 
ATOM   322   C CB  . LYS A 1 40  ? 63.163  150.532 -14.475 1.00 100.00 ? 41  LYS S CB  1 
ATOM   323   C CG  . LYS A 1 40  ? 63.458  151.376 -13.235 1.00 100.00 ? 41  LYS S CG  1 
ATOM   324   C CD  . LYS A 1 40  ? 62.766  150.816 -11.987 1.00 100.00 ? 41  LYS S CD  1 
ATOM   325   C CE  . LYS A 1 40  ? 62.091  151.919 -11.166 1.00 100.00 ? 41  LYS S CE  1 
ATOM   326   N NZ  . LYS A 1 40  ? 60.612  152.033 -11.432 1.00 100.00 ? 41  LYS S NZ  1 
ATOM   327   N N   . HIS A 1 41  ? 63.379  147.562 -16.190 1.00 26.66  ? 42  HIS S N   1 
ATOM   328   C CA  . HIS A 1 41  ? 62.628  146.388 -16.642 1.00 26.66  ? 42  HIS S CA  1 
ATOM   329   C C   . HIS A 1 41  ? 63.573  145.356 -17.235 1.00 26.66  ? 42  HIS S C   1 
ATOM   330   O O   . HIS A 1 41  ? 63.146  144.307 -17.703 1.00 92.36  ? 42  HIS S O   1 
ATOM   331   C CB  . HIS A 1 41  ? 61.608  146.791 -17.702 1.00 92.36  ? 42  HIS S CB  1 
ATOM   332   C CG  . HIS A 1 41  ? 60.467  147.595 -17.170 1.00 92.36  ? 42  HIS S CG  1 
ATOM   333   N ND1 . HIS A 1 41  ? 60.502  148.219 -15.943 1.00 92.36  ? 42  HIS S ND1 1 
ATOM   334   C CD2 . HIS A 1 41  ? 59.258  147.885 -17.707 1.00 92.36  ? 42  HIS S CD2 1 
ATOM   335   C CE1 . HIS A 1 41  ? 59.363  148.855 -15.742 1.00 92.36  ? 42  HIS S CE1 1 
ATOM   336   N NE2 . HIS A 1 41  ? 58.590  148.670 -16.800 1.00 92.36  ? 42  HIS S NE2 1 
ATOM   337   N N   . GLY A 1 42  ? 64.862  145.667 -17.204 1.00 13.19  ? 43  GLY S N   1 
ATOM   338   C CA  . GLY A 1 42  ? 65.853  144.771 -17.767 1.00 13.19  ? 43  GLY S CA  1 
ATOM   339   C C   . GLY A 1 42  ? 65.758  144.831 -19.276 1.00 13.19  ? 43  GLY S C   1 
ATOM   340   O O   . GLY A 1 42  ? 66.757  144.920 -19.991 1.00 49.60  ? 43  GLY S O   1 
ATOM   341   N N   . PHE A 1 43  ? 64.522  144.781 -19.750 1.00 51.45  ? 44  PHE S N   1 
ATOM   342   C CA  . PHE A 1 43  ? 64.219  144.854 -21.165 1.00 51.45  ? 44  PHE S CA  1 
ATOM   343   C C   . PHE A 1 43  ? 62.803  145.382 -21.230 1.00 51.45  ? 44  PHE S C   1 
ATOM   344   O O   . PHE A 1 43  ? 62.095  145.354 -20.226 1.00 42.64  ? 44  PHE S O   1 
ATOM   345   C CB  . PHE A 1 43  ? 64.273  143.472 -21.793 1.00 42.64  ? 44  PHE S CB  1 
ATOM   346   C CG  . PHE A 1 43  ? 65.633  142.888 -21.823 1.00 42.64  ? 44  PHE S CG  1 
ATOM   347   C CD1 . PHE A 1 43  ? 66.565  143.342 -22.735 1.00 42.64  ? 44  PHE S CD1 1 
ATOM   348   C CD2 . PHE A 1 43  ? 65.988  141.893 -20.940 1.00 42.64  ? 44  PHE S CD2 1 
ATOM   349   C CE1 . PHE A 1 43  ? 67.835  142.810 -22.765 1.00 42.64  ? 44  PHE S CE1 1 
ATOM   350   C CE2 . PHE A 1 43  ? 67.252  141.353 -20.960 1.00 42.64  ? 44  PHE S CE2 1 
ATOM   351   C CZ  . PHE A 1 43  ? 68.184  141.812 -21.875 1.00 42.64  ? 44  PHE S CZ  1 
ATOM   352   N N   . GLU A 1 44  ? 62.388  145.864 -22.393 1.00 50.52  ? 45  GLU S N   1 
ATOM   353   C CA  . GLU A 1 44  ? 61.039  146.378 -22.534 1.00 50.52  ? 45  GLU S CA  1 
ATOM   354   C C   . GLU A 1 44  ? 60.588  146.357 -23.984 1.00 50.52  ? 45  GLU S C   1 
ATOM   355   O O   . GLU A 1 44  ? 61.414  146.344 -24.896 1.00 100.00 ? 45  GLU S O   1 
ATOM   356   C CB  . GLU A 1 44  ? 60.955  147.787 -21.938 1.00 100.00 ? 45  GLU S CB  1 
ATOM   357   C CG  . GLU A 1 44  ? 61.267  148.926 -22.882 1.00 100.00 ? 45  GLU S CG  1 
ATOM   358   C CD  . GLU A 1 44  ? 60.519  150.186 -22.493 1.00 100.00 ? 45  GLU S CD  1 
ATOM   359   O OE1 . GLU A 1 44  ? 60.619  150.595 -21.314 1.00 100.00 ? 45  GLU S OE1 1 
ATOM   360   O OE2 . GLU A 1 44  ? 59.826  150.762 -23.362 1.00 100.00 ? 45  GLU S OE2 1 
ATOM   361   N N   . ALA A 1 45  ? 59.271  146.344 -24.187 1.00 48.74  ? 46  ALA S N   1 
ATOM   362   C CA  . ALA A 1 45  ? 58.689  146.306 -25.526 1.00 48.74  ? 46  ALA S CA  1 
ATOM   363   C C   . ALA A 1 45  ? 58.834  147.609 -26.295 1.00 48.74  ? 46  ALA S C   1 
ATOM   364   O O   . ALA A 1 45  ? 58.722  148.688 -25.730 1.00 15.79  ? 46  ALA S O   1 
ATOM   365   C CB  . ALA A 1 45  ? 57.238  145.941 -25.438 1.00 15.79  ? 46  ALA S CB  1 
ATOM   366   N N   . ALA A 1 46  ? 59.077  147.498 -27.596 1.00 92.76  ? 47  ALA S N   1 
ATOM   367   C CA  . ALA A 1 46  ? 59.241  148.661 -28.457 1.00 92.76  ? 47  ALA S CA  1 
ATOM   368   C C   . ALA A 1 46  ? 59.242  148.206 -29.902 1.00 92.76  ? 47  ALA S C   1 
ATOM   369   O O   . ALA A 1 46  ? 59.415  147.012 -30.179 1.00 30.20  ? 47  ALA S O   1 
ATOM   370   C CB  . ALA A 1 46  ? 60.549  149.368 -28.136 1.00 30.20  ? 47  ALA S CB  1 
ATOM   371   N N   . SER A 1 47  ? 59.046  149.144 -30.824 1.00 71.20  ? 48  SER S N   1 
ATOM   372   C CA  . SER A 1 47  ? 59.039  148.788 -32.241 1.00 71.20  ? 48  SER S CA  1 
ATOM   373   C C   . SER A 1 47  ? 59.918  149.628 -33.155 1.00 71.20  ? 48  SER S C   1 
ATOM   374   O O   . SER A 1 47  ? 59.922  150.864 -33.099 1.00 18.17  ? 48  SER S O   1 
ATOM   375   C CB  . SER A 1 47  ? 57.615  148.782 -32.794 1.00 18.17  ? 48  SER S CB  1 
ATOM   376   O OG  . SER A 1 47  ? 57.556  148.045 -34.008 1.00 18.17  ? 48  SER S OG  1 
ATOM   377   N N   . ILE A 1 48  ? 60.652  148.916 -34.010 1.00 57.15  ? 49  ILE S N   1 
ATOM   378   C CA  . ILE A 1 48  ? 61.566  149.515 -34.965 1.00 57.15  ? 49  ILE S CA  1 
ATOM   379   C C   . ILE A 1 48  ? 60.888  150.631 -35.746 1.00 57.15  ? 49  ILE S C   1 
ATOM   380   O O   . ILE A 1 48  ? 59.733  150.511 -36.171 1.00 33.90  ? 49  ILE S O   1 
ATOM   381   C CB  . ILE A 1 48  ? 62.114  148.454 -35.967 1.00 33.90  ? 49  ILE S CB  1 
ATOM   382   C CG1 . ILE A 1 48  ? 62.681  147.248 -35.219 1.00 33.90  ? 49  ILE S CG1 1 
ATOM   383   C CG2 . ILE A 1 48  ? 63.197  149.066 -36.837 1.00 33.90  ? 49  ILE S CG2 1 
ATOM   384   C CD1 . ILE A 1 48  ? 62.856  146.015 -36.096 1.00 33.90  ? 49  ILE S CD1 1 
ATOM   385   N N   . LYS A 1 49  ? 61.624  151.721 -35.928 1.00 100.00 ? 50  LYS S N   1 
ATOM   386   C CA  . LYS A 1 49  ? 61.146  152.883 -36.667 1.00 100.00 ? 50  LYS S CA  1 
ATOM   387   C C   . LYS A 1 49  ? 61.977  153.074 -37.940 1.00 100.00 ? 50  LYS S C   1 
ATOM   388   O O   . LYS A 1 49  ? 61.446  153.462 -38.982 1.00 73.18  ? 50  LYS S O   1 
ATOM   389   C CB  . LYS A 1 49  ? 61.232  154.130 -35.786 1.00 73.18  ? 50  LYS S CB  1 
ATOM   390   C CG  . LYS A 1 49  ? 60.226  154.136 -34.656 1.00 73.18  ? 50  LYS S CG  1 
ATOM   391   C CD  . LYS A 1 49  ? 58.820  153.991 -35.215 1.00 73.18  ? 50  LYS S CD  1 
ATOM   392   C CE  . LYS A 1 49  ? 57.765  154.340 -34.174 1.00 73.18  ? 50  LYS S CE  1 
ATOM   393   N NZ  . LYS A 1 49  ? 56.859  155.448 -34.604 1.00 73.18  ? 50  LYS S NZ  1 
ATOM   394   N N   . GLU A 1 50  ? 63.281  152.796 -37.851 1.00 57.37  ? 51  GLU S N   1 
ATOM   395   C CA  . GLU A 1 50  ? 64.170  152.919 -39.003 1.00 57.37  ? 51  GLU S CA  1 
ATOM   396   C C   . GLU A 1 50  ? 65.516  152.222 -38.824 1.00 57.37  ? 51  GLU S C   1 
ATOM   397   O O   . GLU A 1 50  ? 66.304  152.586 -37.947 1.00 100.00 ? 51  GLU S O   1 
ATOM   398   C CB  . GLU A 1 50  ? 64.400  154.389 -39.333 1.00 100.00 ? 51  GLU S CB  1 
ATOM   399   C CG  . GLU A 1 50  ? 64.378  154.685 -40.821 1.00 100.00 ? 51  GLU S CG  1 
ATOM   400   C CD  . GLU A 1 50  ? 64.530  156.169 -41.122 1.00 100.00 ? 51  GLU S CD  1 
ATOM   401   O OE1 . GLU A 1 50  ? 64.662  156.963 -40.161 1.00 100.00 ? 51  GLU S OE1 1 
ATOM   402   O OE2 . GLU A 1 50  ? 64.515  156.535 -42.323 1.00 100.00 ? 51  GLU S OE2 1 
ATOM   403   N N   . GLU A 1 51  ? 65.775  151.225 -39.672 1.00 53.24  ? 52  GLU S N   1 
ATOM   404   C CA  . GLU A 1 51  ? 67.031  150.479 -39.619 1.00 53.24  ? 52  GLU S CA  1 
ATOM   405   C C   . GLU A 1 51  ? 68.127  151.263 -40.329 1.00 53.24  ? 52  GLU S C   1 
ATOM   406   O O   . GLU A 1 51  ? 68.085  151.444 -41.548 1.00 100.00 ? 52  GLU S O   1 
ATOM   407   C CB  . GLU A 1 51  ? 66.869  149.099 -40.271 1.00 100.00 ? 52  GLU S CB  1 
ATOM   408   C CG  . GLU A 1 51  ? 66.679  147.942 -39.275 1.00 100.00 ? 52  GLU S CG  1 
ATOM   409   C CD  . GLU A 1 51  ? 67.406  146.652 -39.680 1.00 100.00 ? 52  GLU S CD  1 
ATOM   410   O OE1 . GLU A 1 51  ? 68.211  146.686 -40.639 1.00 100.00 ? 52  GLU S OE1 1 
ATOM   411   O OE2 . GLU A 1 51  ? 67.168  145.601 -39.032 1.00 100.00 ? 52  GLU S OE2 1 
ATOM   412   N N   . LYS A 1 52  ? 69.108  151.729 -39.559 1.00 72.05  ? 53  LYS S N   1 
ATOM   413   C CA  . LYS A 1 52  ? 70.209  152.516 -40.105 1.00 72.05  ? 53  LYS S CA  1 
ATOM   414   C C   . LYS A 1 52  ? 71.559  151.858 -39.862 1.00 72.05  ? 53  LYS S C   1 
ATOM   415   O O   . LYS A 1 52  ? 72.297  152.258 -38.959 1.00 100.00 ? 53  LYS S O   1 
ATOM   416   C CB  . LYS A 1 52  ? 70.206  153.914 -39.483 1.00 100.00 ? 53  LYS S CB  1 
ATOM   417   C CG  . LYS A 1 52  ? 69.011  154.185 -38.574 1.00 100.00 ? 53  LYS S CG  1 
ATOM   418   C CD  . LYS A 1 52  ? 68.039  155.183 -39.192 1.00 100.00 ? 53  LYS S CD  1 
ATOM   419   C CE  . LYS A 1 52  ? 67.763  154.877 -40.659 1.00 100.00 ? 53  LYS S CE  1 
ATOM   420   N NZ  . LYS A 1 52  ? 67.897  156.098 -41.507 1.00 100.00 ? 53  LYS S NZ  1 
ATOM   421   N N   . GLY A 1 53  ? 71.880  150.856 -40.670 1.00 67.78  ? 54  GLY S N   1 
ATOM   422   C CA  . GLY A 1 53  ? 73.147  150.162 -40.520 1.00 67.78  ? 54  GLY S CA  1 
ATOM   423   C C   . GLY A 1 53  ? 73.347  149.601 -39.121 1.00 67.78  ? 54  GLY S C   1 
ATOM   424   O O   . GLY A 1 53  ? 72.403  149.099 -38.508 1.00 54.42  ? 54  GLY S O   1 
ATOM   425   N N   . ASP A 1 54  ? 74.574  149.686 -38.616 1.00 58.04  ? 55  ASP S N   1 
ATOM   426   C CA  . ASP A 1 54  ? 74.906  149.181 -37.286 1.00 58.04  ? 55  ASP S CA  1 
ATOM   427   C C   . ASP A 1 54  ? 73.952  149.669 -36.189 1.00 58.04  ? 55  ASP S C   1 
ATOM   428   O O   . ASP A 1 54  ? 73.979  149.159 -35.071 1.00 99.20  ? 55  ASP S O   1 
ATOM   429   C CB  . ASP A 1 54  ? 76.339  149.578 -36.929 1.00 99.20  ? 55  ASP S CB  1 
ATOM   430   C CG  . ASP A 1 54  ? 76.777  149.020 -35.595 1.00 99.20  ? 55  ASP S CG  1 
ATOM   431   O OD1 . ASP A 1 54  ? 76.552  147.814 -35.364 1.00 99.20  ? 55  ASP S OD1 1 
ATOM   432   O OD2 . ASP A 1 54  ? 77.343  149.780 -34.780 1.00 99.20  ? 55  ASP S OD2 1 
ATOM   433   N N   . GLU A 1 55  ? 73.125  150.661 -36.519 1.00 66.89  ? 56  GLU S N   1 
ATOM   434   C CA  . GLU A 1 55  ? 72.157  151.226 -35.580 1.00 66.89  ? 56  GLU S CA  1 
ATOM   435   C C   . GLU A 1 55  ? 70.740  151.229 -36.148 1.00 66.89  ? 56  GLU S C   1 
ATOM   436   O O   . GLU A 1 55  ? 70.544  151.099 -37.359 1.00 100.00 ? 56  GLU S O   1 
ATOM   437   C CB  . GLU A 1 55  ? 72.546  152.656 -35.217 1.00 100.00 ? 56  GLU S CB  1 
ATOM   438   C CG  . GLU A 1 55  ? 73.594  152.743 -34.130 1.00 100.00 ? 56  GLU S CG  1 
ATOM   439   C CD  . GLU A 1 55  ? 75.005  152.790 -34.687 1.00 100.00 ? 56  GLU S CD  1 
ATOM   440   O OE1 . GLU A 1 55  ? 75.236  152.216 -35.776 1.00 100.00 ? 56  GLU S OE1 1 
ATOM   441   O OE2 . GLU A 1 55  ? 75.881  153.405 -34.037 1.00 100.00 ? 56  GLU S OE2 1 
ATOM   442   N N   . VAL A 1 56  ? 69.752  151.378 -35.267 1.00 45.71  ? 57  VAL S N   1 
ATOM   443   C CA  . VAL A 1 56  ? 68.352  151.390 -35.680 1.00 45.71  ? 57  VAL S CA  1 
ATOM   444   C C   . VAL A 1 56  ? 67.505  152.229 -34.732 1.00 45.71  ? 57  VAL S C   1 
ATOM   445   O O   . VAL A 1 56  ? 67.700  152.201 -33.515 1.00 97.80  ? 57  VAL S O   1 
ATOM   446   C CB  . VAL A 1 56  ? 67.767  149.961 -35.718 1.00 97.80  ? 57  VAL S CB  1 
ATOM   447   C CG1 . VAL A 1 56  ? 66.338  150.004 -36.224 1.00 97.80  ? 57  VAL S CG1 1 
ATOM   448   C CG2 . VAL A 1 56  ? 68.622  149.060 -36.608 1.00 97.80  ? 57  VAL S CG2 1 
ATOM   449   N N   . THR A 1 57  ? 66.562  152.973 -35.303 1.00 99.24  ? 58  THR S N   1 
ATOM   450   C CA  . THR A 1 57  ? 65.663  153.834 -34.536 1.00 99.24  ? 58  THR S CA  1 
ATOM   451   C C   . THR A 1 57  ? 64.413  153.060 -34.116 1.00 99.24  ? 58  THR S C   1 
ATOM   452   O O   . THR A 1 57  ? 63.835  152.334 -34.921 1.00 100.00 ? 58  THR S O   1 
ATOM   453   C CB  . THR A 1 57  ? 65.231  155.066 -35.373 1.00 100.00 ? 58  THR S CB  1 
ATOM   454   O OG1 . THR A 1 57  ? 64.183  154.688 -36.276 1.00 100.00 ? 58  THR S OG1 1 
ATOM   455   C CG2 . THR A 1 57  ? 66.406  155.605 -36.179 1.00 100.00 ? 58  THR S CG2 1 
ATOM   456   N N   . VAL A 1 58  ? 63.994  153.209 -32.861 1.00 34.72  ? 59  VAL S N   1 
ATOM   457   C CA  . VAL A 1 58  ? 62.816  152.496 -32.376 1.00 34.72  ? 59  VAL S CA  1 
ATOM   458   C C   . VAL A 1 58  ? 62.014  153.317 -31.375 1.00 34.72  ? 59  VAL S C   1 
ATOM   459   O O   . VAL A 1 58  ? 62.567  154.154 -30.669 1.00 88.35  ? 59  VAL S O   1 
ATOM   460   C CB  . VAL A 1 58  ? 63.234  151.172 -31.697 1.00 88.35  ? 59  VAL S CB  1 
ATOM   461   C CG1 . VAL A 1 58  ? 62.033  150.510 -31.046 1.00 88.35  ? 59  VAL S CG1 1 
ATOM   462   C CG2 . VAL A 1 58  ? 63.866  150.241 -32.716 1.00 88.35  ? 59  VAL S CG2 1 
ATOM   463   N N   . GLU A 1 59  ? 60.709  153.069 -31.311 1.00 38.97  ? 60  GLU S N   1 
ATOM   464   C CA  . GLU A 1 59  ? 59.851  153.769 -30.359 1.00 38.97  ? 60  GLU S CA  1 
ATOM   465   C C   . GLU A 1 59  ? 59.232  152.787 -29.354 1.00 38.97  ? 60  GLU S C   1 
ATOM   466   O O   . GLU A 1 59  ? 58.619  151.783 -29.745 1.00 100.00 ? 60  GLU S O   1 
ATOM   467   C CB  . GLU A 1 59  ? 58.743  154.516 -31.094 1.00 100.00 ? 60  GLU S CB  1 
ATOM   468   C CG  . GLU A 1 59  ? 57.622  155.014 -30.192 1.00 100.00 ? 60  GLU S CG  1 
ATOM   469   C CD  . GLU A 1 59  ? 56.949  156.267 -30.730 1.00 100.00 ? 60  GLU S CD  1 
ATOM   470   O OE1 . GLU A 1 59  ? 57.613  157.324 -30.807 1.00 100.00 ? 60  GLU S OE1 1 
ATOM   471   O OE2 . GLU A 1 59  ? 55.748  156.192 -31.072 1.00 100.00 ? 60  GLU S OE2 1 
ATOM   472   N N   . LEU A 1 60  ? 59.396  153.082 -28.063 1.00 17.75  ? 61  LEU S N   1 
ATOM   473   C CA  . LEU A 1 60  ? 58.857  152.220 -27.015 1.00 17.75  ? 61  LEU S CA  1 
ATOM   474   C C   . LEU A 1 60  ? 57.365  152.014 -27.151 1.00 17.75  ? 61  LEU S C   1 
ATOM   475   O O   . LEU A 1 60  ? 56.602  152.967 -27.100 1.00 38.87  ? 61  LEU S O   1 
ATOM   476   C CB  . LEU A 1 60  ? 59.121  152.800 -25.628 1.00 38.87  ? 61  LEU S CB  1 
ATOM   477   C CG  . LEU A 1 60  ? 60.343  153.688 -25.442 1.00 38.87  ? 61  LEU S CG  1 
ATOM   478   C CD1 . LEU A 1 60  ? 60.482  154.037 -23.960 1.00 38.87  ? 61  LEU S CD1 1 
ATOM   479   C CD2 . LEU A 1 60  ? 61.586  152.978 -25.971 1.00 38.87  ? 61  LEU S CD2 1 
ATOM   480   N N   . GLN A 1 61  ? 56.957  150.761 -27.332 1.00 98.63  ? 62  GLN S N   1 
ATOM   481   C CA  . GLN A 1 61  ? 55.542  150.434 -27.432 1.00 98.63  ? 62  GLN S CA  1 
ATOM   482   C C   . GLN A 1 61  ? 54.983  150.583 -26.007 1.00 98.63  ? 62  GLN S C   1 
ATOM   483   O O   . GLN A 1 61  ? 53.932  150.041 -25.652 1.00 100.00 ? 62  GLN S O   1 
ATOM   484   C CB  . GLN A 1 61  ? 55.366  149.001 -27.973 1.00 100.00 ? 62  GLN S CB  1 
ATOM   485   C CG  . GLN A 1 61  ? 54.828  147.970 -26.979 1.00 100.00 ? 62  GLN S CG  1 
ATOM   486   C CD  . GLN A 1 61  ? 53.722  147.109 -27.562 1.00 100.00 ? 62  GLN S CD  1 
ATOM   487   O OE1 . GLN A 1 61  ? 53.342  147.264 -28.728 1.00 100.00 ? 62  GLN S OE1 1 
ATOM   488   N NE2 . GLN A 1 61  ? 53.200  146.187 -26.753 1.00 100.00 ? 62  GLN S NE2 1 
ATOM   489   N N   . GLU A 1 62  ? 55.710  151.349 -25.201 1.00 15.94  ? 63  GLU S N   1 
ATOM   490   C CA  . GLU A 1 62  ? 55.325  151.607 -23.823 1.00 15.94  ? 63  GLU S CA  1 
ATOM   491   C C   . GLU A 1 62  ? 55.158  153.105 -23.576 1.00 15.94  ? 63  GLU S C   1 
ATOM   492   O O   . GLU A 1 62  ? 54.039  153.617 -23.540 1.00 100.00 ? 63  GLU S O   1 
ATOM   493   C CB  . GLU A 1 62  ? 56.389  151.036 -22.878 1.00 100.00 ? 63  GLU S CB  1 
ATOM   494   C CG  . GLU A 1 62  ? 56.419  151.647 -21.478 1.00 100.00 ? 63  GLU S CG  1 
ATOM   495   C CD  . GLU A 1 62  ? 55.034  151.968 -20.937 1.00 100.00 ? 63  GLU S CD  1 
ATOM   496   O OE1 . GLU A 1 62  ? 54.218  151.032 -20.792 1.00 100.00 ? 63  GLU S OE1 1 
ATOM   497   O OE2 . GLU A 1 62  ? 54.764  153.157 -20.659 1.00 100.00 ? 63  GLU S OE2 1 
ATOM   498   N N   . ASN A 1 63  ? 56.277  153.805 -23.423 1.00 81.34  ? 64  ASN S N   1 
ATOM   499   C CA  . ASN A 1 63  ? 56.252  155.244 -23.161 1.00 81.34  ? 64  ASN S CA  1 
ATOM   500   C C   . ASN A 1 63  ? 55.977  156.097 -24.397 1.00 81.34  ? 64  ASN S C   1 
ATOM   501   O O   . ASN A 1 63  ? 56.013  157.326 -24.328 1.00 100.00 ? 64  ASN S O   1 
ATOM   502   C CB  . ASN A 1 63  ? 57.578  155.682 -22.539 1.00 100.00 ? 64  ASN S CB  1 
ATOM   503   C CG  . ASN A 1 63  ? 57.502  157.072 -21.936 1.00 100.00 ? 64  ASN S CG  1 
ATOM   504   O OD1 . ASN A 1 63  ? 58.252  157.971 -22.321 1.00 100.00 ? 64  ASN S OD1 1 
ATOM   505   N ND2 . ASN A 1 63  ? 56.591  157.256 -20.983 1.00 100.00 ? 64  ASN S ND2 1 
ATOM   506   N N   . GLY A 1 64  ? 55.702  155.452 -25.524 1.00 76.17  ? 65  GLY S N   1 
ATOM   507   C CA  . GLY A 1 64  ? 55.447  156.193 -26.746 1.00 76.17  ? 65  GLY S CA  1 
ATOM   508   C C   . GLY A 1 64  ? 56.690  156.965 -27.154 1.00 76.17  ? 65  GLY S C   1 
ATOM   509   O O   . GLY A 1 64  ? 56.710  157.624 -28.197 1.00 36.57  ? 65  GLY S O   1 
ATOM   510   N N   . LYS A 1 65  ? 57.728  156.878 -26.323 1.00 75.35  ? 66  LYS S N   1 
ATOM   511   C CA  . LYS A 1 65  ? 58.996  157.562 -26.563 1.00 75.35  ? 66  LYS S CA  1 
ATOM   512   C C   . LYS A 1 65  ? 59.715  157.021 -27.792 1.00 75.35  ? 66  LYS S C   1 
ATOM   513   O O   . LYS A 1 65  ? 59.496  155.880 -28.205 1.00 100.00 ? 66  LYS S O   1 
ATOM   514   C CB  . LYS A 1 65  ? 59.900  157.427 -25.338 1.00 100.00 ? 66  LYS S CB  1 
ATOM   515   C CG  . LYS A 1 65  ? 60.592  158.716 -24.951 1.00 100.00 ? 66  LYS S CG  1 
ATOM   516   C CD  . LYS A 1 65  ? 61.816  158.970 -25.824 1.00 100.00 ? 66  LYS S CD  1 
ATOM   517   C CE  . LYS A 1 65  ? 62.732  160.033 -25.211 1.00 100.00 ? 66  LYS S CE  1 
ATOM   518   N NZ  . LYS A 1 65  ? 64.002  159.463 -24.661 1.00 100.00 ? 66  LYS S NZ  1 
ATOM   519   N N   . LYS A 1 66  ? 60.580  157.847 -28.374 1.00 64.47  ? 67  LYS S N   1 
ATOM   520   C CA  . LYS A 1 66  ? 61.340  157.455 -29.557 1.00 64.47  ? 67  LYS S CA  1 
ATOM   521   C C   . LYS A 1 66  ? 62.855  157.573 -29.353 1.00 64.47  ? 67  LYS S C   1 
ATOM   522   O O   . LYS A 1 66  ? 63.407  158.680 -29.328 1.00 100.00 ? 67  LYS S O   1 
ATOM   523   C CB  . LYS A 1 66  ? 60.922  158.305 -30.756 1.00 100.00 ? 67  LYS S CB  1 
ATOM   524   C CG  . LYS A 1 66  ? 60.858  157.536 -32.069 1.00 100.00 ? 67  LYS S CG  1 
ATOM   525   C CD  . LYS A 1 66  ? 59.640  157.948 -32.885 1.00 100.00 ? 67  LYS S CD  1 
ATOM   526   C CE  . LYS A 1 66  ? 59.850  157.697 -34.372 1.00 100.00 ? 67  LYS S CE  1 
ATOM   527   N NZ  . LYS A 1 66  ? 58.782  158.330 -35.202 1.00 100.00 ? 67  LYS S NZ  1 
ATOM   528   N N   . VAL A 1 67  ? 63.517  156.420 -29.214 1.00 100.00 ? 68  VAL S N   1 
ATOM   529   C CA  . VAL A 1 67  ? 64.969  156.353 -29.019 1.00 100.00 ? 68  VAL S CA  1 
ATOM   530   C C   . VAL A 1 67  ? 65.621  155.358 -29.983 1.00 100.00 ? 68  VAL S C   1 
ATOM   531   O O   . VAL A 1 67  ? 65.047  154.320 -30.317 1.00 80.19  ? 68  VAL S O   1 
ATOM   532   C CB  . VAL A 1 67  ? 65.339  155.916 -27.580 1.00 80.19  ? 68  VAL S CB  1 
ATOM   533   C CG1 . VAL A 1 67  ? 66.841  156.072 -27.363 1.00 80.19  ? 68  VAL S CG1 1 
ATOM   534   C CG2 . VAL A 1 67  ? 64.558  156.739 -26.563 1.00 80.19  ? 68  VAL S CG2 1 
ATOM   535   N N   . THR A 1 68  ? 66.835  155.679 -30.416 1.00 100.00 ? 69  THR S N   1 
ATOM   536   C CA  . THR A 1 68  ? 67.560  154.820 -31.341 1.00 100.00 ? 69  THR S CA  1 
ATOM   537   C C   . THR A 1 68  ? 68.762  154.155 -30.677 1.00 100.00 ? 69  THR S C   1 
ATOM   538   O O   . THR A 1 68  ? 69.585  154.819 -30.033 1.00 89.41  ? 69  THR S O   1 
ATOM   539   C CB  . THR A 1 68  ? 68.044  155.616 -32.561 1.00 89.41  ? 69  THR S CB  1 
ATOM   540   O OG1 . THR A 1 68  ? 66.910  156.069 -33.305 1.00 89.41  ? 69  THR S OG1 1 
ATOM   541   C CG2 . THR A 1 68  ? 68.928  154.753 -33.453 1.00 89.41  ? 69  THR S CG2 1 
ATOM   542   N N   . LEU A 1 69  ? 68.846  152.846 -30.842 1.00 100.00 ? 70  LEU S N   1 
ATOM   543   C CA  . LEU A 1 69  ? 69.946  152.057 -30.279 1.00 100.00 ? 70  LEU S CA  1 
ATOM   544   C C   . LEU A 1 69  ? 70.666  151.241 -31.353 1.00 100.00 ? 70  LEU S C   1 
ATOM   545   O O   . LEU A 1 69  ? 70.154  151.102 -32.471 1.00 41.60  ? 70  LEU S O   1 
ATOM   546   C CB  . LEU A 1 69  ? 69.433  151.125 -29.177 1.00 41.60  ? 70  LEU S CB  1 
ATOM   547   C CG  . LEU A 1 69  ? 68.768  151.792 -27.971 1.00 41.60  ? 70  LEU S CG  1 
ATOM   548   C CD1 . LEU A 1 69  ? 68.303  150.749 -26.967 1.00 41.60  ? 70  LEU S CD1 1 
ATOM   549   C CD2 . LEU A 1 69  ? 69.715  152.782 -27.312 1.00 41.60  ? 70  LEU S CD2 1 
ATOM   550   N N   . SER A 1 70  ? 71.832  150.727 -31.008 1.00 27.62  ? 71  SER S N   1 
ATOM   551   C CA  . SER A 1 70  ? 72.604  149.924 -31.943 1.00 27.62  ? 71  SER S CA  1 
ATOM   552   C C   . SER A 1 70  ? 71.775  148.760 -32.487 1.00 27.62  ? 71  SER S C   1 
ATOM   553   O O   . SER A 1 70  ? 70.921  148.194 -31.799 1.00 37.64  ? 71  SER S O   1 
ATOM   554   C CB  . SER A 1 70  ? 73.877  149.398 -31.263 1.00 37.64  ? 71  SER S CB  1 
ATOM   555   O OG  . SER A 1 70  ? 75.018  149.554 -32.103 1.00 37.64  ? 71  SER S OG  1 
ATOM   556   N N   . LYS A 1 71  ? 72.038  148.415 -33.739 1.00 21.60  ? 72  LYS S N   1 
ATOM   557   C CA  . LYS A 1 71  ? 71.335  147.329 -34.405 1.00 21.60  ? 72  LYS S CA  1 
ATOM   558   C C   . LYS A 1 71  ? 71.754  145.991 -33.808 1.00 21.60  ? 72  LYS S C   1 
ATOM   559   O O   . LYS A 1 71  ? 71.743  144.965 -34.485 1.00 99.61  ? 72  LYS S O   1 
ATOM   560   C CB  . LYS A 1 71  ? 71.655  147.367 -35.900 1.00 99.61  ? 72  LYS S CB  1 
ATOM   561   C CG  . LYS A 1 71  ? 70.926  146.342 -36.734 1.00 99.61  ? 72  LYS S CG  1 
ATOM   562   C CD  . LYS A 1 71  ? 71.893  145.654 -37.683 1.00 99.61  ? 72  LYS S CD  1 
ATOM   563   C CE  . LYS A 1 71  ? 71.241  145.374 -39.035 1.00 99.61  ? 72  LYS S CE  1 
ATOM   564   N NZ  . LYS A 1 71  ? 71.099  146.596 -39.895 1.00 99.61  ? 72  LYS S NZ  1 
ATOM   565   N N   . ASP A 1 72  ? 72.132  146.002 -32.525 1.00 62.45  ? 73  ASP S N   1 
ATOM   566   C CA  . ASP A 1 72  ? 72.564  144.801 -31.845 1.00 62.45  ? 73  ASP S CA  1 
ATOM   567   C C   . ASP A 1 72  ? 72.191  144.846 -30.380 1.00 62.45  ? 73  ASP S C   1 
ATOM   568   O O   . ASP A 1 72  ? 72.610  143.993 -29.582 1.00 100.00 ? 73  ASP S O   1 
ATOM   569   C CB  . ASP A 1 72  ? 74.073  144.653 -31.890 1.00 100.00 ? 73  ASP S CB  1 
ATOM   570   C CG  . ASP A 1 72  ? 74.707  145.952 -32.336 1.00 100.00 ? 73  ASP S CG  1 
ATOM   571   O OD1 . ASP A 1 72  ? 74.817  146.162 -33.564 1.00 100.00 ? 73  ASP S OD1 1 
ATOM   572   O OD2 . ASP A 1 72  ? 75.079  146.764 -31.468 1.00 100.00 ? 73  ASP S OD2 1 
ATOM   573   N N   . ASP A 1 73  ? 71.397  145.839 -29.999 1.00 75.51  ? 74  ASP S N   1 
ATOM   574   C CA  . ASP A 1 73  ? 70.968  145.981 -28.621 1.00 75.51  ? 74  ASP S CA  1 
ATOM   575   C C   . ASP A 1 73  ? 69.485  145.666 -28.536 1.00 75.51  ? 74  ASP S C   1 
ATOM   576   O O   . ASP A 1 73  ? 68.863  145.774 -27.478 1.00 95.27  ? 74  ASP S O   1 
ATOM   577   C CB  . ASP A 1 73  ? 71.257  147.399 -28.131 1.00 95.27  ? 74  ASP S CB  1 
ATOM   578   C CG  . ASP A 1 73  ? 72.741  147.654 -27.934 1.00 95.27  ? 74  ASP S CG  1 
ATOM   579   O OD1 . ASP A 1 73  ? 73.548  147.063 -28.680 1.00 95.27  ? 74  ASP S OD1 1 
ATOM   580   O OD2 . ASP A 1 73  ? 73.105  148.441 -27.037 1.00 95.27  ? 74  ASP S OD2 1 
ATOM   581   N N   . ILE A 1 74  ? 68.927  145.275 -29.674 1.00 43.79  ? 75  ILE S N   1 
ATOM   582   C CA  . ILE A 1 74  ? 67.522  144.901 -29.755 1.00 43.79  ? 75  ILE S CA  1 
ATOM   583   C C   . ILE A 1 74  ? 67.425  143.374 -29.785 1.00 43.79  ? 75  ILE S C   1 
ATOM   584   O O   . ILE A 1 74  ? 68.330  142.699 -30.277 1.00 36.07  ? 75  ILE S O   1 
ATOM   585   C CB  . ILE A 1 74  ? 66.858  145.467 -31.021 1.00 36.07  ? 75  ILE S CB  1 
ATOM   586   C CG1 . ILE A 1 74  ? 67.617  144.992 -32.254 1.00 36.07  ? 75  ILE S CG1 1 
ATOM   587   C CG2 . ILE A 1 74  ? 66.836  146.985 -30.964 1.00 36.07  ? 75  ILE S CG2 1 
ATOM   588   C CD1 . ILE A 1 74  ? 66.748  144.858 -33.479 1.00 36.07  ? 75  ILE S CD1 1 
ATOM   589   N N   . GLN A 1 75  ? 66.333  142.832 -29.260 1.00 2.00   ? 76  GLN S N   1 
ATOM   590   C CA  . GLN A 1 75  ? 66.165  141.400 -29.221 1.00 2.00   ? 76  GLN S CA  1 
ATOM   591   C C   . GLN A 1 75  ? 64.792  140.993 -29.674 1.00 2.00   ? 76  GLN S C   1 
ATOM   592   O O   . GLN A 1 75  ? 63.778  141.507 -29.210 1.00 82.26  ? 76  GLN S O   1 
ATOM   593   C CB  . GLN A 1 75  ? 66.430  140.879 -27.814 1.00 82.26  ? 76  GLN S CB  1 
ATOM   594   C CG  . GLN A 1 75  ? 67.829  141.181 -27.312 1.00 82.26  ? 76  GLN S CG  1 
ATOM   595   C CD  . GLN A 1 75  ? 68.041  140.749 -25.876 1.00 82.26  ? 76  GLN S CD  1 
ATOM   596   O OE1 . GLN A 1 75  ? 67.352  139.861 -25.373 1.00 82.26  ? 76  GLN S OE1 1 
ATOM   597   N NE2 . GLN A 1 75  ? 69.000  141.380 -25.205 1.00 82.26  ? 76  GLN S NE2 1 
ATOM   598   N N   . LYS A 1 76  ? 64.788  140.046 -30.600 1.00 16.71  ? 77  LYS S N   1 
ATOM   599   C CA  . LYS A 1 76  ? 63.574  139.490 -31.183 1.00 16.71  ? 77  LYS S CA  1 
ATOM   600   C C   . LYS A 1 76  ? 62.544  139.110 -30.124 1.00 16.71  ? 77  LYS S C   1 
ATOM   601   O O   . LYS A 1 76  ? 62.863  138.544 -29.088 1.00 28.59  ? 77  LYS S O   1 
ATOM   602   C CB  . LYS A 1 76  ? 63.934  138.266 -32.035 1.00 28.59  ? 77  LYS S CB  1 
ATOM   603   C CG  . LYS A 1 76  ? 65.440  138.199 -32.454 1.00 28.59  ? 77  LYS S CG  1 
ATOM   604   C CD  . LYS A 1 76  ? 66.348  137.572 -31.349 1.00 28.59  ? 77  LYS S CD  1 
ATOM   605   C CE  . LYS A 1 76  ? 67.783  137.302 -31.828 1.00 28.59  ? 77  LYS S CE  1 
ATOM   606   N NZ  . LYS A 1 76  ? 68.786  137.856 -30.886 1.00 28.59  ? 77  LYS S NZ  1 
ATOM   607   N N   . MET A 1 77  ? 61.294  139.441 -30.405 1.00 24.13  ? 78  MET S N   1 
ATOM   608   C CA  . MET A 1 77  ? 60.190  139.165 -29.502 1.00 24.13  ? 78  MET S CA  1 
ATOM   609   C C   . MET A 1 77  ? 59.496  137.885 -29.971 1.00 24.13  ? 78  MET S C   1 
ATOM   610   O O   . MET A 1 77  ? 59.460  137.583 -31.171 1.00 25.70  ? 78  MET S O   1 
ATOM   611   C CB  . MET A 1 77  ? 59.204  140.331 -29.550 1.00 25.70  ? 78  MET S CB  1 
ATOM   612   C CG  . MET A 1 77  ? 58.547  140.614 -28.198 1.00 25.70  ? 78  MET S CG  1 
ATOM   613   S SD  . MET A 1 77  ? 58.099  142.324 -27.986 1.00 25.70  ? 78  MET S SD  1 
ATOM   614   C CE  . MET A 1 77  ? 56.691  142.456 -26.908 1.00 25.70  ? 78  MET S CE  1 
ATOM   615   N N   . ASN A 1 78  ? 58.955  137.146 -29.024 1.00 16.97  ? 79  ASN S N   1 
ATOM   616   C CA  . ASN A 1 78  ? 58.264  135.890 -29.347 1.00 16.97  ? 79  ASN S CA  1 
ATOM   617   C C   . ASN A 1 78  ? 56.764  136.148 -29.517 1.00 16.97  ? 79  ASN S C   1 
ATOM   618   O O   . ASN A 1 78  ? 56.186  137.012 -28.839 1.00 9.04   ? 79  ASN S O   1 
ATOM   619   C CB  . ASN A 1 78  ? 58.531  134.838 -28.277 1.00 9.04   ? 79  ASN S CB  1 
ATOM   620   C CG  . ASN A 1 78  ? 59.370  133.680 -28.823 1.00 9.04   ? 79  ASN S CG  1 
ATOM   621   O OD1 . ASN A 1 78  ? 60.343  133.272 -28.195 1.00 9.04   ? 79  ASN S OD1 1 
ATOM   622   N ND2 . ASN A 1 78  ? 59.050  133.124 -29.980 1.00 9.04   ? 79  ASN S ND2 1 
ATOM   623   N N   . PRO A 1 79  ? 56.105  135.397 -30.414 1.00 4.60   ? 80  PRO S N   1 
ATOM   624   C CA  . PRO A 1 79  ? 54.696  135.607 -30.738 1.00 4.60   ? 80  PRO S CA  1 
ATOM   625   C C   . PRO A 1 79  ? 53.798  135.510 -29.529 1.00 4.60   ? 80  PRO S C   1 
ATOM   626   O O   . PRO A 1 79  ? 54.212  134.886 -28.501 1.00 3.50   ? 80  PRO S O   1 
ATOM   627   C CB  . PRO A 1 79  ? 54.389  134.538 -31.755 1.00 3.50   ? 80  PRO S CB  1 
ATOM   628   C CG  . PRO A 1 79  ? 55.666  133.749 -32.001 1.00 3.50   ? 80  PRO S CG  1 
ATOM   629   C CD  . PRO A 1 79  ? 56.755  134.308 -31.144 1.00 3.50   ? 80  PRO S CD  1 
ATOM   630   N N   . PRO A 1 80  ? 52.582  136.102 -29.608 1.00 51.66  ? 81  PRO S N   1 
ATOM   631   C CA  . PRO A 1 80  ? 51.622  136.091 -28.507 1.00 51.66  ? 81  PRO S CA  1 
ATOM   632   C C   . PRO A 1 80  ? 51.189  134.690 -28.148 1.00 51.66  ? 81  PRO S C   1 
ATOM   633   O O   . PRO A 1 80  ? 50.625  134.485 -27.028 1.00 62.12  ? 81  PRO S O   1 
ATOM   634   C CB  . PRO A 1 80  ? 50.443  136.879 -29.035 1.00 62.12  ? 81  PRO S CB  1 
ATOM   635   C CG  . PRO A 1 80  ? 50.770  137.316 -30.454 1.00 62.12  ? 81  PRO S CG  1 
ATOM   636   C CD  . PRO A 1 80  ? 52.132  136.811 -30.812 1.00 62.12  ? 81  PRO S CD  1 
ATOM   637   N N   . LYS A 1 81  ? 51.445  133.778 -29.064 1.00 10.42  ? 82  LYS S N   1 
ATOM   638   C CA  . LYS A 1 81  ? 51.061  132.363 -28.913 1.00 10.42  ? 82  LYS S CA  1 
ATOM   639   C C   . LYS A 1 81  ? 51.949  131.640 -27.893 1.00 10.42  ? 82  LYS S C   1 
ATOM   640   O O   . LYS A 1 81  ? 51.767  130.444 -27.621 1.00 100.00 ? 82  LYS S O   1 
ATOM   641   C CB  . LYS A 1 81  ? 51.215  131.632 -30.251 1.00 100.00 ? 82  LYS S CB  1 
ATOM   642   C CG  . LYS A 1 81  ? 51.923  130.280 -30.117 1.00 100.00 ? 82  LYS S CG  1 
ATOM   643   C CD  . LYS A 1 81  ? 53.319  130.266 -30.745 1.00 100.00 ? 82  LYS S CD  1 
ATOM   644   C CE  . LYS A 1 81  ? 53.290  130.257 -32.274 1.00 100.00 ? 82  LYS S CE  1 
ATOM   645   N NZ  . LYS A 1 81  ? 52.699  129.034 -32.832 1.00 100.00 ? 82  LYS S NZ  1 
ATOM   646   N N   . PHE A 1 82  ? 52.890  132.380 -27.335 1.00 40.00  ? 83  PHE S N   1 
ATOM   647   C CA  . PHE A 1 82  ? 53.855  131.807 -26.385 1.00 40.00  ? 83  PHE S CA  1 
ATOM   648   C C   . PHE A 1 82  ? 53.668  132.333 -24.977 1.00 40.00  ? 83  PHE S C   1 
ATOM   649   O O   . PHE A 1 82  ? 54.397  131.938 -24.072 1.00 11.66  ? 83  PHE S O   1 
ATOM   650   C CB  . PHE A 1 82  ? 55.282  132.139 -26.818 1.00 11.66  ? 83  PHE S CB  1 
ATOM   651   C CG  . PHE A 1 82  ? 55.785  131.232 -27.938 1.00 11.66  ? 83  PHE S CG  1 
ATOM   652   C CD1 . PHE A 1 82  ? 55.783  129.842 -27.765 1.00 11.66  ? 83  PHE S CD1 1 
ATOM   653   C CD2 . PHE A 1 82  ? 56.243  131.788 -29.136 1.00 11.66  ? 83  PHE S CD2 1 
ATOM   654   C CE1 . PHE A 1 82  ? 56.241  129.009 -28.792 1.00 11.66  ? 83  PHE S CE1 1 
ATOM   655   C CE2 . PHE A 1 82  ? 56.700  130.956 -30.162 1.00 11.66  ? 83  PHE S CE2 1 
ATOM   656   C CZ  . PHE A 1 82  ? 56.700  129.567 -29.992 1.00 11.66  ? 83  PHE S CZ  1 
ATOM   657   N N   . SER A 1 83  ? 52.704  133.212 -24.762 1.00 28.42  ? 84  SER S N   1 
ATOM   658   C CA  . SER A 1 83  ? 52.545  133.758 -23.423 1.00 28.42  ? 84  SER S CA  1 
ATOM   659   C C   . SER A 1 83  ? 52.441  132.717 -22.323 1.00 28.42  ? 84  SER S C   1 
ATOM   660   O O   . SER A 1 83  ? 51.650  131.783 -22.405 1.00 84.94  ? 84  SER S O   1 
ATOM   661   C CB  . SER A 1 83  ? 51.344  134.701 -23.364 1.00 84.94  ? 84  SER S CB  1 
ATOM   662   O OG  . SER A 1 83  ? 51.771  135.995 -22.951 1.00 84.94  ? 84  SER S OG  1 
ATOM   663   N N   . LYS A 1 84  ? 53.280  132.887 -21.307 1.00 2.00   ? 85  LYS S N   1 
ATOM   664   C CA  . LYS A 1 84  ? 53.292  132.012 -20.146 1.00 2.00   ? 85  LYS S CA  1 
ATOM   665   C C   . LYS A 1 84  ? 53.548  130.555 -20.470 1.00 2.00   ? 85  LYS S C   1 
ATOM   666   O O   . LYS A 1 84  ? 52.903  129.680 -19.915 1.00 46.37  ? 85  LYS S O   1 
ATOM   667   C CB  . LYS A 1 84  ? 51.962  132.115 -19.394 1.00 46.37  ? 85  LYS S CB  1 
ATOM   668   C CG  . LYS A 1 84  ? 52.021  132.955 -18.140 1.00 46.37  ? 85  LYS S CG  1 
ATOM   669   C CD  . LYS A 1 84  ? 51.055  134.111 -18.211 1.00 46.37  ? 85  LYS S CD  1 
ATOM   670   C CE  . LYS A 1 84  ? 49.628  133.626 -18.073 1.00 46.37  ? 85  LYS S CE  1 
ATOM   671   N NZ  . LYS A 1 84  ? 48.664  134.766 -18.120 1.00 46.37  ? 85  LYS S NZ  1 
ATOM   672   N N   . VAL A 1 85  ? 54.495  130.273 -21.347 1.00 16.98  ? 86  VAL S N   1 
ATOM   673   C CA  . VAL A 1 85  ? 54.839  128.907 -21.759 1.00 16.98  ? 86  VAL S CA  1 
ATOM   674   C C   . VAL A 1 85  ? 55.297  127.961 -20.639 1.00 16.98  ? 86  VAL S C   1 
ATOM   675   O O   . VAL A 1 85  ? 55.744  128.404 -19.593 1.00 2.00   ? 86  VAL S O   1 
ATOM   676   C CB  . VAL A 1 85  ? 55.941  128.976 -22.785 1.00 2.00   ? 86  VAL S CB  1 
ATOM   677   C CG1 . VAL A 1 85  ? 57.275  128.990 -22.079 1.00 2.00   ? 86  VAL S CG1 1 
ATOM   678   C CG2 . VAL A 1 85  ? 55.812  127.828 -23.752 1.00 2.00   ? 86  VAL S CG2 1 
ATOM   679   N N   . GLU A 1 86  ? 55.198  126.660 -20.880 1.00 2.80   ? 87  GLU S N   1 
ATOM   680   C CA  . GLU A 1 86  ? 55.606  125.656 -19.908 1.00 2.80   ? 87  GLU S CA  1 
ATOM   681   C C   . GLU A 1 86  ? 57.086  125.258 -20.031 1.00 2.80   ? 87  GLU S C   1 
ATOM   682   O O   . GLU A 1 86  ? 57.763  125.047 -19.017 1.00 97.20  ? 87  GLU S O   1 
ATOM   683   C CB  . GLU A 1 86  ? 54.746  124.403 -20.065 1.00 97.20  ? 87  GLU S CB  1 
ATOM   684   C CG  . GLU A 1 86  ? 53.271  124.637 -19.853 1.00 97.20  ? 87  GLU S CG  1 
ATOM   685   C CD  . GLU A 1 86  ? 52.942  124.961 -18.412 1.00 97.20  ? 87  GLU S CD  1 
ATOM   686   O OE1 . GLU A 1 86  ? 53.685  125.755 -17.796 1.00 97.20  ? 87  GLU S OE1 1 
ATOM   687   O OE2 . GLU A 1 86  ? 51.941  124.420 -17.896 1.00 97.20  ? 87  GLU S OE2 1 
ATOM   688   N N   . ASP A 1 87  ? 57.587  125.149 -21.264 1.00 2.00   ? 88  ASP S N   1 
ATOM   689   C CA  . ASP A 1 87  ? 58.976  124.756 -21.519 1.00 2.00   ? 88  ASP S CA  1 
ATOM   690   C C   . ASP A 1 87  ? 59.728  125.720 -22.431 1.00 2.00   ? 88  ASP S C   1 
ATOM   691   O O   . ASP A 1 87  ? 59.689  125.563 -23.637 1.00 3.43   ? 88  ASP S O   1 
ATOM   692   C CB  . ASP A 1 87  ? 58.993  123.347 -22.123 1.00 3.43   ? 88  ASP S CB  1 
ATOM   693   C CG  . ASP A 1 87  ? 60.396  122.829 -22.354 1.00 3.43   ? 88  ASP S CG  1 
ATOM   694   O OD1 . ASP A 1 87  ? 61.360  123.612 -22.154 1.00 3.43   ? 88  ASP S OD1 1 
ATOM   695   O OD2 . ASP A 1 87  ? 60.539  121.636 -22.733 1.00 3.43   ? 88  ASP S OD2 1 
ATOM   696   N N   . MET A 1 88  ? 60.421  126.703 -21.849 1.00 2.00   ? 89  MET S N   1 
ATOM   697   C CA  . MET A 1 88  ? 61.200  127.702 -22.593 1.00 2.00   ? 89  MET S CA  1 
ATOM   698   C C   . MET A 1 88  ? 61.827  127.135 -23.839 1.00 2.00   ? 89  MET S C   1 
ATOM   699   O O   . MET A 1 88  ? 61.946  127.811 -24.855 1.00 2.00   ? 89  MET S O   1 
ATOM   700   C CB  . MET A 1 88  ? 62.308  128.241 -21.738 1.00 2.00   ? 89  MET S CB  1 
ATOM   701   C CG  . MET A 1 88  ? 61.921  128.330 -20.330 1.00 2.00   ? 89  MET S CG  1 
ATOM   702   S SD  . MET A 1 88  ? 61.067  129.856 -20.171 1.00 2.00   ? 89  MET S SD  1 
ATOM   703   C CE  . MET A 1 88  ? 62.176  130.676 -18.916 1.00 2.00   ? 89  MET S CE  1 
ATOM   704   N N   . ALA A 1 89  ? 62.250  125.887 -23.757 1.00 2.00   ? 90  ALA S N   1 
ATOM   705   C CA  . ALA A 1 89  ? 62.843  125.231 -24.893 1.00 2.00   ? 90  ALA S CA  1 
ATOM   706   C C   . ALA A 1 89  ? 61.834  125.171 -26.057 1.00 2.00   ? 90  ALA S C   1 
ATOM   707   O O   . ALA A 1 89  ? 62.089  124.542 -27.079 1.00 33.94  ? 90  ALA S O   1 
ATOM   708   C CB  . ALA A 1 89  ? 63.275  123.845 -24.499 1.00 33.94  ? 90  ALA S CB  1 
ATOM   709   N N   . GLU A 1 90  ? 60.689  125.831 -25.910 1.00 2.00   ? 91  GLU S N   1 
ATOM   710   C CA  . GLU A 1 90  ? 59.654  125.837 -26.946 1.00 2.00   ? 91  GLU S CA  1 
ATOM   711   C C   . GLU A 1 90  ? 59.611  127.153 -27.737 1.00 2.00   ? 91  GLU S C   1 
ATOM   712   O O   . GLU A 1 90  ? 59.624  127.149 -28.976 1.00 100.00 ? 91  GLU S O   1 
ATOM   713   C CB  . GLU A 1 90  ? 58.277  125.586 -26.325 1.00 100.00 ? 91  GLU S CB  1 
ATOM   714   C CG  . GLU A 1 90  ? 57.849  124.126 -26.380 1.00 100.00 ? 91  GLU S CG  1 
ATOM   715   C CD  . GLU A 1 90  ? 57.319  123.629 -25.040 1.00 100.00 ? 91  GLU S CD  1 
ATOM   716   O OE1 . GLU A 1 90  ? 57.197  124.454 -24.056 1.00 100.00 ? 91  GLU S OE1 1 
ATOM   717   O OE2 . GLU A 1 90  ? 57.001  122.392 -24.895 1.00 100.00 ? 91  GLU S OE2 1 
ATOM   718   N N   . LEU A 1 91  ? 59.548  128.265 -27.025 1.00 16.79  ? 92  LEU S N   1 
ATOM   719   C CA  . LEU A 1 91  ? 59.498  129.594 -27.675 1.00 16.79  ? 92  LEU S CA  1 
ATOM   720   C C   . LEU A 1 91  ? 60.510  129.636 -28.823 1.00 16.79  ? 92  LEU S C   1 
ATOM   721   O O   . LEU A 1 91  ? 61.691  129.311 -28.643 1.00 3.36   ? 92  LEU S O   1 
ATOM   722   C CB  . LEU A 1 91  ? 59.846  130.700 -26.680 1.00 3.36   ? 92  LEU S CB  1 
ATOM   723   C CG  . LEU A 1 91  ? 59.084  130.599 -25.361 1.00 3.36   ? 92  LEU S CG  1 
ATOM   724   C CD1 . LEU A 1 91  ? 60.016  130.563 -24.148 1.00 3.36   ? 92  LEU S CD1 1 
ATOM   725   C CD2 . LEU A 1 91  ? 58.134  131.777 -25.130 1.00 3.36   ? 92  LEU S CD2 1 
ATOM   726   N N   . THR A 1 92  ? 60.022  130.047 -29.979 1.00 29.21  ? 93  THR S N   1 
ATOM   727   C CA  . THR A 1 92  ? 60.832  130.096 -31.208 1.00 29.21  ? 93  THR S CA  1 
ATOM   728   C C   . THR A 1 92  ? 61.917  131.148 -31.152 1.00 29.21  ? 93  THR S C   1 
ATOM   729   O O   . THR A 1 92  ? 62.599  131.370 -32.136 1.00 2.00   ? 93  THR S O   1 
ATOM   730   C CB  . THR A 1 92  ? 59.966  130.397 -32.429 1.00 2.00   ? 93  THR S CB  1 
ATOM   731   O OG1 . THR A 1 92  ? 58.746  130.990 -32.027 1.00 2.00   ? 93  THR S OG1 1 
ATOM   732   C CG2 . THR A 1 92  ? 59.631  129.139 -33.235 1.00 2.00   ? 93  THR S CG2 1 
ATOM   733   N N   . CYS A 1 93  ? 62.066  131.804 -30.005 1.00 80.60  ? 94  CYS S N   1 
ATOM   734   C CA  . CYS A 1 93  ? 63.096  132.822 -29.835 1.00 80.60  ? 94  CYS S CA  1 
ATOM   735   C C   . CYS A 1 93  ? 63.688  132.718 -28.438 1.00 80.60  ? 94  CYS S C   1 
ATOM   736   O O   . CYS A 1 93  ? 62.988  132.951 -27.456 1.00 100.00 ? 94  CYS S O   1 
ATOM   737   C CB  . CYS A 1 93  ? 62.512  134.219 -30.024 1.00 100.00 ? 94  CYS S CB  1 
ATOM   738   S SG  . CYS A 1 93  ? 62.004  134.591 -31.709 1.00 100.00 ? 94  CYS S SG  1 
ATOM   739   N N   . LEU A 1 94  ? 64.967  132.357 -28.344 1.00 2.00   ? 95  LEU S N   1 
ATOM   740   C CA  . LEU A 1 94  ? 65.630  132.253 -27.047 1.00 2.00   ? 95  LEU S CA  1 
ATOM   741   C C   . LEU A 1 94  ? 66.367  133.556 -26.792 1.00 2.00   ? 95  LEU S C   1 
ATOM   742   O O   . LEU A 1 94  ? 67.144  134.009 -27.624 1.00 41.94  ? 95  LEU S O   1 
ATOM   743   C CB  . LEU A 1 94  ? 66.602  131.102 -27.061 1.00 41.94  ? 95  LEU S CB  1 
ATOM   744   C CG  . LEU A 1 94  ? 65.897  129.903 -26.467 1.00 41.94  ? 95  LEU S CG  1 
ATOM   745   C CD1 . LEU A 1 94  ? 66.332  128.641 -27.192 1.00 41.94  ? 95  LEU S CD1 1 
ATOM   746   C CD2 . LEU A 1 94  ? 66.203  129.842 -24.985 1.00 41.94  ? 95  LEU S CD2 1 
ATOM   747   N N   . ASN A 1 95  ? 66.111  134.182 -25.657 1.00 2.00   ? 96  ASN S N   1 
ATOM   748   C CA  . ASN A 1 95  ? 66.746  135.452 -25.351 1.00 2.00   ? 96  ASN S CA  1 
ATOM   749   C C   . ASN A 1 95  ? 66.833  135.615 -23.853 1.00 2.00   ? 96  ASN S C   1 
ATOM   750   O O   . ASN A 1 95  ? 66.062  135.018 -23.092 1.00 24.14  ? 96  ASN S O   1 
ATOM   751   C CB  . ASN A 1 95  ? 65.921  136.628 -25.891 1.00 24.14  ? 96  ASN S CB  1 
ATOM   752   C CG  . ASN A 1 95  ? 65.907  136.698 -27.397 1.00 24.14  ? 96  ASN S CG  1 
ATOM   753   O OD1 . ASN A 1 95  ? 65.135  136.007 -28.052 1.00 24.14  ? 96  ASN S OD1 1 
ATOM   754   N ND2 . ASN A 1 95  ? 66.757  137.544 -27.958 1.00 24.14  ? 96  ASN S ND2 1 
ATOM   755   N N   . GLU A 1 96  ? 67.769  136.446 -23.430 1.00 50.01  ? 97  GLU S N   1 
ATOM   756   C CA  . GLU A 1 96  ? 67.924  136.727 -22.017 1.00 50.01  ? 97  GLU S CA  1 
ATOM   757   C C   . GLU A 1 96  ? 66.676  137.529 -21.673 1.00 50.01  ? 97  GLU S C   1 
ATOM   758   O O   . GLU A 1 96  ? 66.280  137.651 -20.511 1.00 55.77  ? 97  GLU S O   1 
ATOM   759   C CB  . GLU A 1 96  ? 69.184  137.564 -21.793 1.00 55.77  ? 97  GLU S CB  1 
ATOM   760   C CG  . GLU A 1 96  ? 69.688  137.594 -20.358 1.00 55.77  ? 97  GLU S CG  1 
ATOM   761   C CD  . GLU A 1 96  ? 70.633  138.752 -20.109 1.00 55.77  ? 97  GLU S CD  1 
ATOM   762   O OE1 . GLU A 1 96  ? 71.271  139.203 -21.082 1.00 55.77  ? 97  GLU S OE1 1 
ATOM   763   O OE2 . GLU A 1 96  ? 70.740  139.221 -18.953 1.00 55.77  ? 97  GLU S OE2 1 
ATOM   764   N N   . ALA A 1 97  ? 66.049  138.053 -22.722 1.00 23.63  ? 98  ALA S N   1 
ATOM   765   C CA  . ALA A 1 97  ? 64.854  138.866 -22.607 1.00 23.63  ? 98  ALA S CA  1 
ATOM   766   C C   . ALA A 1 97  ? 63.579  138.045 -22.482 1.00 23.63  ? 98  ALA S C   1 
ATOM   767   O O   . ALA A 1 97  ? 62.837  138.182 -21.492 1.00 41.07  ? 98  ALA S O   1 
ATOM   768   C CB  . ALA A 1 97  ? 64.750  139.772 -23.794 1.00 41.07  ? 98  ALA S CB  1 
ATOM   769   N N   . SER A 1 98  ? 63.308  137.218 -23.489 1.00 53.30  ? 99  SER S N   1 
ATOM   770   C CA  . SER A 1 98  ? 62.111  136.380 -23.487 1.00 53.30  ? 99  SER S CA  1 
ATOM   771   C C   . SER A 1 98  ? 62.131  135.476 -22.268 1.00 53.30  ? 99  SER S C   1 
ATOM   772   O O   . SER A 1 98  ? 61.225  135.530 -21.424 1.00 51.62  ? 99  SER S O   1 
ATOM   773   C CB  . SER A 1 98  ? 62.067  135.539 -24.754 1.00 51.62  ? 99  SER S CB  1 
ATOM   774   O OG  . SER A 1 98  ? 63.006  136.031 -25.692 1.00 51.62  ? 99  SER S OG  1 
ATOM   775   N N   . VAL A 1 99  ? 63.176  134.652 -22.184 1.00 10.33  ? 100 VAL S N   1 
ATOM   776   C CA  . VAL A 1 99  ? 63.377  133.730 -21.071 1.00 10.33  ? 100 VAL S CA  1 
ATOM   777   C C   . VAL A 1 99  ? 63.044  134.431 -19.745 1.00 10.33  ? 100 VAL S C   1 
ATOM   778   O O   . VAL A 1 99  ? 62.472  133.845 -18.820 1.00 15.35  ? 100 VAL S O   1 
ATOM   779   C CB  . VAL A 1 99  ? 64.832  133.272 -21.045 1.00 15.35  ? 100 VAL S CB  1 
ATOM   780   C CG1 . VAL A 1 99  ? 65.143  132.569 -19.736 1.00 15.35  ? 100 VAL S CG1 1 
ATOM   781   C CG2 . VAL A 1 99  ? 65.089  132.373 -22.222 1.00 15.35  ? 100 VAL S CG2 1 
ATOM   782   N N   . LEU A 1 100 ? 63.425  135.699 -19.673 1.00 39.75  ? 101 LEU S N   1 
ATOM   783   C CA  . LEU A 1 100 ? 63.177  136.511 -18.499 1.00 39.75  ? 101 LEU S CA  1 
ATOM   784   C C   . LEU A 1 100 ? 61.697  136.756 -18.474 1.00 39.75  ? 101 LEU S C   1 
ATOM   785   O O   . LEU A 1 100 ? 61.021  136.418 -17.513 1.00 12.84  ? 101 LEU S O   1 
ATOM   786   C CB  . LEU A 1 100 ? 63.912  137.854 -18.602 1.00 12.84  ? 101 LEU S CB  1 
ATOM   787   C CG  . LEU A 1 100 ? 63.254  139.067 -17.941 1.00 12.84  ? 101 LEU S CG  1 
ATOM   788   C CD1 . LEU A 1 100 ? 63.281  138.933 -16.417 1.00 12.84  ? 101 LEU S CD1 1 
ATOM   789   C CD2 . LEU A 1 100 ? 63.993  140.310 -18.367 1.00 12.84  ? 101 LEU S CD2 1 
ATOM   790   N N   . HIS A 1 101 ? 61.208  137.354 -19.553 1.00 30.25  ? 102 HIS S N   1 
ATOM   791   C CA  . HIS A 1 101 ? 59.796  137.656 -19.676 1.00 30.25  ? 102 HIS S CA  1 
ATOM   792   C C   . HIS A 1 101 ? 58.940  136.511 -19.152 1.00 30.25  ? 102 HIS S C   1 
ATOM   793   O O   . HIS A 1 101 ? 58.295  136.635 -18.100 1.00 48.51  ? 102 HIS S O   1 
ATOM   794   C CB  . HIS A 1 101 ? 59.438  137.941 -21.128 1.00 48.51  ? 102 HIS S CB  1 
ATOM   795   C CG  . HIS A 1 101 ? 58.208  138.765 -21.280 1.00 48.51  ? 102 HIS S CG  1 
ATOM   796   N ND1 . HIS A 1 101 ? 57.224  138.476 -22.197 1.00 48.51  ? 102 HIS S ND1 1 
ATOM   797   C CD2 . HIS A 1 101 ? 57.786  139.855 -20.602 1.00 48.51  ? 102 HIS S CD2 1 
ATOM   798   C CE1 . HIS A 1 101 ? 56.244  139.352 -22.078 1.00 48.51  ? 102 HIS S CE1 1 
ATOM   799   N NE2 . HIS A 1 101 ? 56.559  140.202 -21.117 1.00 48.51  ? 102 HIS S NE2 1 
ATOM   800   N N   . ASN A 1 102 ? 58.961  135.394 -19.880 1.00 3.97   ? 103 ASN S N   1 
ATOM   801   C CA  . ASN A 1 102 ? 58.186  134.221 -19.505 1.00 3.97   ? 103 ASN S CA  1 
ATOM   802   C C   . ASN A 1 102 ? 58.178  133.993 -18.030 1.00 3.97   ? 103 ASN S C   1 
ATOM   803   O O   . ASN A 1 102 ? 57.124  133.905 -17.418 1.00 2.00   ? 103 ASN S O   1 
ATOM   804   C CB  . ASN A 1 102 ? 58.734  132.983 -20.170 1.00 2.00   ? 103 ASN S CB  1 
ATOM   805   C CG  . ASN A 1 102 ? 57.644  131.993 -20.490 1.00 2.00   ? 103 ASN S CG  1 
ATOM   806   O OD1 . ASN A 1 102 ? 56.915  132.139 -21.490 1.00 2.00   ? 103 ASN S OD1 1 
ATOM   807   N ND2 . ASN A 1 102 ? 57.496  130.986 -19.636 1.00 2.00   ? 103 ASN S ND2 1 
ATOM   808   N N   . LEU A 1 103 ? 59.375  133.889 -17.476 1.00 35.27  ? 104 LEU S N   1 
ATOM   809   C CA  . LEU A 1 103 ? 59.527  133.681 -16.053 1.00 35.27  ? 104 LEU S CA  1 
ATOM   810   C C   . LEU A 1 103 ? 58.768  134.760 -15.281 1.00 35.27  ? 104 LEU S C   1 
ATOM   811   O O   . LEU A 1 103 ? 58.090  134.442 -14.295 1.00 2.00   ? 104 LEU S O   1 
ATOM   812   C CB  . LEU A 1 103 ? 61.009  133.701 -15.680 1.00 2.00   ? 104 LEU S CB  1 
ATOM   813   C CG  . LEU A 1 103 ? 61.843  132.595 -16.299 1.00 2.00   ? 104 LEU S CG  1 
ATOM   814   C CD1 . LEU A 1 103 ? 63.255  132.677 -15.777 1.00 2.00   ? 104 LEU S CD1 1 
ATOM   815   C CD2 . LEU A 1 103 ? 61.236  131.259 -15.953 1.00 2.00   ? 104 LEU S CD2 1 
ATOM   816   N N   . ARG A 1 104 ? 58.872  136.021 -15.729 1.00 2.00   ? 105 ARG S N   1 
ATOM   817   C CA  . ARG A 1 104 ? 58.190  137.131 -15.071 1.00 2.00   ? 105 ARG S CA  1 
ATOM   818   C C   . ARG A 1 104 ? 56.681  136.914 -15.013 1.00 2.00   ? 105 ARG S C   1 
ATOM   819   O O   . ARG A 1 104 ? 56.072  136.974 -13.944 1.00 48.04  ? 105 ARG S O   1 
ATOM   820   C CB  . ARG A 1 104 ? 58.480  138.446 -15.779 1.00 48.04  ? 105 ARG S CB  1 
ATOM   821   C CG  . ARG A 1 104 ? 57.987  139.638 -14.991 1.00 48.04  ? 105 ARG S CG  1 
ATOM   822   C CD  . ARG A 1 104 ? 58.794  140.868 -15.286 1.00 48.04  ? 105 ARG S CD  1 
ATOM   823   N NE  . ARG A 1 104 ? 58.856  141.102 -16.718 1.00 48.04  ? 105 ARG S NE  1 
ATOM   824   C CZ  . ARG A 1 104 ? 59.745  141.897 -17.306 1.00 48.04  ? 105 ARG S CZ  1 
ATOM   825   N NH1 . ARG A 1 104 ? 60.657  142.543 -16.577 1.00 48.04  ? 105 ARG S NH1 1 
ATOM   826   N NH2 . ARG A 1 104 ? 59.714  142.053 -18.630 1.00 48.04  ? 105 ARG S NH2 1 
ATOM   827   N N   . GLU A 1 105 ? 56.083  136.647 -16.168 1.00 2.00   ? 106 GLU S N   1 
ATOM   828   C CA  . GLU A 1 105 ? 54.654  136.415 -16.246 1.00 2.00   ? 106 GLU S CA  1 
ATOM   829   C C   . GLU A 1 105 ? 54.234  135.293 -15.319 1.00 2.00   ? 106 GLU S C   1 
ATOM   830   O O   . GLU A 1 105 ? 53.672  135.538 -14.254 1.00 100.00 ? 106 GLU S O   1 
ATOM   831   C CB  . GLU A 1 105 ? 54.254  136.078 -17.682 1.00 100.00 ? 106 GLU S CB  1 
ATOM   832   C CG  . GLU A 1 105 ? 54.068  137.300 -18.582 1.00 100.00 ? 106 GLU S CG  1 
ATOM   833   C CD  . GLU A 1 105 ? 55.079  138.408 -18.308 1.00 100.00 ? 106 GLU S CD  1 
ATOM   834   O OE1 . GLU A 1 105 ? 56.298  138.128 -18.278 1.00 100.00 ? 106 GLU S OE1 1 
ATOM   835   O OE2 . GLU A 1 105 ? 54.650  139.567 -18.123 1.00 100.00 ? 106 GLU S OE2 1 
ATOM   836   N N   . ARG A 1 106 ? 54.512  134.062 -15.721 1.00 6.21   ? 107 ARG S N   1 
ATOM   837   C CA  . ARG A 1 106 ? 54.155  132.901 -14.903 1.00 6.21   ? 107 ARG S CA  1 
ATOM   838   C C   . ARG A 1 106 ? 54.333  133.199 -13.421 1.00 6.21   ? 107 ARG S C   1 
ATOM   839   O O   . ARG A 1 106 ? 53.509  132.798 -12.584 1.00 3.97   ? 107 ARG S O   1 
ATOM   840   C CB  . ARG A 1 106 ? 55.022  131.682 -15.289 1.00 3.97   ? 107 ARG S CB  1 
ATOM   841   C CG  . ARG A 1 106 ? 55.602  131.738 -16.697 1.00 3.97   ? 107 ARG S CG  1 
ATOM   842   C CD  . ARG A 1 106 ? 55.694  130.348 -17.316 1.00 3.97   ? 107 ARG S CD  1 
ATOM   843   N NE  . ARG A 1 106 ? 54.481  129.563 -17.069 1.00 3.97   ? 107 ARG S NE  1 
ATOM   844   C CZ  . ARG A 1 106 ? 54.450  128.381 -16.440 1.00 3.97   ? 107 ARG S CZ  1 
ATOM   845   N NH1 . ARG A 1 106 ? 55.570  127.813 -15.981 1.00 3.97   ? 107 ARG S NH1 1 
ATOM   846   N NH2 . ARG A 1 106 ? 53.324  127.686 -16.228 1.00 3.97   ? 107 ARG S NH2 1 
ATOM   847   N N   . TYR A 1 107 ? 55.401  133.903 -13.114 1.00 2.00   ? 108 TYR S N   1 
ATOM   848   C CA  . TYR A 1 107 ? 55.707  134.242 -11.725 1.00 2.00   ? 108 TYR S CA  1 
ATOM   849   C C   . TYR A 1 107 ? 54.560  135.031 -11.097 1.00 2.00   ? 108 TYR S C   1 
ATOM   850   O O   . TYR A 1 107 ? 54.044  134.674 -10.033 1.00 2.92   ? 108 TYR S O   1 
ATOM   851   C CB  . TYR A 1 107 ? 56.969  135.091 -11.600 1.00 2.92   ? 108 TYR S CB  1 
ATOM   852   C CG  . TYR A 1 107 ? 57.252  135.425 -10.134 1.00 2.92   ? 108 TYR S CG  1 
ATOM   853   C CD1 . TYR A 1 107 ? 57.214  134.409 -9.173  1.00 2.92   ? 108 TYR S CD1 1 
ATOM   854   C CD2 . TYR A 1 107 ? 57.534  136.740 -9.747  1.00 2.92   ? 108 TYR S CD2 1 
ATOM   855   C CE1 . TYR A 1 107 ? 57.452  134.704 -7.828  1.00 2.92   ? 108 TYR S CE1 1 
ATOM   856   C CE2 . TYR A 1 107 ? 57.769  137.037 -8.399  1.00 2.92   ? 108 TYR S CE2 1 
ATOM   857   C CZ  . TYR A 1 107 ? 57.724  136.020 -7.440  1.00 2.92   ? 108 TYR S CZ  1 
ATOM   858   O OH  . TYR A 1 107 ? 57.946  136.309 -6.130  1.00 2.92   ? 108 TYR S OH  1 
ATOM   859   N N   . PHE A 1 108 ? 54.171  136.094 -11.767 1.00 2.16   ? 109 PHE S N   1 
ATOM   860   C CA  . PHE A 1 108 ? 53.113  136.971 -11.256 1.00 2.16   ? 109 PHE S CA  1 
ATOM   861   C C   . PHE A 1 108 ? 51.757  136.295 -11.323 1.00 2.16   ? 109 PHE S C   1 
ATOM   862   O O   . PHE A 1 108 ? 50.875  136.593 -10.522 1.00 43.33  ? 109 PHE S O   1 
ATOM   863   C CB  . PHE A 1 108 ? 53.097  138.283 -12.023 1.00 43.33  ? 109 PHE S CB  1 
ATOM   864   C CG  . PHE A 1 108 ? 54.184  139.225 -11.518 1.00 43.33  ? 109 PHE S CG  1 
ATOM   865   C CD1 . PHE A 1 108 ? 54.344  139.425 -10.142 1.00 43.33  ? 109 PHE S CD1 1 
ATOM   866   C CD2 . PHE A 1 108 ? 55.024  139.872 -12.427 1.00 43.33  ? 109 PHE S CD2 1 
ATOM   867   C CE1 . PHE A 1 108 ? 55.356  140.267 -9.674  1.00 43.33  ? 109 PHE S CE1 1 
ATOM   868   C CE2 . PHE A 1 108 ? 56.033  140.717 -11.959 1.00 43.33  ? 109 PHE S CE2 1 
ATOM   869   C CZ  . PHE A 1 108 ? 56.202  140.913 -10.583 1.00 43.33  ? 109 PHE S CZ  1 
ATOM   870   N N   . SER A 1 109 ? 51.606  135.361 -12.258 1.00 2.00   ? 110 SER S N   1 
ATOM   871   C CA  . SER A 1 109 ? 50.359  134.629 -12.401 1.00 2.00   ? 110 SER S CA  1 
ATOM   872   C C   . SER A 1 109 ? 50.165  133.636 -11.257 1.00 2.00   ? 110 SER S C   1 
ATOM   873   O O   . SER A 1 109 ? 49.054  133.169 -11.009 1.00 63.67  ? 110 SER S O   1 
ATOM   874   C CB  . SER A 1 109 ? 50.341  133.909 -13.739 1.00 63.67  ? 110 SER S CB  1 
ATOM   875   O OG  . SER A 1 109 ? 50.630  134.834 -14.771 1.00 63.67  ? 110 SER S OG  1 
ATOM   876   N N   . GLY A 1 110 ? 51.258  133.310 -10.562 1.00 12.47  ? 111 GLY S N   1 
ATOM   877   C CA  . GLY A 1 110 ? 51.176  132.402 -9.435  1.00 12.47  ? 111 GLY S CA  1 
ATOM   878   C C   . GLY A 1 110 ? 51.904  131.093 -9.610  1.00 12.47  ? 111 GLY S C   1 
ATOM   879   O O   . GLY A 1 110 ? 51.912  130.243 -8.710  1.00 8.97   ? 111 GLY S O   1 
ATOM   880   N N   . LEU A 1 111 ? 52.509  130.911 -10.774 1.00 20.03  ? 112 LEU S N   1 
ATOM   881   C CA  . LEU A 1 111 ? 53.234  129.679 -11.016 1.00 20.03  ? 112 LEU S CA  1 
ATOM   882   C C   . LEU A 1 111 ? 54.708  129.977 -10.890 1.00 20.03  ? 112 LEU S C   1 
ATOM   883   O O   . LEU A 1 111 ? 55.199  130.947 -11.479 1.00 4.62   ? 112 LEU S O   1 
ATOM   884   C CB  . LEU A 1 111 ? 52.942  129.166 -12.416 1.00 4.62   ? 112 LEU S CB  1 
ATOM   885   C CG  . LEU A 1 111 ? 51.736  129.820 -13.064 1.00 4.62   ? 112 LEU S CG  1 
ATOM   886   C CD1 . LEU A 1 111 ? 52.149  130.372 -14.395 1.00 4.62   ? 112 LEU S CD1 1 
ATOM   887   C CD2 . LEU A 1 111 ? 50.614  128.791 -13.176 1.00 4.62   ? 112 LEU S CD2 1 
ATOM   888   N N   . ILE A 1 112 ? 55.419  129.159 -10.120 1.00 29.32  ? 113 ILE S N   1 
ATOM   889   C CA  . ILE A 1 112 ? 56.846  129.389 -9.958  1.00 29.32  ? 113 ILE S CA  1 
ATOM   890   C C   . ILE A 1 112 ? 57.713  128.373 -10.726 1.00 29.32  ? 113 ILE S C   1 
ATOM   891   O O   . ILE A 1 112 ? 58.752  128.727 -11.299 1.00 8.75   ? 113 ILE S O   1 
ATOM   892   C CB  . ILE A 1 112 ? 57.224  129.440 -8.461  1.00 8.75   ? 113 ILE S CB  1 
ATOM   893   C CG1 . ILE A 1 112 ? 56.791  128.181 -7.709  1.00 8.75   ? 113 ILE S CG1 1 
ATOM   894   C CG2 . ILE A 1 112 ? 56.580  130.621 -7.736  1.00 8.75   ? 113 ILE S CG2 1 
ATOM   895   C CD1 . ILE A 1 112 ? 56.419  128.448 -6.253  1.00 8.75   ? 113 ILE S CD1 1 
ATOM   896   N N   . TYR A 1 113 ? 57.301  127.124 -10.754 1.00 2.00   ? 114 TYR S N   1 
ATOM   897   C CA  . TYR A 1 113 ? 58.068  126.073 -11.461 1.00 2.00   ? 114 TYR S CA  1 
ATOM   898   C C   . TYR A 1 113 ? 57.897  126.208 -12.986 1.00 2.00   ? 114 TYR S C   1 
ATOM   899   O O   . TYR A 1 113 ? 56.780  126.351 -13.497 1.00 11.99  ? 114 TYR S O   1 
ATOM   900   C CB  . TYR A 1 113 ? 57.573  124.690 -11.051 1.00 11.99  ? 114 TYR S CB  1 
ATOM   901   C CG  . TYR A 1 113 ? 57.745  124.399 -9.560  1.00 11.99  ? 114 TYR S CG  1 
ATOM   902   C CD1 . TYR A 1 113 ? 56.884  124.985 -8.626  1.00 11.99  ? 114 TYR S CD1 1 
ATOM   903   C CD2 . TYR A 1 113 ? 58.762  123.540 -9.134  1.00 11.99  ? 114 TYR S CD2 1 
ATOM   904   C CE1 . TYR A 1 113 ? 57.032  124.702 -7.265  1.00 11.99  ? 114 TYR S CE1 1 
ATOM   905   C CE2 . TYR A 1 113 ? 58.908  123.250 -7.772  1.00 11.99  ? 114 TYR S CE2 1 
ATOM   906   C CZ  . TYR A 1 113 ? 58.043  123.830 -6.838  1.00 11.99  ? 114 TYR S CZ  1 
ATOM   907   O OH  . TYR A 1 113 ? 58.179  123.543 -5.516  1.00 11.99  ? 114 TYR S OH  1 
ATOM   908   N N   . THR A 1 114 ? 59.017  126.147 -13.696 1.00 2.00   ? 115 THR S N   1 
ATOM   909   C CA  . THR A 1 114 ? 59.025  126.259 -15.172 1.00 2.00   ? 115 THR S CA  1 
ATOM   910   C C   . THR A 1 114 ? 60.102  125.356 -15.773 1.00 2.00   ? 115 THR S C   1 
ATOM   911   O O   . THR A 1 114 ? 61.182  125.238 -15.207 1.00 2.00   ? 115 THR S O   1 
ATOM   912   C CB  . THR A 1 114 ? 59.324  127.695 -15.589 1.00 2.00   ? 115 THR S CB  1 
ATOM   913   O OG1 . THR A 1 114 ? 58.725  128.597 -14.673 1.00 2.00   ? 115 THR S OG1 1 
ATOM   914   C CG2 . THR A 1 114 ? 58.798  128.027 -16.984 1.00 2.00   ? 115 THR S CG2 1 
ATOM   915   N N   . TYR A 1 115 ? 59.827  124.724 -16.907 1.00 2.00   ? 116 TYR S N   1 
ATOM   916   C CA  . TYR A 1 115 ? 60.835  123.855 -17.501 1.00 2.00   ? 116 TYR S CA  1 
ATOM   917   C C   . TYR A 1 115 ? 61.724  124.620 -18.457 1.00 2.00   ? 116 TYR S C   1 
ATOM   918   O O   . TYR A 1 115 ? 61.283  125.571 -19.094 1.00 13.73  ? 116 TYR S O   1 
ATOM   919   C CB  . TYR A 1 115 ? 60.204  122.714 -18.261 1.00 13.73  ? 116 TYR S CB  1 
ATOM   920   C CG  . TYR A 1 115 ? 59.572  121.696 -17.389 1.00 13.73  ? 116 TYR S CG  1 
ATOM   921   C CD1 . TYR A 1 115 ? 59.787  121.680 -16.024 1.00 13.73  ? 116 TYR S CD1 1 
ATOM   922   C CD2 . TYR A 1 115 ? 58.717  120.757 -17.928 1.00 13.73  ? 116 TYR S CD2 1 
ATOM   923   C CE1 . TYR A 1 115 ? 59.148  120.748 -15.214 1.00 13.73  ? 116 TYR S CE1 1 
ATOM   924   C CE2 . TYR A 1 115 ? 58.078  119.822 -17.128 1.00 13.73  ? 116 TYR S CE2 1 
ATOM   925   C CZ  . TYR A 1 115 ? 58.292  119.819 -15.779 1.00 13.73  ? 116 TYR S CZ  1 
ATOM   926   O OH  . TYR A 1 115 ? 57.632  118.890 -15.014 1.00 13.73  ? 116 TYR S OH  1 
ATOM   927   N N   . SER A 1 116 ? 62.981  124.198 -18.548 1.00 2.00   ? 117 SER S N   1 
ATOM   928   C CA  . SER A 1 116 ? 63.966  124.818 -19.426 1.00 2.00   ? 117 SER S CA  1 
ATOM   929   C C   . SER A 1 116 ? 64.763  123.657 -19.988 1.00 2.00   ? 117 SER S C   1 
ATOM   930   O O   . SER A 1 116 ? 65.838  123.326 -19.506 1.00 54.96  ? 117 SER S O   1 
ATOM   931   C CB  . SER A 1 116 ? 64.891  125.770 -18.659 1.00 54.96  ? 117 SER S CB  1 
ATOM   932   O OG  . SER A 1 116 ? 64.959  125.439 -17.283 1.00 54.96  ? 117 SER S OG  1 
ATOM   933   N N   . GLY A 1 117 ? 64.201  123.023 -21.002 1.00 31.44  ? 118 GLY S N   1 
ATOM   934   C CA  . GLY A 1 117 ? 64.872  121.897 -21.599 1.00 31.44  ? 118 GLY S CA  1 
ATOM   935   C C   . GLY A 1 117 ? 64.809  120.749 -20.630 1.00 31.44  ? 118 GLY S C   1 
ATOM   936   O O   . GLY A 1 117 ? 63.725  120.281 -20.297 1.00 99.60  ? 118 GLY S O   1 
ATOM   937   N N   . LEU A 1 118 ? 65.966  120.301 -20.161 1.00 2.63   ? 119 LEU S N   1 
ATOM   938   C CA  . LEU A 1 118 ? 66.007  119.186 -19.232 1.00 2.63   ? 119 LEU S CA  1 
ATOM   939   C C   . LEU A 1 118 ? 65.807  119.660 -17.814 1.00 2.63   ? 119 LEU S C   1 
ATOM   940   O O   . LEU A 1 118 ? 64.908  119.185 -17.119 1.00 6.87   ? 119 LEU S O   1 
ATOM   941   C CB  . LEU A 1 118 ? 67.337  118.471 -19.341 1.00 6.87   ? 119 LEU S CB  1 
ATOM   942   C CG  . LEU A 1 118 ? 67.587  117.950 -20.743 1.00 6.87   ? 119 LEU S CG  1 
ATOM   943   C CD1 . LEU A 1 118 ? 68.982  118.392 -21.191 1.00 6.87   ? 119 LEU S CD1 1 
ATOM   944   C CD2 . LEU A 1 118 ? 67.422  116.437 -20.767 1.00 6.87   ? 119 LEU S CD2 1 
ATOM   945   N N   . PHE A 1 119 ? 66.643  120.594 -17.373 1.00 2.00   ? 120 PHE S N   1 
ATOM   946   C CA  . PHE A 1 119 ? 66.516  121.130 -16.025 1.00 2.00   ? 120 PHE S CA  1 
ATOM   947   C C   . PHE A 1 119 ? 65.300  122.038 -15.945 1.00 2.00   ? 120 PHE S C   1 
ATOM   948   O O   . PHE A 1 119 ? 64.667  122.322 -16.958 1.00 2.00   ? 120 PHE S O   1 
ATOM   949   C CB  . PHE A 1 119 ? 67.759  121.922 -15.662 1.00 2.00   ? 120 PHE S CB  1 
ATOM   950   C CG  . PHE A 1 119 ? 68.109  122.952 -16.651 1.00 2.00   ? 120 PHE S CG  1 
ATOM   951   C CD1 . PHE A 1 119 ? 68.451  122.590 -17.926 1.00 2.00   ? 120 PHE S CD1 1 
ATOM   952   C CD2 . PHE A 1 119 ? 68.115  124.282 -16.303 1.00 2.00   ? 120 PHE S CD2 1 
ATOM   953   C CE1 . PHE A 1 119 ? 68.797  123.543 -18.849 1.00 2.00   ? 120 PHE S CE1 1 
ATOM   954   C CE2 . PHE A 1 119 ? 68.460  125.246 -17.209 1.00 2.00   ? 120 PHE S CE2 1 
ATOM   955   C CZ  . PHE A 1 119 ? 68.805  124.885 -18.490 1.00 2.00   ? 120 PHE S CZ  1 
ATOM   956   N N   . CYS A 1 120 ? 64.973  122.487 -14.739 1.00 2.00   ? 121 CYS S N   1 
ATOM   957   C CA  . CYS A 1 120 ? 63.835  123.366 -14.564 1.00 2.00   ? 121 CYS S CA  1 
ATOM   958   C C   . CYS A 1 120 ? 64.076  124.492 -13.550 1.00 2.00   ? 121 CYS S C   1 
ATOM   959   O O   . CYS A 1 120 ? 64.651  124.249 -12.499 1.00 2.00   ? 121 CYS S O   1 
ATOM   960   C CB  . CYS A 1 120 ? 62.619  122.539 -14.163 1.00 2.00   ? 121 CYS S CB  1 
ATOM   961   S SG  . CYS A 1 120 ? 62.118  122.788 -12.476 1.00 2.00   ? 121 CYS S SG  1 
ATOM   962   N N   . VAL A 1 121 ? 63.636  125.714 -13.885 1.00 2.00   ? 122 VAL S N   1 
ATOM   963   C CA  . VAL A 1 121 ? 63.789  126.886 -13.023 1.00 2.00   ? 122 VAL S CA  1 
ATOM   964   C C   . VAL A 1 121 ? 62.692  126.890 -11.974 1.00 2.00   ? 122 VAL S C   1 
ATOM   965   O O   . VAL A 1 121 ? 61.708  126.195 -12.151 1.00 2.00   ? 122 VAL S O   1 
ATOM   966   C CB  . VAL A 1 121 ? 63.714  128.174 -13.820 1.00 2.00   ? 122 VAL S CB  1 
ATOM   967   C CG1 . VAL A 1 121 ? 64.278  129.307 -13.018 1.00 2.00   ? 122 VAL S CG1 1 
ATOM   968   C CG2 . VAL A 1 121 ? 64.502  128.034 -15.075 1.00 2.00   ? 122 VAL S CG2 1 
ATOM   969   N N   . VAL A 1 122 ? 62.859  127.648 -10.884 1.00 2.00   ? 123 VAL S N   1 
ATOM   970   C CA  . VAL A 1 122 ? 61.866  127.669 -9.798  1.00 2.00   ? 123 VAL S CA  1 
ATOM   971   C C   . VAL A 1 122 ? 61.889  128.916 -8.910  1.00 2.00   ? 123 VAL S C   1 
ATOM   972   O O   . VAL A 1 122 ? 62.229  128.805 -7.747  1.00 2.00   ? 123 VAL S O   1 
ATOM   973   C CB  . VAL A 1 122 ? 62.048  126.447 -8.831  1.00 2.00   ? 123 VAL S CB  1 
ATOM   974   C CG1 . VAL A 1 122 ? 60.948  126.436 -7.796  1.00 2.00   ? 123 VAL S CG1 1 
ATOM   975   C CG2 . VAL A 1 122 ? 62.017  125.140 -9.584  1.00 2.00   ? 123 VAL S CG2 1 
ATOM   976   N N   . ILE A 1 123 ? 61.486  130.078 -9.424  1.00 2.00   ? 124 ILE S N   1 
ATOM   977   C CA  . ILE A 1 123 ? 61.519  131.331 -8.648  1.00 2.00   ? 124 ILE S CA  1 
ATOM   978   C C   . ILE A 1 123 ? 60.795  131.310 -7.314  1.00 2.00   ? 124 ILE S C   1 
ATOM   979   O O   . ILE A 1 123 ? 59.604  131.104 -7.267  1.00 2.00   ? 124 ILE S O   1 
ATOM   980   C CB  . ILE A 1 123 ? 60.942  132.523 -9.445  1.00 2.00   ? 124 ILE S CB  1 
ATOM   981   C CG1 . ILE A 1 123 ? 61.762  132.785 -10.702 1.00 2.00   ? 124 ILE S CG1 1 
ATOM   982   C CG2 . ILE A 1 123 ? 60.964  133.756 -8.586  1.00 2.00   ? 124 ILE S CG2 1 
ATOM   983   C CD1 . ILE A 1 123 ? 61.045  132.463 -11.973 1.00 2.00   ? 124 ILE S CD1 1 
ATOM   984   N N   . ASN A 1 124 ? 61.516  131.557 -6.227  1.00 32.97  ? 125 ASN S N   1 
ATOM   985   C CA  . ASN A 1 124 ? 60.918  131.580 -4.890  1.00 32.97  ? 125 ASN S CA  1 
ATOM   986   C C   . ASN A 1 124 ? 59.652  132.440 -4.921  1.00 32.97  ? 125 ASN S C   1 
ATOM   987   O O   . ASN A 1 124 ? 59.642  133.510 -5.520  1.00 7.63   ? 125 ASN S O   1 
ATOM   988   C CB  . ASN A 1 124 ? 61.918  132.174 -3.868  1.00 7.63   ? 125 ASN S CB  1 
ATOM   989   C CG  . ASN A 1 124 ? 61.564  131.855 -2.386  1.00 7.63   ? 125 ASN S CG  1 
ATOM   990   O OD1 . ASN A 1 124 ? 60.407  131.647 -2.022  1.00 7.63   ? 125 ASN S OD1 1 
ATOM   991   N ND2 . ASN A 1 124 ? 62.579  131.831 -1.534  1.00 7.63   ? 125 ASN S ND2 1 
ATOM   992   N N   . PRO A 1 125 ? 58.552  131.945 -4.321  1.00 2.00   ? 126 PRO S N   1 
ATOM   993   C CA  . PRO A 1 125 ? 57.294  132.686 -4.277  1.00 2.00   ? 126 PRO S CA  1 
ATOM   994   C C   . PRO A 1 125 ? 57.325  133.619 -3.080  1.00 2.00   ? 126 PRO S C   1 
ATOM   995   O O   . PRO A 1 125 ? 56.952  134.787 -3.176  1.00 15.32  ? 126 PRO S O   1 
ATOM   996   C CB  . PRO A 1 125 ? 56.251  131.588 -4.094  1.00 15.32  ? 126 PRO S CB  1 
ATOM   997   C CG  . PRO A 1 125 ? 56.957  130.568 -3.247  1.00 15.32  ? 126 PRO S CG  1 
ATOM   998   C CD  . PRO A 1 125 ? 58.407  130.606 -3.704  1.00 15.32  ? 126 PRO S CD  1 
ATOM   999   N N   . TYR A 1 126 ? 57.777  133.056 -1.957  1.00 71.40  ? 127 TYR S N   1 
ATOM   1000  C CA  . TYR A 1 126 ? 57.882  133.719 -0.662  1.00 71.40  ? 127 TYR S CA  1 
ATOM   1001  C C   . TYR A 1 126 ? 56.512  133.758 -0.016  1.00 71.40  ? 127 TYR S C   1 
ATOM   1002  O O   . TYR A 1 126 ? 56.343  134.251 1.102   1.00 23.07  ? 127 TYR S O   1 
ATOM   1003  C CB  . TYR A 1 126 ? 58.432  135.135 -0.811  1.00 23.07  ? 127 TYR S CB  1 
ATOM   1004  C CG  . TYR A 1 126 ? 59.919  135.219 -0.569  1.00 23.07  ? 127 TYR S CG  1 
ATOM   1005  C CD1 . TYR A 1 126 ? 60.556  134.374 0.353   1.00 23.07  ? 127 TYR S CD1 1 
ATOM   1006  C CD2 . TYR A 1 126 ? 60.699  136.142 -1.263  1.00 23.07  ? 127 TYR S CD2 1 
ATOM   1007  C CE1 . TYR A 1 126 ? 61.941  134.452 0.574   1.00 23.07  ? 127 TYR S CE1 1 
ATOM   1008  C CE2 . TYR A 1 126 ? 62.086  136.230 -1.048  1.00 23.07  ? 127 TYR S CE2 1 
ATOM   1009  C CZ  . TYR A 1 126 ? 62.698  135.388 -0.133  1.00 23.07  ? 127 TYR S CZ  1 
ATOM   1010  O OH  . TYR A 1 126 ? 64.055  135.522 0.070   1.00 23.07  ? 127 TYR S OH  1 
ATOM   1011  N N   . LYS A 1 127 ? 55.542  133.213 -0.739  1.00 11.69  ? 128 LYS S N   1 
ATOM   1012  C CA  . LYS A 1 127 ? 54.166  133.178 -0.301  1.00 11.69  ? 128 LYS S CA  1 
ATOM   1013  C C   . LYS A 1 127 ? 53.754  131.729 -0.206  1.00 11.69  ? 128 LYS S C   1 
ATOM   1014  O O   . LYS A 1 127 ? 54.359  130.847 -0.824  1.00 66.22  ? 128 LYS S O   1 
ATOM   1015  C CB  . LYS A 1 127 ? 53.287  133.922 -1.305  1.00 66.22  ? 128 LYS S CB  1 
ATOM   1016  C CG  . LYS A 1 127 ? 51.821  133.952 -0.953  1.00 66.22  ? 128 LYS S CG  1 
ATOM   1017  C CD  . LYS A 1 127 ? 50.961  134.183 -2.194  1.00 66.22  ? 128 LYS S CD  1 
ATOM   1018  C CE  . LYS A 1 127 ? 49.625  133.436 -2.100  1.00 66.22  ? 128 LYS S CE  1 
ATOM   1019  N NZ  . LYS A 1 127 ? 48.486  134.162 -2.755  1.00 66.22  ? 128 LYS S NZ  1 
ATOM   1020  N N   . GLN A 1 128 ? 52.716  131.503 0.581   1.00 2.00   ? 129 GLN S N   1 
ATOM   1021  C CA  . GLN A 1 128 ? 52.171  130.184 0.808   1.00 2.00   ? 129 GLN S CA  1 
ATOM   1022  C C   . GLN A 1 128 ? 51.190  129.730 -0.287  1.00 2.00   ? 129 GLN S C   1 
ATOM   1023  O O   . GLN A 1 128 ? 49.992  129.592 -0.037  1.00 100.00 ? 129 GLN S O   1 
ATOM   1024  C CB  . GLN A 1 128 ? 51.485  130.161 2.178   1.00 100.00 ? 129 GLN S CB  1 
ATOM   1025  C CG  . GLN A 1 128 ? 52.328  130.788 3.300   1.00 100.00 ? 129 GLN S CG  1 
ATOM   1026  C CD  . GLN A 1 128 ? 51.930  132.227 3.658   1.00 100.00 ? 129 GLN S CD  1 
ATOM   1027  O OE1 . GLN A 1 128 ? 52.077  133.149 2.850   1.00 100.00 ? 129 GLN S OE1 1 
ATOM   1028  N NE2 . GLN A 1 128 ? 51.433  132.418 4.881   1.00 100.00 ? 129 GLN S NE2 1 
ATOM   1029  N N   . LEU A 1 129 ? 51.699  129.502 -1.497  1.00 11.04  ? 130 LEU S N   1 
ATOM   1030  C CA  . LEU A 1 129 ? 50.874  129.023 -2.607  1.00 11.04  ? 130 LEU S CA  1 
ATOM   1031  C C   . LEU A 1 129 ? 50.320  127.684 -2.170  1.00 11.04  ? 130 LEU S C   1 
ATOM   1032  O O   . LEU A 1 129 ? 50.903  127.024 -1.314  1.00 9.92   ? 130 LEU S O   1 
ATOM   1033  C CB  . LEU A 1 129 ? 51.733  128.833 -3.860  1.00 9.92   ? 130 LEU S CB  1 
ATOM   1034  C CG  . LEU A 1 129 ? 52.509  130.069 -4.330  1.00 9.92   ? 130 LEU S CG  1 
ATOM   1035  C CD1 . LEU A 1 129 ? 52.908  129.934 -5.787  1.00 9.92   ? 130 LEU S CD1 1 
ATOM   1036  C CD2 . LEU A 1 129 ? 51.635  131.297 -4.134  1.00 9.92   ? 130 LEU S CD2 1 
ATOM   1037  N N   . PRO A 1 130 ? 49.183  127.262 -2.736  1.00 15.57  ? 131 PRO S N   1 
ATOM   1038  C CA  . PRO A 1 130 ? 48.570  125.983 -2.373  1.00 15.57  ? 131 PRO S CA  1 
ATOM   1039  C C   . PRO A 1 130 ? 48.747  124.918 -3.459  1.00 15.57  ? 131 PRO S C   1 
ATOM   1040  O O   . PRO A 1 130 ? 47.781  124.540 -4.116  1.00 23.00  ? 131 PRO S O   1 
ATOM   1041  C CB  . PRO A 1 130 ? 47.114  126.357 -2.229  1.00 23.00  ? 131 PRO S CB  1 
ATOM   1042  C CG  . PRO A 1 130 ? 46.939  127.433 -3.353  1.00 23.00  ? 131 PRO S CG  1 
ATOM   1043  C CD  . PRO A 1 130 ? 48.334  127.957 -3.709  1.00 23.00  ? 131 PRO S CD  1 
ATOM   1044  N N   . ILE A 1 131 ? 49.963  124.429 -3.643  1.00 2.00   ? 132 ILE S N   1 
ATOM   1045  C CA  . ILE A 1 131 ? 50.166  123.443 -4.699  1.00 2.00   ? 132 ILE S CA  1 
ATOM   1046  C C   . ILE A 1 131 ? 50.922  122.220 -4.186  1.00 2.00   ? 132 ILE S C   1 
ATOM   1047  O O   . ILE A 1 131 ? 51.584  121.542 -4.969  1.00 10.81  ? 132 ILE S O   1 
ATOM   1048  C CB  . ILE A 1 131 ? 50.939  124.043 -5.888  1.00 10.81  ? 132 ILE S CB  1 
ATOM   1049  C CG1 . ILE A 1 131 ? 52.392  124.352 -5.516  1.00 10.81  ? 132 ILE S CG1 1 
ATOM   1050  C CG2 . ILE A 1 131 ? 50.326  125.347 -6.396  1.00 10.81  ? 132 ILE S CG2 1 
ATOM   1051  C CD1 . ILE A 1 131 ? 53.273  124.662 -6.721  1.00 10.81  ? 132 ILE S CD1 1 
ATOM   1052  N N   . TYR A 1 132 ? 50.801  121.963 -2.893  1.00 2.00   ? 133 TYR S N   1 
ATOM   1053  C CA  . TYR A 1 132 ? 51.410  120.791 -2.274  1.00 2.00   ? 133 TYR S CA  1 
ATOM   1054  C C   . TYR A 1 132 ? 50.340  120.150 -1.381  1.00 2.00   ? 133 TYR S C   1 
ATOM   1055  O O   . TYR A 1 132 ? 49.979  120.723 -0.377  1.00 2.00   ? 133 TYR S O   1 
ATOM   1056  C CB  . TYR A 1 132 ? 52.606  121.214 -1.439  1.00 2.00   ? 133 TYR S CB  1 
ATOM   1057  C CG  . TYR A 1 132 ? 53.596  122.087 -2.175  1.00 2.00   ? 133 TYR S CG  1 
ATOM   1058  C CD1 . TYR A 1 132 ? 54.395  121.572 -3.197  1.00 2.00   ? 133 TYR S CD1 1 
ATOM   1059  C CD2 . TYR A 1 132 ? 53.760  123.420 -1.833  1.00 2.00   ? 133 TYR S CD2 1 
ATOM   1060  C CE1 . TYR A 1 132 ? 55.336  122.380 -3.866  1.00 2.00   ? 133 TYR S CE1 1 
ATOM   1061  C CE2 . TYR A 1 132 ? 54.697  124.227 -2.496  1.00 2.00   ? 133 TYR S CE2 1 
ATOM   1062  C CZ  . TYR A 1 132 ? 55.470  123.696 -3.510  1.00 2.00   ? 133 TYR S CZ  1 
ATOM   1063  O OH  . TYR A 1 132 ? 56.330  124.489 -4.200  1.00 2.00   ? 133 TYR S OH  1 
ATOM   1064  N N   . SER A 1 133 ? 49.809  118.990 -1.748  1.00 2.00   ? 134 SER S N   1 
ATOM   1065  C CA  . SER A 1 133 ? 48.777  118.356 -0.939  1.00 2.00   ? 134 SER S CA  1 
ATOM   1066  C C   . SER A 1 133 ? 48.532  116.949 -1.436  1.00 2.00   ? 134 SER S C   1 
ATOM   1067  O O   . SER A 1 133 ? 48.732  116.670 -2.612  1.00 87.43  ? 134 SER S O   1 
ATOM   1068  C CB  . SER A 1 133 ? 47.466  119.135 -1.021  1.00 87.43  ? 134 SER S CB  1 
ATOM   1069  O OG  . SER A 1 133 ? 46.405  118.286 -1.422  1.00 87.43  ? 134 SER S OG  1 
ATOM   1070  N N   . GLU A 1 134 ? 48.106  116.061 -0.545  1.00 2.00   ? 135 GLU S N   1 
ATOM   1071  C CA  . GLU A 1 134 ? 47.827  114.688 -0.932  1.00 2.00   ? 135 GLU S CA  1 
ATOM   1072  C C   . GLU A 1 134 ? 47.108  114.738 -2.272  1.00 2.00   ? 135 GLU S C   1 
ATOM   1073  O O   . GLU A 1 134 ? 47.459  114.029 -3.219  1.00 98.65  ? 135 GLU S O   1 
ATOM   1074  C CB  . GLU A 1 134 ? 46.922  114.009 0.095   1.00 98.65  ? 135 GLU S CB  1 
ATOM   1075  C CG  . GLU A 1 134 ? 47.331  112.598 0.429   1.00 98.65  ? 135 GLU S CG  1 
ATOM   1076  C CD  . GLU A 1 134 ? 48.321  112.553 1.567   1.00 98.65  ? 135 GLU S CD  1 
ATOM   1077  O OE1 . GLU A 1 134 ? 48.169  113.349 2.519   1.00 98.65  ? 135 GLU S OE1 1 
ATOM   1078  O OE2 . GLU A 1 134 ? 49.248  111.723 1.508   1.00 98.65  ? 135 GLU S OE2 1 
ATOM   1079  N N   . LYS A 1 135 ? 46.092  115.594 -2.326  1.00 31.52  ? 136 LYS S N   1 
ATOM   1080  C CA  . LYS A 1 135 ? 45.298  115.778 -3.524  1.00 31.52  ? 136 LYS S CA  1 
ATOM   1081  C C   . LYS A 1 135 ? 46.222  115.904 -4.734  1.00 31.52  ? 136 LYS S C   1 
ATOM   1082  O O   . LYS A 1 135 ? 46.180  115.084 -5.659  1.00 53.91  ? 136 LYS S O   1 
ATOM   1083  C CB  . LYS A 1 135 ? 44.438  117.033 -3.367  1.00 53.91  ? 136 LYS S CB  1 
ATOM   1084  C CG  . LYS A 1 135 ? 43.672  117.445 -4.619  1.00 53.91  ? 136 LYS S CG  1 
ATOM   1085  C CD  . LYS A 1 135 ? 43.259  118.925 -4.567  1.00 53.91  ? 136 LYS S CD  1 
ATOM   1086  C CE  . LYS A 1 135 ? 42.196  119.264 -5.614  1.00 53.91  ? 136 LYS S CE  1 
ATOM   1087  N NZ  . LYS A 1 135 ? 42.795  119.768 -6.888  1.00 53.91  ? 136 LYS S NZ  1 
ATOM   1088  N N   . ILE A 1 136 ? 47.072  116.923 -4.707  1.00 2.00   ? 137 ILE S N   1 
ATOM   1089  C CA  . ILE A 1 136 ? 47.995  117.179 -5.795  1.00 2.00   ? 137 ILE S CA  1 
ATOM   1090  C C   . ILE A 1 136 ? 49.023  116.090 -5.982  1.00 2.00   ? 137 ILE S C   1 
ATOM   1091  O O   . ILE A 1 136 ? 49.518  115.899 -7.081  1.00 2.00   ? 137 ILE S O   1 
ATOM   1092  C CB  . ILE A 1 136 ? 48.752  118.487 -5.594  1.00 2.00   ? 137 ILE S CB  1 
ATOM   1093  C CG1 . ILE A 1 136 ? 47.792  119.575 -5.131  1.00 2.00   ? 137 ILE S CG1 1 
ATOM   1094  C CG2 . ILE A 1 136 ? 49.465  118.874 -6.862  1.00 2.00   ? 137 ILE S CG2 1 
ATOM   1095  C CD1 . ILE A 1 136 ? 47.354  120.522 -6.247  1.00 2.00   ? 137 ILE S CD1 1 
ATOM   1096  N N   . ILE A 1 137 ? 49.367  115.383 -4.911  1.00 2.00   ? 138 ILE S N   1 
ATOM   1097  C CA  . ILE A 1 137 ? 50.362  114.313 -4.996  1.00 2.00   ? 138 ILE S CA  1 
ATOM   1098  C C   . ILE A 1 137 ? 49.854  113.249 -5.927  1.00 2.00   ? 138 ILE S C   1 
ATOM   1099  O O   . ILE A 1 137 ? 50.562  112.841 -6.842  1.00 2.00   ? 138 ILE S O   1 
ATOM   1100  C CB  . ILE A 1 137 ? 50.599  113.607 -3.651  1.00 2.00   ? 138 ILE S CB  1 
ATOM   1101  C CG1 . ILE A 1 137 ? 51.179  114.587 -2.633  1.00 2.00   ? 138 ILE S CG1 1 
ATOM   1102  C CG2 . ILE A 1 137 ? 51.514  112.421 -3.854  1.00 2.00   ? 138 ILE S CG2 1 
ATOM   1103  C CD1 . ILE A 1 137 ? 52.481  115.165 -3.055  1.00 2.00   ? 138 ILE S CD1 1 
ATOM   1104  N N   . ASP A 1 138 ? 48.618  112.809 -5.679  1.00 2.00   ? 139 ASP S N   1 
ATOM   1105  C CA  . ASP A 1 138 ? 47.995  111.759 -6.473  1.00 2.00   ? 139 ASP S CA  1 
ATOM   1106  C C   . ASP A 1 138 ? 47.708  112.189 -7.897  1.00 2.00   ? 139 ASP S C   1 
ATOM   1107  O O   . ASP A 1 138 ? 47.602  111.362 -8.805  1.00 100.00 ? 139 ASP S O   1 
ATOM   1108  C CB  . ASP A 1 138 ? 46.728  111.275 -5.783  1.00 100.00 ? 139 ASP S CB  1 
ATOM   1109  C CG  . ASP A 1 138 ? 47.032  110.333 -4.633  1.00 100.00 ? 139 ASP S CG  1 
ATOM   1110  O OD1 . ASP A 1 138 ? 47.633  109.265 -4.882  1.00 100.00 ? 139 ASP S OD1 1 
ATOM   1111  O OD2 . ASP A 1 138 ? 46.682  110.658 -3.477  1.00 100.00 ? 139 ASP S OD2 1 
ATOM   1112  N N   . MET A 1 139 ? 47.605  113.495 -8.094  1.00 2.07   ? 140 MET S N   1 
ATOM   1113  C CA  . MET A 1 139 ? 47.367  114.033 -9.423  1.00 2.07   ? 140 MET S CA  1 
ATOM   1114  C C   . MET A 1 139 ? 48.565  113.722 -10.327 1.00 2.07   ? 140 MET S C   1 
ATOM   1115  O O   . MET A 1 139 ? 48.407  113.293 -11.476 1.00 92.21  ? 140 MET S O   1 
ATOM   1116  C CB  . MET A 1 139 ? 47.159  115.552 -9.343  1.00 92.21  ? 140 MET S CB  1 
ATOM   1117  C CG  . MET A 1 139 ? 45.709  115.990 -9.552  1.00 92.21  ? 140 MET S CG  1 
ATOM   1118  S SD  . MET A 1 139 ? 45.519  117.762 -9.538  1.00 92.21  ? 140 MET S SD  1 
ATOM   1119  C CE  . MET A 1 139 ? 45.667  118.391 -11.194 1.00 92.21  ? 140 MET S CE  1 
ATOM   1120  N N   . TYR A 1 140 ? 49.743  113.935 -9.766  1.00 2.00   ? 141 TYR S N   1 
ATOM   1121  C CA  . TYR A 1 140 ? 51.016  113.769 -10.488 1.00 2.00   ? 141 TYR S CA  1 
ATOM   1122  C C   . TYR A 1 140 ? 51.533  112.315 -10.456 1.00 2.00   ? 141 TYR S C   1 
ATOM   1123  O O   . TYR A 1 140 ? 52.359  111.915 -11.286 1.00 2.00   ? 141 TYR S O   1 
ATOM   1124  C CB  . TYR A 1 140 ? 52.074  114.675 -9.869  1.00 2.00   ? 141 TYR S CB  1 
ATOM   1125  C CG  . TYR A 1 140 ? 51.976  116.116 -10.367 1.00 2.00   ? 141 TYR S CG  1 
ATOM   1126  C CD1 . TYR A 1 140 ? 52.489  116.451 -11.624 1.00 2.00   ? 141 TYR S CD1 1 
ATOM   1127  C CD2 . TYR A 1 140 ? 51.371  117.096 -9.571  1.00 2.00   ? 141 TYR S CD2 1 
ATOM   1128  C CE1 . TYR A 1 140 ? 52.410  117.772 -12.082 1.00 2.00   ? 141 TYR S CE1 1 
ATOM   1129  C CE2 . TYR A 1 140 ? 51.290  118.419 -10.030 1.00 2.00   ? 141 TYR S CE2 1 
ATOM   1130  C CZ  . TYR A 1 140 ? 51.813  118.756 -11.284 1.00 2.00   ? 141 TYR S CZ  1 
ATOM   1131  O OH  . TYR A 1 140 ? 51.739  120.037 -11.729 1.00 2.00   ? 141 TYR S OH  1 
ATOM   1132  N N   . LYS A 1 141 ? 51.047  111.549 -9.500  1.00 2.00   ? 142 LYS S N   1 
ATOM   1133  C CA  . LYS A 1 141 ? 51.446  110.133 -9.341  1.00 2.00   ? 142 LYS S CA  1 
ATOM   1134  C C   . LYS A 1 141 ? 51.330  109.407 -10.668 1.00 2.00   ? 142 LYS S C   1 
ATOM   1135  O O   . LYS A 1 141 ? 50.233  109.219 -11.181 1.00 80.50  ? 142 LYS S O   1 
ATOM   1136  C CB  . LYS A 1 141 ? 50.527  109.459 -8.324  1.00 80.50  ? 142 LYS S CB  1 
ATOM   1137  C CG  . LYS A 1 141 ? 51.014  108.077 -7.895  1.00 80.50  ? 142 LYS S CG  1 
ATOM   1138  C CD  . LYS A 1 141 ? 50.681  107.763 -6.436  1.00 80.50  ? 142 LYS S CD  1 
ATOM   1139  C CE  . LYS A 1 141 ? 49.795  106.527 -6.275  1.00 80.50  ? 142 LYS S CE  1 
ATOM   1140  N NZ  . LYS A 1 141 ? 49.326  106.337 -4.896  1.00 80.50  ? 142 LYS S NZ  1 
ATOM   1141  N N   . GLY A 1 142 ? 52.457  109.005 -11.231 1.00 2.00   ? 143 GLY S N   1 
ATOM   1142  C CA  . GLY A 1 142 ? 52.431  108.270 -12.479 1.00 2.00   ? 143 GLY S CA  1 
ATOM   1143  C C   . GLY A 1 142 ? 52.355  109.163 -13.696 1.00 2.00   ? 143 GLY S C   1 
ATOM   1144  O O   . GLY A 1 142 ? 52.912  108.840 -14.755 1.00 2.00   ? 143 GLY S O   1 
ATOM   1145  N N   . LYS A 1 143 ? 51.672  110.292 -13.538 1.00 11.46  ? 144 LYS S N   1 
ATOM   1146  C CA  . LYS A 1 143 ? 51.504  111.249 -14.628 1.00 11.46  ? 144 LYS S CA  1 
ATOM   1147  C C   . LYS A 1 143 ? 52.833  111.599 -15.303 1.00 11.46  ? 144 LYS S C   1 
ATOM   1148  O O   . LYS A 1 143 ? 53.809  112.008 -14.660 1.00 51.76  ? 144 LYS S O   1 
ATOM   1149  C CB  . LYS A 1 143 ? 50.817  112.523 -14.104 1.00 51.76  ? 144 LYS S CB  1 
ATOM   1150  C CG  . LYS A 1 143 ? 49.527  112.906 -14.816 1.00 51.76  ? 144 LYS S CG  1 
ATOM   1151  C CD  . LYS A 1 143 ? 48.585  111.723 -14.956 1.00 51.76  ? 144 LYS S CD  1 
ATOM   1152  C CE  . LYS A 1 143 ? 47.301  111.903 -14.126 1.00 51.76  ? 144 LYS S CE  1 
ATOM   1153  N NZ  . LYS A 1 143 ? 46.124  111.074 -14.622 1.00 51.76  ? 144 LYS S NZ  1 
ATOM   1154  N N   . LYS A 1 144 ? 52.848  111.423 -16.616 1.00 2.00   ? 145 LYS S N   1 
ATOM   1155  C CA  . LYS A 1 144 ? 54.008  111.706 -17.445 1.00 2.00   ? 145 LYS S CA  1 
ATOM   1156  C C   . LYS A 1 144 ? 54.544  113.102 -17.263 1.00 2.00   ? 145 LYS S C   1 
ATOM   1157  O O   . LYS A 1 144 ? 54.148  113.807 -16.331 1.00 15.58  ? 145 LYS S O   1 
ATOM   1158  C CB  . LYS A 1 144 ? 53.658  111.507 -18.905 1.00 15.58  ? 145 LYS S CB  1 
ATOM   1159  C CG  . LYS A 1 144 ? 54.850  111.350 -19.826 1.00 15.58  ? 145 LYS S CG  1 
ATOM   1160  C CD  . LYS A 1 144 ? 54.736  110.069 -20.669 1.00 15.58  ? 145 LYS S CD  1 
ATOM   1161  C CE  . LYS A 1 144 ? 54.166  108.910 -19.858 1.00 15.58  ? 145 LYS S CE  1 
ATOM   1162  N NZ  . LYS A 1 144 ? 53.665  107.807 -20.724 1.00 15.58  ? 145 LYS S NZ  1 
ATOM   1163  N N   . ARG A 1 145 ? 55.441  113.499 -18.165 1.00 2.00   ? 146 ARG S N   1 
ATOM   1164  C CA  . ARG A 1 145 ? 56.069  114.820 -18.092 1.00 2.00   ? 146 ARG S CA  1 
ATOM   1165  C C   . ARG A 1 145 ? 55.115  115.897 -18.546 1.00 2.00   ? 146 ARG S C   1 
ATOM   1166  O O   . ARG A 1 145 ? 55.010  116.957 -17.922 1.00 36.01  ? 146 ARG S O   1 
ATOM   1167  C CB  . ARG A 1 145 ? 57.327  114.875 -18.963 1.00 36.01  ? 146 ARG S CB  1 
ATOM   1168  C CG  . ARG A 1 145 ? 58.381  113.811 -18.653 1.00 36.01  ? 146 ARG S CG  1 
ATOM   1169  C CD  . ARG A 1 145 ? 58.103  112.500 -19.379 1.00 36.01  ? 146 ARG S CD  1 
ATOM   1170  N NE  . ARG A 1 145 ? 57.746  111.463 -18.421 1.00 36.01  ? 146 ARG S NE  1 
ATOM   1171  C CZ  . ARG A 1 145 ? 58.629  110.800 -17.689 1.00 36.01  ? 146 ARG S CZ  1 
ATOM   1172  N NH1 . ARG A 1 145 ? 59.923  111.070 -17.814 1.00 36.01  ? 146 ARG S NH1 1 
ATOM   1173  N NH2 . ARG A 1 145 ? 58.216  109.884 -16.822 1.00 36.01  ? 146 ARG S NH2 1 
ATOM   1174  N N   . HIS A 1 146 ? 54.409  115.600 -19.632 1.00 28.87  ? 147 HIS S N   1 
ATOM   1175  C CA  . HIS A 1 146 ? 53.463  116.531 -20.220 1.00 28.87  ? 147 HIS S CA  1 
ATOM   1176  C C   . HIS A 1 146 ? 52.018  116.356 -19.749 1.00 28.87  ? 147 HIS S C   1 
ATOM   1177  O O   . HIS A 1 146 ? 51.224  117.284 -19.821 1.00 2.00   ? 147 HIS S O   1 
ATOM   1178  C CB  . HIS A 1 146 ? 53.545  116.441 -21.741 1.00 2.00   ? 147 HIS S CB  1 
ATOM   1179  C CG  . HIS A 1 146 ? 53.311  115.072 -22.278 1.00 2.00   ? 147 HIS S CG  1 
ATOM   1180  N ND1 . HIS A 1 146 ? 52.104  114.422 -22.146 1.00 2.00   ? 147 HIS S ND1 1 
ATOM   1181  C CD2 . HIS A 1 146 ? 54.126  114.229 -22.954 1.00 2.00   ? 147 HIS S CD2 1 
ATOM   1182  C CE1 . HIS A 1 146 ? 52.183  113.237 -22.723 1.00 2.00   ? 147 HIS S CE1 1 
ATOM   1183  N NE2 . HIS A 1 146 ? 53.402  113.098 -23.222 1.00 2.00   ? 147 HIS S NE2 1 
ATOM   1184  N N   . GLU A 1 147 ? 51.655  115.182 -19.265 1.00 2.00   ? 148 GLU S N   1 
ATOM   1185  C CA  . GLU A 1 147 ? 50.299  115.010 -18.796 1.00 2.00   ? 148 GLU S CA  1 
ATOM   1186  C C   . GLU A 1 147 ? 49.960  115.953 -17.633 1.00 2.00   ? 148 GLU S C   1 
ATOM   1187  O O   . GLU A 1 147 ? 48.883  115.861 -17.035 1.00 45.02  ? 148 GLU S O   1 
ATOM   1188  C CB  . GLU A 1 147 ? 50.098  113.584 -18.351 1.00 45.02  ? 148 GLU S CB  1 
ATOM   1189  C CG  . GLU A 1 147 ? 50.761  112.616 -19.251 1.00 45.02  ? 148 GLU S CG  1 
ATOM   1190  C CD  . GLU A 1 147 ? 49.773  111.837 -20.039 1.00 45.02  ? 148 GLU S CD  1 
ATOM   1191  O OE1 . GLU A 1 147 ? 49.015  111.063 -19.413 1.00 45.02  ? 148 GLU S OE1 1 
ATOM   1192  O OE2 . GLU A 1 147 ? 49.755  112.005 -21.276 1.00 45.02  ? 148 GLU S OE2 1 
ATOM   1193  N N   . MET A 1 148 ? 50.870  116.862 -17.314 1.00 2.00   ? 149 MET S N   1 
ATOM   1194  C CA  . MET A 1 148 ? 50.655  117.779 -16.213 1.00 2.00   ? 149 MET S CA  1 
ATOM   1195  C C   . MET A 1 148 ? 51.620  118.947 -16.321 1.00 2.00   ? 149 MET S C   1 
ATOM   1196  O O   . MET A 1 148 ? 52.558  118.919 -17.111 1.00 24.89  ? 149 MET S O   1 
ATOM   1197  C CB  . MET A 1 148 ? 50.890  117.043 -14.897 1.00 24.89  ? 149 MET S CB  1 
ATOM   1198  C CG  . MET A 1 148 ? 49.749  116.184 -14.483 1.00 24.89  ? 149 MET S CG  1 
ATOM   1199  S SD  . MET A 1 148 ? 48.638  117.212 -13.581 1.00 24.89  ? 149 MET S SD  1 
ATOM   1200  C CE  . MET A 1 148 ? 47.860  115.984 -12.509 1.00 24.89  ? 149 MET S CE  1 
ATOM   1201  N N   . PRO A 1 149 ? 51.413  119.989 -15.516 1.00 2.62   ? 150 PRO S N   1 
ATOM   1202  C CA  . PRO A 1 149 ? 52.281  121.163 -15.540 1.00 2.62   ? 150 PRO S CA  1 
ATOM   1203  C C   . PRO A 1 149 ? 53.530  121.079 -14.639 1.00 2.62   ? 150 PRO S C   1 
ATOM   1204  O O   . PRO A 1 149 ? 53.551  120.361 -13.619 1.00 2.00   ? 150 PRO S O   1 
ATOM   1205  C CB  . PRO A 1 149 ? 51.361  122.269 -15.099 1.00 2.00   ? 150 PRO S CB  1 
ATOM   1206  C CG  . PRO A 1 149 ? 50.489  121.593 -14.100 1.00 2.00   ? 150 PRO S CG  1 
ATOM   1207  C CD  . PRO A 1 149 ? 50.343  120.147 -14.522 1.00 2.00   ? 150 PRO S CD  1 
ATOM   1208  N N   . PRO A 1 150 ? 54.586  121.827 -15.004 1.00 11.76  ? 151 PRO S N   1 
ATOM   1209  C CA  . PRO A 1 150 ? 55.827  121.854 -14.251 1.00 11.76  ? 151 PRO S CA  1 
ATOM   1210  C C   . PRO A 1 150 ? 55.510  122.054 -12.800 1.00 11.76  ? 151 PRO S C   1 
ATOM   1211  O O   . PRO A 1 150 ? 54.779  122.975 -12.450 1.00 6.89   ? 151 PRO S O   1 
ATOM   1212  C CB  . PRO A 1 150 ? 56.573  123.063 -14.809 1.00 6.89   ? 151 PRO S CB  1 
ATOM   1213  C CG  . PRO A 1 150 ? 55.616  123.774 -15.672 1.00 6.89   ? 151 PRO S CG  1 
ATOM   1214  C CD  . PRO A 1 150 ? 54.681  122.721 -16.161 1.00 6.89   ? 151 PRO S CD  1 
ATOM   1215  N N   . HIS A 1 151 ? 56.056  121.177 -11.972 1.00 41.67  ? 152 HIS S N   1 
ATOM   1216  C CA  . HIS A 1 151 ? 55.887  121.234 -10.535 1.00 41.67  ? 152 HIS S CA  1 
ATOM   1217  C C   . HIS A 1 151 ? 56.993  120.367 -9.962  1.00 41.67  ? 152 HIS S C   1 
ATOM   1218  O O   . HIS A 1 151 ? 57.526  119.484 -10.646 1.00 6.30   ? 152 HIS S O   1 
ATOM   1219  C CB  . HIS A 1 151 ? 54.542  120.673 -10.122 1.00 6.30   ? 152 HIS S CB  1 
ATOM   1220  C CG  . HIS A 1 151 ? 54.288  120.696 -8.625  1.00 6.30   ? 152 HIS S CG  1 
ATOM   1221  N ND1 . HIS A 1 151 ? 54.826  119.738 -7.776  1.00 6.30   ? 152 HIS S ND1 1 
ATOM   1222  C CD2 . HIS A 1 151 ? 53.567  121.540 -7.850  1.00 6.30   ? 152 HIS S CD2 1 
ATOM   1223  C CE1 . HIS A 1 151 ? 54.426  120.012 -6.549  1.00 6.30   ? 152 HIS S CE1 1 
ATOM   1224  N NE2 . HIS A 1 151 ? 53.674  121.086 -6.574  1.00 6.30   ? 152 HIS S NE2 1 
ATOM   1225  N N   . ILE A 1 152 ? 57.351  120.601 -8.730  1.00 7.52   ? 153 ILE S N   1 
ATOM   1226  C CA  . ILE A 1 152 ? 58.425  119.812 -8.130  1.00 7.52   ? 153 ILE S CA  1 
ATOM   1227  C C   . ILE A 1 152 ? 58.028  118.334 -8.074  1.00 7.52   ? 153 ILE S C   1 
ATOM   1228  O O   . ILE A 1 152 ? 58.786  117.452 -8.487  1.00 2.00   ? 153 ILE S O   1 
ATOM   1229  C CB  . ILE A 1 152 ? 58.765  120.297 -6.732  1.00 2.00   ? 153 ILE S CB  1 
ATOM   1230  C CG1 . ILE A 1 152 ? 60.023  119.617 -6.180  1.00 2.00   ? 153 ILE S CG1 1 
ATOM   1231  C CG2 . ILE A 1 152 ? 57.650  120.038 -5.722  1.00 2.00   ? 153 ILE S CG2 1 
ATOM   1232  C CD1 . ILE A 1 152 ? 61.233  119.745 -7.111  1.00 2.00   ? 153 ILE S CD1 1 
ATOM   1233  N N   . TYR A 1 153 ? 56.837  118.064 -7.566  1.00 2.00   ? 154 TYR S N   1 
ATOM   1234  C CA  . TYR A 1 153 ? 56.358  116.676 -7.461  1.00 2.00   ? 154 TYR S CA  1 
ATOM   1235  C C   . TYR A 1 153 ? 56.576  115.949 -8.774  1.00 2.00   ? 154 TYR S C   1 
ATOM   1236  O O   . TYR A 1 153 ? 56.605  114.703 -8.804  1.00 7.10   ? 154 TYR S O   1 
ATOM   1237  C CB  . TYR A 1 153 ? 54.868  116.612 -7.165  1.00 7.10   ? 154 TYR S CB  1 
ATOM   1238  C CG  . TYR A 1 153 ? 54.487  117.100 -5.772  1.00 7.10   ? 154 TYR S CG  1 
ATOM   1239  C CD1 . TYR A 1 153 ? 55.439  117.152 -4.744  1.00 7.10   ? 154 TYR S CD1 1 
ATOM   1240  C CD2 . TYR A 1 153 ? 53.173  117.495 -5.537  1.00 7.10   ? 154 TYR S CD2 1 
ATOM   1241  C CE1 . TYR A 1 153 ? 55.064  117.619 -3.476  1.00 7.10   ? 154 TYR S CE1 1 
ATOM   1242  C CE2 . TYR A 1 153 ? 52.800  117.965 -4.275  1.00 7.10   ? 154 TYR S CE2 1 
ATOM   1243  C CZ  . TYR A 1 153 ? 53.743  118.028 -3.245  1.00 7.10   ? 154 TYR S CZ  1 
ATOM   1244  O OH  . TYR A 1 153 ? 53.371  118.489 -2.021  1.00 7.10   ? 154 TYR S OH  1 
ATOM   1245  N N   . ALA A 1 154 ? 56.720  116.710 -9.860  1.00 2.00   ? 155 ALA S N   1 
ATOM   1246  C CA  . ALA A 1 154 ? 56.924  116.123 -11.178 1.00 2.00   ? 155 ALA S CA  1 
ATOM   1247  C C   . ALA A 1 154 ? 58.361  115.645 -11.360 1.00 2.00   ? 155 ALA S C   1 
ATOM   1248  O O   . ALA A 1 154 ? 58.591  114.526 -11.819 1.00 67.14  ? 155 ALA S O   1 
ATOM   1249  C CB  . ALA A 1 154 ? 56.574  117.124 -12.246 1.00 67.14  ? 155 ALA S CB  1 
ATOM   1250  N N   . ILE A 1 155 ? 59.330  116.489 -10.999 1.00 7.02   ? 156 ILE S N   1 
ATOM   1251  C CA  . ILE A 1 155 ? 60.756  116.137 -11.117 1.00 7.02   ? 156 ILE S CA  1 
ATOM   1252  C C   . ILE A 1 155 ? 61.016  114.904 -10.288 1.00 7.02   ? 156 ILE S C   1 
ATOM   1253  O O   . ILE A 1 155 ? 61.726  114.011 -10.713 1.00 2.00   ? 156 ILE S O   1 
ATOM   1254  C CB  . ILE A 1 155 ? 61.674  117.267 -10.618 1.00 2.00   ? 156 ILE S CB  1 
ATOM   1255  C CG1 . ILE A 1 155 ? 61.486  118.514 -11.490 1.00 2.00   ? 156 ILE S CG1 1 
ATOM   1256  C CG2 . ILE A 1 155 ? 63.100  116.830 -10.677 1.00 2.00   ? 156 ILE S CG2 1 
ATOM   1257  C CD1 . ILE A 1 155 ? 61.540  119.832 -10.757 1.00 2.00   ? 156 ILE S CD1 1 
ATOM   1258  N N   . ALA A 1 156 ? 60.420  114.870 -9.102  1.00 8.52   ? 157 ALA S N   1 
ATOM   1259  C CA  . ALA A 1 156 ? 60.546  113.739 -8.202  1.00 8.52   ? 157 ALA S CA  1 
ATOM   1260  C C   . ALA A 1 156 ? 60.037  112.456 -8.866  1.00 8.52   ? 157 ALA S C   1 
ATOM   1261  O O   . ALA A 1 156 ? 60.740  111.447 -8.895  1.00 8.73   ? 157 ALA S O   1 
ATOM   1262  C CB  . ALA A 1 156 ? 59.777  114.003 -6.929  1.00 8.73   ? 157 ALA S CB  1 
ATOM   1263  N N   . ASP A 1 157 ? 58.826  112.478 -9.411  1.00 2.00   ? 158 ASP S N   1 
ATOM   1264  C CA  . ASP A 1 157 ? 58.316  111.282 -10.045 1.00 2.00   ? 158 ASP S CA  1 
ATOM   1265  C C   . ASP A 1 157 ? 59.085  110.911 -11.309 1.00 2.00   ? 158 ASP S C   1 
ATOM   1266  O O   . ASP A 1 157 ? 59.288  109.735 -11.604 1.00 14.99  ? 158 ASP S O   1 
ATOM   1267  C CB  . ASP A 1 157 ? 56.824  111.427 -10.373 1.00 14.99  ? 158 ASP S CB  1 
ATOM   1268  C CG  . ASP A 1 157 ? 56.184  110.098 -10.828 1.00 14.99  ? 158 ASP S CG  1 
ATOM   1269  O OD1 . ASP A 1 157 ? 56.331  109.729 -12.013 1.00 14.99  ? 158 ASP S OD1 1 
ATOM   1270  O OD2 . ASP A 1 157 ? 55.541  109.422 -9.996  1.00 14.99  ? 158 ASP S OD2 1 
ATOM   1271  N N   . THR A 1 158 ? 59.516  111.911 -12.061 1.00 2.00   ? 159 THR S N   1 
ATOM   1272  C CA  . THR A 1 158 ? 60.243  111.656 -13.311 1.00 2.00   ? 159 THR S CA  1 
ATOM   1273  C C   . THR A 1 158 ? 61.522  110.874 -13.054 1.00 2.00   ? 159 THR S C   1 
ATOM   1274  O O   . THR A 1 158 ? 61.905  110.015 -13.844 1.00 35.14  ? 159 THR S O   1 
ATOM   1275  C CB  . THR A 1 158 ? 60.617  112.973 -14.039 1.00 35.14  ? 159 THR S CB  1 
ATOM   1276  O OG1 . THR A 1 158 ? 59.439  113.746 -14.306 1.00 35.14  ? 159 THR S OG1 1 
ATOM   1277  C CG2 . THR A 1 158 ? 61.289  112.667 -15.356 1.00 35.14  ? 159 THR S CG2 1 
ATOM   1278  N N   . ALA A 1 159 ? 62.182  111.193 -11.943 1.00 3.65   ? 160 ALA S N   1 
ATOM   1279  C CA  . ALA A 1 159 ? 63.416  110.538 -11.551 1.00 3.65   ? 160 ALA S CA  1 
ATOM   1280  C C   . ALA A 1 159 ? 63.083  109.172 -10.980 1.00 3.65   ? 160 ALA S C   1 
ATOM   1281  O O   . ALA A 1 159 ? 63.528  108.148 -11.490 1.00 2.00   ? 160 ALA S O   1 
ATOM   1282  C CB  . ALA A 1 159 ? 64.124  111.372 -10.514 1.00 2.00   ? 160 ALA S CB  1 
ATOM   1283  N N   . TYR A 1 160 ? 62.267  109.167 -9.930  1.00 2.00   ? 161 TYR S N   1 
ATOM   1284  C CA  . TYR A 1 160 ? 61.882  107.932 -9.259  1.00 2.00   ? 161 TYR S CA  1 
ATOM   1285  C C   . TYR A 1 160 ? 61.436  106.823 -10.176 1.00 2.00   ? 161 TYR S C   1 
ATOM   1286  O O   . TYR A 1 160 ? 61.452  105.663 -9.795  1.00 2.00   ? 161 TYR S O   1 
ATOM   1287  C CB  . TYR A 1 160 ? 60.785  108.178 -8.247  1.00 2.00   ? 161 TYR S CB  1 
ATOM   1288  C CG  . TYR A 1 160 ? 60.156  106.899 -7.814  1.00 2.00   ? 161 TYR S CG  1 
ATOM   1289  C CD1 . TYR A 1 160 ? 60.797  106.064 -6.935  1.00 2.00   ? 161 TYR S CD1 1 
ATOM   1290  C CD2 . TYR A 1 160 ? 58.948  106.498 -8.330  1.00 2.00   ? 161 TYR S CD2 1 
ATOM   1291  C CE1 . TYR A 1 160 ? 60.242  104.857 -6.584  1.00 2.00   ? 161 TYR S CE1 1 
ATOM   1292  C CE2 . TYR A 1 160 ? 58.383  105.298 -7.988  1.00 2.00   ? 161 TYR S CE2 1 
ATOM   1293  C CZ  . TYR A 1 160 ? 59.024  104.477 -7.118  1.00 2.00   ? 161 TYR S CZ  1 
ATOM   1294  O OH  . TYR A 1 160 ? 58.445  103.269 -6.772  1.00 2.00   ? 161 TYR S OH  1 
ATOM   1295  N N   . ARG A 1 161 ? 60.997  107.176 -11.370 1.00 2.00   ? 162 ARG S N   1 
ATOM   1296  C CA  . ARG A 1 161 ? 60.581  106.169 -12.319 1.00 2.00   ? 162 ARG S CA  1 
ATOM   1297  C C   . ARG A 1 161 ? 61.812  105.829 -13.134 1.00 2.00   ? 162 ARG S C   1 
ATOM   1298  O O   . ARG A 1 161 ? 62.207  104.674 -13.233 1.00 34.25  ? 162 ARG S O   1 
ATOM   1299  C CB  . ARG A 1 161 ? 59.511  106.706 -13.246 1.00 34.25  ? 162 ARG S CB  1 
ATOM   1300  C CG  . ARG A 1 161 ? 59.392  105.877 -14.500 1.00 34.25  ? 162 ARG S CG  1 
ATOM   1301  C CD  . ARG A 1 161 ? 57.984  105.317 -14.662 1.00 34.25  ? 162 ARG S CD  1 
ATOM   1302  N NE  . ARG A 1 161 ? 57.720  104.170 -13.800 1.00 34.25  ? 162 ARG S NE  1 
ATOM   1303  C CZ  . ARG A 1 161 ? 56.955  104.228 -12.717 1.00 34.25  ? 162 ARG S CZ  1 
ATOM   1304  N NH1 . ARG A 1 161 ? 56.389  105.377 -12.366 1.00 34.25  ? 162 ARG S NH1 1 
ATOM   1305  N NH2 . ARG A 1 161 ? 56.751  103.144 -11.984 1.00 34.25  ? 162 ARG S NH2 1 
ATOM   1306  N N   . SER A 1 162 ? 62.417  106.863 -13.714 1.00 20.74  ? 163 SER S N   1 
ATOM   1307  C CA  . SER A 1 162 ? 63.617  106.706 -14.523 1.00 20.74  ? 163 SER S CA  1 
ATOM   1308  C C   . SER A 1 162 ? 64.534  105.706 -13.854 1.00 20.74  ? 163 SER S C   1 
ATOM   1309  O O   . SER A 1 162 ? 65.158  104.883 -14.514 1.00 2.00   ? 163 SER S O   1 
ATOM   1310  C CB  . SER A 1 162 ? 64.333  108.041 -14.677 1.00 2.00   ? 163 SER S CB  1 
ATOM   1311  O OG  . SER A 1 162 ? 64.743  108.238 -16.015 1.00 2.00   ? 163 SER S OG  1 
ATOM   1312  N N   . MET A 1 163 ? 64.612  105.775 -12.534 1.00 27.48  ? 164 MET S N   1 
ATOM   1313  C CA  . MET A 1 163 ? 65.444  104.835 -11.796 1.00 27.48  ? 164 MET S CA  1 
ATOM   1314  C C   . MET A 1 163 ? 64.935  103.424 -12.073 1.00 27.48  ? 164 MET S C   1 
ATOM   1315  O O   . MET A 1 163 ? 65.655  102.606 -12.607 1.00 2.00   ? 164 MET S O   1 
ATOM   1316  C CB  . MET A 1 163 ? 65.385  105.137 -10.295 1.00 2.00   ? 164 MET S CB  1 
ATOM   1317  C CG  . MET A 1 163 ? 65.524  103.938 -9.397  1.00 2.00   ? 164 MET S CG  1 
ATOM   1318  S SD  . MET A 1 163 ? 64.908  104.252 -7.751  1.00 2.00   ? 164 MET S SD  1 
ATOM   1319  C CE  . MET A 1 163 ? 65.685  105.799 -7.411  1.00 2.00   ? 164 MET S CE  1 
ATOM   1320  N N   . LEU A 1 164 ? 63.684  103.155 -11.739 1.00 2.00   ? 165 LEU S N   1 
ATOM   1321  C CA  . LEU A 1 164 ? 63.111  101.838 -11.950 1.00 2.00   ? 165 LEU S CA  1 
ATOM   1322  C C   . LEU A 1 164 ? 62.979  101.412 -13.402 1.00 2.00   ? 165 LEU S C   1 
ATOM   1323  O O   . LEU A 1 164 ? 62.667  100.254 -13.689 1.00 3.85   ? 165 LEU S O   1 
ATOM   1324  C CB  . LEU A 1 164 ? 61.730  101.748 -11.310 1.00 3.85   ? 165 LEU S CB  1 
ATOM   1325  C CG  . LEU A 1 164 ? 61.603  102.141 -9.847  1.00 3.85   ? 165 LEU S CG  1 
ATOM   1326  C CD1 . LEU A 1 164 ? 60.499  103.143 -9.660  1.00 3.85   ? 165 LEU S CD1 1 
ATOM   1327  C CD2 . LEU A 1 164 ? 61.309  100.917 -9.044  1.00 3.85   ? 165 LEU S CD2 1 
ATOM   1328  N N   . GLN A 1 165 ? 63.203  102.335 -14.329 1.00 2.00   ? 166 GLN S N   1 
ATOM   1329  C CA  . GLN A 1 165 ? 63.053  101.992 -15.747 1.00 2.00   ? 166 GLN S CA  1 
ATOM   1330  C C   . GLN A 1 165 ? 64.323  101.471 -16.384 1.00 2.00   ? 166 GLN S C   1 
ATOM   1331  O O   . GLN A 1 165 ? 64.364  100.328 -16.843 1.00 79.30  ? 166 GLN S O   1 
ATOM   1332  C CB  . GLN A 1 165 ? 62.536  103.197 -16.540 1.00 79.30  ? 166 GLN S CB  1 
ATOM   1333  C CG  . GLN A 1 165 ? 61.007  103.326 -16.573 1.00 79.30  ? 166 GLN S CG  1 
ATOM   1334  C CD  . GLN A 1 165 ? 60.298  102.038 -16.990 1.00 79.30  ? 166 GLN S CD  1 
ATOM   1335  O OE1 . GLN A 1 165 ? 60.782  101.301 -17.855 1.00 79.30  ? 166 GLN S OE1 1 
ATOM   1336  N NE2 . GLN A 1 165 ? 59.147  101.764 -16.370 1.00 79.30  ? 166 GLN S NE2 1 
ATOM   1337  N N   . ASP A 1 166 ? 65.356  102.309 -16.415 1.00 47.64  ? 167 ASP S N   1 
ATOM   1338  C CA  . ASP A 1 166 ? 66.638  101.922 -16.996 1.00 47.64  ? 167 ASP S CA  1 
ATOM   1339  C C   . ASP A 1 166 ? 67.609  101.425 -15.930 1.00 47.64  ? 167 ASP S C   1 
ATOM   1340  O O   . ASP A 1 166 ? 68.797  101.251 -16.188 1.00 49.71  ? 167 ASP S O   1 
ATOM   1341  C CB  . ASP A 1 166 ? 67.260  103.093 -17.760 1.00 49.71  ? 167 ASP S CB  1 
ATOM   1342  C CG  . ASP A 1 166 ? 67.163  104.384 -17.004 1.00 49.71  ? 167 ASP S CG  1 
ATOM   1343  O OD1 . ASP A 1 166 ? 67.315  104.337 -15.763 1.00 49.71  ? 167 ASP S OD1 1 
ATOM   1344  O OD2 . ASP A 1 166 ? 66.937  105.436 -17.649 1.00 49.71  ? 167 ASP S OD2 1 
ATOM   1345  N N   . ARG A 1 167 ? 67.082  101.195 -14.736 1.00 44.06  ? 168 ARG S N   1 
ATOM   1346  C CA  . ARG A 1 167 ? 67.865  100.697 -13.611 1.00 44.06  ? 168 ARG S CA  1 
ATOM   1347  C C   . ARG A 1 167 ? 69.187  101.441 -13.542 1.00 44.06  ? 168 ARG S C   1 
ATOM   1348  O O   . ARG A 1 167 ? 70.210  100.933 -13.990 1.00 100.00 ? 168 ARG S O   1 
ATOM   1349  C CB  . ARG A 1 167 ? 68.100  99.190  -13.773 1.00 100.00 ? 168 ARG S CB  1 
ATOM   1350  C CG  . ARG A 1 167 ? 66.841  98.404  -14.147 1.00 100.00 ? 168 ARG S CG  1 
ATOM   1351  C CD  . ARG A 1 167 ? 67.161  97.147  -14.942 1.00 100.00 ? 168 ARG S CD  1 
ATOM   1352  N NE  . ARG A 1 167 ? 67.247  95.970  -14.080 1.00 100.00 ? 168 ARG S NE  1 
ATOM   1353  C CZ  . ARG A 1 167 ? 68.054  94.933  -14.299 1.00 100.00 ? 168 ARG S CZ  1 
ATOM   1354  N NH1 . ARG A 1 167 ? 68.855  94.914  -15.360 1.00 100.00 ? 168 ARG S NH1 1 
ATOM   1355  N NH2 . ARG A 1 167 ? 68.059  93.909  -13.457 1.00 100.00 ? 168 ARG S NH2 1 
ATOM   1356  N N   . GLU A 1 168 ? 69.161  102.647 -12.977 1.00 2.00   ? 169 GLU S N   1 
ATOM   1357  C CA  . GLU A 1 168 ? 70.365  103.473 -12.883 1.00 2.00   ? 169 GLU S CA  1 
ATOM   1358  C C   . GLU A 1 168 ? 70.176  104.687 -11.992 1.00 2.00   ? 169 GLU S C   1 
ATOM   1359  O O   . GLU A 1 168 ? 69.679  105.729 -12.411 1.00 97.46  ? 169 GLU S O   1 
ATOM   1360  C CB  . GLU A 1 168 ? 70.793  103.893 -14.286 1.00 97.46  ? 169 GLU S CB  1 
ATOM   1361  C CG  . GLU A 1 168 ? 71.450  105.243 -14.393 1.00 97.46  ? 169 GLU S CG  1 
ATOM   1362  C CD  . GLU A 1 168 ? 71.216  105.861 -15.751 1.00 97.46  ? 169 GLU S CD  1 
ATOM   1363  O OE1 . GLU A 1 168 ? 70.175  106.534 -15.929 1.00 97.46  ? 169 GLU S OE1 1 
ATOM   1364  O OE2 . GLU A 1 168 ? 72.072  105.662 -16.642 1.00 97.46  ? 169 GLU S OE2 1 
ATOM   1365  N N   . ASP A 1 169 ? 70.603  104.518 -10.749 1.00 20.29  ? 170 ASP S N   1 
ATOM   1366  C CA  . ASP A 1 169 ? 70.497  105.525 -9.699  1.00 20.29  ? 170 ASP S CA  1 
ATOM   1367  C C   . ASP A 1 169 ? 70.498  106.973 -10.149 1.00 20.29  ? 170 ASP S C   1 
ATOM   1368  O O   . ASP A 1 169 ? 71.102  107.328 -11.160 1.00 96.61  ? 170 ASP S O   1 
ATOM   1369  C CB  . ASP A 1 169 ? 71.579  105.271 -8.647  1.00 96.61  ? 170 ASP S CB  1 
ATOM   1370  C CG  . ASP A 1 169 ? 71.446  103.894 -8.002  1.00 96.61  ? 170 ASP S CG  1 
ATOM   1371  O OD1 . ASP A 1 169 ? 70.401  103.613 -7.367  1.00 96.61  ? 170 ASP S OD1 1 
ATOM   1372  O OD2 . ASP A 1 169 ? 72.390  103.089 -8.137  1.00 96.61  ? 170 ASP S OD2 1 
ATOM   1373  N N   . GLN A 1 170 ? 69.809  107.807 -9.377  1.00 2.00   ? 171 GLN S N   1 
ATOM   1374  C CA  . GLN A 1 170 ? 69.668  109.204 -9.729  1.00 2.00   ? 171 GLN S CA  1 
ATOM   1375  C C   . GLN A 1 170 ? 69.798  110.202 -8.603  1.00 2.00   ? 171 GLN S C   1 
ATOM   1376  O O   . GLN A 1 170 ? 69.663  109.872 -7.419  1.00 9.02   ? 171 GLN S O   1 
ATOM   1377  C CB  . GLN A 1 170 ? 68.328  109.419 -10.405 1.00 9.02   ? 171 GLN S CB  1 
ATOM   1378  C CG  . GLN A 1 170 ? 67.859  108.256 -11.230 1.00 9.02   ? 171 GLN S CG  1 
ATOM   1379  C CD  . GLN A 1 170 ? 67.756  108.617 -12.670 1.00 9.02   ? 171 GLN S CD  1 
ATOM   1380  O OE1 . GLN A 1 170 ? 67.624  109.804 -13.014 1.00 9.02   ? 171 GLN S OE1 1 
ATOM   1381  N NE2 . GLN A 1 170 ? 67.819  107.610 -13.543 1.00 9.02   ? 171 GLN S NE2 1 
ATOM   1382  N N   . SER A 1 171 ? 70.020  111.444 -9.014  1.00 2.00   ? 172 SER S N   1 
ATOM   1383  C CA  . SER A 1 171 ? 70.211  112.560 -8.110  1.00 2.00   ? 172 SER S CA  1 
ATOM   1384  C C   . SER A 1 171 ? 69.404  113.795 -8.505  1.00 2.00   ? 172 SER S C   1 
ATOM   1385  O O   . SER A 1 171 ? 69.253  114.098 -9.675  1.00 20.58  ? 172 SER S O   1 
ATOM   1386  C CB  . SER A 1 171 ? 71.688  112.933 -8.091  1.00 20.58  ? 172 SER S CB  1 
ATOM   1387  O OG  . SER A 1 171 ? 72.086  113.365 -9.378  1.00 20.58  ? 172 SER S OG  1 
ATOM   1388  N N   . ILE A 1 172 ? 68.895  114.509 -7.510  1.00 2.00   ? 173 ILE S N   1 
ATOM   1389  C CA  . ILE A 1 172 ? 68.136  115.721 -7.728  1.00 2.00   ? 173 ILE S CA  1 
ATOM   1390  C C   . ILE A 1 172 ? 68.977  116.764 -7.002  1.00 2.00   ? 173 ILE S C   1 
ATOM   1391  O O   . ILE A 1 172 ? 68.997  116.790 -5.784  1.00 2.00   ? 173 ILE S O   1 
ATOM   1392  C CB  . ILE A 1 172 ? 66.707  115.619 -7.110  1.00 2.00   ? 173 ILE S CB  1 
ATOM   1393  C CG1 . ILE A 1 172 ? 65.884  114.581 -7.858  1.00 2.00   ? 173 ILE S CG1 1 
ATOM   1394  C CG2 . ILE A 1 172 ? 66.001  116.926 -7.220  1.00 2.00   ? 173 ILE S CG2 1 
ATOM   1395  C CD1 . ILE A 1 172 ? 64.809  113.958 -7.040  1.00 2.00   ? 173 ILE S CD1 1 
ATOM   1396  N N   . LEU A 1 173 ? 69.688  117.595 -7.757  1.00 2.00   ? 174 LEU S N   1 
ATOM   1397  C CA  . LEU A 1 173 ? 70.557  118.627 -7.208  1.00 2.00   ? 174 LEU S CA  1 
ATOM   1398  C C   . LEU A 1 173 ? 69.979  120.028 -7.225  1.00 2.00   ? 174 LEU S C   1 
ATOM   1399  O O   . LEU A 1 173 ? 69.906  120.622 -8.286  1.00 2.00   ? 174 LEU S O   1 
ATOM   1400  C CB  . LEU A 1 173 ? 71.851  118.653 -7.996  1.00 2.00   ? 174 LEU S CB  1 
ATOM   1401  C CG  . LEU A 1 173 ? 72.379  117.305 -8.435  1.00 2.00   ? 174 LEU S CG  1 
ATOM   1402  C CD1 . LEU A 1 173 ? 73.376  117.475 -9.541  1.00 2.00   ? 174 LEU S CD1 1 
ATOM   1403  C CD2 . LEU A 1 173 ? 73.031  116.648 -7.271  1.00 2.00   ? 174 LEU S CD2 1 
ATOM   1404  N N   . CYS A 1 174 ? 69.610  120.580 -6.069  1.00 2.00   ? 175 CYS S N   1 
ATOM   1405  C CA  . CYS A 1 174 ? 69.045  121.943 -6.012  1.00 2.00   ? 175 CYS S CA  1 
ATOM   1406  C C   . CYS A 1 174 ? 70.111  123.016 -5.942  1.00 2.00   ? 175 CYS S C   1 
ATOM   1407  O O   . CYS A 1 174 ? 70.773  123.156 -4.919  1.00 18.14  ? 175 CYS S O   1 
ATOM   1408  C CB  . CYS A 1 174 ? 68.151  122.117 -4.790  1.00 18.14  ? 175 CYS S CB  1 
ATOM   1409  S SG  . CYS A 1 174 ? 66.747  121.025 -4.716  1.00 18.14  ? 175 CYS S SG  1 
ATOM   1410  N N   . THR A 1 175 ? 70.267  123.776 -7.022  1.00 32.53  ? 176 THR S N   1 
ATOM   1411  C CA  . THR A 1 175 ? 71.268  124.845 -7.070  1.00 32.53  ? 176 THR S CA  1 
ATOM   1412  C C   . THR A 1 175 ? 70.629  126.137 -6.605  1.00 32.53  ? 176 THR S C   1 
ATOM   1413  O O   . THR A 1 175 ? 69.691  126.113 -5.822  1.00 40.08  ? 176 THR S O   1 
ATOM   1414  C CB  . THR A 1 175 ? 71.822  125.066 -8.502  1.00 40.08  ? 176 THR S CB  1 
ATOM   1415  O OG1 . THR A 1 175 ? 70.903  125.874 -9.255  1.00 40.08  ? 176 THR S OG1 1 
ATOM   1416  C CG2 . THR A 1 175 ? 72.041  123.728 -9.206  1.00 40.08  ? 176 THR S CG2 1 
ATOM   1417  N N   . GLY A 1 176 ? 71.137  127.262 -7.096  1.00 85.10  ? 177 GLY S N   1 
ATOM   1418  C CA  . GLY A 1 176 ? 70.573  128.536 -6.710  1.00 85.10  ? 177 GLY S CA  1 
ATOM   1419  C C   . GLY A 1 176 ? 71.290  129.183 -5.541  1.00 85.10  ? 177 GLY S C   1 
ATOM   1420  O O   . GLY A 1 176 ? 71.732  128.504 -4.610  1.00 2.00   ? 177 GLY S O   1 
ATOM   1421  N N   . GLU A 1 177 ? 71.384  130.510 -5.596  1.00 25.71  ? 178 GLU S N   1 
ATOM   1422  C CA  . GLU A 1 177 ? 72.046  131.301 -4.574  1.00 25.71  ? 178 GLU S CA  1 
ATOM   1423  C C   . GLU A 1 177 ? 71.354  131.170 -3.244  1.00 25.71  ? 178 GLU S C   1 
ATOM   1424  O O   . GLU A 1 177 ? 70.209  130.737 -3.165  1.00 22.43  ? 178 GLU S O   1 
ATOM   1425  C CB  . GLU A 1 177 ? 72.089  132.769 -4.990  1.00 22.43  ? 178 GLU S CB  1 
ATOM   1426  C CG  . GLU A 1 177 ? 70.823  133.524 -4.693  1.00 22.43  ? 178 GLU S CG  1 
ATOM   1427  C CD  . GLU A 1 177 ? 71.088  134.890 -4.112  1.00 22.43  ? 178 GLU S CD  1 
ATOM   1428  O OE1 . GLU A 1 177 ? 71.518  135.782 -4.888  1.00 22.43  ? 178 GLU S OE1 1 
ATOM   1429  O OE2 . GLU A 1 177 ? 70.864  135.064 -2.884  1.00 22.43  ? 178 GLU S OE2 1 
ATOM   1430  N N   . SER A 1 178 ? 72.054  131.562 -2.193  1.00 2.00   ? 179 SER S N   1 
ATOM   1431  C CA  . SER A 1 178 ? 71.490  131.452 -0.863  1.00 2.00   ? 179 SER S CA  1 
ATOM   1432  C C   . SER A 1 178 ? 70.119  132.069 -0.722  1.00 2.00   ? 179 SER S C   1 
ATOM   1433  O O   . SER A 1 178 ? 69.915  133.239 -1.058  1.00 2.97   ? 179 SER S O   1 
ATOM   1434  C CB  . SER A 1 178 ? 72.400  132.088 0.164   1.00 2.97   ? 179 SER S CB  1 
ATOM   1435  O OG  . SER A 1 178 ? 71.707  132.135 1.400   1.00 2.97   ? 179 SER S OG  1 
ATOM   1436  N N   . GLY A 1 179 ? 69.194  131.274 -0.205  1.00 2.00   ? 180 GLY S N   1 
ATOM   1437  C CA  . GLY A 1 179 ? 67.835  131.748 0.001   1.00 2.00   ? 180 GLY S CA  1 
ATOM   1438  C C   . GLY A 1 179 ? 66.854  131.313 -1.058  1.00 2.00   ? 180 GLY S C   1 
ATOM   1439  O O   . GLY A 1 179 ? 65.669  131.159 -0.771  1.00 2.00   ? 180 GLY S O   1 
ATOM   1440  N N   . ALA A 1 180 ? 67.359  131.099 -2.271  1.00 2.00   ? 181 ALA S N   1 
ATOM   1441  C CA  . ALA A 1 180 ? 66.541  130.701 -3.411  1.00 2.00   ? 181 ALA S CA  1 
ATOM   1442  C C   . ALA A 1 180 ? 65.671  129.471 -3.215  1.00 2.00   ? 181 ALA S C   1 
ATOM   1443  O O   . ALA A 1 180 ? 65.029  129.025 -4.152  1.00 43.85  ? 181 ALA S O   1 
ATOM   1444  C CB  . ALA A 1 180 ? 67.412  130.506 -4.635  1.00 43.85  ? 181 ALA S CB  1 
ATOM   1445  N N   . GLY A 1 181 ? 65.649  128.908 -2.018  1.00 16.47  ? 182 GLY S N   1 
ATOM   1446  C CA  . GLY A 1 181 ? 64.783  127.766 -1.792  1.00 16.47  ? 182 GLY S CA  1 
ATOM   1447  C C   . GLY A 1 181 ? 65.355  126.378 -1.981  1.00 16.47  ? 182 GLY S C   1 
ATOM   1448  O O   . GLY A 1 181 ? 64.605  125.420 -2.141  1.00 2.00   ? 182 GLY S O   1 
ATOM   1449  N N   . LYS A 1 182 ? 66.674  126.259 -1.968  1.00 2.00   ? 183 LYS S N   1 
ATOM   1450  C CA  . LYS A 1 182 ? 67.286  124.957 -2.128  1.00 2.00   ? 183 LYS S CA  1 
ATOM   1451  C C   . LYS A 1 182 ? 66.660  123.892 -1.219  1.00 2.00   ? 183 LYS S C   1 
ATOM   1452  O O   . LYS A 1 182 ? 66.437  122.743 -1.634  1.00 2.00   ? 183 LYS S O   1 
ATOM   1453  C CB  . LYS A 1 182 ? 68.772  125.070 -1.827  1.00 2.00   ? 183 LYS S CB  1 
ATOM   1454  C CG  . LYS A 1 182 ? 69.635  125.041 -3.042  1.00 2.00   ? 183 LYS S CG  1 
ATOM   1455  C CD  . LYS A 1 182 ? 70.227  126.383 -3.318  1.00 2.00   ? 183 LYS S CD  1 
ATOM   1456  C CE  . LYS A 1 182 ? 70.823  126.985 -2.094  1.00 2.00   ? 183 LYS S CE  1 
ATOM   1457  N NZ  . LYS A 1 182 ? 70.873  128.466 -2.277  1.00 2.00   ? 183 LYS S NZ  1 
ATOM   1458  N N   . THR A 1 183 ? 66.378  124.286 0.020   1.00 70.92  ? 184 THR S N   1 
ATOM   1459  C CA  . THR A 1 183 ? 65.825  123.384 1.024   1.00 70.92  ? 184 THR S CA  1 
ATOM   1460  C C   . THR A 1 183 ? 64.399  122.933 0.783   1.00 70.92  ? 184 THR S C   1 
ATOM   1461  O O   . THR A 1 183 ? 64.141  121.758 0.518   1.00 18.55  ? 184 THR S O   1 
ATOM   1462  C CB  . THR A 1 183 ? 65.874  124.005 2.444   1.00 18.55  ? 184 THR S CB  1 
ATOM   1463  O OG1 . THR A 1 183 ? 67.220  124.350 2.787   1.00 18.55  ? 184 THR S OG1 1 
ATOM   1464  C CG2 . THR A 1 183 ? 65.342  122.994 3.479   1.00 18.55  ? 184 THR S CG2 1 
ATOM   1465  N N   . GLU A 1 184 ? 63.466  123.867 0.900   1.00 29.25  ? 185 GLU S N   1 
ATOM   1466  C CA  . GLU A 1 184 ? 62.059  123.543 0.719   1.00 29.25  ? 185 GLU S CA  1 
ATOM   1467  C C   . GLU A 1 184 ? 61.872  122.461 -0.346  1.00 29.25  ? 185 GLU S C   1 
ATOM   1468  O O   . GLU A 1 184 ? 61.397  121.361 -0.069  1.00 68.44  ? 185 GLU S O   1 
ATOM   1469  C CB  . GLU A 1 184 ? 61.283  124.808 0.332   1.00 68.44  ? 185 GLU S CB  1 
ATOM   1470  C CG  . GLU A 1 184 ? 61.280  125.897 1.404   1.00 68.44  ? 185 GLU S CG  1 
ATOM   1471  C CD  . GLU A 1 184 ? 60.308  125.605 2.536   1.00 68.44  ? 185 GLU S CD  1 
ATOM   1472  O OE1 . GLU A 1 184 ? 59.959  124.420 2.728   1.00 68.44  ? 185 GLU S OE1 1 
ATOM   1473  O OE2 . GLU A 1 184 ? 59.894  126.562 3.234   1.00 68.44  ? 185 GLU S OE2 1 
ATOM   1474  N N   . ASN A 1 185 ? 62.285  122.790 -1.563  1.00 19.10  ? 186 ASN S N   1 
ATOM   1475  C CA  . ASN A 1 185 ? 62.166  121.897 -2.693  1.00 19.10  ? 186 ASN S CA  1 
ATOM   1476  C C   . ASN A 1 185 ? 62.680  120.514 -2.420  1.00 19.10  ? 186 ASN S C   1 
ATOM   1477  O O   . ASN A 1 185 ? 62.354  119.584 -3.141  1.00 15.02  ? 186 ASN S O   1 
ATOM   1478  C CB  . ASN A 1 185 ? 62.885  122.504 -3.884  1.00 15.02  ? 186 ASN S CB  1 
ATOM   1479  C CG  . ASN A 1 185 ? 62.082  123.610 -4.522  1.00 15.02  ? 186 ASN S CG  1 
ATOM   1480  O OD1 . ASN A 1 185 ? 61.601  123.456 -5.629  1.00 15.02  ? 186 ASN S OD1 1 
ATOM   1481  N ND2 . ASN A 1 185 ? 61.917  124.726 -3.825  1.00 15.02  ? 186 ASN S ND2 1 
ATOM   1482  N N   . THR A 1 186 ? 63.490  120.362 -1.384  1.00 9.50   ? 187 THR S N   1 
ATOM   1483  C CA  . THR A 1 186 ? 64.010  119.043 -1.057  1.00 9.50   ? 187 THR S CA  1 
ATOM   1484  C C   . THR A 1 186 ? 62.998  118.360 -0.175  1.00 9.50   ? 187 THR S C   1 
ATOM   1485  O O   . THR A 1 186 ? 62.692  117.174 -0.359  1.00 11.94  ? 187 THR S O   1 
ATOM   1486  C CB  . THR A 1 186 ? 65.328  119.119 -0.285  1.00 11.94  ? 187 THR S CB  1 
ATOM   1487  O OG1 . THR A 1 186 ? 66.338  119.682 -1.130  1.00 11.94  ? 187 THR S OG1 1 
ATOM   1488  C CG2 . THR A 1 186 ? 65.757  117.733 0.177   1.00 11.94  ? 187 THR S CG2 1 
ATOM   1489  N N   . LYS A 1 187 ? 62.474  119.125 0.779   1.00 13.29  ? 188 LYS S N   1 
ATOM   1490  C CA  . LYS A 1 187 ? 61.497  118.597 1.711   1.00 13.29  ? 188 LYS S CA  1 
ATOM   1491  C C   . LYS A 1 187 ? 60.302  118.049 0.940   1.00 13.29  ? 188 LYS S C   1 
ATOM   1492  O O   . LYS A 1 187 ? 59.661  117.085 1.367   1.00 23.06  ? 188 LYS S O   1 
ATOM   1493  C CB  . LYS A 1 187 ? 61.070  119.688 2.696   1.00 23.06  ? 188 LYS S CB  1 
ATOM   1494  C CG  . LYS A 1 187 ? 62.185  120.140 3.656   1.00 23.06  ? 188 LYS S CG  1 
ATOM   1495  C CD  . LYS A 1 187 ? 61.623  120.751 4.950   1.00 23.06  ? 188 LYS S CD  1 
ATOM   1496  C CE  . LYS A 1 187 ? 61.874  122.254 5.023   1.00 23.06  ? 188 LYS S CE  1 
ATOM   1497  N NZ  . LYS A 1 187 ? 61.225  122.859 6.212   1.00 23.06  ? 188 LYS S NZ  1 
ATOM   1498  N N   . LYS A 1 188 ? 60.008  118.659 -0.206  1.00 4.47   ? 189 LYS S N   1 
ATOM   1499  C CA  . LYS A 1 188 ? 58.892  118.201 -1.027  1.00 4.47   ? 189 LYS S CA  1 
ATOM   1500  C C   . LYS A 1 188 ? 59.244  116.873 -1.661  1.00 4.47   ? 189 LYS S C   1 
ATOM   1501  O O   . LYS A 1 188 ? 58.527  115.893 -1.489  1.00 10.23  ? 189 LYS S O   1 
ATOM   1502  C CB  . LYS A 1 188 ? 58.576  119.227 -2.101  1.00 10.23  ? 189 LYS S CB  1 
ATOM   1503  C CG  . LYS A 1 188 ? 58.346  120.623 -1.529  1.00 10.23  ? 189 LYS S CG  1 
ATOM   1504  C CD  . LYS A 1 188 ? 56.972  120.754 -0.896  1.00 10.23  ? 189 LYS S CD  1 
ATOM   1505  C CE  . LYS A 1 188 ? 57.048  121.496 0.425   1.00 10.23  ? 189 LYS S CE  1 
ATOM   1506  N NZ  . LYS A 1 188 ? 56.262  120.786 1.493   1.00 10.23  ? 189 LYS S NZ  1 
ATOM   1507  N N   . VAL A 1 189 ? 60.357  116.838 -2.382  1.00 2.00   ? 190 VAL S N   1 
ATOM   1508  C CA  . VAL A 1 189 ? 60.816  115.607 -3.011  1.00 2.00   ? 190 VAL S CA  1 
ATOM   1509  C C   . VAL A 1 189 ? 60.717  114.404 -2.073  1.00 2.00   ? 190 VAL S C   1 
ATOM   1510  O O   . VAL A 1 189 ? 60.393  113.288 -2.511  1.00 2.00   ? 190 VAL S O   1 
ATOM   1511  C CB  . VAL A 1 189 ? 62.254  115.733 -3.462  1.00 2.00   ? 190 VAL S CB  1 
ATOM   1512  C CG1 . VAL A 1 189 ? 62.701  114.472 -4.188  1.00 2.00   ? 190 VAL S CG1 1 
ATOM   1513  C CG2 . VAL A 1 189 ? 62.368  116.924 -4.346  1.00 2.00   ? 190 VAL S CG2 1 
ATOM   1514  N N   . ILE A 1 190 ? 61.004  114.609 -0.785  1.00 14.90  ? 191 ILE S N   1 
ATOM   1515  C CA  . ILE A 1 190 ? 60.902  113.499 0.143   1.00 14.90  ? 191 ILE S CA  1 
ATOM   1516  C C   . ILE A 1 190 ? 59.439  113.298 0.415   1.00 14.90  ? 191 ILE S C   1 
ATOM   1517  O O   . ILE A 1 190 ? 58.949  112.185 0.385   1.00 2.00   ? 191 ILE S O   1 
ATOM   1518  C CB  . ILE A 1 190 ? 61.603  113.768 1.467   1.00 2.00   ? 191 ILE S CB  1 
ATOM   1519  C CG1 . ILE A 1 190 ? 63.054  114.208 1.211   1.00 2.00   ? 191 ILE S CG1 1 
ATOM   1520  C CG2 . ILE A 1 190 ? 61.542  112.496 2.321   1.00 2.00   ? 191 ILE S CG2 1 
ATOM   1521  C CD1 . ILE A 1 190 ? 64.042  113.932 2.360   1.00 2.00   ? 191 ILE S CD1 1 
ATOM   1522  N N   . GLN A 1 191 ? 58.755  114.408 0.657   1.00 2.00   ? 192 GLN S N   1 
ATOM   1523  C CA  . GLN A 1 191 ? 57.321  114.428 0.949   1.00 2.00   ? 192 GLN S CA  1 
ATOM   1524  C C   . GLN A 1 191 ? 56.524  113.583 -0.043  1.00 2.00   ? 192 GLN S C   1 
ATOM   1525  O O   . GLN A 1 191 ? 55.675  112.770 0.329   1.00 29.94  ? 192 GLN S O   1 
ATOM   1526  C CB  . GLN A 1 191 ? 56.833  115.886 0.947   1.00 29.94  ? 192 GLN S CB  1 
ATOM   1527  C CG  . GLN A 1 191 ? 55.326  116.075 0.836   1.00 29.94  ? 192 GLN S CG  1 
ATOM   1528  C CD  . GLN A 1 191 ? 54.936  117.504 0.438   1.00 29.94  ? 192 GLN S CD  1 
ATOM   1529  O OE1 . GLN A 1 191 ? 55.792  118.333 0.123   1.00 29.94  ? 192 GLN S OE1 1 
ATOM   1530  N NE2 . GLN A 1 191 ? 53.636  117.791 0.455   1.00 29.94  ? 192 GLN S NE2 1 
ATOM   1531  N N   . TYR A 1 192 ? 56.832  113.790 -1.312  1.00 17.91  ? 193 TYR S N   1 
ATOM   1532  C CA  . TYR A 1 192 ? 56.195  113.075 -2.392  1.00 17.91  ? 193 TYR S CA  1 
ATOM   1533  C C   . TYR A 1 192 ? 56.613  111.600 -2.349  1.00 17.91  ? 193 TYR S C   1 
ATOM   1534  O O   . TYR A 1 192 ? 55.800  110.715 -2.105  1.00 4.92   ? 193 TYR S O   1 
ATOM   1535  C CB  . TYR A 1 192 ? 56.603  113.719 -3.711  1.00 4.92   ? 193 TYR S CB  1 
ATOM   1536  C CG  . TYR A 1 192 ? 56.055  113.054 -4.941  1.00 4.92   ? 193 TYR S CG  1 
ATOM   1537  C CD1 . TYR A 1 192 ? 56.584  111.858 -5.385  1.00 4.92   ? 193 TYR S CD1 1 
ATOM   1538  C CD2 . TYR A 1 192 ? 55.056  113.647 -5.711  1.00 4.92   ? 193 TYR S CD2 1 
ATOM   1539  C CE1 . TYR A 1 192 ? 56.145  111.269 -6.573  1.00 4.92   ? 193 TYR S CE1 1 
ATOM   1540  C CE2 . TYR A 1 192 ? 54.618  113.057 -6.896  1.00 4.92   ? 193 TYR S CE2 1 
ATOM   1541  C CZ  . TYR A 1 192 ? 55.175  111.870 -7.312  1.00 4.92   ? 193 TYR S CZ  1 
ATOM   1542  O OH  . TYR A 1 192 ? 54.800  111.254 -8.460  1.00 4.92   ? 193 TYR S OH  1 
ATOM   1543  N N   . LEU A 1 193 ? 57.888  111.331 -2.572  1.00 17.31  ? 194 LEU S N   1 
ATOM   1544  C CA  . LEU A 1 193 ? 58.387  109.963 -2.534  1.00 17.31  ? 194 LEU S CA  1 
ATOM   1545  C C   . LEU A 1 193 ? 58.010  109.181 -1.256  1.00 17.31  ? 194 LEU S C   1 
ATOM   1546  O O   . LEU A 1 193 ? 58.025  107.957 -1.226  1.00 2.00   ? 194 LEU S O   1 
ATOM   1547  C CB  . LEU A 1 193 ? 59.909  109.994 -2.699  1.00 2.00   ? 194 LEU S CB  1 
ATOM   1548  C CG  . LEU A 1 193 ? 60.370  109.767 -4.136  1.00 2.00   ? 194 LEU S CG  1 
ATOM   1549  C CD1 . LEU A 1 193 ? 60.988  111.013 -4.687  1.00 2.00   ? 194 LEU S CD1 1 
ATOM   1550  C CD2 . LEU A 1 193 ? 61.346  108.632 -4.157  1.00 2.00   ? 194 LEU S CD2 1 
ATOM   1551  N N   . ALA A 1 194 ? 57.666  109.894 -0.197  1.00 36.91  ? 195 ALA S N   1 
ATOM   1552  C CA  . ALA A 1 194 ? 57.306  109.238 1.051   1.00 36.91  ? 195 ALA S CA  1 
ATOM   1553  C C   . ALA A 1 194 ? 55.937  108.578 0.973   1.00 36.91  ? 195 ALA S C   1 
ATOM   1554  O O   . ALA A 1 194 ? 55.598  107.708 1.781   1.00 50.82  ? 195 ALA S O   1 
ATOM   1555  C CB  . ALA A 1 194 ? 57.319  110.242 2.178   1.00 50.82  ? 195 ALA S CB  1 
ATOM   1556  N N   . VAL A 1 195 ? 55.143  108.996 0.001   1.00 29.88  ? 196 VAL S N   1 
ATOM   1557  C CA  . VAL A 1 195 ? 53.810  108.450 -0.159  1.00 29.88  ? 196 VAL S CA  1 
ATOM   1558  C C   . VAL A 1 195 ? 53.684  107.735 -1.487  1.00 29.88  ? 196 VAL S C   1 
ATOM   1559  O O   . VAL A 1 195 ? 53.129  106.651 -1.569  1.00 17.60  ? 196 VAL S O   1 
ATOM   1560  C CB  . VAL A 1 195 ? 52.750  109.577 -0.051  1.00 17.60  ? 196 VAL S CB  1 
ATOM   1561  C CG1 . VAL A 1 195 ? 52.575  110.278 -1.366  1.00 17.60  ? 196 VAL S CG1 1 
ATOM   1562  C CG2 . VAL A 1 195 ? 51.442  109.000 0.419   1.00 17.60  ? 196 VAL S CG2 1 
ATOM   1563  N N   . VAL A 1 196 ? 54.240  108.336 -2.523  1.00 2.00   ? 197 VAL S N   1 
ATOM   1564  C CA  . VAL A 1 196 ? 54.170  107.768 -3.835  1.00 2.00   ? 197 VAL S CA  1 
ATOM   1565  C C   . VAL A 1 196 ? 54.976  106.492 -3.986  1.00 2.00   ? 197 VAL S C   1 
ATOM   1566  O O   . VAL A 1 196 ? 54.699  105.700 -4.877  1.00 13.12  ? 197 VAL S O   1 
ATOM   1567  C CB  . VAL A 1 196 ? 54.638  108.776 -4.881  1.00 13.12  ? 197 VAL S CB  1 
ATOM   1568  C CG1 . VAL A 1 196 ? 54.642  108.133 -6.267  1.00 13.12  ? 197 VAL S CG1 1 
ATOM   1569  C CG2 . VAL A 1 196 ? 53.734  109.985 -4.864  1.00 13.12  ? 197 VAL S CG2 1 
ATOM   1570  N N   . ALA A 1 197 ? 55.962  106.264 -3.129  1.00 61.77  ? 198 ALA S N   1 
ATOM   1571  C CA  . ALA A 1 197 ? 56.771  105.055 -3.285  1.00 61.77  ? 198 ALA S CA  1 
ATOM   1572  C C   . ALA A 1 197 ? 56.797  104.142 -2.083  1.00 61.77  ? 198 ALA S C   1 
ATOM   1573  O O   . ALA A 1 197 ? 57.299  103.029 -2.162  1.00 15.36  ? 198 ALA S O   1 
ATOM   1574  C CB  . ALA A 1 197 ? 58.206  105.428 -3.676  1.00 15.36  ? 198 ALA S CB  1 
ATOM   1575  N N   . SER A 1 198 ? 56.255  104.613 -0.970  1.00 26.52  ? 199 SER S N   1 
ATOM   1576  C CA  . SER A 1 198 ? 56.237  103.822 0.250   1.00 26.52  ? 199 SER S CA  1 
ATOM   1577  C C   . SER A 1 198 ? 55.365  102.595 0.109   1.00 26.52  ? 199 SER S C   1 
ATOM   1578  O O   . SER A 1 198 ? 54.613  102.462 -0.853  1.00 33.32  ? 199 SER S O   1 
ATOM   1579  C CB  . SER A 1 198 ? 55.704  104.661 1.408   1.00 33.32  ? 199 SER S CB  1 
ATOM   1580  O OG  . SER A 1 198 ? 54.332  104.396 1.652   1.00 33.32  ? 199 SER S OG  1 
ATOM   1581  N N   . SER A 1 199 ? 55.482  101.686 1.064   1.00 47.38  ? 200 SER S N   1 
ATOM   1582  C CA  . SER A 1 199 ? 54.634  100.508 1.053   1.00 47.38  ? 200 SER S CA  1 
ATOM   1583  C C   . SER A 1 199 ? 53.582  100.813 2.112   1.00 47.38  ? 200 SER S C   1 
ATOM   1584  O O   . SER A 1 199 ? 53.867  101.479 3.120   1.00 67.74  ? 200 SER S O   1 
ATOM   1585  C CB  . SER A 1 199 ? 55.419  99.246  1.409   1.00 67.74  ? 200 SER S CB  1 
ATOM   1586  O OG  . SER A 1 199 ? 54.853  98.123  0.751   1.00 67.74  ? 200 SER S OG  1 
ATOM   1587  N N   . HIS A 1 200 ? 52.366  100.332 1.887   1.00 100.00 ? 201 HIS S N   1 
ATOM   1588  C CA  . HIS A 1 200 ? 51.255  100.598 2.796   1.00 100.00 ? 201 HIS S CA  1 
ATOM   1589  C C   . HIS A 1 200 ? 50.878  99.431  3.707   1.00 100.00 ? 201 HIS S C   1 
ATOM   1590  O O   . HIS A 1 200 ? 51.166  98.268  3.401   1.00 100.00 ? 201 HIS S O   1 
ATOM   1591  C CB  . HIS A 1 200 ? 50.037  101.002 1.965   1.00 100.00 ? 201 HIS S CB  1 
ATOM   1592  C CG  . HIS A 1 200 ? 50.019  100.378 0.601   1.00 100.00 ? 201 HIS S CG  1 
ATOM   1593  N ND1 . HIS A 1 200 ? 49.965  101.122 -0.558  1.00 100.00 ? 201 HIS S ND1 1 
ATOM   1594  C CD2 . HIS A 1 200 ? 50.083  99.081  0.214   1.00 100.00 ? 201 HIS S CD2 1 
ATOM   1595  C CE1 . HIS A 1 200 ? 49.997  100.310 -1.601  1.00 100.00 ? 201 HIS S CE1 1 
ATOM   1596  N NE2 . HIS A 1 200 ? 50.069  99.066  -1.160  1.00 100.00 ? 201 HIS S NE2 1 
ATOM   1597  N N   . LYS A 1 201 ? 50.237  99.759  4.831   1.00 100.00 ? 202 LYS S N   1 
ATOM   1598  C CA  . LYS A 1 201 ? 49.766  98.762  5.799   1.00 100.00 ? 202 LYS S CA  1 
ATOM   1599  C C   . LYS A 1 201 ? 48.363  98.347  5.337   1.00 100.00 ? 202 LYS S C   1 
ATOM   1600  O O   . LYS A 1 201 ? 47.448  98.119  6.143   1.00 100.00 ? 202 LYS S O   1 
ATOM   1601  C CB  . LYS A 1 201 ? 49.698  99.377  7.205   1.00 100.00 ? 202 LYS S CB  1 
ATOM   1602  C CG  . LYS A 1 201 ? 49.305  98.396  8.319   1.00 100.00 ? 202 LYS S CG  1 
ATOM   1603  C CD  . LYS A 1 201 ? 50.188  98.575  9.560   1.00 100.00 ? 202 LYS S CD  1 
ATOM   1604  C CE  . LYS A 1 201 ? 49.519  98.010  10.820  1.00 100.00 ? 202 LYS S CE  1 
ATOM   1605  N NZ  . LYS A 1 201 ? 50.458  97.910  11.992  1.00 100.00 ? 202 LYS S NZ  1 
ATOM   1606  N N   . GLY A 1 202 ? 48.221  98.245  4.015   1.00 100.00 ? 203 GLY S N   1 
ATOM   1607  C CA  . GLY A 1 202 ? 46.947  97.902  3.411   1.00 100.00 ? 203 GLY S CA  1 
ATOM   1608  C C   . GLY A 1 202 ? 46.300  99.221  3.040   1.00 100.00 ? 203 GLY S C   1 
ATOM   1609  O O   . GLY A 1 202 ? 46.851  99.998  2.245   1.00 23.74  ? 203 GLY S O   1 
ATOM   1610  N N   . LYS A 1 203 ? 45.141  99.489  3.638   1.00 89.24  ? 204 LYS S N   1 
ATOM   1611  C CA  . LYS A 1 203 ? 44.411  100.729 3.388   1.00 89.24  ? 204 LYS S CA  1 
ATOM   1612  C C   . LYS A 1 203 ? 43.946  100.814 1.935   1.00 89.24  ? 204 LYS S C   1 
ATOM   1613  O O   . LYS A 1 203 ? 44.231  101.835 1.271   1.00 99.39  ? 204 LYS S O   1 
ATOM   1614  C CB  . LYS A 1 203 ? 45.297  101.940 3.736   1.00 99.39  ? 204 LYS S CB  1 
ATOM   1615  C CG  . LYS A 1 203 ? 46.147  101.770 5.002   1.00 99.39  ? 204 LYS S CG  1 
ATOM   1616  C CD  . LYS A 1 203 ? 45.284  101.753 6.271   1.00 99.39  ? 204 LYS S CD  1 
ATOM   1617  C CE  . LYS A 1 203 ? 46.137  101.679 7.546   1.00 99.39  ? 204 LYS S CE  1 
ATOM   1618  N NZ  . LYS A 1 203 ? 46.007  102.898 8.410   1.00 99.39  ? 204 LYS S NZ  1 
ATOM   1619  N N   . GLN A 1 210 ? 43.555  114.539 1.488   1.00 100.00 ? 211 GLN S N   1 
ATOM   1620  C CA  . GLN A 1 210 ? 43.236  115.979 1.742   1.00 100.00 ? 211 GLN S CA  1 
ATOM   1621  C C   . GLN A 1 210 ? 44.465  116.674 2.307   1.00 100.00 ? 211 GLN S C   1 
ATOM   1622  O O   . GLN A 1 210 ? 44.767  116.570 3.498   1.00 100.00 ? 211 GLN S O   1 
ATOM   1623  C CB  . GLN A 1 210 ? 42.071  116.112 2.730   1.00 100.00 ? 211 GLN S CB  1 
ATOM   1624  C CG  . GLN A 1 210 ? 41.596  114.790 3.330   1.00 100.00 ? 211 GLN S CG  1 
ATOM   1625  C CD  . GLN A 1 210 ? 40.864  114.965 4.657   1.00 100.00 ? 211 GLN S CD  1 
ATOM   1626  O OE1 . GLN A 1 210 ? 40.854  116.056 5.246   1.00 100.00 ? 211 GLN S OE1 1 
ATOM   1627  N NE2 . GLN A 1 210 ? 40.245  113.885 5.132   1.00 100.00 ? 211 GLN S NE2 1 
ATOM   1628  N N   . GLY A 1 211 ? 45.166  117.402 1.449   1.00 75.90  ? 212 GLY S N   1 
ATOM   1629  C CA  . GLY A 1 211 ? 46.365  118.060 1.905   1.00 75.90  ? 212 GLY S CA  1 
ATOM   1630  C C   . GLY A 1 211 ? 47.207  116.957 2.501   1.00 75.90  ? 212 GLY S C   1 
ATOM   1631  O O   . GLY A 1 211 ? 47.294  115.858 1.933   1.00 2.00   ? 212 GLY S O   1 
ATOM   1632  N N   . PRO A 1 212 ? 47.808  117.200 3.667   1.00 45.55  ? 213 PRO S N   1 
ATOM   1633  C CA  . PRO A 1 212 ? 48.659  116.220 4.358   1.00 45.55  ? 213 PRO S CA  1 
ATOM   1634  C C   . PRO A 1 212 ? 47.942  114.982 4.900   1.00 45.55  ? 213 PRO S C   1 
ATOM   1635  O O   . PRO A 1 212 ? 48.585  114.028 5.337   1.00 100.00 ? 213 PRO S O   1 
ATOM   1636  C CB  . PRO A 1 212 ? 49.315  117.037 5.470   1.00 100.00 ? 213 PRO S CB  1 
ATOM   1637  C CG  . PRO A 1 212 ? 48.352  118.163 5.724   1.00 100.00 ? 213 PRO S CG  1 
ATOM   1638  C CD  . PRO A 1 212 ? 47.706  118.473 4.403   1.00 100.00 ? 213 PRO S CD  1 
ATOM   1639  N N   . SER A 1 213 ? 46.613  115.000 4.862   1.00 100.00 ? 214 SER S N   1 
ATOM   1640  C CA  . SER A 1 213 ? 45.818  113.881 5.360   1.00 100.00 ? 214 SER S CA  1 
ATOM   1641  C C   . SER A 1 213 ? 46.142  112.554 4.666   1.00 100.00 ? 214 SER S C   1 
ATOM   1642  O O   . SER A 1 213 ? 45.773  112.335 3.506   1.00 100.00 ? 214 SER S O   1 
ATOM   1643  C CB  . SER A 1 213 ? 44.327  114.200 5.213   1.00 100.00 ? 214 SER S CB  1 
ATOM   1644  O OG  . SER A 1 213 ? 43.957  115.283 6.054   1.00 100.00 ? 214 SER S OG  1 
ATOM   1645  N N   . PHE A 1 214 ? 46.826  111.673 5.400   1.00 100.00 ? 215 PHE S N   1 
ATOM   1646  C CA  . PHE A 1 214 ? 47.239  110.359 4.902   1.00 100.00 ? 215 PHE S CA  1 
ATOM   1647  C C   . PHE A 1 214 ? 48.097  109.613 5.934   1.00 100.00 ? 215 PHE S C   1 
ATOM   1648  O O   . PHE A 1 214 ? 49.013  110.189 6.525   1.00 100.00 ? 215 PHE S O   1 
ATOM   1649  C CB  . PHE A 1 214 ? 48.058  110.523 3.623   1.00 100.00 ? 215 PHE S CB  1 
ATOM   1650  C CG  . PHE A 1 214 ? 48.103  109.296 2.761   1.00 100.00 ? 215 PHE S CG  1 
ATOM   1651  C CD1 . PHE A 1 214 ? 48.622  108.103 3.254   1.00 100.00 ? 215 PHE S CD1 1 
ATOM   1652  C CD2 . PHE A 1 214 ? 47.630  109.337 1.452   1.00 100.00 ? 215 PHE S CD2 1 
ATOM   1653  C CE1 . PHE A 1 214 ? 48.668  106.966 2.460   1.00 100.00 ? 215 PHE S CE1 1 
ATOM   1654  C CE2 . PHE A 1 214 ? 47.672  108.207 0.646   1.00 100.00 ? 215 PHE S CE2 1 
ATOM   1655  C CZ  . PHE A 1 214 ? 48.194  107.015 1.154   1.00 100.00 ? 215 PHE S CZ  1 
ATOM   1656  N N   . SER A 1 215 ? 47.807  108.334 6.148   1.00 98.45  ? 216 SER S N   1 
ATOM   1657  C CA  . SER A 1 215 ? 48.584  107.541 7.092   1.00 98.45  ? 216 SER S CA  1 
ATOM   1658  C C   . SER A 1 215 ? 49.685  106.830 6.316   1.00 98.45  ? 216 SER S C   1 
ATOM   1659  O O   . SER A 1 215 ? 49.419  105.894 5.554   1.00 100.00 ? 216 SER S O   1 
ATOM   1660  C CB  . SER A 1 215 ? 47.689  106.522 7.815   1.00 100.00 ? 216 SER S CB  1 
ATOM   1661  O OG  . SER A 1 215 ? 47.911  105.197 7.355   1.00 100.00 ? 216 SER S OG  1 
ATOM   1662  N N   . TYR A 1 216 ? 50.921  107.292 6.506   1.00 100.00 ? 217 TYR S N   1 
ATOM   1663  C CA  . TYR A 1 216 ? 52.080  106.719 5.820   1.00 100.00 ? 217 TYR S CA  1 
ATOM   1664  C C   . TYR A 1 216 ? 52.573  105.440 6.489   1.00 100.00 ? 217 TYR S C   1 
ATOM   1665  O O   . TYR A 1 216 ? 52.063  105.043 7.540   1.00 63.40  ? 217 TYR S O   1 
ATOM   1666  C CB  . TYR A 1 216 ? 53.226  107.733 5.768   1.00 63.40  ? 217 TYR S CB  1 
ATOM   1667  C CG  . TYR A 1 216 ? 52.808  109.102 5.306   1.00 63.40  ? 217 TYR S CG  1 
ATOM   1668  C CD1 . TYR A 1 216 ? 52.134  109.957 6.163   1.00 63.40  ? 217 TYR S CD1 1 
ATOM   1669  C CD2 . TYR A 1 216 ? 53.092  109.545 4.013   1.00 63.40  ? 217 TYR S CD2 1 
ATOM   1670  C CE1 . TYR A 1 216 ? 51.756  111.222 5.746   1.00 63.40  ? 217 TYR S CE1 1 
ATOM   1671  C CE2 . TYR A 1 216 ? 52.718  110.807 3.586   1.00 63.40  ? 217 TYR S CE2 1 
ATOM   1672  C CZ  . TYR A 1 216 ? 52.053  111.645 4.453   1.00 63.40  ? 217 TYR S CZ  1 
ATOM   1673  O OH  . TYR A 1 216 ? 51.696  112.917 4.045   1.00 63.40  ? 217 TYR S OH  1 
ATOM   1674  N N   . GLY A 1 217 ? 53.564  104.801 5.867   1.00 100.00 ? 218 GLY S N   1 
ATOM   1675  C CA  . GLY A 1 217 ? 54.125  103.582 6.420   1.00 100.00 ? 218 GLY S CA  1 
ATOM   1676  C C   . GLY A 1 217 ? 54.719  103.866 7.786   1.00 100.00 ? 218 GLY S C   1 
ATOM   1677  O O   . GLY A 1 217 ? 54.511  104.937 8.352   1.00 2.00   ? 218 GLY S O   1 
ATOM   1678  N N   . GLU A 1 218 ? 55.472  102.915 8.323   1.00 77.51  ? 219 GLU S N   1 
ATOM   1679  C CA  . GLU A 1 218 ? 56.066  103.090 9.642   1.00 77.51  ? 219 GLU S CA  1 
ATOM   1680  C C   . GLU A 1 218 ? 57.396  103.836 9.567   1.00 77.51  ? 219 GLU S C   1 
ATOM   1681  O O   . GLU A 1 218 ? 57.704  104.669 10.416  1.00 91.54  ? 219 GLU S O   1 
ATOM   1682  C CB  . GLU A 1 218 ? 56.259  101.719 10.308  1.00 91.54  ? 219 GLU S CB  1 
ATOM   1683  C CG  . GLU A 1 218 ? 54.948  100.977 10.640  1.00 91.54  ? 219 GLU S CG  1 
ATOM   1684  C CD  . GLU A 1 218 ? 54.503  99.999  9.551   1.00 91.54  ? 219 GLU S CD  1 
ATOM   1685  O OE1 . GLU A 1 218 ? 55.378  99.404  8.882   1.00 91.54  ? 219 GLU S OE1 1 
ATOM   1686  O OE2 . GLU A 1 218 ? 53.275  99.828  9.364   1.00 91.54  ? 219 GLU S OE2 1 
ATOM   1687  N N   . LEU A 1 219 ? 58.171  103.527 8.540   1.00 100.00 ? 220 LEU S N   1 
ATOM   1688  C CA  . LEU A 1 219 ? 59.480  104.158 8.356   1.00 100.00 ? 220 LEU S CA  1 
ATOM   1689  C C   . LEU A 1 219 ? 59.343  105.512 7.667   1.00 100.00 ? 220 LEU S C   1 
ATOM   1690  O O   . LEU A 1 219 ? 60.046  106.450 8.017   1.00 25.48  ? 220 LEU S O   1 
ATOM   1691  C CB  . LEU A 1 219 ? 60.393  103.235 7.541   1.00 25.48  ? 220 LEU S CB  1 
ATOM   1692  C CG  . LEU A 1 219 ? 61.865  103.640 7.453   1.00 25.48  ? 220 LEU S CG  1 
ATOM   1693  C CD1 . LEU A 1 219 ? 62.555  103.442 8.793   1.00 25.48  ? 220 LEU S CD1 1 
ATOM   1694  C CD2 . LEU A 1 219 ? 62.573  102.849 6.364   1.00 25.48  ? 220 LEU S CD2 1 
ATOM   1695  N N   . GLU A 1 220 ? 58.451  105.578 6.687   1.00 42.80  ? 221 GLU S N   1 
ATOM   1696  C CA  . GLU A 1 220 ? 58.227  106.817 5.958   1.00 42.80  ? 221 GLU S CA  1 
ATOM   1697  C C   . GLU A 1 220 ? 57.760  107.864 6.954   1.00 42.80  ? 221 GLU S C   1 
ATOM   1698  O O   . GLU A 1 220 ? 57.879  109.071 6.726   1.00 64.30  ? 221 GLU S O   1 
ATOM   1699  C CB  . GLU A 1 220 ? 57.179  106.583 4.882   1.00 64.30  ? 221 GLU S CB  1 
ATOM   1700  C CG  . GLU A 1 220 ? 57.574  105.488 3.906   1.00 64.30  ? 221 GLU S CG  1 
ATOM   1701  C CD  . GLU A 1 220 ? 57.146  104.102 4.361   1.00 64.30  ? 221 GLU S CD  1 
ATOM   1702  O OE1 . GLU A 1 220 ? 56.722  103.975 5.528   1.00 64.30  ? 221 GLU S OE1 1 
ATOM   1703  O OE2 . GLU A 1 220 ? 57.235  103.144 3.557   1.00 64.30  ? 221 GLU S OE2 1 
ATOM   1704  N N   . LYS A 1 221 ? 57.237  107.376 8.074   1.00 32.31  ? 222 LYS S N   1 
ATOM   1705  C CA  . LYS A 1 221 ? 56.767  108.232 9.157   1.00 32.31  ? 222 LYS S CA  1 
ATOM   1706  C C   . LYS A 1 221 ? 57.961  108.999 9.681   1.00 32.31  ? 222 LYS S C   1 
ATOM   1707  O O   . LYS A 1 221 ? 57.935  110.217 9.810   1.00 100.00 ? 222 LYS S O   1 
ATOM   1708  C CB  . LYS A 1 221 ? 56.182  107.375 10.277  1.00 100.00 ? 222 LYS S CB  1 
ATOM   1709  C CG  . LYS A 1 221 ? 54.873  107.895 10.851  1.00 100.00 ? 222 LYS S CG  1 
ATOM   1710  C CD  . LYS A 1 221 ? 53.867  106.764 11.036  1.00 100.00 ? 222 LYS S CD  1 
ATOM   1711  C CE  . LYS A 1 221 ? 52.438  107.242 10.783  1.00 100.00 ? 222 LYS S CE  1 
ATOM   1712  N NZ  . LYS A 1 221 ? 52.049  107.195 9.339   1.00 100.00 ? 222 LYS S NZ  1 
ATOM   1713  N N   . GLN A 1 222 ? 59.012  108.248 9.983   1.00 11.62  ? 223 GLN S N   1 
ATOM   1714  C CA  . GLN A 1 222 ? 60.259  108.814 10.478  1.00 11.62  ? 223 GLN S CA  1 
ATOM   1715  C C   . GLN A 1 222 ? 61.000  109.608 9.389   1.00 11.62  ? 223 GLN S C   1 
ATOM   1716  O O   . GLN A 1 222 ? 61.425  110.739 9.620   1.00 45.97  ? 223 GLN S O   1 
ATOM   1717  C CB  . GLN A 1 222 ? 61.167  107.695 10.986  1.00 45.97  ? 223 GLN S CB  1 
ATOM   1718  C CG  . GLN A 1 222 ? 61.010  107.381 12.449  1.00 45.97  ? 223 GLN S CG  1 
ATOM   1719  C CD  . GLN A 1 222 ? 61.200  105.913 12.746  1.00 45.97  ? 223 GLN S CD  1 
ATOM   1720  O OE1 . GLN A 1 222 ? 60.609  105.383 13.691  1.00 45.97  ? 223 GLN S OE1 1 
ATOM   1721  N NE2 . GLN A 1 222 ? 62.027  105.240 11.941  1.00 45.97  ? 223 GLN S NE2 1 
ATOM   1722  N N   . LEU A 1 223 ? 61.156  108.998 8.208   1.00 25.88  ? 224 LEU S N   1 
ATOM   1723  C CA  . LEU A 1 223 ? 61.844  109.633 7.088   1.00 25.88  ? 224 LEU S CA  1 
ATOM   1724  C C   . LEU A 1 223 ? 61.344  111.067 6.963   1.00 25.88  ? 224 LEU S C   1 
ATOM   1725  O O   . LEU A 1 223 ? 62.065  111.978 6.514   1.00 2.00   ? 224 LEU S O   1 
ATOM   1726  C CB  . LEU A 1 223 ? 61.580  108.844 5.792   1.00 2.00   ? 224 LEU S CB  1 
ATOM   1727  C CG  . LEU A 1 223 ? 62.059  109.464 4.466   1.00 2.00   ? 224 LEU S CG  1 
ATOM   1728  C CD1 . LEU A 1 223 ? 63.423  110.155 4.602   1.00 2.00   ? 224 LEU S CD1 1 
ATOM   1729  C CD2 . LEU A 1 223 ? 62.127  108.378 3.442   1.00 2.00   ? 224 LEU S CD2 1 
ATOM   1730  N N   . LEU A 1 224 ? 60.107  111.262 7.404   1.00 28.20  ? 225 LEU S N   1 
ATOM   1731  C CA  . LEU A 1 224 ? 59.456  112.564 7.358   1.00 28.20  ? 225 LEU S CA  1 
ATOM   1732  C C   . LEU A 1 224 ? 59.823  113.500 8.510   1.00 28.20  ? 225 LEU S C   1 
ATOM   1733  O O   . LEU A 1 224 ? 59.989  114.706 8.316   1.00 35.29  ? 225 LEU S O   1 
ATOM   1734  C CB  . LEU A 1 224 ? 57.941  112.366 7.343   1.00 35.29  ? 225 LEU S CB  1 
ATOM   1735  C CG  . LEU A 1 224 ? 57.179  113.101 6.243   1.00 35.29  ? 225 LEU S CG  1 
ATOM   1736  C CD1 . LEU A 1 224 ? 57.886  112.902 4.903   1.00 35.29  ? 225 LEU S CD1 1 
ATOM   1737  C CD2 . LEU A 1 224 ? 55.746  112.578 6.199   1.00 35.29  ? 225 LEU S CD2 1 
ATOM   1738  N N   . GLN A 1 225 ? 59.942  112.929 9.706   1.00 98.31  ? 226 GLN S N   1 
ATOM   1739  C CA  . GLN A 1 225 ? 60.265  113.685 10.910  1.00 98.31  ? 226 GLN S CA  1 
ATOM   1740  C C   . GLN A 1 225 ? 61.754  113.954 11.139  1.00 98.31  ? 226 GLN S C   1 
ATOM   1741  O O   . GLN A 1 225 ? 62.120  114.608 12.117  1.00 100.00 ? 226 GLN S O   1 
ATOM   1742  C CB  . GLN A 1 225 ? 59.695  112.962 12.132  1.00 100.00 ? 226 GLN S CB  1 
ATOM   1743  C CG  . GLN A 1 225 ? 58.916  113.857 13.077  1.00 100.00 ? 226 GLN S CG  1 
ATOM   1744  C CD  . GLN A 1 225 ? 57.820  114.640 12.375  1.00 100.00 ? 226 GLN S CD  1 
ATOM   1745  O OE1 . GLN A 1 225 ? 57.520  115.776 12.741  1.00 100.00 ? 226 GLN S OE1 1 
ATOM   1746  N NE2 . GLN A 1 225 ? 57.214  114.031 11.363  1.00 100.00 ? 226 GLN S NE2 1 
ATOM   1747  N N   . ALA A 1 226 ? 62.607  113.468 10.239  1.00 8.93   ? 227 ALA S N   1 
ATOM   1748  C CA  . ALA A 1 226 ? 64.058  113.653 10.359  1.00 8.93   ? 227 ALA S CA  1 
ATOM   1749  C C   . ALA A 1 226 ? 64.489  115.082 10.080  1.00 8.93   ? 227 ALA S C   1 
ATOM   1750  O O   . ALA A 1 226 ? 65.011  115.754 10.956  1.00 45.87  ? 227 ALA S O   1 
ATOM   1751  C CB  . ALA A 1 226 ? 64.794  112.691 9.419   1.00 45.87  ? 227 ALA S CB  1 
ATOM   1752  N N   . ASN A 1 227 ? 64.284  115.531 8.853   1.00 17.54  ? 228 ASN S N   1 
ATOM   1753  C CA  . ASN A 1 227 ? 64.625  116.897 8.456   1.00 17.54  ? 228 ASN S CA  1 
ATOM   1754  C C   . ASN A 1 227 ? 64.180  117.990 9.448   1.00 17.54  ? 228 ASN S C   1 
ATOM   1755  O O   . ASN A 1 227 ? 64.849  119.015 9.589   1.00 17.63  ? 228 ASN S O   1 
ATOM   1756  C CB  . ASN A 1 227 ? 64.036  117.188 7.077   1.00 17.63  ? 228 ASN S CB  1 
ATOM   1757  C CG  . ASN A 1 227 ? 65.077  117.647 6.098   1.00 17.63  ? 228 ASN S CG  1 
ATOM   1758  O OD1 . ASN A 1 227 ? 65.590  118.769 6.204   1.00 17.63  ? 228 ASN S OD1 1 
ATOM   1759  N ND2 . ASN A 1 227 ? 65.415  116.785 5.139   1.00 17.63  ? 228 ASN S ND2 1 
ATOM   1760  N N   . PRO A 1 228 ? 63.017  117.809 10.110  1.00 44.75  ? 229 PRO S N   1 
ATOM   1761  C CA  . PRO A 1 228 ? 62.575  118.829 11.073  1.00 44.75  ? 229 PRO S CA  1 
ATOM   1762  C C   . PRO A 1 228 ? 63.419  118.809 12.353  1.00 44.75  ? 229 PRO S C   1 
ATOM   1763  O O   . PRO A 1 228 ? 63.294  119.684 13.204  1.00 83.95  ? 229 PRO S O   1 
ATOM   1764  C CB  . PRO A 1 228 ? 61.124  118.454 11.349  1.00 83.95  ? 229 PRO S CB  1 
ATOM   1765  C CG  . PRO A 1 228 ? 61.076  116.991 11.123  1.00 83.95  ? 229 PRO S CG  1 
ATOM   1766  C CD  . PRO A 1 228 ? 62.021  116.731 9.977   1.00 83.95  ? 229 PRO S CD  1 
ATOM   1767  N N   . ILE A 1 229 ? 64.272  117.800 12.488  1.00 35.21  ? 230 ILE S N   1 
ATOM   1768  C CA  . ILE A 1 229 ? 65.153  117.682 13.637  1.00 35.21  ? 230 ILE S CA  1 
ATOM   1769  C C   . ILE A 1 229 ? 66.461  118.396 13.323  1.00 35.21  ? 230 ILE S C   1 
ATOM   1770  O O   . ILE A 1 229 ? 66.808  119.373 13.980  1.00 2.00   ? 230 ILE S O   1 
ATOM   1771  C CB  . ILE A 1 229 ? 65.413  116.217 13.957  1.00 2.00   ? 230 ILE S CB  1 
ATOM   1772  C CG1 . ILE A 1 229 ? 64.466  115.799 15.061  1.00 2.00   ? 230 ILE S CG1 1 
ATOM   1773  C CG2 . ILE A 1 229 ? 66.872  115.981 14.305  1.00 2.00   ? 230 ILE S CG2 1 
ATOM   1774  C CD1 . ILE A 1 229 ? 63.769  114.485 14.784  1.00 2.00   ? 230 ILE S CD1 1 
ATOM   1775  N N   . LEU A 1 230 ? 67.172  117.926 12.308  1.00 6.03   ? 231 LEU S N   1 
ATOM   1776  C CA  . LEU A 1 230 ? 68.432  118.551 11.921  1.00 6.03   ? 231 LEU S CA  1 
ATOM   1777  C C   . LEU A 1 230 ? 68.225  120.039 11.706  1.00 6.03   ? 231 LEU S C   1 
ATOM   1778  O O   . LEU A 1 230 ? 69.170  120.828 11.745  1.00 13.53  ? 231 LEU S O   1 
ATOM   1779  C CB  . LEU A 1 230 ? 68.973  117.943 10.626  1.00 13.53  ? 231 LEU S CB  1 
ATOM   1780  C CG  . LEU A 1 230 ? 68.973  116.419 10.455  1.00 13.53  ? 231 LEU S CG  1 
ATOM   1781  C CD1 . LEU A 1 230 ? 70.070  116.052 9.464   1.00 13.53  ? 231 LEU S CD1 1 
ATOM   1782  C CD2 . LEU A 1 230 ? 69.193  115.713 11.793  1.00 13.53  ? 231 LEU S CD2 1 
ATOM   1783  N N   . GLU A 1 231 ? 66.982  120.425 11.470  1.00 39.67  ? 232 GLU S N   1 
ATOM   1784  C CA  . GLU A 1 231 ? 66.697  121.825 11.235  1.00 39.67  ? 232 GLU S CA  1 
ATOM   1785  C C   . GLU A 1 231 ? 66.849  122.619 12.517  1.00 39.67  ? 232 GLU S C   1 
ATOM   1786  O O   . GLU A 1 231 ? 67.114  123.828 12.489  1.00 54.40  ? 232 GLU S O   1 
ATOM   1787  C CB  . GLU A 1 231 ? 65.286  121.999 10.637  1.00 54.40  ? 232 GLU S CB  1 
ATOM   1788  C CG  . GLU A 1 231 ? 65.272  122.076 9.093   1.00 54.40  ? 232 GLU S CG  1 
ATOM   1789  C CD  . GLU A 1 231 ? 64.062  122.808 8.527   1.00 54.40  ? 232 GLU S CD  1 
ATOM   1790  O OE1 . GLU A 1 231 ? 63.893  124.010 8.820   1.00 54.40  ? 232 GLU S OE1 1 
ATOM   1791  O OE2 . GLU A 1 231 ? 63.283  122.175 7.783   1.00 54.40  ? 232 GLU S OE2 1 
ATOM   1792  N N   . ALA A 1 232 ? 66.684  121.929 13.641  1.00 53.43  ? 233 ALA S N   1 
ATOM   1793  C CA  . ALA A 1 232 ? 66.825  122.562 14.943  1.00 53.43  ? 233 ALA S CA  1 
ATOM   1794  C C   . ALA A 1 232 ? 68.306  122.902 15.143  1.00 53.43  ? 233 ALA S C   1 
ATOM   1795  O O   . ALA A 1 232 ? 68.733  124.039 14.905  1.00 61.36  ? 233 ALA S O   1 
ATOM   1796  C CB  . ALA A 1 232 ? 66.342  121.622 16.035  1.00 61.36  ? 233 ALA S CB  1 
ATOM   1797  N N   . PHE A 1 233 ? 69.093  121.917 15.571  1.00 2.00   ? 234 PHE S N   1 
ATOM   1798  C CA  . PHE A 1 233 ? 70.515  122.136 15.766  1.00 2.00   ? 234 PHE S CA  1 
ATOM   1799  C C   . PHE A 1 233 ? 71.173  122.164 14.390  1.00 2.00   ? 234 PHE S C   1 
ATOM   1800  O O   . PHE A 1 233 ? 71.799  121.196 13.995  1.00 29.13  ? 234 PHE S O   1 
ATOM   1801  C CB  . PHE A 1 233 ? 71.121  120.988 16.567  1.00 29.13  ? 234 PHE S CB  1 
ATOM   1802  C CG  . PHE A 1 233 ? 70.134  120.209 17.404  1.00 29.13  ? 234 PHE S CG  1 
ATOM   1803  C CD1 . PHE A 1 233 ? 69.518  120.803 18.503  1.00 29.13  ? 234 PHE S CD1 1 
ATOM   1804  C CD2 . PHE A 1 233 ? 69.896  118.861 17.150  1.00 29.13  ? 234 PHE S CD2 1 
ATOM   1805  C CE1 . PHE A 1 233 ? 68.687  120.078 19.344  1.00 29.13  ? 234 PHE S CE1 1 
ATOM   1806  C CE2 . PHE A 1 233 ? 69.067  118.116 17.981  1.00 29.13  ? 234 PHE S CE2 1 
ATOM   1807  C CZ  . PHE A 1 233 ? 68.461  118.730 19.085  1.00 29.13  ? 234 PHE S CZ  1 
ATOM   1808  N N   . GLY A 1 234 ? 71.043  123.245 13.643  1.00 2.00   ? 235 GLY S N   1 
ATOM   1809  C CA  . GLY A 1 234 ? 71.656  123.238 12.332  1.00 2.00   ? 235 GLY S CA  1 
ATOM   1810  C C   . GLY A 1 234 ? 71.226  124.393 11.466  1.00 2.00   ? 235 GLY S C   1 
ATOM   1811  O O   . GLY A 1 234 ? 71.928  124.749 10.525  1.00 6.04   ? 235 GLY S O   1 
ATOM   1812  N N   . ASN A 1 235 ? 70.079  124.984 11.782  1.00 2.00   ? 236 ASN S N   1 
ATOM   1813  C CA  . ASN A 1 235 ? 69.549  126.113 11.016  1.00 2.00   ? 236 ASN S CA  1 
ATOM   1814  C C   . ASN A 1 235 ? 69.469  127.344 11.877  1.00 2.00   ? 236 ASN S C   1 
ATOM   1815  O O   . ASN A 1 235 ? 69.215  127.237 13.071  1.00 33.80  ? 236 ASN S O   1 
ATOM   1816  C CB  . ASN A 1 235 ? 68.150  125.794 10.514  1.00 33.80  ? 236 ASN S CB  1 
ATOM   1817  C CG  . ASN A 1 235 ? 68.153  124.760 9.422   1.00 33.80  ? 236 ASN S CG  1 
ATOM   1818  O OD1 . ASN A 1 235 ? 67.952  123.580 9.688   1.00 33.80  ? 236 ASN S OD1 1 
ATOM   1819  N ND2 . ASN A 1 235 ? 68.379  125.192 8.182   1.00 33.80  ? 236 ASN S ND2 1 
ATOM   1820  N N   . ALA A 1 236 ? 69.647  128.518 11.280  1.00 19.58  ? 237 ALA S N   1 
ATOM   1821  C CA  . ALA A 1 236 ? 69.576  129.749 12.060  1.00 19.58  ? 237 ALA S CA  1 
ATOM   1822  C C   . ALA A 1 236 ? 69.398  131.029 11.251  1.00 19.58  ? 237 ALA S C   1 
ATOM   1823  O O   . ALA A 1 236 ? 69.900  131.147 10.136  1.00 44.83  ? 237 ALA S O   1 
ATOM   1824  C CB  . ALA A 1 236 ? 70.804  129.863 12.934  1.00 44.83  ? 237 ALA S CB  1 
ATOM   1825  N N   . LYS A 1 237 ? 68.697  131.992 11.851  1.00 2.00   ? 238 LYS S N   1 
ATOM   1826  C CA  . LYS A 1 237 ? 68.390  133.267 11.211  1.00 2.00   ? 238 LYS S CA  1 
ATOM   1827  C C   . LYS A 1 237 ? 69.567  134.075 10.739  1.00 2.00   ? 238 LYS S C   1 
ATOM   1828  O O   . LYS A 1 237 ? 70.475  134.362 11.490  1.00 6.27   ? 238 LYS S O   1 
ATOM   1829  C CB  . LYS A 1 237 ? 67.532  134.134 12.131  1.00 6.27   ? 238 LYS S CB  1 
ATOM   1830  C CG  . LYS A 1 237 ? 67.783  135.630 11.999  1.00 6.27   ? 238 LYS S CG  1 
ATOM   1831  C CD  . LYS A 1 237 ? 66.501  136.376 11.703  1.00 6.27   ? 238 LYS S CD  1 
ATOM   1832  C CE  . LYS A 1 237 ? 66.792  137.631 10.875  1.00 6.27   ? 238 LYS S CE  1 
ATOM   1833  N NZ  . LYS A 1 237 ? 66.711  137.383 9.389   1.00 6.27   ? 238 LYS S NZ  1 
ATOM   1834  N N   . THR A 1 238 ? 69.532  134.459 9.474   1.00 2.00   ? 239 THR S N   1 
ATOM   1835  C CA  . THR A 1 238 ? 70.593  135.266 8.918   1.00 2.00   ? 239 THR S CA  1 
ATOM   1836  C C   . THR A 1 238 ? 70.045  136.362 8.023   1.00 2.00   ? 239 THR S C   1 
ATOM   1837  O O   . THR A 1 238 ? 68.894  136.322 7.598   1.00 18.66  ? 239 THR S O   1 
ATOM   1838  C CB  . THR A 1 238 ? 71.582  134.419 8.135   1.00 18.66  ? 239 THR S CB  1 
ATOM   1839  O OG1 . THR A 1 238 ? 71.497  134.751 6.751   1.00 18.66  ? 239 THR S OG1 1 
ATOM   1840  C CG2 . THR A 1 238 ? 71.285  132.950 8.338   1.00 18.66  ? 239 THR S CG2 1 
ATOM   1841  N N   . VAL A 1 239 ? 70.889  137.351 7.757   1.00 2.00   ? 240 VAL S N   1 
ATOM   1842  C CA  . VAL A 1 239 ? 70.536  138.512 6.947   1.00 2.00   ? 240 VAL S CA  1 
ATOM   1843  C C   . VAL A 1 239 ? 70.050  138.117 5.566   1.00 2.00   ? 240 VAL S C   1 
ATOM   1844  O O   . VAL A 1 239 ? 69.746  138.973 4.740   1.00 71.06  ? 240 VAL S O   1 
ATOM   1845  C CB  . VAL A 1 239 ? 71.743  139.450 6.806   1.00 71.06  ? 240 VAL S CB  1 
ATOM   1846  C CG1 . VAL A 1 239 ? 72.274  139.816 8.182   1.00 71.06  ? 240 VAL S CG1 1 
ATOM   1847  C CG2 . VAL A 1 239 ? 72.833  138.772 5.993   1.00 71.06  ? 240 VAL S CG2 1 
ATOM   1848  N N   . LYS A 1 240 ? 69.981  136.819 5.313   1.00 15.31  ? 241 LYS S N   1 
ATOM   1849  C CA  . LYS A 1 240 ? 69.521  136.335 4.028   1.00 15.31  ? 241 LYS S CA  1 
ATOM   1850  C C   . LYS A 1 240 ? 68.378  135.318 4.195   1.00 15.31  ? 241 LYS S C   1 
ATOM   1851  O O   . LYS A 1 240 ? 67.651  135.028 3.246   1.00 27.15  ? 241 LYS S O   1 
ATOM   1852  C CB  . LYS A 1 240 ? 70.692  135.716 3.275   1.00 27.15  ? 241 LYS S CB  1 
ATOM   1853  C CG  . LYS A 1 240 ? 71.852  136.651 3.110   1.00 27.15  ? 241 LYS S CG  1 
ATOM   1854  C CD  . LYS A 1 240 ? 72.538  136.407 1.795   1.00 27.15  ? 241 LYS S CD  1 
ATOM   1855  C CE  . LYS A 1 240 ? 73.268  137.656 1.275   1.00 27.15  ? 241 LYS S CE  1 
ATOM   1856  N NZ  . LYS A 1 240 ? 73.824  137.431 -0.132  1.00 27.15  ? 241 LYS S NZ  1 
ATOM   1857  N N   . ASN A 1 241 ? 68.203  134.780 5.399   1.00 6.46   ? 242 ASN S N   1 
ATOM   1858  C CA  . ASN A 1 241 ? 67.142  133.810 5.614   1.00 6.46   ? 242 ASN S CA  1 
ATOM   1859  C C   . ASN A 1 241 ? 66.851  133.466 7.070   1.00 6.46   ? 242 ASN S C   1 
ATOM   1860  O O   . ASN A 1 241 ? 67.664  132.867 7.754   1.00 25.13  ? 242 ASN S O   1 
ATOM   1861  C CB  . ASN A 1 241 ? 67.454  132.530 4.853   1.00 25.13  ? 242 ASN S CB  1 
ATOM   1862  C CG  . ASN A 1 241 ? 66.662  131.360 5.369   1.00 25.13  ? 242 ASN S CG  1 
ATOM   1863  O OD1 . ASN A 1 241 ? 65.785  131.510 6.221   1.00 25.13  ? 242 ASN S OD1 1 
ATOM   1864  N ND2 . ASN A 1 241 ? 66.963  130.180 4.859   1.00 25.13  ? 242 ASN S ND2 1 
ATOM   1865  N N   . ASP A 1 242 ? 65.652  133.823 7.505   1.00 2.00   ? 243 ASP S N   1 
ATOM   1866  C CA  . ASP A 1 242 ? 65.176  133.563 8.857   1.00 2.00   ? 243 ASP S CA  1 
ATOM   1867  C C   . ASP A 1 242 ? 65.431  132.127 9.318   1.00 2.00   ? 243 ASP S C   1 
ATOM   1868  O O   . ASP A 1 242 ? 65.621  131.885 10.509  1.00 82.58  ? 243 ASP S O   1 
ATOM   1869  C CB  . ASP A 1 242 ? 63.675  133.860 8.952   1.00 82.58  ? 243 ASP S CB  1 
ATOM   1870  C CG  . ASP A 1 242 ? 63.316  135.228 8.414   1.00 82.58  ? 243 ASP S CG  1 
ATOM   1871  O OD1 . ASP A 1 242 ? 64.100  136.174 8.630   1.00 82.58  ? 243 ASP S OD1 1 
ATOM   1872  O OD2 . ASP A 1 242 ? 62.247  135.345 7.779   1.00 82.58  ? 243 ASP S OD2 1 
ATOM   1873  N N   . ASN A 1 243 ? 65.399  131.172 8.403   1.00 2.46   ? 244 ASN S N   1 
ATOM   1874  C CA  . ASN A 1 243 ? 65.668  129.794 8.771   1.00 2.46   ? 244 ASN S CA  1 
ATOM   1875  C C   . ASN A 1 243 ? 66.633  129.197 7.766   1.00 2.46   ? 244 ASN S C   1 
ATOM   1876  O O   . ASN A 1 243 ? 66.267  128.333 6.956   1.00 2.00   ? 244 ASN S O   1 
ATOM   1877  C CB  . ASN A 1 243 ? 64.406  128.961 8.789   1.00 2.00   ? 244 ASN S CB  1 
ATOM   1878  C CG  . ASN A 1 243 ? 64.704  127.477 8.826   1.00 2.00   ? 244 ASN S CG  1 
ATOM   1879  O OD1 . ASN A 1 243 ? 64.803  126.902 9.899   1.00 2.00   ? 244 ASN S OD1 1 
ATOM   1880  N ND2 . ASN A 1 243 ? 64.854  126.851 7.662   1.00 2.00   ? 244 ASN S ND2 1 
ATOM   1881  N N   . SER A 1 244 ? 67.880  129.662 7.819   1.00 47.78  ? 245 SER S N   1 
ATOM   1882  C CA  . SER A 1 244 ? 68.900  129.196 6.901   1.00 47.78  ? 245 SER S CA  1 
ATOM   1883  C C   . SER A 1 244 ? 69.517  127.895 7.307   1.00 47.78  ? 245 SER S C   1 
ATOM   1884  O O   . SER A 1 244 ? 69.720  127.635 8.491   1.00 26.28  ? 245 SER S O   1 
ATOM   1885  C CB  . SER A 1 244 ? 70.013  130.225 6.755   1.00 26.28  ? 245 SER S CB  1 
ATOM   1886  O OG  . SER A 1 244 ? 70.816  129.908 5.632   1.00 26.28  ? 245 SER S OG  1 
ATOM   1887  N N   . SER A 1 245 ? 69.799  127.082 6.296   1.00 45.73  ? 246 SER S N   1 
ATOM   1888  C CA  . SER A 1 245 ? 70.444  125.800 6.496   1.00 45.73  ? 246 SER S CA  1 
ATOM   1889  C C   . SER A 1 245 ? 71.946  126.093 6.688   1.00 45.73  ? 246 SER S C   1 
ATOM   1890  O O   . SER A 1 245 ? 72.640  126.515 5.753   1.00 45.84  ? 246 SER S O   1 
ATOM   1891  C CB  . SER A 1 245 ? 70.265  124.920 5.250   1.00 45.84  ? 246 SER S CB  1 
ATOM   1892  O OG  . SER A 1 245 ? 68.921  124.471 5.161   1.00 45.84  ? 246 SER S OG  1 
ATOM   1893  N N   . ARG A 1 246 ? 72.430  125.878 7.900   1.00 21.48  ? 247 ARG S N   1 
ATOM   1894  C CA  . ARG A 1 246 ? 73.832  126.195 8.254   1.00 21.48  ? 247 ARG S CA  1 
ATOM   1895  C C   . ARG A 1 246 ? 74.781  125.011 8.025   1.00 21.48  ? 247 ARG S C   1 
ATOM   1896  O O   . ARG A 1 246 ? 75.755  124.819 8.768   1.00 2.00   ? 247 ARG S O   1 
ATOM   1897  C CB  . ARG A 1 246 ? 73.930  126.579 9.729   1.00 2.00   ? 247 ARG S CB  1 
ATOM   1898  C CG  . ARG A 1 246 ? 74.425  128.012 9.938   1.00 2.00   ? 247 ARG S CG  1 
ATOM   1899  C CD  . ARG A 1 246 ? 73.636  129.037 9.123   1.00 2.00   ? 247 ARG S CD  1 
ATOM   1900  N NE  . ARG A 1 246 ? 74.473  130.118 8.585   1.00 2.00   ? 247 ARG S NE  1 
ATOM   1901  C CZ  . ARG A 1 246 ? 75.076  130.077 7.390   1.00 2.00   ? 247 ARG S CZ  1 
ATOM   1902  N NH1 . ARG A 1 246 ? 74.947  129.011 6.587   1.00 2.00   ? 247 ARG S NH1 1 
ATOM   1903  N NH2 . ARG A 1 246 ? 75.839  131.064 6.899   1.00 2.00   ? 247 ARG S NH2 1 
ATOM   1904  N N   . PHE A 1 247 ? 74.498  124.241 6.994   1.00 3.65   ? 248 PHE S N   1 
ATOM   1905  C CA  . PHE A 1 247 ? 75.318  123.068 6.656   1.00 3.65   ? 248 PHE S CA  1 
ATOM   1906  C C   . PHE A 1 247 ? 74.730  122.316 5.470   1.00 3.65   ? 248 PHE S C   1 
ATOM   1907  O O   . PHE A 1 247 ? 73.525  122.033 5.428   1.00 6.03   ? 248 PHE S O   1 
ATOM   1908  C CB  . PHE A 1 247 ? 75.346  122.093 7.829   1.00 6.03   ? 248 PHE S CB  1 
ATOM   1909  C CG  . PHE A 1 247 ? 73.951  121.584 8.180   1.00 6.03   ? 248 PHE S CG  1 
ATOM   1910  C CD1 . PHE A 1 247 ? 73.430  120.461 7.529   1.00 6.03   ? 248 PHE S CD1 1 
ATOM   1911  C CD2 . PHE A 1 247 ? 73.192  122.251 9.147   1.00 6.03   ? 248 PHE S CD2 1 
ATOM   1912  C CE1 . PHE A 1 247 ? 72.144  120.004 7.842   1.00 6.03   ? 248 PHE S CE1 1 
ATOM   1913  C CE2 . PHE A 1 247 ? 71.905  121.796 9.458   1.00 6.03   ? 248 PHE S CE2 1 
ATOM   1914  C CZ  . PHE A 1 247 ? 71.381  120.673 8.806   1.00 6.03   ? 248 PHE S CZ  1 
ATOM   1915  N N   . GLY A 1 248 ? 75.605  122.011 4.536   1.00 19.77  ? 249 GLY S N   1 
ATOM   1916  C CA  . GLY A 1 248 ? 75.230  121.241 3.352   1.00 19.77  ? 249 GLY S CA  1 
ATOM   1917  C C   . GLY A 1 248 ? 74.651  119.933 3.821   1.00 19.77  ? 249 GLY S C   1 
ATOM   1918  O O   . GLY A 1 248 ? 74.933  119.517 4.937   1.00 9.13   ? 249 GLY S O   1 
ATOM   1919  N N   . LYS A 1 249 ? 73.840  119.298 2.983   1.00 2.00   ? 250 LYS S N   1 
ATOM   1920  C CA  . LYS A 1 249 ? 73.220  118.023 3.320   1.00 2.00   ? 250 LYS S CA  1 
ATOM   1921  C C   . LYS A 1 249 ? 72.887  117.229 2.063   1.00 2.00   ? 250 LYS S C   1 
ATOM   1922  O O   . LYS A 1 249 ? 72.359  117.783 1.115   1.00 5.74   ? 250 LYS S O   1 
ATOM   1923  C CB  . LYS A 1 249 ? 71.959  118.261 4.153   1.00 5.74   ? 250 LYS S CB  1 
ATOM   1924  C CG  . LYS A 1 249 ? 70.632  118.287 3.402   1.00 5.74   ? 250 LYS S CG  1 
ATOM   1925  C CD  . LYS A 1 249 ? 69.498  118.061 4.393   1.00 5.74   ? 250 LYS S CD  1 
ATOM   1926  C CE  . LYS A 1 249 ? 68.363  119.028 4.204   1.00 5.74   ? 250 LYS S CE  1 
ATOM   1927  N NZ  . LYS A 1 249 ? 68.368  120.211 5.139   1.00 5.74   ? 250 LYS S NZ  1 
ATOM   1928  N N   . PHE A 1 250 ? 73.206  115.939 2.058   1.00 7.18   ? 251 PHE S N   1 
ATOM   1929  C CA  . PHE A 1 250 ? 72.952  115.076 0.905   1.00 7.18   ? 251 PHE S CA  1 
ATOM   1930  C C   . PHE A 1 250 ? 72.193  113.829 1.390   1.00 7.18   ? 251 PHE S C   1 
ATOM   1931  O O   . PHE A 1 250 ? 72.793  112.891 1.904   1.00 2.00   ? 251 PHE S O   1 
ATOM   1932  C CB  . PHE A 1 250 ? 74.290  114.683 0.254   1.00 2.00   ? 251 PHE S CB  1 
ATOM   1933  C CG  . PHE A 1 250 ? 74.182  113.579 -0.749  1.00 2.00   ? 251 PHE S CG  1 
ATOM   1934  C CD1 . PHE A 1 250 ? 74.145  112.255 -0.359  1.00 2.00   ? 251 PHE S CD1 1 
ATOM   1935  C CD2 . PHE A 1 250 ? 74.154  113.864 -2.096  1.00 2.00   ? 251 PHE S CD2 1 
ATOM   1936  C CE1 . PHE A 1 250 ? 74.084  111.229 -1.295  1.00 2.00   ? 251 PHE S CE1 1 
ATOM   1937  C CE2 . PHE A 1 250 ? 74.091  112.837 -3.041  1.00 2.00   ? 251 PHE S CE2 1 
ATOM   1938  C CZ  . PHE A 1 250 ? 74.058  111.525 -2.637  1.00 2.00   ? 251 PHE S CZ  1 
ATOM   1939  N N   . ILE A 1 251 ? 70.869  113.819 1.232   1.00 2.00   ? 252 ILE S N   1 
ATOM   1940  C CA  . ILE A 1 251 ? 70.027  112.688 1.650   1.00 2.00   ? 252 ILE S CA  1 
ATOM   1941  C C   . ILE A 1 251 ? 69.984  111.565 0.640   1.00 2.00   ? 252 ILE S C   1 
ATOM   1942  O O   . ILE A 1 251 ? 69.815  111.804 -0.533  1.00 2.00   ? 252 ILE S O   1 
ATOM   1943  C CB  . ILE A 1 251 ? 68.586  113.109 1.853   1.00 2.00   ? 252 ILE S CB  1 
ATOM   1944  C CG1 . ILE A 1 251 ? 68.528  114.439 2.596   1.00 2.00   ? 252 ILE S CG1 1 
ATOM   1945  C CG2 . ILE A 1 251 ? 67.855  112.033 2.612   1.00 2.00   ? 252 ILE S CG2 1 
ATOM   1946  C CD1 . ILE A 1 251 ? 68.235  115.636 1.719   1.00 2.00   ? 252 ILE S CD1 1 
ATOM   1947  N N   . ARG A 1 252 ? 70.092  110.331 1.098   1.00 2.00   ? 253 ARG S N   1 
ATOM   1948  C CA  . ARG A 1 252 ? 70.068  109.185 0.199   1.00 2.00   ? 253 ARG S CA  1 
ATOM   1949  C C   . ARG A 1 252 ? 68.932  108.234 0.546   1.00 2.00   ? 253 ARG S C   1 
ATOM   1950  O O   . ARG A 1 252 ? 68.871  107.698 1.645   1.00 43.21  ? 253 ARG S O   1 
ATOM   1951  C CB  . ARG A 1 252 ? 71.383  108.437 0.297   1.00 43.21  ? 253 ARG S CB  1 
ATOM   1952  C CG  . ARG A 1 252 ? 71.870  107.867 -0.991  1.00 43.21  ? 253 ARG S CG  1 
ATOM   1953  C CD  . ARG A 1 252 ? 73.108  107.037 -0.752  1.00 43.21  ? 253 ARG S CD  1 
ATOM   1954  N NE  . ARG A 1 252 ? 72.747  105.651 -0.486  1.00 43.21  ? 253 ARG S NE  1 
ATOM   1955  C CZ  . ARG A 1 252 ? 73.088  104.634 -1.269  1.00 43.21  ? 253 ARG S CZ  1 
ATOM   1956  N NH1 . ARG A 1 252 ? 73.799  104.851 -2.365  1.00 43.21  ? 253 ARG S NH1 1 
ATOM   1957  N NH2 . ARG A 1 252 ? 72.712  103.398 -0.969  1.00 43.21  ? 253 ARG S NH2 1 
ATOM   1958  N N   . ILE A 1 253 ? 68.019  108.022 -0.393  1.00 2.00   ? 254 ILE S N   1 
ATOM   1959  C CA  . ILE A 1 253 ? 66.900  107.116 -0.164  1.00 2.00   ? 254 ILE S CA  1 
ATOM   1960  C C   . ILE A 1 253 ? 67.102  105.818 -0.937  1.00 2.00   ? 254 ILE S C   1 
ATOM   1961  O O   . ILE A 1 253 ? 67.436  105.826 -2.133  1.00 2.00   ? 254 ILE S O   1 
ATOM   1962  C CB  . ILE A 1 253 ? 65.560  107.759 -0.573  1.00 2.00   ? 254 ILE S CB  1 
ATOM   1963  C CG1 . ILE A 1 253 ? 64.953  108.518 0.606   1.00 2.00   ? 254 ILE S CG1 1 
ATOM   1964  C CG2 . ILE A 1 253 ? 64.585  106.688 -0.953  1.00 2.00   ? 254 ILE S CG2 1 
ATOM   1965  C CD1 . ILE A 1 253 ? 64.505  109.893 0.280   1.00 2.00   ? 254 ILE S CD1 1 
ATOM   1966  N N   . ASN A 1 254 ? 66.869  104.711 -0.236  1.00 2.66   ? 255 ASN S N   1 
ATOM   1967  C CA  . ASN A 1 254 ? 67.063  103.371 -0.782  1.00 2.66   ? 255 ASN S CA  1 
ATOM   1968  C C   . ASN A 1 254 ? 65.800  102.580 -1.121  1.00 2.66   ? 255 ASN S C   1 
ATOM   1969  O O   . ASN A 1 254 ? 64.924  102.413 -0.265  1.00 56.01  ? 255 ASN S O   1 
ATOM   1970  C CB  . ASN A 1 254 ? 67.913  102.561 0.199   1.00 56.01  ? 255 ASN S CB  1 
ATOM   1971  C CG  . ASN A 1 254 ? 69.335  103.102 0.334   1.00 56.01  ? 255 ASN S CG  1 
ATOM   1972  O OD1 . ASN A 1 254 ? 70.069  103.225 -0.653  1.00 56.01  ? 255 ASN S OD1 1 
ATOM   1973  N ND2 . ASN A 1 254 ? 69.732  103.418 1.563   1.00 56.01  ? 255 ASN S ND2 1 
ATOM   1974  N N   . PHE A 1 255 ? 65.732  102.071 -2.359  1.00 2.00   ? 256 PHE S N   1 
ATOM   1975  C CA  . PHE A 1 255 ? 64.572  101.299 -2.826  1.00 2.00   ? 256 PHE S CA  1 
ATOM   1976  C C   . PHE A 1 255 ? 64.900  99.844  -3.144  1.00 2.00   ? 256 PHE S C   1 
ATOM   1977  O O   . PHE A 1 255 ? 66.022  99.538  -3.582  1.00 2.00   ? 256 PHE S O   1 
ATOM   1978  C CB  . PHE A 1 255 ? 63.981  101.916 -4.095  1.00 2.00   ? 256 PHE S CB  1 
ATOM   1979  C CG  . PHE A 1 255 ? 63.771  103.394 -4.025  1.00 2.00   ? 256 PHE S CG  1 
ATOM   1980  C CD1 . PHE A 1 255 ? 62.766  103.915 -3.256  1.00 2.00   ? 256 PHE S CD1 1 
ATOM   1981  C CD2 . PHE A 1 255 ? 64.574  104.257 -4.743  1.00 2.00   ? 256 PHE S CD2 1 
ATOM   1982  C CE1 . PHE A 1 255 ? 62.565  105.265 -3.206  1.00 2.00   ? 256 PHE S CE1 1 
ATOM   1983  C CE2 . PHE A 1 255 ? 64.380  105.602 -4.695  1.00 2.00   ? 256 PHE S CE2 1 
ATOM   1984  C CZ  . PHE A 1 255 ? 63.378  106.105 -3.927  1.00 2.00   ? 256 PHE S CZ  1 
ATOM   1985  N N   . ASP A 1 256 ? 63.919  98.958  -2.951  1.00 2.00   ? 257 ASP S N   1 
ATOM   1986  C CA  . ASP A 1 256 ? 64.122  97.550  -3.247  1.00 2.00   ? 257 ASP S CA  1 
ATOM   1987  C C   . ASP A 1 256 ? 63.913  97.340  -4.738  1.00 2.00   ? 257 ASP S C   1 
ATOM   1988  O O   . ASP A 1 256 ? 63.923  98.293  -5.515  1.00 72.11  ? 257 ASP S O   1 
ATOM   1989  C CB  . ASP A 1 256 ? 63.141  96.692  -2.460  1.00 72.11  ? 257 ASP S CB  1 
ATOM   1990  C CG  . ASP A 1 256 ? 61.713  96.878  -2.914  1.00 72.11  ? 257 ASP S CG  1 
ATOM   1991  O OD1 . ASP A 1 256 ? 61.487  97.589  -3.915  1.00 72.11  ? 257 ASP S OD1 1 
ATOM   1992  O OD2 . ASP A 1 256 ? 60.812  96.310  -2.264  1.00 72.11  ? 257 ASP S OD2 1 
ATOM   1993  N N   . VAL A 1 257 ? 63.705  96.091  -5.138  1.00 58.51  ? 258 VAL S N   1 
ATOM   1994  C CA  . VAL A 1 257 ? 63.471  95.777  -6.545  1.00 58.51  ? 258 VAL S CA  1 
ATOM   1995  C C   . VAL A 1 257 ? 62.032  96.097  -6.955  1.00 58.51  ? 258 VAL S C   1 
ATOM   1996  O O   . VAL A 1 257 ? 61.781  96.508  -8.086  1.00 72.47  ? 258 VAL S O   1 
ATOM   1997  C CB  . VAL A 1 257 ? 63.724  94.288  -6.846  1.00 72.47  ? 258 VAL S CB  1 
ATOM   1998  C CG1 . VAL A 1 257 ? 64.616  94.145  -8.061  1.00 72.47  ? 258 VAL S CG1 1 
ATOM   1999  C CG2 . VAL A 1 257 ? 64.349  93.622  -5.646  1.00 72.47  ? 258 VAL S CG2 1 
ATOM   2000  N N   . THR A 1 258 ? 61.087  95.902  -6.038  1.00 2.00   ? 259 THR S N   1 
ATOM   2001  C CA  . THR A 1 258 ? 59.687  96.171  -6.319  1.00 2.00   ? 259 THR S CA  1 
ATOM   2002  C C   . THR A 1 258 ? 59.422  97.665  -6.431  1.00 2.00   ? 259 THR S C   1 
ATOM   2003  O O   . THR A 1 258 ? 58.340  98.076  -6.851  1.00 86.41  ? 259 THR S O   1 
ATOM   2004  C CB  . THR A 1 258 ? 58.779  95.583  -5.237  1.00 86.41  ? 259 THR S CB  1 
ATOM   2005  O OG1 . THR A 1 258 ? 59.576  95.052  -4.175  1.00 86.41  ? 259 THR S OG1 1 
ATOM   2006  C CG2 . THR A 1 258 ? 57.927  94.478  -5.821  1.00 86.41  ? 259 THR S CG2 1 
ATOM   2007  N N   . GLY A 1 259 ? 60.409  98.473  -6.053  1.00 10.35  ? 260 GLY S N   1 
ATOM   2008  C CA  . GLY A 1 259 ? 60.266  99.912  -6.152  1.00 10.35  ? 260 GLY S CA  1 
ATOM   2009  C C   . GLY A 1 259 ? 59.851  100.603 -4.878  1.00 10.35  ? 260 GLY S C   1 
ATOM   2010  O O   . GLY A 1 259 ? 59.379  101.740 -4.920  1.00 84.04  ? 260 GLY S O   1 
ATOM   2011  N N   . TYR A 1 260 ? 60.027  99.939  -3.738  1.00 25.40  ? 261 TYR S N   1 
ATOM   2012  C CA  . TYR A 1 260 ? 59.639  100.548 -2.468  1.00 25.40  ? 261 TYR S CA  1 
ATOM   2013  C C   . TYR A 1 260 ? 60.777  101.116 -1.627  1.00 25.40  ? 261 TYR S C   1 
ATOM   2014  O O   . TYR A 1 260 ? 61.911  100.627 -1.673  1.00 49.07  ? 261 TYR S O   1 
ATOM   2015  C CB  . TYR A 1 260 ? 58.857  99.547  -1.641  1.00 49.07  ? 261 TYR S CB  1 
ATOM   2016  C CG  . TYR A 1 260 ? 57.670  99.023  -2.378  1.00 49.07  ? 261 TYR S CG  1 
ATOM   2017  C CD1 . TYR A 1 260 ? 57.830  98.188  -3.469  1.00 49.07  ? 261 TYR S CD1 1 
ATOM   2018  C CD2 . TYR A 1 260 ? 56.388  99.405  -2.015  1.00 49.07  ? 261 TYR S CD2 1 
ATOM   2019  C CE1 . TYR A 1 260 ? 56.750  97.746  -4.187  1.00 49.07  ? 261 TYR S CE1 1 
ATOM   2020  C CE2 . TYR A 1 260 ? 55.292  98.966  -2.724  1.00 49.07  ? 261 TYR S CE2 1 
ATOM   2021  C CZ  . TYR A 1 260 ? 55.479  98.134  -3.819  1.00 49.07  ? 261 TYR S CZ  1 
ATOM   2022  O OH  . TYR A 1 260 ? 54.399  97.708  -4.566  1.00 49.07  ? 261 TYR S OH  1 
ATOM   2023  N N   . ILE A 1 261 ? 60.452  102.152 -0.859  1.00 11.36  ? 262 ILE S N   1 
ATOM   2024  C CA  . ILE A 1 261 ? 61.423  102.802 0.002   1.00 11.36  ? 262 ILE S CA  1 
ATOM   2025  C C   . ILE A 1 261 ? 61.720  101.830 1.117   1.00 11.36  ? 262 ILE S C   1 
ATOM   2026  O O   . ILE A 1 261 ? 60.803  101.194 1.650   1.00 5.64   ? 262 ILE S O   1 
ATOM   2027  C CB  . ILE A 1 261 ? 60.861  104.133 0.588   1.00 5.64   ? 262 ILE S CB  1 
ATOM   2028  C CG1 . ILE A 1 261 ? 61.749  105.293 0.171   1.00 5.64   ? 262 ILE S CG1 1 
ATOM   2029  C CG2 . ILE A 1 261 ? 60.842  104.105 2.083   1.00 5.64   ? 262 ILE S CG2 1 
ATOM   2030  C CD1 . ILE A 1 261 ? 61.253  106.611 0.649   1.00 5.64   ? 262 ILE S CD1 1 
ATOM   2031  N N   . VAL A 1 262 ? 62.998  101.709 1.466   1.00 56.49  ? 263 VAL S N   1 
ATOM   2032  C CA  . VAL A 1 262 ? 63.385  100.801 2.521   1.00 56.49  ? 263 VAL S CA  1 
ATOM   2033  C C   . VAL A 1 262 ? 64.444  101.403 3.437   1.00 56.49  ? 263 VAL S C   1 
ATOM   2034  O O   . VAL A 1 262 ? 64.539  101.038 4.595   1.00 20.33  ? 263 VAL S O   1 
ATOM   2035  C CB  . VAL A 1 262 ? 63.899  99.493  1.928   1.00 20.33  ? 263 VAL S CB  1 
ATOM   2036  C CG1 . VAL A 1 262 ? 64.677  99.772  0.656   1.00 20.33  ? 263 VAL S CG1 1 
ATOM   2037  C CG2 . VAL A 1 262 ? 64.770  98.791  2.933   1.00 20.33  ? 263 VAL S CG2 1 
ATOM   2038  N N   . GLY A 1 263 ? 65.236  102.332 2.927   1.00 30.76  ? 264 GLY S N   1 
ATOM   2039  C CA  . GLY A 1 263 ? 66.261  102.929 3.763   1.00 30.76  ? 264 GLY S CA  1 
ATOM   2040  C C   . GLY A 1 263 ? 66.549  104.393 3.466   1.00 30.76  ? 264 GLY S C   1 
ATOM   2041  O O   . GLY A 1 263 ? 66.024  104.947 2.499   1.00 59.77  ? 264 GLY S O   1 
ATOM   2042  N N   . ALA A 1 264 ? 67.406  105.012 4.273   1.00 2.00   ? 265 ALA S N   1 
ATOM   2043  C CA  . ALA A 1 264 ? 67.741  106.422 4.106   1.00 2.00   ? 265 ALA S CA  1 
ATOM   2044  C C   . ALA A 1 264 ? 68.936  106.858 4.950   1.00 2.00   ? 265 ALA S C   1 
ATOM   2045  O O   . ALA A 1 264 ? 68.969  106.718 6.164   1.00 4.88   ? 265 ALA S O   1 
ATOM   2046  C CB  . ALA A 1 264 ? 66.537  107.284 4.440   1.00 4.88   ? 265 ALA S CB  1 
ATOM   2047  N N   . ASN A 1 265 ? 69.907  107.427 4.267   1.00 2.00   ? 266 ASN S N   1 
ATOM   2048  C CA  . ASN A 1 265 ? 71.138  107.894 4.860   1.00 2.00   ? 266 ASN S CA  1 
ATOM   2049  C C   . ASN A 1 265 ? 71.170  109.399 4.751   1.00 2.00   ? 266 ASN S C   1 
ATOM   2050  O O   . ASN A 1 265 ? 70.436  109.983 3.962   1.00 65.35  ? 266 ASN S O   1 
ATOM   2051  C CB  . ASN A 1 265 ? 72.290  107.326 4.049   1.00 65.35  ? 266 ASN S CB  1 
ATOM   2052  C CG  . ASN A 1 265 ? 73.355  106.730 4.900   1.00 65.35  ? 266 ASN S CG  1 
ATOM   2053  O OD1 . ASN A 1 265 ? 73.787  105.591 4.680   1.00 65.35  ? 266 ASN S OD1 1 
ATOM   2054  N ND2 . ASN A 1 265 ? 73.800  107.493 5.883   1.00 65.35  ? 266 ASN S ND2 1 
ATOM   2055  N N   . ILE A 1 266 ? 72.037  110.033 5.521   1.00 7.43   ? 267 ILE S N   1 
ATOM   2056  C CA  . ILE A 1 266 ? 72.176  111.488 5.451   1.00 7.43   ? 267 ILE S CA  1 
ATOM   2057  C C   . ILE A 1 266 ? 73.641  111.896 5.677   1.00 7.43   ? 267 ILE S C   1 
ATOM   2058  O O   . ILE A 1 266 ? 74.191  111.730 6.771   1.00 2.00   ? 267 ILE S O   1 
ATOM   2059  C CB  . ILE A 1 266 ? 71.321  112.218 6.534   1.00 2.00   ? 267 ILE S CB  1 
ATOM   2060  C CG1 . ILE A 1 266 ? 69.819  112.071 6.297   1.00 2.00   ? 267 ILE S CG1 1 
ATOM   2061  C CG2 . ILE A 1 266 ? 71.590  113.722 6.585   1.00 2.00   ? 267 ILE S CG2 1 
ATOM   2062  C CD1 . ILE A 1 266 ? 69.154  111.112 7.280   1.00 2.00   ? 267 ILE S CD1 1 
ATOM   2063  N N   . GLU A 1 267 ? 74.259  112.426 4.631   1.00 2.00   ? 268 GLU S N   1 
ATOM   2064  C CA  . GLU A 1 267 ? 75.660  112.884 4.700   1.00 2.00   ? 268 GLU S CA  1 
ATOM   2065  C C   . GLU A 1 267 ? 75.701  114.404 4.916   1.00 2.00   ? 268 GLU S C   1 
ATOM   2066  O O   . GLU A 1 267 ? 75.523  115.187 3.975   1.00 98.21  ? 268 GLU S O   1 
ATOM   2067  C CB  . GLU A 1 267 ? 76.400  112.540 3.402   1.00 98.21  ? 268 GLU S CB  1 
ATOM   2068  C CG  . GLU A 1 267 ? 77.911  112.779 3.493   1.00 98.21  ? 268 GLU S CG  1 
ATOM   2069  C CD  . GLU A 1 267 ? 78.612  111.802 4.439   1.00 98.21  ? 268 GLU S CD  1 
ATOM   2070  O OE1 . GLU A 1 267 ? 77.930  110.889 5.040   1.00 98.21  ? 268 GLU S OE1 1 
ATOM   2071  O OE2 . GLU A 1 267 ? 79.884  111.894 4.633   1.00 98.21  ? 268 GLU S OE2 1 
ATOM   2072  N N   . THR A 1 268 ? 75.933  114.778 6.165   1.00 10.20  ? 269 THR S N   1 
ATOM   2073  C CA  . THR A 1 268 ? 76.012  116.195 6.590   1.00 10.20  ? 269 THR S CA  1 
ATOM   2074  C C   . THR A 1 268 ? 77.419  116.733 6.294   1.00 10.20  ? 269 THR S C   1 
ATOM   2075  O O   . THR A 1 268 ? 78.397  115.984 6.245   1.00 6.58   ? 269 THR S O   1 
ATOM   2076  C CB  . THR A 1 268 ? 75.730  116.276 8.086   1.00 6.58   ? 269 THR S CB  1 
ATOM   2077  O OG1 . THR A 1 268 ? 76.402  117.390 8.644   1.00 6.58   ? 269 THR S OG1 1 
ATOM   2078  C CG2 . THR A 1 268 ? 76.193  115.026 8.837   1.00 6.58   ? 269 THR S CG2 1 
ATOM   2079  N N   . TYR A 1 269 ? 77.543  118.042 6.106   1.00 56.38  ? 270 TYR S N   1 
ATOM   2080  C CA  . TYR A 1 269 ? 78.860  118.610 5.750   1.00 56.38  ? 270 TYR S CA  1 
ATOM   2081  C C   . TYR A 1 269 ? 79.326  119.728 6.707   1.00 56.38  ? 270 TYR S C   1 
ATOM   2082  O O   . TYR A 1 269 ? 79.369  119.553 7.931   1.00 29.85  ? 270 TYR S O   1 
ATOM   2083  C CB  . TYR A 1 269 ? 78.832  119.146 4.316   1.00 29.85  ? 270 TYR S CB  1 
ATOM   2084  C CG  . TYR A 1 269 ? 78.509  118.057 3.281   1.00 29.85  ? 270 TYR S CG  1 
ATOM   2085  C CD1 . TYR A 1 269 ? 79.533  117.272 2.727   1.00 29.85  ? 270 TYR S CD1 1 
ATOM   2086  C CD2 . TYR A 1 269 ? 77.185  117.844 2.885   1.00 29.85  ? 270 TYR S CD2 1 
ATOM   2087  C CE1 . TYR A 1 269 ? 79.229  116.285 1.783   1.00 29.85  ? 270 TYR S CE1 1 
ATOM   2088  C CE2 . TYR A 1 269 ? 76.883  116.854 1.942   1.00 29.85  ? 270 TYR S CE2 1 
ATOM   2089  C CZ  . TYR A 1 269 ? 77.904  116.076 1.391   1.00 29.85  ? 270 TYR S CZ  1 
ATOM   2090  O OH  . TYR A 1 269 ? 77.606  115.117 0.474   1.00 29.85  ? 270 TYR S OH  1 
ATOM   2091  N N   . LEU A 1 270 ? 79.666  120.847 6.089   1.00 2.00   ? 271 LEU S N   1 
ATOM   2092  C CA  . LEU A 1 270 ? 80.280  122.021 6.752   1.00 2.00   ? 271 LEU S CA  1 
ATOM   2093  C C   . LEU A 1 270 ? 79.389  122.730 7.767   1.00 2.00   ? 271 LEU S C   1 
ATOM   2094  O O   . LEU A 1 270 ? 78.843  123.790 7.472   1.00 100.00 ? 271 LEU S O   1 
ATOM   2095  C CB  . LEU A 1 270 ? 80.688  123.024 5.692   1.00 100.00 ? 271 LEU S CB  1 
ATOM   2096  C CG  . LEU A 1 270 ? 81.326  122.337 4.490   1.00 100.00 ? 271 LEU S CG  1 
ATOM   2097  C CD1 . LEU A 1 270 ? 80.741  122.801 3.161   1.00 100.00 ? 271 LEU S CD1 1 
ATOM   2098  C CD2 . LEU A 1 270 ? 82.832  122.569 4.413   1.00 100.00 ? 271 LEU S CD2 1 
ATOM   2099  N N   . LEU A 1 271 ? 79.277  122.174 8.968   1.00 2.00   ? 272 LEU S N   1 
ATOM   2100  C CA  . LEU A 1 271 ? 78.442  122.791 9.994   1.00 2.00   ? 272 LEU S CA  1 
ATOM   2101  C C   . LEU A 1 271 ? 79.063  124.046 10.621  1.00 2.00   ? 272 LEU S C   1 
ATOM   2102  O O   . LEU A 1 271 ? 79.832  123.936 11.561  1.00 14.75  ? 272 LEU S O   1 
ATOM   2103  C CB  . LEU A 1 271 ? 78.131  121.780 11.108  1.00 14.75  ? 272 LEU S CB  1 
ATOM   2104  C CG  . LEU A 1 271 ? 77.618  122.309 12.461  1.00 14.75  ? 272 LEU S CG  1 
ATOM   2105  C CD1 . LEU A 1 271 ? 76.851  123.625 12.327  1.00 14.75  ? 272 LEU S CD1 1 
ATOM   2106  C CD2 . LEU A 1 271 ? 76.718  121.261 13.066  1.00 14.75  ? 272 LEU S CD2 1 
ATOM   2107  N N   . GLU A 1 272 ? 78.710  125.233 10.132  1.00 14.65  ? 273 GLU S N   1 
ATOM   2108  C CA  . GLU A 1 272 ? 79.255  126.494 10.668  1.00 14.65  ? 273 GLU S CA  1 
ATOM   2109  C C   . GLU A 1 272 ? 78.900  126.673 12.150  1.00 14.65  ? 273 GLU S C   1 
ATOM   2110  O O   . GLU A 1 272 ? 78.141  127.565 12.528  1.00 51.42  ? 273 GLU S O   1 
ATOM   2111  C CB  . GLU A 1 272 ? 78.728  127.668 9.826   1.00 51.42  ? 273 GLU S CB  1 
ATOM   2112  C CG  . GLU A 1 272 ? 78.986  129.068 10.373  1.00 51.42  ? 273 GLU S CG  1 
ATOM   2113  C CD  . GLU A 1 272 ? 78.071  130.136 9.742   1.00 51.42  ? 273 GLU S CD  1 
ATOM   2114  O OE1 . GLU A 1 272 ? 78.343  130.577 8.600   1.00 51.42  ? 273 GLU S OE1 1 
ATOM   2115  O OE2 . GLU A 1 272 ? 77.074  130.535 10.391  1.00 51.42  ? 273 GLU S OE2 1 
ATOM   2116  N N   . LYS A 1 273 ? 79.463  125.807 12.983  1.00 12.62  ? 274 LYS S N   1 
ATOM   2117  C CA  . LYS A 1 273 ? 79.224  125.833 14.419  1.00 12.62  ? 274 LYS S CA  1 
ATOM   2118  C C   . LYS A 1 273 ? 79.957  126.984 15.084  1.00 12.62  ? 274 LYS S C   1 
ATOM   2119  O O   . LYS A 1 273 ? 79.891  127.161 16.301  1.00 96.44  ? 274 LYS S O   1 
ATOM   2120  C CB  . LYS A 1 273 ? 79.644  124.518 15.078  1.00 96.44  ? 274 LYS S CB  1 
ATOM   2121  C CG  . LYS A 1 273 ? 80.955  123.951 14.575  1.00 96.44  ? 274 LYS S CG  1 
ATOM   2122  C CD  . LYS A 1 273 ? 82.137  124.868 14.879  1.00 96.44  ? 274 LYS S CD  1 
ATOM   2123  C CE  . LYS A 1 273 ? 83.436  124.295 14.318  1.00 96.44  ? 274 LYS S CE  1 
ATOM   2124  N NZ  . LYS A 1 273 ? 84.077  123.299 15.230  1.00 96.44  ? 274 LYS S NZ  1 
ATOM   2125  N N   . SER A 1 274 ? 80.678  127.754 14.284  1.00 3.39   ? 275 SER S N   1 
ATOM   2126  C CA  . SER A 1 274 ? 81.361  128.909 14.820  1.00 3.39   ? 275 SER S CA  1 
ATOM   2127  C C   . SER A 1 274 ? 80.284  129.721 15.564  1.00 3.39   ? 275 SER S C   1 
ATOM   2128  O O   . SER A 1 274 ? 80.308  129.825 16.797  1.00 52.18  ? 275 SER S O   1 
ATOM   2129  C CB  . SER A 1 274 ? 81.959  129.730 13.679  1.00 52.18  ? 275 SER S CB  1 
ATOM   2130  O OG  . SER A 1 274 ? 82.561  128.877 12.719  1.00 52.18  ? 275 SER S OG  1 
ATOM   2131  N N   . ARG A 1 275 ? 79.323  130.249 14.807  1.00 38.25  ? 276 ARG S N   1 
ATOM   2132  C CA  . ARG A 1 275 ? 78.223  131.063 15.330  1.00 38.25  ? 276 ARG S CA  1 
ATOM   2133  C C   . ARG A 1 275 ? 77.580  130.598 16.627  1.00 38.25  ? 276 ARG S C   1 
ATOM   2134  O O   . ARG A 1 275 ? 76.720  131.291 17.175  1.00 44.46  ? 276 ARG S O   1 
ATOM   2135  C CB  . ARG A 1 275 ? 77.125  131.209 14.265  1.00 44.46  ? 276 ARG S CB  1 
ATOM   2136  C CG  . ARG A 1 275 ? 76.053  130.111 14.271  1.00 44.46  ? 276 ARG S CG  1 
ATOM   2137  C CD  . ARG A 1 275 ? 74.838  130.482 13.410  1.00 44.46  ? 276 ARG S CD  1 
ATOM   2138  N NE  . ARG A 1 275 ? 75.225  131.129 12.154  1.00 44.46  ? 276 ARG S NE  1 
ATOM   2139  C CZ  . ARG A 1 275 ? 74.815  132.335 11.762  1.00 44.46  ? 276 ARG S CZ  1 
ATOM   2140  N NH1 . ARG A 1 275 ? 73.995  133.046 12.526  1.00 44.46  ? 276 ARG S NH1 1 
ATOM   2141  N NH2 . ARG A 1 275 ? 75.239  132.844 10.614  1.00 44.46  ? 276 ARG S NH2 1 
ATOM   2142  N N   . ALA A 1 276 ? 77.972  129.427 17.108  1.00 25.49  ? 277 ALA S N   1 
ATOM   2143  C CA  . ALA A 1 276 ? 77.417  128.912 18.347  1.00 25.49  ? 277 ALA S CA  1 
ATOM   2144  C C   . ALA A 1 276 ? 77.896  129.756 19.530  1.00 25.49  ? 277 ALA S C   1 
ATOM   2145  O O   . ALA A 1 276 ? 77.311  129.700 20.627  1.00 15.88  ? 277 ALA S O   1 
ATOM   2146  C CB  . ALA A 1 276 ? 77.838  127.484 18.536  1.00 15.88  ? 277 ALA S CB  1 
ATOM   2147  N N   . ILE A 1 277 ? 78.953  130.539 19.294  1.00 37.41  ? 278 ILE S N   1 
ATOM   2148  C CA  . ILE A 1 277 ? 79.552  131.395 20.319  1.00 37.41  ? 278 ILE S CA  1 
ATOM   2149  C C   . ILE A 1 277 ? 79.303  132.875 20.107  1.00 37.41  ? 278 ILE S C   1 
ATOM   2150  O O   . ILE A 1 277 ? 79.097  133.609 21.071  1.00 19.48  ? 278 ILE S O   1 
ATOM   2151  C CB  . ILE A 1 277 ? 81.075  131.204 20.389  1.00 19.48  ? 278 ILE S CB  1 
ATOM   2152  C CG1 . ILE A 1 277 ? 81.678  131.442 19.017  1.00 19.48  ? 278 ILE S CG1 1 
ATOM   2153  C CG2 . ILE A 1 277 ? 81.415  129.797 20.860  1.00 19.48  ? 278 ILE S CG2 1 
ATOM   2154  C CD1 . ILE A 1 277 ? 83.162  131.619 19.050  1.00 19.48  ? 278 ILE S CD1 1 
ATOM   2155  N N   . ARG A 1 278 ? 79.359  133.316 18.855  1.00 2.00   ? 279 ARG S N   1 
ATOM   2156  C CA  . ARG A 1 278 ? 79.125  134.722 18.543  1.00 2.00   ? 279 ARG S CA  1 
ATOM   2157  C C   . ARG A 1 278 ? 78.441  134.875 17.183  1.00 2.00   ? 279 ARG S C   1 
ATOM   2158  O O   . ARG A 1 278 ? 78.990  134.479 16.145  1.00 99.99  ? 279 ARG S O   1 
ATOM   2159  C CB  . ARG A 1 278 ? 80.446  135.485 18.547  1.00 99.99  ? 279 ARG S CB  1 
ATOM   2160  C CG  . ARG A 1 278 ? 81.166  135.427 19.894  1.00 99.99  ? 279 ARG S CG  1 
ATOM   2161  C CD  . ARG A 1 278 ? 82.641  135.050 19.764  1.00 99.99  ? 279 ARG S CD  1 
ATOM   2162  N NE  . ARG A 1 278 ? 83.171  134.384 20.961  1.00 99.99  ? 279 ARG S NE  1 
ATOM   2163  C CZ  . ARG A 1 278 ? 84.474  134.173 21.185  1.00 99.99  ? 279 ARG S CZ  1 
ATOM   2164  N NH1 . ARG A 1 278 ? 85.398  134.572 20.300  1.00 99.99  ? 279 ARG S NH1 1 
ATOM   2165  N NH2 . ARG A 1 278 ? 84.957  133.567 22.275  1.00 99.99  ? 279 ARG S NH2 1 
ATOM   2166  N N   . GLN A 1 279 ? 77.257  135.458 17.257  1.00 2.00   ? 280 GLN S N   1 
ATOM   2167  C CA  . GLN A 1 279 ? 76.411  135.720 16.084  1.00 2.00   ? 280 GLN S CA  1 
ATOM   2168  C C   . GLN A 1 279 ? 76.549  137.173 15.644  1.00 2.00   ? 280 GLN S C   1 
ATOM   2169  O O   . GLN A 1 279 ? 76.615  138.089 16.479  1.00 33.92  ? 280 GLN S O   1 
ATOM   2170  C CB  . GLN A 1 279 ? 74.942  135.456 16.416  1.00 33.92  ? 280 GLN S CB  1 
ATOM   2171  C CG  . GLN A 1 279 ? 74.719  134.122 17.131  1.00 33.92  ? 280 GLN S CG  1 
ATOM   2172  C CD  . GLN A 1 279 ? 75.152  134.154 18.598  1.00 33.92  ? 280 GLN S CD  1 
ATOM   2173  O OE1 . GLN A 1 279 ? 74.466  134.749 19.427  1.00 33.92  ? 280 GLN S OE1 1 
ATOM   2174  N NE2 . GLN A 1 279 ? 76.262  133.545 18.972  1.00 33.92  ? 280 GLN S NE2 1 
ATOM   2175  N N   . ALA A 1 280 ? 76.587  137.330 14.337  1.00 45.03  ? 281 ALA S N   1 
ATOM   2176  C CA  . ALA A 1 280 ? 76.706  138.641 13.697  1.00 45.03  ? 281 ALA S CA  1 
ATOM   2177  C C   . ALA A 1 280 ? 75.457  139.469 13.984  1.00 45.03  ? 281 ALA S C   1 
ATOM   2178  O O   . ALA A 1 280 ? 74.507  138.996 14.625  1.00 99.41  ? 281 ALA S O   1 
ATOM   2179  C CB  . ALA A 1 280 ? 76.859  138.471 12.184  1.00 99.41  ? 281 ALA S CB  1 
ATOM   2180  N N   . LYS A 1 281 ? 75.506  140.691 13.497  1.00 77.14  ? 282 LYS S N   1 
ATOM   2181  C CA  . LYS A 1 281 ? 74.414  141.658 13.639  1.00 77.14  ? 282 LYS S CA  1 
ATOM   2182  C C   . LYS A 1 281 ? 73.155  141.140 12.930  1.00 77.14  ? 282 LYS S C   1 
ATOM   2183  O O   . LYS A 1 281 ? 73.214  140.700 11.773  1.00 100.00 ? 282 LYS S O   1 
ATOM   2184  C CB  . LYS A 1 281 ? 74.823  142.991 13.008  1.00 100.00 ? 282 LYS S CB  1 
ATOM   2185  C CG  . LYS A 1 281 ? 74.196  144.202 13.699  1.00 100.00 ? 282 LYS S CG  1 
ATOM   2186  C CD  . LYS A 1 281 ? 72.999  144.770 12.939  1.00 100.00 ? 282 LYS S CD  1 
ATOM   2187  C CE  . LYS A 1 281 ? 72.840  146.282 13.112  1.00 100.00 ? 282 LYS S CE  1 
ATOM   2188  N NZ  . LYS A 1 281 ? 72.511  146.973 11.858  1.00 100.00 ? 282 LYS S NZ  1 
ATOM   2189  N N   . ASP A 1 282 ? 72.064  141.208 13.674  1.00 11.81  ? 283 ASP S N   1 
ATOM   2190  C CA  . ASP A 1 282 ? 70.707  140.819 13.222  1.00 11.81  ? 283 ASP S CA  1 
ATOM   2191  C C   . ASP A 1 282 ? 70.605  139.327 12.851  1.00 11.81  ? 283 ASP S C   1 
ATOM   2192  O O   . ASP A 1 282 ? 69.680  138.904 12.141  1.00 96.69  ? 283 ASP S O   1 
ATOM   2193  C CB  . ASP A 1 282 ? 70.289  141.651 12.011  1.00 96.69  ? 283 ASP S CB  1 
ATOM   2194  C CG  . ASP A 1 282 ? 69.879  143.074 12.398  1.00 96.69  ? 283 ASP S CG  1 
ATOM   2195  O OD1 . ASP A 1 282 ? 69.563  143.344 13.619  1.00 96.69  ? 283 ASP S OD1 1 
ATOM   2196  O OD2 . ASP A 1 282 ? 69.852  144.004 11.504  1.00 96.69  ? 283 ASP S OD2 1 
ATOM   2197  N N   . GLU A 1 283 ? 71.551  138.549 13.341  1.00 4.33   ? 284 GLU S N   1 
ATOM   2198  C CA  . GLU A 1 283 ? 71.558  137.089 13.127  1.00 4.33   ? 284 GLU S CA  1 
ATOM   2199  C C   . GLU A 1 283 ? 71.343  136.391 14.470  1.00 4.33   ? 284 GLU S C   1 
ATOM   2200  O O   . GLU A 1 283 ? 71.446  137.021 15.532  1.00 40.27  ? 284 GLU S O   1 
ATOM   2201  C CB  . GLU A 1 283 ? 72.888  136.642 12.526  1.00 40.27  ? 284 GLU S CB  1 
ATOM   2202  C CG  . GLU A 1 283 ? 73.102  137.154 11.103  1.00 40.27  ? 284 GLU S CG  1 
ATOM   2203  C CD  . GLU A 1 283 ? 74.089  136.304 10.306  1.00 40.27  ? 284 GLU S CD  1 
ATOM   2204  O OE1 . GLU A 1 283 ? 74.709  135.331 10.882  1.00 40.27  ? 284 GLU S OE1 1 
ATOM   2205  O OE2 . GLU A 1 283 ? 74.302  136.561 9.061   1.00 40.27  ? 284 GLU S OE2 1 
ATOM   2206  N N   . ARG A 1 284 ? 71.053  135.105 14.381  1.00 2.00   ? 285 ARG S N   1 
ATOM   2207  C CA  . ARG A 1 284 ? 70.800  134.254 15.560  1.00 2.00   ? 285 ARG S CA  1 
ATOM   2208  C C   . ARG A 1 284 ? 71.671  132.998 15.517  1.00 2.00   ? 285 ARG S C   1 
ATOM   2209  O O   . ARG A 1 284 ? 72.348  132.721 14.516  1.00 58.71  ? 285 ARG S O   1 
ATOM   2210  C CB  . ARG A 1 284 ? 69.340  133.788 15.572  1.00 58.71  ? 285 ARG S CB  1 
ATOM   2211  C CG  . ARG A 1 284 ? 68.373  134.817 16.157  1.00 58.71  ? 285 ARG S CG  1 
ATOM   2212  C CD  . ARG A 1 284 ? 66.908  134.519 15.817  1.00 58.71  ? 285 ARG S CD  1 
ATOM   2213  N NE  . ARG A 1 284 ? 66.566  133.090 15.929  1.00 58.71  ? 285 ARG S NE  1 
ATOM   2214  C CZ  . ARG A 1 284 ? 65.544  132.618 16.659  1.00 58.71  ? 285 ARG S CZ  1 
ATOM   2215  N NH1 . ARG A 1 284 ? 64.751  133.449 17.351  1.00 58.71  ? 285 ARG S NH1 1 
ATOM   2216  N NH2 . ARG A 1 284 ? 65.230  131.320 16.760  1.00 58.71  ? 285 ARG S NH2 1 
ATOM   2217  N N   . THR A 1 285 ? 71.622  132.276 16.626  1.00 2.79   ? 286 THR S N   1 
ATOM   2218  C CA  . THR A 1 285 ? 72.323  130.992 16.774  1.00 2.79   ? 286 THR S CA  1 
ATOM   2219  C C   . THR A 1 285 ? 71.387  129.897 16.311  1.00 2.79   ? 286 THR S C   1 
ATOM   2220  O O   . THR A 1 285 ? 70.298  130.163 15.786  1.00 61.79  ? 286 THR S O   1 
ATOM   2221  C CB  . THR A 1 285 ? 72.708  130.751 18.235  1.00 61.79  ? 286 THR S CB  1 
ATOM   2222  O OG1 . THR A 1 285 ? 71.999  131.640 19.081  1.00 61.79  ? 286 THR S OG1 1 
ATOM   2223  C CG2 . THR A 1 285 ? 74.202  130.954 18.500  1.00 61.79  ? 286 THR S CG2 1 
ATOM   2224  N N   . PHE A 1 286 ? 71.818  128.666 16.542  1.00 3.03   ? 287 PHE S N   1 
ATOM   2225  C CA  . PHE A 1 286 ? 71.058  127.503 16.145  1.00 3.03   ? 287 PHE S CA  1 
ATOM   2226  C C   . PHE A 1 286 ? 69.721  127.434 16.863  1.00 3.03   ? 287 PHE S C   1 
ATOM   2227  O O   . PHE A 1 286 ? 69.661  127.227 18.072  1.00 10.73  ? 287 PHE S O   1 
ATOM   2228  C CB  . PHE A 1 286 ? 71.906  126.242 16.378  1.00 10.73  ? 287 PHE S CB  1 
ATOM   2229  C CG  . PHE A 1 286 ? 73.211  126.273 15.643  1.00 10.73  ? 287 PHE S CG  1 
ATOM   2230  C CD1 . PHE A 1 286 ? 74.256  127.034 16.116  1.00 10.73  ? 287 PHE S CD1 1 
ATOM   2231  C CD2 . PHE A 1 286 ? 73.354  125.639 14.424  1.00 10.73  ? 287 PHE S CD2 1 
ATOM   2232  C CE1 . PHE A 1 286 ? 75.415  127.172 15.383  1.00 10.73  ? 287 PHE S CE1 1 
ATOM   2233  C CE2 . PHE A 1 286 ? 74.513  125.776 13.682  1.00 10.73  ? 287 PHE S CE2 1 
ATOM   2234  C CZ  . PHE A 1 286 ? 75.542  126.543 14.158  1.00 10.73  ? 287 PHE S CZ  1 
ATOM   2235  N N   . HIS A 1 287 ? 68.654  127.627 16.088  1.00 47.87  ? 288 HIS S N   1 
ATOM   2236  C CA  . HIS A 1 287 ? 67.279  127.601 16.578  1.00 47.87  ? 288 HIS S CA  1 
ATOM   2237  C C   . HIS A 1 287 ? 67.136  126.935 17.949  1.00 47.87  ? 288 HIS S C   1 
ATOM   2238  O O   . HIS A 1 287 ? 66.805  127.590 18.945  1.00 31.13  ? 288 HIS S O   1 
ATOM   2239  C CB  . HIS A 1 287 ? 66.381  126.886 15.552  1.00 31.13  ? 288 HIS S CB  1 
ATOM   2240  C CG  . HIS A 1 287 ? 66.103  127.690 14.314  1.00 31.13  ? 288 HIS S CG  1 
ATOM   2241  N ND1 . HIS A 1 287 ? 65.024  127.436 13.492  1.00 31.13  ? 288 HIS S ND1 1 
ATOM   2242  C CD2 . HIS A 1 287 ? 66.764  128.734 13.754  1.00 31.13  ? 288 HIS S CD2 1 
ATOM   2243  C CE1 . HIS A 1 287 ? 65.036  128.290 12.482  1.00 31.13  ? 288 HIS S CE1 1 
ATOM   2244  N NE2 . HIS A 1 287 ? 66.080  129.086 12.618  1.00 31.13  ? 288 HIS S NE2 1 
ATOM   2245  N N   . ILE A 1 288 ? 67.404  125.635 17.991  1.00 5.37   ? 289 ILE S N   1 
ATOM   2246  C CA  . ILE A 1 288 ? 67.295  124.876 19.229  1.00 5.37   ? 289 ILE S CA  1 
ATOM   2247  C C   . ILE A 1 288 ? 67.632  125.662 20.492  1.00 5.37   ? 289 ILE S C   1 
ATOM   2248  O O   . ILE A 1 288 ? 66.958  125.503 21.506  1.00 2.00   ? 289 ILE S O   1 
ATOM   2249  C CB  . ILE A 1 288 ? 68.180  123.636 19.193  1.00 2.00   ? 289 ILE S CB  1 
ATOM   2250  C CG1 . ILE A 1 288 ? 68.214  122.983 20.575  1.00 2.00   ? 289 ILE S CG1 1 
ATOM   2251  C CG2 . ILE A 1 288 ? 69.569  124.018 18.702  1.00 2.00   ? 289 ILE S CG2 1 
ATOM   2252  C CD1 . ILE A 1 288 ? 66.883  122.395 21.043  1.00 2.00   ? 289 ILE S CD1 1 
ATOM   2253  N N   . PHE A 1 289 ? 68.664  126.501 20.436  1.00 56.69  ? 290 PHE S N   1 
ATOM   2254  C CA  . PHE A 1 289 ? 69.056  127.296 21.603  1.00 56.69  ? 290 PHE S CA  1 
ATOM   2255  C C   . PHE A 1 289 ? 67.855  128.077 22.125  1.00 56.69  ? 290 PHE S C   1 
ATOM   2256  O O   . PHE A 1 289 ? 67.367  127.835 23.245  1.00 22.51  ? 290 PHE S O   1 
ATOM   2257  C CB  . PHE A 1 289 ? 70.192  128.278 21.251  1.00 22.51  ? 290 PHE S CB  1 
ATOM   2258  C CG  . PHE A 1 289 ? 71.583  127.657 21.276  1.00 22.51  ? 290 PHE S CG  1 
ATOM   2259  C CD1 . PHE A 1 289 ? 71.858  126.535 22.078  1.00 22.51  ? 290 PHE S CD1 1 
ATOM   2260  C CD2 . PHE A 1 289 ? 72.611  128.171 20.469  1.00 22.51  ? 290 PHE S CD2 1 
ATOM   2261  C CE1 . PHE A 1 289 ? 73.122  125.934 22.072  1.00 22.51  ? 290 PHE S CE1 1 
ATOM   2262  C CE2 . PHE A 1 289 ? 73.876  127.578 20.458  1.00 22.51  ? 290 PHE S CE2 1 
ATOM   2263  C CZ  . PHE A 1 289 ? 74.129  126.454 21.262  1.00 22.51  ? 290 PHE S CZ  1 
ATOM   2264  N N   . TYR A 1 290 ? 67.387  129.015 21.304  1.00 2.00   ? 291 TYR S N   1 
ATOM   2265  C CA  . TYR A 1 290 ? 66.239  129.829 21.660  1.00 2.00   ? 291 TYR S CA  1 
ATOM   2266  C C   . TYR A 1 290 ? 65.060  128.933 22.022  1.00 2.00   ? 291 TYR S C   1 
ATOM   2267  O O   . TYR A 1 290 ? 64.383  129.164 23.030  1.00 30.90  ? 291 TYR S O   1 
ATOM   2268  C CB  . TYR A 1 290 ? 65.873  130.734 20.497  1.00 30.90  ? 291 TYR S CB  1 
ATOM   2269  C CG  . TYR A 1 290 ? 67.009  131.616 20.042  1.00 30.90  ? 291 TYR S CG  1 
ATOM   2270  C CD1 . TYR A 1 290 ? 67.918  131.180 19.078  1.00 30.90  ? 291 TYR S CD1 1 
ATOM   2271  C CD2 . TYR A 1 290 ? 67.163  132.908 20.550  1.00 30.90  ? 291 TYR S CD2 1 
ATOM   2272  C CE1 . TYR A 1 290 ? 68.960  132.016 18.622  1.00 30.90  ? 291 TYR S CE1 1 
ATOM   2273  C CE2 . TYR A 1 290 ? 68.194  133.754 20.108  1.00 30.90  ? 291 TYR S CE2 1 
ATOM   2274  C CZ  . TYR A 1 290 ? 69.088  133.304 19.145  1.00 30.90  ? 291 TYR S CZ  1 
ATOM   2275  O OH  . TYR A 1 290 ? 70.093  134.151 18.718  1.00 30.90  ? 291 TYR S OH  1 
ATOM   2276  N N   . TYR A 1 291 ? 64.811  127.905 21.216  1.00 77.31  ? 292 TYR S N   1 
ATOM   2277  C CA  . TYR A 1 291 ? 63.705  126.997 21.502  1.00 77.31  ? 292 TYR S CA  1 
ATOM   2278  C C   . TYR A 1 291 ? 63.802  126.583 22.968  1.00 77.31  ? 292 TYR S C   1 
ATOM   2279  O O   . TYR A 1 291 ? 62.845  126.715 23.725  1.00 90.60  ? 292 TYR S O   1 
ATOM   2280  C CB  . TYR A 1 291 ? 63.766  125.735 20.623  1.00 90.60  ? 292 TYR S CB  1 
ATOM   2281  C CG  . TYR A 1 291 ? 63.483  125.950 19.137  1.00 90.60  ? 292 TYR S CG  1 
ATOM   2282  C CD1 . TYR A 1 291 ? 63.731  127.191 18.537  1.00 90.60  ? 292 TYR S CD1 1 
ATOM   2283  C CD2 . TYR A 1 291 ? 62.979  124.889 18.372  1.00 90.60  ? 292 TYR S CD2 1 
ATOM   2284  C CE1 . TYR A 1 291 ? 63.482  127.368 17.170  1.00 90.60  ? 292 TYR S CE1 1 
ATOM   2285  C CE2 . TYR A 1 291 ? 62.735  125.065 17.005  1.00 90.60  ? 292 TYR S CE2 1 
ATOM   2286  C CZ  . TYR A 1 291 ? 62.988  126.304 16.404  1.00 90.60  ? 292 TYR S CZ  1 
ATOM   2287  O OH  . TYR A 1 291 ? 62.757  126.473 15.073  1.00 90.60  ? 292 TYR S OH  1 
ATOM   2288  N N   . LEU A 1 292 ? 64.978  126.107 23.370  1.00 2.00   ? 293 LEU S N   1 
ATOM   2289  C CA  . LEU A 1 292 ? 65.188  125.655 24.734  1.00 2.00   ? 293 LEU S CA  1 
ATOM   2290  C C   . LEU A 1 292 ? 65.030  126.715 25.783  1.00 2.00   ? 293 LEU S C   1 
ATOM   2291  O O   . LEU A 1 292 ? 64.308  126.513 26.756  1.00 23.27  ? 293 LEU S O   1 
ATOM   2292  C CB  . LEU A 1 292 ? 66.563  125.028 24.893  1.00 23.27  ? 293 LEU S CB  1 
ATOM   2293  C CG  . LEU A 1 292 ? 66.755  124.289 26.228  1.00 23.27  ? 293 LEU S CG  1 
ATOM   2294  C CD1 . LEU A 1 292 ? 65.451  123.618 26.677  1.00 23.27  ? 293 LEU S CD1 1 
ATOM   2295  C CD2 . LEU A 1 292 ? 67.867  123.255 26.073  1.00 23.27  ? 293 LEU S CD2 1 
ATOM   2296  N N   . ILE A 1 293 ? 65.717  127.836 25.609  1.00 13.44  ? 294 ILE S N   1 
ATOM   2297  C CA  . ILE A 1 293 ? 65.590  128.917 26.582  1.00 13.44  ? 294 ILE S CA  1 
ATOM   2298  C C   . ILE A 1 293 ? 64.131  129.303 26.794  1.00 13.44  ? 294 ILE S C   1 
ATOM   2299  O O   . ILE A 1 293 ? 63.797  129.942 27.787  1.00 82.08  ? 294 ILE S O   1 
ATOM   2300  C CB  . ILE A 1 293 ? 66.331  130.199 26.145  1.00 82.08  ? 294 ILE S CB  1 
ATOM   2301  C CG1 . ILE A 1 293 ? 67.786  129.880 25.805  1.00 82.08  ? 294 ILE S CG1 1 
ATOM   2302  C CG2 . ILE A 1 293 ? 66.290  131.226 27.271  1.00 82.08  ? 294 ILE S CG2 1 
ATOM   2303  C CD1 . ILE A 1 293 ? 68.607  131.106 25.416  1.00 82.08  ? 294 ILE S CD1 1 
ATOM   2304  N N   . ALA A 1 294 ? 63.257  128.903 25.868  1.00 66.81  ? 295 ALA S N   1 
ATOM   2305  C CA  . ALA A 1 294 ? 61.840  129.239 25.973  1.00 66.81  ? 295 ALA S CA  1 
ATOM   2306  C C   . ALA A 1 294 ? 60.906  128.055 26.171  1.00 66.81  ? 295 ALA S C   1 
ATOM   2307  O O   . ALA A 1 294 ? 60.085  128.050 27.077  1.00 30.30  ? 295 ALA S O   1 
ATOM   2308  C CB  . ALA A 1 294 ? 61.413  130.013 24.757  1.00 30.30  ? 295 ALA S CB  1 
ATOM   2309  N N   . GLY A 1 295 ? 61.031  127.053 25.315  1.00 8.68   ? 296 GLY S N   1 
ATOM   2310  C CA  . GLY A 1 295 ? 60.167  125.888 25.406  1.00 8.68   ? 296 GLY S CA  1 
ATOM   2311  C C   . GLY A 1 295 ? 60.462  125.042 26.612  1.00 8.68   ? 296 GLY S C   1 
ATOM   2312  O O   . GLY A 1 295 ? 59.803  124.033 26.869  1.00 11.46  ? 296 GLY S O   1 
ATOM   2313  N N   . ALA A 1 296 ? 61.474  125.462 27.354  1.00 81.84  ? 297 ALA S N   1 
ATOM   2314  C CA  . ALA A 1 296 ? 61.874  124.757 28.552  1.00 81.84  ? 297 ALA S CA  1 
ATOM   2315  C C   . ALA A 1 296 ? 60.740  124.734 29.581  1.00 81.84  ? 297 ALA S C   1 
ATOM   2316  O O   . ALA A 1 296 ? 60.102  125.763 29.862  1.00 38.68  ? 297 ALA S O   1 
ATOM   2317  C CB  . ALA A 1 296 ? 63.112  125.422 29.143  1.00 38.68  ? 297 ALA S CB  1 
ATOM   2318  N N   . SER A 1 297 ? 60.488  123.548 30.127  1.00 79.37  ? 298 SER S N   1 
ATOM   2319  C CA  . SER A 1 297 ? 59.452  123.379 31.134  1.00 79.37  ? 298 SER S CA  1 
ATOM   2320  C C   . SER A 1 297 ? 59.951  123.970 32.454  1.00 79.37  ? 298 SER S C   1 
ATOM   2321  O O   . SER A 1 297 ? 61.138  123.892 32.761  1.00 61.06  ? 298 SER S O   1 
ATOM   2322  C CB  . SER A 1 297 ? 59.138  121.890 31.321  1.00 61.06  ? 298 SER S CB  1 
ATOM   2323  O OG  . SER A 1 297 ? 59.454  121.456 32.634  1.00 61.06  ? 298 SER S OG  1 
ATOM   2324  N N   . GLU A 1 298 ? 59.047  124.565 33.225  1.00 100.00 ? 299 GLU S N   1 
ATOM   2325  C CA  . GLU A 1 298 ? 59.411  125.158 34.511  1.00 100.00 ? 299 GLU S CA  1 
ATOM   2326  C C   . GLU A 1 298 ? 60.402  124.259 35.249  1.00 100.00 ? 299 GLU S C   1 
ATOM   2327  O O   . GLU A 1 298 ? 61.508  124.674 35.597  1.00 100.00 ? 299 GLU S O   1 
ATOM   2328  C CB  . GLU A 1 298 ? 58.156  125.362 35.372  1.00 100.00 ? 299 GLU S CB  1 
ATOM   2329  C CG  . GLU A 1 298 ? 58.241  126.538 36.338  1.00 100.00 ? 299 GLU S CG  1 
ATOM   2330  C CD  . GLU A 1 298 ? 59.571  126.593 37.077  1.00 100.00 ? 299 GLU S CD  1 
ATOM   2331  O OE1 . GLU A 1 298 ? 60.562  127.075 36.477  1.00 100.00 ? 299 GLU S OE1 1 
ATOM   2332  O OE2 . GLU A 1 298 ? 59.621  126.148 38.254  1.00 100.00 ? 299 GLU S OE2 1 
ATOM   2333  N N   . GLN A 1 299 ? 59.995  123.016 35.486  1.00 66.99  ? 300 GLN S N   1 
ATOM   2334  C CA  . GLN A 1 299 ? 60.842  122.065 36.177  1.00 66.99  ? 300 GLN S CA  1 
ATOM   2335  C C   . GLN A 1 299 ? 62.188  121.934 35.471  1.00 66.99  ? 300 GLN S C   1 
ATOM   2336  O O   . GLN A 1 299 ? 63.199  122.452 35.944  1.00 100.00 ? 300 GLN S O   1 
ATOM   2337  C CB  . GLN A 1 299 ? 60.141  120.709 36.242  1.00 100.00 ? 300 GLN S CB  1 
ATOM   2338  C CG  . GLN A 1 299 ? 60.406  119.946 37.524  1.00 100.00 ? 300 GLN S CG  1 
ATOM   2339  C CD  . GLN A 1 299 ? 61.239  118.698 37.284  1.00 100.00 ? 300 GLN S CD  1 
ATOM   2340  O OE1 . GLN A 1 299 ? 61.695  118.450 36.162  1.00 100.00 ? 300 GLN S OE1 1 
ATOM   2341  N NE2 . GLN A 1 299 ? 61.446  117.907 38.337  1.00 100.00 ? 300 GLN S NE2 1 
ATOM   2342  N N   . MET A 1 300 ? 62.199  121.245 34.335  1.00 46.02  ? 301 MET S N   1 
ATOM   2343  C CA  . MET A 1 300 ? 63.424  121.059 33.571  1.00 46.02  ? 301 MET S CA  1 
ATOM   2344  C C   . MET A 1 300 ? 64.117  122.398 33.345  1.00 46.02  ? 301 MET S C   1 
ATOM   2345  O O   . MET A 1 300 ? 65.305  122.442 33.006  1.00 94.33  ? 301 MET S O   1 
ATOM   2346  C CB  . MET A 1 300 ? 63.114  120.410 32.219  1.00 94.33  ? 301 MET S CB  1 
ATOM   2347  C CG  . MET A 1 300 ? 62.649  121.396 31.148  1.00 94.33  ? 301 MET S CG  1 
ATOM   2348  S SD  . MET A 1 300 ? 63.206  120.992 29.478  1.00 94.33  ? 301 MET S SD  1 
ATOM   2349  C CE  . MET A 1 300 ? 64.649  122.019 29.331  1.00 94.33  ? 301 MET S CE  1 
ATOM   2350  N N   . ARG A 1 301 ? 63.375  123.486 33.540  1.00 2.00   ? 302 ARG S N   1 
ATOM   2351  C CA  . ARG A 1 301 ? 63.930  124.813 33.349  1.00 2.00   ? 302 ARG S CA  1 
ATOM   2352  C C   . ARG A 1 301 ? 65.198  124.903 34.178  1.00 2.00   ? 302 ARG S C   1 
ATOM   2353  O O   . ARG A 1 301 ? 66.297  125.105 33.650  1.00 100.00 ? 302 ARG S O   1 
ATOM   2354  C CB  . ARG A 1 301 ? 62.925  125.892 33.782  1.00 100.00 ? 302 ARG S CB  1 
ATOM   2355  C CG  . ARG A 1 301 ? 63.061  127.239 33.079  1.00 100.00 ? 302 ARG S CG  1 
ATOM   2356  C CD  . ARG A 1 301 ? 63.756  128.254 33.982  1.00 100.00 ? 302 ARG S CD  1 
ATOM   2357  N NE  . ARG A 1 301 ? 65.188  127.975 34.122  1.00 100.00 ? 302 ARG S NE  1 
ATOM   2358  C CZ  . ARG A 1 301 ? 65.815  127.763 35.279  1.00 100.00 ? 302 ARG S CZ  1 
ATOM   2359  N NH1 . ARG A 1 301 ? 65.143  127.797 36.426  1.00 100.00 ? 302 ARG S NH1 1 
ATOM   2360  N NH2 . ARG A 1 301 ? 67.120  127.507 35.290  1.00 100.00 ? 302 ARG S NH2 1 
ATOM   2361  N N   . ASN A 1 302 ? 65.049  124.738 35.484  1.00 90.43  ? 303 ASN S N   1 
ATOM   2362  C CA  . ASN A 1 302 ? 66.191  124.798 36.379  1.00 90.43  ? 303 ASN S CA  1 
ATOM   2363  C C   . ASN A 1 302 ? 67.098  123.594 36.168  1.00 90.43  ? 303 ASN S C   1 
ATOM   2364  O O   . ASN A 1 302 ? 68.324  123.725 36.178  1.00 100.00 ? 303 ASN S O   1 
ATOM   2365  C CB  . ASN A 1 302 ? 65.726  124.852 37.839  1.00 100.00 ? 303 ASN S CB  1 
ATOM   2366  C CG  . ASN A 1 302 ? 64.562  123.916 38.118  1.00 100.00 ? 303 ASN S CG  1 
ATOM   2367  O OD1 . ASN A 1 302 ? 64.736  122.697 38.208  1.00 100.00 ? 303 ASN S OD1 1 
ATOM   2368  N ND2 . ASN A 1 302 ? 63.365  124.482 38.256  1.00 100.00 ? 303 ASN S ND2 1 
ATOM   2369  N N   . ASP A 1 303 ? 66.488  122.428 35.964  1.00 24.42  ? 304 ASP S N   1 
ATOM   2370  C CA  . ASP A 1 303 ? 67.226  121.184 35.762  1.00 24.42  ? 304 ASP S CA  1 
ATOM   2371  C C   . ASP A 1 303 ? 68.469  121.292 34.877  1.00 24.42  ? 304 ASP S C   1 
ATOM   2372  O O   . ASP A 1 303 ? 69.375  120.458 34.965  1.00 100.00 ? 304 ASP S O   1 
ATOM   2373  C CB  . ASP A 1 303 ? 66.293  120.119 35.192  1.00 100.00 ? 304 ASP S CB  1 
ATOM   2374  C CG  . ASP A 1 303 ? 65.466  119.448 36.261  1.00 100.00 ? 304 ASP S CG  1 
ATOM   2375  O OD1 . ASP A 1 303 ? 65.209  120.094 37.301  1.00 100.00 ? 304 ASP S OD1 1 
ATOM   2376  O OD2 . ASP A 1 303 ? 65.080  118.279 36.062  1.00 100.00 ? 304 ASP S OD2 1 
ATOM   2377  N N   . LEU A 1 304 ? 68.513  122.307 34.019  1.00 66.14  ? 305 LEU S N   1 
ATOM   2378  C CA  . LEU A 1 304 ? 69.664  122.504 33.149  1.00 66.14  ? 305 LEU S CA  1 
ATOM   2379  C C   . LEU A 1 304 ? 70.223  123.895 33.377  1.00 66.14  ? 305 LEU S C   1 
ATOM   2380  O O   . LEU A 1 304 ? 71.066  124.371 32.617  1.00 59.66  ? 305 LEU S O   1 
ATOM   2381  C CB  . LEU A 1 304 ? 69.257  122.352 31.685  1.00 59.66  ? 305 LEU S CB  1 
ATOM   2382  C CG  . LEU A 1 304 ? 68.138  121.365 31.354  1.00 59.66  ? 305 LEU S CG  1 
ATOM   2383  C CD1 . LEU A 1 304 ? 67.903  121.368 29.848  1.00 59.66  ? 305 LEU S CD1 1 
ATOM   2384  C CD2 . LEU A 1 304 ? 68.517  119.973 31.835  1.00 59.66  ? 305 LEU S CD2 1 
ATOM   2385  N N   . LEU A 1 305 ? 69.741  124.542 34.433  1.00 95.83  ? 306 LEU S N   1 
ATOM   2386  C CA  . LEU A 1 305 ? 70.166  125.892 34.793  1.00 95.83  ? 306 LEU S CA  1 
ATOM   2387  C C   . LEU A 1 305 ? 69.969  126.789 33.581  1.00 95.83  ? 306 LEU S C   1 
ATOM   2388  O O   . LEU A 1 305 ? 70.912  127.379 33.041  1.00 72.49  ? 306 LEU S O   1 
ATOM   2389  C CB  . LEU A 1 305 ? 71.627  125.877 35.231  1.00 72.49  ? 306 LEU S CB  1 
ATOM   2390  C CG  . LEU A 1 305 ? 71.881  124.939 36.414  1.00 72.49  ? 306 LEU S CG  1 
ATOM   2391  C CD1 . LEU A 1 305 ? 73.109  124.070 36.161  1.00 72.49  ? 306 LEU S CD1 1 
ATOM   2392  C CD2 . LEU A 1 305 ? 72.052  125.775 37.661  1.00 72.49  ? 306 LEU S CD2 1 
ATOM   2393  N N   . LEU A 1 306 ? 68.714  126.876 33.166  1.00 96.11  ? 307 LEU S N   1 
ATOM   2394  C CA  . LEU A 1 306 ? 68.342  127.658 32.006  1.00 96.11  ? 307 LEU S CA  1 
ATOM   2395  C C   . LEU A 1 306 ? 67.794  129.036 32.352  1.00 96.11  ? 307 LEU S C   1 
ATOM   2396  O O   . LEU A 1 306 ? 66.590  129.278 32.286  1.00 100.00 ? 307 LEU S O   1 
ATOM   2397  C CB  . LEU A 1 306 ? 67.323  126.872 31.177  1.00 100.00 ? 307 LEU S CB  1 
ATOM   2398  C CG  . LEU A 1 306 ? 67.769  125.447 30.823  1.00 100.00 ? 307 LEU S CG  1 
ATOM   2399  C CD1 . LEU A 1 306 ? 66.611  124.467 30.952  1.00 100.00 ? 307 LEU S CD1 1 
ATOM   2400  C CD2 . LEU A 1 306 ? 68.317  125.442 29.410  1.00 100.00 ? 307 LEU S CD2 1 
ATOM   2401  N N   . GLU A 1 307 ? 68.691  129.938 32.728  1.00 45.31  ? 308 GLU S N   1 
ATOM   2402  C CA  . GLU A 1 307 ? 68.308  131.303 33.048  1.00 45.31  ? 308 GLU S CA  1 
ATOM   2403  C C   . GLU A 1 307 ? 67.672  131.887 31.790  1.00 45.31  ? 308 GLU S C   1 
ATOM   2404  O O   . GLU A 1 307 ? 67.859  131.357 30.693  1.00 100.00 ? 308 GLU S O   1 
ATOM   2405  C CB  . GLU A 1 307 ? 69.549  132.106 33.439  1.00 100.00 ? 308 GLU S CB  1 
ATOM   2406  C CG  . GLU A 1 307 ? 70.727  131.230 33.887  1.00 100.00 ? 308 GLU S CG  1 
ATOM   2407  C CD  . GLU A 1 307 ? 71.998  132.028 34.139  1.00 100.00 ? 308 GLU S CD  1 
ATOM   2408  O OE1 . GLU A 1 307 ? 72.131  133.134 33.571  1.00 100.00 ? 308 GLU S OE1 1 
ATOM   2409  O OE2 . GLU A 1 307 ? 72.865  131.550 34.904  1.00 100.00 ? 308 GLU S OE2 1 
ATOM   2410  N N   . GLY A 1 308 ? 66.915  132.966 31.946  1.00 93.97  ? 309 GLY S N   1 
ATOM   2411  C CA  . GLY A 1 308 ? 66.260  133.576 30.801  1.00 93.97  ? 309 GLY S CA  1 
ATOM   2412  C C   . GLY A 1 308 ? 67.195  134.072 29.712  1.00 93.97  ? 309 GLY S C   1 
ATOM   2413  O O   . GLY A 1 308 ? 68.402  133.829 29.745  1.00 5.43   ? 309 GLY S O   1 
ATOM   2414  N N   . PHE A 1 309 ? 66.636  134.780 28.737  1.00 55.58  ? 310 PHE S N   1 
ATOM   2415  C CA  . PHE A 1 309 ? 67.435  135.310 27.643  1.00 55.58  ? 310 PHE S CA  1 
ATOM   2416  C C   . PHE A 1 309 ? 68.271  136.488 28.139  1.00 55.58  ? 310 PHE S C   1 
ATOM   2417  O O   . PHE A 1 309 ? 67.909  137.157 29.108  1.00 98.39  ? 310 PHE S O   1 
ATOM   2418  C CB  . PHE A 1 309 ? 66.525  135.764 26.491  1.00 98.39  ? 310 PHE S CB  1 
ATOM   2419  C CG  . PHE A 1 309 ? 65.981  134.635 25.663  1.00 98.39  ? 310 PHE S CG  1 
ATOM   2420  C CD1 . PHE A 1 309 ? 64.852  133.940 26.073  1.00 98.39  ? 310 PHE S CD1 1 
ATOM   2421  C CD2 . PHE A 1 309 ? 66.598  134.266 24.475  1.00 98.39  ? 310 PHE S CD2 1 
ATOM   2422  C CE1 . PHE A 1 309 ? 64.342  132.889 25.312  1.00 98.39  ? 310 PHE S CE1 1 
ATOM   2423  C CE2 . PHE A 1 309 ? 66.095  133.218 23.710  1.00 98.39  ? 310 PHE S CE2 1 
ATOM   2424  C CZ  . PHE A 1 309 ? 64.965  132.528 24.130  1.00 98.39  ? 310 PHE S CZ  1 
ATOM   2425  N N   . ASN A 1 310 ? 69.389  136.731 27.471  1.00 88.43  ? 311 ASN S N   1 
ATOM   2426  C CA  . ASN A 1 310 ? 70.278  137.827 27.833  1.00 88.43  ? 311 ASN S CA  1 
ATOM   2427  C C   . ASN A 1 310 ? 70.986  137.599 29.161  1.00 88.43  ? 311 ASN S C   1 
ATOM   2428  O O   . ASN A 1 310 ? 71.545  138.525 29.757  1.00 100.00 ? 311 ASN S O   1 
ATOM   2429  C CB  . ASN A 1 310 ? 69.498  139.140 27.864  1.00 100.00 ? 311 ASN S CB  1 
ATOM   2430  C CG  . ASN A 1 310 ? 69.136  139.622 26.477  1.00 100.00 ? 311 ASN S CG  1 
ATOM   2431  O OD1 . ASN A 1 310 ? 69.293  140.803 26.152  1.00 100.00 ? 311 ASN S OD1 1 
ATOM   2432  N ND2 . ASN A 1 310 ? 68.652  138.703 25.641  1.00 100.00 ? 311 ASN S ND2 1 
ATOM   2433  N N   . ASN A 1 311 ? 70.946  136.356 29.624  1.00 100.00 ? 312 ASN S N   1 
ATOM   2434  C CA  . ASN A 1 311 ? 71.615  135.970 30.857  1.00 100.00 ? 312 ASN S CA  1 
ATOM   2435  C C   . ASN A 1 311 ? 72.811  135.147 30.386  1.00 100.00 ? 312 ASN S C   1 
ATOM   2436  O O   . ASN A 1 311 ? 73.667  134.749 31.176  1.00 100.00 ? 312 ASN S O   1 
ATOM   2437  C CB  . ASN A 1 311 ? 70.686  135.116 31.726  1.00 100.00 ? 312 ASN S CB  1 
ATOM   2438  C CG  . ASN A 1 311 ? 69.522  135.913 32.295  1.00 100.00 ? 312 ASN S CG  1 
ATOM   2439  O OD1 . ASN A 1 311 ? 68.994  135.588 33.359  1.00 100.00 ? 312 ASN S OD1 1 
ATOM   2440  N ND2 . ASN A 1 311 ? 69.121  136.961 31.588  1.00 100.00 ? 312 ASN S ND2 1 
ATOM   2441  N N   . TYR A 1 312 ? 72.843  134.911 29.073  1.00 48.59  ? 313 TYR S N   1 
ATOM   2442  C CA  . TYR A 1 312 ? 73.899  134.148 28.408  1.00 48.59  ? 313 TYR S CA  1 
ATOM   2443  C C   . TYR A 1 312 ? 74.611  135.062 27.415  1.00 48.59  ? 313 TYR S C   1 
ATOM   2444  O O   . TYR A 1 312 ? 73.978  135.877 26.740  1.00 9.24   ? 313 TYR S O   1 
ATOM   2445  C CB  . TYR A 1 312 ? 73.295  132.946 27.682  1.00 9.24   ? 313 TYR S CB  1 
ATOM   2446  C CG  . TYR A 1 312 ? 72.489  132.034 28.584  1.00 9.24   ? 313 TYR S CG  1 
ATOM   2447  C CD1 . TYR A 1 312 ? 71.400  132.513 29.310  1.00 9.24   ? 313 TYR S CD1 1 
ATOM   2448  C CD2 . TYR A 1 312 ? 72.829  130.699 28.718  1.00 9.24   ? 313 TYR S CD2 1 
ATOM   2449  C CE1 . TYR A 1 312 ? 70.678  131.680 30.148  1.00 9.24   ? 313 TYR S CE1 1 
ATOM   2450  C CE2 . TYR A 1 312 ? 72.123  129.855 29.544  1.00 9.24   ? 313 TYR S CE2 1 
ATOM   2451  C CZ  . TYR A 1 312 ? 71.050  130.342 30.261  1.00 9.24   ? 313 TYR S CZ  1 
ATOM   2452  O OH  . TYR A 1 312 ? 70.372  129.478 31.104  1.00 9.24   ? 313 TYR S OH  1 
ATOM   2453  N N   . THR A 1 313 ? 75.926  134.928 27.322  1.00 51.47  ? 314 THR S N   1 
ATOM   2454  C CA  . THR A 1 313 ? 76.696  135.795 26.439  1.00 51.47  ? 314 THR S CA  1 
ATOM   2455  C C   . THR A 1 313 ? 76.949  135.244 25.046  1.00 51.47  ? 314 THR S C   1 
ATOM   2456  O O   . THR A 1 313 ? 77.465  135.948 24.179  1.00 100.00 ? 314 THR S O   1 
ATOM   2457  C CB  . THR A 1 313 ? 78.056  136.171 27.073  1.00 100.00 ? 314 THR S CB  1 
ATOM   2458  O OG1 . THR A 1 313 ? 78.025  135.897 28.480  1.00 100.00 ? 314 THR S OG1 1 
ATOM   2459  C CG2 . THR A 1 313 ? 78.351  137.653 26.858  1.00 100.00 ? 314 THR S CG2 1 
ATOM   2460  N N   . PHE A 1 314 ? 76.587  133.988 24.827  1.00 71.00  ? 315 PHE S N   1 
ATOM   2461  C CA  . PHE A 1 314 ? 76.778  133.387 23.516  1.00 71.00  ? 315 PHE S CA  1 
ATOM   2462  C C   . PHE A 1 314 ? 75.701  133.860 22.543  1.00 71.00  ? 315 PHE S C   1 
ATOM   2463  O O   . PHE A 1 314 ? 75.778  133.592 21.348  1.00 73.39  ? 315 PHE S O   1 
ATOM   2464  C CB  . PHE A 1 314 ? 76.738  131.866 23.627  1.00 73.39  ? 315 PHE S CB  1 
ATOM   2465  C CG  . PHE A 1 314 ? 78.060  131.252 23.972  1.00 73.39  ? 315 PHE S CG  1 
ATOM   2466  C CD1 . PHE A 1 314 ? 79.237  131.773 23.444  1.00 73.39  ? 315 PHE S CD1 1 
ATOM   2467  C CD2 . PHE A 1 314 ? 78.128  130.148 24.818  1.00 73.39  ? 315 PHE S CD2 1 
ATOM   2468  C CE1 . PHE A 1 314 ? 80.458  131.204 23.748  1.00 73.39  ? 315 PHE S CE1 1 
ATOM   2469  C CE2 . PHE A 1 314 ? 79.352  129.569 25.131  1.00 73.39  ? 315 PHE S CE2 1 
ATOM   2470  C CZ  . PHE A 1 314 ? 80.518  130.098 24.596  1.00 73.39  ? 315 PHE S CZ  1 
ATOM   2471  N N   . LEU A 1 315 ? 74.705  134.568 23.067  1.00 5.49   ? 316 LEU S N   1 
ATOM   2472  C CA  . LEU A 1 315 ? 73.613  135.082 22.264  1.00 5.49   ? 316 LEU S CA  1 
ATOM   2473  C C   . LEU A 1 315 ? 73.771  136.570 22.004  1.00 5.49   ? 316 LEU S C   1 
ATOM   2474  O O   . LEU A 1 315 ? 73.262  137.398 22.750  1.00 32.71  ? 316 LEU S O   1 
ATOM   2475  C CB  . LEU A 1 315 ? 72.276  134.800 22.957  1.00 32.71  ? 316 LEU S CB  1 
ATOM   2476  C CG  . LEU A 1 315 ? 72.275  133.508 23.788  1.00 32.71  ? 316 LEU S CG  1 
ATOM   2477  C CD1 . LEU A 1 315 ? 71.588  133.762 25.115  1.00 32.71  ? 316 LEU S CD1 1 
ATOM   2478  C CD2 . LEU A 1 315 ? 71.575  132.398 23.031  1.00 32.71  ? 316 LEU S CD2 1 
ATOM   2479  N N   . SER A 1 316 ? 74.505  136.897 20.943  1.00 32.25  ? 317 SER S N   1 
ATOM   2480  C CA  . SER A 1 316 ? 74.719  138.278 20.529  1.00 32.25  ? 317 SER S CA  1 
ATOM   2481  C C   . SER A 1 316 ? 73.361  138.804 20.094  1.00 32.25  ? 317 SER S C   1 
ATOM   2482  O O   . SER A 1 316 ? 72.474  138.028 19.718  1.00 84.78  ? 317 SER S O   1 
ATOM   2483  C CB  . SER A 1 316 ? 75.693  138.331 19.355  1.00 84.78  ? 317 SER S CB  1 
ATOM   2484  O OG  . SER A 1 316 ? 75.966  137.033 18.857  1.00 84.78  ? 317 SER S OG  1 
ATOM   2485  N N   . ASN A 1 317 ? 73.196  140.121 20.125  1.00 44.98  ? 318 ASN S N   1 
ATOM   2486  C CA  . ASN A 1 317 ? 71.917  140.722 19.752  1.00 44.98  ? 318 ASN S CA  1 
ATOM   2487  C C   . ASN A 1 317 ? 70.844  140.171 20.696  1.00 44.98  ? 318 ASN S C   1 
ATOM   2488  O O   . ASN A 1 317 ? 69.678  140.057 20.322  1.00 61.22  ? 318 ASN S O   1 
ATOM   2489  C CB  . ASN A 1 317 ? 71.505  140.374 18.302  1.00 61.22  ? 318 ASN S CB  1 
ATOM   2490  C CG  . ASN A 1 317 ? 72.651  140.454 17.309  1.00 61.22  ? 318 ASN S CG  1 
ATOM   2491  O OD1 . ASN A 1 317 ? 73.002  141.538 16.827  1.00 61.22  ? 318 ASN S OD1 1 
ATOM   2492  N ND2 . ASN A 1 317 ? 73.227  139.300 16.979  1.00 61.22  ? 318 ASN S ND2 1 
ATOM   2493  N N   . GLY A 1 318 ? 71.238  139.821 21.916  1.00 100.00 ? 319 GLY S N   1 
ATOM   2494  C CA  . GLY A 1 318 ? 70.277  139.281 22.862  1.00 100.00 ? 319 GLY S CA  1 
ATOM   2495  C C   . GLY A 1 318 ? 69.290  138.325 22.212  1.00 100.00 ? 319 GLY S C   1 
ATOM   2496  O O   . GLY A 1 318 ? 69.678  137.522 21.363  1.00 2.00   ? 319 GLY S O   1 
ATOM   2497  N N   . HIS A 1 319 ? 68.022  138.408 22.604  1.00 50.80  ? 320 HIS S N   1 
ATOM   2498  C CA  . HIS A 1 319 ? 66.995  137.550 22.028  1.00 50.80  ? 320 HIS S CA  1 
ATOM   2499  C C   . HIS A 1 319 ? 66.303  138.228 20.849  1.00 50.80  ? 320 HIS S C   1 
ATOM   2500  O O   . HIS A 1 319 ? 65.501  139.146 21.038  1.00 52.46  ? 320 HIS S O   1 
ATOM   2501  C CB  . HIS A 1 319 ? 65.946  137.177 23.081  1.00 52.46  ? 320 HIS S CB  1 
ATOM   2502  C CG  . HIS A 1 319 ? 64.648  136.690 22.501  1.00 52.46  ? 320 HIS S CG  1 
ATOM   2503  N ND1 . HIS A 1 319 ? 64.031  137.297 21.425  1.00 52.46  ? 320 HIS S ND1 1 
ATOM   2504  C CD2 . HIS A 1 319 ? 63.839  135.662 22.863  1.00 52.46  ? 320 HIS S CD2 1 
ATOM   2505  C CE1 . HIS A 1 319 ? 62.905  136.667 21.151  1.00 52.46  ? 320 HIS S CE1 1 
ATOM   2506  N NE2 . HIS A 1 319 ? 62.765  135.670 22.007  1.00 52.46  ? 320 HIS S NE2 1 
ATOM   2507  N N   . VAL A 1 320 ? 66.615  137.772 19.639  1.00 24.63  ? 321 VAL S N   1 
ATOM   2508  C CA  . VAL A 1 320 ? 66.005  138.308 18.436  1.00 24.63  ? 321 VAL S CA  1 
ATOM   2509  C C   . VAL A 1 320 ? 64.885  137.349 18.056  1.00 24.63  ? 321 VAL S C   1 
ATOM   2510  O O   . VAL A 1 320 ? 65.017  136.132 18.207  1.00 30.66  ? 321 VAL S O   1 
ATOM   2511  C CB  . VAL A 1 320 ? 67.016  138.400 17.290  1.00 30.66  ? 321 VAL S CB  1 
ATOM   2512  C CG1 . VAL A 1 320 ? 66.305  138.290 15.947  1.00 30.66  ? 321 VAL S CG1 1 
ATOM   2513  C CG2 . VAL A 1 320 ? 67.755  139.705 17.376  1.00 30.66  ? 321 VAL S CG2 1 
ATOM   2514  N N   . PRO A 1 321 ? 63.773  137.884 17.551  1.00 32.62  ? 322 PRO S N   1 
ATOM   2515  C CA  . PRO A 1 321 ? 62.628  137.077 17.158  1.00 32.62  ? 322 PRO S CA  1 
ATOM   2516  C C   . PRO A 1 321 ? 62.615  136.766 15.665  1.00 32.62  ? 322 PRO S C   1 
ATOM   2517  O O   . PRO A 1 321 ? 63.214  137.478 14.849  1.00 37.34  ? 322 PRO S O   1 
ATOM   2518  C CB  . PRO A 1 321 ? 61.460  137.950 17.559  1.00 37.34  ? 322 PRO S CB  1 
ATOM   2519  C CG  . PRO A 1 321 ? 61.976  139.344 17.216  1.00 37.34  ? 322 PRO S CG  1 
ATOM   2520  C CD  . PRO A 1 321 ? 63.494  139.308 17.314  1.00 37.34  ? 322 PRO S CD  1 
ATOM   2521  N N   . ILE A 1 322 ? 61.898  135.702 15.321  1.00 51.54  ? 323 ILE S N   1 
ATOM   2522  C CA  . ILE A 1 322 ? 61.770  135.260 13.945  1.00 51.54  ? 323 ILE S CA  1 
ATOM   2523  C C   . ILE A 1 322 ? 60.330  135.434 13.447  1.00 51.54  ? 323 ILE S C   1 
ATOM   2524  O O   . ILE A 1 322 ? 59.381  134.907 14.036  1.00 75.05  ? 323 ILE S O   1 
ATOM   2525  C CB  . ILE A 1 322 ? 62.187  133.789 13.827  1.00 75.05  ? 323 ILE S CB  1 
ATOM   2526  C CG1 . ILE A 1 322 ? 62.159  133.366 12.364  1.00 75.05  ? 323 ILE S CG1 1 
ATOM   2527  C CG2 . ILE A 1 322 ? 61.297  132.915 14.706  1.00 75.05  ? 323 ILE S CG2 1 
ATOM   2528  C CD1 . ILE A 1 322 ? 63.444  132.722 11.922  1.00 75.05  ? 323 ILE S CD1 1 
ATOM   2529  N N   . PRO A 1 323 ? 60.157  136.183 12.351  1.00 37.51  ? 324 PRO S N   1 
ATOM   2530  C CA  . PRO A 1 323 ? 58.836  136.436 11.763  1.00 37.51  ? 324 PRO S CA  1 
ATOM   2531  C C   . PRO A 1 323 ? 58.040  135.191 11.417  1.00 37.51  ? 324 PRO S C   1 
ATOM   2532  O O   . PRO A 1 323 ? 58.576  134.228 10.868  1.00 93.43  ? 324 PRO S O   1 
ATOM   2533  C CB  . PRO A 1 323 ? 59.144  137.274 10.519  1.00 93.43  ? 324 PRO S CB  1 
ATOM   2534  C CG  . PRO A 1 323 ? 60.602  137.082 10.262  1.00 93.43  ? 324 PRO S CG  1 
ATOM   2535  C CD  . PRO A 1 323 ? 61.232  136.847 11.600  1.00 93.43  ? 324 PRO S CD  1 
ATOM   2536  N N   . ALA A 1 324 ? 56.755  135.223 11.753  1.00 12.14  ? 325 ALA S N   1 
ATOM   2537  C CA  . ALA A 1 324 ? 55.835  134.120 11.471  1.00 12.14  ? 325 ALA S CA  1 
ATOM   2538  C C   . ALA A 1 324 ? 56.145  132.809 12.178  1.00 12.14  ? 325 ALA S C   1 
ATOM   2539  O O   . ALA A 1 324 ? 55.451  131.807 11.985  1.00 64.90  ? 325 ALA S O   1 
ATOM   2540  C CB  . ALA A 1 324 ? 55.783  133.879 9.970   1.00 64.90  ? 325 ALA S CB  1 
ATOM   2541  N N   . GLN A 1 325 ? 57.193  132.816 12.993  1.00 91.05  ? 326 GLN S N   1 
ATOM   2542  C CA  . GLN A 1 325 ? 57.584  131.615 13.708  1.00 91.05  ? 326 GLN S CA  1 
ATOM   2543  C C   . GLN A 1 325 ? 57.581  131.858 15.212  1.00 91.05  ? 326 GLN S C   1 
ATOM   2544  O O   . GLN A 1 325 ? 58.086  132.873 15.686  1.00 99.96  ? 326 GLN S O   1 
ATOM   2545  C CB  . GLN A 1 325 ? 58.973  131.172 13.243  1.00 99.96  ? 326 GLN S CB  1 
ATOM   2546  C CG  . GLN A 1 325 ? 59.313  129.725 13.548  1.00 99.96  ? 326 GLN S CG  1 
ATOM   2547  C CD  . GLN A 1 325 ? 60.808  129.464 13.503  1.00 99.96  ? 326 GLN S CD  1 
ATOM   2548  O OE1 . GLN A 1 325 ? 61.371  129.155 12.445  1.00 99.96  ? 326 GLN S OE1 1 
ATOM   2549  N NE2 . GLN A 1 325 ? 61.465  129.582 14.658  1.00 99.96  ? 326 GLN S NE2 1 
ATOM   2550  N N   . GLN A 1 326 ? 56.990  130.928 15.956  1.00 100.00 ? 327 GLN S N   1 
ATOM   2551  C CA  . GLN A 1 326 ? 56.928  131.038 17.408  1.00 100.00 ? 327 GLN S CA  1 
ATOM   2552  C C   . GLN A 1 326 ? 57.806  129.969 18.058  1.00 100.00 ? 327 GLN S C   1 
ATOM   2553  O O   . GLN A 1 326 ? 57.438  128.794 18.123  1.00 100.00 ? 327 GLN S O   1 
ATOM   2554  C CB  . GLN A 1 326 ? 55.483  130.895 17.897  1.00 100.00 ? 327 GLN S CB  1 
ATOM   2555  C CG  . GLN A 1 326 ? 55.319  131.024 19.409  1.00 100.00 ? 327 GLN S CG  1 
ATOM   2556  C CD  . GLN A 1 326 ? 54.141  131.901 19.804  1.00 100.00 ? 327 GLN S CD  1 
ATOM   2557  O OE1 . GLN A 1 326 ? 53.948  132.991 19.256  1.00 100.00 ? 327 GLN S OE1 1 
ATOM   2558  N NE2 . GLN A 1 326 ? 53.345  131.426 20.762  1.00 100.00 ? 327 GLN S NE2 1 
ATOM   2559  N N   . ASP A 1 327 ? 58.970  130.396 18.535  1.00 70.97  ? 328 ASP S N   1 
ATOM   2560  C CA  . ASP A 1 327 ? 59.925  129.504 19.178  1.00 70.97  ? 328 ASP S CA  1 
ATOM   2561  C C   . ASP A 1 327 ? 59.251  128.724 20.299  1.00 70.97  ? 328 ASP S C   1 
ATOM   2562  O O   . ASP A 1 327 ? 59.532  127.541 20.503  1.00 72.15  ? 328 ASP S O   1 
ATOM   2563  C CB  . ASP A 1 327 ? 61.107  130.314 19.725  1.00 72.15  ? 328 ASP S CB  1 
ATOM   2564  C CG  . ASP A 1 327 ? 61.869  131.063 18.625  1.00 72.15  ? 328 ASP S CG  1 
ATOM   2565  O OD1 . ASP A 1 327 ? 61.991  130.521 17.503  1.00 72.15  ? 328 ASP S OD1 1 
ATOM   2566  O OD2 . ASP A 1 327 ? 62.345  132.191 18.880  1.00 72.15  ? 328 ASP S OD2 1 
ATOM   2567  N N   . ASP A 1 328 ? 58.351  129.397 21.009  1.00 53.62  ? 329 ASP S N   1 
ATOM   2568  C CA  . ASP A 1 328 ? 57.609  128.793 22.113  1.00 53.62  ? 329 ASP S CA  1 
ATOM   2569  C C   . ASP A 1 328 ? 57.125  127.402 21.726  1.00 53.62  ? 329 ASP S C   1 
ATOM   2570  O O   . ASP A 1 328 ? 57.483  126.408 22.357  1.00 100.00 ? 329 ASP S O   1 
ATOM   2571  C CB  . ASP A 1 328 ? 56.390  129.654 22.485  1.00 100.00 ? 329 ASP S CB  1 
ATOM   2572  C CG  . ASP A 1 328 ? 56.678  131.149 22.441  1.00 100.00 ? 329 ASP S CG  1 
ATOM   2573  O OD1 . ASP A 1 328 ? 57.548  131.597 21.658  1.00 100.00 ? 329 ASP S OD1 1 
ATOM   2574  O OD2 . ASP A 1 328 ? 56.021  131.887 23.198  1.00 100.00 ? 329 ASP S OD2 1 
ATOM   2575  N N   . GLU A 1 329 ? 56.303  127.349 20.683  1.00 100.00 ? 330 GLU S N   1 
ATOM   2576  C CA  . GLU A 1 329 ? 55.747  126.091 20.189  1.00 100.00 ? 330 GLU S CA  1 
ATOM   2577  C C   . GLU A 1 329 ? 56.821  125.292 19.469  1.00 100.00 ? 330 GLU S C   1 
ATOM   2578  O O   . GLU A 1 329 ? 56.926  124.075 19.635  1.00 91.40  ? 330 GLU S O   1 
ATOM   2579  C CB  . GLU A 1 329 ? 54.584  126.372 19.232  1.00 91.40  ? 330 GLU S CB  1 
ATOM   2580  C CG  . GLU A 1 329 ? 54.729  127.669 18.437  1.00 91.40  ? 330 GLU S CG  1 
ATOM   2581  C CD  . GLU A 1 329 ? 53.451  128.084 17.714  1.00 91.40  ? 330 GLU S CD  1 
ATOM   2582  O OE1 . GLU A 1 329 ? 52.399  128.202 18.387  1.00 91.40  ? 330 GLU S OE1 1 
ATOM   2583  O OE2 . GLU A 1 329 ? 53.501  128.296 16.477  1.00 91.40  ? 330 GLU S OE2 1 
ATOM   2584  N N   . MET A 1 330 ? 57.607  125.999 18.664  1.00 45.65  ? 331 MET S N   1 
ATOM   2585  C CA  . MET A 1 330 ? 58.690  125.403 17.903  1.00 45.65  ? 331 MET S CA  1 
ATOM   2586  C C   . MET A 1 330 ? 59.315  124.279 18.694  1.00 45.65  ? 331 MET S C   1 
ATOM   2587  O O   . MET A 1 330 ? 59.634  123.228 18.153  1.00 32.65  ? 331 MET S O   1 
ATOM   2588  C CB  . MET A 1 330 ? 59.738  126.464 17.588  1.00 32.65  ? 331 MET S CB  1 
ATOM   2589  C CG  . MET A 1 330 ? 59.532  127.091 16.229  1.00 32.65  ? 331 MET S CG  1 
ATOM   2590  S SD  . MET A 1 330 ? 58.912  125.857 15.065  1.00 32.65  ? 331 MET S SD  1 
ATOM   2591  C CE  . MET A 1 330 ? 57.724  126.790 14.148  1.00 32.65  ? 331 MET S CE  1 
ATOM   2592  N N   . PHE A 1 331 ? 59.469  124.513 19.989  1.00 31.52  ? 332 PHE S N   1 
ATOM   2593  C CA  . PHE A 1 331 ? 60.042  123.520 20.878  1.00 31.52  ? 332 PHE S CA  1 
ATOM   2594  C C   . PHE A 1 331 ? 59.305  122.194 20.715  1.00 31.52  ? 332 PHE S C   1 
ATOM   2595  O O   . PHE A 1 331 ? 59.843  121.233 20.171  1.00 36.53  ? 332 PHE S O   1 
ATOM   2596  C CB  . PHE A 1 331 ? 59.931  124.012 22.321  1.00 36.53  ? 332 PHE S CB  1 
ATOM   2597  C CG  . PHE A 1 331 ? 60.900  123.362 23.265  1.00 36.53  ? 332 PHE S CG  1 
ATOM   2598  C CD1 . PHE A 1 331 ? 62.234  123.737 23.273  1.00 36.53  ? 332 PHE S CD1 1 
ATOM   2599  C CD2 . PHE A 1 331 ? 60.467  122.386 24.160  1.00 36.53  ? 332 PHE S CD2 1 
ATOM   2600  C CE1 . PHE A 1 331 ? 63.129  123.154 24.154  1.00 36.53  ? 332 PHE S CE1 1 
ATOM   2601  C CE2 . PHE A 1 331 ? 61.348  121.793 25.051  1.00 36.53  ? 332 PHE S CE2 1 
ATOM   2602  C CZ  . PHE A 1 331 ? 62.687  122.177 25.049  1.00 36.53  ? 332 PHE S CZ  1 
ATOM   2603  N N   . GLN A 1 332 ? 58.061  122.157 21.173  1.00 28.06  ? 333 GLN S N   1 
ATOM   2604  C CA  . GLN A 1 332 ? 57.253  120.947 21.095  1.00 28.06  ? 333 GLN S CA  1 
ATOM   2605  C C   . GLN A 1 332 ? 57.344  120.279 19.736  1.00 28.06  ? 333 GLN S C   1 
ATOM   2606  O O   . GLN A 1 332 ? 57.591  119.081 19.641  1.00 100.00 ? 333 GLN S O   1 
ATOM   2607  C CB  . GLN A 1 332 ? 55.791  121.265 21.414  1.00 100.00 ? 333 GLN S CB  1 
ATOM   2608  C CG  . GLN A 1 332 ? 55.019  120.079 21.984  1.00 100.00 ? 333 GLN S CG  1 
ATOM   2609  C CD  . GLN A 1 332 ? 55.270  119.862 23.476  1.00 100.00 ? 333 GLN S CD  1 
ATOM   2610  O OE1 . GLN A 1 332 ? 55.693  120.779 24.194  1.00 100.00 ? 333 GLN S OE1 1 
ATOM   2611  N NE2 . GLN A 1 332 ? 55.007  118.639 23.949  1.00 100.00 ? 333 GLN S NE2 1 
ATOM   2612  N N   . GLU A 1 333 ? 57.145  121.068 18.685  1.00 56.31  ? 334 GLU S N   1 
ATOM   2613  C CA  . GLU A 1 333 ? 57.210  120.547 17.330  1.00 56.31  ? 334 GLU S CA  1 
ATOM   2614  C C   . GLU A 1 333 ? 58.431  119.641 17.184  1.00 56.31  ? 334 GLU S C   1 
ATOM   2615  O O   . GLU A 1 333 ? 58.325  118.474 16.796  1.00 92.94  ? 334 GLU S O   1 
ATOM   2616  C CB  . GLU A 1 333 ? 57.282  121.708 16.327  1.00 92.94  ? 334 GLU S CB  1 
ATOM   2617  C CG  . GLU A 1 333 ? 56.172  121.694 15.273  1.00 92.94  ? 334 GLU S CG  1 
ATOM   2618  C CD  . GLU A 1 333 ? 55.874  123.071 14.690  1.00 92.94  ? 334 GLU S CD  1 
ATOM   2619  O OE1 . GLU A 1 333 ? 56.666  123.536 13.839  1.00 92.94  ? 334 GLU S OE1 1 
ATOM   2620  O OE2 . GLU A 1 333 ? 54.849  123.683 15.076  1.00 92.94  ? 334 GLU S OE2 1 
ATOM   2621  N N   . THR A 1 334 ? 59.593  120.187 17.521  1.00 75.40  ? 335 THR S N   1 
ATOM   2622  C CA  . THR A 1 334 ? 60.835  119.440 17.427  1.00 75.40  ? 335 THR S CA  1 
ATOM   2623  C C   . THR A 1 334 ? 60.893  118.394 18.524  1.00 75.40  ? 335 THR S C   1 
ATOM   2624  O O   . THR A 1 334 ? 61.439  117.309 18.333  1.00 36.29  ? 335 THR S O   1 
ATOM   2625  C CB  . THR A 1 334 ? 62.055  120.356 17.566  1.00 36.29  ? 335 THR S CB  1 
ATOM   2626  O OG1 . THR A 1 334 ? 62.485  120.355 18.927  1.00 36.29  ? 335 THR S OG1 1 
ATOM   2627  C CG2 . THR A 1 334 ? 61.725  121.778 17.131  1.00 36.29  ? 335 THR S CG2 1 
ATOM   2628  N N   . LEU A 1 335 ? 60.348  118.725 19.685  1.00 41.77  ? 336 LEU S N   1 
ATOM   2629  C CA  . LEU A 1 335 ? 60.343  117.764 20.770  1.00 41.77  ? 336 LEU S CA  1 
ATOM   2630  C C   . LEU A 1 335 ? 59.554  116.588 20.224  1.00 41.77  ? 336 LEU S C   1 
ATOM   2631  O O   . LEU A 1 335 ? 60.002  115.437 20.248  1.00 26.28  ? 336 LEU S O   1 
ATOM   2632  C CB  . LEU A 1 335 ? 59.652  118.350 22.003  1.00 26.28  ? 336 LEU S CB  1 
ATOM   2633  C CG  . LEU A 1 335 ? 60.558  118.434 23.230  1.00 26.28  ? 336 LEU S CG  1 
ATOM   2634  C CD1 . LEU A 1 335 ? 61.053  117.024 23.591  1.00 26.28  ? 336 LEU S CD1 1 
ATOM   2635  C CD2 . LEU A 1 335 ? 61.738  119.354 22.935  1.00 26.28  ? 336 LEU S CD2 1 
ATOM   2636  N N   . GLU A 1 336 ? 58.376  116.910 19.702  1.00 34.48  ? 337 GLU S N   1 
ATOM   2637  C CA  . GLU A 1 336 ? 57.478  115.927 19.115  1.00 34.48  ? 337 GLU S CA  1 
ATOM   2638  C C   . GLU A 1 336 ? 58.208  115.108 18.058  1.00 34.48  ? 337 GLU S C   1 
ATOM   2639  O O   . GLU A 1 336 ? 58.080  113.886 17.988  1.00 100.00 ? 337 GLU S O   1 
ATOM   2640  C CB  . GLU A 1 336 ? 56.292  116.639 18.459  1.00 100.00 ? 337 GLU S CB  1 
ATOM   2641  C CG  . GLU A 1 336 ? 55.306  117.278 19.429  1.00 100.00 ? 337 GLU S CG  1 
ATOM   2642  C CD  . GLU A 1 336 ? 53.961  117.585 18.777  1.00 100.00 ? 337 GLU S CD  1 
ATOM   2643  O OE1 . GLU A 1 336 ? 53.202  116.631 18.488  1.00 100.00 ? 337 GLU S OE1 1 
ATOM   2644  O OE2 . GLU A 1 336 ? 53.661  118.781 18.555  1.00 100.00 ? 337 GLU S OE2 1 
ATOM   2645  N N   . ALA A 1 337 ? 58.967  115.800 17.221  1.00 59.40  ? 338 ALA S N   1 
ATOM   2646  C CA  . ALA A 1 337 ? 59.709  115.141 16.169  1.00 59.40  ? 338 ALA S CA  1 
ATOM   2647  C C   . ALA A 1 337 ? 60.633  114.109 16.789  1.00 59.40  ? 338 ALA S C   1 
ATOM   2648  O O   . ALA A 1 337 ? 60.491  112.908 16.545  1.00 2.66   ? 338 ALA S O   1 
ATOM   2649  C CB  . ALA A 1 337 ? 60.510  116.175 15.363  1.00 2.66   ? 338 ALA S CB  1 
ATOM   2650  N N   . MET A 1 338 ? 61.558  114.586 17.617  1.00 25.49  ? 339 MET S N   1 
ATOM   2651  C CA  . MET A 1 338 ? 62.530  113.717 18.271  1.00 25.49  ? 339 MET S CA  1 
ATOM   2652  C C   . MET A 1 338 ? 61.926  112.385 18.699  1.00 25.49  ? 339 MET S C   1 
ATOM   2653  O O   . MET A 1 338 ? 62.531  111.332 18.499  1.00 48.20  ? 339 MET S O   1 
ATOM   2654  C CB  . MET A 1 338 ? 63.151  114.429 19.475  1.00 48.20  ? 339 MET S CB  1 
ATOM   2655  C CG  . MET A 1 338 ? 64.125  115.539 19.087  1.00 48.20  ? 339 MET S CG  1 
ATOM   2656  S SD  . MET A 1 338 ? 65.261  116.065 20.387  1.00 48.20  ? 339 MET S SD  1 
ATOM   2657  C CE  . MET A 1 338 ? 64.325  117.421 21.169  1.00 48.20  ? 339 MET S CE  1 
ATOM   2658  N N   . THR A 1 339 ? 60.727  112.432 19.272  1.00 100.00 ? 340 THR S N   1 
ATOM   2659  C CA  . THR A 1 339 ? 60.051  111.220 19.723  1.00 100.00 ? 340 THR S CA  1 
ATOM   2660  C C   . THR A 1 339 ? 59.679  110.350 18.528  1.00 100.00 ? 340 THR S C   1 
ATOM   2661  O O   . THR A 1 339 ? 59.970  109.153 18.505  1.00 63.33  ? 340 THR S O   1 
ATOM   2662  C CB  . THR A 1 339 ? 58.774  111.554 20.526  1.00 63.33  ? 340 THR S CB  1 
ATOM   2663  O OG1 . THR A 1 339 ? 58.014  112.549 19.831  1.00 63.33  ? 340 THR S OG1 1 
ATOM   2664  C CG2 . THR A 1 339 ? 59.130  112.087 21.896  1.00 63.33  ? 340 THR S CG2 1 
ATOM   2665  N N   . ILE A 1 340 ? 59.032  110.966 17.541  1.00 72.17  ? 341 ILE S N   1 
ATOM   2666  C CA  . ILE A 1 340 ? 58.628  110.269 16.332  1.00 72.17  ? 341 ILE S CA  1 
ATOM   2667  C C   . ILE A 1 340 ? 59.845  109.528 15.815  1.00 72.17  ? 341 ILE S C   1 
ATOM   2668  O O   . ILE A 1 340 ? 59.780  108.336 15.482  1.00 40.48  ? 341 ILE S O   1 
ATOM   2669  C CB  . ILE A 1 340 ? 58.195  111.256 15.236  1.00 40.48  ? 341 ILE S CB  1 
ATOM   2670  C CG1 . ILE A 1 340 ? 57.009  112.080 15.716  1.00 40.48  ? 341 ILE S CG1 1 
ATOM   2671  C CG2 . ILE A 1 340 ? 57.857  110.496 13.968  1.00 40.48  ? 341 ILE S CG2 1 
ATOM   2672  C CD1 . ILE A 1 340 ? 55.709  111.317 15.720  1.00 40.48  ? 341 ILE S CD1 1 
ATOM   2673  N N   . MET A 1 341 ? 60.951  110.266 15.755  1.00 2.00   ? 342 MET S N   1 
ATOM   2674  C CA  . MET A 1 341 ? 62.214  109.736 15.278  1.00 2.00   ? 342 MET S CA  1 
ATOM   2675  C C   . MET A 1 341 ? 62.622  108.517 16.108  1.00 2.00   ? 342 MET S C   1 
ATOM   2676  O O   . MET A 1 341 ? 62.833  107.436 15.561  1.00 19.92  ? 342 MET S O   1 
ATOM   2677  C CB  . MET A 1 341 ? 63.300  110.818 15.346  1.00 19.92  ? 342 MET S CB  1 
ATOM   2678  C CG  . MET A 1 341 ? 63.857  111.263 13.990  1.00 19.92  ? 342 MET S CG  1 
ATOM   2679  S SD  . MET A 1 341 ? 64.225  109.916 12.789  1.00 19.92  ? 342 MET S SD  1 
ATOM   2680  C CE  . MET A 1 341 ? 65.035  108.706 13.800  1.00 19.92  ? 342 MET S CE  1 
ATOM   2681  N N   . GLY A 1 342 ? 62.734  108.689 17.426  1.00 100.00 ? 343 GLY S N   1 
ATOM   2682  C CA  . GLY A 1 342 ? 63.112  107.569 18.282  1.00 100.00 ? 343 GLY S CA  1 
ATOM   2683  C C   . GLY A 1 342 ? 63.860  107.872 19.578  1.00 100.00 ? 343 GLY S C   1 
ATOM   2684  O O   . GLY A 1 342 ? 63.993  106.994 20.440  1.00 49.66  ? 343 GLY S O   1 
ATOM   2685  N N   . PHE A 1 343 ? 64.346  109.103 19.724  1.00 42.86  ? 344 PHE S N   1 
ATOM   2686  C CA  . PHE A 1 343 ? 65.082  109.502 20.915  1.00 42.86  ? 344 PHE S CA  1 
ATOM   2687  C C   . PHE A 1 343 ? 64.327  109.251 22.216  1.00 42.86  ? 344 PHE S C   1 
ATOM   2688  O O   . PHE A 1 343 ? 63.351  109.933 22.516  1.00 34.55  ? 344 PHE S O   1 
ATOM   2689  C CB  . PHE A 1 343 ? 65.454  110.977 20.811  1.00 34.55  ? 344 PHE S CB  1 
ATOM   2690  C CG  . PHE A 1 343 ? 66.337  111.285 19.655  1.00 34.55  ? 344 PHE S CG  1 
ATOM   2691  C CD1 . PHE A 1 343 ? 66.805  110.261 18.835  1.00 34.55  ? 344 PHE S CD1 1 
ATOM   2692  C CD2 . PHE A 1 343 ? 66.719  112.590 19.390  1.00 34.55  ? 344 PHE S CD2 1 
ATOM   2693  C CE1 . PHE A 1 343 ? 67.643  110.533 17.768  1.00 34.55  ? 344 PHE S CE1 1 
ATOM   2694  C CE2 . PHE A 1 343 ? 67.556  112.880 18.324  1.00 34.55  ? 344 PHE S CE2 1 
ATOM   2695  C CZ  . PHE A 1 343 ? 68.022  111.846 17.509  1.00 34.55  ? 344 PHE S CZ  1 
ATOM   2696  N N   . THR A 1 344 ? 64.797  108.273 22.989  1.00 55.90  ? 345 THR S N   1 
ATOM   2697  C CA  . THR A 1 344 ? 64.195  107.908 24.269  1.00 55.90  ? 345 THR S CA  1 
ATOM   2698  C C   . THR A 1 344 ? 63.770  109.119 25.075  1.00 55.90  ? 345 THR S C   1 
ATOM   2699  O O   . THR A 1 344 ? 64.414  110.166 25.041  1.00 54.57  ? 345 THR S O   1 
ATOM   2700  C CB  . THR A 1 344 ? 65.169  107.098 25.139  1.00 54.57  ? 345 THR S CB  1 
ATOM   2701  O OG1 . THR A 1 344 ? 65.653  105.975 24.394  1.00 54.57  ? 345 THR S OG1 1 
ATOM   2702  C CG2 . THR A 1 344 ? 64.482  106.622 26.410  1.00 54.57  ? 345 THR S CG2 1 
ATOM   2703  N N   . GLU A 1 345 ? 62.676  108.961 25.804  1.00 35.06  ? 346 GLU S N   1 
ATOM   2704  C CA  . GLU A 1 345 ? 62.131  110.021 26.635  1.00 35.06  ? 346 GLU S CA  1 
ATOM   2705  C C   . GLU A 1 345 ? 63.246  110.864 27.263  1.00 35.06  ? 346 GLU S C   1 
ATOM   2706  O O   . GLU A 1 345 ? 63.320  112.076 27.056  1.00 100.00 ? 346 GLU S O   1 
ATOM   2707  C CB  . GLU A 1 345 ? 61.255  109.397 27.727  1.00 100.00 ? 346 GLU S CB  1 
ATOM   2708  C CG  . GLU A 1 345 ? 61.637  107.947 28.090  1.00 100.00 ? 346 GLU S CG  1 
ATOM   2709  C CD  . GLU A 1 345 ? 60.888  106.897 27.271  1.00 100.00 ? 346 GLU S CD  1 
ATOM   2710  O OE1 . GLU A 1 345 ? 61.134  106.807 26.047  1.00 100.00 ? 346 GLU S OE1 1 
ATOM   2711  O OE2 . GLU A 1 345 ? 60.058  106.156 27.856  1.00 100.00 ? 346 GLU S OE2 1 
ATOM   2712  N N   . GLU A 1 346 ? 64.110  110.207 28.027  1.00 100.00 ? 347 GLU S N   1 
ATOM   2713  C CA  . GLU A 1 346 ? 65.217  110.886 28.687  1.00 100.00 ? 347 GLU S CA  1 
ATOM   2714  C C   . GLU A 1 346 ? 66.323  111.155 27.682  1.00 100.00 ? 347 GLU S C   1 
ATOM   2715  O O   . GLU A 1 346 ? 67.013  112.172 27.752  1.00 100.00 ? 347 GLU S O   1 
ATOM   2716  C CB  . GLU A 1 346 ? 65.764  110.024 29.832  1.00 100.00 ? 347 GLU S CB  1 
ATOM   2717  C CG  . GLU A 1 346 ? 65.626  108.515 29.609  1.00 100.00 ? 347 GLU S CG  1 
ATOM   2718  C CD  . GLU A 1 346 ? 66.962  107.824 29.348  1.00 100.00 ? 347 GLU S CD  1 
ATOM   2719  O OE1 . GLU A 1 346 ? 67.428  107.844 28.182  1.00 100.00 ? 347 GLU S OE1 1 
ATOM   2720  O OE2 . GLU A 1 346 ? 67.544  107.258 30.306  1.00 100.00 ? 347 GLU S OE2 1 
ATOM   2721  N N   . GLU A 1 347 ? 66.481  110.231 26.740  1.00 45.93  ? 348 GLU S N   1 
ATOM   2722  C CA  . GLU A 1 347 ? 67.500  110.347 25.710  1.00 45.93  ? 348 GLU S CA  1 
ATOM   2723  C C   . GLU A 1 347 ? 67.481  111.747 25.137  1.00 45.93  ? 348 GLU S C   1 
ATOM   2724  O O   . GLU A 1 347 ? 68.403  112.156 24.438  1.00 100.00 ? 348 GLU S O   1 
ATOM   2725  C CB  . GLU A 1 347 ? 67.240  109.330 24.599  1.00 100.00 ? 348 GLU S CB  1 
ATOM   2726  C CG  . GLU A 1 347 ? 68.292  109.301 23.509  1.00 100.00 ? 348 GLU S CG  1 
ATOM   2727  C CD  . GLU A 1 347 ? 68.035  108.212 22.485  1.00 100.00 ? 348 GLU S CD  1 
ATOM   2728  O OE1 . GLU A 1 347 ? 67.775  107.058 22.894  1.00 100.00 ? 348 GLU S OE1 1 
ATOM   2729  O OE2 . GLU A 1 347 ? 68.094  108.517 21.271  1.00 100.00 ? 348 GLU S OE2 1 
ATOM   2730  N N   . GLN A 1 348 ? 66.425  112.484 25.445  1.00 2.00   ? 349 GLN S N   1 
ATOM   2731  C CA  . GLN A 1 348 ? 66.292  113.833 24.937  1.00 2.00   ? 349 GLN S CA  1 
ATOM   2732  C C   . GLN A 1 348 ? 66.693  114.825 26.000  1.00 2.00   ? 349 GLN S C   1 
ATOM   2733  O O   . GLN A 1 348 ? 67.559  115.673 25.782  1.00 53.80  ? 349 GLN S O   1 
ATOM   2734  C CB  . GLN A 1 348 ? 64.849  114.101 24.505  1.00 53.80  ? 349 GLN S CB  1 
ATOM   2735  C CG  . GLN A 1 348 ? 64.297  113.113 23.491  1.00 53.80  ? 349 GLN S CG  1 
ATOM   2736  C CD  . GLN A 1 348 ? 62.798  113.227 23.358  1.00 53.80  ? 349 GLN S CD  1 
ATOM   2737  O OE1 . GLN A 1 348 ? 62.279  114.270 22.962  1.00 53.80  ? 349 GLN S OE1 1 
ATOM   2738  N NE2 . GLN A 1 348 ? 62.088  112.157 23.697  1.00 53.80  ? 349 GLN S NE2 1 
ATOM   2739  N N   . THR A 1 349 ? 66.046  114.724 27.152  1.00 89.00  ? 350 THR S N   1 
ATOM   2740  C CA  . THR A 1 349 ? 66.332  115.609 28.275  1.00 89.00  ? 350 THR S CA  1 
ATOM   2741  C C   . THR A 1 349 ? 67.832  115.887 28.283  1.00 89.00  ? 350 THR S C   1 
ATOM   2742  O O   . THR A 1 349 ? 68.286  117.018 28.496  1.00 66.06  ? 350 THR S O   1 
ATOM   2743  C CB  . THR A 1 349 ? 65.928  114.934 29.601  1.00 66.06  ? 350 THR S CB  1 
ATOM   2744  O OG1 . THR A 1 349 ? 66.614  113.679 29.722  1.00 66.06  ? 350 THR S OG1 1 
ATOM   2745  C CG2 . THR A 1 349 ? 64.428  114.679 29.638  1.00 66.06  ? 350 THR S CG2 1 
ATOM   2746  N N   . SER A 1 350 ? 68.589  114.827 28.033  1.00 66.34  ? 351 SER S N   1 
ATOM   2747  C CA  . SER A 1 350 ? 70.033  114.903 27.989  1.00 66.34  ? 351 SER S CA  1 
ATOM   2748  C C   . SER A 1 350 ? 70.469  115.853 26.886  1.00 66.34  ? 351 SER S C   1 
ATOM   2749  O O   . SER A 1 350 ? 71.080  116.886 27.161  1.00 71.14  ? 351 SER S O   1 
ATOM   2750  C CB  . SER A 1 350 ? 70.621  113.512 27.744  1.00 71.14  ? 351 SER S CB  1 
ATOM   2751  O OG  . SER A 1 350 ? 69.684  112.504 28.073  1.00 71.14  ? 351 SER S OG  1 
ATOM   2752  N N   . ILE A 1 351 ? 70.143  115.509 25.640  1.00 100.00 ? 352 ILE S N   1 
ATOM   2753  C CA  . ILE A 1 351 ? 70.526  116.336 24.497  1.00 100.00 ? 352 ILE S CA  1 
ATOM   2754  C C   . ILE A 1 351 ? 70.171  117.791 24.747  1.00 100.00 ? 352 ILE S C   1 
ATOM   2755  O O   . ILE A 1 351 ? 70.587  118.660 23.999  1.00 60.79  ? 352 ILE S O   1 
ATOM   2756  C CB  . ILE A 1 351 ? 69.833  115.899 23.169  1.00 60.79  ? 352 ILE S CB  1 
ATOM   2757  C CG1 . ILE A 1 351 ? 69.541  114.401 23.180  1.00 60.79  ? 352 ILE S CG1 1 
ATOM   2758  C CG2 . ILE A 1 351 ? 70.731  116.244 21.990  1.00 60.79  ? 352 ILE S CG2 1 
ATOM   2759  C CD1 . ILE A 1 351 ? 69.153  113.838 21.827  1.00 60.79  ? 352 ILE S CD1 1 
ATOM   2760  N N   . LEU A 1 352 ? 69.405  118.057 25.798  1.00 31.22  ? 353 LEU S N   1 
ATOM   2761  C CA  . LEU A 1 352 ? 69.035  119.427 26.100  1.00 31.22  ? 353 LEU S CA  1 
ATOM   2762  C C   . LEU A 1 352 ? 70.002  120.059 27.107  1.00 31.22  ? 353 LEU S C   1 
ATOM   2763  O O   . LEU A 1 352 ? 70.469  121.190 26.907  1.00 10.94  ? 353 LEU S O   1 
ATOM   2764  C CB  . LEU A 1 352 ? 67.597  119.475 26.609  1.00 10.94  ? 353 LEU S CB  1 
ATOM   2765  C CG  . LEU A 1 352 ? 66.547  119.326 25.501  1.00 10.94  ? 353 LEU S CG  1 
ATOM   2766  C CD1 . LEU A 1 352 ? 65.409  118.420 25.972  1.00 10.94  ? 353 LEU S CD1 1 
ATOM   2767  C CD2 . LEU A 1 352 ? 66.018  120.696 25.120  1.00 10.94  ? 353 LEU S CD2 1 
ATOM   2768  N N   . ARG A 1 353 ? 70.319  119.336 28.178  1.00 84.74  ? 354 ARG S N   1 
ATOM   2769  C CA  . ARG A 1 353 ? 71.253  119.870 29.165  1.00 84.74  ? 354 ARG S CA  1 
ATOM   2770  C C   . ARG A 1 353 ? 72.553  120.226 28.441  1.00 84.74  ? 354 ARG S C   1 
ATOM   2771  O O   . ARG A 1 353 ? 73.095  121.317 28.606  1.00 99.69  ? 354 ARG S O   1 
ATOM   2772  C CB  . ARG A 1 353 ? 71.522  118.842 30.269  1.00 99.69  ? 354 ARG S CB  1 
ATOM   2773  C CG  . ARG A 1 353 ? 72.072  117.513 29.786  1.00 99.69  ? 354 ARG S CG  1 
ATOM   2774  C CD  . ARG A 1 353 ? 72.416  116.600 30.960  1.00 99.69  ? 354 ARG S CD  1 
ATOM   2775  N NE  . ARG A 1 353 ? 71.242  116.226 31.748  1.00 99.69  ? 354 ARG S NE  1 
ATOM   2776  C CZ  . ARG A 1 353 ? 70.984  116.672 32.975  1.00 99.69  ? 354 ARG S CZ  1 
ATOM   2777  N NH1 . ARG A 1 353 ? 71.821  117.513 33.573  1.00 99.69  ? 354 ARG S NH1 1 
ATOM   2778  N NH2 . ARG A 1 353 ? 69.888  116.276 33.610  1.00 99.69  ? 354 ARG S NH2 1 
ATOM   2779  N N   . VAL A 1 354 ? 73.035  119.295 27.625  1.00 2.00   ? 355 VAL S N   1 
ATOM   2780  C CA  . VAL A 1 354 ? 74.248  119.502 26.846  1.00 2.00   ? 355 VAL S CA  1 
ATOM   2781  C C   . VAL A 1 354 ? 74.159  120.799 26.052  1.00 2.00   ? 355 VAL S C   1 
ATOM   2782  O O   . VAL A 1 354 ? 75.168  121.317 25.573  1.00 14.91  ? 355 VAL S O   1 
ATOM   2783  C CB  . VAL A 1 354 ? 74.465  118.348 25.860  1.00 14.91  ? 355 VAL S CB  1 
ATOM   2784  C CG1 . VAL A 1 354 ? 75.750  118.566 25.054  1.00 14.91  ? 355 VAL S CG1 1 
ATOM   2785  C CG2 . VAL A 1 354 ? 74.498  117.026 26.635  1.00 14.91  ? 355 VAL S CG2 1 
ATOM   2786  N N   . VAL A 1 355 ? 72.947  121.320 25.896  1.00 57.32  ? 356 VAL S N   1 
ATOM   2787  C CA  . VAL A 1 355 ? 72.778  122.560 25.163  1.00 57.32  ? 356 VAL S CA  1 
ATOM   2788  C C   . VAL A 1 355 ? 73.032  123.688 26.131  1.00 57.32  ? 356 VAL S C   1 
ATOM   2789  O O   . VAL A 1 355 ? 73.886  124.545 25.891  1.00 12.09  ? 356 VAL S O   1 
ATOM   2790  C CB  . VAL A 1 355 ? 71.363  122.710 24.604  1.00 12.09  ? 356 VAL S CB  1 
ATOM   2791  C CG1 . VAL A 1 355 ? 71.344  123.798 23.562  1.00 12.09  ? 356 VAL S CG1 1 
ATOM   2792  C CG2 . VAL A 1 355 ? 70.909  121.415 24.003  1.00 12.09  ? 356 VAL S CG2 1 
ATOM   2793  N N   . SER A 1 356 ? 72.290  123.674 27.235  1.00 29.75  ? 357 SER S N   1 
ATOM   2794  C CA  . SER A 1 356 ? 72.445  124.704 28.251  1.00 29.75  ? 357 SER S CA  1 
ATOM   2795  C C   . SER A 1 356 ? 73.925  124.789 28.573  1.00 29.75  ? 357 SER S C   1 
ATOM   2796  O O   . SER A 1 356 ? 74.502  125.875 28.679  1.00 55.22  ? 357 SER S O   1 
ATOM   2797  C CB  . SER A 1 356 ? 71.658  124.332 29.511  1.00 55.22  ? 357 SER S CB  1 
ATOM   2798  O OG  . SER A 1 356 ? 71.310  122.960 29.494  1.00 55.22  ? 357 SER S OG  1 
ATOM   2799  N N   . SER A 1 357 ? 74.532  123.618 28.716  1.00 11.75  ? 358 SER S N   1 
ATOM   2800  C CA  . SER A 1 357 ? 75.942  123.529 29.020  1.00 11.75  ? 358 SER S CA  1 
ATOM   2801  C C   . SER A 1 357 ? 76.694  124.385 28.009  1.00 11.75  ? 358 SER S C   1 
ATOM   2802  O O   . SER A 1 357 ? 77.391  125.325 28.380  1.00 15.90  ? 358 SER S O   1 
ATOM   2803  C CB  . SER A 1 357 ? 76.397  122.064 28.959  1.00 15.90  ? 358 SER S CB  1 
ATOM   2804  O OG  . SER A 1 357 ? 77.235  121.834 27.846  1.00 15.90  ? 358 SER S OG  1 
ATOM   2805  N N   . VAL A 1 358 ? 76.514  124.081 26.731  1.00 41.70  ? 359 VAL S N   1 
ATOM   2806  C CA  . VAL A 1 358 ? 77.180  124.822 25.664  1.00 41.70  ? 359 VAL S CA  1 
ATOM   2807  C C   . VAL A 1 358 ? 76.898  126.327 25.719  1.00 41.70  ? 359 VAL S C   1 
ATOM   2808  O O   . VAL A 1 358 ? 77.464  127.116 24.956  1.00 9.89   ? 359 VAL S O   1 
ATOM   2809  C CB  . VAL A 1 358 ? 76.751  124.263 24.296  1.00 9.89   ? 359 VAL S CB  1 
ATOM   2810  C CG1 . VAL A 1 358 ? 77.044  125.268 23.195  1.00 9.89   ? 359 VAL S CG1 1 
ATOM   2811  C CG2 . VAL A 1 358 ? 77.487  122.954 24.029  1.00 9.89   ? 359 VAL S CG2 1 
ATOM   2812  N N   . LEU A 1 359 ? 76.025  126.730 26.633  1.00 12.42  ? 360 LEU S N   1 
ATOM   2813  C CA  . LEU A 1 359 ? 75.701  128.136 26.752  1.00 12.42  ? 360 LEU S CA  1 
ATOM   2814  C C   . LEU A 1 359 ? 76.309  128.732 28.025  1.00 12.42  ? 360 LEU S C   1 
ATOM   2815  O O   . LEU A 1 359 ? 76.855  129.845 27.997  1.00 40.81  ? 360 LEU S O   1 
ATOM   2816  C CB  . LEU A 1 359 ? 74.174  128.321 26.733  1.00 40.81  ? 360 LEU S CB  1 
ATOM   2817  C CG  . LEU A 1 359 ? 73.489  128.397 25.356  1.00 40.81  ? 360 LEU S CG  1 
ATOM   2818  C CD1 . LEU A 1 359 ? 72.451  127.282 25.250  1.00 40.81  ? 360 LEU S CD1 1 
ATOM   2819  C CD2 . LEU A 1 359 ? 72.837  129.782 25.151  1.00 40.81  ? 360 LEU S CD2 1 
ATOM   2820  N N   . GLN A 1 360 ? 76.216  127.989 29.134  1.00 42.30  ? 361 GLN S N   1 
ATOM   2821  C CA  . GLN A 1 360 ? 76.743  128.425 30.440  1.00 42.30  ? 361 GLN S CA  1 
ATOM   2822  C C   . GLN A 1 360 ? 78.233  128.680 30.309  1.00 42.30  ? 361 GLN S C   1 
ATOM   2823  O O   . GLN A 1 360 ? 78.759  129.704 30.737  1.00 29.65  ? 361 GLN S O   1 
ATOM   2824  C CB  . GLN A 1 360 ? 76.484  127.339 31.493  1.00 29.65  ? 361 GLN S CB  1 
ATOM   2825  C CG  . GLN A 1 360 ? 76.694  127.786 32.941  1.00 29.65  ? 361 GLN S CG  1 
ATOM   2826  C CD  . GLN A 1 360 ? 75.535  128.612 33.478  1.00 29.65  ? 361 GLN S CD  1 
ATOM   2827  O OE1 . GLN A 1 360 ? 74.367  128.262 33.293  1.00 29.65  ? 361 GLN S OE1 1 
ATOM   2828  N NE2 . GLN A 1 360 ? 75.853  129.718 34.150  1.00 29.65  ? 361 GLN S NE2 1 
ATOM   2829  N N   . LEU A 1 361 ? 78.902  127.715 29.697  1.00 2.00   ? 362 LEU S N   1 
ATOM   2830  C CA  . LEU A 1 361 ? 80.328  127.763 29.452  1.00 2.00   ? 362 LEU S CA  1 
ATOM   2831  C C   . LEU A 1 361 ? 80.698  129.095 28.839  1.00 2.00   ? 362 LEU S C   1 
ATOM   2832  O O   . LEU A 1 361 ? 81.865  129.371 28.584  1.00 29.36  ? 362 LEU S O   1 
ATOM   2833  C CB  . LEU A 1 361 ? 80.704  126.649 28.484  1.00 29.36  ? 362 LEU S CB  1 
ATOM   2834  C CG  . LEU A 1 361 ? 81.851  125.733 28.887  1.00 29.36  ? 362 LEU S CG  1 
ATOM   2835  C CD1 . LEU A 1 361 ? 81.389  124.272 28.942  1.00 29.36  ? 362 LEU S CD1 1 
ATOM   2836  C CD2 . LEU A 1 361 ? 82.965  125.919 27.864  1.00 29.36  ? 362 LEU S CD2 1 
ATOM   2837  N N   . GLY A 1 362 ? 79.688  129.910 28.574  1.00 37.88  ? 363 GLY S N   1 
ATOM   2838  C CA  . GLY A 1 362 ? 79.917  131.206 27.974  1.00 37.88  ? 363 GLY S CA  1 
ATOM   2839  C C   . GLY A 1 362 ? 79.985  132.276 29.027  1.00 37.88  ? 363 GLY S C   1 
ATOM   2840  O O   . GLY A 1 362 ? 80.585  133.331 28.822  1.00 38.50  ? 363 GLY S O   1 
ATOM   2841  N N   . ASN A 1 363 ? 79.360  132.004 30.163  1.00 49.28  ? 364 ASN S N   1 
ATOM   2842  C CA  . ASN A 1 363 ? 79.355  132.956 31.267  1.00 49.28  ? 364 ASN S CA  1 
ATOM   2843  C C   . ASN A 1 363 ? 80.742  132.994 31.902  1.00 49.28  ? 364 ASN S C   1 
ATOM   2844  O O   . ASN A 1 363 ? 81.241  134.059 32.282  1.00 100.00 ? 364 ASN S O   1 
ATOM   2845  C CB  . ASN A 1 363 ? 78.314  132.544 32.312  1.00 100.00 ? 364 ASN S CB  1 
ATOM   2846  C CG  . ASN A 1 363 ? 76.942  132.321 31.711  1.00 100.00 ? 364 ASN S CG  1 
ATOM   2847  O OD1 . ASN A 1 363 ? 76.741  132.499 30.508  1.00 100.00 ? 364 ASN S OD1 1 
ATOM   2848  N ND2 . ASN A 1 363 ? 75.985  131.926 32.546  1.00 100.00 ? 364 ASN S ND2 1 
ATOM   2849  N N   . ILE A 1 364 ? 81.359  131.818 32.008  1.00 94.43  ? 365 ILE S N   1 
ATOM   2850  C CA  . ILE A 1 364 ? 82.690  131.664 32.592  1.00 94.43  ? 365 ILE S CA  1 
ATOM   2851  C C   . ILE A 1 364 ? 83.597  132.829 32.210  1.00 94.43  ? 365 ILE S C   1 
ATOM   2852  O O   . ILE A 1 364 ? 83.785  133.128 31.025  1.00 24.20  ? 365 ILE S O   1 
ATOM   2853  C CB  . ILE A 1 364 ? 83.327  130.329 32.138  1.00 24.20  ? 365 ILE S CB  1 
ATOM   2854  C CG1 . ILE A 1 364 ? 83.017  129.232 33.165  1.00 24.20  ? 365 ILE S CG1 1 
ATOM   2855  C CG2 . ILE A 1 364 ? 84.825  130.495 31.938  1.00 24.20  ? 365 ILE S CG2 1 
ATOM   2856  C CD1 . ILE A 1 364 ? 83.113  127.805 32.614  1.00 24.20  ? 365 ILE S CD1 1 
ATOM   2857  N N   . VAL A 1 365 ? 84.161  133.477 33.225  1.00 53.06  ? 366 VAL S N   1 
ATOM   2858  C CA  . VAL A 1 365 ? 85.032  134.632 33.011  1.00 53.06  ? 366 VAL S CA  1 
ATOM   2859  C C   . VAL A 1 365 ? 86.493  134.454 33.397  1.00 53.06  ? 366 VAL S C   1 
ATOM   2860  O O   . VAL A 1 365 ? 86.844  133.594 34.206  1.00 93.12  ? 366 VAL S O   1 
ATOM   2861  C CB  . VAL A 1 365 ? 84.518  135.868 33.769  1.00 93.12  ? 366 VAL S CB  1 
ATOM   2862  C CG1 . VAL A 1 365 ? 84.622  137.101 32.869  1.00 93.12  ? 366 VAL S CG1 1 
ATOM   2863  C CG2 . VAL A 1 365 ? 83.085  135.633 34.247  1.00 93.12  ? 366 VAL S CG2 1 
ATOM   2864  N N   . PHE A 1 366 ? 87.336  135.300 32.814  1.00 87.63  ? 367 PHE S N   1 
ATOM   2865  C CA  . PHE A 1 366 ? 88.767  135.268 33.080  1.00 87.63  ? 367 PHE S CA  1 
ATOM   2866  C C   . PHE A 1 366 ? 89.329  136.675 32.965  1.00 87.63  ? 367 PHE S C   1 
ATOM   2867  O O   . PHE A 1 366 ? 89.728  137.112 31.883  1.00 50.32  ? 367 PHE S O   1 
ATOM   2868  C CB  . PHE A 1 366 ? 89.471  134.340 32.086  1.00 50.32  ? 367 PHE S CB  1 
ATOM   2869  C CG  . PHE A 1 366 ? 89.114  132.890 32.261  1.00 50.32  ? 367 PHE S CG  1 
ATOM   2870  C CD1 . PHE A 1 366 ? 89.315  132.260 33.486  1.00 50.32  ? 367 PHE S CD1 1 
ATOM   2871  C CD2 . PHE A 1 366 ? 88.577  132.155 31.208  1.00 50.32  ? 367 PHE S CD2 1 
ATOM   2872  C CE1 . PHE A 1 366 ? 88.986  130.919 33.656  1.00 50.32  ? 367 PHE S CE1 1 
ATOM   2873  C CE2 . PHE A 1 366 ? 88.247  130.818 31.367  1.00 50.32  ? 367 PHE S CE2 1 
ATOM   2874  C CZ  . PHE A 1 366 ? 88.451  130.196 32.594  1.00 50.32  ? 367 PHE S CZ  1 
ATOM   2875  N N   . LYS A 1 367 ? 89.352  137.379 34.094  1.00 99.47  ? 368 LYS S N   1 
ATOM   2876  C CA  . LYS A 1 367 ? 89.860  138.747 34.143  1.00 99.47  ? 368 LYS S CA  1 
ATOM   2877  C C   . LYS A 1 367 ? 91.361  138.762 34.371  1.00 99.47  ? 368 LYS S C   1 
ATOM   2878  O O   . LYS A 1 367 ? 91.877  138.096 35.271  1.00 100.00 ? 368 LYS S O   1 
ATOM   2879  C CB  . LYS A 1 367 ? 89.170  139.547 35.257  1.00 100.00 ? 368 LYS S CB  1 
ATOM   2880  C CG  . LYS A 1 367 ? 89.762  140.941 35.460  1.00 100.00 ? 368 LYS S CG  1 
ATOM   2881  C CD  . LYS A 1 367 ? 88.685  142.017 35.458  1.00 100.00 ? 368 LYS S CD  1 
ATOM   2882  C CE  . LYS A 1 367 ? 88.579  142.710 34.104  1.00 100.00 ? 368 LYS S CE  1 
ATOM   2883  N NZ  . LYS A 1 367 ? 87.300  143.477 33.973  1.00 100.00 ? 368 LYS S NZ  1 
ATOM   2884  N N   . LYS A 1 368 ? 92.050  139.539 33.546  1.00 67.97  ? 369 LYS S N   1 
ATOM   2885  C CA  . LYS A 1 368 ? 93.496  139.661 33.620  1.00 67.97  ? 369 LYS S CA  1 
ATOM   2886  C C   . LYS A 1 368 ? 93.976  139.844 35.046  1.00 67.97  ? 369 LYS S C   1 
ATOM   2887  O O   . LYS A 1 368 ? 93.215  140.253 35.918  1.00 100.00 ? 369 LYS S O   1 
ATOM   2888  C CB  . LYS A 1 368 ? 93.963  140.849 32.773  1.00 100.00 ? 369 LYS S CB  1 
ATOM   2889  C CG  . LYS A 1 368 ? 95.481  140.975 32.642  1.00 100.00 ? 369 LYS S CG  1 
ATOM   2890  C CD  . LYS A 1 368 ? 95.965  140.432 31.302  1.00 100.00 ? 369 LYS S CD  1 
ATOM   2891  C CE  . LYS A 1 368 ? 96.285  138.943 31.386  1.00 100.00 ? 369 LYS S CE  1 
ATOM   2892  N NZ  . LYS A 1 368 ? 95.787  138.202 30.184  1.00 100.00 ? 369 LYS S NZ  1 
ATOM   2893  N N   . GLU A 1 369 ? 95.249  139.542 35.275  1.00 100.00 ? 370 GLU S N   1 
ATOM   2894  C CA  . GLU A 1 369 ? 95.844  139.690 36.594  1.00 100.00 ? 370 GLU S CA  1 
ATOM   2895  C C   . GLU A 1 369 ? 97.173  140.430 36.460  1.00 100.00 ? 370 GLU S C   1 
ATOM   2896  O O   . GLU A 1 369 ? 98.191  139.834 36.144  1.00 100.00 ? 370 GLU S O   1 
ATOM   2897  C CB  . GLU A 1 369 ? 96.067  138.320 37.229  1.00 100.00 ? 370 GLU S CB  1 
ATOM   2898  C CG  . GLU A 1 369 ? 95.653  138.250 38.688  1.00 100.00 ? 370 GLU S CG  1 
ATOM   2899  C CD  . GLU A 1 369 ? 96.831  138.001 39.601  1.00 100.00 ? 370 GLU S CD  1 
ATOM   2900  O OE1 . GLU A 1 369 ? 97.974  138.175 39.134  1.00 100.00 ? 370 GLU S OE1 1 
ATOM   2901  O OE2 . GLU A 1 369 ? 96.617  137.638 40.777  1.00 100.00 ? 370 GLU S OE2 1 
ATOM   2902  N N   . ARG A 1 370 ? 97.147  141.738 36.700  1.00 100.00 ? 371 ARG S N   1 
ATOM   2903  C CA  . ARG A 1 370 ? 98.342  142.577 36.594  1.00 100.00 ? 371 ARG S CA  1 
ATOM   2904  C C   . ARG A 1 370 ? 99.444  142.206 37.594  1.00 100.00 ? 371 ARG S C   1 
ATOM   2905  O O   . ARG A 1 370 ? 100.521 142.816 37.608  1.00 100.00 ? 371 ARG S O   1 
ATOM   2906  C CB  . ARG A 1 370 ? 97.952  144.053 36.771  1.00 100.00 ? 371 ARG S CB  1 
ATOM   2907  C CG  . ARG A 1 370 ? 96.445  144.322 36.644  1.00 100.00 ? 371 ARG S CG  1 
ATOM   2908  C CD  . ARG A 1 370 ? 95.826  144.979 37.898  1.00 100.00 ? 371 ARG S CD  1 
ATOM   2909  N NE  . ARG A 1 370 ? 94.786  146.011 37.577  1.00 100.00 ? 371 ARG S NE  1 
ATOM   2910  C CZ  . ARG A 1 370 ? 94.365  147.029 38.369  1.00 100.00 ? 371 ARG S CZ  1 
ATOM   2911  N NH1 . ARG A 1 370 ? 94.855  147.231 39.590  1.00 100.00 ? 371 ARG S NH1 1 
ATOM   2912  N NH2 . ARG A 1 370 ? 93.483  147.910 37.916  1.00 100.00 ? 371 ARG S NH2 1 
ATOM   2913  N N   . ASN A 1 371 ? 99.171  141.210 38.428  1.00 93.94  ? 372 ASN S N   1 
ATOM   2914  C CA  . ASN A 1 371 ? 100.142 140.760 39.416  1.00 93.94  ? 372 ASN S CA  1 
ATOM   2915  C C   . ASN A 1 371 ? 100.960 139.636 38.794  1.00 93.94  ? 372 ASN S C   1 
ATOM   2916  O O   . ASN A 1 371 ? 102.184 139.738 38.676  1.00 84.06  ? 372 ASN S O   1 
ATOM   2917  C CB  . ASN A 1 371 ? 99.428  140.255 40.673  1.00 84.06  ? 372 ASN S CB  1 
ATOM   2918  C CG  . ASN A 1 371 ? 98.155  141.022 40.972  1.00 84.06  ? 372 ASN S CG  1 
ATOM   2919  O OD1 . ASN A 1 371 ? 97.955  142.134 40.477  1.00 84.06  ? 372 ASN S OD1 1 
ATOM   2920  N ND2 . ASN A 1 371 ? 97.285  140.434 41.786  1.00 84.06  ? 372 ASN S ND2 1 
ATOM   2921  N N   . THR A 1 372 ? 100.268 138.576 38.381  1.00 100.00 ? 373 THR S N   1 
ATOM   2922  C CA  . THR A 1 372 ? 100.884 137.404 37.759  1.00 100.00 ? 373 THR S CA  1 
ATOM   2923  C C   . THR A 1 372 ? 100.722 137.468 36.243  1.00 100.00 ? 373 THR S C   1 
ATOM   2924  O O   . THR A 1 372 ? 101.568 136.969 35.500  1.00 100.00 ? 373 THR S O   1 
ATOM   2925  C CB  . THR A 1 372 ? 100.236 136.088 38.258  1.00 100.00 ? 373 THR S CB  1 
ATOM   2926  O OG1 . THR A 1 372 ? 98.889  136.005 37.770  1.00 100.00 ? 373 THR S OG1 1 
ATOM   2927  C CG2 . THR A 1 372 ? 100.228 136.037 39.786  1.00 100.00 ? 373 THR S CG2 1 
ATOM   2928  N N   . ASP A 1 373 ? 99.620  138.076 35.805  1.00 67.51  ? 374 ASP S N   1 
ATOM   2929  C CA  . ASP A 1 373 ? 99.295  138.244 34.389  1.00 67.51  ? 374 ASP S CA  1 
ATOM   2930  C C   . ASP A 1 373 ? 98.683  136.996 33.769  1.00 67.51  ? 374 ASP S C   1 
ATOM   2931  O O   . ASP A 1 373 ? 98.817  136.744 32.571  1.00 79.73  ? 374 ASP S O   1 
ATOM   2932  C CB  . ASP A 1 373 ? 100.545 138.684 33.624  1.00 79.73  ? 374 ASP S CB  1 
ATOM   2933  C CG  . ASP A 1 373 ? 101.218 139.892 34.266  1.00 79.73  ? 374 ASP S CG  1 
ATOM   2934  O OD1 . ASP A 1 373 ? 100.580 140.965 34.338  1.00 79.73  ? 374 ASP S OD1 1 
ATOM   2935  O OD2 . ASP A 1 373 ? 102.376 139.763 34.708  1.00 79.73  ? 374 ASP S OD2 1 
ATOM   2936  N N   . GLN A 1 374 ? 98.001  136.229 34.612  1.00 95.74  ? 375 GLN S N   1 
ATOM   2937  C CA  . GLN A 1 374 ? 97.333  135.000 34.207  1.00 95.74  ? 375 GLN S CA  1 
ATOM   2938  C C   . GLN A 1 374 ? 95.936  135.047 34.800  1.00 95.74  ? 375 GLN S C   1 
ATOM   2939  O O   . GLN A 1 374 ? 95.700  134.521 35.887  1.00 99.75  ? 375 GLN S O   1 
ATOM   2940  C CB  . GLN A 1 374 ? 98.073  133.767 34.751  1.00 99.75  ? 375 GLN S CB  1 
ATOM   2941  C CG  . GLN A 1 374 ? 99.048  133.133 33.770  1.00 99.75  ? 375 GLN S CG  1 
ATOM   2942  C CD  . GLN A 1 374 ? 100.394 133.846 33.741  1.00 99.75  ? 375 GLN S CD  1 
ATOM   2943  O OE1 . GLN A 1 374 ? 101.266 133.586 34.573  1.00 99.75  ? 375 GLN S OE1 1 
ATOM   2944  N NE2 . GLN A 1 374 ? 100.569 134.754 32.780  1.00 99.75  ? 375 GLN S NE2 1 
ATOM   2945  N N   . ALA A 1 375 ? 95.028  135.697 34.085  1.00 40.61  ? 376 ALA S N   1 
ATOM   2946  C CA  . ALA A 1 375 ? 93.642  135.834 34.515  1.00 40.61  ? 376 ALA S CA  1 
ATOM   2947  C C   . ALA A 1 375 ? 93.164  134.615 35.285  1.00 40.61  ? 376 ALA S C   1 
ATOM   2948  O O   . ALA A 1 375 ? 93.614  133.490 35.033  1.00 52.60  ? 376 ALA S O   1 
ATOM   2949  C CB  . ALA A 1 375 ? 92.746  136.052 33.307  1.00 52.60  ? 376 ALA S CB  1 
ATOM   2950  N N   . SER A 1 376 ? 92.233  134.827 36.212  1.00 24.27  ? 377 SER S N   1 
ATOM   2951  C CA  . SER A 1 376 ? 91.737  133.711 36.992  1.00 24.27  ? 377 SER S CA  1 
ATOM   2952  C C   . SER A 1 376 ? 90.239  133.529 36.964  1.00 24.27  ? 377 SER S C   1 
ATOM   2953  O O   . SER A 1 376 ? 89.529  134.123 36.154  1.00 100.00 ? 377 SER S O   1 
ATOM   2954  C CB  . SER A 1 376 ? 92.198  133.826 38.449  1.00 100.00 ? 377 SER S CB  1 
ATOM   2955  O OG  . SER A 1 376 ? 92.122  132.564 39.105  1.00 100.00 ? 377 SER S OG  1 
ATOM   2956  N N   . MET A 1 377 ? 89.792  132.669 37.871  1.00 55.72  ? 378 MET S N   1 
ATOM   2957  C CA  . MET A 1 377 ? 88.393  132.318 38.050  1.00 55.72  ? 378 MET S CA  1 
ATOM   2958  C C   . MET A 1 377 ? 87.876  133.042 39.291  1.00 55.72  ? 378 MET S C   1 
ATOM   2959  O O   . MET A 1 377 ? 87.682  132.440 40.349  1.00 70.17  ? 378 MET S O   1 
ATOM   2960  C CB  . MET A 1 377 ? 88.263  130.796 38.239  1.00 70.17  ? 378 MET S CB  1 
ATOM   2961  C CG  . MET A 1 377 ? 87.103  130.125 37.501  1.00 70.17  ? 378 MET S CG  1 
ATOM   2962  S SD  . MET A 1 377 ? 86.773  130.856 35.910  1.00 70.17  ? 378 MET S SD  1 
ATOM   2963  C CE  . MET A 1 377 ? 85.625  132.201 36.376  1.00 70.17  ? 378 MET S CE  1 
ATOM   2964  N N   . PRO A 1 378 ? 87.679  134.365 39.184  1.00 95.09  ? 379 PRO S N   1 
ATOM   2965  C CA  . PRO A 1 378 ? 87.180  135.141 40.321  1.00 95.09  ? 379 PRO S CA  1 
ATOM   2966  C C   . PRO A 1 378 ? 85.792  134.676 40.781  1.00 95.09  ? 379 PRO S C   1 
ATOM   2967  O O   . PRO A 1 378 ? 85.367  135.017 41.885  1.00 100.00 ? 379 PRO S O   1 
ATOM   2968  C CB  . PRO A 1 378 ? 87.160  136.581 39.793  1.00 100.00 ? 379 PRO S CB  1 
ATOM   2969  C CG  . PRO A 1 378 ? 88.118  136.571 38.630  1.00 100.00 ? 379 PRO S CG  1 
ATOM   2970  C CD  . PRO A 1 378 ? 87.941  135.218 38.015  1.00 100.00 ? 379 PRO S CD  1 
ATOM   2971  N N   . ASP A 1 379 ? 85.095  133.903 39.936  1.00 44.21  ? 380 ASP S N   1 
ATOM   2972  C CA  . ASP A 1 379 ? 83.762  133.389 40.276  1.00 44.21  ? 380 ASP S CA  1 
ATOM   2973  C C   . ASP A 1 379 ? 83.543  131.912 39.969  1.00 44.21  ? 380 ASP S C   1 
ATOM   2974  O O   . ASP A 1 379 ? 83.769  131.448 38.857  1.00 100.00 ? 380 ASP S O   1 
ATOM   2975  C CB  . ASP A 1 379 ? 82.668  134.195 39.583  1.00 100.00 ? 380 ASP S CB  1 
ATOM   2976  C CG  . ASP A 1 379 ? 81.292  133.913 40.159  1.00 100.00 ? 380 ASP S CG  1 
ATOM   2977  O OD1 . ASP A 1 379 ? 81.205  133.165 41.160  1.00 100.00 ? 380 ASP S OD1 1 
ATOM   2978  O OD2 . ASP A 1 379 ? 80.296  134.434 39.613  1.00 100.00 ? 380 ASP S OD2 1 
ATOM   2979  N N   . ASN A 1 380 ? 83.048  131.178 40.965  1.00 46.56  ? 381 ASN S N   1 
ATOM   2980  C CA  . ASN A 1 380 ? 82.821  129.754 40.875  1.00 46.56  ? 381 ASN S CA  1 
ATOM   2981  C C   . ASN A 1 380 ? 81.533  129.460 40.136  1.00 46.56  ? 381 ASN S C   1 
ATOM   2982  O O   . ASN A 1 380 ? 81.541  128.701 39.139  1.00 100.00 ? 381 ASN S O   1 
ATOM   2983  C CB  . ASN A 1 380 ? 82.880  129.128 42.262  1.00 100.00 ? 381 ASN S CB  1 
ATOM   2984  C CG  . ASN A 1 380 ? 84.238  129.333 42.904  1.00 100.00 ? 381 ASN S CG  1 
ATOM   2985  O OD1 . ASN A 1 380 ? 85.273  129.220 42.241  1.00 100.00 ? 381 ASN S OD1 1 
ATOM   2986  N ND2 . ASN A 1 380 ? 84.247  129.641 44.196  1.00 100.00 ? 381 ASN S ND2 1 
ATOM   2987  N N   . THR A 1 381 ? 80.400  129.984 40.597  1.00 75.59  ? 382 THR S N   1 
ATOM   2988  C CA  . THR A 1 381 ? 79.086  129.735 40.005  1.00 75.59  ? 382 THR S CA  1 
ATOM   2989  C C   . THR A 1 381 ? 79.138  129.306 38.546  1.00 75.59  ? 382 THR S C   1 
ATOM   2990  O O   . THR A 1 381 ? 78.637  128.238 38.187  1.00 84.69  ? 382 THR S O   1 
ATOM   2991  C CB  . THR A 1 381 ? 78.186  130.977 40.105  1.00 84.69  ? 382 THR S CB  1 
ATOM   2992  O OG1 . THR A 1 381 ? 78.321  131.760 38.912  1.00 84.69  ? 382 THR S OG1 1 
ATOM   2993  C CG2 . THR A 1 381 ? 78.564  131.823 41.318  1.00 84.69  ? 382 THR S CG2 1 
ATOM   2994  N N   . ALA A 1 382 ? 79.745  130.144 37.713  1.00 71.64  ? 383 ALA S N   1 
ATOM   2995  C CA  . ALA A 1 382 ? 79.870  129.865 36.288  1.00 71.64  ? 383 ALA S CA  1 
ATOM   2996  C C   . ALA A 1 382 ? 80.218  128.397 36.032  1.00 71.64  ? 383 ALA S C   1 
ATOM   2997  O O   . ALA A 1 382 ? 79.329  127.540 35.909  1.00 54.41  ? 383 ALA S O   1 
ATOM   2998  C CB  . ALA A 1 382 ? 80.940  130.775 35.677  1.00 54.41  ? 383 ALA S CB  1 
ATOM   2999  N N   . ALA A 1 383 ? 81.517  128.120 35.954  1.00 24.37  ? 384 ALA S N   1 
ATOM   3000  C CA  . ALA A 1 383 ? 82.025  126.768 35.718  1.00 24.37  ? 384 ALA S CA  1 
ATOM   3001  C C   . ALA A 1 383 ? 81.471  125.827 36.774  1.00 24.37  ? 384 ALA S C   1 
ATOM   3002  O O   . ALA A 1 383 ? 81.387  124.618 36.568  1.00 10.99  ? 384 ALA S O   1 
ATOM   3003  C CB  . ALA A 1 383 ? 83.554  126.775 35.764  1.00 10.99  ? 384 ALA S CB  1 
ATOM   3004  N N   . GLN A 1 384 ? 81.109  126.396 37.911  1.00 10.78  ? 385 GLN S N   1 
ATOM   3005  C CA  . GLN A 1 384 ? 80.550  125.612 38.986  1.00 10.78  ? 385 GLN S CA  1 
ATOM   3006  C C   . GLN A 1 384 ? 79.408  124.818 38.367  1.00 10.78  ? 385 GLN S C   1 
ATOM   3007  O O   . GLN A 1 384 ? 79.379  123.588 38.427  1.00 100.00 ? 385 GLN S O   1 
ATOM   3008  C CB  . GLN A 1 384 ? 80.034  126.536 40.088  1.00 100.00 ? 385 GLN S CB  1 
ATOM   3009  C CG  . GLN A 1 384 ? 79.059  125.909 41.061  1.00 100.00 ? 385 GLN S CG  1 
ATOM   3010  C CD  . GLN A 1 384 ? 78.305  126.952 41.857  1.00 100.00 ? 385 GLN S CD  1 
ATOM   3011  O OE1 . GLN A 1 384 ? 77.419  127.631 41.333  1.00 100.00 ? 385 GLN S OE1 1 
ATOM   3012  N NE2 . GLN A 1 384 ? 78.656  127.089 43.128  1.00 100.00 ? 385 GLN S NE2 1 
ATOM   3013  N N   . LYS A 1 385 ? 78.484  125.546 37.754  1.00 56.56  ? 386 LYS S N   1 
ATOM   3014  C CA  . LYS A 1 385 ? 77.334  124.947 37.103  1.00 56.56  ? 386 LYS S CA  1 
ATOM   3015  C C   . LYS A 1 385 ? 77.806  124.064 35.954  1.00 56.56  ? 386 LYS S C   1 
ATOM   3016  O O   . LYS A 1 385 ? 77.643  122.833 35.988  1.00 18.85  ? 386 LYS S O   1 
ATOM   3017  C CB  . LYS A 1 385 ? 76.424  126.045 36.559  1.00 18.85  ? 386 LYS S CB  1 
ATOM   3018  C CG  . LYS A 1 385 ? 75.511  126.681 37.596  1.00 18.85  ? 386 LYS S CG  1 
ATOM   3019  C CD  . LYS A 1 385 ? 74.756  127.828 36.977  1.00 18.85  ? 386 LYS S CD  1 
ATOM   3020  C CE  . LYS A 1 385 ? 74.230  128.773 38.023  1.00 18.85  ? 386 LYS S CE  1 
ATOM   3021  N NZ  . LYS A 1 385 ? 73.574  129.963 37.396  1.00 18.85  ? 386 LYS S NZ  1 
ATOM   3022  N N   . VAL A 1 386 ? 78.390  124.707 34.947  1.00 34.68  ? 387 VAL S N   1 
ATOM   3023  C CA  . VAL A 1 386 ? 78.893  124.024 33.764  1.00 34.68  ? 387 VAL S CA  1 
ATOM   3024  C C   . VAL A 1 386 ? 79.454  122.622 34.031  1.00 34.68  ? 387 VAL S C   1 
ATOM   3025  O O   . VAL A 1 386 ? 79.063  121.648 33.376  1.00 62.52  ? 387 VAL S O   1 
ATOM   3026  C CB  . VAL A 1 386 ? 79.991  124.870 33.076  1.00 62.52  ? 387 VAL S CB  1 
ATOM   3027  C CG1 . VAL A 1 386 ? 80.786  124.018 32.092  1.00 62.52  ? 387 VAL S CG1 1 
ATOM   3028  C CG2 . VAL A 1 386 ? 79.354  126.039 32.360  1.00 62.52  ? 387 VAL S CG2 1 
ATOM   3029  N N   . CYS A 1 387 ? 80.368  122.520 34.991  1.00 100.00 ? 388 CYS S N   1 
ATOM   3030  C CA  . CYS A 1 387 ? 80.992  121.238 35.311  1.00 100.00 ? 388 CYS S CA  1 
ATOM   3031  C C   . CYS A 1 387 ? 80.018  120.201 35.837  1.00 100.00 ? 388 CYS S C   1 
ATOM   3032  O O   . CYS A 1 387 ? 80.321  119.008 35.851  1.00 100.00 ? 388 CYS S O   1 
ATOM   3033  C CB  . CYS A 1 387 ? 82.118  121.442 36.316  1.00 100.00 ? 388 CYS S CB  1 
ATOM   3034  S SG  . CYS A 1 387 ? 83.611  122.073 35.534  1.00 100.00 ? 388 CYS S SG  1 
ATOM   3035  N N   . HIS A 1 388 ? 78.846  120.666 36.267  1.00 82.72  ? 389 HIS S N   1 
ATOM   3036  C CA  . HIS A 1 388 ? 77.809  119.781 36.792  1.00 82.72  ? 389 HIS S CA  1 
ATOM   3037  C C   . HIS A 1 388 ? 77.116  119.105 35.622  1.00 82.72  ? 389 HIS S C   1 
ATOM   3038  O O   . HIS A 1 388 ? 76.898  117.889 35.615  1.00 100.00 ? 389 HIS S O   1 
ATOM   3039  C CB  . HIS A 1 388 ? 76.782  120.578 37.612  1.00 100.00 ? 389 HIS S CB  1 
ATOM   3040  C CG  . HIS A 1 388 ? 75.701  119.734 38.224  1.00 100.00 ? 389 HIS S CG  1 
ATOM   3041  N ND1 . HIS A 1 388 ? 75.273  118.547 37.666  1.00 100.00 ? 389 HIS S ND1 1 
ATOM   3042  C CD2 . HIS A 1 388 ? 74.957  119.910 39.343  1.00 100.00 ? 389 HIS S CD2 1 
ATOM   3043  C CE1 . HIS A 1 388 ? 74.312  118.032 38.412  1.00 100.00 ? 389 HIS S CE1 1 
ATOM   3044  N NE2 . HIS A 1 388 ? 74.100  118.839 39.436  1.00 100.00 ? 389 HIS S NE2 1 
ATOM   3045  N N   . LEU A 1 389 ? 76.777  119.917 34.633  1.00 77.17  ? 390 LEU S N   1 
ATOM   3046  C CA  . LEU A 1 389 ? 76.107  119.410 33.452  1.00 77.17  ? 390 LEU S CA  1 
ATOM   3047  C C   . LEU A 1 389 ? 77.032  118.466 32.681  1.00 77.17  ? 390 LEU S C   1 
ATOM   3048  O O   . LEU A 1 389 ? 76.572  117.560 31.978  1.00 85.69  ? 390 LEU S O   1 
ATOM   3049  C CB  . LEU A 1 389 ? 75.665  120.584 32.568  1.00 85.69  ? 390 LEU S CB  1 
ATOM   3050  C CG  . LEU A 1 389 ? 75.024  121.771 33.300  1.00 85.69  ? 390 LEU S CG  1 
ATOM   3051  C CD1 . LEU A 1 389 ? 74.764  122.890 32.308  1.00 85.69  ? 390 LEU S CD1 1 
ATOM   3052  C CD2 . LEU A 1 389 ? 73.726  121.348 33.981  1.00 85.69  ? 390 LEU S CD2 1 
ATOM   3053  N N   . MET A 1 390 ? 78.339  118.657 32.825  1.00 39.87  ? 391 MET S N   1 
ATOM   3054  C CA  . MET A 1 390 ? 79.286  117.807 32.122  1.00 39.87  ? 391 MET S CA  1 
ATOM   3055  C C   . MET A 1 390 ? 79.557  116.492 32.820  1.00 39.87  ? 391 MET S C   1 
ATOM   3056  O O   . MET A 1 390 ? 80.203  115.620 32.254  1.00 54.13  ? 391 MET S O   1 
ATOM   3057  C CB  . MET A 1 390 ? 80.606  118.529 31.925  1.00 54.13  ? 391 MET S CB  1 
ATOM   3058  C CG  . MET A 1 390 ? 80.787  119.059 30.541  1.00 54.13  ? 391 MET S CG  1 
ATOM   3059  S SD  . MET A 1 390 ? 81.216  120.788 30.621  1.00 54.13  ? 391 MET S SD  1 
ATOM   3060  C CE  . MET A 1 390 ? 82.595  120.828 29.430  1.00 54.13  ? 391 MET S CE  1 
ATOM   3061  N N   . GLY A 1 391 ? 79.069  116.343 34.044  1.00 80.57  ? 392 GLY S N   1 
ATOM   3062  C CA  . GLY A 1 391 ? 79.315  115.110 34.767  1.00 80.57  ? 392 GLY S CA  1 
ATOM   3063  C C   . GLY A 1 391 ? 80.790  114.997 35.125  1.00 80.57  ? 392 GLY S C   1 
ATOM   3064  O O   . GLY A 1 391 ? 81.290  113.897 35.407  1.00 37.65  ? 392 GLY S O   1 
ATOM   3065  N N   . ILE A 1 392 ? 81.484  116.138 35.103  1.00 100.00 ? 393 ILE S N   1 
ATOM   3066  C CA  . ILE A 1 392 ? 82.916  116.211 35.430  1.00 100.00 ? 393 ILE S CA  1 
ATOM   3067  C C   . ILE A 1 392 ? 83.115  116.917 36.768  1.00 100.00 ? 393 ILE S C   1 
ATOM   3068  O O   . ILE A 1 392 ? 82.205  116.941 37.600  1.00 6.29   ? 393 ILE S O   1 
ATOM   3069  C CB  . ILE A 1 392 ? 83.733  117.001 34.363  1.00 6.29   ? 393 ILE S CB  1 
ATOM   3070  C CG1 . ILE A 1 392 ? 83.217  118.453 34.283  1.00 6.29   ? 393 ILE S CG1 1 
ATOM   3071  C CG2 . ILE A 1 392 ? 83.707  116.252 33.033  1.00 6.29   ? 393 ILE S CG2 1 
ATOM   3072  C CD1 . ILE A 1 392 ? 84.239  119.440 33.798  1.00 6.29   ? 393 ILE S CD1 1 
ATOM   3073  N N   . ASN A 1 393 ? 84.306  117.492 36.962  1.00 100.00 ? 394 ASN S N   1 
ATOM   3074  C CA  . ASN A 1 393 ? 84.632  118.208 38.203  1.00 100.00 ? 394 ASN S CA  1 
ATOM   3075  C C   . ASN A 1 393 ? 85.242  119.600 38.058  1.00 100.00 ? 394 ASN S C   1 
ATOM   3076  O O   . ASN A 1 393 ? 86.043  119.875 37.162  1.00 77.87  ? 394 ASN S O   1 
ATOM   3077  C CB  . ASN A 1 393 ? 85.569  117.393 39.093  1.00 77.87  ? 394 ASN S CB  1 
ATOM   3078  C CG  . ASN A 1 393 ? 86.088  118.206 40.259  1.00 77.87  ? 394 ASN S CG  1 
ATOM   3079  O OD1 . ASN A 1 393 ? 87.006  119.015 40.107  1.00 77.87  ? 394 ASN S OD1 1 
ATOM   3080  N ND2 . ASN A 1 393 ? 85.486  118.013 41.430  1.00 77.87  ? 394 ASN S ND2 1 
ATOM   3081  N N   . VAL A 1 394 ? 84.872  120.451 39.008  1.00 39.33  ? 395 VAL S N   1 
ATOM   3082  C CA  . VAL A 1 394 ? 85.315  121.837 39.080  1.00 39.33  ? 395 VAL S CA  1 
ATOM   3083  C C   . VAL A 1 394 ? 86.822  121.966 39.082  1.00 39.33  ? 395 VAL S C   1 
ATOM   3084  O O   . VAL A 1 394 ? 87.457  122.052 38.033  1.00 49.58  ? 395 VAL S O   1 
ATOM   3085  C CB  . VAL A 1 394 ? 84.792  122.474 40.365  1.00 49.58  ? 395 VAL S CB  1 
ATOM   3086  C CG1 . VAL A 1 394 ? 83.534  123.273 40.080  1.00 49.58  ? 395 VAL S CG1 1 
ATOM   3087  C CG2 . VAL A 1 394 ? 84.509  121.375 41.394  1.00 49.58  ? 395 VAL S CG2 1 
ATOM   3088  N N   . THR A 1 395 ? 87.367  121.995 40.294  1.00 89.78  ? 396 THR S N   1 
ATOM   3089  C CA  . THR A 1 395 ? 88.797  122.118 40.549  1.00 89.78  ? 396 THR S CA  1 
ATOM   3090  C C   . THR A 1 395 ? 89.623  121.622 39.380  1.00 89.78  ? 396 THR S C   1 
ATOM   3091  O O   . THR A 1 395 ? 90.447  122.349 38.826  1.00 65.89  ? 396 THR S O   1 
ATOM   3092  C CB  . THR A 1 395 ? 89.193  121.315 41.797  1.00 65.89  ? 396 THR S CB  1 
ATOM   3093  O OG1 . THR A 1 395 ? 88.873  119.931 41.591  1.00 65.89  ? 396 THR S OG1 1 
ATOM   3094  C CG2 . THR A 1 395 ? 88.439  121.827 43.023  1.00 65.89  ? 396 THR S CG2 1 
ATOM   3095  N N   . ASP A 1 396 ? 89.399  120.370 39.010  1.00 54.61  ? 397 ASP S N   1 
ATOM   3096  C CA  . ASP A 1 396 ? 90.124  119.793 37.900  1.00 54.61  ? 397 ASP S CA  1 
ATOM   3097  C C   . ASP A 1 396 ? 89.899  120.698 36.706  1.00 54.61  ? 397 ASP S C   1 
ATOM   3098  O O   . ASP A 1 396 ? 90.826  121.346 36.229  1.00 56.70  ? 397 ASP S O   1 
ATOM   3099  C CB  . ASP A 1 396 ? 89.603  118.392 37.619  1.00 56.70  ? 397 ASP S CB  1 
ATOM   3100  C CG  . ASP A 1 396 ? 89.702  117.491 38.825  1.00 56.70  ? 397 ASP S CG  1 
ATOM   3101  O OD1 . ASP A 1 396 ? 88.736  117.447 39.620  1.00 56.70  ? 397 ASP S OD1 1 
ATOM   3102  O OD2 . ASP A 1 396 ? 90.752  116.833 38.973  1.00 56.70  ? 397 ASP S OD2 1 
ATOM   3103  N N   . PHE A 1 397 ? 88.655  120.748 36.241  1.00 100.00 ? 398 PHE S N   1 
ATOM   3104  C CA  . PHE A 1 397 ? 88.290  121.589 35.107  1.00 100.00 ? 398 PHE S CA  1 
ATOM   3105  C C   . PHE A 1 397 ? 89.064  122.906 35.197  1.00 100.00 ? 398 PHE S C   1 
ATOM   3106  O O   . PHE A 1 397 ? 89.870  123.238 34.319  1.00 45.73  ? 398 PHE S O   1 
ATOM   3107  C CB  . PHE A 1 397 ? 86.774  121.862 35.129  1.00 45.73  ? 398 PHE S CB  1 
ATOM   3108  C CG  . PHE A 1 397 ? 86.274  122.721 33.975  1.00 45.73  ? 398 PHE S CG  1 
ATOM   3109  C CD1 . PHE A 1 397 ? 86.033  122.159 32.724  1.00 45.73  ? 398 PHE S CD1 1 
ATOM   3110  C CD2 . PHE A 1 397 ? 86.046  124.087 34.149  1.00 45.73  ? 398 PHE S CD2 1 
ATOM   3111  C CE1 . PHE A 1 397 ? 85.576  122.942 31.674  1.00 45.73  ? 398 PHE S CE1 1 
ATOM   3112  C CE2 . PHE A 1 397 ? 85.587  124.872 33.100  1.00 45.73  ? 398 PHE S CE2 1 
ATOM   3113  C CZ  . PHE A 1 397 ? 85.353  124.298 31.864  1.00 45.73  ? 398 PHE S CZ  1 
ATOM   3114  N N   . THR A 1 398 ? 88.838  123.630 36.286  1.00 12.84  ? 399 THR S N   1 
ATOM   3115  C CA  . THR A 1 398 ? 89.475  124.919 36.500  1.00 12.84  ? 399 THR S CA  1 
ATOM   3116  C C   . THR A 1 398 ? 90.965  124.925 36.164  1.00 12.84  ? 399 THR S C   1 
ATOM   3117  O O   . THR A 1 398 ? 91.411  125.644 35.261  1.00 66.82  ? 399 THR S O   1 
ATOM   3118  C CB  . THR A 1 398 ? 89.259  125.368 37.949  1.00 66.82  ? 399 THR S CB  1 
ATOM   3119  O OG1 . THR A 1 398 ? 88.176  124.616 38.524  1.00 66.82  ? 399 THR S OG1 1 
ATOM   3120  C CG2 . THR A 1 398 ? 88.916  126.852 37.994  1.00 66.82  ? 399 THR S CG2 1 
ATOM   3121  N N   . ARG A 1 399 ? 91.734  124.122 36.896  1.00 99.78  ? 400 ARG S N   1 
ATOM   3122  C CA  . ARG A 1 399 ? 93.166  124.039 36.657  1.00 99.78  ? 400 ARG S CA  1 
ATOM   3123  C C   . ARG A 1 399 ? 93.353  123.845 35.161  1.00 99.78  ? 400 ARG S C   1 
ATOM   3124  O O   . ARG A 1 399 ? 93.879  124.715 34.476  1.00 84.77  ? 400 ARG S O   1 
ATOM   3125  C CB  . ARG A 1 399 ? 93.772  122.856 37.416  1.00 84.77  ? 400 ARG S CB  1 
ATOM   3126  C CG  . ARG A 1 399 ? 95.278  122.725 37.250  1.00 84.77  ? 400 ARG S CG  1 
ATOM   3127  C CD  . ARG A 1 399 ? 95.715  121.274 37.135  1.00 84.77  ? 400 ARG S CD  1 
ATOM   3128  N NE  . ARG A 1 399 ? 95.365  120.521 38.336  1.00 84.77  ? 400 ARG S NE  1 
ATOM   3129  C CZ  . ARG A 1 399 ? 94.664  119.392 38.336  1.00 84.77  ? 400 ARG S CZ  1 
ATOM   3130  N NH1 . ARG A 1 399 ? 94.226  118.872 37.197  1.00 84.77  ? 400 ARG S NH1 1 
ATOM   3131  N NH2 . ARG A 1 399 ? 94.390  118.788 39.485  1.00 84.77  ? 400 ARG S NH2 1 
ATOM   3132  N N   . SER A 1 400 ? 92.888  122.705 34.663  1.00 90.81  ? 401 SER S N   1 
ATOM   3133  C CA  . SER A 1 400 ? 92.990  122.363 33.248  1.00 90.81  ? 401 SER S CA  1 
ATOM   3134  C C   . SER A 1 400 ? 92.639  123.546 32.363  1.00 90.81  ? 401 SER S C   1 
ATOM   3135  O O   . SER A 1 400 ? 93.311  123.812 31.370  1.00 62.09  ? 401 SER S O   1 
ATOM   3136  C CB  . SER A 1 400 ? 92.053  121.198 32.920  1.00 62.09  ? 401 SER S CB  1 
ATOM   3137  O OG  . SER A 1 400 ? 91.724  120.438 34.075  1.00 62.09  ? 401 SER S OG  1 
ATOM   3138  N N   . ILE A 1 401 ? 91.584  124.254 32.742  1.00 49.33  ? 402 ILE S N   1 
ATOM   3139  C CA  . ILE A 1 401 ? 91.110  125.393 31.982  1.00 49.33  ? 402 ILE S CA  1 
ATOM   3140  C C   . ILE A 1 401 ? 92.020  126.608 32.113  1.00 49.33  ? 402 ILE S C   1 
ATOM   3141  O O   . ILE A 1 401 ? 92.123  127.413 31.183  1.00 58.57  ? 402 ILE S O   1 
ATOM   3142  C CB  . ILE A 1 401 ? 89.655  125.751 32.400  1.00 58.57  ? 402 ILE S CB  1 
ATOM   3143  C CG1 . ILE A 1 401 ? 88.722  125.626 31.191  1.00 58.57  ? 402 ILE S CG1 1 
ATOM   3144  C CG2 . ILE A 1 401 ? 89.586  127.147 32.983  1.00 58.57  ? 402 ILE S CG2 1 
ATOM   3145  C CD1 . ILE A 1 401 ? 88.510  124.194 30.703  1.00 58.57  ? 402 ILE S CD1 1 
ATOM   3146  N N   . LEU A 1 402 ? 92.687  126.735 33.255  1.00 55.66  ? 403 LEU S N   1 
ATOM   3147  C CA  . LEU A 1 402 ? 93.577  127.869 33.493  1.00 55.66  ? 403 LEU S CA  1 
ATOM   3148  C C   . LEU A 1 402 ? 95.061  127.522 33.318  1.00 55.66  ? 403 LEU S C   1 
ATOM   3149  O O   . LEU A 1 402 ? 95.811  128.209 32.591  1.00 28.48  ? 403 LEU S O   1 
ATOM   3150  C CB  . LEU A 1 402 ? 93.345  128.408 34.902  1.00 28.48  ? 403 LEU S CB  1 
ATOM   3151  C CG  . LEU A 1 402 ? 91.933  128.888 35.241  1.00 28.48  ? 403 LEU S CG  1 
ATOM   3152  C CD1 . LEU A 1 402 ? 91.460  128.246 36.551  1.00 28.48  ? 403 LEU S CD1 1 
ATOM   3153  C CD2 . LEU A 1 402 ? 91.928  130.426 35.330  1.00 28.48  ? 403 LEU S CD2 1 
ATOM   3154  N N   . THR A 1 403 ? 95.469  126.455 34.007  1.00 87.73  ? 404 THR S N   1 
ATOM   3155  C CA  . THR A 1 403 ? 96.839  125.944 33.992  1.00 87.73  ? 404 THR S CA  1 
ATOM   3156  C C   . THR A 1 403 ? 96.909  124.593 33.281  1.00 87.73  ? 404 THR S C   1 
ATOM   3157  O O   . THR A 1 403 ? 96.672  123.531 33.864  1.00 73.79  ? 404 THR S O   1 
ATOM   3158  C CB  . THR A 1 403 ? 97.376  125.767 35.420  1.00 73.79  ? 404 THR S CB  1 
ATOM   3159  O OG1 . THR A 1 403 ? 96.949  124.503 35.936  1.00 73.79  ? 404 THR S OG1 1 
ATOM   3160  C CG2 . THR A 1 403 ? 96.864  126.876 36.331  1.00 73.79  ? 404 THR S CG2 1 
ATOM   3161  N N   . PRO A 1 404 ? 97.236  124.620 31.993  1.00 19.47  ? 405 PRO S N   1 
ATOM   3162  C CA  . PRO A 1 404 ? 97.329  123.384 31.219  1.00 19.47  ? 405 PRO S CA  1 
ATOM   3163  C C   . PRO A 1 404 ? 98.468  122.479 31.643  1.00 19.47  ? 405 PRO S C   1 
ATOM   3164  O O   . PRO A 1 404 ? 99.629  122.722 31.296  1.00 73.00  ? 405 PRO S O   1 
ATOM   3165  C CB  . PRO A 1 404 ? 97.500  123.878 29.786  1.00 73.00  ? 405 PRO S CB  1 
ATOM   3166  C CG  . PRO A 1 404 ? 98.123  125.228 29.926  1.00 73.00  ? 405 PRO S CG  1 
ATOM   3167  C CD  . PRO A 1 404 ? 97.513  125.811 31.168  1.00 73.00  ? 405 PRO S CD  1 
ATOM   3168  N N   . ARG A 1 405 ? 98.131  121.441 32.401  1.00 79.97  ? 406 ARG S N   1 
ATOM   3169  C CA  . ARG A 1 405 ? 99.116  120.465 32.870  1.00 79.97  ? 406 ARG S CA  1 
ATOM   3170  C C   . ARG A 1 405 ? 99.509  119.608 31.676  1.00 79.97  ? 406 ARG S C   1 
ATOM   3171  O O   . ARG A 1 405 ? 99.624  118.383 31.779  1.00 100.00 ? 406 ARG S O   1 
ATOM   3172  C CB  . ARG A 1 405 ? 98.507  119.578 33.954  1.00 100.00 ? 406 ARG S CB  1 
ATOM   3173  C CG  . ARG A 1 405 ? 99.213  119.657 35.295  1.00 100.00 ? 406 ARG S CG  1 
ATOM   3174  C CD  . ARG A 1 405 ? 99.792  118.308 35.693  1.00 100.00 ? 406 ARG S CD  1 
ATOM   3175  N NE  . ARG A 1 405 ? 99.159  117.781 36.899  1.00 100.00 ? 406 ARG S NE  1 
ATOM   3176  C CZ  . ARG A 1 405 ? 98.424  116.675 36.928  1.00 100.00 ? 406 ARG S CZ  1 
ATOM   3177  N NH1 . ARG A 1 405 ? 98.226  115.975 35.819  1.00 100.00 ? 406 ARG S NH1 1 
ATOM   3178  N NH2 . ARG A 1 405 ? 97.885  116.268 38.070  1.00 100.00 ? 406 ARG S NH2 1 
ATOM   3179  N N   . ILE A 1 406 ? 99.710  120.276 30.546  1.00 47.12  ? 407 ILE S N   1 
ATOM   3180  C CA  . ILE A 1 406 ? 100.055 119.634 29.284  1.00 47.12  ? 407 ILE S CA  1 
ATOM   3181  C C   . ILE A 1 406 ? 101.290 118.754 29.307  1.00 47.12  ? 407 ILE S C   1 
ATOM   3182  O O   . ILE A 1 406 ? 101.915 118.576 30.340  1.00 50.78  ? 407 ILE S O   1 
ATOM   3183  C CB  . ILE A 1 406 ? 100.251 120.679 28.156  1.00 50.78  ? 407 ILE S CB  1 
ATOM   3184  C CG1 . ILE A 1 406 ? 101.693 121.169 28.124  1.00 50.78  ? 407 ILE S CG1 1 
ATOM   3185  C CG2 . ILE A 1 406 ? 99.339  121.858 28.375  1.00 50.78  ? 407 ILE S CG2 1 
ATOM   3186  C CD1 . ILE A 1 406 ? 102.495 120.639 26.988  1.00 50.78  ? 407 ILE S CD1 1 
ATOM   3187  N N   . LYS A 1 407 ? 101.628 118.205 28.145  1.00 63.61  ? 408 LYS S N   1 
ATOM   3188  C CA  . LYS A 1 407 ? 102.795 117.356 28.001  1.00 63.61  ? 408 LYS S CA  1 
ATOM   3189  C C   . LYS A 1 407 ? 103.345 117.406 26.587  1.00 63.61  ? 408 LYS S C   1 
ATOM   3190  O O   . LYS A 1 407 ? 103.131 116.478 25.800  1.00 100.00 ? 408 LYS S O   1 
ATOM   3191  C CB  . LYS A 1 407 ? 102.453 115.916 28.357  1.00 100.00 ? 408 LYS S CB  1 
ATOM   3192  C CG  . LYS A 1 407 ? 103.688 115.067 28.587  1.00 100.00 ? 408 LYS S CG  1 
ATOM   3193  C CD  . LYS A 1 407 ? 103.734 113.886 27.633  1.00 100.00 ? 408 LYS S CD  1 
ATOM   3194  C CE  . LYS A 1 407 ? 102.951 112.697 28.195  1.00 100.00 ? 408 LYS S CE  1 
ATOM   3195  N NZ  . LYS A 1 407 ? 101.963 113.086 29.262  1.00 100.00 ? 408 LYS S NZ  1 
ATOM   3196  N N   . VAL A 1 408 ? 104.058 118.482 26.268  1.00 30.29  ? 409 VAL S N   1 
ATOM   3197  C CA  . VAL A 1 408 ? 104.623 118.627 24.930  1.00 30.29  ? 409 VAL S CA  1 
ATOM   3198  C C   . VAL A 1 408 ? 105.749 117.625 24.729  1.00 30.29  ? 409 VAL S C   1 
ATOM   3199  O O   . VAL A 1 408 ? 106.435 117.275 25.686  1.00 98.98  ? 409 VAL S O   1 
ATOM   3200  C CB  . VAL A 1 408 ? 105.179 120.055 24.681  1.00 98.98  ? 409 VAL S CB  1 
ATOM   3201  C CG1 . VAL A 1 408 ? 106.257 120.023 23.588  1.00 98.98  ? 409 VAL S CG1 1 
ATOM   3202  C CG2 . VAL A 1 408 ? 104.052 120.991 24.262  1.00 98.98  ? 409 VAL S CG2 1 
ATOM   3203  N N   . GLY A 1 409 ? 105.924 117.176 23.482  1.00 100.00 ? 410 GLY S N   1 
ATOM   3204  C CA  . GLY A 1 409 ? 106.971 116.222 23.139  1.00 100.00 ? 410 GLY S CA  1 
ATOM   3205  C C   . GLY A 1 409 ? 107.392 115.284 24.259  1.00 100.00 ? 410 GLY S C   1 
ATOM   3206  O O   . GLY A 1 409 ? 106.554 114.592 24.858  1.00 100.00 ? 410 GLY S O   1 
ATOM   3207  N N   . ARG A 1 410 ? 108.698 115.264 24.535  1.00 100.00 ? 411 ARG S N   1 
ATOM   3208  C CA  . ARG A 1 410 ? 109.278 114.422 25.591  1.00 100.00 ? 411 ARG S CA  1 
ATOM   3209  C C   . ARG A 1 410 ? 109.329 115.171 26.932  1.00 100.00 ? 411 ARG S C   1 
ATOM   3210  O O   . ARG A 1 410 ? 110.252 114.978 27.739  1.00 100.00 ? 411 ARG S O   1 
ATOM   3211  C CB  . ARG A 1 410 ? 110.693 113.992 25.197  1.00 100.00 ? 411 ARG S CB  1 
ATOM   3212  C CG  . ARG A 1 410 ? 111.337 114.869 24.120  1.00 100.00 ? 411 ARG S CG  1 
ATOM   3213  C CD  . ARG A 1 410 ? 112.860 114.884 24.255  1.00 100.00 ? 411 ARG S CD  1 
ATOM   3214  N NE  . ARG A 1 410 ? 113.447 113.568 23.994  1.00 100.00 ? 411 ARG S NE  1 
ATOM   3215  C CZ  . ARG A 1 410 ? 114.417 113.016 24.720  1.00 100.00 ? 411 ARG S CZ  1 
ATOM   3216  N NH1 . ARG A 1 410 ? 114.921 113.667 25.767  1.00 100.00 ? 411 ARG S NH1 1 
ATOM   3217  N NH2 . ARG A 1 410 ? 114.885 111.812 24.392  1.00 100.00 ? 411 ARG S NH2 1 
ATOM   3218  N N   . ASP A 1 411 ? 108.319 116.012 27.160  1.00 100.00 ? 412 ASP S N   1 
ATOM   3219  C CA  . ASP A 1 411 ? 108.240 116.809 28.376  1.00 100.00 ? 412 ASP S CA  1 
ATOM   3220  C C   . ASP A 1 411 ? 106.807 117.056 28.862  1.00 100.00 ? 412 ASP S C   1 
ATOM   3221  O O   . ASP A 1 411 ? 105.878 117.224 28.059  1.00 53.50  ? 412 ASP S O   1 
ATOM   3222  C CB  . ASP A 1 411 ? 108.942 118.163 28.157  1.00 53.50  ? 412 ASP S CB  1 
ATOM   3223  C CG  . ASP A 1 411 ? 109.053 118.540 26.678  1.00 53.50  ? 412 ASP S CG  1 
ATOM   3224  O OD1 . ASP A 1 411 ? 110.023 118.116 26.017  1.00 53.50  ? 412 ASP S OD1 1 
ATOM   3225  O OD2 . ASP A 1 411 ? 108.169 119.266 26.178  1.00 53.50  ? 412 ASP S OD2 1 
ATOM   3226  N N   . VAL A 1 412 ? 106.654 117.066 30.187  1.00 100.00 ? 413 VAL S N   1 
ATOM   3227  C CA  . VAL A 1 412 ? 105.374 117.327 30.847  1.00 100.00 ? 413 VAL S CA  1 
ATOM   3228  C C   . VAL A 1 412 ? 105.313 118.838 31.084  1.00 100.00 ? 413 VAL S C   1 
ATOM   3229  O O   . VAL A 1 412 ? 105.135 119.329 32.209  1.00 7.01   ? 413 VAL S O   1 
ATOM   3230  C CB  . VAL A 1 412 ? 105.281 116.585 32.204  1.00 7.01   ? 413 VAL S CB  1 
ATOM   3231  C CG1 . VAL A 1 412 ? 103.970 116.922 32.914  1.00 7.01   ? 413 VAL S CG1 1 
ATOM   3232  C CG2 . VAL A 1 412 ? 105.400 115.077 31.965  1.00 7.01   ? 413 VAL S CG2 1 
ATOM   3233  N N   . VAL A 1 413 ? 105.491 119.571 29.994  1.00 78.50  ? 414 VAL S N   1 
ATOM   3234  C CA  . VAL A 1 413 ? 105.477 121.020 30.028  1.00 78.50  ? 414 VAL S CA  1 
ATOM   3235  C C   . VAL A 1 413 ? 104.260 121.573 30.761  1.00 78.50  ? 414 VAL S C   1 
ATOM   3236  O O   . VAL A 1 413 ? 103.239 121.866 30.140  1.00 100.00 ? 414 VAL S O   1 
ATOM   3237  C CB  . VAL A 1 413 ? 105.493 121.590 28.594  1.00 100.00 ? 414 VAL S CB  1 
ATOM   3238  C CG1 . VAL A 1 413 ? 105.816 123.081 28.630  1.00 100.00 ? 414 VAL S CG1 1 
ATOM   3239  C CG2 . VAL A 1 413 ? 106.499 120.827 27.740  1.00 100.00 ? 414 VAL S CG2 1 
ATOM   3240  N N   . GLN A 1 414 ? 104.345 121.708 32.078  1.00 77.11  ? 415 GLN S N   1 
ATOM   3241  C CA  . GLN A 1 414 ? 103.212 122.258 32.806  1.00 77.11  ? 415 GLN S CA  1 
ATOM   3242  C C   . GLN A 1 414 ? 103.295 123.784 32.682  1.00 77.11  ? 415 GLN S C   1 
ATOM   3243  O O   . GLN A 1 414 ? 104.321 124.398 33.005  1.00 100.00 ? 415 GLN S O   1 
ATOM   3244  C CB  . GLN A 1 414 ? 103.277 121.865 34.284  1.00 100.00 ? 415 GLN S CB  1 
ATOM   3245  C CG  . GLN A 1 414 ? 103.026 123.042 35.230  1.00 100.00 ? 415 GLN S CG  1 
ATOM   3246  C CD  . GLN A 1 414 ? 101.572 123.519 35.219  1.00 100.00 ? 415 GLN S CD  1 
ATOM   3247  O OE1 . GLN A 1 414 ? 101.250 124.500 34.552  1.00 100.00 ? 415 GLN S OE1 1 
ATOM   3248  N NE2 . GLN A 1 414 ? 100.660 122.875 35.926  1.00 100.00 ? 415 GLN S NE2 1 
ATOM   3249  N N   . LYS A 1 415 ? 102.225 124.390 32.204  1.00 45.70  ? 416 LYS S N   1 
ATOM   3250  C CA  . LYS A 1 415 ? 102.201 125.851 32.012  1.00 45.70  ? 416 LYS S CA  1 
ATOM   3251  C C   . LYS A 1 415 ? 100.803 126.420 32.277  1.00 45.70  ? 416 LYS S C   1 
ATOM   3252  O O   . LYS A 1 415 ? 99.839  125.673 32.495  1.00 79.25  ? 416 LYS S O   1 
ATOM   3253  C CB  . LYS A 1 415 ? 102.629 126.189 30.581  1.00 79.25  ? 416 LYS S CB  1 
ATOM   3254  C CG  . LYS A 1 415 ? 101.456 126.324 29.613  1.00 79.25  ? 416 LYS S CG  1 
ATOM   3255  C CD  . LYS A 1 415 ? 101.559 127.567 28.731  1.00 79.25  ? 416 LYS S CD  1 
ATOM   3256  C CE  . LYS A 1 415 ? 101.913 128.829 29.521  1.00 79.25  ? 416 LYS S CE  1 
ATOM   3257  N NZ  . LYS A 1 415 ? 101.249 130.033 29.004  1.00 79.25  ? 416 LYS S NZ  1 
ATOM   3258  N N   . ALA A 1 416 ? 100.755 127.744 32.250  1.00 79.03  ? 417 ALA S N   1 
ATOM   3259  C CA  . ALA A 1 416 ? 99.522  128.515 32.484  1.00 79.03  ? 417 ALA S CA  1 
ATOM   3260  C C   . ALA A 1 416 ? 99.355  129.585 31.398  1.00 79.03  ? 417 ALA S C   1 
ATOM   3261  O O   . ALA A 1 416 ? 100.259 130.395 31.156  1.00 68.95  ? 417 ALA S O   1 
ATOM   3262  C CB  . ALA A 1 416 ? 99.588  129.201 33.851  1.00 68.95  ? 417 ALA S CB  1 
ATOM   3263  N N   . GLN A 1 417 ? 98.189  129.546 30.781  1.00 68.18  ? 418 GLN S N   1 
ATOM   3264  C CA  . GLN A 1 417 ? 97.815  130.462 29.692  1.00 68.18  ? 418 GLN S CA  1 
ATOM   3265  C C   . GLN A 1 417 ? 97.442  131.849 30.251  1.00 68.18  ? 418 GLN S C   1 
ATOM   3266  O O   . GLN A 1 417 ? 97.401  132.049 31.476  1.00 100.00 ? 418 GLN S O   1 
ATOM   3267  C CB  . GLN A 1 417 ? 96.623  129.877 28.931  1.00 100.00 ? 418 GLN S CB  1 
ATOM   3268  C CG  . GLN A 1 417 ? 96.645  128.342 28.888  1.00 100.00 ? 418 GLN S CG  1 
ATOM   3269  C CD  . GLN A 1 417 ? 95.251  127.711 28.958  1.00 100.00 ? 418 GLN S CD  1 
ATOM   3270  O OE1 . GLN A 1 417 ? 94.809  127.309 30.033  1.00 100.00 ? 418 GLN S OE1 1 
ATOM   3271  N NE2 . GLN A 1 417 ? 94.524  127.598 27.860  1.00 100.00 ? 418 GLN S NE2 1 
ATOM   3272  N N   . THR A 1 418 ? 97.187  132.756 29.312  1.00 11.24  ? 419 THR S N   1 
ATOM   3273  C CA  . THR A 1 418 ? 96.798  134.158 29.602  1.00 11.24  ? 419 THR S CA  1 
ATOM   3274  C C   . THR A 1 418 ? 95.297  134.352 29.407  1.00 11.24  ? 419 THR S C   1 
ATOM   3275  O O   . THR A 1 418 ? 94.690  133.767 28.505  1.00 86.90  ? 419 THR S O   1 
ATOM   3276  C CB  . THR A 1 418 ? 97.476  135.130 28.630  1.00 86.90  ? 419 THR S CB  1 
ATOM   3277  O OG1 . THR A 1 418 ? 98.224  134.413 27.664  1.00 86.90  ? 419 THR S OG1 1 
ATOM   3278  C CG2 . THR A 1 418 ? 98.423  136.109 29.321  1.00 86.90  ? 419 THR S CG2 1 
ATOM   3279  N N   . LYS A 1 419 ? 94.740  135.185 30.261  1.00 83.58  ? 420 LYS S N   1 
ATOM   3280  C CA  . LYS A 1 419 ? 93.308  135.501 30.228  1.00 83.58  ? 420 LYS S CA  1 
ATOM   3281  C C   . LYS A 1 419 ? 92.687  135.021 28.906  1.00 83.58  ? 420 LYS S C   1 
ATOM   3282  O O   . LYS A 1 419 ? 91.779  134.179 28.897  1.00 29.77  ? 420 LYS S O   1 
ATOM   3283  C CB  . LYS A 1 419 ? 93.097  137.010 30.347  1.00 29.77  ? 420 LYS S CB  1 
ATOM   3284  C CG  . LYS A 1 419 ? 91.691  137.444 29.935  1.00 29.77  ? 420 LYS S CG  1 
ATOM   3285  C CD  . LYS A 1 419 ? 91.635  138.002 28.511  1.00 29.77  ? 420 LYS S CD  1 
ATOM   3286  C CE  . LYS A 1 419 ? 90.647  139.161 28.368  1.00 29.77  ? 420 LYS S CE  1 
ATOM   3287  N NZ  . LYS A 1 419 ? 90.174  139.674 29.663  1.00 29.77  ? 420 LYS S NZ  1 
ATOM   3288  N N   . GLU A 1 420 ? 93.201  135.579 27.821  1.00 45.68  ? 421 GLU S N   1 
ATOM   3289  C CA  . GLU A 1 420 ? 92.730  135.268 26.458  1.00 45.68  ? 421 GLU S CA  1 
ATOM   3290  C C   . GLU A 1 420 ? 92.663  133.752 26.244  1.00 45.68  ? 421 GLU S C   1 
ATOM   3291  O O   . GLU A 1 420 ? 91.575  133.174 26.105  1.00 100.00 ? 421 GLU S O   1 
ATOM   3292  C CB  . GLU A 1 420 ? 93.681  135.865 25.417  1.00 100.00 ? 421 GLU S CB  1 
ATOM   3293  C CG  . GLU A 1 420 ? 93.585  137.388 25.330  1.00 100.00 ? 421 GLU S CG  1 
ATOM   3294  C CD  . GLU A 1 420 ? 94.096  138.087 26.590  1.00 100.00 ? 421 GLU S CD  1 
ATOM   3295  O OE1 . GLU A 1 420 ? 94.855  137.448 27.415  1.00 100.00 ? 421 GLU S OE1 1 
ATOM   3296  O OE2 . GLU A 1 420 ? 93.772  139.312 26.825  1.00 100.00 ? 421 GLU S OE2 1 
ATOM   3297  N N   . GLN A 1 421 ? 93.840  133.153 26.220  1.00 33.03  ? 422 GLN S N   1 
ATOM   3298  C CA  . GLN A 1 421 ? 93.991  131.702 26.028  1.00 33.03  ? 422 GLN S CA  1 
ATOM   3299  C C   . GLN A 1 421 ? 93.006  130.951 26.922  1.00 33.03  ? 422 GLN S C   1 
ATOM   3300  O O   . GLN A 1 421 ? 92.480  129.893 26.546  1.00 90.53  ? 422 GLN S O   1 
ATOM   3301  C CB  . GLN A 1 421 ? 95.406  131.259 26.401  1.00 90.53  ? 422 GLN S CB  1 
ATOM   3302  C CG  . GLN A 1 421 ? 96.493  132.193 25.869  1.00 90.53  ? 422 GLN S CG  1 
ATOM   3303  C CD  . GLN A 1 421 ? 97.904  131.662 26.121  1.00 90.53  ? 422 GLN S CD  1 
ATOM   3304  O OE1 . GLN A 1 421 ? 98.491  131.036 25.240  1.00 90.53  ? 422 GLN S OE1 1 
ATOM   3305  N NE2 . GLN A 1 421 ? 98.492  131.873 27.283  1.00 90.53  ? 422 GLN S NE2 1 
ATOM   3306  N N   . ALA A 1 422 ? 92.795  131.537 28.083  1.00 46.69  ? 423 ALA S N   1 
ATOM   3307  C CA  . ALA A 1 422 ? 91.895  130.990 29.104  1.00 46.69  ? 423 ALA S CA  1 
ATOM   3308  C C   . ALA A 1 422 ? 90.480  130.858 28.545  1.00 46.69  ? 423 ALA S C   1 
ATOM   3309  O O   . ALA A 1 422 ? 89.685  130.029 29.013  1.00 47.52  ? 423 ALA S O   1 
ATOM   3310  C CB  . ALA A 1 422 ? 91.860  131.919 30.319  1.00 47.52  ? 423 ALA S CB  1 
ATOM   3311  N N   . ASP A 1 423 ? 90.204  131.680 27.552  1.00 48.49  ? 424 ASP S N   1 
ATOM   3312  C CA  . ASP A 1 423 ? 88.883  131.726 26.910  1.00 48.49  ? 424 ASP S CA  1 
ATOM   3313  C C   . ASP A 1 423 ? 88.907  131.035 25.557  1.00 48.49  ? 424 ASP S C   1 
ATOM   3314  O O   . ASP A 1 423 ? 88.044  130.205 25.270  1.00 100.00 ? 424 ASP S O   1 
ATOM   3315  C CB  . ASP A 1 423 ? 88.443  133.179 26.736  1.00 100.00 ? 424 ASP S CB  1 
ATOM   3316  C CG  . ASP A 1 423 ? 88.232  133.885 28.075  1.00 100.00 ? 424 ASP S CG  1 
ATOM   3317  O OD1 . ASP A 1 423 ? 89.200  133.959 28.924  1.00 100.00 ? 424 ASP S OD1 1 
ATOM   3318  O OD2 . ASP A 1 423 ? 87.085  134.403 28.358  1.00 100.00 ? 424 ASP S OD2 1 
ATOM   3319  N N   . PHE A 1 424 ? 89.891  131.375 24.725  1.00 5.03   ? 425 PHE S N   1 
ATOM   3320  C CA  . PHE A 1 424 ? 90.014  130.770 23.399  1.00 5.03   ? 425 PHE S CA  1 
ATOM   3321  C C   . PHE A 1 424 ? 89.816  129.273 23.533  1.00 5.03   ? 425 PHE S C   1 
ATOM   3322  O O   . PHE A 1 424 ? 89.502  128.580 22.572  1.00 87.14  ? 425 PHE S O   1 
ATOM   3323  C CB  . PHE A 1 424 ? 91.383  131.057 22.803  1.00 87.14  ? 425 PHE S CB  1 
ATOM   3324  C CG  . PHE A 1 424 ? 91.621  130.365 21.504  1.00 87.14  ? 425 PHE S CG  1 
ATOM   3325  C CD1 . PHE A 1 424 ? 91.924  129.010 21.470  1.00 87.14  ? 425 PHE S CD1 1 
ATOM   3326  C CD2 . PHE A 1 424 ? 91.521  131.059 20.307  1.00 87.14  ? 425 PHE S CD2 1 
ATOM   3327  C CE1 . PHE A 1 424 ? 92.121  128.348 20.265  1.00 87.14  ? 425 PHE S CE1 1 
ATOM   3328  C CE2 . PHE A 1 424 ? 91.719  130.409 19.094  1.00 87.14  ? 425 PHE S CE2 1 
ATOM   3329  C CZ  . PHE A 1 424 ? 92.019  129.047 19.075  1.00 87.14  ? 425 PHE S CZ  1 
ATOM   3330  N N   . ALA A 1 425 ? 90.003  128.781 24.748  1.00 18.62  ? 426 ALA S N   1 
ATOM   3331  C CA  . ALA A 1 425 ? 89.832  127.372 25.034  1.00 18.62  ? 426 ALA S CA  1 
ATOM   3332  C C   . ALA A 1 425 ? 88.406  127.120 25.501  1.00 18.62  ? 426 ALA S C   1 
ATOM   3333  O O   . ALA A 1 425 ? 87.662  126.386 24.863  1.00 100.00 ? 426 ALA S O   1 
ATOM   3334  C CB  . ALA A 1 425 ? 90.819  126.940 26.108  1.00 100.00 ? 426 ALA S CB  1 
ATOM   3335  N N   . ILE A 1 426 ? 88.025  127.735 26.617  1.00 28.28  ? 427 ILE S N   1 
ATOM   3336  C CA  . ILE A 1 426 ? 86.684  127.563 27.159  1.00 28.28  ? 427 ILE S CA  1 
ATOM   3337  C C   . ILE A 1 426 ? 85.669  127.857 26.069  1.00 28.28  ? 427 ILE S C   1 
ATOM   3338  O O   . ILE A 1 426 ? 84.523  127.391 26.125  1.00 34.33  ? 427 ILE S O   1 
ATOM   3339  C CB  . ILE A 1 426 ? 86.447  128.498 28.368  1.00 34.33  ? 427 ILE S CB  1 
ATOM   3340  C CG1 . ILE A 1 426 ? 85.264  127.983 29.193  1.00 34.33  ? 427 ILE S CG1 1 
ATOM   3341  C CG2 . ILE A 1 426 ? 86.192  129.928 27.903  1.00 34.33  ? 427 ILE S CG2 1 
ATOM   3342  C CD1 . ILE A 1 426 ? 85.650  127.253 30.485  1.00 34.33  ? 427 ILE S CD1 1 
ATOM   3343  N N   . GLU A 1 427 ? 86.112  128.623 25.069  1.00 32.13  ? 428 GLU S N   1 
ATOM   3344  C CA  . GLU A 1 427 ? 85.274  128.999 23.930  1.00 32.13  ? 428 GLU S CA  1 
ATOM   3345  C C   . GLU A 1 427 ? 85.292  127.883 22.885  1.00 32.13  ? 428 GLU S C   1 
ATOM   3346  O O   . GLU A 1 427 ? 84.291  127.200 22.644  1.00 22.94  ? 428 GLU S O   1 
ATOM   3347  C CB  . GLU A 1 427 ? 85.785  130.308 23.322  1.00 22.94  ? 428 GLU S CB  1 
ATOM   3348  C CG  . GLU A 1 427 ? 85.227  130.622 21.959  1.00 22.94  ? 428 GLU S CG  1 
ATOM   3349  C CD  . GLU A 1 427 ? 86.299  130.641 20.884  1.00 22.94  ? 428 GLU S CD  1 
ATOM   3350  O OE1 . GLU A 1 427 ? 86.925  129.583 20.634  1.00 22.94  ? 428 GLU S OE1 1 
ATOM   3351  O OE2 . GLU A 1 427 ? 86.521  131.718 20.284  1.00 22.94  ? 428 GLU S OE2 1 
ATOM   3352  N N   . ALA A 1 428 ? 86.450  127.693 22.282  1.00 2.00   ? 429 ALA S N   1 
ATOM   3353  C CA  . ALA A 1 428 ? 86.602  126.667 21.271  1.00 2.00   ? 429 ALA S CA  1 
ATOM   3354  C C   . ALA A 1 428 ? 86.373  125.277 21.874  1.00 2.00   ? 429 ALA S C   1 
ATOM   3355  O O   . ALA A 1 428 ? 86.606  124.243 21.238  1.00 3.68   ? 429 ALA S O   1 
ATOM   3356  C CB  . ALA A 1 428 ? 88.005  126.771 20.638  1.00 3.68   ? 429 ALA S CB  1 
ATOM   3357  N N   . LEU A 1 429 ? 85.918  125.249 23.116  1.00 11.83  ? 430 LEU S N   1 
ATOM   3358  C CA  . LEU A 1 429 ? 85.661  123.980 23.769  1.00 11.83  ? 430 LEU S CA  1 
ATOM   3359  C C   . LEU A 1 429 ? 84.193  123.744 23.601  1.00 11.83  ? 430 LEU S C   1 
ATOM   3360  O O   . LEU A 1 429 ? 83.778  122.750 23.017  1.00 62.76  ? 430 LEU S O   1 
ATOM   3361  C CB  . LEU A 1 429 ? 86.001  124.036 25.262  1.00 62.76  ? 430 LEU S CB  1 
ATOM   3362  C CG  . LEU A 1 429 ? 85.229  123.021 26.114  1.00 62.76  ? 430 LEU S CG  1 
ATOM   3363  C CD1 . LEU A 1 429 ? 85.676  121.604 25.772  1.00 62.76  ? 430 LEU S CD1 1 
ATOM   3364  C CD2 . LEU A 1 429 ? 85.442  123.324 27.582  1.00 62.76  ? 430 LEU S CD2 1 
ATOM   3365  N N   . ALA A 1 430 ? 83.405  124.673 24.122  1.00 72.53  ? 431 ALA S N   1 
ATOM   3366  C CA  . ALA A 1 430 ? 81.963  124.575 24.016  1.00 72.53  ? 431 ALA S CA  1 
ATOM   3367  C C   . ALA A 1 430 ? 81.636  124.459 22.525  1.00 72.53  ? 431 ALA S C   1 
ATOM   3368  O O   . ALA A 1 430 ? 80.912  123.544 22.088  1.00 33.18  ? 431 ALA S O   1 
ATOM   3369  C CB  . ALA A 1 430 ? 81.324  125.822 24.621  1.00 33.18  ? 431 ALA S CB  1 
ATOM   3370  N N   . LYS A 1 431 ? 82.196  125.392 21.757  1.00 21.44  ? 432 LYS S N   1 
ATOM   3371  C CA  . LYS A 1 431 ? 82.026  125.434 20.315  1.00 21.44  ? 432 LYS S CA  1 
ATOM   3372  C C   . LYS A 1 431 ? 82.181  124.051 19.643  1.00 21.44  ? 432 LYS S C   1 
ATOM   3373  O O   . LYS A 1 431 ? 81.465  123.708 18.715  1.00 33.35  ? 432 LYS S O   1 
ATOM   3374  C CB  . LYS A 1 431 ? 83.039  126.416 19.742  1.00 33.35  ? 432 LYS S CB  1 
ATOM   3375  C CG  . LYS A 1 431 ? 83.803  125.897 18.547  1.00 33.35  ? 432 LYS S CG  1 
ATOM   3376  C CD  . LYS A 1 431 ? 84.199  127.042 17.634  1.00 33.35  ? 432 LYS S CD  1 
ATOM   3377  C CE  . LYS A 1 431 ? 83.971  128.415 18.280  1.00 33.35  ? 432 LYS S CE  1 
ATOM   3378  N NZ  . LYS A 1 431 ? 84.509  129.541 17.444  1.00 33.35  ? 432 LYS S NZ  1 
ATOM   3379  N N   . ALA A 1 432 ? 83.116  123.251 20.113  1.00 15.02  ? 433 ALA S N   1 
ATOM   3380  C CA  . ALA A 1 432 ? 83.321  121.932 19.540  1.00 15.02  ? 433 ALA S CA  1 
ATOM   3381  C C   . ALA A 1 432 ? 82.490  120.903 20.285  1.00 15.02  ? 433 ALA S C   1 
ATOM   3382  O O   . ALA A 1 432 ? 82.221  119.820 19.772  1.00 61.95  ? 433 ALA S O   1 
ATOM   3383  C CB  . ALA A 1 432 ? 84.787  121.560 19.609  1.00 61.95  ? 433 ALA S CB  1 
ATOM   3384  N N   . LYS A 1 433 ? 82.115  121.231 21.516  1.00 90.13  ? 434 LYS S N   1 
ATOM   3385  C CA  . LYS A 1 433 ? 81.301  120.318 22.298  1.00 90.13  ? 434 LYS S CA  1 
ATOM   3386  C C   . LYS A 1 433 ? 79.969  120.262 21.576  1.00 90.13  ? 434 LYS S C   1 
ATOM   3387  O O   . LYS A 1 433 ? 79.253  119.258 21.635  1.00 39.87  ? 434 LYS S O   1 
ATOM   3388  C CB  . LYS A 1 433 ? 81.099  120.835 23.724  1.00 39.87  ? 434 LYS S CB  1 
ATOM   3389  C CG  . LYS A 1 433 ? 80.118  120.001 24.525  1.00 39.87  ? 434 LYS S CG  1 
ATOM   3390  C CD  . LYS A 1 433 ? 80.382  120.109 26.008  1.00 39.87  ? 434 LYS S CD  1 
ATOM   3391  C CE  . LYS A 1 433 ? 79.988  118.829 26.733  1.00 39.87  ? 434 LYS S CE  1 
ATOM   3392  N NZ  . LYS A 1 433 ? 79.015  119.080 27.848  1.00 39.87  ? 434 LYS S NZ  1 
ATOM   3393  N N   . PHE A 1 434 ? 79.647  121.350 20.885  1.00 45.63  ? 435 PHE S N   1 
ATOM   3394  C CA  . PHE A 1 434 ? 78.398  121.443 20.132  1.00 45.63  ? 435 PHE S CA  1 
ATOM   3395  C C   . PHE A 1 434 ? 78.413  120.462 18.971  1.00 45.63  ? 435 PHE S C   1 
ATOM   3396  O O   . PHE A 1 434 ? 77.602  119.532 18.908  1.00 20.59  ? 435 PHE S O   1 
ATOM   3397  C CB  . PHE A 1 434 ? 78.219  122.865 19.589  1.00 20.59  ? 435 PHE S CB  1 
ATOM   3398  C CG  . PHE A 1 434 ? 76.888  123.100 18.911  1.00 20.59  ? 435 PHE S CG  1 
ATOM   3399  C CD1 . PHE A 1 434 ? 75.704  123.193 19.664  1.00 20.59  ? 435 PHE S CD1 1 
ATOM   3400  C CD2 . PHE A 1 434 ? 76.820  123.256 17.526  1.00 20.59  ? 435 PHE S CD2 1 
ATOM   3401  C CE1 . PHE A 1 434 ? 74.464  123.440 19.049  1.00 20.59  ? 435 PHE S CE1 1 
ATOM   3402  C CE2 . PHE A 1 434 ? 75.584  123.500 16.896  1.00 20.59  ? 435 PHE S CE2 1 
ATOM   3403  C CZ  . PHE A 1 434 ? 74.404  123.594 17.664  1.00 20.59  ? 435 PHE S CZ  1 
ATOM   3404  N N   . GLU A 1 435 ? 79.347  120.694 18.053  1.00 2.00   ? 436 GLU S N   1 
ATOM   3405  C CA  . GLU A 1 435 ? 79.509  119.862 16.876  1.00 2.00   ? 436 GLU S CA  1 
ATOM   3406  C C   . GLU A 1 435 ? 79.468  118.388 17.252  1.00 2.00   ? 436 GLU S C   1 
ATOM   3407  O O   . GLU A 1 435 ? 78.975  117.552 16.492  1.00 98.50  ? 436 GLU S O   1 
ATOM   3408  C CB  . GLU A 1 435 ? 80.832  120.197 16.187  1.00 98.50  ? 436 GLU S CB  1 
ATOM   3409  C CG  . GLU A 1 435 ? 80.999  119.571 14.817  1.00 98.50  ? 436 GLU S CG  1 
ATOM   3410  C CD  . GLU A 1 435 ? 82.455  119.432 14.417  1.00 98.50  ? 436 GLU S CD  1 
ATOM   3411  O OE1 . GLU A 1 435 ? 83.219  118.784 15.166  1.00 98.50  ? 436 GLU S OE1 1 
ATOM   3412  O OE2 . GLU A 1 435 ? 82.839  119.972 13.358  1.00 98.50  ? 436 GLU S OE2 1 
ATOM   3413  N N   . ARG A 1 436 ? 79.992  118.082 18.429  1.00 67.64  ? 437 ARG S N   1 
ATOM   3414  C CA  . ARG A 1 436 ? 80.021  116.711 18.920  1.00 67.64  ? 437 ARG S CA  1 
ATOM   3415  C C   . ARG A 1 436 ? 78.577  116.267 19.085  1.00 67.64  ? 437 ARG S C   1 
ATOM   3416  O O   . ARG A 1 436 ? 78.287  115.071 19.114  1.00 48.50  ? 437 ARG S O   1 
ATOM   3417  C CB  . ARG A 1 436 ? 80.757  116.632 20.271  1.00 48.50  ? 437 ARG S CB  1 
ATOM   3418  C CG  . ARG A 1 436 ? 82.233  116.168 20.212  1.00 48.50  ? 437 ARG S CG  1 
ATOM   3419  C CD  . ARG A 1 436 ? 82.366  114.654 20.470  1.00 48.50  ? 437 ARG S CD  1 
ATOM   3420  N NE  . ARG A 1 436 ? 83.521  114.272 21.285  1.00 48.50  ? 437 ARG S NE  1 
ATOM   3421  C CZ  . ARG A 1 436 ? 84.790  114.404 20.910  1.00 48.50  ? 437 ARG S CZ  1 
ATOM   3422  N NH1 . ARG A 1 436 ? 85.095  114.915 19.725  1.00 48.50  ? 437 ARG S NH1 1 
ATOM   3423  N NH2 . ARG A 1 436 ? 85.759  113.999 21.714  1.00 48.50  ? 437 ARG S NH2 1 
ATOM   3424  N N   . LEU A 1 437 ? 77.675  117.237 19.201  1.00 6.62   ? 438 LEU S N   1 
ATOM   3425  C CA  . LEU A 1 437 ? 76.272  116.893 19.354  1.00 6.62   ? 438 LEU S CA  1 
ATOM   3426  C C   . LEU A 1 437 ? 75.610  116.625 18.016  1.00 6.62   ? 438 LEU S C   1 
ATOM   3427  O O   . LEU A 1 437 ? 75.019  115.560 17.806  1.00 11.45  ? 438 LEU S O   1 
ATOM   3428  C CB  . LEU A 1 437 ? 75.498  117.995 20.066  1.00 11.45  ? 438 LEU S CB  1 
ATOM   3429  C CG  . LEU A 1 437 ? 74.178  117.422 20.607  1.00 11.45  ? 438 LEU S CG  1 
ATOM   3430  C CD1 . LEU A 1 437 ? 74.398  116.096 21.341  1.00 11.45  ? 438 LEU S CD1 1 
ATOM   3431  C CD2 . LEU A 1 437 ? 73.573  118.420 21.544  1.00 11.45  ? 438 LEU S CD2 1 
ATOM   3432  N N   . PHE A 1 438 ? 75.711  117.599 17.114  1.00 54.07  ? 439 PHE S N   1 
ATOM   3433  C CA  . PHE A 1 438 ? 75.123  117.460 15.792  1.00 54.07  ? 439 PHE S CA  1 
ATOM   3434  C C   . PHE A 1 438 ? 75.488  116.112 15.238  1.00 54.07  ? 439 PHE S C   1 
ATOM   3435  O O   . PHE A 1 438 ? 74.626  115.267 15.060  1.00 20.36  ? 439 PHE S O   1 
ATOM   3436  C CB  . PHE A 1 438 ? 75.633  118.528 14.840  1.00 20.36  ? 439 PHE S CB  1 
ATOM   3437  C CG  . PHE A 1 438 ? 74.924  118.526 13.525  1.00 20.36  ? 439 PHE S CG  1 
ATOM   3438  C CD1 . PHE A 1 438 ? 73.663  119.097 13.393  1.00 20.36  ? 439 PHE S CD1 1 
ATOM   3439  C CD2 . PHE A 1 438 ? 75.501  117.942 12.411  1.00 20.36  ? 439 PHE S CD2 1 
ATOM   3440  C CE1 . PHE A 1 438 ? 72.988  119.087 12.182  1.00 20.36  ? 439 PHE S CE1 1 
ATOM   3441  C CE2 . PHE A 1 438 ? 74.819  117.931 11.188  1.00 20.36  ? 439 PHE S CE2 1 
ATOM   3442  C CZ  . PHE A 1 438 ? 73.565  118.505 11.083  1.00 20.36  ? 439 PHE S CZ  1 
ATOM   3443  N N   . ARG A 1 439 ? 76.778  115.915 14.981  1.00 2.00   ? 440 ARG S N   1 
ATOM   3444  C CA  . ARG A 1 439 ? 77.265  114.651 14.449  1.00 2.00   ? 440 ARG S CA  1 
ATOM   3445  C C   . ARG A 1 439 ? 76.688  113.431 15.181  1.00 2.00   ? 440 ARG S C   1 
ATOM   3446  O O   . ARG A 1 439 ? 76.565  112.355 14.602  1.00 100.00 ? 440 ARG S O   1 
ATOM   3447  C CB  . ARG A 1 439 ? 78.796  114.632 14.517  1.00 100.00 ? 440 ARG S CB  1 
ATOM   3448  C CG  . ARG A 1 439 ? 79.470  115.519 13.480  1.00 100.00 ? 440 ARG S CG  1 
ATOM   3449  C CD  . ARG A 1 439 ? 79.458  114.847 12.119  1.00 100.00 ? 440 ARG S CD  1 
ATOM   3450  N NE  . ARG A 1 439 ? 79.532  115.815 11.027  1.00 100.00 ? 440 ARG S NE  1 
ATOM   3451  C CZ  . ARG A 1 439 ? 79.402  115.504 9.738   1.00 100.00 ? 440 ARG S CZ  1 
ATOM   3452  N NH1 . ARG A 1 439 ? 79.190  114.239 9.367   1.00 100.00 ? 440 ARG S NH1 1 
ATOM   3453  N NH2 . ARG A 1 439 ? 79.486  116.459 8.819   1.00 100.00 ? 440 ARG S NH2 1 
ATOM   3454  N N   . TRP A 1 440 ? 76.331  113.608 16.449  1.00 32.33  ? 441 TRP S N   1 
ATOM   3455  C CA  . TRP A 1 440 ? 75.782  112.519 17.257  1.00 32.33  ? 441 TRP S CA  1 
ATOM   3456  C C   . TRP A 1 440 ? 74.352  112.241 16.874  1.00 32.33  ? 441 TRP S C   1 
ATOM   3457  O O   . TRP A 1 440 ? 74.007  111.116 16.527  1.00 77.70  ? 441 TRP S O   1 
ATOM   3458  C CB  . TRP A 1 440 ? 75.825  112.858 18.747  1.00 77.70  ? 441 TRP S CB  1 
ATOM   3459  C CG  . TRP A 1 440 ? 75.278  111.758 19.585  1.00 77.70  ? 441 TRP S CG  1 
ATOM   3460  C CD1 . TRP A 1 440 ? 75.956  110.676 20.053  1.00 77.70  ? 441 TRP S CD1 1 
ATOM   3461  C CD2 . TRP A 1 440 ? 73.928  111.613 20.042  1.00 77.70  ? 441 TRP S CD2 1 
ATOM   3462  N NE1 . TRP A 1 440 ? 75.117  109.860 20.772  1.00 77.70  ? 441 TRP S NE1 1 
ATOM   3463  C CE2 . TRP A 1 440 ? 73.864  110.411 20.782  1.00 77.70  ? 441 TRP S CE2 1 
ATOM   3464  C CE3 . TRP A 1 440 ? 72.764  112.376 19.895  1.00 77.70  ? 441 TRP S CE3 1 
ATOM   3465  C CZ2 . TRP A 1 440 ? 72.680  109.956 21.381  1.00 77.70  ? 441 TRP S CZ2 1 
ATOM   3466  C CZ3 . TRP A 1 440 ? 71.584  111.924 20.493  1.00 77.70  ? 441 TRP S CZ3 1 
ATOM   3467  C CH2 . TRP A 1 440 ? 71.554  110.723 21.225  1.00 77.70  ? 441 TRP S CH2 1 
ATOM   3468  N N   . ILE A 1 441 ? 73.517  113.271 16.967  1.00 32.59  ? 442 ILE S N   1 
ATOM   3469  C CA  . ILE A 1 441 ? 72.100  113.166 16.614  1.00 32.59  ? 442 ILE S CA  1 
ATOM   3470  C C   . ILE A 1 441 ? 72.004  112.543 15.230  1.00 32.59  ? 442 ILE S C   1 
ATOM   3471  O O   . ILE A 1 441 ? 71.346  111.533 15.009  1.00 13.72  ? 442 ILE S O   1 
ATOM   3472  C CB  . ILE A 1 441 ? 71.436  114.555 16.533  1.00 13.72  ? 442 ILE S CB  1 
ATOM   3473  C CG1 . ILE A 1 441 ? 71.711  115.361 17.820  1.00 13.72  ? 442 ILE S CG1 1 
ATOM   3474  C CG2 . ILE A 1 441 ? 69.962  114.398 16.214  1.00 13.72  ? 442 ILE S CG2 1 
ATOM   3475  C CD1 . ILE A 1 441 ? 70.824  115.022 19.009  1.00 13.72  ? 442 ILE S CD1 1 
ATOM   3476  N N   . LEU A 1 442 ? 72.688  113.179 14.298  1.00 4.38   ? 443 LEU S N   1 
ATOM   3477  C CA  . LEU A 1 442 ? 72.726  112.749 12.918  1.00 4.38   ? 443 LEU S CA  1 
ATOM   3478  C C   . LEU A 1 442 ? 72.937  111.273 12.735  1.00 4.38   ? 443 LEU S C   1 
ATOM   3479  O O   . LEU A 1 442 ? 72.523  110.717 11.719  1.00 5.56   ? 443 LEU S O   1 
ATOM   3480  C CB  . LEU A 1 442 ? 73.826  113.480 12.167  1.00 5.56   ? 443 LEU S CB  1 
ATOM   3481  C CG  . LEU A 1 442 ? 73.412  113.688 10.725  1.00 5.56   ? 443 LEU S CG  1 
ATOM   3482  C CD1 . LEU A 1 442 ? 73.743  115.105 10.350  1.00 5.56   ? 443 LEU S CD1 1 
ATOM   3483  C CD2 . LEU A 1 442 ? 74.082  112.666 9.817   1.00 5.56   ? 443 LEU S CD2 1 
ATOM   3484  N N   . THR A 1 443 ? 73.605  110.635 13.690  1.00 2.00   ? 444 THR S N   1 
ATOM   3485  C CA  . THR A 1 443 ? 73.842  109.201 13.579  1.00 2.00   ? 444 THR S CA  1 
ATOM   3486  C C   . THR A 1 443 ? 72.798  108.442 14.374  1.00 2.00   ? 444 THR S C   1 
ATOM   3487  O O   . THR A 1 443 ? 72.710  107.214 14.303  1.00 20.12  ? 444 THR S O   1 
ATOM   3488  C CB  . THR A 1 443 ? 75.246  108.814 14.052  1.00 20.12  ? 444 THR S CB  1 
ATOM   3489  O OG1 . THR A 1 443 ? 75.941  109.988 14.510  1.00 20.12  ? 444 THR S OG1 1 
ATOM   3490  C CG2 . THR A 1 443 ? 76.017  108.172 12.895  1.00 20.12  ? 444 THR S CG2 1 
ATOM   3491  N N   . ARG A 1 444 ? 72.014  109.196 15.135  1.00 18.57  ? 445 ARG S N   1 
ATOM   3492  C CA  . ARG A 1 444 ? 70.933  108.625 15.909  1.00 18.57  ? 445 ARG S CA  1 
ATOM   3493  C C   . ARG A 1 444 ? 69.769  108.612 14.926  1.00 18.57  ? 445 ARG S C   1 
ATOM   3494  O O   . ARG A 1 444 ? 69.021  107.632 14.842  1.00 57.33  ? 445 ARG S O   1 
ATOM   3495  C CB  . ARG A 1 444 ? 70.603  109.494 17.123  1.00 57.33  ? 445 ARG S CB  1 
ATOM   3496  C CG  . ARG A 1 444 ? 70.914  108.819 18.438  1.00 57.33  ? 445 ARG S CG  1 
ATOM   3497  C CD  . ARG A 1 444 ? 70.551  107.356 18.383  1.00 57.33  ? 445 ARG S CD  1 
ATOM   3498  N NE  . ARG A 1 444 ? 69.126  107.207 18.125  1.00 57.33  ? 445 ARG S NE  1 
ATOM   3499  C CZ  . ARG A 1 444 ? 68.289  106.549 18.920  1.00 57.33  ? 445 ARG S CZ  1 
ATOM   3500  N NH1 . ARG A 1 444 ? 68.746  105.981 20.029  1.00 57.33  ? 445 ARG S NH1 1 
ATOM   3501  N NH2 . ARG A 1 444 ? 66.997  106.475 18.619  1.00 57.33  ? 445 ARG S NH2 1 
ATOM   3502  N N   . VAL A 1 445 ? 69.629  109.700 14.166  1.00 29.57  ? 446 VAL S N   1 
ATOM   3503  C CA  . VAL A 1 445 ? 68.580  109.805 13.154  1.00 29.57  ? 446 VAL S CA  1 
ATOM   3504  C C   . VAL A 1 445 ? 68.867  108.734 12.129  1.00 29.57  ? 446 VAL S C   1 
ATOM   3505  O O   . VAL A 1 445 ? 68.054  107.845 11.886  1.00 2.33   ? 446 VAL S O   1 
ATOM   3506  C CB  . VAL A 1 445 ? 68.624  111.149 12.430  1.00 2.33   ? 446 VAL S CB  1 
ATOM   3507  C CG1 . VAL A 1 445 ? 68.114  110.989 11.012  1.00 2.33   ? 446 VAL S CG1 1 
ATOM   3508  C CG2 . VAL A 1 445 ? 67.780  112.168 13.186  1.00 2.33   ? 446 VAL S CG2 1 
ATOM   3509  N N   . ASN A 1 446 ? 70.054  108.837 11.549  1.00 2.00   ? 447 ASN S N   1 
ATOM   3510  C CA  . ASN A 1 446 ? 70.516  107.912 10.541  1.00 2.00   ? 447 ASN S CA  1 
ATOM   3511  C C   . ASN A 1 446 ? 70.521  106.464 10.995  1.00 2.00   ? 447 ASN S C   1 
ATOM   3512  O O   . ASN A 1 446 ? 70.784  105.563 10.195  1.00 53.03  ? 447 ASN S O   1 
ATOM   3513  C CB  . ASN A 1 446 ? 71.915  108.305 10.075  1.00 53.03  ? 447 ASN S CB  1 
ATOM   3514  C CG  . ASN A 1 446 ? 71.941  108.721 8.611   1.00 53.03  ? 447 ASN S CG  1 
ATOM   3515  O OD1 . ASN A 1 446 ? 71.640  107.928 7.711   1.00 53.03  ? 447 ASN S OD1 1 
ATOM   3516  N ND2 . ASN A 1 446 ? 72.303  109.971 8.364   1.00 53.03  ? 447 ASN S ND2 1 
ATOM   3517  N N   . LYS A 1 447 ? 70.238  106.234 12.274  1.00 68.03  ? 448 LYS S N   1 
ATOM   3518  C CA  . LYS A 1 447 ? 70.225  104.877 12.811  1.00 68.03  ? 448 LYS S CA  1 
ATOM   3519  C C   . LYS A 1 447 ? 68.883  104.215 12.568  1.00 68.03  ? 448 LYS S C   1 
ATOM   3520  O O   . LYS A 1 447 ? 68.788  102.989 12.536  1.00 100.00 ? 448 LYS S O   1 
ATOM   3521  C CB  . LYS A 1 447 ? 70.526  104.884 14.310  1.00 100.00 ? 448 LYS S CB  1 
ATOM   3522  C CG  . LYS A 1 447 ? 70.663  103.494 14.915  1.00 100.00 ? 448 LYS S CG  1 
ATOM   3523  C CD  . LYS A 1 447 ? 72.125  103.107 15.093  1.00 100.00 ? 448 LYS S CD  1 
ATOM   3524  C CE  . LYS A 1 447 ? 72.561  103.256 16.542  1.00 100.00 ? 448 LYS S CE  1 
ATOM   3525  N NZ  . LYS A 1 447 ? 73.970  103.734 16.661  1.00 100.00 ? 448 LYS S NZ  1 
ATOM   3526  N N   . ALA A 1 448 ? 67.850  105.037 12.402  1.00 80.38  ? 449 ALA S N   1 
ATOM   3527  C CA  . ALA A 1 448 ? 66.502  104.535 12.157  1.00 80.38  ? 449 ALA S CA  1 
ATOM   3528  C C   . ALA A 1 448 ? 66.216  104.550 10.671  1.00 80.38  ? 449 ALA S C   1 
ATOM   3529  O O   . ALA A 1 448 ? 65.737  103.561 10.110  1.00 33.66  ? 449 ALA S O   1 
ATOM   3530  C CB  . ALA A 1 448 ? 65.477  105.387 12.882  1.00 33.66  ? 449 ALA S CB  1 
ATOM   3531  N N   . LEU A 1 449 ? 66.515  105.675 10.031  1.00 2.00   ? 450 LEU S N   1 
ATOM   3532  C CA  . LEU A 1 449 ? 66.274  105.793 8.610   1.00 2.00   ? 450 LEU S CA  1 
ATOM   3533  C C   . LEU A 1 449 ? 67.003  104.696 7.873   1.00 2.00   ? 450 LEU S C   1 
ATOM   3534  O O   . LEU A 1 449 ? 66.855  104.576 6.664   1.00 17.49  ? 450 LEU S O   1 
ATOM   3535  C CB  . LEU A 1 449 ? 66.749  107.133 8.090   1.00 17.49  ? 450 LEU S CB  1 
ATOM   3536  C CG  . LEU A 1 449 ? 66.473  108.310 9.006   1.00 17.49  ? 450 LEU S CG  1 
ATOM   3537  C CD1 . LEU A 1 449 ? 66.383  109.527 8.149   1.00 17.49  ? 450 LEU S CD1 1 
ATOM   3538  C CD2 . LEU A 1 449 ? 65.202  108.121 9.797   1.00 17.49  ? 450 LEU S CD2 1 
ATOM   3539  N N   . ASP A 1 450 ? 67.817  103.930 8.599   1.00 49.42  ? 451 ASP S N   1 
ATOM   3540  C CA  . ASP A 1 450 ? 68.604  102.845 8.032   1.00 49.42  ? 451 ASP S CA  1 
ATOM   3541  C C   . ASP A 1 450 ? 68.578  101.703 9.044   1.00 49.42  ? 451 ASP S C   1 
ATOM   3542  O O   . ASP A 1 450 ? 68.548  100.542 8.616   1.00 100.00 ? 451 ASP S O   1 
ATOM   3543  C CB  . ASP A 1 450 ? 70.052  103.294 7.789   1.00 100.00 ? 451 ASP S CB  1 
ATOM   3544  C CG  . ASP A 1 450 ? 70.566  102.953 6.382   1.00 100.00 ? 451 ASP S CG  1 
ATOM   3545  O OD1 . ASP A 1 450 ? 70.856  101.772 6.089   1.00 100.00 ? 451 ASP S OD1 1 
ATOM   3546  O OD2 . ASP A 1 450 ? 70.694  103.887 5.560   1.00 100.00 ? 451 ASP S OD2 1 
ATOM   3547  N N   . ALA A 1 457 ? 68.789  97.384  -3.976  1.00 35.36  ? 458 ALA S N   1 
ATOM   3548  C CA  . ALA A 1 457 ? 69.505  97.702  -5.244  1.00 35.36  ? 458 ALA S CA  1 
ATOM   3549  C C   . ALA A 1 457 ? 69.516  99.184  -5.754  1.00 35.36  ? 458 ALA S C   1 
ATOM   3550  O O   . ALA A 1 457 ? 70.342  99.568  -6.594  1.00 49.99  ? 458 ALA S O   1 
ATOM   3551  C CB  . ALA A 1 457 ? 68.891  96.915  -6.403  1.00 49.99  ? 458 ALA S CB  1 
ATOM   3552  N N   . SER A 1 458 ? 68.639  100.084 -5.313  1.00 2.00   ? 459 SER S N   1 
ATOM   3553  C CA  . SER A 1 458 ? 68.654  101.468 -5.901  1.00 2.00   ? 459 SER S CA  1 
ATOM   3554  C C   . SER A 1 458 ? 68.558  102.586 -4.851  1.00 2.00   ? 459 SER S C   1 
ATOM   3555  O O   . SER A 1 458 ? 68.064  102.376 -3.735  1.00 12.65  ? 459 SER S O   1 
ATOM   3556  C CB  . SER A 1 458 ? 67.475  101.650 -6.858  1.00 12.65  ? 459 SER S CB  1 
ATOM   3557  O OG  . SER A 1 458 ? 66.521  100.621 -6.653  1.00 12.65  ? 459 SER S OG  1 
ATOM   3558  N N   . PHE A 1 459 ? 69.036  103.779 -5.255  1.00 2.00   ? 460 PHE S N   1 
ATOM   3559  C CA  . PHE A 1 459 ? 69.020  104.962 -4.368  1.00 2.00   ? 460 PHE S CA  1 
ATOM   3560  C C   . PHE A 1 459 ? 68.734  106.250 -5.096  1.00 2.00   ? 460 PHE S C   1 
ATOM   3561  O O   . PHE A 1 459 ? 69.130  106.428 -6.241  1.00 2.00   ? 460 PHE S O   1 
ATOM   3562  C CB  . PHE A 1 459 ? 70.326  105.057 -3.560  1.00 2.00   ? 460 PHE S CB  1 
ATOM   3563  C CG  . PHE A 1 459 ? 71.481  105.773 -4.259  1.00 2.00   ? 460 PHE S CG  1 
ATOM   3564  C CD1 . PHE A 1 459 ? 71.649  107.155 -4.103  1.00 2.00   ? 460 PHE S CD1 1 
ATOM   3565  C CD2 . PHE A 1 459 ? 72.382  105.041 -5.036  1.00 2.00   ? 460 PHE S CD2 1 
ATOM   3566  C CE1 . PHE A 1 459 ? 72.720  107.804 -4.728  1.00 2.00   ? 460 PHE S CE1 1 
ATOM   3567  C CE2 . PHE A 1 459 ? 73.453  105.688 -5.661  1.00 2.00   ? 460 PHE S CE2 1 
ATOM   3568  C CZ  . PHE A 1 459 ? 73.623  107.068 -5.507  1.00 2.00   ? 460 PHE S CZ  1 
ATOM   3569  N N   . LEU A 1 460 ? 68.007  107.145 -4.452  1.00 2.21   ? 461 LEU S N   1 
ATOM   3570  C CA  . LEU A 1 460 ? 67.716  108.427 -5.076  1.00 2.21   ? 461 LEU S CA  1 
ATOM   3571  C C   . LEU A 1 460 ? 68.540  109.441 -4.298  1.00 2.21   ? 461 LEU S C   1 
ATOM   3572  O O   . LEU A 1 460 ? 68.536  109.424 -3.086  1.00 2.00   ? 461 LEU S O   1 
ATOM   3573  C CB  . LEU A 1 460 ? 66.210  108.761 -4.975  1.00 2.00   ? 461 LEU S CB  1 
ATOM   3574  C CG  . LEU A 1 460 ? 65.625  109.747 -6.007  1.00 2.00   ? 461 LEU S CG  1 
ATOM   3575  C CD1 . LEU A 1 460 ? 64.626  109.043 -6.858  1.00 2.00   ? 461 LEU S CD1 1 
ATOM   3576  C CD2 . LEU A 1 460 ? 64.977  110.932 -5.318  1.00 2.00   ? 461 LEU S CD2 1 
ATOM   3577  N N   . GLY A 1 461 ? 69.252  110.313 -4.983  1.00 2.00   ? 462 GLY S N   1 
ATOM   3578  C CA  . GLY A 1 461 ? 70.025  111.291 -4.265  1.00 2.00   ? 462 GLY S CA  1 
ATOM   3579  C C   . GLY A 1 461 ? 69.487  112.712 -4.320  1.00 2.00   ? 462 GLY S C   1 
ATOM   3580  O O   . GLY A 1 461 ? 69.293  113.256 -5.396  1.00 87.68  ? 462 GLY S O   1 
ATOM   3581  N N   . ILE A 1 462 ? 69.256  113.322 -3.161  1.00 2.00   ? 463 ILE S N   1 
ATOM   3582  C CA  . ILE A 1 462 ? 68.772  114.698 -3.070  1.00 2.00   ? 463 ILE S CA  1 
ATOM   3583  C C   . ILE A 1 462 ? 69.838  115.574 -2.414  1.00 2.00   ? 463 ILE S C   1 
ATOM   3584  O O   . ILE A 1 462 ? 70.149  115.384 -1.254  1.00 4.30   ? 463 ILE S O   1 
ATOM   3585  C CB  . ILE A 1 462 ? 67.536  114.767 -2.211  1.00 4.30   ? 463 ILE S CB  1 
ATOM   3586  C CG1 . ILE A 1 462 ? 66.581  113.672 -2.631  1.00 4.30   ? 463 ILE S CG1 1 
ATOM   3587  C CG2 . ILE A 1 462 ? 66.896  116.121 -2.330  1.00 4.30   ? 463 ILE S CG2 1 
ATOM   3588  C CD1 . ILE A 1 462 ? 65.468  113.480 -1.659  1.00 4.30   ? 463 ILE S CD1 1 
ATOM   3589  N N   . LEU A 1 463 ? 70.385  116.541 -3.136  1.00 10.73  ? 464 LEU S N   1 
ATOM   3590  C CA  . LEU A 1 463 ? 71.420  117.406 -2.566  1.00 10.73  ? 464 LEU S CA  1 
ATOM   3591  C C   . LEU A 1 463 ? 71.068  118.867 -2.215  1.00 10.73  ? 464 LEU S C   1 
ATOM   3592  O O   . LEU A 1 463 ? 70.778  119.709 -3.071  1.00 7.41   ? 464 LEU S O   1 
ATOM   3593  C CB  . LEU A 1 463 ? 72.651  117.421 -3.465  1.00 7.41   ? 464 LEU S CB  1 
ATOM   3594  C CG  . LEU A 1 463 ? 73.784  118.327 -2.981  1.00 7.41   ? 464 LEU S CG  1 
ATOM   3595  C CD1 . LEU A 1 463 ? 74.324  117.736 -1.696  1.00 7.41   ? 464 LEU S CD1 1 
ATOM   3596  C CD2 . LEU A 1 463 ? 74.892  118.428 -4.022  1.00 7.41   ? 464 LEU S CD2 1 
ATOM   3597  N N   . ASP A 1 464 ? 71.153  119.146 -0.922  1.00 2.00   ? 465 ASP S N   1 
ATOM   3598  C CA  . ASP A 1 464 ? 70.871  120.445 -0.370  1.00 2.00   ? 465 ASP S CA  1 
ATOM   3599  C C   . ASP A 1 464 ? 72.169  121.021 0.168   1.00 2.00   ? 465 ASP S C   1 
ATOM   3600  O O   . ASP A 1 464 ? 72.489  120.842 1.340   1.00 39.65  ? 465 ASP S O   1 
ATOM   3601  C CB  . ASP A 1 464 ? 69.839  120.293 0.759   1.00 39.65  ? 465 ASP S CB  1 
ATOM   3602  C CG  . ASP A 1 464 ? 70.000  121.328 1.861   1.00 39.65  ? 465 ASP S CG  1 
ATOM   3603  O OD1 . ASP A 1 464 ? 70.465  122.454 1.583   1.00 39.65  ? 465 ASP S OD1 1 
ATOM   3604  O OD2 . ASP A 1 464 ? 69.658  121.017 3.014   1.00 39.65  ? 465 ASP S OD2 1 
ATOM   3605  N N   . ILE A 1 465 ? 72.936  121.681 -0.685  1.00 2.00   ? 466 ILE S N   1 
ATOM   3606  C CA  . ILE A 1 465 ? 74.172  122.290 -0.210  1.00 2.00   ? 466 ILE S CA  1 
ATOM   3607  C C   . ILE A 1 465 ? 73.816  123.689 0.267   1.00 2.00   ? 466 ILE S C   1 
ATOM   3608  O O   . ILE A 1 465 ? 72.732  124.177 -0.019  1.00 12.40  ? 466 ILE S O   1 
ATOM   3609  C CB  . ILE A 1 465 ? 75.203  122.420 -1.325  1.00 12.40  ? 466 ILE S CB  1 
ATOM   3610  C CG1 . ILE A 1 465 ? 74.572  123.127 -2.517  1.00 12.40  ? 466 ILE S CG1 1 
ATOM   3611  C CG2 . ILE A 1 465 ? 75.711  121.051 -1.729  1.00 12.40  ? 466 ILE S CG2 1 
ATOM   3612  C CD1 . ILE A 1 465 ? 74.993  124.563 -2.647  1.00 12.40  ? 466 ILE S CD1 1 
ATOM   3613  N N   . ALA A 1 466 ? 74.699  124.344 1.007   1.00 12.85  ? 467 ALA S N   1 
ATOM   3614  C CA  . ALA A 1 466 ? 74.401  125.703 1.455   1.00 12.85  ? 467 ALA S CA  1 
ATOM   3615  C C   . ALA A 1 466 ? 74.704  126.613 0.256   1.00 12.85  ? 467 ALA S C   1 
ATOM   3616  O O   . ALA A 1 466 ? 75.694  126.412 -0.464  1.00 2.00   ? 467 ALA S O   1 
ATOM   3617  C CB  . ALA A 1 466 ? 75.228  126.067 2.674   1.00 2.00   ? 467 ALA S CB  1 
ATOM   3618  N N   . GLY A 1 467 ? 73.846  127.588 0.064   1.00 2.00   ? 468 GLY S N   1 
ATOM   3619  C CA  . GLY A 1 467 ? 73.920  128.484 -1.105  1.00 2.00   ? 468 GLY S CA  1 
ATOM   3620  C C   . GLY A 1 467 ? 74.924  129.626 -0.930  1.00 2.00   ? 468 GLY S C   1 
ATOM   3621  O O   . GLY A 1 467 ? 75.138  130.131 0.184   1.00 2.00   ? 468 GLY S O   1 
ATOM   3622  N N   . PHE A 1 468 ? 75.497  129.976 -2.076  1.00 2.00   ? 469 PHE S N   1 
ATOM   3623  C CA  . PHE A 1 468 ? 76.423  131.100 -2.190  1.00 2.00   ? 469 PHE S CA  1 
ATOM   3624  C C   . PHE A 1 468 ? 75.927  132.170 -1.244  1.00 2.00   ? 469 PHE S C   1 
ATOM   3625  O O   . PHE A 1 468 ? 74.817  132.694 -1.393  1.00 14.76  ? 469 PHE S O   1 
ATOM   3626  C CB  . PHE A 1 468 ? 76.399  131.620 -3.638  1.00 14.76  ? 469 PHE S CB  1 
ATOM   3627  C CG  . PHE A 1 468 ? 77.605  132.486 -4.046  1.00 14.76  ? 469 PHE S CG  1 
ATOM   3628  C CD1 . PHE A 1 468 ? 77.596  133.870 -3.817  1.00 14.76  ? 469 PHE S CD1 1 
ATOM   3629  C CD2 . PHE A 1 468 ? 78.716  131.896 -4.667  1.00 14.76  ? 469 PHE S CD2 1 
ATOM   3630  C CE1 . PHE A 1 468 ? 78.692  134.655 -4.207  1.00 14.76  ? 469 PHE S CE1 1 
ATOM   3631  C CE2 . PHE A 1 468 ? 79.807  132.683 -5.059  1.00 14.76  ? 469 PHE S CE2 1 
ATOM   3632  C CZ  . PHE A 1 468 ? 79.796  134.062 -4.829  1.00 14.76  ? 469 PHE S CZ  1 
ATOM   3633  N N   . GLU A 1 469 ? 76.735  132.458 -0.271  1.00 14.32  ? 470 GLU S N   1 
ATOM   3634  C CA  . GLU A 1 469 ? 76.405  133.469 0.716   1.00 14.32  ? 470 GLU S CA  1 
ATOM   3635  C C   . GLU A 1 469 ? 77.596  134.362 0.883   1.00 14.32  ? 470 GLU S C   1 
ATOM   3636  O O   . GLU A 1 469 ? 78.746  133.898 0.918   1.00 26.47  ? 470 GLU S O   1 
ATOM   3637  C CB  . GLU A 1 469 ? 76.044  132.807 2.035   1.00 26.47  ? 470 GLU S CB  1 
ATOM   3638  C CG  . GLU A 1 469 ? 77.253  132.234 2.767   1.00 26.47  ? 470 GLU S CG  1 
ATOM   3639  C CD  . GLU A 1 469 ? 76.873  131.623 4.111   1.00 26.47  ? 470 GLU S CD  1 
ATOM   3640  O OE1 . GLU A 1 469 ? 75.713  131.077 4.260   1.00 26.47  ? 470 GLU S OE1 1 
ATOM   3641  O OE2 . GLU A 1 469 ? 77.705  131.655 5.092   1.00 26.47  ? 470 GLU S OE2 1 
ATOM   3642  N N   . ILE A 1 470 ? 77.321  135.627 0.983   1.00 5.55   ? 471 ILE S N   1 
ATOM   3643  C CA  . ILE A 1 470 ? 78.407  136.558 1.073   1.00 5.55   ? 471 ILE S CA  1 
ATOM   3644  C C   . ILE A 1 470 ? 78.074  137.826 1.879   1.00 5.55   ? 471 ILE S C   1 
ATOM   3645  O O   . ILE A 1 470 ? 77.626  138.833 1.336   1.00 19.07  ? 471 ILE S O   1 
ATOM   3646  C CB  . ILE A 1 470 ? 78.841  136.971 -0.337  1.00 19.07  ? 471 ILE S CB  1 
ATOM   3647  C CG1 . ILE A 1 470 ? 78.757  138.476 -0.588  1.00 19.07  ? 471 ILE S CG1 1 
ATOM   3648  C CG2 . ILE A 1 470 ? 77.993  136.327 -1.436  1.00 19.07  ? 471 ILE S CG2 1 
ATOM   3649  C CD1 . ILE A 1 470 ? 79.045  138.851 -2.044  1.00 19.07  ? 471 ILE S CD1 1 
ATOM   3650  N N   . PHE A 1 471 ? 78.337  137.807 3.192   1.00 51.33  ? 472 PHE S N   1 
ATOM   3651  C CA  . PHE A 1 471 ? 77.939  138.898 4.074   1.00 51.33  ? 472 PHE S CA  1 
ATOM   3652  C C   . PHE A 1 471 ? 79.007  139.977 4.110   1.00 51.33  ? 472 PHE S C   1 
ATOM   3653  O O   . PHE A 1 471 ? 79.498  140.506 3.108   1.00 29.97  ? 472 PHE S O   1 
ATOM   3654  C CB  . PHE A 1 471 ? 77.666  138.373 5.483   1.00 29.97  ? 472 PHE S CB  1 
ATOM   3655  C CG  . PHE A 1 471 ? 76.846  137.120 5.508   1.00 29.97  ? 472 PHE S CG  1 
ATOM   3656  C CD1 . PHE A 1 471 ? 75.466  137.187 5.556   1.00 29.97  ? 472 PHE S CD1 1 
ATOM   3657  C CD2 . PHE A 1 471 ? 77.457  135.879 5.481   1.00 29.97  ? 472 PHE S CD2 1 
ATOM   3658  C CE1 . PHE A 1 471 ? 74.705  136.034 5.579   1.00 29.97  ? 472 PHE S CE1 1 
ATOM   3659  C CE2 . PHE A 1 471 ? 76.702  134.720 5.503   1.00 29.97  ? 472 PHE S CE2 1 
ATOM   3660  C CZ  . PHE A 1 471 ? 75.324  134.799 5.554   1.00 29.97  ? 472 PHE S CZ  1 
ATOM   3661  N N   . GLU A 1 472 ? 79.304  140.428 5.371   1.00 100.00 ? 473 GLU S N   1 
ATOM   3662  C CA  . GLU A 1 472 ? 80.277  141.485 5.663   1.00 100.00 ? 473 GLU S CA  1 
ATOM   3663  C C   . GLU A 1 472 ? 81.634  140.839 5.900   1.00 100.00 ? 473 GLU S C   1 
ATOM   3664  O O   . GLU A 1 472 ? 82.586  141.047 5.148   1.00 100.00 ? 473 GLU S O   1 
ATOM   3665  C CB  . GLU A 1 472 ? 79.864  142.247 6.926   1.00 100.00 ? 473 GLU S CB  1 
ATOM   3666  C CG  . GLU A 1 472 ? 78.832  143.338 6.695   1.00 100.00 ? 473 GLU S CG  1 
ATOM   3667  C CD  . GLU A 1 472 ? 78.602  143.614 5.219   1.00 100.00 ? 473 GLU S CD  1 
ATOM   3668  O OE1 . GLU A 1 472 ? 79.450  144.302 4.606   1.00 100.00 ? 473 GLU S OE1 1 
ATOM   3669  O OE2 . GLU A 1 472 ? 77.578  143.137 4.676   1.00 100.00 ? 473 GLU S OE2 1 
ATOM   3670  N N   . ILE A 1 473 ? 81.704  140.062 6.969   1.00 52.40  ? 474 ILE S N   1 
ATOM   3671  C CA  . ILE A 1 473 ? 82.914  139.343 7.321   1.00 52.40  ? 474 ILE S CA  1 
ATOM   3672  C C   . ILE A 1 473 ? 82.913  138.049 6.502   1.00 52.40  ? 474 ILE S C   1 
ATOM   3673  O O   . ILE A 1 473 ? 82.139  137.125 6.781   1.00 100.00 ? 474 ILE S O   1 
ATOM   3674  C CB  . ILE A 1 473 ? 82.929  138.980 8.825   1.00 100.00 ? 474 ILE S CB  1 
ATOM   3675  C CG1 . ILE A 1 473 ? 81.780  139.686 9.553   1.00 100.00 ? 474 ILE S CG1 1 
ATOM   3676  C CG2 . ILE A 1 473 ? 84.262  139.364 9.432   1.00 100.00 ? 474 ILE S CG2 1 
ATOM   3677  C CD1 . ILE A 1 473 ? 81.391  139.033 10.879  1.00 100.00 ? 474 ILE S CD1 1 
ATOM   3678  N N   . ASN A 1 474 ? 83.769  137.979 5.491   1.00 2.00   ? 475 ASN S N   1 
ATOM   3679  C CA  . ASN A 1 474 ? 83.803  136.784 4.675   1.00 2.00   ? 475 ASN S CA  1 
ATOM   3680  C C   . ASN A 1 474 ? 84.825  135.783 5.162   1.00 2.00   ? 475 ASN S C   1 
ATOM   3681  O O   . ASN A 1 474 ? 85.852  135.545 4.535   1.00 37.66  ? 475 ASN S O   1 
ATOM   3682  C CB  . ASN A 1 474 ? 84.034  137.173 3.227   1.00 37.66  ? 475 ASN S CB  1 
ATOM   3683  C CG  . ASN A 1 474 ? 82.762  137.648 2.576   1.00 37.66  ? 475 ASN S CG  1 
ATOM   3684  O OD1 . ASN A 1 474 ? 81.668  137.187 2.925   1.00 37.66  ? 475 ASN S OD1 1 
ATOM   3685  N ND2 . ASN A 1 474 ? 82.884  138.583 1.643   1.00 37.66  ? 475 ASN S ND2 1 
ATOM   3686  N N   . SER A 1 475 ? 84.498  135.185 6.300   1.00 20.80  ? 476 SER S N   1 
ATOM   3687  C CA  . SER A 1 475 ? 85.355  134.211 6.957   1.00 20.80  ? 476 SER S CA  1 
ATOM   3688  C C   . SER A 1 475 ? 85.669  132.978 6.124   1.00 20.80  ? 476 SER S C   1 
ATOM   3689  O O   . SER A 1 475 ? 85.294  132.885 4.948   1.00 20.57  ? 476 SER S O   1 
ATOM   3690  C CB  . SER A 1 475 ? 84.733  133.781 8.293   1.00 20.57  ? 476 SER S CB  1 
ATOM   3691  O OG  . SER A 1 475 ? 85.714  133.191 9.137   1.00 20.57  ? 476 SER S OG  1 
ATOM   3692  N N   . PHE A 1 476 ? 86.368  132.037 6.756   1.00 2.00   ? 477 PHE S N   1 
ATOM   3693  C CA  . PHE A 1 476 ? 86.766  130.798 6.115   1.00 2.00   ? 477 PHE S CA  1 
ATOM   3694  C C   . PHE A 1 476 ? 85.552  130.046 5.605   1.00 2.00   ? 477 PHE S C   1 
ATOM   3695  O O   . PHE A 1 476 ? 85.483  129.701 4.429   1.00 15.79  ? 477 PHE S O   1 
ATOM   3696  C CB  . PHE A 1 476 ? 87.538  129.922 7.099   1.00 15.79  ? 477 PHE S CB  1 
ATOM   3697  C CG  . PHE A 1 476 ? 88.261  128.781 6.445   1.00 15.79  ? 477 PHE S CG  1 
ATOM   3698  C CD1 . PHE A 1 476 ? 88.808  128.934 5.172   1.00 15.79  ? 477 PHE S CD1 1 
ATOM   3699  C CD2 . PHE A 1 476 ? 88.388  127.544 7.088   1.00 15.79  ? 477 PHE S CD2 1 
ATOM   3700  C CE1 . PHE A 1 476 ? 89.474  127.866 4.538   1.00 15.79  ? 477 PHE S CE1 1 
ATOM   3701  C CE2 . PHE A 1 476 ? 89.052  126.468 6.469   1.00 15.79  ? 477 PHE S CE2 1 
ATOM   3702  C CZ  . PHE A 1 476 ? 89.594  126.630 5.196   1.00 15.79  ? 477 PHE S CZ  1 
ATOM   3703  N N   . GLU A 1 477 ? 84.611  129.791 6.512   1.00 16.86  ? 478 GLU S N   1 
ATOM   3704  C CA  . GLU A 1 477 ? 83.357  129.104 6.226   1.00 16.86  ? 478 GLU S CA  1 
ATOM   3705  C C   . GLU A 1 477 ? 82.805  129.540 4.875   1.00 16.86  ? 478 GLU S C   1 
ATOM   3706  O O   . GLU A 1 477 ? 82.614  128.720 3.972   1.00 39.48  ? 478 GLU S O   1 
ATOM   3707  C CB  . GLU A 1 477 ? 82.351  129.440 7.321   1.00 39.48  ? 478 GLU S CB  1 
ATOM   3708  C CG  . GLU A 1 477 ? 82.816  129.025 8.713   1.00 39.48  ? 478 GLU S CG  1 
ATOM   3709  C CD  . GLU A 1 477 ? 83.828  129.979 9.343   1.00 39.48  ? 478 GLU S CD  1 
ATOM   3710  O OE1 . GLU A 1 477 ? 84.620  130.599 8.605   1.00 39.48  ? 478 GLU S OE1 1 
ATOM   3711  O OE2 . GLU A 1 477 ? 83.835  130.103 10.590  1.00 39.48  ? 478 GLU S OE2 1 
ATOM   3712  N N   . GLN A 1 478 ? 82.558  130.845 4.754   1.00 7.57   ? 479 GLN S N   1 
ATOM   3713  C CA  . GLN A 1 478 ? 82.059  131.440 3.529   1.00 7.57   ? 479 GLN S CA  1 
ATOM   3714  C C   . GLN A 1 478 ? 82.950  131.066 2.345   1.00 7.57   ? 479 GLN S C   1 
ATOM   3715  O O   . GLN A 1 478 ? 82.500  131.045 1.201   1.00 97.32  ? 479 GLN S O   1 
ATOM   3716  C CB  . GLN A 1 478 ? 82.009  132.963 3.674   1.00 97.32  ? 479 GLN S CB  1 
ATOM   3717  C CG  . GLN A 1 478 ? 80.868  133.464 4.532   1.00 97.32  ? 479 GLN S CG  1 
ATOM   3718  C CD  . GLN A 1 478 ? 81.043  133.132 6.006   1.00 97.32  ? 479 GLN S CD  1 
ATOM   3719  O OE1 . GLN A 1 478 ? 81.096  131.967 6.396   1.00 97.32  ? 479 GLN S OE1 1 
ATOM   3720  N NE2 . GLN A 1 478 ? 81.130  134.165 6.835   1.00 97.32  ? 479 GLN S NE2 1 
ATOM   3721  N N   . LEU A 1 479 ? 84.214  130.772 2.614   1.00 9.55   ? 480 LEU S N   1 
ATOM   3722  C CA  . LEU A 1 479 ? 85.131  130.405 1.536   1.00 9.55   ? 480 LEU S CA  1 
ATOM   3723  C C   . LEU A 1 479 ? 84.886  129.014 0.987   1.00 9.55   ? 480 LEU S C   1 
ATOM   3724  O O   . LEU A 1 479 ? 84.866  128.827 -0.218  1.00 41.47  ? 480 LEU S O   1 
ATOM   3725  C CB  . LEU A 1 479 ? 86.591  130.492 1.997   1.00 41.47  ? 480 LEU S CB  1 
ATOM   3726  C CG  . LEU A 1 479 ? 87.575  129.960 0.947   1.00 41.47  ? 480 LEU S CG  1 
ATOM   3727  C CD1 . LEU A 1 479 ? 87.553  130.891 -0.267  1.00 41.47  ? 480 LEU S CD1 1 
ATOM   3728  C CD2 . LEU A 1 479 ? 88.976  129.839 1.544   1.00 41.47  ? 480 LEU S CD2 1 
ATOM   3729  N N   . CYS A 1 480 ? 84.726  128.034 1.869   1.00 13.67  ? 481 CYS S N   1 
ATOM   3730  C CA  . CYS A 1 480 ? 84.474  126.673 1.416   1.00 13.67  ? 481 CYS S CA  1 
ATOM   3731  C C   . CYS A 1 480 ? 83.050  126.590 0.884   1.00 13.67  ? 481 CYS S C   1 
ATOM   3732  O O   . CYS A 1 480 ? 82.785  125.879 -0.081  1.00 53.36  ? 481 CYS S O   1 
ATOM   3733  C CB  . CYS A 1 480 ? 84.654  125.671 2.563   1.00 53.36  ? 481 CYS S CB  1 
ATOM   3734  S SG  . CYS A 1 480 ? 85.864  126.152 3.820   1.00 53.36  ? 481 CYS S SG  1 
ATOM   3735  N N   . ILE A 1 481 ? 82.140  127.323 1.518   1.00 18.40  ? 482 ILE S N   1 
ATOM   3736  C CA  . ILE A 1 481 ? 80.747  127.345 1.100   1.00 18.40  ? 482 ILE S CA  1 
ATOM   3737  C C   . ILE A 1 481 ? 80.649  127.851 -0.330  1.00 18.40  ? 482 ILE S C   1 
ATOM   3738  O O   . ILE A 1 481 ? 80.154  127.136 -1.193  1.00 2.00   ? 482 ILE S O   1 
ATOM   3739  C CB  . ILE A 1 481 ? 79.905  128.244 2.035   1.00 2.00   ? 482 ILE S CB  1 
ATOM   3740  C CG1 . ILE A 1 481 ? 79.190  127.373 3.068   1.00 2.00   ? 482 ILE S CG1 1 
ATOM   3741  C CG2 . ILE A 1 481 ? 78.893  129.047 1.248   1.00 2.00   ? 482 ILE S CG2 1 
ATOM   3742  C CD1 . ILE A 1 481 ? 78.771  128.117 4.338   1.00 2.00   ? 482 ILE S CD1 1 
ATOM   3743  N N   . ASN A 1 482 ? 81.123  129.070 -0.589  1.00 2.00   ? 483 ASN S N   1 
ATOM   3744  C CA  . ASN A 1 482 ? 81.071  129.616 -1.938  1.00 2.00   ? 483 ASN S CA  1 
ATOM   3745  C C   . ASN A 1 482 ? 82.013  128.831 -2.850  1.00 2.00   ? 483 ASN S C   1 
ATOM   3746  O O   . ASN A 1 482 ? 82.030  129.027 -4.064  1.00 24.40  ? 483 ASN S O   1 
ATOM   3747  C CB  . ASN A 1 482 ? 81.440  131.097 -1.934  1.00 24.40  ? 483 ASN S CB  1 
ATOM   3748  C CG  . ASN A 1 482 ? 80.380  131.958 -1.259  1.00 24.40  ? 483 ASN S CG  1 
ATOM   3749  O OD1 . ASN A 1 482 ? 80.037  131.732 -0.108  1.00 24.40  ? 483 ASN S OD1 1 
ATOM   3750  N ND2 . ASN A 1 482 ? 79.855  132.941 -1.975  1.00 24.40  ? 483 ASN S ND2 1 
ATOM   3751  N N   . TYR A 1 483 ? 82.801  127.938 -2.258  1.00 3.92   ? 484 TYR S N   1 
ATOM   3752  C CA  . TYR A 1 483 ? 83.728  127.090 -3.010  1.00 3.92   ? 484 TYR S CA  1 
ATOM   3753  C C   . TYR A 1 483 ? 82.865  125.991 -3.616  1.00 3.92   ? 484 TYR S C   1 
ATOM   3754  O O   . TYR A 1 483 ? 82.801  125.859 -4.826  1.00 18.86  ? 484 TYR S O   1 
ATOM   3755  C CB  . TYR A 1 483 ? 84.777  126.474 -2.067  1.00 18.86  ? 484 TYR S CB  1 
ATOM   3756  C CG  . TYR A 1 483 ? 85.532  125.277 -2.628  1.00 18.86  ? 484 TYR S CG  1 
ATOM   3757  C CD1 . TYR A 1 483 ? 86.002  125.277 -3.949  1.00 18.86  ? 484 TYR S CD1 1 
ATOM   3758  C CD2 . TYR A 1 483 ? 85.764  124.132 -1.840  1.00 18.86  ? 484 TYR S CD2 1 
ATOM   3759  C CE1 . TYR A 1 483 ? 86.679  124.163 -4.475  1.00 18.86  ? 484 TYR S CE1 1 
ATOM   3760  C CE2 . TYR A 1 483 ? 86.441  123.013 -2.362  1.00 18.86  ? 484 TYR S CE2 1 
ATOM   3761  C CZ  . TYR A 1 483 ? 86.888  123.041 -3.674  1.00 18.86  ? 484 TYR S CZ  1 
ATOM   3762  O OH  . TYR A 1 483 ? 87.528  121.951 -4.193  1.00 18.86  ? 484 TYR S OH  1 
ATOM   3763  N N   . THR A 1 484 ? 82.196  125.221 -2.757  1.00 2.00   ? 485 THR S N   1 
ATOM   3764  C CA  . THR A 1 484 ? 81.314  124.128 -3.162  1.00 2.00   ? 485 THR S CA  1 
ATOM   3765  C C   . THR A 1 484 ? 80.344  124.621 -4.207  1.00 2.00   ? 485 THR S C   1 
ATOM   3766  O O   . THR A 1 484 ? 80.153  123.972 -5.223  1.00 23.73  ? 485 THR S O   1 
ATOM   3767  C CB  . THR A 1 484 ? 80.486  123.601 -1.979  1.00 23.73  ? 485 THR S CB  1 
ATOM   3768  O OG1 . THR A 1 484 ? 81.070  124.033 -0.746  1.00 23.73  ? 485 THR S OG1 1 
ATOM   3769  C CG2 . THR A 1 484 ? 80.447  122.108 -1.990  1.00 23.73  ? 485 THR S CG2 1 
ATOM   3770  N N   . ASN A 1 485 ? 79.729  125.769 -3.941  1.00 2.00   ? 486 ASN S N   1 
ATOM   3771  C CA  . ASN A 1 485 ? 78.771  126.381 -4.861  1.00 2.00   ? 486 ASN S CA  1 
ATOM   3772  C C   . ASN A 1 485 ? 79.404  126.529 -6.242  1.00 2.00   ? 486 ASN S C   1 
ATOM   3773  O O   . ASN A 1 485 ? 78.790  126.211 -7.248  1.00 26.81  ? 486 ASN S O   1 
ATOM   3774  C CB  . ASN A 1 485 ? 78.329  127.744 -4.338  1.00 26.81  ? 486 ASN S CB  1 
ATOM   3775  C CG  . ASN A 1 485 ? 77.075  127.661 -3.477  1.00 26.81  ? 486 ASN S CG  1 
ATOM   3776  O OD1 . ASN A 1 485 ? 76.070  128.296 -3.771  1.00 26.81  ? 486 ASN S OD1 1 
ATOM   3777  N ND2 . ASN A 1 485 ? 77.131  126.877 -2.408  1.00 26.81  ? 486 ASN S ND2 1 
ATOM   3778  N N   . GLU A 1 486 ? 80.640  127.012 -6.289  1.00 2.00   ? 487 GLU S N   1 
ATOM   3779  C CA  . GLU A 1 486 ? 81.355  127.157 -7.552  1.00 2.00   ? 487 GLU S CA  1 
ATOM   3780  C C   . GLU A 1 486 ? 81.612  125.753 -8.100  1.00 2.00   ? 487 GLU S C   1 
ATOM   3781  O O   . GLU A 1 486 ? 81.559  125.524 -9.295  1.00 10.64  ? 487 GLU S O   1 
ATOM   3782  C CB  . GLU A 1 486 ? 82.689  127.884 -7.322  1.00 10.64  ? 487 GLU S CB  1 
ATOM   3783  C CG  . GLU A 1 486 ? 83.435  128.247 -8.589  1.00 10.64  ? 487 GLU S CG  1 
ATOM   3784  C CD  . GLU A 1 486 ? 83.515  129.765 -8.808  1.00 10.64  ? 487 GLU S CD  1 
ATOM   3785  O OE1 . GLU A 1 486 ? 83.210  130.513 -7.848  1.00 10.64  ? 487 GLU S OE1 1 
ATOM   3786  O OE2 . GLU A 1 486 ? 83.877  130.213 -9.937  1.00 10.64  ? 487 GLU S OE2 1 
ATOM   3787  N N   . LYS A 1 487 ? 81.876  124.818 -7.197  1.00 2.00   ? 488 LYS S N   1 
ATOM   3788  C CA  . LYS A 1 487 ? 82.161  123.434 -7.542  1.00 2.00   ? 488 LYS S CA  1 
ATOM   3789  C C   . LYS A 1 487 ? 80.988  122.817 -8.269  1.00 2.00   ? 488 LYS S C   1 
ATOM   3790  O O   . LYS A 1 487 ? 81.081  122.414 -9.422  1.00 7.73   ? 488 LYS S O   1 
ATOM   3791  C CB  . LYS A 1 487 ? 82.450  122.628 -6.265  1.00 7.73   ? 488 LYS S CB  1 
ATOM   3792  C CG  . LYS A 1 487 ? 83.887  122.081 -6.153  1.00 7.73   ? 488 LYS S CG  1 
ATOM   3793  C CD  . LYS A 1 487 ? 84.000  120.676 -6.749  1.00 7.73   ? 488 LYS S CD  1 
ATOM   3794  C CE  . LYS A 1 487 ? 85.441  120.310 -7.109  1.00 7.73   ? 488 LYS S CE  1 
ATOM   3795  N NZ  . LYS A 1 487 ? 85.637  120.035 -8.578  1.00 7.73   ? 488 LYS S NZ  1 
ATOM   3796  N N   . LEU A 1 488 ? 79.883  122.730 -7.550  1.00 49.90  ? 489 LEU S N   1 
ATOM   3797  C CA  . LEU A 1 488 ? 78.652  122.166 -8.068  1.00 49.90  ? 489 LEU S CA  1 
ATOM   3798  C C   . LEU A 1 488 ? 78.288  122.740 -9.432  1.00 49.90  ? 489 LEU S C   1 
ATOM   3799  O O   . LEU A 1 488 ? 78.073  121.985 -10.377 1.00 49.94  ? 489 LEU S O   1 
ATOM   3800  C CB  . LEU A 1 488 ? 77.524  122.440 -7.074  1.00 49.94  ? 489 LEU S CB  1 
ATOM   3801  C CG  . LEU A 1 488 ? 76.114  121.871 -7.252  1.00 49.94  ? 489 LEU S CG  1 
ATOM   3802  C CD1 . LEU A 1 488 ? 75.962  121.086 -8.540  1.00 49.94  ? 489 LEU S CD1 1 
ATOM   3803  C CD2 . LEU A 1 488 ? 75.833  120.990 -6.062  1.00 49.94  ? 489 LEU S CD2 1 
ATOM   3804  N N   . GLN A 1 489 ? 78.206  124.064 -9.539  1.00 6.19   ? 490 GLN S N   1 
ATOM   3805  C CA  . GLN A 1 489 ? 77.845  124.692 -10.805 1.00 6.19   ? 490 GLN S CA  1 
ATOM   3806  C C   . GLN A 1 489 ? 78.622  124.058 -11.941 1.00 6.19   ? 490 GLN S C   1 
ATOM   3807  O O   . GLN A 1 489 ? 78.043  123.602 -12.918 1.00 10.69  ? 490 GLN S O   1 
ATOM   3808  C CB  . GLN A 1 489 ? 78.138  126.182 -10.777 1.00 10.69  ? 490 GLN S CB  1 
ATOM   3809  C CG  . GLN A 1 489 ? 78.165  126.823 -12.165 1.00 10.69  ? 490 GLN S CG  1 
ATOM   3810  C CD  . GLN A 1 489 ? 76.771  127.008 -12.749 1.00 10.69  ? 490 GLN S CD  1 
ATOM   3811  O OE1 . GLN A 1 489 ? 75.788  127.111 -12.011 1.00 10.69  ? 490 GLN S OE1 1 
ATOM   3812  N NE2 . GLN A 1 489 ? 76.675  127.046 -14.076 1.00 10.69  ? 490 GLN S NE2 1 
ATOM   3813  N N   . GLN A 1 490 ? 79.940  124.022 -11.791 1.00 22.82  ? 491 GLN S N   1 
ATOM   3814  C CA  . GLN A 1 490 ? 80.801  123.433 -12.803 1.00 22.82  ? 491 GLN S CA  1 
ATOM   3815  C C   . GLN A 1 490 ? 80.354  122.028 -13.175 1.00 22.82  ? 491 GLN S C   1 
ATOM   3816  O O   . GLN A 1 490 ? 80.546  121.601 -14.305 1.00 3.00   ? 491 GLN S O   1 
ATOM   3817  C CB  . GLN A 1 490 ? 82.246  123.385 -12.318 1.00 3.00   ? 491 GLN S CB  1 
ATOM   3818  C CG  . GLN A 1 490 ? 83.190  122.764 -13.312 1.00 3.00   ? 491 GLN S CG  1 
ATOM   3819  C CD  . GLN A 1 490 ? 83.312  123.585 -14.555 1.00 3.00   ? 491 GLN S CD  1 
ATOM   3820  O OE1 . GLN A 1 490 ? 83.346  124.819 -14.499 1.00 3.00   ? 491 GLN S OE1 1 
ATOM   3821  N NE2 . GLN A 1 490 ? 83.375  122.914 -15.695 1.00 3.00   ? 491 GLN S NE2 1 
ATOM   3822  N N   . LEU A 1 491 ? 79.768  121.309 -12.225 1.00 2.00   ? 492 LEU S N   1 
ATOM   3823  C CA  . LEU A 1 491 ? 79.284  119.953 -12.497 1.00 2.00   ? 492 LEU S CA  1 
ATOM   3824  C C   . LEU A 1 491 ? 78.228  120.053 -13.587 1.00 2.00   ? 492 LEU S C   1 
ATOM   3825  O O   . LEU A 1 491 ? 78.283  119.329 -14.587 1.00 2.00   ? 492 LEU S O   1 
ATOM   3826  C CB  . LEU A 1 491 ? 78.683  119.313 -11.228 1.00 2.00   ? 492 LEU S CB  1 
ATOM   3827  C CG  . LEU A 1 491 ? 77.907  117.982 -11.263 1.00 2.00   ? 492 LEU S CG  1 
ATOM   3828  C CD1 . LEU A 1 491 ? 78.430  117.089 -12.349 1.00 2.00   ? 492 LEU S CD1 1 
ATOM   3829  C CD2 . LEU A 1 491 ? 78.004  117.290 -9.924  1.00 2.00   ? 492 LEU S CD2 1 
ATOM   3830  N N   . PHE A 1 492 ? 77.282  120.967 -13.386 1.00 2.00   ? 493 PHE S N   1 
ATOM   3831  C CA  . PHE A 1 492 ? 76.206  121.191 -14.334 1.00 2.00   ? 493 PHE S CA  1 
ATOM   3832  C C   . PHE A 1 492 ? 76.769  121.557 -15.675 1.00 2.00   ? 493 PHE S C   1 
ATOM   3833  O O   . PHE A 1 492 ? 76.246  121.140 -16.689 1.00 2.00   ? 493 PHE S O   1 
ATOM   3834  C CB  . PHE A 1 492 ? 75.308  122.323 -13.860 1.00 2.00   ? 493 PHE S CB  1 
ATOM   3835  C CG  . PHE A 1 492 ? 74.276  122.764 -14.881 1.00 2.00   ? 493 PHE S CG  1 
ATOM   3836  C CD1 . PHE A 1 492 ? 73.067  122.090 -15.003 1.00 2.00   ? 493 PHE S CD1 1 
ATOM   3837  C CD2 . PHE A 1 492 ? 74.503  123.871 -15.694 1.00 2.00   ? 493 PHE S CD2 1 
ATOM   3838  C CE1 . PHE A 1 492 ? 72.119  122.514 -15.916 1.00 2.00   ? 493 PHE S CE1 1 
ATOM   3839  C CE2 . PHE A 1 492 ? 73.550  124.293 -16.610 1.00 2.00   ? 493 PHE S CE2 1 
ATOM   3840  C CZ  . PHE A 1 492 ? 72.361  123.618 -16.723 1.00 2.00   ? 493 PHE S CZ  1 
ATOM   3841  N N   . ASN A 1 493 ? 77.832  122.354 -15.676 1.00 2.00   ? 494 ASN S N   1 
ATOM   3842  C CA  . ASN A 1 493 ? 78.476  122.778 -16.916 1.00 2.00   ? 494 ASN S CA  1 
ATOM   3843  C C   . ASN A 1 493 ? 79.067  121.572 -17.640 1.00 2.00   ? 494 ASN S C   1 
ATOM   3844  O O   . ASN A 1 493 ? 78.980  121.456 -18.851 1.00 18.41  ? 494 ASN S O   1 
ATOM   3845  C CB  . ASN A 1 493 ? 79.602  123.763 -16.626 1.00 18.41  ? 494 ASN S CB  1 
ATOM   3846  C CG  . ASN A 1 493 ? 79.130  124.998 -15.910 1.00 18.41  ? 494 ASN S CG  1 
ATOM   3847  O OD1 . ASN A 1 493 ? 79.549  126.110 -16.228 1.00 18.41  ? 494 ASN S OD1 1 
ATOM   3848  N ND2 . ASN A 1 493 ? 78.261  124.817 -14.926 1.00 18.41  ? 494 ASN S ND2 1 
ATOM   3849  N N   . HIS A 1 494 ? 79.675  120.667 -16.891 1.00 2.00   ? 495 HIS S N   1 
ATOM   3850  C CA  . HIS A 1 494 ? 80.295  119.491 -17.470 1.00 2.00   ? 495 HIS S CA  1 
ATOM   3851  C C   . HIS A 1 494 ? 79.297  118.569 -18.094 1.00 2.00   ? 495 HIS S C   1 
ATOM   3852  O O   . HIS A 1 494 ? 79.340  118.287 -19.290 1.00 38.67  ? 495 HIS S O   1 
ATOM   3853  C CB  . HIS A 1 494 ? 81.037  118.721 -16.399 1.00 38.67  ? 495 HIS S CB  1 
ATOM   3854  C CG  . HIS A 1 494 ? 82.202  117.960 -16.928 1.00 38.67  ? 495 HIS S CG  1 
ATOM   3855  N ND1 . HIS A 1 494 ? 83.435  118.540 -17.126 1.00 38.67  ? 495 HIS S ND1 1 
ATOM   3856  C CD2 . HIS A 1 494 ? 82.310  116.681 -17.351 1.00 38.67  ? 495 HIS S CD2 1 
ATOM   3857  C CE1 . HIS A 1 494 ? 84.256  117.647 -17.653 1.00 38.67  ? 495 HIS S CE1 1 
ATOM   3858  N NE2 . HIS A 1 494 ? 83.596  116.511 -17.800 1.00 38.67  ? 495 HIS S NE2 1 
ATOM   3859  N N   . THR A 1 495 ? 78.413  118.076 -17.244 1.00 2.66   ? 496 THR S N   1 
ATOM   3860  C CA  . THR A 1 495 ? 77.364  117.166 -17.649 1.00 2.66   ? 496 THR S CA  1 
ATOM   3861  C C   . THR A 1 495 ? 76.401  117.762 -18.701 1.00 2.66   ? 496 THR S C   1 
ATOM   3862  O O   . THR A 1 495 ? 75.749  117.023 -19.448 1.00 26.53  ? 496 THR S O   1 
ATOM   3863  C CB  . THR A 1 495 ? 76.554  116.751 -16.418 1.00 26.53  ? 496 THR S CB  1 
ATOM   3864  O OG1 . THR A 1 495 ? 76.727  117.742 -15.400 1.00 26.53  ? 496 THR S OG1 1 
ATOM   3865  C CG2 . THR A 1 495 ? 77.026  115.398 -15.888 1.00 26.53  ? 496 THR S CG2 1 
ATOM   3866  N N   . MET A 1 496 ? 76.327  119.092 -18.764 1.00 12.80  ? 497 MET S N   1 
ATOM   3867  C CA  . MET A 1 496 ? 75.422  119.781 -19.684 1.00 12.80  ? 497 MET S CA  1 
ATOM   3868  C C   . MET A 1 496 ? 75.973  120.070 -21.070 1.00 12.80  ? 497 MET S C   1 
ATOM   3869  O O   . MET A 1 496 ? 75.276  119.894 -22.056 1.00 16.60  ? 497 MET S O   1 
ATOM   3870  C CB  . MET A 1 496 ? 74.941  121.096 -19.060 1.00 16.60  ? 497 MET S CB  1 
ATOM   3871  C CG  . MET A 1 496 ? 73.468  121.427 -19.298 1.00 16.60  ? 497 MET S CG  1 
ATOM   3872  S SD  . MET A 1 496 ? 72.273  120.329 -18.505 1.00 16.60  ? 497 MET S SD  1 
ATOM   3873  C CE  . MET A 1 496 ? 72.104  119.050 -19.748 1.00 16.60  ? 497 MET S CE  1 
ATOM   3874  N N   . PHE A 1 497 ? 77.209  120.524 -21.155 1.00 2.00   ? 498 PHE S N   1 
ATOM   3875  C CA  . PHE A 1 497 ? 77.778  120.828 -22.447 1.00 2.00   ? 498 PHE S CA  1 
ATOM   3876  C C   . PHE A 1 497 ? 78.946  119.918 -22.804 1.00 2.00   ? 498 PHE S C   1 
ATOM   3877  O O   . PHE A 1 497 ? 78.955  119.308 -23.881 1.00 3.72   ? 498 PHE S O   1 
ATOM   3878  C CB  . PHE A 1 497 ? 78.224  122.277 -22.478 1.00 3.72   ? 498 PHE S CB  1 
ATOM   3879  C CG  . PHE A 1 497 ? 77.316  123.195 -21.738 1.00 3.72   ? 498 PHE S CG  1 
ATOM   3880  C CD1 . PHE A 1 497 ? 76.185  123.693 -22.344 1.00 3.72   ? 498 PHE S CD1 1 
ATOM   3881  C CD2 . PHE A 1 497 ? 77.605  123.573 -20.432 1.00 3.72   ? 498 PHE S CD2 1 
ATOM   3882  C CE1 . PHE A 1 497 ? 75.352  124.559 -21.670 1.00 3.72   ? 498 PHE S CE1 1 
ATOM   3883  C CE2 . PHE A 1 497 ? 76.784  124.441 -19.737 1.00 3.72   ? 498 PHE S CE2 1 
ATOM   3884  C CZ  . PHE A 1 497 ? 75.654  124.937 -20.357 1.00 3.72   ? 498 PHE S CZ  1 
ATOM   3885  N N   . ILE A 1 498 ? 79.922  119.818 -21.903 1.00 9.63   ? 499 ILE S N   1 
ATOM   3886  C CA  . ILE A 1 498 ? 81.111  119.000 -22.125 1.00 9.63   ? 499 ILE S CA  1 
ATOM   3887  C C   . ILE A 1 498 ? 80.809  117.550 -22.442 1.00 9.63   ? 499 ILE S C   1 
ATOM   3888  O O   . ILE A 1 498 ? 80.994  117.098 -23.564 1.00 12.76  ? 499 ILE S O   1 
ATOM   3889  C CB  . ILE A 1 498 ? 82.001  119.016 -20.908 1.00 12.76  ? 499 ILE S CB  1 
ATOM   3890  C CG1 . ILE A 1 498 ? 82.342  120.461 -20.541 1.00 12.76  ? 499 ILE S CG1 1 
ATOM   3891  C CG2 . ILE A 1 498 ? 83.229  118.176 -21.174 1.00 12.76  ? 499 ILE S CG2 1 
ATOM   3892  C CD1 . ILE A 1 498 ? 83.476  120.611 -19.487 1.00 12.76  ? 499 ILE S CD1 1 
ATOM   3893  N N   . LEU A 1 499 ? 80.344  116.832 -21.435 1.00 2.00   ? 500 LEU S N   1 
ATOM   3894  C CA  . LEU A 1 499 ? 80.032  115.427 -21.562 1.00 2.00   ? 500 LEU S CA  1 
ATOM   3895  C C   . LEU A 1 499 ? 79.151  115.103 -22.741 1.00 2.00   ? 500 LEU S C   1 
ATOM   3896  O O   . LEU A 1 499 ? 79.503  114.266 -23.573 1.00 45.03  ? 500 LEU S O   1 
ATOM   3897  C CB  . LEU A 1 499 ? 79.361  114.932 -20.289 1.00 45.03  ? 500 LEU S CB  1 
ATOM   3898  C CG  . LEU A 1 499 ? 80.343  114.898 -19.124 1.00 45.03  ? 500 LEU S CG  1 
ATOM   3899  C CD1 . LEU A 1 499 ? 79.677  114.538 -17.806 1.00 45.03  ? 500 LEU S CD1 1 
ATOM   3900  C CD2 . LEU A 1 499 ? 81.396  113.886 -19.467 1.00 45.03  ? 500 LEU S CD2 1 
ATOM   3901  N N   . GLU A 1 500 ? 77.996  115.770 -22.811 1.00 40.00  ? 501 GLU S N   1 
ATOM   3902  C CA  . GLU A 1 500 ? 77.024  115.533 -23.877 1.00 40.00  ? 501 GLU S CA  1 
ATOM   3903  C C   . GLU A 1 500 ? 77.647  115.520 -25.250 1.00 40.00  ? 501 GLU S C   1 
ATOM   3904  O O   . GLU A 1 500 ? 77.367  114.633 -26.044 1.00 31.53  ? 501 GLU S O   1 
ATOM   3905  C CB  . GLU A 1 500 ? 75.910  116.573 -23.841 1.00 31.53  ? 501 GLU S CB  1 
ATOM   3906  C CG  . GLU A 1 500 ? 74.950  116.456 -25.004 1.00 31.53  ? 501 GLU S CG  1 
ATOM   3907  C CD  . GLU A 1 500 ? 73.790  115.507 -24.743 1.00 31.53  ? 501 GLU S CD  1 
ATOM   3908  O OE1 . GLU A 1 500 ? 73.015  115.772 -23.802 1.00 31.53  ? 501 GLU S OE1 1 
ATOM   3909  O OE2 . GLU A 1 500 ? 73.637  114.505 -25.477 1.00 31.53  ? 501 GLU S OE2 1 
ATOM   3910  N N   . GLN A 1 501 ? 78.512  116.481 -25.538 1.00 27.51  ? 502 GLN S N   1 
ATOM   3911  C CA  . GLN A 1 501 ? 79.121  116.508 -26.859 1.00 27.51  ? 502 GLN S CA  1 
ATOM   3912  C C   . GLN A 1 501 ? 80.161  115.423 -27.116 1.00 27.51  ? 502 GLN S C   1 
ATOM   3913  O O   . GLN A 1 501 ? 80.361  115.027 -28.265 1.00 4.76   ? 502 GLN S O   1 
ATOM   3914  C CB  . GLN A 1 501 ? 79.705  117.888 -27.149 1.00 4.76   ? 502 GLN S CB  1 
ATOM   3915  C CG  . GLN A 1 501 ? 78.816  118.713 -28.081 1.00 4.76   ? 502 GLN S CG  1 
ATOM   3916  C CD  . GLN A 1 501 ? 78.962  120.196 -27.869 1.00 4.76   ? 502 GLN S CD  1 
ATOM   3917  O OE1 . GLN A 1 501 ? 79.051  120.947 -28.825 1.00 4.76   ? 502 GLN S OE1 1 
ATOM   3918  N NE2 . GLN A 1 501 ? 78.990  120.628 -26.613 1.00 4.76   ? 502 GLN S NE2 1 
ATOM   3919  N N   . GLU A 1 502 ? 80.815  114.943 -26.060 1.00 5.92   ? 503 GLU S N   1 
ATOM   3920  C CA  . GLU A 1 502 ? 81.803  113.871 -26.195 1.00 5.92   ? 503 GLU S CA  1 
ATOM   3921  C C   . GLU A 1 502 ? 81.135  112.630 -26.788 1.00 5.92   ? 503 GLU S C   1 
ATOM   3922  O O   . GLU A 1 502 ? 81.631  112.070 -27.769 1.00 100.00 ? 503 GLU S O   1 
ATOM   3923  C CB  . GLU A 1 502 ? 82.389  113.514 -24.837 1.00 100.00 ? 503 GLU S CB  1 
ATOM   3924  C CG  . GLU A 1 502 ? 82.830  114.715 -24.038 1.00 100.00 ? 503 GLU S CG  1 
ATOM   3925  C CD  . GLU A 1 502 ? 84.313  114.692 -23.733 1.00 100.00 ? 503 GLU S CD  1 
ATOM   3926  O OE1 . GLU A 1 502 ? 84.702  114.057 -22.728 1.00 100.00 ? 503 GLU S OE1 1 
ATOM   3927  O OE2 . GLU A 1 502 ? 85.085  115.306 -24.502 1.00 100.00 ? 503 GLU S OE2 1 
ATOM   3928  N N   . GLU A 1 503 ? 80.002  112.221 -26.204 1.00 2.00   ? 504 GLU S N   1 
ATOM   3929  C CA  . GLU A 1 503 ? 79.255  111.052 -26.671 1.00 2.00   ? 504 GLU S CA  1 
ATOM   3930  C C   . GLU A 1 503 ? 78.759  111.191 -28.116 1.00 2.00   ? 504 GLU S C   1 
ATOM   3931  O O   . GLU A 1 503 ? 78.583  110.190 -28.831 1.00 97.60  ? 504 GLU S O   1 
ATOM   3932  C CB  . GLU A 1 503 ? 78.060  110.774 -25.762 1.00 97.60  ? 504 GLU S CB  1 
ATOM   3933  C CG  . GLU A 1 503 ? 76.985  109.901 -26.408 1.00 97.60  ? 504 GLU S CG  1 
ATOM   3934  C CD  . GLU A 1 503 ? 77.142  108.429 -26.077 1.00 97.60  ? 504 GLU S CD  1 
ATOM   3935  O OE1 . GLU A 1 503 ? 76.675  108.020 -24.997 1.00 97.60  ? 504 GLU S OE1 1 
ATOM   3936  O OE2 . GLU A 1 503 ? 77.726  107.680 -26.890 1.00 97.60  ? 504 GLU S OE2 1 
ATOM   3937  N N   . TYR A 1 504 ? 78.512  112.425 -28.537 1.00 20.41  ? 505 TYR S N   1 
ATOM   3938  C CA  . TYR A 1 504 ? 78.082  112.661 -29.899 1.00 20.41  ? 505 TYR S CA  1 
ATOM   3939  C C   . TYR A 1 504 ? 79.275  112.234 -30.765 1.00 20.41  ? 505 TYR S C   1 
ATOM   3940  O O   . TYR A 1 504 ? 79.127  111.588 -31.803 1.00 2.00   ? 505 TYR S O   1 
ATOM   3941  C CB  . TYR A 1 504 ? 77.763  114.134 -30.088 1.00 2.00   ? 505 TYR S CB  1 
ATOM   3942  C CG  . TYR A 1 504 ? 76.460  114.558 -29.480 1.00 2.00   ? 505 TYR S CG  1 
ATOM   3943  C CD1 . TYR A 1 504 ? 75.403  113.666 -29.336 1.00 2.00   ? 505 TYR S CD1 1 
ATOM   3944  C CD2 . TYR A 1 504 ? 76.277  115.858 -29.062 1.00 2.00   ? 505 TYR S CD2 1 
ATOM   3945  C CE1 . TYR A 1 504 ? 74.187  114.069 -28.788 1.00 2.00   ? 505 TYR S CE1 1 
ATOM   3946  C CE2 . TYR A 1 504 ? 75.071  116.274 -28.514 1.00 2.00   ? 505 TYR S CE2 1 
ATOM   3947  C CZ  . TYR A 1 504 ? 74.028  115.378 -28.376 1.00 2.00   ? 505 TYR S CZ  1 
ATOM   3948  O OH  . TYR A 1 504 ? 72.840  115.789 -27.825 1.00 2.00   ? 505 TYR S OH  1 
ATOM   3949  N N   . GLN A 1 505 ? 80.467  112.591 -30.311 1.00 2.00   ? 506 GLN S N   1 
ATOM   3950  C CA  . GLN A 1 505 ? 81.697  112.225 -30.997 1.00 2.00   ? 506 GLN S CA  1 
ATOM   3951  C C   . GLN A 1 505 ? 81.868  110.703 -30.977 1.00 2.00   ? 506 GLN S C   1 
ATOM   3952  O O   . GLN A 1 505 ? 81.925  110.060 -32.014 1.00 92.11  ? 506 GLN S O   1 
ATOM   3953  C CB  . GLN A 1 505 ? 82.889  112.895 -30.312 1.00 92.11  ? 506 GLN S CB  1 
ATOM   3954  C CG  . GLN A 1 505 ? 83.541  113.977 -31.154 1.00 92.11  ? 506 GLN S CG  1 
ATOM   3955  C CD  . GLN A 1 505 ? 83.505  115.351 -30.499 1.00 92.11  ? 506 GLN S CD  1 
ATOM   3956  O OE1 . GLN A 1 505 ? 83.928  115.516 -29.353 1.00 92.11  ? 506 GLN S OE1 1 
ATOM   3957  N NE2 . GLN A 1 505 ? 83.003  116.345 -31.231 1.00 92.11  ? 506 GLN S NE2 1 
ATOM   3958  N N   . ARG A 1 506 ? 81.928  110.150 -29.778 1.00 2.00   ? 507 ARG S N   1 
ATOM   3959  C CA  . ARG A 1 506 ? 82.089  108.720 -29.583 1.00 2.00   ? 507 ARG S CA  1 
ATOM   3960  C C   . ARG A 1 506 ? 81.267  107.893 -30.555 1.00 2.00   ? 507 ARG S C   1 
ATOM   3961  O O   . ARG A 1 506 ? 81.824  107.144 -31.359 1.00 55.60  ? 507 ARG S O   1 
ATOM   3962  C CB  . ARG A 1 506 ? 81.708  108.333 -28.146 1.00 55.60  ? 507 ARG S CB  1 
ATOM   3963  C CG  . ARG A 1 506 ? 82.845  108.378 -27.149 1.00 55.60  ? 507 ARG S CG  1 
ATOM   3964  C CD  . ARG A 1 506 ? 82.487  107.599 -25.902 1.00 55.60  ? 507 ARG S CD  1 
ATOM   3965  N NE  . ARG A 1 506 ? 82.095  108.473 -24.800 1.00 55.60  ? 507 ARG S NE  1 
ATOM   3966  C CZ  . ARG A 1 506 ? 82.909  109.352 -24.223 1.00 55.60  ? 507 ARG S CZ  1 
ATOM   3967  N NH1 . ARG A 1 506 ? 84.164  109.475 -24.643 1.00 55.60  ? 507 ARG S NH1 1 
ATOM   3968  N NH2 . ARG A 1 506 ? 82.472  110.112 -23.226 1.00 55.60  ? 507 ARG S NH2 1 
ATOM   3969  N N   . GLU A 1 507 ? 79.944  108.015 -30.474 1.00 49.72  ? 508 GLU S N   1 
ATOM   3970  C CA  . GLU A 1 507 ? 79.045  107.257 -31.341 1.00 49.72  ? 508 GLU S CA  1 
ATOM   3971  C C   . GLU A 1 507 ? 79.297  107.632 -32.790 1.00 49.72  ? 508 GLU S C   1 
ATOM   3972  O O   . GLU A 1 507 ? 78.900  106.916 -33.717 1.00 22.28  ? 508 GLU S O   1 
ATOM   3973  C CB  . GLU A 1 507 ? 77.589  107.534 -30.962 1.00 22.28  ? 508 GLU S CB  1 
ATOM   3974  C CG  . GLU A 1 507 ? 77.136  106.837 -29.689 1.00 22.28  ? 508 GLU S CG  1 
ATOM   3975  C CD  . GLU A 1 507 ? 77.262  105.326 -29.770 1.00 22.28  ? 508 GLU S CD  1 
ATOM   3976  O OE1 . GLU A 1 507 ? 76.968  104.751 -30.841 1.00 22.28  ? 508 GLU S OE1 1 
ATOM   3977  O OE2 . GLU A 1 507 ? 77.658  104.705 -28.753 1.00 22.28  ? 508 GLU S OE2 1 
ATOM   3978  N N   . GLY A 1 508 ? 79.963  108.773 -32.966 1.00 2.00   ? 509 GLY S N   1 
ATOM   3979  C CA  . GLY A 1 508 ? 80.302  109.257 -34.297 1.00 2.00   ? 509 GLY S CA  1 
ATOM   3980  C C   . GLY A 1 508 ? 79.139  109.704 -35.167 1.00 2.00   ? 509 GLY S C   1 
ATOM   3981  O O   . GLY A 1 508 ? 79.002  109.294 -36.320 1.00 2.00   ? 509 GLY S O   1 
ATOM   3982  N N   . ILE A 1 509 ? 78.295  110.555 -34.611 1.00 11.19  ? 510 ILE S N   1 
ATOM   3983  C CA  . ILE A 1 509 ? 77.142  111.061 -35.335 1.00 11.19  ? 510 ILE S CA  1 
ATOM   3984  C C   . ILE A 1 509 ? 77.548  112.340 -36.043 1.00 11.19  ? 510 ILE S C   1 
ATOM   3985  O O   . ILE A 1 509 ? 78.554  112.958 -35.681 1.00 4.95   ? 510 ILE S O   1 
ATOM   3986  C CB  . ILE A 1 509 ? 75.979  111.356 -34.369 1.00 4.95   ? 510 ILE S CB  1 
ATOM   3987  C CG1 . ILE A 1 509 ? 76.477  112.161 -33.164 1.00 4.95   ? 510 ILE S CG1 1 
ATOM   3988  C CG2 . ILE A 1 509 ? 75.396  110.054 -33.862 1.00 4.95   ? 510 ILE S CG2 1 
ATOM   3989  C CD1 . ILE A 1 509 ? 75.538  113.230 -32.694 1.00 4.95   ? 510 ILE S CD1 1 
ATOM   3990  N N   . GLU A 1 510 ? 76.771  112.725 -37.054 1.00 4.80   ? 511 GLU S N   1 
ATOM   3991  C CA  . GLU A 1 510 ? 77.049  113.935 -37.814 1.00 4.80   ? 511 GLU S CA  1 
ATOM   3992  C C   . GLU A 1 510 ? 76.873  115.110 -36.873 1.00 4.80   ? 511 GLU S C   1 
ATOM   3993  O O   . GLU A 1 510 ? 75.776  115.621 -36.736 1.00 35.16  ? 511 GLU S O   1 
ATOM   3994  C CB  . GLU A 1 510 ? 76.081  114.046 -38.995 1.00 35.16  ? 511 GLU S CB  1 
ATOM   3995  C CG  . GLU A 1 510 ? 76.161  115.357 -39.739 1.00 35.16  ? 511 GLU S CG  1 
ATOM   3996  C CD  . GLU A 1 510 ? 74.903  115.651 -40.533 1.00 35.16  ? 511 GLU S CD  1 
ATOM   3997  O OE1 . GLU A 1 510 ? 74.277  114.689 -41.025 1.00 35.16  ? 511 GLU S OE1 1 
ATOM   3998  O OE2 . GLU A 1 510 ? 74.531  116.837 -40.673 1.00 35.16  ? 511 GLU S OE2 1 
ATOM   3999  N N   . TRP A 1 511 ? 77.951  115.535 -36.219 1.00 43.06  ? 512 TRP S N   1 
ATOM   4000  C CA  . TRP A 1 511 ? 77.865  116.640 -35.269 1.00 43.06  ? 512 TRP S CA  1 
ATOM   4001  C C   . TRP A 1 511 ? 79.144  117.447 -35.153 1.00 43.06  ? 512 TRP S C   1 
ATOM   4002  O O   . TRP A 1 511 ? 80.252  116.901 -35.164 1.00 28.93  ? 512 TRP S O   1 
ATOM   4003  C CB  . TRP A 1 511 ? 77.498  116.110 -33.872 1.00 28.93  ? 512 TRP S CB  1 
ATOM   4004  C CG  . TRP A 1 511 ? 77.668  117.117 -32.752 1.00 28.93  ? 512 TRP S CG  1 
ATOM   4005  C CD1 . TRP A 1 511 ? 78.796  117.343 -31.997 1.00 28.93  ? 512 TRP S CD1 1 
ATOM   4006  C CD2 . TRP A 1 511 ? 76.676  118.013 -32.252 1.00 28.93  ? 512 TRP S CD2 1 
ATOM   4007  N NE1 . TRP A 1 511 ? 78.557  118.330 -31.054 1.00 28.93  ? 512 TRP S NE1 1 
ATOM   4008  C CE2 . TRP A 1 511 ? 77.263  118.753 -31.190 1.00 28.93  ? 512 TRP S CE2 1 
ATOM   4009  C CE3 . TRP A 1 511 ? 75.349  118.266 -32.593 1.00 28.93  ? 512 TRP S CE3 1 
ATOM   4010  C CZ2 . TRP A 1 511 ? 76.569  119.716 -30.479 1.00 28.93  ? 512 TRP S CZ2 1 
ATOM   4011  C CZ3 . TRP A 1 511 ? 74.657  119.227 -31.883 1.00 28.93  ? 512 TRP S CZ3 1 
ATOM   4012  C CH2 . TRP A 1 511 ? 75.266  119.942 -30.836 1.00 28.93  ? 512 TRP S CH2 1 
ATOM   4013  N N   . ASN A 1 512 ? 78.980  118.758 -35.019 1.00 25.29  ? 513 ASN S N   1 
ATOM   4014  C CA  . ASN A 1 512 ? 80.117  119.652 -34.846 1.00 25.29  ? 513 ASN S CA  1 
ATOM   4015  C C   . ASN A 1 512 ? 80.020  120.257 -33.448 1.00 25.29  ? 513 ASN S C   1 
ATOM   4016  O O   . ASN A 1 512 ? 78.930  120.535 -32.947 1.00 47.68  ? 513 ASN S O   1 
ATOM   4017  C CB  . ASN A 1 512 ? 80.097  120.756 -35.894 1.00 47.68  ? 513 ASN S CB  1 
ATOM   4018  C CG  . ASN A 1 512 ? 78.746  121.428 -36.000 1.00 47.68  ? 513 ASN S CG  1 
ATOM   4019  O OD1 . ASN A 1 512 ? 78.230  121.612 -37.102 1.00 47.68  ? 513 ASN S OD1 1 
ATOM   4020  N ND2 . ASN A 1 512 ? 78.164  121.797 -34.857 1.00 47.68  ? 513 ASN S ND2 1 
ATOM   4021  N N   . PHE A 1 513 ? 81.169  120.460 -32.823 1.00 2.00   ? 514 PHE S N   1 
ATOM   4022  C CA  . PHE A 1 513 ? 81.222  120.995 -31.472 1.00 2.00   ? 514 PHE S CA  1 
ATOM   4023  C C   . PHE A 1 513 ? 80.674  122.394 -31.362 1.00 2.00   ? 514 PHE S C   1 
ATOM   4024  O O   . PHE A 1 513 ? 80.560  123.106 -32.344 1.00 48.60  ? 514 PHE S O   1 
ATOM   4025  C CB  . PHE A 1 513 ? 82.658  120.967 -30.968 1.00 48.60  ? 514 PHE S CB  1 
ATOM   4026  C CG  . PHE A 1 513 ? 82.799  121.390 -29.556 1.00 48.60  ? 514 PHE S CG  1 
ATOM   4027  C CD1 . PHE A 1 513 ? 82.976  122.725 -29.244 1.00 48.60  ? 514 PHE S CD1 1 
ATOM   4028  C CD2 . PHE A 1 513 ? 82.750  120.456 -28.539 1.00 48.60  ? 514 PHE S CD2 1 
ATOM   4029  C CE1 . PHE A 1 513 ? 83.104  123.133 -27.932 1.00 48.60  ? 514 PHE S CE1 1 
ATOM   4030  C CE2 . PHE A 1 513 ? 82.876  120.846 -27.223 1.00 48.60  ? 514 PHE S CE2 1 
ATOM   4031  C CZ  . PHE A 1 513 ? 83.054  122.193 -26.913 1.00 48.60  ? 514 PHE S CZ  1 
ATOM   4032  N N   . ILE A 1 514 ? 80.341  122.779 -30.141 1.00 4.94   ? 515 ILE S N   1 
ATOM   4033  C CA  . ILE A 1 514 ? 79.792  124.097 -29.860 1.00 4.94   ? 515 ILE S CA  1 
ATOM   4034  C C   . ILE A 1 514 ? 80.342  124.548 -28.521 1.00 4.94   ? 515 ILE S C   1 
ATOM   4035  O O   . ILE A 1 514 ? 80.153  123.868 -27.507 1.00 40.63  ? 515 ILE S O   1 
ATOM   4036  C CB  . ILE A 1 514 ? 78.254  124.046 -29.778 1.00 40.63  ? 515 ILE S CB  1 
ATOM   4037  C CG1 . ILE A 1 514 ? 77.663  124.096 -31.185 1.00 40.63  ? 515 ILE S CG1 1 
ATOM   4038  C CG2 . ILE A 1 514 ? 77.730  125.218 -28.986 1.00 40.63  ? 515 ILE S CG2 1 
ATOM   4039  C CD1 . ILE A 1 514 ? 77.417  122.739 -31.815 1.00 40.63  ? 515 ILE S CD1 1 
ATOM   4040  N N   . ASP A 1 515 ? 81.029  125.691 -28.507 1.00 32.14  ? 516 ASP S N   1 
ATOM   4041  C CA  . ASP A 1 515 ? 81.613  126.192 -27.269 1.00 32.14  ? 516 ASP S CA  1 
ATOM   4042  C C   . ASP A 1 515 ? 80.699  127.148 -26.537 1.00 32.14  ? 516 ASP S C   1 
ATOM   4043  O O   . ASP A 1 515 ? 80.582  128.315 -26.901 1.00 100.00 ? 516 ASP S O   1 
ATOM   4044  C CB  . ASP A 1 515 ? 82.947  126.884 -27.542 1.00 100.00 ? 516 ASP S CB  1 
ATOM   4045  C CG  . ASP A 1 515 ? 83.883  126.826 -26.350 1.00 100.00 ? 516 ASP S CG  1 
ATOM   4046  O OD1 . ASP A 1 515 ? 83.551  126.123 -25.369 1.00 100.00 ? 516 ASP S OD1 1 
ATOM   4047  O OD2 . ASP A 1 515 ? 84.948  127.482 -26.391 1.00 100.00 ? 516 ASP S OD2 1 
ATOM   4048  N N   . PHE A 1 516 ? 80.061  126.647 -25.488 1.00 17.34  ? 517 PHE S N   1 
ATOM   4049  C CA  . PHE A 1 516 ? 79.149  127.455 -24.712 1.00 17.34  ? 517 PHE S CA  1 
ATOM   4050  C C   . PHE A 1 516 ? 79.902  128.382 -23.763 1.00 17.34  ? 517 PHE S C   1 
ATOM   4051  O O   . PHE A 1 516 ? 79.295  129.199 -23.051 1.00 12.82  ? 517 PHE S O   1 
ATOM   4052  C CB  . PHE A 1 516 ? 78.182  126.536 -23.956 1.00 12.82  ? 517 PHE S CB  1 
ATOM   4053  C CG  . PHE A 1 516 ? 77.281  125.747 -24.860 1.00 12.82  ? 517 PHE S CG  1 
ATOM   4054  C CD1 . PHE A 1 516 ? 76.062  126.264 -25.292 1.00 12.82  ? 517 PHE S CD1 1 
ATOM   4055  C CD2 . PHE A 1 516 ? 77.672  124.510 -25.326 1.00 12.82  ? 517 PHE S CD2 1 
ATOM   4056  C CE1 . PHE A 1 516 ? 75.257  125.562 -26.178 1.00 12.82  ? 517 PHE S CE1 1 
ATOM   4057  C CE2 . PHE A 1 516 ? 76.870  123.792 -26.218 1.00 12.82  ? 517 PHE S CE2 1 
ATOM   4058  C CZ  . PHE A 1 516 ? 75.661  124.321 -26.642 1.00 12.82  ? 517 PHE S CZ  1 
ATOM   4059  N N   . GLY A 1 517 ? 81.228  128.266 -23.772 1.00 50.18  ? 518 GLY S N   1 
ATOM   4060  C CA  . GLY A 1 517 ? 82.047  129.090 -22.905 1.00 50.18  ? 518 GLY S CA  1 
ATOM   4061  C C   . GLY A 1 517 ? 81.544  129.091 -21.473 1.00 50.18  ? 518 GLY S C   1 
ATOM   4062  O O   . GLY A 1 517 ? 81.079  130.114 -20.961 1.00 100.00 ? 518 GLY S O   1 
ATOM   4063  N N   . LEU A 1 518 ? 81.616  127.940 -20.819 1.00 11.09  ? 519 LEU S N   1 
ATOM   4064  C CA  . LEU A 1 518 ? 81.158  127.849 -19.446 1.00 11.09  ? 519 LEU S CA  1 
ATOM   4065  C C   . LEU A 1 518 ? 82.094  126.953 -18.633 1.00 11.09  ? 519 LEU S C   1 
ATOM   4066  O O   . LEU A 1 518 ? 81.891  125.735 -18.551 1.00 43.94  ? 519 LEU S O   1 
ATOM   4067  C CB  . LEU A 1 518 ? 79.740  127.305 -19.415 1.00 43.94  ? 519 LEU S CB  1 
ATOM   4068  C CG  . LEU A 1 518 ? 78.693  128.398 -19.295 1.00 43.94  ? 519 LEU S CG  1 
ATOM   4069  C CD1 . LEU A 1 518 ? 77.329  127.771 -19.422 1.00 43.94  ? 519 LEU S CD1 1 
ATOM   4070  C CD2 . LEU A 1 518 ? 78.840  129.114 -17.955 1.00 43.94  ? 519 LEU S CD2 1 
ATOM   4071  N N   . ASP A 1 519 ? 83.130  127.567 -18.051 1.00 26.54  ? 520 ASP S N   1 
ATOM   4072  C CA  . ASP A 1 519 ? 84.100  126.833 -17.247 1.00 26.54  ? 520 ASP S CA  1 
ATOM   4073  C C   . ASP A 1 519 ? 84.592  127.631 -16.066 1.00 26.54  ? 520 ASP S C   1 
ATOM   4074  O O   . ASP A 1 519 ? 84.865  128.823 -16.177 1.00 42.86  ? 520 ASP S O   1 
ATOM   4075  C CB  . ASP A 1 519 ? 85.301  126.437 -18.087 1.00 42.86  ? 520 ASP S CB  1 
ATOM   4076  C CG  . ASP A 1 519 ? 86.185  125.429 -17.383 1.00 42.86  ? 520 ASP S CG  1 
ATOM   4077  O OD1 . ASP A 1 519 ? 86.829  125.785 -16.367 1.00 42.86  ? 520 ASP S OD1 1 
ATOM   4078  O OD2 . ASP A 1 519 ? 86.229  124.270 -17.844 1.00 42.86  ? 520 ASP S OD2 1 
ATOM   4079  N N   . LEU A 1 520 ? 84.708  126.962 -14.927 1.00 60.11  ? 521 LEU S N   1 
ATOM   4080  C CA  . LEU A 1 520 ? 85.184  127.610 -13.729 1.00 60.11  ? 521 LEU S CA  1 
ATOM   4081  C C   . LEU A 1 520 ? 86.322  126.794 -13.125 1.00 60.11  ? 521 LEU S C   1 
ATOM   4082  O O   . LEU A 1 520 ? 86.739  127.057 -11.996 1.00 41.13  ? 521 LEU S O   1 
ATOM   4083  C CB  . LEU A 1 520 ? 84.049  127.766 -12.713 1.00 41.13  ? 521 LEU S CB  1 
ATOM   4084  C CG  . LEU A 1 520 ? 82.619  127.465 -13.156 1.00 41.13  ? 521 LEU S CG  1 
ATOM   4085  C CD1 . LEU A 1 520 ? 81.690  127.681 -11.987 1.00 41.13  ? 521 LEU S CD1 1 
ATOM   4086  C CD2 . LEU A 1 520 ? 82.227  128.364 -14.313 1.00 41.13  ? 521 LEU S CD2 1 
ATOM   4087  N N   . GLN A 1 521 ? 86.820  125.810 -13.878 1.00 3.71   ? 522 GLN S N   1 
ATOM   4088  C CA  . GLN A 1 521 ? 87.917  124.987 -13.395 1.00 3.71   ? 522 GLN S CA  1 
ATOM   4089  C C   . GLN A 1 521 ? 88.933  125.930 -12.759 1.00 3.71   ? 522 GLN S C   1 
ATOM   4090  O O   . GLN A 1 521 ? 89.329  125.763 -11.597 1.00 45.26  ? 522 GLN S O   1 
ATOM   4091  C CB  . GLN A 1 521 ? 88.544  124.200 -14.538 1.00 45.26  ? 522 GLN S CB  1 
ATOM   4092  C CG  . GLN A 1 521 ? 88.946  122.792 -14.154 1.00 45.26  ? 522 GLN S CG  1 
ATOM   4093  C CD  . GLN A 1 521 ? 87.953  122.123 -13.210 1.00 45.26  ? 522 GLN S CD  1 
ATOM   4094  O OE1 . GLN A 1 521 ? 88.189  122.016 -11.999 1.00 45.26  ? 522 GLN S OE1 1 
ATOM   4095  N NE2 . GLN A 1 521 ? 86.834  121.663 -13.764 1.00 45.26  ? 522 GLN S NE2 1 
ATOM   4096  N N   . PRO A 1 522 ? 89.360  126.946 -13.514 1.00 60.32  ? 523 PRO S N   1 
ATOM   4097  C CA  . PRO A 1 522 ? 90.317  127.923 -13.008 1.00 60.32  ? 523 PRO S CA  1 
ATOM   4098  C C   . PRO A 1 522 ? 90.014  128.312 -11.560 1.00 60.32  ? 523 PRO S C   1 
ATOM   4099  O O   . PRO A 1 522 ? 90.741  127.935 -10.643 1.00 15.53  ? 523 PRO S O   1 
ATOM   4100  C CB  . PRO A 1 522 ? 90.164  129.117 -13.954 1.00 15.53  ? 523 PRO S CB  1 
ATOM   4101  C CG  . PRO A 1 522 ? 89.219  128.683 -15.035 1.00 15.53  ? 523 PRO S CG  1 
ATOM   4102  C CD  . PRO A 1 522 ? 89.005  127.213 -14.912 1.00 15.53  ? 523 PRO S CD  1 
ATOM   4103  N N   . CYS A 1 523 ? 88.926  129.048 -11.359 1.00 9.72   ? 524 CYS S N   1 
ATOM   4104  C CA  . CYS A 1 523 ? 88.574  129.485 -10.022 1.00 9.72   ? 524 CYS S CA  1 
ATOM   4105  C C   . CYS A 1 523 ? 88.574  128.360 -9.002  1.00 9.72   ? 524 CYS S C   1 
ATOM   4106  O O   . CYS A 1 523 ? 88.493  128.634 -7.803  1.00 80.54  ? 524 CYS S O   1 
ATOM   4107  C CB  . CYS A 1 523 ? 87.220  130.200 -10.006 1.00 80.54  ? 524 CYS S CB  1 
ATOM   4108  S SG  . CYS A 1 523 ? 86.939  131.160 -8.497  1.00 80.54  ? 524 CYS S SG  1 
ATOM   4109  N N   . ILE A 1 524 ? 88.653  127.102 -9.442  1.00 42.48  ? 525 ILE S N   1 
ATOM   4110  C CA  . ILE A 1 524 ? 88.698  126.001 -8.478  1.00 42.48  ? 525 ILE S CA  1 
ATOM   4111  C C   . ILE A 1 524 ? 90.152  125.708 -8.148  1.00 42.48  ? 525 ILE S C   1 
ATOM   4112  O O   . ILE A 1 524 ? 90.521  125.510 -6.991  1.00 10.84  ? 525 ILE S O   1 
ATOM   4113  C CB  . ILE A 1 524 ? 88.057  124.718 -8.998  1.00 10.84  ? 525 ILE S CB  1 
ATOM   4114  C CG1 . ILE A 1 524 ? 86.924  125.054 -9.951  1.00 10.84  ? 525 ILE S CG1 1 
ATOM   4115  C CG2 . ILE A 1 524 ? 87.489  123.933 -7.839  1.00 10.84  ? 525 ILE S CG2 1 
ATOM   4116  C CD1 . ILE A 1 524 ? 86.161  123.844 -10.413 1.00 10.84  ? 525 ILE S CD1 1 
ATOM   4117  N N   . GLU A 1 525 ? 90.991  125.684 -9.169  1.00 2.00   ? 526 GLU S N   1 
ATOM   4118  C CA  . GLU A 1 525 ? 92.403  125.452 -8.927  1.00 2.00   ? 526 GLU S CA  1 
ATOM   4119  C C   . GLU A 1 525 ? 92.932  126.483 -7.914  1.00 2.00   ? 526 GLU S C   1 
ATOM   4120  O O   . GLU A 1 525 ? 93.625  126.132 -6.962  1.00 100.00 ? 526 GLU S O   1 
ATOM   4121  C CB  . GLU A 1 525 ? 93.177  125.580 -10.239 1.00 100.00 ? 526 GLU S CB  1 
ATOM   4122  C CG  . GLU A 1 525 ? 92.482  124.935 -11.426 1.00 100.00 ? 526 GLU S CG  1 
ATOM   4123  C CD  . GLU A 1 525 ? 92.020  123.524 -11.125 1.00 100.00 ? 526 GLU S CD  1 
ATOM   4124  O OE1 . GLU A 1 525 ? 91.061  123.374 -10.334 1.00 100.00 ? 526 GLU S OE1 1 
ATOM   4125  O OE2 . GLU A 1 525 ? 92.616  122.570 -11.677 1.00 100.00 ? 526 GLU S OE2 1 
ATOM   4126  N N   . LEU A 1 526 ? 92.592  127.759 -8.135  1.00 15.10  ? 527 LEU S N   1 
ATOM   4127  C CA  . LEU A 1 526 ? 93.034  128.846 -7.269  1.00 15.10  ? 527 LEU S CA  1 
ATOM   4128  C C   . LEU A 1 526 ? 92.734  128.554 -5.813  1.00 15.10  ? 527 LEU S C   1 
ATOM   4129  O O   . LEU A 1 526 ? 93.249  129.233 -4.927  1.00 6.82   ? 527 LEU S O   1 
ATOM   4130  C CB  . LEU A 1 526 ? 92.359  130.163 -7.670  1.00 6.82   ? 527 LEU S CB  1 
ATOM   4131  C CG  . LEU A 1 526 ? 92.925  131.468 -7.087  1.00 6.82   ? 527 LEU S CG  1 
ATOM   4132  C CD1 . LEU A 1 526 ? 92.380  132.660 -7.860  1.00 6.82   ? 527 LEU S CD1 1 
ATOM   4133  C CD2 . LEU A 1 526 ? 92.542  131.612 -5.627  1.00 6.82   ? 527 LEU S CD2 1 
ATOM   4134  N N   . ILE A 1 527 ? 91.927  127.534 -5.552  1.00 14.98  ? 528 ILE S N   1 
ATOM   4135  C CA  . ILE A 1 527 ? 91.571  127.219 -4.176  1.00 14.98  ? 528 ILE S CA  1 
ATOM   4136  C C   . ILE A 1 527 ? 91.547  125.718 -3.884  1.00 14.98  ? 528 ILE S C   1 
ATOM   4137  O O   . ILE A 1 527 ? 91.502  125.282 -2.730  1.00 22.56  ? 528 ILE S O   1 
ATOM   4138  C CB  . ILE A 1 527 ? 90.191  127.875 -3.832  1.00 22.56  ? 528 ILE S CB  1 
ATOM   4139  C CG1 . ILE A 1 527 ? 89.690  127.414 -2.468  1.00 22.56  ? 528 ILE S CG1 1 
ATOM   4140  C CG2 . ILE A 1 527 ? 89.179  127.549 -4.894  1.00 22.56  ? 528 ILE S CG2 1 
ATOM   4141  C CD1 . ILE A 1 527 ? 88.780  128.416 -1.819  1.00 22.56  ? 528 ILE S CD1 1 
ATOM   4142  N N   . GLU A 1 528 ? 91.629  124.929 -4.943  1.00 2.00   ? 529 GLU S N   1 
ATOM   4143  C CA  . GLU A 1 528 ? 91.566  123.482 -4.811  1.00 2.00   ? 529 GLU S CA  1 
ATOM   4144  C C   . GLU A 1 528 ? 92.928  122.844 -4.969  1.00 2.00   ? 529 GLU S C   1 
ATOM   4145  O O   . GLU A 1 528 ? 93.446  122.242 -4.043  1.00 48.39  ? 529 GLU S O   1 
ATOM   4146  C CB  . GLU A 1 528 ? 90.590  122.935 -5.864  1.00 48.39  ? 529 GLU S CB  1 
ATOM   4147  C CG  . GLU A 1 528 ? 90.606  121.433 -6.082  1.00 48.39  ? 529 GLU S CG  1 
ATOM   4148  C CD  . GLU A 1 528 ? 89.497  120.979 -7.026  1.00 48.39  ? 529 GLU S CD  1 
ATOM   4149  O OE1 . GLU A 1 528 ? 88.395  120.685 -6.537  1.00 48.39  ? 529 GLU S OE1 1 
ATOM   4150  O OE2 . GLU A 1 528 ? 89.724  120.915 -8.251  1.00 48.39  ? 529 GLU S OE2 1 
ATOM   4151  N N   . ARG A 1 529 ? 93.506  122.996 -6.154  1.00 42.28  ? 530 ARG S N   1 
ATOM   4152  C CA  . ARG A 1 529 ? 94.819  122.443 -6.461  1.00 42.28  ? 530 ARG S CA  1 
ATOM   4153  C C   . ARG A 1 529 ? 95.804  122.575 -5.300  1.00 42.28  ? 530 ARG S C   1 
ATOM   4154  O O   . ARG A 1 529 ? 95.823  123.587 -4.601  1.00 100.00 ? 530 ARG S O   1 
ATOM   4155  C CB  . ARG A 1 529 ? 95.390  123.143 -7.697  1.00 100.00 ? 530 ARG S CB  1 
ATOM   4156  C CG  . ARG A 1 529 ? 96.898  123.059 -7.811  1.00 100.00 ? 530 ARG S CG  1 
ATOM   4157  C CD  . ARG A 1 529 ? 97.300  122.069 -8.877  1.00 100.00 ? 530 ARG S CD  1 
ATOM   4158  N NE  . ARG A 1 529 ? 97.627  122.749 -10.120 1.00 100.00 ? 530 ARG S NE  1 
ATOM   4159  C CZ  . ARG A 1 529 ? 97.154  122.399 -11.311 1.00 100.00 ? 530 ARG S CZ  1 
ATOM   4160  N NH1 . ARG A 1 529 ? 96.324  121.367 -11.426 1.00 100.00 ? 530 ARG S NH1 1 
ATOM   4161  N NH2 . ARG A 1 529 ? 97.511  123.081 -12.396 1.00 100.00 ? 530 ARG S NH2 1 
ATOM   4162  N N   . PRO A 1 530 ? 96.630  121.542 -5.082  1.00 84.72  ? 531 PRO S N   1 
ATOM   4163  C CA  . PRO A 1 530 ? 97.648  121.458 -4.030  1.00 84.72  ? 531 PRO S CA  1 
ATOM   4164  C C   . PRO A 1 530 ? 99.068  121.765 -4.514  1.00 84.72  ? 531 PRO S C   1 
ATOM   4165  O O   . PRO A 1 530 ? 99.499  122.926 -4.563  1.00 39.78  ? 531 PRO S O   1 
ATOM   4166  C CB  . PRO A 1 530 ? 97.523  120.015 -3.559  1.00 39.78  ? 531 PRO S CB  1 
ATOM   4167  C CG  . PRO A 1 530 ? 97.073  119.262 -4.829  1.00 39.78  ? 531 PRO S CG  1 
ATOM   4168  C CD  . PRO A 1 530 ? 96.586  120.287 -5.846  1.00 39.78  ? 531 PRO S CD  1 
ATOM   4169  N N   . THR A 1 531 ? 99.802  120.708 -4.856  1.00 55.21  ? 532 THR S N   1 
ATOM   4170  C CA  . THR A 1 531 ? 101.159 120.875 -5.346  1.00 55.21  ? 532 THR S CA  1 
ATOM   4171  C C   . THR A 1 531 ? 101.046 121.722 -6.601  1.00 55.21  ? 532 THR S C   1 
ATOM   4172  O O   . THR A 1 531 ? 99.943  122.105 -6.994  1.00 100.00 ? 532 THR S O   1 
ATOM   4173  C CB  . THR A 1 531 ? 101.820 119.521 -5.695  1.00 100.00 ? 532 THR S CB  1 
ATOM   4174  O OG1 . THR A 1 531 ? 100.860 118.669 -6.336  1.00 100.00 ? 532 THR S OG1 1 
ATOM   4175  C CG2 . THR A 1 531 ? 102.348 118.836 -4.431  1.00 100.00 ? 532 THR S CG2 1 
ATOM   4176  N N   . ASN A 1 532 ? 102.175 122.013 -7.232  1.00 66.62  ? 533 ASN S N   1 
ATOM   4177  C CA  . ASN A 1 532 ? 102.133 122.835 -8.428  1.00 66.62  ? 533 ASN S CA  1 
ATOM   4178  C C   . ASN A 1 532 ? 101.463 124.114 -7.960  1.00 66.62  ? 533 ASN S C   1 
ATOM   4179  O O   . ASN A 1 532 ? 101.233 124.280 -6.764  1.00 100.00 ? 533 ASN S O   1 
ATOM   4180  C CB  . ASN A 1 532 ? 101.293 122.144 -9.503  1.00 100.00 ? 533 ASN S CB  1 
ATOM   4181  C CG  . ASN A 1 532 ? 101.382 120.626 -9.427  1.00 100.00 ? 533 ASN S CG  1 
ATOM   4182  O OD1 . ASN A 1 532 ? 102.429 120.037 -9.724  1.00 100.00 ? 533 ASN S OD1 1 
ATOM   4183  N ND2 . ASN A 1 532 ? 100.283 119.984 -9.028  1.00 100.00 ? 533 ASN S ND2 1 
ATOM   4184  N N   . PRO A 1 533 ? 101.134 125.032 -8.884  1.00 61.34  ? 534 PRO S N   1 
ATOM   4185  C CA  . PRO A 1 533 ? 100.491 126.259 -8.407  1.00 61.34  ? 534 PRO S CA  1 
ATOM   4186  C C   . PRO A 1 533 ? 99.517  125.945 -7.280  1.00 61.34  ? 534 PRO S C   1 
ATOM   4187  O O   . PRO A 1 533 ? 98.421  125.452 -7.523  1.00 44.52  ? 534 PRO S O   1 
ATOM   4188  C CB  . PRO A 1 533 ? 99.794  126.812 -9.653  1.00 44.52  ? 534 PRO S CB  1 
ATOM   4189  C CG  . PRO A 1 533 ? 100.133 125.838 -10.792 1.00 44.52  ? 534 PRO S CG  1 
ATOM   4190  C CD  . PRO A 1 533 ? 101.298 125.031 -10.345 1.00 44.52  ? 534 PRO S CD  1 
ATOM   4191  N N   . PRO A 1 534 ? 99.920  126.216 -6.026  1.00 100.00 ? 535 PRO S N   1 
ATOM   4192  C CA  . PRO A 1 534 ? 99.067  125.945 -4.864  1.00 100.00 ? 535 PRO S CA  1 
ATOM   4193  C C   . PRO A 1 534 ? 97.725  126.663 -4.884  1.00 100.00 ? 535 PRO S C   1 
ATOM   4194  O O   . PRO A 1 534 ? 97.537  127.649 -5.604  1.00 100.00 ? 535 PRO S O   1 
ATOM   4195  C CB  . PRO A 1 534 ? 99.922  126.379 -3.669  1.00 100.00 ? 535 PRO S CB  1 
ATOM   4196  C CG  . PRO A 1 534 ? 101.314 126.420 -4.183  1.00 100.00 ? 535 PRO S CG  1 
ATOM   4197  C CD  . PRO A 1 534 ? 101.207 126.807 -5.627  1.00 100.00 ? 535 PRO S CD  1 
ATOM   4198  N N   . GLY A 1 535 ? 96.793  126.147 -4.089  1.00 79.56  ? 536 GLY S N   1 
ATOM   4199  C CA  . GLY A 1 535 ? 95.474  126.744 -4.000  1.00 79.56  ? 536 GLY S CA  1 
ATOM   4200  C C   . GLY A 1 535 ? 95.357  127.461 -2.675  1.00 79.56  ? 536 GLY S C   1 
ATOM   4201  O O   . GLY A 1 535 ? 96.112  127.182 -1.761  1.00 2.00   ? 536 GLY S O   1 
ATOM   4202  N N   . VAL A 1 536 ? 94.419  128.394 -2.572  1.00 2.27   ? 537 VAL S N   1 
ATOM   4203  C CA  . VAL A 1 536 ? 94.227  129.139 -1.344  1.00 2.27   ? 537 VAL S CA  1 
ATOM   4204  C C   . VAL A 1 536 ? 94.232  128.211 -0.137  1.00 2.27   ? 537 VAL S C   1 
ATOM   4205  O O   . VAL A 1 536 ? 94.863  128.511 0.884   1.00 19.97  ? 537 VAL S O   1 
ATOM   4206  C CB  . VAL A 1 536 ? 92.905  129.919 -1.381  1.00 19.97  ? 537 VAL S CB  1 
ATOM   4207  C CG1 . VAL A 1 536 ? 92.706  130.683 -0.079  1.00 19.97  ? 537 VAL S CG1 1 
ATOM   4208  C CG2 . VAL A 1 536 ? 92.917  130.879 -2.544  1.00 19.97  ? 537 VAL S CG2 1 
ATOM   4209  N N   . LEU A 1 537 ? 93.546  127.080 -0.256  1.00 19.47  ? 538 LEU S N   1 
ATOM   4210  C CA  . LEU A 1 537 ? 93.470  126.121 0.844   1.00 19.47  ? 538 LEU S CA  1 
ATOM   4211  C C   . LEU A 1 537 ? 94.834  125.537 1.162   1.00 19.47  ? 538 LEU S C   1 
ATOM   4212  O O   . LEU A 1 537 ? 95.207  125.390 2.325   1.00 85.74  ? 538 LEU S O   1 
ATOM   4213  C CB  . LEU A 1 537 ? 92.492  124.994 0.502   1.00 85.74  ? 538 LEU S CB  1 
ATOM   4214  C CG  . LEU A 1 537 ? 91.036  125.177 0.942   1.00 85.74  ? 538 LEU S CG  1 
ATOM   4215  C CD1 . LEU A 1 537 ? 90.177  124.136 0.251   1.00 85.74  ? 538 LEU S CD1 1 
ATOM   4216  C CD2 . LEU A 1 537 ? 90.915  125.046 2.452   1.00 85.74  ? 538 LEU S CD2 1 
ATOM   4217  N N   . ALA A 1 538 ? 95.571  125.206 0.109   1.00 62.75  ? 539 ALA S N   1 
ATOM   4218  C CA  . ALA A 1 538 ? 96.914  124.638 0.227   1.00 62.75  ? 539 ALA S CA  1 
ATOM   4219  C C   . ALA A 1 538 ? 97.799  125.438 1.180   1.00 62.75  ? 539 ALA S C   1 
ATOM   4220  O O   . ALA A 1 538 ? 98.187  124.964 2.243   1.00 39.32  ? 539 ALA S O   1 
ATOM   4221  C CB  . ALA A 1 538 ? 97.568  124.586 -1.152  1.00 39.32  ? 539 ALA S CB  1 
ATOM   4222  N N   . LEU A 1 539 ? 98.127  126.656 0.770   1.00 15.81  ? 540 LEU S N   1 
ATOM   4223  C CA  . LEU A 1 539 ? 98.950  127.538 1.570   1.00 15.81  ? 540 LEU S CA  1 
ATOM   4224  C C   . LEU A 1 539 ? 98.467  127.528 3.007   1.00 15.81  ? 540 LEU S C   1 
ATOM   4225  O O   . LEU A 1 539 ? 99.133  126.976 3.870   1.00 2.74   ? 540 LEU S O   1 
ATOM   4226  C CB  . LEU A 1 539 ? 98.903  128.942 0.985   1.00 2.74   ? 540 LEU S CB  1 
ATOM   4227  C CG  . LEU A 1 539 ? 98.939  128.842 -0.543  1.00 2.74   ? 540 LEU S CG  1 
ATOM   4228  C CD1 . LEU A 1 539 ? 98.717  130.208 -1.158  1.00 2.74   ? 540 LEU S CD1 1 
ATOM   4229  C CD2 . LEU A 1 539 ? 100.270 128.234 -0.992  1.00 2.74   ? 540 LEU S CD2 1 
ATOM   4230  N N   . LEU A 1 540 ? 97.299  128.105 3.260   1.00 42.08  ? 541 LEU S N   1 
ATOM   4231  C CA  . LEU A 1 540 ? 96.755  128.143 4.616   1.00 42.08  ? 541 LEU S CA  1 
ATOM   4232  C C   . LEU A 1 540 ? 96.883  126.826 5.387   1.00 42.08  ? 541 LEU S C   1 
ATOM   4233  O O   . LEU A 1 540 ? 96.662  126.799 6.602   1.00 46.36  ? 541 LEU S O   1 
ATOM   4234  C CB  . LEU A 1 540 ? 95.285  128.562 4.584   1.00 46.36  ? 541 LEU S CB  1 
ATOM   4235  C CG  . LEU A 1 540 ? 94.732  129.048 5.924   1.00 46.36  ? 541 LEU S CG  1 
ATOM   4236  C CD1 . LEU A 1 540 ? 95.035  130.527 6.087   1.00 46.36  ? 541 LEU S CD1 1 
ATOM   4237  C CD2 . LEU A 1 540 ? 93.240  128.799 5.992   1.00 46.36  ? 541 LEU S CD2 1 
ATOM   4238  N N   . ASP A 1 541 ? 97.242  125.744 4.692   1.00 19.99  ? 542 ASP S N   1 
ATOM   4239  C CA  . ASP A 1 541 ? 97.379  124.433 5.334   1.00 19.99  ? 542 ASP S CA  1 
ATOM   4240  C C   . ASP A 1 541 ? 98.768  124.226 5.931   1.00 19.99  ? 542 ASP S C   1 
ATOM   4241  O O   . ASP A 1 541 ? 98.908  123.937 7.126   1.00 100.00 ? 542 ASP S O   1 
ATOM   4242  C CB  . ASP A 1 541 ? 97.060  123.306 4.336   1.00 100.00 ? 542 ASP S CB  1 
ATOM   4243  C CG  . ASP A 1 541 ? 95.564  123.198 4.010   1.00 100.00 ? 542 ASP S CG  1 
ATOM   4244  O OD1 . ASP A 1 541 ? 94.726  123.586 4.856   1.00 100.00 ? 542 ASP S OD1 1 
ATOM   4245  O OD2 . ASP A 1 541 ? 95.227  122.721 2.903   1.00 100.00 ? 542 ASP S OD2 1 
ATOM   4246  N N   . GLU A 1 542 ? 99.791  124.378 5.102   1.00 41.82  ? 543 GLU S N   1 
ATOM   4247  C CA  . GLU A 1 542 ? 101.164 124.214 5.557   1.00 41.82  ? 543 GLU S CA  1 
ATOM   4248  C C   . GLU A 1 542 ? 101.590 125.437 6.383   1.00 41.82  ? 543 GLU S C   1 
ATOM   4249  O O   . GLU A 1 542 ? 102.149 125.304 7.473   1.00 93.29  ? 543 GLU S O   1 
ATOM   4250  C CB  . GLU A 1 542 ? 102.086 124.034 4.345   1.00 93.29  ? 543 GLU S CB  1 
ATOM   4251  C CG  . GLU A 1 542 ? 103.132 125.125 4.161   1.00 93.29  ? 543 GLU S CG  1 
ATOM   4252  C CD  . GLU A 1 542 ? 102.789 126.086 3.040   1.00 93.29  ? 543 GLU S CD  1 
ATOM   4253  O OE1 . GLU A 1 542 ? 102.854 125.668 1.863   1.00 93.29  ? 543 GLU S OE1 1 
ATOM   4254  O OE2 . GLU A 1 542 ? 102.459 127.259 3.334   1.00 93.29  ? 543 GLU S OE2 1 
ATOM   4255  N N   . GLU A 1 543 ? 101.309 126.623 5.842   1.00 13.09  ? 544 GLU S N   1 
ATOM   4256  C CA  . GLU A 1 543 ? 101.627 127.899 6.477   1.00 13.09  ? 544 GLU S CA  1 
ATOM   4257  C C   . GLU A 1 543 ? 100.958 127.947 7.836   1.00 13.09  ? 544 GLU S C   1 
ATOM   4258  O O   . GLU A 1 543 ? 101.174 128.864 8.627   1.00 99.39  ? 544 GLU S O   1 
ATOM   4259  C CB  . GLU A 1 543 ? 101.116 129.042 5.604   1.00 99.39  ? 544 GLU S CB  1 
ATOM   4260  C CG  . GLU A 1 543 ? 102.208 129.951 5.084   1.00 99.39  ? 544 GLU S CG  1 
ATOM   4261  C CD  . GLU A 1 543 ? 102.542 131.054 6.072   1.00 99.39  ? 544 GLU S CD  1 
ATOM   4262  O OE1 . GLU A 1 543 ? 101.846 131.141 7.111   1.00 99.39  ? 544 GLU S OE1 1 
ATOM   4263  O OE2 . GLU A 1 543 ? 103.494 131.828 5.814   1.00 99.39  ? 544 GLU S OE2 1 
ATOM   4264  N N   . CYS A 1 544 ? 100.135 126.936 8.084   1.00 58.52  ? 545 CYS S N   1 
ATOM   4265  C CA  . CYS A 1 544 ? 99.408  126.797 9.328   1.00 58.52  ? 545 CYS S CA  1 
ATOM   4266  C C   . CYS A 1 544 ? 100.277 125.996 10.292  1.00 58.52  ? 545 CYS S C   1 
ATOM   4267  O O   . CYS A 1 544 ? 100.034 125.956 11.498  1.00 100.00 ? 545 CYS S O   1 
ATOM   4268  C CB  . CYS A 1 544 ? 98.080  126.080 9.063   1.00 100.00 ? 545 CYS S CB  1 
ATOM   4269  S SG  . CYS A 1 544 ? 97.442  125.064 10.409  1.00 100.00 ? 545 CYS S SG  1 
ATOM   4270  N N   . TRP A 1 545 ? 101.312 125.377 9.744   1.00 93.78  ? 546 TRP S N   1 
ATOM   4271  C CA  . TRP A 1 545 ? 102.228 124.581 10.538  1.00 93.78  ? 546 TRP S CA  1 
ATOM   4272  C C   . TRP A 1 545 ? 103.646 125.164 10.529  1.00 93.78  ? 546 TRP S C   1 
ATOM   4273  O O   . TRP A 1 545 ? 104.598 124.523 10.083  1.00 100.00 ? 546 TRP S O   1 
ATOM   4274  C CB  . TRP A 1 545 ? 102.236 123.147 10.013  1.00 100.00 ? 546 TRP S CB  1 
ATOM   4275  C CG  . TRP A 1 545 ? 101.217 122.288 10.674  1.00 100.00 ? 546 TRP S CG  1 
ATOM   4276  C CD1 . TRP A 1 545 ? 100.730 122.420 11.948  1.00 100.00 ? 546 TRP S CD1 1 
ATOM   4277  C CD2 . TRP A 1 545 ? 100.558 121.155 10.108  1.00 100.00 ? 546 TRP S CD2 1 
ATOM   4278  N NE1 . TRP A 1 545 ? 99.805  121.433 12.208  1.00 100.00 ? 546 TRP S NE1 1 
ATOM   4279  C CE2 . TRP A 1 545 ? 99.680  120.642 11.097  1.00 100.00 ? 546 TRP S CE2 1 
ATOM   4280  C CE3 . TRP A 1 545 ? 100.624 120.518 8.861   1.00 100.00 ? 546 TRP S CE3 1 
ATOM   4281  C CZ2 . TRP A 1 545 ? 98.871  119.522 10.878  1.00 100.00 ? 546 TRP S CZ2 1 
ATOM   4282  C CZ3 . TRP A 1 545 ? 99.821  119.403 8.640   1.00 100.00 ? 546 TRP S CZ3 1 
ATOM   4283  C CH2 . TRP A 1 545 ? 98.955  118.916 9.648   1.00 100.00 ? 546 TRP S CH2 1 
ATOM   4284  N N   . PHE A 1 546 ? 103.768 126.390 11.028  1.00 100.00 ? 547 PHE S N   1 
ATOM   4285  C CA  . PHE A 1 546 ? 105.049 127.097 11.107  1.00 100.00 ? 547 PHE S CA  1 
ATOM   4286  C C   . PHE A 1 546 ? 104.852 128.294 12.048  1.00 100.00 ? 547 PHE S C   1 
ATOM   4287  O O   . PHE A 1 546 ? 104.032 129.184 11.789  1.00 83.08  ? 547 PHE S O   1 
ATOM   4288  C CB  . PHE A 1 546 ? 105.489 127.550 9.705   1.00 83.08  ? 547 PHE S CB  1 
ATOM   4289  C CG  . PHE A 1 546 ? 106.429 128.721 9.708   1.00 83.08  ? 547 PHE S CG  1 
ATOM   4290  C CD1 . PHE A 1 546 ? 107.399 128.861 10.699  1.00 83.08  ? 547 PHE S CD1 1 
ATOM   4291  C CD2 . PHE A 1 546 ? 106.335 129.694 8.718   1.00 83.08  ? 547 PHE S CD2 1 
ATOM   4292  C CE1 . PHE A 1 546 ? 108.257 129.947 10.705  1.00 83.08  ? 547 PHE S CE1 1 
ATOM   4293  C CE2 . PHE A 1 546 ? 107.193 130.789 8.714   1.00 83.08  ? 547 PHE S CE2 1 
ATOM   4294  C CZ  . PHE A 1 546 ? 108.157 130.914 9.712   1.00 83.08  ? 547 PHE S CZ  1 
ATOM   4295  N N   . PRO A 1 547 ? 105.614 128.325 13.155  1.00 100.00 ? 548 PRO S N   1 
ATOM   4296  C CA  . PRO A 1 547 ? 105.589 129.361 14.196  1.00 100.00 ? 548 PRO S CA  1 
ATOM   4297  C C   . PRO A 1 547 ? 105.516 130.813 13.724  1.00 100.00 ? 548 PRO S C   1 
ATOM   4298  O O   . PRO A 1 547 ? 104.526 131.500 13.978  1.00 98.76  ? 548 PRO S O   1 
ATOM   4299  C CB  . PRO A 1 547 ? 106.864 129.094 15.008  1.00 98.76  ? 548 PRO S CB  1 
ATOM   4300  C CG  . PRO A 1 547 ? 107.669 128.117 14.167  1.00 98.76  ? 548 PRO S CG  1 
ATOM   4301  C CD  . PRO A 1 547 ? 106.644 127.315 13.442  1.00 98.76  ? 548 PRO S CD  1 
ATOM   4302  N N   . LYS A 1 548 ? 106.569 131.272 13.048  1.00 84.09  ? 549 LYS S N   1 
ATOM   4303  C CA  . LYS A 1 548 ? 106.635 132.648 12.564  1.00 84.09  ? 549 LYS S CA  1 
ATOM   4304  C C   . LYS A 1 548 ? 105.678 132.916 11.406  1.00 84.09  ? 549 LYS S C   1 
ATOM   4305  O O   . LYS A 1 548 ? 106.047 133.540 10.403  1.00 100.00 ? 549 LYS S O   1 
ATOM   4306  C CB  . LYS A 1 548 ? 108.070 132.993 12.141  1.00 100.00 ? 549 LYS S CB  1 
ATOM   4307  C CG  . LYS A 1 548 ? 108.716 134.125 12.945  1.00 100.00 ? 549 LYS S CG  1 
ATOM   4308  C CD  . LYS A 1 548 ? 110.070 134.536 12.357  1.00 100.00 ? 549 LYS S CD  1 
ATOM   4309  C CE  . LYS A 1 548 ? 110.593 135.823 12.997  1.00 100.00 ? 549 LYS S CE  1 
ATOM   4310  N NZ  . LYS A 1 548 ? 110.716 136.952 12.021  1.00 100.00 ? 549 LYS S NZ  1 
ATOM   4311  N N   . ALA A 1 549 ? 104.446 132.438 11.554  1.00 100.00 ? 550 ALA S N   1 
ATOM   4312  C CA  . ALA A 1 549 ? 103.413 132.624 10.540  1.00 100.00 ? 550 ALA S CA  1 
ATOM   4313  C C   . ALA A 1 549 ? 102.111 133.094 11.179  1.00 100.00 ? 550 ALA S C   1 
ATOM   4314  O O   . ALA A 1 549 ? 101.724 132.644 12.269  1.00 2.00   ? 550 ALA S O   1 
ATOM   4315  C CB  . ALA A 1 549 ? 103.167 131.313 9.767   1.00 2.00   ? 550 ALA S CB  1 
ATOM   4316  N N   . THR A 1 550 ? 101.450 134.014 10.487  1.00 49.72  ? 551 THR S N   1 
ATOM   4317  C CA  . THR A 1 550 ? 100.178 134.553 10.932  1.00 49.72  ? 551 THR S CA  1 
ATOM   4318  C C   . THR A 1 550 ? 99.287  134.735 9.731   1.00 49.72  ? 551 THR S C   1 
ATOM   4319  O O   . THR A 1 550 ? 99.755  134.863 8.602   1.00 92.42  ? 551 THR S O   1 
ATOM   4320  C CB  . THR A 1 550 ? 100.310 135.932 11.588  1.00 92.42  ? 551 THR S CB  1 
ATOM   4321  O OG1 . THR A 1 550 ? 101.240 136.731 10.843  1.00 92.42  ? 551 THR S OG1 1 
ATOM   4322  C CG2 . THR A 1 550 ? 100.755 135.795 13.032  1.00 92.42  ? 551 THR S CG2 1 
ATOM   4323  N N   . ASP A 1 551 ? 97.977  134.712 10.024  1.00 57.59  ? 552 ASP S N   1 
ATOM   4324  C CA  . ASP A 1 551 ? 97.010  134.941 8.999   1.00 57.59  ? 552 ASP S CA  1 
ATOM   4325  C C   . ASP A 1 551 ? 97.526  135.906 7.951   1.00 57.59  ? 552 ASP S C   1 
ATOM   4326  O O   . ASP A 1 551 ? 97.467  135.690 6.764   1.00 100.00 ? 552 ASP S O   1 
ATOM   4327  C CB  . ASP A 1 551 ? 95.751  135.447 9.687   1.00 100.00 ? 552 ASP S CB  1 
ATOM   4328  C CG  . ASP A 1 551 ? 95.334  134.497 10.800  1.00 100.00 ? 552 ASP S CG  1 
ATOM   4329  O OD1 . ASP A 1 551 ? 95.029  133.321 10.490  1.00 100.00 ? 552 ASP S OD1 1 
ATOM   4330  O OD2 . ASP A 1 551 ? 95.322  134.912 11.978  1.00 100.00 ? 552 ASP S OD2 1 
ATOM   4331  N N   . THR A 1 552 ? 98.153  136.950 8.511   1.00 2.00   ? 553 THR S N   1 
ATOM   4332  C CA  . THR A 1 552 ? 98.777  137.968 7.687   1.00 2.00   ? 553 THR S CA  1 
ATOM   4333  C C   . THR A 1 552 ? 99.844  137.277 6.869   1.00 2.00   ? 553 THR S C   1 
ATOM   4334  O O   . THR A 1 552 ? 99.730  137.151 5.650   1.00 34.28  ? 553 THR S O   1 
ATOM   4335  C CB  . THR A 1 552 ? 99.420  139.047 8.558   1.00 34.28  ? 553 THR S CB  1 
ATOM   4336  O OG1 . THR A 1 552 ? 98.874  138.952 9.878   1.00 34.28  ? 553 THR S OG1 1 
ATOM   4337  C CG2 . THR A 1 552 ? 99.135  140.440 8.004   1.00 34.28  ? 553 THR S CG2 1 
ATOM   4338  N N   . SER A 1 553 ? 100.876 136.814 7.559   1.00 100.00 ? 554 SER S N   1 
ATOM   4339  C CA  . SER A 1 553 ? 101.961 136.108 6.905   1.00 100.00 ? 554 SER S CA  1 
ATOM   4340  C C   . SER A 1 553 ? 101.368 135.278 5.758   1.00 100.00 ? 554 SER S C   1 
ATOM   4341  O O   . SER A 1 553 ? 101.842 135.312 4.618   1.00 12.49  ? 554 SER S O   1 
ATOM   4342  C CB  . SER A 1 553 ? 102.690 135.211 7.934   1.00 12.49  ? 554 SER S CB  1 
ATOM   4343  O OG  . SER A 1 553 ? 101.974 134.029 8.253   1.00 12.49  ? 554 SER S OG  1 
ATOM   4344  N N   . PHE A 1 554 ? 100.296 134.563 6.071   1.00 55.80  ? 555 PHE S N   1 
ATOM   4345  C CA  . PHE A 1 554 ? 99.615  133.735 5.091   1.00 55.80  ? 555 PHE S CA  1 
ATOM   4346  C C   . PHE A 1 554 ? 99.273  134.553 3.852   1.00 55.80  ? 555 PHE S C   1 
ATOM   4347  O O   . PHE A 1 554 ? 99.880  134.379 2.799   1.00 48.71  ? 555 PHE S O   1 
ATOM   4348  C CB  . PHE A 1 554 ? 98.341  133.165 5.709   1.00 48.71  ? 555 PHE S CB  1 
ATOM   4349  C CG  . PHE A 1 554 ? 97.333  132.703 4.704   1.00 48.71  ? 555 PHE S CG  1 
ATOM   4350  C CD1 . PHE A 1 554 ? 97.609  131.630 3.865   1.00 48.71  ? 555 PHE S CD1 1 
ATOM   4351  C CD2 . PHE A 1 554 ? 96.101  133.330 4.603   1.00 48.71  ? 555 PHE S CD2 1 
ATOM   4352  C CE1 . PHE A 1 554 ? 96.674  131.185 2.938   1.00 48.71  ? 555 PHE S CE1 1 
ATOM   4353  C CE2 . PHE A 1 554 ? 95.156  132.894 3.682   1.00 48.71  ? 555 PHE S CE2 1 
ATOM   4354  C CZ  . PHE A 1 554 ? 95.445  131.818 2.847   1.00 48.71  ? 555 PHE S CZ  1 
ATOM   4355  N N   . VAL A 1 555 ? 98.294  135.439 3.995   1.00 24.40  ? 556 VAL S N   1 
ATOM   4356  C CA  . VAL A 1 555 ? 97.855  136.305 2.911   1.00 24.40  ? 556 VAL S CA  1 
ATOM   4357  C C   . VAL A 1 555 ? 98.982  136.803 2.024   1.00 24.40  ? 556 VAL S C   1 
ATOM   4358  O O   . VAL A 1 555 ? 98.906  136.708 0.807   1.00 19.91  ? 556 VAL S O   1 
ATOM   4359  C CB  . VAL A 1 555 ? 97.181  137.545 3.446   1.00 19.91  ? 556 VAL S CB  1 
ATOM   4360  C CG1 . VAL A 1 555 ? 96.411  138.218 2.342   1.00 19.91  ? 556 VAL S CG1 1 
ATOM   4361  C CG2 . VAL A 1 555 ? 96.307  137.183 4.613   1.00 19.91  ? 556 VAL S CG2 1 
ATOM   4362  N N   . GLU A 1 556 ? 100.014 137.365 2.650   1.00 45.47  ? 557 GLU S N   1 
ATOM   4363  C CA  . GLU A 1 556 ? 101.172 137.899 1.936   1.00 45.47  ? 557 GLU S CA  1 
ATOM   4364  C C   . GLU A 1 556 ? 101.723 136.827 1.019   1.00 45.47  ? 557 GLU S C   1 
ATOM   4365  O O   . GLU A 1 556 ? 102.001 137.077 -0.149  1.00 98.70  ? 557 GLU S O   1 
ATOM   4366  C CB  . GLU A 1 556 ? 102.247 138.338 2.932   1.00 98.70  ? 557 GLU S CB  1 
ATOM   4367  C CG  . GLU A 1 556 ? 101.720 138.649 4.330   1.00 98.70  ? 557 GLU S CG  1 
ATOM   4368  C CD  . GLU A 1 556 ? 100.563 139.636 4.320   1.00 98.70  ? 557 GLU S CD  1 
ATOM   4369  O OE1 . GLU A 1 556 ? 100.521 140.503 3.415   1.00 98.70  ? 557 GLU S OE1 1 
ATOM   4370  O OE2 . GLU A 1 556 ? 99.696  139.549 5.216   1.00 98.70  ? 557 GLU S OE2 1 
ATOM   4371  N N   . LYS A 1 557 ? 101.879 135.628 1.568   1.00 26.15  ? 558 LYS S N   1 
ATOM   4372  C CA  . LYS A 1 557 ? 102.368 134.500 0.799   1.00 26.15  ? 558 LYS S CA  1 
ATOM   4373  C C   . LYS A 1 557 ? 101.295 134.264 -0.252  1.00 26.15  ? 558 LYS S C   1 
ATOM   4374  O O   . LYS A 1 557 ? 101.588 134.037 -1.422  1.00 79.01  ? 558 LYS S O   1 
ATOM   4375  C CB  . LYS A 1 557 ? 102.514 133.264 1.692   1.00 79.01  ? 558 LYS S CB  1 
ATOM   4376  C CG  . LYS A 1 557 ? 103.351 132.148 1.075   1.00 79.01  ? 558 LYS S CG  1 
ATOM   4377  C CD  . LYS A 1 557 ? 103.423 130.917 1.977   1.00 79.01  ? 558 LYS S CD  1 
ATOM   4378  C CE  . LYS A 1 557 ? 104.678 130.094 1.707   1.00 79.01  ? 558 LYS S CE  1 
ATOM   4379  N NZ  . LYS A 1 557 ? 105.726 130.305 2.749   1.00 79.01  ? 558 LYS S NZ  1 
ATOM   4380  N N   . LEU A 1 558 ? 100.034 134.341 0.168   1.00 91.30  ? 559 LEU S N   1 
ATOM   4381  C CA  . LEU A 1 558 ? 98.925  134.130 -0.755  1.00 91.30  ? 559 LEU S CA  1 
ATOM   4382  C C   . LEU A 1 558 ? 99.137  134.967 -2.002  1.00 91.30  ? 559 LEU S C   1 
ATOM   4383  O O   . LEU A 1 558 ? 99.038  134.470 -3.118  1.00 39.76  ? 559 LEU S O   1 
ATOM   4384  C CB  . LEU A 1 558 ? 97.596  134.496 -0.096  1.00 39.76  ? 559 LEU S CB  1 
ATOM   4385  C CG  . LEU A 1 558 ? 96.369  133.841 -0.743  1.00 39.76  ? 559 LEU S CG  1 
ATOM   4386  C CD1 . LEU A 1 558 ? 96.247  132.404 -0.254  1.00 39.76  ? 559 LEU S CD1 1 
ATOM   4387  C CD2 . LEU A 1 558 ? 95.109  134.644 -0.409  1.00 39.76  ? 559 LEU S CD2 1 
ATOM   4388  N N   . ILE A 1 559 ? 99.438  136.243 -1.799  1.00 61.41  ? 560 ILE S N   1 
ATOM   4389  C CA  . ILE A 1 559 ? 99.681  137.137 -2.917  1.00 61.41  ? 560 ILE S CA  1 
ATOM   4390  C C   . ILE A 1 559 ? 100.862 136.592 -3.704  1.00 61.41  ? 560 ILE S C   1 
ATOM   4391  O O   . ILE A 1 559 ? 100.904 136.691 -4.929  1.00 67.37  ? 560 ILE S O   1 
ATOM   4392  C CB  . ILE A 1 559 ? 100.033 138.568 -2.453  1.00 67.37  ? 560 ILE S CB  1 
ATOM   4393  C CG1 . ILE A 1 559 ? 99.658  138.761 -0.974  1.00 67.37  ? 560 ILE S CG1 1 
ATOM   4394  C CG2 . ILE A 1 559 ? 99.367  139.580 -3.373  1.00 67.37  ? 560 ILE S CG2 1 
ATOM   4395  C CD1 . ILE A 1 559 ? 98.164  138.875 -0.687  1.00 67.37  ? 560 ILE S CD1 1 
ATOM   4396  N N   . GLN A 1 560 ? 101.824 136.010 -2.992  1.00 83.65  ? 561 GLN S N   1 
ATOM   4397  C CA  . GLN A 1 560 ? 103.013 135.446 -3.621  1.00 83.65  ? 561 GLN S CA  1 
ATOM   4398  C C   . GLN A 1 560 ? 102.634 134.483 -4.741  1.00 83.65  ? 561 GLN S C   1 
ATOM   4399  O O   . GLN A 1 560 ? 102.884 134.752 -5.918  1.00 99.27  ? 561 GLN S O   1 
ATOM   4400  C CB  . GLN A 1 560 ? 103.878 134.723 -2.569  1.00 99.27  ? 561 GLN S CB  1 
ATOM   4401  C CG  . GLN A 1 560 ? 104.626 133.470 -3.070  1.00 99.27  ? 561 GLN S CG  1 
ATOM   4402  C CD  . GLN A 1 560 ? 104.094 132.163 -2.476  1.00 99.27  ? 561 GLN S CD  1 
ATOM   4403  O OE1 . GLN A 1 560 ? 102.909 132.045 -2.156  1.00 99.27  ? 561 GLN S OE1 1 
ATOM   4404  N NE2 . GLN A 1 560 ? 104.976 131.175 -2.339  1.00 99.27  ? 561 GLN S NE2 1 
ATOM   4405  N N   . GLU A 1 561 ? 102.016 133.365 -4.368  1.00 69.05  ? 562 GLU S N   1 
ATOM   4406  C CA  . GLU A 1 561 ? 101.624 132.346 -5.331  1.00 69.05  ? 562 GLU S CA  1 
ATOM   4407  C C   . GLU A 1 561 ? 100.639 132.863 -6.374  1.00 69.05  ? 562 GLU S C   1 
ATOM   4408  O O   . GLU A 1 561 ? 101.029 133.226 -7.485  1.00 100.00 ? 562 GLU S O   1 
ATOM   4409  C CB  . GLU A 1 561 ? 101.019 131.143 -4.604  1.00 100.00 ? 562 GLU S CB  1 
ATOM   4410  C CG  . GLU A 1 561 ? 102.041 130.137 -4.091  1.00 100.00 ? 562 GLU S CG  1 
ATOM   4411  C CD  . GLU A 1 561 ? 103.164 129.856 -5.085  1.00 100.00 ? 562 GLU S CD  1 
ATOM   4412  O OE1 . GLU A 1 561 ? 102.989 130.133 -6.297  1.00 100.00 ? 562 GLU S OE1 1 
ATOM   4413  O OE2 . GLU A 1 561 ? 104.226 129.351 -4.651  1.00 100.00 ? 562 GLU S OE2 1 
ATOM   4414  N N   . GLN A 1 562 ? 99.361  132.884 -6.007  1.00 40.89  ? 563 GLN S N   1 
ATOM   4415  C CA  . GLN A 1 562 ? 98.308  133.349 -6.900  1.00 40.89  ? 563 GLN S CA  1 
ATOM   4416  C C   . GLN A 1 562 ? 98.677  134.709 -7.450  1.00 40.89  ? 563 GLN S C   1 
ATOM   4417  O O   . GLN A 1 562 ? 99.080  134.824 -8.603  1.00 68.13  ? 563 GLN S O   1 
ATOM   4418  C CB  . GLN A 1 562 ? 96.989  133.421 -6.141  1.00 68.13  ? 563 GLN S CB  1 
ATOM   4419  C CG  . GLN A 1 562 ? 96.288  132.074 -6.015  1.00 68.13  ? 563 GLN S CG  1 
ATOM   4420  C CD  . GLN A 1 562 ? 97.187  130.895 -6.373  1.00 68.13  ? 563 GLN S CD  1 
ATOM   4421  O OE1 . GLN A 1 562 ? 97.342  130.545 -7.543  1.00 68.13  ? 563 GLN S OE1 1 
ATOM   4422  N NE2 . GLN A 1 562 ? 97.782  130.279 -5.362  1.00 68.13  ? 563 GLN S NE2 1 
ATOM   4423  N N   . GLY A 1 563 ? 98.547  135.732 -6.615  1.00 28.72  ? 564 GLY S N   1 
ATOM   4424  C CA  . GLY A 1 563 ? 98.892  137.079 -7.027  1.00 28.72  ? 564 GLY S CA  1 
ATOM   4425  C C   . GLY A 1 563 ? 98.222  137.568 -8.300  1.00 28.72  ? 564 GLY S C   1 
ATOM   4426  O O   . GLY A 1 563 ? 97.271  138.357 -8.253  1.00 84.57  ? 564 GLY S O   1 
ATOM   4427  N N   . ASN A 1 564 ? 98.718  137.109 -9.443  1.00 86.19  ? 565 ASN S N   1 
ATOM   4428  C CA  . ASN A 1 564 ? 98.173  137.517 -10.733 1.00 86.19  ? 565 ASN S CA  1 
ATOM   4429  C C   . ASN A 1 564 ? 97.186  136.508 -11.328 1.00 86.19  ? 565 ASN S C   1 
ATOM   4430  O O   . ASN A 1 564 ? 96.928  136.515 -12.534 1.00 100.00 ? 565 ASN S O   1 
ATOM   4431  C CB  . ASN A 1 564 ? 99.320  137.788 -11.718 1.00 100.00 ? 565 ASN S CB  1 
ATOM   4432  C CG  . ASN A 1 564 ? 99.518  136.658 -12.719 1.00 100.00 ? 565 ASN S CG  1 
ATOM   4433  O OD1 . ASN A 1 564 ? 99.469  136.875 -13.932 1.00 100.00 ? 565 ASN S OD1 1 
ATOM   4434  N ND2 . ASN A 1 564 ? 99.739  135.447 -12.214 1.00 100.00 ? 565 ASN S ND2 1 
ATOM   4435  N N   . HIS A 1 565 ? 96.633  135.640 -10.487 1.00 95.53  ? 566 HIS S N   1 
ATOM   4436  C CA  . HIS A 1 565 ? 95.670  134.649 -10.959 1.00 95.53  ? 566 HIS S CA  1 
ATOM   4437  C C   . HIS A 1 565 ? 94.447  135.347 -11.565 1.00 95.53  ? 566 HIS S C   1 
ATOM   4438  O O   . HIS A 1 565 ? 93.815  136.203 -10.935 1.00 84.42  ? 566 HIS S O   1 
ATOM   4439  C CB  . HIS A 1 565 ? 95.241  133.732 -9.808  1.00 84.42  ? 566 HIS S CB  1 
ATOM   4440  C CG  . HIS A 1 565 ? 94.430  132.549 -10.244 1.00 84.42  ? 566 HIS S CG  1 
ATOM   4441  N ND1 . HIS A 1 565 ? 93.402  132.644 -11.159 1.00 84.42  ? 566 HIS S ND1 1 
ATOM   4442  C CD2 . HIS A 1 565 ? 94.473  131.249 -9.865  1.00 84.42  ? 566 HIS S CD2 1 
ATOM   4443  C CE1 . HIS A 1 565 ? 92.848  131.456 -11.324 1.00 84.42  ? 566 HIS S CE1 1 
ATOM   4444  N NE2 . HIS A 1 565 ? 93.480  130.592 -10.548 1.00 84.42  ? 566 HIS S NE2 1 
ATOM   4445  N N   . ALA A 1 566 ? 94.128  134.984 -12.799 1.00 60.19  ? 567 ALA S N   1 
ATOM   4446  C CA  . ALA A 1 566 ? 92.995  135.573 -13.495 1.00 60.19  ? 567 ALA S CA  1 
ATOM   4447  C C   . ALA A 1 566 ? 91.766  135.639 -12.605 1.00 60.19  ? 567 ALA S C   1 
ATOM   4448  O O   . ALA A 1 566 ? 90.886  136.467 -12.824 1.00 77.69  ? 567 ALA S O   1 
ATOM   4449  C CB  . ALA A 1 566 ? 92.680  134.772 -14.747 1.00 77.69  ? 567 ALA S CB  1 
ATOM   4450  N N   . LYS A 1 567 ? 91.709  134.757 -11.609 1.00 14.24  ? 568 LYS S N   1 
ATOM   4451  C CA  . LYS A 1 567 ? 90.576  134.719 -10.687 1.00 14.24  ? 568 LYS S CA  1 
ATOM   4452  C C   . LYS A 1 567 ? 90.875  135.282 -9.300  1.00 14.24  ? 568 LYS S C   1 
ATOM   4453  O O   . LYS A 1 567 ? 90.047  135.185 -8.394  1.00 73.88  ? 568 LYS S O   1 
ATOM   4454  C CB  . LYS A 1 567 ? 90.051  133.294 -10.556 1.00 73.88  ? 568 LYS S CB  1 
ATOM   4455  C CG  . LYS A 1 567 ? 89.090  132.904 -11.660 1.00 73.88  ? 568 LYS S CG  1 
ATOM   4456  C CD  . LYS A 1 567 ? 87.858  133.797 -11.659 1.00 73.88  ? 568 LYS S CD  1 
ATOM   4457  C CE  . LYS A 1 567 ? 87.987  134.943 -12.654 1.00 73.88  ? 568 LYS S CE  1 
ATOM   4458  N NZ  . LYS A 1 567 ? 88.601  134.505 -13.938 1.00 73.88  ? 568 LYS S NZ  1 
ATOM   4459  N N   . PHE A 1 568 ? 92.061  135.862 -9.135  1.00 11.78  ? 569 PHE S N   1 
ATOM   4460  C CA  . PHE A 1 568 ? 92.428  136.451 -7.861  1.00 11.78  ? 569 PHE S CA  1 
ATOM   4461  C C   . PHE A 1 568 ? 92.484  137.965 -7.990  1.00 11.78  ? 569 PHE S C   1 
ATOM   4462  O O   . PHE A 1 568 ? 92.612  138.513 -9.087  1.00 41.62  ? 569 PHE S O   1 
ATOM   4463  C CB  . PHE A 1 568 ? 93.786  135.941 -7.358  1.00 41.62  ? 569 PHE S CB  1 
ATOM   4464  C CG  . PHE A 1 568 ? 94.141  136.454 -5.981  1.00 41.62  ? 569 PHE S CG  1 
ATOM   4465  C CD1 . PHE A 1 568 ? 93.713  135.774 -4.837  1.00 41.62  ? 569 PHE S CD1 1 
ATOM   4466  C CD2 . PHE A 1 568 ? 94.830  137.659 -5.826  1.00 41.62  ? 569 PHE S CD2 1 
ATOM   4467  C CE1 . PHE A 1 568 ? 93.958  136.287 -3.555  1.00 41.62  ? 569 PHE S CE1 1 
ATOM   4468  C CE2 . PHE A 1 568 ? 95.080  138.182 -4.552  1.00 41.62  ? 569 PHE S CE2 1 
ATOM   4469  C CZ  . PHE A 1 568 ? 94.640  137.491 -3.415  1.00 41.62  ? 569 PHE S CZ  1 
ATOM   4470  N N   . GLN A 1 569 ? 92.380  138.626 -6.846  1.00 17.51  ? 570 GLN S N   1 
ATOM   4471  C CA  . GLN A 1 569 ? 92.427  140.070 -6.761  1.00 17.51  ? 570 GLN S CA  1 
ATOM   4472  C C   . GLN A 1 569 ? 92.705  140.462 -5.300  1.00 17.51  ? 570 GLN S C   1 
ATOM   4473  O O   . GLN A 1 569 ? 92.203  139.824 -4.361  1.00 95.29  ? 570 GLN S O   1 
ATOM   4474  C CB  . GLN A 1 569 ? 91.097  140.662 -7.225  1.00 95.29  ? 570 GLN S CB  1 
ATOM   4475  C CG  . GLN A 1 569 ? 91.094  142.188 -7.257  1.00 95.29  ? 570 GLN S CG  1 
ATOM   4476  C CD  . GLN A 1 569 ? 89.884  142.786 -6.547  1.00 95.29  ? 570 GLN S CD  1 
ATOM   4477  O OE1 . GLN A 1 569 ? 88.756  142.357 -6.786  1.00 95.29  ? 570 GLN S OE1 1 
ATOM   4478  N NE2 . GLN A 1 569 ? 90.050  143.763 -5.675  1.00 95.29  ? 570 GLN S NE2 1 
ATOM   4479  N N   . LYS A 1 570 ? 93.513  141.500 -5.129  1.00 72.74  ? 571 LYS S N   1 
ATOM   4480  C CA  . LYS A 1 570 ? 93.892  141.994 -3.786  1.00 72.74  ? 571 LYS S CA  1 
ATOM   4481  C C   . LYS A 1 570 ? 92.830  142.976 -3.265  1.00 72.74  ? 571 LYS S C   1 
ATOM   4482  O O   . LYS A 1 570 ? 92.167  143.669 -4.043  1.00 100.00 ? 571 LYS S O   1 
ATOM   4483  C CB  . LYS A 1 570 ? 95.266  142.664 -3.836  1.00 100.00 ? 571 LYS S CB  1 
ATOM   4484  C CG  . LYS A 1 570 ? 95.277  143.988 -4.595  1.00 100.00 ? 571 LYS S CG  1 
ATOM   4485  C CD  . LYS A 1 570 ? 96.669  144.621 -4.640  1.00 100.00 ? 571 LYS S CD  1 
ATOM   4486  C CE  . LYS A 1 570 ? 96.697  145.959 -5.374  1.00 100.00 ? 571 LYS S CE  1 
ATOM   4487  N NZ  . LYS A 1 570 ? 98.037  146.561 -5.414  1.00 100.00 ? 571 LYS S NZ  1 
ATOM   4488  N N   . SER A 1 571 ? 92.718  142.993 -1.944  1.00 79.06  ? 572 SER S N   1 
ATOM   4489  C CA  . SER A 1 571 ? 91.716  143.796 -1.210  1.00 79.06  ? 572 SER S CA  1 
ATOM   4490  C C   . SER A 1 571 ? 91.852  145.303 -1.481  1.00 79.06  ? 572 SER S C   1 
ATOM   4491  O O   . SER A 1 571 ? 92.584  145.734 -2.380  1.00 73.31  ? 572 SER S O   1 
ATOM   4492  C CB  . SER A 1 571 ? 91.860  143.567 0.297   1.00 73.31  ? 572 SER S CB  1 
ATOM   4493  O OG  . SER A 1 571 ? 92.813  144.467 0.842   1.00 73.31  ? 572 SER S OG  1 
ATOM   4494  N N   . LYS A 1 572 ? 91.112  146.055 -0.675  1.00 100.00 ? 573 LYS S N   1 
ATOM   4495  C CA  . LYS A 1 572 ? 91.084  147.524 -0.742  1.00 100.00 ? 573 LYS S CA  1 
ATOM   4496  C C   . LYS A 1 572 ? 92.132  148.104 0.202   1.00 100.00 ? 573 LYS S C   1 
ATOM   4497  O O   . LYS A 1 572 ? 91.811  148.854 1.132   1.00 100.00 ? 573 LYS S O   1 
ATOM   4498  C CB  . LYS A 1 572 ? 89.711  148.049 -0.310  1.00 100.00 ? 573 LYS S CB  1 
ATOM   4499  C CG  . LYS A 1 572 ? 88.606  147.750 -1.320  1.00 100.00 ? 573 LYS S CG  1 
ATOM   4500  C CD  . LYS A 1 572 ? 88.212  146.275 -1.350  1.00 100.00 ? 573 LYS S CD  1 
ATOM   4501  C CE  . LYS A 1 572 ? 88.184  145.698 -2.762  1.00 100.00 ? 573 LYS S CE  1 
ATOM   4502  N NZ  . LYS A 1 572 ? 87.153  144.668 -2.940  1.00 100.00 ? 573 LYS S NZ  1 
ATOM   4503  N N   . GLN A 1 573 ? 93.370  147.735 -0.063  1.00 95.22  ? 574 GLN S N   1 
ATOM   4504  C CA  . GLN A 1 573 ? 94.512  148.175 0.745   1.00 95.22  ? 574 GLN S CA  1 
ATOM   4505  C C   . GLN A 1 573 ? 94.160  148.072 2.231   1.00 95.22  ? 574 GLN S C   1 
ATOM   4506  O O   . GLN A 1 573 ? 94.346  149.021 3.004   1.00 100.00 ? 574 GLN S O   1 
ATOM   4507  C CB  . GLN A 1 573 ? 94.876  149.626 0.410   1.00 100.00 ? 574 GLN S CB  1 
ATOM   4508  C CG  . GLN A 1 573 ? 96.259  149.753 -0.232  1.00 100.00 ? 574 GLN S CG  1 
ATOM   4509  C CD  . GLN A 1 573 ? 96.755  151.198 -0.337  1.00 100.00 ? 574 GLN S CD  1 
ATOM   4510  O OE1 . GLN A 1 573 ? 96.764  151.921 0.659   1.00 100.00 ? 574 GLN S OE1 1 
ATOM   4511  N NE2 . GLN A 1 573 ? 97.177  151.664 -1.497  1.00 100.00 ? 574 GLN S NE2 1 
ATOM   4512  N N   . LEU A 1 574 ? 93.650  146.909 2.594   1.00 100.00 ? 575 LEU S N   1 
ATOM   4513  C CA  . LEU A 1 574 ? 93.271  146.629 3.982   1.00 100.00 ? 575 LEU S CA  1 
ATOM   4514  C C   . LEU A 1 574 ? 93.903  145.325 4.451   1.00 100.00 ? 575 LEU S C   1 
ATOM   4515  O O   . LEU A 1 574 ? 93.243  144.485 5.082   1.00 100.00 ? 575 LEU S O   1 
ATOM   4516  C CB  . LEU A 1 574 ? 91.755  146.548 4.120   1.00 100.00 ? 575 LEU S CB  1 
ATOM   4517  C CG  . LEU A 1 574 ? 91.179  147.749 4.871   1.00 100.00 ? 575 LEU S CG  1 
ATOM   4518  C CD1 . LEU A 1 574 ? 90.372  148.678 3.964   1.00 100.00 ? 575 LEU S CD1 1 
ATOM   4519  C CD2 . LEU A 1 574 ? 90.247  147.349 6.013   1.00 100.00 ? 575 LEU S CD2 1 
ATOM   4520  N N   . LYS A 1 575 ? 95.173  145.201 4.114   1.00 89.69  ? 576 LYS S N   1 
ATOM   4521  C CA  . LYS A 1 575 ? 95.975  144.060 4.540   1.00 89.69  ? 576 LYS S CA  1 
ATOM   4522  C C   . LYS A 1 575 ? 96.137  144.168 6.048   1.00 89.69  ? 576 LYS S C   1 
ATOM   4523  O O   . LYS A 1 575 ? 96.730  143.294 6.692   1.00 92.67  ? 576 LYS S O   1 
ATOM   4524  C CB  . LYS A 1 575 ? 97.339  144.069 3.851   1.00 92.67  ? 576 LYS S CB  1 
ATOM   4525  C CG  . LYS A 1 575 ? 97.632  145.374 3.114   1.00 92.67  ? 576 LYS S CG  1 
ATOM   4526  C CD  . LYS A 1 575 ? 97.783  146.567 4.055   1.00 92.67  ? 576 LYS S CD  1 
ATOM   4527  C CE  . LYS A 1 575 ? 97.185  147.854 3.483   1.00 92.67  ? 576 LYS S CE  1 
ATOM   4528  N NZ  . LYS A 1 575 ? 97.306  149.000 4.395   1.00 92.67  ? 576 LYS S NZ  1 
ATOM   4529  N N   . ASP A 1 576 ? 95.603  145.274 6.561   1.00 100.00 ? 577 ASP S N   1 
ATOM   4530  C CA  . ASP A 1 576 ? 95.581  145.522 8.003   1.00 100.00 ? 577 ASP S CA  1 
ATOM   4531  C C   . ASP A 1 576 ? 94.702  144.444 8.602   1.00 100.00 ? 577 ASP S C   1 
ATOM   4532  O O   . ASP A 1 576 ? 95.033  143.839 9.627   1.00 100.00 ? 577 ASP S O   1 
ATOM   4533  C CB  . ASP A 1 576 ? 95.034  146.919 8.311   1.00 100.00 ? 577 ASP S CB  1 
ATOM   4534  C CG  . ASP A 1 576 ? 93.904  147.352 7.382   1.00 100.00 ? 577 ASP S CG  1 
ATOM   4535  O OD1 . ASP A 1 576 ? 92.742  146.805 7.483   1.00 100.00 ? 577 ASP S OD1 1 
ATOM   4536  O OD2 . ASP A 1 576 ? 94.115  148.265 6.498   1.00 100.00 ? 577 ASP S OD2 1 
ATOM   4537  N N   . LYS A 1 577 ? 93.599  144.248 7.914   1.00 42.38  ? 578 LYS S N   1 
ATOM   4538  C CA  . LYS A 1 577 ? 92.668  143.175 8.219   1.00 42.38  ? 578 LYS S CA  1 
ATOM   4539  C C   . LYS A 1 577 ? 93.162  141.971 7.432   1.00 42.38  ? 578 LYS S C   1 
ATOM   4540  O O   . LYS A 1 577 ? 92.870  140.820 7.771   1.00 100.00 ? 578 LYS S O   1 
ATOM   4541  C CB  . LYS A 1 577 ? 91.252  143.564 7.773   1.00 100.00 ? 578 LYS S CB  1 
ATOM   4542  C CG  . LYS A 1 577 ? 90.458  144.316 8.844   1.00 100.00 ? 578 LYS S CG  1 
ATOM   4543  C CD  . LYS A 1 577 ? 89.016  143.818 8.981   1.00 100.00 ? 578 LYS S CD  1 
ATOM   4544  C CE  . LYS A 1 577 ? 88.600  143.599 10.437  1.00 100.00 ? 578 LYS S CE  1 
ATOM   4545  N NZ  . LYS A 1 577 ? 87.147  143.453 10.607  1.00 100.00 ? 578 LYS S NZ  1 
ATOM   4546  N N   . THR A 1 578 ? 93.922  142.330 6.406   1.00 100.00 ? 579 THR S N   1 
ATOM   4547  C CA  . THR A 1 578 ? 94.515  141.383 5.461   1.00 100.00 ? 579 THR S CA  1 
ATOM   4548  C C   . THR A 1 578 ? 93.411  140.520 4.867   1.00 100.00 ? 579 THR S C   1 
ATOM   4549  O O   . THR A 1 578 ? 93.055  139.470 5.412   1.00 32.34  ? 579 THR S O   1 
ATOM   4550  C CB  . THR A 1 578 ? 95.548  140.504 6.164   1.00 32.34  ? 579 THR S CB  1 
ATOM   4551  O OG1 . THR A 1 578 ? 95.475  140.692 7.568   1.00 32.34  ? 579 THR S OG1 1 
ATOM   4552  C CG2 . THR A 1 578 ? 96.982  140.821 5.725   1.00 32.34  ? 579 THR S CG2 1 
ATOM   4553  N N   . GLU A 1 579 ? 92.904  141.003 3.756   1.00 34.88  ? 580 GLU S N   1 
ATOM   4554  C CA  . GLU A 1 579 ? 91.811  140.350 3.037   1.00 34.88  ? 580 GLU S CA  1 
ATOM   4555  C C   . GLU A 1 579 ? 92.179  140.184 1.567   1.00 34.88  ? 580 GLU S C   1 
ATOM   4556  O O   . GLU A 1 579 ? 93.044  140.895 1.037   1.00 100.00 ? 580 GLU S O   1 
ATOM   4557  C CB  . GLU A 1 579 ? 90.565  141.227 3.136   1.00 100.00 ? 580 GLU S CB  1 
ATOM   4558  C CG  . GLU A 1 579 ? 90.908  142.703 3.357   1.00 100.00 ? 580 GLU S CG  1 
ATOM   4559  C CD  . GLU A 1 579 ? 89.678  143.576 3.588   1.00 100.00 ? 580 GLU S CD  1 
ATOM   4560  O OE1 . GLU A 1 579 ? 88.953  143.400 4.638   1.00 100.00 ? 580 GLU S OE1 1 
ATOM   4561  O OE2 . GLU A 1 579 ? 89.369  144.486 2.730   1.00 100.00 ? 580 GLU S OE2 1 
ATOM   4562  N N   . PHE A 1 580 ? 91.517  139.237 0.931   1.00 56.51  ? 581 PHE S N   1 
ATOM   4563  C CA  . PHE A 1 580 ? 91.733  138.992 -0.496  1.00 56.51  ? 581 PHE S CA  1 
ATOM   4564  C C   . PHE A 1 580 ? 90.406  138.774 -1.207  1.00 56.51  ? 581 PHE S C   1 
ATOM   4565  O O   . PHE A 1 580 ? 89.356  138.591 -0.572  1.00 16.61  ? 581 PHE S O   1 
ATOM   4566  C CB  . PHE A 1 580 ? 92.681  137.807 -0.726  1.00 16.61  ? 581 PHE S CB  1 
ATOM   4567  C CG  . PHE A 1 580 ? 92.283  136.513 -0.014  1.00 16.61  ? 581 PHE S CG  1 
ATOM   4568  C CD1 . PHE A 1 580 ? 92.248  136.459 1.382   1.00 16.61  ? 581 PHE S CD1 1 
ATOM   4569  C CD2 . PHE A 1 580 ? 91.972  135.375 -0.767  1.00 16.61  ? 581 PHE S CD2 1 
ATOM   4570  C CE1 . PHE A 1 580 ? 91.902  135.264 2.026   1.00 16.61  ? 581 PHE S CE1 1 
ATOM   4571  C CE2 . PHE A 1 580 ? 91.622  134.183 -0.125  1.00 16.61  ? 581 PHE S CE2 1 
ATOM   4572  C CZ  . PHE A 1 580 ? 91.589  134.127 1.272   1.00 16.61  ? 581 PHE S CZ  1 
ATOM   4573  N N   . CYS A 1 581 ? 90.456  138.828 -2.533  1.00 37.55  ? 582 CYS S N   1 
ATOM   4574  C CA  . CYS A 1 581 ? 89.273  138.638 -3.354  1.00 37.55  ? 582 CYS S CA  1 
ATOM   4575  C C   . CYS A 1 581 ? 89.498  137.517 -4.361  1.00 37.55  ? 582 CYS S C   1 
ATOM   4576  O O   . CYS A 1 581 ? 90.637  137.220 -4.730  1.00 32.94  ? 582 CYS S O   1 
ATOM   4577  C CB  . CYS A 1 581 ? 88.941  139.927 -4.103  1.00 32.94  ? 582 CYS S CB  1 
ATOM   4578  S SG  . CYS A 1 581 ? 88.505  141.279 -3.043  1.00 32.94  ? 582 CYS S SG  1 
ATOM   4579  N N   . ILE A 1 582 ? 88.404  136.898 -4.796  1.00 77.27  ? 583 ILE S N   1 
ATOM   4580  C CA  . ILE A 1 582 ? 88.440  135.826 -5.787  1.00 77.27  ? 583 ILE S CA  1 
ATOM   4581  C C   . ILE A 1 582 ? 87.173  135.950 -6.610  1.00 77.27  ? 583 ILE S C   1 
ATOM   4582  O O   . ILE A 1 582 ? 86.093  136.151 -6.057  1.00 96.53  ? 583 ILE S O   1 
ATOM   4583  C CB  . ILE A 1 582 ? 88.465  134.420 -5.143  1.00 96.53  ? 583 ILE S CB  1 
ATOM   4584  C CG1 . ILE A 1 582 ? 88.188  134.517 -3.645  1.00 96.53  ? 583 ILE S CG1 1 
ATOM   4585  C CG2 . ILE A 1 582 ? 89.809  133.754 -5.415  1.00 96.53  ? 583 ILE S CG2 1 
ATOM   4586  C CD1 . ILE A 1 582 ? 88.742  133.349 -2.828  1.00 96.53  ? 583 ILE S CD1 1 
ATOM   4587  N N   . LEU A 1 583 ? 87.306  135.839 -7.924  1.00 28.03  ? 584 LEU S N   1 
ATOM   4588  C CA  . LEU A 1 583 ? 86.156  135.950 -8.811  1.00 28.03  ? 584 LEU S CA  1 
ATOM   4589  C C   . LEU A 1 583 ? 85.341  134.659 -8.986  1.00 28.03  ? 584 LEU S C   1 
ATOM   4590  O O   . LEU A 1 583 ? 85.574  133.879 -9.920  1.00 11.60  ? 584 LEU S O   1 
ATOM   4591  C CB  . LEU A 1 583 ? 86.613  136.451 -10.175 1.00 11.60  ? 584 LEU S CB  1 
ATOM   4592  C CG  . LEU A 1 583 ? 87.621  137.590 -10.116 1.00 11.60  ? 584 LEU S CG  1 
ATOM   4593  C CD1 . LEU A 1 583 ? 87.646  138.311 -11.460 1.00 11.60  ? 584 LEU S CD1 1 
ATOM   4594  C CD2 . LEU A 1 583 ? 87.239  138.551 -9.000  1.00 11.60  ? 584 LEU S CD2 1 
ATOM   4595  N N   . HIS A 1 584 ? 84.380  134.440 -8.093  1.00 15.69  ? 585 HIS S N   1 
ATOM   4596  C CA  . HIS A 1 584 ? 83.543  133.262 -8.178  1.00 15.69  ? 585 HIS S CA  1 
ATOM   4597  C C   . HIS A 1 584 ? 82.684  133.333 -9.421  1.00 15.69  ? 585 HIS S C   1 
ATOM   4598  O O   . HIS A 1 584 ? 82.933  134.166 -10.292 1.00 16.94  ? 585 HIS S O   1 
ATOM   4599  C CB  . HIS A 1 584 ? 82.682  133.181 -6.948  1.00 16.94  ? 585 HIS S CB  1 
ATOM   4600  C CG  . HIS A 1 584 ? 83.452  132.804 -5.737  1.00 16.94  ? 585 HIS S CG  1 
ATOM   4601  N ND1 . HIS A 1 584 ? 84.615  132.072 -5.813  1.00 16.94  ? 585 HIS S ND1 1 
ATOM   4602  C CD2 . HIS A 1 584 ? 83.252  133.064 -4.426  1.00 16.94  ? 585 HIS S CD2 1 
ATOM   4603  C CE1 . HIS A 1 584 ? 85.098  131.894 -4.599  1.00 16.94  ? 585 HIS S CE1 1 
ATOM   4604  N NE2 . HIS A 1 584 ? 84.291  132.486 -3.739  1.00 16.94  ? 585 HIS S NE2 1 
ATOM   4605  N N   . TYR A 1 585 ? 81.689  132.459 -9.525  1.00 2.00   ? 586 TYR S N   1 
ATOM   4606  C CA  . TYR A 1 585 ? 80.808  132.479 -10.688 1.00 2.00   ? 586 TYR S CA  1 
ATOM   4607  C C   . TYR A 1 585 ? 79.670  133.416 -10.339 1.00 2.00   ? 586 TYR S C   1 
ATOM   4608  O O   . TYR A 1 585 ? 79.157  134.145 -11.196 1.00 8.79   ? 586 TYR S O   1 
ATOM   4609  C CB  . TYR A 1 585 ? 80.269  131.080 -10.991 1.00 8.79   ? 586 TYR S CB  1 
ATOM   4610  C CG  . TYR A 1 585 ? 79.340  130.549 -9.944  1.00 8.79   ? 586 TYR S CG  1 
ATOM   4611  C CD1 . TYR A 1 585 ? 79.632  130.684 -8.599  1.00 8.79   ? 586 TYR S CD1 1 
ATOM   4612  C CD2 . TYR A 1 585 ? 78.141  129.958 -10.293 1.00 8.79   ? 586 TYR S CD2 1 
ATOM   4613  C CE1 . TYR A 1 585 ? 78.754  130.257 -7.625  1.00 8.79   ? 586 TYR S CE1 1 
ATOM   4614  C CE2 . TYR A 1 585 ? 77.252  129.521 -9.326  1.00 8.79   ? 586 TYR S CE2 1 
ATOM   4615  C CZ  . TYR A 1 585 ? 77.560  129.677 -7.997  1.00 8.79   ? 586 TYR S CZ  1 
ATOM   4616  O OH  . TYR A 1 585 ? 76.647  129.268 -7.050  1.00 8.79   ? 586 TYR S OH  1 
ATOM   4617  N N   . ALA A 1 586 ? 79.298  133.405 -9.063  1.00 11.11  ? 587 ALA S N   1 
ATOM   4618  C CA  . ALA A 1 586 ? 78.216  134.237 -8.571  1.00 11.11  ? 587 ALA S CA  1 
ATOM   4619  C C   . ALA A 1 586 ? 78.721  135.641 -8.297  1.00 11.11  ? 587 ALA S C   1 
ATOM   4620  O O   . ALA A 1 586 ? 77.955  136.489 -7.849  1.00 55.38  ? 587 ALA S O   1 
ATOM   4621  C CB  . ALA A 1 586 ? 77.626  133.634 -7.310  1.00 55.38  ? 587 ALA S CB  1 
ATOM   4622  N N   . GLY A 1 587 ? 80.008  135.884 -8.552  1.00 42.47  ? 588 GLY S N   1 
ATOM   4623  C CA  . GLY A 1 587 ? 80.569  137.212 -8.336  1.00 42.47  ? 588 GLY S CA  1 
ATOM   4624  C C   . GLY A 1 587 ? 81.763  137.315 -7.402  1.00 42.47  ? 588 GLY S C   1 
ATOM   4625  O O   . GLY A 1 587 ? 82.190  136.318 -6.803  1.00 54.24  ? 588 GLY S O   1 
ATOM   4626  N N   . LYS A 1 588 ? 82.292  138.536 -7.270  1.00 57.26  ? 589 LYS S N   1 
ATOM   4627  C CA  . LYS A 1 588 ? 83.454  138.799 -6.419  1.00 57.26  ? 589 LYS S CA  1 
ATOM   4628  C C   . LYS A 1 588 ? 83.144  138.833 -4.933  1.00 57.26  ? 589 LYS S C   1 
ATOM   4629  O O   . LYS A 1 588 ? 82.041  139.192 -4.521  1.00 75.17  ? 589 LYS S O   1 
ATOM   4630  C CB  . LYS A 1 588 ? 84.130  140.113 -6.819  1.00 75.17  ? 589 LYS S CB  1 
ATOM   4631  C CG  . LYS A 1 588 ? 85.549  140.260 -6.280  1.00 75.17  ? 589 LYS S CG  1 
ATOM   4632  C CD  . LYS A 1 588 ? 85.701  141.534 -5.462  1.00 75.17  ? 589 LYS S CD  1 
ATOM   4633  C CE  . LYS A 1 588 ? 85.852  142.754 -6.365  1.00 75.17  ? 589 LYS S CE  1 
ATOM   4634  N NZ  . LYS A 1 588 ? 85.474  144.026 -5.688  1.00 75.17  ? 589 LYS S NZ  1 
ATOM   4635  N N   . VAL A 1 589 ? 84.141  138.461 -4.136  1.00 47.13  ? 590 VAL S N   1 
ATOM   4636  C CA  . VAL A 1 589 ? 84.006  138.416 -2.688  1.00 47.13  ? 590 VAL S CA  1 
ATOM   4637  C C   . VAL A 1 589 ? 85.313  138.783 -1.992  1.00 47.13  ? 590 VAL S C   1 
ATOM   4638  O O   . VAL A 1 589 ? 86.377  138.335 -2.394  1.00 24.51  ? 590 VAL S O   1 
ATOM   4639  C CB  . VAL A 1 589 ? 83.610  137.005 -2.222  1.00 24.51  ? 590 VAL S CB  1 
ATOM   4640  C CG1 . VAL A 1 589 ? 83.292  137.022 -0.738  1.00 24.51  ? 590 VAL S CG1 1 
ATOM   4641  C CG2 . VAL A 1 589 ? 82.418  136.488 -3.032  1.00 24.51  ? 590 VAL S CG2 1 
ATOM   4642  N N   . THR A 1 590 ? 85.233  139.590 -0.942  1.00 54.40  ? 591 THR S N   1 
ATOM   4643  C CA  . THR A 1 590 ? 86.427  139.985 -0.196  1.00 54.40  ? 591 THR S CA  1 
ATOM   4644  C C   . THR A 1 590 ? 86.465  139.207 1.125   1.00 54.40  ? 591 THR S C   1 
ATOM   4645  O O   . THR A 1 590 ? 85.753  139.522 2.088   1.00 77.05  ? 591 THR S O   1 
ATOM   4646  C CB  . THR A 1 590 ? 86.442  141.513 0.085   1.00 77.05  ? 591 THR S CB  1 
ATOM   4647  O OG1 . THR A 1 590 ? 85.608  142.190 -0.867  1.00 77.05  ? 591 THR S OG1 1 
ATOM   4648  C CG2 . THR A 1 590 ? 87.853  142.058 -0.024  1.00 77.05  ? 591 THR S CG2 1 
ATOM   4649  N N   . TYR A 1 591 ? 87.299  138.176 1.152   1.00 24.23  ? 592 TYR S N   1 
ATOM   4650  C CA  . TYR A 1 591 ? 87.427  137.335 2.330   1.00 24.23  ? 592 TYR S CA  1 
ATOM   4651  C C   . TYR A 1 591 ? 88.418  137.923 3.323   1.00 24.23  ? 592 TYR S C   1 
ATOM   4652  O O   . TYR A 1 591 ? 89.378  138.582 2.924   1.00 47.25  ? 592 TYR S O   1 
ATOM   4653  C CB  . TYR A 1 591 ? 87.899  135.943 1.922   1.00 47.25  ? 592 TYR S CB  1 
ATOM   4654  C CG  . TYR A 1 591 ? 86.902  135.150 1.110   1.00 47.25  ? 592 TYR S CG  1 
ATOM   4655  C CD1 . TYR A 1 591 ? 85.930  134.365 1.730   1.00 47.25  ? 592 TYR S CD1 1 
ATOM   4656  C CD2 . TYR A 1 591 ? 86.953  135.143 -0.277  1.00 47.25  ? 592 TYR S CD2 1 
ATOM   4657  C CE1 . TYR A 1 591 ? 85.036  133.584 0.982   1.00 47.25  ? 592 TYR S CE1 1 
ATOM   4658  C CE2 . TYR A 1 591 ? 86.065  134.365 -1.034  1.00 47.25  ? 592 TYR S CE2 1 
ATOM   4659  C CZ  . TYR A 1 591 ? 85.114  133.589 -0.398  1.00 47.25  ? 592 TYR S CZ  1 
ATOM   4660  O OH  . TYR A 1 591 ? 84.246  132.815 -1.133  1.00 47.25  ? 592 TYR S OH  1 
ATOM   4661  N N   . ASN A 1 592 ? 88.181  137.673 4.613   1.00 83.46  ? 593 ASN S N   1 
ATOM   4662  C CA  . ASN A 1 592 ? 89.056  138.154 5.691   1.00 83.46  ? 593 ASN S CA  1 
ATOM   4663  C C   . ASN A 1 592 ? 89.848  136.971 6.252   1.00 83.46  ? 593 ASN S C   1 
ATOM   4664  O O   . ASN A 1 592 ? 89.386  136.247 7.136   1.00 60.31  ? 593 ASN S O   1 
ATOM   4665  C CB  . ASN A 1 592 ? 88.222  138.803 6.805   1.00 60.31  ? 593 ASN S CB  1 
ATOM   4666  C CG  . ASN A 1 592 ? 89.073  139.362 7.930   1.00 60.31  ? 593 ASN S CG  1 
ATOM   4667  O OD1 . ASN A 1 592 ? 88.706  139.285 9.107   1.00 60.31  ? 593 ASN S OD1 1 
ATOM   4668  N ND2 . ASN A 1 592 ? 90.216  139.924 7.577   1.00 60.31  ? 593 ASN S ND2 1 
ATOM   4669  N N   . ALA A 1 593 ? 91.051  136.795 5.716   1.00 81.42  ? 594 ALA S N   1 
ATOM   4670  C CA  . ALA A 1 593 ? 91.944  135.701 6.086   1.00 81.42  ? 594 ALA S CA  1 
ATOM   4671  C C   . ALA A 1 593 ? 92.232  135.589 7.571   1.00 81.42  ? 594 ALA S C   1 
ATOM   4672  O O   . ALA A 1 593 ? 92.791  134.593 8.030   1.00 44.75  ? 594 ALA S O   1 
ATOM   4673  C CB  . ALA A 1 593 ? 93.252  135.832 5.319   1.00 44.75  ? 594 ALA S CB  1 
ATOM   4674  N N   . SER A 1 594 ? 91.855  136.609 8.327   1.00 47.27  ? 595 SER S N   1 
ATOM   4675  C CA  . SER A 1 594 ? 92.087  136.591 9.768   1.00 47.27  ? 595 SER S CA  1 
ATOM   4676  C C   . SER A 1 594 ? 91.651  135.299 10.463  1.00 47.27  ? 595 SER S C   1 
ATOM   4677  O O   . SER A 1 594 ? 90.690  134.650 10.059  1.00 78.56  ? 595 SER S O   1 
ATOM   4678  C CB  . SER A 1 594 ? 91.377  137.771 10.431  1.00 78.56  ? 595 SER S CB  1 
ATOM   4679  O OG  . SER A 1 594 ? 90.842  137.383 11.685  1.00 78.56  ? 595 SER S OG  1 
ATOM   4680  N N   . ALA A 1 595 ? 92.382  134.935 11.511  1.00 70.44  ? 596 ALA S N   1 
ATOM   4681  C CA  . ALA A 1 595 ? 92.083  133.746 12.303  1.00 70.44  ? 596 ALA S CA  1 
ATOM   4682  C C   . ALA A 1 595 ? 91.910  132.450 11.502  1.00 70.44  ? 596 ALA S C   1 
ATOM   4683  O O   . ALA A 1 595 ? 91.426  131.438 12.026  1.00 4.47   ? 596 ALA S O   1 
ATOM   4684  C CB  . ALA A 1 595 ? 90.801  133.979 13.100  1.00 4.47   ? 596 ALA S CB  1 
ATOM   4685  N N   . TRP A 1 596 ? 92.329  132.454 10.259  1.00 19.15  ? 597 TRP S N   1 
ATOM   4686  C CA  . TRP A 1 596 ? 92.146  131.275 9.388   1.00 19.15  ? 597 TRP S CA  1 
ATOM   4687  C C   . TRP A 1 596 ? 93.016  130.081 9.811   1.00 19.15  ? 597 TRP S C   1 
ATOM   4688  O O   . TRP A 1 596 ? 92.574  128.924 9.777   1.00 34.54  ? 597 TRP S O   1 
ATOM   4689  C CB  . TRP A 1 596 ? 92.467  131.623 7.946   1.00 34.54  ? 597 TRP S CB  1 
ATOM   4690  C CG  . TRP A 1 596 ? 91.262  132.223 7.236   1.00 34.54  ? 597 TRP S CG  1 
ATOM   4691  C CD1 . TRP A 1 596 ? 90.257  132.901 7.805   1.00 34.54  ? 597 TRP S CD1 1 
ATOM   4692  C CD2 . TRP A 1 596 ? 91.013  132.153 5.846   1.00 34.54  ? 597 TRP S CD2 1 
ATOM   4693  N NE1 . TRP A 1 596 ? 89.363  133.280 6.759   1.00 34.54  ? 597 TRP S NE1 1 
ATOM   4694  C CE2 . TRP A 1 596 ? 89.826  132.837 5.617   1.00 34.54  ? 597 TRP S CE2 1 
ATOM   4695  C CE3 . TRP A 1 596 ? 91.692  131.581 4.764   1.00 34.54  ? 597 TRP S CE3 1 
ATOM   4696  C CZ2 . TRP A 1 596 ? 89.273  133.000 4.343   1.00 34.54  ? 597 TRP S CZ2 1 
ATOM   4697  C CZ3 . TRP A 1 596 ? 91.123  131.743 3.485   1.00 34.54  ? 597 TRP S CZ3 1 
ATOM   4698  C CH2 . TRP A 1 596 ? 89.971  132.421 3.286   1.00 34.54  ? 597 TRP S CH2 1 
ATOM   4699  N N   . LEU A 1 597 ? 94.242  130.353 10.200  1.00 67.08  ? 598 LEU S N   1 
ATOM   4700  C CA  . LEU A 1 597 ? 95.175  129.283 10.601  1.00 67.08  ? 598 LEU S CA  1 
ATOM   4701  C C   . LEU A 1 597 ? 94.650  128.537 11.839  1.00 67.08  ? 598 LEU S C   1 
ATOM   4702  O O   . LEU A 1 597 ? 94.807  127.316 11.966  1.00 29.20  ? 598 LEU S O   1 
ATOM   4703  C CB  . LEU A 1 597 ? 96.553  129.856 10.921  1.00 29.20  ? 598 LEU S CB  1 
ATOM   4704  C CG  . LEU A 1 597 ? 97.244  130.491 9.712   1.00 29.20  ? 598 LEU S CG  1 
ATOM   4705  C CD1 . LEU A 1 597 ? 98.662  130.976 10.031  1.00 29.20  ? 598 LEU S CD1 1 
ATOM   4706  C CD2 . LEU A 1 597 ? 97.384  129.537 8.523   1.00 29.20  ? 598 LEU S CD2 1 
ATOM   4707  N N   . THR A 1 598 ? 94.031  129.286 12.743  1.00 44.62  ? 599 THR S N   1 
ATOM   4708  C CA  . THR A 1 598 ? 93.484  128.711 13.988  1.00 44.62  ? 599 THR S CA  1 
ATOM   4709  C C   . THR A 1 598 ? 92.361  127.745 13.670  1.00 44.62  ? 599 THR S C   1 
ATOM   4710  O O   . THR A 1 598 ? 92.403  126.580 14.067  1.00 51.40  ? 599 THR S O   1 
ATOM   4711  C CB  . THR A 1 598 ? 92.928  129.796 14.911  1.00 51.40  ? 599 THR S CB  1 
ATOM   4712  O OG1 . THR A 1 598 ? 93.253  131.080 14.412  1.00 51.40  ? 599 THR S OG1 1 
ATOM   4713  C CG2 . THR A 1 598 ? 93.483  129.697 16.335  1.00 51.40  ? 599 THR S CG2 1 
ATOM   4714  N N   . LYS A 1 599 ? 91.355  128.249 12.958  1.00 97.48  ? 600 LYS S N   1 
ATOM   4715  C CA  . LYS A 1 599 ? 90.197  127.458 12.563  1.00 97.48  ? 600 LYS S CA  1 
ATOM   4716  C C   . LYS A 1 599 ? 90.661  126.257 11.757  1.00 97.48  ? 600 LYS S C   1 
ATOM   4717  O O   . LYS A 1 599 ? 90.250  125.122 12.018  1.00 91.67  ? 600 LYS S O   1 
ATOM   4718  C CB  . LYS A 1 599 ? 89.237  128.310 11.722  1.00 91.67  ? 600 LYS S CB  1 
ATOM   4719  C CG  . LYS A 1 599 ? 88.135  129.009 12.519  1.00 91.67  ? 600 LYS S CG  1 
ATOM   4720  C CD  . LYS A 1 599 ? 87.678  130.308 11.850  1.00 91.67  ? 600 LYS S CD  1 
ATOM   4721  C CE  . LYS A 1 599 ? 86.806  131.150 12.786  1.00 91.67  ? 600 LYS S CE  1 
ATOM   4722  N NZ  . LYS A 1 599 ? 86.310  132.416 12.166  1.00 91.67  ? 600 LYS S NZ  1 
ATOM   4723  N N   . ASN A 1 600 ? 91.524  126.517 10.783  1.00 40.32  ? 601 ASN S N   1 
ATOM   4724  C CA  . ASN A 1 600 ? 92.050  125.469 9.924   1.00 40.32  ? 601 ASN S CA  1 
ATOM   4725  C C   . ASN A 1 600 ? 92.777  124.363 10.701  1.00 40.32  ? 601 ASN S C   1 
ATOM   4726  O O   . ASN A 1 600 ? 93.006  123.279 10.164  1.00 34.48  ? 601 ASN S O   1 
ATOM   4727  C CB  . ASN A 1 600 ? 92.988  126.085 8.881   1.00 34.48  ? 601 ASN S CB  1 
ATOM   4728  C CG  . ASN A 1 600 ? 93.101  125.234 7.619   1.00 34.48  ? 601 ASN S CG  1 
ATOM   4729  O OD1 . ASN A 1 600 ? 93.058  124.002 7.682   1.00 34.48  ? 601 ASN S OD1 1 
ATOM   4730  N ND2 . ASN A 1 600 ? 93.246  125.887 6.467   1.00 34.48  ? 601 ASN S ND2 1 
ATOM   4731  N N   . MET A 1 601 ? 93.121  124.634 11.963  1.00 36.76  ? 602 MET S N   1 
ATOM   4732  C CA  . MET A 1 601 ? 93.830  123.671 12.813  1.00 36.76  ? 602 MET S CA  1 
ATOM   4733  C C   . MET A 1 601 ? 92.914  123.020 13.837  1.00 36.76  ? 602 MET S C   1 
ATOM   4734  O O   . MET A 1 601 ? 93.071  121.847 14.172  1.00 97.00  ? 602 MET S O   1 
ATOM   4735  C CB  . MET A 1 601 ? 94.976  124.365 13.544  1.00 97.00  ? 602 MET S CB  1 
ATOM   4736  C CG  . MET A 1 601 ? 95.996  123.400 14.106  1.00 97.00  ? 602 MET S CG  1 
ATOM   4737  S SD  . MET A 1 601 ? 97.398  123.221 13.009  1.00 97.00  ? 602 MET S SD  1 
ATOM   4738  C CE  . MET A 1 601 ? 98.397  124.664 13.531  1.00 97.00  ? 602 MET S CE  1 
ATOM   4739  N N   . ASP A 1 602 ? 91.960  123.800 14.332  1.00 49.77  ? 603 ASP S N   1 
ATOM   4740  C CA  . ASP A 1 602 ? 90.992  123.332 15.315  1.00 49.77  ? 603 ASP S CA  1 
ATOM   4741  C C   . ASP A 1 602 ? 91.680  122.691 16.505  1.00 49.77  ? 603 ASP S C   1 
ATOM   4742  O O   . ASP A 1 602 ? 91.645  121.469 16.688  1.00 100.00 ? 603 ASP S O   1 
ATOM   4743  C CB  . ASP A 1 602 ? 90.017  122.334 14.678  1.00 100.00 ? 603 ASP S CB  1 
ATOM   4744  C CG  . ASP A 1 602 ? 88.567  122.576 15.100  1.00 100.00 ? 603 ASP S CG  1 
ATOM   4745  O OD1 . ASP A 1 602 ? 87.957  123.567 14.625  1.00 100.00 ? 603 ASP S OD1 1 
ATOM   4746  O OD2 . ASP A 1 602 ? 88.040  121.770 15.905  1.00 100.00 ? 603 ASP S OD2 1 
ATOM   4747  N N   . PRO A 1 603 ? 92.319  123.521 17.332  1.00 23.95  ? 604 PRO S N   1 
ATOM   4748  C CA  . PRO A 1 603 ? 93.033  123.073 18.529  1.00 23.95  ? 604 PRO S CA  1 
ATOM   4749  C C   . PRO A 1 603 ? 92.148  123.199 19.764  1.00 23.95  ? 604 PRO S C   1 
ATOM   4750  O O   . PRO A 1 603 ? 91.098  123.843 19.713  1.00 82.24  ? 604 PRO S O   1 
ATOM   4751  C CB  . PRO A 1 603 ? 94.217  124.030 18.588  1.00 82.24  ? 604 PRO S CB  1 
ATOM   4752  C CG  . PRO A 1 603 ? 93.696  125.322 17.897  1.00 82.24  ? 604 PRO S CG  1 
ATOM   4753  C CD  . PRO A 1 603 ? 92.421  124.980 17.163  1.00 82.24  ? 604 PRO S CD  1 
ATOM   4754  N N   . LEU A 1 604 ? 92.585  122.583 20.892  1.00 55.96  ? 605 LEU S N   1 
ATOM   4755  C CA  . LEU A 1 604 ? 91.772  122.717 22.103  1.00 55.96  ? 605 LEU S CA  1 
ATOM   4756  C C   . LEU A 1 604 ? 92.390  121.942 23.266  1.00 55.96  ? 605 LEU S C   1 
ATOM   4757  O O   . LEU A 1 604 ? 92.976  120.879 23.155  1.00 12.23  ? 605 LEU S O   1 
ATOM   4758  C CB  . LEU A 1 604 ? 90.346  122.229 21.834  1.00 12.23  ? 605 LEU S CB  1 
ATOM   4759  C CG  . LEU A 1 604 ? 89.369  122.292 23.009  1.00 12.23  ? 605 LEU S CG  1 
ATOM   4760  C CD1 . LEU A 1 604 ? 89.011  123.734 23.329  1.00 12.23  ? 605 LEU S CD1 1 
ATOM   4761  C CD2 . LEU A 1 604 ? 88.117  121.482 22.711  1.00 12.23  ? 605 LEU S CD2 1 
ATOM   4762  N N   . ASN A 1 605 ? 92.160  122.513 24.476  1.00 24.03  ? 606 ASN S N   1 
ATOM   4763  C CA  . ASN A 1 605 ? 92.632  121.966 25.741  1.00 24.03  ? 606 ASN S CA  1 
ATOM   4764  C C   . ASN A 1 605 ? 92.244  120.524 26.019  1.00 24.03  ? 606 ASN S C   1 
ATOM   4765  O O   . ASN A 1 605 ? 91.188  120.228 26.572  1.00 83.73  ? 606 ASN S O   1 
ATOM   4766  C CB  . ASN A 1 605 ? 92.153  122.851 26.886  1.00 83.73  ? 606 ASN S CB  1 
ATOM   4767  C CG  . ASN A 1 605 ? 92.499  122.282 28.239  1.00 83.73  ? 606 ASN S CG  1 
ATOM   4768  O OD1 . ASN A 1 605 ? 92.099  121.165 28.568  1.00 83.73  ? 606 ASN S OD1 1 
ATOM   4769  N ND2 . ASN A 1 605 ? 93.248  123.044 29.031  1.00 83.73  ? 606 ASN S ND2 1 
ATOM   4770  N N   . ASP A 1 606 ? 93.137  119.629 25.639  1.00 3.94   ? 607 ASP S N   1 
ATOM   4771  C CA  . ASP A 1 606 ? 92.958  118.210 25.838  1.00 3.94   ? 607 ASP S CA  1 
ATOM   4772  C C   . ASP A 1 606 ? 92.812  117.910 27.330  1.00 3.94   ? 607 ASP S C   1 
ATOM   4773  O O   . ASP A 1 606 ? 92.212  116.914 27.714  1.00 100.00 ? 607 ASP S O   1 
ATOM   4774  C CB  . ASP A 1 606 ? 94.160  117.445 25.260  1.00 100.00 ? 607 ASP S CB  1 
ATOM   4775  C CG  . ASP A 1 606 ? 95.425  118.307 25.146  1.00 100.00 ? 607 ASP S CG  1 
ATOM   4776  O OD1 . ASP A 1 606 ? 95.332  119.512 24.829  1.00 100.00 ? 607 ASP S OD1 1 
ATOM   4777  O OD2 . ASP A 1 606 ? 96.530  117.775 25.373  1.00 100.00 ? 607 ASP S OD2 1 
ATOM   4778  N N   . ASN A 1 607 ? 93.374  118.776 28.166  1.00 72.16  ? 608 ASN S N   1 
ATOM   4779  C CA  . ASN A 1 607 ? 93.314  118.594 29.615  1.00 72.16  ? 608 ASN S CA  1 
ATOM   4780  C C   . ASN A 1 607 ? 91.869  118.346 30.023  1.00 72.16  ? 608 ASN S C   1 
ATOM   4781  O O   . ASN A 1 607 ? 91.537  117.343 30.656  1.00 95.35  ? 608 ASN S O   1 
ATOM   4782  C CB  . ASN A 1 607 ? 93.843  119.847 30.332  1.00 95.35  ? 608 ASN S CB  1 
ATOM   4783  C CG  . ASN A 1 607 ? 95.229  119.654 30.931  1.00 95.35  ? 608 ASN S CG  1 
ATOM   4784  O OD1 . ASN A 1 607 ? 96.222  119.536 30.210  1.00 95.35  ? 608 ASN S OD1 1 
ATOM   4785  N ND2 . ASN A 1 607 ? 95.299  119.629 32.257  1.00 95.35  ? 608 ASN S ND2 1 
ATOM   4786  N N   . VAL A 1 608 ? 91.007  119.276 29.641  1.00 30.81  ? 609 VAL S N   1 
ATOM   4787  C CA  . VAL A 1 608 ? 89.600  119.185 29.966  1.00 30.81  ? 609 VAL S CA  1 
ATOM   4788  C C   . VAL A 1 608 ? 88.972  118.171 29.009  1.00 30.81  ? 609 VAL S C   1 
ATOM   4789  O O   . VAL A 1 608 ? 88.029  117.478 29.361  1.00 2.00   ? 609 VAL S O   1 
ATOM   4790  C CB  . VAL A 1 608 ? 88.944  120.603 29.870  1.00 2.00   ? 609 VAL S CB  1 
ATOM   4791  C CG1 . VAL A 1 608 ? 89.184  121.188 28.512  1.00 2.00   ? 609 VAL S CG1 1 
ATOM   4792  C CG2 . VAL A 1 608 ? 87.466  120.535 30.223  1.00 2.00   ? 609 VAL S CG2 1 
ATOM   4793  N N   . THR A 1 609 ? 89.526  118.075 27.805  1.00 24.17  ? 610 THR S N   1 
ATOM   4794  C CA  . THR A 1 609 ? 89.041  117.118 26.816  1.00 24.17  ? 610 THR S CA  1 
ATOM   4795  C C   . THR A 1 609 ? 88.855  115.754 27.484  1.00 24.17  ? 610 THR S C   1 
ATOM   4796  O O   . THR A 1 609 ? 87.739  115.327 27.775  1.00 46.04  ? 610 THR S O   1 
ATOM   4797  C CB  . THR A 1 609 ? 90.056  116.972 25.643  1.00 46.04  ? 610 THR S CB  1 
ATOM   4798  O OG1 . THR A 1 609 ? 89.710  117.890 24.601  1.00 46.04  ? 610 THR S OG1 1 
ATOM   4799  C CG2 . THR A 1 609 ? 90.066  115.548 25.072  1.00 46.04  ? 610 THR S CG2 1 
ATOM   4800  N N   . SER A 1 610 ? 89.973  115.086 27.731  1.00 65.47  ? 611 SER S N   1 
ATOM   4801  C CA  . SER A 1 610 ? 89.999  113.773 28.359  1.00 65.47  ? 611 SER S CA  1 
ATOM   4802  C C   . SER A 1 610 ? 89.286  113.810 29.702  1.00 65.47  ? 611 SER S C   1 
ATOM   4803  O O   . SER A 1 610 ? 88.686  112.823 30.127  1.00 79.63  ? 611 SER S O   1 
ATOM   4804  C CB  . SER A 1 610 ? 91.454  113.337 28.549  1.00 79.63  ? 611 SER S CB  1 
ATOM   4805  O OG  . SER A 1 610 ? 92.358  114.351 28.109  1.00 79.63  ? 611 SER S OG  1 
ATOM   4806  N N   . LEU A 1 611 ? 89.368  114.957 30.368  1.00 85.85  ? 612 LEU S N   1 
ATOM   4807  C CA  . LEU A 1 611 ? 88.724  115.136 31.660  1.00 85.85  ? 612 LEU S CA  1 
ATOM   4808  C C   . LEU A 1 611 ? 87.289  114.608 31.541  1.00 85.85  ? 612 LEU S C   1 
ATOM   4809  O O   . LEU A 1 611 ? 86.779  113.904 32.428  1.00 75.98  ? 612 LEU S O   1 
ATOM   4810  C CB  . LEU A 1 611 ? 88.738  116.625 32.034  1.00 75.98  ? 612 LEU S CB  1 
ATOM   4811  C CG  . LEU A 1 611 ? 88.031  117.079 33.321  1.00 75.98  ? 612 LEU S CG  1 
ATOM   4812  C CD1 . LEU A 1 611 ? 89.055  117.260 34.428  1.00 75.98  ? 612 LEU S CD1 1 
ATOM   4813  C CD2 . LEU A 1 611 ? 87.278  118.380 33.067  1.00 75.98  ? 612 LEU S CD2 1 
ATOM   4814  N N   . LEU A 1 612 ? 86.650  114.942 30.423  1.00 71.11  ? 613 LEU S N   1 
ATOM   4815  C CA  . LEU A 1 612 ? 85.286  114.506 30.164  1.00 71.11  ? 613 LEU S CA  1 
ATOM   4816  C C   . LEU A 1 612 ? 85.313  113.064 29.694  1.00 71.11  ? 613 LEU S C   1 
ATOM   4817  O O   . LEU A 1 612 ? 84.501  112.247 30.124  1.00 5.75   ? 613 LEU S O   1 
ATOM   4818  C CB  . LEU A 1 612 ? 84.643  115.360 29.075  1.00 5.75   ? 613 LEU S CB  1 
ATOM   4819  C CG  . LEU A 1 612 ? 84.795  116.876 29.157  1.00 5.75   ? 613 LEU S CG  1 
ATOM   4820  C CD1 . LEU A 1 612 ? 85.351  117.426 27.859  1.00 5.75   ? 613 LEU S CD1 1 
ATOM   4821  C CD2 . LEU A 1 612 ? 83.436  117.499 29.461  1.00 5.75   ? 613 LEU S CD2 1 
ATOM   4822  N N   . ASN A 1 613 ? 86.250  112.757 28.806  1.00 46.05  ? 614 ASN S N   1 
ATOM   4823  C CA  . ASN A 1 613 ? 86.382  111.417 28.247  1.00 46.05  ? 614 ASN S CA  1 
ATOM   4824  C C   . ASN A 1 613 ? 86.008  110.286 29.203  1.00 46.05  ? 614 ASN S C   1 
ATOM   4825  O O   . ASN A 1 613 ? 85.710  109.173 28.769  1.00 84.25  ? 614 ASN S O   1 
ATOM   4826  C CB  . ASN A 1 613 ? 87.808  111.193 27.739  1.00 84.25  ? 614 ASN S CB  1 
ATOM   4827  C CG  . ASN A 1 613 ? 87.937  109.913 26.934  1.00 84.25  ? 614 ASN S CG  1 
ATOM   4828  O OD1 . ASN A 1 613 ? 88.479  108.916 27.415  1.00 84.25  ? 614 ASN S OD1 1 
ATOM   4829  N ND2 . ASN A 1 613 ? 87.444  109.937 25.698  1.00 84.25  ? 614 ASN S ND2 1 
ATOM   4830  N N   . GLN A 1 614 ? 86.036  110.568 30.501  1.00 65.61  ? 615 GLN S N   1 
ATOM   4831  C CA  . GLN A 1 614 ? 85.693  109.564 31.496  1.00 65.61  ? 615 GLN S CA  1 
ATOM   4832  C C   . GLN A 1 614 ? 84.719  110.127 32.515  1.00 65.61  ? 615 GLN S C   1 
ATOM   4833  O O   . GLN A 1 614 ? 84.526  109.550 33.580  1.00 100.00 ? 615 GLN S O   1 
ATOM   4834  C CB  . GLN A 1 614 ? 86.957  109.074 32.206  1.00 100.00 ? 615 GLN S CB  1 
ATOM   4835  C CG  . GLN A 1 614 ? 88.170  108.915 31.291  1.00 100.00 ? 615 GLN S CG  1 
ATOM   4836  C CD  . GLN A 1 614 ? 89.372  109.733 31.752  1.00 100.00 ? 615 GLN S CD  1 
ATOM   4837  O OE1 . GLN A 1 614 ? 90.352  109.185 32.255  1.00 100.00 ? 615 GLN S OE1 1 
ATOM   4838  N NE2 . GLN A 1 614 ? 89.296  111.053 31.585  1.00 100.00 ? 615 GLN S NE2 1 
ATOM   4839  N N   . SER A 1 615 ? 84.107  111.259 32.188  1.00 73.15  ? 616 SER S N   1 
ATOM   4840  C CA  . SER A 1 615 ? 83.141  111.900 33.070  1.00 73.15  ? 616 SER S CA  1 
ATOM   4841  C C   . SER A 1 615 ? 82.065  110.919 33.543  1.00 73.15  ? 616 SER S C   1 
ATOM   4842  O O   . SER A 1 615 ? 81.829  109.873 32.909  1.00 7.71   ? 616 SER S O   1 
ATOM   4843  C CB  . SER A 1 615 ? 82.461  113.058 32.350  1.00 7.71   ? 616 SER S CB  1 
ATOM   4844  O OG  . SER A 1 615 ? 81.078  112.790 32.177  1.00 7.71   ? 616 SER S OG  1 
ATOM   4845  N N   . SER A 1 616 ? 81.409  111.271 34.647  1.00 32.94  ? 617 SER S N   1 
ATOM   4846  C CA  . SER A 1 616 ? 80.364  110.436 35.222  1.00 32.94  ? 617 SER S CA  1 
ATOM   4847  C C   . SER A 1 616 ? 79.170  110.329 34.289  1.00 32.94  ? 617 SER S C   1 
ATOM   4848  O O   . SER A 1 616 ? 78.556  109.263 34.176  1.00 73.19  ? 617 SER S O   1 
ATOM   4849  C CB  . SER A 1 616 ? 79.905  111.006 36.558  1.00 73.19  ? 617 SER S CB  1 
ATOM   4850  O OG  . SER A 1 616 ? 78.507  111.242 36.556  1.00 73.19  ? 617 SER S OG  1 
ATOM   4851  N N   . ASP A 1 617 ? 78.844  111.445 33.633  1.00 100.00 ? 618 ASP S N   1 
ATOM   4852  C CA  . ASP A 1 617 ? 77.714  111.523 32.705  1.00 100.00 ? 618 ASP S CA  1 
ATOM   4853  C C   . ASP A 1 617 ? 77.939  110.741 31.409  1.00 100.00 ? 618 ASP S C   1 
ATOM   4854  O O   . ASP A 1 617 ? 78.627  111.206 30.497  1.00 100.00 ? 618 ASP S O   1 
ATOM   4855  C CB  . ASP A 1 617 ? 77.421  112.985 32.377  1.00 100.00 ? 618 ASP S CB  1 
ATOM   4856  C CG  . ASP A 1 617 ? 76.074  113.166 31.727  1.00 100.00 ? 618 ASP S CG  1 
ATOM   4857  O OD1 . ASP A 1 617 ? 75.546  112.169 31.191  1.00 100.00 ? 618 ASP S OD1 1 
ATOM   4858  O OD2 . ASP A 1 617 ? 75.546  114.301 31.753  1.00 100.00 ? 618 ASP S OD2 1 
ATOM   4859  N N   . LYS A 1 618 ? 77.323  109.564 31.330  1.00 30.98  ? 619 LYS S N   1 
ATOM   4860  C CA  . LYS A 1 618 ? 77.471  108.686 30.176  1.00 30.98  ? 619 LYS S CA  1 
ATOM   4861  C C   . LYS A 1 618 ? 77.249  109.378 28.850  1.00 30.98  ? 619 LYS S C   1 
ATOM   4862  O O   . LYS A 1 618 ? 78.060  109.259 27.939  1.00 100.00 ? 619 LYS S O   1 
ATOM   4863  C CB  . LYS A 1 618 ? 76.522  107.493 30.290  1.00 100.00 ? 619 LYS S CB  1 
ATOM   4864  C CG  . LYS A 1 618 ? 77.133  106.187 29.797  1.00 100.00 ? 619 LYS S CG  1 
ATOM   4865  C CD  . LYS A 1 618 ? 76.080  105.273 29.179  1.00 100.00 ? 619 LYS S CD  1 
ATOM   4866  C CE  . LYS A 1 618 ? 75.557  104.240 30.185  1.00 100.00 ? 619 LYS S CE  1 
ATOM   4867  N NZ  . LYS A 1 618 ? 74.069  104.059 30.104  1.00 100.00 ? 619 LYS S NZ  1 
ATOM   4868  N N   . PHE A 1 619 ? 76.137  110.096 28.730  1.00 70.62  ? 620 PHE S N   1 
ATOM   4869  C CA  . PHE A 1 619 ? 75.852  110.788 27.486  1.00 70.62  ? 620 PHE S CA  1 
ATOM   4870  C C   . PHE A 1 619 ? 77.075  111.590 27.075  1.00 70.62  ? 620 PHE S C   1 
ATOM   4871  O O   . PHE A 1 619 ? 77.528  111.483 25.937  1.00 59.03  ? 620 PHE S O   1 
ATOM   4872  C CB  . PHE A 1 619 ? 74.632  111.708 27.627  1.00 59.03  ? 620 PHE S CB  1 
ATOM   4873  C CG  . PHE A 1 619 ? 74.199  112.348 26.331  1.00 59.03  ? 620 PHE S CG  1 
ATOM   4874  C CD1 . PHE A 1 619 ? 74.186  111.609 25.153  1.00 59.03  ? 620 PHE S CD1 1 
ATOM   4875  C CD2 . PHE A 1 619 ? 73.844  113.695 26.281  1.00 59.03  ? 620 PHE S CD2 1 
ATOM   4876  C CE1 . PHE A 1 619 ? 73.835  112.201 23.942  1.00 59.03  ? 620 PHE S CE1 1 
ATOM   4877  C CE2 . PHE A 1 619 ? 73.489  114.293 25.073  1.00 59.03  ? 620 PHE S CE2 1 
ATOM   4878  C CZ  . PHE A 1 619 ? 73.487  113.547 23.904  1.00 59.03  ? 620 PHE S CZ  1 
ATOM   4879  N N   . VAL A 1 620 ? 77.619  112.380 28.002  1.00 16.89  ? 621 VAL S N   1 
ATOM   4880  C CA  . VAL A 1 620 ? 78.799  113.178 27.691  1.00 16.89  ? 621 VAL S CA  1 
ATOM   4881  C C   . VAL A 1 620 ? 79.957  112.232 27.515  1.00 16.89  ? 621 VAL S C   1 
ATOM   4882  O O   . VAL A 1 620 ? 80.938  112.550 26.832  1.00 23.23  ? 621 VAL S O   1 
ATOM   4883  C CB  . VAL A 1 620 ? 79.169  114.177 28.795  1.00 23.23  ? 621 VAL S CB  1 
ATOM   4884  C CG1 . VAL A 1 620 ? 79.884  115.370 28.173  1.00 23.23  ? 621 VAL S CG1 1 
ATOM   4885  C CG2 . VAL A 1 620 ? 77.920  114.643 29.538  1.00 23.23  ? 621 VAL S CG2 1 
ATOM   4886  N N   . ALA A 1 621 ? 79.821  111.056 28.121  1.00 38.06  ? 622 ALA S N   1 
ATOM   4887  C CA  . ALA A 1 621 ? 80.852  110.030 28.030  1.00 38.06  ? 622 ALA S CA  1 
ATOM   4888  C C   . ALA A 1 621 ? 81.006  109.565 26.592  1.00 38.06  ? 622 ALA S C   1 
ATOM   4889  O O   . ALA A 1 621 ? 82.050  109.752 25.969  1.00 37.95  ? 622 ALA S O   1 
ATOM   4890  C CB  . ALA A 1 621 ? 80.496  108.839 28.927  1.00 37.95  ? 622 ALA S CB  1 
ATOM   4891  N N   . ASP A 1 622 ? 79.943  108.960 26.080  1.00 72.48  ? 623 ASP S N   1 
ATOM   4892  C CA  . ASP A 1 622 ? 79.929  108.446 24.719  1.00 72.48  ? 623 ASP S CA  1 
ATOM   4893  C C   . ASP A 1 622 ? 80.118  109.572 23.709  1.00 72.48  ? 623 ASP S C   1 
ATOM   4894  O O   . ASP A 1 622 ? 80.692  109.375 22.633  1.00 100.00 ? 623 ASP S O   1 
ATOM   4895  C CB  . ASP A 1 622 ? 78.607  107.720 24.445  1.00 100.00 ? 623 ASP S CB  1 
ATOM   4896  C CG  . ASP A 1 622 ? 77.843  107.383 25.719  1.00 100.00 ? 623 ASP S CG  1 
ATOM   4897  O OD1 . ASP A 1 622 ? 78.482  107.117 26.767  1.00 100.00 ? 623 ASP S OD1 1 
ATOM   4898  O OD2 . ASP A 1 622 ? 76.590  107.381 25.664  1.00 100.00 ? 623 ASP S OD2 1 
ATOM   4899  N N   . LEU A 1 623 ? 79.624  110.752 24.060  1.00 7.83   ? 624 LEU S N   1 
ATOM   4900  C CA  . LEU A 1 623 ? 79.752  111.914 23.197  1.00 7.83   ? 624 LEU S CA  1 
ATOM   4901  C C   . LEU A 1 623 ? 81.230  112.092 22.909  1.00 7.83   ? 624 LEU S C   1 
ATOM   4902  O O   . LEU A 1 623 ? 81.667  112.101 21.757  1.00 31.11  ? 624 LEU S O   1 
ATOM   4903  C CB  . LEU A 1 623 ? 79.220  113.157 23.905  1.00 31.11  ? 624 LEU S CB  1 
ATOM   4904  C CG  . LEU A 1 623 ? 78.065  113.886 23.226  1.00 31.11  ? 624 LEU S CG  1 
ATOM   4905  C CD1 . LEU A 1 623 ? 76.895  114.039 24.196  1.00 31.11  ? 624 LEU S CD1 1 
ATOM   4906  C CD2 . LEU A 1 623 ? 78.552  115.238 22.746  1.00 31.11  ? 624 LEU S CD2 1 
ATOM   4907  N N   . TRP A 1 624 ? 81.999  112.198 23.985  1.00 38.89  ? 625 TRP S N   1 
ATOM   4908  C CA  . TRP A 1 624 ? 83.425  112.400 23.884  1.00 38.89  ? 625 TRP S CA  1 
ATOM   4909  C C   . TRP A 1 624 ? 84.251  111.090 23.776  1.00 38.89  ? 625 TRP S C   1 
ATOM   4910  O O   . TRP A 1 624 ? 85.398  111.097 23.306  1.00 2.00   ? 625 TRP S O   1 
ATOM   4911  C CB  . TRP A 1 624 ? 83.884  113.179 25.102  1.00 2.00   ? 625 TRP S CB  1 
ATOM   4912  C CG  . TRP A 1 624 ? 83.356  114.614 25.147  1.00 2.00   ? 625 TRP S CG  1 
ATOM   4913  C CD1 . TRP A 1 624 ? 82.280  115.059 25.809  1.00 2.00   ? 625 TRP S CD1 1 
ATOM   4914  C CD2 . TRP A 1 624 ? 83.945  115.719 24.481  1.00 2.00   ? 625 TRP S CD2 1 
ATOM   4915  N NE1 . TRP A 1 624 ? 82.185  116.466 25.564  1.00 2.00   ? 625 TRP S NE1 1 
ATOM   4916  C CE2 . TRP A 1 624 ? 83.174  116.833 24.784  1.00 2.00   ? 625 TRP S CE2 1 
ATOM   4917  C CE3 . TRP A 1 624 ? 85.063  115.866 23.652  1.00 2.00   ? 625 TRP S CE3 1 
ATOM   4918  C CZ2 . TRP A 1 624 ? 83.460  118.115 24.305  1.00 2.00   ? 625 TRP S CZ2 1 
ATOM   4919  C CZ3 . TRP A 1 624 ? 85.341  117.162 23.171  1.00 2.00   ? 625 TRP S CZ3 1 
ATOM   4920  C CH2 . TRP A 1 624 ? 84.579  118.233 23.484  1.00 2.00   ? 625 TRP S CH2 1 
ATOM   4921  N N   . LYS A 1 625 ? 83.656  110.004 24.209  1.00 33.28  ? 626 LYS S N   1 
ATOM   4922  C CA  . LYS A 1 625 ? 84.289  108.658 24.234  1.00 33.28  ? 626 LYS S CA  1 
ATOM   4923  C C   . LYS A 1 625 ? 85.470  108.503 23.230  1.00 33.28  ? 626 LYS S C   1 
ATOM   4924  O O   . LYS A 1 625 ? 86.353  107.647 23.401  1.00 95.85  ? 626 LYS S O   1 
ATOM   4925  C CB  . LYS A 1 625 ? 83.243  107.591 23.914  1.00 95.85  ? 626 LYS S CB  1 
ATOM   4926  C CG  . LYS A 1 625 ? 83.529  106.834 22.624  1.00 95.85  ? 626 LYS S CG  1 
ATOM   4927  C CD  . LYS A 1 625 ? 83.729  105.334 22.846  1.00 95.85  ? 626 LYS S CD  1 
ATOM   4928  C CE  . LYS A 1 625 ? 84.400  104.643 21.657  1.00 95.85  ? 626 LYS S CE  1 
ATOM   4929  N NZ  . LYS A 1 625 ? 84.835  103.273 21.961  1.00 95.85  ? 626 LYS S NZ  1 
ATOM   4930  N N   . ASP A 1 626 ? 85.489  109.321 22.188  1.00 13.75  ? 627 ASP S N   1 
ATOM   4931  C CA  . ASP A 1 626 ? 86.565  109.280 21.162  1.00 13.75  ? 627 ASP S CA  1 
ATOM   4932  C C   . ASP A 1 626 ? 87.265  110.640 21.082  1.00 13.75  ? 627 ASP S C   1 
ATOM   4933  O O   . ASP A 1 626 ? 86.823  111.545 20.358  1.00 100.00 ? 627 ASP S O   1 
ATOM   4934  C CB  . ASP A 1 626 ? 85.969  108.994 19.792  1.00 100.00 ? 627 ASP S CB  1 
ATOM   4935  C CG  . ASP A 1 626 ? 85.201  110.195 19.268  1.00 100.00 ? 627 ASP S CG  1 
ATOM   4936  O OD1 . ASP A 1 626 ? 84.746  111.067 20.101  1.00 100.00 ? 627 ASP S OD1 1 
ATOM   4937  O OD2 . ASP A 1 626 ? 85.010  110.337 18.008  1.00 100.00 ? 627 ASP S OD2 1 
ATOM   4938  N N   . VAL A 1 627 ? 88.355  110.740 21.825  1.00 64.60  ? 628 VAL S N   1 
ATOM   4939  C CA  . VAL A 1 627 ? 89.130  111.988 21.942  1.00 64.60  ? 628 VAL S CA  1 
ATOM   4940  C C   . VAL A 1 627 ? 90.577  111.836 21.455  1.00 64.60  ? 628 VAL S C   1 
ATOM   4941  O O   . VAL A 1 627 ? 91.414  112.727 21.642  1.00 52.79  ? 628 VAL S O   1 
ATOM   4942  C CB  . VAL A 1 627 ? 89.231  112.395 23.413  1.00 52.79  ? 628 VAL S CB  1 
ATOM   4943  C CG1 . VAL A 1 627 ? 90.588  113.011 23.771  1.00 52.79  ? 628 VAL S CG1 1 
ATOM   4944  C CG2 . VAL A 1 627 ? 88.184  113.425 23.829  1.00 52.79  ? 628 VAL S CG2 1 
ATOM   4945  N N   . ASP A 1 628 ? 90.860  110.727 20.823  1.00 98.97  ? 629 ASP S N   1 
ATOM   4946  C CA  . ASP A 1 628 ? 92.236  110.405 20.415  1.00 98.97  ? 629 ASP S CA  1 
ATOM   4947  C C   . ASP A 1 628 ? 92.861  111.419 19.428  1.00 98.97  ? 629 ASP S C   1 
ATOM   4948  O O   . ASP A 1 628 ? 94.082  111.452 19.233  1.00 100.00 ? 629 ASP S O   1 
ATOM   4949  C CB  . ASP A 1 628 ? 92.288  109.013 19.790  1.00 100.00 ? 629 ASP S CB  1 
ATOM   4950  C CG  . ASP A 1 628 ? 92.785  107.971 20.793  1.00 100.00 ? 629 ASP S CG  1 
ATOM   4951  O OD1 . ASP A 1 628 ? 92.811  108.256 22.053  1.00 100.00 ? 629 ASP S OD1 1 
ATOM   4952  O OD2 . ASP A 1 628 ? 93.181  106.816 20.386  1.00 100.00 ? 629 ASP S OD2 1 
ATOM   4953  N N   . ARG A 1 629 ? 92.060  112.272 18.808  1.00 34.21  ? 630 ARG S N   1 
ATOM   4954  C CA  . ARG A 1 629 ? 92.609  113.222 17.804  1.00 34.21  ? 630 ARG S CA  1 
ATOM   4955  C C   . ARG A 1 629 ? 92.845  114.640 18.370  1.00 34.21  ? 630 ARG S C   1 
ATOM   4956  O O   . ARG A 1 629 ? 93.458  115.497 17.718  1.00 100.00 ? 630 ARG S O   1 
ATOM   4957  C CB  . ARG A 1 629 ? 91.667  113.348 16.609  1.00 100.00 ? 630 ARG S CB  1 
ATOM   4958  C CG  . ARG A 1 629 ? 92.360  113.063 15.271  1.00 100.00 ? 630 ARG S CG  1 
ATOM   4959  C CD  . ARG A 1 629 ? 91.694  113.774 14.094  1.00 100.00 ? 630 ARG S CD  1 
ATOM   4960  N NE  . ARG A 1 629 ? 91.951  113.127 12.801  1.00 100.00 ? 630 ARG S NE  1 
ATOM   4961  C CZ  . ARG A 1 629 ? 92.313  113.790 11.695  1.00 100.00 ? 630 ARG S CZ  1 
ATOM   4962  N NH1 . ARG A 1 629 ? 92.468  115.121 11.713  1.00 100.00 ? 630 ARG S NH1 1 
ATOM   4963  N NH2 . ARG A 1 629 ? 92.544  113.207 10.512  1.00 100.00 ? 630 ARG S NH2 1 
ATOM   4964  N N   . ILE A 1 630 ? 92.366  114.895 19.573  1.00 54.21  ? 631 ILE S N   1 
ATOM   4965  C CA  . ILE A 1 630 ? 92.539  116.220 20.206  1.00 54.21  ? 631 ILE S CA  1 
ATOM   4966  C C   . ILE A 1 630 ? 93.990  116.695 20.007  1.00 54.21  ? 631 ILE S C   1 
ATOM   4967  O O   . ILE A 1 630 ? 94.892  115.894 19.726  1.00 100.00 ? 631 ILE S O   1 
ATOM   4968  C CB  . ILE A 1 630 ? 92.221  116.142 21.700  1.00 100.00 ? 631 ILE S CB  1 
ATOM   4969  C CG1 . ILE A 1 630 ? 90.978  115.301 22.001  1.00 100.00 ? 631 ILE S CG1 1 
ATOM   4970  C CG2 . ILE A 1 630 ? 91.953  117.513 22.326  1.00 100.00 ? 631 ILE S CG2 1 
ATOM   4971  C CD1 . ILE A 1 630 ? 89.696  115.892 21.412  1.00 100.00 ? 631 ILE S CD1 1 
ATOM   4972  N N   . VAL A 1 631 ? 94.185  118.001 20.159  1.00 86.44  ? 632 VAL S N   1 
ATOM   4973  C CA  . VAL A 1 631 ? 95.512  118.636 19.989  1.00 86.44  ? 632 VAL S CA  1 
ATOM   4974  C C   . VAL A 1 631 ? 96.047  119.153 21.329  1.00 86.44  ? 632 VAL S C   1 
ATOM   4975  O O   . VAL A 1 631 ? 95.373  119.911 22.024  1.00 100.00 ? 632 VAL S O   1 
ATOM   4976  C CB  . VAL A 1 631 ? 95.420  119.812 19.017  1.00 100.00 ? 632 VAL S CB  1 
ATOM   4977  C CG1 . VAL A 1 631 ? 96.694  120.659 18.984  1.00 100.00 ? 632 VAL S CG1 1 
ATOM   4978  C CG2 . VAL A 1 631 ? 95.180  119.373 17.570  1.00 100.00 ? 632 VAL S CG2 1 
ATOM   4979  N N   . GLY A 1 632 ? 97.259  118.726 21.683  1.00 74.55  ? 633 GLY S N   1 
ATOM   4980  C CA  . GLY A 1 632 ? 97.884  119.156 22.924  1.00 74.55  ? 633 GLY S CA  1 
ATOM   4981  C C   . GLY A 1 632 ? 99.373  119.357 22.712  1.00 74.55  ? 633 GLY S C   1 
ATOM   4982  O O   . GLY A 1 632 ? 100.195 118.563 23.181  1.00 32.99  ? 633 GLY S O   1 
ATOM   4983  N N   . LEU A 1 633 ? 99.724  120.431 22.000  1.00 100.00 ? 634 LEU S N   1 
ATOM   4984  C CA  . LEU A 1 633 ? 101.134 120.701 21.711  1.00 100.00 ? 634 LEU S CA  1 
ATOM   4985  C C   . LEU A 1 633 ? 101.307 122.079 21.077  1.00 100.00 ? 634 LEU S C   1 
ATOM   4986  O O   . LEU A 1 633 ? 102.193 122.835 21.557  1.00 100.00 ? 634 LEU S O   1 
ATOM   4987  C CB  . LEU A 1 633 ? 101.696 119.616 20.786  1.00 100.00 ? 634 LEU S CB  1 
ATOM   4988  C CG  . LEU A 1 633 ? 103.163 119.756 20.382  1.00 100.00 ? 634 LEU S CG  1 
ATOM   4989  C CD1 . LEU A 1 633 ? 104.057 118.997 21.351  1.00 100.00 ? 634 LEU S CD1 1 
ATOM   4990  C CD2 . LEU A 1 633 ? 103.377 119.266 18.959  1.00 100.00 ? 634 LEU S CD2 1 
ATOM   4991  N N   . PHE A 1 655 ? 96.941  116.441 13.523  1.00 67.22  ? 656 PHE S N   1 
ATOM   4992  C CA  . PHE A 1 655 ? 97.024  115.369 12.488  1.00 67.22  ? 656 PHE S CA  1 
ATOM   4993  C C   . PHE A 1 655 ? 96.618  115.885 11.105  1.00 67.22  ? 656 PHE S C   1 
ATOM   4994  O O   . PHE A 1 655 ? 97.446  116.429 10.369  1.00 100.00 ? 656 PHE S O   1 
ATOM   4995  C CB  . PHE A 1 655 ? 96.135  114.179 12.880  1.00 100.00 ? 656 PHE S CB  1 
ATOM   4996  C CG  . PHE A 1 655 ? 96.250  112.996 11.949  1.00 100.00 ? 656 PHE S CG  1 
ATOM   4997  C CD1 . PHE A 1 655 ? 97.475  112.663 11.366  1.00 100.00 ? 656 PHE S CD1 1 
ATOM   4998  C CD2 . PHE A 1 655 ? 95.131  112.222 11.649  1.00 100.00 ? 656 PHE S CD2 1 
ATOM   4999  C CE1 . PHE A 1 655 ? 97.586  111.573 10.495  1.00 100.00 ? 656 PHE S CE1 1 
ATOM   5000  C CE2 . PHE A 1 655 ? 95.226  111.128 10.782  1.00 100.00 ? 656 PHE S CE2 1 
ATOM   5001  C CZ  . PHE A 1 655 ? 96.460  110.803 10.202  1.00 100.00 ? 656 PHE S CZ  1 
ATOM   5002  N N   . ARG A 1 656 ? 95.348  115.712 10.750  1.00 77.57  ? 657 ARG S N   1 
ATOM   5003  C CA  . ARG A 1 656 ? 94.865  116.169 9.456   1.00 77.57  ? 657 ARG S CA  1 
ATOM   5004  C C   . ARG A 1 656 ? 94.196  117.535 9.525   1.00 77.57  ? 657 ARG S C   1 
ATOM   5005  O O   . ARG A 1 656 ? 93.508  117.866 10.492  1.00 100.00 ? 657 ARG S O   1 
ATOM   5006  C CB  . ARG A 1 656 ? 93.902  115.158 8.852   1.00 100.00 ? 657 ARG S CB  1 
ATOM   5007  C CG  . ARG A 1 656 ? 93.737  115.344 7.357   1.00 100.00 ? 657 ARG S CG  1 
ATOM   5008  C CD  . ARG A 1 656 ? 95.044  115.094 6.615   1.00 100.00 ? 657 ARG S CD  1 
ATOM   5009  N NE  . ARG A 1 656 ? 94.914  114.025 5.623   1.00 100.00 ? 657 ARG S NE  1 
ATOM   5010  C CZ  . ARG A 1 656 ? 94.456  112.802 5.888   1.00 100.00 ? 657 ARG S CZ  1 
ATOM   5011  N NH1 . ARG A 1 656 ? 94.080  112.477 7.120   1.00 100.00 ? 657 ARG S NH1 1 
ATOM   5012  N NH2 . ARG A 1 656 ? 94.372  111.901 4.915   1.00 100.00 ? 657 ARG S NH2 1 
ATOM   5013  N N   . THR A 1 657 ? 94.404  118.312 8.469   1.00 18.45  ? 658 THR S N   1 
ATOM   5014  C CA  . THR A 1 657 ? 93.885  119.663 8.361   1.00 18.45  ? 658 THR S CA  1 
ATOM   5015  C C   . THR A 1 657 ? 92.394  119.748 7.992   1.00 18.45  ? 658 THR S C   1 
ATOM   5016  O O   . THR A 1 657 ? 91.896  118.947 7.212   1.00 25.10  ? 658 THR S O   1 
ATOM   5017  C CB  . THR A 1 657 ? 94.743  120.444 7.335   1.00 25.10  ? 658 THR S CB  1 
ATOM   5018  O OG1 . THR A 1 657 ? 94.134  121.710 7.043   1.00 25.10  ? 658 THR S OG1 1 
ATOM   5019  C CG2 . THR A 1 657 ? 94.923  119.610 6.060   1.00 25.10  ? 658 THR S CG2 1 
ATOM   5020  N N   . VAL A 1 658 ? 91.685  120.722 8.562   1.00 42.78  ? 659 VAL S N   1 
ATOM   5021  C CA  . VAL A 1 658 ? 90.263  120.914 8.275   1.00 42.78  ? 659 VAL S CA  1 
ATOM   5022  C C   . VAL A 1 658 ? 90.030  120.996 6.773   1.00 42.78  ? 659 VAL S C   1 
ATOM   5023  O O   . VAL A 1 658 ? 89.322  120.183 6.192   1.00 35.54  ? 659 VAL S O   1 
ATOM   5024  C CB  . VAL A 1 658 ? 89.727  122.220 8.926   1.00 35.54  ? 659 VAL S CB  1 
ATOM   5025  C CG1 . VAL A 1 658 ? 88.949  123.066 7.907   1.00 35.54  ? 659 VAL S CG1 1 
ATOM   5026  C CG2 . VAL A 1 658 ? 88.843  121.869 10.110  1.00 35.54  ? 659 VAL S CG2 1 
ATOM   5027  N N   . GLY A 1 659 ? 90.645  121.988 6.150   1.00 6.70   ? 660 GLY S N   1 
ATOM   5028  C CA  . GLY A 1 659 ? 90.492  122.161 4.722   1.00 6.70   ? 660 GLY S CA  1 
ATOM   5029  C C   . GLY A 1 659 ? 90.673  120.923 3.861   1.00 6.70   ? 660 GLY S C   1 
ATOM   5030  O O   . GLY A 1 659 ? 90.119  120.849 2.769   1.00 92.03  ? 660 GLY S O   1 
ATOM   5031  N N   . GLN A 1 660 ? 91.451  119.955 4.316   1.00 2.00   ? 661 GLN S N   1 
ATOM   5032  C CA  . GLN A 1 660 ? 91.660  118.752 3.531   1.00 2.00   ? 661 GLN S CA  1 
ATOM   5033  C C   . GLN A 1 660 ? 90.786  117.648 4.081   1.00 2.00   ? 661 GLN S C   1 
ATOM   5034  O O   . GLN A 1 660 ? 90.508  116.673 3.400   1.00 100.00 ? 661 GLN S O   1 
ATOM   5035  C CB  . GLN A 1 660 ? 93.127  118.323 3.568   1.00 100.00 ? 661 GLN S CB  1 
ATOM   5036  C CG  . GLN A 1 660 ? 93.457  117.135 2.658   1.00 100.00 ? 661 GLN S CG  1 
ATOM   5037  C CD  . GLN A 1 660 ? 94.301  117.519 1.441   1.00 100.00 ? 661 GLN S CD  1 
ATOM   5038  O OE1 . GLN A 1 660 ? 94.502  116.710 0.523   1.00 100.00 ? 661 GLN S OE1 1 
ATOM   5039  N NE2 . GLN A 1 660 ? 94.801  118.755 1.432   1.00 100.00 ? 661 GLN S NE2 1 
ATOM   5040  N N   . LEU A 1 661 ? 90.356  117.798 5.328   1.00 35.70  ? 662 LEU S N   1 
ATOM   5041  C CA  . LEU A 1 661 ? 89.472  116.816 5.943   1.00 35.70  ? 662 LEU S CA  1 
ATOM   5042  C C   . LEU A 1 661 ? 88.171  116.916 5.153   1.00 35.70  ? 662 LEU S C   1 
ATOM   5043  O O   . LEU A 1 661 ? 87.576  115.906 4.743   1.00 56.89  ? 662 LEU S O   1 
ATOM   5044  C CB  . LEU A 1 661 ? 89.213  117.189 7.394   1.00 56.89  ? 662 LEU S CB  1 
ATOM   5045  C CG  . LEU A 1 661 ? 89.391  116.078 8.417   1.00 56.89  ? 662 LEU S CG  1 
ATOM   5046  C CD1 . LEU A 1 661 ? 90.213  114.944 7.827   1.00 56.89  ? 662 LEU S CD1 1 
ATOM   5047  C CD2 . LEU A 1 661 ? 90.058  116.669 9.650   1.00 56.89  ? 662 LEU S CD2 1 
ATOM   5048  N N   . TYR A 1 662 ? 87.736  118.164 4.962   1.00 50.47  ? 663 TYR S N   1 
ATOM   5049  C CA  . TYR A 1 662 ? 86.536  118.469 4.200   1.00 50.47  ? 663 TYR S CA  1 
ATOM   5050  C C   . TYR A 1 662 ? 86.855  118.066 2.774   1.00 50.47  ? 663 TYR S C   1 
ATOM   5051  O O   . TYR A 1 662 ? 86.465  116.992 2.321   1.00 15.78  ? 663 TYR S O   1 
ATOM   5052  C CB  . TYR A 1 662 ? 86.240  119.966 4.232   1.00 15.78  ? 663 TYR S CB  1 
ATOM   5053  C CG  . TYR A 1 662 ? 85.222  120.404 3.202   1.00 15.78  ? 663 TYR S CG  1 
ATOM   5054  C CD1 . TYR A 1 662 ? 83.948  119.838 3.180   1.00 15.78  ? 663 TYR S CD1 1 
ATOM   5055  C CD2 . TYR A 1 662 ? 85.516  121.391 2.249   1.00 15.78  ? 663 TYR S CD2 1 
ATOM   5056  C CE1 . TYR A 1 662 ? 82.980  120.242 2.240   1.00 15.78  ? 663 TYR S CE1 1 
ATOM   5057  C CE2 . TYR A 1 662 ? 84.548  121.805 1.299   1.00 15.78  ? 663 TYR S CE2 1 
ATOM   5058  C CZ  . TYR A 1 662 ? 83.283  121.219 1.312   1.00 15.78  ? 663 TYR S CZ  1 
ATOM   5059  O OH  . TYR A 1 662 ? 82.301  121.609 0.438   1.00 15.78  ? 663 TYR S OH  1 
ATOM   5060  N N   . LYS A 1 663 ? 87.594  118.936 2.089   1.00 2.00   ? 664 LYS S N   1 
ATOM   5061  C CA  . LYS A 1 663 ? 88.002  118.734 0.702   1.00 2.00   ? 664 LYS S CA  1 
ATOM   5062  C C   . LYS A 1 663 ? 88.275  117.282 0.291   1.00 2.00   ? 664 LYS S C   1 
ATOM   5063  O O   . LYS A 1 663 ? 88.480  116.994 -0.886  1.00 43.34  ? 664 LYS S O   1 
ATOM   5064  C CB  . LYS A 1 663 ? 89.240  119.587 0.408   1.00 43.34  ? 664 LYS S CB  1 
ATOM   5065  C CG  . LYS A 1 663 ? 89.538  119.739 -1.056  1.00 43.34  ? 664 LYS S CG  1 
ATOM   5066  C CD  . LYS A 1 663 ? 90.855  119.073 -1.412  1.00 43.34  ? 664 LYS S CD  1 
ATOM   5067  C CE  . LYS A 1 663 ? 92.000  120.080 -1.398  1.00 43.34  ? 664 LYS S CE  1 
ATOM   5068  N NZ  . LYS A 1 663 ? 92.379  120.504 -2.785  1.00 43.34  ? 664 LYS S NZ  1 
ATOM   5069  N N   . GLU A 1 664 ? 88.289  116.371 1.257   1.00 26.99  ? 665 GLU S N   1 
ATOM   5070  C CA  . GLU A 1 664 ? 88.546  114.961 0.984   1.00 26.99  ? 665 GLU S CA  1 
ATOM   5071  C C   . GLU A 1 664 ? 87.227  114.245 0.851   1.00 26.99  ? 665 GLU S C   1 
ATOM   5072  O O   . GLU A 1 664 ? 87.045  113.445 -0.065  1.00 100.00 ? 665 GLU S O   1 
ATOM   5073  C CB  . GLU A 1 664 ? 89.360  114.323 2.113   1.00 100.00 ? 665 GLU S CB  1 
ATOM   5074  C CG  . GLU A 1 664 ? 90.550  113.500 1.628   1.00 100.00 ? 665 GLU S CG  1 
ATOM   5075  C CD  . GLU A 1 664 ? 91.860  114.280 1.647   1.00 100.00 ? 665 GLU S CD  1 
ATOM   5076  O OE1 . GLU A 1 664 ? 92.435  114.464 2.746   1.00 100.00 ? 665 GLU S OE1 1 
ATOM   5077  O OE2 . GLU A 1 664 ? 92.315  114.703 0.560   1.00 100.00 ? 665 GLU S OE2 1 
ATOM   5078  N N   . GLN A 1 665 ? 86.307  114.527 1.768   1.00 35.83  ? 666 GLN S N   1 
ATOM   5079  C CA  . GLN A 1 665 ? 84.992  113.901 1.727   1.00 35.83  ? 666 GLN S CA  1 
ATOM   5080  C C   . GLN A 1 665 ? 84.158  114.502 0.596   1.00 35.83  ? 666 GLN S C   1 
ATOM   5081  O O   . GLN A 1 665 ? 83.314  113.829 0.000   1.00 82.18  ? 666 GLN S O   1 
ATOM   5082  C CB  . GLN A 1 665 ? 84.283  114.093 3.068   1.00 82.18  ? 666 GLN S CB  1 
ATOM   5083  C CG  . GLN A 1 665 ? 83.300  115.241 3.106   1.00 82.18  ? 666 GLN S CG  1 
ATOM   5084  C CD  . GLN A 1 665 ? 82.466  115.237 4.374   1.00 82.18  ? 666 GLN S CD  1 
ATOM   5085  O OE1 . GLN A 1 665 ? 82.960  115.559 5.455   1.00 82.18  ? 666 GLN S OE1 1 
ATOM   5086  N NE2 . GLN A 1 665 ? 81.196  114.872 4.248   1.00 82.18  ? 666 GLN S NE2 1 
ATOM   5087  N N   . LEU A 1 666 ? 84.414  115.771 0.299   1.00 7.71   ? 667 LEU S N   1 
ATOM   5088  C CA  . LEU A 1 666 ? 83.694  116.464 -0.757  1.00 7.71   ? 667 LEU S CA  1 
ATOM   5089  C C   . LEU A 1 666 ? 84.116  115.959 -2.119  1.00 7.71   ? 667 LEU S C   1 
ATOM   5090  O O   . LEU A 1 666 ? 83.647  116.449 -3.133  1.00 5.39   ? 667 LEU S O   1 
ATOM   5091  C CB  . LEU A 1 666 ? 83.925  117.981 -0.686  1.00 5.39   ? 667 LEU S CB  1 
ATOM   5092  C CG  . LEU A 1 666 ? 83.134  118.772 -1.724  1.00 5.39   ? 667 LEU S CG  1 
ATOM   5093  C CD1 . LEU A 1 666 ? 81.849  119.199 -1.088  1.00 5.39   ? 667 LEU S CD1 1 
ATOM   5094  C CD2 . LEU A 1 666 ? 83.929  119.958 -2.236  1.00 5.39   ? 667 LEU S CD2 1 
ATOM   5095  N N   . THR A 1 667 ? 85.030  115.003 -2.150  1.00 2.00   ? 668 THR S N   1 
ATOM   5096  C CA  . THR A 1 667 ? 85.467  114.439 -3.419  1.00 2.00   ? 668 THR S CA  1 
ATOM   5097  C C   . THR A 1 667 ? 84.811  113.083 -3.455  1.00 2.00   ? 668 THR S C   1 
ATOM   5098  O O   . THR A 1 667 ? 84.671  112.462 -4.505  1.00 84.64  ? 668 THR S O   1 
ATOM   5099  C CB  . THR A 1 667 ? 86.992  114.267 -3.501  1.00 84.64  ? 668 THR S CB  1 
ATOM   5100  O OG1 . THR A 1 667 ? 87.614  114.778 -2.313  1.00 84.64  ? 668 THR S OG1 1 
ATOM   5101  C CG2 . THR A 1 667 ? 87.522  115.013 -4.709  1.00 84.64  ? 668 THR S CG2 1 
ATOM   5102  N N   . LYS A 1 668 ? 84.422  112.625 -2.273  1.00 2.00   ? 669 LYS S N   1 
ATOM   5103  C CA  . LYS A 1 668 ? 83.749  111.363 -2.150  1.00 2.00   ? 669 LYS S CA  1 
ATOM   5104  C C   . LYS A 1 668 ? 82.413  111.690 -2.776  1.00 2.00   ? 669 LYS S C   1 
ATOM   5105  O O   . LYS A 1 668 ? 81.995  111.039 -3.727  1.00 100.00 ? 669 LYS S O   1 
ATOM   5106  C CB  . LYS A 1 668 ? 83.566  110.995 -0.681  1.00 100.00 ? 669 LYS S CB  1 
ATOM   5107  C CG  . LYS A 1 668 ? 83.789  109.524 -0.386  1.00 100.00 ? 669 LYS S CG  1 
ATOM   5108  C CD  . LYS A 1 668 ? 83.913  109.270 1.114   1.00 100.00 ? 669 LYS S CD  1 
ATOM   5109  C CE  . LYS A 1 668 ? 85.283  109.698 1.647   1.00 100.00 ? 669 LYS S CE  1 
ATOM   5110  N NZ  . LYS A 1 668 ? 85.472  109.406 3.103   1.00 100.00 ? 669 LYS S NZ  1 
ATOM   5111  N N   . LEU A 1 669 ? 81.748  112.726 -2.255  1.00 79.20  ? 670 LEU S N   1 
ATOM   5112  C CA  . LEU A 1 669 ? 80.443  113.143 -2.776  1.00 79.20  ? 670 LEU S CA  1 
ATOM   5113  C C   . LEU A 1 669 ? 80.513  113.397 -4.273  1.00 79.20  ? 670 LEU S C   1 
ATOM   5114  O O   . LEU A 1 669 ? 79.786  112.777 -5.039  1.00 2.00   ? 670 LEU S O   1 
ATOM   5115  C CB  . LEU A 1 669 ? 79.935  114.407 -2.061  1.00 2.00   ? 670 LEU S CB  1 
ATOM   5116  C CG  . LEU A 1 669 ? 78.867  115.296 -2.738  1.00 2.00   ? 670 LEU S CG  1 
ATOM   5117  C CD1 . LEU A 1 669 ? 77.506  114.610 -2.742  1.00 2.00   ? 670 LEU S CD1 1 
ATOM   5118  C CD2 . LEU A 1 669 ? 78.781  116.635 -2.008  1.00 2.00   ? 670 LEU S CD2 1 
ATOM   5119  N N   . MET A 1 670 ? 81.390  114.296 -4.697  1.00 3.33   ? 671 MET S N   1 
ATOM   5120  C CA  . MET A 1 670 ? 81.524  114.604 -6.117  1.00 3.33   ? 671 MET S CA  1 
ATOM   5121  C C   . MET A 1 670 ? 81.723  113.334 -6.952  1.00 3.33   ? 671 MET S C   1 
ATOM   5122  O O   . MET A 1 670 ? 81.526  113.348 -8.168  1.00 59.60  ? 671 MET S O   1 
ATOM   5123  C CB  . MET A 1 670 ? 82.702  115.556 -6.342  1.00 59.60  ? 671 MET S CB  1 
ATOM   5124  C CG  . MET A 1 670 ? 82.423  116.708 -7.295  1.00 59.60  ? 671 MET S CG  1 
ATOM   5125  S SD  . MET A 1 670 ? 80.793  117.484 -7.103  1.00 59.60  ? 671 MET S SD  1 
ATOM   5126  C CE  . MET A 1 670 ? 80.663  117.669 -5.335  1.00 59.60  ? 671 MET S CE  1 
ATOM   5127  N N   . THR A 1 671 ? 82.109  112.238 -6.296  1.00 6.35   ? 672 THR S N   1 
ATOM   5128  C CA  . THR A 1 671 ? 82.352  110.963 -6.981  1.00 6.35   ? 672 THR S CA  1 
ATOM   5129  C C   . THR A 1 671 ? 81.075  110.175 -7.249  1.00 6.35   ? 672 THR S C   1 
ATOM   5130  O O   . THR A 1 671 ? 80.864  109.705 -8.364  1.00 100.00 ? 672 THR S O   1 
ATOM   5131  C CB  . THR A 1 671 ? 83.321  110.069 -6.169  1.00 100.00 ? 672 THR S CB  1 
ATOM   5132  O OG1 . THR A 1 671 ? 84.665  110.537 -6.342  1.00 100.00 ? 672 THR S OG1 1 
ATOM   5133  C CG2 . THR A 1 671 ? 83.235  108.615 -6.641  1.00 100.00 ? 672 THR S CG2 1 
ATOM   5134  N N   . THR A 1 672 ? 80.225  110.024 -6.237  1.00 37.77  ? 673 THR S N   1 
ATOM   5135  C CA  . THR A 1 672 ? 78.988  109.280 -6.430  1.00 37.77  ? 673 THR S CA  1 
ATOM   5136  C C   . THR A 1 672 ? 78.064  110.036 -7.371  1.00 37.77  ? 673 THR S C   1 
ATOM   5137  O O   . THR A 1 672 ? 77.402  109.420 -8.208  1.00 33.40  ? 673 THR S O   1 
ATOM   5138  C CB  . THR A 1 672 ? 78.234  109.030 -5.118  1.00 33.40  ? 673 THR S CB  1 
ATOM   5139  O OG1 . THR A 1 672 ? 77.022  109.781 -5.138  1.00 33.40  ? 673 THR S OG1 1 
ATOM   5140  C CG2 . THR A 1 672 ? 79.077  109.443 -3.915  1.00 33.40  ? 673 THR S CG2 1 
ATOM   5141  N N   . LEU A 1 673 ? 78.010  111.364 -7.237  1.00 2.50   ? 674 LEU S N   1 
ATOM   5142  C CA  . LEU A 1 673 ? 77.159  112.168 -8.113  1.00 2.50   ? 674 LEU S CA  1 
ATOM   5143  C C   . LEU A 1 673 ? 77.495  111.884 -9.547  1.00 2.50   ? 674 LEU S C   1 
ATOM   5144  O O   . LEU A 1 673 ? 76.607  111.809 -10.370 1.00 2.00   ? 674 LEU S O   1 
ATOM   5145  C CB  . LEU A 1 673 ? 77.354  113.652 -7.899  1.00 2.00   ? 674 LEU S CB  1 
ATOM   5146  C CG  . LEU A 1 673 ? 76.924  114.210 -6.559  1.00 2.00   ? 674 LEU S CG  1 
ATOM   5147  C CD1 . LEU A 1 673 ? 76.648  115.700 -6.706  1.00 2.00   ? 674 LEU S CD1 1 
ATOM   5148  C CD2 . LEU A 1 673 ? 75.721  113.452 -6.047  1.00 2.00   ? 674 LEU S CD2 1 
ATOM   5149  N N   . ARG A 1 674 ? 78.785  111.744 -9.843  1.00 2.00   ? 675 ARG S N   1 
ATOM   5150  C CA  . ARG A 1 674 ? 79.243  111.481 -11.203 1.00 2.00   ? 675 ARG S CA  1 
ATOM   5151  C C   . ARG A 1 674 ? 78.911  110.065 -11.610 1.00 2.00   ? 675 ARG S C   1 
ATOM   5152  O O   . ARG A 1 674 ? 79.096  109.674 -12.759 1.00 95.07  ? 675 ARG S O   1 
ATOM   5153  C CB  . ARG A 1 674 ? 80.754  111.722 -11.312 1.00 95.07  ? 675 ARG S CB  1 
ATOM   5154  C CG  . ARG A 1 674 ? 81.132  113.108 -11.829 1.00 95.07  ? 675 ARG S CG  1 
ATOM   5155  C CD  . ARG A 1 674 ? 82.259  113.734 -11.006 1.00 95.07  ? 675 ARG S CD  1 
ATOM   5156  N NE  . ARG A 1 674 ? 82.438  115.156 -11.305 1.00 95.07  ? 675 ARG S NE  1 
ATOM   5157  C CZ  . ARG A 1 674 ? 83.384  115.932 -10.777 1.00 95.07  ? 675 ARG S CZ  1 
ATOM   5158  N NH1 . ARG A 1 674 ? 84.255  115.423 -9.909  1.00 95.07  ? 675 ARG S NH1 1 
ATOM   5159  N NH2 . ARG A 1 674 ? 83.460  117.217 -11.118 1.00 95.07  ? 675 ARG S NH2 1 
ATOM   5160  N N   . ASN A 1 675 ? 78.401  109.303 -10.658 1.00 2.58   ? 676 ASN S N   1 
ATOM   5161  C CA  . ASN A 1 675 ? 78.040  107.916 -10.908 1.00 2.58   ? 676 ASN S CA  1 
ATOM   5162  C C   . ASN A 1 675 ? 76.536  107.688 -10.866 1.00 2.58   ? 676 ASN S C   1 
ATOM   5163  O O   . ASN A 1 675 ? 76.070  106.546 -10.918 1.00 100.00 ? 676 ASN S O   1 
ATOM   5164  C CB  . ASN A 1 675 ? 78.697  107.007 -9.877  1.00 100.00 ? 676 ASN S CB  1 
ATOM   5165  C CG  . ASN A 1 675 ? 79.800  106.166 -10.469 1.00 100.00 ? 676 ASN S CG  1 
ATOM   5166  O OD1 . ASN A 1 675 ? 80.013  106.160 -11.683 1.00 100.00 ? 676 ASN S OD1 1 
ATOM   5167  N ND2 . ASN A 1 675 ? 80.517  105.447 -9.608  1.00 100.00 ? 676 ASN S ND2 1 
ATOM   5168  N N   . THR A 1 676 ? 75.786  108.781 -10.768 1.00 51.54  ? 677 THR S N   1 
ATOM   5169  C CA  . THR A 1 676 ? 74.328  108.724 -10.725 1.00 51.54  ? 677 THR S CA  1 
ATOM   5170  C C   . THR A 1 676 ? 73.777  109.537 -11.872 1.00 51.54  ? 677 THR S C   1 
ATOM   5171  O O   . THR A 1 676 ? 74.520  110.027 -12.709 1.00 3.96   ? 677 THR S O   1 
ATOM   5172  C CB  . THR A 1 676 ? 73.788  109.339 -9.438  1.00 3.96   ? 677 THR S CB  1 
ATOM   5173  O OG1 . THR A 1 676 ? 73.969  110.754 -9.468  1.00 3.96   ? 677 THR S OG1 1 
ATOM   5174  C CG2 . THR A 1 676 ? 74.525  108.787 -8.249  1.00 3.96   ? 677 THR S CG2 1 
ATOM   5175  N N   . ASN A 1 677 ? 72.465  109.680 -11.933 1.00 7.91   ? 678 ASN S N   1 
ATOM   5176  C CA  . ASN A 1 677 ? 71.907  110.498 -12.987 1.00 7.91   ? 678 ASN S CA  1 
ATOM   5177  C C   . ASN A 1 677 ? 71.380  111.767 -12.365 1.00 7.91   ? 678 ASN S C   1 
ATOM   5178  O O   . ASN A 1 677 ? 70.473  111.732 -11.534 1.00 6.60   ? 678 ASN S O   1 
ATOM   5179  C CB  . ASN A 1 677 ? 70.783  109.804 -13.713 1.00 6.60   ? 678 ASN S CB  1 
ATOM   5180  C CG  . ASN A 1 677 ? 70.362  110.564 -14.922 1.00 6.60   ? 678 ASN S CG  1 
ATOM   5181  O OD1 . ASN A 1 677 ? 69.374  110.244 -15.557 1.00 6.60   ? 678 ASN S OD1 1 
ATOM   5182  N ND2 . ASN A 1 677 ? 71.116  111.586 -15.254 1.00 6.60   ? 678 ASN S ND2 1 
ATOM   5183  N N   . PRO A 1 678 ? 71.953  112.912 -12.750 1.00 2.86   ? 679 PRO S N   1 
ATOM   5184  C CA  . PRO A 1 678 ? 71.573  114.225 -12.241 1.00 2.86   ? 679 PRO S CA  1 
ATOM   5185  C C   . PRO A 1 678 ? 70.266  114.765 -12.793 1.00 2.86   ? 679 PRO S C   1 
ATOM   5186  O O   . PRO A 1 678 ? 69.981  114.598 -13.981 1.00 3.03   ? 679 PRO S O   1 
ATOM   5187  C CB  . PRO A 1 678 ? 72.728  115.112 -12.654 1.00 3.03   ? 679 PRO S CB  1 
ATOM   5188  C CG  . PRO A 1 678 ? 73.160  114.528 -13.911 1.00 3.03   ? 679 PRO S CG  1 
ATOM   5189  C CD  . PRO A 1 678 ? 73.043  113.035 -13.728 1.00 3.03   ? 679 PRO S CD  1 
ATOM   5190  N N   . ASN A 1 679 ? 69.498  115.410 -11.911 1.00 2.77   ? 680 ASN S N   1 
ATOM   5191  C CA  . ASN A 1 679 ? 68.232  116.054 -12.221 1.00 2.77   ? 680 ASN S CA  1 
ATOM   5192  C C   . ASN A 1 679 ? 68.377  117.405 -11.522 1.00 2.77   ? 680 ASN S C   1 
ATOM   5193  O O   . ASN A 1 679 ? 68.290  117.480 -10.298 1.00 70.48  ? 680 ASN S O   1 
ATOM   5194  C CB  . ASN A 1 679 ? 67.071  115.254 -11.633 1.00 70.48  ? 680 ASN S CB  1 
ATOM   5195  C CG  . ASN A 1 679 ? 67.003  113.832 -12.180 1.00 70.48  ? 680 ASN S CG  1 
ATOM   5196  O OD1 . ASN A 1 679 ? 66.091  113.474 -12.932 1.00 70.48  ? 680 ASN S OD1 1 
ATOM   5197  N ND2 . ASN A 1 679 ? 67.974  113.015 -11.804 1.00 70.48  ? 680 ASN S ND2 1 
ATOM   5198  N N   . PHE A 1 680 ? 68.634  118.458 -12.295 1.00 2.00   ? 681 PHE S N   1 
ATOM   5199  C CA  . PHE A 1 680 ? 68.832  119.806 -11.754 1.00 2.00   ? 681 PHE S CA  1 
ATOM   5200  C C   . PHE A 1 680 ? 67.571  120.659 -11.515 1.00 2.00   ? 681 PHE S C   1 
ATOM   5201  O O   . PHE A 1 680 ? 66.749  120.829 -12.415 1.00 33.58  ? 681 PHE S O   1 
ATOM   5202  C CB  . PHE A 1 680 ? 69.768  120.590 -12.674 1.00 33.58  ? 681 PHE S CB  1 
ATOM   5203  C CG  . PHE A 1 680 ? 71.172  120.112 -12.649 1.00 33.58  ? 681 PHE S CG  1 
ATOM   5204  C CD1 . PHE A 1 680 ? 72.007  120.452 -11.592 1.00 33.58  ? 681 PHE S CD1 1 
ATOM   5205  C CD2 . PHE A 1 680 ? 71.664  119.316 -13.678 1.00 33.58  ? 681 PHE S CD2 1 
ATOM   5206  C CE1 . PHE A 1 680 ? 73.317  120.006 -11.553 1.00 33.58  ? 681 PHE S CE1 1 
ATOM   5207  C CE2 . PHE A 1 680 ? 72.976  118.859 -13.655 1.00 33.58  ? 681 PHE S CE2 1 
ATOM   5208  C CZ  . PHE A 1 680 ? 73.805  119.206 -12.589 1.00 33.58  ? 681 PHE S CZ  1 
ATOM   5209  N N   . VAL A 1 681 ? 67.440  121.226 -10.319 1.00 2.00   ? 682 VAL S N   1 
ATOM   5210  C CA  . VAL A 1 681 ? 66.286  122.044 -10.000 1.00 2.00   ? 682 VAL S CA  1 
ATOM   5211  C C   . VAL A 1 681 ? 66.779  123.437 -9.637  1.00 2.00   ? 682 VAL S C   1 
ATOM   5212  O O   . VAL A 1 681 ? 66.684  123.844 -8.487  1.00 4.05   ? 682 VAL S O   1 
ATOM   5213  C CB  . VAL A 1 681 ? 65.468  121.437 -8.806  1.00 4.05   ? 682 VAL S CB  1 
ATOM   5214  C CG1 . VAL A 1 681 ? 64.306  122.338 -8.445  1.00 4.05   ? 682 VAL S CG1 1 
ATOM   5215  C CG2 . VAL A 1 681 ? 64.954  120.046 -9.159  1.00 4.05   ? 682 VAL S CG2 1 
ATOM   5216  N N   . ARG A 1 682 ? 67.286  124.172 -10.623 1.00 2.00   ? 683 ARG S N   1 
ATOM   5217  C CA  . ARG A 1 682 ? 67.815  125.530 -10.416 1.00 2.00   ? 683 ARG S CA  1 
ATOM   5218  C C   . ARG A 1 682 ? 66.981  126.611 -9.703  1.00 2.00   ? 683 ARG S C   1 
ATOM   5219  O O   . ARG A 1 682 ? 66.386  127.458 -10.362 1.00 9.07   ? 683 ARG S O   1 
ATOM   5220  C CB  . ARG A 1 682 ? 68.257  126.127 -11.746 1.00 9.07   ? 683 ARG S CB  1 
ATOM   5221  C CG  . ARG A 1 682 ? 68.242  125.160 -12.883 1.00 9.07   ? 683 ARG S CG  1 
ATOM   5222  C CD  . ARG A 1 682 ? 69.635  124.973 -13.445 1.00 9.07   ? 683 ARG S CD  1 
ATOM   5223  N NE  . ARG A 1 682 ? 70.663  125.362 -12.486 1.00 9.07   ? 683 ARG S NE  1 
ATOM   5224  C CZ  . ARG A 1 682 ? 71.972  125.291 -12.722 1.00 9.07   ? 683 ARG S CZ  1 
ATOM   5225  N NH1 . ARG A 1 682 ? 72.410  124.844 -13.891 1.00 9.07   ? 683 ARG S NH1 1 
ATOM   5226  N NH2 . ARG A 1 682 ? 72.847  125.658 -11.793 1.00 9.07   ? 683 ARG S NH2 1 
ATOM   5227  N N   . CYS A 1 683 ? 66.969  126.612 -8.369  1.00 30.96  ? 684 CYS S N   1 
ATOM   5228  C CA  . CYS A 1 683 ? 66.235  127.627 -7.608  1.00 30.96  ? 684 CYS S CA  1 
ATOM   5229  C C   . CYS A 1 683 ? 66.709  129.030 -8.007  1.00 30.96  ? 684 CYS S C   1 
ATOM   5230  O O   . CYS A 1 683 ? 67.876  129.227 -8.364  1.00 17.05  ? 684 CYS S O   1 
ATOM   5231  C CB  . CYS A 1 683 ? 66.467  127.424 -6.120  1.00 17.05  ? 684 CYS S CB  1 
ATOM   5232  S SG  . CYS A 1 683 ? 66.076  125.744 -5.564  1.00 17.05  ? 684 CYS S SG  1 
ATOM   5233  N N   . ILE A 1 684 ? 65.806  130.002 -7.939  1.00 5.44   ? 685 ILE S N   1 
ATOM   5234  C CA  . ILE A 1 684 ? 66.131  131.381 -8.295  1.00 5.44   ? 685 ILE S CA  1 
ATOM   5235  C C   . ILE A 1 684 ? 65.534  132.407 -7.347  1.00 5.44   ? 685 ILE S C   1 
ATOM   5236  O O   . ILE A 1 684 ? 64.316  132.480 -7.188  1.00 18.43  ? 685 ILE S O   1 
ATOM   5237  C CB  . ILE A 1 684 ? 65.623  131.717 -9.682  1.00 18.43  ? 685 ILE S CB  1 
ATOM   5238  C CG1 . ILE A 1 684 ? 66.366  130.872 -10.707 1.00 18.43  ? 685 ILE S CG1 1 
ATOM   5239  C CG2 . ILE A 1 684 ? 65.818  133.200 -9.962  1.00 18.43  ? 685 ILE S CG2 1 
ATOM   5240  C CD1 . ILE A 1 684 ? 67.016  131.692 -11.833 1.00 18.43  ? 685 ILE S CD1 1 
ATOM   5241  N N   . ILE A 1 685 ? 66.392  133.216 -6.736  1.00 8.00   ? 686 ILE S N   1 
ATOM   5242  C CA  . ILE A 1 685 ? 65.945  134.258 -5.817  1.00 8.00   ? 686 ILE S CA  1 
ATOM   5243  C C   . ILE A 1 685 ? 65.366  135.438 -6.613  1.00 8.00   ? 686 ILE S C   1 
ATOM   5244  O O   . ILE A 1 685 ? 66.007  135.954 -7.537  1.00 11.86  ? 686 ILE S O   1 
ATOM   5245  C CB  . ILE A 1 685 ? 67.098  134.731 -4.952  1.00 11.86  ? 686 ILE S CB  1 
ATOM   5246  C CG1 . ILE A 1 685 ? 66.808  134.357 -3.506  1.00 11.86  ? 686 ILE S CG1 1 
ATOM   5247  C CG2 . ILE A 1 685 ? 67.341  136.227 -5.148  1.00 11.86  ? 686 ILE S CG2 1 
ATOM   5248  C CD1 . ILE A 1 685 ? 66.131  135.455 -2.741  1.00 11.86  ? 686 ILE S CD1 1 
ATOM   5249  N N   . PRO A 1 686 ? 64.151  135.892 -6.241  1.00 2.32   ? 687 PRO S N   1 
ATOM   5250  C CA  . PRO A 1 686 ? 63.419  136.987 -6.883  1.00 2.32   ? 687 PRO S CA  1 
ATOM   5251  C C   . PRO A 1 686 ? 63.834  138.371 -6.445  1.00 2.32   ? 687 PRO S C   1 
ATOM   5252  O O   . PRO A 1 686 ? 63.799  139.322 -7.223  1.00 2.00   ? 687 PRO S O   1 
ATOM   5253  C CB  . PRO A 1 686 ? 61.991  136.698 -6.483  1.00 2.00   ? 687 PRO S CB  1 
ATOM   5254  C CG  . PRO A 1 686 ? 62.133  136.175 -5.080  1.00 2.00   ? 687 PRO S CG  1 
ATOM   5255  C CD  . PRO A 1 686 ? 63.403  135.368 -5.082  1.00 2.00   ? 687 PRO S CD  1 
ATOM   5256  N N   . ASN A 1 687 ? 64.183  138.478 -5.172  1.00 35.76  ? 688 ASN S N   1 
ATOM   5257  C CA  . ASN A 1 687 ? 64.587  139.740 -4.589  1.00 35.76  ? 688 ASN S CA  1 
ATOM   5258  C C   . ASN A 1 687 ? 65.263  139.482 -3.249  1.00 35.76  ? 688 ASN S C   1 
ATOM   5259  O O   . ASN A 1 687 ? 65.086  138.421 -2.623  1.00 14.41  ? 688 ASN S O   1 
ATOM   5260  C CB  . ASN A 1 687 ? 63.367  140.649 -4.391  1.00 14.41  ? 688 ASN S CB  1 
ATOM   5261  C CG  . ASN A 1 687 ? 62.408  140.124 -3.326  1.00 14.41  ? 688 ASN S CG  1 
ATOM   5262  O OD1 . ASN A 1 687 ? 62.662  140.246 -2.121  1.00 14.41  ? 688 ASN S OD1 1 
ATOM   5263  N ND2 . ASN A 1 687 ? 61.294  139.541 -3.764  1.00 14.41  ? 688 ASN S ND2 1 
ATOM   5264  N N   . HIS A 1 688 ? 66.034  140.476 -2.820  1.00 19.13  ? 689 HIS S N   1 
ATOM   5265  C CA  . HIS A 1 688 ? 66.772  140.429 -1.560  1.00 19.13  ? 689 HIS S CA  1 
ATOM   5266  C C   . HIS A 1 688 ? 66.008  141.125 -0.442  1.00 19.13  ? 689 HIS S C   1 
ATOM   5267  O O   . HIS A 1 688 ? 66.426  141.111 0.710   1.00 99.62  ? 689 HIS S O   1 
ATOM   5268  C CB  . HIS A 1 688 ? 68.134  141.091 -1.750  1.00 99.62  ? 689 HIS S CB  1 
ATOM   5269  C CG  . HIS A 1 688 ? 69.101  140.261 -2.539  1.00 99.62  ? 689 HIS S CG  1 
ATOM   5270  N ND1 . HIS A 1 688 ? 69.771  140.741 -3.645  1.00 99.62  ? 689 HIS S ND1 1 
ATOM   5271  C CD2 . HIS A 1 688 ? 69.522  138.982 -2.369  1.00 99.62  ? 689 HIS S CD2 1 
ATOM   5272  C CE1 . HIS A 1 688 ? 70.562  139.795 -4.121  1.00 99.62  ? 689 HIS S CE1 1 
ATOM   5273  N NE2 . HIS A 1 688 ? 70.430  138.719 -3.367  1.00 99.62  ? 689 HIS S NE2 1 
ATOM   5274  N N   . GLU A 1 689 ? 64.886  141.743 -0.798  1.00 2.00   ? 690 GLU S N   1 
ATOM   5275  C CA  . GLU A 1 689 ? 64.060  142.431 0.171   1.00 2.00   ? 690 GLU S CA  1 
ATOM   5276  C C   . GLU A 1 689 ? 63.176  141.434 0.923   1.00 2.00   ? 690 GLU S C   1 
ATOM   5277  O O   . GLU A 1 689 ? 62.377  141.822 1.773   1.00 100.00 ? 690 GLU S O   1 
ATOM   5278  C CB  . GLU A 1 689 ? 63.192  143.480 -0.528  1.00 100.00 ? 690 GLU S CB  1 
ATOM   5279  C CG  . GLU A 1 689 ? 63.486  144.910 -0.092  1.00 100.00 ? 690 GLU S CG  1 
ATOM   5280  C CD  . GLU A 1 689 ? 62.234  145.670 0.339   1.00 100.00 ? 690 GLU S CD  1 
ATOM   5281  O OE1 . GLU A 1 689 ? 61.260  145.724 -0.448  1.00 100.00 ? 690 GLU S OE1 1 
ATOM   5282  O OE2 . GLU A 1 689 ? 62.222  146.215 1.471   1.00 100.00 ? 690 GLU S OE2 1 
ATOM   5283  N N   . LYS A 1 690 ? 63.333  140.147 0.622   1.00 10.90  ? 691 LYS S N   1 
ATOM   5284  C CA  . LYS A 1 690 ? 62.527  139.123 1.275   1.00 10.90  ? 691 LYS S CA  1 
ATOM   5285  C C   . LYS A 1 690 ? 61.052  139.466 1.068   1.00 10.90  ? 691 LYS S C   1 
ATOM   5286  O O   . LYS A 1 690 ? 60.198  139.139 1.896   1.00 74.24  ? 691 LYS S O   1 
ATOM   5287  C CB  . LYS A 1 690 ? 62.837  139.081 2.767   1.00 74.24  ? 691 LYS S CB  1 
ATOM   5288  C CG  . LYS A 1 690 ? 62.469  137.774 3.445   1.00 74.24  ? 691 LYS S CG  1 
ATOM   5289  C CD  . LYS A 1 690 ? 63.165  137.640 4.796   1.00 74.24  ? 691 LYS S CD  1 
ATOM   5290  C CE  . LYS A 1 690 ? 64.650  137.306 4.652   1.00 74.24  ? 691 LYS S CE  1 
ATOM   5291  N NZ  . LYS A 1 690 ? 65.421  137.478 5.923   1.00 74.24  ? 691 LYS S NZ  1 
ATOM   5292  N N   . ARG A 1 691 ? 60.771  140.132 -0.053  1.00 2.00   ? 692 ARG S N   1 
ATOM   5293  C CA  . ARG A 1 691 ? 59.426  140.555 -0.387  1.00 2.00   ? 692 ARG S CA  1 
ATOM   5294  C C   . ARG A 1 691 ? 58.788  139.548 -1.304  1.00 2.00   ? 692 ARG S C   1 
ATOM   5295  O O   . ARG A 1 691 ? 59.425  139.007 -2.203  1.00 82.76  ? 692 ARG S O   1 
ATOM   5296  C CB  . ARG A 1 691 ? 59.456  141.907 -1.094  1.00 82.76  ? 692 ARG S CB  1 
ATOM   5297  C CG  . ARG A 1 691 ? 59.840  143.071 -0.219  1.00 82.76  ? 692 ARG S CG  1 
ATOM   5298  C CD  . ARG A 1 691 ? 58.716  144.084 -0.143  1.00 82.76  ? 692 ARG S CD  1 
ATOM   5299  N NE  . ARG A 1 691 ? 57.579  143.581 0.633   1.00 82.76  ? 692 ARG S NE  1 
ATOM   5300  C CZ  . ARG A 1 691 ? 57.452  143.697 1.957   1.00 82.76  ? 692 ARG S CZ  1 
ATOM   5301  N NH1 . ARG A 1 691 ? 58.399  144.307 2.674   1.00 82.76  ? 692 ARG S NH1 1 
ATOM   5302  N NH2 . ARG A 1 691 ? 56.378  143.204 2.573   1.00 82.76  ? 692 ARG S NH2 1 
ATOM   5303  N N   . ALA A 1 692 ? 57.513  139.298 -1.074  1.00 93.41  ? 693 ALA S N   1 
ATOM   5304  C CA  . ALA A 1 692 ? 56.769  138.382 -1.913  1.00 93.41  ? 693 ALA S CA  1 
ATOM   5305  C C   . ALA A 1 692 ? 56.087  139.257 -2.966  1.00 93.41  ? 693 ALA S C   1 
ATOM   5306  O O   . ALA A 1 692 ? 55.726  140.400 -2.689  1.00 100.00 ? 693 ALA S O   1 
ATOM   5307  C CB  . ALA A 1 692 ? 55.736  137.636 -1.082  1.00 100.00 ? 693 ALA S CB  1 
ATOM   5308  N N   . GLY A 1 693 ? 55.915  138.741 -4.173  1.00 44.94  ? 694 GLY S N   1 
ATOM   5309  C CA  . GLY A 1 693 ? 55.266  139.547 -5.189  1.00 44.94  ? 694 GLY S CA  1 
ATOM   5310  C C   . GLY A 1 693 ? 56.197  140.585 -5.783  1.00 44.94  ? 694 GLY S C   1 
ATOM   5311  O O   . GLY A 1 693 ? 55.861  141.258 -6.750  1.00 10.00  ? 694 GLY S O   1 
ATOM   5312  N N   . LYS A 1 694 ? 57.370  140.739 -5.195  1.00 2.00   ? 695 LYS S N   1 
ATOM   5313  C CA  . LYS A 1 694 ? 58.349  141.681 -5.728  1.00 2.00   ? 695 LYS S CA  1 
ATOM   5314  C C   . LYS A 1 694 ? 59.363  140.883 -6.561  1.00 2.00   ? 695 LYS S C   1 
ATOM   5315  O O   . LYS A 1 694 ? 59.902  139.884 -6.079  1.00 100.00 ? 695 LYS S O   1 
ATOM   5316  C CB  . LYS A 1 694 ? 59.076  142.383 -4.581  1.00 100.00 ? 695 LYS S CB  1 
ATOM   5317  C CG  . LYS A 1 694 ? 59.948  143.553 -5.008  1.00 100.00 ? 695 LYS S CG  1 
ATOM   5318  C CD  . LYS A 1 694 ? 60.305  144.436 -3.811  1.00 100.00 ? 695 LYS S CD  1 
ATOM   5319  C CE  . LYS A 1 694 ? 61.484  145.363 -4.123  1.00 100.00 ? 695 LYS S CE  1 
ATOM   5320  N NZ  . LYS A 1 694 ? 62.569  145.301 -3.087  1.00 100.00 ? 695 LYS S NZ  1 
ATOM   5321  N N   . LEU A 1 695 ? 59.619  141.305 -7.796  1.00 2.00   ? 696 LEU S N   1 
ATOM   5322  C CA  . LEU A 1 695 ? 60.581  140.562 -8.611  1.00 2.00   ? 696 LEU S CA  1 
ATOM   5323  C C   . LEU A 1 695 ? 61.560  141.446 -9.359  1.00 2.00   ? 696 LEU S C   1 
ATOM   5324  O O   . LEU A 1 695 ? 61.222  142.025 -10.383 1.00 6.76   ? 696 LEU S O   1 
ATOM   5325  C CB  . LEU A 1 695 ? 59.857  139.641 -9.609  1.00 6.76   ? 696 LEU S CB  1 
ATOM   5326  C CG  . LEU A 1 695 ? 60.597  139.264 -10.908 1.00 6.76   ? 696 LEU S CG  1 
ATOM   5327  C CD1 . LEU A 1 695 ? 61.934  138.647 -10.579 1.00 6.76   ? 696 LEU S CD1 1 
ATOM   5328  C CD2 . LEU A 1 695 ? 59.774  138.292 -11.709 1.00 6.76   ? 696 LEU S CD2 1 
ATOM   5329  N N   . ASP A 1 696 ? 62.785  141.511 -8.848  1.00 2.00   ? 697 ASP S N   1 
ATOM   5330  C CA  . ASP A 1 696 ? 63.849  142.318 -9.434  1.00 2.00   ? 697 ASP S CA  1 
ATOM   5331  C C   . ASP A 1 696 ? 64.343  141.748 -10.755 1.00 2.00   ? 697 ASP S C   1 
ATOM   5332  O O   . ASP A 1 696 ? 64.931  140.665 -10.806 1.00 78.52  ? 697 ASP S O   1 
ATOM   5333  C CB  . ASP A 1 696 ? 65.015  142.426 -8.457  1.00 78.52  ? 697 ASP S CB  1 
ATOM   5334  C CG  . ASP A 1 696 ? 66.190  143.181 -9.038  1.00 78.52  ? 697 ASP S CG  1 
ATOM   5335  O OD1 . ASP A 1 696 ? 66.213  143.408 -10.274 1.00 78.52  ? 697 ASP S OD1 1 
ATOM   5336  O OD2 . ASP A 1 696 ? 67.090  143.546 -8.251  1.00 78.52  ? 697 ASP S OD2 1 
ATOM   5337  N N   . ALA A 1 697 ? 64.133  142.514 -11.814 1.00 65.04  ? 698 ALA S N   1 
ATOM   5338  C CA  . ALA A 1 697 ? 64.502  142.113 -13.161 1.00 65.04  ? 698 ALA S CA  1 
ATOM   5339  C C   . ALA A 1 697 ? 65.937  141.677 -13.346 1.00 65.04  ? 698 ALA S C   1 
ATOM   5340  O O   . ALA A 1 697 ? 66.200  140.520 -13.685 1.00 60.35  ? 698 ALA S O   1 
ATOM   5341  C CB  . ALA A 1 697 ? 64.177  143.237 -14.144 1.00 60.35  ? 698 ALA S CB  1 
ATOM   5342  N N   . HIS A 1 698 ? 66.869  142.597 -13.129 1.00 12.85  ? 699 HIS S N   1 
ATOM   5343  C CA  . HIS A 1 698 ? 68.267  142.275 -13.335 1.00 12.85  ? 699 HIS S CA  1 
ATOM   5344  C C   . HIS A 1 698 ? 68.819  141.241 -12.369 1.00 12.85  ? 699 HIS S C   1 
ATOM   5345  O O   . HIS A 1 698 ? 69.605  140.373 -12.766 1.00 66.99  ? 699 HIS S O   1 
ATOM   5346  C CB  . HIS A 1 698 ? 69.098  143.553 -13.315 1.00 66.99  ? 699 HIS S CB  1 
ATOM   5347  C CG  . HIS A 1 698 ? 68.946  144.374 -14.554 1.00 66.99  ? 699 HIS S CG  1 
ATOM   5348  N ND1 . HIS A 1 698 ? 68.303  145.594 -14.567 1.00 66.99  ? 699 HIS S ND1 1 
ATOM   5349  C CD2 . HIS A 1 698 ? 69.322  144.137 -15.833 1.00 66.99  ? 699 HIS S CD2 1 
ATOM   5350  C CE1 . HIS A 1 698 ? 68.289  146.075 -15.798 1.00 66.99  ? 699 HIS S CE1 1 
ATOM   5351  N NE2 . HIS A 1 698 ? 68.900  145.210 -16.586 1.00 66.99  ? 699 HIS S NE2 1 
ATOM   5352  N N   . LEU A 1 699 ? 68.412  141.305 -11.105 1.00 3.18   ? 700 LEU S N   1 
ATOM   5353  C CA  . LEU A 1 699 ? 68.889  140.333 -10.124 1.00 3.18   ? 700 LEU S CA  1 
ATOM   5354  C C   . LEU A 1 699 ? 68.568  138.942 -10.643 1.00 3.18   ? 700 LEU S C   1 
ATOM   5355  O O   . LEU A 1 699 ? 69.360  138.018 -10.502 1.00 19.32  ? 700 LEU S O   1 
ATOM   5356  C CB  . LEU A 1 699 ? 68.203  140.546 -8.782  1.00 19.32  ? 700 LEU S CB  1 
ATOM   5357  C CG  . LEU A 1 699 ? 68.722  139.637 -7.673  1.00 19.32  ? 700 LEU S CG  1 
ATOM   5358  C CD1 . LEU A 1 699 ? 68.505  140.305 -6.323  1.00 19.32  ? 700 LEU S CD1 1 
ATOM   5359  C CD2 . LEU A 1 699 ? 68.002  138.293 -7.728  1.00 19.32  ? 700 LEU S CD2 1 
ATOM   5360  N N   . VAL A 1 700 ? 67.398  138.806 -11.248 1.00 2.00   ? 701 VAL S N   1 
ATOM   5361  C CA  . VAL A 1 700 ? 66.983  137.536 -11.803 1.00 2.00   ? 701 VAL S CA  1 
ATOM   5362  C C   . VAL A 1 700 ? 67.568  137.359 -13.194 1.00 2.00   ? 701 VAL S C   1 
ATOM   5363  O O   . VAL A 1 700 ? 67.610  136.256 -13.732 1.00 18.60  ? 701 VAL S O   1 
ATOM   5364  C CB  . VAL A 1 700 ? 65.455  137.456 -11.862 1.00 18.60  ? 701 VAL S CB  1 
ATOM   5365  C CG1 . VAL A 1 700 ? 64.978  136.861 -13.201 1.00 18.60  ? 701 VAL S CG1 1 
ATOM   5366  C CG2 . VAL A 1 700 ? 64.970  136.634 -10.680 1.00 18.60  ? 701 VAL S CG2 1 
ATOM   5367  N N   . LEU A 1 701 ? 68.022  138.454 -13.788 1.00 31.57  ? 702 LEU S N   1 
ATOM   5368  C CA  . LEU A 1 701 ? 68.605  138.352 -15.110 1.00 31.57  ? 702 LEU S CA  1 
ATOM   5369  C C   . LEU A 1 701 ? 70.003  137.781 -14.984 1.00 31.57  ? 702 LEU S C   1 
ATOM   5370  O O   . LEU A 1 701 ? 70.399  136.937 -15.798 1.00 7.97   ? 702 LEU S O   1 
ATOM   5371  C CB  . LEU A 1 701 ? 68.647  139.711 -15.814 1.00 7.97   ? 702 LEU S CB  1 
ATOM   5372  C CG  . LEU A 1 701 ? 68.357  139.675 -17.324 1.00 7.97   ? 702 LEU S CG  1 
ATOM   5373  C CD1 . LEU A 1 701 ? 67.482  138.474 -17.696 1.00 7.97   ? 702 LEU S CD1 1 
ATOM   5374  C CD2 . LEU A 1 701 ? 67.666  140.942 -17.731 1.00 7.97   ? 702 LEU S CD2 1 
ATOM   5375  N N   . GLU A 1 702 ? 70.748  138.224 -13.965 1.00 15.99  ? 703 GLU S N   1 
ATOM   5376  C CA  . GLU A 1 702 ? 72.102  137.716 -13.748 1.00 15.99  ? 703 GLU S CA  1 
ATOM   5377  C C   . GLU A 1 702 ? 72.088  136.223 -13.389 1.00 15.99  ? 703 GLU S C   1 
ATOM   5378  O O   . GLU A 1 702 ? 72.825  135.428 -13.965 1.00 100.00 ? 703 GLU S O   1 
ATOM   5379  C CB  . GLU A 1 702 ? 72.808  138.485 -12.625 1.00 100.00 ? 703 GLU S CB  1 
ATOM   5380  C CG  . GLU A 1 702 ? 74.353  138.380 -12.670 1.00 100.00 ? 703 GLU S CG  1 
ATOM   5381  C CD  . GLU A 1 702 ? 74.939  137.178 -11.886 1.00 100.00 ? 703 GLU S CD  1 
ATOM   5382  O OE1 . GLU A 1 702 ? 74.164  136.441 -11.228 1.00 100.00 ? 703 GLU S OE1 1 
ATOM   5383  O OE2 . GLU A 1 702 ? 76.183  136.974 -11.933 1.00 100.00 ? 703 GLU S OE2 1 
ATOM   5384  N N   . GLN A 1 703 ? 71.267  135.857 -12.416 1.00 2.00   ? 704 GLN S N   1 
ATOM   5385  C CA  . GLN A 1 703 ? 71.168  134.477 -12.011 1.00 2.00   ? 704 GLN S CA  1 
ATOM   5386  C C   . GLN A 1 703 ? 71.049  133.622 -13.259 1.00 2.00   ? 704 GLN S C   1 
ATOM   5387  O O   . GLN A 1 703 ? 71.800  132.689 -13.440 1.00 13.24  ? 704 GLN S O   1 
ATOM   5388  C CB  . GLN A 1 703 ? 69.938  134.282 -11.136 1.00 13.24  ? 704 GLN S CB  1 
ATOM   5389  C CG  . GLN A 1 703 ? 70.246  134.066 -9.662  1.00 13.24  ? 704 GLN S CG  1 
ATOM   5390  C CD  . GLN A 1 703 ? 69.187  134.668 -8.760  1.00 13.24  ? 704 GLN S CD  1 
ATOM   5391  O OE1 . GLN A 1 703 ? 68.574  133.985 -7.947  1.00 13.24  ? 704 GLN S OE1 1 
ATOM   5392  N NE2 . GLN A 1 703 ? 68.964  135.956 -8.911  1.00 13.24  ? 704 GLN S NE2 1 
ATOM   5393  N N   . LEU A 1 704 ? 70.103  133.941 -14.127 1.00 6.51   ? 705 LEU S N   1 
ATOM   5394  C CA  . LEU A 1 704 ? 69.937  133.178 -15.351 1.00 6.51   ? 705 LEU S CA  1 
ATOM   5395  C C   . LEU A 1 704 ? 71.211  133.245 -16.211 1.00 6.51   ? 705 LEU S C   1 
ATOM   5396  O O   . LEU A 1 704 ? 71.361  132.500 -17.195 1.00 16.79  ? 705 LEU S O   1 
ATOM   5397  C CB  . LEU A 1 704 ? 68.739  133.724 -16.136 1.00 16.79  ? 705 LEU S CB  1 
ATOM   5398  C CG  . LEU A 1 704 ? 67.326  133.543 -15.548 1.00 16.79  ? 705 LEU S CG  1 
ATOM   5399  C CD1 . LEU A 1 704 ? 66.358  133.772 -16.688 1.00 16.79  ? 705 LEU S CD1 1 
ATOM   5400  C CD2 . LEU A 1 704 ? 67.087  132.155 -14.950 1.00 16.79  ? 705 LEU S CD2 1 
ATOM   5401  N N   . ARG A 1 705 ? 72.126  134.142 -15.842 1.00 26.06  ? 706 ARG S N   1 
ATOM   5402  C CA  . ARG A 1 705 ? 73.377  134.307 -16.576 1.00 26.06  ? 706 ARG S CA  1 
ATOM   5403  C C   . ARG A 1 705 ? 74.489  133.408 -16.021 1.00 26.06  ? 706 ARG S C   1 
ATOM   5404  O O   . ARG A 1 705 ? 75.063  132.595 -16.742 1.00 100.00 ? 706 ARG S O   1 
ATOM   5405  C CB  . ARG A 1 705 ? 73.823  135.765 -16.525 1.00 100.00 ? 706 ARG S CB  1 
ATOM   5406  C CG  . ARG A 1 705 ? 72.946  136.690 -17.323 1.00 100.00 ? 706 ARG S CG  1 
ATOM   5407  C CD  . ARG A 1 705 ? 73.687  137.967 -17.674 1.00 100.00 ? 706 ARG S CD  1 
ATOM   5408  N NE  . ARG A 1 705 ? 73.709  138.200 -19.119 1.00 100.00 ? 706 ARG S NE  1 
ATOM   5409  C CZ  . ARG A 1 705 ? 74.820  138.353 -19.842 1.00 100.00 ? 706 ARG S CZ  1 
ATOM   5410  N NH1 . ARG A 1 705 ? 76.013  138.301 -19.253 1.00 100.00 ? 706 ARG S NH1 1 
ATOM   5411  N NH2 . ARG A 1 705 ? 74.737  138.548 -21.159 1.00 100.00 ? 706 ARG S NH2 1 
ATOM   5412  N N   . CYS A 1 706 ? 74.780  133.556 -14.735 1.00 29.91  ? 707 CYS S N   1 
ATOM   5413  C CA  . CYS A 1 706 ? 75.830  132.781 -14.080 1.00 29.91  ? 707 CYS S CA  1 
ATOM   5414  C C   . CYS A 1 706 ? 75.479  131.304 -13.862 1.00 29.91  ? 707 CYS S C   1 
ATOM   5415  O O   . CYS A 1 706 ? 76.345  130.507 -13.486 1.00 47.91  ? 707 CYS S O   1 
ATOM   5416  C CB  . CYS A 1 706 ? 76.194  133.430 -12.732 1.00 47.91  ? 707 CYS S CB  1 
ATOM   5417  S SG  . CYS A 1 706 ? 75.159  132.966 -11.303 1.00 47.91  ? 707 CYS S SG  1 
ATOM   5418  N N   . ASN A 1 707 ? 74.217  130.949 -14.110 1.00 2.00   ? 708 ASN S N   1 
ATOM   5419  C CA  . ASN A 1 707 ? 73.728  129.582 -13.922 1.00 2.00   ? 708 ASN S CA  1 
ATOM   5420  C C   . ASN A 1 707 ? 73.738  128.764 -15.205 1.00 2.00   ? 708 ASN S C   1 
ATOM   5421  O O   . ASN A 1 707 ? 73.642  127.539 -15.178 1.00 47.19  ? 708 ASN S O   1 
ATOM   5422  C CB  . ASN A 1 707 ? 72.319  129.611 -13.335 1.00 47.19  ? 708 ASN S CB  1 
ATOM   5423  C CG  . ASN A 1 707 ? 72.313  129.330 -11.840 1.00 47.19  ? 708 ASN S CG  1 
ATOM   5424  O OD1 . ASN A 1 707 ? 72.578  128.203 -11.412 1.00 47.19  ? 708 ASN S OD1 1 
ATOM   5425  N ND2 . ASN A 1 707 ? 72.013  130.356 -11.036 1.00 47.19  ? 708 ASN S ND2 1 
ATOM   5426  N N   . GLY A 1 708 ? 73.867  129.462 -16.328 1.00 29.97  ? 709 GLY S N   1 
ATOM   5427  C CA  . GLY A 1 708 ? 73.923  128.802 -17.617 1.00 29.97  ? 709 GLY S CA  1 
ATOM   5428  C C   . GLY A 1 708 ? 72.597  128.335 -18.178 1.00 29.97  ? 709 GLY S C   1 
ATOM   5429  O O   . GLY A 1 708 ? 72.551  127.392 -18.967 1.00 48.23  ? 709 GLY S O   1 
ATOM   5430  N N   . VAL A 1 709 ? 71.513  129.008 -17.802 1.00 15.39  ? 710 VAL S N   1 
ATOM   5431  C CA  . VAL A 1 709 ? 70.183  128.622 -18.275 1.00 15.39  ? 710 VAL S CA  1 
ATOM   5432  C C   . VAL A 1 709 ? 70.069  128.596 -19.777 1.00 15.39  ? 710 VAL S C   1 
ATOM   5433  O O   . VAL A 1 709 ? 69.879  127.542 -20.359 1.00 2.00   ? 710 VAL S O   1 
ATOM   5434  C CB  . VAL A 1 709 ? 69.091  129.539 -17.729 1.00 2.00   ? 710 VAL S CB  1 
ATOM   5435  C CG1 . VAL A 1 709 ? 67.763  129.059 -18.198 1.00 2.00   ? 710 VAL S CG1 1 
ATOM   5436  C CG2 . VAL A 1 709 ? 69.128  129.537 -16.207 1.00 2.00   ? 710 VAL S CG2 1 
ATOM   5437  N N   . LEU A 1 710 ? 70.196  129.748 -20.413 1.00 2.00   ? 711 LEU S N   1 
ATOM   5438  C CA  . LEU A 1 710 ? 70.079  129.791 -21.857 1.00 2.00   ? 711 LEU S CA  1 
ATOM   5439  C C   . LEU A 1 710 ? 70.826  128.667 -22.560 1.00 2.00   ? 711 LEU S C   1 
ATOM   5440  O O   . LEU A 1 710 ? 70.218  127.878 -23.282 1.00 25.70  ? 711 LEU S O   1 
ATOM   5441  C CB  . LEU A 1 710 ? 70.569  131.133 -22.373 1.00 25.70  ? 711 LEU S CB  1 
ATOM   5442  C CG  . LEU A 1 710 ? 69.648  132.312 -22.061 1.00 25.70  ? 711 LEU S CG  1 
ATOM   5443  C CD1 . LEU A 1 710 ? 68.331  132.149 -22.822 1.00 25.70  ? 711 LEU S CD1 1 
ATOM   5444  C CD2 . LEU A 1 710 ? 69.427  132.410 -20.550 1.00 25.70  ? 711 LEU S CD2 1 
ATOM   5445  N N   . GLU A 1 711 ? 72.145  128.607 -22.358 1.00 2.00   ? 712 GLU S N   1 
ATOM   5446  C CA  . GLU A 1 711 ? 72.978  127.585 -22.970 1.00 2.00   ? 712 GLU S CA  1 
ATOM   5447  C C   . GLU A 1 711 ? 72.374  126.261 -22.599 1.00 2.00   ? 712 GLU S C   1 
ATOM   5448  O O   . GLU A 1 711 ? 72.203  125.389 -23.437 1.00 51.55  ? 712 GLU S O   1 
ATOM   5449  C CB  . GLU A 1 711 ? 74.400  127.660 -22.444 1.00 51.55  ? 712 GLU S CB  1 
ATOM   5450  C CG  . GLU A 1 711 ? 74.958  129.054 -22.435 1.00 51.55  ? 712 GLU S CG  1 
ATOM   5451  C CD  . GLU A 1 711 ? 74.459  129.857 -21.260 1.00 51.55  ? 712 GLU S CD  1 
ATOM   5452  O OE1 . GLU A 1 711 ? 73.490  129.417 -20.606 1.00 51.55  ? 712 GLU S OE1 1 
ATOM   5453  O OE2 . GLU A 1 711 ? 75.039  130.930 -20.988 1.00 51.55  ? 712 GLU S OE2 1 
ATOM   5454  N N   . GLY A 1 712 ? 72.028  126.132 -21.328 1.00 61.42  ? 713 GLY S N   1 
ATOM   5455  C CA  . GLY A 1 712 ? 71.424  124.905 -20.856 1.00 61.42  ? 713 GLY S CA  1 
ATOM   5456  C C   . GLY A 1 712 ? 70.220  124.518 -21.695 1.00 61.42  ? 713 GLY S C   1 
ATOM   5457  O O   . GLY A 1 712 ? 69.757  123.374 -21.664 1.00 2.00   ? 713 GLY S O   1 
ATOM   5458  N N   . ILE A 1 713 ? 69.714  125.466 -22.469 1.00 13.02  ? 714 ILE S N   1 
ATOM   5459  C CA  . ILE A 1 713 ? 68.553  125.191 -23.301 1.00 13.02  ? 714 ILE S CA  1 
ATOM   5460  C C   . ILE A 1 713 ? 68.922  125.016 -24.780 1.00 13.02  ? 714 ILE S C   1 
ATOM   5461  O O   . ILE A 1 713 ? 68.294  124.221 -25.496 1.00 2.00   ? 714 ILE S O   1 
ATOM   5462  C CB  . ILE A 1 713 ? 67.482  126.311 -23.136 1.00 2.00   ? 714 ILE S CB  1 
ATOM   5463  C CG1 . ILE A 1 713 ? 66.842  126.210 -21.746 1.00 2.00   ? 714 ILE S CG1 1 
ATOM   5464  C CG2 . ILE A 1 713 ? 66.390  126.155 -24.161 1.00 2.00   ? 714 ILE S CG2 1 
ATOM   5465  C CD1 . ILE A 1 713 ? 66.377  127.531 -21.170 1.00 2.00   ? 714 ILE S CD1 1 
ATOM   5466  N N   . ARG A 1 714 ? 69.955  125.741 -25.226 1.00 2.69   ? 715 ARG S N   1 
ATOM   5467  C CA  . ARG A 1 714 ? 70.382  125.669 -26.621 1.00 2.69   ? 715 ARG S CA  1 
ATOM   5468  C C   . ARG A 1 714 ? 70.609  124.218 -27.064 1.00 2.69   ? 715 ARG S C   1 
ATOM   5469  O O   . ARG A 1 714 ? 70.074  123.774 -28.089 1.00 52.17  ? 715 ARG S O   1 
ATOM   5470  C CB  . ARG A 1 714 ? 71.646  126.512 -26.835 1.00 52.17  ? 715 ARG S CB  1 
ATOM   5471  C CG  . ARG A 1 714 ? 71.359  127.910 -27.381 1.00 52.17  ? 715 ARG S CG  1 
ATOM   5472  C CD  . ARG A 1 714 ? 72.457  128.415 -28.319 1.00 52.17  ? 715 ARG S CD  1 
ATOM   5473  N NE  . ARG A 1 714 ? 72.482  127.699 -29.599 1.00 52.17  ? 715 ARG S NE  1 
ATOM   5474  C CZ  . ARG A 1 714 ? 73.515  127.705 -30.449 1.00 52.17  ? 715 ARG S CZ  1 
ATOM   5475  N NH1 . ARG A 1 714 ? 74.633  128.390 -30.176 1.00 52.17  ? 715 ARG S NH1 1 
ATOM   5476  N NH2 . ARG A 1 714 ? 73.519  127.043 -31.615 1.00 52.17  ? 715 ARG S NH2 1 
ATOM   5477  N N   . ILE A 1 715 ? 71.391  123.487 -26.292 1.00 2.00   ? 716 ILE S N   1 
ATOM   5478  C CA  . ILE A 1 715 ? 71.714  122.090 -26.633 1.00 2.00   ? 716 ILE S CA  1 
ATOM   5479  C C   . ILE A 1 715 ? 70.450  121.211 -26.671 1.00 2.00   ? 716 ILE S C   1 
ATOM   5480  O O   . ILE A 1 715 ? 70.346  120.272 -27.469 1.00 7.91   ? 716 ILE S O   1 
ATOM   5481  C CB  . ILE A 1 715 ? 72.701  121.491 -25.638 1.00 7.91   ? 716 ILE S CB  1 
ATOM   5482  C CG1 . ILE A 1 715 ? 73.203  120.111 -26.079 1.00 7.91   ? 716 ILE S CG1 1 
ATOM   5483  C CG2 . ILE A 1 715 ? 72.105  121.309 -24.245 1.00 7.91   ? 716 ILE S CG2 1 
ATOM   5484  C CD1 . ILE A 1 715 ? 73.824  120.117 -27.480 1.00 7.91   ? 716 ILE S CD1 1 
ATOM   5485  N N   . CYS A 1 716 ? 69.489  121.499 -25.807 1.00 30.59  ? 717 CYS S N   1 
ATOM   5486  C CA  . CYS A 1 716 ? 68.220  120.733 -25.790 1.00 30.59  ? 717 CYS S CA  1 
ATOM   5487  C C   . CYS A 1 716 ? 67.514  120.938 -27.130 1.00 30.59  ? 717 CYS S C   1 
ATOM   5488  O O   . CYS A 1 716 ? 66.830  120.052 -27.632 1.00 82.63  ? 717 CYS S O   1 
ATOM   5489  C CB  . CYS A 1 716 ? 67.313  121.224 -24.663 1.00 82.63  ? 717 CYS S CB  1 
ATOM   5490  S SG  . CYS A 1 716 ? 68.149  121.217 -23.006 1.00 82.63  ? 717 CYS S SG  1 
ATOM   5491  N N   . ARG A 1 717 ? 67.692  122.125 -27.703 1.00 15.45  ? 718 ARG S N   1 
ATOM   5492  C CA  . ARG A 1 717 ? 67.104  122.430 -28.981 1.00 15.45  ? 718 ARG S CA  1 
ATOM   5493  C C   . ARG A 1 717 ? 68.119  122.057 -30.063 1.00 15.45  ? 718 ARG S C   1 
ATOM   5494  O O   . ARG A 1 717 ? 67.768  121.418 -31.063 1.00 79.42  ? 718 ARG S O   1 
ATOM   5495  C CB  . ARG A 1 717 ? 66.722  123.916 -29.032 1.00 79.42  ? 718 ARG S CB  1 
ATOM   5496  C CG  . ARG A 1 717 ? 67.757  124.874 -29.625 1.00 79.42  ? 718 ARG S CG  1 
ATOM   5497  C CD  . ARG A 1 717 ? 67.072  126.101 -30.280 1.00 79.42  ? 718 ARG S CD  1 
ATOM   5498  N NE  . ARG A 1 717 ? 67.870  127.331 -30.201 1.00 79.42  ? 718 ARG S NE  1 
ATOM   5499  C CZ  . ARG A 1 717 ? 68.167  128.116 -31.237 1.00 79.42  ? 718 ARG S CZ  1 
ATOM   5500  N NH1 . ARG A 1 717 ? 67.736  127.809 -32.454 1.00 79.42  ? 718 ARG S NH1 1 
ATOM   5501  N NH2 . ARG A 1 717 ? 68.898  129.208 -31.053 1.00 79.42  ? 718 ARG S NH2 1 
ATOM   5502  N N   . GLN A 1 718 ? 69.380  122.428 -29.847 1.00 2.00   ? 719 GLN S N   1 
ATOM   5503  C CA  . GLN A 1 718 ? 70.440  122.141 -30.792 1.00 2.00   ? 719 GLN S CA  1 
ATOM   5504  C C   . GLN A 1 718 ? 70.737  120.656 -30.989 1.00 2.00   ? 719 GLN S C   1 
ATOM   5505  O O   . GLN A 1 718 ? 70.578  120.124 -32.087 1.00 28.38  ? 719 GLN S O   1 
ATOM   5506  C CB  . GLN A 1 718 ? 71.714  122.846 -30.356 1.00 28.38  ? 719 GLN S CB  1 
ATOM   5507  C CG  . GLN A 1 718 ? 71.575  124.341 -30.248 1.00 28.38  ? 719 GLN S CG  1 
ATOM   5508  C CD  . GLN A 1 718 ? 71.259  124.965 -31.563 1.00 28.38  ? 719 GLN S CD  1 
ATOM   5509  O OE1 . GLN A 1 718 ? 71.005  126.158 -31.644 1.00 28.38  ? 719 GLN S OE1 1 
ATOM   5510  N NE2 . GLN A 1 718 ? 71.272  124.159 -32.618 1.00 28.38  ? 719 GLN S NE2 1 
ATOM   5511  N N   . GLY A 1 719 ? 71.170  119.995 -29.921 1.00 10.90  ? 720 GLY S N   1 
ATOM   5512  C CA  . GLY A 1 719 ? 71.529  118.584 -29.989 1.00 10.90  ? 720 GLY S CA  1 
ATOM   5513  C C   . GLY A 1 719 ? 70.409  117.577 -29.841 1.00 10.90  ? 720 GLY S C   1 
ATOM   5514  O O   . GLY A 1 719 ? 69.253  117.926 -29.979 1.00 2.51   ? 720 GLY S O   1 
ATOM   5515  N N   . PHE A 1 720 ? 70.761  116.330 -29.543 1.00 2.00   ? 721 PHE S N   1 
ATOM   5516  C CA  . PHE A 1 720 ? 69.793  115.258 -29.401 1.00 2.00   ? 721 PHE S CA  1 
ATOM   5517  C C   . PHE A 1 720 ? 69.900  114.636 -28.017 1.00 2.00   ? 721 PHE S C   1 
ATOM   5518  O O   . PHE A 1 720 ? 70.487  113.578 -27.873 1.00 2.00   ? 721 PHE S O   1 
ATOM   5519  C CB  . PHE A 1 720 ? 70.084  114.206 -30.453 1.00 2.00   ? 721 PHE S CB  1 
ATOM   5520  C CG  . PHE A 1 720 ? 70.356  114.775 -31.813 1.00 2.00   ? 721 PHE S CG  1 
ATOM   5521  C CD1 . PHE A 1 720 ? 71.306  115.761 -31.991 1.00 2.00   ? 721 PHE S CD1 1 
ATOM   5522  C CD2 . PHE A 1 720 ? 69.687  114.289 -32.935 1.00 2.00   ? 721 PHE S CD2 1 
ATOM   5523  C CE1 . PHE A 1 720 ? 71.585  116.247 -33.246 1.00 2.00   ? 721 PHE S CE1 1 
ATOM   5524  C CE2 . PHE A 1 720 ? 69.961  114.768 -34.204 1.00 2.00   ? 721 PHE S CE2 1 
ATOM   5525  C CZ  . PHE A 1 720 ? 70.909  115.745 -34.359 1.00 2.00   ? 721 PHE S CZ  1 
ATOM   5526  N N   . PRO A 1 721 ? 69.277  115.250 -26.994 1.00 2.00   ? 722 PRO S N   1 
ATOM   5527  C CA  . PRO A 1 721 ? 69.303  114.795 -25.594 1.00 2.00   ? 722 PRO S CA  1 
ATOM   5528  C C   . PRO A 1 721 ? 68.713  113.456 -25.260 1.00 2.00   ? 722 PRO S C   1 
ATOM   5529  O O   . PRO A 1 721 ? 68.683  113.068 -24.091 1.00 23.01  ? 722 PRO S O   1 
ATOM   5530  C CB  . PRO A 1 721 ? 68.602  115.906 -24.823 1.00 23.01  ? 722 PRO S CB  1 
ATOM   5531  C CG  . PRO A 1 721 ? 68.494  117.038 -25.767 1.00 23.01  ? 722 PRO S CG  1 
ATOM   5532  C CD  . PRO A 1 721 ? 68.444  116.444 -27.143 1.00 23.01  ? 722 PRO S CD  1 
ATOM   5533  N N   . ASN A 1 722 ? 68.240  112.746 -26.276 1.00 2.00   ? 723 ASN S N   1 
ATOM   5534  C CA  . ASN A 1 722 ? 67.665  111.425 -26.074 1.00 2.00   ? 723 ASN S CA  1 
ATOM   5535  C C   . ASN A 1 722 ? 68.361  110.444 -26.973 1.00 2.00   ? 723 ASN S C   1 
ATOM   5536  O O   . ASN A 1 722 ? 68.580  110.722 -28.150 1.00 40.01  ? 723 ASN S O   1 
ATOM   5537  C CB  . ASN A 1 722 ? 66.176  111.433 -26.377 1.00 40.01  ? 723 ASN S CB  1 
ATOM   5538  C CG  . ASN A 1 722 ? 65.360  111.812 -25.181 1.00 40.01  ? 723 ASN S CG  1 
ATOM   5539  O OD1 . ASN A 1 722 ? 65.751  111.513 -24.058 1.00 40.01  ? 723 ASN S OD1 1 
ATOM   5540  N ND2 . ASN A 1 722 ? 64.223  112.482 -25.397 1.00 40.01  ? 723 ASN S ND2 1 
ATOM   5541  N N   . ARG A 1 723 ? 68.722  109.301 -26.413 1.00 2.00   ? 724 ARG S N   1 
ATOM   5542  C CA  . ARG A 1 723 ? 69.406  108.281 -27.178 1.00 2.00   ? 724 ARG S CA  1 
ATOM   5543  C C   . ARG A 1 723 ? 68.925  106.938 -26.715 1.00 2.00   ? 724 ARG S C   1 
ATOM   5544  O O   . ARG A 1 723 ? 68.552  106.785 -25.576 1.00 13.68  ? 724 ARG S O   1 
ATOM   5545  C CB  . ARG A 1 723 ? 70.908  108.381 -26.978 1.00 13.68  ? 724 ARG S CB  1 
ATOM   5546  C CG  . ARG A 1 723 ? 71.379  107.791 -25.668 1.00 13.68  ? 724 ARG S CG  1 
ATOM   5547  C CD  . ARG A 1 723 ? 72.628  108.493 -25.169 1.00 13.68  ? 724 ARG S CD  1 
ATOM   5548  N NE  . ARG A 1 723 ? 72.531  109.926 -25.387 1.00 13.68  ? 724 ARG S NE  1 
ATOM   5549  C CZ  . ARG A 1 723 ? 72.899  110.833 -24.496 1.00 13.68  ? 724 ARG S CZ  1 
ATOM   5550  N NH1 . ARG A 1 723 ? 73.390  110.435 -23.322 1.00 13.68  ? 724 ARG S NH1 1 
ATOM   5551  N NH2 . ARG A 1 723 ? 72.768  112.129 -24.771 1.00 13.68  ? 724 ARG S NH2 1 
ATOM   5552  N N   . ILE A 1 724 ? 68.949  105.965 -27.608 1.00 2.00   ? 725 ILE S N   1 
ATOM   5553  C CA  . ILE A 1 724 ? 68.475  104.646 -27.295 1.00 2.00   ? 725 ILE S CA  1 
ATOM   5554  C C   . ILE A 1 724 ? 69.233  103.671 -28.172 1.00 2.00   ? 725 ILE S C   1 
ATOM   5555  O O   . ILE A 1 724 ? 69.417  103.903 -29.353 1.00 2.00   ? 725 ILE S O   1 
ATOM   5556  C CB  . ILE A 1 724 ? 66.970  104.552 -27.578 1.00 2.00   ? 725 ILE S CB  1 
ATOM   5557  C CG1 . ILE A 1 724 ? 66.453  103.173 -27.222 1.00 2.00   ? 725 ILE S CG1 1 
ATOM   5558  C CG2 . ILE A 1 724 ? 66.698  104.827 -29.026 1.00 2.00   ? 725 ILE S CG2 1 
ATOM   5559  C CD1 . ILE A 1 724 ? 65.093  102.845 -27.823 1.00 2.00   ? 725 ILE S CD1 1 
ATOM   5560  N N   . VAL A 1 725 ? 69.684  102.581 -27.577 1.00 2.00   ? 726 VAL S N   1 
ATOM   5561  C CA  . VAL A 1 725 ? 70.433  101.549 -28.271 1.00 2.00   ? 726 VAL S CA  1 
ATOM   5562  C C   . VAL A 1 725 ? 69.608  100.673 -29.231 1.00 2.00   ? 726 VAL S C   1 
ATOM   5563  O O   . VAL A 1 725 ? 68.475  100.259 -28.943 1.00 6.24   ? 726 VAL S O   1 
ATOM   5564  C CB  . VAL A 1 725 ? 71.118  100.647 -27.257 1.00 6.24   ? 726 VAL S CB  1 
ATOM   5565  C CG1 . VAL A 1 725 ? 70.075  99.829  -26.505 1.00 6.24   ? 726 VAL S CG1 1 
ATOM   5566  C CG2 . VAL A 1 725 ? 72.096  99.756  -27.958 1.00 6.24   ? 726 VAL S CG2 1 
ATOM   5567  N N   . PHE A 1 726 ? 70.223  100.365 -30.361 1.00 2.00   ? 727 PHE S N   1 
ATOM   5568  C CA  . PHE A 1 726 ? 69.581  99.598  -31.410 1.00 2.00   ? 727 PHE S CA  1 
ATOM   5569  C C   . PHE A 1 726 ? 68.698  98.447  -31.018 1.00 2.00   ? 727 PHE S C   1 
ATOM   5570  O O   . PHE A 1 726 ? 67.808  98.098  -31.781 1.00 3.79   ? 727 PHE S O   1 
ATOM   5571  C CB  . PHE A 1 726 ? 70.614  99.071  -32.396 1.00 3.79   ? 727 PHE S CB  1 
ATOM   5572  C CG  . PHE A 1 726 ? 71.391  100.130 -33.083 1.00 3.79   ? 727 PHE S CG  1 
ATOM   5573  C CD1 . PHE A 1 726 ? 70.932  101.424 -33.132 1.00 3.79   ? 727 PHE S CD1 1 
ATOM   5574  C CD2 . PHE A 1 726 ? 72.587  99.828  -33.678 1.00 3.79   ? 727 PHE S CD2 1 
ATOM   5575  C CE1 . PHE A 1 726 ? 71.657  102.408 -33.765 1.00 3.79   ? 727 PHE S CE1 1 
ATOM   5576  C CE2 . PHE A 1 726 ? 73.319  100.795 -34.316 1.00 3.79   ? 727 PHE S CE2 1 
ATOM   5577  C CZ  . PHE A 1 726 ? 72.858  102.095 -34.363 1.00 3.79   ? 727 PHE S CZ  1 
ATOM   5578  N N   . GLN A 1 727 ? 68.916  97.848  -29.861 1.00 2.00   ? 728 GLN S N   1 
ATOM   5579  C CA  . GLN A 1 727 ? 68.112  96.689  -29.488 1.00 2.00   ? 728 GLN S CA  1 
ATOM   5580  C C   . GLN A 1 727 ? 66.832  97.068  -28.798 1.00 2.00   ? 728 GLN S C   1 
ATOM   5581  O O   . GLN A 1 727 ? 65.758  96.578  -29.133 1.00 62.85  ? 728 GLN S O   1 
ATOM   5582  C CB  . GLN A 1 727 ? 68.911  95.754  -28.592 1.00 62.85  ? 728 GLN S CB  1 
ATOM   5583  C CG  . GLN A 1 727 ? 68.092  95.104  -27.499 1.00 62.85  ? 728 GLN S CG  1 
ATOM   5584  C CD  . GLN A 1 727 ? 67.091  94.104  -28.042 1.00 62.85  ? 728 GLN S CD  1 
ATOM   5585  O OE1 . GLN A 1 727 ? 66.684  93.168  -27.341 1.00 62.85  ? 728 GLN S OE1 1 
ATOM   5586  N NE2 . GLN A 1 727 ? 66.689  94.293  -29.295 1.00 62.85  ? 728 GLN S NE2 1 
ATOM   5587  N N   . GLU A 1 728 ? 66.951  97.952  -27.830 1.00 2.00   ? 729 GLU S N   1 
ATOM   5588  C CA  . GLU A 1 728 ? 65.781  98.375  -27.105 1.00 2.00   ? 729 GLU S CA  1 
ATOM   5589  C C   . GLU A 1 728 ? 64.829  99.124  -28.033 1.00 2.00   ? 729 GLU S C   1 
ATOM   5590  O O   . GLU A 1 728 ? 63.619  99.139  -27.801 1.00 99.82  ? 729 GLU S O   1 
ATOM   5591  C CB  . GLU A 1 728 ? 66.193  99.248  -25.921 1.00 99.82  ? 729 GLU S CB  1 
ATOM   5592  C CG  . GLU A 1 728 ? 66.185  98.492  -24.592 1.00 99.82  ? 729 GLU S CG  1 
ATOM   5593  C CD  . GLU A 1 728 ? 67.575  98.091  -24.112 1.00 99.82  ? 729 GLU S CD  1 
ATOM   5594  O OE1 . GLU A 1 728 ? 68.351  98.995  -23.721 1.00 99.82  ? 729 GLU S OE1 1 
ATOM   5595  O OE2 . GLU A 1 728 ? 67.887  96.874  -24.117 1.00 99.82  ? 729 GLU S OE2 1 
ATOM   5596  N N   . PHE A 1 729 ? 65.363  99.719  -29.092 1.00 13.52  ? 730 PHE S N   1 
ATOM   5597  C CA  . PHE A 1 729 ? 64.512  100.438 -30.030 1.00 13.52  ? 730 PHE S CA  1 
ATOM   5598  C C   . PHE A 1 729 ? 63.699  99.502  -30.927 1.00 13.52  ? 730 PHE S C   1 
ATOM   5599  O O   . PHE A 1 729 ? 62.492  99.684  -31.092 1.00 4.70   ? 730 PHE S O   1 
ATOM   5600  C CB  . PHE A 1 729 ? 65.333  101.389 -30.905 1.00 4.70   ? 730 PHE S CB  1 
ATOM   5601  C CG  . PHE A 1 729 ? 64.497  102.258 -31.805 1.00 4.70   ? 730 PHE S CG  1 
ATOM   5602  C CD1 . PHE A 1 729 ? 64.021  101.774 -33.010 1.00 4.70   ? 730 PHE S CD1 1 
ATOM   5603  C CD2 . PHE A 1 729 ? 64.151  103.542 -31.434 1.00 4.70   ? 730 PHE S CD2 1 
ATOM   5604  C CE1 . PHE A 1 729 ? 63.210  102.557 -33.824 1.00 4.70   ? 730 PHE S CE1 1 
ATOM   5605  C CE2 . PHE A 1 729 ? 63.346  104.321 -32.242 1.00 4.70   ? 730 PHE S CE2 1 
ATOM   5606  C CZ  . PHE A 1 729 ? 62.875  103.832 -33.432 1.00 4.70   ? 730 PHE S CZ  1 
ATOM   5607  N N   . ARG A 1 730 ? 64.344  98.509  -31.520 1.00 2.00   ? 731 ARG S N   1 
ATOM   5608  C CA  . ARG A 1 730 ? 63.625  97.586  -32.379 1.00 2.00   ? 731 ARG S CA  1 
ATOM   5609  C C   . ARG A 1 730 ? 62.771  96.694  -31.483 1.00 2.00   ? 731 ARG S C   1 
ATOM   5610  O O   . ARG A 1 730 ? 61.962  95.877  -31.957 1.00 2.00   ? 731 ARG S O   1 
ATOM   5611  C CB  . ARG A 1 730 ? 64.617  96.762  -33.214 1.00 2.00   ? 731 ARG S CB  1 
ATOM   5612  C CG  . ARG A 1 730 ? 64.402  95.260  -33.211 1.00 2.00   ? 731 ARG S CG  1 
ATOM   5613  C CD  . ARG A 1 730 ? 63.402  94.830  -34.270 1.00 2.00   ? 731 ARG S CD  1 
ATOM   5614  N NE  . ARG A 1 730 ? 63.469  93.395  -34.550 1.00 2.00   ? 731 ARG S NE  1 
ATOM   5615  C CZ  . ARG A 1 730 ? 64.584  92.733  -34.873 1.00 2.00   ? 731 ARG S CZ  1 
ATOM   5616  N NH1 . ARG A 1 730 ? 65.754  93.361  -34.959 1.00 2.00   ? 731 ARG S NH1 1 
ATOM   5617  N NH2 . ARG A 1 730 ? 64.529  91.433  -35.137 1.00 2.00   ? 731 ARG S NH2 1 
ATOM   5618  N N   . GLN A 1 731 ? 62.940  96.879  -30.173 1.00 2.00   ? 732 GLN S N   1 
ATOM   5619  C CA  . GLN A 1 731 ? 62.214  96.102  -29.171 1.00 2.00   ? 732 GLN S CA  1 
ATOM   5620  C C   . GLN A 1 731 ? 60.905  96.765  -28.742 1.00 2.00   ? 732 GLN S C   1 
ATOM   5621  O O   . GLN A 1 731 ? 59.834  96.170  -28.850 1.00 52.18  ? 732 GLN S O   1 
ATOM   5622  C CB  . GLN A 1 731 ? 63.095  95.895  -27.940 1.00 52.18  ? 732 GLN S CB  1 
ATOM   5623  C CG  . GLN A 1 731 ? 62.349  95.363  -26.731 1.00 52.18  ? 732 GLN S CG  1 
ATOM   5624  C CD  . GLN A 1 731 ? 61.976  93.898  -26.887 1.00 52.18  ? 732 GLN S CD  1 
ATOM   5625  O OE1 . GLN A 1 731 ? 62.279  93.273  -27.911 1.00 52.18  ? 732 GLN S OE1 1 
ATOM   5626  N NE2 . GLN A 1 731 ? 61.319  93.343  -25.872 1.00 52.18  ? 732 GLN S NE2 1 
ATOM   5627  N N   . ARG A 1 732 ? 61.012  97.999  -28.256 1.00 2.00   ? 733 ARG S N   1 
ATOM   5628  C CA  . ARG A 1 732 ? 59.862  98.762  -27.791 1.00 2.00   ? 733 ARG S CA  1 
ATOM   5629  C C   . ARG A 1 732 ? 58.852  99.114  -28.884 1.00 2.00   ? 733 ARG S C   1 
ATOM   5630  O O   . ARG A 1 732 ? 57.657  98.850  -28.741 1.00 72.68  ? 733 ARG S O   1 
ATOM   5631  C CB  . ARG A 1 732 ? 60.338  100.045 -27.102 1.00 72.68  ? 733 ARG S CB  1 
ATOM   5632  C CG  . ARG A 1 732 ? 59.367  100.595 -26.059 1.00 72.68  ? 733 ARG S CG  1 
ATOM   5633  C CD  . ARG A 1 732 ? 60.059  100.877 -24.729 1.00 72.68  ? 733 ARG S CD  1 
ATOM   5634  N NE  . ARG A 1 732 ? 59.125  101.329 -23.697 1.00 72.68  ? 733 ARG S NE  1 
ATOM   5635  C CZ  . ARG A 1 732 ? 58.427  100.520 -22.896 1.00 72.68  ? 733 ARG S CZ  1 
ATOM   5636  N NH1 . ARG A 1 732 ? 58.550  99.204  -23.002 1.00 72.68  ? 733 ARG S NH1 1 
ATOM   5637  N NH2 . ARG A 1 732 ? 57.617  101.028 -21.976 1.00 72.68  ? 733 ARG S NH2 1 
ATOM   5638  N N   . TYR A 1 733 ? 59.358  99.694  -29.975 1.00 3.30   ? 734 TYR S N   1 
ATOM   5639  C CA  . TYR A 1 733 ? 58.532  100.142 -31.097 1.00 3.30   ? 734 TYR S CA  1 
ATOM   5640  C C   . TYR A 1 733 ? 58.497  99.290  -32.358 1.00 3.30   ? 734 TYR S C   1 
ATOM   5641  O O   . TYR A 1 733 ? 58.355  99.815  -33.474 1.00 26.78  ? 734 TYR S O   1 
ATOM   5642  C CB  . TYR A 1 733 ? 58.977  101.534 -31.489 1.00 26.78  ? 734 TYR S CB  1 
ATOM   5643  C CG  . TYR A 1 733 ? 59.291  102.401 -30.276 1.00 26.78  ? 734 TYR S CG  1 
ATOM   5644  C CD1 . TYR A 1 733 ? 58.412  102.413 -29.188 1.00 26.78  ? 734 TYR S CD1 1 
ATOM   5645  C CD2 . TYR A 1 733 ? 60.455  103.172 -30.252 1.00 26.78  ? 734 TYR S CD2 1 
ATOM   5646  C CE1 . TYR A 1 733 ? 58.701  103.200 -28.069 1.00 26.78  ? 734 TYR S CE1 1 
ATOM   5647  C CE2 . TYR A 1 733 ? 60.744  103.959 -29.133 1.00 26.78  ? 734 TYR S CE2 1 
ATOM   5648  C CZ  . TYR A 1 733 ? 59.866  103.972 -28.041 1.00 26.78  ? 734 TYR S CZ  1 
ATOM   5649  O OH  . TYR A 1 733 ? 60.148  104.735 -26.954 1.00 26.78  ? 734 TYR S OH  1 
ATOM   5650  N N   . GLU A 1 734 ? 58.581  98.000  -32.215 1.00 2.00   ? 735 GLU S N   1 
ATOM   5651  C CA  . GLU A 1 734 ? 58.432  97.138  -33.385 1.00 2.00   ? 735 GLU S CA  1 
ATOM   5652  C C   . GLU A 1 734 ? 56.945  97.020  -33.694 1.00 2.00   ? 735 GLU S C   1 
ATOM   5653  O O   . GLU A 1 734 ? 56.531  96.956  -34.858 1.00 48.81  ? 735 GLU S O   1 
ATOM   5654  C CB  . GLU A 1 734 ? 58.997  95.748  -33.129 1.00 48.81  ? 735 GLU S CB  1 
ATOM   5655  C CG  . GLU A 1 734 ? 58.401  94.695  -34.076 1.00 48.81  ? 735 GLU S CG  1 
ATOM   5656  C CD  . GLU A 1 734 ? 59.461  93.929  -34.871 1.00 48.81  ? 735 GLU S CD  1 
ATOM   5657  O OE1 . GLU A 1 734 ? 60.544  93.541  -34.286 1.00 48.81  ? 735 GLU S OE1 1 
ATOM   5658  O OE2 . GLU A 1 734 ? 59.271  93.667  -36.118 1.00 48.81  ? 735 GLU S OE2 1 
ATOM   5659  N N   . ILE A 1 735 ? 56.176  97.007  -32.616 1.00 32.86  ? 736 ILE S N   1 
ATOM   5660  C CA  . ILE A 1 735 ? 54.721  96.885  -32.702 1.00 32.86  ? 736 ILE S CA  1 
ATOM   5661  C C   . ILE A 1 735 ? 54.148  97.951  -33.621 1.00 32.86  ? 736 ILE S C   1 
ATOM   5662  O O   . ILE A 1 735 ? 53.006  97.850  -34.083 1.00 26.03  ? 736 ILE S O   1 
ATOM   5663  C CB  . ILE A 1 735 ? 54.055  97.061  -31.338 1.00 26.03  ? 736 ILE S CB  1 
ATOM   5664  C CG1 . ILE A 1 735 ? 52.624  96.517  -31.331 1.00 26.03  ? 736 ILE S CG1 1 
ATOM   5665  C CG2 . ILE A 1 735 ? 53.956  98.526  -30.905 1.00 26.03  ? 736 ILE S CG2 1 
ATOM   5666  C CD1 . ILE A 1 735 ? 51.895  96.744  -30.010 1.00 26.03  ? 736 ILE S CD1 1 
ATOM   5667  N N   . LEU A 1 736 ? 54.944  98.959  -33.878 1.00 5.86   ? 737 LEU S N   1 
ATOM   5668  C CA  . LEU A 1 736 ? 54.510  100.062 -34.735 1.00 5.86   ? 737 LEU S CA  1 
ATOM   5669  C C   . LEU A 1 736 ? 54.681  99.658  -36.215 1.00 5.86   ? 737 LEU S C   1 
ATOM   5670  O O   . LEU A 1 736 ? 53.840  99.966  -37.066 1.00 5.15   ? 737 LEU S O   1 
ATOM   5671  C CB  . LEU A 1 736 ? 55.277  101.329 -34.356 1.00 5.15   ? 737 LEU S CB  1 
ATOM   5672  C CG  . LEU A 1 736 ? 54.969  101.777 -32.916 1.00 5.15   ? 737 LEU S CG  1 
ATOM   5673  C CD1 . LEU A 1 736 ? 55.091  103.288 -32.706 1.00 5.15   ? 737 LEU S CD1 1 
ATOM   5674  C CD2 . LEU A 1 736 ? 53.550  101.418 -32.458 1.00 5.15   ? 737 LEU S CD2 1 
ATOM   5675  N N   . ALA A 1 737 ? 55.764  98.957  -36.512 1.00 27.24  ? 738 ALA S N   1 
ATOM   5676  C CA  . ALA A 1 737 ? 56.029  98.470  -37.886 1.00 27.24  ? 738 ALA S CA  1 
ATOM   5677  C C   . ALA A 1 737 ? 56.239  96.954  -37.850 1.00 27.24  ? 738 ALA S C   1 
ATOM   5678  O O   . ALA A 1 737 ? 57.371  96.467  -37.756 1.00 5.39   ? 738 ALA S O   1 
ATOM   5679  C CB  . ALA A 1 737 ? 57.277  99.142  -38.460 1.00 5.39   ? 738 ALA S CB  1 
ATOM   5680  N N   . ALA A 1 738 ? 55.135  96.251  -37.926 1.00 2.00   ? 739 ALA S N   1 
ATOM   5681  C CA  . ALA A 1 738 ? 55.128  94.788  -37.843 1.00 2.00   ? 739 ALA S CA  1 
ATOM   5682  C C   . ALA A 1 738 ? 55.739  94.137  -39.092 1.00 2.00   ? 739 ALA S C   1 
ATOM   5683  O O   . ALA A 1 738 ? 56.183  92.982  -39.055 1.00 90.10  ? 739 ALA S O   1 
ATOM   5684  C CB  . ALA A 1 738 ? 53.693  94.277  -37.705 1.00 90.10  ? 739 ALA S CB  1 
ATOM   5685  N N   . ASN A 1 739 ? 55.772  94.884  -40.184 1.00 17.61  ? 740 ASN S N   1 
ATOM   5686  C CA  . ASN A 1 739 ? 56.244  94.331  -41.469 1.00 17.61  ? 740 ASN S CA  1 
ATOM   5687  C C   . ASN A 1 739 ? 57.430  95.094  -42.074 1.00 17.61  ? 740 ASN S C   1 
ATOM   5688  O O   . ASN A 1 739 ? 57.728  94.967  -43.269 1.00 84.39  ? 740 ASN S O   1 
ATOM   5689  C CB  . ASN A 1 739 ? 55.114  94.369  -42.492 1.00 84.39  ? 740 ASN S CB  1 
ATOM   5690  C CG  . ASN A 1 739 ? 53.740  94.507  -41.837 1.00 84.39  ? 740 ASN S CG  1 
ATOM   5691  O OD1 . ASN A 1 739 ? 53.148  93.507  -41.440 1.00 84.39  ? 740 ASN S OD1 1 
ATOM   5692  N ND2 . ASN A 1 739 ? 53.194  95.699  -41.699 1.00 84.39  ? 740 ASN S ND2 1 
ATOM   5693  N N   . ALA A 1 740 ? 58.107  95.877  -41.270 1.00 27.20  ? 741 ALA S N   1 
ATOM   5694  C CA  . ALA A 1 740 ? 59.287  96.616  -41.748 1.00 27.20  ? 741 ALA S CA  1 
ATOM   5695  C C   . ALA A 1 740 ? 60.480  95.672  -41.757 1.00 27.20  ? 741 ALA S C   1 
ATOM   5696  O O   . ALA A 1 740 ? 61.272  95.659  -42.686 1.00 2.42   ? 741 ALA S O   1 
ATOM   5697  C CB  . ALA A 1 740 ? 59.572  97.803  -40.827 1.00 2.42   ? 741 ALA S CB  1 
ATOM   5698  N N   . ILE A 1 741 ? 60.600  94.874  -40.709 1.00 9.85   ? 742 ILE S N   1 
ATOM   5699  C CA  . ILE A 1 741 ? 61.703  93.927  -40.600 1.00 9.85   ? 742 ILE S CA  1 
ATOM   5700  C C   . ILE A 1 741 ? 61.210  92.592  -41.103 1.00 9.85   ? 742 ILE S C   1 
ATOM   5701  O O   . ILE A 1 741 ? 60.176  92.106  -40.642 1.00 28.31  ? 742 ILE S O   1 
ATOM   5702  C CB  . ILE A 1 741 ? 62.145  93.729  -39.123 1.00 28.31  ? 742 ILE S CB  1 
ATOM   5703  C CG1 . ILE A 1 741 ? 62.886  94.963  -38.616 1.00 28.31  ? 742 ILE S CG1 1 
ATOM   5704  C CG2 . ILE A 1 741 ? 63.039  92.507  -39.002 1.00 28.31  ? 742 ILE S CG2 1 
ATOM   5705  C CD1 . ILE A 1 741 ? 61.969  96.037  -38.049 1.00 28.31  ? 742 ILE S CD1 1 
ATOM   5706  N N   . PRO A 1 742 ? 61.929  91.972  -42.046 1.00 18.15  ? 743 PRO S N   1 
ATOM   5707  C CA  . PRO A 1 742 ? 61.580  90.669  -42.626 1.00 18.15  ? 743 PRO S CA  1 
ATOM   5708  C C   . PRO A 1 742 ? 61.577  89.548  -41.580 1.00 18.15  ? 743 PRO S C   1 
ATOM   5709  O O   . PRO A 1 742 ? 62.147  89.703  -40.491 1.00 2.00   ? 743 PRO S O   1 
ATOM   5710  C CB  . PRO A 1 742 ? 62.638  90.456  -43.666 1.00 2.00   ? 743 PRO S CB  1 
ATOM   5711  C CG  . PRO A 1 742 ? 63.201  91.805  -43.911 1.00 2.00   ? 743 PRO S CG  1 
ATOM   5712  C CD  . PRO A 1 742 ? 63.142  92.522  -42.644 1.00 2.00   ? 743 PRO S CD  1 
ATOM   5713  N N   . LYS A 1 743 ? 60.932  88.428  -41.916 1.00 100.00 ? 744 LYS S N   1 
ATOM   5714  C CA  . LYS A 1 743 ? 60.820  87.285  -41.005 1.00 100.00 ? 744 LYS S CA  1 
ATOM   5715  C C   . LYS A 1 743 ? 62.180  86.773  -40.519 1.00 100.00 ? 744 LYS S C   1 
ATOM   5716  O O   . LYS A 1 743 ? 62.309  86.296  -39.380 1.00 99.86  ? 744 LYS S O   1 
ATOM   5717  C CB  . LYS A 1 743 ? 60.060  86.131  -41.679 1.00 99.86  ? 744 LYS S CB  1 
ATOM   5718  C CG  . LYS A 1 743 ? 59.614  85.049  -40.694 1.00 99.86  ? 744 LYS S CG  1 
ATOM   5719  C CD  . LYS A 1 743 ? 60.184  83.669  -41.030 1.00 99.86  ? 744 LYS S CD  1 
ATOM   5720  C CE  . LYS A 1 743 ? 59.312  82.887  -42.014 1.00 99.86  ? 744 LYS S CE  1 
ATOM   5721  N NZ  . LYS A 1 743 ? 60.096  82.176  -43.036 1.00 99.86  ? 744 LYS S NZ  1 
ATOM   5722  N N   . GLY A 1 744 ? 63.175  86.870  -41.376 1.00 2.00   ? 745 GLY S N   1 
ATOM   5723  C CA  . GLY A 1 744 ? 64.540  86.405  -41.053 1.00 2.00   ? 745 GLY S CA  1 
ATOM   5724  C C   . GLY A 1 744 ? 65.214  87.373  -40.072 1.00 2.00   ? 745 GLY S C   1 
ATOM   5725  O O   . GLY A 1 744 ? 64.669  88.429  -39.736 1.00 78.08  ? 745 GLY S O   1 
ATOM   5726  N N   . PHE A 1 745 ? 66.401  86.991  -39.627 1.00 47.06  ? 746 PHE S N   1 
ATOM   5727  C CA  . PHE A 1 745 ? 67.181  87.818  -38.692 1.00 47.06  ? 746 PHE S CA  1 
ATOM   5728  C C   . PHE A 1 745 ? 67.755  89.024  -39.429 1.00 47.06  ? 746 PHE S C   1 
ATOM   5729  O O   . PHE A 1 745 ? 67.507  89.221  -40.628 1.00 100.00 ? 746 PHE S O   1 
ATOM   5730  C CB  . PHE A 1 745 ? 68.315  87.006  -38.080 1.00 100.00 ? 746 PHE S CB  1 
ATOM   5731  C CG  . PHE A 1 745 ? 67.807  85.840  -37.241 1.00 100.00 ? 746 PHE S CG  1 
ATOM   5732  C CD1 . PHE A 1 745 ? 67.493  86.033  -35.892 1.00 100.00 ? 746 PHE S CD1 1 
ATOM   5733  C CD2 . PHE A 1 745 ? 67.654  84.584  -37.826 1.00 100.00 ? 746 PHE S CD2 1 
ATOM   5734  C CE1 . PHE A 1 745 ? 67.026  84.959  -35.127 1.00 100.00 ? 746 PHE S CE1 1 
ATOM   5735  C CE2 . PHE A 1 745 ? 67.188  83.513  -37.063 1.00 100.00 ? 746 PHE S CE2 1 
ATOM   5736  C CZ  . PHE A 1 745 ? 66.874  83.699  -35.712 1.00 100.00 ? 746 PHE S CZ  1 
ATOM   5737  N N   . MET A 1 746 ? 68.518  89.818  -38.704 1.00 48.23  ? 747 MET S N   1 
ATOM   5738  C CA  . MET A 1 746 ? 69.114  91.023  -39.279 1.00 48.23  ? 747 MET S CA  1 
ATOM   5739  C C   . MET A 1 746 ? 69.881  91.834  -38.241 1.00 48.23  ? 747 MET S C   1 
ATOM   5740  O O   . MET A 1 746 ? 69.560  91.819  -37.047 1.00 16.45  ? 747 MET S O   1 
ATOM   5741  C CB  . MET A 1 746 ? 68.018  91.916  -39.835 1.00 16.45  ? 747 MET S CB  1 
ATOM   5742  C CG  . MET A 1 746 ? 68.513  92.832  -40.940 1.00 16.45  ? 747 MET S CG  1 
ATOM   5743  S SD  . MET A 1 746 ? 67.218  93.312  -42.048 1.00 16.45  ? 747 MET S SD  1 
ATOM   5744  C CE  . MET A 1 746 ? 65.796  93.808  -41.103 1.00 16.45  ? 747 MET S CE  1 
ATOM   5745  N N   . ASP A 1 747 ? 70.869  92.530  -38.756 1.00 2.00   ? 748 ASP S N   1 
ATOM   5746  C CA  . ASP A 1 747 ? 71.757  93.368  -37.954 1.00 2.00   ? 748 ASP S CA  1 
ATOM   5747  C C   . ASP A 1 747 ? 70.970  94.423  -37.196 1.00 2.00   ? 748 ASP S C   1 
ATOM   5748  O O   . ASP A 1 747 ? 70.267  95.233  -37.791 1.00 39.01  ? 748 ASP S O   1 
ATOM   5749  C CB  . ASP A 1 747 ? 72.777  94.041  -38.869 1.00 39.01  ? 748 ASP S CB  1 
ATOM   5750  C CG  . ASP A 1 747 ? 73.435  95.256  -38.233 1.00 39.01  ? 748 ASP S CG  1 
ATOM   5751  O OD1 . ASP A 1 747 ? 73.648  95.281  -36.962 1.00 39.01  ? 748 ASP S OD1 1 
ATOM   5752  O OD2 . ASP A 1 747 ? 73.774  96.256  -38.969 1.00 39.01  ? 748 ASP S OD2 1 
ATOM   5753  N N   . GLY A 1 748 ? 71.102  94.407  -35.876 1.00 37.43  ? 749 GLY S N   1 
ATOM   5754  C CA  . GLY A 1 748 ? 70.391  95.354  -35.039 1.00 37.43  ? 749 GLY S CA  1 
ATOM   5755  C C   . GLY A 1 748 ? 70.229  96.715  -35.667 1.00 37.43  ? 749 GLY S C   1 
ATOM   5756  O O   . GLY A 1 748 ? 69.112  97.196  -35.836 1.00 48.23  ? 749 GLY S O   1 
ATOM   5757  N N   . LYS A 1 749 ? 71.342  97.340  -36.016 1.00 2.00   ? 750 LYS S N   1 
ATOM   5758  C CA  . LYS A 1 749 ? 71.274  98.647  -36.614 1.00 2.00   ? 750 LYS S CA  1 
ATOM   5759  C C   . LYS A 1 749 ? 70.376  98.606  -37.842 1.00 2.00   ? 750 LYS S C   1 
ATOM   5760  O O   . LYS A 1 749 ? 69.193  98.927  -37.782 1.00 10.12  ? 750 LYS S O   1 
ATOM   5761  C CB  . LYS A 1 749 ? 72.664  99.123  -37.009 1.00 10.12  ? 750 LYS S CB  1 
ATOM   5762  C CG  . LYS A 1 749 ? 72.674  100.538 -37.530 1.00 10.12  ? 750 LYS S CG  1 
ATOM   5763  C CD  . LYS A 1 749 ? 73.554  100.639 -38.736 1.00 10.12  ? 750 LYS S CD  1 
ATOM   5764  C CE  . LYS A 1 749 ? 74.691  101.628 -38.491 1.00 10.12  ? 750 LYS S CE  1 
ATOM   5765  N NZ  . LYS A 1 749 ? 75.360  102.139 -39.760 1.00 10.12  ? 750 LYS S NZ  1 
ATOM   5766  N N   . GLN A 1 750 ? 70.941  98.202  -38.965 1.00 16.92  ? 751 GLN S N   1 
ATOM   5767  C CA  . GLN A 1 750 ? 70.181  98.114  -40.209 1.00 16.92  ? 751 GLN S CA  1 
ATOM   5768  C C   . GLN A 1 750 ? 68.733  97.622  -39.996 1.00 16.92  ? 751 GLN S C   1 
ATOM   5769  O O   . GLN A 1 750 ? 67.786  98.224  -40.486 1.00 13.95  ? 751 GLN S O   1 
ATOM   5770  C CB  . GLN A 1 750 ? 70.912  97.176  -41.179 1.00 13.95  ? 751 GLN S CB  1 
ATOM   5771  C CG  . GLN A 1 750 ? 70.384  97.218  -42.593 1.00 13.95  ? 751 GLN S CG  1 
ATOM   5772  C CD  . GLN A 1 750 ? 69.524  96.031  -42.945 1.00 13.95  ? 751 GLN S CD  1 
ATOM   5773  O OE1 . GLN A 1 750 ? 68.627  96.149  -43.772 1.00 13.95  ? 751 GLN S OE1 1 
ATOM   5774  N NE2 . GLN A 1 750 ? 69.796  94.885  -42.330 1.00 13.95  ? 751 GLN S NE2 1 
ATOM   5775  N N   . ALA A 1 751 ? 68.570  96.532  -39.258 1.00 2.00   ? 752 ALA S N   1 
ATOM   5776  C CA  . ALA A 1 751 ? 67.260  95.973  -39.010 1.00 2.00   ? 752 ALA S CA  1 
ATOM   5777  C C   . ALA A 1 751 ? 66.313  96.974  -38.375 1.00 2.00   ? 752 ALA S C   1 
ATOM   5778  O O   . ALA A 1 751 ? 65.101  96.881  -38.559 1.00 89.10  ? 752 ALA S O   1 
ATOM   5779  C CB  . ALA A 1 751 ? 67.372  94.737  -38.134 1.00 89.10  ? 752 ALA S CB  1 
ATOM   5780  N N   . CYS A 1 752 ? 66.841  97.929  -37.632 1.00 2.00   ? 753 CYS S N   1 
ATOM   5781  C CA  . CYS A 1 752 ? 65.977  98.908  -37.008 1.00 2.00   ? 753 CYS S CA  1 
ATOM   5782  C C   . CYS A 1 752 ? 65.847  100.179 -37.846 1.00 2.00   ? 753 CYS S C   1 
ATOM   5783  O O   . CYS A 1 752 ? 64.886  100.931 -37.710 1.00 53.38  ? 753 CYS S O   1 
ATOM   5784  C CB  . CYS A 1 752 ? 66.458  99.195  -35.572 1.00 53.38  ? 753 CYS S CB  1 
ATOM   5785  S SG  . CYS A 1 752 ? 67.388  100.718 -35.243 1.00 53.38  ? 753 CYS S SG  1 
ATOM   5786  N N   . ILE A 1 753 ? 66.810  100.394 -38.736 1.00 32.00  ? 754 ILE S N   1 
ATOM   5787  C CA  . ILE A 1 753 ? 66.797  101.545 -39.656 1.00 32.00  ? 754 ILE S CA  1 
ATOM   5788  C C   . ILE A 1 753 ? 65.644  101.339 -40.637 1.00 32.00  ? 754 ILE S C   1 
ATOM   5789  O O   . ILE A 1 753 ? 65.133  102.282 -41.235 1.00 2.56   ? 754 ILE S O   1 
ATOM   5790  C CB  . ILE A 1 753 ? 68.124  101.655 -40.487 1.00 2.56   ? 754 ILE S CB  1 
ATOM   5791  C CG1 . ILE A 1 753 ? 69.069  102.659 -39.840 1.00 2.56   ? 754 ILE S CG1 1 
ATOM   5792  C CG2 . ILE A 1 753 ? 67.837  102.110 -41.879 1.00 2.56   ? 754 ILE S CG2 1 
ATOM   5793  C CD1 . ILE A 1 753 ? 69.455  102.306 -38.397 1.00 2.56   ? 754 ILE S CD1 1 
ATOM   5794  N N   . LEU A 1 754 ? 65.259  100.086 -40.812 1.00 2.00   ? 755 LEU S N   1 
ATOM   5795  C CA  . LEU A 1 754 ? 64.151  99.734  -41.678 1.00 2.00   ? 755 LEU S CA  1 
ATOM   5796  C C   . LEU A 1 754 ? 62.886  100.345 -41.101 1.00 2.00   ? 755 LEU S C   1 
ATOM   5797  O O   . LEU A 1 754 ? 62.173  101.089 -41.768 1.00 29.37  ? 755 LEU S O   1 
ATOM   5798  C CB  . LEU A 1 754 ? 63.981  98.222  -41.712 1.00 29.37  ? 755 LEU S CB  1 
ATOM   5799  C CG  . LEU A 1 754 ? 64.303  97.489  -43.006 1.00 29.37  ? 755 LEU S CG  1 
ATOM   5800  C CD1 . LEU A 1 754 ? 65.624  97.986  -43.566 1.00 29.37  ? 755 LEU S CD1 1 
ATOM   5801  C CD2 . LEU A 1 754 ? 64.365  95.993  -42.732 1.00 29.37  ? 755 LEU S CD2 1 
ATOM   5802  N N   . MET A 1 755 ? 62.626  100.022 -39.840 1.00 2.00   ? 756 MET S N   1 
ATOM   5803  C CA  . MET A 1 755 ? 61.437  100.507 -39.179 1.00 2.00   ? 756 MET S CA  1 
ATOM   5804  C C   . MET A 1 755 ? 61.447  101.994 -38.944 1.00 2.00   ? 756 MET S C   1 
ATOM   5805  O O   . MET A 1 755 ? 60.471  102.543 -38.463 1.00 12.60  ? 756 MET S O   1 
ATOM   5806  C CB  . MET A 1 755 ? 61.213  99.775  -37.863 1.00 12.60  ? 756 MET S CB  1 
ATOM   5807  C CG  . MET A 1 755 ? 62.466  99.423  -37.138 1.00 12.60  ? 756 MET S CG  1 
ATOM   5808  S SD  . MET A 1 755 ? 62.051  99.239  -35.428 1.00 12.60  ? 756 MET S SD  1 
ATOM   5809  C CE  . MET A 1 755 ? 61.139  97.715  -35.487 1.00 12.60  ? 756 MET S CE  1 
ATOM   5810  N N   . ILE A 1 756 ? 62.545  102.659 -39.269 1.00 2.00   ? 757 ILE S N   1 
ATOM   5811  C CA  . ILE A 1 756 ? 62.584  104.104 -39.094 1.00 2.00   ? 757 ILE S CA  1 
ATOM   5812  C C   . ILE A 1 756 ? 61.987  104.646 -40.376 1.00 2.00   ? 757 ILE S C   1 
ATOM   5813  O O   . ILE A 1 756 ? 61.349  105.703 -40.378 1.00 2.00   ? 757 ILE S O   1 
ATOM   5814  C CB  . ILE A 1 756 ? 64.028  104.677 -38.929 1.00 2.00   ? 757 ILE S CB  1 
ATOM   5815  C CG1 . ILE A 1 756 ? 64.607  104.311 -37.559 1.00 2.00   ? 757 ILE S CG1 1 
ATOM   5816  C CG2 . ILE A 1 756 ? 64.000  106.184 -39.065 1.00 2.00   ? 757 ILE S CG2 1 
ATOM   5817  C CD1 . ILE A 1 756 ? 65.683  105.258 -37.095 1.00 2.00   ? 757 ILE S CD1 1 
ATOM   5818  N N   . LYS A 1 757 ? 62.185  103.910 -41.469 1.00 2.00   ? 758 LYS S N   1 
ATOM   5819  C CA  . LYS A 1 757 ? 61.643  104.317 -42.767 1.00 2.00   ? 758 LYS S CA  1 
ATOM   5820  C C   . LYS A 1 757 ? 60.168  103.984 -42.738 1.00 2.00   ? 758 LYS S C   1 
ATOM   5821  O O   . LYS A 1 757 ? 59.346  104.634 -43.376 1.00 52.94  ? 758 LYS S O   1 
ATOM   5822  C CB  . LYS A 1 757 ? 62.340  103.570 -43.905 1.00 52.94  ? 758 LYS S CB  1 
ATOM   5823  C CG  . LYS A 1 757 ? 63.805  103.971 -44.102 1.00 52.94  ? 758 LYS S CG  1 
ATOM   5824  C CD  . LYS A 1 757 ? 63.976  105.470 -44.366 1.00 52.94  ? 758 LYS S CD  1 
ATOM   5825  C CE  . LYS A 1 757 ? 64.572  106.212 -43.161 1.00 52.94  ? 758 LYS S CE  1 
ATOM   5826  N NZ  . LYS A 1 757 ? 64.206  107.669 -43.143 1.00 52.94  ? 758 LYS S NZ  1 
ATOM   5827  N N   . ALA A 1 758 ? 59.851  102.962 -41.962 1.00 4.04   ? 759 ALA S N   1 
ATOM   5828  C CA  . ALA A 1 758 ? 58.490  102.514 -41.800 1.00 4.04   ? 759 ALA S CA  1 
ATOM   5829  C C   . ALA A 1 758 ? 57.653  103.576 -41.073 1.00 4.04   ? 759 ALA S C   1 
ATOM   5830  O O   . ALA A 1 758 ? 56.433  103.588 -41.143 1.00 2.00   ? 759 ALA S O   1 
ATOM   5831  C CB  . ALA A 1 758 ? 58.486  101.211 -41.030 1.00 2.00   ? 759 ALA S CB  1 
ATOM   5832  N N   . LEU A 1 759 ? 58.298  104.471 -40.349 1.00 2.00   ? 760 LEU S N   1 
ATOM   5833  C CA  . LEU A 1 759 ? 57.530  105.489 -39.659 1.00 2.00   ? 760 LEU S CA  1 
ATOM   5834  C C   . LEU A 1 759 ? 57.765  106.775 -40.392 1.00 2.00   ? 760 LEU S C   1 
ATOM   5835  O O   . LEU A 1 759 ? 57.254  107.822 -39.989 1.00 2.00   ? 760 LEU S O   1 
ATOM   5836  C CB  . LEU A 1 759 ? 57.981  105.652 -38.207 1.00 2.00   ? 760 LEU S CB  1 
ATOM   5837  C CG  . LEU A 1 759 ? 58.234  104.400 -37.374 1.00 2.00   ? 760 LEU S CG  1 
ATOM   5838  C CD1 . LEU A 1 759 ? 58.792  104.803 -36.049 1.00 2.00   ? 760 LEU S CD1 1 
ATOM   5839  C CD2 . LEU A 1 759 ? 56.955  103.626 -37.185 1.00 2.00   ? 760 LEU S CD2 1 
ATOM   5840  N N   . GLU A 1 760 ? 58.545  106.699 -41.470 1.00 68.16  ? 761 GLU S N   1 
ATOM   5841  C CA  . GLU A 1 760 ? 58.864  107.872 -42.272 1.00 68.16  ? 761 GLU S CA  1 
ATOM   5842  C C   . GLU A 1 760 ? 59.278  109.046 -41.372 1.00 68.16  ? 761 GLU S C   1 
ATOM   5843  O O   . GLU A 1 760 ? 58.903  110.194 -41.606 1.00 100.00 ? 761 GLU S O   1 
ATOM   5844  C CB  . GLU A 1 760 ? 57.660  108.265 -43.133 1.00 100.00 ? 761 GLU S CB  1 
ATOM   5845  C CG  . GLU A 1 760 ? 57.151  107.145 -44.025 1.00 100.00 ? 761 GLU S CG  1 
ATOM   5846  C CD  . GLU A 1 760 ? 55.747  107.403 -44.544 1.00 100.00 ? 761 GLU S CD  1 
ATOM   5847  O OE1 . GLU A 1 760 ? 55.564  108.363 -45.323 1.00 100.00 ? 761 GLU S OE1 1 
ATOM   5848  O OE2 . GLU A 1 760 ? 54.828  106.642 -44.172 1.00 100.00 ? 761 GLU S OE2 1 
ATOM   5849  N N   . LEU A 1 761 ? 60.045  108.738 -40.333 1.00 2.00   ? 762 LEU S N   1 
ATOM   5850  C CA  . LEU A 1 761 ? 60.542  109.728 -39.389 1.00 2.00   ? 762 LEU S CA  1 
ATOM   5851  C C   . LEU A 1 761 ? 61.416  110.749 -40.105 1.00 2.00   ? 762 LEU S C   1 
ATOM   5852  O O   . LEU A 1 761 ? 62.257  110.382 -40.921 1.00 3.75   ? 762 LEU S O   1 
ATOM   5853  C CB  . LEU A 1 761 ? 61.385  109.019 -38.329 1.00 3.75   ? 762 LEU S CB  1 
ATOM   5854  C CG  . LEU A 1 761 ? 60.876  108.966 -36.896 1.00 3.75   ? 762 LEU S CG  1 
ATOM   5855  C CD1 . LEU A 1 761 ? 61.310  110.215 -36.156 1.00 3.75   ? 762 LEU S CD1 1 
ATOM   5856  C CD2 . LEU A 1 761 ? 59.354  108.836 -36.912 1.00 3.75   ? 762 LEU S CD2 1 
ATOM   5857  N N   . ASP A 1 762 ? 61.254  112.026 -39.795 1.00 2.00   ? 763 ASP S N   1 
ATOM   5858  C CA  . ASP A 1 762 ? 62.076  113.008 -40.471 1.00 2.00   ? 763 ASP S CA  1 
ATOM   5859  C C   . ASP A 1 762 ? 63.529  112.913 -40.092 1.00 2.00   ? 763 ASP S C   1 
ATOM   5860  O O   . ASP A 1 762 ? 63.877  112.862 -38.926 1.00 32.15  ? 763 ASP S O   1 
ATOM   5861  C CB  . ASP A 1 762 ? 61.596  114.427 -40.203 1.00 32.15  ? 763 ASP S CB  1 
ATOM   5862  C CG  . ASP A 1 762 ? 62.479  115.467 -40.878 1.00 32.15  ? 763 ASP S CG  1 
ATOM   5863  O OD1 . ASP A 1 762 ? 63.666  115.564 -40.492 1.00 32.15  ? 763 ASP S OD1 1 
ATOM   5864  O OD2 . ASP A 1 762 ? 61.989  116.178 -41.802 1.00 32.15  ? 763 ASP S OD2 1 
ATOM   5865  N N   . PRO A 1 763 ? 64.406  112.909 -41.097 1.00 11.34  ? 764 PRO S N   1 
ATOM   5866  C CA  . PRO A 1 763 ? 65.859  112.821 -40.936 1.00 11.34  ? 764 PRO S CA  1 
ATOM   5867  C C   . PRO A 1 763 ? 66.481  113.978 -40.167 1.00 11.34  ? 764 PRO S C   1 
ATOM   5868  O O   . PRO A 1 763 ? 67.669  114.263 -40.315 1.00 29.14  ? 764 PRO S O   1 
ATOM   5869  C CB  . PRO A 1 763 ? 66.387  112.743 -42.376 1.00 29.14  ? 764 PRO S CB  1 
ATOM   5870  C CG  . PRO A 1 763 ? 65.314  113.348 -43.196 1.00 29.14  ? 764 PRO S CG  1 
ATOM   5871  C CD  . PRO A 1 763 ? 64.020  112.983 -42.514 1.00 29.14  ? 764 PRO S CD  1 
ATOM   5872  N N   . ASN A 1 764 ? 65.685  114.665 -39.358 1.00 2.00   ? 765 ASN S N   1 
ATOM   5873  C CA  . ASN A 1 764 ? 66.242  115.755 -38.583 1.00 2.00   ? 765 ASN S CA  1 
ATOM   5874  C C   . ASN A 1 764 ? 65.870  115.578 -37.137 1.00 2.00   ? 765 ASN S C   1 
ATOM   5875  O O   . ASN A 1 764 ? 66.386  116.234 -36.246 1.00 57.90  ? 765 ASN S O   1 
ATOM   5876  C CB  . ASN A 1 764 ? 65.752  117.100 -39.066 1.00 57.90  ? 765 ASN S CB  1 
ATOM   5877  C CG  . ASN A 1 764 ? 66.601  118.218 -38.534 1.00 57.90  ? 765 ASN S CG  1 
ATOM   5878  O OD1 . ASN A 1 764 ? 66.185  118.967 -37.640 1.00 57.90  ? 765 ASN S OD1 1 
ATOM   5879  N ND2 . ASN A 1 764 ? 67.821  118.330 -39.060 1.00 57.90  ? 765 ASN S ND2 1 
ATOM   5880  N N   . LEU A 1 765 ? 64.944  114.671 -36.913 1.00 5.90   ? 766 LEU S N   1 
ATOM   5881  C CA  . LEU A 1 765 ? 64.511  114.378 -35.577 1.00 5.90   ? 766 LEU S CA  1 
ATOM   5882  C C   . LEU A 1 765 ? 65.551  113.437 -35.012 1.00 5.90   ? 766 LEU S C   1 
ATOM   5883  O O   . LEU A 1 765 ? 66.013  113.650 -33.912 1.00 2.00   ? 766 LEU S O   1 
ATOM   5884  C CB  . LEU A 1 765 ? 63.150  113.710 -35.615 1.00 2.00   ? 766 LEU S CB  1 
ATOM   5885  C CG  . LEU A 1 765 ? 62.249  114.366 -36.640 1.00 2.00   ? 766 LEU S CG  1 
ATOM   5886  C CD1 . LEU A 1 765 ? 61.244  113.376 -37.183 1.00 2.00   ? 766 LEU S CD1 1 
ATOM   5887  C CD2 . LEU A 1 765 ? 61.596  115.527 -35.977 1.00 2.00   ? 766 LEU S CD2 1 
ATOM   5888  N N   . TYR A 1 766 ? 65.938  112.419 -35.778 1.00 2.00   ? 767 TYR S N   1 
ATOM   5889  C CA  . TYR A 1 766 ? 66.918  111.458 -35.310 1.00 2.00   ? 767 TYR S CA  1 
ATOM   5890  C C   . TYR A 1 766 ? 68.328  111.623 -35.824 1.00 2.00   ? 767 TYR S C   1 
ATOM   5891  O O   . TYR A 1 766 ? 68.599  112.489 -36.635 1.00 9.76   ? 767 TYR S O   1 
ATOM   5892  C CB  . TYR A 1 766 ? 66.438  110.034 -35.589 1.00 9.76   ? 767 TYR S CB  1 
ATOM   5893  C CG  . TYR A 1 766 ? 66.531  109.593 -37.012 1.00 9.76   ? 767 TYR S CG  1 
ATOM   5894  C CD1 . TYR A 1 766 ? 67.745  109.324 -37.588 1.00 9.76   ? 767 TYR S CD1 1 
ATOM   5895  C CD2 . TYR A 1 766 ? 65.404  109.457 -37.786 1.00 9.76   ? 767 TYR S CD2 1 
ATOM   5896  C CE1 . TYR A 1 766 ? 67.842  108.935 -38.917 1.00 9.76   ? 767 TYR S CE1 1 
ATOM   5897  C CE2 . TYR A 1 766 ? 65.483  109.074 -39.109 1.00 9.76   ? 767 TYR S CE2 1 
ATOM   5898  C CZ  . TYR A 1 766 ? 66.706  108.815 -39.677 1.00 9.76   ? 767 TYR S CZ  1 
ATOM   5899  O OH  . TYR A 1 766 ? 66.795  108.457 -41.012 1.00 9.76   ? 767 TYR S OH  1 
ATOM   5900  N N   . ARG A 1 767 ? 69.219  110.775 -35.325 1.00 2.00   ? 768 ARG S N   1 
ATOM   5901  C CA  . ARG A 1 767 ? 70.637  110.745 -35.686 1.00 2.00   ? 768 ARG S CA  1 
ATOM   5902  C C   . ARG A 1 767 ? 71.135  109.341 -35.351 1.00 2.00   ? 768 ARG S C   1 
ATOM   5903  O O   . ARG A 1 767 ? 71.293  109.012 -34.194 1.00 10.91  ? 768 ARG S O   1 
ATOM   5904  C CB  . ARG A 1 767 ? 71.430  111.773 -34.865 1.00 10.91  ? 768 ARG S CB  1 
ATOM   5905  C CG  . ARG A 1 767 ? 72.097  112.899 -35.641 1.00 10.91  ? 768 ARG S CG  1 
ATOM   5906  C CD  . ARG A 1 767 ? 71.460  113.096 -37.006 1.00 10.91  ? 768 ARG S CD  1 
ATOM   5907  N NE  . ARG A 1 767 ? 71.059  114.478 -37.302 1.00 10.91  ? 768 ARG S NE  1 
ATOM   5908  C CZ  . ARG A 1 767 ? 71.900  115.503 -37.468 1.00 10.91  ? 768 ARG S CZ  1 
ATOM   5909  N NH1 . ARG A 1 767 ? 73.218  115.317 -37.365 1.00 10.91  ? 768 ARG S NH1 1 
ATOM   5910  N NH2 . ARG A 1 767 ? 71.422  116.709 -37.771 1.00 10.91  ? 768 ARG S NH2 1 
ATOM   5911  N N   . ILE A 1 768 ? 71.351  108.510 -36.362 1.00 2.00   ? 769 ILE S N   1 
ATOM   5912  C CA  . ILE A 1 768 ? 71.836  107.152 -36.163 1.00 2.00   ? 769 ILE S CA  1 
ATOM   5913  C C   . ILE A 1 768 ? 73.311  107.199 -35.779 1.00 2.00   ? 769 ILE S C   1 
ATOM   5914  O O   . ILE A 1 768 ? 74.097  107.961 -36.363 1.00 2.00   ? 769 ILE S O   1 
ATOM   5915  C CB  . ILE A 1 768 ? 71.685  106.317 -37.442 1.00 2.00   ? 769 ILE S CB  1 
ATOM   5916  C CG1 . ILE A 1 768 ? 70.275  105.781 -37.523 1.00 2.00   ? 769 ILE S CG1 1 
ATOM   5917  C CG2 . ILE A 1 768 ? 72.629  105.141 -37.432 1.00 2.00   ? 769 ILE S CG2 1 
ATOM   5918  C CD1 . ILE A 1 768 ? 69.891  105.015 -36.313 1.00 2.00   ? 769 ILE S CD1 1 
ATOM   5919  N N   . GLY A 1 769 ? 73.681  106.384 -34.792 1.00 43.11  ? 770 GLY S N   1 
ATOM   5920  C CA  . GLY A 1 769 ? 75.059  106.348 -34.339 1.00 43.11  ? 770 GLY S CA  1 
ATOM   5921  C C   . GLY A 1 769 ? 75.749  105.020 -34.606 1.00 43.11  ? 770 GLY S C   1 
ATOM   5922  O O   . GLY A 1 769 ? 75.546  104.400 -35.648 1.00 64.90  ? 770 GLY S O   1 
ATOM   5923  N N   . GLN A 1 770 ? 76.572  104.581 -33.661 1.00 15.33  ? 771 GLN S N   1 
ATOM   5924  C CA  . GLN A 1 770 ? 77.300  103.319 -33.805 1.00 15.33  ? 771 GLN S CA  1 
ATOM   5925  C C   . GLN A 1 770 ? 76.531  102.170 -33.189 1.00 15.33  ? 771 GLN S C   1 
ATOM   5926  O O   . GLN A 1 770 ? 76.300  101.161 -33.849 1.00 100.00 ? 771 GLN S O   1 
ATOM   5927  C CB  . GLN A 1 770 ? 78.679  103.418 -33.141 1.00 100.00 ? 771 GLN S CB  1 
ATOM   5928  C CG  . GLN A 1 770 ? 79.843  103.157 -34.085 1.00 100.00 ? 771 GLN S CG  1 
ATOM   5929  C CD  . GLN A 1 770 ? 79.828  101.751 -34.670 1.00 100.00 ? 771 GLN S CD  1 
ATOM   5930  O OE1 . GLN A 1 770 ? 80.765  101.349 -35.358 1.00 100.00 ? 771 GLN S OE1 1 
ATOM   5931  N NE2 . GLN A 1 770 ? 78.764  100.997 -34.402 1.00 100.00 ? 771 GLN S NE2 1 
ATOM   5932  N N   . SER A 1 771 ? 76.141  102.335 -31.924 1.00 12.40  ? 772 SER S N   1 
ATOM   5933  C CA  . SER A 1 771 ? 75.395  101.316 -31.198 1.00 12.40  ? 772 SER S CA  1 
ATOM   5934  C C   . SER A 1 771 ? 73.998  101.781 -30.805 1.00 12.40  ? 772 SER S C   1 
ATOM   5935  O O   . SER A 1 771 ? 73.098  100.968 -30.569 1.00 59.42  ? 772 SER S O   1 
ATOM   5936  C CB  . SER A 1 771 ? 76.151  100.919 -29.936 1.00 59.42  ? 772 SER S CB  1 
ATOM   5937  O OG  . SER A 1 771 ? 75.857  101.810 -28.876 1.00 59.42  ? 772 SER S OG  1 
ATOM   5938  N N   . LYS A 1 772 ? 73.823  103.094 -30.752 1.00 13.86  ? 773 LYS S N   1 
ATOM   5939  C CA  . LYS A 1 772 ? 72.554  103.672 -30.356 1.00 13.86  ? 773 LYS S CA  1 
ATOM   5940  C C   . LYS A 1 772 ? 72.110  104.760 -31.336 1.00 13.86  ? 773 LYS S C   1 
ATOM   5941  O O   . LYS A 1 772 ? 72.922  105.258 -32.121 1.00 2.00   ? 773 LYS S O   1 
ATOM   5942  C CB  . LYS A 1 772 ? 72.730  104.281 -28.975 1.00 2.00   ? 773 LYS S CB  1 
ATOM   5943  C CG  . LYS A 1 772 ? 73.873  105.283 -28.939 1.00 2.00   ? 773 LYS S CG  1 
ATOM   5944  C CD  . LYS A 1 772 ? 73.864  106.098 -27.665 1.00 2.00   ? 773 LYS S CD  1 
ATOM   5945  C CE  . LYS A 1 772 ? 74.970  105.657 -26.714 1.00 2.00   ? 773 LYS S CE  1 
ATOM   5946  N NZ  . LYS A 1 772 ? 74.478  105.373 -25.326 1.00 2.00   ? 773 LYS S NZ  1 
ATOM   5947  N N   . ILE A 1 773 ? 70.818  105.111 -31.284 1.00 2.00   ? 774 ILE S N   1 
ATOM   5948  C CA  . ILE A 1 773 ? 70.244  106.175 -32.106 1.00 2.00   ? 774 ILE S CA  1 
ATOM   5949  C C   . ILE A 1 773 ? 70.068  107.431 -31.242 1.00 2.00   ? 774 ILE S C   1 
ATOM   5950  O O   . ILE A 1 773 ? 69.672  107.335 -30.090 1.00 2.00   ? 774 ILE S O   1 
ATOM   5951  C CB  . ILE A 1 773 ? 68.871  105.809 -32.625 1.00 2.00   ? 774 ILE S CB  1 
ATOM   5952  C CG1 . ILE A 1 773 ? 68.884  104.438 -33.238 1.00 2.00   ? 774 ILE S CG1 1 
ATOM   5953  C CG2 . ILE A 1 773 ? 68.447  106.788 -33.650 1.00 2.00   ? 774 ILE S CG2 1 
ATOM   5954  C CD1 . ILE A 1 773 ? 67.553  104.049 -33.738 1.00 2.00   ? 774 ILE S CD1 1 
ATOM   5955  N N   . PHE A 1 774 ? 70.350  108.608 -31.785 1.00 2.00   ? 775 PHE S N   1 
ATOM   5956  C CA  . PHE A 1 774 ? 70.185  109.835 -31.024 1.00 2.00   ? 775 PHE S CA  1 
ATOM   5957  C C   . PHE A 1 774 ? 68.977  110.603 -31.526 1.00 2.00   ? 775 PHE S C   1 
ATOM   5958  O O   . PHE A 1 774 ? 69.013  111.141 -32.620 1.00 3.73   ? 775 PHE S O   1 
ATOM   5959  C CB  . PHE A 1 774 ? 71.414  110.703 -31.174 1.00 3.73   ? 775 PHE S CB  1 
ATOM   5960  C CG  . PHE A 1 774 ? 72.584  110.239 -30.356 1.00 3.73   ? 775 PHE S CG  1 
ATOM   5961  C CD1 . PHE A 1 774 ? 73.411  109.217 -30.812 1.00 3.73   ? 775 PHE S CD1 1 
ATOM   5962  C CD2 . PHE A 1 774 ? 72.862  110.840 -29.124 1.00 3.73   ? 775 PHE S CD2 1 
ATOM   5963  C CE1 . PHE A 1 774 ? 74.483  108.807 -30.064 1.00 3.73   ? 775 PHE S CE1 1 
ATOM   5964  C CE2 . PHE A 1 774 ? 73.934  110.435 -28.368 1.00 3.73   ? 775 PHE S CE2 1 
ATOM   5965  C CZ  . PHE A 1 774 ? 74.748  109.414 -28.837 1.00 3.73   ? 775 PHE S CZ  1 
ATOM   5966  N N   . PHE A 1 775 ? 67.915  110.666 -30.736 1.00 2.00   ? 776 PHE S N   1 
ATOM   5967  C CA  . PHE A 1 775 ? 66.718  111.372 -31.135 1.00 2.00   ? 776 PHE S CA  1 
ATOM   5968  C C   . PHE A 1 775 ? 66.623  112.792 -30.632 1.00 2.00   ? 776 PHE S C   1 
ATOM   5969  O O   . PHE A 1 775 ? 67.387  113.217 -29.797 1.00 2.00   ? 776 PHE S O   1 
ATOM   5970  C CB  . PHE A 1 775 ? 65.511  110.618 -30.676 1.00 2.00   ? 776 PHE S CB  1 
ATOM   5971  C CG  . PHE A 1 775 ? 65.308  109.361 -31.392 1.00 2.00   ? 776 PHE S CG  1 
ATOM   5972  C CD1 . PHE A 1 775 ? 65.001  109.365 -32.717 1.00 2.00   ? 776 PHE S CD1 1 
ATOM   5973  C CD2 . PHE A 1 775 ? 65.383  108.174 -30.738 1.00 2.00   ? 776 PHE S CD2 1 
ATOM   5974  C CE1 . PHE A 1 775 ? 64.769  108.194 -33.388 1.00 2.00   ? 776 PHE S CE1 1 
ATOM   5975  C CE2 . PHE A 1 775 ? 65.151  106.999 -31.394 1.00 2.00   ? 776 PHE S CE2 1 
ATOM   5976  C CZ  . PHE A 1 775 ? 64.843  107.008 -32.727 1.00 2.00   ? 776 PHE S CZ  1 
ATOM   5977  N N   . ARG A 1 776 ? 65.663  113.520 -31.162 1.00 2.00   ? 777 ARG S N   1 
ATOM   5978  C CA  . ARG A 1 776 ? 65.436  114.897 -30.786 1.00 2.00   ? 777 ARG S CA  1 
ATOM   5979  C C   . ARG A 1 776 ? 64.349  114.934 -29.724 1.00 2.00   ? 777 ARG S C   1 
ATOM   5980  O O   . ARG A 1 776 ? 63.549  114.003 -29.584 1.00 16.84  ? 777 ARG S O   1 
ATOM   5981  C CB  . ARG A 1 776 ? 64.985  115.701 -31.995 1.00 16.84  ? 777 ARG S CB  1 
ATOM   5982  C CG  . ARG A 1 776 ? 65.599  117.045 -32.056 1.00 16.84  ? 777 ARG S CG  1 
ATOM   5983  C CD  . ARG A 1 776 ? 67.059  116.900 -32.371 1.00 16.84  ? 777 ARG S CD  1 
ATOM   5984  N NE  . ARG A 1 776 ? 67.296  116.986 -33.806 1.00 16.84  ? 777 ARG S NE  1 
ATOM   5985  C CZ  . ARG A 1 776 ? 68.081  117.896 -34.380 1.00 16.84  ? 777 ARG S CZ  1 
ATOM   5986  N NH1 . ARG A 1 776 ? 68.709  118.804 -33.627 1.00 16.84  ? 777 ARG S NH1 1 
ATOM   5987  N NH2 . ARG A 1 776 ? 68.221  117.907 -35.713 1.00 16.84  ? 777 ARG S NH2 1 
ATOM   5988  N N   . THR A 1 777 ? 64.312  116.018 -28.970 1.00 2.00   ? 778 THR S N   1 
ATOM   5989  C CA  . THR A 1 777 ? 63.315  116.151 -27.924 1.00 2.00   ? 778 THR S CA  1 
ATOM   5990  C C   . THR A 1 777 ? 61.922  115.866 -28.440 1.00 2.00   ? 778 THR S C   1 
ATOM   5991  O O   . THR A 1 777 ? 61.553  116.285 -29.531 1.00 41.79  ? 778 THR S O   1 
ATOM   5992  C CB  . THR A 1 777 ? 63.320  117.550 -27.320 1.00 41.79  ? 778 THR S CB  1 
ATOM   5993  O OG1 . THR A 1 777 ? 64.384  118.315 -27.901 1.00 41.79  ? 778 THR S OG1 1 
ATOM   5994  C CG2 . THR A 1 777 ? 63.524  117.470 -25.817 1.00 41.79  ? 778 THR S CG2 1 
ATOM   5995  N N   . GLY A 1 778 ? 61.163  115.135 -27.638 1.00 24.72  ? 779 GLY S N   1 
ATOM   5996  C CA  . GLY A 1 778 ? 59.789  114.795 -27.968 1.00 24.72  ? 779 GLY S CA  1 
ATOM   5997  C C   . GLY A 1 778 ? 59.580  113.666 -28.958 1.00 24.72  ? 779 GLY S C   1 
ATOM   5998  O O   . GLY A 1 778 ? 58.555  112.984 -28.943 1.00 2.00   ? 779 GLY S O   1 
ATOM   5999  N N   . VAL A 1 779 ? 60.559  113.457 -29.819 1.00 2.00   ? 780 VAL S N   1 
ATOM   6000  C CA  . VAL A 1 779 ? 60.441  112.425 -30.824 1.00 2.00   ? 780 VAL S CA  1 
ATOM   6001  C C   . VAL A 1 779 ? 60.198  111.059 -30.202 1.00 2.00   ? 780 VAL S C   1 
ATOM   6002  O O   . VAL A 1 779 ? 59.433  110.260 -30.700 1.00 2.00   ? 780 VAL S O   1 
ATOM   6003  C CB  . VAL A 1 779 ? 61.698  112.399 -31.712 1.00 2.00   ? 780 VAL S CB  1 
ATOM   6004  C CG1 . VAL A 1 779 ? 61.554  111.365 -32.800 1.00 2.00   ? 780 VAL S CG1 1 
ATOM   6005  C CG2 . VAL A 1 779 ? 61.917  113.771 -32.327 1.00 2.00   ? 780 VAL S CG2 1 
ATOM   6006  N N   . LEU A 1 780 ? 60.831  110.776 -29.089 1.00 2.00   ? 781 LEU S N   1 
ATOM   6007  C CA  . LEU A 1 780 ? 60.619  109.472 -28.479 1.00 2.00   ? 781 LEU S CA  1 
ATOM   6008  C C   . LEU A 1 780 ? 59.300  109.408 -27.700 1.00 2.00   ? 781 LEU S C   1 
ATOM   6009  O O   . LEU A 1 780 ? 58.705  108.349 -27.546 1.00 2.00   ? 781 LEU S O   1 
ATOM   6010  C CB  . LEU A 1 780 ? 61.792  109.143 -27.548 1.00 2.00   ? 781 LEU S CB  1 
ATOM   6011  C CG  . LEU A 1 780 ? 62.609  107.855 -27.756 1.00 2.00   ? 781 LEU S CG  1 
ATOM   6012  C CD1 . LEU A 1 780 ? 62.139  107.100 -28.992 1.00 2.00   ? 781 LEU S CD1 1 
ATOM   6013  C CD2 . LEU A 1 780 ? 64.089  108.235 -27.859 1.00 2.00   ? 781 LEU S CD2 1 
ATOM   6014  N N   . ALA A 1 781 ? 58.845  110.551 -27.201 1.00 14.41  ? 782 ALA S N   1 
ATOM   6015  C CA  . ALA A 1 781 ? 57.616  110.612 -26.422 1.00 14.41  ? 782 ALA S CA  1 
ATOM   6016  C C   . ALA A 1 781 ? 56.440  110.178 -27.245 1.00 14.41  ? 782 ALA S C   1 
ATOM   6017  O O   . ALA A 1 781 ? 55.628  109.380 -26.813 1.00 2.00   ? 782 ALA S O   1 
ATOM   6018  C CB  . ALA A 1 781 ? 57.386  112.021 -25.930 1.00 2.00   ? 782 ALA S CB  1 
ATOM   6019  N N   . HIS A 1 782 ? 56.368  110.735 -28.443 1.00 2.90   ? 783 HIS S N   1 
ATOM   6020  C CA  . HIS A 1 782 ? 55.290  110.458 -29.387 1.00 2.90   ? 783 HIS S CA  1 
ATOM   6021  C C   . HIS A 1 782 ? 55.321  109.002 -29.778 1.00 2.90   ? 783 HIS S C   1 
ATOM   6022  O O   . HIS A 1 782 ? 54.292  108.362 -29.895 1.00 23.15  ? 783 HIS S O   1 
ATOM   6023  C CB  . HIS A 1 782 ? 55.446  111.369 -30.621 1.00 23.15  ? 783 HIS S CB  1 
ATOM   6024  C CG  . HIS A 1 782 ? 54.758  110.867 -31.850 1.00 23.15  ? 783 HIS S CG  1 
ATOM   6025  N ND1 . HIS A 1 782 ? 53.426  111.113 -32.113 1.00 23.15  ? 783 HIS S ND1 1 
ATOM   6026  C CD2 . HIS A 1 782 ? 55.220  110.136 -32.890 1.00 23.15  ? 783 HIS S CD2 1 
ATOM   6027  C CE1 . HIS A 1 782 ? 53.098  110.554 -33.263 1.00 23.15  ? 783 HIS S CE1 1 
ATOM   6028  N NE2 . HIS A 1 782 ? 54.168  109.955 -33.753 1.00 23.15  ? 783 HIS S NE2 1 
ATOM   6029  N N   . LEU A 1 783 ? 56.517  108.482 -29.971 1.00 2.00   ? 784 LEU S N   1 
ATOM   6030  C CA  . LEU A 1 783 ? 56.690  107.084 -30.324 1.00 2.00   ? 784 LEU S CA  1 
ATOM   6031  C C   . LEU A 1 783 ? 56.101  106.215 -29.207 1.00 2.00   ? 784 LEU S C   1 
ATOM   6032  O O   . LEU A 1 783 ? 55.458  105.198 -29.455 1.00 2.00   ? 784 LEU S O   1 
ATOM   6033  C CB  . LEU A 1 783 ? 58.184  106.770 -30.494 1.00 2.00   ? 784 LEU S CB  1 
ATOM   6034  C CG  . LEU A 1 783 ? 58.686  106.483 -31.899 1.00 2.00   ? 784 LEU S CG  1 
ATOM   6035  C CD1 . LEU A 1 783 ? 57.843  105.395 -32.504 1.00 2.00   ? 784 LEU S CD1 1 
ATOM   6036  C CD2 . LEU A 1 783 ? 58.611  107.730 -32.732 1.00 2.00   ? 784 LEU S CD2 1 
ATOM   6037  N N   . GLU A 1 784 ? 56.327  106.629 -27.967 1.00 2.00   ? 785 GLU S N   1 
ATOM   6038  C CA  . GLU A 1 784 ? 55.829  105.895 -26.820 1.00 2.00   ? 785 GLU S CA  1 
ATOM   6039  C C   . GLU A 1 784 ? 54.305  105.948 -26.795 1.00 2.00   ? 785 GLU S C   1 
ATOM   6040  O O   . GLU A 1 784 ? 53.648  104.928 -26.650 1.00 17.56  ? 785 GLU S O   1 
ATOM   6041  C CB  . GLU A 1 784 ? 56.405  106.503 -25.547 1.00 17.56  ? 785 GLU S CB  1 
ATOM   6042  C CG  . GLU A 1 784 ? 56.352  105.574 -24.352 1.00 17.56  ? 785 GLU S CG  1 
ATOM   6043  C CD  . GLU A 1 784 ? 57.436  104.513 -24.389 1.00 17.56  ? 785 GLU S CD  1 
ATOM   6044  O OE1 . GLU A 1 784 ? 58.168  104.440 -25.394 1.00 17.56  ? 785 GLU S OE1 1 
ATOM   6045  O OE2 . GLU A 1 784 ? 57.555  103.746 -23.411 1.00 17.56  ? 785 GLU S OE2 1 
ATOM   6046  N N   . GLU A 1 785 ? 53.750  107.149 -26.933 1.00 5.54   ? 786 GLU S N   1 
ATOM   6047  C CA  . GLU A 1 785 ? 52.300  107.355 -26.944 1.00 5.54   ? 786 GLU S CA  1 
ATOM   6048  C C   . GLU A 1 785 ? 51.654  106.327 -27.864 1.00 5.54   ? 786 GLU S C   1 
ATOM   6049  O O   . GLU A 1 785 ? 50.902  105.473 -27.419 1.00 100.00 ? 786 GLU S O   1 
ATOM   6050  C CB  . GLU A 1 785 ? 51.975  108.766 -27.453 1.00 100.00 ? 786 GLU S CB  1 
ATOM   6051  C CG  . GLU A 1 785 ? 50.622  109.321 -27.015 1.00 100.00 ? 786 GLU S CG  1 
ATOM   6052  C CD  . GLU A 1 785 ? 50.651  110.837 -26.772 1.00 100.00 ? 786 GLU S CD  1 
ATOM   6053  O OE1 . GLU A 1 785 ? 50.731  111.608 -27.755 1.00 100.00 ? 786 GLU S OE1 1 
ATOM   6054  O OE2 . GLU A 1 785 ? 50.590  111.257 -25.595 1.00 100.00 ? 786 GLU S OE2 1 
ATOM   6055  N N   . GLU A 1 786 ? 51.978  106.412 -29.150 1.00 11.19  ? 787 GLU S N   1 
ATOM   6056  C CA  . GLU A 1 786 ? 51.459  105.504 -30.168 1.00 11.19  ? 787 GLU S CA  1 
ATOM   6057  C C   . GLU A 1 786 ? 51.417  104.059 -29.682 1.00 11.19  ? 787 GLU S C   1 
ATOM   6058  O O   . GLU A 1 786 ? 50.360  103.424 -29.667 1.00 44.95  ? 787 GLU S O   1 
ATOM   6059  C CB  . GLU A 1 786 ? 52.321  105.594 -31.432 1.00 44.95  ? 787 GLU S CB  1 
ATOM   6060  C CG  . GLU A 1 786 ? 52.487  106.997 -31.982 1.00 44.95  ? 787 GLU S CG  1 
ATOM   6061  C CD  . GLU A 1 786 ? 51.338  107.406 -32.881 1.00 44.95  ? 787 GLU S CD  1 
ATOM   6062  O OE1 . GLU A 1 786 ? 50.667  106.505 -33.431 1.00 44.95  ? 787 GLU S OE1 1 
ATOM   6063  O OE2 . GLU A 1 786 ? 51.103  108.628 -33.037 1.00 44.95  ? 787 GLU S OE2 1 
ATOM   6064  N N   . ARG A 1 787 ? 52.577  103.547 -29.286 1.00 38.03  ? 788 ARG S N   1 
ATOM   6065  C CA  . ARG A 1 787 ? 52.691  102.177 -28.798 1.00 38.03  ? 788 ARG S CA  1 
ATOM   6066  C C   . ARG A 1 787 ? 51.717  101.887 -27.681 1.00 38.03  ? 788 ARG S C   1 
ATOM   6067  O O   . ARG A 1 787 ? 51.171  100.798 -27.614 1.00 3.80   ? 788 ARG S O   1 
ATOM   6068  C CB  . ARG A 1 787 ? 54.098  101.901 -28.269 1.00 3.80   ? 788 ARG S CB  1 
ATOM   6069  C CG  . ARG A 1 787 ? 54.215  100.579 -27.511 1.00 3.80   ? 788 ARG S CG  1 
ATOM   6070  C CD  . ARG A 1 787 ? 55.621  100.344 -26.951 1.00 3.80   ? 788 ARG S CD  1 
ATOM   6071  N NE  . ARG A 1 787 ? 55.893  101.244 -25.843 1.00 3.80   ? 788 ARG S NE  1 
ATOM   6072  C CZ  . ARG A 1 787 ? 55.135  101.333 -24.761 1.00 3.80   ? 788 ARG S CZ  1 
ATOM   6073  N NH1 . ARG A 1 787 ? 54.059  100.568 -24.642 1.00 3.80   ? 788 ARG S NH1 1 
ATOM   6074  N NH2 . ARG A 1 787 ? 55.439  102.201 -23.808 1.00 3.80   ? 788 ARG S NH2 1 
ATOM   6075  N N   . ASP A 1 788 ? 51.528  102.856 -26.791 1.00 3.81   ? 789 ASP S N   1 
ATOM   6076  C CA  . ASP A 1 788 ? 50.628  102.699 -25.652 1.00 3.81   ? 789 ASP S CA  1 
ATOM   6077  C C   . ASP A 1 788 ? 49.181  102.671 -26.113 1.00 3.81   ? 789 ASP S C   1 
ATOM   6078  O O   . ASP A 1 788 ? 48.294  102.209 -25.401 1.00 98.90  ? 789 ASP S O   1 
ATOM   6079  C CB  . ASP A 1 788 ? 50.855  103.843 -24.650 1.00 98.90  ? 789 ASP S CB  1 
ATOM   6080  C CG  . ASP A 1 788 ? 52.095  103.627 -23.781 1.00 98.90  ? 789 ASP S CG  1 
ATOM   6081  O OD1 . ASP A 1 788 ? 53.158  103.290 -24.346 1.00 98.90  ? 789 ASP S OD1 1 
ATOM   6082  O OD2 . ASP A 1 788 ? 52.009  103.796 -22.540 1.00 98.90  ? 789 ASP S OD2 1 
ATOM   6083  N N   . LEU A 1 789 ? 48.958  103.175 -27.318 1.00 2.00   ? 790 LEU S N   1 
ATOM   6084  C CA  . LEU A 1 789 ? 47.632  103.221 -27.917 1.00 2.00   ? 790 LEU S CA  1 
ATOM   6085  C C   . LEU A 1 789 ? 47.438  101.903 -28.622 1.00 2.00   ? 790 LEU S C   1 
ATOM   6086  O O   . LEU A 1 789 ? 46.408  101.252 -28.505 1.00 2.53   ? 790 LEU S O   1 
ATOM   6087  C CB  . LEU A 1 789 ? 47.543  104.369 -28.918 1.00 2.53   ? 790 LEU S CB  1 
ATOM   6088  C CG  . LEU A 1 789 ? 46.769  105.588 -28.425 1.00 2.53   ? 790 LEU S CG  1 
ATOM   6089  C CD1 . LEU A 1 789 ? 47.702  106.581 -27.731 1.00 2.53   ? 790 LEU S CD1 1 
ATOM   6090  C CD2 . LEU A 1 789 ? 46.098  106.233 -29.608 1.00 2.53   ? 790 LEU S CD2 1 
ATOM   6091  N N   . LYS A 1 790 ? 48.458  101.516 -29.364 1.00 25.47  ? 791 LYS S N   1 
ATOM   6092  C CA  . LYS A 1 790 ? 48.434  100.261 -30.080 1.00 25.47  ? 791 LYS S CA  1 
ATOM   6093  C C   . LYS A 1 790 ? 48.127  99.075  -29.148 1.00 25.47  ? 791 LYS S C   1 
ATOM   6094  O O   . LYS A 1 790 ? 47.731  98.004  -29.612 1.00 55.48  ? 791 LYS S O   1 
ATOM   6095  C CB  . LYS A 1 790 ? 49.786  100.046 -30.758 1.00 55.48  ? 791 LYS S CB  1 
ATOM   6096  C CG  . LYS A 1 790 ? 49.736  100.102 -32.262 1.00 55.48  ? 791 LYS S CG  1 
ATOM   6097  C CD  . LYS A 1 790 ? 49.512  98.720  -32.844 1.00 55.48  ? 791 LYS S CD  1 
ATOM   6098  C CE  . LYS A 1 790 ? 48.203  98.666  -33.609 1.00 55.48  ? 791 LYS S CE  1 
ATOM   6099  N NZ  . LYS A 1 790 ? 48.106  99.762  -34.623 1.00 55.48  ? 791 LYS S NZ  1 
ATOM   6100  N N   . ILE A 1 791 ? 48.290  99.269  -27.838 1.00 4.87   ? 792 ILE S N   1 
ATOM   6101  C CA  . ILE A 1 791 ? 48.066  98.174  -26.887 1.00 4.87   ? 792 ILE S CA  1 
ATOM   6102  C C   . ILE A 1 791 ? 47.001  98.415  -25.825 1.00 4.87   ? 792 ILE S C   1 
ATOM   6103  O O   . ILE A 1 791 ? 46.710  97.508  -25.048 1.00 4.27   ? 792 ILE S O   1 
ATOM   6104  C CB  . ILE A 1 791 ? 49.384  97.793  -26.149 1.00 4.27   ? 792 ILE S CB  1 
ATOM   6105  C CG1 . ILE A 1 791 ? 49.947  99.017  -25.404 1.00 4.27   ? 792 ILE S CG1 1 
ATOM   6106  C CG2 . ILE A 1 791 ? 50.410  97.299  -27.145 1.00 4.27   ? 792 ILE S CG2 1 
ATOM   6107  C CD1 . ILE A 1 791 ? 50.206  98.793  -23.930 1.00 4.27   ? 792 ILE S CD1 1 
ATOM   6108  N N   . THR A 1 792 ? 46.426  99.618  -25.794 1.00 4.86   ? 793 THR S N   1 
ATOM   6109  C CA  . THR A 1 792 ? 45.413  99.975  -24.799 1.00 4.86   ? 793 THR S CA  1 
ATOM   6110  C C   . THR A 1 792 ? 44.323  98.940  -24.666 1.00 4.86   ? 793 THR S C   1 
ATOM   6111  O O   . THR A 1 792 ? 44.149  98.329  -23.610 1.00 99.03  ? 793 THR S O   1 
ATOM   6112  C CB  . THR A 1 792 ? 44.752  101.312 -25.127 1.00 99.03  ? 793 THR S CB  1 
ATOM   6113  O OG1 . THR A 1 792 ? 45.319  101.839 -26.327 1.00 99.03  ? 793 THR S OG1 1 
ATOM   6114  C CG2 . THR A 1 792 ? 44.968  102.302 -23.985 1.00 99.03  ? 793 THR S CG2 1 
ATOM   6115  N N   . ASP A 1 793 ? 43.583  98.761  -25.742 1.00 3.26   ? 794 ASP S N   1 
ATOM   6116  C CA  . ASP A 1 793 ? 42.495  97.793  -25.789 1.00 3.26   ? 794 ASP S CA  1 
ATOM   6117  C C   . ASP A 1 793 ? 42.884  96.489  -25.103 1.00 3.26   ? 794 ASP S C   1 
ATOM   6118  O O   . ASP A 1 793 ? 42.255  96.066  -24.130 1.00 100.00 ? 794 ASP S O   1 
ATOM   6119  C CB  . ASP A 1 793 ? 42.161  97.533  -27.241 1.00 100.00 ? 794 ASP S CB  1 
ATOM   6120  C CG  . ASP A 1 793 ? 43.234  98.070  -28.157 1.00 100.00 ? 794 ASP S CG  1 
ATOM   6121  O OD1 . ASP A 1 793 ? 44.422  97.724  -27.935 1.00 100.00 ? 794 ASP S OD1 1 
ATOM   6122  O OD2 . ASP A 1 793 ? 42.893  98.845  -29.079 1.00 100.00 ? 794 ASP S OD2 1 
ATOM   6123  N N   . VAL A 1 794 ? 43.928  95.859  -25.625 1.00 30.74  ? 795 VAL S N   1 
ATOM   6124  C CA  . VAL A 1 794 ? 44.437  94.611  -25.064 1.00 30.74  ? 795 VAL S CA  1 
ATOM   6125  C C   . VAL A 1 794 ? 44.569  94.734  -23.546 1.00 30.74  ? 795 VAL S C   1 
ATOM   6126  O O   . VAL A 1 794 ? 44.132  93.864  -22.798 1.00 15.40  ? 795 VAL S O   1 
ATOM   6127  C CB  . VAL A 1 794 ? 45.816  94.287  -25.642 1.00 15.40  ? 795 VAL S CB  1 
ATOM   6128  C CG1 . VAL A 1 794 ? 45.996  92.785  -25.779 1.00 15.40  ? 795 VAL S CG1 1 
ATOM   6129  C CG2 . VAL A 1 794 ? 45.979  94.998  -26.979 1.00 15.40  ? 795 VAL S CG2 1 
ATOM   6130  N N   . ILE A 1 795 ? 45.386  95.935  -23.152 1.00 2.00   ? 796 ILE S N   1 
ATOM   6131  C CA  . ILE A 1 795 ? 45.411  96.052  -21.714 1.00 2.00   ? 796 ILE S CA  1 
ATOM   6132  C C   . ILE A 1 795 ? 43.970  95.892  -21.257 1.00 2.00   ? 796 ILE S C   1 
ATOM   6133  O O   . ILE A 1 795 ? 43.675  95.110  -20.356 1.00 12.52  ? 796 ILE S O   1 
ATOM   6134  C CB  . ILE A 1 795 ? 45.935  97.422  -21.288 1.00 12.52  ? 796 ILE S CB  1 
ATOM   6135  C CG1 . ILE A 1 795 ? 47.270  97.692  -21.968 1.00 12.52  ? 796 ILE S CG1 1 
ATOM   6136  C CG2 . ILE A 1 795 ? 46.133  97.465  -19.797 1.00 12.52  ? 796 ILE S CG2 1 
ATOM   6137  C CD1 . ILE A 1 795 ? 48.324  96.664  -21.643 1.00 12.52  ? 796 ILE S CD1 1 
ATOM   6138  N N   . ILE A 1 796 ? 43.464  96.183  -19.635 1.00 6.96   ? 797 ILE S N   1 
ATOM   6139  C CA  . ILE A 1 796 ? 42.053  96.439  -19.854 1.00 6.96   ? 797 ILE S CA  1 
ATOM   6140  C C   . ILE A 1 796 ? 41.409  95.146  -20.308 1.00 6.96   ? 797 ILE S C   1 
ATOM   6141  O O   . ILE A 1 796 ? 40.392  94.727  -19.774 1.00 26.77  ? 797 ILE S O   1 
ATOM   6142  C CB  . ILE A 1 796 ? 41.873  97.517  -20.927 1.00 26.77  ? 797 ILE S CB  1 
ATOM   6143  C CG1 . ILE A 1 796 ? 41.387  98.811  -20.279 1.00 26.77  ? 797 ILE S CG1 1 
ATOM   6144  C CG2 . ILE A 1 796 ? 40.926  97.043  -21.996 1.00 26.77  ? 797 ILE S CG2 1 
ATOM   6145  C CD1 . ILE A 1 796 ? 42.143  100.035 -20.744 1.00 26.77  ? 797 ILE S CD1 1 
ATOM   6146  N N   . ALA A 1 797 ? 42.026  94.510  -21.289 1.00 2.00   ? 798 ALA S N   1 
ATOM   6147  C CA  . ALA A 1 797 ? 41.536  93.250  -21.828 1.00 2.00   ? 798 ALA S CA  1 
ATOM   6148  C C   . ALA A 1 797 ? 41.382  92.221  -20.744 1.00 2.00   ? 798 ALA S C   1 
ATOM   6149  O O   . ALA A 1 797 ? 40.301  91.686  -20.523 1.00 68.18  ? 798 ALA S O   1 
ATOM   6150  C CB  . ALA A 1 797 ? 42.503  92.738  -22.859 1.00 68.18  ? 798 ALA S CB  1 
ATOM   6151  N N   . PHE A 1 798 ? 42.487  91.951  -20.062 1.00 5.54   ? 799 PHE S N   1 
ATOM   6152  C CA  . PHE A 1 798 ? 42.498  90.978  -18.982 1.00 5.54   ? 799 PHE S CA  1 
ATOM   6153  C C   . PHE A 1 798 ? 41.463  91.354  -17.910 1.00 5.54   ? 799 PHE S C   1 
ATOM   6154  O O   . PHE A 1 798 ? 40.576  90.549  -17.598 1.00 2.00   ? 799 PHE S O   1 
ATOM   6155  C CB  . PHE A 1 798 ? 43.911  90.884  -18.391 1.00 2.00   ? 799 PHE S CB  1 
ATOM   6156  C CG  . PHE A 1 798 ? 44.023  89.971  -17.197 1.00 2.00   ? 799 PHE S CG  1 
ATOM   6157  C CD1 . PHE A 1 798 ? 43.817  88.607  -17.329 1.00 2.00   ? 799 PHE S CD1 1 
ATOM   6158  C CD2 . PHE A 1 798 ? 44.283  90.495  -15.925 1.00 2.00   ? 799 PHE S CD2 1 
ATOM   6159  C CE1 . PHE A 1 798 ? 43.859  87.778  -16.211 1.00 2.00   ? 799 PHE S CE1 1 
ATOM   6160  C CE2 . PHE A 1 798 ? 44.327  89.670  -14.808 1.00 2.00   ? 799 PHE S CE2 1 
ATOM   6161  C CZ  . PHE A 1 798 ? 44.112  88.313  -14.951 1.00 2.00   ? 799 PHE S CZ  1 
ATOM   6162  N N   . GLN A 1 799 ? 41.566  92.573  -17.370 1.00 2.00   ? 800 GLN S N   1 
ATOM   6163  C CA  . GLN A 1 799 ? 40.636  93.038  -16.352 1.00 2.00   ? 800 GLN S CA  1 
ATOM   6164  C C   . GLN A 1 799 ? 39.229  92.546  -16.622 1.00 2.00   ? 800 GLN S C   1 
ATOM   6165  O O   . GLN A 1 799 ? 38.541  92.108  -15.700 1.00 28.54  ? 800 GLN S O   1 
ATOM   6166  C CB  . GLN A 1 799 ? 40.616  94.550  -16.306 1.00 28.54  ? 800 GLN S CB  1 
ATOM   6167  C CG  . GLN A 1 799 ? 41.258  95.111  -15.080 1.00 28.54  ? 800 GLN S CG  1 
ATOM   6168  C CD  . GLN A 1 799 ? 42.130  96.289  -15.415 1.00 28.54  ? 800 GLN S CD  1 
ATOM   6169  O OE1 . GLN A 1 799 ? 42.589  96.420  -16.549 1.00 28.54  ? 800 GLN S OE1 1 
ATOM   6170  N NE2 . GLN A 1 799 ? 42.366  97.165  -14.437 1.00 28.54  ? 800 GLN S NE2 1 
ATOM   6171  N N   . ALA A 1 800 ? 38.811  92.617  -17.884 1.00 2.00   ? 801 ALA S N   1 
ATOM   6172  C CA  . ALA A 1 800 ? 37.473  92.196  -18.313 1.00 2.00   ? 801 ALA S CA  1 
ATOM   6173  C C   . ALA A 1 800 ? 37.169  90.756  -17.935 1.00 2.00   ? 801 ALA S C   1 
ATOM   6174  O O   . ALA A 1 800 ? 36.279  90.485  -17.123 1.00 84.95  ? 801 ALA S O   1 
ATOM   6175  C CB  . ALA A 1 800 ? 37.333  92.358  -19.805 1.00 84.95  ? 801 ALA S CB  1 
ATOM   6176  N N   . GLN A 1 801 ? 37.921  89.841  -18.530 1.00 2.46   ? 802 GLN S N   1 
ATOM   6177  C CA  . GLN A 1 801 ? 37.757  88.421  -18.280 1.00 2.46   ? 802 GLN S CA  1 
ATOM   6178  C C   . GLN A 1 801 ? 37.679  88.152  -16.785 1.00 2.46   ? 802 GLN S C   1 
ATOM   6179  O O   . GLN A 1 801 ? 36.998  87.225  -16.351 1.00 12.93  ? 802 GLN S O   1 
ATOM   6180  C CB  . GLN A 1 801 ? 38.923  87.659  -18.883 1.00 12.93  ? 802 GLN S CB  1 
ATOM   6181  C CG  . GLN A 1 801 ? 39.243  88.086  -20.300 1.00 12.93  ? 802 GLN S CG  1 
ATOM   6182  C CD  . GLN A 1 801 ? 39.104  86.943  -21.311 1.00 12.93  ? 802 GLN S CD  1 
ATOM   6183  O OE1 . GLN A 1 801 ? 38.521  85.910  -21.006 1.00 12.93  ? 802 GLN S OE1 1 
ATOM   6184  N NE2 . GLN A 1 801 ? 39.642  87.130  -22.515 1.00 12.93  ? 802 GLN S NE2 1 
ATOM   6185  N N   . CYS A 1 802 ? 38.378  88.967  -15.997 1.00 3.08   ? 803 CYS S N   1 
ATOM   6186  C CA  . CYS A 1 802 ? 38.376  88.822  -14.552 1.00 3.08   ? 803 CYS S CA  1 
ATOM   6187  C C   . CYS A 1 802 ? 37.003  89.153  -14.013 1.00 3.08   ? 803 CYS S C   1 
ATOM   6188  O O   . CYS A 1 802 ? 36.469  88.420  -13.192 1.00 2.00   ? 803 CYS S O   1 
ATOM   6189  C CB  . CYS A 1 802 ? 39.396  89.753  -13.917 1.00 2.00   ? 803 CYS S CB  1 
ATOM   6190  S SG  . CYS A 1 802 ? 41.045  89.368  -14.373 1.00 2.00   ? 803 CYS S SG  1 
ATOM   6191  N N   . ARG A 1 803 ? 36.435  90.268  -14.460 1.00 2.00   ? 804 ARG S N   1 
ATOM   6192  C CA  . ARG A 1 803 ? 35.102  90.656  -14.005 1.00 2.00   ? 804 ARG S CA  1 
ATOM   6193  C C   . ARG A 1 803 ? 34.157  89.548  -14.468 1.00 2.00   ? 804 ARG S C   1 
ATOM   6194  O O   . ARG A 1 803 ? 33.180  89.212  -13.790 1.00 39.52  ? 804 ARG S O   1 
ATOM   6195  C CB  . ARG A 1 803 ? 34.667  91.993  -14.630 1.00 39.52  ? 804 ARG S CB  1 
ATOM   6196  C CG  . ARG A 1 803 ? 35.489  93.201  -14.224 1.00 39.52  ? 804 ARG S CG  1 
ATOM   6197  C CD  . ARG A 1 803 ? 35.693  94.126  -15.414 1.00 39.52  ? 804 ARG S CD  1 
ATOM   6198  N NE  . ARG A 1 803 ? 36.447  95.331  -15.072 1.00 39.52  ? 804 ARG S NE  1 
ATOM   6199  C CZ  . ARG A 1 803 ? 36.184  96.106  -14.022 1.00 39.52  ? 804 ARG S CZ  1 
ATOM   6200  N NH1 . ARG A 1 803 ? 35.178  95.806  -13.198 1.00 39.52  ? 804 ARG S NH1 1 
ATOM   6201  N NH2 . ARG A 1 803 ? 36.927  97.182  -13.802 1.00 39.52  ? 804 ARG S NH2 1 
ATOM   6202  N N   . GLY A 1 804 ? 34.466  88.996  -15.633 1.00 2.00   ? 805 GLY S N   1 
ATOM   6203  C CA  . GLY A 1 804 ? 33.667  87.915  -16.171 1.00 2.00   ? 805 GLY S CA  1 
ATOM   6204  C C   . GLY A 1 804 ? 33.758  86.773  -15.187 1.00 2.00   ? 805 GLY S C   1 
ATOM   6205  O O   . GLY A 1 804 ? 32.825  86.520  -14.446 1.00 10.94  ? 805 GLY S O   1 
ATOM   6206  N N   . TYR A 1 805 ? 34.900  86.097  -15.178 1.00 10.07  ? 806 TYR S N   1 
ATOM   6207  C CA  . TYR A 1 805 ? 35.173  84.993  -14.257 1.00 10.07  ? 806 TYR S CA  1 
ATOM   6208  C C   . TYR A 1 805 ? 34.608  85.342  -12.870 1.00 10.07  ? 806 TYR S C   1 
ATOM   6209  O O   . TYR A 1 805 ? 33.660  84.717  -12.385 1.00 15.01  ? 806 TYR S O   1 
ATOM   6210  C CB  . TYR A 1 805 ? 36.694  84.796  -14.179 1.00 15.01  ? 806 TYR S CB  1 
ATOM   6211  C CG  . TYR A 1 805 ? 37.169  83.739  -13.212 1.00 15.01  ? 806 TYR S CG  1 
ATOM   6212  C CD1 . TYR A 1 805 ? 37.294  84.008  -11.850 1.00 15.01  ? 806 TYR S CD1 1 
ATOM   6213  C CD2 . TYR A 1 805 ? 37.467  82.460  -13.659 1.00 15.01  ? 806 TYR S CD2 1 
ATOM   6214  C CE1 . TYR A 1 805 ? 37.691  83.032  -10.961 1.00 15.01  ? 806 TYR S CE1 1 
ATOM   6215  C CE2 . TYR A 1 805 ? 37.866  81.467  -12.784 1.00 15.01  ? 806 TYR S CE2 1 
ATOM   6216  C CZ  . TYR A 1 805 ? 37.971  81.756  -11.436 1.00 15.01  ? 806 TYR S CZ  1 
ATOM   6217  O OH  . TYR A 1 805 ? 38.307  80.731  -10.571 1.00 15.01  ? 806 TYR S OH  1 
ATOM   6218  N N   . LEU A 1 806 ? 35.204  86.362  -12.251 1.00 44.55  ? 807 LEU S N   1 
ATOM   6219  C CA  . LEU A 1 806 ? 34.810  86.846  -10.935 1.00 44.55  ? 807 LEU S CA  1 
ATOM   6220  C C   . LEU A 1 806 ? 33.300  86.979  -10.820 1.00 44.55  ? 807 LEU S C   1 
ATOM   6221  O O   . LEU A 1 806 ? 32.759  87.014  -9.721  1.00 100.00 ? 807 LEU S O   1 
ATOM   6222  C CB  . LEU A 1 806 ? 35.454  88.211  -10.669 1.00 100.00 ? 807 LEU S CB  1 
ATOM   6223  C CG  . LEU A 1 806 ? 35.742  88.704  -9.247  1.00 100.00 ? 807 LEU S CG  1 
ATOM   6224  C CD1 . LEU A 1 806 ? 36.453  90.056  -9.336  1.00 100.00 ? 807 LEU S CD1 1 
ATOM   6225  C CD2 . LEU A 1 806 ? 34.451  88.840  -8.441  1.00 100.00 ? 807 LEU S CD2 1 
ATOM   6226  N N   . ALA A 1 807 ? 32.614  87.052  -11.947 1.00 41.49  ? 808 ALA S N   1 
ATOM   6227  C CA  . ALA A 1 807 ? 31.167  87.212  -11.921 1.00 41.49  ? 808 ALA S CA  1 
ATOM   6228  C C   . ALA A 1 807 ? 30.372  85.910  -12.011 1.00 41.49  ? 808 ALA S C   1 
ATOM   6229  O O   . ALA A 1 807 ? 29.663  85.543  -11.071 1.00 17.93  ? 808 ALA S O   1 
ATOM   6230  C CB  . ALA A 1 807 ? 30.741  88.161  -13.026 1.00 17.93  ? 808 ALA S CB  1 
ATOM   6231  N N   . ARG A 1 808 ? 30.488  85.218  -13.142 1.00 5.35   ? 809 ARG S N   1 
ATOM   6232  C CA  . ARG A 1 808 ? 29.780  83.966  -13.361 1.00 5.35   ? 809 ARG S CA  1 
ATOM   6233  C C   . ARG A 1 808 ? 29.832  83.113  -12.114 1.00 5.35   ? 809 ARG S C   1 
ATOM   6234  O O   . ARG A 1 808 ? 28.885  82.383  -11.815 1.00 65.57  ? 809 ARG S O   1 
ATOM   6235  C CB  . ARG A 1 808 ? 30.392  83.177  -14.523 1.00 65.57  ? 809 ARG S CB  1 
ATOM   6236  C CG  . ARG A 1 808 ? 31.633  83.794  -15.125 1.00 65.57  ? 809 ARG S CG  1 
ATOM   6237  C CD  . ARG A 1 808 ? 31.261  84.723  -16.278 1.00 65.57  ? 809 ARG S CD  1 
ATOM   6238  N NE  . ARG A 1 808 ? 32.285  84.756  -17.315 1.00 65.57  ? 809 ARG S NE  1 
ATOM   6239  C CZ  . ARG A 1 808 ? 32.650  83.695  -18.017 1.00 65.57  ? 809 ARG S CZ  1 
ATOM   6240  N NH1 . ARG A 1 808 ? 32.077  82.520  -17.795 1.00 65.57  ? 809 ARG S NH1 1 
ATOM   6241  N NH2 . ARG A 1 808 ? 33.595  83.803  -18.936 1.00 65.57  ? 809 ARG S NH2 1 
ATOM   6242  N N   . LYS A 1 809 ? 30.923  83.226  -11.366 1.00 6.87   ? 810 LYS S N   1 
ATOM   6243  C CA  . LYS A 1 809 ? 31.096  82.423  -10.162 1.00 6.87   ? 810 LYS S CA  1 
ATOM   6244  C C   . LYS A 1 809 ? 30.312  82.883  -8.938  1.00 6.87   ? 810 LYS S C   1 
ATOM   6245  O O   . LYS A 1 809 ? 29.617  82.079  -8.311  1.00 93.42  ? 810 LYS S O   1 
ATOM   6246  C CB  . LYS A 1 809 ? 32.588  82.320  -9.832  1.00 93.42  ? 810 LYS S CB  1 
ATOM   6247  C CG  . LYS A 1 809 ? 33.441  81.800  -11.006 1.00 93.42  ? 810 LYS S CG  1 
ATOM   6248  C CD  . LYS A 1 809 ? 33.715  80.285  -10.914 1.00 93.42  ? 810 LYS S CD  1 
ATOM   6249  C CE  . LYS A 1 809 ? 34.645  79.807  -12.040 1.00 93.42  ? 810 LYS S CE  1 
ATOM   6250  N NZ  . LYS A 1 809 ? 35.473  78.615  -11.680 1.00 93.42  ? 810 LYS S NZ  1 
ATOM   6251  N N   . ALA A 1 810 ? 30.414  84.162  -8.596  1.00 91.27  ? 811 ALA S N   1 
ATOM   6252  C CA  . ALA A 1 810 ? 29.700  84.691  -7.430  1.00 91.27  ? 811 ALA S CA  1 
ATOM   6253  C C   . ALA A 1 810 ? 28.176  84.767  -7.605  1.00 91.27  ? 811 ALA S C   1 
ATOM   6254  O O   . ALA A 1 810 ? 27.438  85.010  -6.639  1.00 86.77  ? 811 ALA S O   1 
ATOM   6255  C CB  . ALA A 1 810 ? 30.250  86.061  -7.056  1.00 86.77  ? 811 ALA S CB  1 
ATOM   6256  N N   . PHE A 1 811 ? 27.720  84.584  -8.845  1.00 27.32  ? 812 PHE S N   1 
ATOM   6257  C CA  . PHE A 1 811 ? 26.291  84.575  -9.158  1.00 27.32  ? 812 PHE S CA  1 
ATOM   6258  C C   . PHE A 1 811 ? 25.853  83.126  -8.948  1.00 27.32  ? 812 PHE S C   1 
ATOM   6259  O O   . PHE A 1 811 ? 24.872  82.839  -8.240  1.00 48.51  ? 812 PHE S O   1 
ATOM   6260  C CB  . PHE A 1 811 ? 26.045  84.980  -10.615 1.00 48.51  ? 812 PHE S CB  1 
ATOM   6261  C CG  . PHE A 1 811 ? 25.185  83.989  -11.402 1.00 48.51  ? 812 PHE S CG  1 
ATOM   6262  C CD1 . PHE A 1 811 ? 23.791  84.053  -11.362 1.00 48.51  ? 812 PHE S CD1 1 
ATOM   6263  C CD2 . PHE A 1 811 ? 25.770  83.021  -12.215 1.00 48.51  ? 812 PHE S CD2 1 
ATOM   6264  C CE1 . PHE A 1 811 ? 23.002  83.169  -12.125 1.00 48.51  ? 812 PHE S CE1 1 
ATOM   6265  C CE2 . PHE A 1 811 ? 24.986  82.148  -12.971 1.00 48.51  ? 812 PHE S CE2 1 
ATOM   6266  C CZ  . PHE A 1 811 ? 23.606  82.226  -12.924 1.00 48.51  ? 812 PHE S CZ  1 
ATOM   6267  N N   . ALA A 1 812 ? 26.600  82.217  -9.570  1.00 14.81  ? 813 ALA S N   1 
ATOM   6268  C CA  . ALA A 1 812 ? 26.348  80.792  -9.458  1.00 14.81  ? 813 ALA S CA  1 
ATOM   6269  C C   . ALA A 1 812 ? 26.526  80.378  -7.989  1.00 14.81  ? 813 ALA S C   1 
ATOM   6270  O O   . ALA A 1 812 ? 26.496  79.195  -7.656  1.00 64.78  ? 813 ALA S O   1 
ATOM   6271  C CB  . ALA A 1 812 ? 27.318  80.034  -10.331 1.00 64.78  ? 813 ALA S CB  1 
ATOM   6272  N N   . LYS A 1 813 ? 26.708  81.367  -7.120  1.00 50.10  ? 814 LYS S N   1 
ATOM   6273  C CA  . LYS A 1 813 ? 26.852  81.126  -5.690  1.00 50.10  ? 814 LYS S CA  1 
ATOM   6274  C C   . LYS A 1 813 ? 25.501  81.379  -5.042  1.00 50.10  ? 814 LYS S C   1 
ATOM   6275  O O   . LYS A 1 813 ? 24.984  80.530  -4.331  1.00 87.18  ? 814 LYS S O   1 
ATOM   6276  C CB  . LYS A 1 813 ? 27.910  82.064  -5.087  1.00 87.18  ? 814 LYS S CB  1 
ATOM   6277  C CG  . LYS A 1 813 ? 27.408  83.003  -3.987  1.00 87.18  ? 814 LYS S CG  1 
ATOM   6278  C CD  . LYS A 1 813 ? 27.461  82.330  -2.626  1.00 87.18  ? 814 LYS S CD  1 
ATOM   6279  C CE  . LYS A 1 813 ? 27.451  83.356  -1.509  1.00 87.18  ? 814 LYS S CE  1 
ATOM   6280  N NZ  . LYS A 1 813 ? 28.607  83.196  -0.588  1.00 87.18  ? 814 LYS S NZ  1 
ATOM   6281  N N   . ARG A 1 814 ? 24.927  82.552  -5.305  1.00 58.56  ? 815 ARG S N   1 
ATOM   6282  C CA  . ARG A 1 814 ? 23.631  82.902  -4.743  1.00 58.56  ? 815 ARG S CA  1 
ATOM   6283  C C   . ARG A 1 814 ? 22.647  81.829  -5.155  1.00 58.56  ? 815 ARG S C   1 
ATOM   6284  O O   . ARG A 1 814 ? 21.565  81.690  -4.571  1.00 100.00 ? 815 ARG S O   1 
ATOM   6285  C CB  . ARG A 1 814 ? 23.168  84.263  -5.252  1.00 100.00 ? 815 ARG S CB  1 
ATOM   6286  C CG  . ARG A 1 814 ? 22.919  85.266  -4.137  1.00 100.00 ? 815 ARG S CG  1 
ATOM   6287  C CD  . ARG A 1 814 ? 24.209  85.590  -3.386  1.00 100.00 ? 815 ARG S CD  1 
ATOM   6288  N NE  . ARG A 1 814 ? 24.004  85.683  -1.941  1.00 100.00 ? 815 ARG S NE  1 
ATOM   6289  C CZ  . ARG A 1 814 ? 24.919  86.115  -1.079  1.00 100.00 ? 815 ARG S CZ  1 
ATOM   6290  N NH1 . ARG A 1 814 ? 26.115  86.500  -1.506  1.00 100.00 ? 815 ARG S NH1 1 
ATOM   6291  N NH2 . ARG A 1 814 ? 24.643  86.163  0.218   1.00 100.00 ? 815 ARG S NH2 1 
ATOM   6292  N N   . GLN A 1 815 ? 23.046  81.064  -6.168  1.00 41.16  ? 816 GLN S N   1 
ATOM   6293  C CA  . GLN A 1 815 ? 22.241  79.971  -6.689  1.00 41.16  ? 816 GLN S CA  1 
ATOM   6294  C C   . GLN A 1 815 ? 22.188  78.800  -5.700  1.00 41.16  ? 816 GLN S C   1 
ATOM   6295  O O   . GLN A 1 815 ? 21.191  78.073  -5.643  1.00 62.29  ? 816 GLN S O   1 
ATOM   6296  C CB  . GLN A 1 815 ? 22.823  79.495  -8.015  1.00 62.29  ? 816 GLN S CB  1 
ATOM   6297  C CG  . GLN A 1 815 ? 21.805  79.358  -9.132  1.00 62.29  ? 816 GLN S CG  1 
ATOM   6298  C CD  . GLN A 1 815 ? 22.448  79.032  -10.467 1.00 62.29  ? 816 GLN S CD  1 
ATOM   6299  O OE1 . GLN A 1 815 ? 23.419  79.674  -10.879 1.00 62.29  ? 816 GLN S OE1 1 
ATOM   6300  N NE2 . GLN A 1 815 ? 21.907  78.033  -11.156 1.00 62.29  ? 816 GLN S NE2 1 
ATOM   6301  N N   . GLN A 1 816 ? 23.254  78.613  -4.916  1.00 58.01  ? 817 GLN S N   1 
ATOM   6302  C CA  . GLN A 1 816 ? 23.309  77.517  -3.957  1.00 58.01  ? 817 GLN S CA  1 
ATOM   6303  C C   . GLN A 1 816 ? 22.429  77.802  -2.747  1.00 58.01  ? 817 GLN S C   1 
ATOM   6304  O O   . GLN A 1 816 ? 21.734  76.905  -2.256  1.00 90.87  ? 817 GLN S O   1 
ATOM   6305  C CB  . GLN A 1 816 ? 24.750  77.254  -3.524  1.00 90.87  ? 817 GLN S CB  1 
ATOM   6306  C CG  . GLN A 1 816 ? 25.345  78.339  -2.644  1.00 90.87  ? 817 GLN S CG  1 
ATOM   6307  C CD  . GLN A 1 816 ? 26.834  78.165  -2.431  1.00 90.87  ? 817 GLN S CD  1 
ATOM   6308  O OE1 . GLN A 1 816 ? 27.436  77.221  -2.943  1.00 90.87  ? 817 GLN S OE1 1 
ATOM   6309  N NE2 . GLN A 1 816 ? 27.626  78.951  -1.714  1.00 90.87  ? 817 GLN S NE2 1 
ATOM   6310  N N   . GLN A 1 817 ? 22.464  79.039  -2.264  1.00 80.63  ? 818 GLN S N   1 
ATOM   6311  C CA  . GLN A 1 817 ? 21.655  79.429  -1.116  1.00 80.63  ? 818 GLN S CA  1 
ATOM   6312  C C   . GLN A 1 817 ? 20.190  79.359  -1.529  1.00 80.63  ? 818 GLN S C   1 
ATOM   6313  O O   . GLN A 1 817 ? 19.290  79.280  -0.689  1.00 100.00 ? 818 GLN S O   1 
ATOM   6314  C CB  . GLN A 1 817 ? 22.001  80.847  -0.669  1.00 100.00 ? 818 GLN S CB  1 
ATOM   6315  C CG  . GLN A 1 817 ? 22.463  81.748  -1.796  1.00 100.00 ? 818 GLN S CG  1 
ATOM   6316  C CD  . GLN A 1 817 ? 23.955  81.999  -1.755  1.00 100.00 ? 818 GLN S CD  1 
ATOM   6317  O OE1 . GLN A 1 817 ? 24.745  81.125  -2.099  1.00 100.00 ? 818 GLN S OE1 1 
ATOM   6318  N NE2 . GLN A 1 817 ? 24.345  83.195  -1.333  1.00 100.00 ? 818 GLN S NE2 1 
ATOM   6319  N N   . LEU A 1 818 ? 19.967  79.409  -2.836  1.00 67.28  ? 819 LEU S N   1 
ATOM   6320  C CA  . LEU A 1 818 ? 18.625  79.307  -3.384  1.00 67.28  ? 819 LEU S CA  1 
ATOM   6321  C C   . LEU A 1 818 ? 18.314  77.804  -3.425  1.00 67.28  ? 819 LEU S C   1 
ATOM   6322  O O   . LEU A 1 818 ? 17.252  77.351  -2.988  1.00 94.29  ? 819 LEU S O   1 
ATOM   6323  C CB  . LEU A 1 818 ? 18.585  79.897  -4.798  1.00 94.29  ? 819 LEU S CB  1 
ATOM   6324  C CG  . LEU A 1 818 ? 17.791  79.120  -5.857  1.00 94.29  ? 819 LEU S CG  1 
ATOM   6325  C CD1 . LEU A 1 818 ? 16.467  79.829  -6.106  1.00 94.29  ? 819 LEU S CD1 1 
ATOM   6326  C CD2 . LEU A 1 818 ? 18.601  78.992  -7.154  1.00 94.29  ? 819 LEU S CD2 1 
ATOM   6327  N N   . GLU A 1 819 ? 17.774  76.161  -4.327  1.00 18.89  ? 820 GLU S N   1 
ATOM   6328  C CA  . GLU A 1 819 ? 16.836  75.471  -3.495  1.00 76.51  ? 820 GLU S CA  1 
ATOM   6329  C C   . GLU A 1 819 ? 16.973  75.662  -2.013  1.00 42.17  ? 820 GLU S C   1 
ATOM   6330  O O   . GLU A 1 819 ? 15.957  75.756  -1.293  1.00 48.85  ? 820 GLU S O   1 
ATOM   6331  C CB  . GLU A 1 819 ? 16.800  73.972  -3.817  1.00 86.91  ? 820 GLU S CB  1 
ATOM   6332  C CG  . GLU A 1 819 ? 18.112  73.302  -3.428  1.00 100.00 ? 820 GLU S CG  1 
ATOM   6333  C CD  . GLU A 1 819 ? 18.407  72.110  -4.282  1.00 100.00 ? 820 GLU S CD  1 
ATOM   6334  O OE1 . GLU A 1 819 ? 18.576  72.427  -5.558  1.00 100.00 ? 820 GLU S OE1 1 
ATOM   6335  O OE2 . GLU A 1 819 ? 18.460  70.962  -3.848  1.00 100.00 ? 820 GLU S OE2 1 
ATOM   6336  N N   . SER A 1 820 ? 18.203  75.673  -1.514  1.00 40.56  ? 821 SER S N   1 
ATOM   6337  C CA  . SER A 1 820 ? 18.402  75.819  -0.089  1.00 24.99  ? 821 SER S CA  1 
ATOM   6338  C C   . SER A 1 820 ? 17.638  76.973  0.470   1.00 9.50   ? 821 SER S C   1 
ATOM   6339  O O   . SER A 1 820 ? 17.220  76.938  1.620   1.00 46.15  ? 821 SER S O   1 
ATOM   6340  C CB  . SER A 1 820 ? 19.865  75.786  0.343   1.00 52.22  ? 821 SER S CB  1 
ATOM   6341  O OG  . SER A 1 820 ? 20.304  74.462  0.532   1.00 78.06  ? 821 SER S OG  1 
ATOM   6342  N N   . ILE A 1 821 ? 17.358  77.935  -0.405  1.00 25.75  ? 822 ILE S N   1 
ATOM   6343  C CA  . ILE A 1 821 ? 16.581  79.074  0.003   1.00 29.41  ? 822 ILE S CA  1 
ATOM   6344  C C   . ILE A 1 821 ? 15.150  78.636  0.246   1.00 50.63  ? 822 ILE S C   1 
ATOM   6345  O O   . ILE A 1 821 ? 14.636  78.714  1.362   1.00 64.54  ? 822 ILE S O   1 
ATOM   6346  C CB  . ILE A 1 821 ? 16.612  80.181  -1.047  1.00 100.00 ? 822 ILE S CB  1 
ATOM   6347  C CG1 . ILE A 1 821 ? 18.045  80.647  -1.243  1.00 34.31  ? 822 ILE S CG1 1 
ATOM   6348  C CG2 . ILE A 1 821 ? 15.720  81.340  -0.604  1.00 100.00 ? 822 ILE S CG2 1 
ATOM   6349  C CD1 . ILE A 1 821 ? 18.171  81.936  -2.037  1.00 41.84  ? 822 ILE S CD1 1 
ATOM   6350  N N   . PHE A 1 822 ? 14.538  78.163  -0.842  1.00 35.76  ? 823 PHE S N   1 
ATOM   6351  C CA  . PHE A 1 822 ? 13.190  77.669  -0.908  1.00 20.62  ? 823 PHE S CA  1 
ATOM   6352  C C   . PHE A 1 822 ? 12.884  76.906  0.340   1.00 24.38  ? 823 PHE S C   1 
ATOM   6353  O O   . PHE A 1 822 ? 11.971  77.230  1.069   1.00 21.24  ? 823 PHE S O   1 
ATOM   6354  C CB  . PHE A 1 822 ? 13.046  76.677  -2.054  1.00 30.86  ? 823 PHE S CB  1 
ATOM   6355  C CG  . PHE A 1 822 ? 12.753  77.278  -3.397  1.00 73.87  ? 823 PHE S CG  1 
ATOM   6356  C CD1 . PHE A 1 822 ? 11.969  78.422  -3.543  1.00 34.51  ? 823 PHE S CD1 1 
ATOM   6357  C CD2 . PHE A 1 822 ? 13.315  76.704  -4.534  1.00 100.00 ? 823 PHE S CD2 1 
ATOM   6358  C CE1 . PHE A 1 822 ? 11.760  78.996  -4.797  1.00 100.00 ? 823 PHE S CE1 1 
ATOM   6359  C CE2 . PHE A 1 822 ? 13.083  77.233  -5.800  1.00 64.90  ? 823 PHE S CE2 1 
ATOM   6360  C CZ  . PHE A 1 822 ? 12.310  78.383  -5.921  1.00 63.25  ? 823 PHE S CZ  1 
ATOM   6361  N N   . CYS A 1 823 ? 13.772  75.976  0.586   1.00 1.00   ? 824 CYS S N   1 
ATOM   6362  C CA  . CYS A 1 823 ? 13.681  75.151  1.760   1.00 12.00  ? 824 CYS S CA  1 
ATOM   6363  C C   . CYS A 1 823 ? 13.544  76.046  2.926   1.00 1.00   ? 824 CYS S C   1 
ATOM   6364  O O   . CYS A 1 823 ? 12.633  75.927  3.737   1.00 57.09  ? 824 CYS S O   1 
ATOM   6365  C CB  . CYS A 1 823 ? 14.943  74.333  1.959   1.00 15.40  ? 824 CYS S CB  1 
ATOM   6366  S SG  . CYS A 1 823 ? 14.709  73.590  3.528   1.00 38.96  ? 824 CYS S SG  1 
ATOM   6367  N N   . ILE A 1 824 ? 14.433  76.985  2.975   1.00 35.92  ? 825 ILE S N   1 
ATOM   6368  C CA  . ILE A 1 824 ? 14.348  77.919  4.066   1.00 57.24  ? 825 ILE S CA  1 
ATOM   6369  C C   . ILE A 1 824 ? 13.069  78.702  3.913   1.00 29.28  ? 825 ILE S C   1 
ATOM   6370  O O   . ILE A 1 824 ? 12.315  78.826  4.861   1.00 79.73  ? 825 ILE S O   1 
ATOM   6371  C CB  . ILE A 1 824 ? 15.538  78.868  4.205   1.00 60.08  ? 825 ILE S CB  1 
ATOM   6372  C CG1 . ILE A 1 824 ? 16.848  78.103  4.221   1.00 100.00 ? 825 ILE S CG1 1 
ATOM   6373  C CG2 . ILE A 1 824 ? 15.471  79.672  5.512   1.00 15.50  ? 825 ILE S CG2 1 
ATOM   6374  C CD1 . ILE A 1 824 ? 17.743  78.523  5.404   1.00 43.40  ? 825 ILE S CD1 1 
ATOM   6375  N N   . GLN A 1 825 ? 12.822  79.178  2.692   1.00 50.20  ? 826 GLN S N   1 
ATOM   6376  C CA  . GLN A 1 825 ? 11.640  80.003  2.401   1.00 100.00 ? 826 GLN S CA  1 
ATOM   6377  C C   . GLN A 1 825 ? 10.359  79.429  2.959   1.00 9.68   ? 826 GLN S C   1 
ATOM   6378  O O   . GLN A 1 825 ? 9.808   79.871  3.965   1.00 100.00 ? 826 GLN S O   1 
ATOM   6379  C CB  . GLN A 1 825 ? 11.459  80.420  0.907   1.00 59.52  ? 826 GLN S CB  1 
ATOM   6380  C CG  . GLN A 1 825 ? 11.942  81.861  0.584   1.00 100.00 ? 826 GLN S CG  1 
ATOM   6381  C CD  . GLN A 1 825 ? 11.985  82.142  -0.896  1.00 57.60  ? 826 GLN S CD  1 
ATOM   6382  O OE1 . GLN A 1 825 ? 11.576  81.285  -1.673  1.00 64.11  ? 826 GLN S OE1 1 
ATOM   6383  N NE2 . GLN A 1 825 ? 12.457  83.327  -1.275  1.00 100.00 ? 826 GLN S NE2 1 
ATOM   6384  N N   . TYR A 1 826 ? 9.882   78.396  2.301   1.00 100.00 ? 827 TYR S N   1 
ATOM   6385  C CA  . TYR A 1 826 ? 8.660   77.728  2.695   1.00 4.75   ? 827 TYR S CA  1 
ATOM   6386  C C   . TYR A 1 826 ? 8.624   77.363  4.164   1.00 27.17  ? 827 TYR S C   1 
ATOM   6387  O O   . TYR A 1 826 ? 7.651   77.641  4.859   1.00 53.59  ? 827 TYR S O   1 
ATOM   6388  C CB  . TYR A 1 826 ? 8.484   76.497  1.820   1.00 59.26  ? 827 TYR S CB  1 
ATOM   6389  C CG  . TYR A 1 826 ? 8.212   76.834  0.370   1.00 100.00 ? 827 TYR S CG  1 
ATOM   6390  C CD1 . TYR A 1 826 ? 7.337   77.863  0.004   1.00 75.69  ? 827 TYR S CD1 1 
ATOM   6391  C CD2 . TYR A 1 826 ? 8.804   76.071  -0.639  1.00 100.00 ? 827 TYR S CD2 1 
ATOM   6392  C CE1 . TYR A 1 826 ? 7.115   78.179  -1.327  1.00 43.29  ? 827 TYR S CE1 1 
ATOM   6393  C CE2 . TYR A 1 826 ? 8.592   76.368  -1.983  1.00 100.00 ? 827 TYR S CE2 1 
ATOM   6394  C CZ  . TYR A 1 826 ? 7.731   77.410  -2.322  1.00 100.00 ? 827 TYR S CZ  1 
ATOM   6395  O OH  . TYR A 1 826 ? 7.514   77.723  -3.643  1.00 100.00 ? 827 TYR S OH  1 
ATOM   6396  N N   . ASN A 1 827 ? 9.696   76.699  4.593   1.00 25.59  ? 828 ASN S N   1 
ATOM   6397  C CA  . ASN A 1 827 ? 9.852   76.193  5.950   1.00 33.86  ? 828 ASN S CA  1 
ATOM   6398  C C   . ASN A 1 827 ? 9.459   77.078  7.083   1.00 9.16   ? 828 ASN S C   1 
ATOM   6399  O O   . ASN A 1 827 ? 8.958   76.582  8.079   1.00 37.44  ? 828 ASN S O   1 
ATOM   6400  C CB  . ASN A 1 827 ? 11.204  75.547  6.204   1.00 1.00   ? 828 ASN S CB  1 
ATOM   6401  C CG  . ASN A 1 827 ? 11.003  74.059  6.342   1.00 29.99  ? 828 ASN S CG  1 
ATOM   6402  O OD1 . ASN A 1 827 ? 10.492  73.601  7.382   1.00 68.47  ? 828 ASN S OD1 1 
ATOM   6403  N ND2 . ASN A 1 827 ? 11.299  73.314  5.259   1.00 40.95  ? 828 ASN S ND2 1 
ATOM   6404  N N   . VAL A 1 828 ? 9.758   78.365  6.917   1.00 65.70  ? 829 VAL S N   1 
ATOM   6405  C CA  . VAL A 1 828 ? 9.458   79.401  7.900   1.00 3.05   ? 829 VAL S CA  1 
ATOM   6406  C C   . VAL A 1 828 ? 7.971   79.692  7.920   1.00 100.00 ? 829 VAL S C   1 
ATOM   6407  O O   . VAL A 1 828 ? 7.286   79.711  8.964   1.00 79.40  ? 829 VAL S O   1 
ATOM   6408  C CB  . VAL A 1 828 ? 10.157  80.685  7.514   1.00 46.10  ? 829 VAL S CB  1 
ATOM   6409  C CG1 . VAL A 1 828 ? 9.495   81.837  8.207   1.00 35.68  ? 829 VAL S CG1 1 
ATOM   6410  C CG2 . VAL A 1 828 ? 11.626  80.597  7.909   1.00 18.30  ? 829 VAL S CG2 1 
ATOM   6411  N N   . ARG A 1 829 ? 7.492   79.972  6.716   1.00 30.78  ? 830 ARG S N   1 
ATOM   6412  C CA  . ARG A 1 829 ? 6.099   80.251  6.478   1.00 28.61  ? 830 ARG S CA  1 
ATOM   6413  C C   . ARG A 1 829 ? 5.178   79.297  7.228   1.00 94.72  ? 830 ARG S C   1 
ATOM   6414  O O   . ARG A 1 829 ? 4.231   79.783  7.829   1.00 60.39  ? 830 ARG S O   1 
ATOM   6415  C CB  . ARG A 1 829 ? 5.797   80.220  4.997   1.00 75.35  ? 830 ARG S CB  1 
ATOM   6416  C CG  . ARG A 1 829 ? 6.119   81.578  4.368   1.00 26.49  ? 830 ARG S CG  1 
ATOM   6417  C CD  . ARG A 1 829 ? 5.511   81.728  2.984   1.00 47.21  ? 830 ARG S CD  1 
ATOM   6418  N NE  . ARG A 1 829 ? 6.271   82.645  2.141   1.00 35.32  ? 830 ARG S NE  1 
ATOM   6419  C CZ  . ARG A 1 829 ? 6.730   82.313  0.931   1.00 60.27  ? 830 ARG S CZ  1 
ATOM   6420  N NH1 . ARG A 1 829 ? 6.547   81.100  0.401   1.00 40.56  ? 830 ARG S NH1 1 
ATOM   6421  N NH2 . ARG A 1 829 ? 7.387   83.218  0.230   1.00 48.78  ? 830 ARG S NH2 1 
ATOM   6422  N N   . SER A 1 830 ? 5.493   77.974  7.161   1.00 22.62  ? 831 SER S N   1 
ATOM   6423  C CA  . SER A 1 830 ? 4.765   76.935  7.838   1.00 74.51  ? 831 SER S CA  1 
ATOM   6424  C C   . SER A 1 830 ? 4.483   77.431  9.228   1.00 34.43  ? 831 SER S C   1 
ATOM   6425  O O   . SER A 1 830 ? 3.379   77.847  9.584   1.00 88.09  ? 831 SER S O   1 
ATOM   6426  C CB  . SER A 1 830 ? 5.641   75.700  8.033   1.00 19.38  ? 831 SER S CB  1 
ATOM   6427  O OG  . SER A 1 830 ? 5.322   74.735  7.058   1.00 94.17  ? 831 SER S OG  1 
ATOM   6428  N N   . PHE A 1 831 ? 5.559   77.430  9.952   1.00 15.33  ? 832 PHE S N   1 
ATOM   6429  C CA  . PHE A 1 831 ? 5.619   77.798  11.304  1.00 31.04  ? 832 PHE S CA  1 
ATOM   6430  C C   . PHE A 1 831 ? 4.797   79.010  11.679  1.00 15.33  ? 832 PHE S C   1 
ATOM   6431  O O   . PHE A 1 831 ? 4.068   79.013  12.657  1.00 100.00 ? 832 PHE S O   1 
ATOM   6432  C CB  . PHE A 1 831 ? 7.063   77.950  11.640  1.00 21.31  ? 832 PHE S CB  1 
ATOM   6433  C CG  . PHE A 1 831 ? 7.228   78.494  12.987  1.00 16.69  ? 832 PHE S CG  1 
ATOM   6434  C CD1 . PHE A 1 831 ? 7.128   77.670  14.114  1.00 100.00 ? 832 PHE S CD1 1 
ATOM   6435  C CD2 . PHE A 1 831 ? 7.457   79.854  13.125  1.00 30.05  ? 832 PHE S CD2 1 
ATOM   6436  C CE1 . PHE A 1 831 ? 7.264   78.227  15.385  1.00 50.78  ? 832 PHE S CE1 1 
ATOM   6437  C CE2 . PHE A 1 831 ? 7.632   80.406  14.383  1.00 24.67  ? 832 PHE S CE2 1 
ATOM   6438  C CZ  . PHE A 1 831 ? 7.531   79.590  15.506  1.00 22.24  ? 832 PHE S CZ  1 
ATOM   6439  N N   . MET A 1 832 ? 4.887   80.038  10.893  1.00 34.35  ? 833 MET S N   1 
ATOM   6440  C CA  . MET A 1 832 ? 4.116   81.235  11.153  1.00 66.62  ? 833 MET S CA  1 
ATOM   6441  C C   . MET A 1 832 ? 2.618   81.002  11.171  1.00 34.12  ? 833 MET S C   1 
ATOM   6442  O O   . MET A 1 832 ? 1.842   81.772  11.702  1.00 90.64  ? 833 MET S O   1 
ATOM   6443  C CB  . MET A 1 832 ? 4.371   82.169  10.004  1.00 31.25  ? 833 MET S CB  1 
ATOM   6444  C CG  . MET A 1 832 ? 5.787   82.668  10.090  1.00 30.50  ? 833 MET S CG  1 
ATOM   6445  S SD  . MET A 1 832 ? 5.845   84.246  10.869  1.00 100.00 ? 833 MET S SD  1 
ATOM   6446  C CE  . MET A 1 832 ? 6.961   83.762  12.190  1.00 11.23  ? 833 MET S CE  1 
ATOM   6447  N N   . ASN A 1 833 ? 2.240   79.960  10.512  1.00 48.13  ? 834 ASN S N   1 
ATOM   6448  C CA  . ASN A 1 833 ? 0.854   79.615  10.372  1.00 61.40  ? 834 ASN S CA  1 
ATOM   6449  C C   . ASN A 1 833 ? 0.398   78.665  11.428  1.00 55.14  ? 834 ASN S C   1 
ATOM   6450  O O   . ASN A 1 833 ? -0.684  78.759  12.017  1.00 45.84  ? 834 ASN S O   1 
ATOM   6451  C CB  . ASN A 1 833 ? 0.777   78.861  9.063   1.00 15.81  ? 834 ASN S CB  1 
ATOM   6452  C CG  . ASN A 1 833 ? 0.502   79.803  7.937   1.00 100.00 ? 834 ASN S CG  1 
ATOM   6453  O OD1 . ASN A 1 833 ? 1.264   80.773  7.699   1.00 53.73  ? 834 ASN S OD1 1 
ATOM   6454  N ND2 . ASN A 1 833 ? -0.615  79.561  7.279   1.00 100.00 ? 834 ASN S ND2 1 
ATOM   6455  N N   . VAL A 1 834 ? 1.289   77.727  11.627  1.00 31.02  ? 835 VAL S N   1 
ATOM   6456  C CA  . VAL A 1 834 ? 1.091   76.664  12.525  1.00 25.02  ? 835 VAL S CA  1 
ATOM   6457  C C   . VAL A 1 834 ? 1.134   77.032  13.973  1.00 13.69  ? 835 VAL S C   1 
ATOM   6458  O O   . VAL A 1 834 ? 0.211   76.715  14.700  1.00 20.97  ? 835 VAL S O   1 
ATOM   6459  C CB  . VAL A 1 834 ? 1.992   75.500  12.190  1.00 3.06   ? 835 VAL S CB  1 
ATOM   6460  C CG1 . VAL A 1 834 ? 1.796   74.425  13.241  1.00 100.00 ? 835 VAL S CG1 1 
ATOM   6461  C CG2 . VAL A 1 834 ? 1.594   74.964  10.822  1.00 52.79  ? 835 VAL S CG2 1 
HETATM 6462  N N   . MLY A 1 835 ? 2.219   77.661  14.380  1.00 35.64  ? 836 MLY S N   1 
HETATM 6463  C CA  . MLY A 1 835 ? 2.459   78.076  15.751  1.00 22.46  ? 836 MLY S CA  1 
HETATM 6464  C CB  . MLY A 1 835 ? 3.592   79.078  15.824  1.00 76.47  ? 836 MLY S CB  1 
HETATM 6465  C CG  . MLY A 1 835 ? 3.109   80.511  15.560  1.00 16.39  ? 836 MLY S CG  1 
HETATM 6466  C CD  . MLY A 1 835 ? 4.126   81.532  16.058  1.00 31.25  ? 836 MLY S CD  1 
HETATM 6467  C CE  . MLY A 1 835 ? 3.912   82.922  15.471  1.00 64.83  ? 836 MLY S CE  1 
HETATM 6468  N NZ  . MLY A 1 835 ? 4.734   83.971  16.098  1.00 61.63  ? 836 MLY S NZ  1 
HETATM 6469  C CH1 . MLY A 1 835 ? 4.000   85.255  15.991  1.00 94.43  ? 836 MLY S CH1 1 
HETATM 6470  C CH2 . MLY A 1 835 ? 6.048   84.052  15.449  1.00 100.00 ? 836 MLY S CH2 1 
HETATM 6471  C C   . MLY A 1 835 ? 1.219   78.622  16.462  1.00 100.00 ? 836 MLY S C   1 
HETATM 6472  O O   . MLY A 1 835 ? 1.198   78.636  17.693  1.00 43.41  ? 836 MLY S O   1 
ATOM   6473  N N   . HIS A 1 836 ? 0.188   79.040  15.693  1.00 54.70  ? 837 HIS S N   1 
ATOM   6474  C CA  . HIS A 1 836 ? -1.022  79.573  16.326  1.00 45.04  ? 837 HIS S CA  1 
ATOM   6475  C C   . HIS A 1 836 ? -2.147  78.521  16.442  1.00 34.78  ? 837 HIS S C   1 
ATOM   6476  O O   . HIS A 1 836 ? -3.160  78.770  17.068  1.00 68.88  ? 837 HIS S O   1 
ATOM   6477  C CB  . HIS A 1 836 ? -1.527  80.915  15.698  1.00 61.39  ? 837 HIS S CB  1 
ATOM   6478  C CG  . HIS A 1 836 ? -0.948  82.241  16.234  1.00 100.00 ? 837 HIS S CG  1 
ATOM   6479  N ND1 . HIS A 1 836 ? -0.729  82.502  17.594  1.00 100.00 ? 837 HIS S ND1 1 
ATOM   6480  C CD2 . HIS A 1 836 ? -0.620  83.404  15.547  1.00 100.00 ? 837 HIS S CD2 1 
ATOM   6481  C CE1 . HIS A 1 836 ? -0.245  83.766  17.687  1.00 100.00 ? 837 HIS S CE1 1 
ATOM   6482  N NE2 . HIS A 1 836 ? -0.166  84.345  16.476  1.00 100.00 ? 837 HIS S NE2 1 
ATOM   6483  N N   . TRP A 1 837 ? -1.959  77.335  15.822  1.00 28.81  ? 838 TRP S N   1 
ATOM   6484  C CA  . TRP A 1 837 ? -2.875  76.153  15.745  1.00 5.35   ? 838 TRP S CA  1 
ATOM   6485  C C   . TRP A 1 837 ? -2.900  75.206  16.973  1.00 37.02  ? 838 TRP S C   1 
ATOM   6486  O O   . TRP A 1 837 ? -1.912  74.523  17.279  1.00 41.53  ? 838 TRP S O   1 
ATOM   6487  C CB  . TRP A 1 837 ? -2.397  75.284  14.546  1.00 7.20   ? 838 TRP S CB  1 
ATOM   6488  C CG  . TRP A 1 837 ? -3.419  74.394  13.988  1.00 1.64   ? 838 TRP S CG  1 
ATOM   6489  C CD1 . TRP A 1 837 ? -4.702  74.721  13.778  1.00 2.73   ? 838 TRP S CD1 1 
ATOM   6490  C CD2 . TRP A 1 837 ? -3.243  73.052  13.487  1.00 1.00   ? 838 TRP S CD2 1 
ATOM   6491  N NE1 . TRP A 1 837 ? -5.364  73.643  13.264  1.00 74.67  ? 838 TRP S NE1 1 
ATOM   6492  C CE2 . TRP A 1 837 ? -4.488  72.604  13.069  1.00 5.17   ? 838 TRP S CE2 1 
ATOM   6493  C CE3 . TRP A 1 837 ? -2.192  72.194  13.351  1.00 18.82  ? 838 TRP S CE3 1 
ATOM   6494  C CZ2 . TRP A 1 837 ? -4.689  71.310  12.608  1.00 1.00   ? 838 TRP S CZ2 1 
ATOM   6495  C CZ3 . TRP A 1 837 ? -2.378  70.914  12.846  1.00 11.29  ? 838 TRP S CZ3 1 
ATOM   6496  C CH2 . TRP A 1 837 ? -3.607  70.500  12.464  1.00 8.02   ? 838 TRP S CH2 1 
ATOM   6497  N N   . PRO A 1 838 ? -4.056  75.120  17.627  1.00 13.15  ? 839 PRO S N   1 
ATOM   6498  C CA  . PRO A 1 838 ? -4.297  74.296  18.804  1.00 4.79   ? 839 PRO S CA  1 
ATOM   6499  C C   . PRO A 1 838 ? -3.538  73.004  18.792  1.00 1.00   ? 839 PRO S C   1 
ATOM   6500  O O   . PRO A 1 838 ? -2.680  72.734  19.654  1.00 19.26  ? 839 PRO S O   1 
ATOM   6501  C CB  . PRO A 1 838 ? -5.779  74.033  18.778  1.00 65.20  ? 839 PRO S CB  1 
ATOM   6502  C CG  . PRO A 1 838 ? -6.409  75.083  17.880  1.00 17.03  ? 839 PRO S CG  1 
ATOM   6503  C CD  . PRO A 1 838 ? -5.281  75.813  17.219  1.00 12.83  ? 839 PRO S CD  1 
ATOM   6504  N N   . TRP A 1 839 ? -3.813  72.283  17.735  1.00 1.00   ? 840 TRP S N   1 
ATOM   6505  C CA  . TRP A 1 839 ? -3.253  70.974  17.497  1.00 1.00   ? 840 TRP S CA  1 
ATOM   6506  C C   . TRP A 1 839 ? -1.777  71.031  17.490  1.00 4.23   ? 840 TRP S C   1 
ATOM   6507  O O   . TRP A 1 839 ? -1.107  70.102  17.891  1.00 28.61  ? 840 TRP S O   1 
ATOM   6508  C CB  . TRP A 1 839 ? -3.756  70.442  16.162  1.00 49.34  ? 840 TRP S CB  1 
ATOM   6509  C CG  . TRP A 1 839 ? -5.206  70.155  16.255  1.00 6.48   ? 840 TRP S CG  1 
ATOM   6510  C CD1 . TRP A 1 839 ? -6.228  70.927  15.833  1.00 86.37  ? 840 TRP S CD1 1 
ATOM   6511  C CD2 . TRP A 1 839 ? -5.769  69.016  16.862  1.00 10.73  ? 840 TRP S CD2 1 
ATOM   6512  N NE1 . TRP A 1 839 ? -7.417  70.311  16.121  1.00 15.09  ? 840 TRP S NE1 1 
ATOM   6513  C CE2 . TRP A 1 839 ? -7.161  69.144  16.774  1.00 12.57  ? 840 TRP S CE2 1 
ATOM   6514  C CE3 . TRP A 1 839 ? -5.225  67.898  17.470  1.00 18.78  ? 840 TRP S CE3 1 
ATOM   6515  C CZ2 . TRP A 1 839 ? -7.985  68.186  17.274  1.00 27.63  ? 840 TRP S CZ2 1 
ATOM   6516  C CZ3 . TRP A 1 839 ? -6.046  66.932  17.967  1.00 1.00   ? 840 TRP S CZ3 1 
ATOM   6517  C CH2 . TRP A 1 839 ? -7.406  67.076  17.857  1.00 1.00   ? 840 TRP S CH2 1 
ATOM   6518  N N   . MET A 1 840 ? -1.262  72.129  16.967  1.00 44.83  ? 841 MET S N   1 
ATOM   6519  C CA  . MET A 1 840 ? 0.178   72.175  16.924  1.00 9.16   ? 841 MET S CA  1 
ATOM   6520  C C   . MET A 1 840 ? 0.770   72.542  18.278  1.00 20.34  ? 841 MET S C   1 
ATOM   6521  O O   . MET A 1 840 ? 1.754   71.960  18.665  1.00 48.30  ? 841 MET S O   1 
ATOM   6522  C CB  . MET A 1 840 ? 0.850   72.708  15.672  1.00 1.00   ? 841 MET S CB  1 
ATOM   6523  C CG  . MET A 1 840 ? 2.270   72.212  15.517  1.00 1.00   ? 841 MET S CG  1 
ATOM   6524  S SD  . MET A 1 840 ? 2.435   71.114  14.208  1.00 37.80  ? 841 MET S SD  1 
ATOM   6525  C CE  . MET A 1 840 ? 4.200   70.797  14.326  1.00 25.03  ? 841 MET S CE  1 
HETATM 6526  N N   . MLY A 1 841 ? 0.109   73.396  19.049  1.00 1.00   ? 842 MLY S N   1 
HETATM 6527  C CA  . MLY A 1 841 ? 0.590   73.692  20.349  1.00 13.53  ? 842 MLY S CA  1 
HETATM 6528  C CB  . MLY A 1 841 ? -0.227  74.732  21.057  1.00 1.00   ? 842 MLY S CB  1 
HETATM 6529  C CG  . MLY A 1 841 ? -0.841  75.721  20.150  1.00 13.68  ? 842 MLY S CG  1 
HETATM 6530  C CD  . MLY A 1 841 ? -0.649  77.153  20.632  1.00 49.78  ? 842 MLY S CD  1 
HETATM 6531  C CE  . MLY A 1 841 ? -1.942  77.976  20.500  1.00 100.00 ? 842 MLY S CE  1 
HETATM 6532  N NZ  . MLY A 1 841 ? -1.863  79.274  21.191  1.00 90.23  ? 842 MLY S NZ  1 
HETATM 6533  C CH1 . MLY A 1 841 ? -2.096  80.399  20.269  1.00 100.00 ? 842 MLY S CH1 1 
HETATM 6534  C CH2 . MLY A 1 841 ? -2.860  79.319  22.270  1.00 100.00 ? 842 MLY S CH2 1 
HETATM 6535  C C   . MLY A 1 841 ? 0.552   72.468  21.194  1.00 1.00   ? 842 MLY S C   1 
HETATM 6536  O O   . MLY A 1 841 ? 1.438   72.197  22.005  1.00 32.49  ? 842 MLY S O   1 
ATOM   6537  N N   . LEU A 1 842 ? -0.509  71.735  21.001  1.00 12.98  ? 843 LEU S N   1 
ATOM   6538  C CA  . LEU A 1 842 ? -0.696  70.484  21.737  1.00 1.00   ? 843 LEU S CA  1 
ATOM   6539  C C   . LEU A 1 842 ? 0.483   69.564  21.531  1.00 6.64   ? 843 LEU S C   1 
ATOM   6540  O O   . LEU A 1 842 ? 1.159   69.163  22.475  1.00 27.61  ? 843 LEU S O   1 
ATOM   6541  C CB  . LEU A 1 842 ? -1.967  69.789  21.334  1.00 35.75  ? 843 LEU S CB  1 
ATOM   6542  C CG  . LEU A 1 842 ? -2.434  68.756  22.371  1.00 1.00   ? 843 LEU S CG  1 
ATOM   6543  C CD1 . LEU A 1 842 ? -3.777  69.113  23.000  1.00 18.58  ? 843 LEU S CD1 1 
ATOM   6544  C CD2 . LEU A 1 842 ? -2.649  67.466  21.656  1.00 61.77  ? 843 LEU S CD2 1 
ATOM   6545  N N   . PHE A 1 843 ? 0.726   69.278  20.259  1.00 2.24   ? 844 PHE S N   1 
ATOM   6546  C CA  . PHE A 1 843 ? 1.859   68.421  19.854  1.00 8.35   ? 844 PHE S CA  1 
ATOM   6547  C C   . PHE A 1 843 ? 3.122   68.894  20.517  1.00 28.49  ? 844 PHE S C   1 
ATOM   6548  O O   . PHE A 1 843 ? 3.996   68.143  20.854  1.00 36.35  ? 844 PHE S O   1 
ATOM   6549  C CB  . PHE A 1 843 ? 2.113   68.670  18.381  1.00 3.58   ? 844 PHE S CB  1 
ATOM   6550  C CG  . PHE A 1 843 ? 3.147   67.788  17.764  1.00 1.35   ? 844 PHE S CG  1 
ATOM   6551  C CD1 . PHE A 1 843 ? 3.075   66.403  17.900  1.00 11.89  ? 844 PHE S CD1 1 
ATOM   6552  C CD2 . PHE A 1 843 ? 4.142   68.320  16.946  1.00 40.08  ? 844 PHE S CD2 1 
ATOM   6553  C CE1 . PHE A 1 843 ? 3.993   65.550  17.290  1.00 30.82  ? 844 PHE S CE1 1 
ATOM   6554  C CE2 . PHE A 1 843 ? 5.071   67.480  16.338  1.00 14.12  ? 844 PHE S CE2 1 
ATOM   6555  C CZ  . PHE A 1 843 ? 4.986   66.108  16.493  1.00 1.52   ? 844 PHE S CZ  1 
ATOM   6556  N N   . PHE A 1 844 ? 3.172   70.205  20.634  1.00 32.90  ? 845 PHE S N   1 
ATOM   6557  C CA  . PHE A 1 844 ? 4.303   70.861  21.211  1.00 3.66   ? 845 PHE S CA  1 
ATOM   6558  C C   . PHE A 1 844 ? 4.460   70.539  22.681  1.00 53.31  ? 845 PHE S C   1 
ATOM   6559  O O   . PHE A 1 844 ? 5.504   70.013  23.089  1.00 28.54  ? 845 PHE S O   1 
ATOM   6560  C CB  . PHE A 1 844 ? 4.326   72.354  20.897  1.00 69.19  ? 845 PHE S CB  1 
ATOM   6561  C CG  . PHE A 1 844 ? 4.832   72.624  19.498  1.00 1.00   ? 845 PHE S CG  1 
ATOM   6562  C CD1 . PHE A 1 844 ? 5.641   71.733  18.795  1.00 23.94  ? 845 PHE S CD1 1 
ATOM   6563  C CD2 . PHE A 1 844 ? 4.511   73.832  18.873  1.00 100.00 ? 845 PHE S CD2 1 
ATOM   6564  C CE1 . PHE A 1 844 ? 6.126   72.032  17.511  1.00 1.00   ? 845 PHE S CE1 1 
ATOM   6565  C CE2 . PHE A 1 844 ? 4.950   74.128  17.582  1.00 40.16  ? 845 PHE S CE2 1 
ATOM   6566  C CZ  . PHE A 1 844 ? 5.754   73.223  16.886  1.00 6.96   ? 845 PHE S CZ  1 
HETATM 6567  N N   . MLY A 1 845 ? 3.445   70.818  23.492  1.00 1.00   ? 846 MLY S N   1 
HETATM 6568  C CA  . MLY A 1 845 ? 3.631   70.515  24.895  1.00 1.00   ? 846 MLY S CA  1 
HETATM 6569  C CB  . MLY A 1 845 ? 2.442   70.981  25.719  1.00 1.00   ? 846 MLY S CB  1 
HETATM 6570  C CG  . MLY A 1 845 ? 1.814   72.250  25.192  1.00 1.00   ? 846 MLY S CG  1 
HETATM 6571  C CD  . MLY A 1 845 ? 1.505   73.296  26.272  1.00 35.22  ? 846 MLY S CD  1 
HETATM 6572  C CE  . MLY A 1 845 ? 0.288   74.133  25.948  1.00 81.02  ? 846 MLY S CE  1 
HETATM 6573  N NZ  . MLY A 1 845 ? -0.026  75.077  27.029  1.00 100.00 ? 846 MLY S NZ  1 
HETATM 6574  C CH1 . MLY A 1 845 ? 0.280   76.461  26.596  1.00 100.00 ? 846 MLY S CH1 1 
HETATM 6575  C CH2 . MLY A 1 845 ? -1.448  74.911  27.392  1.00 100.00 ? 846 MLY S CH2 1 
HETATM 6576  C C   . MLY A 1 845 ? 3.881   69.029  25.037  1.00 1.00   ? 846 MLY S C   1 
HETATM 6577  O O   . MLY A 1 845 ? 4.693   68.565  25.797  1.00 25.77  ? 846 MLY S O   1 
ATOM   6578  N N   . ILE A 1 846 ? 3.207   68.291  24.205  1.00 47.79  ? 847 ILE S N   1 
ATOM   6579  C CA  . ILE A 1 846 ? 3.276   66.835  24.253  1.00 18.52  ? 847 ILE S CA  1 
ATOM   6580  C C   . ILE A 1 846 ? 4.529   66.183  23.684  1.00 6.19   ? 847 ILE S C   1 
ATOM   6581  O O   . ILE A 1 846 ? 5.021   65.246  24.244  1.00 19.31  ? 847 ILE S O   1 
ATOM   6582  C CB  . ILE A 1 846 ? 1.926   66.245  23.884  1.00 23.97  ? 847 ILE S CB  1 
ATOM   6583  C CG1 . ILE A 1 846 ? 1.244   65.782  25.097  1.00 28.61  ? 847 ILE S CG1 1 
ATOM   6584  C CG2 . ILE A 1 846 ? 1.876   65.178  22.827  1.00 14.55  ? 847 ILE S CG2 1 
ATOM   6585  C CD1 . ILE A 1 846 ? -0.231  65.672  24.804  1.00 100.00 ? 847 ILE S CD1 1 
HETATM 6586  N N   . MLY A 1 847 ? 5.072   66.753  22.619  1.00 11.80  ? 848 MLY S N   1 
HETATM 6587  C CA  . MLY A 1 847 ? 6.272   66.269  21.953  1.00 3.14   ? 848 MLY S CA  1 
HETATM 6588  C CB  . MLY A 1 847 ? 6.891   67.346  21.095  1.00 7.83   ? 848 MLY S CB  1 
HETATM 6589  C CG  . MLY A 1 847 ? 8.159   66.894  20.347  1.00 14.28  ? 848 MLY S CG  1 
HETATM 6590  C CD  . MLY A 1 847 ? 8.446   67.680  19.059  1.00 1.36   ? 848 MLY S CD  1 
HETATM 6591  C CE  . MLY A 1 847 ? 9.062   66.828  17.947  1.00 42.56  ? 848 MLY S CE  1 
HETATM 6592  N NZ  . MLY A 1 847 ? 9.638   67.656  16.885  1.00 6.89   ? 848 MLY S NZ  1 
HETATM 6593  C CH1 . MLY A 1 847 ? 11.070  67.803  17.160  1.00 100.00 ? 848 MLY S CH1 1 
HETATM 6594  C CH2 . MLY A 1 847 ? 9.342   67.063  15.559  1.00 100.00 ? 848 MLY S CH2 1 
HETATM 6595  C C   . MLY A 1 847 ? 7.362   65.821  22.891  1.00 8.03   ? 848 MLY S C   1 
HETATM 6596  O O   . MLY A 1 847 ? 8.270   65.114  22.532  1.00 50.36  ? 848 MLY S O   1 
ATOM   6597  N N   . PRO A 1 848 ? 7.363   66.299  24.106  1.00 17.01  ? 849 PRO S N   1 
ATOM   6598  C CA  . PRO A 1 848 ? 8.440   65.886  24.975  1.00 18.32  ? 849 PRO S CA  1 
ATOM   6599  C C   . PRO A 1 848 ? 8.247   64.573  25.670  1.00 23.57  ? 849 PRO S C   1 
ATOM   6600  O O   . PRO A 1 848 ? 9.167   63.761  25.717  1.00 48.47  ? 849 PRO S O   1 
ATOM   6601  C CB  . PRO A 1 848 ? 8.684   67.035  25.960  1.00 5.91   ? 849 PRO S CB  1 
ATOM   6602  C CG  . PRO A 1 848 ? 7.746   68.156  25.582  1.00 41.02  ? 849 PRO S CG  1 
ATOM   6603  C CD  . PRO A 1 848 ? 6.980   67.718  24.350  1.00 44.57  ? 849 PRO S CD  1 
ATOM   6604  N N   . LEU A 1 849 ? 7.044   64.361  26.226  1.00 6.03   ? 850 LEU S N   1 
ATOM   6605  C CA  . LEU A 1 849 ? 6.748   63.111  26.934  1.00 40.29  ? 850 LEU S CA  1 
ATOM   6606  C C   . LEU A 1 849 ? 7.108   61.860  26.117  1.00 1.00   ? 850 LEU S C   1 
ATOM   6607  O O   . LEU A 1 849 ? 7.131   60.756  26.619  1.00 100.00 ? 850 LEU S O   1 
ATOM   6608  C CB  . LEU A 1 849 ? 5.252   63.038  27.287  1.00 2.73   ? 850 LEU S CB  1 
ATOM   6609  C CG  . LEU A 1 849 ? 4.867   63.716  28.546  1.00 1.00   ? 850 LEU S CG  1 
ATOM   6610  C CD1 . LEU A 1 849 ? 5.134   65.209  28.399  1.00 95.80  ? 850 LEU S CD1 1 
ATOM   6611  C CD2 . LEU A 1 849 ? 3.380   63.500  28.889  1.00 31.38  ? 850 LEU S CD2 1 
ATOM   6612  N N   . LEU A 1 850 ? 7.328   62.079  24.832  1.00 39.81  ? 851 LEU S N   1 
ATOM   6613  C CA  . LEU A 1 850 ? 7.611   61.003  23.948  1.00 13.60  ? 851 LEU S CA  1 
ATOM   6614  C C   . LEU A 1 850 ? 9.016   60.543  24.058  1.00 15.88  ? 851 LEU S C   1 
ATOM   6615  O O   . LEU A 1 850 ? 9.855   61.162  24.681  1.00 53.29  ? 851 LEU S O   1 
ATOM   6616  C CB  . LEU A 1 850 ? 7.496   61.456  22.510  1.00 9.94   ? 851 LEU S CB  1 
ATOM   6617  C CG  . LEU A 1 850 ? 6.067   61.439  22.010  1.00 30.11  ? 851 LEU S CG  1 
ATOM   6618  C CD1 . LEU A 1 850 ? 5.099   61.629  23.158  1.00 1.00   ? 851 LEU S CD1 1 
ATOM   6619  C CD2 . LEU A 1 850 ? 5.806   62.549  21.006  1.00 2.27   ? 851 LEU S CD2 1 
ATOM   6620  N N   . LYS A 1 851 ? 9.234   59.457  23.348  1.00 82.78  ? 852 LYS S N   1 
ATOM   6621  C CA  . LYS A 1 851 ? 10.552  58.858  23.293  1.00 100.00 ? 852 LYS S CA  1 
ATOM   6622  C C   . LYS A 1 851 ? 10.776  58.266  21.907  1.00 100.00 ? 852 LYS S C   1 
ATOM   6623  O O   . LYS A 1 851 ? 9.938   57.513  21.417  1.00 100.00 ? 852 LYS S O   1 
ATOM   6624  C CB  . LYS A 1 851 ? 10.744  57.804  24.377  1.00 100.00 ? 852 LYS S CB  1 
ATOM   6625  C CG  . LYS A 1 851 ? 9.695   56.685  24.335  1.00 100.00 ? 852 LYS S CG  1 
ATOM   6626  C CD  . LYS A 1 851 ? 9.559   55.941  25.668  1.00 100.00 ? 852 LYS S CD  1 
ATOM   6627  C CE  . LYS A 1 851 ? 10.420  54.684  25.774  1.00 100.00 ? 852 LYS S CE  1 
ATOM   6628  N NZ  . LYS A 1 851 ? 9.681   53.514  26.273  1.00 100.00 ? 852 LYS S NZ  1 
ATOM   6629  N N   . VAL A 1 852 ? 9.796   55.846  26.629  0.00 0.00   ? 853 VAL S N   1 
ATOM   6630  C CA  . VAL A 1 852 ? 10.687  56.680  27.433  0.00 0.00   ? 853 VAL S CA  1 
ATOM   6631  C C   . VAL A 1 852 ? 10.830  56.080  28.820  0.00 0.00   ? 853 VAL S C   1 
ATOM   6632  O O   . VAL A 1 852 ? 11.942  55.957  29.323  0.00 0.00   ? 853 VAL S O   1 
ATOM   6633  N N   . THR A 1 853 ? 9.712   55.728  29.413  0.00 0.00   ? 854 THR S N   1 
ATOM   6634  C CA  . THR A 1 853 ? 9.730   55.147  30.765  0.00 0.00   ? 854 THR S CA  1 
ATOM   6635  C C   . THR A 1 853 ? 10.616  53.893  30.778  0.00 0.00   ? 854 THR S C   1 
ATOM   6636  O O   . THR A 1 853 ? 11.491  53.718  31.659  0.00 0.00   ? 854 THR S O   1 
ATOM   6637  N N   . ARG A 1 854 ? 9.025   52.844  31.837  0.00 0.00   ? 855 ARG S N   1 
ATOM   6638  C CA  . ARG A 1 854 ? 8.883   51.824  32.894  0.00 0.00   ? 855 ARG S CA  1 
ATOM   6639  C C   . ARG A 1 854 ? 10.234  51.606  33.593  0.00 0.00   ? 855 ARG S C   1 
ATOM   6640  O O   . ARG A 1 854 ? 10.337  51.573  34.834  0.00 0.00   ? 855 ARG S O   1 
ATOM   6641  N N   . GLN A 1 855 ? 11.258  51.451  32.781  0.00 0.00   ? 856 GLN S N   1 
ATOM   6642  C CA  . GLN A 1 855 ? 12.606  51.220  33.299  0.00 0.00   ? 856 GLN S CA  1 
ATOM   6643  C C   . GLN A 1 855 ? 13.006  52.367  34.210  0.00 0.00   ? 856 GLN S C   1 
ATOM   6644  O O   . GLN A 1 855 ? 13.517  52.144  35.297  0.00 0.00   ? 856 GLN S O   1 
ATOM   6645  N N   . GLU A 1 856 ? 12.781  53.576  33.745  0.00 0.00   ? 857 GLU S N   1 
ATOM   6646  C CA  . GLU A 1 856 ? 13.136  54.765  34.521  0.00 0.00   ? 857 GLU S CA  1 
ATOM   6647  C C   . GLU A 1 856 ? 12.438  54.720  35.877  0.00 0.00   ? 857 GLU S C   1 
ATOM   6648  O O   . GLU A 1 856 ? 13.070  54.937  36.921  0.00 0.00   ? 857 GLU S O   1 
ATOM   6649  N N   . GLU A 1 857 ? 11.151  54.440  35.842  0.00 0.00   ? 858 GLU S N   1 
ATOM   6650  C CA  . GLU A 1 857 ? 10.368  54.376  37.092  0.00 0.00   ? 858 GLU S CA  1 
ATOM   6651  C C   . GLU A 1 857 ? 10.991  53.339  38.046  0.00 0.00   ? 858 GLU S C   1 
ATOM   6652  O O   . GLU A 1 857 ? 11.213  53.593  39.256  0.00 0.00   ? 858 GLU S O   1 
ATOM   6653  N N   . GLU A 1 858 ? 11.271  52.178  37.488  0.00 0.00   ? 859 GLU S N   1 
ATOM   6654  C CA  . GLU A 1 858 ? 11.859  51.088  38.281  0.00 0.00   ? 859 GLU S CA  1 
ATOM   6655  C C   . GLU A 1 858 ? 13.175  51.554  38.897  0.00 0.00   ? 859 GLU S C   1 
ATOM   6656  O O   . GLU A 1 858 ? 13.435  51.341  40.081  0.00 0.00   ? 859 GLU S O   1 
ATOM   6657  N N   . MET A 1 859 ? 13.998  52.170  38.078  0.00 0.00   ? 860 MET S N   1 
ATOM   6658  C CA  . MET A 1 859 ? 15.299  52.655  38.526  0.00 0.00   ? 860 MET S CA  1 
ATOM   6659  C C   . MET A 1 859 ? 15.112  53.615  39.688  0.00 0.00   ? 860 MET S C   1 
ATOM   6660  O O   . MET A 1 859 ? 15.798  53.501  40.697  0.00 0.00   ? 860 MET S O   1 
ATOM   6661  N N   . GLN A 1 860 ? 16.310  51.532  40.833  0.00 0.00   ? 861 GLN S N   1 
ATOM   6662  C CA  . GLN A 1 860 ? 15.409  52.097  41.850  0.00 0.00   ? 861 GLN S CA  1 
ATOM   6663  C C   . GLN A 1 860 ? 15.690  53.597  42.015  0.00 0.00   ? 861 GLN S C   1 
ATOM   6664  O O   . GLN A 1 860 ? 14.764  54.442  42.012  0.00 0.00   ? 861 GLN S O   1 
ATOM   6665  N N   . ALA A 1 861 ? 16.964  53.909  42.156  0.00 0.00   ? 862 ALA S N   1 
ATOM   6666  C CA  . ALA A 1 861 ? 17.367  55.317  42.333  0.00 0.00   ? 862 ALA S CA  1 
ATOM   6667  C C   . ALA A 1 861 ? 16.875  56.155  41.144  0.00 0.00   ? 862 ALA S C   1 
ATOM   6668  O O   . ALA A 1 861 ? 16.296  57.247  41.300  0.00 0.00   ? 862 ALA S O   1 
ATOM   6669  N N   . LYS A 1 862 ? 17.119  55.633  39.961  0.00 0.00   ? 863 LYS S N   1 
ATOM   6670  C CA  . LYS A 1 862 ? 16.721  56.322  38.732  0.00 0.00   ? 863 LYS S CA  1 
ATOM   6671  C C   . LYS A 1 862 ? 15.223  56.564  38.746  0.00 0.00   ? 863 LYS S C   1 
ATOM   6672  O O   . LYS A 1 862 ? 14.770  57.658  38.443  0.00 0.00   ? 863 LYS S O   1 
ATOM   6673  N N   . ASP A 1 863 ? 14.477  55.534  39.080  0.00 0.00   ? 864 ASP S N   1 
ATOM   6674  C CA  . ASP A 1 863 ? 13.016  55.634  39.117  0.00 0.00   ? 864 ASP S CA  1 
ATOM   6675  C C   . ASP A 1 863 ? 12.603  56.755  40.066  0.00 0.00   ? 864 ASP S C   1 
ATOM   6676  O O   . ASP A 1 863 ? 11.767  57.603  39.716  0.00 0.00   ? 864 ASP S O   1 
ATOM   6677  N N   . GLU A 1 864 ? 13.190  56.744  41.244  0.00 0.00   ? 865 GLU S N   1 
ATOM   6678  C CA  . GLU A 1 864 ? 12.863  57.777  42.248  0.00 0.00   ? 865 GLU S CA  1 
ATOM   6679  C C   . GLU A 1 864 ? 13.132  59.176  41.665  0.00 0.00   ? 865 GLU S C   1 
ATOM   6680  O O   . GLU A 1 864 ? 12.294  60.107  41.754  0.00 0.00   ? 865 GLU S O   1 
ATOM   6681  N N   . GLU A 1 865 ? 14.300  59.308  41.072  0.00 0.00   ? 866 GLU S N   1 
ATOM   6682  C CA  . GLU A 1 865 ? 14.698  60.593  40.478  0.00 0.00   ? 866 GLU S CA  1 
ATOM   6683  C C   . GLU A 1 865 ? 13.676  61.014  39.427  0.00 0.00   ? 866 GLU S C   1 
ATOM   6684  O O   . GLU A 1 865 ? 13.234  62.161  39.389  0.00 0.00   ? 866 GLU S O   1 
ATOM   6685  N N   . LEU A 1 866 ? 13.322  60.077  38.575  0.00 0.00   ? 867 LEU S N   1 
ATOM   6686  C CA  . LEU A 1 866 ? 12.364  60.343  37.505  0.00 0.00   ? 867 LEU S CA  1 
ATOM   6687  C C   . LEU A 1 866 ? 11.060  60.837  38.101  0.00 0.00   ? 867 LEU S C   1 
ATOM   6688  O O   . LEU A 1 866 ? 10.507  61.826  37.635  0.00 0.00   ? 867 LEU S O   1 
ATOM   6689  N N   . GLN A 1 867 ? 10.587  60.139  39.112  0.00 0.00   ? 868 GLN S N   1 
ATOM   6690  C CA  . GLN A 1 867 ? 9.325   60.519  39.763  0.00 0.00   ? 868 GLN S CA  1 
ATOM   6691  C C   . GLN A 1 867 ? 9.416   61.967  40.268  0.00 0.00   ? 868 GLN S C   1 
ATOM   6692  O O   . GLN A 1 867 ? 8.511   62.801  40.032  0.00 0.00   ? 868 GLN S O   1 
ATOM   6693  N N   . ARG A 1 868 ? 10.509  62.246  40.950  0.00 0.00   ? 869 ARG S N   1 
ATOM   6694  C CA  . ARG A 1 868 ? 10.716  63.602  41.499  0.00 0.00   ? 869 ARG S CA  1 
ATOM   6695  C C   . ARG A 1 868 ? 10.671  64.635  40.363  0.00 0.00   ? 869 ARG S C   1 
ATOM   6696  O O   . ARG A 1 868 ? 10.005  65.684  40.451  0.00 0.00   ? 869 ARG S O   1 
ATOM   6697  N N   . THR A 1 869 ? 11.394  64.328  39.307  0.00 0.00   ? 870 THR S N   1 
ATOM   6698  C CA  . THR A 1 869 ? 11.464  65.222  38.151  0.00 0.00   ? 870 THR S CA  1 
ATOM   6699  C C   . THR A 1 869 ? 10.068  65.460  37.607  0.00 0.00   ? 870 THR S C   1 
ATOM   6700  O O   . THR A 1 869 ? 9.695   66.592  37.331  0.00 0.00   ? 870 THR S O   1 
ATOM   6701  N N   . LYS A 1 870 ? 9.321   64.390  37.446  0.00 0.00   ? 871 LYS S N   1 
ATOM   6702  C CA  . LYS A 1 870 ? 7.961   64.486  36.915  0.00 0.00   ? 871 LYS S CA  1 
ATOM   6703  C C   . LYS A 1 870 ? 7.134   65.424  37.788  0.00 0.00   ? 871 LYS S C   1 
ATOM   6704  O O   . LYS A 1 870 ? 6.446   66.321  37.278  0.00 0.00   ? 871 LYS S O   1 
ATOM   6705  N N   . GLU A 1 871 ? 7.212   65.205  39.085  0.00 0.00   ? 872 GLU S N   1 
ATOM   6706  C CA  . GLU A 1 871 ? 6.449   66.047  40.029  0.00 0.00   ? 872 GLU S CA  1 
ATOM   6707  C C   . GLU A 1 871 ? 6.829   67.527  39.835  0.00 0.00   ? 872 GLU S C   1 
ATOM   6708  O O   . GLU A 1 871 ? 5.962   68.431  39.733  0.00 0.00   ? 872 GLU S O   1 
ATOM   6709  N N   . ARG A 1 872 ? 8.125   67.758  39.785  0.00 0.00   ? 873 ARG S N   1 
ATOM   6710  C CA  . ARG A 1 872 ? 8.636   69.127  39.614  0.00 0.00   ? 873 ARG S CA  1 
ATOM   6711  C C   . ARG A 1 872 ? 8.079   69.726  38.325  0.00 0.00   ? 873 ARG S C   1 
ATOM   6712  O O   . ARG A 1 872 ? 7.612   70.863  38.302  0.00 0.00   ? 873 ARG S O   1 
ATOM   6713  N N   . GLN A 1 873 ? 8.153   68.954  37.264  0.00 0.00   ? 874 GLN S N   1 
ATOM   6714  C CA  . GLN A 1 873 ? 7.674   69.404  35.959  0.00 0.00   ? 874 GLN S CA  1 
ATOM   6715  C C   . GLN A 1 873 ? 6.210   69.790  36.060  0.00 0.00   ? 874 GLN S C   1 
ATOM   6716  O O   . GLN A 1 873 ? 5.818   70.848  35.578  0.00 0.00   ? 874 GLN S O   1 
ATOM   6717  N N   . GLN A 1 874 ? 5.429   68.927  36.673  0.00 0.00   ? 875 GLN S N   1 
ATOM   6718  C CA  . GLN A 1 874 ? 3.989   69.190  36.820  0.00 0.00   ? 875 GLN S CA  1 
ATOM   6719  C C   . GLN A 1 874 ? 3.777   70.527  37.547  0.00 0.00   ? 875 GLN S C   1 
ATOM   6720  O O   . GLN A 1 874 ? 2.982   71.391  37.109  0.00 0.00   ? 875 GLN S O   1 
ATOM   6721  N N   . LYS A 1 875 ? 4.493   70.680  38.642  0.00 0.00   ? 876 LYS S N   1 
ATOM   6722  C CA  . LYS A 1 875 ? 4.378   71.918  39.438  0.00 0.00   ? 876 LYS S CA  1 
ATOM   6723  C C   . LYS A 1 875 ? 4.712   73.134  38.562  0.00 0.00   ? 876 LYS S C   1 
ATOM   6724  O O   . LYS A 1 875 ? 3.995   74.153  38.545  0.00 0.00   ? 876 LYS S O   1 
ATOM   6725  N N   . ALA A 1 876 ? 5.809   73.015  37.846  0.00 0.00   ? 877 ALA S N   1 
ATOM   6726  C CA  . ALA A 1 876 ? 6.266   74.098  36.973  0.00 0.00   ? 877 ALA S CA  1 
ATOM   6727  C C   . ALA A 1 876 ? 5.180   74.430  35.965  0.00 0.00   ? 877 ALA S C   1 
ATOM   6728  O O   . ALA A 1 876 ? 4.872   75.593  35.751  0.00 0.00   ? 877 ALA S O   1 
ATOM   6729  N N   . GLU A 1 877 ? 4.631   73.407  35.351  0.00 0.00   ? 878 GLU S N   1 
ATOM   6730  C CA  . GLU A 1 877 ? 3.585   73.596  34.344  0.00 0.00   ? 878 GLU S CA  1 
ATOM   6731  C C   . GLU A 1 877 ? 2.420   74.369  34.958  0.00 0.00   ? 878 GLU S C   1 
ATOM   6732  O O   . GLU A 1 877 ? 1.929   75.344  34.367  0.00 0.00   ? 878 GLU S O   1 
ATOM   6733  N N   . ALA A 1 878 ? 2.000   73.926  36.124  0.00 0.00   ? 879 ALA S N   1 
ATOM   6734  C CA  . ALA A 1 878 ? 0.872   74.593  36.809  0.00 0.00   ? 879 ALA S CA  1 
ATOM   6735  C C   . ALA A 1 878 ? 1.197   76.081  37.024  0.00 0.00   ? 879 ALA S C   1 
ATOM   6736  O O   . ALA A 1 878 ? 0.381   76.992  36.733  0.00 0.00   ? 879 ALA S O   1 
ATOM   6737  N N   . GLU A 1 879 ? 2.390   76.316  37.531  0.00 0.00   ? 880 GLU S N   1 
ATOM   6738  C CA  . GLU A 1 879 ? 2.834   77.692  37.800  0.00 0.00   ? 880 GLU S CA  1 
ATOM   6739  C C   . GLU A 1 879 ? 2.787   78.508  36.513  0.00 0.00   ? 880 GLU S C   1 
ATOM   6740  O O   . GLU A 1 879 ? 2.290   79.635  36.488  0.00 0.00   ? 880 GLU S O   1 
ATOM   6741  N N   . LEU A 1 880 ? 3.324   77.934  35.459  0.00 0.00   ? 881 LEU S N   1 
ATOM   6742  C CA  . LEU A 1 880 ? 3.365   78.606  34.163  0.00 0.00   ? 881 LEU S CA  1 
ATOM   6743  C C   . LEU A 1 880 ? 1.955   78.972  33.735  0.00 0.00   ? 881 LEU S C   1 
ATOM   6744  O O   . LEU A 1 880 ? 1.713   80.098  33.314  0.00 0.00   ? 881 LEU S O   1 
ATOM   6745  N N   . LYS A 1 881 ? 1.058   78.017  33.837  0.00 0.00   ? 882 LYS S N   1 
ATOM   6746  C CA  . LYS A 1 881 ? -0.340  78.253  33.441  0.00 0.00   ? 882 LYS S CA  1 
ATOM   6747  C C   . LYS A 1 881 ? -0.909  79.443  34.228  0.00 0.00   ? 882 LYS S C   1 
ATOM   6748  O O   . LYS A 1 881 ? -1.525  80.372  33.656  0.00 0.00   ? 882 LYS S O   1 
ATOM   6749  N N   . GLU A 1 882 ? -0.692  79.402  35.527  0.00 0.00   ? 883 GLU S N   1 
ATOM   6750  C CA  . GLU A 1 882 ? -1.194  80.480  36.399  0.00 0.00   ? 883 GLU S CA  1 
ATOM   6751  C C   . GLU A 1 882 ? -0.625  81.831  35.938  0.00 0.00   ? 883 GLU S C   1 
ATOM   6752  O O   . GLU A 1 882 ? -1.345  82.838  35.802  0.00 0.00   ? 883 GLU S O   1 
ATOM   6753  N N   . LEU A 1 883 ? 0.669   81.836  35.707  0.00 0.00   ? 884 LEU S N   1 
ATOM   6754  C CA  . LEU A 1 883 ? 1.358   83.054  35.276  0.00 0.00   ? 884 LEU S CA  1 
ATOM   6755  C C   . LEU A 1 883 ? 0.734   83.560  33.988  0.00 0.00   ? 884 LEU S C   1 
ATOM   6756  O O   . LEU A 1 883 ? 0.457   84.744  33.860  0.00 0.00   ? 884 LEU S O   1 
ATOM   6757  N N   . GLU A 1 884 ? 0.540   82.661  33.049  0.00 0.00   ? 885 GLU S N   1 
ATOM   6758  C CA  . GLU A 1 884 ? -0.040  83.026  31.756  0.00 0.00   ? 885 GLU S CA  1 
ATOM   6759  C C   . GLU A 1 884 ? -1.399  83.682  31.971  0.00 0.00   ? 885 GLU S C   1 
ATOM   6760  O O   . GLU A 1 884 ? -1.685  84.746  31.399  0.00 0.00   ? 885 GLU S O   1 
ATOM   6761  N N   . GLN A 1 885 ? -2.213  83.043  32.785  0.00 0.00   ? 886 GLN S N   1 
ATOM   6762  C CA  . GLN A 1 885 ? -3.561  83.581  33.063  0.00 0.00   ? 886 GLN S CA  1 
ATOM   6763  C C   . GLN A 1 885 ? -3.448  85.010  33.626  0.00 0.00   ? 886 GLN S C   1 
ATOM   6764  O O   . GLN A 1 885 ? -4.144  85.958  33.186  0.00 0.00   ? 886 GLN S O   1 
ATOM   6765  N N   . LYS A 1 886 ? -2.567  85.149  34.598  0.00 0.00   ? 887 LYS S N   1 
ATOM   6766  C CA  . LYS A 1 886 ? -2.360  86.455  35.239  0.00 0.00   ? 887 LYS S CA  1 
ATOM   6767  C C   . LYS A 1 886 ? -1.952  87.485  34.189  0.00 0.00   ? 887 LYS S C   1 
ATOM   6768  O O   . LYS A 1 886 ? -2.474  88.598  34.152  0.00 0.00   ? 887 LYS S O   1 
ATOM   6769  N N   . HIS A 1 887 ? -1.009  87.103  33.357  0.00 0.00   ? 888 HIS S N   1 
ATOM   6770  C CA  . HIS A 1 887 ? -0.508  87.991  32.312  0.00 0.00   ? 888 HIS S CA  1 
ATOM   6771  C C   . HIS A 1 887 ? -1.658  88.429  31.424  0.00 0.00   ? 888 HIS S C   1 
ATOM   6772  O O   . HIS A 1 887 ? -1.793  89.613  31.129  0.00 0.00   ? 888 HIS S O   1 
ATOM   6773  N N   . THR A 1 888 ? -2.459  87.472  31.006  0.00 0.00   ? 889 THR S N   1 
ATOM   6774  C CA  . THR A 1 888 ? -3.601  87.778  30.130  0.00 0.00   ? 889 THR S CA  1 
ATOM   6775  C C   . THR A 1 888 ? -4.512  88.812  30.806  0.00 0.00   ? 889 THR S C   1 
ATOM   6776  O O   . THR A 1 888 ? -4.917  89.829  30.195  0.00 0.00   ? 889 THR S O   1 
ATOM   6777  N N   . GLN A 1 889 ? -4.818  88.544  32.060  0.00 0.00   ? 890 GLN S N   1 
ATOM   6778  C CA  . GLN A 1 889 ? -5.694  89.454  32.823  0.00 0.00   ? 890 GLN S CA  1 
ATOM   6779  C C   . GLN A 1 889 ? -5.084  90.863  32.850  0.00 0.00   ? 890 GLN S C   1 
ATOM   6780  O O   . GLN A 1 889 ? -5.759  91.880  32.603  0.00 0.00   ? 890 GLN S O   1 
ATOM   6781  N N   . LEU A 1 890 ? -3.804  90.906  33.158  0.00 0.00   ? 891 LEU S N   1 
ATOM   6782  C CA  . LEU A 1 890 ? -3.087  92.179  33.237  0.00 0.00   ? 891 LEU S CA  1 
ATOM   6783  C C   . LEU A 1 890 ? -3.188  92.904  31.908  0.00 0.00   ? 891 LEU S C   1 
ATOM   6784  O O   . LEU A 1 890 ? -3.473  94.092  31.873  0.00 0.00   ? 891 LEU S O   1 
ATOM   6785  N N   . CYS A 1 891 ? -2.938  92.184  30.838  0.00 0.00   ? 892 CYS S N   1 
ATOM   6786  C CA  . CYS A 1 891 ? -2.987  92.771  29.498  0.00 0.00   ? 892 CYS S CA  1 
ATOM   6787  C C   . CYS A 1 891 ? -4.365  93.382  29.257  0.00 0.00   ? 892 CYS S C   1 
ATOM   6788  O O   . CYS A 1 891 ? -4.474  94.531  28.799  0.00 0.00   ? 892 CYS S O   1 
ATOM   6789  N N   . GLU A 1 892 ? -5.387  92.613  29.567  0.00 0.00   ? 893 GLU S N   1 
ATOM   6790  C CA  . GLU A 1 892 ? -6.769  93.096  29.368  0.00 0.00   ? 893 GLU S CA  1 
ATOM   6791  C C   . GLU A 1 892 ? -6.982  94.404  30.153  0.00 0.00   ? 893 GLU S C   1 
ATOM   6792  O O   . GLU A 1 892 ? -7.513  95.416  29.633  0.00 0.00   ? 893 GLU S O   1 
ATOM   6793  N N   . GLU A 1 893 ? -6.565  94.369  31.403  0.00 0.00   ? 894 GLU S N   1 
ATOM   6794  C CA  . GLU A 1 893 ? -6.713  95.543  32.275  0.00 0.00   ? 894 GLU S CA  1 
ATOM   6795  C C   . GLU A 1 893 ? -5.997  96.739  31.656  0.00 0.00   ? 894 GLU S C   1 
ATOM   6796  O O   . GLU A 1 893 ? -6.538  97.843  31.594  0.00 0.00   ? 894 GLU S O   1 
ATOM   6797  N N   . LYS A 1 894 ? -4.781  96.506  31.218  0.00 0.00   ? 895 LYS S N   1 
ATOM   6798  C CA  . LYS A 1 894 ? -3.971  97.563  30.616  0.00 0.00   ? 895 LYS S CA  1 
ATOM   6799  C C   . LYS A 1 894 ? -4.709  98.152  29.426  0.00 0.00   ? 895 LYS S C   1 
ATOM   6800  O O   . LYS A 1 894 ? -4.797  99.369  29.298  0.00 0.00   ? 895 LYS S O   1 
ATOM   6801  N N   . ASN A 1 895 ? -5.215  97.285  28.577  0.00 0.00   ? 896 ASN S N   1 
ATOM   6802  C CA  . ASN A 1 895 ? -5.941  97.742  27.381  0.00 0.00   ? 896 ASN S CA  1 
ATOM   6803  C C   . ASN A 1 895 ? -7.111  98.644  27.797  0.00 0.00   ? 896 ASN S C   1 
ATOM   6804  O O   . ASN A 1 895 ? -7.312  99.753  27.248  0.00 0.00   ? 896 ASN S O   1 
ATOM   6805  N N   . LEU A 1 896 ? -7.866  98.160  28.763  0.00 0.00   ? 897 LEU S N   1 
ATOM   6806  C CA  . LEU A 1 896 ? -9.030  98.926  29.251  0.00 0.00   ? 897 LEU S CA  1 
ATOM   6807  C C   . LEU A 1 896 ? -8.574  100.306 29.745  0.00 0.00   ? 897 LEU S C   1 
ATOM   6808  O O   . LEU A 1 896 ? -9.166  101.353 29.420  0.00 0.00   ? 897 LEU S O   1 
ATOM   6809  N N   . LEU A 1 897 ? -7.525  100.293 30.540  0.00 0.00   ? 898 LEU S N   1 
ATOM   6810  C CA  . LEU A 1 897 ? -6.983  101.530 31.102  0.00 0.00   ? 898 LEU S CA  1 
ATOM   6811  C C   . LEU A 1 897 ? -6.605  102.477 29.979  0.00 0.00   ? 898 LEU S C   1 
ATOM   6812  O O   . LEU A 1 897 ? -6.933  103.654 30.025  0.00 0.00   ? 898 LEU S O   1 
ATOM   6813  N N   . GLN A 1 898 ? -5.908  101.954 28.996  0.00 0.00   ? 899 GLN S N   1 
ATOM   6814  C CA  . GLN A 1 898 ? -5.468  102.768 27.859  0.00 0.00   ? 899 GLN S CA  1 
ATOM   6815  C C   . GLN A 1 898 ? -6.678  103.415 27.194  0.00 0.00   ? 899 GLN S C   1 
ATOM   6816  O O   . GLN A 1 898 ? -6.677  104.624 26.922  0.00 0.00   ? 899 GLN S O   1 
ATOM   6817  N N   . GLU A 1 899 ? -7.687  102.605 26.943  0.00 0.00   ? 900 GLU S N   1 
ATOM   6818  C CA  . GLU A 1 899 ? -8.908  103.118 26.293  0.00 0.00   ? 900 GLU S CA  1 
ATOM   6819  C C   . GLU A 1 899 ? -9.501  104.269 27.128  0.00 0.00   ? 900 GLU S C   1 
ATOM   6820  O O   . GLU A 1 899 ? -9.852  105.357 26.609  0.00 0.00   ? 900 GLU S O   1 
ATOM   6821  N N   . LYS A 1 900 ? -9.603  104.015 28.417  0.00 0.00   ? 901 LYS S N   1 
ATOM   6822  C CA  . LYS A 1 900 ? -10.161 105.018 29.335  0.00 0.00   ? 901 LYS S CA  1 
ATOM   6823  C C   . LYS A 1 900 ? -9.343  106.303 29.254  0.00 0.00   ? 901 LYS S C   1 
ATOM   6824  O O   . LYS A 1 900 ? -9.889  107.402 29.161  0.00 0.00   ? 901 LYS S O   1 
ATOM   6825  N N   . LEU A 1 901 ? -8.039  106.148 29.304  0.00 0.00   ? 902 LEU S N   1 
ATOM   6826  C CA  . LEU A 1 901 ? -7.132  107.292 29.251  0.00 0.00   ? 902 LEU S CA  1 
ATOM   6827  C C   . LEU A 1 901 ? -7.382  108.082 27.980  0.00 0.00   ? 902 LEU S C   1 
ATOM   6828  O O   . LEU A 1 901 ? -7.495  109.302 28.026  0.00 0.00   ? 902 LEU S O   1 
ATOM   6829  N N   . GLN A 1 902 ? -7.455  107.377 26.871  0.00 0.00   ? 903 GLN S N   1 
ATOM   6830  C CA  . GLN A 1 902 ? -7.684  108.039 25.576  0.00 0.00   ? 903 GLN S CA  1 
ATOM   6831  C C   . GLN A 1 902 ? -8.983  108.856 25.633  0.00 0.00   ? 903 GLN S C   1 
ATOM   6832  O O   . GLN A 1 902 ? -9.025  110.044 25.236  0.00 0.00   ? 903 GLN S O   1 
ATOM   6833  N N   . ALA A 1 903 ? -9.696  109.944 26.965  0.00 0.00   ? 904 ALA S N   1 
ATOM   6834  C CA  . ALA A 1 903 ? -9.109  111.202 26.462  0.00 0.00   ? 904 ALA S CA  1 
ATOM   6835  C C   . ALA A 1 903 ? -8.134  111.774 27.500  0.00 0.00   ? 904 ALA S C   1 
ATOM   6836  O O   . ALA A 1 903 ? -6.999  112.177 27.188  0.00 0.00   ? 904 ALA S O   1 
ATOM   6837  N N   . GLU A 1 904 ? -8.596  111.809 28.732  0.00 0.00   ? 905 GLU S N   1 
ATOM   6838  C CA  . GLU A 1 904 ? -7.787  112.341 29.830  0.00 0.00   ? 905 GLU S CA  1 
ATOM   6839  C C   . GLU A 1 904 ? -6.488  111.565 29.927  0.00 0.00   ? 905 GLU S C   1 
ATOM   6840  O O   . GLU A 1 904 ? -5.423  112.154 30.046  0.00 0.00   ? 905 GLU S O   1 
ATOM   6841  N N   . THR A 1 905 ? -6.594  110.256 29.892  0.00 0.00   ? 906 THR S N   1 
ATOM   6842  C CA  . THR A 1 905 ? -5.416  109.393 29.993  0.00 0.00   ? 906 THR S CA  1 
ATOM   6843  C C   . THR A 1 905 ? -4.427  109.747 28.885  0.00 0.00   ? 906 THR S C   1 
ATOM   6844  O O   . THR A 1 905 ? -3.226  109.919 29.142  0.00 0.00   ? 906 THR S O   1 
ATOM   6845  N N   . GLU A 1 906 ? -4.944  109.846 27.677  0.00 0.00   ? 907 GLU S N   1 
ATOM   6846  C CA  . GLU A 1 906 ? -4.082  110.174 26.525  0.00 0.00   ? 907 GLU S CA  1 
ATOM   6847  C C   . GLU A 1 906 ? -3.357  111.510 26.778  0.00 0.00   ? 907 GLU S C   1 
ATOM   6848  O O   . GLU A 1 906 ? -2.123  111.647 26.590  0.00 0.00   ? 907 GLU S O   1 
ATOM   6849  N N   . LEU A 1 907 ? -4.137  112.484 27.202  0.00 0.00   ? 908 LEU S N   1 
ATOM   6850  C CA  . LEU A 1 907 ? -3.585  113.819 27.475  0.00 0.00   ? 908 LEU S CA  1 
ATOM   6851  C C   . LEU A 1 907 ? -2.480  113.716 28.522  0.00 0.00   ? 908 LEU S C   1 
ATOM   6852  O O   . LEU A 1 907 ? -1.403  114.292 28.371  0.00 0.00   ? 908 LEU S O   1 
ATOM   6853  N N   . TYR A 1 908 ? -2.767  112.993 29.581  0.00 0.00   ? 909 TYR S N   1 
ATOM   6854  C CA  . TYR A 1 908 ? -1.811  112.819 30.669  0.00 0.00   ? 909 TYR S CA  1 
ATOM   6855  C C   . TYR A 1 908 ? -0.527  112.222 30.127  0.00 0.00   ? 909 TYR S C   1 
ATOM   6856  O O   . TYR A 1 908 ? 0.557   112.706 30.439  0.00 0.00   ? 909 TYR S O   1 
ATOM   6857  N N   . ALA A 1 909 ? -0.665  111.180 29.338  0.00 0.00   ? 910 ALA S N   1 
ATOM   6858  C CA  . ALA A 1 909 ? 0.512   110.512 28.762  0.00 0.00   ? 910 ALA S CA  1 
ATOM   6859  C C   . ALA A 1 909 ? 1.347   111.524 27.965  0.00 0.00   ? 910 ALA S C   1 
ATOM   6860  O O   . ALA A 1 909 ? 2.587   111.618 28.121  0.00 0.00   ? 910 ALA S O   1 
ATOM   6861  N N   . GLU A 1 910 ? 0.657   112.271 27.126  0.00 0.00   ? 911 GLU S N   1 
ATOM   6862  C CA  . GLU A 1 910 ? 1.342   113.281 26.295  0.00 0.00   ? 911 GLU S CA  1 
ATOM   6863  C C   . GLU A 1 910 ? 2.096   114.270 27.192  0.00 0.00   ? 911 GLU S C   1 
ATOM   6864  O O   . GLU A 1 910 ? 3.275   114.603 26.965  0.00 0.00   ? 911 GLU S O   1 
ATOM   6865  N N   . ALA A 1 911 ? 1.400   114.741 28.206  0.00 0.00   ? 912 ALA S N   1 
ATOM   6866  C CA  . ALA A 1 911 ? 1.979   115.705 29.141  0.00 0.00   ? 912 ALA S CA  1 
ATOM   6867  C C   . ALA A 1 911 ? 3.228   115.117 29.772  0.00 0.00   ? 912 ALA S C   1 
ATOM   6868  O O   . ALA A 1 911 ? 4.253   115.779 29.849  0.00 0.00   ? 912 ALA S O   1 
ATOM   6869  N N   . GLU A 1 912 ? 3.120   113.889 30.227  0.00 0.00   ? 913 GLU S N   1 
ATOM   6870  C CA  . GLU A 1 912 ? 4.248   113.213 30.870  0.00 0.00   ? 913 GLU S CA  1 
ATOM   6871  C C   . GLU A 1 912 ? 5.439   113.186 29.917  0.00 0.00   ? 913 GLU S C   1 
ATOM   6872  O O   . GLU A 1 912 ? 6.567   113.525 30.305  0.00 0.00   ? 913 GLU S O   1 
ATOM   6873  N N   . GLU A 1 913 ? 5.173   112.782 28.691  0.00 0.00   ? 914 GLU S N   1 
ATOM   6874  C CA  . GLU A 1 913 ? 6.250   112.706 27.684  0.00 0.00   ? 914 GLU S CA  1 
ATOM   6875  C C   . GLU A 1 913 ? 6.920   114.084 27.529  0.00 0.00   ? 914 GLU S C   1 
ATOM   6876  O O   . GLU A 1 913 ? 8.168   114.225 27.537  0.00 0.00   ? 914 GLU S O   1 
ATOM   6877  N N   . MET A 1 914 ? 6.079   115.089 27.391  0.00 0.00   ? 915 MET S N   1 
ATOM   6878  C CA  . MET A 1 914 ? 6.577   116.463 27.224  0.00 0.00   ? 915 MET S CA  1 
ATOM   6879  C C   . MET A 1 914 ? 7.451   116.843 28.415  0.00 0.00   ? 915 MET S C   1 
ATOM   6880  O O   . MET A 1 914 ? 8.542   117.392 28.255  0.00 0.00   ? 915 MET S O   1 
ATOM   6881  N N   . ARG A 1 915 ? 6.954   116.559 29.597  0.00 0.00   ? 916 ARG S N   1 
ATOM   6882  C CA  . ARG A 1 915 ? 7.674   116.881 30.825  0.00 0.00   ? 916 ARG S CA  1 
ATOM   6883  C C   . ARG A 1 915 ? 9.037   116.212 30.805  0.00 0.00   ? 916 ARG S C   1 
ATOM   6884  O O   . ARG A 1 915 ? 10.041  116.853 31.100  0.00 0.00   ? 916 ARG S O   1 
ATOM   6885  N N   . VAL A 1 916 ? 9.049   114.941 30.469  0.00 0.00   ? 917 VAL S N   1 
ATOM   6886  C CA  . VAL A 1 916 ? 10.312  114.187 30.427  0.00 0.00   ? 917 VAL S CA  1 
ATOM   6887  C C   . VAL A 1 916 ? 11.295  114.876 29.470  0.00 0.00   ? 917 VAL S C   1 
ATOM   6888  O O   . VAL A 1 916 ? 12.481  115.109 29.805  0.00 0.00   ? 917 VAL S O   1 
ATOM   6889  N N   . ARG A 1 917 ? 10.792  115.197 28.296  0.00 0.00   ? 918 ARG S N   1 
ATOM   6890  C CA  . ARG A 1 917 ? 11.635  115.859 27.282  0.00 0.00   ? 918 ARG S CA  1 
ATOM   6891  C C   . ARG A 1 917 ? 12.204  117.167 27.850  0.00 0.00   ? 918 ARG S C   1 
ATOM   6892  O O   . ARG A 1 917 ? 13.408  117.468 27.735  0.00 0.00   ? 918 ARG S O   1 
ATOM   6893  N N   . LEU A 1 918 ? 11.325  117.938 28.454  0.00 0.00   ? 919 LEU S N   1 
ATOM   6894  C CA  . LEU A 1 918 ? 11.716  119.224 29.032  0.00 0.00   ? 919 LEU S CA  1 
ATOM   6895  C C   . LEU A 1 918 ? 12.811  119.007 30.061  0.00 0.00   ? 919 LEU S C   1 
ATOM   6896  O O   . LEU A 1 918 ? 13.804  119.718 30.064  0.00 0.00   ? 919 LEU S O   1 
ATOM   6897  N N   . ALA A 1 919 ? 12.603  118.041 30.928  0.00 0.00   ? 920 ALA S N   1 
ATOM   6898  C CA  . ALA A 1 919 ? 13.577  117.741 31.979  0.00 0.00   ? 920 ALA S CA  1 
ATOM   6899  C C   . ALA A 1 919 ? 14.933  117.436 31.350  0.00 0.00   ? 920 ALA S C   1 
ATOM   6900  O O   . ALA A 1 919 ? 15.964  117.976 31.778  0.00 0.00   ? 920 ALA S O   1 
ATOM   6901  N N   . ALA A 1 920 ? 14.912  116.578 30.350  0.00 0.00   ? 921 ALA S N   1 
ATOM   6902  C CA  . ALA A 1 920 ? 16.166  116.199 29.669  0.00 0.00   ? 921 ALA S CA  1 
ATOM   6903  C C   . ALA A 1 920 ? 16.865  117.457 29.121  0.00 0.00   ? 921 ALA S C   1 
ATOM   6904  O O   . ALA A 1 920 ? 18.087  117.676 29.306  0.00 0.00   ? 921 ALA S O   1 
ATOM   6905  N N   . LYS A 1 921 ? 16.077  118.274 28.451  0.00 0.00   ? 922 LYS S N   1 
ATOM   6906  C CA  . LYS A 1 921 ? 16.607  119.511 27.861  0.00 0.00   ? 922 LYS S CA  1 
ATOM   6907  C C   . LYS A 1 921 ? 17.233  120.375 28.952  0.00 0.00   ? 922 LYS S C   1 
ATOM   6908  O O   . LYS A 1 921 ? 18.337  120.898 28.799  0.00 0.00   ? 922 LYS S O   1 
ATOM   6909  N N   . LYS A 1 922 ? 16.509  120.529 30.038  0.00 0.00   ? 923 LYS S N   1 
ATOM   6910  C CA  . LYS A 1 922 ? 16.972  121.343 31.158  0.00 0.00   ? 923 LYS S CA  1 
ATOM   6911  C C   . LYS A 1 922 ? 18.308  120.814 31.650  0.00 0.00   ? 923 LYS S C   1 
ATOM   6912  O O   . LYS A 1 922 ? 19.238  121.586 31.855  0.00 0.00   ? 923 LYS S O   1 
ATOM   6913  N N   . GLN A 1 923 ? 18.376  119.515 31.841  0.00 0.00   ? 924 GLN S N   1 
ATOM   6914  C CA  . GLN A 1 923 ? 19.615  118.891 32.328  0.00 0.00   ? 924 GLN S CA  1 
ATOM   6915  C C   . GLN A 1 923 ? 20.775  119.231 31.381  0.00 0.00   ? 924 GLN S C   1 
ATOM   6916  O O   . GLN A 1 923 ? 21.873  119.655 31.814  0.00 0.00   ? 924 GLN S O   1 
ATOM   6917  N N   . GLU A 1 924 ? 20.516  119.045 30.101  0.00 0.00   ? 925 GLU S N   1 
ATOM   6918  C CA  . GLU A 1 924 ? 21.550  119.328 29.086  0.00 0.00   ? 925 GLU S CA  1 
ATOM   6919  C C   . GLU A 1 924 ? 22.007  120.789 29.199  0.00 0.00   ? 925 GLU S C   1 
ATOM   6920  O O   . GLU A 1 924 ? 23.211  121.106 29.202  0.00 0.00   ? 925 GLU S O   1 
ATOM   6921  N N   . LEU A 1 925 ? 21.031  121.669 29.283  0.00 0.00   ? 926 LEU S N   1 
ATOM   6922  C CA  . LEU A 1 925 ? 21.308  123.101 29.382  0.00 0.00   ? 926 LEU S CA  1 
ATOM   6923  C C   . LEU A 1 925 ? 22.176  123.371 30.598  0.00 0.00   ? 926 LEU S C   1 
ATOM   6924  O O   . LEU A 1 925 ? 23.156  124.097 30.511  0.00 0.00   ? 926 LEU S O   1 
ATOM   6925  N N   . GLU A 1 926 ? 21.794  122.794 31.715  0.00 0.00   ? 927 GLU S N   1 
ATOM   6926  C CA  . GLU A 1 926 ? 22.537  122.986 32.961  0.00 0.00   ? 927 GLU S CA  1 
ATOM   6927  C C   . GLU A 1 926 ? 23.988  122.559 32.764  0.00 0.00   ? 927 GLU S C   1 
ATOM   6928  O O   . GLU A 1 926 ? 24.918  123.291 33.134  0.00 0.00   ? 927 GLU S O   1 
ATOM   6929  N N   . GLU A 1 927 ? 24.159  121.386 32.189  0.00 0.00   ? 928 GLU S N   1 
ATOM   6930  C CA  . GLU A 1 927 ? 25.520  120.864 31.953  0.00 0.00   ? 928 GLU S CA  1 
ATOM   6931  C C   . GLU A 1 927 ? 26.324  121.864 31.101  0.00 0.00   ? 928 GLU S C   1 
ATOM   6932  O O   . GLU A 1 927 ? 27.486  122.221 31.410  0.00 0.00   ? 928 GLU S O   1 
ATOM   6933  N N   . ILE A 1 928 ? 25.690  122.308 30.035  0.00 0.00   ? 929 ILE S N   1 
ATOM   6934  C CA  . ILE A 1 928 ? 26.338  123.261 29.121  0.00 0.00   ? 929 ILE S CA  1 
ATOM   6935  C C   . ILE A 1 928 ? 26.741  124.516 29.889  0.00 0.00   ? 929 ILE S C   1 
ATOM   6936  O O   . ILE A 1 928 ? 27.858  125.016 29.753  0.00 0.00   ? 929 ILE S O   1 
ATOM   6937  N N   . LEU A 1 929 ? 25.817  125.021 30.674  0.00 0.00   ? 930 LEU S N   1 
ATOM   6938  C CA  . LEU A 1 929 ? 26.057  126.230 31.457  0.00 0.00   ? 930 LEU S CA  1 
ATOM   6939  C C   . LEU A 1 929 ? 27.263  126.023 32.354  0.00 0.00   ? 930 LEU S C   1 
ATOM   6940  O O   . LEU A 1 929 ? 28.141  126.877 32.415  0.00 0.00   ? 930 LEU S O   1 
ATOM   6941  N N   . HIS A 1 930 ? 27.282  124.902 33.044  0.00 0.00   ? 931 HIS S N   1 
ATOM   6942  C CA  . HIS A 1 930 ? 28.396  124.598 33.955  0.00 0.00   ? 931 HIS S CA  1 
ATOM   6943  C C   . HIS A 1 930 ? 29.723  124.631 33.183  0.00 0.00   ? 931 HIS S C   1 
ATOM   6944  O O   . HIS A 1 930 ? 30.715  125.264 33.613  0.00 0.00   ? 931 HIS S O   1 
ATOM   6945  N N   . GLU A 1 931 ? 29.721  123.955 32.051  0.00 0.00   ? 932 GLU S N   1 
ATOM   6946  C CA  . GLU A 1 931 ? 30.938  123.901 31.217  0.00 0.00   ? 932 GLU S CA  1 
ATOM   6947  C C   . GLU A 1 931 ? 31.374  125.324 30.838  0.00 0.00   ? 932 GLU S C   1 
ATOM   6948  O O   . GLU A 1 931 ? 32.556  125.701 30.942  0.00 0.00   ? 932 GLU S O   1 
ATOM   6949  N N   . MET A 1 932 ? 30.409  126.099 30.393  0.00 0.00   ? 933 MET S N   1 
ATOM   6950  C CA  . MET A 1 932 ? 30.673  127.477 29.978  0.00 0.00   ? 933 MET S CA  1 
ATOM   6951  C C   . MET A 1 932 ? 31.283  128.248 31.134  0.00 0.00   ? 933 MET S C   1 
ATOM   6952  O O   . MET A 1 932 ? 32.267  128.952 30.957  0.00 0.00   ? 933 MET S O   1 
ATOM   6953  N N   . GLU A 1 933 ? 30.683  128.115 32.296  0.00 0.00   ? 934 GLU S N   1 
ATOM   6954  C CA  . GLU A 1 933 ? 31.166  128.819 33.486  0.00 0.00   ? 934 GLU S CA  1 
ATOM   6955  C C   . GLU A 1 933 ? 32.625  128.450 33.741  0.00 0.00   ? 934 GLU S C   1 
ATOM   6956  O O   . GLU A 1 933 ? 33.469  129.331 33.965  0.00 0.00   ? 934 GLU S O   1 
ATOM   6957  N N   . ALA A 1 934 ? 32.896  127.162 33.706  0.00 0.00   ? 935 ALA S N   1 
ATOM   6958  C CA  . ALA A 1 934 ? 34.273  126.685 33.949  0.00 0.00   ? 935 ALA S CA  1 
ATOM   6959  C C   . ALA A 1 934 ? 35.237  127.338 32.941  0.00 0.00   ? 935 ALA S C   1 
ATOM   6960  O O   . ALA A 1 934 ? 36.318  127.866 33.299  0.00 0.00   ? 935 ALA S O   1 
ATOM   6961  N N   . ARG A 1 935 ? 34.832  127.297 31.688  0.00 0.00   ? 936 ARG S N   1 
ATOM   6962  C CA  . ARG A 1 935 ? 35.655  127.873 30.615  0.00 0.00   ? 936 ARG S CA  1 
ATOM   6963  C C   . ARG A 1 935 ? 35.909  129.351 30.898  0.00 0.00   ? 936 ARG S C   1 
ATOM   6964  O O   . ARG A 1 935 ? 37.033  129.838 30.790  0.00 0.00   ? 936 ARG S O   1 
ATOM   6965  N N   . ILE A 1 936 ? 34.850  130.053 31.242  0.00 0.00   ? 937 ILE S N   1 
ATOM   6966  C CA  . ILE A 1 936 ? 34.941  131.483 31.524  0.00 0.00   ? 937 ILE S CA  1 
ATOM   6967  C C   . ILE A 1 936 ? 35.942  131.716 32.639  0.00 0.00   ? 937 ILE S C   1 
ATOM   6968  O O   . ILE A 1 936 ? 36.798  132.588 32.525  0.00 0.00   ? 937 ILE S O   1 
ATOM   6969  N N   . GLU A 1 937 ? 35.816  130.945 33.698  0.00 0.00   ? 938 GLU S N   1 
ATOM   6970  C CA  . GLU A 1 937 ? 36.724  131.090 34.846  0.00 0.00   ? 938 GLU S CA  1 
ATOM   6971  C C   . GLU A 1 937 ? 38.179  130.919 34.382  0.00 0.00   ? 938 GLU S C   1 
ATOM   6972  O O   . GLU A 1 937 ? 39.071  131.734 34.712  0.00 0.00   ? 938 GLU S O   1 
ATOM   6973  N N   . GLU A 1 938 ? 38.395  129.864 33.622  0.00 0.00   ? 939 GLU S N   1 
ATOM   6974  C CA  . GLU A 1 938 ? 39.754  129.581 33.115  0.00 0.00   ? 939 GLU S CA  1 
ATOM   6975  C C   . GLU A 1 938 ? 40.268  130.779 32.304  0.00 0.00   ? 939 GLU S C   1 
ATOM   6976  O O   . GLU A 1 938 ? 41.409  131.249 32.471  0.00 0.00   ? 939 GLU S O   1 
ATOM   6977  N N   . GLU A 1 939 ? 39.415  131.257 31.422  0.00 0.00   ? 940 GLU S N   1 
ATOM   6978  C CA  . GLU A 1 939 ? 39.768  132.389 30.564  0.00 0.00   ? 940 GLU S CA  1 
ATOM   6979  C C   . GLU A 1 939 ? 40.144  133.581 31.423  0.00 0.00   ? 940 GLU S C   1 
ATOM   6980  O O   . GLU A 1 939 ? 41.148  134.232 31.172  0.00 0.00   ? 940 GLU S O   1 
ATOM   6981  N N   . GLU A 1 940 ? 39.324  133.859 32.412  0.00 0.00   ? 941 GLU S N   1 
ATOM   6982  C CA  . GLU A 1 940 ? 39.568  134.995 33.303  0.00 0.00   ? 941 GLU S CA  1 
ATOM   6983  C C   . GLU A 1 940 ? 40.942  134.854 33.949  0.00 0.00   ? 941 GLU S C   1 
ATOM   6984  O O   . GLU A 1 940 ? 41.734  135.809 33.966  0.00 0.00   ? 941 GLU S O   1 
ATOM   6985  N N   . GLU A 1 941 ? 41.206  133.671 34.467  0.00 0.00   ? 942 GLU S N   1 
ATOM   6986  C CA  . GLU A 1 941 ? 42.503  133.421 35.126  0.00 0.00   ? 942 GLU S CA  1 
ATOM   6987  C C   . GLU A 1 941 ? 43.652  133.706 34.141  0.00 0.00   ? 942 GLU S C   1 
ATOM   6988  O O   . GLU A 1 941 ? 44.648  134.404 34.460  0.00 0.00   ? 942 GLU S O   1 
ATOM   6989  N N   . ARG A 1 942 ? 43.502  133.163 32.950  0.00 0.00   ? 943 ARG S N   1 
ATOM   6990  C CA  . ARG A 1 942 ? 44.528  133.343 31.911  0.00 0.00   ? 943 ARG S CA  1 
ATOM   6991  C C   . ARG A 1 942 ? 44.732  134.830 31.641  0.00 0.00   ? 943 ARG S C   1 
ATOM   6992  O O   . ARG A 1 942 ? 45.861  135.316 31.565  0.00 0.00   ? 943 ARG S O   1 
ATOM   6993  N N   . PHE B 2 3   ? 21.161  82.814  -31.865 1.00 100.00 ? 3   PHE T N   1 
ATOM   6994  C CA  . PHE B 2 3   ? 21.025  82.039  -30.603 1.00 100.00 ? 3   PHE T CA  1 
ATOM   6995  C C   . PHE B 2 3   ? 19.852  81.068  -30.684 1.00 100.00 ? 3   PHE T C   1 
ATOM   6996  O O   . PHE B 2 3   ? 18.696  81.470  -30.569 1.00 85.52  ? 3   PHE T O   1 
ATOM   6997  C CB  . PHE B 2 3   ? 20.818  82.989  -29.420 1.00 85.52  ? 3   PHE T CB  1 
ATOM   6998  C CG  . PHE B 2 3   ? 22.097  83.445  -28.773 1.00 85.52  ? 3   PHE T CG  1 
ATOM   6999  C CD1 . PHE B 2 3   ? 23.100  82.536  -28.461 1.00 85.52  ? 3   PHE T CD1 1 
ATOM   7000  C CD2 . PHE B 2 3   ? 22.294  84.789  -28.473 1.00 85.52  ? 3   PHE T CD2 1 
ATOM   7001  C CE1 . PHE B 2 3   ? 24.282  82.955  -27.852 1.00 85.52  ? 3   PHE T CE1 1 
ATOM   7002  C CE2 . PHE B 2 3   ? 23.473  85.220  -27.864 1.00 85.52  ? 3   PHE T CE2 1 
ATOM   7003  C CZ  . PHE B 2 3   ? 24.468  84.301  -27.555 1.00 85.52  ? 3   PHE T CZ  1 
ATOM   7004  N N   . SER B 2 4   ? 20.159  79.791  -30.890 1.00 100.00 ? 4   SER T N   1 
ATOM   7005  C CA  . SER B 2 4   ? 19.131  78.760  -30.983 1.00 100.00 ? 4   SER T CA  1 
ATOM   7006  C C   . SER B 2 4   ? 18.120  78.922  -29.856 1.00 100.00 ? 4   SER T C   1 
ATOM   7007  O O   . SER B 2 4   ? 18.491  79.238  -28.725 1.00 49.13  ? 4   SER T O   1 
ATOM   7008  C CB  . SER B 2 4   ? 19.768  77.369  -30.908 1.00 49.13  ? 4   SER T CB  1 
ATOM   7009  O OG  . SER B 2 4   ? 20.005  76.988  -29.564 1.00 49.13  ? 4   SER T OG  1 
ATOM   7010  N N   . GLU B 2 5   ? 16.845  78.712  -30.162 1.00 100.00 ? 5   GLU T N   1 
ATOM   7011  C CA  . GLU B 2 5   ? 15.802  78.838  -29.154 1.00 100.00 ? 5   GLU T CA  1 
ATOM   7012  C C   . GLU B 2 5   ? 16.183  78.005  -27.939 1.00 100.00 ? 5   GLU T C   1 
ATOM   7013  O O   . GLU B 2 5   ? 15.860  78.355  -26.807 1.00 100.00 ? 5   GLU T O   1 
ATOM   7014  C CB  . GLU B 2 5   ? 14.458  78.362  -29.707 1.00 100.00 ? 5   GLU T CB  1 
ATOM   7015  C CG  . GLU B 2 5   ? 13.266  78.715  -28.828 1.00 100.00 ? 5   GLU T CG  1 
ATOM   7016  C CD  . GLU B 2 5   ? 12.993  80.208  -28.780 1.00 100.00 ? 5   GLU T CD  1 
ATOM   7017  O OE1 . GLU B 2 5   ? 13.869  80.962  -28.306 1.00 100.00 ? 5   GLU T OE1 1 
ATOM   7018  O OE2 . GLU B 2 5   ? 11.904  80.627  -29.220 1.00 100.00 ? 5   GLU T OE2 1 
ATOM   7019  N N   . GLU B 2 6   ? 16.879  76.898  -28.189 1.00 86.51  ? 6   GLU T N   1 
ATOM   7020  C CA  . GLU B 2 6   ? 17.321  76.008  -27.127 1.00 86.51  ? 6   GLU T CA  1 
ATOM   7021  C C   . GLU B 2 6   ? 18.012  76.820  -26.034 1.00 86.51  ? 6   GLU T C   1 
ATOM   7022  O O   . GLU B 2 6   ? 17.694  76.683  -24.853 1.00 100.00 ? 6   GLU T O   1 
ATOM   7023  C CB  . GLU B 2 6   ? 18.276  74.957  -27.697 1.00 100.00 ? 6   GLU T CB  1 
ATOM   7024  C CG  . GLU B 2 6   ? 19.277  74.388  -26.707 1.00 100.00 ? 6   GLU T CG  1 
ATOM   7025  C CD  . GLU B 2 6   ? 20.449  73.720  -27.396 1.00 100.00 ? 6   GLU T CD  1 
ATOM   7026  O OE1 . GLU B 2 6   ? 20.216  72.924  -28.329 1.00 100.00 ? 6   GLU T OE1 1 
ATOM   7027  O OE2 . GLU B 2 6   ? 21.604  73.990  -27.005 1.00 100.00 ? 6   GLU T OE2 1 
ATOM   7028  N N   . GLN B 2 7   ? 18.960  77.667  -26.431 1.00 100.00 ? 7   GLN T N   1 
ATOM   7029  C CA  . GLN B 2 7   ? 19.673  78.501  -25.472 1.00 100.00 ? 7   GLN T CA  1 
ATOM   7030  C C   . GLN B 2 7   ? 18.823  79.713  -25.120 1.00 100.00 ? 7   GLN T C   1 
ATOM   7031  O O   . GLN B 2 7   ? 18.686  80.064  -23.949 1.00 100.00 ? 7   GLN T O   1 
ATOM   7032  C CB  . GLN B 2 7   ? 21.023  78.957  -26.039 1.00 100.00 ? 7   GLN T CB  1 
ATOM   7033  C CG  . GLN B 2 7   ? 20.983  79.468  -27.468 1.00 100.00 ? 7   GLN T CG  1 
ATOM   7034  C CD  . GLN B 2 7   ? 22.263  79.169  -28.222 1.00 100.00 ? 7   GLN T CD  1 
ATOM   7035  O OE1 . GLN B 2 7   ? 23.176  78.539  -27.690 1.00 100.00 ? 7   GLN T OE1 1 
ATOM   7036  N NE2 . GLN B 2 7   ? 22.339  79.620  -29.467 1.00 100.00 ? 7   GLN T NE2 1 
ATOM   7037  N N   . THR B 2 8   ? 18.250  80.348  -26.138 1.00 53.24  ? 8   THR T N   1 
ATOM   7038  C CA  . THR B 2 8   ? 17.401  81.515  -25.929 1.00 53.24  ? 8   THR T CA  1 
ATOM   7039  C C   . THR B 2 8   ? 16.368  81.190  -24.857 1.00 53.24  ? 8   THR T C   1 
ATOM   7040  O O   . THR B 2 8   ? 16.048  82.026  -24.013 1.00 60.19  ? 8   THR T O   1 
ATOM   7041  C CB  . THR B 2 8   ? 16.663  81.909  -27.223 1.00 60.19  ? 8   THR T CB  1 
ATOM   7042  O OG1 . THR B 2 8   ? 17.604  82.002  -28.301 1.00 60.19  ? 8   THR T OG1 1 
ATOM   7043  C CG2 . THR B 2 8   ? 15.966  83.252  -27.051 1.00 60.19  ? 8   THR T CG2 1 
ATOM   7044  N N   . ALA B 2 9   ? 15.863  79.962  -24.894 1.00 98.62  ? 9   ALA T N   1 
ATOM   7045  C CA  . ALA B 2 9   ? 14.874  79.503  -23.926 1.00 98.62  ? 9   ALA T CA  1 
ATOM   7046  C C   . ALA B 2 9   ? 15.484  79.526  -22.531 1.00 98.62  ? 9   ALA T C   1 
ATOM   7047  O O   . ALA B 2 9   ? 14.828  79.900  -21.559 1.00 100.00 ? 9   ALA T O   1 
ATOM   7048  C CB  . ALA B 2 9   ? 14.418  78.091  -24.271 1.00 100.00 ? 9   ALA T CB  1 
ATOM   7049  N N   . GLU B 2 10  ? 16.747  79.126  -22.443 1.00 100.00 ? 10  GLU T N   1 
ATOM   7050  C CA  . GLU B 2 10  ? 17.451  79.102  -21.170 1.00 100.00 ? 10  GLU T CA  1 
ATOM   7051  C C   . GLU B 2 10  ? 17.895  80.495  -20.751 1.00 100.00 ? 10  GLU T C   1 
ATOM   7052  O O   . GLU B 2 10  ? 17.859  80.833  -19.570 1.00 76.02  ? 10  GLU T O   1 
ATOM   7053  C CB  . GLU B 2 10  ? 18.661  78.175  -21.251 1.00 76.02  ? 10  GLU T CB  1 
ATOM   7054  C CG  . GLU B 2 10  ? 18.553  76.982  -20.334 1.00 76.02  ? 10  GLU T CG  1 
ATOM   7055  C CD  . GLU B 2 10  ? 18.737  75.663  -21.058 1.00 76.02  ? 10  GLU T CD  1 
ATOM   7056  O OE1 . GLU B 2 10  ? 19.626  75.584  -21.935 1.00 76.02  ? 10  GLU T OE1 1 
ATOM   7057  O OE2 . GLU B 2 10  ? 18.005  74.704  -20.741 1.00 76.02  ? 10  GLU T OE2 1 
ATOM   7058  N N   . PHE B 2 11  ? 18.324  81.298  -21.721 1.00 54.12  ? 11  PHE T N   1 
ATOM   7059  C CA  . PHE B 2 11  ? 18.758  82.662  -21.444 1.00 54.12  ? 11  PHE T CA  1 
ATOM   7060  C C   . PHE B 2 11  ? 17.749  83.279  -20.490 1.00 54.12  ? 11  PHE T C   1 
ATOM   7061  O O   . PHE B 2 11  ? 18.113  83.893  -19.485 1.00 67.93  ? 11  PHE T O   1 
ATOM   7062  C CB  . PHE B 2 11  ? 18.789  83.482  -22.735 1.00 67.93  ? 11  PHE T CB  1 
ATOM   7063  C CG  . PHE B 2 11  ? 20.012  83.256  -23.579 1.00 67.93  ? 11  PHE T CG  1 
ATOM   7064  C CD1 . PHE B 2 11  ? 20.871  82.189  -23.331 1.00 67.93  ? 11  PHE T CD1 1 
ATOM   7065  C CD2 . PHE B 2 11  ? 20.301  84.116  -24.633 1.00 67.93  ? 11  PHE T CD2 1 
ATOM   7066  C CE1 . PHE B 2 11  ? 21.999  81.982  -24.123 1.00 67.93  ? 11  PHE T CE1 1 
ATOM   7067  C CE2 . PHE B 2 11  ? 21.422  83.918  -25.428 1.00 67.93  ? 11  PHE T CE2 1 
ATOM   7068  C CZ  . PHE B 2 11  ? 22.273  82.849  -25.173 1.00 67.93  ? 11  PHE T CZ  1 
ATOM   7069  N N   . LYS B 2 12  ? 16.476  83.106  -20.822 1.00 100.00 ? 12  LYS T N   1 
ATOM   7070  C CA  . LYS B 2 12  ? 15.377  83.623  -20.019 1.00 100.00 ? 12  LYS T CA  1 
ATOM   7071  C C   . LYS B 2 12  ? 15.528  83.143  -18.584 1.00 100.00 ? 12  LYS T C   1 
ATOM   7072  O O   . LYS B 2 12  ? 15.378  83.917  -17.638 1.00 100.00 ? 12  LYS T O   1 
ATOM   7073  C CB  . LYS B 2 12  ? 14.039  83.145  -20.591 1.00 100.00 ? 12  LYS T CB  1 
ATOM   7074  C CG  . LYS B 2 12  ? 14.075  82.832  -22.082 1.00 100.00 ? 12  LYS T CG  1 
ATOM   7075  C CD  . LYS B 2 12  ? 12.867  82.015  -22.517 1.00 100.00 ? 12  LYS T CD  1 
ATOM   7076  C CE  . LYS B 2 12  ? 12.655  82.098  -24.022 1.00 100.00 ? 12  LYS T CE  1 
ATOM   7077  N NZ  . LYS B 2 12  ? 11.812  80.981  -24.533 1.00 100.00 ? 12  LYS T NZ  1 
ATOM   7078  N N   . GLU B 2 13  ? 15.827  81.858  -18.430 1.00 95.74  ? 13  GLU T N   1 
ATOM   7079  C CA  . GLU B 2 13  ? 16.006  81.258  -17.113 1.00 95.74  ? 13  GLU T CA  1 
ATOM   7080  C C   . GLU B 2 13  ? 17.078  82.011  -16.333 1.00 95.74  ? 13  GLU T C   1 
ATOM   7081  O O   . GLU B 2 13  ? 16.985  82.158  -15.115 1.00 100.00 ? 13  GLU T O   1 
ATOM   7082  C CB  . GLU B 2 13  ? 16.398  79.786  -17.259 1.00 100.00 ? 13  GLU T CB  1 
ATOM   7083  C CG  . GLU B 2 13  ? 15.679  79.069  -18.392 1.00 100.00 ? 13  GLU T CG  1 
ATOM   7084  C CD  . GLU B 2 13  ? 15.903  77.568  -18.386 1.00 100.00 ? 13  GLU T CD  1 
ATOM   7085  O OE1 . GLU B 2 13  ? 16.854  77.107  -17.722 1.00 100.00 ? 13  GLU T OE1 1 
ATOM   7086  O OE2 . GLU B 2 13  ? 15.124  76.850  -19.050 1.00 100.00 ? 13  GLU T OE2 1 
ATOM   7087  N N   . ALA B 2 14  ? 18.093  82.489  -17.046 1.00 100.00 ? 14  ALA T N   1 
ATOM   7088  C CA  . ALA B 2 14  ? 19.180  83.231  -16.421 1.00 100.00 ? 14  ALA T CA  1 
ATOM   7089  C C   . ALA B 2 14  ? 18.743  84.661  -16.134 1.00 100.00 ? 14  ALA T C   1 
ATOM   7090  O O   . ALA B 2 14  ? 18.898  85.155  -15.015 1.00 75.34  ? 14  ALA T O   1 
ATOM   7091  C CB  . ALA B 2 14  ? 20.396  83.233  -17.325 1.00 75.34  ? 14  ALA T CB  1 
ATOM   7092  N N   . PHE B 2 15  ? 18.196  85.324  -17.149 1.00 34.69  ? 15  PHE T N   1 
ATOM   7093  C CA  . PHE B 2 15  ? 17.734  86.695  -16.993 1.00 34.69  ? 15  PHE T CA  1 
ATOM   7094  C C   . PHE B 2 15  ? 16.761  86.779  -15.823 1.00 34.69  ? 15  PHE T C   1 
ATOM   7095  O O   . PHE B 2 15  ? 16.926  87.599  -14.918 1.00 90.04  ? 15  PHE T O   1 
ATOM   7096  C CB  . PHE B 2 15  ? 17.035  87.175  -18.266 1.00 90.04  ? 15  PHE T CB  1 
ATOM   7097  C CG  . PHE B 2 15  ? 16.828  88.659  -18.312 1.00 90.04  ? 15  PHE T CG  1 
ATOM   7098  C CD1 . PHE B 2 15  ? 15.695  89.234  -17.747 1.00 90.04  ? 15  PHE T CD1 1 
ATOM   7099  C CD2 . PHE B 2 15  ? 17.780  89.485  -18.894 1.00 90.04  ? 15  PHE T CD2 1 
ATOM   7100  C CE1 . PHE B 2 15  ? 15.516  90.615  -17.760 1.00 90.04  ? 15  PHE T CE1 1 
ATOM   7101  C CE2 . PHE B 2 15  ? 17.609  90.865  -18.911 1.00 90.04  ? 15  PHE T CE2 1 
ATOM   7102  C CZ  . PHE B 2 15  ? 16.477  91.432  -18.342 1.00 90.04  ? 15  PHE T CZ  1 
ATOM   7103  N N   . GLN B 2 16  ? 15.752  85.915  -15.852 1.00 83.62  ? 16  GLN T N   1 
ATOM   7104  C CA  . GLN B 2 16  ? 14.741  85.866  -14.805 1.00 83.62  ? 16  GLN T CA  1 
ATOM   7105  C C   . GLN B 2 16  ? 15.403  85.693  -13.447 1.00 83.62  ? 16  GLN T C   1 
ATOM   7106  O O   . GLN B 2 16  ? 15.009  86.313  -12.460 1.00 93.46  ? 16  GLN T O   1 
ATOM   7107  C CB  . GLN B 2 16  ? 13.791  84.697  -15.059 1.00 93.46  ? 16  GLN T CB  1 
ATOM   7108  C CG  . GLN B 2 16  ? 12.802  84.950  -16.179 1.00 93.46  ? 16  GLN T CG  1 
ATOM   7109  C CD  . GLN B 2 16  ? 11.433  85.316  -15.656 1.00 93.46  ? 16  GLN T CD  1 
ATOM   7110  O OE1 . GLN B 2 16  ? 10.887  84.637  -14.786 1.00 93.46  ? 16  GLN T OE1 1 
ATOM   7111  N NE2 . GLN B 2 16  ? 10.871  86.397  -16.178 1.00 93.46  ? 16  GLN T NE2 1 
ATOM   7112  N N   . LEU B 2 17  ? 16.418  84.839  -13.411 1.00 71.92  ? 17  LEU T N   1 
ATOM   7113  C CA  . LEU B 2 17  ? 17.159  84.563  -12.186 1.00 71.92  ? 17  LEU T CA  1 
ATOM   7114  C C   . LEU B 2 17  ? 18.026  85.766  -11.818 1.00 71.92  ? 17  LEU T C   1 
ATOM   7115  O O   . LEU B 2 17  ? 19.173  85.607  -11.396 1.00 98.57  ? 17  LEU T O   1 
ATOM   7116  C CB  . LEU B 2 17  ? 18.045  83.331  -12.393 1.00 98.57  ? 17  LEU T CB  1 
ATOM   7117  C CG  . LEU B 2 17  ? 18.829  82.780  -11.201 1.00 98.57  ? 17  LEU T CG  1 
ATOM   7118  C CD1 . LEU B 2 17  ? 17.892  82.592  -10.024 1.00 98.57  ? 17  LEU T CD1 1 
ATOM   7119  C CD2 . LEU B 2 17  ? 19.487  81.460  -11.579 1.00 98.57  ? 17  LEU T CD2 1 
ATOM   7120  N N   . PHE B 2 18  ? 17.474  86.966  -11.966 1.00 81.80  ? 18  PHE T N   1 
ATOM   7121  C CA  . PHE B 2 18  ? 18.238  88.177  -11.673 1.00 81.80  ? 18  PHE T CA  1 
ATOM   7122  C C   . PHE B 2 18  ? 17.454  89.372  -11.130 1.00 81.80  ? 18  PHE T C   1 
ATOM   7123  O O   . PHE B 2 18  ? 17.942  90.502  -11.189 1.00 95.10  ? 18  PHE T O   1 
ATOM   7124  C CB  . PHE B 2 18  ? 18.966  88.629  -12.938 1.00 95.10  ? 18  PHE T CB  1 
ATOM   7125  C CG  . PHE B 2 18  ? 20.414  88.247  -12.981 1.00 95.10  ? 18  PHE T CG  1 
ATOM   7126  C CD1 . PHE B 2 18  ? 21.340  88.909  -12.183 1.00 95.10  ? 18  PHE T CD1 1 
ATOM   7127  C CD2 . PHE B 2 18  ? 20.856  87.244  -13.835 1.00 95.10  ? 18  PHE T CD2 1 
ATOM   7128  C CE1 . PHE B 2 18  ? 22.685  88.581  -12.237 1.00 95.10  ? 18  PHE T CE1 1 
ATOM   7129  C CE2 . PHE B 2 18  ? 22.204  86.907  -13.898 1.00 95.10  ? 18  PHE T CE2 1 
ATOM   7130  C CZ  . PHE B 2 18  ? 23.120  87.578  -13.096 1.00 95.10  ? 18  PHE T CZ  1 
ATOM   7131  N N   . ASP B 2 19  ? 16.257  89.142  -10.602 1.00 84.06  ? 19  ASP T N   1 
ATOM   7132  C CA  . ASP B 2 19  ? 15.465  90.252  -10.084 1.00 84.06  ? 19  ASP T CA  1 
ATOM   7133  C C   . ASP B 2 19  ? 15.106  90.100  -8.609  1.00 84.06  ? 19  ASP T C   1 
ATOM   7134  O O   . ASP B 2 19  ? 14.354  89.204  -8.232  1.00 98.79  ? 19  ASP T O   1 
ATOM   7135  C CB  . ASP B 2 19  ? 14.193  90.420  -10.920 1.00 98.79  ? 19  ASP T CB  1 
ATOM   7136  C CG  . ASP B 2 19  ? 13.644  91.833  -10.869 1.00 98.79  ? 19  ASP T CG  1 
ATOM   7137  O OD1 . ASP B 2 19  ? 13.927  92.545  -9.884  1.00 98.79  ? 19  ASP T OD1 1 
ATOM   7138  O OD2 . ASP B 2 19  ? 12.930  92.226  -11.815 1.00 98.79  ? 19  ASP T OD2 1 
ATOM   7139  N N   . ARG B 2 20  ? 15.656  90.988  -7.781  1.00 100.00 ? 20  ARG T N   1 
ATOM   7140  C CA  . ARG B 2 20  ? 15.415  90.963  -6.339  1.00 100.00 ? 20  ARG T CA  1 
ATOM   7141  C C   . ARG B 2 20  ? 13.935  91.095  -5.978  1.00 100.00 ? 20  ARG T C   1 
ATOM   7142  O O   . ARG B 2 20  ? 13.427  90.347  -5.143  1.00 100.00 ? 20  ARG T O   1 
ATOM   7143  C CB  . ARG B 2 20  ? 16.218  92.070  -5.649  1.00 100.00 ? 20  ARG T CB  1 
ATOM   7144  C CG  . ARG B 2 20  ? 16.291  91.925  -4.136  1.00 100.00 ? 20  ARG T CG  1 
ATOM   7145  C CD  . ARG B 2 20  ? 17.661  92.292  -3.583  1.00 100.00 ? 20  ARG T CD  1 
ATOM   7146  N NE  . ARG B 2 20  ? 18.691  92.353  -4.617  1.00 100.00 ? 20  ARG T NE  1 
ATOM   7147  C CZ  . ARG B 2 20  ? 19.995  92.390  -4.370  1.00 100.00 ? 20  ARG T CZ  1 
ATOM   7148  N NH1 . ARG B 2 20  ? 20.443  92.366  -3.119  1.00 100.00 ? 20  ARG T NH1 1 
ATOM   7149  N NH2 . ARG B 2 20  ? 20.859  92.448  -5.373  1.00 100.00 ? 20  ARG T NH2 1 
ATOM   7150  N N   . THR B 2 21  ? 13.252  92.051  -6.605  1.00 100.00 ? 21  THR T N   1 
ATOM   7151  C CA  . THR B 2 21  ? 11.829  92.261  -6.350  1.00 100.00 ? 21  THR T CA  1 
ATOM   7152  C C   . THR B 2 21  ? 11.014  91.350  -7.272  1.00 100.00 ? 21  THR T C   1 
ATOM   7153  O O   . THR B 2 21  ? 10.747  90.200  -6.917  1.00 94.27  ? 21  THR T O   1 
ATOM   7154  C CB  . THR B 2 21  ? 11.437  93.741  -6.566  1.00 94.27  ? 21  THR T CB  1 
ATOM   7155  O OG1 . THR B 2 21  ? 12.420  94.382  -7.387  1.00 94.27  ? 21  THR T OG1 1 
ATOM   7156  C CG2 . THR B 2 21  ? 11.366  94.473  -5.226  1.00 94.27  ? 21  THR T CG2 1 
ATOM   7157  N N   . GLY B 2 22  ? 10.623  91.840  -8.452  1.00 39.03  ? 22  GLY T N   1 
ATOM   7158  C CA  . GLY B 2 22  ? 9.864   90.982  -9.353  1.00 39.03  ? 22  GLY T CA  1 
ATOM   7159  C C   . GLY B 2 22  ? 9.259   91.439  -10.681 1.00 39.03  ? 22  GLY T C   1 
ATOM   7160  O O   . GLY B 2 22  ? 8.751   90.604  -11.428 1.00 25.55  ? 22  GLY T O   1 
ATOM   7161  N N   . ASP B 2 23  ? 9.288   92.735  -10.990 1.00 49.44  ? 23  ASP T N   1 
ATOM   7162  C CA  . ASP B 2 23  ? 8.713   93.229  -12.243 1.00 49.44  ? 23  ASP T CA  1 
ATOM   7163  C C   . ASP B 2 23  ? 9.190   92.429  -13.455 1.00 49.44  ? 23  ASP T C   1 
ATOM   7164  O O   . ASP B 2 23  ? 8.472   92.288  -14.450 1.00 100.00 ? 23  ASP T O   1 
ATOM   7165  C CB  . ASP B 2 23  ? 9.069   94.707  -12.450 1.00 100.00 ? 23  ASP T CB  1 
ATOM   7166  C CG  . ASP B 2 23  ? 10.092  95.210  -11.452 1.00 100.00 ? 23  ASP T CG  1 
ATOM   7167  O OD1 . ASP B 2 23  ? 9.684   95.660  -10.366 1.00 100.00 ? 23  ASP T OD1 1 
ATOM   7168  O OD2 . ASP B 2 23  ? 11.302  95.156  -11.752 1.00 100.00 ? 23  ASP T OD2 1 
ATOM   7169  N N   . GLY B 2 24  ? 10.403  91.898  -13.356 1.00 100.00 ? 24  GLY T N   1 
ATOM   7170  C CA  . GLY B 2 24  ? 10.971  91.143  -14.456 1.00 100.00 ? 24  GLY T CA  1 
ATOM   7171  C C   . GLY B 2 24  ? 11.871  92.091  -15.216 1.00 100.00 ? 24  GLY T C   1 
ATOM   7172  O O   . GLY B 2 24  ? 11.930  92.081  -16.446 1.00 56.56  ? 24  GLY T O   1 
ATOM   7173  N N   . LYS B 2 25  ? 12.580  92.925  -14.460 1.00 70.63  ? 25  LYS T N   1 
ATOM   7174  C CA  . LYS B 2 25  ? 13.478  93.904  -15.042 1.00 70.63  ? 25  LYS T CA  1 
ATOM   7175  C C   . LYS B 2 25  ? 14.873  93.887  -14.434 1.00 70.63  ? 25  LYS T C   1 
ATOM   7176  O O   . LYS B 2 25  ? 15.044  93.746  -13.221 1.00 94.56  ? 25  LYS T O   1 
ATOM   7177  C CB  . LYS B 2 25  ? 12.878  95.304  -14.900 1.00 94.56  ? 25  LYS T CB  1 
ATOM   7178  C CG  . LYS B 2 25  ? 12.012  95.718  -16.075 1.00 94.56  ? 25  LYS T CG  1 
ATOM   7179  C CD  . LYS B 2 25  ? 10.561  95.323  -15.862 1.00 94.56  ? 25  LYS T CD  1 
ATOM   7180  C CE  . LYS B 2 25  ? 9.625   96.471  -16.200 1.00 94.56  ? 25  LYS T CE  1 
ATOM   7181  N NZ  . LYS B 2 25  ? 8.781   96.861  -15.037 1.00 94.56  ? 25  LYS T NZ  1 
ATOM   7182  N N   . ILE B 2 26  ? 15.868  94.038  -15.303 1.00 80.18  ? 26  ILE T N   1 
ATOM   7183  C CA  . ILE B 2 26  ? 17.265  94.056  -14.903 1.00 80.18  ? 26  ILE T CA  1 
ATOM   7184  C C   . ILE B 2 26  ? 17.755  95.495  -15.001 1.00 80.18  ? 26  ILE T C   1 
ATOM   7185  O O   . ILE B 2 26  ? 17.833  96.057  -16.095 1.00 82.85  ? 26  ILE T O   1 
ATOM   7186  C CB  . ILE B 2 26  ? 18.108  93.140  -15.838 1.00 82.85  ? 26  ILE T CB  1 
ATOM   7187  C CG1 . ILE B 2 26  ? 18.254  91.747  -15.218 1.00 82.85  ? 26  ILE T CG1 1 
ATOM   7188  C CG2 . ILE B 2 26  ? 19.488  93.740  -16.078 1.00 82.85  ? 26  ILE T CG2 1 
ATOM   7189  C CD1 . ILE B 2 26  ? 17.001  91.224  -14.539 1.00 82.85  ? 26  ILE T CD1 1 
ATOM   7190  N N   . LEU B 2 27  ? 18.066  96.094  -13.858 1.00 100.00 ? 27  LEU T N   1 
ATOM   7191  C CA  . LEU B 2 27  ? 18.547  97.471  -13.836 1.00 100.00 ? 27  LEU T CA  1 
ATOM   7192  C C   . LEU B 2 27  ? 19.652  97.618  -14.870 1.00 100.00 ? 27  LEU T C   1 
ATOM   7193  O O   . LEU B 2 27  ? 20.466  96.714  -15.049 1.00 100.00 ? 27  LEU T O   1 
ATOM   7194  C CB  . LEU B 2 27  ? 19.073  97.833  -12.444 1.00 100.00 ? 27  LEU T CB  1 
ATOM   7195  C CG  . LEU B 2 27  ? 18.074  97.777  -11.281 1.00 100.00 ? 27  LEU T CG  1 
ATOM   7196  C CD1 . LEU B 2 27  ? 18.473  98.798  -10.228 1.00 100.00 ? 27  LEU T CD1 1 
ATOM   7197  C CD2 . LEU B 2 27  ? 16.659  98.048  -11.775 1.00 100.00 ? 27  LEU T CD2 1 
ATOM   7198  N N   . TYR B 2 28  ? 19.672  98.759  -15.553 1.00 67.27  ? 28  TYR T N   1 
ATOM   7199  C CA  . TYR B 2 28  ? 20.677  99.016  -16.579 1.00 67.27  ? 28  TYR T CA  1 
ATOM   7200  C C   . TYR B 2 28  ? 22.065  98.585  -16.129 1.00 67.27  ? 28  TYR T C   1 
ATOM   7201  O O   . TYR B 2 28  ? 22.939  98.306  -16.951 1.00 98.05  ? 28  TYR T O   1 
ATOM   7202  C CB  . TYR B 2 28  ? 20.676  100.499 -16.954 1.00 98.05  ? 28  TYR T CB  1 
ATOM   7203  C CG  . TYR B 2 28  ? 19.986  100.784 -18.268 1.00 98.05  ? 28  TYR T CG  1 
ATOM   7204  C CD1 . TYR B 2 28  ? 18.874  100.040 -18.666 1.00 98.05  ? 28  TYR T CD1 1 
ATOM   7205  C CD2 . TYR B 2 28  ? 20.459  101.771 -19.131 1.00 98.05  ? 28  TYR T CD2 1 
ATOM   7206  C CE1 . TYR B 2 28  ? 18.248  100.272 -19.883 1.00 98.05  ? 28  TYR T CE1 1 
ATOM   7207  C CE2 . TYR B 2 28  ? 19.840  102.013 -20.355 1.00 98.05  ? 28  TYR T CE2 1 
ATOM   7208  C CZ  . TYR B 2 28  ? 18.737  101.257 -20.727 1.00 98.05  ? 28  TYR T CZ  1 
ATOM   7209  O OH  . TYR B 2 28  ? 18.126  101.483 -21.938 1.00 98.05  ? 28  TYR T OH  1 
ATOM   7210  N N   . SER B 2 29  ? 22.259  98.528  -14.816 1.00 52.07  ? 29  SER T N   1 
ATOM   7211  C CA  . SER B 2 29  ? 23.532  98.121  -14.241 1.00 52.07  ? 29  SER T CA  1 
ATOM   7212  C C   . SER B 2 29  ? 23.796  96.635  -14.468 1.00 52.07  ? 29  SER T C   1 
ATOM   7213  O O   . SER B 2 29  ? 24.756  96.258  -15.138 1.00 100.00 ? 29  SER T O   1 
ATOM   7214  C CB  . SER B 2 29  ? 23.539  98.414  -12.739 1.00 100.00 ? 29  SER T CB  1 
ATOM   7215  O OG  . SER B 2 29  ? 22.419  97.823  -12.102 1.00 100.00 ? 29  SER T OG  1 
ATOM   7216  N N   . GLN B 2 30  ? 22.923  95.802  -13.908 1.00 80.18  ? 30  GLN T N   1 
ATOM   7217  C CA  . GLN B 2 30  ? 23.031  94.348  -14.000 1.00 80.18  ? 30  GLN T CA  1 
ATOM   7218  C C   . GLN B 2 30  ? 23.349  93.766  -15.372 1.00 80.18  ? 30  GLN T C   1 
ATOM   7219  O O   . GLN B 2 30  ? 23.964  92.703  -15.459 1.00 88.82  ? 30  GLN T O   1 
ATOM   7220  C CB  . GLN B 2 30  ? 21.748  93.698  -13.485 1.00 88.82  ? 30  GLN T CB  1 
ATOM   7221  C CG  . GLN B 2 30  ? 21.158  94.375  -12.267 1.00 88.82  ? 30  GLN T CG  1 
ATOM   7222  C CD  . GLN B 2 30  ? 20.337  93.420  -11.426 1.00 88.82  ? 30  GLN T CD  1 
ATOM   7223  O OE1 . GLN B 2 30  ? 19.114  93.369  -11.539 1.00 88.82  ? 30  GLN T OE1 1 
ATOM   7224  N NE2 . GLN B 2 30  ? 21.010  92.655  -10.578 1.00 88.82  ? 30  GLN T NE2 1 
ATOM   7225  N N   . CYS B 2 31  ? 22.922  94.442  -16.434 1.00 36.87  ? 31  CYS T N   1 
ATOM   7226  C CA  . CYS B 2 31  ? 23.174  93.948  -17.783 1.00 36.87  ? 31  CYS T CA  1 
ATOM   7227  C C   . CYS B 2 31  ? 24.528  93.251  -17.851 1.00 36.87  ? 31  CYS T C   1 
ATOM   7228  O O   . CYS B 2 31  ? 24.619  92.095  -18.258 1.00 22.75  ? 31  CYS T O   1 
ATOM   7229  C CB  . CYS B 2 31  ? 23.135  95.097  -18.794 1.00 22.75  ? 31  CYS T CB  1 
ATOM   7230  S SG  . CYS B 2 31  ? 23.106  94.555  -20.522 1.00 22.75  ? 31  CYS T SG  1 
ATOM   7231  N N   . GLY B 2 32  ? 25.572  93.955  -17.421 1.00 95.18  ? 32  GLY T N   1 
ATOM   7232  C CA  . GLY B 2 32  ? 26.915  93.400  -17.443 1.00 95.18  ? 32  GLY T CA  1 
ATOM   7233  C C   . GLY B 2 32  ? 27.057  92.003  -16.867 1.00 95.18  ? 32  GLY T C   1 
ATOM   7234  O O   . GLY B 2 32  ? 27.465  91.078  -17.572 1.00 5.70   ? 32  GLY T O   1 
ATOM   7235  N N   . ASP B 2 33  ? 26.725  91.844  -15.589 1.00 6.42   ? 33  ASP T N   1 
ATOM   7236  C CA  . ASP B 2 33  ? 26.837  90.551  -14.922 1.00 6.42   ? 33  ASP T CA  1 
ATOM   7237  C C   . ASP B 2 33  ? 25.984  89.465  -15.569 1.00 6.42   ? 33  ASP T C   1 
ATOM   7238  O O   . ASP B 2 33  ? 26.399  88.308  -15.644 1.00 99.72  ? 33  ASP T O   1 
ATOM   7239  C CB  . ASP B 2 33  ? 26.456  90.689  -13.446 1.00 99.72  ? 33  ASP T CB  1 
ATOM   7240  C CG  . ASP B 2 33  ? 27.349  91.664  -12.705 1.00 99.72  ? 33  ASP T CG  1 
ATOM   7241  O OD1 . ASP B 2 33  ? 28.554  91.737  -13.034 1.00 99.72  ? 33  ASP T OD1 1 
ATOM   7242  O OD2 . ASP B 2 33  ? 26.850  92.355  -11.793 1.00 99.72  ? 33  ASP T OD2 1 
ATOM   7243  N N   . VAL B 2 34  ? 24.795  89.836  -16.033 1.00 34.14  ? 34  VAL T N   1 
ATOM   7244  C CA  . VAL B 2 34  ? 23.901  88.877  -16.671 1.00 34.14  ? 34  VAL T CA  1 
ATOM   7245  C C   . VAL B 2 34  ? 24.509  88.378  -17.978 1.00 34.14  ? 34  VAL T C   1 
ATOM   7246  O O   . VAL B 2 34  ? 24.342  87.216  -18.348 1.00 90.36  ? 34  VAL T O   1 
ATOM   7247  C CB  . VAL B 2 34  ? 22.524  89.509  -16.962 1.00 90.36  ? 34  VAL T CB  1 
ATOM   7248  C CG1 . VAL B 2 34  ? 21.612  88.490  -17.631 1.00 90.36  ? 34  VAL T CG1 1 
ATOM   7249  C CG2 . VAL B 2 34  ? 21.902  90.006  -15.670 1.00 90.36  ? 34  VAL T CG2 1 
ATOM   7250  N N   . MET B 2 35  ? 25.213  89.264  -18.673 1.00 37.29  ? 35  MET T N   1 
ATOM   7251  C CA  . MET B 2 35  ? 25.866  88.891  -19.921 1.00 37.29  ? 35  MET T CA  1 
ATOM   7252  C C   . MET B 2 35  ? 26.996  87.947  -19.543 1.00 37.29  ? 35  MET T C   1 
ATOM   7253  O O   . MET B 2 35  ? 27.196  86.910  -20.168 1.00 50.89  ? 35  MET T O   1 
ATOM   7254  C CB  . MET B 2 35  ? 26.434  90.127  -20.621 1.00 50.89  ? 35  MET T CB  1 
ATOM   7255  C CG  . MET B 2 35  ? 25.482  91.305  -20.665 1.00 50.89  ? 35  MET T CG  1 
ATOM   7256  S SD  . MET B 2 35  ? 25.622  92.281  -22.160 1.00 50.89  ? 35  MET T SD  1 
ATOM   7257  C CE  . MET B 2 35  ? 25.373  91.020  -23.394 1.00 50.89  ? 35  MET T CE  1 
ATOM   7258  N N   . ARG B 2 36  ? 27.722  88.323  -18.493 1.00 26.28  ? 36  ARG T N   1 
ATOM   7259  C CA  . ARG B 2 36  ? 28.834  87.527  -17.993 1.00 26.28  ? 36  ARG T CA  1 
ATOM   7260  C C   . ARG B 2 36  ? 28.346  86.149  -17.577 1.00 26.28  ? 36  ARG T C   1 
ATOM   7261  O O   . ARG B 2 36  ? 28.851  85.136  -18.054 1.00 37.61  ? 36  ARG T O   1 
ATOM   7262  C CB  . ARG B 2 36  ? 29.480  88.223  -16.794 1.00 37.61  ? 36  ARG T CB  1 
ATOM   7263  C CG  . ARG B 2 36  ? 30.696  89.057  -17.143 1.00 37.61  ? 36  ARG T CG  1 
ATOM   7264  C CD  . ARG B 2 36  ? 30.578  90.462  -16.582 1.00 37.61  ? 36  ARG T CD  1 
ATOM   7265  N NE  . ARG B 2 36  ? 31.359  91.421  -17.356 1.00 37.61  ? 36  ARG T NE  1 
ATOM   7266  C CZ  . ARG B 2 36  ? 31.448  92.715  -17.068 1.00 37.61  ? 36  ARG T CZ  1 
ATOM   7267  N NH1 . ARG B 2 36  ? 30.802  93.210  -16.021 1.00 37.61  ? 36  ARG T NH1 1 
ATOM   7268  N NH2 . ARG B 2 36  ? 32.183  93.515  -17.827 1.00 37.61  ? 36  ARG T NH2 1 
ATOM   7269  N N   . ALA B 2 37  ? 27.363  86.124  -16.682 1.00 15.55  ? 37  ALA T N   1 
ATOM   7270  C CA  . ALA B 2 37  ? 26.792  84.875  -16.192 1.00 15.55  ? 37  ALA T CA  1 
ATOM   7271  C C   . ALA B 2 37  ? 26.452  83.953  -17.356 1.00 15.55  ? 37  ALA T C   1 
ATOM   7272  O O   . ALA B 2 37  ? 26.540  82.732  -17.237 1.00 27.31  ? 37  ALA T O   1 
ATOM   7273  C CB  . ALA B 2 37  ? 25.546  85.163  -15.367 1.00 27.31  ? 37  ALA T CB  1 
ATOM   7274  N N   . LEU B 2 38  ? 26.063  84.548  -18.478 1.00 2.00   ? 38  LEU T N   1 
ATOM   7275  C CA  . LEU B 2 38  ? 25.721  83.782  -19.671 1.00 2.00   ? 38  LEU T CA  1 
ATOM   7276  C C   . LEU B 2 38  ? 27.000  83.419  -20.412 1.00 2.00   ? 38  LEU T C   1 
ATOM   7277  O O   . LEU B 2 38  ? 26.977  83.091  -21.599 1.00 40.79  ? 38  LEU T O   1 
ATOM   7278  C CB  . LEU B 2 38  ? 24.808  84.601  -20.589 1.00 40.79  ? 38  LEU T CB  1 
ATOM   7279  C CG  . LEU B 2 38  ? 23.358  84.836  -20.147 1.00 40.79  ? 38  LEU T CG  1 
ATOM   7280  C CD1 . LEU B 2 38  ? 22.443  84.775  -21.359 1.00 40.79  ? 38  LEU T CD1 1 
ATOM   7281  C CD2 . LEU B 2 38  ? 22.945  83.796  -19.120 1.00 40.79  ? 38  LEU T CD2 1 
ATOM   7282  N N   . GLY B 2 39  ? 28.118  83.486  -19.698 1.00 83.69  ? 39  GLY T N   1 
ATOM   7283  C CA  . GLY B 2 39  ? 29.402  83.162  -20.287 1.00 83.69  ? 39  GLY T CA  1 
ATOM   7284  C C   . GLY B 2 39  ? 29.964  84.246  -21.185 1.00 83.69  ? 39  GLY T C   1 
ATOM   7285  O O   . GLY B 2 39  ? 30.700  83.950  -22.126 1.00 2.00   ? 39  GLY T O   1 
ATOM   7286  N N   . GLN B 2 40  ? 29.625  85.501  -20.910 1.00 83.22  ? 40  GLN T N   1 
ATOM   7287  C CA  . GLN B 2 40  ? 30.130  86.596  -21.726 1.00 83.22  ? 40  GLN T CA  1 
ATOM   7288  C C   . GLN B 2 40  ? 31.180  87.417  -20.992 1.00 83.22  ? 40  GLN T C   1 
ATOM   7289  O O   . GLN B 2 40  ? 31.080  87.637  -19.785 1.00 95.94  ? 40  GLN T O   1 
ATOM   7290  C CB  . GLN B 2 40  ? 28.990  87.510  -22.176 1.00 95.94  ? 40  GLN T CB  1 
ATOM   7291  C CG  . GLN B 2 40  ? 28.944  87.737  -23.678 1.00 95.94  ? 40  GLN T CG  1 
ATOM   7292  C CD  . GLN B 2 40  ? 29.648  86.637  -24.448 1.00 95.94  ? 40  GLN T CD  1 
ATOM   7293  O OE1 . GLN B 2 40  ? 30.860  86.686  -24.660 1.00 95.94  ? 40  GLN T OE1 1 
ATOM   7294  N NE2 . GLN B 2 40  ? 28.889  85.631  -24.868 1.00 95.94  ? 40  GLN T NE2 1 
ATOM   7295  N N   . ASN B 2 41  ? 32.183  87.868  -21.732 1.00 36.24  ? 41  ASN T N   1 
ATOM   7296  C CA  . ASN B 2 41  ? 33.253  88.667  -21.156 1.00 36.24  ? 41  ASN T CA  1 
ATOM   7297  C C   . ASN B 2 41  ? 33.310  90.052  -21.800 1.00 36.24  ? 41  ASN T C   1 
ATOM   7298  O O   . ASN B 2 41  ? 34.382  90.520  -22.189 1.00 49.62  ? 41  ASN T O   1 
ATOM   7299  C CB  . ASN B 2 41  ? 34.592  87.952  -21.333 1.00 49.62  ? 41  ASN T CB  1 
ATOM   7300  C CG  . ASN B 2 41  ? 34.516  86.489  -20.957 1.00 49.62  ? 41  ASN T CG  1 
ATOM   7301  O OD1 . ASN B 2 41  ? 34.173  86.143  -19.826 1.00 49.62  ? 41  ASN T OD1 1 
ATOM   7302  N ND2 . ASN B 2 41  ? 34.835  85.611  -21.903 1.00 49.62  ? 41  ASN T ND2 1 
ATOM   7303  N N   . PRO B 2 42  ? 32.162  90.726  -21.912 1.00 2.00   ? 42  PRO T N   1 
ATOM   7304  C CA  . PRO B 2 42  ? 32.175  92.058  -22.525 1.00 2.00   ? 42  PRO T CA  1 
ATOM   7305  C C   . PRO B 2 42  ? 32.951  93.043  -21.661 1.00 2.00   ? 42  PRO T C   1 
ATOM   7306  O O   . PRO B 2 42  ? 32.777  93.077  -20.444 1.00 75.79  ? 42  PRO T O   1 
ATOM   7307  C CB  . PRO B 2 42  ? 30.702  92.449  -22.652 1.00 75.79  ? 42  PRO T CB  1 
ATOM   7308  C CG  . PRO B 2 42  ? 29.920  91.415  -21.939 1.00 75.79  ? 42  PRO T CG  1 
ATOM   7309  C CD  . PRO B 2 42  ? 30.813  90.322  -21.464 1.00 75.79  ? 42  PRO T CD  1 
ATOM   7310  N N   . THR B 2 43  ? 33.819  93.831  -22.286 1.00 21.87  ? 43  THR T N   1 
ATOM   7311  C CA  . THR B 2 43  ? 34.590  94.821  -21.544 1.00 21.87  ? 43  THR T CA  1 
ATOM   7312  C C   . THR B 2 43  ? 33.587  95.844  -21.035 1.00 21.87  ? 43  THR T C   1 
ATOM   7313  O O   . THR B 2 43  ? 32.424  95.815  -21.422 1.00 20.41  ? 43  THR T O   1 
ATOM   7314  C CB  . THR B 2 43  ? 35.631  95.522  -22.441 1.00 20.41  ? 43  THR T CB  1 
ATOM   7315  O OG1 . THR B 2 43  ? 35.105  96.774  -22.899 1.00 20.41  ? 43  THR T OG1 1 
ATOM   7316  C CG2 . THR B 2 43  ? 35.983  94.652  -23.637 1.00 20.41  ? 43  THR T CG2 1 
ATOM   7317  N N   . ASN B 2 44  ? 34.030  96.749  -20.170 1.00 37.85  ? 44  ASN T N   1 
ATOM   7318  C CA  . ASN B 2 44  ? 33.136  97.758  -19.613 1.00 37.85  ? 44  ASN T CA  1 
ATOM   7319  C C   . ASN B 2 44  ? 32.534  98.690  -20.661 1.00 37.85  ? 44  ASN T C   1 
ATOM   7320  O O   . ASN B 2 44  ? 31.420  99.188  -20.488 1.00 93.54  ? 44  ASN T O   1 
ATOM   7321  C CB  . ASN B 2 44  ? 33.870  98.581  -18.554 1.00 93.54  ? 44  ASN T CB  1 
ATOM   7322  C CG  . ASN B 2 44  ? 33.823  97.938  -17.187 1.00 93.54  ? 44  ASN T CG  1 
ATOM   7323  O OD1 . ASN B 2 44  ? 32.780  97.443  -16.755 1.00 93.54  ? 44  ASN T OD1 1 
ATOM   7324  N ND2 . ASN B 2 44  ? 34.953  97.936  -16.492 1.00 93.54  ? 44  ASN T ND2 1 
ATOM   7325  N N   . ALA B 2 45  ? 33.269  98.927  -21.743 1.00 58.44  ? 45  ALA T N   1 
ATOM   7326  C CA  . ALA B 2 45  ? 32.798  99.808  -22.807 1.00 58.44  ? 45  ALA T CA  1 
ATOM   7327  C C   . ALA B 2 45  ? 31.780  99.102  -23.697 1.00 58.44  ? 45  ALA T C   1 
ATOM   7328  O O   . ALA B 2 45  ? 30.736  99.666  -24.030 1.00 42.19  ? 45  ALA T O   1 
ATOM   7329  C CB  . ALA B 2 45  ? 33.975  100.287 -23.643 1.00 42.19  ? 45  ALA T CB  1 
ATOM   7330  N N   . GLU B 2 46  ? 32.095  97.868  -24.076 1.00 2.00   ? 46  GLU T N   1 
ATOM   7331  C CA  . GLU B 2 46  ? 31.218  97.075  -24.929 1.00 2.00   ? 46  GLU T CA  1 
ATOM   7332  C C   . GLU B 2 46  ? 29.816  96.977  -24.340 1.00 2.00   ? 46  GLU T C   1 
ATOM   7333  O O   . GLU B 2 46  ? 28.857  96.688  -25.056 1.00 100.00 ? 46  GLU T O   1 
ATOM   7334  C CB  . GLU B 2 46  ? 31.787  95.665  -25.107 1.00 100.00 ? 46  GLU T CB  1 
ATOM   7335  C CG  . GLU B 2 46  ? 33.038  95.595  -25.964 1.00 100.00 ? 46  GLU T CG  1 
ATOM   7336  C CD  . GLU B 2 46  ? 33.764  94.272  -25.819 1.00 100.00 ? 46  GLU T CD  1 
ATOM   7337  O OE1 . GLU B 2 46  ? 33.417  93.496  -24.902 1.00 100.00 ? 46  GLU T OE1 1 
ATOM   7338  O OE2 . GLU B 2 46  ? 34.684  94.007  -26.623 1.00 100.00 ? 46  GLU T OE2 1 
ATOM   7339  N N   . VAL B 2 47  ? 29.700  97.222  -23.040 1.00 57.24  ? 47  VAL T N   1 
ATOM   7340  C CA  . VAL B 2 47  ? 28.416  97.154  -22.353 1.00 57.24  ? 47  VAL T CA  1 
ATOM   7341  C C   . VAL B 2 47  ? 27.671  98.484  -22.390 1.00 57.24  ? 47  VAL T C   1 
ATOM   7342  O O   . VAL B 2 47  ? 26.454  98.517  -22.576 1.00 78.95  ? 47  VAL T O   1 
ATOM   7343  C CB  . VAL B 2 47  ? 28.594  96.738  -20.881 1.00 78.95  ? 47  VAL T CB  1 
ATOM   7344  C CG1 . VAL B 2 47  ? 27.335  96.057  -20.376 1.00 78.95  ? 47  VAL T CG1 1 
ATOM   7345  C CG2 . VAL B 2 47  ? 29.778  95.804  -20.745 1.00 78.95  ? 47  VAL T CG2 1 
ATOM   7346  N N   . MET B 2 48  ? 28.405  99.578  -22.206 1.00 2.00   ? 48  MET T N   1 
ATOM   7347  C CA  . MET B 2 48  ? 27.802  100.905 -22.221 1.00 2.00   ? 48  MET T CA  1 
ATOM   7348  C C   . MET B 2 48  ? 27.379  101.271 -23.637 1.00 2.00   ? 48  MET T C   1 
ATOM   7349  O O   . MET B 2 48  ? 26.310  101.847 -23.848 1.00 58.68  ? 48  MET T O   1 
ATOM   7350  C CB  . MET B 2 48  ? 28.799  101.944 -21.699 1.00 58.68  ? 48  MET T CB  1 
ATOM   7351  C CG  . MET B 2 48  ? 28.193  102.951 -20.736 1.00 58.68  ? 48  MET T CG  1 
ATOM   7352  S SD  . MET B 2 48  ? 27.425  102.164 -19.309 1.00 58.68  ? 48  MET T SD  1 
ATOM   7353  C CE  . MET B 2 48  ? 28.805  102.111 -18.175 1.00 58.68  ? 48  MET T CE  1 
ATOM   7354  N N   . LYS B 2 49  ? 28.223  100.929 -24.604 1.00 29.83  ? 49  LYS T N   1 
ATOM   7355  C CA  . LYS B 2 49  ? 27.949  101.207 -26.007 1.00 29.83  ? 49  LYS T CA  1 
ATOM   7356  C C   . LYS B 2 49  ? 26.557  100.710 -26.390 1.00 29.83  ? 49  LYS T C   1 
ATOM   7357  O O   . LYS B 2 49  ? 25.837  101.374 -27.135 1.00 74.18  ? 49  LYS T O   1 
ATOM   7358  C CB  . LYS B 2 49  ? 29.009  100.538 -26.888 1.00 74.18  ? 49  LYS T CB  1 
ATOM   7359  C CG  . LYS B 2 49  ? 28.562  100.256 -28.315 1.00 74.18  ? 49  LYS T CG  1 
ATOM   7360  C CD  . LYS B 2 49  ? 29.458  100.956 -29.322 1.00 74.18  ? 49  LYS T CD  1 
ATOM   7361  C CE  . LYS B 2 49  ? 30.535  100.021 -29.849 1.00 74.18  ? 49  LYS T CE  1 
ATOM   7362  N NZ  . LYS B 2 49  ? 31.539  100.747 -30.677 1.00 74.18  ? 49  LYS T NZ  1 
ATOM   7363  N N   . VAL B 2 50  ? 26.188  99.541  -25.874 1.00 84.14  ? 50  VAL T N   1 
ATOM   7364  C CA  . VAL B 2 50  ? 24.881  98.959  -26.157 1.00 84.14  ? 50  VAL T CA  1 
ATOM   7365  C C   . VAL B 2 50  ? 23.897  99.301  -25.049 1.00 84.14  ? 50  VAL T C   1 
ATOM   7366  O O   . VAL B 2 50  ? 22.954  98.559  -24.784 1.00 46.41  ? 50  VAL T O   1 
ATOM   7367  C CB  . VAL B 2 50  ? 24.949  97.421  -26.283 1.00 46.41  ? 50  VAL T CB  1 
ATOM   7368  C CG1 . VAL B 2 50  ? 24.368  96.986  -27.614 1.00 46.41  ? 50  VAL T CG1 1 
ATOM   7369  C CG2 . VAL B 2 50  ? 26.378  96.948  -26.150 1.00 46.41  ? 50  VAL T CG2 1 
ATOM   7370  N N   . LEU B 2 51  ? 24.132  100.434 -24.399 1.00 28.49  ? 51  LEU T N   1 
ATOM   7371  C CA  . LEU B 2 51  ? 23.268  100.904 -23.325 1.00 28.49  ? 51  LEU T CA  1 
ATOM   7372  C C   . LEU B 2 51  ? 22.984  102.375 -23.578 1.00 28.49  ? 51  LEU T C   1 
ATOM   7373  O O   . LEU B 2 51  ? 22.309  103.037 -22.788 1.00 72.54  ? 51  LEU T O   1 
ATOM   7374  C CB  . LEU B 2 51  ? 23.954  100.725 -21.969 1.00 72.54  ? 51  LEU T CB  1 
ATOM   7375  C CG  . LEU B 2 51  ? 23.586  99.504  -21.114 1.00 72.54  ? 51  LEU T CG  1 
ATOM   7376  C CD1 . LEU B 2 51  ? 23.211  99.976  -19.722 1.00 72.54  ? 51  LEU T CD1 1 
ATOM   7377  C CD2 . LEU B 2 51  ? 22.434  98.729  -21.742 1.00 72.54  ? 51  LEU T CD2 1 
ATOM   7378  N N   . GLY B 2 52  ? 23.507  102.874 -24.691 1.00 74.07  ? 52  GLY T N   1 
ATOM   7379  C CA  . GLY B 2 52  ? 23.312  104.266 -25.044 1.00 74.07  ? 52  GLY T CA  1 
ATOM   7380  C C   . GLY B 2 52  ? 24.100  105.185 -24.136 1.00 74.07  ? 52  GLY T C   1 
ATOM   7381  O O   . GLY B 2 52  ? 23.758  106.355 -23.979 1.00 63.27  ? 52  GLY T O   1 
ATOM   7382  N N   . ASN B 2 53  ? 25.159  104.652 -23.535 1.00 44.78  ? 53  ASN T N   1 
ATOM   7383  C CA  . ASN B 2 53  ? 26.010  105.423 -22.637 1.00 44.78  ? 53  ASN T CA  1 
ATOM   7384  C C   . ASN B 2 53  ? 25.192  106.265 -21.663 1.00 44.78  ? 53  ASN T C   1 
ATOM   7385  O O   . ASN B 2 53  ? 25.169  107.492 -21.754 1.00 91.72  ? 53  ASN T O   1 
ATOM   7386  C CB  . ASN B 2 53  ? 26.937  106.332 -23.446 1.00 91.72  ? 53  ASN T CB  1 
ATOM   7387  C CG  . ASN B 2 53  ? 27.400  105.688 -24.737 1.00 91.72  ? 53  ASN T CG  1 
ATOM   7388  O OD1 . ASN B 2 53  ? 28.457  105.059 -24.787 1.00 91.72  ? 53  ASN T OD1 1 
ATOM   7389  N ND2 . ASN B 2 53  ? 26.610  105.843 -25.794 1.00 91.72  ? 53  ASN T ND2 1 
ATOM   7390  N N   . PRO B 2 54  ? 24.497  105.610 -20.719 1.00 69.89  ? 54  PRO T N   1 
ATOM   7391  C CA  . PRO B 2 54  ? 23.683  106.332 -19.735 1.00 69.89  ? 54  PRO T CA  1 
ATOM   7392  C C   . PRO B 2 54  ? 24.571  107.055 -18.725 1.00 69.89  ? 54  PRO T C   1 
ATOM   7393  O O   . PRO B 2 54  ? 25.736  107.334 -19.004 1.00 46.53  ? 54  PRO T O   1 
ATOM   7394  C CB  . PRO B 2 54  ? 22.841  105.230 -19.078 1.00 46.53  ? 54  PRO T CB  1 
ATOM   7395  C CG  . PRO B 2 54  ? 23.077  103.983 -19.899 1.00 46.53  ? 54  PRO T CG  1 
ATOM   7396  C CD  . PRO B 2 54  ? 24.421  104.154 -20.526 1.00 46.53  ? 54  PRO T CD  1 
ATOM   7397  N N   . LYS B 2 55  ? 24.019  107.357 -17.555 1.00 18.39  ? 55  LYS T N   1 
ATOM   7398  C CA  . LYS B 2 55  ? 24.779  108.038 -16.516 1.00 18.39  ? 55  LYS T CA  1 
ATOM   7399  C C   . LYS B 2 55  ? 24.497  107.428 -15.151 1.00 18.39  ? 55  LYS T C   1 
ATOM   7400  O O   . LYS B 2 55  ? 23.343  107.233 -14.779 1.00 100.00 ? 55  LYS T O   1 
ATOM   7401  C CB  . LYS B 2 55  ? 24.442  109.532 -16.492 1.00 100.00 ? 55  LYS T CB  1 
ATOM   7402  C CG  . LYS B 2 55  ? 25.572  110.435 -16.959 1.00 100.00 ? 55  LYS T CG  1 
ATOM   7403  C CD  . LYS B 2 55  ? 26.633  110.586 -15.881 1.00 100.00 ? 55  LYS T CD  1 
ATOM   7404  C CE  . LYS B 2 55  ? 26.766  112.034 -15.435 1.00 100.00 ? 55  LYS T CE  1 
ATOM   7405  N NZ  . LYS B 2 55  ? 25.490  112.559 -14.872 1.00 100.00 ? 55  LYS T NZ  1 
ATOM   7406  N N   . SER B 2 56  ? 25.569  107.124 -14.422 1.00 100.00 ? 56  SER T N   1 
ATOM   7407  C CA  . SER B 2 56  ? 25.495  106.535 -13.086 1.00 100.00 ? 56  SER T CA  1 
ATOM   7408  C C   . SER B 2 56  ? 24.096  106.566 -12.480 1.00 100.00 ? 56  SER T C   1 
ATOM   7409  O O   . SER B 2 56  ? 23.492  105.522 -12.232 1.00 86.48  ? 56  SER T O   1 
ATOM   7410  C CB  . SER B 2 56  ? 26.465  107.260 -12.154 1.00 86.48  ? 56  SER T CB  1 
ATOM   7411  O OG  . SER B 2 56  ? 26.397  108.662 -12.347 1.00 86.48  ? 56  SER T OG  1 
ATOM   7412  N N   . ASP B 2 57  ? 23.592  107.772 -12.243 1.00 100.00 ? 57  ASP T N   1 
ATOM   7413  C CA  . ASP B 2 57  ? 22.267  107.959 -11.662 1.00 100.00 ? 57  ASP T CA  1 
ATOM   7414  C C   . ASP B 2 57  ? 21.205  107.132 -12.385 1.00 100.00 ? 57  ASP T C   1 
ATOM   7415  O O   . ASP B 2 57  ? 20.589  106.249 -11.790 1.00 100.00 ? 57  ASP T O   1 
ATOM   7416  C CB  . ASP B 2 57  ? 21.880  109.441 -11.698 1.00 100.00 ? 57  ASP T CB  1 
ATOM   7417  C CG  . ASP B 2 57  ? 22.579  110.205 -12.810 1.00 100.00 ? 57  ASP T CG  1 
ATOM   7418  O OD1 . ASP B 2 57  ? 23.826  110.175 -12.870 1.00 100.00 ? 57  ASP T OD1 1 
ATOM   7419  O OD2 . ASP B 2 57  ? 21.878  110.844 -13.623 1.00 100.00 ? 57  ASP T OD2 1 
ATOM   7420  N N   . GLU B 2 58  ? 21.004  107.423 -13.665 1.00 60.99  ? 58  GLU T N   1 
ATOM   7421  C CA  . GLU B 2 58  ? 20.014  106.713 -14.467 1.00 60.99  ? 58  GLU T CA  1 
ATOM   7422  C C   . GLU B 2 58  ? 20.392  105.253 -14.692 1.00 60.99  ? 58  GLU T C   1 
ATOM   7423  O O   . GLU B 2 58  ? 19.584  104.465 -15.183 1.00 95.81  ? 58  GLU T O   1 
ATOM   7424  C CB  . GLU B 2 58  ? 19.832  107.409 -15.816 1.00 95.81  ? 58  GLU T CB  1 
ATOM   7425  C CG  . GLU B 2 58  ? 21.120  107.609 -16.590 1.00 95.81  ? 58  GLU T CG  1 
ATOM   7426  C CD  . GLU B 2 58  ? 21.456  109.071 -16.783 1.00 95.81  ? 58  GLU T CD  1 
ATOM   7427  O OE1 . GLU B 2 58  ? 21.280  109.854 -15.828 1.00 95.81  ? 58  GLU T OE1 1 
ATOM   7428  O OE2 . GLU B 2 58  ? 21.897  109.443 -17.892 1.00 95.81  ? 58  GLU T OE2 1 
ATOM   7429  N N   . MET B 2 59  ? 21.622  104.896 -14.339 1.00 78.78  ? 59  MET T N   1 
ATOM   7430  C CA  . MET B 2 59  ? 22.089  103.527 -14.505 1.00 78.78  ? 59  MET T CA  1 
ATOM   7431  C C   . MET B 2 59  ? 21.582  102.665 -13.355 1.00 78.78  ? 59  MET T C   1 
ATOM   7432  O O   . MET B 2 59  ? 21.721  101.442 -13.371 1.00 100.00 ? 59  MET T O   1 
ATOM   7433  C CB  . MET B 2 59  ? 23.617  103.488 -14.554 1.00 100.00 ? 59  MET T CB  1 
ATOM   7434  C CG  . MET B 2 59  ? 24.193  103.775 -15.930 1.00 100.00 ? 59  MET T CG  1 
ATOM   7435  S SD  . MET B 2 59  ? 24.921  102.316 -16.695 1.00 100.00 ? 59  MET T SD  1 
ATOM   7436  C CE  . MET B 2 59  ? 26.488  102.252 -15.847 1.00 100.00 ? 59  MET T CE  1 
ATOM   7437  N N   . ASN B 2 60  ? 20.992  103.316 -12.355 1.00 59.24  ? 60  ASN T N   1 
ATOM   7438  C CA  . ASN B 2 60  ? 20.454  102.617 -11.198 1.00 59.24  ? 60  ASN T CA  1 
ATOM   7439  C C   . ASN B 2 60  ? 18.937  102.762 -11.161 1.00 59.24  ? 60  ASN T C   1 
ATOM   7440  O O   . ASN B 2 60  ? 18.274  102.261 -10.250 1.00 100.00 ? 60  ASN T O   1 
ATOM   7441  C CB  . ASN B 2 60  ? 21.061  103.178 -9.909  1.00 100.00 ? 60  ASN T CB  1 
ATOM   7442  C CG  . ASN B 2 60  ? 21.493  102.089 -8.947  1.00 100.00 ? 60  ASN T CG  1 
ATOM   7443  O OD1 . ASN B 2 60  ? 21.409  102.248 -7.730  1.00 100.00 ? 60  ASN T OD1 1 
ATOM   7444  N ND2 . ASN B 2 60  ? 21.961  100.971 -9.493  1.00 100.00 ? 60  ASN T ND2 1 
ATOM   7445  N N   . LEU B 2 61  ? 18.390  103.455 -12.157 1.00 56.26  ? 61  LEU T N   1 
ATOM   7446  C CA  . LEU B 2 61  ? 16.951  103.663 -12.255 1.00 56.26  ? 61  LEU T CA  1 
ATOM   7447  C C   . LEU B 2 61  ? 16.381  102.890 -13.442 1.00 56.26  ? 61  LEU T C   1 
ATOM   7448  O O   . LEU B 2 61  ? 15.404  102.153 -13.306 1.00 94.42  ? 61  LEU T O   1 
ATOM   7449  C CB  . LEU B 2 61  ? 16.631  105.152 -12.421 1.00 94.42  ? 61  LEU T CB  1 
ATOM   7450  C CG  . LEU B 2 61  ? 17.423  106.172 -11.599 1.00 94.42  ? 61  LEU T CG  1 
ATOM   7451  C CD1 . LEU B 2 61  ? 17.467  107.498 -12.342 1.00 94.42  ? 61  LEU T CD1 1 
ATOM   7452  C CD2 . LEU B 2 61  ? 16.778  106.351 -10.233 1.00 94.42  ? 61  LEU T CD2 1 
ATOM   7453  N N   . LYS B 2 62  ? 17.005  103.063 -14.603 1.00 80.20  ? 62  LYS T N   1 
ATOM   7454  C CA  . LYS B 2 62  ? 16.576  102.397 -15.829 1.00 80.20  ? 62  LYS T CA  1 
ATOM   7455  C C   . LYS B 2 62  ? 16.502  100.882 -15.662 1.00 80.20  ? 62  LYS T C   1 
ATOM   7456  O O   . LYS B 2 62  ? 17.287  100.293 -14.919 1.00 100.00 ? 62  LYS T O   1 
ATOM   7457  C CB  . LYS B 2 62  ? 17.531  102.745 -16.973 1.00 100.00 ? 62  LYS T CB  1 
ATOM   7458  C CG  . LYS B 2 62  ? 17.340  104.147 -17.531 1.00 100.00 ? 62  LYS T CG  1 
ATOM   7459  C CD  . LYS B 2 62  ? 16.303  104.161 -18.641 1.00 100.00 ? 62  LYS T CD  1 
ATOM   7460  C CE  . LYS B 2 62  ? 16.870  104.755 -19.922 1.00 100.00 ? 62  LYS T CE  1 
ATOM   7461  N NZ  . LYS B 2 62  ? 15.799  105.111 -20.892 1.00 100.00 ? 62  LYS T NZ  1 
ATOM   7462  N N   . THR B 2 63  ? 15.564  100.251 -16.365 1.00 36.34  ? 63  THR T N   1 
ATOM   7463  C CA  . THR B 2 63  ? 15.386  98.804  -16.279 1.00 36.34  ? 63  THR T CA  1 
ATOM   7464  C C   . THR B 2 63  ? 15.414  98.100  -17.633 1.00 36.34  ? 63  THR T C   1 
ATOM   7465  O O   . THR B 2 63  ? 15.458  98.745  -18.681 1.00 96.28  ? 63  THR T O   1 
ATOM   7466  C CB  . THR B 2 63  ? 14.061  98.454  -15.579 1.00 96.28  ? 63  THR T CB  1 
ATOM   7467  O OG1 . THR B 2 63  ? 12.963  98.940  -16.361 1.00 96.28  ? 63  THR T OG1 1 
ATOM   7468  C CG2 . THR B 2 63  ? 14.013  99.084  -14.195 1.00 96.28  ? 63  THR T CG2 1 
ATOM   7469  N N   . LEU B 2 64  ? 15.373  96.770  -17.597 1.00 34.30  ? 64  LEU T N   1 
ATOM   7470  C CA  . LEU B 2 64  ? 15.410  95.973  -18.814 1.00 34.30  ? 64  LEU T CA  1 
ATOM   7471  C C   . LEU B 2 64  ? 14.494  94.756  -18.789 1.00 34.30  ? 64  LEU T C   1 
ATOM   7472  O O   . LEU B 2 64  ? 14.253  94.160  -17.740 1.00 100.00 ? 64  LEU T O   1 
ATOM   7473  C CB  . LEU B 2 64  ? 16.844  95.509  -19.079 1.00 100.00 ? 64  LEU T CB  1 
ATOM   7474  C CG  . LEU B 2 64  ? 17.618  96.281  -20.146 1.00 100.00 ? 64  LEU T CG  1 
ATOM   7475  C CD1 . LEU B 2 64  ? 19.110  96.079  -19.947 1.00 100.00 ? 64  LEU T CD1 1 
ATOM   7476  C CD2 . LEU B 2 64  ? 17.187  95.800  -21.518 1.00 100.00 ? 64  LEU T CD2 1 
ATOM   7477  N N   . LYS B 2 65  ? 13.993  94.390  -19.965 1.00 54.09  ? 65  LYS T N   1 
ATOM   7478  C CA  . LYS B 2 65  ? 13.122  93.232  -20.127 1.00 54.09  ? 65  LYS T CA  1 
ATOM   7479  C C   . LYS B 2 65  ? 13.819  92.318  -21.127 1.00 54.09  ? 65  LYS T C   1 
ATOM   7480  O O   . LYS B 2 65  ? 14.369  92.789  -22.118 1.00 100.00 ? 65  LYS T O   1 
ATOM   7481  C CB  . LYS B 2 65  ? 11.756  93.671  -20.659 1.00 100.00 ? 65  LYS T CB  1 
ATOM   7482  C CG  . LYS B 2 65  ? 11.003  94.612  -19.727 1.00 100.00 ? 65  LYS T CG  1 
ATOM   7483  C CD  . LYS B 2 65  ? 10.186  95.640  -20.495 1.00 100.00 ? 65  LYS T CD  1 
ATOM   7484  C CE  . LYS B 2 65  ? 9.864   96.849  -19.632 1.00 100.00 ? 65  LYS T CE  1 
ATOM   7485  N NZ  . LYS B 2 65  ? 8.498   97.383  -19.903 1.00 100.00 ? 65  LYS T NZ  1 
ATOM   7486  N N   . PHE B 2 66  ? 13.809  91.012  -20.867 1.00 98.58  ? 66  PHE T N   1 
ATOM   7487  C CA  . PHE B 2 66  ? 14.482  90.066  -21.752 1.00 98.58  ? 66  PHE T CA  1 
ATOM   7488  C C   . PHE B 2 66  ? 14.385  90.396  -23.237 1.00 98.58  ? 66  PHE T C   1 
ATOM   7489  O O   . PHE B 2 66  ? 15.402  90.446  -23.928 1.00 100.00 ? 66  PHE T O   1 
ATOM   7490  C CB  . PHE B 2 66  ? 13.964  88.640  -21.529 1.00 100.00 ? 66  PHE T CB  1 
ATOM   7491  C CG  . PHE B 2 66  ? 14.760  87.593  -22.262 1.00 100.00 ? 66  PHE T CG  1 
ATOM   7492  C CD1 . PHE B 2 66  ? 14.692  87.493  -23.650 1.00 100.00 ? 66  PHE T CD1 1 
ATOM   7493  C CD2 . PHE B 2 66  ? 15.605  86.733  -21.573 1.00 100.00 ? 66  PHE T CD2 1 
ATOM   7494  C CE1 . PHE B 2 66  ? 15.453  86.555  -24.337 1.00 100.00 ? 66  PHE T CE1 1 
ATOM   7495  C CE2 . PHE B 2 66  ? 16.371  85.791  -22.256 1.00 100.00 ? 66  PHE T CE2 1 
ATOM   7496  C CZ  . PHE B 2 66  ? 16.295  85.703  -23.640 1.00 100.00 ? 66  PHE T CZ  1 
ATOM   7497  N N   . GLU B 2 67  ? 13.171  90.616  -23.732 1.00 56.53  ? 67  GLU T N   1 
ATOM   7498  C CA  . GLU B 2 67  ? 12.987  90.917  -25.146 1.00 56.53  ? 67  GLU T CA  1 
ATOM   7499  C C   . GLU B 2 67  ? 13.861  92.064  -25.638 1.00 56.53  ? 67  GLU T C   1 
ATOM   7500  O O   . GLU B 2 67  ? 14.336  92.038  -26.771 1.00 100.00 ? 67  GLU T O   1 
ATOM   7501  C CB  . GLU B 2 67  ? 11.517  91.218  -25.445 1.00 100.00 ? 67  GLU T CB  1 
ATOM   7502  C CG  . GLU B 2 67  ? 10.981  90.510  -26.687 1.00 100.00 ? 67  GLU T CG  1 
ATOM   7503  C CD  . GLU B 2 67  ? 12.064  89.790  -27.477 1.00 100.00 ? 67  GLU T CD  1 
ATOM   7504  O OE1 . GLU B 2 67  ? 12.874  90.473  -28.141 1.00 100.00 ? 67  GLU T OE1 1 
ATOM   7505  O OE2 . GLU B 2 67  ? 12.106  88.542  -27.432 1.00 100.00 ? 67  GLU T OE2 1 
ATOM   7506  N N   . GLN B 2 68  ? 14.069  93.071  -24.797 1.00 51.95  ? 68  GLN T N   1 
ATOM   7507  C CA  . GLN B 2 68  ? 14.906  94.201  -25.182 1.00 51.95  ? 68  GLN T CA  1 
ATOM   7508  C C   . GLN B 2 68  ? 16.357  93.914  -24.811 1.00 51.95  ? 68  GLN T C   1 
ATOM   7509  O O   . GLN B 2 68  ? 17.277  94.560  -25.316 1.00 100.00 ? 68  GLN T O   1 
ATOM   7510  C CB  . GLN B 2 68  ? 14.439  95.490  -24.497 1.00 100.00 ? 68  GLN T CB  1 
ATOM   7511  C CG  . GLN B 2 68  ? 13.720  95.289  -23.175 1.00 100.00 ? 68  GLN T CG  1 
ATOM   7512  C CD  . GLN B 2 68  ? 13.663  96.558  -22.346 1.00 100.00 ? 68  GLN T CD  1 
ATOM   7513  O OE1 . GLN B 2 68  ? 14.685  97.190  -22.086 1.00 100.00 ? 68  GLN T OE1 1 
ATOM   7514  N NE2 . GLN B 2 68  ? 12.461  96.936  -21.928 1.00 100.00 ? 68  GLN T NE2 1 
ATOM   7515  N N   . PHE B 2 69  ? 16.553  92.939  -23.930 1.00 90.00  ? 69  PHE T N   1 
ATOM   7516  C CA  . PHE B 2 69  ? 17.890  92.557  -23.494 1.00 90.00  ? 69  PHE T CA  1 
ATOM   7517  C C   . PHE B 2 69  ? 18.526  91.601  -24.490 1.00 90.00  ? 69  PHE T C   1 
ATOM   7518  O O   . PHE B 2 69  ? 19.678  91.779  -24.887 1.00 55.78  ? 69  PHE T O   1 
ATOM   7519  C CB  . PHE B 2 69  ? 17.831  91.893  -22.117 1.00 55.78  ? 69  PHE T CB  1 
ATOM   7520  C CG  . PHE B 2 69  ? 19.048  91.072  -21.785 1.00 55.78  ? 69  PHE T CG  1 
ATOM   7521  C CD1 . PHE B 2 69  ? 20.183  91.672  -21.249 1.00 55.78  ? 69  PHE T CD1 1 
ATOM   7522  C CD2 . PHE B 2 69  ? 19.058  89.697  -21.999 1.00 55.78  ? 69  PHE T CD2 1 
ATOM   7523  C CE1 . PHE B 2 69  ? 21.310  90.916  -20.933 1.00 55.78  ? 69  PHE T CE1 1 
ATOM   7524  C CE2 . PHE B 2 69  ? 20.178  88.933  -21.688 1.00 55.78  ? 69  PHE T CE2 1 
ATOM   7525  C CZ  . PHE B 2 69  ? 21.307  89.545  -21.151 1.00 55.78  ? 69  PHE T CZ  1 
ATOM   7526  N N   . LEU B 2 70  ? 17.772  90.582  -24.889 1.00 57.80  ? 70  LEU T N   1 
ATOM   7527  C CA  . LEU B 2 70  ? 18.263  89.589  -25.838 1.00 57.80  ? 70  LEU T CA  1 
ATOM   7528  C C   . LEU B 2 70  ? 18.978  90.222  -27.029 1.00 57.80  ? 70  LEU T C   1 
ATOM   7529  O O   . LEU B 2 70  ? 20.079  89.809  -27.385 1.00 79.63  ? 70  LEU T O   1 
ATOM   7530  C CB  . LEU B 2 70  ? 17.116  88.714  -26.346 1.00 79.63  ? 70  LEU T CB  1 
ATOM   7531  C CG  . LEU B 2 70  ? 17.532  87.729  -27.441 1.00 79.63  ? 70  LEU T CG  1 
ATOM   7532  C CD1 . LEU B 2 70  ? 17.650  86.334  -26.856 1.00 79.63  ? 70  LEU T CD1 1 
ATOM   7533  C CD2 . LEU B 2 70  ? 16.521  87.757  -28.575 1.00 79.63  ? 70  LEU T CD2 1 
ATOM   7534  N N   . PRO B 2 71  ? 18.360  91.237  -27.660 1.00 81.06  ? 71  PRO T N   1 
ATOM   7535  C CA  . PRO B 2 71  ? 18.977  91.900  -28.814 1.00 81.06  ? 71  PRO T CA  1 
ATOM   7536  C C   . PRO B 2 71  ? 20.395  92.391  -28.540 1.00 81.06  ? 71  PRO T C   1 
ATOM   7537  O O   . PRO B 2 71  ? 21.182  92.589  -29.464 1.00 49.11  ? 71  PRO T O   1 
ATOM   7538  C CB  . PRO B 2 71  ? 18.022  93.054  -29.131 1.00 49.11  ? 71  PRO T CB  1 
ATOM   7539  C CG  . PRO B 2 71  ? 17.167  93.203  -27.913 1.00 49.11  ? 71  PRO T CG  1 
ATOM   7540  C CD  . PRO B 2 71  ? 17.057  91.835  -27.331 1.00 49.11  ? 71  PRO T CD  1 
ATOM   7541  N N   . MET B 2 72  ? 20.711  92.584  -27.264 1.00 62.57  ? 72  MET T N   1 
ATOM   7542  C CA  . MET B 2 72  ? 22.036  93.046  -26.870 1.00 62.57  ? 72  MET T CA  1 
ATOM   7543  C C   . MET B 2 72  ? 22.951  91.856  -26.622 1.00 62.57  ? 72  MET T C   1 
ATOM   7544  O O   . MET B 2 72  ? 24.105  91.848  -27.052 1.00 47.81  ? 72  MET T O   1 
ATOM   7545  C CB  . MET B 2 72  ? 21.946  93.899  -25.606 1.00 47.81  ? 72  MET T CB  1 
ATOM   7546  C CG  . MET B 2 72  ? 21.145  95.173  -25.784 1.00 47.81  ? 72  MET T CG  1 
ATOM   7547  S SD  . MET B 2 72  ? 21.205  96.219  -24.323 1.00 47.81  ? 72  MET T SD  1 
ATOM   7548  C CE  . MET B 2 72  ? 19.559  96.006  -23.702 1.00 47.81  ? 72  MET T CE  1 
ATOM   7549  N N   . MET B 2 73  ? 22.426  90.856  -25.921 1.00 69.82  ? 73  MET T N   1 
ATOM   7550  C CA  . MET B 2 73  ? 23.184  89.650  -25.615 1.00 69.82  ? 73  MET T CA  1 
ATOM   7551  C C   . MET B 2 73  ? 23.953  89.201  -26.851 1.00 69.82  ? 73  MET T C   1 
ATOM   7552  O O   . MET B 2 73  ? 25.148  88.911  -26.782 1.00 71.47  ? 73  MET T O   1 
ATOM   7553  C CB  . MET B 2 73  ? 22.238  88.535  -25.169 1.00 71.47  ? 73  MET T CB  1 
ATOM   7554  C CG  . MET B 2 73  ? 22.603  87.903  -23.836 1.00 71.47  ? 73  MET T CG  1 
ATOM   7555  S SD  . MET B 2 73  ? 24.311  87.338  -23.775 1.00 71.47  ? 73  MET T SD  1 
ATOM   7556  C CE  . MET B 2 73  ? 24.113  85.616  -24.197 1.00 71.47  ? 73  MET T CE  1 
ATOM   7557  N N   . GLN B 2 74  ? 23.256  89.158  -27.981 1.00 52.77  ? 74  GLN T N   1 
ATOM   7558  C CA  . GLN B 2 74  ? 23.860  88.748  -29.243 1.00 52.77  ? 74  GLN T CA  1 
ATOM   7559  C C   . GLN B 2 74  ? 24.840  89.791  -29.757 1.00 52.77  ? 74  GLN T C   1 
ATOM   7560  O O   . GLN B 2 74  ? 26.022  89.500  -29.921 1.00 100.00 ? 74  GLN T O   1 
ATOM   7561  C CB  . GLN B 2 74  ? 22.777  88.502  -30.296 1.00 100.00 ? 74  GLN T CB  1 
ATOM   7562  C CG  . GLN B 2 74  ? 21.400  88.226  -29.723 1.00 100.00 ? 74  GLN T CG  1 
ATOM   7563  C CD  . GLN B 2 74  ? 20.385  89.277  -30.123 1.00 100.00 ? 74  GLN T CD  1 
ATOM   7564  O OE1 . GLN B 2 74  ? 20.744  90.332  -30.647 1.00 100.00 ? 74  GLN T OE1 1 
ATOM   7565  N NE2 . GLN B 2 74  ? 19.113  88.995  -29.879 1.00 100.00 ? 74  GLN T NE2 1 
ATOM   7566  N N   . THR B 2 75  ? 24.345  91.003  -30.015 1.00 100.00 ? 75  THR T N   1 
ATOM   7567  C CA  . THR B 2 75  ? 25.188  92.084  -30.520 1.00 100.00 ? 75  THR T CA  1 
ATOM   7568  C C   . THR B 2 75  ? 26.576  91.972  -29.906 1.00 100.00 ? 75  THR T C   1 
ATOM   7569  O O   . THR B 2 75  ? 27.584  92.127  -30.595 1.00 68.72  ? 75  THR T O   1 
ATOM   7570  C CB  . THR B 2 75  ? 24.604  93.472  -30.185 1.00 68.72  ? 75  THR T CB  1 
ATOM   7571  O OG1 . THR B 2 75  ? 23.781  93.375  -29.018 1.00 68.72  ? 75  THR T OG1 1 
ATOM   7572  C CG2 . THR B 2 75  ? 23.765  93.988  -31.345 1.00 68.72  ? 75  THR T CG2 1 
ATOM   7573  N N   . ILE B 2 76  ? 26.621  91.698  -28.606 1.00 56.30  ? 76  ILE T N   1 
ATOM   7574  C CA  . ILE B 2 76  ? 27.894  91.526  -27.927 1.00 56.30  ? 76  ILE T CA  1 
ATOM   7575  C C   . ILE B 2 76  ? 28.447  90.196  -28.419 1.00 56.30  ? 76  ILE T C   1 
ATOM   7576  O O   . ILE B 2 76  ? 29.443  90.161  -29.127 1.00 39.58  ? 76  ILE T O   1 
ATOM   7577  C CB  . ILE B 2 76  ? 27.720  91.456  -26.395 1.00 39.58  ? 76  ILE T CB  1 
ATOM   7578  C CG1 . ILE B 2 76  ? 26.922  92.670  -25.905 1.00 39.58  ? 76  ILE T CG1 1 
ATOM   7579  C CG2 . ILE B 2 76  ? 29.092  91.362  -25.729 1.00 39.58  ? 76  ILE T CG2 1 
ATOM   7580  C CD1 . ILE B 2 76  ? 27.430  93.294  -24.615 1.00 39.58  ? 76  ILE T CD1 1 
ATOM   7581  N N   . ALA B 2 77  ? 27.765  89.113  -28.053 1.00 46.65  ? 77  ALA T N   1 
ATOM   7582  C CA  . ALA B 2 77  ? 28.147  87.756  -28.439 1.00 46.65  ? 77  ALA T CA  1 
ATOM   7583  C C   . ALA B 2 77  ? 29.046  87.685  -29.674 1.00 46.65  ? 77  ALA T C   1 
ATOM   7584  O O   . ALA B 2 77  ? 30.038  86.959  -29.684 1.00 45.99  ? 77  ALA T O   1 
ATOM   7585  C CB  . ALA B 2 77  ? 26.894  86.914  -28.663 1.00 45.99  ? 77  ALA T CB  1 
ATOM   7586  N N   . LYS B 2 78  ? 28.692  88.436  -30.714 1.00 32.55  ? 78  LYS T N   1 
ATOM   7587  C CA  . LYS B 2 78  ? 29.478  88.458  -31.946 1.00 32.55  ? 78  LYS T CA  1 
ATOM   7588  C C   . LYS B 2 78  ? 30.438  89.649  -31.937 1.00 32.55  ? 78  LYS T C   1 
ATOM   7589  O O   . LYS B 2 78  ? 30.016  90.788  -32.148 1.00 100.00 ? 78  LYS T O   1 
ATOM   7590  C CB  . LYS B 2 78  ? 28.551  88.553  -33.162 1.00 100.00 ? 78  LYS T CB  1 
ATOM   7591  C CG  . LYS B 2 78  ? 27.069  88.399  -32.839 1.00 100.00 ? 78  LYS T CG  1 
ATOM   7592  C CD  . LYS B 2 78  ? 26.373  89.751  -32.791 1.00 100.00 ? 78  LYS T CD  1 
ATOM   7593  C CE  . LYS B 2 78  ? 24.885  89.616  -33.062 1.00 100.00 ? 78  LYS T CE  1 
ATOM   7594  N NZ  . LYS B 2 78  ? 24.307  90.879  -33.603 1.00 100.00 ? 78  LYS T NZ  1 
ATOM   7595  N N   . ASN B 2 79  ? 31.724  89.387  -31.704 1.00 98.79  ? 79  ASN T N   1 
ATOM   7596  C CA  . ASN B 2 79  ? 32.705  90.468  -31.660 1.00 98.79  ? 79  ASN T CA  1 
ATOM   7597  C C   . ASN B 2 79  ? 33.940  90.253  -32.530 1.00 98.79  ? 79  ASN T C   1 
ATOM   7598  O O   . ASN B 2 79  ? 34.125  89.185  -33.125 1.00 100.00 ? 79  ASN T O   1 
ATOM   7599  C CB  . ASN B 2 79  ? 33.131  90.717  -30.216 1.00 100.00 ? 79  ASN T CB  1 
ATOM   7600  C CG  . ASN B 2 79  ? 31.949  90.924  -29.293 1.00 100.00 ? 79  ASN T CG  1 
ATOM   7601  O OD1 . ASN B 2 79  ? 31.230  91.923  -29.405 1.00 100.00 ? 79  ASN T OD1 1 
ATOM   7602  N ND2 . ASN B 2 79  ? 31.735  89.976  -28.377 1.00 100.00 ? 79  ASN T ND2 1 
ATOM   7603  N N   . LYS B 2 80  ? 34.784  91.281  -32.585 1.00 100.00 ? 80  LYS T N   1 
ATOM   7604  C CA  . LYS B 2 80  ? 35.999  91.263  -33.397 1.00 100.00 ? 80  LYS T CA  1 
ATOM   7605  C C   . LYS B 2 80  ? 37.192  90.541  -32.778 1.00 100.00 ? 80  LYS T C   1 
ATOM   7606  O O   . LYS B 2 80  ? 37.923  89.842  -33.484 1.00 70.02  ? 80  LYS T O   1 
ATOM   7607  C CB  . LYS B 2 80  ? 36.428  92.693  -33.743 1.00 70.02  ? 80  LYS T CB  1 
ATOM   7608  C CG  . LYS B 2 80  ? 35.338  93.738  -33.586 1.00 70.02  ? 80  LYS T CG  1 
ATOM   7609  C CD  . LYS B 2 80  ? 35.254  94.239  -32.155 1.00 70.02  ? 80  LYS T CD  1 
ATOM   7610  C CE  . LYS B 2 80  ? 33.992  95.069  -31.938 1.00 70.02  ? 80  LYS T CE  1 
ATOM   7611  N NZ  . LYS B 2 80  ? 34.296  96.470  -31.519 1.00 70.02  ? 80  LYS T NZ  1 
ATOM   7612  N N   . ASP B 2 81  ? 37.395  90.707  -31.470 1.00 100.00 ? 81  ASP T N   1 
ATOM   7613  C CA  . ASP B 2 81  ? 38.539  90.076  -30.814 1.00 100.00 ? 81  ASP T CA  1 
ATOM   7614  C C   . ASP B 2 81  ? 38.277  89.312  -29.520 1.00 100.00 ? 81  ASP T C   1 
ATOM   7615  O O   . ASP B 2 81  ? 37.176  88.827  -29.263 1.00 100.00 ? 81  ASP T O   1 
ATOM   7616  C CB  . ASP B 2 81  ? 39.626  91.131  -30.551 1.00 100.00 ? 81  ASP T CB  1 
ATOM   7617  C CG  . ASP B 2 81  ? 40.678  91.185  -31.661 1.00 100.00 ? 81  ASP T CG  1 
ATOM   7618  O OD1 . ASP B 2 81  ? 40.978  90.121  -32.260 1.00 100.00 ? 81  ASP T OD1 1 
ATOM   7619  O OD2 . ASP B 2 81  ? 41.202  92.293  -31.933 1.00 100.00 ? 81  ASP T OD2 1 
ATOM   7620  N N   . GLN B 2 82  ? 39.343  89.218  -28.728 1.00 97.15  ? 82  GLN T N   1 
ATOM   7621  C CA  . GLN B 2 82  ? 39.366  88.543  -27.437 1.00 97.15  ? 82  GLN T CA  1 
ATOM   7622  C C   . GLN B 2 82  ? 40.830  88.350  -27.011 1.00 97.15  ? 82  GLN T C   1 
ATOM   7623  O O   . GLN B 2 82  ? 41.729  88.281  -27.855 1.00 100.00 ? 82  GLN T O   1 
ATOM   7624  C CB  . GLN B 2 82  ? 38.671  87.177  -27.518 1.00 100.00 ? 82  GLN T CB  1 
ATOM   7625  C CG  . GLN B 2 82  ? 37.664  86.915  -26.390 1.00 100.00 ? 82  GLN T CG  1 
ATOM   7626  C CD  . GLN B 2 82  ? 38.181  85.947  -25.316 1.00 100.00 ? 82  GLN T CD  1 
ATOM   7627  O OE1 . GLN B 2 82  ? 39.388  85.704  -25.195 1.00 100.00 ? 82  GLN T OE1 1 
ATOM   7628  N NE2 . GLN B 2 82  ? 37.260  85.393  -24.535 1.00 100.00 ? 82  GLN T NE2 1 
ATOM   7629  N N   . GLY B 2 83  ? 41.069  88.277  -25.703 1.00 100.00 ? 83  GLY T N   1 
ATOM   7630  C CA  . GLY B 2 83  ? 42.421  88.072  -25.215 1.00 100.00 ? 83  GLY T CA  1 
ATOM   7631  C C   . GLY B 2 83  ? 42.779  86.609  -25.343 1.00 100.00 ? 83  GLY T C   1 
ATOM   7632  O O   . GLY B 2 83  ? 41.990  85.824  -25.873 1.00 38.88  ? 83  GLY T O   1 
ATOM   7633  N N   . CYS B 2 84  ? 43.957  86.232  -24.849 1.00 100.00 ? 84  CYS T N   1 
ATOM   7634  C CA  . CYS B 2 84  ? 44.422  84.847  -24.928 1.00 100.00 ? 84  CYS T CA  1 
ATOM   7635  C C   . CYS B 2 84  ? 45.786  84.697  -24.270 1.00 100.00 ? 84  CYS T C   1 
ATOM   7636  O O   . CYS B 2 84  ? 46.645  85.567  -24.417 1.00 61.55  ? 84  CYS T O   1 
ATOM   7637  C CB  . CYS B 2 84  ? 44.539  84.417  -26.388 1.00 61.55  ? 84  CYS T CB  1 
ATOM   7638  S SG  . CYS B 2 84  ? 45.658  85.468  -27.352 1.00 61.55  ? 84  CYS T SG  1 
ATOM   7639  N N   . PHE B 2 85  ? 45.977  83.592  -23.553 1.00 21.96  ? 85  PHE T N   1 
ATOM   7640  C CA  . PHE B 2 85  ? 47.226  83.289  -22.863 1.00 21.96  ? 85  PHE T CA  1 
ATOM   7641  C C   . PHE B 2 85  ? 48.333  84.023  -23.610 1.00 21.96  ? 85  PHE T C   1 
ATOM   7642  O O   . PHE B 2 85  ? 48.897  85.024  -23.178 1.00 39.35  ? 85  PHE T O   1 
ATOM   7643  C CB  . PHE B 2 85  ? 47.428  81.781  -22.935 1.00 39.35  ? 85  PHE T CB  1 
ATOM   7644  C CG  . PHE B 2 85  ? 48.208  81.231  -21.820 1.00 39.35  ? 85  PHE T CG  1 
ATOM   7645  C CD1 . PHE B 2 85  ? 47.587  80.888  -20.638 1.00 39.35  ? 85  PHE T CD1 1 
ATOM   7646  C CD2 . PHE B 2 85  ? 49.588  81.089  -21.938 1.00 39.35  ? 85  PHE T CD2 1 
ATOM   7647  C CE1 . PHE B 2 85  ? 48.328  80.418  -19.579 1.00 39.35  ? 85  PHE T CE1 1 
ATOM   7648  C CE2 . PHE B 2 85  ? 50.353  80.616  -20.876 1.00 39.35  ? 85  PHE T CE2 1 
ATOM   7649  C CZ  . PHE B 2 85  ? 49.723  80.280  -19.692 1.00 39.35  ? 85  PHE T CZ  1 
ATOM   7650  N N   . GLU B 2 86  ? 48.512  83.567  -24.821 1.00 100.00 ? 86  GLU T N   1 
ATOM   7651  C CA  . GLU B 2 86  ? 49.507  84.087  -25.723 1.00 100.00 ? 86  GLU T CA  1 
ATOM   7652  C C   . GLU B 2 86  ? 49.963  85.519  -25.427 1.00 100.00 ? 86  GLU T C   1 
ATOM   7653  O O   . GLU B 2 86  ? 51.157  85.761  -25.224 1.00 100.00 ? 86  GLU T O   1 
ATOM   7654  C CB  . GLU B 2 86  ? 48.960  83.958  -27.153 1.00 100.00 ? 86  GLU T CB  1 
ATOM   7655  C CG  . GLU B 2 86  ? 48.770  82.493  -27.637 1.00 100.00 ? 86  GLU T CG  1 
ATOM   7656  C CD  . GLU B 2 86  ? 48.105  81.571  -26.601 1.00 100.00 ? 86  GLU T CD  1 
ATOM   7657  O OE1 . GLU B 2 86  ? 46.916  81.797  -26.264 1.00 100.00 ? 86  GLU T OE1 1 
ATOM   7658  O OE2 . GLU B 2 86  ? 48.773  80.616  -26.129 1.00 100.00 ? 86  GLU T OE2 1 
ATOM   7659  N N   . ASP B 2 87  ? 49.013  86.452  -25.388 1.00 47.82  ? 87  ASP T N   1 
ATOM   7660  C CA  . ASP B 2 87  ? 49.325  87.847  -25.127 1.00 47.82  ? 87  ASP T CA  1 
ATOM   7661  C C   . ASP B 2 87  ? 49.007  88.188  -23.682 1.00 47.82  ? 87  ASP T C   1 
ATOM   7662  O O   . ASP B 2 87  ? 49.781  88.868  -23.008 1.00 100.00 ? 87  ASP T O   1 
ATOM   7663  C CB  . ASP B 2 87  ? 48.524  88.764  -26.073 1.00 100.00 ? 87  ASP T CB  1 
ATOM   7664  C CG  . ASP B 2 87  ? 48.677  88.380  -27.551 1.00 100.00 ? 87  ASP T CG  1 
ATOM   7665  O OD1 . ASP B 2 87  ? 49.775  88.575  -28.123 1.00 100.00 ? 87  ASP T OD1 1 
ATOM   7666  O OD2 . ASP B 2 87  ? 47.688  87.887  -28.144 1.00 100.00 ? 87  ASP T OD2 1 
ATOM   7667  N N   . TYR B 2 88  ? 47.866  87.696  -23.207 1.00 38.07  ? 88  TYR T N   1 
ATOM   7668  C CA  . TYR B 2 88  ? 47.421  87.967  -21.841 1.00 38.07  ? 88  TYR T CA  1 
ATOM   7669  C C   . TYR B 2 88  ? 48.572  87.897  -20.874 1.00 38.07  ? 88  TYR T C   1 
ATOM   7670  O O   . TYR B 2 88  ? 48.934  88.889  -20.256 1.00 33.53  ? 88  TYR T O   1 
ATOM   7671  C CB  . TYR B 2 88  ? 46.322  86.986  -21.406 1.00 33.53  ? 88  TYR T CB  1 
ATOM   7672  C CG  . TYR B 2 88  ? 44.919  87.530  -21.594 1.00 33.53  ? 88  TYR T CG  1 
ATOM   7673  C CD1 . TYR B 2 88  ? 44.672  88.897  -21.508 1.00 33.53  ? 88  TYR T CD1 1 
ATOM   7674  C CD2 . TYR B 2 88  ? 43.848  86.689  -21.896 1.00 33.53  ? 88  TYR T CD2 1 
ATOM   7675  C CE1 . TYR B 2 88  ? 43.399  89.419  -21.727 1.00 33.53  ? 88  TYR T CE1 1 
ATOM   7676  C CE2 . TYR B 2 88  ? 42.574  87.195  -22.114 1.00 33.53  ? 88  TYR T CE2 1 
ATOM   7677  C CZ  . TYR B 2 88  ? 42.354  88.570  -22.028 1.00 33.53  ? 88  TYR T CZ  1 
ATOM   7678  O OH  . TYR B 2 88  ? 41.113  89.139  -22.257 1.00 33.53  ? 88  TYR T OH  1 
ATOM   7679  N N   . VAL B 2 89  ? 49.163  86.724  -20.754 1.00 43.97  ? 89  VAL T N   1 
ATOM   7680  C CA  . VAL B 2 89  ? 50.280  86.564  -19.832 1.00 43.97  ? 89  VAL T CA  1 
ATOM   7681  C C   . VAL B 2 89  ? 51.512  87.389  -20.237 1.00 43.97  ? 89  VAL T C   1 
ATOM   7682  O O   . VAL B 2 89  ? 52.251  87.909  -19.381 1.00 2.00   ? 89  VAL T O   1 
ATOM   7683  C CB  . VAL B 2 89  ? 50.666  85.070  -19.704 1.00 2.00   ? 89  VAL T CB  1 
ATOM   7684  C CG1 . VAL B 2 89  ? 49.454  84.208  -20.009 1.00 2.00   ? 89  VAL T CG1 1 
ATOM   7685  C CG2 . VAL B 2 89  ? 51.791  84.742  -20.641 1.00 2.00   ? 89  VAL T CG2 1 
ATOM   7686  N N   . GLU B 2 90  ? 51.723  87.510  -21.543 1.00 2.00   ? 90  GLU T N   1 
ATOM   7687  C CA  . GLU B 2 90  ? 52.846  88.273  -22.067 1.00 2.00   ? 90  GLU T CA  1 
ATOM   7688  C C   . GLU B 2 90  ? 52.929  89.648  -21.412 1.00 2.00   ? 90  GLU T C   1 
ATOM   7689  O O   . GLU B 2 90  ? 53.999  90.242  -21.316 1.00 100.00 ? 90  GLU T O   1 
ATOM   7690  C CB  . GLU B 2 90  ? 52.701  88.424  -23.588 1.00 100.00 ? 90  GLU T CB  1 
ATOM   7691  C CG  . GLU B 2 90  ? 53.171  89.772  -24.168 1.00 100.00 ? 90  GLU T CG  1 
ATOM   7692  C CD  . GLU B 2 90  ? 52.206  90.357  -25.202 1.00 100.00 ? 90  GLU T CD  1 
ATOM   7693  O OE1 . GLU B 2 90  ? 51.031  90.630  -24.839 1.00 100.00 ? 90  GLU T OE1 1 
ATOM   7694  O OE2 . GLU B 2 90  ? 52.625  90.545  -26.375 1.00 100.00 ? 90  GLU T OE2 1 
ATOM   7695  N N   . GLY B 2 91  ? 51.786  90.148  -20.975 1.00 2.00   ? 91  GLY T N   1 
ATOM   7696  C CA  . GLY B 2 91  ? 51.741  91.446  -20.341 1.00 2.00   ? 91  GLY T CA  1 
ATOM   7697  C C   . GLY B 2 91  ? 52.088  91.381  -18.867 1.00 2.00   ? 91  GLY T C   1 
ATOM   7698  O O   . GLY B 2 91  ? 52.799  92.245  -18.353 1.00 71.50  ? 91  GLY T O   1 
ATOM   7699  N N   . LEU B 2 92  ? 51.597  90.357  -18.180 1.00 9.10   ? 92  LEU T N   1 
ATOM   7700  C CA  . LEU B 2 92  ? 51.874  90.226  -16.760 1.00 9.10   ? 92  LEU T CA  1 
ATOM   7701  C C   . LEU B 2 92  ? 53.343  89.883  -16.523 1.00 9.10   ? 92  LEU T C   1 
ATOM   7702  O O   . LEU B 2 92  ? 53.968  90.386  -15.582 1.00 16.06  ? 92  LEU T O   1 
ATOM   7703  C CB  . LEU B 2 92  ? 50.948  89.173  -16.142 1.00 16.06  ? 92  LEU T CB  1 
ATOM   7704  C CG  . LEU B 2 92  ? 49.453  89.474  -16.305 1.00 16.06  ? 92  LEU T CG  1 
ATOM   7705  C CD1 . LEU B 2 92  ? 48.680  88.844  -15.158 1.00 16.06  ? 92  LEU T CD1 1 
ATOM   7706  C CD2 . LEU B 2 92  ? 49.197  91.002  -16.345 1.00 16.06  ? 92  LEU T CD2 1 
ATOM   7707  N N   . ARG B 2 93  ? 53.898  89.059  -17.410 1.00 2.00   ? 93  ARG T N   1 
ATOM   7708  C CA  . ARG B 2 93  ? 55.300  88.644  -17.329 1.00 2.00   ? 93  ARG T CA  1 
ATOM   7709  C C   . ARG B 2 93  ? 56.264  89.823  -17.301 1.00 2.00   ? 93  ARG T C   1 
ATOM   7710  O O   . ARG B 2 93  ? 57.462  89.664  -17.103 1.00 99.54  ? 93  ARG T O   1 
ATOM   7711  C CB  . ARG B 2 93  ? 55.617  87.729  -18.511 1.00 99.54  ? 93  ARG T CB  1 
ATOM   7712  C CG  . ARG B 2 93  ? 57.074  87.692  -18.918 1.00 99.54  ? 93  ARG T CG  1 
ATOM   7713  C CD  . ARG B 2 93  ? 57.558  86.272  -19.209 1.00 99.54  ? 93  ARG T CD  1 
ATOM   7714  N NE  . ARG B 2 93  ? 58.995  86.239  -19.491 1.00 99.54  ? 93  ARG T NE  1 
ATOM   7715  C CZ  . ARG B 2 93  ? 59.798  85.206  -19.231 1.00 99.54  ? 93  ARG T CZ  1 
ATOM   7716  N NH1 . ARG B 2 93  ? 59.306  84.104  -18.673 1.00 99.54  ? 93  ARG T NH1 1 
ATOM   7717  N NH2 . ARG B 2 93  ? 61.096  85.278  -19.528 1.00 99.54  ? 93  ARG T NH2 1 
ATOM   7718  N N   . VAL B 2 94  ? 55.716  91.010  -17.494 1.00 16.52  ? 94  VAL T N   1 
ATOM   7719  C CA  . VAL B 2 94  ? 56.467  92.263  -17.487 1.00 16.52  ? 94  VAL T CA  1 
ATOM   7720  C C   . VAL B 2 94  ? 56.613  92.790  -16.057 1.00 16.52  ? 94  VAL T C   1 
ATOM   7721  O O   . VAL B 2 94  ? 57.291  93.796  -15.809 1.00 10.38  ? 94  VAL T O   1 
ATOM   7722  C CB  . VAL B 2 94  ? 55.722  93.341  -18.306 1.00 10.38  ? 94  VAL T CB  1 
ATOM   7723  C CG1 . VAL B 2 94  ? 56.488  94.668  -18.298 1.00 10.38  ? 94  VAL T CG1 1 
ATOM   7724  C CG2 . VAL B 2 94  ? 55.504  92.839  -19.699 1.00 10.38  ? 94  VAL T CG2 1 
ATOM   7725  N N   . PHE B 2 95  ? 55.950  92.129  -15.123 1.00 23.94  ? 95  PHE T N   1 
ATOM   7726  C CA  . PHE B 2 95  ? 56.004  92.560  -13.751 1.00 23.94  ? 95  PHE T CA  1 
ATOM   7727  C C   . PHE B 2 95  ? 56.735  91.513  -12.934 1.00 23.94  ? 95  PHE T C   1 
ATOM   7728  O O   . PHE B 2 95  ? 56.828  91.595  -11.693 1.00 10.92  ? 95  PHE T O   1 
ATOM   7729  C CB  . PHE B 2 95  ? 54.586  92.774  -13.252 1.00 10.92  ? 95  PHE T CB  1 
ATOM   7730  C CG  . PHE B 2 95  ? 53.890  93.895  -13.931 1.00 10.92  ? 95  PHE T CG  1 
ATOM   7731  C CD1 . PHE B 2 95  ? 54.320  95.198  -13.755 1.00 10.92  ? 95  PHE T CD1 1 
ATOM   7732  C CD2 . PHE B 2 95  ? 52.813  93.656  -14.744 1.00 10.92  ? 95  PHE T CD2 1 
ATOM   7733  C CE1 . PHE B 2 95  ? 53.678  96.254  -14.380 1.00 10.92  ? 95  PHE T CE1 1 
ATOM   7734  C CE2 . PHE B 2 95  ? 52.172  94.698  -15.373 1.00 10.92  ? 95  PHE T CE2 1 
ATOM   7735  C CZ  . PHE B 2 95  ? 52.607  96.008  -15.188 1.00 10.92  ? 95  PHE T CZ  1 
ATOM   7736  N N   . ASP B 2 96  ? 57.284  90.537  -13.648 1.00 17.36  ? 96  ASP T N   1 
ATOM   7737  C CA  . ASP B 2 96  ? 58.029  89.437  -13.041 1.00 17.36  ? 96  ASP T CA  1 
ATOM   7738  C C   . ASP B 2 96  ? 59.426  89.891  -12.613 1.00 17.36  ? 96  ASP T C   1 
ATOM   7739  O O   . ASP B 2 96  ? 60.409  89.601  -13.294 1.00 29.02  ? 96  ASP T O   1 
ATOM   7740  C CB  . ASP B 2 96  ? 58.116  88.307  -14.064 1.00 29.02  ? 96  ASP T CB  1 
ATOM   7741  C CG  . ASP B 2 96  ? 58.964  87.164  -13.599 1.00 29.02  ? 96  ASP T CG  1 
ATOM   7742  O OD1 . ASP B 2 96  ? 59.566  87.282  -12.510 1.00 29.02  ? 96  ASP T OD1 1 
ATOM   7743  O OD2 . ASP B 2 96  ? 59.017  86.153  -14.339 1.00 29.02  ? 96  ASP T OD2 1 
ATOM   7744  N N   . LYS B 2 97  ? 59.497  90.596  -11.479 1.00 6.09   ? 97  LYS T N   1 
ATOM   7745  C CA  . LYS B 2 97  ? 60.745  91.147  -10.932 1.00 6.09   ? 97  LYS T CA  1 
ATOM   7746  C C   . LYS B 2 97  ? 62.057  90.563  -11.459 1.00 6.09   ? 97  LYS T C   1 
ATOM   7747  O O   . LYS B 2 97  ? 62.976  91.319  -11.793 1.00 93.79  ? 97  LYS T O   1 
ATOM   7748  C CB  . LYS B 2 97  ? 60.742  91.055  -9.404  1.00 93.79  ? 97  LYS T CB  1 
ATOM   7749  C CG  . LYS B 2 97  ? 61.868  91.850  -8.737  1.00 93.79  ? 97  LYS T CG  1 
ATOM   7750  C CD  . LYS B 2 97  ? 61.452  92.418  -7.379  1.00 93.79  ? 97  LYS T CD  1 
ATOM   7751  C CE  . LYS B 2 97  ? 62.611  92.428  -6.387  1.00 93.79  ? 97  LYS T CE  1 
ATOM   7752  N NZ  . LYS B 2 97  ? 63.524  93.592  -6.584  1.00 93.79  ? 97  LYS T NZ  1 
ATOM   7753  N N   . GLU B 2 98  ? 62.154  89.235  -11.516 1.00 2.00   ? 98  GLU T N   1 
ATOM   7754  C CA  . GLU B 2 98  ? 63.369  88.601  -12.010 1.00 2.00   ? 98  GLU T CA  1 
ATOM   7755  C C   . GLU B 2 98  ? 63.179  87.245  -12.685 1.00 2.00   ? 98  GLU T C   1 
ATOM   7756  O O   . GLU B 2 98  ? 63.624  86.216  -12.172 1.00 99.64  ? 98  GLU T O   1 
ATOM   7757  C CB  . GLU B 2 98  ? 64.394  88.450  -10.884 1.00 99.64  ? 98  GLU T CB  1 
ATOM   7758  C CG  . GLU B 2 98  ? 64.239  89.429  -9.725  1.00 99.64  ? 98  GLU T CG  1 
ATOM   7759  C CD  . GLU B 2 98  ? 64.280  88.737  -8.363  1.00 99.64  ? 98  GLU T CD  1 
ATOM   7760  O OE1 . GLU B 2 98  ? 64.012  87.514  -8.300  1.00 99.64  ? 98  GLU T OE1 1 
ATOM   7761  O OE2 . GLU B 2 98  ? 64.578  89.421  -7.352  1.00 99.64  ? 98  GLU T OE2 1 
ATOM   7762  N N   . GLY B 2 99  ? 62.538  87.259  -13.851 1.00 100.00 ? 99  GLY T N   1 
ATOM   7763  C CA  . GLY B 2 99  ? 62.304  86.039  -14.612 1.00 100.00 ? 99  GLY T CA  1 
ATOM   7764  C C   . GLY B 2 99  ? 61.956  84.802  -13.813 1.00 100.00 ? 99  GLY T C   1 
ATOM   7765  O O   . GLY B 2 99  ? 62.056  83.692  -14.322 1.00 2.00   ? 99  GLY T O   1 
ATOM   7766  N N   . ASN B 2 100 ? 61.541  84.986  -12.566 1.00 100.00 ? 100 ASN T N   1 
ATOM   7767  C CA  . ASN B 2 100 ? 61.176  83.869  -11.697 1.00 100.00 ? 100 ASN T CA  1 
ATOM   7768  C C   . ASN B 2 100 ? 59.995  83.081  -12.260 1.00 100.00 ? 100 ASN T C   1 
ATOM   7769  O O   . ASN B 2 100 ? 59.898  81.869  -12.080 1.00 96.62  ? 100 ASN T O   1 
ATOM   7770  C CB  . ASN B 2 100 ? 60.818  84.394  -10.296 1.00 96.62  ? 100 ASN T CB  1 
ATOM   7771  C CG  . ASN B 2 100 ? 61.228  85.855  -10.087 1.00 96.62  ? 100 ASN T CG  1 
ATOM   7772  O OD1 . ASN B 2 100 ? 62.412  86.192  -10.150 1.00 96.62  ? 100 ASN T OD1 1 
ATOM   7773  N ND2 . ASN B 2 100 ? 60.248  86.725  -9.833  1.00 96.62  ? 100 ASN T ND2 1 
ATOM   7774  N N   . GLY B 2 101 ? 59.100  83.785  -12.941 1.00 100.00 ? 101 GLY T N   1 
ATOM   7775  C CA  . GLY B 2 101 ? 57.923  83.156  -13.509 1.00 100.00 ? 101 GLY T CA  1 
ATOM   7776  C C   . GLY B 2 101 ? 56.723  83.468  -12.639 1.00 100.00 ? 101 GLY T C   1 
ATOM   7777  O O   . GLY B 2 101 ? 55.598  83.068  -12.935 1.00 11.44  ? 101 GLY T O   1 
ATOM   7778  N N   . THR B 2 102 ? 56.984  84.190  -11.552 1.00 10.88  ? 102 THR T N   1 
ATOM   7779  C CA  . THR B 2 102 ? 55.960  84.595  -10.602 1.00 10.88  ? 102 THR T CA  1 
ATOM   7780  C C   . THR B 2 102 ? 56.032  86.088  -10.257 1.00 10.88  ? 102 THR T C   1 
ATOM   7781  O O   . THR B 2 102 ? 57.108  86.694  -10.284 1.00 86.17  ? 102 THR T O   1 
ATOM   7782  C CB  . THR B 2 102 ? 56.111  83.810  -9.306  1.00 86.17  ? 102 THR T CB  1 
ATOM   7783  O OG1 . THR B 2 102 ? 57.297  84.247  -8.625  1.00 86.17  ? 102 THR T OG1 1 
ATOM   7784  C CG2 . THR B 2 102 ? 56.224  82.325  -9.602  1.00 86.17  ? 102 THR T CG2 1 
ATOM   7785  N N   . VAL B 2 103 ? 54.888  86.674  -9.930  1.00 5.66   ? 103 VAL T N   1 
ATOM   7786  C CA  . VAL B 2 103 ? 54.845  88.076  -9.545  1.00 5.66   ? 103 VAL T CA  1 
ATOM   7787  C C   . VAL B 2 103 ? 54.258  88.179  -8.151  1.00 5.66   ? 103 VAL T C   1 
ATOM   7788  O O   . VAL B 2 103 ? 53.427  87.349  -7.755  1.00 27.11  ? 103 VAL T O   1 
ATOM   7789  C CB  . VAL B 2 103 ? 53.958  88.891  -10.462 1.00 27.11  ? 103 VAL T CB  1 
ATOM   7790  C CG1 . VAL B 2 103 ? 54.437  90.322  -10.476 1.00 27.11  ? 103 VAL T CG1 1 
ATOM   7791  C CG2 . VAL B 2 103 ? 53.954  88.278  -11.837 1.00 27.11  ? 103 VAL T CG2 1 
ATOM   7792  N N   . MET B 2 104 ? 54.672  89.208  -7.416  1.00 19.03  ? 104 MET T N   1 
ATOM   7793  C CA  . MET B 2 104 ? 54.175  89.415  -6.056  1.00 19.03  ? 104 MET T CA  1 
ATOM   7794  C C   . MET B 2 104 ? 52.698  89.783  -6.038  1.00 19.03  ? 104 MET T C   1 
ATOM   7795  O O   . MET B 2 104 ? 52.272  90.739  -6.685  1.00 100.00 ? 104 MET T O   1 
ATOM   7796  C CB  . MET B 2 104 ? 54.986  90.512  -5.356  1.00 100.00 ? 104 MET T CB  1 
ATOM   7797  C CG  . MET B 2 104 ? 56.284  90.892  -6.061  1.00 100.00 ? 104 MET T CG  1 
ATOM   7798  S SD  . MET B 2 104 ? 56.694  92.653  -5.935  1.00 100.00 ? 104 MET T SD  1 
ATOM   7799  C CE  . MET B 2 104 ? 57.477  92.932  -7.550  1.00 100.00 ? 104 MET T CE  1 
ATOM   7800  N N   . GLY B 2 105 ? 51.922  89.015  -5.288  1.00 73.96  ? 105 GLY T N   1 
ATOM   7801  C CA  . GLY B 2 105 ? 50.497  89.262  -5.199  1.00 73.96  ? 105 GLY T CA  1 
ATOM   7802  C C   . GLY B 2 105 ? 50.130  90.672  -4.771  1.00 73.96  ? 105 GLY T C   1 
ATOM   7803  O O   . GLY B 2 105 ? 48.958  90.996  -4.555  1.00 16.35  ? 105 GLY T O   1 
ATOM   7804  N N   . ALA B 2 106 ? 51.137  91.522  -4.647  1.00 17.97  ? 106 ALA T N   1 
ATOM   7805  C CA  . ALA B 2 106 ? 50.891  92.885  -4.237  1.00 17.97  ? 106 ALA T CA  1 
ATOM   7806  C C   . ALA B 2 106 ? 51.067  93.767  -5.453  1.00 17.97  ? 106 ALA T C   1 
ATOM   7807  O O   . ALA B 2 106 ? 50.365  94.761  -5.625  1.00 3.09   ? 106 ALA T O   1 
ATOM   7808  C CB  . ALA B 2 106 ? 51.864  93.279  -3.145  1.00 3.09   ? 106 ALA T CB  1 
ATOM   7809  N N   . GLU B 2 107 ? 52.029  93.398  -6.288  1.00 67.38  ? 107 GLU T N   1 
ATOM   7810  C CA  . GLU B 2 107 ? 52.276  94.146  -7.500  1.00 67.38  ? 107 GLU T CA  1 
ATOM   7811  C C   . GLU B 2 107 ? 51.140  93.801  -8.451  1.00 67.38  ? 107 GLU T C   1 
ATOM   7812  O O   . GLU B 2 107 ? 50.597  94.680  -9.118  1.00 36.17  ? 107 GLU T O   1 
ATOM   7813  C CB  . GLU B 2 107 ? 53.616  93.752  -8.114  1.00 36.17  ? 107 GLU T CB  1 
ATOM   7814  C CG  . GLU B 2 107 ? 54.592  94.900  -8.203  1.00 36.17  ? 107 GLU T CG  1 
ATOM   7815  C CD  . GLU B 2 107 ? 55.230  95.024  -9.580  1.00 36.17  ? 107 GLU T CD  1 
ATOM   7816  O OE1 . GLU B 2 107 ? 55.892  94.058  -10.016 1.00 36.17  ? 107 GLU T OE1 1 
ATOM   7817  O OE2 . GLU B 2 107 ? 55.073  96.086  -10.226 1.00 36.17  ? 107 GLU T OE2 1 
ATOM   7818  N N   . ILE B 2 108 ? 50.761  92.527  -8.504  1.00 2.00   ? 108 ILE T N   1 
ATOM   7819  C CA  . ILE B 2 108 ? 49.670  92.139  -9.379  1.00 2.00   ? 108 ILE T CA  1 
ATOM   7820  C C   . ILE B 2 108 ? 48.451  92.858  -8.861  1.00 2.00   ? 108 ILE T C   1 
ATOM   7821  O O   . ILE B 2 108 ? 47.685  93.409  -9.636  1.00 10.61  ? 108 ILE T O   1 
ATOM   7822  C CB  . ILE B 2 108 ? 49.404  90.629  -9.347  1.00 10.61  ? 108 ILE T CB  1 
ATOM   7823  C CG1 . ILE B 2 108 ? 49.609  90.057  -10.737 1.00 10.61  ? 108 ILE T CG1 1 
ATOM   7824  C CG2 . ILE B 2 108 ? 47.955  90.346  -8.937  1.00 10.61  ? 108 ILE T CG2 1 
ATOM   7825  C CD1 . ILE B 2 108 ? 48.474  90.430  -11.680 1.00 10.61  ? 108 ILE T CD1 1 
ATOM   7826  N N   . ARG B 2 109 ? 48.285  92.870  -7.544  1.00 9.34   ? 109 ARG T N   1 
ATOM   7827  C CA  . ARG B 2 109 ? 47.126  93.524  -6.936  1.00 9.34   ? 109 ARG T CA  1 
ATOM   7828  C C   . ARG B 2 109 ? 47.088  95.019  -7.248  1.00 9.34   ? 109 ARG T C   1 
ATOM   7829  O O   . ARG B 2 109 ? 46.029  95.642  -7.247  1.00 36.96  ? 109 ARG T O   1 
ATOM   7830  C CB  . ARG B 2 109 ? 47.135  93.297  -5.423  1.00 36.96  ? 109 ARG T CB  1 
ATOM   7831  C CG  . ARG B 2 109 ? 45.869  92.676  -4.867  1.00 36.96  ? 109 ARG T CG  1 
ATOM   7832  C CD  . ARG B 2 109 ? 45.923  92.661  -3.349  1.00 36.96  ? 109 ARG T CD  1 
ATOM   7833  N NE  . ARG B 2 109 ? 45.399  91.410  -2.816  1.00 36.96  ? 109 ARG T NE  1 
ATOM   7834  C CZ  . ARG B 2 109 ? 46.138  90.349  -2.514  1.00 36.96  ? 109 ARG T CZ  1 
ATOM   7835  N NH1 . ARG B 2 109 ? 47.455  90.381  -2.690  1.00 36.96  ? 109 ARG T NH1 1 
ATOM   7836  N NH2 . ARG B 2 109 ? 45.554  89.251  -2.046  1.00 36.96  ? 109 ARG T NH2 1 
ATOM   7837  N N   . HIS B 2 110 ? 48.246  95.596  -7.529  1.00 23.80  ? 110 HIS T N   1 
ATOM   7838  C CA  . HIS B 2 110 ? 48.317  97.012  -7.839  1.00 23.80  ? 110 HIS T CA  1 
ATOM   7839  C C   . HIS B 2 110 ? 47.808  97.241  -9.248  1.00 23.80  ? 110 HIS T C   1 
ATOM   7840  O O   . HIS B 2 110 ? 46.689  97.698  -9.456  1.00 23.58  ? 110 HIS T O   1 
ATOM   7841  C CB  . HIS B 2 110 ? 49.764  97.470  -7.752  1.00 23.58  ? 110 HIS T CB  1 
ATOM   7842  C CG  . HIS B 2 110 ? 49.924  98.917  -7.432  1.00 23.58  ? 110 HIS T CG  1 
ATOM   7843  N ND1 . HIS B 2 110 ? 51.017  99.648  -7.842  1.00 23.58  ? 110 HIS T ND1 1 
ATOM   7844  C CD2 . HIS B 2 110 ? 49.140  99.767  -6.727  1.00 23.58  ? 110 HIS T CD2 1 
ATOM   7845  C CE1 . HIS B 2 110 ? 50.899  100.889 -7.405  1.00 23.58  ? 110 HIS T CE1 1 
ATOM   7846  N NE2 . HIS B 2 110 ? 49.769  100.990 -6.725  1.00 23.58  ? 110 HIS T NE2 1 
ATOM   7847  N N   . VAL B 2 111 ? 48.657  96.908  -10.205 1.00 25.71  ? 111 VAL T N   1 
ATOM   7848  C CA  . VAL B 2 111 ? 48.360  97.051  -11.617 1.00 25.71  ? 111 VAL T CA  1 
ATOM   7849  C C   . VAL B 2 111 ? 46.887  96.886  -11.903 1.00 25.71  ? 111 VAL T C   1 
ATOM   7850  O O   . VAL B 2 111 ? 46.253  97.745  -12.506 1.00 2.00   ? 111 VAL T O   1 
ATOM   7851  C CB  . VAL B 2 111 ? 49.129  95.991  -12.455 1.00 2.00   ? 111 VAL T CB  1 
ATOM   7852  C CG1 . VAL B 2 111 ? 48.431  95.766  -13.798 1.00 2.00   ? 111 VAL T CG1 1 
ATOM   7853  C CG2 . VAL B 2 111 ? 50.560  96.446  -12.676 1.00 2.00   ? 111 VAL T CG2 1 
ATOM   7854  N N   . LEU B 2 112 ? 46.342  95.768  -11.458 1.00 2.00   ? 112 LEU T N   1 
ATOM   7855  C CA  . LEU B 2 112 ? 44.944  95.469  -11.699 1.00 2.00   ? 112 LEU T CA  1 
ATOM   7856  C C   . LEU B 2 112 ? 44.011  96.545  -11.182 1.00 2.00   ? 112 LEU T C   1 
ATOM   7857  O O   . LEU B 2 112 ? 42.875  96.661  -11.639 1.00 21.12  ? 112 LEU T O   1 
ATOM   7858  C CB  . LEU B 2 112 ? 44.594  94.112  -11.085 1.00 21.12  ? 112 LEU T CB  1 
ATOM   7859  C CG  . LEU B 2 112 ? 44.943  92.886  -11.931 1.00 21.12  ? 112 LEU T CG  1 
ATOM   7860  C CD1 . LEU B 2 112 ? 43.684  92.129  -12.234 1.00 21.12  ? 112 LEU T CD1 1 
ATOM   7861  C CD2 . LEU B 2 112 ? 45.619  93.298  -13.230 1.00 21.12  ? 112 LEU T CD2 1 
ATOM   7862  N N   . VAL B 2 113 ? 44.477  97.344  -10.234 1.00 29.20  ? 113 VAL T N   1 
ATOM   7863  C CA  . VAL B 2 113 ? 43.616  98.378  -9.717  1.00 29.20  ? 113 VAL T CA  1 
ATOM   7864  C C   . VAL B 2 113 ? 44.220  99.751  -9.882  1.00 29.20  ? 113 VAL T C   1 
ATOM   7865  O O   . VAL B 2 113 ? 44.088  100.582 -8.992  1.00 2.77   ? 113 VAL T O   1 
ATOM   7866  C CB  . VAL B 2 113 ? 43.303  98.147  -8.249  1.00 2.77   ? 113 VAL T CB  1 
ATOM   7867  C CG1 . VAL B 2 113 ? 42.056  98.895  -7.886  1.00 2.77   ? 113 VAL T CG1 1 
ATOM   7868  C CG2 . VAL B 2 113 ? 43.100  96.696  -7.993  1.00 2.77   ? 113 VAL T CG2 1 
ATOM   7869  N N   . THR B 2 114 ? 44.876  99.990  -11.019 1.00 21.67  ? 114 THR T N   1 
ATOM   7870  C CA  . THR B 2 114 ? 45.511  101.288 -11.288 1.00 21.67  ? 114 THR T CA  1 
ATOM   7871  C C   . THR B 2 114 ? 45.734  101.517 -12.760 1.00 21.67  ? 114 THR T C   1 
ATOM   7872  O O   . THR B 2 114 ? 46.329  102.510 -13.140 1.00 5.09   ? 114 THR T O   1 
ATOM   7873  C CB  . THR B 2 114 ? 46.908  101.420 -10.628 1.00 5.09   ? 114 THR T CB  1 
ATOM   7874  O OG1 . THR B 2 114 ? 47.304  100.157 -10.054 1.00 5.09   ? 114 THR T OG1 1 
ATOM   7875  C CG2 . THR B 2 114 ? 46.889  102.530 -9.583  1.00 5.09   ? 114 THR T CG2 1 
ATOM   7876  N N   . LEU B 2 115 ? 45.292  100.576 -13.583 1.00 36.51  ? 115 LEU T N   1 
ATOM   7877  C CA  . LEU B 2 115 ? 45.461  100.680 -15.026 1.00 36.51  ? 115 LEU T CA  1 
ATOM   7878  C C   . LEU B 2 115 ? 44.166  100.299 -15.722 1.00 36.51  ? 115 LEU T C   1 
ATOM   7879  O O   . LEU B 2 115 ? 43.395  99.488  -15.208 1.00 45.84  ? 115 LEU T O   1 
ATOM   7880  C CB  . LEU B 2 115 ? 46.571  99.745  -15.498 1.00 45.84  ? 115 LEU T CB  1 
ATOM   7881  C CG  . LEU B 2 115 ? 48.005  100.123 -15.153 1.00 45.84  ? 115 LEU T CG  1 
ATOM   7882  C CD1 . LEU B 2 115 ? 48.233  100.099 -13.653 1.00 45.84  ? 115 LEU T CD1 1 
ATOM   7883  C CD2 . LEU B 2 115 ? 48.921  99.136  -15.840 1.00 45.84  ? 115 LEU T CD2 1 
ATOM   7884  N N   . GLY B 2 116 ? 43.927  100.878 -16.895 1.00 22.23  ? 116 GLY T N   1 
ATOM   7885  C CA  . GLY B 2 116 ? 42.717  100.561 -17.638 1.00 22.23  ? 116 GLY T CA  1 
ATOM   7886  C C   . GLY B 2 116 ? 41.446  100.475 -16.808 1.00 22.23  ? 116 GLY T C   1 
ATOM   7887  O O   . GLY B 2 116 ? 41.245  101.270 -15.884 1.00 18.65  ? 116 GLY T O   1 
ATOM   7888  N N   . GLU B 2 117 ? 40.585  99.515  -17.142 1.00 50.75  ? 117 GLU T N   1 
ATOM   7889  C CA  . GLU B 2 117 ? 39.313  99.321  -16.441 1.00 50.75  ? 117 GLU T CA  1 
ATOM   7890  C C   . GLU B 2 117 ? 39.561  98.985  -14.980 1.00 50.75  ? 117 GLU T C   1 
ATOM   7891  O O   . GLU B 2 117 ? 39.304  97.870  -14.534 1.00 77.30  ? 117 GLU T O   1 
ATOM   7892  C CB  . GLU B 2 117 ? 38.500  98.194  -17.093 1.00 77.30  ? 117 GLU T CB  1 
ATOM   7893  C CG  . GLU B 2 117 ? 38.416  98.262  -18.617 1.00 77.30  ? 117 GLU T CG  1 
ATOM   7894  C CD  . GLU B 2 117 ? 37.418  99.293  -19.122 1.00 77.30  ? 117 GLU T CD  1 
ATOM   7895  O OE1 . GLU B 2 117 ? 36.980  100.144 -18.321 1.00 77.30  ? 117 GLU T OE1 1 
ATOM   7896  O OE2 . GLU B 2 117 ? 37.073  99.256  -20.326 1.00 77.30  ? 117 GLU T OE2 1 
ATOM   7897  N N   . LYS B 2 118 ? 40.042  99.977  -14.239 1.00 2.00   ? 118 LYS T N   1 
ATOM   7898  C CA  . LYS B 2 118 ? 40.366  99.812  -12.834 1.00 2.00   ? 118 LYS T CA  1 
ATOM   7899  C C   . LYS B 2 118 ? 39.363  98.973  -12.048 1.00 2.00   ? 118 LYS T C   1 
ATOM   7900  O O   . LYS B 2 118 ? 38.169  99.266  -12.038 1.00 100.00 ? 118 LYS T O   1 
ATOM   7901  C CB  . LYS B 2 118 ? 40.530  101.187 -12.175 1.00 100.00 ? 118 LYS T CB  1 
ATOM   7902  C CG  . LYS B 2 118 ? 41.218  102.222 -13.054 1.00 100.00 ? 118 LYS T CG  1 
ATOM   7903  C CD  . LYS B 2 118 ? 41.797  103.360 -12.224 1.00 100.00 ? 118 LYS T CD  1 
ATOM   7904  C CE  . LYS B 2 118 ? 41.790  104.673 -12.997 1.00 100.00 ? 118 LYS T CE  1 
ATOM   7905  N NZ  . LYS B 2 118 ? 41.804  105.879 -12.103 1.00 100.00 ? 118 LYS T NZ  1 
ATOM   7906  N N   . MET B 2 119 ? 39.866  97.932  -11.383 1.00 2.00   ? 119 MET T N   1 
ATOM   7907  C CA  . MET B 2 119 ? 39.045  97.059  -10.559 1.00 2.00   ? 119 MET T CA  1 
ATOM   7908  C C   . MET B 2 119 ? 38.985  97.640  -9.146  1.00 2.00   ? 119 MET T C   1 
ATOM   7909  O O   . MET B 2 119 ? 39.456  98.750  -8.903  1.00 29.60  ? 119 MET T O   1 
ATOM   7910  C CB  . MET B 2 119 ? 39.663  95.671  -10.504 1.00 29.60  ? 119 MET T CB  1 
ATOM   7911  C CG  . MET B 2 119 ? 39.826  95.033  -11.857 1.00 29.60  ? 119 MET T CG  1 
ATOM   7912  S SD  . MET B 2 119 ? 39.251  93.321  -11.859 1.00 29.60  ? 119 MET T SD  1 
ATOM   7913  C CE  . MET B 2 119 ? 40.493  92.550  -12.839 1.00 29.60  ? 119 MET T CE  1 
ATOM   7914  N N   . THR B 2 120 ? 38.414  96.897  -8.208  1.00 25.54  ? 120 THR T N   1 
ATOM   7915  C CA  . THR B 2 120 ? 38.337  97.368  -6.829  1.00 25.54  ? 120 THR T CA  1 
ATOM   7916  C C   . THR B 2 120 ? 39.268  96.538  -5.943  1.00 25.54  ? 120 THR T C   1 
ATOM   7917  O O   . THR B 2 120 ? 39.678  95.426  -6.305  1.00 16.42  ? 120 THR T O   1 
ATOM   7918  C CB  . THR B 2 120 ? 36.915  97.265  -6.277  1.00 16.42  ? 120 THR T CB  1 
ATOM   7919  O OG1 . THR B 2 120 ? 36.855  96.191  -5.328  1.00 16.42  ? 120 THR T OG1 1 
ATOM   7920  C CG2 . THR B 2 120 ? 35.932  96.993  -7.398  1.00 16.42  ? 120 THR T CG2 1 
ATOM   7921  N N   . GLU B 2 121 ? 39.600  97.093  -4.784  1.00 11.56  ? 121 GLU T N   1 
ATOM   7922  C CA  . GLU B 2 121 ? 40.476  96.436  -3.826  1.00 11.56  ? 121 GLU T CA  1 
ATOM   7923  C C   . GLU B 2 121 ? 39.936  95.047  -3.503  1.00 11.56  ? 121 GLU T C   1 
ATOM   7924  O O   . GLU B 2 121 ? 40.691  94.073  -3.405  1.00 97.99  ? 121 GLU T O   1 
ATOM   7925  C CB  . GLU B 2 121 ? 40.567  97.281  -2.550  1.00 97.99  ? 121 GLU T CB  1 
ATOM   7926  C CG  . GLU B 2 121 ? 39.276  98.053  -2.220  1.00 97.99  ? 121 GLU T CG  1 
ATOM   7927  C CD  . GLU B 2 121 ? 39.175  99.419  -2.917  1.00 97.99  ? 121 GLU T CD  1 
ATOM   7928  O OE1 . GLU B 2 121 ? 39.757  100.397 -2.397  1.00 97.99  ? 121 GLU T OE1 1 
ATOM   7929  O OE2 . GLU B 2 121 ? 38.509  99.522  -3.975  1.00 97.99  ? 121 GLU T OE2 1 
ATOM   7930  N N   . GLU B 2 122 ? 38.619  94.959  -3.352  1.00 2.95   ? 122 GLU T N   1 
ATOM   7931  C CA  . GLU B 2 122 ? 37.971  93.695  -3.029  1.00 2.95   ? 122 GLU T CA  1 
ATOM   7932  C C   . GLU B 2 122 ? 38.004  92.783  -4.241  1.00 2.95   ? 122 GLU T C   1 
ATOM   7933  O O   . GLU B 2 122 ? 38.362  91.606  -4.135  1.00 100.00 ? 122 GLU T O   1 
ATOM   7934  C CB  . GLU B 2 122 ? 36.516  93.921  -2.591  1.00 100.00 ? 122 GLU T CB  1 
ATOM   7935  C CG  . GLU B 2 122 ? 36.333  95.013  -1.535  1.00 100.00 ? 122 GLU T CG  1 
ATOM   7936  C CD  . GLU B 2 122 ? 36.151  94.469  -0.115  1.00 100.00 ? 122 GLU T CD  1 
ATOM   7937  O OE1 . GLU B 2 122 ? 35.756  93.288  0.036   1.00 100.00 ? 122 GLU T OE1 1 
ATOM   7938  O OE2 . GLU B 2 122 ? 36.403  95.235  0.846   1.00 100.00 ? 122 GLU T OE2 1 
ATOM   7939  N N   . GLU B 2 123 ? 37.633  93.329  -5.393  1.00 24.90  ? 123 GLU T N   1 
ATOM   7940  C CA  . GLU B 2 123 ? 37.628  92.550  -6.616  1.00 24.90  ? 123 GLU T CA  1 
ATOM   7941  C C   . GLU B 2 123 ? 38.919  91.731  -6.720  1.00 24.90  ? 123 GLU T C   1 
ATOM   7942  O O   . GLU B 2 123 ? 38.869  90.504  -6.739  1.00 53.68  ? 123 GLU T O   1 
ATOM   7943  C CB  . GLU B 2 123 ? 37.481  93.476  -7.826  1.00 53.68  ? 123 GLU T CB  1 
ATOM   7944  C CG  . GLU B 2 123 ? 36.045  93.655  -8.300  1.00 53.68  ? 123 GLU T CG  1 
ATOM   7945  C CD  . GLU B 2 123 ? 35.921  94.548  -9.535  1.00 53.68  ? 123 GLU T CD  1 
ATOM   7946  O OE1 . GLU B 2 123 ? 36.835  95.362  -9.791  1.00 53.68  ? 123 GLU T OE1 1 
ATOM   7947  O OE2 . GLU B 2 123 ? 34.905  94.438  -10.253 1.00 53.68  ? 123 GLU T OE2 1 
ATOM   7948  N N   . VAL B 2 124 ? 40.069  92.411  -6.771  1.00 5.42   ? 124 VAL T N   1 
ATOM   7949  C CA  . VAL B 2 124 ? 41.359  91.733  -6.890  1.00 5.42   ? 124 VAL T CA  1 
ATOM   7950  C C   . VAL B 2 124 ? 41.574  90.787  -5.744  1.00 5.42   ? 124 VAL T C   1 
ATOM   7951  O O   . VAL B 2 124 ? 42.076  89.682  -5.942  1.00 83.32  ? 124 VAL T O   1 
ATOM   7952  C CB  . VAL B 2 124 ? 42.507  92.708  -6.888  1.00 83.32  ? 124 VAL T CB  1 
ATOM   7953  C CG1 . VAL B 2 124 ? 42.607  93.380  -8.236  1.00 83.32  ? 124 VAL T CG1 1 
ATOM   7954  C CG2 . VAL B 2 124 ? 42.303  93.713  -5.785  1.00 83.32  ? 124 VAL T CG2 1 
ATOM   7955  N N   . GLU B 2 125 ? 41.208  91.211  -4.538  1.00 29.55  ? 125 GLU T N   1 
ATOM   7956  C CA  . GLU B 2 125 ? 41.372  90.334  -3.383  1.00 29.55  ? 125 GLU T CA  1 
ATOM   7957  C C   . GLU B 2 125 ? 40.754  88.965  -3.688  1.00 29.55  ? 125 GLU T C   1 
ATOM   7958  O O   . GLU B 2 125 ? 41.457  87.956  -3.718  1.00 100.00 ? 125 GLU T O   1 
ATOM   7959  C CB  . GLU B 2 125 ? 40.705  90.937  -2.149  1.00 100.00 ? 125 GLU T CB  1 
ATOM   7960  C CG  . GLU B 2 125 ? 41.322  90.456  -0.839  1.00 100.00 ? 125 GLU T CG  1 
ATOM   7961  C CD  . GLU B 2 125 ? 42.833  90.627  -0.801  1.00 100.00 ? 125 GLU T CD  1 
ATOM   7962  O OE1 . GLU B 2 125 ? 43.307  91.730  -1.147  1.00 100.00 ? 125 GLU T OE1 1 
ATOM   7963  O OE2 . GLU B 2 125 ? 43.542  89.666  -0.420  1.00 100.00 ? 125 GLU T OE2 1 
ATOM   7964  N N   . GLN B 2 126 ? 39.445  88.962  -3.950  1.00 66.77  ? 126 GLN T N   1 
ATOM   7965  C CA  . GLN B 2 126 ? 38.691  87.749  -4.274  1.00 66.77  ? 126 GLN T CA  1 
ATOM   7966  C C   . GLN B 2 126 ? 39.304  86.937  -5.412  1.00 66.77  ? 126 GLN T C   1 
ATOM   7967  O O   . GLN B 2 126 ? 39.133  85.729  -5.478  1.00 92.02  ? 126 GLN T O   1 
ATOM   7968  C CB  . GLN B 2 126 ? 37.257  88.109  -4.674  1.00 92.02  ? 126 GLN T CB  1 
ATOM   7969  C CG  . GLN B 2 126 ? 36.331  88.444  -3.526  1.00 92.02  ? 126 GLN T CG  1 
ATOM   7970  C CD  . GLN B 2 126 ? 34.900  88.691  -3.993  1.00 92.02  ? 126 GLN T CD  1 
ATOM   7971  O OE1 . GLN B 2 126 ? 34.150  87.751  -4.270  1.00 92.02  ? 126 GLN T OE1 1 
ATOM   7972  N NE2 . GLN B 2 126 ? 34.518  89.960  -4.082  1.00 92.02  ? 126 GLN T NE2 1 
ATOM   7973  N N   . LEU B 2 127 ? 40.012  87.604  -6.312  1.00 12.76  ? 127 LEU T N   1 
ATOM   7974  C CA  . LEU B 2 127 ? 40.614  86.931  -7.457  1.00 12.76  ? 127 LEU T CA  1 
ATOM   7975  C C   . LEU B 2 127 ? 41.885  86.165  -7.143  1.00 12.76  ? 127 LEU T C   1 
ATOM   7976  O O   . LEU B 2 127 ? 41.885  84.943  -7.161  1.00 28.04  ? 127 LEU T O   1 
ATOM   7977  C CB  . LEU B 2 127 ? 40.901  87.938  -8.580  1.00 28.04  ? 127 LEU T CB  1 
ATOM   7978  C CG  . LEU B 2 127 ? 41.420  87.299  -9.868  1.00 28.04  ? 127 LEU T CG  1 
ATOM   7979  C CD1 . LEU B 2 127 ? 40.272  86.628  -10.566 1.00 28.04  ? 127 LEU T CD1 1 
ATOM   7980  C CD2 . LEU B 2 127 ? 42.061  88.347  -10.759 1.00 28.04  ? 127 LEU T CD2 1 
ATOM   7981  N N   . VAL B 2 128 ? 42.963  86.893  -6.869  1.00 19.37  ? 128 VAL T N   1 
ATOM   7982  C CA  . VAL B 2 128 ? 44.268  86.301  -6.567  1.00 19.37  ? 128 VAL T CA  1 
ATOM   7983  C C   . VAL B 2 128 ? 44.238  85.475  -5.306  1.00 19.37  ? 128 VAL T C   1 
ATOM   7984  O O   . VAL B 2 128 ? 44.900  84.442  -5.212  1.00 15.02  ? 128 VAL T O   1 
ATOM   7985  C CB  . VAL B 2 128 ? 45.340  87.382  -6.363  1.00 15.02  ? 128 VAL T CB  1 
ATOM   7986  C CG1 . VAL B 2 128 ? 45.702  88.019  -7.696  1.00 15.02  ? 128 VAL T CG1 1 
ATOM   7987  C CG2 . VAL B 2 128 ? 44.829  88.427  -5.373  1.00 15.02  ? 128 VAL T CG2 1 
ATOM   7988  N N   . ALA B 2 129 ? 43.479  85.964  -4.331  1.00 60.90  ? 129 ALA T N   1 
ATOM   7989  C CA  . ALA B 2 129 ? 43.341  85.299  -3.042  1.00 60.90  ? 129 ALA T CA  1 
ATOM   7990  C C   . ALA B 2 129 ? 43.420  83.778  -3.148  1.00 60.90  ? 129 ALA T C   1 
ATOM   7991  O O   . ALA B 2 129 ? 42.556  83.138  -3.763  1.00 28.95  ? 129 ALA T O   1 
ATOM   7992  C CB  . ALA B 2 129 ? 42.038  85.701  -2.392  1.00 28.95  ? 129 ALA T CB  1 
ATOM   7993  N N   . GLY B 2 130 ? 44.462  83.211  -2.552  1.00 53.95  ? 130 GLY T N   1 
ATOM   7994  C CA  . GLY B 2 130 ? 44.628  81.772  -2.564  1.00 53.95  ? 130 GLY T CA  1 
ATOM   7995  C C   . GLY B 2 130 ? 45.569  81.268  -3.634  1.00 53.95  ? 130 GLY T C   1 
ATOM   7996  O O   . GLY B 2 130 ? 45.627  80.064  -3.882  1.00 49.33  ? 130 GLY T O   1 
ATOM   7997  N N   . HIS B 2 131 ? 46.303  82.177  -4.267  1.00 6.56   ? 131 HIS T N   1 
ATOM   7998  C CA  . HIS B 2 131 ? 47.236  81.781  -5.318  1.00 6.56   ? 131 HIS T CA  1 
ATOM   7999  C C   . HIS B 2 131 ? 48.604  82.313  -4.969  1.00 6.56   ? 131 HIS T C   1 
ATOM   8000  O O   . HIS B 2 131 ? 49.582  82.066  -5.684  1.00 100.00 ? 131 HIS T O   1 
ATOM   8001  C CB  . HIS B 2 131 ? 46.784  82.314  -6.671  1.00 100.00 ? 131 HIS T CB  1 
ATOM   8002  C CG  . HIS B 2 131 ? 45.505  81.706  -7.147  1.00 100.00 ? 131 HIS T CG  1 
ATOM   8003  N ND1 . HIS B 2 131 ? 44.372  81.671  -6.364  1.00 100.00 ? 131 HIS T ND1 1 
ATOM   8004  C CD2 . HIS B 2 131 ? 45.186  81.088  -8.307  1.00 100.00 ? 131 HIS T CD2 1 
ATOM   8005  C CE1 . HIS B 2 131 ? 43.408  81.055  -7.024  1.00 100.00 ? 131 HIS T CE1 1 
ATOM   8006  N NE2 . HIS B 2 131 ? 43.876  80.694  -8.205  1.00 100.00 ? 131 HIS T NE2 1 
ATOM   8007  N N   . GLU B 2 132 ? 48.657  83.050  -3.863  1.00 3.55   ? 132 GLU T N   1 
ATOM   8008  C CA  . GLU B 2 132 ? 49.907  83.608  -3.373  1.00 3.55   ? 132 GLU T CA  1 
ATOM   8009  C C   . GLU B 2 132 ? 50.503  82.492  -2.543  1.00 3.55   ? 132 GLU T C   1 
ATOM   8010  O O   . GLU B 2 132 ? 49.774  81.816  -1.821  1.00 94.26  ? 132 GLU T O   1 
ATOM   8011  C CB  . GLU B 2 132 ? 49.637  84.827  -2.502  1.00 94.26  ? 132 GLU T CB  1 
ATOM   8012  C CG  . GLU B 2 132 ? 48.171  85.185  -2.378  1.00 94.26  ? 132 GLU T CG  1 
ATOM   8013  C CD  . GLU B 2 132 ? 47.893  86.628  -2.741  1.00 94.26  ? 132 GLU T CD  1 
ATOM   8014  O OE1 . GLU B 2 132 ? 48.840  87.338  -3.129  1.00 94.26  ? 132 GLU T OE1 1 
ATOM   8015  O OE2 . GLU B 2 132 ? 46.723  87.054  -2.638  1.00 94.26  ? 132 GLU T OE2 1 
ATOM   8016  N N   . ASP B 2 133 ? 51.808  82.269  -2.644  1.00 53.52  ? 133 ASP T N   1 
ATOM   8017  C CA  . ASP B 2 133 ? 52.430  81.199  -1.866  1.00 53.52  ? 133 ASP T CA  1 
ATOM   8018  C C   . ASP B 2 133 ? 52.880  81.704  -0.501  1.00 53.52  ? 133 ASP T C   1 
ATOM   8019  O O   . ASP B 2 133 ? 52.367  82.691  0.013   1.00 25.90  ? 133 ASP T O   1 
ATOM   8020  C CB  . ASP B 2 133 ? 53.623  80.612  -2.620  1.00 25.90  ? 133 ASP T CB  1 
ATOM   8021  C CG  . ASP B 2 133 ? 54.797  81.550  -2.662  1.00 25.90  ? 133 ASP T CG  1 
ATOM   8022  O OD1 . ASP B 2 133 ? 54.692  82.665  -2.089  1.00 25.90  ? 133 ASP T OD1 1 
ATOM   8023  O OD2 . ASP B 2 133 ? 55.820  81.161  -3.270  1.00 25.90  ? 133 ASP T OD2 1 
ATOM   8024  N N   . SER B 2 134 ? 53.854  81.019  0.086   1.00 44.25  ? 134 SER T N   1 
ATOM   8025  C CA  . SER B 2 134 ? 54.371  81.401  1.389   1.00 44.25  ? 134 SER T CA  1 
ATOM   8026  C C   . SER B 2 134 ? 54.897  82.816  1.316   1.00 44.25  ? 134 SER T C   1 
ATOM   8027  O O   . SER B 2 134 ? 54.717  83.607  2.235   1.00 73.71  ? 134 SER T O   1 
ATOM   8028  C CB  . SER B 2 134 ? 55.501  80.458  1.814   1.00 73.71  ? 134 SER T CB  1 
ATOM   8029  O OG  . SER B 2 134 ? 55.778  79.488  0.812   1.00 73.71  ? 134 SER T OG  1 
ATOM   8030  N N   . ASN B 2 135 ? 55.541  83.123  0.201   1.00 2.00   ? 135 ASN T N   1 
ATOM   8031  C CA  . ASN B 2 135 ? 56.121  84.439  -0.012  1.00 2.00   ? 135 ASN T CA  1 
ATOM   8032  C C   . ASN B 2 135 ? 55.151  85.326  -0.747  1.00 2.00   ? 135 ASN T C   1 
ATOM   8033  O O   . ASN B 2 135 ? 55.545  86.301  -1.370  1.00 41.85  ? 135 ASN T O   1 
ATOM   8034  C CB  . ASN B 2 135 ? 57.415  84.311  -0.807  1.00 41.85  ? 135 ASN T CB  1 
ATOM   8035  C CG  . ASN B 2 135 ? 57.980  82.917  -0.750  1.00 41.85  ? 135 ASN T CG  1 
ATOM   8036  O OD1 . ASN B 2 135 ? 58.270  82.308  -1.779  1.00 41.85  ? 135 ASN T OD1 1 
ATOM   8037  N ND2 . ASN B 2 135 ? 58.130  82.395  0.458   1.00 41.85  ? 135 ASN T ND2 1 
ATOM   8038  N N   . GLY B 2 136 ? 53.874  84.972  -0.657  1.00 83.32  ? 136 GLY T N   1 
ATOM   8039  C CA  . GLY B 2 136 ? 52.839  85.744  -1.318  1.00 83.32  ? 136 GLY T CA  1 
ATOM   8040  C C   . GLY B 2 136 ? 53.076  85.859  -2.806  1.00 83.32  ? 136 GLY T C   1 
ATOM   8041  O O   . GLY B 2 136 ? 52.762  86.884  -3.424  1.00 33.39  ? 136 GLY T O   1 
ATOM   8042  N N   . CYS B 2 137 ? 53.622  84.800  -3.388  1.00 30.31  ? 137 CYS T N   1 
ATOM   8043  C CA  . CYS B 2 137 ? 53.921  84.793  -4.809  1.00 30.31  ? 137 CYS T CA  1 
ATOM   8044  C C   . CYS B 2 137 ? 52.936  84.000  -5.636  1.00 30.31  ? 137 CYS T C   1 
ATOM   8045  O O   . CYS B 2 137 ? 52.645  82.840  -5.360  1.00 100.00 ? 137 CYS T O   1 
ATOM   8046  C CB  . CYS B 2 137 ? 55.335  84.277  -5.038  1.00 100.00 ? 137 CYS T CB  1 
ATOM   8047  S SG  . CYS B 2 137 ? 56.569  85.184  -4.072  1.00 100.00 ? 137 CYS T SG  1 
ATOM   8048  N N   . ILE B 2 138 ? 52.439  84.670  -6.664  1.00 33.36  ? 138 ILE T N   1 
ATOM   8049  C CA  . ILE B 2 138 ? 51.461  84.126  -7.578  1.00 33.36  ? 138 ILE T CA  1 
ATOM   8050  C C   . ILE B 2 138 ? 52.150  83.755  -8.877  1.00 33.36  ? 138 ILE T C   1 
ATOM   8051  O O   . ILE B 2 138 ? 53.105  84.435  -9.269  1.00 8.12   ? 138 ILE T O   1 
ATOM   8052  C CB  . ILE B 2 138 ? 50.419  85.195  -7.894  1.00 8.12   ? 138 ILE T CB  1 
ATOM   8053  C CG1 . ILE B 2 138 ? 49.603  85.509  -6.655  1.00 8.12   ? 138 ILE T CG1 1 
ATOM   8054  C CG2 . ILE B 2 138 ? 49.542  84.733  -9.021  1.00 8.12   ? 138 ILE T CG2 1 
ATOM   8055  C CD1 . ILE B 2 138 ? 48.513  86.500  -6.894  1.00 8.12   ? 138 ILE T CD1 1 
ATOM   8056  N N   . ASN B 2 139 ? 51.685  82.691  -9.538  1.00 2.00   ? 139 ASN T N   1 
ATOM   8057  C CA  . ASN B 2 139 ? 52.252  82.315  -10.834 1.00 2.00   ? 139 ASN T CA  1 
ATOM   8058  C C   . ASN B 2 139 ? 51.226  82.715  -11.907 1.00 2.00   ? 139 ASN T C   1 
ATOM   8059  O O   . ASN B 2 139 ? 50.209  82.034  -12.104 1.00 99.12  ? 139 ASN T O   1 
ATOM   8060  C CB  . ASN B 2 139 ? 52.481  80.820  -10.962 1.00 99.12  ? 139 ASN T CB  1 
ATOM   8061  C CG  . ASN B 2 139 ? 52.700  80.385  -12.414 1.00 99.12  ? 139 ASN T CG  1 
ATOM   8062  O OD1 . ASN B 2 139 ? 52.209  79.333  -12.821 1.00 99.12  ? 139 ASN T OD1 1 
ATOM   8063  N ND2 . ASN B 2 139 ? 53.415  81.139  -13.229 1.00 99.12  ? 139 ASN T ND2 1 
ATOM   8064  N N   . TYR B 2 140 ? 51.486  83.823  -12.593 1.00 2.00   ? 140 TYR T N   1 
ATOM   8065  C CA  . TYR B 2 140 ? 50.524  84.345  -13.588 1.00 2.00   ? 140 TYR T CA  1 
ATOM   8066  C C   . TYR B 2 140 ? 50.067  83.235  -14.546 1.00 2.00   ? 140 TYR T C   1 
ATOM   8067  O O   . TYR B 2 140 ? 48.871  82.925  -14.638 1.00 38.37  ? 140 TYR T O   1 
ATOM   8068  C CB  . TYR B 2 140 ? 51.085  85.531  -14.396 1.00 38.37  ? 140 TYR T CB  1 
ATOM   8069  C CG  . TYR B 2 140 ? 52.546  85.416  -14.842 1.00 38.37  ? 140 TYR T CG  1 
ATOM   8070  C CD1 . TYR B 2 140 ? 52.919  84.483  -15.817 1.00 38.37  ? 140 TYR T CD1 1 
ATOM   8071  C CD2 . TYR B 2 140 ? 53.508  86.267  -14.284 1.00 38.37  ? 140 TYR T CD2 1 
ATOM   8072  C CE1 . TYR B 2 140 ? 54.254  84.402  -16.236 1.00 38.37  ? 140 TYR T CE1 1 
ATOM   8073  C CE2 . TYR B 2 140 ? 54.842  86.190  -14.705 1.00 38.37  ? 140 TYR T CE2 1 
ATOM   8074  C CZ  . TYR B 2 140 ? 55.214  85.258  -15.681 1.00 38.37  ? 140 TYR T CZ  1 
ATOM   8075  O OH  . TYR B 2 140 ? 56.511  85.183  -16.091 1.00 38.37  ? 140 TYR T OH  1 
ATOM   8076  N N   . GLU B 2 141 ? 51.013  82.654  -15.254 1.00 2.00   ? 141 GLU T N   1 
ATOM   8077  C CA  . GLU B 2 141 ? 50.713  81.580  -16.216 1.00 2.00   ? 141 GLU T CA  1 
ATOM   8078  C C   . GLU B 2 141 ? 49.437  80.839  -15.798 1.00 2.00   ? 141 GLU T C   1 
ATOM   8079  O O   . GLU B 2 141 ? 48.532  80.607  -16.614 1.00 100.00 ? 141 GLU T O   1 
ATOM   8080  C CB  . GLU B 2 141 ? 51.858  80.570  -16.274 1.00 100.00 ? 141 GLU T CB  1 
ATOM   8081  C CG  . GLU B 2 141 ? 53.232  81.231  -16.372 1.00 100.00 ? 141 GLU T CG  1 
ATOM   8082  C CD  . GLU B 2 141 ? 53.788  81.251  -17.799 1.00 100.00 ? 141 GLU T CD  1 
ATOM   8083  O OE1 . GLU B 2 141 ? 53.485  80.310  -18.626 1.00 100.00 ? 141 GLU T OE1 1 
ATOM   8084  O OE2 . GLU B 2 141 ? 54.563  82.213  -18.176 1.00 100.00 ? 141 GLU T OE2 1 
ATOM   8085  N N   . GLU B 2 142 ? 49.404  80.489  -14.525 1.00 22.49  ? 142 GLU T N   1 
ATOM   8086  C CA  . GLU B 2 142 ? 48.276  79.757  -13.932 1.00 22.49  ? 142 GLU T CA  1 
ATOM   8087  C C   . GLU B 2 142 ? 47.088  80.694  -13.711 1.00 22.49  ? 142 GLU T C   1 
ATOM   8088  O O   . GLU B 2 142 ? 46.025  80.482  -14.293 1.00 99.65  ? 142 GLU T O   1 
ATOM   8089  C CB  . GLU B 2 142 ? 48.688  79.142  -12.593 1.00 99.65  ? 142 GLU T CB  1 
ATOM   8090  C CG  . GLU B 2 142 ? 49.488  77.846  -12.748 1.00 99.65  ? 142 GLU T CG  1 
ATOM   8091  C CD  . GLU B 2 142 ? 48.956  76.930  -13.856 1.00 99.65  ? 142 GLU T CD  1 
ATOM   8092  O OE1 . GLU B 2 142 ? 47.805  76.360  -13.729 1.00 99.65  ? 142 GLU T OE1 1 
ATOM   8093  O OE2 . GLU B 2 142 ? 49.662  76.727  -14.919 1.00 99.65  ? 142 GLU T OE2 1 
ATOM   8094  N N   . LEU B 2 143 ? 47.270  81.718  -12.877 1.00 19.86  ? 143 LEU T N   1 
ATOM   8095  C CA  . LEU B 2 143 ? 46.193  82.677  -12.612 1.00 19.86  ? 143 LEU T CA  1 
ATOM   8096  C C   . LEU B 2 143 ? 45.504  83.034  -13.931 1.00 19.86  ? 143 LEU T C   1 
ATOM   8097  O O   . LEU B 2 143 ? 44.278  83.192  -13.975 1.00 2.00   ? 143 LEU T O   1 
ATOM   8098  C CB  . LEU B 2 143 ? 46.738  83.953  -11.958 1.00 2.00   ? 143 LEU T CB  1 
ATOM   8099  C CG  . LEU B 2 143 ? 45.750  85.116  -11.853 1.00 2.00   ? 143 LEU T CG  1 
ATOM   8100  C CD1 . LEU B 2 143 ? 44.976  84.999  -10.538 1.00 2.00   ? 143 LEU T CD1 1 
ATOM   8101  C CD2 . LEU B 2 143 ? 46.495  86.449  -11.961 1.00 2.00   ? 143 LEU T CD2 1 
ATOM   8102  N N   . VAL B 2 144 ? 46.301  83.163  -14.995 1.00 2.00   ? 144 VAL T N   1 
ATOM   8103  C CA  . VAL B 2 144 ? 45.795  83.472  -16.319 1.00 2.00   ? 144 VAL T CA  1 
ATOM   8104  C C   . VAL B 2 144 ? 44.783  82.406  -16.668 1.00 2.00   ? 144 VAL T C   1 
ATOM   8105  O O   . VAL B 2 144 ? 43.593  82.687  -16.826 1.00 11.72  ? 144 VAL T O   1 
ATOM   8106  C CB  . VAL B 2 144 ? 46.913  83.433  -17.348 1.00 11.72  ? 144 VAL T CB  1 
ATOM   8107  C CG1 . VAL B 2 144 ? 46.369  83.008  -18.702 1.00 11.72  ? 144 VAL T CG1 1 
ATOM   8108  C CG2 . VAL B 2 144 ? 47.562  84.791  -17.423 1.00 11.72  ? 144 VAL T CG2 1 
ATOM   8109  N N   . ARG B 2 145 ? 45.260  81.173  -16.757 1.00 2.00   ? 145 ARG T N   1 
ATOM   8110  C CA  . ARG B 2 145 ? 44.405  80.043  -17.090 1.00 2.00   ? 145 ARG T CA  1 
ATOM   8111  C C   . ARG B 2 145 ? 43.178  79.941  -16.201 1.00 2.00   ? 145 ARG T C   1 
ATOM   8112  O O   . ARG B 2 145 ? 42.075  79.634  -16.661 1.00 97.53  ? 145 ARG T O   1 
ATOM   8113  C CB  . ARG B 2 145 ? 45.215  78.743  -17.029 1.00 97.53  ? 145 ARG T CB  1 
ATOM   8114  C CG  . ARG B 2 145 ? 46.591  78.866  -17.651 1.00 97.53  ? 145 ARG T CG  1 
ATOM   8115  C CD  . ARG B 2 145 ? 47.291  77.532  -17.841 1.00 97.53  ? 145 ARG T CD  1 
ATOM   8116  N NE  . ARG B 2 145 ? 48.740  77.658  -17.656 1.00 97.53  ? 145 ARG T NE  1 
ATOM   8117  C CZ  . ARG B 2 145 ? 49.639  77.628  -18.641 1.00 97.53  ? 145 ARG T CZ  1 
ATOM   8118  N NH1 . ARG B 2 145 ? 49.242  77.472  -19.902 1.00 97.53  ? 145 ARG T NH1 1 
ATOM   8119  N NH2 . ARG B 2 145 ? 50.938  77.779  -18.366 1.00 97.53  ? 145 ARG T NH2 1 
ATOM   8120  N N   . MET B 2 146 ? 43.376  80.203  -14.923 1.00 4.78   ? 146 MET T N   1 
ATOM   8121  C CA  . MET B 2 146 ? 42.281  80.134  -13.966 1.00 4.78   ? 146 MET T CA  1 
ATOM   8122  C C   . MET B 2 146 ? 41.064  80.953  -14.403 1.00 4.78   ? 146 MET T C   1 
ATOM   8123  O O   . MET B 2 146 ? 39.975  80.413  -14.595 1.00 79.43  ? 146 MET T O   1 
ATOM   8124  C CB  . MET B 2 146 ? 42.768  80.623  -12.594 1.00 79.43  ? 146 MET T CB  1 
ATOM   8125  C CG  . MET B 2 146 ? 41.725  80.571  -11.485 1.00 79.43  ? 146 MET T CG  1 
ATOM   8126  S SD  . MET B 2 146 ? 41.415  82.199  -10.797 1.00 79.43  ? 146 MET T SD  1 
ATOM   8127  C CE  . MET B 2 146 ? 40.989  81.806  -9.107  1.00 79.43  ? 146 MET T CE  1 
ATOM   8128  N N   . VAL B 2 147 ? 41.253  82.262  -14.535 1.00 2.00   ? 147 VAL T N   1 
ATOM   8129  C CA  . VAL B 2 147 ? 40.175  83.118  -14.923 1.00 2.00   ? 147 VAL T CA  1 
ATOM   8130  C C   . VAL B 2 147 ? 39.735  82.698  -16.300 1.00 2.00   ? 147 VAL T C   1 
ATOM   8131  O O   . VAL B 2 147 ? 38.557  82.732  -16.629 1.00 2.00   ? 147 VAL T O   1 
ATOM   8132  C CB  . VAL B 2 147 ? 40.616  84.583  -14.948 1.00 2.00   ? 147 VAL T CB  1 
ATOM   8133  C CG1 . VAL B 2 147 ? 40.037  85.313  -13.771 1.00 2.00   ? 147 VAL T CG1 1 
ATOM   8134  C CG2 . VAL B 2 147 ? 42.110  84.674  -14.910 1.00 2.00   ? 147 VAL T CG2 1 
ATOM   8135  N N   . LEU B 2 148 ? 40.688  82.267  -17.104 1.00 2.00   ? 148 LEU T N   1 
ATOM   8136  C CA  . LEU B 2 148 ? 40.346  81.891  -18.453 1.00 2.00   ? 148 LEU T CA  1 
ATOM   8137  C C   . LEU B 2 148 ? 39.524  80.628  -18.505 1.00 2.00   ? 148 LEU T C   1 
ATOM   8138  O O   . LEU B 2 148 ? 38.294  80.676  -18.485 1.00 9.80   ? 148 LEU T O   1 
ATOM   8139  C CB  . LEU B 2 148 ? 41.605  81.757  -19.309 1.00 9.80   ? 148 LEU T CB  1 
ATOM   8140  C CG  . LEU B 2 148 ? 41.793  82.939  -20.276 1.00 9.80   ? 148 LEU T CG  1 
ATOM   8141  C CD1 . LEU B 2 148 ? 41.757  84.258  -19.506 1.00 9.80   ? 148 LEU T CD1 1 
ATOM   8142  C CD2 . LEU B 2 148 ? 43.103  82.789  -21.016 1.00 9.80   ? 148 LEU T CD2 1 
ATOM   8143  N N   . SER B 2 149 ? 40.205  79.494  -18.583 1.00 47.21  ? 149 SER T N   1 
ATOM   8144  C CA  . SER B 2 149 ? 39.531  78.208  -18.639 1.00 47.21  ? 149 SER T CA  1 
ATOM   8145  C C   . SER B 2 149 ? 38.391  78.113  -17.614 1.00 47.21  ? 149 SER T C   1 
ATOM   8146  O O   . SER B 2 149 ? 37.498  77.281  -17.755 1.00 100.00 ? 149 SER T O   1 
ATOM   8147  C CB  . SER B 2 149 ? 40.540  77.071  -18.429 1.00 100.00 ? 149 SER T CB  1 
ATOM   8148  O OG  . SER B 2 149 ? 41.029  76.586  -19.672 1.00 100.00 ? 149 SER T OG  1 
ATOM   8149  N N   . GLY B 2 150 ? 38.423  78.951  -16.584 1.00 21.05  ? 150 GLY T N   1 
ATOM   8150  C CA  . GLY B 2 150 ? 37.347  78.943  -15.608 1.00 21.05  ? 150 GLY T CA  1 
ATOM   8151  C C   . GLY B 2 150 ? 36.145  79.682  -16.200 1.00 21.05  ? 150 GLY T C   1 
ATOM   8152  O O   . GLY B 2 150 ? 35.495  79.132  -17.113 1.00 38.40  ? 150 GLY T O   1 
ATOM   8153  C CA  . PHE C 3 19  ? 6.538   62.763  5.902   1.00 16.21  ? 19  PHE U CA  1 
ATOM   8154  C CA  . ASP C 3 20  ? 9.211   60.634  7.483   1.00 12.75  ? 20  ASP U CA  1 
ATOM   8155  C CA  . GLU C 3 21  ? 8.853   57.288  9.085   1.00 9.20   ? 21  GLU U CA  1 
ATOM   8156  C CA  . THR C 3 22  ? 10.137  58.964  12.173  1.00 68.65  ? 22  THR U CA  1 
ATOM   8157  C CA  . GLU C 3 23  ? 7.973   62.024  11.910  1.00 18.34  ? 23  GLU U CA  1 
ATOM   8158  C CA  . ILE C 3 24  ? 5.086   59.733  11.605  1.00 19.20  ? 24  ILE U CA  1 
ATOM   8159  C CA  . GLU C 3 25  ? 6.040   57.610  14.592  1.00 23.09  ? 25  GLU U CA  1 
ATOM   8160  C CA  . ASP C 3 26  ? 6.343   60.785  16.700  1.00 1.00   ? 26  ASP U CA  1 
ATOM   8161  C CA  . PHE C 3 27  ? 2.794   61.466  15.711  1.00 8.28   ? 27  PHE U CA  1 
ATOM   8162  C CA  . LYS C 3 28  ? 1.587   58.100  16.470  1.00 6.04   ? 28  LYS U CA  1 
ATOM   8163  C CA  . GLU C 3 29  ? 2.913   58.102  19.959  1.00 29.01  ? 29  GLU U CA  1 
ATOM   8164  C CA  . ALA C 3 30  ? 1.567   61.525  20.241  1.00 7.02   ? 30  ALA U CA  1 
ATOM   8165  C CA  . PHE C 3 31  ? -1.768  60.260  19.052  1.00 7.69   ? 31  PHE U CA  1 
ATOM   8166  C CA  . THR C 3 32  ? -1.587  57.596  21.637  1.00 1.80   ? 32  THR U CA  1 
ATOM   8167  C CA  . VAL C 3 33  ? -0.944  60.003  24.521  1.00 2.28   ? 33  VAL U CA  1 
ATOM   8168  C CA  . ILE C 3 34  ? -4.050  61.917  23.644  1.00 1.00   ? 34  ILE U CA  1 
ATOM   8169  C CA  . ASP C 3 35  ? -6.103  58.804  23.092  1.00 6.03   ? 35  ASP U CA  1 
ATOM   8170  C CA  . GLN C 3 36  ? -6.736  58.160  26.802  1.00 1.00   ? 36  GLN U CA  1 
ATOM   8171  C CA  . ASN C 3 37  ? -8.989  55.207  26.159  1.00 1.00   ? 37  ASN U CA  1 
ATOM   8172  C CA  . ALA C 3 38  ? -6.934  53.031  23.778  1.00 54.62  ? 38  ALA U CA  1 
ATOM   8173  C CA  . ASP C 3 39  ? -10.147 52.766  21.708  1.00 6.41   ? 39  ASP U CA  1 
ATOM   8174  C CA  . GLY C 3 40  ? -8.324  54.081  18.696  1.00 13.40  ? 40  GLY U CA  1 
ATOM   8175  C CA  . ILE C 3 41  ? -10.305 57.277  18.196  1.00 12.50  ? 41  ILE U CA  1 
ATOM   8176  C CA  . ILE C 3 42  ? -9.668  60.756  19.622  1.00 4.39   ? 42  ILE U CA  1 
ATOM   8177  C CA  . ASP C 3 43  ? -12.633 62.571  21.075  1.00 1.00   ? 43  ASP U CA  1 
ATOM   8178  C CA  . LYS C 3 44  ? -13.624 65.307  23.525  1.00 1.00   ? 44  LYS U CA  1 
ATOM   8179  C CA  . ASP C 3 45  ? -13.160 63.034  26.490  1.00 6.40   ? 45  ASP U CA  1 
ATOM   8180  C CA  . ASP C 3 46  ? -9.559  62.297  25.604  1.00 1.00   ? 46  ASP U CA  1 
ATOM   8181  C CA  . LEU C 3 47  ? -8.809  65.934  25.011  1.00 1.00   ? 47  LEU U CA  1 
ATOM   8182  C CA  . ARG C 3 48  ? -10.197 67.137  28.308  1.00 1.00   ? 48  ARG U CA  1 
ATOM   8183  C CA  . GLU C 3 49  ? -8.115  64.625  30.117  1.00 8.94   ? 49  GLU U CA  1 
ATOM   8184  C CA  . THR C 3 50  ? -5.045  65.118  28.000  1.00 2.86   ? 50  THR U CA  1 
ATOM   8185  C CA  . PHE C 3 51  ? -5.216  68.645  29.189  1.00 10.70  ? 51  PHE U CA  1 
ATOM   8186  C CA  . ALA C 3 52  ? -6.112  68.014  32.776  1.00 22.55  ? 52  ALA U CA  1 
ATOM   8187  C CA  . ALA C 3 53  ? -3.079  65.760  32.946  1.00 1.00   ? 53  ALA U CA  1 
ATOM   8188  C CA  . MET C 3 54  ? -0.953  68.622  31.697  1.00 1.00   ? 54  MET U CA  1 
ATOM   8189  C CA  . GLY C 3 55  ? -2.353  71.022  34.257  1.00 1.75   ? 55  GLY U CA  1 
ATOM   8190  C CA  . ARG C 3 56  ? -5.015  72.839  32.303  1.00 1.68   ? 56  ARG U CA  1 
ATOM   8191  C CA  . LEU C 3 57  ? -8.356  72.513  34.048  1.00 71.79  ? 57  LEU U CA  1 
ATOM   8192  C CA  . ASN C 3 58  ? -10.060 75.622  32.763  1.00 75.30  ? 58  ASN U CA  1 
ATOM   8193  C CA  . VAL C 3 59  ? -11.278 73.930  29.624  1.00 9.17   ? 59  VAL U CA  1 
ATOM   8194  C CA  . LYS C 3 60  ? -14.326 75.249  27.839  1.00 31.60  ? 60  LYS U CA  1 
ATOM   8195  C CA  . ASN C 3 61  ? -16.201 73.037  25.422  1.00 1.00   ? 61  ASN U CA  1 
ATOM   8196  C CA  . GLU C 3 62  ? -16.101 75.606  22.640  1.00 1.00   ? 62  GLU U CA  1 
ATOM   8197  C CA  . GLU C 3 63  ? -12.403 74.997  22.700  1.00 35.78  ? 63  GLU U CA  1 
ATOM   8198  C CA  . LEU C 3 64  ? -12.686 71.269  22.822  1.00 1.00   ? 64  LEU U CA  1 
ATOM   8199  C CA  . ASP C 3 65  ? -15.232 71.545  20.015  1.00 1.00   ? 65  ASP U CA  1 
ATOM   8200  C CA  . ALA C 3 66  ? -13.252 73.929  17.947  1.00 2.00   ? 66  ALA U CA  1 
ATOM   8201  C CA  . MET C 3 67  ? -10.413 71.485  17.778  1.00 1.00   ? 67  MET U CA  1 
ATOM   8202  C CA  . ILE C 3 68  ? -12.742 68.721  16.836  1.00 1.00   ? 68  ILE U CA  1 
ATOM   8203  C CA  . LYS C 3 69  ? -14.484 70.537  14.118  1.00 26.73  ? 69  LYS U CA  1 
ATOM   8204  C CA  . GLU C 3 70  ? -11.205 70.594  12.198  1.00 12.03  ? 70  GLU U CA  1 
ATOM   8205  C CA  . ALA C 3 71  ? -12.241 67.261  10.844  1.00 22.91  ? 71  ALA U CA  1 
ATOM   8206  C CA  . SER C 3 72  ? -15.390 65.759  9.256   1.00 50.14  ? 72  SER U CA  1 
ATOM   8207  C CA  . GLY C 3 73  ? -14.914 62.287  10.685  1.00 70.63  ? 73  GLY U CA  1 
ATOM   8208  C CA  . PRO C 3 74  ? -14.171 60.486  13.907  1.00 100.00 ? 74  PRO U CA  1 
ATOM   8209  C CA  . ILE C 3 75  ? -10.566 61.442  14.426  1.00 17.40  ? 75  ILE U CA  1 
ATOM   8210  C CA  . ASN C 3 76  ? -8.705  58.216  13.996  1.00 5.09   ? 76  ASN U CA  1 
ATOM   8211  C CA  . PHE C 3 77  ? -4.979  58.141  13.071  1.00 13.48  ? 77  PHE U CA  1 
ATOM   8212  C CA  . THR C 3 78  ? -5.349  58.689  9.383   1.00 1.00   ? 78  THR U CA  1 
ATOM   8213  C CA  . VAL C 3 79  ? -7.697  61.647  9.827   1.00 55.52  ? 79  VAL U CA  1 
ATOM   8214  C CA  . PHE C 3 80  ? -5.319  63.088  12.367  1.00 8.29   ? 80  PHE U CA  1 
ATOM   8215  C CA  . LEU C 3 81  ? -2.189  62.522  10.344  1.00 1.00   ? 81  LEU U CA  1 
ATOM   8216  C CA  . THR C 3 82  ? -3.960  63.921  7.312   1.00 3.78   ? 82  THR U CA  1 
ATOM   8217  C CA  . MET C 3 83  ? -5.214  66.877  9.287   1.00 2.12   ? 83  MET U CA  1 
ATOM   8218  C CA  . PHE C 3 84  ? -1.738  67.660  10.465  1.00 36.34  ? 84  PHE U CA  1 
ATOM   8219  C CA  . GLY C 3 85  ? -0.056  66.894  7.199   1.00 28.25  ? 85  GLY U CA  1 
ATOM   8220  C CA  . GLU C 3 86  ? -2.186  69.460  5.522   1.00 10.78  ? 86  GLU U CA  1 
ATOM   8221  C CA  . LYS C 3 87  ? -1.226  72.386  7.732   1.00 4.94   ? 87  LYS U CA  1 
ATOM   8222  C CA  . LEU C 3 88  ? 2.514   71.632  7.627   1.00 2.22   ? 88  LEU U CA  1 
ATOM   8223  C CA  . LYS C 3 89  ? 2.635   71.312  3.851   1.00 60.57  ? 89  LYS U CA  1 
ATOM   8224  C CA  . GLY C 3 90  ? 5.955   73.094  3.225   1.00 100.00 ? 90  GLY U CA  1 
ATOM   8225  C CA  . ALA C 3 91  ? 7.544   71.947  6.457   1.00 1.00   ? 91  ALA U CA  1 
ATOM   8226  C CA  . ASP C 3 92  ? 10.580  69.682  6.762   1.00 57.29  ? 92  ASP U CA  1 
ATOM   8227  C CA  . PRO C 3 93  ? 12.402  67.896  9.562   1.00 1.00   ? 93  PRO U CA  1 
ATOM   8228  C CA  . GLU C 3 94  ? 15.001  69.851  11.542  1.00 21.55  ? 94  GLU U CA  1 
ATOM   8229  C CA  . ASP C 3 95  ? 18.219  68.588  9.997   1.00 56.71  ? 95  ASP U CA  1 
ATOM   8230  C CA  . VAL C 3 96  ? 16.862  69.079  6.529   1.00 52.98  ? 96  VAL U CA  1 
ATOM   8231  C CA  . ILE C 3 97  ? 16.403  72.752  7.452   1.00 64.29  ? 97  ILE U CA  1 
ATOM   8232  C CA  . MET C 3 98  ? 19.865  73.150  8.881   1.00 85.37  ? 98  MET U CA  1 
ATOM   8233  C CA  . GLY C 3 99  ? 21.364  72.184  5.531   1.00 28.87  ? 99  GLY U CA  1 
ATOM   8234  C CA  . ALA C 3 100 ? 19.725  75.187  3.878   1.00 30.49  ? 100 ALA U CA  1 
ATOM   8235  C CA  . PHE C 3 101 ? 21.555  77.222  6.358   1.00 61.14  ? 101 PHE U CA  1 
ATOM   8236  C CA  . LYS C 3 102 ? 24.705  75.154  6.264   1.00 100.00 ? 102 LYS U CA  1 
ATOM   8237  C CA  . VAL C 3 103 ? 24.776  75.964  2.591   1.00 37.17  ? 103 VAL U CA  1 
ATOM   8238  C CA  . LEU C 3 104 ? 24.436  79.654  3.353   1.00 44.82  ? 104 LEU U CA  1 
ATOM   8239  C CA  . ASP C 3 105 ? 27.124  79.188  5.957   1.00 1.61   ? 105 ASP U CA  1 
ATOM   8240  C CA  . PRO C 3 106 ? 29.145  77.379  3.283   1.00 100.00 ? 106 PRO U CA  1 
ATOM   8241  C CA  . ASP C 3 107 ? 32.054  78.648  5.294   1.00 100.00 ? 107 ASP U CA  1 
ATOM   8242  C CA  . GLY C 3 108 ? 31.233  76.501  8.259   1.00 100.00 ? 108 GLY U CA  1 
ATOM   8243  C CA  . LYS C 3 109 ? 30.387  77.249  11.814  1.00 100.00 ? 109 LYS U CA  1 
ATOM   8244  C CA  . GLY C 3 110 ? 28.834  80.354  13.271  1.00 100.00 ? 110 GLY U CA  1 
ATOM   8245  C CA  . SER C 3 111 ? 25.843  81.992  11.650  1.00 41.71  ? 111 SER U CA  1 
ATOM   8246  C CA  . ILE C 3 112 ? 24.682  84.441  9.034   1.00 98.84  ? 112 ILE U CA  1 
ATOM   8247  C CA  . LYS C 3 113 ? 23.951  88.184  9.013   1.00 74.32  ? 113 LYS U CA  1 
ATOM   8248  C CA  . LYS C 3 114 ? 20.599  90.043  9.025   1.00 22.97  ? 114 LYS U CA  1 
ATOM   8249  C CA  . SER C 3 115 ? 21.043  91.840  5.708   1.00 84.85  ? 115 SER U CA  1 
ATOM   8250  C CA  . PHE C 3 116 ? 22.652  88.865  4.025   1.00 100.00 ? 116 PHE U CA  1 
ATOM   8251  C CA  . LEU C 3 117 ? 19.432  86.894  4.273   1.00 26.48  ? 117 LEU U CA  1 
ATOM   8252  C CA  . GLU C 3 118 ? 17.164  89.900  4.248   1.00 46.66  ? 118 GLU U CA  1 
ATOM   8253  C CA  . GLU C 3 119 ? 18.144  90.518  0.618   1.00 100.00 ? 119 GLU U CA  1 
ATOM   8254  C CA  . LEU C 3 120 ? 18.204  86.874  -0.312  1.00 34.85  ? 120 LEU U CA  1 
ATOM   8255  C CA  . LEU C 3 121 ? 14.647  86.087  0.791   1.00 22.32  ? 121 LEU U CA  1 
ATOM   8256  C CA  . THR C 3 122 ? 13.577  89.152  -1.147  1.00 39.87  ? 122 THR U CA  1 
ATOM   8257  C CA  . THR C 3 123 ? 15.873  88.618  -4.182  1.00 40.14  ? 123 THR U CA  1 
ATOM   8258  C CA  . GLY C 3 124 ? 14.809  85.148  -5.044  1.00 53.00  ? 124 GLY U CA  1 
ATOM   8259  C CA  . GLY C 3 125 ? 12.483  82.382  -4.053  1.00 77.07  ? 125 GLY U CA  1 
ATOM   8260  C CA  . GLY C 3 126 ? 9.577   84.733  -3.407  1.00 59.33  ? 126 GLY U CA  1 
ATOM   8261  C CA  . PHE C 3 128 ? 9.249   86.756  -0.176  1.00 30.51  ? 128 PHE U CA  1 
ATOM   8262  C CA  . THR C 3 129 ? 7.523   89.919  1.098   1.00 79.51  ? 129 THR U CA  1 
ATOM   8263  C CA  . PRO C 3 130 ? 8.554   92.585  3.658   1.00 100.00 ? 130 PRO U CA  1 
ATOM   8264  C CA  . GLU C 3 131 ? 5.473   92.276  5.856   1.00 100.00 ? 131 GLU U CA  1 
ATOM   8265  C CA  . GLU C 3 132 ? 6.778   88.702  6.005   1.00 25.65  ? 132 GLU U CA  1 
ATOM   8266  C CA  . ILE C 3 133 ? 10.351  89.542  7.022   1.00 74.84  ? 133 ILE U CA  1 
ATOM   8267  C CA  . LYS C 3 134 ? 9.874   91.944  9.939   1.00 96.32  ? 134 LYS U CA  1 
ATOM   8268  C CA  . ASN C 3 135 ? 7.571   89.350  11.412  1.00 100.00 ? 135 ASN U CA  1 
ATOM   8269  C CA  . MET C 3 136 ? 10.528  87.022  11.070  1.00 46.65  ? 136 MET U CA  1 
ATOM   8270  C CA  . TRP C 3 137 ? 13.049  89.207  12.848  1.00 58.33  ? 137 TRP U CA  1 
ATOM   8271  C CA  . ALA C 3 138 ? 10.371  89.751  15.442  1.00 53.09  ? 138 ALA U CA  1 
ATOM   8272  C CA  . ALA C 3 139 ? 9.797   86.039  15.913  1.00 24.62  ? 139 ALA U CA  1 
ATOM   8273  C CA  . PHE C 3 140 ? 13.320  85.119  14.952  1.00 73.19  ? 140 PHE U CA  1 
ATOM   8274  C CA  . PRO C 3 141 ? 15.400  87.934  16.504  1.00 100.00 ? 141 PRO U CA  1 
ATOM   8275  C CA  . VAL C 3 148 ? 21.057  85.298  13.388  1.00 74.78  ? 148 VAL U CA  1 
ATOM   8276  C CA  . ASP C 3 149 ? 21.743  81.975  15.128  1.00 100.00 ? 149 ASP U CA  1 
ATOM   8277  C CA  . TYR C 3 150 ? 19.884  79.696  12.753  1.00 23.84  ? 150 TYR U CA  1 
ATOM   8278  C CA  . LYS C 3 151 ? 20.657  76.623  14.831  1.00 69.27  ? 151 LYS U CA  1 
ATOM   8279  C CA  . ASN C 3 152 ? 18.140  78.099  17.221  1.00 1.76   ? 152 ASN U CA  1 
ATOM   8280  C CA  . ILE C 3 153 ? 15.866  79.105  14.381  1.00 33.65  ? 153 ILE U CA  1 
ATOM   8281  C CA  . CYS C 3 154 ? 15.404  75.463  13.456  1.00 17.60  ? 154 CYS U CA  1 
ATOM   8282  C CA  . TYR C 3 155 ? 14.843  74.115  16.928  1.00 67.56  ? 155 TYR U CA  1 
ATOM   8283  C CA  . VAL C 3 156 ? 11.963  76.469  17.325  1.00 60.88  ? 156 VAL U CA  1 
ATOM   8284  C CA  . ILE C 3 157 ? 10.241  75.613  14.090  1.00 40.84  ? 157 ILE U CA  1 
ATOM   8285  C CA  . THR C 3 158 ? 10.594  71.936  14.860  1.00 11.76  ? 158 THR U CA  1 
ATOM   8286  C CA  . HIS C 3 159 ? 10.367  72.152  18.639  1.00 35.86  ? 159 HIS U CA  1 
ATOM   8287  C CA  . GLY C 3 160 ? 8.030   75.032  19.456  1.00 31.10  ? 160 GLY U CA  1 
ATOM   8288  C CA  . GLU C 3 161 ? 8.243   78.743  20.277  1.00 50.46  ? 161 GLU U CA  1 
ATOM   8289  C CA  . ASP C 3 162 ? 9.746   78.860  23.778  1.00 49.81  ? 162 ASP U CA  1 
ATOM   8290  C CA  . ALA C 3 163 ? 13.088  77.129  23.349  1.00 62.93  ? 163 ALA U CA  1 
ATOM   8291  N N   . ALA D 1 1   ? 85.460  12.189  -15.247 1.00 41.92  ? 2   ALA V N   1 
ATOM   8292  C CA  . ALA D 1 1   ? 84.446  11.145  -14.913 1.00 41.92  ? 2   ALA V CA  1 
ATOM   8293  C C   . ALA D 1 1   ? 83.278  11.806  -14.222 1.00 41.92  ? 2   ALA V C   1 
ATOM   8294  O O   . ALA D 1 1   ? 82.753  11.271  -13.240 1.00 2.00   ? 2   ALA V O   1 
ATOM   8295  C CB  . ALA D 1 1   ? 85.051  10.126  -13.990 1.00 2.00   ? 2   ALA V CB  1 
ATOM   8296  N N   . GLN D 1 2   ? 82.866  12.960  -14.738 1.00 50.43  ? 3   GLN V N   1 
ATOM   8297  C CA  . GLN D 1 2   ? 81.786  13.712  -14.118 1.00 50.43  ? 3   GLN V CA  1 
ATOM   8298  C C   . GLN D 1 2   ? 80.490  13.892  -14.893 1.00 50.43  ? 3   GLN V C   1 
ATOM   8299  O O   . GLN D 1 2   ? 80.404  13.605  -16.091 1.00 94.32  ? 3   GLN V O   1 
ATOM   8300  C CB  . GLN D 1 2   ? 82.306  15.086  -13.690 1.00 94.32  ? 3   GLN V CB  1 
ATOM   8301  C CG  . GLN D 1 2   ? 83.446  15.034  -12.677 1.00 94.32  ? 3   GLN V CG  1 
ATOM   8302  C CD  . GLN D 1 2   ? 82.997  14.575  -11.292 1.00 94.32  ? 3   GLN V CD  1 
ATOM   8303  O OE1 . GLN D 1 2   ? 82.942  13.374  -11.008 1.00 94.32  ? 3   GLN V OE1 1 
ATOM   8304  N NE2 . GLN D 1 2   ? 82.677  15.531  -10.424 1.00 94.32  ? 3   GLN V NE2 1 
ATOM   8305  N N   . LYS D 1 3   ? 79.487  14.371  -14.165 1.00 2.00   ? 4   LYS V N   1 
ATOM   8306  C CA  . LYS D 1 3   ? 78.165  14.624  -14.695 1.00 2.00   ? 4   LYS V CA  1 
ATOM   8307  C C   . LYS D 1 3   ? 78.251  15.283  -16.054 1.00 2.00   ? 4   LYS V C   1 
ATOM   8308  O O   . LYS D 1 3   ? 79.334  15.663  -16.508 1.00 6.43   ? 4   LYS V O   1 
ATOM   8309  C CB  . LYS D 1 3   ? 77.406  15.543  -13.746 1.00 6.43   ? 4   LYS V CB  1 
ATOM   8310  C CG  . LYS D 1 3   ? 76.044  15.049  -13.349 1.00 6.43   ? 4   LYS V CG  1 
ATOM   8311  C CD  . LYS D 1 3   ? 75.735  15.422  -11.915 1.00 6.43   ? 4   LYS V CD  1 
ATOM   8312  C CE  . LYS D 1 3   ? 74.229  15.439  -11.695 1.00 6.43   ? 4   LYS V CE  1 
ATOM   8313  N NZ  . LYS D 1 3   ? 73.834  15.771  -10.292 1.00 6.43   ? 4   LYS V NZ  1 
ATOM   8314  N N   . PRO D 1 4   ? 77.112  15.402  -16.748 1.00 12.75  ? 5   PRO V N   1 
ATOM   8315  C CA  . PRO D 1 4   ? 77.091  16.032  -18.067 1.00 12.75  ? 5   PRO V CA  1 
ATOM   8316  C C   . PRO D 1 4   ? 76.610  17.481  -17.964 1.00 12.75  ? 5   PRO V C   1 
ATOM   8317  O O   . PRO D 1 4   ? 75.781  17.797  -17.124 1.00 28.96  ? 5   PRO V O   1 
ATOM   8318  C CB  . PRO D 1 4   ? 76.123  15.150  -18.846 1.00 28.96  ? 5   PRO V CB  1 
ATOM   8319  C CG  . PRO D 1 4   ? 75.275  14.437  -17.754 1.00 28.96  ? 5   PRO V CG  1 
ATOM   8320  C CD  . PRO D 1 4   ? 75.782  14.886  -16.410 1.00 28.96  ? 5   PRO V CD  1 
ATOM   8321  N N   . LEU D 1 5   ? 77.115  18.353  -18.823 1.00 6.08   ? 6   LEU V N   1 
ATOM   8322  C CA  . LEU D 1 5   ? 76.704  19.744  -18.761 1.00 6.08   ? 6   LEU V CA  1 
ATOM   8323  C C   . LEU D 1 5   ? 75.779  20.270  -19.853 1.00 6.08   ? 6   LEU V C   1 
ATOM   8324  O O   . LEU D 1 5   ? 76.056  20.138  -21.050 1.00 8.35   ? 6   LEU V O   1 
ATOM   8325  C CB  . LEU D 1 5   ? 77.932  20.632  -18.725 1.00 8.35   ? 6   LEU V CB  1 
ATOM   8326  C CG  . LEU D 1 5   ? 79.035  20.062  -17.863 1.00 8.35   ? 6   LEU V CG  1 
ATOM   8327  C CD1 . LEU D 1 5   ? 80.297  20.895  -18.120 1.00 8.35   ? 6   LEU V CD1 1 
ATOM   8328  C CD2 . LEU D 1 5   ? 78.601  20.066  -16.375 1.00 8.35   ? 6   LEU V CD2 1 
ATOM   8329  N N   . SER D 1 6   ? 74.692  20.902  -19.420 1.00 2.00   ? 7   SER V N   1 
ATOM   8330  C CA  . SER D 1 6   ? 73.735  21.493  -20.338 1.00 2.00   ? 7   SER V CA  1 
ATOM   8331  C C   . SER D 1 6   ? 74.464  22.555  -21.134 1.00 2.00   ? 7   SER V C   1 
ATOM   8332  O O   . SER D 1 6   ? 75.350  23.223  -20.621 1.00 12.34  ? 7   SER V O   1 
ATOM   8333  C CB  . SER D 1 6   ? 72.566  22.127  -19.561 1.00 12.34  ? 7   SER V CB  1 
ATOM   8334  O OG  . SER D 1 6   ? 72.261  23.437  -20.020 1.00 12.34  ? 7   SER V OG  1 
ATOM   8335  N N   . ASP D 1 7   ? 74.078  22.702  -22.391 1.00 4.23   ? 8   ASP V N   1 
ATOM   8336  C CA  . ASP D 1 7   ? 74.672  23.683  -23.288 1.00 4.23   ? 8   ASP V CA  1 
ATOM   8337  C C   . ASP D 1 7   ? 74.913  25.013  -22.589 1.00 4.23   ? 8   ASP V C   1 
ATOM   8338  O O   . ASP D 1 7   ? 75.868  25.728  -22.909 1.00 74.23  ? 8   ASP V O   1 
ATOM   8339  C CB  . ASP D 1 7   ? 73.757  23.890  -24.486 1.00 74.23  ? 8   ASP V CB  1 
ATOM   8340  C CG  . ASP D 1 7   ? 72.360  23.371  -24.230 1.00 74.23  ? 8   ASP V CG  1 
ATOM   8341  O OD1 . ASP D 1 7   ? 71.835  23.625  -23.124 1.00 74.23  ? 8   ASP V OD1 1 
ATOM   8342  O OD2 . ASP D 1 7   ? 71.792  22.708  -25.123 1.00 74.23  ? 8   ASP V OD2 1 
ATOM   8343  N N   . ASP D 1 8   ? 74.052  25.336  -21.631 1.00 2.00   ? 9   ASP V N   1 
ATOM   8344  C CA  . ASP D 1 8   ? 74.156  26.577  -20.881 1.00 2.00   ? 9   ASP V CA  1 
ATOM   8345  C C   . ASP D 1 8   ? 75.247  26.516  -19.828 1.00 2.00   ? 9   ASP V C   1 
ATOM   8346  O O   . ASP D 1 8   ? 76.109  27.389  -19.759 1.00 66.51  ? 9   ASP V O   1 
ATOM   8347  C CB  . ASP D 1 8   ? 72.815  26.898  -20.217 1.00 66.51  ? 9   ASP V CB  1 
ATOM   8348  C CG  . ASP D 1 8   ? 71.709  27.138  -21.231 1.00 66.51  ? 9   ASP V CG  1 
ATOM   8349  O OD1 . ASP D 1 8   ? 71.980  26.958  -22.440 1.00 66.51  ? 9   ASP V OD1 1 
ATOM   8350  O OD2 . ASP D 1 8   ? 70.583  27.502  -20.824 1.00 66.51  ? 9   ASP V OD2 1 
ATOM   8351  N N   . GLU D 1 9   ? 75.203  25.483  -19.005 1.00 7.29   ? 10  GLU V N   1 
ATOM   8352  C CA  . GLU D 1 9   ? 76.196  25.318  -17.959 1.00 7.29   ? 10  GLU V CA  1 
ATOM   8353  C C   . GLU D 1 9   ? 77.604  25.383  -18.523 1.00 7.29   ? 10  GLU V C   1 
ATOM   8354  O O   . GLU D 1 9   ? 78.581  25.619  -17.800 1.00 32.51  ? 10  GLU V O   1 
ATOM   8355  C CB  . GLU D 1 9   ? 76.000  23.980  -17.265 1.00 32.51  ? 10  GLU V CB  1 
ATOM   8356  C CG  . GLU D 1 9   ? 74.900  23.996  -16.246 1.00 32.51  ? 10  GLU V CG  1 
ATOM   8357  C CD  . GLU D 1 9   ? 74.009  22.804  -16.381 1.00 32.51  ? 10  GLU V CD  1 
ATOM   8358  O OE1 . GLU D 1 9   ? 74.276  21.979  -17.285 1.00 32.51  ? 10  GLU V OE1 1 
ATOM   8359  O OE2 . GLU D 1 9   ? 73.050  22.691  -15.586 1.00 32.51  ? 10  GLU V OE2 1 
ATOM   8360  N N   . LYS D 1 10  ? 77.693  25.173  -19.828 1.00 15.65  ? 11  LYS V N   1 
ATOM   8361  C CA  . LYS D 1 10  ? 78.970  25.181  -20.512 1.00 15.65  ? 11  LYS V CA  1 
ATOM   8362  C C   . LYS D 1 10  ? 79.490  26.601  -20.623 1.00 15.65  ? 11  LYS V C   1 
ATOM   8363  O O   . LYS D 1 10  ? 80.574  26.851  -21.163 1.00 100.00 ? 11  LYS V O   1 
ATOM   8364  C CB  . LYS D 1 10  ? 78.807  24.532  -21.885 1.00 100.00 ? 11  LYS V CB  1 
ATOM   8365  C CG  . LYS D 1 10  ? 78.113  23.173  -21.813 1.00 100.00 ? 11  LYS V CG  1 
ATOM   8366  C CD  . LYS D 1 10  ? 77.650  22.701  -23.178 1.00 100.00 ? 11  LYS V CD  1 
ATOM   8367  C CE  . LYS D 1 10  ? 78.039  21.249  -23.426 1.00 100.00 ? 11  LYS V CE  1 
ATOM   8368  N NZ  . LYS D 1 10  ? 79.186  21.140  -24.378 1.00 100.00 ? 11  LYS V NZ  1 
ATOM   8369  N N   . PHE D 1 11  ? 78.705  27.527  -20.082 1.00 43.23  ? 12  PHE V N   1 
ATOM   8370  C CA  . PHE D 1 11  ? 79.045  28.941  -20.102 1.00 43.23  ? 12  PHE V CA  1 
ATOM   8371  C C   . PHE D 1 11  ? 79.596  29.451  -18.779 1.00 43.23  ? 12  PHE V C   1 
ATOM   8372  O O   . PHE D 1 11  ? 80.042  30.602  -18.678 1.00 3.50   ? 12  PHE V O   1 
ATOM   8373  C CB  . PHE D 1 11  ? 77.833  29.782  -20.497 1.00 3.50   ? 12  PHE V CB  1 
ATOM   8374  C CG  . PHE D 1 11  ? 77.795  30.092  -21.979 1.00 3.50   ? 12  PHE V CG  1 
ATOM   8375  C CD1 . PHE D 1 11  ? 78.984  30.343  -22.661 1.00 3.50   ? 12  PHE V CD1 1 
ATOM   8376  C CD2 . PHE D 1 11  ? 76.570  30.126  -22.639 1.00 3.50   ? 12  PHE V CD2 1 
ATOM   8377  C CE1 . PHE D 1 11  ? 78.950  30.622  -24.028 1.00 3.50   ? 12  PHE V CE1 1 
ATOM   8378  C CE2 . PHE D 1 11  ? 76.534  30.402  -24.006 1.00 3.50   ? 12  PHE V CE2 1 
ATOM   8379  C CZ  . PHE D 1 11  ? 77.724  30.650  -24.703 1.00 3.50   ? 12  PHE V CZ  1 
ATOM   8380  N N   . LEU D 1 12  ? 79.565  28.607  -17.789 1.00 2.00   ? 13  LEU V N   1 
ATOM   8381  C CA  . LEU D 1 12  ? 80.119  28.952  -16.478 1.00 2.00   ? 13  LEU V CA  1 
ATOM   8382  C C   . LEU D 1 12  ? 80.877  27.750  -15.925 1.00 2.00   ? 13  LEU V C   1 
ATOM   8383  O O   . LEU D 1 12  ? 81.591  27.853  -14.922 1.00 13.98  ? 13  LEU V O   1 
ATOM   8384  C CB  . LEU D 1 12  ? 79.010  29.354  -15.509 1.00 13.98  ? 13  LEU V CB  1 
ATOM   8385  C CG  . LEU D 1 12  ? 78.541  30.803  -15.678 1.00 13.98  ? 13  LEU V CG  1 
ATOM   8386  C CD1 . LEU D 1 12  ? 77.520  31.221  -14.615 1.00 13.98  ? 13  LEU V CD1 1 
ATOM   8387  C CD2 . LEU D 1 12  ? 79.677  31.825  -15.591 1.00 13.98  ? 13  LEU V CD2 1 
ATOM   8388  N N   . PHE D 1 13  ? 80.693  26.633  -16.606 1.00 32.73  ? 14  PHE V N   1 
ATOM   8389  C CA  . PHE D 1 13  ? 81.337  25.367  -16.231 1.00 32.73  ? 14  PHE V CA  1 
ATOM   8390  C C   . PHE D 1 13  ? 82.314  24.923  -17.322 1.00 32.73  ? 14  PHE V C   1 
ATOM   8391  O O   . PHE D 1 13  ? 82.062  25.113  -18.522 1.00 2.00   ? 14  PHE V O   1 
ATOM   8392  C CB  . PHE D 1 13  ? 80.285  24.269  -16.057 1.00 2.00   ? 14  PHE V CB  1 
ATOM   8393  C CG  . PHE D 1 13  ? 79.788  24.120  -14.616 1.00 2.00   ? 14  PHE V CG  1 
ATOM   8394  C CD1 . PHE D 1 13  ? 80.649  23.644  -13.618 1.00 2.00   ? 14  PHE V CD1 1 
ATOM   8395  C CD2 . PHE D 1 13  ? 78.468  24.456  -14.300 1.00 2.00   ? 14  PHE V CD2 1 
ATOM   8396  C CE1 . PHE D 1 13  ? 80.182  23.499  -12.305 1.00 2.00   ? 14  PHE V CE1 1 
ATOM   8397  C CE2 . PHE D 1 13  ? 78.003  24.313  -12.989 1.00 2.00   ? 14  PHE V CE2 1 
ATOM   8398  C CZ  . PHE D 1 13  ? 78.858  23.832  -11.990 1.00 2.00   ? 14  PHE V CZ  1 
ATOM   8399  N N   . VAL D 1 14  ? 83.406  24.335  -16.873 1.00 6.86   ? 15  VAL V N   1 
ATOM   8400  C CA  . VAL D 1 14  ? 84.461  23.830  -17.764 1.00 6.86   ? 15  VAL V CA  1 
ATOM   8401  C C   . VAL D 1 14  ? 84.130  22.408  -18.214 1.00 6.86   ? 15  VAL V C   1 
ATOM   8402  O O   . VAL D 1 14  ? 83.717  21.561  -17.410 1.00 4.14   ? 15  VAL V O   1 
ATOM   8403  C CB  . VAL D 1 14  ? 85.804  23.782  -17.027 1.00 4.14   ? 15  VAL V CB  1 
ATOM   8404  C CG1 . VAL D 1 14  ? 86.696  24.988  -17.330 1.00 4.14   ? 15  VAL V CG1 1 
ATOM   8405  C CG2 . VAL D 1 14  ? 85.651  23.751  -15.506 1.00 4.14   ? 15  VAL V CG2 1 
ATOM   8406  N N   . ASP D 1 15  ? 84.321  22.187  -19.495 1.00 43.90  ? 16  ASP V N   1 
ATOM   8407  C CA  . ASP D 1 15  ? 84.091  20.880  -20.115 1.00 43.90  ? 16  ASP V CA  1 
ATOM   8408  C C   . ASP D 1 15  ? 85.340  20.028  -19.912 1.00 43.90  ? 16  ASP V C   1 
ATOM   8409  O O   . ASP D 1 15  ? 86.380  20.256  -20.547 1.00 100.00 ? 16  ASP V O   1 
ATOM   8410  C CB  . ASP D 1 15  ? 83.769  21.087  -21.586 1.00 100.00 ? 16  ASP V CB  1 
ATOM   8411  C CG  . ASP D 1 15  ? 82.515  21.935  -21.755 1.00 100.00 ? 16  ASP V CG  1 
ATOM   8412  O OD1 . ASP D 1 15  ? 81.662  22.003  -20.789 1.00 100.00 ? 16  ASP V OD1 1 
ATOM   8413  O OD2 . ASP D 1 15  ? 82.310  22.577  -22.848 1.00 100.00 ? 16  ASP V OD2 1 
ATOM   8414  N N   . LYS D 1 16  ? 85.196  19.064  -19.019 1.00 42.87  ? 17  LYS V N   1 
ATOM   8415  C CA  . LYS D 1 16  ? 86.308  18.192  -18.621 1.00 42.87  ? 17  LYS V CA  1 
ATOM   8416  C C   . LYS D 1 16  ? 86.067  16.715  -18.952 1.00 42.87  ? 17  LYS V C   1 
ATOM   8417  O O   . LYS D 1 16  ? 86.991  15.891  -18.919 1.00 66.58  ? 17  LYS V O   1 
ATOM   8418  C CB  . LYS D 1 16  ? 86.524  18.274  -17.109 1.00 66.58  ? 17  LYS V CB  1 
ATOM   8419  C CG  . LYS D 1 16  ? 87.560  19.321  -16.703 1.00 66.58  ? 17  LYS V CG  1 
ATOM   8420  C CD  . LYS D 1 16  ? 87.811  19.350  -15.193 1.00 66.58  ? 17  LYS V CD  1 
ATOM   8421  C CE  . LYS D 1 16  ? 87.445  18.034  -14.502 1.00 66.58  ? 17  LYS V CE  1 
ATOM   8422  N NZ  . LYS D 1 16  ? 86.579  18.220  -13.330 1.00 66.58  ? 17  LYS V NZ  1 
ATOM   8423  N N   . ASN D 1 17  ? 84.836  16.371  -19.261 1.00 98.92  ? 18  ASN V N   1 
ATOM   8424  C CA  . ASN D 1 17  ? 84.504  14.972  -19.567 1.00 98.92  ? 18  ASN V CA  1 
ATOM   8425  C C   . ASN D 1 17  ? 84.900  14.639  -21.007 1.00 98.92  ? 18  ASN V C   1 
ATOM   8426  O O   . ASN D 1 17  ? 84.111  14.830  -21.947 1.00 100.00 ? 18  ASN V O   1 
ATOM   8427  C CB  . ASN D 1 17  ? 83.021  14.712  -19.330 1.00 100.00 ? 18  ASN V CB  1 
ATOM   8428  C CG  . ASN D 1 17  ? 82.784  13.874  -18.069 1.00 100.00 ? 18  ASN V CG  1 
ATOM   8429  O OD1 . ASN D 1 17  ? 83.399  14.134  -17.034 1.00 100.00 ? 18  ASN V OD1 1 
ATOM   8430  N ND2 . ASN D 1 17  ? 81.930  12.870  -18.089 1.00 100.00 ? 18  ASN V ND2 1 
ATOM   8431  N N   . PHE D 1 18  ? 86.127  14.152  -21.093 1.00 93.58  ? 19  PHE V N   1 
ATOM   8432  C CA  . PHE D 1 18  ? 86.774  13.738  -22.347 1.00 93.58  ? 19  PHE V CA  1 
ATOM   8433  C C   . PHE D 1 18  ? 87.731  12.575  -22.061 1.00 93.58  ? 19  PHE V C   1 
ATOM   8434  O O   . PHE D 1 18  ? 87.812  12.080  -20.926 1.00 92.32  ? 19  PHE V O   1 
ATOM   8435  C CB  . PHE D 1 18  ? 87.575  14.906  -22.931 1.00 92.32  ? 19  PHE V CB  1 
ATOM   8436  C CG  . PHE D 1 18  ? 86.695  15.977  -23.577 1.00 92.32  ? 19  PHE V CG  1 
ATOM   8437  C CD1 . PHE D 1 18  ? 85.347  15.710  -23.837 1.00 92.32  ? 19  PHE V CD1 1 
ATOM   8438  C CD2 . PHE D 1 18  ? 87.239  17.224  -23.909 1.00 92.32  ? 19  PHE V CD2 1 
ATOM   8439  C CE1 . PHE D 1 18  ? 84.541  16.689  -24.432 1.00 92.32  ? 19  PHE V CE1 1 
ATOM   8440  C CE2 . PHE D 1 18  ? 86.434  18.203  -24.503 1.00 92.32  ? 19  PHE V CE2 1 
ATOM   8441  C CZ  . PHE D 1 18  ? 85.086  17.935  -24.766 1.00 92.32  ? 19  PHE V CZ  1 
ATOM   8442  N N   . VAL D 1 19  ? 88.435  12.169  -23.102 1.00 73.93  ? 20  VAL V N   1 
ATOM   8443  C CA  . VAL D 1 19  ? 89.414  11.072  -23.021 1.00 73.93  ? 20  VAL V CA  1 
ATOM   8444  C C   . VAL D 1 19  ? 90.775  11.617  -22.594 1.00 73.93  ? 20  VAL V C   1 
ATOM   8445  O O   . VAL D 1 19  ? 91.130  12.762  -22.907 1.00 33.41  ? 20  VAL V O   1 
ATOM   8446  C CB  . VAL D 1 19  ? 89.571  10.394  -24.383 1.00 33.41  ? 20  VAL V CB  1 
ATOM   8447  C CG1 . VAL D 1 19  ? 90.262  11.285  -25.417 1.00 33.41  ? 20  VAL V CG1 1 
ATOM   8448  C CG2 . VAL D 1 19  ? 90.406  9.112   -24.319 1.00 33.41  ? 20  VAL V CG2 1 
ATOM   8449  N N   . ASN D 1 20  ? 91.500  10.772  -21.888 1.00 49.28  ? 21  ASN V N   1 
ATOM   8450  C CA  . ASN D 1 20  ? 92.831  11.120  -21.383 1.00 49.28  ? 21  ASN V CA  1 
ATOM   8451  C C   . ASN D 1 20  ? 93.876  11.005  -22.496 1.00 49.28  ? 21  ASN V C   1 
ATOM   8452  O O   . ASN D 1 20  ? 94.879  10.289  -22.360 1.00 100.00 ? 21  ASN V O   1 
ATOM   8453  C CB  . ASN D 1 20  ? 93.237  10.192  -20.234 1.00 100.00 ? 21  ASN V CB  1 
ATOM   8454  C CG  . ASN D 1 20  ? 92.342  8.960   -20.101 1.00 100.00 ? 21  ASN V CG  1 
ATOM   8455  O OD1 . ASN D 1 20  ? 91.165  9.090   -19.772 1.00 100.00 ? 21  ASN V OD1 1 
ATOM   8456  N ND2 . ASN D 1 20  ? 92.834  7.758   -20.334 1.00 100.00 ? 21  ASN V ND2 1 
ATOM   8457  N N   . ASN D 1 21  ? 93.630  11.719  -23.594 1.00 100.00 ? 22  ASN V N   1 
ATOM   8458  C CA  . ASN D 1 21  ? 94.532  11.716  -24.742 1.00 100.00 ? 22  ASN V CA  1 
ATOM   8459  C C   . ASN D 1 21  ? 95.985  11.980  -24.344 1.00 100.00 ? 22  ASN V C   1 
ATOM   8460  O O   . ASN D 1 21  ? 96.287  12.920  -23.601 1.00 100.00 ? 22  ASN V O   1 
ATOM   8461  C CB  . ASN D 1 21  ? 94.089  12.763  -25.772 1.00 100.00 ? 22  ASN V CB  1 
ATOM   8462  C CG  . ASN D 1 21  ? 95.004  13.991  -25.793 1.00 100.00 ? 22  ASN V CG  1 
ATOM   8463  O OD1 . ASN D 1 21  ? 95.706  14.240  -26.773 1.00 100.00 ? 22  ASN V OD1 1 
ATOM   8464  N ND2 . ASN D 1 21  ? 94.995  14.760  -24.708 1.00 100.00 ? 22  ASN V ND2 1 
ATOM   8465  N N   . PRO D 1 22  ? 96.901  11.124  -24.814 1.00 100.00 ? 23  PRO V N   1 
ATOM   8466  C CA  . PRO D 1 22  ? 98.326  11.252  -24.525 1.00 100.00 ? 23  PRO V CA  1 
ATOM   8467  C C   . PRO D 1 22  ? 99.041  12.022  -25.612 1.00 100.00 ? 23  PRO V C   1 
ATOM   8468  O O   . PRO D 1 22  ? 100.310 12.054  -25.613 1.00 60.20  ? 23  PRO V O   1 
ATOM   8469  C CB  . PRO D 1 22  ? 98.808  9.800   -24.445 1.00 60.20  ? 23  PRO V CB  1 
ATOM   8470  C CG  . PRO D 1 22  ? 97.681  8.958   -25.001 1.00 60.20  ? 23  PRO V CG  1 
ATOM   8471  C CD  . PRO D 1 22  ? 96.668  9.902   -25.574 1.00 60.20  ? 23  PRO V CD  1 
ATOM   8472  N N   . LEU D 1 23  ? 98.270  12.621  -26.510 1.00 100.00 ? 24  LEU V N   1 
ATOM   8473  C CA  . LEU D 1 23  ? 98.843  13.436  -27.602 1.00 100.00 ? 24  LEU V CA  1 
ATOM   8474  C C   . LEU D 1 23  ? 99.626  14.603  -26.992 1.00 100.00 ? 24  LEU V C   1 
ATOM   8475  O O   . LEU D 1 23  ? 100.801 14.836  -27.312 1.00 100.00 ? 24  LEU V O   1 
ATOM   8476  C CB  . LEU D 1 23  ? 97.748  14.038  -28.491 1.00 100.00 ? 24  LEU V CB  1 
ATOM   8477  C CG  . LEU D 1 23  ? 96.908  13.021  -29.278 1.00 100.00 ? 24  LEU V CG  1 
ATOM   8478  C CD1 . LEU D 1 23  ? 96.850  13.333  -30.780 1.00 100.00 ? 24  LEU V CD1 1 
ATOM   8479  C CD2 . LEU D 1 23  ? 97.414  11.585  -29.168 1.00 100.00 ? 24  LEU V CD2 1 
ATOM   8480  N N   . ALA D 1 24  ? 98.934  15.315  -26.123 1.00 72.86  ? 25  ALA V N   1 
ATOM   8481  C CA  . ALA D 1 24  ? 99.508  16.457  -25.407 1.00 72.86  ? 25  ALA V CA  1 
ATOM   8482  C C   . ALA D 1 24  ? 100.454 15.936  -24.329 1.00 72.86  ? 25  ALA V C   1 
ATOM   8483  O O   . ALA D 1 24  ? 101.537 16.489  -24.103 1.00 77.89  ? 25  ALA V O   1 
ATOM   8484  C CB  . ALA D 1 24  ? 98.398  17.285  -24.757 1.00 77.89  ? 25  ALA V CB  1 
ATOM   8485  N N   . GLN D 1 25  ? 100.015 14.865  -23.697 1.00 62.54  ? 26  GLN V N   1 
ATOM   8486  C CA  . GLN D 1 25  ? 100.773 14.218  -22.621 1.00 62.54  ? 26  GLN V CA  1 
ATOM   8487  C C   . GLN D 1 25  ? 102.047 13.569  -23.174 1.00 62.54  ? 26  GLN V C   1 
ATOM   8488  O O   . GLN D 1 25  ? 102.918 13.118  -22.420 1.00 100.00 ? 26  GLN V O   1 
ATOM   8489  C CB  . GLN D 1 25  ? 99.926  13.140  -21.945 1.00 100.00 ? 26  GLN V CB  1 
ATOM   8490  C CG  . GLN D 1 25  ? 100.563 12.599  -20.663 1.00 100.00 ? 26  GLN V CG  1 
ATOM   8491  C CD  . GLN D 1 25  ? 101.058 11.161  -20.814 1.00 100.00 ? 26  GLN V CD  1 
ATOM   8492  O OE1 . GLN D 1 25  ? 100.756 10.314  -19.973 1.00 100.00 ? 26  GLN V OE1 1 
ATOM   8493  N NE2 . GLN D 1 25  ? 101.811 10.831  -21.847 1.00 100.00 ? 26  GLN V NE2 1 
ATOM   8494  N N   . ALA D 1 26  ? 102.146 13.528  -24.488 1.00 91.41  ? 27  ALA V N   1 
ATOM   8495  C CA  . ALA D 1 26  ? 103.321 12.944  -25.153 1.00 91.41  ? 27  ALA V CA  1 
ATOM   8496  C C   . ALA D 1 26  ? 104.180 14.054  -25.758 1.00 91.41  ? 27  ALA V C   1 
ATOM   8497  O O   . ALA D 1 26  ? 105.417 14.008  -25.715 1.00 74.16  ? 27  ALA V O   1 
ATOM   8498  C CB  . ALA D 1 26  ? 102.887 11.981  -26.255 1.00 74.16  ? 27  ALA V CB  1 
ATOM   8499  N N   . ASP D 1 27  ? 103.496 15.034  -26.310 1.00 94.64  ? 28  ASP V N   1 
ATOM   8500  C CA  . ASP D 1 27  ? 104.144 16.185  -26.946 1.00 94.64  ? 28  ASP V CA  1 
ATOM   8501  C C   . ASP D 1 27  ? 105.040 16.922  -25.941 1.00 94.64  ? 28  ASP V C   1 
ATOM   8502  O O   . ASP D 1 27  ? 105.944 17.678  -26.324 1.00 95.46  ? 28  ASP V O   1 
ATOM   8503  C CB  . ASP D 1 27  ? 103.088 17.156  -27.473 1.00 95.46  ? 28  ASP V CB  1 
ATOM   8504  C CG  . ASP D 1 27  ? 103.632 18.086  -28.551 1.00 95.46  ? 28  ASP V CG  1 
ATOM   8505  O OD1 . ASP D 1 27  ? 104.878 18.416  -28.543 1.00 95.46  ? 28  ASP V OD1 1 
ATOM   8506  O OD2 . ASP D 1 27  ? 102.846 18.537  -29.465 1.00 95.46  ? 28  ASP V OD2 1 
ATOM   8507  N N   . TRP D 1 28  ? 104.764 16.674  -24.672 1.00 100.00 ? 29  TRP V N   1 
ATOM   8508  C CA  . TRP D 1 28  ? 105.481 17.309  -23.549 1.00 100.00 ? 29  TRP V CA  1 
ATOM   8509  C C   . TRP D 1 28  ? 107.003 17.201  -23.717 1.00 100.00 ? 29  TRP V C   1 
ATOM   8510  O O   . TRP D 1 28  ? 107.764 18.011  -23.169 1.00 93.48  ? 29  TRP V O   1 
ATOM   8511  C CB  . TRP D 1 28  ? 105.090 16.650  -22.221 1.00 93.48  ? 29  TRP V CB  1 
ATOM   8512  C CG  . TRP D 1 28  ? 105.753 15.288  -21.990 1.00 93.48  ? 29  TRP V CG  1 
ATOM   8513  C CD1 . TRP D 1 28  ? 105.584 14.179  -22.722 1.00 93.48  ? 29  TRP V CD1 1 
ATOM   8514  C CD2 . TRP D 1 28  ? 106.669 14.987  -20.945 1.00 93.48  ? 29  TRP V CD2 1 
ATOM   8515  N NE1 . TRP D 1 28  ? 106.387 13.155  -22.126 1.00 93.48  ? 29  TRP V NE1 1 
ATOM   8516  C CE2 . TRP D 1 28  ? 107.011 13.648  -21.084 1.00 93.48  ? 29  TRP V CE2 1 
ATOM   8517  C CE3 . TRP D 1 28  ? 107.226 15.728  -19.895 1.00 93.48  ? 29  TRP V CE3 1 
ATOM   8518  C CZ2 . TRP D 1 28  ? 107.886 12.987  -20.210 1.00 93.48  ? 29  TRP V CZ2 1 
ATOM   8519  C CZ3 . TRP D 1 28  ? 108.111 15.055  -19.025 1.00 93.48  ? 29  TRP V CZ3 1 
ATOM   8520  C CH2 . TRP D 1 28  ? 108.423 13.748  -19.177 1.00 93.48  ? 29  TRP V CH2 1 
ATOM   8521  N N   . SER D 1 29  ? 107.420 16.202  -24.472 1.00 68.50  ? 30  SER V N   1 
ATOM   8522  C CA  . SER D 1 29  ? 108.852 15.951  -24.720 1.00 68.50  ? 30  SER V CA  1 
ATOM   8523  C C   . SER D 1 29  ? 109.496 17.186  -25.359 1.00 68.50  ? 30  SER V C   1 
ATOM   8524  O O   . SER D 1 29  ? 110.688 17.466  -25.162 1.00 80.26  ? 30  SER V O   1 
ATOM   8525  C CB  . SER D 1 29  ? 109.017 14.738  -25.629 1.00 80.26  ? 30  SER V CB  1 
ATOM   8526  O OG  . SER D 1 29  ? 108.488 13.584  -24.988 1.00 80.26  ? 30  SER V OG  1 
ATOM   8527  N N   . ALA D 1 30  ? 108.692 17.899  -26.124 1.00 100.00 ? 31  ALA V N   1 
ATOM   8528  C CA  . ALA D 1 30  ? 109.131 19.147  -26.753 1.00 100.00 ? 31  ALA V CA  1 
ATOM   8529  C C   . ALA D 1 30  ? 109.262 20.187  -25.647 1.00 100.00 ? 31  ALA V C   1 
ATOM   8530  O O   . ALA D 1 30  ? 108.979 21.374  -25.845 1.00 7.72   ? 31  ALA V O   1 
ATOM   8531  C CB  . ALA D 1 30  ? 108.106 19.605  -27.794 1.00 7.72   ? 31  ALA V CB  1 
ATOM   8532  N N   . LYS D 1 31  ? 109.680 19.673  -24.507 1.00 91.08  ? 32  LYS V N   1 
ATOM   8533  C CA  . LYS D 1 31  ? 109.857 20.460  -23.284 1.00 91.08  ? 32  LYS V CA  1 
ATOM   8534  C C   . LYS D 1 31  ? 110.298 21.885  -23.617 1.00 91.08  ? 32  LYS V C   1 
ATOM   8535  O O   . LYS D 1 31  ? 109.946 22.843  -22.918 1.00 100.00 ? 32  LYS V O   1 
ATOM   8536  C CB  . LYS D 1 31  ? 110.903 19.800  -22.388 1.00 100.00 ? 32  LYS V CB  1 
ATOM   8537  C CG  . LYS D 1 31  ? 110.472 18.414  -21.903 1.00 100.00 ? 32  LYS V CG  1 
ATOM   8538  C CD  . LYS D 1 31  ? 111.371 17.869  -20.797 1.00 100.00 ? 32  LYS V CD  1 
ATOM   8539  C CE  . LYS D 1 31  ? 110.957 16.475  -20.328 1.00 100.00 ? 32  LYS V CE  1 
ATOM   8540  N NZ  . LYS D 1 31  ? 111.827 15.948  -19.268 1.00 100.00 ? 32  LYS V NZ  1 
ATOM   8541  N N   . LYS D 1 32  ? 111.059 22.000  -24.683 1.00 59.52  ? 33  LYS V N   1 
ATOM   8542  C CA  . LYS D 1 32  ? 111.586 23.296  -25.130 1.00 59.52  ? 33  LYS V CA  1 
ATOM   8543  C C   . LYS D 1 32  ? 110.452 24.247  -25.486 1.00 59.52  ? 33  LYS V C   1 
ATOM   8544  O O   . LYS D 1 32  ? 110.695 25.334  -26.000 1.00 63.44  ? 33  LYS V O   1 
ATOM   8545  C CB  . LYS D 1 32  ? 112.479 23.102  -26.355 1.00 63.44  ? 33  LYS V CB  1 
ATOM   8546  C CG  . LYS D 1 32  ? 113.767 22.343  -26.033 1.00 63.44  ? 33  LYS V CG  1 
ATOM   8547  C CD  . LYS D 1 32  ? 114.328 22.681  -24.651 1.00 63.44  ? 33  LYS V CD  1 
ATOM   8548  C CE  . LYS D 1 32  ? 113.867 21.712  -23.564 1.00 63.44  ? 33  LYS V CE  1 
ATOM   8549  N NZ  . LYS D 1 32  ? 113.457 22.391  -22.326 1.00 63.44  ? 33  LYS V NZ  1 
ATOM   8550  N N   . LEU D 1 33  ? 109.213 23.843  -25.209 1.00 17.85  ? 34  LEU V N   1 
ATOM   8551  C CA  . LEU D 1 33  ? 108.058 24.669  -25.509 1.00 17.85  ? 34  LEU V CA  1 
ATOM   8552  C C   . LEU D 1 33  ? 108.013 25.869  -24.582 1.00 17.85  ? 34  LEU V C   1 
ATOM   8553  O O   . LEU D 1 33  ? 108.056 25.732  -23.354 1.00 37.41  ? 34  LEU V O   1 
ATOM   8554  C CB  . LEU D 1 33  ? 106.790 23.840  -25.376 1.00 37.41  ? 34  LEU V CB  1 
ATOM   8555  C CG  . LEU D 1 33  ? 106.385 23.260  -26.724 1.00 37.41  ? 34  LEU V CG  1 
ATOM   8556  C CD1 . LEU D 1 33  ? 105.449 22.108  -26.473 1.00 37.41  ? 34  LEU V CD1 1 
ATOM   8557  C CD2 . LEU D 1 33  ? 105.738 24.333  -27.604 1.00 37.41  ? 34  LEU V CD2 1 
ATOM   8558  N N   . VAL D 1 34  ? 107.943 27.051  -25.181 1.00 39.73  ? 35  VAL V N   1 
ATOM   8559  C CA  . VAL D 1 34  ? 107.914 28.292  -24.416 1.00 39.73  ? 35  VAL V CA  1 
ATOM   8560  C C   . VAL D 1 34  ? 106.963 29.290  -25.023 1.00 39.73  ? 35  VAL V C   1 
ATOM   8561  O O   . VAL D 1 34  ? 106.260 29.003  -25.972 1.00 4.05   ? 35  VAL V O   1 
ATOM   8562  C CB  . VAL D 1 34  ? 109.310 28.971  -24.359 1.00 4.05   ? 35  VAL V CB  1 
ATOM   8563  C CG1 . VAL D 1 34  ? 110.352 27.969  -23.880 1.00 4.05   ? 35  VAL V CG1 1 
ATOM   8564  C CG2 . VAL D 1 34  ? 109.681 29.535  -25.732 1.00 4.05   ? 35  VAL V CG2 1 
ATOM   8565  N N   . TRP D 1 35  ? 106.963 30.482  -24.461 1.00 17.93  ? 36  TRP V N   1 
ATOM   8566  C CA  . TRP D 1 35  ? 106.107 31.541  -24.938 1.00 17.93  ? 36  TRP V CA  1 
ATOM   8567  C C   . TRP D 1 35  ? 107.018 32.607  -25.486 1.00 17.93  ? 36  TRP V C   1 
ATOM   8568  O O   . TRP D 1 35  ? 108.128 32.766  -25.000 1.00 4.34   ? 36  TRP V O   1 
ATOM   8569  C CB  . TRP D 1 35  ? 105.293 32.106  -23.778 1.00 4.34   ? 36  TRP V CB  1 
ATOM   8570  C CG  . TRP D 1 35  ? 104.199 31.181  -23.347 1.00 4.34   ? 36  TRP V CG  1 
ATOM   8571  C CD1 . TRP D 1 35  ? 104.174 30.377  -22.234 1.00 4.34   ? 36  TRP V CD1 1 
ATOM   8572  C CD2 . TRP D 1 35  ? 102.957 30.966  -24.021 1.00 4.34   ? 36  TRP V CD2 1 
ATOM   8573  N NE1 . TRP D 1 35  ? 102.990 29.682  -22.178 1.00 4.34   ? 36  TRP V NE1 1 
ATOM   8574  C CE2 . TRP D 1 35  ? 102.224 30.028  -23.263 1.00 4.34   ? 36  TRP V CE2 1 
ATOM   8575  C CE3 . TRP D 1 35  ? 102.390 31.477  -25.193 1.00 4.34   ? 36  TRP V CE3 1 
ATOM   8576  C CZ2 . TRP D 1 35  ? 100.953 29.590  -23.647 1.00 4.34   ? 36  TRP V CZ2 1 
ATOM   8577  C CZ3 . TRP D 1 35  ? 101.128 31.038  -25.567 1.00 4.34   ? 36  TRP V CZ3 1 
ATOM   8578  C CH2 . TRP D 1 35  ? 100.424 30.108  -24.794 1.00 4.34   ? 36  TRP V CH2 1 
ATOM   8579  N N   . VAL D 1 36  ? 106.576 33.329  -26.504 1.00 16.82  ? 37  VAL V N   1 
ATOM   8580  C CA  . VAL D 1 36  ? 107.408 34.387  -27.057 1.00 16.82  ? 37  VAL V CA  1 
ATOM   8581  C C   . VAL D 1 36  ? 106.623 35.438  -27.815 1.00 16.82  ? 37  VAL V C   1 
ATOM   8582  O O   . VAL D 1 36  ? 105.512 35.203  -28.266 1.00 5.83   ? 37  VAL V O   1 
ATOM   8583  C CB  . VAL D 1 36  ? 108.491 33.836  -27.992 1.00 5.83   ? 37  VAL V CB  1 
ATOM   8584  C CG1 . VAL D 1 36  ? 109.840 33.942  -27.321 1.00 5.83   ? 37  VAL V CG1 1 
ATOM   8585  C CG2 . VAL D 1 36  ? 108.191 32.411  -28.332 1.00 5.83   ? 37  VAL V CG2 1 
ATOM   8586  N N   . PRO D 1 37  ? 107.203 36.628  -27.944 1.00 2.00   ? 38  PRO V N   1 
ATOM   8587  C CA  . PRO D 1 37  ? 106.638 37.784  -28.631 1.00 2.00   ? 38  PRO V CA  1 
ATOM   8588  C C   . PRO D 1 37  ? 105.735 37.456  -29.799 1.00 2.00   ? 38  PRO V C   1 
ATOM   8589  O O   . PRO D 1 37  ? 105.794 36.365  -30.360 1.00 100.00 ? 38  PRO V O   1 
ATOM   8590  C CB  . PRO D 1 37  ? 107.871 38.574  -29.075 1.00 100.00 ? 38  PRO V CB  1 
ATOM   8591  C CG  . PRO D 1 37  ? 109.064 37.935  -28.347 1.00 100.00 ? 38  PRO V CG  1 
ATOM   8592  C CD  . PRO D 1 37  ? 108.519 36.949  -27.369 1.00 100.00 ? 38  PRO V CD  1 
ATOM   8593  N N   . SER D 1 38  ? 104.906 38.428  -30.163 1.00 39.27  ? 39  SER V N   1 
ATOM   8594  C CA  . SER D 1 38  ? 103.969 38.283  -31.272 1.00 39.27  ? 39  SER V CA  1 
ATOM   8595  C C   . SER D 1 38  ? 103.222 39.590  -31.495 1.00 39.27  ? 39  SER V C   1 
ATOM   8596  O O   . SER D 1 38  ? 102.382 39.986  -30.687 1.00 53.47  ? 39  SER V O   1 
ATOM   8597  C CB  . SER D 1 38  ? 102.968 37.166  -30.976 1.00 53.47  ? 39  SER V CB  1 
ATOM   8598  O OG  . SER D 1 38  ? 101.974 37.105  -31.982 1.00 53.47  ? 39  SER V OG  1 
ATOM   8599  N N   . GLU D 1 39  ? 103.529 40.264  -32.595 1.00 67.42  ? 40  GLU V N   1 
ATOM   8600  C CA  . GLU D 1 39  ? 102.878 41.529  -32.905 1.00 67.42  ? 40  GLU V CA  1 
ATOM   8601  C C   . GLU D 1 39  ? 101.412 41.319  -33.262 1.00 67.42  ? 40  GLU V C   1 
ATOM   8602  O O   . GLU D 1 39  ? 100.745 42.239  -33.731 1.00 98.94  ? 40  GLU V O   1 
ATOM   8603  C CB  . GLU D 1 39  ? 103.602 42.220  -34.065 1.00 98.94  ? 40  GLU V CB  1 
ATOM   8604  C CG  . GLU D 1 39  ? 104.325 43.504  -33.674 1.00 98.94  ? 40  GLU V CG  1 
ATOM   8605  C CD  . GLU D 1 39  ? 105.050 44.143  -34.843 1.00 98.94  ? 40  GLU V CD  1 
ATOM   8606  O OE1 . GLU D 1 39  ? 106.236 43.808  -35.076 1.00 98.94  ? 40  GLU V OE1 1 
ATOM   8607  O OE2 . GLU D 1 39  ? 104.430 44.982  -35.531 1.00 98.94  ? 40  GLU V OE2 1 
ATOM   8608  N N   . LYS D 1 40  ? 100.912 40.110  -33.030 1.00 62.88  ? 41  LYS V N   1 
ATOM   8609  C CA  . LYS D 1 40  ? 99.525  39.793  -33.345 1.00 62.88  ? 41  LYS V CA  1 
ATOM   8610  C C   . LYS D 1 40  ? 98.851  38.837  -32.350 1.00 62.88  ? 41  LYS V C   1 
ATOM   8611  O O   . LYS D 1 40  ? 97.627  38.656  -32.383 1.00 100.00 ? 41  LYS V O   1 
ATOM   8612  C CB  . LYS D 1 40  ? 99.441  39.201  -34.757 1.00 100.00 ? 41  LYS V CB  1 
ATOM   8613  C CG  . LYS D 1 40  ? 99.001  40.204  -35.824 1.00 100.00 ? 41  LYS V CG  1 
ATOM   8614  C CD  . LYS D 1 40  ? 97.475  40.346  -35.877 1.00 100.00 ? 41  LYS V CD  1 
ATOM   8615  C CE  . LYS D 1 40  ? 96.953  40.330  -37.317 1.00 100.00 ? 41  LYS V CE  1 
ATOM   8616  N NZ  . LYS D 1 40  ? 96.431  38.982  -37.743 1.00 100.00 ? 41  LYS V NZ  1 
ATOM   8617  N N   . HIS D 1 41  ? 99.645  38.233  -31.466 1.00 26.66  ? 42  HIS V N   1 
ATOM   8618  C CA  . HIS D 1 41  ? 99.120  37.305  -30.461 1.00 26.66  ? 42  HIS V CA  1 
ATOM   8619  C C   . HIS D 1 41  ? 99.641  37.676  -29.083 1.00 26.66  ? 42  HIS V C   1 
ATOM   8620  O O   . HIS D 1 41  ? 99.349  37.008  -28.097 1.00 92.36  ? 42  HIS V O   1 
ATOM   8621  C CB  . HIS D 1 41  ? 99.553  35.879  -30.785 1.00 92.36  ? 42  HIS V CB  1 
ATOM   8622  C CG  . HIS D 1 41  ? 98.885  35.302  -31.990 1.00 92.36  ? 42  HIS V CG  1 
ATOM   8623  N ND1 . HIS D 1 41  ? 98.231  36.077  -32.922 1.00 92.36  ? 42  HIS V ND1 1 
ATOM   8624  C CD2 . HIS D 1 41  ? 98.778  34.023  -32.422 1.00 92.36  ? 42  HIS V CD2 1 
ATOM   8625  C CE1 . HIS D 1 41  ? 97.746  35.301  -33.874 1.00 92.36  ? 42  HIS V CE1 1 
ATOM   8626  N NE2 . HIS D 1 41  ? 98.065  34.050  -33.594 1.00 92.36  ? 42  HIS V NE2 1 
ATOM   8627  N N   . GLY D 1 42  ? 100.413 38.754  -29.025 1.00 13.19  ? 43  GLY V N   1 
ATOM   8628  C CA  . GLY D 1 42  ? 100.989 39.185  -27.767 1.00 13.19  ? 43  GLY V CA  1 
ATOM   8629  C C   . GLY D 1 42  ? 102.100 38.230  -27.391 1.00 13.19  ? 43  GLY V C   1 
ATOM   8630  O O   . GLY D 1 42  ? 103.194 38.626  -26.984 1.00 49.60  ? 43  GLY V O   1 
ATOM   8631  N N   . PHE D 1 43  ? 101.796 36.949  -27.538 1.00 51.45  ? 44  PHE V N   1 
ATOM   8632  C CA  . PHE D 1 43  ? 102.734 35.881  -27.258 1.00 51.45  ? 44  PHE V CA  1 
ATOM   8633  C C   . PHE D 1 43  ? 102.261 34.721  -28.105 1.00 51.45  ? 44  PHE V C   1 
ATOM   8634  O O   . PHE D 1 43  ? 101.126 34.732  -28.576 1.00 42.64  ? 44  PHE V O   1 
ATOM   8635  C CB  . PHE D 1 43  ? 102.677 35.493  -25.791 1.00 42.64  ? 44  PHE V CB  1 
ATOM   8636  C CG  . PHE D 1 43  ? 103.170 36.549  -24.879 1.00 42.64  ? 44  PHE V CG  1 
ATOM   8637  C CD1 . PHE D 1 43  ? 104.524 36.794  -24.765 1.00 42.64  ? 44  PHE V CD1 1 
ATOM   8638  C CD2 . PHE D 1 43  ? 102.286 37.305  -24.140 1.00 42.64  ? 44  PHE V CD2 1 
ATOM   8639  C CE1 . PHE D 1 43  ? 104.991 37.780  -23.924 1.00 42.64  ? 44  PHE V CE1 1 
ATOM   8640  C CE2 . PHE D 1 43  ? 102.739 38.293  -23.298 1.00 42.64  ? 44  PHE V CE2 1 
ATOM   8641  C CZ  . PHE D 1 43  ? 104.098 38.535  -23.187 1.00 42.64  ? 44  PHE V CZ  1 
ATOM   8642  N N   . GLU D 1 44  ? 103.117 33.728  -28.306 1.00 50.52  ? 45  GLU V N   1 
ATOM   8643  C CA  . GLU D 1 44  ? 102.730 32.577  -29.100 1.00 50.52  ? 45  GLU V CA  1 
ATOM   8644  C C   . GLU D 1 44  ? 103.580 31.363  -28.764 1.00 50.52  ? 45  GLU V C   1 
ATOM   8645  O O   . GLU D 1 44  ? 104.691 31.500  -28.251 1.00 100.00 ? 45  GLU V O   1 
ATOM   8646  C CB  . GLU D 1 44  ? 102.807 32.924  -30.590 1.00 100.00 ? 45  GLU V CB  1 
ATOM   8647  C CG  . GLU D 1 44  ? 104.140 32.679  -31.260 1.00 100.00 ? 45  GLU V CG  1 
ATOM   8648  C CD  . GLU D 1 44  ? 103.968 32.360  -32.732 1.00 100.00 ? 45  GLU V CD  1 
ATOM   8649  O OE1 . GLU D 1 44  ? 103.297 33.148  -33.435 1.00 100.00 ? 45  GLU V OE1 1 
ATOM   8650  O OE2 . GLU D 1 44  ? 104.496 31.318  -33.183 1.00 100.00 ? 45  GLU V OE2 1 
ATOM   8651  N N   . ALA D 1 45  ? 103.044 30.177  -29.048 1.00 48.74  ? 46  ALA V N   1 
ATOM   8652  C CA  . ALA D 1 45  ? 103.735 28.922  -28.766 1.00 48.74  ? 46  ALA V CA  1 
ATOM   8653  C C   . ALA D 1 45  ? 104.916 28.652  -29.684 1.00 48.74  ? 46  ALA V C   1 
ATOM   8654  O O   . ALA D 1 45  ? 104.867 28.942  -30.871 1.00 15.79  ? 46  ALA V O   1 
ATOM   8655  C CB  . ALA D 1 45  ? 102.768 27.780  -28.854 1.00 15.79  ? 46  ALA V CB  1 
ATOM   8656  N N   . ALA D 1 46  ? 105.977 28.084  -29.122 1.00 92.76  ? 47  ALA V N   1 
ATOM   8657  C CA  . ALA D 1 46  ? 107.181 27.769  -29.881 1.00 92.76  ? 47  ALA V CA  1 
ATOM   8658  C C   . ALA D 1 46  ? 108.085 26.905  -29.026 1.00 92.76  ? 47  ALA V C   1 
ATOM   8659  O O   . ALA D 1 46  ? 107.903 26.827  -27.804 1.00 30.20  ? 47  ALA V O   1 
ATOM   8660  C CB  . ALA D 1 46  ? 107.904 29.050  -30.268 1.00 30.20  ? 47  ALA V CB  1 
ATOM   8661  N N   . SER D 1 47  ? 109.058 26.252  -29.657 1.00 71.20  ? 48  SER V N   1 
ATOM   8662  C CA  . SER D 1 47  ? 109.978 25.403  -28.904 1.00 71.20  ? 48  SER V CA  1 
ATOM   8663  C C   . SER D 1 47  ? 111.462 25.620  -29.157 1.00 71.20  ? 48  SER V C   1 
ATOM   8664  O O   . SER D 1 47  ? 111.921 25.715  -30.302 1.00 18.17  ? 48  SER V O   1 
ATOM   8665  C CB  . SER D 1 47  ? 109.653 23.925  -29.119 1.00 18.17  ? 48  SER V CB  1 
ATOM   8666  O OG  . SER D 1 47  ? 110.239 23.134  -28.093 1.00 18.17  ? 48  SER V OG  1 
ATOM   8667  N N   . ILE D 1 48  ? 112.200 25.682  -28.049 1.00 57.15  ? 49  ILE V N   1 
ATOM   8668  C CA  . ILE D 1 48  ? 113.634 25.894  -28.058 1.00 57.15  ? 49  ILE V CA  1 
ATOM   8669  C C   . ILE D 1 48  ? 114.322 24.941  -29.025 1.00 57.15  ? 49  ILE V C   1 
ATOM   8670  O O   . ILE D 1 48  ? 113.994 23.752  -29.100 1.00 33.90  ? 49  ILE V O   1 
ATOM   8671  C CB  . ILE D 1 48  ? 114.246 25.702  -26.637 1.00 33.90  ? 49  ILE V CB  1 
ATOM   8672  C CG1 . ILE D 1 48  ? 113.489 26.541  -25.607 1.00 33.90  ? 49  ILE V CG1 1 
ATOM   8673  C CG2 . ILE D 1 48  ? 115.711 26.102  -26.638 1.00 33.90  ? 49  ILE V CG2 1 
ATOM   8674  C CD1 . ILE D 1 48  ? 113.742 26.112  -24.168 1.00 33.90  ? 49  ILE V CD1 1 
ATOM   8675  N N   . LYS D 1 49  ? 115.282 25.483  -29.766 1.00 100.00 ? 50  LYS V N   1 
ATOM   8676  C CA  . LYS D 1 49  ? 116.060 24.720  -30.734 1.00 100.00 ? 50  LYS V CA  1 
ATOM   8677  C C   . LYS D 1 49  ? 117.528 24.659  -30.296 1.00 100.00 ? 50  LYS V C   1 
ATOM   8678  O O   . LYS D 1 49  ? 118.193 23.639  -30.480 1.00 73.18  ? 50  LYS V O   1 
ATOM   8679  C CB  . LYS D 1 49  ? 115.945 25.363  -32.116 1.00 73.18  ? 50  LYS V CB  1 
ATOM   8680  C CG  . LYS D 1 49  ? 114.574 25.208  -32.736 1.00 73.18  ? 50  LYS V CG  1 
ATOM   8681  C CD  . LYS D 1 49  ? 114.207 23.735  -32.817 1.00 73.18  ? 50  LYS V CD  1 
ATOM   8682  C CE  . LYS D 1 49  ? 113.015 23.504  -33.738 1.00 73.18  ? 50  LYS V CE  1 
ATOM   8683  N NZ  . LYS D 1 49  ? 113.317 22.572  -34.866 1.00 73.18  ? 50  LYS V NZ  1 
ATOM   8684  N N   . GLU D 1 50  ? 118.024 25.754  -29.715 1.00 57.37  ? 51  GLU V N   1 
ATOM   8685  C CA  . GLU D 1 50  ? 119.402 25.808  -29.237 1.00 57.37  ? 51  GLU V CA  1 
ATOM   8686  C C   . GLU D 1 50  ? 119.686 26.970  -28.290 1.00 57.37  ? 51  GLU V C   1 
ATOM   8687  O O   . GLU D 1 50  ? 119.580 28.139  -28.674 1.00 100.00 ? 51  GLU V O   1 
ATOM   8688  C CB  . GLU D 1 50  ? 120.364 25.872  -30.418 1.00 100.00 ? 51  GLU V CB  1 
ATOM   8689  C CG  . GLU D 1 50  ? 121.595 24.999  -30.244 1.00 100.00 ? 51  GLU V CG  1 
ATOM   8690  C CD  . GLU D 1 50  ? 122.499 25.016  -31.468 1.00 100.00 ? 51  GLU V CD  1 
ATOM   8691  O OE1 . GLU D 1 50  ? 122.165 25.723  -32.448 1.00 100.00 ? 51  GLU V OE1 1 
ATOM   8692  O OE2 . GLU D 1 50  ? 123.543 24.320  -31.442 1.00 100.00 ? 51  GLU V OE2 1 
ATOM   8693  N N   . GLU D 1 51  ? 120.056 26.638  -27.052 1.00 53.24  ? 52  GLU V N   1 
ATOM   8694  C CA  . GLU D 1 51  ? 120.366 27.652  -26.044 1.00 53.24  ? 52  GLU V CA  1 
ATOM   8695  C C   . GLU D 1 51  ? 121.788 28.162  -26.249 1.00 53.24  ? 52  GLU V C   1 
ATOM   8696  O O   . GLU D 1 51  ? 122.757 27.425  -26.056 1.00 100.00 ? 52  GLU V O   1 
ATOM   8697  C CB  . GLU D 1 51  ? 120.216 27.075  -24.631 1.00 100.00 ? 52  GLU V CB  1 
ATOM   8698  C CG  . GLU D 1 51  ? 118.900 27.446  -23.927 1.00 100.00 ? 52  GLU V CG  1 
ATOM   8699  C CD  . GLU D 1 51  ? 119.061 27.738  -22.428 1.00 100.00 ? 52  GLU V CD  1 
ATOM   8700  O OE1 . GLU D 1 51  ? 120.215 27.832  -21.951 1.00 100.00 ? 52  GLU V OE1 1 
ATOM   8701  O OE2 . GLU D 1 51  ? 118.025 27.873  -21.730 1.00 100.00 ? 52  GLU V OE2 1 
ATOM   8702  N N   . LYS D 1 52  ? 121.905 29.428  -26.641 1.00 72.05  ? 53  LYS V N   1 
ATOM   8703  C CA  . LYS D 1 52  ? 123.205 30.040  -26.896 1.00 72.05  ? 53  LYS V CA  1 
ATOM   8704  C C   . LYS D 1 52  ? 123.456 31.245  -26.001 1.00 72.05  ? 53  LYS V C   1 
ATOM   8705  O O   . LYS D 1 52  ? 123.321 32.389  -26.439 1.00 100.00 ? 53  LYS V O   1 
ATOM   8706  C CB  . LYS D 1 52  ? 123.300 30.467  -28.362 1.00 100.00 ? 53  LYS V CB  1 
ATOM   8707  C CG  . LYS D 1 52  ? 122.104 30.042  -29.209 1.00 100.00 ? 53  LYS V CG  1 
ATOM   8708  C CD  . LYS D 1 52  ? 122.468 28.941  -30.198 1.00 100.00 ? 53  LYS V CD  1 
ATOM   8709  C CE  . LYS D 1 52  ? 123.307 27.846  -29.549 1.00 100.00 ? 53  LYS V CE  1 
ATOM   8710  N NZ  . LYS D 1 52  ? 124.508 27.517  -30.371 1.00 100.00 ? 53  LYS V NZ  1 
ATOM   8711  N N   . GLY D 1 53  ? 123.828 30.985  -24.753 1.00 67.78  ? 54  GLY V N   1 
ATOM   8712  C CA  . GLY D 1 53  ? 124.092 32.067  -23.822 1.00 67.78  ? 54  GLY V CA  1 
ATOM   8713  C C   . GLY D 1 53  ? 122.915 33.019  -23.678 1.00 67.78  ? 54  GLY V C   1 
ATOM   8714  O O   . GLY D 1 53  ? 121.760 32.589  -23.662 1.00 54.42  ? 54  GLY V O   1 
ATOM   8715  N N   . ASP D 1 54  ? 123.206 34.313  -23.575 1.00 58.04  ? 55  ASP V N   1 
ATOM   8716  C CA  . ASP D 1 54  ? 122.173 35.335  -23.426 1.00 58.04  ? 55  ASP V CA  1 
ATOM   8717  C C   . ASP D 1 54  ? 121.049 35.226  -24.464 1.00 58.04  ? 55  ASP V C   1 
ATOM   8718  O O   . ASP D 1 54  ? 120.014 35.875  -24.329 1.00 99.20  ? 55  ASP V O   1 
ATOM   8719  C CB  . ASP D 1 54  ? 122.807 36.722  -23.509 1.00 99.20  ? 55  ASP V CB  1 
ATOM   8720  C CG  . ASP D 1 54  ? 121.804 37.830  -23.283 1.00 99.20  ? 55  ASP V CG  1 
ATOM   8721  O OD1 . ASP D 1 54  ? 121.027 37.726  -22.313 1.00 99.20  ? 55  ASP V OD1 1 
ATOM   8722  O OD2 . ASP D 1 54  ? 121.791 38.800  -24.071 1.00 99.20  ? 55  ASP V OD2 1 
ATOM   8723  N N   . GLU D 1 55  ? 121.268 34.409  -25.494 1.00 66.89  ? 56  GLU V N   1 
ATOM   8724  C CA  . GLU D 1 55  ? 120.287 34.200  -26.559 1.00 66.89  ? 56  GLU V CA  1 
ATOM   8725  C C   . GLU D 1 55  ? 119.980 32.720  -26.774 1.00 66.89  ? 56  GLU V C   1 
ATOM   8726  O O   . GLU D 1 55  ? 120.738 31.847  -26.343 1.00 100.00 ? 56  GLU V O   1 
ATOM   8727  C CB  . GLU D 1 55  ? 120.793 34.795  -27.869 1.00 100.00 ? 56  GLU V CB  1 
ATOM   8728  C CG  . GLU D 1 55  ? 120.553 36.282  -27.993 1.00 100.00 ? 56  GLU V CG  1 
ATOM   8729  C CD  . GLU D 1 55  ? 121.725 37.103  -27.484 1.00 100.00 ? 56  GLU V CD  1 
ATOM   8730  O OE1 . GLU D 1 55  ? 122.432 36.627  -26.567 1.00 100.00 ? 56  GLU V OE1 1 
ATOM   8731  O OE2 . GLU D 1 55  ? 121.937 38.222  -28.004 1.00 100.00 ? 56  GLU V OE2 1 
ATOM   8732  N N   . VAL D 1 56  ? 118.864 32.441  -27.445 1.00 45.71  ? 57  VAL V N   1 
ATOM   8733  C CA  . VAL D 1 56  ? 118.453 31.065  -27.711 1.00 45.71  ? 57  VAL V CA  1 
ATOM   8734  C C   . VAL D 1 56  ? 117.638 30.972  -28.994 1.00 45.71  ? 57  VAL V C   1 
ATOM   8735  O O   . VAL D 1 56  ? 116.811 31.839  -29.285 1.00 97.80  ? 57  VAL V O   1 
ATOM   8736  C CB  . VAL D 1 56  ? 117.601 30.501  -26.554 1.00 97.80  ? 57  VAL V CB  1 
ATOM   8737  C CG1 . VAL D 1 56  ? 117.258 29.050  -26.827 1.00 97.80  ? 57  VAL V CG1 1 
ATOM   8738  C CG2 . VAL D 1 56  ? 118.351 30.632  -25.227 1.00 97.80  ? 57  VAL V CG2 1 
ATOM   8739  N N   . THR D 1 57  ? 117.879 29.910  -29.758 1.00 99.24  ? 58  THR V N   1 
ATOM   8740  C CA  . THR D 1 57  ? 117.184 29.670  -31.021 1.00 99.24  ? 58  THR V CA  1 
ATOM   8741  C C   . THR D 1 57  ? 115.905 28.865  -30.780 1.00 99.24  ? 58  THR V C   1 
ATOM   8742  O O   . THR D 1 57  ? 115.918 27.893  -30.030 1.00 100.00 ? 58  THR V O   1 
ATOM   8743  C CB  . THR D 1 57  ? 118.087 28.890  -32.009 1.00 100.00 ? 58  THR V CB  1 
ATOM   8744  O OG1 . THR D 1 57  ? 118.071 27.495  -31.676 1.00 100.00 ? 58  THR V OG1 1 
ATOM   8745  C CG2 . THR D 1 57  ? 119.522 29.396  -31.939 1.00 100.00 ? 58  THR V CG2 1 
ATOM   8746  N N   . VAL D 1 58  ? 114.802 29.266  -31.410 1.00 34.72  ? 59  VAL V N   1 
ATOM   8747  C CA  . VAL D 1 58  ? 113.538 28.561  -31.226 1.00 34.72  ? 59  VAL V CA  1 
ATOM   8748  C C   . VAL D 1 58  ? 112.699 28.534  -32.497 1.00 34.72  ? 59  VAL V C   1 
ATOM   8749  O O   . VAL D 1 58  ? 112.793 29.434  -33.326 1.00 88.35  ? 59  VAL V O   1 
ATOM   8750  C CB  . VAL D 1 58  ? 112.709 29.233  -30.108 1.00 88.35  ? 59  VAL V CB  1 
ATOM   8751  C CG1 . VAL D 1 58  ? 111.327 28.608  -30.027 1.00 88.35  ? 59  VAL V CG1 1 
ATOM   8752  C CG2 . VAL D 1 58  ? 113.428 29.106  -28.778 1.00 88.35  ? 59  VAL V CG2 1 
ATOM   8753  N N   . GLU D 1 59  ? 111.874 27.502  -32.643 1.00 38.97  ? 60  GLU V N   1 
ATOM   8754  C CA  . GLU D 1 59  ? 110.994 27.396  -33.804 1.00 38.97  ? 60  GLU V CA  1 
ATOM   8755  C C   . GLU D 1 59  ? 109.519 27.434  -33.380 1.00 38.97  ? 60  GLU V C   1 
ATOM   8756  O O   . GLU D 1 59  ? 109.090 26.661  -32.511 1.00 100.00 ? 60  GLU V O   1 
ATOM   8757  C CB  . GLU D 1 59  ? 111.275 26.104  -34.565 1.00 100.00 ? 60  GLU V CB  1 
ATOM   8758  C CG  . GLU D 1 59  ? 110.214 25.746  -35.598 1.00 100.00 ? 60  GLU V CG  1 
ATOM   8759  C CD  . GLU D 1 59  ? 110.775 24.945  -36.763 1.00 100.00 ? 60  GLU V CD  1 
ATOM   8760  O OE1 . GLU D 1 59  ? 111.606 25.489  -37.524 1.00 100.00 ? 60  GLU V OE1 1 
ATOM   8761  O OE2 . GLU D 1 59  ? 110.380 23.770  -36.917 1.00 100.00 ? 60  GLU V OE2 1 
ATOM   8762  N N   . LEU D 1 60  ? 108.751 28.334  -33.996 1.00 17.75  ? 61  LEU V N   1 
ATOM   8763  C CA  . LEU D 1 60  ? 107.333 28.469  -33.672 1.00 17.75  ? 61  LEU V CA  1 
ATOM   8764  C C   . LEU D 1 60  ? 106.577 27.170  -33.847 1.00 17.75  ? 61  LEU V C   1 
ATOM   8765  O O   . LEU D 1 60  ? 106.528 26.627  -34.941 1.00 38.87  ? 61  LEU V O   1 
ATOM   8766  C CB  . LEU D 1 60  ? 106.659 29.520  -34.550 1.00 38.87  ? 61  LEU V CB  1 
ATOM   8767  C CG  . LEU D 1 60  ? 107.513 30.661  -35.086 1.00 38.87  ? 61  LEU V CG  1 
ATOM   8768  C CD1 . LEU D 1 60  ? 106.610 31.655  -35.816 1.00 38.87  ? 61  LEU V CD1 1 
ATOM   8769  C CD2 . LEU D 1 60  ? 108.269 31.326  -33.940 1.00 38.87  ? 61  LEU V CD2 1 
ATOM   8770  N N   . GLN D 1 61  ? 105.997 26.674  -32.759 1.00 98.63  ? 62  GLN V N   1 
ATOM   8771  C CA  . GLN D 1 61  ? 105.205 25.454  -32.814 1.00 98.63  ? 62  GLN V CA  1 
ATOM   8772  C C   . GLN D 1 61  ? 103.902 25.840  -33.534 1.00 98.63  ? 62  GLN V C   1 
ATOM   8773  O O   . GLN D 1 61  ? 102.870 25.170  -33.431 1.00 100.00 ? 62  GLN V O   1 
ATOM   8774  C CB  . GLN D 1 61  ? 104.943 24.927  -31.390 1.00 100.00 ? 62  GLN V CB  1 
ATOM   8775  C CG  . GLN D 1 61  ? 103.498 25.023  -30.896 1.00 100.00 ? 62  GLN V CG  1 
ATOM   8776  C CD  . GLN D 1 61  ? 103.015 23.745  -30.232 1.00 100.00 ? 62  GLN V CD  1 
ATOM   8777  O OE1 . GLN D 1 61  ? 103.758 22.764  -30.124 1.00 100.00 ? 62  GLN V OE1 1 
ATOM   8778  N NE2 . GLN D 1 61  ? 101.762 23.752  -29.777 1.00 100.00 ? 62  GLN V NE2 1 
ATOM   8779  N N   . GLU D 1 62  ? 103.981 26.937  -34.280 1.00 15.94  ? 63  GLU V N   1 
ATOM   8780  C CA  . GLU D 1 62  ? 102.848 27.442  -35.038 1.00 15.94  ? 63  GLU V CA  1 
ATOM   8781  C C   . GLU D 1 62  ? 103.180 27.521  -36.527 1.00 15.94  ? 63  GLU V C   1 
ATOM   8782  O O   . GLU D 1 62  ? 102.779 26.659  -37.310 1.00 100.00 ? 63  GLU V O   1 
ATOM   8783  C CB  . GLU D 1 62  ? 102.458 28.829  -34.513 1.00 100.00 ? 63  GLU V CB  1 
ATOM   8784  C CG  . GLU D 1 62  ? 101.665 29.699  -35.487 1.00 100.00 ? 63  GLU V CG  1 
ATOM   8785  C CD  . GLU D 1 62  ? 100.669 28.908  -36.320 1.00 100.00 ? 63  GLU V CD  1 
ATOM   8786  O OE1 . GLU D 1 62  ? 99.757  28.286  -35.731 1.00 100.00 ? 63  GLU V OE1 1 
ATOM   8787  O OE2 . GLU D 1 62  ? 100.800 28.907  -37.565 1.00 100.00 ? 63  GLU V OE2 1 
ATOM   8788  N N   . ASN D 1 63  ? 103.929 28.550  -36.909 1.00 81.34  ? 64  ASN V N   1 
ATOM   8789  C CA  . ASN D 1 63  ? 104.300 28.751  -38.309 1.00 81.34  ? 64  ASN V CA  1 
ATOM   8790  C C   . ASN D 1 63  ? 105.432 27.847  -38.789 1.00 81.34  ? 64  ASN V C   1 
ATOM   8791  O O   . ASN D 1 63  ? 105.896 27.975  -39.923 1.00 100.00 ? 64  ASN V O   1 
ATOM   8792  C CB  . ASN D 1 63  ? 104.697 30.210  -38.537 1.00 100.00 ? 64  ASN V CB  1 
ATOM   8793  C CG  . ASN D 1 63  ? 104.764 30.567  -40.010 1.00 100.00 ? 64  ASN V CG  1 
ATOM   8794  O OD1 . ASN D 1 63  ? 105.807 30.992  -40.512 1.00 100.00 ? 64  ASN V OD1 1 
ATOM   8795  N ND2 . ASN D 1 63  ? 103.648 30.393  -40.714 1.00 100.00 ? 64  ASN V ND2 1 
ATOM   8796  N N   . GLY D 1 64  ? 105.879 26.936  -37.933 1.00 76.17  ? 65  GLY V N   1 
ATOM   8797  C CA  . GLY D 1 64  ? 106.966 26.050  -38.310 1.00 76.17  ? 65  GLY V CA  1 
ATOM   8798  C C   . GLY D 1 64  ? 108.230 26.856  -38.554 1.00 76.17  ? 65  GLY V C   1 
ATOM   8799  O O   . GLY D 1 64  ? 109.293 26.295  -38.834 1.00 36.57  ? 65  GLY V O   1 
ATOM   8800  N N   . LYS D 1 65  ? 108.108 28.179  -38.443 1.00 75.35  ? 66  LYS V N   1 
ATOM   8801  C CA  . LYS D 1 65  ? 109.223 29.098  -38.651 1.00 75.35  ? 66  LYS V CA  1 
ATOM   8802  C C   . LYS D 1 65  ? 110.303 28.938  -37.589 1.00 75.35  ? 66  LYS V C   1 
ATOM   8803  O O   . LYS D 1 65  ? 110.040 28.466  -36.482 1.00 100.00 ? 66  LYS V O   1 
ATOM   8804  C CB  . LYS D 1 65  ? 108.715 30.540  -38.653 1.00 100.00 ? 66  LYS V CB  1 
ATOM   8805  C CG  . LYS D 1 65  ? 109.303 31.389  -39.760 1.00 100.00 ? 66  LYS V CG  1 
ATOM   8806  C CD  . LYS D 1 65  ? 110.699 31.882  -39.394 1.00 100.00 ? 66  LYS V CD  1 
ATOM   8807  C CE  . LYS D 1 65  ? 111.142 33.033  -40.303 1.00 100.00 ? 66  LYS V CE  1 
ATOM   8808  N NZ  . LYS D 1 65  ? 111.156 34.356  -39.604 1.00 100.00 ? 66  LYS V NZ  1 
ATOM   8809  N N   . LYS D 1 66  ? 111.524 29.339  -37.933 1.00 64.47  ? 67  LYS V N   1 
ATOM   8810  C CA  . LYS D 1 66  ? 112.652 29.245  -37.010 1.00 64.47  ? 67  LYS V CA  1 
ATOM   8811  C C   . LYS D 1 66  ? 113.332 30.598  -36.768 1.00 64.47  ? 67  LYS V C   1 
ATOM   8812  O O   . LYS D 1 66  ? 114.047 31.112  -37.638 1.00 100.00 ? 67  LYS V O   1 
ATOM   8813  C CB  . LYS D 1 66  ? 113.681 28.246  -37.538 1.00 100.00 ? 67  LYS V CB  1 
ATOM   8814  C CG  . LYS D 1 66  ? 114.326 27.392  -36.455 1.00 100.00 ? 67  LYS V CG  1 
ATOM   8815  C CD  . LYS D 1 66  ? 114.475 25.948  -36.915 1.00 100.00 ? 67  LYS V CD  1 
ATOM   8816  C CE  . LYS D 1 66  ? 115.603 25.238  -36.178 1.00 100.00 ? 67  LYS V CE  1 
ATOM   8817  N NZ  . LYS D 1 66  ? 115.930 23.917  -36.796 1.00 100.00 ? 67  LYS V NZ  1 
ATOM   8818  N N   . VAL D 1 67  ? 113.106 31.161  -35.578 1.00 100.00 ? 68  VAL V N   1 
ATOM   8819  C CA  . VAL D 1 67  ? 113.685 32.448  -35.180 1.00 100.00 ? 68  VAL V CA  1 
ATOM   8820  C C   . VAL D 1 67  ? 114.348 32.367  -33.803 1.00 100.00 ? 68  VAL V C   1 
ATOM   8821  O O   . VAL D 1 67  ? 113.881 31.657  -32.910 1.00 80.19  ? 68  VAL V O   1 
ATOM   8822  C CB  . VAL D 1 67  ? 112.617 33.568  -35.117 1.00 80.19  ? 68  VAL V CB  1 
ATOM   8823  C CG1 . VAL D 1 67  ? 113.296 34.920  -34.918 1.00 80.19  ? 68  VAL V CG1 1 
ATOM   8824  C CG2 . VAL D 1 67  ? 111.778 33.567  -36.389 1.00 80.19  ? 68  VAL V CG2 1 
ATOM   8825  N N   . THR D 1 68  ? 115.433 33.113  -33.635 1.00 100.00 ? 69  THR V N   1 
ATOM   8826  C CA  . THR D 1 68  ? 116.159 33.119  -32.374 1.00 100.00 ? 69  THR V CA  1 
ATOM   8827  C C   . THR D 1 68  ? 116.015 34.449  -31.640 1.00 100.00 ? 69  THR V C   1 
ATOM   8828  O O   . THR D 1 68  ? 116.225 35.524  -32.219 1.00 89.41  ? 69  THR V O   1 
ATOM   8829  C CB  . THR D 1 68  ? 117.651 32.838  -32.600 1.00 89.41  ? 69  THR V CB  1 
ATOM   8830  O OG1 . THR D 1 68  ? 117.806 31.505  -33.097 1.00 89.41  ? 69  THR V OG1 1 
ATOM   8831  C CG2 . THR D 1 68  ? 118.434 32.992  -31.301 1.00 89.41  ? 69  THR V CG2 1 
ATOM   8832  N N   . LEU D 1 69  ? 115.653 34.360  -30.372 1.00 100.00 ? 70  LEU V N   1 
ATOM   8833  C CA  . LEU D 1 69  ? 115.482 35.542  -29.523 1.00 100.00 ? 70  LEU V CA  1 
ATOM   8834  C C   . LEU D 1 69  ? 116.335 35.459  -28.257 1.00 100.00 ? 70  LEU V C   1 
ATOM   8835  O O   . LEU D 1 69  ? 116.855 34.386  -27.930 1.00 41.60  ? 70  LEU V O   1 
ATOM   8836  C CB  . LEU D 1 69  ? 114.008 35.726  -29.145 1.00 41.60  ? 70  LEU V CB  1 
ATOM   8837  C CG  . LEU D 1 69  ? 113.024 35.922  -30.300 1.00 41.60  ? 70  LEU V CG  1 
ATOM   8838  C CD1 . LEU D 1 69  ? 111.605 36.082  -29.777 1.00 41.60  ? 70  LEU V CD1 1 
ATOM   8839  C CD2 . LEU D 1 69  ? 113.420 37.121  -31.147 1.00 41.60  ? 70  LEU V CD2 1 
ATOM   8840  N N   . SER D 1 70  ? 116.472 36.582  -27.575 1.00 27.62  ? 71  SER V N   1 
ATOM   8841  C CA  . SER D 1 70  ? 117.252 36.624  -26.349 1.00 27.62  ? 71  SER V CA  1 
ATOM   8842  C C   . SER D 1 70  ? 116.763 35.578  -25.345 1.00 27.62  ? 71  SER V C   1 
ATOM   8843  O O   . SER D 1 70  ? 115.572 35.262  -25.269 1.00 37.64  ? 71  SER V O   1 
ATOM   8844  C CB  . SER D 1 70  ? 117.189 38.027  -25.728 1.00 37.64  ? 71  SER V CB  1 
ATOM   8845  O OG  . SER D 1 70  ? 118.477 38.469  -25.307 1.00 37.64  ? 71  SER V OG  1 
ATOM   8846  N N   . LYS D 1 71  ? 117.702 35.044  -24.581 1.00 21.60  ? 72  LYS V N   1 
ATOM   8847  C CA  . LYS D 1 71  ? 117.401 34.035  -23.577 1.00 21.60  ? 72  LYS V CA  1 
ATOM   8848  C C   . LYS D 1 71  ? 116.628 34.660  -22.422 1.00 21.60  ? 72  LYS V C   1 
ATOM   8849  O O   . LYS D 1 71  ? 116.718 34.207  -21.282 1.00 99.61  ? 72  LYS V O   1 
ATOM   8850  C CB  . LYS D 1 71  ? 118.708 33.423  -23.072 1.00 99.61  ? 72  LYS V CB  1 
ATOM   8851  C CG  . LYS D 1 71  ? 118.544 32.297  -22.081 1.00 99.61  ? 72  LYS V CG  1 
ATOM   8852  C CD  . LYS D 1 71  ? 119.483 32.494  -20.903 1.00 99.61  ? 72  LYS V CD  1 
ATOM   8853  C CE  . LYS D 1 71  ? 120.050 31.162  -20.416 1.00 99.61  ? 72  LYS V CE  1 
ATOM   8854  N NZ  . LYS D 1 71  ? 121.118 30.603  -21.309 1.00 99.61  ? 72  LYS V NZ  1 
ATOM   8855  N N   . ASP D 1 72  ? 115.862 35.715  -22.718 1.00 62.45  ? 73  ASP V N   1 
ATOM   8856  C CA  . ASP D 1 72  ? 115.089 36.405  -21.709 1.00 62.45  ? 73  ASP V CA  1 
ATOM   8857  C C   . ASP D 1 72  ? 113.811 36.961  -22.295 1.00 62.45  ? 73  ASP V C   1 
ATOM   8858  O O   . ASP D 1 72  ? 113.082 37.725  -21.644 1.00 100.00 ? 73  ASP V O   1 
ATOM   8859  C CB  . ASP D 1 72  ? 115.847 37.595  -21.151 1.00 100.00 ? 73  ASP V CB  1 
ATOM   8860  C CG  . ASP D 1 72  ? 117.036 37.910  -22.030 1.00 100.00 ? 73  ASP V CG  1 
ATOM   8861  O OD1 . ASP D 1 72  ? 118.103 37.292  -21.820 1.00 100.00 ? 73  ASP V OD1 1 
ATOM   8862  O OD2 . ASP D 1 72  ? 116.904 38.757  -22.934 1.00 100.00 ? 73  ASP V OD2 1 
ATOM   8863  N N   . ASP D 1 73  ? 113.512 36.587  -23.534 1.00 75.51  ? 74  ASP V N   1 
ATOM   8864  C CA  . ASP D 1 73  ? 112.309 37.051  -24.197 1.00 75.51  ? 74  ASP V CA  1 
ATOM   8865  C C   . ASP D 1 73  ? 111.348 35.883  -24.337 1.00 75.51  ? 74  ASP V C   1 
ATOM   8866  O O   . ASP D 1 73  ? 110.272 36.002  -24.926 1.00 95.27  ? 74  ASP V O   1 
ATOM   8867  C CB  . ASP D 1 73  ? 112.663 37.638  -25.562 1.00 95.27  ? 74  ASP V CB  1 
ATOM   8868  C CG  . ASP D 1 73  ? 113.388 38.968  -25.451 1.00 95.27  ? 74  ASP V CG  1 
ATOM   8869  O OD1 . ASP D 1 73  ? 114.130 39.158  -24.467 1.00 95.27  ? 74  ASP V OD1 1 
ATOM   8870  O OD2 . ASP D 1 73  ? 113.219 39.824  -26.343 1.00 95.27  ? 74  ASP V OD2 1 
ATOM   8871  N N   . ILE D 1 74  ? 111.757 34.747  -23.787 1.00 43.79  ? 75  ILE V N   1 
ATOM   8872  C CA  . ILE D 1 74  ? 110.938 33.545  -23.803 1.00 43.79  ? 75  ILE V CA  1 
ATOM   8873  C C   . ILE D 1 74  ? 110.293 33.377  -22.425 1.00 43.79  ? 75  ILE V C   1 
ATOM   8874  O O   . ILE D 1 74  ? 110.862 33.790  -21.414 1.00 36.07  ? 75  ILE V O   1 
ATOM   8875  C CB  . ILE D 1 74  ? 111.776 32.293  -24.117 1.00 36.07  ? 75  ILE V CB  1 
ATOM   8876  C CG1 . ILE D 1 74  ? 112.906 32.166  -23.103 1.00 36.07  ? 75  ILE V CG1 1 
ATOM   8877  C CG2 . ILE D 1 74  ? 112.334 32.382  -25.527 1.00 36.07  ? 75  ILE V CG2 1 
ATOM   8878  C CD1 . ILE D 1 74  ? 113.324 30.740  -22.846 1.00 36.07  ? 75  ILE V CD1 1 
ATOM   8879  N N   . GLN D 1 75  ? 109.112 32.772  -22.385 1.00 2.00   ? 76  GLN V N   1 
ATOM   8880  C CA  . GLN D 1 75  ? 108.417 32.591  -21.134 1.00 2.00   ? 76  GLN V CA  1 
ATOM   8881  C C   . GLN D 1 75  ? 107.881 31.194  -20.998 1.00 2.00   ? 76  GLN V C   1 
ATOM   8882  O O   . GLN D 1 75  ? 107.213 30.667  -21.884 1.00 82.26  ? 76  GLN V O   1 
ATOM   8883  C CB  . GLN D 1 75  ? 107.284 33.601  -21.013 1.00 82.26  ? 76  GLN V CB  1 
ATOM   8884  C CG  . GLN D 1 75  ? 107.754 35.043  -21.061 1.00 82.26  ? 76  GLN V CG  1 
ATOM   8885  C CD  . GLN D 1 75  ? 106.609 36.033  -21.044 1.00 82.26  ? 76  GLN V CD  1 
ATOM   8886  O OE1 . GLN D 1 75  ? 105.513 35.725  -20.571 1.00 82.26  ? 76  GLN V OE1 1 
ATOM   8887  N NE2 . GLN D 1 75  ? 106.855 37.231  -21.562 1.00 82.26  ? 76  GLN V NE2 1 
ATOM   8888  N N   . LYS D 1 76  ? 108.194 30.605  -19.855 1.00 16.71  ? 77  LYS V N   1 
ATOM   8889  C CA  . LYS D 1 76  ? 107.778 29.254  -19.499 1.00 16.71  ? 77  LYS V CA  1 
ATOM   8890  C C   . LYS D 1 76  ? 106.292 29.020  -19.753 1.00 16.71  ? 77  LYS V C   1 
ATOM   8891  O O   . LYS D 1 76  ? 105.449 29.856  -19.463 1.00 28.59  ? 77  LYS V O   1 
ATOM   8892  C CB  . LYS D 1 76  ? 108.113 28.991  -18.026 1.00 28.59  ? 77  LYS V CB  1 
ATOM   8893  C CG  . LYS D 1 76  ? 109.182 29.963  -17.429 1.00 28.59  ? 77  LYS V CG  1 
ATOM   8894  C CD  . LYS D 1 76  ? 108.569 31.315  -16.943 1.00 28.59  ? 77  LYS V CD  1 
ATOM   8895  C CE  . LYS D 1 76  ? 109.565 32.185  -16.162 1.00 28.59  ? 77  LYS V CE  1 
ATOM   8896  N NZ  . LYS D 1 76  ? 109.600 33.575  -16.681 1.00 28.59  ? 77  LYS V NZ  1 
ATOM   8897  N N   . MET D 1 77  ? 105.989 27.859  -20.309 1.00 24.13  ? 78  MET V N   1 
ATOM   8898  C CA  . MET D 1 77  ? 104.624 27.479  -20.631 1.00 24.13  ? 78  MET V CA  1 
ATOM   8899  C C   . MET D 1 77  ? 104.101 26.581  -19.509 1.00 24.13  ? 78  MET V C   1 
ATOM   8900  O O   . MET D 1 77  ? 104.864 25.836  -18.879 1.00 25.70  ? 78  MET V O   1 
ATOM   8901  C CB  . MET D 1 77  ? 104.619 26.706  -21.949 1.00 25.70  ? 78  MET V CB  1 
ATOM   8902  C CG  . MET D 1 77  ? 103.374 26.977  -22.796 1.00 25.70  ? 78  MET V CG  1 
ATOM   8903  S SD  . MET D 1 77  ? 103.674 26.818  -24.543 1.00 25.70  ? 78  MET V SD  1 
ATOM   8904  C CE  . MET D 1 77  ? 102.183 26.313  -25.373 1.00 25.70  ? 78  MET V CE  1 
ATOM   8905  N N   . ASN D 1 78  ? 102.808 26.660  -19.266 1.00 16.97  ? 79  ASN V N   1 
ATOM   8906  C CA  . ASN D 1 78  ? 102.184 25.852  -18.209 1.00 16.97  ? 79  ASN V CA  1 
ATOM   8907  C C   . ASN D 1 78  ? 101.638 24.550  -18.800 1.00 16.97  ? 79  ASN V C   1 
ATOM   8908  O O   . ASN D 1 78  ? 101.177 24.518  -19.953 1.00 9.04   ? 79  ASN V O   1 
ATOM   8909  C CB  . ASN D 1 78  ? 101.092 26.644  -17.500 1.00 9.04   ? 79  ASN V CB  1 
ATOM   8910  C CG  . ASN D 1 78  ? 101.471 26.950  -16.049 1.00 9.04   ? 79  ASN V CG  1 
ATOM   8911  O OD1 . ASN D 1 78  ? 101.339 28.086  -15.601 1.00 9.04   ? 79  ASN V OD1 1 
ATOM   8912  N ND2 . ASN D 1 78  ? 101.952 25.989  -15.277 1.00 9.04   ? 79  ASN V ND2 1 
ATOM   8913  N N   . PRO D 1 79  ? 101.669 23.456  -18.022 1.00 4.60   ? 80  PRO V N   1 
ATOM   8914  C CA  . PRO D 1 79  ? 101.266 22.135  -18.499 1.00 4.60   ? 80  PRO V CA  1 
ATOM   8915  C C   . PRO D 1 79  ? 99.850  22.109  -19.021 1.00 4.60   ? 80  PRO V C   1 
ATOM   8916  O O   . PRO D 1 79  ? 99.040  23.014  -18.649 1.00 3.50   ? 80  PRO V O   1 
ATOM   8917  C CB  . PRO D 1 79  ? 101.441 21.241  -17.298 1.00 3.50   ? 80  PRO V CB  1 
ATOM   8918  C CG  . PRO D 1 79  ? 101.970 22.095  -16.155 1.00 3.50   ? 80  PRO V CG  1 
ATOM   8919  C CD  . PRO D 1 79  ? 102.115 23.504  -16.629 1.00 3.50   ? 80  PRO V CD  1 
ATOM   8920  N N   . PRO D 1 80  ? 99.518  21.105  -19.867 1.00 51.66  ? 81  PRO V N   1 
ATOM   8921  C CA  . PRO D 1 80  ? 98.186  20.969  -20.451 1.00 51.66  ? 81  PRO V CA  1 
ATOM   8922  C C   . PRO D 1 80  ? 97.125  20.762  -19.397 1.00 51.66  ? 81  PRO V C   1 
ATOM   8923  O O   . PRO D 1 80  ? 95.905  20.949  -19.703 1.00 62.12  ? 81  PRO V O   1 
ATOM   8924  C CB  . PRO D 1 80  ? 98.290  19.742  -21.331 1.00 62.12  ? 81  PRO V CB  1 
ATOM   8925  C CG  . PRO D 1 80  ? 99.705  19.200  -21.212 1.00 62.12  ? 81  PRO V CG  1 
ATOM   8926  C CD  . PRO D 1 80  ? 100.478 20.071  -20.272 1.00 62.12  ? 81  PRO V CD  1 
ATOM   8927  N N   . LYS D 1 81  ? 97.578  20.391  -18.217 1.00 10.42  ? 82  LYS V N   1 
ATOM   8928  C CA  . LYS D 1 81  ? 96.695  20.100  -17.075 1.00 10.42  ? 82  LYS V CA  1 
ATOM   8929  C C   . LYS D 1 81  ? 96.095  21.381  -16.482 1.00 10.42  ? 82  LYS V C   1 
ATOM   8930  O O   . LYS D 1 81  ? 95.312  21.336  -15.522 1.00 100.00 ? 82  LYS V O   1 
ATOM   8931  C CB  . LYS D 1 81  ? 97.486  19.409  -15.960 1.00 100.00 ? 82  LYS V CB  1 
ATOM   8932  C CG  . LYS D 1 81  ? 97.207  19.998  -14.573 1.00 100.00 ? 82  LYS V CG  1 
ATOM   8933  C CD  . LYS D 1 81  ? 98.398  20.762  -13.991 1.00 100.00 ? 82  LYS V CD  1 
ATOM   8934  C CE  . LYS D 1 81  ? 99.532  19.845  -13.528 1.00 100.00 ? 82  LYS V CE  1 
ATOM   8935  N NZ  . LYS D 1 81  ? 99.151  18.982  -12.402 1.00 100.00 ? 82  LYS V NZ  1 
ATOM   8936  N N   . PHE D 1 82  ? 96.462  22.505  -17.070 1.00 40.00  ? 83  PHE V N   1 
ATOM   8937  C CA  . PHE D 1 82  ? 96.015  23.815  -16.574 1.00 40.00  ? 83  PHE V CA  1 
ATOM   8938  C C   . PHE D 1 82  ? 95.070  24.510  -17.532 1.00 40.00  ? 83  PHE V C   1 
ATOM   8939  O O   . PHE D 1 82  ? 94.607  25.612  -17.246 1.00 11.66  ? 83  PHE V O   1 
ATOM   8940  C CB  . PHE D 1 82  ? 97.217  24.734  -16.358 1.00 11.66  ? 83  PHE V CB  1 
ATOM   8941  C CG  . PHE D 1 82  ? 97.955  24.445  -15.054 1.00 11.66  ? 83  PHE V CG  1 
ATOM   8942  C CD1 . PHE D 1 82  ? 97.262  24.479  -13.836 1.00 11.66  ? 83  PHE V CD1 1 
ATOM   8943  C CD2 . PHE D 1 82  ? 99.320  24.143  -15.075 1.00 11.66  ? 83  PHE V CD2 1 
ATOM   8944  C CE1 . PHE D 1 82  ? 97.937  24.210  -12.641 1.00 11.66  ? 83  PHE V CE1 1 
ATOM   8945  C CE2 . PHE D 1 82  ? 99.994  23.874  -13.880 1.00 11.66  ? 83  PHE V CE2 1 
ATOM   8946  C CZ  . PHE D 1 82  ? 99.305  23.908  -12.662 1.00 11.66  ? 83  PHE V CZ  1 
ATOM   8947  N N   . SER D 1 83  ? 94.764  23.896  -18.661 1.00 28.42  ? 84  SER V N   1 
ATOM   8948  C CA  . SER D 1 83  ? 93.892  24.576  -19.608 1.00 28.42  ? 84  SER V CA  1 
ATOM   8949  C C   . SER D 1 83  ? 92.589  25.084  -19.019 1.00 28.42  ? 84  SER V C   1 
ATOM   8950  O O   . SER D 1 83  ? 91.863  24.350  -18.356 1.00 84.94  ? 84  SER V O   1 
ATOM   8951  C CB  . SER D 1 83  ? 93.606  23.681  -20.814 1.00 84.94  ? 84  SER V CB  1 
ATOM   8952  O OG  . SER D 1 83  ? 94.039  24.330  -22.005 1.00 84.94  ? 84  SER V OG  1 
ATOM   8953  N N   . LYS D 1 84  ? 92.329  26.365  -19.254 1.00 2.00   ? 85  LYS V N   1 
ATOM   8954  C CA  . LYS D 1 84  ? 91.106  27.011  -18.802 1.00 2.00   ? 85  LYS V CA  1 
ATOM   8955  C C   . LYS D 1 84  ? 90.895  26.961  -17.304 1.00 2.00   ? 85  LYS V C   1 
ATOM   8956  O O   . LYS D 1 84  ? 89.789  26.721  -16.848 1.00 46.37  ? 85  LYS V O   1 
ATOM   8957  C CB  . LYS D 1 84  ? 89.891  26.377  -19.485 1.00 46.37  ? 85  LYS V CB  1 
ATOM   8958  C CG  . LYS D 1 84  ? 89.318  27.198  -20.617 1.00 46.37  ? 85  LYS V CG  1 
ATOM   8959  C CD  . LYS D 1 84  ? 89.337  26.427  -21.915 1.00 46.37  ? 85  LYS V CD  1 
ATOM   8960  C CE  . LYS D 1 84  ? 88.295  25.328  -21.900 1.00 46.37  ? 85  LYS V CE  1 
ATOM   8961  N NZ  . LYS D 1 84  ? 88.291  24.574  -23.189 1.00 46.37  ? 85  LYS V NZ  1 
ATOM   8962  N N   . VAL D 1 85  ? 91.933  27.202  -16.524 1.00 16.98  ? 86  VAL V N   1 
ATOM   8963  C CA  . VAL D 1 85  ? 91.870  27.175  -15.057 1.00 16.98  ? 86  VAL V CA  1 
ATOM   8964  C C   . VAL D 1 85  ? 90.882  28.156  -14.409 1.00 16.98  ? 86  VAL V C   1 
ATOM   8965  O O   . VAL D 1 85  ? 90.506  29.150  -15.008 1.00 2.00   ? 86  VAL V O   1 
ATOM   8966  C CB  . VAL D 1 85  ? 93.243  27.473  -14.511 1.00 2.00   ? 86  VAL V CB  1 
ATOM   8967  C CG1 . VAL D 1 85  ? 93.409  28.967  -14.375 1.00 2.00   ? 86  VAL V CG1 1 
ATOM   8968  C CG2 . VAL D 1 85  ? 93.441  26.750  -13.205 1.00 2.00   ? 86  VAL V CG2 1 
ATOM   8969  N N   . GLU D 1 86  ? 90.487  27.873  -13.174 1.00 2.80   ? 87  GLU V N   1 
ATOM   8970  C CA  . GLU D 1 86  ? 89.562  28.723  -12.440 1.00 2.80   ? 87  GLU V CA  1 
ATOM   8971  C C   . GLU D 1 86  ? 90.261  29.834  -11.637 1.00 2.80   ? 87  GLU V C   1 
ATOM   8972  O O   . GLU D 1 86  ? 89.764  30.963  -11.568 1.00 97.20  ? 87  GLU V O   1 
ATOM   8973  C CB  . GLU D 1 86  ? 88.727  27.876  -11.481 1.00 97.20  ? 87  GLU V CB  1 
ATOM   8974  C CG  . GLU D 1 86  ? 87.896  26.816  -12.160 1.00 97.20  ? 87  GLU V CG  1 
ATOM   8975  C CD  . GLU D 1 86  ? 86.771  27.405  -12.982 1.00 97.20  ? 87  GLU V CD  1 
ATOM   8976  O OE1 . GLU D 1 86  ? 87.013  28.406  -13.692 1.00 97.20  ? 87  GLU V OE1 1 
ATOM   8977  O OE2 . GLU D 1 86  ? 85.643  26.870  -12.916 1.00 97.20  ? 87  GLU V OE2 1 
ATOM   8978  N N   . ASP D 1 87  ? 91.406  29.513  -11.028 1.00 2.00   ? 88  ASP V N   1 
ATOM   8979  C CA  . ASP D 1 87  ? 92.160  30.471  -10.215 1.00 2.00   ? 88  ASP V CA  1 
ATOM   8980  C C   . ASP D 1 87  ? 93.627  30.594  -10.615 1.00 2.00   ? 88  ASP V C   1 
ATOM   8981  O O   . ASP D 1 87  ? 94.451  29.851  -10.117 1.00 3.43   ? 88  ASP V O   1 
ATOM   8982  C CB  . ASP D 1 87  ? 92.055  30.066  -8.739  1.00 3.43   ? 88  ASP V CB  1 
ATOM   8983  C CG  . ASP D 1 87  ? 92.748  31.044  -7.815  1.00 3.43   ? 88  ASP V CG  1 
ATOM   8984  O OD1 . ASP D 1 87  ? 93.413  31.979  -8.329  1.00 3.43   ? 88  ASP V OD1 1 
ATOM   8985  O OD2 . ASP D 1 87  ? 92.625  30.881  -6.572  1.00 3.43   ? 88  ASP V OD2 1 
ATOM   8986  N N   . MET D 1 88  ? 93.945  31.543  -11.501 1.00 2.00   ? 89  MET V N   1 
ATOM   8987  C CA  . MET D 1 88  ? 95.314  31.786  -11.977 1.00 2.00   ? 89  MET V CA  1 
ATOM   8988  C C   . MET D 1 88  ? 96.349  31.540  -10.910 1.00 2.00   ? 89  MET V C   1 
ATOM   8989  O O   . MET D 1 88  ? 97.449  31.076  -11.189 1.00 2.00   ? 89  MET V O   1 
ATOM   8990  C CB  . MET D 1 88  ? 95.462  33.210  -12.427 1.00 2.00   ? 89  MET V CB  1 
ATOM   8991  C CG  . MET D 1 88  ? 94.237  33.722  -13.040 1.00 2.00   ? 89  MET V CG  1 
ATOM   8992  S SD  . MET D 1 88  ? 94.290  33.196  -14.714 1.00 2.00   ? 89  MET V SD  1 
ATOM   8993  C CE  . MET D 1 88  ? 94.252  34.866  -15.542 1.00 2.00   ? 89  MET V CE  1 
ATOM   8994  N N   . ALA D 1 89  ? 96.002  31.872  -9.681  1.00 2.00   ? 90  ALA V N   1 
ATOM   8995  C CA  . ALA D 1 89  ? 96.900  31.658  -8.577  1.00 2.00   ? 90  ALA V CA  1 
ATOM   8996  C C   . ALA D 1 89  ? 97.229  30.158  -8.443  1.00 2.00   ? 90  ALA V C   1 
ATOM   8997  O O   . ALA D 1 89  ? 97.877  29.739  -7.490  1.00 33.94  ? 90  ALA V O   1 
ATOM   8998  C CB  . ALA D 1 89  ? 96.268  32.172  -7.312  1.00 33.94  ? 90  ALA V CB  1 
ATOM   8999  N N   . GLU D 1 90  ? 96.791  29.348  -9.402  1.00 2.00   ? 91  GLU V N   1 
ATOM   9000  C CA  . GLU D 1 90  ? 97.037  27.904  -9.375  1.00 2.00   ? 91  GLU V CA  1 
ATOM   9001  C C   . GLU D 1 90  ? 98.142  27.470  -10.349 1.00 2.00   ? 91  GLU V C   1 
ATOM   9002  O O   . GLU D 1 90  ? 99.080  26.756  -9.966  1.00 100.00 ? 91  GLU V O   1 
ATOM   9003  C CB  . GLU D 1 90  ? 95.753  27.139  -9.708  1.00 100.00 ? 91  GLU V CB  1 
ATOM   9004  C CG  . GLU D 1 90  ? 94.982  26.690  -8.473  1.00 100.00 ? 91  GLU V CG  1 
ATOM   9005  C CD  . GLU D 1 90  ? 93.497  27.019  -8.569  1.00 100.00 ? 91  GLU V CD  1 
ATOM   9006  O OE1 . GLU D 1 90  ? 93.025  27.534  -9.653  1.00 100.00 ? 91  GLU V OE1 1 
ATOM   9007  O OE2 . GLU D 1 90  ? 92.723  26.788  -7.569  1.00 100.00 ? 91  GLU V OE2 1 
ATOM   9008  N N   . LEU D 1 91  ? 98.022  27.887  -11.598 1.00 16.79  ? 92  LEU V N   1 
ATOM   9009  C CA  . LEU D 1 91  ? 99.022  27.530  -12.628 1.00 16.79  ? 92  LEU V CA  1 
ATOM   9010  C C   . LEU D 1 91  ? 100.430 27.682  -12.044 1.00 16.79  ? 92  LEU V C   1 
ATOM   9011  O O   . LEU D 1 91  ? 100.775 28.728  -11.481 1.00 3.36   ? 92  LEU V O   1 
ATOM   9012  C CB  . LEU D 1 91  ? 98.900  28.446  -13.846 1.00 3.36   ? 92  LEU V CB  1 
ATOM   9013  C CG  . LEU D 1 91  ? 97.471  28.593  -14.360 1.00 3.36   ? 92  LEU V CG  1 
ATOM   9014  C CD1 . LEU D 1 91  ? 97.026  30.055  -14.441 1.00 3.36   ? 92  LEU V CD1 1 
ATOM   9015  C CD2 . LEU D 1 91  ? 97.279  28.014  -15.764 1.00 3.36   ? 92  LEU V CD2 1 
ATOM   9016  N N   . THR D 1 92  ? 101.213 26.630  -12.203 1.00 29.21  ? 93  THR V N   1 
ATOM   9017  C CA  . THR D 1 92  ? 102.579 26.573  -11.655 1.00 29.21  ? 93  THR V CA  1 
ATOM   9018  C C   . THR D 1 92  ? 103.524 27.534  -12.338 1.00 29.21  ? 93  THR V C   1 
ATOM   9019  O O   . THR D 1 92  ? 104.710 27.523  -12.058 1.00 2.00   ? 93  THR V O   1 
ATOM   9020  C CB  . THR D 1 92  ? 103.171 25.172  -11.795 1.00 2.00   ? 93  THR V CB  1 
ATOM   9021  O OG1 . THR D 1 92  ? 102.475 24.445  -12.791 1.00 2.00   ? 93  THR V OG1 1 
ATOM   9022  C CG2 . THR D 1 92  ? 103.096 24.370  -10.493 1.00 2.00   ? 93  THR V CG2 1 
ATOM   9023  N N   . CYS D 1 93  ? 103.003 28.355  -13.244 1.00 80.60  ? 94  CYS V N   1 
ATOM   9024  C CA  . CYS D 1 93  ? 103.822 29.338  -13.946 1.00 80.60  ? 94  CYS V CA  1 
ATOM   9025  C C   . CYS D 1 93  ? 103.034 30.628  -14.114 1.00 80.60  ? 94  CYS V C   1 
ATOM   9026  O O   . CYS D 1 93  ? 102.025 30.646  -14.814 1.00 100.00 ? 94  CYS V O   1 
ATOM   9027  C CB  . CYS D 1 93  ? 104.225 28.821  -15.324 1.00 100.00 ? 94  CYS V CB  1 
ATOM   9028  S SG  . CYS D 1 93  ? 105.381 27.442  -15.291 1.00 100.00 ? 94  CYS V SG  1 
ATOM   9029  N N   . LEU D 1 94  ? 103.481 31.703  -13.465 1.00 2.00   ? 95  LEU V N   1 
ATOM   9030  C CA  . LEU D 1 94  ? 102.807 32.992  -13.582 1.00 2.00   ? 95  LEU V CA  1 
ATOM   9031  C C   . LEU D 1 94  ? 103.523 33.800  -14.649 1.00 2.00   ? 95  LEU V C   1 
ATOM   9032  O O   . LEU D 1 94  ? 104.737 33.966  -14.601 1.00 41.94  ? 95  LEU V O   1 
ATOM   9033  C CB  . LEU D 1 94  ? 102.856 33.718  -12.263 1.00 41.94  ? 95  LEU V CB  1 
ATOM   9034  C CG  . LEU D 1 94  ? 101.559 33.436  -11.538 1.00 41.94  ? 95  LEU V CG  1 
ATOM   9035  C CD1 . LEU D 1 94  ? 101.821 33.305  -10.048 1.00 41.94  ? 95  LEU V CD1 1 
ATOM   9036  C CD2 . LEU D 1 94  ? 100.577 34.547  -11.849 1.00 41.94  ? 95  LEU V CD2 1 
ATOM   9037  N N   . ASN D 1 95  ? 102.789 34.286  -15.635 1.00 2.00   ? 96  ASN V N   1 
ATOM   9038  C CA  . ASN D 1 95  ? 103.401 35.039  -16.715 1.00 2.00   ? 96  ASN V CA  1 
ATOM   9039  C C   . ASN D 1 95  ? 102.383 35.991  -17.294 1.00 2.00   ? 96  ASN V C   1 
ATOM   9040  O O   . ASN D 1 95  ? 101.169 35.783  -17.188 1.00 24.14  ? 96  ASN V O   1 
ATOM   9041  C CB  . ASN D 1 95  ? 103.855 34.111  -17.850 1.00 24.14  ? 96  ASN V CB  1 
ATOM   9042  C CG  . ASN D 1 95  ? 105.009 33.224  -17.461 1.00 24.14  ? 96  ASN V CG  1 
ATOM   9043  O OD1 . ASN D 1 95  ? 104.823 32.182  -16.842 1.00 24.14  ? 96  ASN V OD1 1 
ATOM   9044  N ND2 . ASN D 1 95  ? 106.216 33.624  -17.834 1.00 24.14  ? 96  ASN V ND2 1 
ATOM   9045  N N   . GLU D 1 96  ? 102.886 37.037  -17.927 1.00 50.01  ? 97  GLU V N   1 
ATOM   9046  C CA  . GLU D 1 96  ? 102.016 38.001  -18.570 1.00 50.01  ? 97  GLU V CA  1 
ATOM   9047  C C   . GLU D 1 96  ? 101.433 37.227  -19.745 1.00 50.01  ? 97  GLU V C   1 
ATOM   9048  O O   . GLU D 1 96  ? 100.402 37.591  -20.316 1.00 55.77  ? 97  GLU V O   1 
ATOM   9049  C CB  . GLU D 1 96  ? 102.840 39.193  -19.060 1.00 55.77  ? 97  GLU V CB  1 
ATOM   9050  C CG  . GLU D 1 96  ? 102.032 40.440  -19.385 1.00 55.77  ? 97  GLU V CG  1 
ATOM   9051  C CD  . GLU D 1 96  ? 102.803 41.406  -20.262 1.00 55.77  ? 97  GLU V CD  1 
ATOM   9052  O OE1 . GLU D 1 96  ? 104.049 41.376  -20.206 1.00 55.77  ? 97  GLU V OE1 1 
ATOM   9053  O OE2 . GLU D 1 96  ? 102.178 42.190  -21.011 1.00 55.77  ? 97  GLU V OE2 1 
ATOM   9054  N N   . ALA D 1 97  ? 102.109 36.133  -20.076 1.00 23.63  ? 98  ALA V N   1 
ATOM   9055  C CA  . ALA D 1 97  ? 101.731 35.270  -21.178 1.00 23.63  ? 98  ALA V CA  1 
ATOM   9056  C C   . ALA D 1 97  ? 100.643 34.271  -20.813 1.00 23.63  ? 98  ALA V C   1 
ATOM   9057  O O   . ALA D 1 97  ? 99.568  34.253  -21.440 1.00 41.07  ? 98  ALA V O   1 
ATOM   9058  C CB  . ALA D 1 97  ? 102.937 34.535  -21.674 1.00 41.07  ? 98  ALA V CB  1 
ATOM   9059  N N   . SER D 1 98  ? 100.926 33.423  -19.826 1.00 53.30  ? 99  SER V N   1 
ATOM   9060  C CA  . SER D 1 98  ? 99.965  32.414  -19.386 1.00 53.30  ? 99  SER V CA  1 
ATOM   9061  C C   . SER D 1 98  ? 98.693  33.100  -18.925 1.00 53.30  ? 99  SER V C   1 
ATOM   9062  O O   . SER D 1 98  ? 97.608  32.861  -19.475 1.00 51.62  ? 99  SER V O   1 
ATOM   9063  C CB  . SER D 1 98  ? 100.557 31.600  -18.246 1.00 51.62  ? 99  SER V CB  1 
ATOM   9064  O OG  . SER D 1 98  ? 101.950 31.836  -18.156 1.00 51.62  ? 99  SER V OG  1 
ATOM   9065  N N   . VAL D 1 99  ? 98.840  33.957  -17.913 1.00 10.33  ? 100 VAL V N   1 
ATOM   9066  C CA  . VAL D 1 99  ? 97.732  34.725  -17.353 1.00 10.33  ? 100 VAL V CA  1 
ATOM   9067  C C   . VAL D 1 99  ? 96.845  35.264  -18.484 1.00 10.33  ? 100 VAL V C   1 
ATOM   9068  O O   . VAL D 1 99  ? 95.614  35.313  -18.385 1.00 15.35  ? 100 VAL V O   1 
ATOM   9069  C CB  . VAL D 1 99  ? 98.283  35.898  -16.547 1.00 15.35  ? 100 VAL V CB  1 
ATOM   9070  C CG1 . VAL D 1 99  ? 97.174  36.882  -16.216 1.00 15.35  ? 100 VAL V CG1 1 
ATOM   9071  C CG2 . VAL D 1 99  ? 98.940  35.377  -15.300 1.00 15.35  ? 100 VAL V CG2 1 
ATOM   9072  N N   . LEU D 1 100 ? 97.500  35.675  -19.561 1.00 39.75  ? 101 LEU V N   1 
ATOM   9073  C CA  . LEU D 1 100 ? 96.815  36.198  -20.726 1.00 39.75  ? 101 LEU V CA  1 
ATOM   9074  C C   . LEU D 1 100 ? 96.127  35.025  -21.360 1.00 39.75  ? 101 LEU V C   1 
ATOM   9075  O O   . LEU D 1 100 ? 94.914  35.022  -21.526 1.00 12.84  ? 101 LEU V O   1 
ATOM   9076  C CB  . LEU D 1 100 ? 97.817  36.796  -21.723 1.00 12.84  ? 101 LEU V CB  1 
ATOM   9077  C CG  . LEU D 1 100 ? 97.467  36.707  -23.210 1.00 12.84  ? 101 LEU V CG  1 
ATOM   9078  C CD1 . LEU D 1 100 ? 96.279  37.613  -23.541 1.00 12.84  ? 101 LEU V CD1 1 
ATOM   9079  C CD2 . LEU D 1 100 ? 98.673  37.117  -24.015 1.00 12.84  ? 101 LEU V CD2 1 
ATOM   9080  N N   . HIS D 1 101 ? 96.927  34.027  -21.713 1.00 30.25  ? 102 HIS V N   1 
ATOM   9081  C CA  . HIS D 1 101 ? 96.409  32.825  -22.335 1.00 30.25  ? 102 HIS V CA  1 
ATOM   9082  C C   . HIS D 1 101 ? 95.107  32.383  -21.679 1.00 30.25  ? 102 HIS V C   1 
ATOM   9083  O O   . HIS D 1 101 ? 94.030  32.479  -22.286 1.00 48.51  ? 102 HIS V O   1 
ATOM   9084  C CB  . HIS D 1 101 ? 97.432  31.700  -22.252 1.00 48.51  ? 102 HIS V CB  1 
ATOM   9085  C CG  . HIS D 1 101 ? 97.241  30.654  -23.293 1.00 48.51  ? 102 HIS V CG  1 
ATOM   9086  N ND1 . HIS D 1 101 ? 97.304  29.306  -23.018 1.00 48.51  ? 102 HIS V ND1 1 
ATOM   9087  C CD2 . HIS D 1 101 ? 96.952  30.758  -24.609 1.00 48.51  ? 102 HIS V CD2 1 
ATOM   9088  C CE1 . HIS D 1 101 ? 97.060  28.623  -24.121 1.00 48.51  ? 102 HIS V CE1 1 
ATOM   9089  N NE2 . HIS D 1 101 ? 96.842  29.480  -25.102 1.00 48.51  ? 102 HIS V NE2 1 
ATOM   9090  N N   . ASN D 1 102 ? 95.215  31.921  -20.433 1.00 3.97   ? 103 ASN V N   1 
ATOM   9091  C CA  . ASN D 1 102 ? 94.057  31.457  -19.686 1.00 3.97   ? 103 ASN V CA  1 
ATOM   9092  C C   . ASN D 1 102 ? 92.849  32.301  -19.926 1.00 3.97   ? 103 ASN V C   1 
ATOM   9093  O O   . ASN D 1 102 ? 91.805  31.800  -20.318 1.00 2.00   ? 103 ASN V O   1 
ATOM   9094  C CB  . ASN D 1 102 ? 94.342  31.454  -18.205 1.00 2.00   ? 103 ASN V CB  1 
ATOM   9095  C CG  . ASN D 1 102 ? 93.618  30.337  -17.499 1.00 2.00   ? 103 ASN V CG  1 
ATOM   9096  O OD1 . ASN D 1 102 ? 94.052  29.169  -17.528 1.00 2.00   ? 103 ASN V OD1 1 
ATOM   9097  N ND2 . ASN D 1 102 ? 92.490  30.668  -16.878 1.00 2.00   ? 103 ASN V ND2 1 
ATOM   9098  N N   . LEU D 1 103 ? 93.011  33.589  -19.674 1.00 35.27  ? 104 LEU V N   1 
ATOM   9099  C CA  . LEU D 1 103 ? 91.934  34.534  -19.873 1.00 35.27  ? 104 LEU V CA  1 
ATOM   9100  C C   . LEU D 1 103 ? 91.394  34.420  -21.298 1.00 35.27  ? 104 LEU V C   1 
ATOM   9101  O O   . LEU D 1 103 ? 90.171  34.432  -21.491 1.00 2.00   ? 104 LEU V O   1 
ATOM   9102  C CB  . LEU D 1 103 ? 92.431  35.953  -19.602 1.00 2.00   ? 104 LEU V CB  1 
ATOM   9103  C CG  . LEU D 1 103 ? 92.883  36.215  -18.178 1.00 2.00   ? 104 LEU V CG  1 
ATOM   9104  C CD1 . LEU D 1 103 ? 93.256  37.668  -18.027 1.00 2.00   ? 104 LEU V CD1 1 
ATOM   9105  C CD2 . LEU D 1 103 ? 91.768  35.862  -17.227 1.00 2.00   ? 104 LEU V CD2 1 
ATOM   9106  N N   . ARG D 1 104 ? 92.296  34.303  -22.287 1.00 2.00   ? 105 ARG V N   1 
ATOM   9107  C CA  . ARG D 1 104 ? 91.894  34.186  -23.685 1.00 2.00   ? 105 ARG V CA  1 
ATOM   9108  C C   . ARG D 1 104 ? 90.980  32.987  -23.915 1.00 2.00   ? 105 ARG V C   1 
ATOM   9109  O O   . ARG D 1 104 ? 89.883  33.121  -24.458 1.00 48.04  ? 105 ARG V O   1 
ATOM   9110  C CB  . ARG D 1 104 ? 93.110  34.071  -24.594 1.00 48.04  ? 105 ARG V CB  1 
ATOM   9111  C CG  . ARG D 1 104 ? 92.742  34.188  -26.054 1.00 48.04  ? 105 ARG V CG  1 
ATOM   9112  C CD  . ARG D 1 104 ? 93.880  34.729  -26.870 1.00 48.04  ? 105 ARG V CD  1 
ATOM   9113  N NE  . ARG D 1 104 ? 95.085  33.953  -26.633 1.00 48.04  ? 105 ARG V NE  1 
ATOM   9114  C CZ  . ARG D 1 104 ? 96.310  34.368  -26.940 1.00 48.04  ? 105 ARG V CZ  1 
ATOM   9115  N NH1 . ARG D 1 104 ? 96.496  35.564  -27.503 1.00 48.04  ? 105 ARG V NH1 1 
ATOM   9116  N NH2 . ARG D 1 104 ? 97.355  33.578  -26.690 1.00 48.04  ? 105 ARG V NH2 1 
ATOM   9117  N N   . GLU D 1 105 ? 91.431  31.815  -23.484 1.00 2.00   ? 106 GLU V N   1 
ATOM   9118  C CA  . GLU D 1 105 ? 90.656  30.601  -23.636 1.00 2.00   ? 106 GLU V CA  1 
ATOM   9119  C C   . GLU D 1 105 ? 89.286  30.749  -23.006 1.00 2.00   ? 106 GLU V C   1 
ATOM   9120  O O   . GLU D 1 105 ? 88.290  30.927  -23.705 1.00 100.00 ? 106 GLU V O   1 
ATOM   9121  C CB  . GLU D 1 105 ? 91.392  29.422  -23.001 1.00 100.00 ? 106 GLU V CB  1 
ATOM   9122  C CG  . GLU D 1 105 ? 92.468  28.803  -23.897 1.00 100.00 ? 106 GLU V CG  1 
ATOM   9123  C CD  . GLU D 1 105 ? 93.234  29.835  -24.718 1.00 100.00 ? 106 GLU V CD  1 
ATOM   9124  O OE1 . GLU D 1 105 ? 93.731  30.828  -24.139 1.00 100.00 ? 106 GLU V OE1 1 
ATOM   9125  O OE2 . GLU D 1 105 ? 93.340  29.652  -25.949 1.00 100.00 ? 106 GLU V OE2 1 
ATOM   9126  N N   . ARG D 1 106 ? 89.235  30.680  -21.684 1.00 6.21   ? 107 ARG V N   1 
ATOM   9127  C CA  . ARG D 1 106 ? 87.965  30.814  -20.968 1.00 6.21   ? 107 ARG V CA  1 
ATOM   9128  C C   . ARG D 1 106 ? 87.061  31.838  -21.642 1.00 6.21   ? 107 ARG V C   1 
ATOM   9129  O O   . ARG D 1 106 ? 85.841  31.640  -21.751 1.00 3.97   ? 107 ARG V O   1 
ATOM   9130  C CB  . ARG D 1 106 ? 88.213  31.233  -19.502 1.00 3.97   ? 107 ARG V CB  1 
ATOM   9131  C CG  . ARG D 1 106 ? 89.597  30.884  -18.970 1.00 3.97   ? 107 ARG V CG  1 
ATOM   9132  C CD  . ARG D 1 106 ? 89.550  30.531  -17.488 1.00 3.97   ? 107 ARG V CD  1 
ATOM   9133  N NE  . ARG D 1 106 ? 88.416  29.656  -17.175 1.00 3.97   ? 107 ARG V NE  1 
ATOM   9134  C CZ  . ARG D 1 106 ? 87.450  29.941  -16.294 1.00 3.97   ? 107 ARG V CZ  1 
ATOM   9135  N NH1 . ARG D 1 106 ? 87.456  31.091  -15.609 1.00 3.97   ? 107 ARG V NH1 1 
ATOM   9136  N NH2 . ARG D 1 106 ? 86.425  29.121  -16.029 1.00 3.97   ? 107 ARG V NH2 1 
ATOM   9137  N N   . TYR D 1 107 ? 87.668  32.916  -22.086 1.00 2.00   ? 108 TYR V N   1 
ATOM   9138  C CA  . TYR D 1 107 ? 86.917  33.991  -22.734 1.00 2.00   ? 108 TYR V CA  1 
ATOM   9139  C C   . TYR D 1 107 ? 86.170  33.466  -23.956 1.00 2.00   ? 108 TYR V C   1 
ATOM   9140  O O   . TYR D 1 107 ? 84.955  33.653  -24.092 1.00 2.92   ? 108 TYR V O   1 
ATOM   9141  C CB  . TYR D 1 107 ? 87.823  35.127  -23.204 1.00 2.92   ? 108 TYR V CB  1 
ATOM   9142  C CG  . TYR D 1 107 ? 87.000  36.228  -23.877 1.00 2.92   ? 108 TYR V CG  1 
ATOM   9143  C CD1 . TYR D 1 107 ? 85.845  36.711  -23.249 1.00 2.92   ? 108 TYR V CD1 1 
ATOM   9144  C CD2 . TYR D 1 107 ? 87.386  36.746  -25.119 1.00 2.92   ? 108 TYR V CD2 1 
ATOM   9145  C CE1 . TYR D 1 107 ? 85.075  37.702  -23.862 1.00 2.92   ? 108 TYR V CE1 1 
ATOM   9146  C CE2 . TYR D 1 107 ? 86.613  37.737  -25.734 1.00 2.92   ? 108 TYR V CE2 1 
ATOM   9147  C CZ  . TYR D 1 107 ? 85.455  38.213  -25.108 1.00 2.92   ? 108 TYR V CZ  1 
ATOM   9148  O OH  . TYR D 1 107 ? 84.701  39.171  -25.708 1.00 2.92   ? 108 TYR V OH  1 
ATOM   9149  N N   . PHE D 1 108 ? 86.901  32.810  -24.831 1.00 2.16   ? 109 PHE V N   1 
ATOM   9150  C CA  . PHE D 1 108 ? 86.321  32.292  -26.074 1.00 2.16   ? 109 PHE V CA  1 
ATOM   9151  C C   . PHE D 1 108 ? 85.394  31.122  -25.804 1.00 2.16   ? 109 PHE V C   1 
ATOM   9152  O O   . PHE D 1 108 ? 84.454  30.889  -26.558 1.00 43.33  ? 109 PHE V O   1 
ATOM   9153  C CB  . PHE D 1 108 ? 87.421  31.894  -27.044 1.00 43.33  ? 109 PHE V CB  1 
ATOM   9154  C CG  . PHE D 1 108 ? 87.985  33.114  -27.762 1.00 43.33  ? 109 PHE V CG  1 
ATOM   9155  C CD1 . PHE D 1 108 ? 87.112  34.056  -28.319 1.00 43.33  ? 109 PHE V CD1 1 
ATOM   9156  C CD2 . PHE D 1 108 ? 89.367  33.295  -27.851 1.00 43.33  ? 109 PHE V CD2 1 
ATOM   9157  C CE1 . PHE D 1 108 ? 87.626  35.190  -28.954 1.00 43.33  ? 109 PHE V CE1 1 
ATOM   9158  C CE2 . PHE D 1 108 ? 89.879  34.426  -28.490 1.00 43.33  ? 109 PHE V CE2 1 
ATOM   9159  C CZ  . PHE D 1 108 ? 89.010  35.376  -29.039 1.00 43.33  ? 109 PHE V CZ  1 
ATOM   9160  N N   . SER D 1 109 ? 85.643  30.410  -24.708 1.00 2.00   ? 110 SER V N   1 
ATOM   9161  C CA  . SER D 1 109 ? 84.808  29.280  -24.335 1.00 2.00   ? 110 SER V CA  1 
ATOM   9162  C C   . SER D 1 109 ? 83.444  29.745  -23.827 1.00 2.00   ? 110 SER V C   1 
ATOM   9163  O O   . SER D 1 109 ? 82.492  28.967  -23.778 1.00 63.67  ? 110 SER V O   1 
ATOM   9164  C CB  . SER D 1 109 ? 85.515  28.450  -23.278 1.00 63.67  ? 110 SER V CB  1 
ATOM   9165  O OG  . SER D 1 109 ? 86.817  28.126  -23.732 1.00 63.67  ? 110 SER V OG  1 
ATOM   9166  N N   . GLY D 1 110 ? 83.357  31.020  -23.443 1.00 12.47  ? 111 GLY V N   1 
ATOM   9167  C CA  . GLY D 1 110 ? 82.098  31.569  -22.977 1.00 12.47  ? 111 GLY V CA  1 
ATOM   9168  C C   . GLY D 1 110 ? 82.078  31.994  -21.530 1.00 12.47  ? 111 GLY V C   1 
ATOM   9169  O O   . GLY D 1 110 ? 81.062  32.487  -21.024 1.00 8.97   ? 111 GLY V O   1 
ATOM   9170  N N   . LEU D 1 111 ? 83.196  31.797  -20.847 1.00 20.03  ? 112 LEU V N   1 
ATOM   9171  C CA  . LEU D 1 111 ? 83.258  32.184  -19.452 1.00 20.03  ? 112 LEU V CA  1 
ATOM   9172  C C   . LEU D 1 111 ? 84.048  33.467  -19.362 1.00 20.03  ? 112 LEU V C   1 
ATOM   9173  O O   . LEU D 1 111 ? 85.139  33.568  -19.937 1.00 4.62   ? 112 LEU V O   1 
ATOM   9174  C CB  . LEU D 1 111 ? 83.953  31.107  -18.638 1.00 4.62   ? 112 LEU V CB  1 
ATOM   9175  C CG  . LEU D 1 111 ? 84.080  29.782  -19.367 1.00 4.62   ? 112 LEU V CG  1 
ATOM   9176  C CD1 . LEU D 1 111 ? 85.519  29.365  -19.357 1.00 4.62   ? 112 LEU V CD1 1 
ATOM   9177  C CD2 . LEU D 1 111 ? 83.166  28.758  -18.699 1.00 4.62   ? 112 LEU V CD2 1 
ATOM   9178  N N   . ILE D 1 112 ? 83.506  34.454  -18.654 1.00 29.32  ? 113 ILE V N   1 
ATOM   9179  C CA  . ILE D 1 112 ? 84.217  35.715  -18.526 1.00 29.32  ? 113 ILE V CA  1 
ATOM   9180  C C   . ILE D 1 112 ? 84.836  35.921  -17.130 1.00 29.32  ? 113 ILE V C   1 
ATOM   9181  O O   . ILE D 1 112 ? 85.950  36.446  -16.998 1.00 8.75   ? 113 ILE V O   1 
ATOM   9182  C CB  . ILE D 1 112 ? 83.307  36.898  -18.923 1.00 8.75   ? 113 ILE V CB  1 
ATOM   9183  C CG1 . ILE D 1 112 ? 82.008  36.928  -18.118 1.00 8.75   ? 113 ILE V CG1 1 
ATOM   9184  C CG2 . ILE D 1 112 ? 82.904  36.856  -20.397 1.00 8.75   ? 113 ILE V CG2 1 
ATOM   9185  C CD1 . ILE D 1 112 ? 80.826  37.488  -18.905 1.00 8.75   ? 113 ILE V CD1 1 
ATOM   9186  N N   . TYR D 1 113 ? 84.138  35.512  -16.093 1.00 2.00   ? 114 TYR V N   1 
ATOM   9187  C CA  . TYR D 1 113 ? 84.645  35.671  -14.710 1.00 2.00   ? 114 TYR V CA  1 
ATOM   9188  C C   . TYR D 1 113 ? 85.759  34.649  -14.418 1.00 2.00   ? 114 TYR V C   1 
ATOM   9189  O O   . TYR D 1 113 ? 85.622  33.452  -14.696 1.00 11.99  ? 114 TYR V O   1 
ATOM   9190  C CB  . TYR D 1 113 ? 83.520  35.444  -13.705 1.00 11.99  ? 114 TYR V CB  1 
ATOM   9191  C CG  . TYR D 1 113 ? 82.369  36.441  -13.843 1.00 11.99  ? 114 TYR V CG  1 
ATOM   9192  C CD1 . TYR D 1 113 ? 81.455  36.316  -14.896 1.00 11.99  ? 114 TYR V CD1 1 
ATOM   9193  C CD2 . TYR D 1 113 ? 82.228  37.473  -12.911 1.00 11.99  ? 114 TYR V CD2 1 
ATOM   9194  C CE1 . TYR D 1 113 ? 80.392  37.217  -15.009 1.00 11.99  ? 114 TYR V CE1 1 
ATOM   9195  C CE2 . TYR D 1 113 ? 81.162  38.372  -13.020 1.00 11.99  ? 114 TYR V CE2 1 
ATOM   9196  C CZ  . TYR D 1 113 ? 80.243  38.244  -14.067 1.00 11.99  ? 114 TYR V CZ  1 
ATOM   9197  O OH  . TYR D 1 113 ? 79.202  39.113  -14.169 1.00 11.99  ? 114 TYR V OH  1 
ATOM   9198  N N   . THR D 1 114 ? 86.851  35.139  -13.842 1.00 2.00   ? 115 THR V N   1 
ATOM   9199  C CA  . THR D 1 114 ? 88.012  34.289  -13.496 1.00 2.00   ? 115 THR V CA  1 
ATOM   9200  C C   . THR D 1 114 ? 88.660  34.768  -12.197 1.00 2.00   ? 115 THR V C   1 
ATOM   9201  O O   . THR D 1 114 ? 88.746  35.969  -11.967 1.00 2.00   ? 115 THR V O   1 
ATOM   9202  C CB  . THR D 1 114 ? 89.061  34.356  -14.600 1.00 2.00   ? 115 THR V CB  1 
ATOM   9203  O OG1 . THR D 1 114 ? 88.425  34.448  -15.865 1.00 2.00   ? 115 THR V OG1 1 
ATOM   9204  C CG2 . THR D 1 114 ? 89.973  33.131  -14.624 1.00 2.00   ? 115 THR V CG2 1 
ATOM   9205  N N   . TYR D 1 115 ? 89.115  33.853  -11.351 1.00 2.00   ? 116 TYR V N   1 
ATOM   9206  C CA  . TYR D 1 115 ? 89.735  34.283  -10.103 1.00 2.00   ? 116 TYR V CA  1 
ATOM   9207  C C   . TYR D 1 115 ? 91.224  34.481  -10.271 1.00 2.00   ? 116 TYR V C   1 
ATOM   9208  O O   . TYR D 1 115 ? 91.860  33.796  -11.066 1.00 13.73  ? 116 TYR V O   1 
ATOM   9209  C CB  . TYR D 1 115 ? 89.519  33.273  -9.002  1.00 13.73  ? 116 TYR V CB  1 
ATOM   9210  C CG  . TYR D 1 115 ? 88.122  33.221  -8.507  1.00 13.73  ? 116 TYR V CG  1 
ATOM   9211  C CD1 . TYR D 1 115 ? 87.200  34.193  -8.848  1.00 13.73  ? 116 TYR V CD1 1 
ATOM   9212  C CD2 . TYR D 1 115 ? 87.705  32.169  -7.719  1.00 13.73  ? 116 TYR V CD2 1 
ATOM   9213  C CE1 . TYR D 1 115 ? 85.880  34.103  -8.415  1.00 13.73  ? 116 TYR V CE1 1 
ATOM   9214  C CE2 . TYR D 1 115 ? 86.393  32.074  -7.281  1.00 13.73  ? 116 TYR V CE2 1 
ATOM   9215  C CZ  . TYR D 1 115 ? 85.487  33.035  -7.628  1.00 13.73  ? 116 TYR V CZ  1 
ATOM   9216  O OH  . TYR D 1 115 ? 84.193  32.902  -7.190  1.00 13.73  ? 116 TYR V OH  1 
ATOM   9217  N N   . SER D 1 116 ? 91.775  35.426  -9.516  1.00 2.00   ? 117 SER V N   1 
ATOM   9218  C CA  . SER D 1 116 ? 93.198  35.740  -9.549  1.00 2.00   ? 117 SER V CA  1 
ATOM   9219  C C   . SER D 1 116 ? 93.566  36.004  -8.103  1.00 2.00   ? 117 SER V C   1 
ATOM   9220  O O   . SER D 1 116 ? 93.628  37.141  -7.654  1.00 54.96  ? 117 SER V O   1 
ATOM   9221  C CB  . SER D 1 116 ? 93.486  36.984  -10.400 1.00 54.96  ? 117 SER V CB  1 
ATOM   9222  O OG  . SER D 1 116 ? 92.351  37.827  -10.496 1.00 54.96  ? 117 SER V OG  1 
ATOM   9223  N N   . GLY D 1 117 ? 93.782  34.926  -7.369  1.00 31.44  ? 118 GLY V N   1 
ATOM   9224  C CA  . GLY D 1 117 ? 94.125  35.068  -5.977  1.00 31.44  ? 118 GLY V CA  1 
ATOM   9225  C C   . GLY D 1 117 ? 92.899  35.528  -5.239  1.00 31.44  ? 118 GLY V C   1 
ATOM   9226  O O   . GLY D 1 117 ? 91.896  34.821  -5.208  1.00 99.60  ? 118 GLY V O   1 
ATOM   9227  N N   . LEU D 1 118 ? 92.966  36.719  -4.658  1.00 2.63   ? 119 LEU V N   1 
ATOM   9228  C CA  . LEU D 1 118 ? 91.836  37.241  -3.908  1.00 2.63   ? 119 LEU V CA  1 
ATOM   9229  C C   . LEU D 1 118 ? 90.856  37.930  -4.826  1.00 2.63   ? 119 LEU V C   1 
ATOM   9230  O O   . LEU D 1 118 ? 89.674  37.585  -4.847  1.00 6.87   ? 119 LEU V O   1 
ATOM   9231  C CB  . LEU D 1 118 ? 92.320  38.221  -2.862  1.00 6.87   ? 119 LEU V CB  1 
ATOM   9232  C CG  . LEU D 1 118 ? 93.296  37.581  -1.893  1.00 6.87   ? 119 LEU V CG  1 
ATOM   9233  C CD1 . LEU D 1 118 ? 94.535  38.472  -1.782  1.00 6.87   ? 119 LEU V CD1 1 
ATOM   9234  C CD2 . LEU D 1 118 ? 92.617  37.360  -0.548  1.00 6.87   ? 119 LEU V CD2 1 
ATOM   9235  N N   . PHE D 1 119 ? 91.335  38.909  -5.585  1.00 2.00   ? 120 PHE V N   1 
ATOM   9236  C CA  . PHE D 1 119 ? 90.471  39.619  -6.517  1.00 2.00   ? 120 PHE V CA  1 
ATOM   9237  C C   . PHE D 1 119 ? 90.146  38.723  -7.701  1.00 2.00   ? 120 PHE V C   1 
ATOM   9238  O O   . PHE D 1 119 ? 90.695  37.632  -7.826  1.00 2.00   ? 120 PHE V O   1 
ATOM   9239  C CB  . PHE D 1 119 ? 91.163  40.875  -7.014  1.00 2.00   ? 120 PHE V CB  1 
ATOM   9240  C CG  . PHE D 1 119 ? 92.505  40.631  -7.560  1.00 2.00   ? 120 PHE V CG  1 
ATOM   9241  C CD1 . PHE D 1 119 ? 93.497  40.145  -6.750  1.00 2.00   ? 120 PHE V CD1 1 
ATOM   9242  C CD2 . PHE D 1 119 ? 92.783  40.902  -8.879  1.00 2.00   ? 120 PHE V CD2 1 
ATOM   9243  C CE1 . PHE D 1 119 ? 94.757  39.932  -7.247  1.00 2.00   ? 120 PHE V CE1 1 
ATOM   9244  C CE2 . PHE D 1 119 ? 94.033  40.697  -9.391  1.00 2.00   ? 120 PHE V CE2 1 
ATOM   9245  C CZ  . PHE D 1 119 ? 95.032  40.212  -8.581  1.00 2.00   ? 120 PHE V CZ  1 
ATOM   9246  N N   . CYS D 1 120 ? 89.249  39.184  -8.566  1.00 2.00   ? 121 CYS V N   1 
ATOM   9247  C CA  . CYS D 1 120 ? 88.881  38.404  -9.731  1.00 2.00   ? 121 CYS V CA  1 
ATOM   9248  C C   . CYS D 1 120 ? 88.698  39.246  -11.001 1.00 2.00   ? 121 CYS V C   1 
ATOM   9249  O O   . CYS D 1 120 ? 88.107  40.314  -10.942 1.00 2.00   ? 121 CYS V O   1 
ATOM   9250  C CB  . CYS D 1 120 ? 87.614  37.614  -9.427  1.00 2.00   ? 121 CYS V CB  1 
ATOM   9251  S SG  . CYS D 1 120 ? 86.183  38.205  -10.302 1.00 2.00   ? 121 CYS V SG  1 
ATOM   9252  N N   . VAL D 1 121 ? 89.215  38.752  -12.135 1.00 2.00   ? 122 VAL V N   1 
ATOM   9253  C CA  . VAL D 1 121 ? 89.120  39.435  -13.426 1.00 2.00   ? 122 VAL V CA  1 
ATOM   9254  C C   . VAL D 1 121 ? 87.761  39.158  -14.044 1.00 2.00   ? 122 VAL V C   1 
ATOM   9255  O O   . VAL D 1 121 ? 87.102  38.225  -13.623 1.00 2.00   ? 122 VAL V O   1 
ATOM   9256  C CB  . VAL D 1 121 ? 90.201  38.969  -14.381 1.00 2.00   ? 122 VAL V CB  1 
ATOM   9257  C CG1 . VAL D 1 121 ? 90.348  39.948  -15.505 1.00 2.00   ? 122 VAL V CG1 1 
ATOM   9258  C CG2 . VAL D 1 121 ? 91.499  38.869  -13.659 1.00 2.00   ? 122 VAL V CG2 1 
ATOM   9259  N N   . VAL D 1 122 ? 87.333  39.966  -15.022 1.00 2.00   ? 123 VAL V N   1 
ATOM   9260  C CA  . VAL D 1 122 ? 86.007  39.796  -15.639 1.00 2.00   ? 123 VAL V CA  1 
ATOM   9261  C C   . VAL D 1 122 ? 85.855  40.392  -17.042 1.00 2.00   ? 123 VAL V C   1 
ATOM   9262  O O   . VAL D 1 122 ? 85.111  41.341  -17.200 1.00 2.00   ? 123 VAL V O   1 
ATOM   9263  C CB  . VAL D 1 122 ? 84.881  40.451  -14.767 1.00 2.00   ? 123 VAL V CB  1 
ATOM   9264  C CG1 . VAL D 1 122 ? 83.526  40.162  -15.369 1.00 2.00   ? 123 VAL V CG1 1 
ATOM   9265  C CG2 . VAL D 1 122 ? 84.903  39.924  -13.352 1.00 2.00   ? 123 VAL V CG2 1 
ATOM   9266  N N   . ILE D 1 123 ? 86.502  39.821  -18.057 1.00 2.00   ? 124 ILE V N   1 
ATOM   9267  C CA  . ILE D 1 123 ? 86.442  40.360  -19.428 1.00 2.00   ? 124 ILE V CA  1 
ATOM   9268  C C   . ILE D 1 123 ? 85.052  40.551  -20.010 1.00 2.00   ? 124 ILE V C   1 
ATOM   9269  O O   . ILE D 1 123 ? 84.316  39.604  -20.158 1.00 2.00   ? 124 ILE V O   1 
ATOM   9270  C CB  . ILE D 1 123 ? 87.224  39.484  -20.432 1.00 2.00   ? 124 ILE V CB  1 
ATOM   9271  C CG1 . ILE D 1 123 ? 88.702  39.427  -20.068 1.00 2.00   ? 124 ILE V CG1 1 
ATOM   9272  C CG2 . ILE D 1 123 ? 87.086  40.061  -21.813 1.00 2.00   ? 124 ILE V CG2 1 
ATOM   9273  C CD1 . ILE D 1 123 ? 89.157  38.088  -19.583 1.00 2.00   ? 124 ILE V CD1 1 
ATOM   9274  N N   . ASN D 1 124 ? 84.708  41.782  -20.368 1.00 32.97  ? 125 ASN V N   1 
ATOM   9275  C CA  . ASN D 1 124 ? 83.399  42.079  -20.957 1.00 32.97  ? 125 ASN V CA  1 
ATOM   9276  C C   . ASN D 1 124 ? 83.113  41.075  -22.076 1.00 32.97  ? 125 ASN V C   1 
ATOM   9277  O O   . ASN D 1 124 ? 83.991  40.769  -22.876 1.00 7.63   ? 125 ASN V O   1 
ATOM   9278  C CB  . ASN D 1 124 ? 83.389  43.515  -21.537 1.00 7.63   ? 125 ASN V CB  1 
ATOM   9279  C CG  . ASN D 1 124 ? 81.959  44.078  -21.791 1.00 7.63   ? 125 ASN V CG  1 
ATOM   9280  O OD1 . ASN D 1 124 ? 81.001  43.343  -22.024 1.00 7.63   ? 125 ASN V OD1 1 
ATOM   9281  N ND2 . ASN D 1 124 ? 81.835  45.396  -21.750 1.00 7.63   ? 125 ASN V ND2 1 
ATOM   9282  N N   . PRO D 1 125 ? 81.890  40.511  -22.105 1.00 2.00   ? 126 PRO V N   1 
ATOM   9283  C CA  . PRO D 1 125 ? 81.504  39.552  -23.137 1.00 2.00   ? 126 PRO V CA  1 
ATOM   9284  C C   . PRO D 1 125 ? 80.994  40.321  -24.343 1.00 2.00   ? 126 PRO V C   1 
ATOM   9285  O O   . PRO D 1 125 ? 81.345  40.018  -25.482 1.00 15.32  ? 126 PRO V O   1 
ATOM   9286  C CB  . PRO D 1 125 ? 80.380  38.762  -22.472 1.00 15.32  ? 126 PRO V CB  1 
ATOM   9287  C CG  . PRO D 1 125 ? 79.697  39.781  -21.605 1.00 15.32  ? 126 PRO V CG  1 
ATOM   9288  C CD  . PRO D 1 125 ? 80.809  40.691  -21.107 1.00 15.32  ? 126 PRO V CD  1 
ATOM   9289  N N   . TYR D 1 126 ? 80.156  41.317  -24.045 1.00 71.40  ? 127 TYR V N   1 
ATOM   9290  C CA  . TYR D 1 126 ? 79.502  42.189  -25.015 1.00 71.40  ? 127 TYR V CA  1 
ATOM   9291  C C   . TYR D 1 126 ? 78.321  41.458  -25.619 1.00 71.40  ? 127 TYR V C   1 
ATOM   9292  O O   . TYR D 1 126 ? 77.589  41.997  -26.453 1.00 23.07  ? 127 TYR V O   1 
ATOM   9293  C CB  . TYR D 1 126 ? 80.473  42.614  -26.113 1.00 23.07  ? 127 TYR V CB  1 
ATOM   9294  C CG  . TYR D 1 126 ? 81.096  43.965  -25.860 1.00 23.07  ? 127 TYR V CG  1 
ATOM   9295  C CD1 . TYR D 1 126 ? 80.392  44.980  -25.194 1.00 23.07  ? 127 TYR V CD1 1 
ATOM   9296  C CD2 . TYR D 1 126 ? 82.396  44.236  -26.282 1.00 23.07  ? 127 TYR V CD2 1 
ATOM   9297  C CE1 . TYR D 1 126 ? 80.975  46.234  -24.956 1.00 23.07  ? 127 TYR V CE1 1 
ATOM   9298  C CE2 . TYR D 1 126 ? 82.990  45.489  -26.050 1.00 23.07  ? 127 TYR V CE2 1 
ATOM   9299  C CZ  . TYR D 1 126 ? 82.279  46.480  -25.392 1.00 23.07  ? 127 TYR V CZ  1 
ATOM   9300  O OH  . TYR D 1 126 ? 82.884  47.704  -25.207 1.00 23.07  ? 127 TYR V OH  1 
ATOM   9301  N N   . LYS D 1 127 ? 78.142  40.224  -25.165 1.00 11.69  ? 128 LYS V N   1 
ATOM   9302  C CA  . LYS D 1 127 ? 77.083  39.363  -25.639 1.00 11.69  ? 128 LYS V CA  1 
ATOM   9303  C C   . LYS D 1 127 ? 76.213  39.015  -24.456 1.00 11.69  ? 128 LYS V C   1 
ATOM   9304  O O   . LYS D 1 127 ? 76.636  39.103  -23.300 1.00 66.22  ? 128 LYS V O   1 
ATOM   9305  C CB  . LYS D 1 127 ? 77.684  38.100  -26.254 1.00 66.22  ? 128 LYS V CB  1 
ATOM   9306  C CG  . LYS D 1 127 ? 76.670  37.118  -26.786 1.00 66.22  ? 128 LYS V CG  1 
ATOM   9307  C CD  . LYS D 1 127 ? 77.252  35.708  -26.855 1.00 66.22  ? 128 LYS V CD  1 
ATOM   9308  C CE  . LYS D 1 127 ? 76.186  34.644  -26.564 1.00 66.22  ? 128 LYS V CE  1 
ATOM   9309  N NZ  . LYS D 1 127 ? 76.382  33.373  -27.338 1.00 66.22  ? 128 LYS V NZ  1 
ATOM   9310  N N   . GLN D 1 128 ? 74.990  38.623  -24.770 1.00 2.00   ? 129 GLN V N   1 
ATOM   9311  C CA  . GLN D 1 128 ? 74.003  38.251  -23.782 1.00 2.00   ? 129 GLN V CA  1 
ATOM   9312  C C   . GLN D 1 128 ? 74.135  36.796  -23.302 1.00 2.00   ? 129 GLN V C   1 
ATOM   9313  O O   . GLN D 1 128 ? 73.269  35.964  -23.578 1.00 100.00 ? 129 GLN V O   1 
ATOM   9314  C CB  . GLN D 1 128 ? 72.606  38.494  -24.362 1.00 100.00 ? 129 GLN V CB  1 
ATOM   9315  C CG  . GLN D 1 128 ? 72.451  39.863  -25.046 1.00 100.00 ? 129 GLN V CG  1 
ATOM   9316  C CD  . GLN D 1 128 ? 72.556  39.817  -26.577 1.00 100.00 ? 129 GLN V CD  1 
ATOM   9317  O OE1 . GLN D 1 128 ? 73.614  39.508  -27.135 1.00 100.00 ? 129 GLN V OE1 1 
ATOM   9318  N NE2 . GLN D 1 128 ? 71.455  40.137  -27.256 1.00 100.00 ? 129 GLN V NE2 1 
ATOM   9319  N N   . LEU D 1 129 ? 75.219  36.490  -22.590 1.00 11.04  ? 130 LEU V N   1 
ATOM   9320  C CA  . LEU D 1 129 ? 75.433  35.151  -22.040 1.00 11.04  ? 130 LEU V CA  1 
ATOM   9321  C C   . LEU D 1 129 ? 74.275  34.894  -21.099 1.00 11.04  ? 130 LEU V C   1 
ATOM   9322  O O   . LEU D 1 129 ? 73.666  35.835  -20.598 1.00 9.92   ? 130 LEU V O   1 
ATOM   9323  C CB  . LEU D 1 129 ? 76.746  35.106  -21.253 1.00 9.92   ? 130 LEU V CB  1 
ATOM   9324  C CG  . LEU D 1 129 ? 78.003  35.519  -22.029 1.00 9.92   ? 130 LEU V CG  1 
ATOM   9325  C CD1 . LEU D 1 129 ? 79.252  34.986  -21.357 1.00 9.92   ? 130 LEU V CD1 1 
ATOM   9326  C CD2 . LEU D 1 129 ? 77.897  34.984  -23.449 1.00 9.92   ? 130 LEU V CD2 1 
ATOM   9327  N N   . PRO D 1 130 ? 73.941  33.623  -20.851 1.00 15.57  ? 131 PRO V N   1 
ATOM   9328  C CA  . PRO D 1 130 ? 72.833  33.276  -19.958 1.00 15.57  ? 131 PRO V CA  1 
ATOM   9329  C C   . PRO D 1 130 ? 73.313  32.735  -18.609 1.00 15.57  ? 131 PRO V C   1 
ATOM   9330  O O   . PRO D 1 130 ? 73.154  31.550  -18.327 1.00 23.00  ? 131 PRO V O   1 
ATOM   9331  C CB  . PRO D 1 130 ? 72.120  32.198  -20.740 1.00 23.00  ? 131 PRO V CB  1 
ATOM   9332  C CG  . PRO D 1 130 ? 73.311  31.451  -21.430 1.00 23.00  ? 131 PRO V CG  1 
ATOM   9333  C CD  . PRO D 1 130 ? 74.515  32.399  -21.422 1.00 23.00  ? 131 PRO V CD  1 
ATOM   9334  N N   . ILE D 1 131 ? 73.884  33.590  -17.776 1.00 2.00   ? 132 ILE V N   1 
ATOM   9335  C CA  . ILE D 1 131 ? 74.387  33.091  -16.501 1.00 2.00   ? 132 ILE V CA  1 
ATOM   9336  C C   . ILE D 1 131 ? 73.899  33.945  -15.334 1.00 2.00   ? 132 ILE V C   1 
ATOM   9337  O O   . ILE D 1 131 ? 74.559  33.992  -14.298 1.00 10.81  ? 132 ILE V O   1 
ATOM   9338  C CB  . ILE D 1 131 ? 75.926  33.052  -16.478 1.00 10.81  ? 132 ILE V CB  1 
ATOM   9339  C CG1 . ILE D 1 131 ? 76.526  34.461  -16.480 1.00 10.81  ? 132 ILE V CG1 1 
ATOM   9340  C CG2 . ILE D 1 131 ? 76.518  32.320  -17.683 1.00 10.81  ? 132 ILE V CG2 1 
ATOM   9341  C CD1 . ILE D 1 131 ? 78.015  34.486  -16.158 1.00 10.81  ? 132 ILE V CD1 1 
ATOM   9342  N N   . TYR D 1 132 ? 72.758  34.590  -15.523 1.00 2.00   ? 133 TYR V N   1 
ATOM   9343  C CA  . TYR D 1 132 ? 72.135  35.389  -14.475 1.00 2.00   ? 133 TYR V CA  1 
ATOM   9344  C C   . TYR D 1 132 ? 70.648  35.013  -14.450 1.00 2.00   ? 133 TYR V C   1 
ATOM   9345  O O   . TYR D 1 132 ? 69.936  35.334  -15.375 1.00 2.00   ? 133 TYR V O   1 
ATOM   9346  C CB  . TYR D 1 132 ? 72.298  36.866  -14.789 1.00 2.00   ? 133 TYR V CB  1 
ATOM   9347  C CG  . TYR D 1 132 ? 73.719  37.281  -15.095 1.00 2.00   ? 133 TYR V CG  1 
ATOM   9348  C CD1 . TYR D 1 132 ? 74.695  37.307  -14.097 1.00 2.00   ? 133 TYR V CD1 1 
ATOM   9349  C CD2 . TYR D 1 132 ? 74.085  37.676  -16.371 1.00 2.00   ? 133 TYR V CD2 1 
ATOM   9350  C CE1 . TYR D 1 132 ? 76.013  37.717  -14.378 1.00 2.00   ? 133 TYR V CE1 1 
ATOM   9351  C CE2 . TYR D 1 132 ? 75.396  38.087  -16.654 1.00 2.00   ? 133 TYR V CE2 1 
ATOM   9352  C CZ  . TYR D 1 132 ? 76.347  38.096  -15.652 1.00 2.00   ? 133 TYR V CZ  1 
ATOM   9353  O OH  . TYR D 1 132 ? 77.633  38.427  -15.933 1.00 2.00   ? 133 TYR V OH  1 
ATOM   9354  N N   . SER D 1 133 ? 70.180  34.313  -13.423 1.00 2.00   ? 134 SER V N   1 
ATOM   9355  C CA  . SER D 1 133 ? 68.779  33.919  -13.369 1.00 2.00   ? 134 SER V CA  1 
ATOM   9356  C C   . SER D 1 133 ? 68.458  33.364  -12.000 1.00 2.00   ? 134 SER V C   1 
ATOM   9357  O O   . SER D 1 133 ? 69.335  32.825  -11.335 1.00 87.43  ? 134 SER V O   1 
ATOM   9358  C CB  . SER D 1 133 ? 68.475  32.846  -14.412 1.00 87.43  ? 134 SER V CB  1 
ATOM   9359  O OG  . SER D 1 133 ? 67.884  31.711  -13.803 1.00 87.43  ? 134 SER V OG  1 
ATOM   9360  N N   . GLU D 1 134 ? 67.207  33.496  -11.575 1.00 2.00   ? 135 GLU V N   1 
ATOM   9361  C CA  . GLU D 1 134 ? 66.799  32.980  -10.279 1.00 2.00   ? 135 GLU V CA  1 
ATOM   9362  C C   . GLU D 1 134 ? 67.455  31.616  -10.114 1.00 2.00   ? 135 GLU V C   1 
ATOM   9363  O O   . GLU D 1 134 ? 68.064  31.314  -9.085  1.00 98.65  ? 135 GLU V O   1 
ATOM   9364  C CB  . GLU D 1 134 ? 65.281  32.814  -10.216 1.00 98.65  ? 135 GLU V CB  1 
ATOM   9365  C CG  . GLU D 1 134 ? 64.672  33.273  -8.917  1.00 98.65  ? 135 GLU V CG  1 
ATOM   9366  C CD  . GLU D 1 134 ? 64.311  34.737  -8.951  1.00 98.65  ? 135 GLU V CD  1 
ATOM   9367  O OE1 . GLU D 1 134 ? 63.837  35.209  -10.007 1.00 98.65  ? 135 GLU V OE1 1 
ATOM   9368  O OE2 . GLU D 1 134 ? 64.501  35.416  -7.922  1.00 98.65  ? 135 GLU V OE2 1 
ATOM   9369  N N   . LYS D 1 135 ? 67.314  30.803  -11.156 1.00 31.52  ? 136 LYS V N   1 
ATOM   9370  C CA  . LYS D 1 135 ? 67.878  29.468  -11.177 1.00 31.52  ? 136 LYS V CA  1 
ATOM   9371  C C   . LYS D 1 135 ? 69.321  29.516  -10.674 1.00 31.52  ? 136 LYS V C   1 
ATOM   9372  O O   . LYS D 1 135 ? 69.665  28.903  -9.657  1.00 53.91  ? 136 LYS V O   1 
ATOM   9373  C CB  . LYS D 1 135 ? 67.821  28.922  -12.605 1.00 53.91  ? 136 LYS V CB  1 
ATOM   9374  C CG  . LYS D 1 135 ? 68.533  27.591  -12.809 1.00 53.91  ? 136 LYS V CG  1 
ATOM   9375  C CD  . LYS D 1 135 ? 68.877  27.356  -14.290 1.00 53.91  ? 136 LYS V CD  1 
ATOM   9376  C CE  . LYS D 1 135 ? 69.251  25.900  -14.572 1.00 53.91  ? 136 LYS V CE  1 
ATOM   9377  N NZ  . LYS D 1 135 ? 70.725  25.666  -14.483 1.00 53.91  ? 136 LYS V NZ  1 
ATOM   9378  N N   . ILE D 1 136 ? 70.153  30.270  -11.383 1.00 2.00   ? 137 ILE V N   1 
ATOM   9379  C CA  . ILE D 1 136 ? 71.556  30.395  -11.036 1.00 2.00   ? 137 ILE V CA  1 
ATOM   9380  C C   . ILE D 1 136 ? 71.790  31.067  -9.705  1.00 2.00   ? 137 ILE V C   1 
ATOM   9381  O O   . ILE D 1 136 ? 72.797  30.818  -9.065  1.00 2.00   ? 137 ILE V O   1 
ATOM   9382  C CB  . ILE D 1 136 ? 72.325  31.188  -12.087 1.00 2.00   ? 137 ILE V CB  1 
ATOM   9383  C CG1 . ILE D 1 136 ? 71.918  30.731  -13.482 1.00 2.00   ? 137 ILE V CG1 1 
ATOM   9384  C CG2 . ILE D 1 136 ? 73.807  31.043  -11.863 1.00 2.00   ? 137 ILE V CG2 1 
ATOM   9385  C CD1 . ILE D 1 136 ? 72.914  29.770  -14.128 1.00 2.00   ? 137 ILE V CD1 1 
ATOM   9386  N N   . ILE D 1 137 ? 70.876  31.937  -9.291  1.00 2.00   ? 138 ILE V N   1 
ATOM   9387  C CA  . ILE D 1 137 ? 71.025  32.644  -8.018  1.00 2.00   ? 138 ILE V CA  1 
ATOM   9388  C C   . ILE D 1 137 ? 71.032  31.637  -6.902  1.00 2.00   ? 138 ILE V C   1 
ATOM   9389  O O   . ILE D 1 137 ? 71.923  31.659  -6.059  1.00 2.00   ? 138 ILE V O   1 
ATOM   9390  C CB  . ILE D 1 137 ? 69.849  33.588  -7.715  1.00 2.00   ? 138 ILE V CB  1 
ATOM   9391  C CG1 . ILE D 1 137 ? 69.779  34.699  -8.761  1.00 2.00   ? 138 ILE V CG1 1 
ATOM   9392  C CG2 . ILE D 1 137 ? 69.997  34.154  -6.322  1.00 2.00   ? 138 ILE V CG2 1 
ATOM   9393  C CD1 . ILE D 1 137 ? 71.006  35.535  -8.808  1.00 2.00   ? 138 ILE V CD1 1 
ATOM   9394  N N   . ASP D 1 138 ? 70.026  30.759  -6.910  1.00 2.00   ? 139 ASP V N   1 
ATOM   9395  C CA  . ASP D 1 138 ? 69.877  29.741  -5.880  1.00 2.00   ? 139 ASP V CA  1 
ATOM   9396  C C   . ASP D 1 138 ? 70.974  28.698  -5.919  1.00 2.00   ? 139 ASP V C   1 
ATOM   9397  O O   . ASP D 1 138 ? 71.268  28.043  -4.918  1.00 100.00 ? 139 ASP V O   1 
ATOM   9398  C CB  . ASP D 1 138 ? 68.504  29.094  -5.991  1.00 100.00 ? 139 ASP V CB  1 
ATOM   9399  C CG  . ASP D 1 138 ? 67.414  29.968  -5.395  1.00 100.00 ? 139 ASP V CG  1 
ATOM   9400  O OD1 . ASP D 1 138 ? 67.483  30.258  -4.182  1.00 100.00 ? 139 ASP V OD1 1 
ATOM   9401  O OD2 . ASP D 1 138 ? 66.494  30.374  -6.139  1.00 100.00 ? 139 ASP V OD2 1 
ATOM   9402  N N   . MET D 1 139 ? 71.596  28.561  -7.081  1.00 2.07   ? 140 MET V N   1 
ATOM   9403  C CA  . MET D 1 139 ? 72.690  27.618  -7.235  1.00 2.07   ? 140 MET V CA  1 
ATOM   9404  C C   . MET D 1 139 ? 73.868  28.047  -6.352  1.00 2.07   ? 140 MET V C   1 
ATOM   9405  O O   . MET D 1 139 ? 74.478  27.226  -5.655  1.00 92.21  ? 140 MET V O   1 
ATOM   9406  C CB  . MET D 1 139 ? 73.137  27.568  -8.703  1.00 92.21  ? 140 MET V CB  1 
ATOM   9407  C CG  . MET D 1 139 ? 72.719  26.292  -9.433  1.00 92.21  ? 140 MET V CG  1 
ATOM   9408  S SD  . MET D 1 139 ? 73.326  26.230  -11.108 1.00 92.21  ? 140 MET V SD  1 
ATOM   9409  C CE  . MET D 1 139 ? 74.903  25.412  -11.140 1.00 92.21  ? 140 MET V CE  1 
ATOM   9410  N N   . TYR D 1 140 ? 74.143  29.339  -6.397  1.00 2.00   ? 141 TYR V N   1 
ATOM   9411  C CA  . TYR D 1 140 ? 75.281  29.940  -5.680  1.00 2.00   ? 141 TYR V CA  1 
ATOM   9412  C C   . TYR D 1 140 ? 74.937  30.309  -4.222  1.00 2.00   ? 141 TYR V C   1 
ATOM   9413  O O   . TYR D 1 140 ? 75.830  30.475  -3.379  1.00 2.00   ? 141 TYR V O   1 
ATOM   9414  C CB  . TYR D 1 140 ? 75.729  31.203  -6.407  1.00 2.00   ? 141 TYR V CB  1 
ATOM   9415  C CG  . TYR D 1 140 ? 76.636  30.901  -7.599  1.00 2.00   ? 141 TYR V CG  1 
ATOM   9416  C CD1 . TYR D 1 140 ? 77.985  30.598  -7.386  1.00 2.00   ? 141 TYR V CD1 1 
ATOM   9417  C CD2 . TYR D 1 140 ? 76.119  30.922  -8.901  1.00 2.00   ? 141 TYR V CD2 1 
ATOM   9418  C CE1 . TYR D 1 140 ? 78.822  30.330  -8.476  1.00 2.00   ? 141 TYR V CE1 1 
ATOM   9419  C CE2 . TYR D 1 140 ? 76.956  30.651  -9.991  1.00 2.00   ? 141 TYR V CE2 1 
ATOM   9420  C CZ  . TYR D 1 140 ? 78.308  30.358  -9.777  1.00 2.00   ? 141 TYR V CZ  1 
ATOM   9421  O OH  . TYR D 1 140 ? 79.123  30.100  -10.833 1.00 2.00   ? 141 TYR V OH  1 
ATOM   9422  N N   . LYS D 1 141 ? 73.656  30.437  -3.943  1.00 2.00   ? 142 LYS V N   1 
ATOM   9423  C CA  . LYS D 1 141 ? 73.171  30.786  -2.589  1.00 2.00   ? 142 LYS V CA  1 
ATOM   9424  C C   . LYS D 1 141 ? 73.817  29.883  -1.555  1.00 2.00   ? 142 LYS V C   1 
ATOM   9425  O O   . LYS D 1 141 ? 73.558  28.686  -1.526  1.00 80.50  ? 142 LYS V O   1 
ATOM   9426  C CB  . LYS D 1 141 ? 71.655  30.604  -2.530  1.00 80.50  ? 142 LYS V CB  1 
ATOM   9427  C CG  . LYS D 1 141 ? 71.026  31.184  -1.265  1.00 80.50  ? 142 LYS V CG  1 
ATOM   9428  C CD  . LYS D 1 141 ? 69.629  31.751  -1.511  1.00 80.50  ? 142 LYS V CD  1 
ATOM   9429  C CE  . LYS D 1 141 ? 68.548  31.068  -0.671  1.00 80.50  ? 142 LYS V CE  1 
ATOM   9430  N NZ  . LYS D 1 141 ? 67.189  31.483  -1.042  1.00 80.50  ? 142 LYS V NZ  1 
ATOM   9431  N N   . GLY D 1 142 ? 74.664  30.449  -0.712  1.00 2.00   ? 143 GLY V N   1 
ATOM   9432  C CA  . GLY D 1 142 ? 75.293  29.665  0.331   1.00 2.00   ? 143 GLY V CA  1 
ATOM   9433  C C   . GLY D 1 142 ? 76.531  28.934  -0.136  1.00 2.00   ? 143 GLY V C   1 
ATOM   9434  O O   . GLY D 1 142 ? 77.487  28.751  0.631   1.00 2.00   ? 143 GLY V O   1 
ATOM   9435  N N   . LYS D 1 143 ? 76.514  28.527  -1.402  1.00 11.46  ? 144 LYS V N   1 
ATOM   9436  C CA  . LYS D 1 143 ? 77.634  27.800  -1.992  1.00 11.46  ? 144 LYS V CA  1 
ATOM   9437  C C   . LYS D 1 143 ? 78.975  28.499  -1.746  1.00 11.46  ? 144 LYS V C   1 
ATOM   9438  O O   . LYS D 1 143 ? 79.162  29.685  -2.049  1.00 51.76  ? 144 LYS V O   1 
ATOM   9439  C CB  . LYS D 1 143 ? 77.398  27.610  -3.501  1.00 51.76  ? 144 LYS V CB  1 
ATOM   9440  C CG  . LYS D 1 143 ? 77.420  26.165  -3.985  1.00 51.76  ? 144 LYS V CG  1 
ATOM   9441  C CD  . LYS D 1 143 ? 76.558  25.265  -3.118  1.00 51.76  ? 144 LYS V CD  1 
ATOM   9442  C CE  . LYS D 1 143 ? 75.338  24.718  -3.883  1.00 51.76  ? 144 LYS V CE  1 
ATOM   9443  N NZ  . LYS D 1 143 ? 74.766  23.435  -3.295  1.00 51.76  ? 144 LYS V NZ  1 
ATOM   9444  N N   . LYS D 1 144 ? 79.899  27.736  -1.184  1.00 2.00   ? 145 LYS V N   1 
ATOM   9445  C CA  . LYS D 1 144 ? 81.240  28.206  -0.875  1.00 2.00   ? 145 LYS V CA  1 
ATOM   9446  C C   . LYS D 1 144 ? 81.946  28.812  -2.060  1.00 2.00   ? 145 LYS V C   1 
ATOM   9447  O O   . LYS D 1 144 ? 81.323  29.068  -3.095  1.00 15.58  ? 145 LYS V O   1 
ATOM   9448  C CB  . LYS D 1 144 ? 82.078  27.060  -0.347  1.00 15.58  ? 145 LYS V CB  1 
ATOM   9449  C CG  . LYS D 1 144 ? 83.327  27.481  0.400   1.00 15.58  ? 145 LYS V CG  1 
ATOM   9450  C CD  . LYS D 1 144 ? 83.386  26.836  1.793   1.00 15.58  ? 145 LYS V CD  1 
ATOM   9451  C CE  . LYS D 1 144 ? 82.011  26.793  2.452   1.00 15.58  ? 145 LYS V CE  1 
ATOM   9452  N NZ  . LYS D 1 144 ? 81.958  25.828  3.585   1.00 15.58  ? 145 LYS V NZ  1 
ATOM   9453  N N   . ARG D 1 145 ? 83.251  29.031  -1.907  1.00 2.00   ? 146 ARG V N   1 
ATOM   9454  C CA  . ARG D 1 145 ? 84.056  29.645  -2.965  1.00 2.00   ? 146 ARG V CA  1 
ATOM   9455  C C   . ARG D 1 145 ? 84.337  28.659  -4.070  1.00 2.00   ? 146 ARG V C   1 
ATOM   9456  O O   . ARG D 1 145 ? 84.241  28.989  -5.256  1.00 36.01  ? 146 ARG V O   1 
ATOM   9457  C CB  . ARG D 1 145 ? 85.388  30.160  -2.409  1.00 36.01  ? 146 ARG V CB  1 
ATOM   9458  C CG  . ARG D 1 145 ? 85.271  31.144  -1.244  1.00 36.01  ? 146 ARG V CG  1 
ATOM   9459  C CD  . ARG D 1 145 ? 85.144  30.433  0.097   1.00 36.01  ? 146 ARG V CD  1 
ATOM   9460  N NE  . ARG D 1 145 ? 83.818  30.654  0.657   1.00 36.01  ? 146 ARG V NE  1 
ATOM   9461  C CZ  . ARG D 1 145 ? 83.457  31.765  1.281   1.00 36.01  ? 146 ARG V CZ  1 
ATOM   9462  N NH1 . ARG D 1 145 ? 84.332  32.754  1.423   1.00 36.01  ? 146 ARG V NH1 1 
ATOM   9463  N NH2 . ARG D 1 145 ? 82.219  31.893  1.743   1.00 36.01  ? 146 ARG V NH2 1 
ATOM   9464  N N   . HIS D 1 146 ? 84.669  27.438  -3.662  1.00 28.87  ? 147 HIS V N   1 
ATOM   9465  C CA  . HIS D 1 146 ? 84.997  26.373  -4.592  1.00 28.87  ? 147 HIS V CA  1 
ATOM   9466  C C   . HIS D 1 146 ? 83.822  25.467  -4.966  1.00 28.87  ? 147 HIS V C   1 
ATOM   9467  O O   . HIS D 1 146 ? 83.839  24.826  -6.009  1.00 2.00   ? 147 HIS V O   1 
ATOM   9468  C CB  . HIS D 1 146 ? 86.150  25.546  -4.027  1.00 2.00   ? 147 HIS V CB  1 
ATOM   9469  C CG  . HIS D 1 146 ? 85.879  24.978  -2.676  1.00 2.00   ? 147 HIS V CG  1 
ATOM   9470  N ND1 . HIS D 1 146 ? 84.890  24.046  -2.451  1.00 2.00   ? 147 HIS V ND1 1 
ATOM   9471  C CD2 . HIS D 1 146 ? 86.471  25.204  -1.481  1.00 2.00   ? 147 HIS V CD2 1 
ATOM   9472  C CE1 . HIS D 1 146 ? 84.887  23.717  -1.172  1.00 2.00   ? 147 HIS V CE1 1 
ATOM   9473  N NE2 . HIS D 1 146 ? 85.839  24.407  -0.563  1.00 2.00   ? 147 HIS V NE2 1 
ATOM   9474  N N   . GLU D 1 147 ? 82.795  25.401  -4.140  1.00 2.00   ? 148 GLU V N   1 
ATOM   9475  C CA  . GLU D 1 147 ? 81.668  24.567  -4.492  1.00 2.00   ? 148 GLU V CA  1 
ATOM   9476  C C   . GLU D 1 147 ? 80.997  25.016  -5.798  1.00 2.00   ? 148 GLU V C   1 
ATOM   9477  O O   . GLU D 1 147 ? 79.951  24.489  -6.188  1.00 45.02  ? 148 GLU V O   1 
ATOM   9478  C CB  . GLU D 1 147 ? 80.652  24.597  -3.379  1.00 45.02  ? 148 GLU V CB  1 
ATOM   9479  C CG  . GLU D 1 147 ? 81.283  24.563  -2.042  1.00 45.02  ? 148 GLU V CG  1 
ATOM   9480  C CD  . GLU D 1 147 ? 81.049  23.266  -1.360  1.00 45.02  ? 148 GLU V CD  1 
ATOM   9481  O OE1 . GLU D 1 147 ? 79.871  22.980  -1.049  1.00 45.02  ? 148 GLU V OE1 1 
ATOM   9482  O OE2 . GLU D 1 147 ? 82.040  22.536  -1.144  1.00 45.02  ? 148 GLU V OE2 1 
ATOM   9483  N N   . MET D 1 148 ? 81.596  25.983  -6.478  1.00 2.00   ? 149 MET V N   1 
ATOM   9484  C CA  . MET D 1 148 ? 81.025  26.495  -7.708  1.00 2.00   ? 149 MET V CA  1 
ATOM   9485  C C   . MET D 1 148 ? 82.079  27.270  -8.480  1.00 2.00   ? 149 MET V C   1 
ATOM   9486  O O   . MET D 1 148 ? 83.151  27.568  -7.960  1.00 24.89  ? 149 MET V O   1 
ATOM   9487  C CB  . MET D 1 148 ? 79.859  27.419  -7.371  1.00 24.89  ? 149 MET V CB  1 
ATOM   9488  C CG  . MET D 1 148 ? 78.608  26.695  -7.020  1.00 24.89  ? 149 MET V CG  1 
ATOM   9489  S SD  . MET D 1 148 ? 77.767  26.370  -8.535  1.00 24.89  ? 149 MET V SD  1 
ATOM   9490  C CE  . MET D 1 148 ? 76.060  26.308  -7.948  1.00 24.89  ? 149 MET V CE  1 
ATOM   9491  N N   . PRO D 1 149 ? 81.788  27.622  -9.732  1.00 2.62   ? 150 PRO V N   1 
ATOM   9492  C CA  . PRO D 1 149 ? 82.730  28.367  -10.560 1.00 2.62   ? 150 PRO V CA  1 
ATOM   9493  C C   . PRO D 1 149 ? 82.665  29.900  -10.418 1.00 2.62   ? 150 PRO V C   1 
ATOM   9494  O O   . PRO D 1 149 ? 81.618  30.480  -10.065 1.00 2.00   ? 150 PRO V O   1 
ATOM   9495  C CB  . PRO D 1 149 ? 82.367  27.931  -11.954 1.00 2.00   ? 150 PRO V CB  1 
ATOM   9496  C CG  . PRO D 1 149 ? 80.889  27.776  -11.876 1.00 2.00   ? 150 PRO V CG  1 
ATOM   9497  C CD  . PRO D 1 149 ? 80.547  27.343  -10.467 1.00 2.00   ? 150 PRO V CD  1 
ATOM   9498  N N   . PRO D 1 150 ? 83.791  30.579  -10.704 1.00 11.76  ? 151 PRO V N   1 
ATOM   9499  C CA  . PRO D 1 150 ? 83.879  32.026  -10.620 1.00 11.76  ? 151 PRO V CA  1 
ATOM   9500  C C   . PRO D 1 150 ? 82.702  32.626  -11.328 1.00 11.76  ? 151 PRO V C   1 
ATOM   9501  O O   . PRO D 1 150 ? 82.430  32.281  -12.473 1.00 6.89   ? 151 PRO V O   1 
ATOM   9502  C CB  . PRO D 1 150 ? 85.175  32.362  -11.353 1.00 6.89   ? 151 PRO V CB  1 
ATOM   9503  C CG  . PRO D 1 150 ? 85.615  31.116  -12.000 1.00 6.89   ? 151 PRO V CG  1 
ATOM   9504  C CD  . PRO D 1 150 ? 85.073  30.024  -11.145 1.00 6.89   ? 151 PRO V CD  1 
ATOM   9505  N N   . HIS D 1 151 ? 82.008  33.510  -10.629 1.00 41.67  ? 152 HIS V N   1 
ATOM   9506  C CA  . HIS D 1 151 ? 80.860  34.216  -11.162 1.00 41.67  ? 152 HIS V CA  1 
ATOM   9507  C C   . HIS D 1 151 ? 80.653  35.405  -10.243 1.00 41.67  ? 152 HIS V C   1 
ATOM   9508  O O   . HIS D 1 151 ? 81.088  35.395  -9.084  1.00 6.30   ? 152 HIS V O   1 
ATOM   9509  C CB  . HIS D 1 151 ? 79.624  33.340  -11.139 1.00 6.30   ? 152 HIS V CB  1 
ATOM   9510  C CG  . HIS D 1 151 ? 78.375  34.010  -11.683 1.00 6.30   ? 152 HIS V CG  1 
ATOM   9511  N ND1 . HIS D 1 151 ? 77.627  34.895  -10.919 1.00 6.30   ? 152 HIS V ND1 1 
ATOM   9512  C CD2 . HIS D 1 151 ? 77.757  33.917  -12.886 1.00 6.30   ? 152 HIS V CD2 1 
ATOM   9513  C CE1 . HIS D 1 151 ? 76.606  35.301  -11.649 1.00 6.30   ? 152 HIS V CE1 1 
ATOM   9514  N NE2 . HIS D 1 151 ? 76.668  34.728  -12.826 1.00 6.30   ? 152 HIS V NE2 1 
ATOM   9515  N N   . ILE D 1 152 ? 80.005  36.426  -10.732 1.00 7.52   ? 153 ILE V N   1 
ATOM   9516  C CA  . ILE D 1 152 ? 79.791  37.608  -9.902  1.00 7.52   ? 153 ILE V CA  1 
ATOM   9517  C C   . ILE D 1 152 ? 78.946  37.249  -8.676  1.00 7.52   ? 153 ILE V C   1 
ATOM   9518  O O   . ILE D 1 152 ? 79.294  37.580  -7.539  1.00 2.00   ? 153 ILE V O   1 
ATOM   9519  C CB  . ILE D 1 152 ? 79.112  38.724  -10.676 1.00 2.00   ? 153 ILE V CB  1 
ATOM   9520  C CG1 . ILE D 1 152 ? 79.073  40.033  -9.880  1.00 2.00   ? 153 ILE V CG1 1 
ATOM   9521  C CG2 . ILE D 1 152 ? 77.667  38.397  -11.048 1.00 2.00   ? 153 ILE V CG2 1 
ATOM   9522  C CD1 . ILE D 1 152 ? 80.455  40.476  -9.386  1.00 2.00   ? 153 ILE V CD1 1 
ATOM   9523  N N   . TYR D 1 153 ? 77.836  36.568  -8.907  1.00 2.00   ? 154 TYR V N   1 
ATOM   9524  C CA  . TYR D 1 153 ? 76.948  36.176  -7.801  1.00 2.00   ? 154 TYR V CA  1 
ATOM   9525  C C   . TYR D 1 153 ? 77.756  35.550  -6.680  1.00 2.00   ? 154 TYR V C   1 
ATOM   9526  O O   . TYR D 1 153 ? 77.291  35.498  -5.525  1.00 7.10   ? 154 TYR V O   1 
ATOM   9527  C CB  . TYR D 1 153 ? 75.926  35.137  -8.238  1.00 7.10   ? 154 TYR V CB  1 
ATOM   9528  C CG  . TYR D 1 153 ? 74.875  35.665  -9.208  1.00 7.10   ? 154 TYR V CG  1 
ATOM   9529  C CD1 . TYR D 1 153 ? 74.617  37.039  -9.308  1.00 7.10   ? 154 TYR V CD1 1 
ATOM   9530  C CD2 . TYR D 1 153 ? 74.176  34.757  -9.996  1.00 7.10   ? 154 TYR V CD2 1 
ATOM   9531  C CE1 . TYR D 1 153 ? 73.656  37.499  -10.220 1.00 7.10   ? 154 TYR V CE1 1 
ATOM   9532  C CE2 . TYR D 1 153 ? 73.222  35.213  -10.909 1.00 7.10   ? 154 TYR V CE2 1 
ATOM   9533  C CZ  . TYR D 1 153 ? 72.961  36.581  -11.023 1.00 7.10   ? 154 TYR V CZ  1 
ATOM   9534  O OH  . TYR D 1 153 ? 72.032  37.017  -11.916 1.00 7.10   ? 154 TYR V OH  1 
ATOM   9535  N N   . ALA D 1 154 ? 78.956  35.070  -7.007  1.00 2.00   ? 155 ALA V N   1 
ATOM   9536  C CA  . ALA D 1 154 ? 79.818  34.438  -6.017  1.00 2.00   ? 155 ALA V CA  1 
ATOM   9537  C C   . ALA D 1 154 ? 80.508  35.474  -5.135  1.00 2.00   ? 155 ALA V C   1 
ATOM   9538  O O   . ALA D 1 154 ? 80.521  35.339  -3.911  1.00 67.14  ? 155 ALA V O   1 
ATOM   9539  C CB  . ALA D 1 154 ? 80.845  33.578  -6.703  1.00 67.14  ? 155 ALA V CB  1 
ATOM   9540  N N   . ILE D 1 155 ? 81.080  36.509  -5.752  1.00 7.02   ? 156 ILE V N   1 
ATOM   9541  C CA  . ILE D 1 155 ? 81.767  37.579  -5.007  1.00 7.02   ? 156 ILE V CA  1 
ATOM   9542  C C   . ILE D 1 155 ? 80.779  38.215  -4.061  1.00 7.02   ? 156 ILE V C   1 
ATOM   9543  O O   . ILE D 1 155 ? 81.107  38.500  -2.924  1.00 2.00   ? 156 ILE V O   1 
ATOM   9544  C CB  . ILE D 1 155 ? 82.323  38.669  -5.941  1.00 2.00   ? 156 ILE V CB  1 
ATOM   9545  C CG1 . ILE D 1 155 ? 83.387  38.066  -6.867  1.00 2.00   ? 156 ILE V CG1 1 
ATOM   9546  C CG2 . ILE D 1 155 ? 82.932  39.768  -5.137  1.00 2.00   ? 156 ILE V CG2 1 
ATOM   9547  C CD1 . ILE D 1 155 ? 83.396  38.600  -8.278  1.00 2.00   ? 156 ILE V CD1 1 
ATOM   9548  N N   . ALA D 1 156 ? 79.562  38.423  -4.551  1.00 8.52   ? 157 ALA V N   1 
ATOM   9549  C CA  . ALA D 1 156 ? 78.493  38.997  -3.756  1.00 8.52   ? 157 ALA V CA  1 
ATOM   9550  C C   . ALA D 1 156 ? 78.211  38.136  -2.520  1.00 8.52   ? 157 ALA V C   1 
ATOM   9551  O O   . ALA D 1 156 ? 78.190  38.642  -1.399  1.00 8.73   ? 157 ALA V O   1 
ATOM   9552  C CB  . ALA D 1 156 ? 77.242  39.131  -4.592  1.00 8.73   ? 157 ALA V CB  1 
ATOM   9553  N N   . ASP D 1 157 ? 78.002  36.838  -2.706  1.00 2.00   ? 158 ASP V N   1 
ATOM   9554  C CA  . ASP D 1 157 ? 77.731  35.998  -1.560  1.00 2.00   ? 158 ASP V CA  1 
ATOM   9555  C C   . ASP D 1 157 ? 78.932  35.865  -0.629  1.00 2.00   ? 158 ASP V C   1 
ATOM   9556  O O   . ASP D 1 157 ? 78.785  35.802  0.591   1.00 14.99  ? 158 ASP V O   1 
ATOM   9557  C CB  . ASP D 1 157 ? 77.262  34.604  -1.997  1.00 14.99  ? 158 ASP V CB  1 
ATOM   9558  C CG  . ASP D 1 157 ? 76.736  33.757  -0.820  1.00 14.99  ? 158 ASP V CG  1 
ATOM   9559  O OD1 . ASP D 1 157 ? 77.556  33.166  -0.084  1.00 14.99  ? 158 ASP V OD1 1 
ATOM   9560  O OD2 . ASP D 1 157 ? 75.503  33.689  -0.629  1.00 14.99  ? 158 ASP V OD2 1 
ATOM   9561  N N   . THR D 1 158 ? 80.127  35.824  -1.197  1.00 2.00   ? 159 THR V N   1 
ATOM   9562  C CA  . THR D 1 158 ? 81.343  35.670  -0.389  1.00 2.00   ? 159 THR V CA  1 
ATOM   9563  C C   . THR D 1 158 ? 81.497  36.819  0.595   1.00 2.00   ? 159 THR V C   1 
ATOM   9564  O O   . THR D 1 158 ? 81.944  36.627  1.724   1.00 35.14  ? 159 THR V O   1 
ATOM   9565  C CB  . THR D 1 158 ? 82.617  35.611  -1.270  1.00 35.14  ? 159 THR V CB  1 
ATOM   9566  O OG1 . THR D 1 158 ? 82.519  34.537  -2.214  1.00 35.14  ? 159 THR V OG1 1 
ATOM   9567  C CG2 . THR D 1 158 ? 83.835  35.371  -0.408  1.00 35.14  ? 159 THR V CG2 1 
ATOM   9568  N N   . ALA D 1 159 ? 81.132  38.018  0.146   1.00 3.65   ? 160 ALA V N   1 
ATOM   9569  C CA  . ALA D 1 159 ? 81.212  39.217  0.962   1.00 3.65   ? 160 ALA V CA  1 
ATOM   9570  C C   . ALA D 1 159 ? 80.058  39.215  1.946   1.00 3.65   ? 160 ALA V C   1 
ATOM   9571  O O   . ALA D 1 159 ? 80.260  39.229  3.157   1.00 2.00   ? 160 ALA V O   1 
ATOM   9572  C CB  . ALA D 1 159 ? 81.136  40.436  0.078   1.00 2.00   ? 160 ALA V CB  1 
ATOM   9573  N N   . TYR D 1 160 ? 78.841  39.167  1.412   1.00 2.00   ? 161 TYR V N   1 
ATOM   9574  C CA  . TYR D 1 160 ? 77.638  39.188  2.232   1.00 2.00   ? 161 TYR V CA  1 
ATOM   9575  C C   . TYR D 1 160 ? 77.647  38.238  3.401   1.00 2.00   ? 161 TYR V C   1 
ATOM   9576  O O   . TYR D 1 160 ? 76.901  38.418  4.351   1.00 2.00   ? 161 TYR V O   1 
ATOM   9577  C CB  . TYR D 1 160 ? 76.404  38.901  1.403   1.00 2.00   ? 161 TYR V CB  1 
ATOM   9578  C CG  . TYR D 1 160 ? 75.236  38.584  2.269   1.00 2.00   ? 161 TYR V CG  1 
ATOM   9579  C CD1 . TYR D 1 160 ? 74.569  39.577  2.940   1.00 2.00   ? 161 TYR V CD1 1 
ATOM   9580  C CD2 . TYR D 1 160 ? 74.835  37.284  2.463   1.00 2.00   ? 161 TYR V CD2 1 
ATOM   9581  C CE1 . TYR D 1 160 ? 73.528  39.275  3.786   1.00 2.00   ? 161 TYR V CE1 1 
ATOM   9582  C CE2 . TYR D 1 160 ? 73.799  36.970  3.303   1.00 2.00   ? 161 TYR V CE2 1 
ATOM   9583  C CZ  . TYR D 1 160 ? 73.145  37.958  3.963   1.00 2.00   ? 161 TYR V CZ  1 
ATOM   9584  O OH  . TYR D 1 160 ? 72.096  37.633  4.805   1.00 2.00   ? 161 TYR V OH  1 
ATOM   9585  N N   . ARG D 1 161 ? 78.462  37.202  3.321   1.00 2.00   ? 162 ARG V N   1 
ATOM   9586  C CA  . ARG D 1 161 ? 78.554  36.263  4.416   1.00 2.00   ? 162 ARG V CA  1 
ATOM   9587  C C   . ARG D 1 161 ? 79.670  36.769  5.307   1.00 2.00   ? 162 ARG V C   1 
ATOM   9588  O O   . ARG D 1 161 ? 79.482  36.976  6.500   1.00 34.25  ? 162 ARG V O   1 
ATOM   9589  C CB  . ARG D 1 161 ? 78.914  34.880  3.916   1.00 34.25  ? 162 ARG V CB  1 
ATOM   9590  C CG  . ARG D 1 161 ? 79.462  34.012  5.019   1.00 34.25  ? 162 ARG V CG  1 
ATOM   9591  C CD  . ARG D 1 161 ? 78.627  32.750  5.198   1.00 34.25  ? 162 ARG V CD  1 
ATOM   9592  N NE  . ARG D 1 161 ? 77.378  32.985  5.913   1.00 34.25  ? 162 ARG V NE  1 
ATOM   9593  C CZ  . ARG D 1 161 ? 76.188  33.000  5.324   1.00 34.25  ? 162 ARG V CZ  1 
ATOM   9594  N NH1 . ARG D 1 161 ? 76.094  32.800  4.016   1.00 34.25  ? 162 ARG V NH1 1 
ATOM   9595  N NH2 . ARG D 1 161 ? 75.092  33.210  6.038   1.00 34.25  ? 162 ARG V NH2 1 
ATOM   9596  N N   . SER D 1 162 ? 80.839  36.969  4.702   1.00 20.74  ? 163 SER V N   1 
ATOM   9597  C CA  . SER D 1 162 ? 82.007  37.462  5.417   1.00 20.74  ? 163 SER V CA  1 
ATOM   9598  C C   . SER D 1 162 ? 81.576  38.548  6.377   1.00 20.74  ? 163 SER V C   1 
ATOM   9599  O O   . SER D 1 162 ? 82.064  38.629  7.498   1.00 2.00   ? 163 SER V O   1 
ATOM   9600  C CB  . SER D 1 162 ? 83.035  38.016  4.438   1.00 2.00   ? 163 SER V CB  1 
ATOM   9601  O OG  . SER D 1 162 ? 84.334  37.576  4.775   1.00 2.00   ? 163 SER V OG  1 
ATOM   9602  N N   . MET D 1 163 ? 80.649  39.385  5.936   1.00 27.48  ? 164 MET V N   1 
ATOM   9603  C CA  . MET D 1 163 ? 80.146  40.446  6.797   1.00 27.48  ? 164 MET V CA  1 
ATOM   9604  C C   . MET D 1 163 ? 79.520  39.805  8.031   1.00 27.48  ? 164 MET V C   1 
ATOM   9605  O O   . MET D 1 163 ? 79.965  40.038  9.136   1.00 2.00   ? 164 MET V O   1 
ATOM   9606  C CB  . MET D 1 163 ? 79.107  41.289  6.050   1.00 2.00   ? 164 MET V CB  1 
ATOM   9607  C CG  . MET D 1 163 ? 78.017  41.870  6.911   1.00 2.00   ? 164 MET V CG  1 
ATOM   9608  S SD  . MET D 1 163 ? 76.585  42.347  5.959   1.00 2.00   ? 164 MET V SD  1 
ATOM   9609  C CE  . MET D 1 163 ? 77.358  43.248  4.654   1.00 2.00   ? 164 MET V CE  1 
ATOM   9610  N N   . LEU D 1 164 ? 78.510  38.973  7.836   1.00 2.00   ? 165 LEU V N   1 
ATOM   9611  C CA  . LEU D 1 164 ? 77.841  38.324  8.948   1.00 2.00   ? 165 LEU V CA  1 
ATOM   9612  C C   . LEU D 1 164 ? 78.693  37.349  9.740   1.00 2.00   ? 165 LEU V C   1 
ATOM   9613  O O   . LEU D 1 164 ? 78.280  36.873  10.801  1.00 3.85   ? 165 LEU V O   1 
ATOM   9614  C CB  . LEU D 1 164 ? 76.605  37.573  8.460   1.00 3.85   ? 165 LEU V CB  1 
ATOM   9615  C CG  . LEU D 1 164 ? 75.596  38.343  7.624   1.00 3.85   ? 165 LEU V CG  1 
ATOM   9616  C CD1 . LEU D 1 164 ? 75.287  37.605  6.352   1.00 3.85   ? 165 LEU V CD1 1 
ATOM   9617  C CD2 . LEU D 1 164 ? 74.344  38.516  8.420   1.00 3.85   ? 165 LEU V CD2 1 
ATOM   9618  N N   . GLN D 1 165 ? 79.880  37.032  9.239   1.00 2.00   ? 166 GLN V N   1 
ATOM   9619  C CA  . GLN D 1 165 ? 80.732  36.067  9.941   1.00 2.00   ? 166 GLN V CA  1 
ATOM   9620  C C   . GLN D 1 165 ? 81.660  36.699  10.955  1.00 2.00   ? 166 GLN V C   1 
ATOM   9621  O O   . GLN D 1 165 ? 81.565  36.411  12.149  1.00 79.30  ? 166 GLN V O   1 
ATOM   9622  C CB  . GLN D 1 165 ? 81.548  35.242  8.939   1.00 79.30  ? 166 GLN V CB  1 
ATOM   9623  C CG  . GLN D 1 165 ? 80.831  33.989  8.417   1.00 79.30  ? 166 GLN V CG  1 
ATOM   9624  C CD  . GLN D 1 165 ? 80.257  33.111  9.527   1.00 79.30  ? 166 GLN V CD  1 
ATOM   9625  O OE1 . GLN D 1 165 ? 80.861  32.963  10.594  1.00 79.30  ? 166 GLN V OE1 1 
ATOM   9626  N NE2 . GLN D 1 165 ? 79.082  32.526  9.276   1.00 79.30  ? 166 GLN V NE2 1 
ATOM   9627  N N   . ASP D 1 166 ? 82.559  37.558  10.478  1.00 47.64  ? 167 ASP V N   1 
ATOM   9628  C CA  . ASP D 1 166 ? 83.505  38.240  11.357  1.00 47.64  ? 167 ASP V CA  1 
ATOM   9629  C C   . ASP D 1 166 ? 83.006  39.625  11.752  1.00 47.64  ? 167 ASP V C   1 
ATOM   9630  O O   . ASP D 1 166 ? 83.747  40.429  12.311  1.00 49.71  ? 167 ASP V O   1 
ATOM   9631  C CB  . ASP D 1 166 ? 84.877  38.353  10.687  1.00 49.71  ? 167 ASP V CB  1 
ATOM   9632  C CG  . ASP D 1 166 ? 84.779  38.777  9.252   1.00 49.71  ? 167 ASP V CG  1 
ATOM   9633  O OD1 . ASP D 1 166 ? 83.904  39.623  8.961   1.00 49.71  ? 167 ASP V OD1 1 
ATOM   9634  O OD2 . ASP D 1 166 ? 85.572  38.267  8.425   1.00 49.71  ? 167 ASP V OD2 1 
ATOM   9635  N N   . ARG D 1 167 ? 81.740  39.884  11.457  1.00 44.06  ? 168 ARG V N   1 
ATOM   9636  C CA  . ARG D 1 167 ? 81.098  41.153  11.784  1.00 44.06  ? 168 ARG V CA  1 
ATOM   9637  C C   . ARG D 1 167 ? 82.033  42.300  11.442  1.00 44.06  ? 168 ARG V C   1 
ATOM   9638  O O   . ARG D 1 167 ? 82.696  42.842  12.320  1.00 100.00 ? 168 ARG V O   1 
ATOM   9639  C CB  . ARG D 1 167 ? 80.733  41.177  13.273  1.00 100.00 ? 168 ARG V CB  1 
ATOM   9640  C CG  . ARG D 1 167 ? 80.044  39.900  13.762  1.00 100.00 ? 168 ARG V CG  1 
ATOM   9641  C CD  . ARG D 1 167 ? 80.301  39.636  15.239  1.00 100.00 ? 168 ARG V CD  1 
ATOM   9642  N NE  . ARG D 1 167 ? 79.221  40.154  16.077  1.00 100.00 ? 168 ARG V NE  1 
ATOM   9643  C CZ  . ARG D 1 167 ? 79.386  40.631  17.309  1.00 100.00 ? 168 ARG V CZ  1 
ATOM   9644  N NH1 . ARG D 1 167 ? 80.593  40.659  17.865  1.00 100.00 ? 168 ARG V NH1 1 
ATOM   9645  N NH2 . ARG D 1 167 ? 78.340  41.078  17.991  1.00 100.00 ? 168 ARG V NH2 1 
ATOM   9646  N N   . GLU D 1 168 ? 82.081  42.666  10.163  1.00 2.00   ? 169 GLU V N   1 
ATOM   9647  C CA  . GLU D 1 168 ? 82.969  43.735  9.707   1.00 2.00   ? 169 GLU V CA  1 
ATOM   9648  C C   . GLU D 1 168 ? 82.689  44.160  8.277   1.00 2.00   ? 169 GLU V C   1 
ATOM   9649  O O   . GLU D 1 168 ? 83.168  43.562  7.316   1.00 97.46  ? 169 GLU V O   1 
ATOM   9650  C CB  . GLU D 1 168 ? 84.417  43.282  9.864   1.00 97.46  ? 169 GLU V CB  1 
ATOM   9651  C CG  . GLU D 1 168 ? 85.384  43.817  8.842   1.00 97.46  ? 169 GLU V CG  1 
ATOM   9652  C CD  . GLU D 1 168 ? 86.535  42.863  8.625   1.00 97.46  ? 169 GLU V CD  1 
ATOM   9653  O OE1 . GLU D 1 168 ? 86.400  41.948  7.781   1.00 97.46  ? 169 GLU V OE1 1 
ATOM   9654  O OE2 . GLU D 1 168 ? 87.571  43.027  9.308   1.00 97.46  ? 169 GLU V OE2 1 
ATOM   9655  N N   . ASP D 1 169 ? 81.907  45.223  8.170   1.00 20.29  ? 170 ASP V N   1 
ATOM   9656  C CA  . ASP D 1 169 ? 81.468  45.798  6.904   1.00 20.29  ? 170 ASP V CA  1 
ATOM   9657  C C   . ASP D 1 169 ? 82.392  45.605  5.718   1.00 20.29  ? 170 ASP V C   1 
ATOM   9658  O O   . ASP D 1 169 ? 83.611  45.521  5.864   1.00 96.61  ? 170 ASP V O   1 
ATOM   9659  C CB  . ASP D 1 169 ? 81.134  47.277  7.111   1.00 96.61  ? 170 ASP V CB  1 
ATOM   9660  C CG  . ASP D 1 169 ? 80.023  47.481  8.138   1.00 96.61  ? 170 ASP V CG  1 
ATOM   9661  O OD1 . ASP D 1 169 ? 78.889  46.991  7.919   1.00 96.61  ? 170 ASP V OD1 1 
ATOM   9662  O OD2 . ASP D 1 169 ? 80.290  48.129  9.171   1.00 96.61  ? 170 ASP V OD2 1 
ATOM   9663  N N   . GLN D 1 170 ? 81.789  45.537  4.534   1.00 2.00   ? 171 GLN V N   1 
ATOM   9664  C CA  . GLN D 1 170 ? 82.546  45.284  3.327   1.00 2.00   ? 171 GLN V CA  1 
ATOM   9665  C C   . GLN D 1 170 ? 82.168  46.094  2.109   1.00 2.00   ? 171 GLN V C   1 
ATOM   9666  O O   . GLN D 1 170 ? 81.074  46.660  2.016   1.00 9.02   ? 171 GLN V O   1 
ATOM   9667  C CB  . GLN D 1 170 ? 82.447  43.813  2.971   1.00 9.02   ? 171 GLN V CB  1 
ATOM   9668  C CG  . GLN D 1 170 ? 82.355  42.897  4.157   1.00 9.02   ? 171 GLN V CG  1 
ATOM   9669  C CD  . GLN D 1 170 ? 83.532  41.989  4.235   1.00 9.02   ? 171 GLN V CD  1 
ATOM   9670  O OE1 . GLN D 1 170 ? 84.201  41.738  3.218   1.00 9.02   ? 171 GLN V OE1 1 
ATOM   9671  N NE2 . GLN D 1 170 ? 83.815  41.482  5.436   1.00 9.02   ? 171 GLN V NE2 1 
ATOM   9672  N N   . SER D 1 171 ? 83.095  46.092  1.160   1.00 2.00   ? 172 SER V N   1 
ATOM   9673  C CA  . SER D 1 171 ? 82.964  46.828  -0.081  1.00 2.00   ? 172 SER V CA  1 
ATOM   9674  C C   . SER D 1 171 ? 83.342  46.003  -1.309  1.00 2.00   ? 172 SER V C   1 
ATOM   9675  O O   . SER D 1 171 ? 84.268  45.211  -1.273  1.00 20.58  ? 172 SER V O   1 
ATOM   9676  C CB  . SER D 1 171 ? 83.867  48.054  -0.026  1.00 20.58  ? 172 SER V CB  1 
ATOM   9677  O OG  . SER D 1 171 ? 85.218  47.646  0.076   1.00 20.58  ? 172 SER V OG  1 
ATOM   9678  N N   . ILE D 1 172 ? 82.617  46.205  -2.402  1.00 2.00   ? 173 ILE V N   1 
ATOM   9679  C CA  . ILE D 1 172 ? 82.876  45.519  -3.648  1.00 2.00   ? 173 ILE V CA  1 
ATOM   9680  C C   . ILE D 1 172 ? 83.187  46.674  -4.592  1.00 2.00   ? 173 ILE V C   1 
ATOM   9681  O O   . ILE D 1 172 ? 82.291  47.403  -4.980  1.00 2.00   ? 173 ILE V O   1 
ATOM   9682  C CB  . ILE D 1 172 ? 81.628  44.718  -4.130  1.00 2.00   ? 173 ILE V CB  1 
ATOM   9683  C CG1 . ILE D 1 172 ? 81.345  43.564  -3.179  1.00 2.00   ? 173 ILE V CG1 1 
ATOM   9684  C CG2 . ILE D 1 172 ? 81.872  44.144  -5.483  1.00 2.00   ? 173 ILE V CG2 1 
ATOM   9685  C CD1 . ILE D 1 172 ? 79.919  43.142  -3.150  1.00 2.00   ? 173 ILE V CD1 1 
ATOM   9686  N N   . LEU D 1 173 ? 84.461  46.849  -4.930  1.00 2.00   ? 174 LEU V N   1 
ATOM   9687  C CA  . LEU D 1 173 ? 84.916  47.923  -5.803  1.00 2.00   ? 174 LEU V CA  1 
ATOM   9688  C C   . LEU D 1 173 ? 85.194  47.511  -7.235  1.00 2.00   ? 174 LEU V C   1 
ATOM   9689  O O   . LEU D 1 173 ? 86.196  46.860  -7.477  1.00 2.00   ? 174 LEU V O   1 
ATOM   9690  C CB  . LEU D 1 173 ? 86.191  48.513  -5.237  1.00 2.00   ? 174 LEU V CB  1 
ATOM   9691  C CG  . LEU D 1 173 ? 86.251  48.620  -3.729  1.00 2.00   ? 174 LEU V CG  1 
ATOM   9692  C CD1 . LEU D 1 173 ? 87.670  48.791  -3.278  1.00 2.00   ? 174 LEU V CD1 1 
ATOM   9693  C CD2 . LEU D 1 173 ? 85.447  49.797  -3.304  1.00 2.00   ? 174 LEU V CD2 1 
ATOM   9694  N N   . CYS D 1 174 ? 84.355  47.914  -8.189  1.00 2.00   ? 175 CYS V N   1 
ATOM   9695  C CA  . CYS D 1 174 ? 84.570  47.554  -9.605  1.00 2.00   ? 175 CYS V CA  1 
ATOM   9696  C C   . CYS D 1 174 ? 85.503  48.509  -10.317 1.00 2.00   ? 175 CYS V C   1 
ATOM   9697  O O   . CYS D 1 174 ? 85.134  49.650  -10.575 1.00 18.14  ? 175 CYS V O   1 
ATOM   9698  C CB  . CYS D 1 174 ? 83.255  47.550  -10.377 1.00 18.14  ? 175 CYS V CB  1 
ATOM   9699  S SG  . CYS D 1 174 ? 82.030  46.404  -9.782  1.00 18.14  ? 175 CYS V SG  1 
ATOM   9700  N N   . THR D 1 175 ? 86.705  48.041  -10.642 1.00 32.53  ? 176 THR V N   1 
ATOM   9701  C CA  . THR D 1 175 ? 87.693  48.875  -11.332 1.00 32.53  ? 176 THR V CA  1 
ATOM   9702  C C   . THR D 1 175 ? 87.533  48.690  -12.827 1.00 32.53  ? 176 THR V C   1 
ATOM   9703  O O   . THR D 1 175 ? 86.447  48.386  -13.297 1.00 40.08  ? 176 THR V O   1 
ATOM   9704  C CB  . THR D 1 175 ? 89.148  48.498  -10.950 1.00 40.08  ? 176 THR V CB  1 
ATOM   9705  O OG1 . THR D 1 175 ? 89.565  47.351  -11.710 1.00 40.08  ? 176 THR V OG1 1 
ATOM   9706  C CG2 . THR D 1 175 ? 89.252  48.200  -9.456  1.00 40.08  ? 176 THR V CG2 1 
ATOM   9707  N N   . GLY D 1 176 ? 88.620  48.868  -13.568 1.00 85.10  ? 177 GLY V N   1 
ATOM   9708  C CA  . GLY D 1 176 ? 88.552  48.696  -15.002 1.00 85.10  ? 177 GLY V CA  1 
ATOM   9709  C C   . GLY D 1 176 ? 88.305  49.991  -15.752 1.00 85.10  ? 177 GLY V C   1 
ATOM   9710  O O   . GLY D 1 176 ? 87.559  50.861  -15.294 1.00 2.00   ? 177 GLY V O   1 
ATOM   9711  N N   . GLU D 1 177 ? 88.931  50.098  -16.922 1.00 25.71  ? 178 GLU V N   1 
ATOM   9712  C CA  . GLU D 1 177 ? 88.825  51.269  -17.774 1.00 25.71  ? 178 GLU V CA  1 
ATOM   9713  C C   . GLU D 1 177 ? 87.411  51.478  -18.245 1.00 25.71  ? 178 GLU V C   1 
ATOM   9714  O O   . GLU D 1 177 ? 86.582  50.576  -18.184 1.00 22.43  ? 178 GLU V O   1 
ATOM   9715  C CB  . GLU D 1 177 ? 89.754  51.130  -18.978 1.00 22.43  ? 178 GLU V CB  1 
ATOM   9716  C CG  . GLU D 1 177 ? 89.177  50.314  -20.101 1.00 22.43  ? 178 GLU V CG  1 
ATOM   9717  C CD  . GLU D 1 177 ? 89.429  50.933  -21.453 1.00 22.43  ? 178 GLU V CD  1 
ATOM   9718  O OE1 . GLU D 1 177 ? 90.597  50.871  -21.916 1.00 22.43  ? 178 GLU V OE1 1 
ATOM   9719  O OE2 . GLU D 1 177 ? 88.458  51.476  -22.045 1.00 22.43  ? 178 GLU V OE2 1 
ATOM   9720  N N   . SER D 1 178 ? 87.140  52.678  -18.731 1.00 2.00   ? 179 SER V N   1 
ATOM   9721  C CA  . SER D 1 178 ? 85.801  52.992  -19.187 1.00 2.00   ? 179 SER V CA  1 
ATOM   9722  C C   . SER D 1 178 ? 85.234  51.993  -20.166 1.00 2.00   ? 179 SER V C   1 
ATOM   9723  O O   . SER D 1 178 ? 85.852  51.687  -21.188 1.00 2.97   ? 179 SER V O   1 
ATOM   9724  C CB  . SER D 1 178 ? 85.757  54.360  -19.832 1.00 2.97   ? 179 SER V CB  1 
ATOM   9725  O OG  . SER D 1 178 ? 84.486  54.522  -20.437 1.00 2.97   ? 179 SER V OG  1 
ATOM   9726  N N   . GLY D 1 179 ? 84.042  51.508  -19.847 1.00 2.00   ? 180 GLY V N   1 
ATOM   9727  C CA  . GLY D 1 179 ? 83.374  50.549  -20.712 1.00 2.00   ? 180 GLY V CA  1 
ATOM   9728  C C   . GLY D 1 179 ? 83.486  49.115  -20.260 1.00 2.00   ? 180 GLY V C   1 
ATOM   9729  O O   . GLY D 1 179 ? 82.593  48.314  -20.528 1.00 2.00   ? 180 GLY V O   1 
ATOM   9730  N N   . ALA D 1 180 ? 84.576  48.805  -19.560 1.00 2.00   ? 181 ALA V N   1 
ATOM   9731  C CA  . ALA D 1 180 ? 84.849  47.458  -19.073 1.00 2.00   ? 181 ALA V CA  1 
ATOM   9732  C C   . ALA D 1 180 ? 83.752  46.809  -18.246 1.00 2.00   ? 181 ALA V C   1 
ATOM   9733  O O   . ALA D 1 180 ? 83.945  45.721  -17.729 1.00 43.85  ? 181 ALA V O   1 
ATOM   9734  C CB  . ALA D 1 180 ? 86.144  47.440  -18.288 1.00 43.85  ? 181 ALA V CB  1 
ATOM   9735  N N   . GLY D 1 181 ? 82.613  47.464  -18.100 1.00 16.47  ? 182 GLY V N   1 
ATOM   9736  C CA  . GLY D 1 181 ? 81.531  46.840  -17.360 1.00 16.47  ? 182 GLY V CA  1 
ATOM   9737  C C   . GLY D 1 181 ? 81.409  47.127  -15.880 1.00 16.47  ? 182 GLY V C   1 
ATOM   9738  O O   . GLY D 1 181 ? 80.754  46.380  -15.159 1.00 2.00   ? 182 GLY V O   1 
ATOM   9739  N N   . LYS D 1 182 ? 82.036  48.198  -15.416 1.00 2.00   ? 183 LYS V N   1 
ATOM   9740  C CA  . LYS D 1 182 ? 81.949  48.539  -14.012 1.00 2.00   ? 183 LYS V CA  1 
ATOM   9741  C C   . LYS D 1 182 ? 80.509  48.512  -13.484 1.00 2.00   ? 183 LYS V C   1 
ATOM   9742  O O   . LYS D 1 182 ? 80.241  48.034  -12.370 1.00 2.00   ? 183 LYS V O   1 
ATOM   9743  C CB  . LYS D 1 182 ? 82.539  49.924  -13.803 1.00 2.00   ? 183 LYS V CB  1 
ATOM   9744  C CG  . LYS D 1 182 ? 83.890  49.912  -13.174 1.00 2.00   ? 183 LYS V CG  1 
ATOM   9745  C CD  . LYS D 1 182 ? 84.947  50.295  -14.156 1.00 2.00   ? 183 LYS V CD  1 
ATOM   9746  C CE  . LYS D 1 182 ? 84.578  51.521  -14.915 1.00 2.00   ? 183 LYS V CE  1 
ATOM   9747  N NZ  . LYS D 1 182 ? 85.340  51.525  -16.199 1.00 2.00   ? 183 LYS V NZ  1 
ATOM   9748  N N   . THR D 1 183 ? 79.588  49.026  -14.297 1.00 70.92  ? 184 THR V N   1 
ATOM   9749  C CA  . THR D 1 183 ? 78.180  49.120  -13.927 1.00 70.92  ? 184 THR V CA  1 
ATOM   9750  C C   . THR D 1 183 ? 77.440  47.803  -13.829 1.00 70.92  ? 184 THR V C   1 
ATOM   9751  O O   . THR D 1 183 ? 77.031  47.383  -12.746 1.00 18.55  ? 184 THR V O   1 
ATOM   9752  C CB  . THR D 1 183 ? 77.387  50.018  -14.910 1.00 18.55  ? 184 THR V CB  1 
ATOM   9753  O OG1 . THR D 1 183 ? 77.967  51.326  -14.964 1.00 18.55  ? 184 THR V OG1 1 
ATOM   9754  C CG2 . THR D 1 183 ? 75.923  50.144  -14.445 1.00 18.55  ? 184 THR V CG2 1 
ATOM   9755  N N   . GLU D 1 184 ? 77.244  47.159  -14.970 1.00 29.25  ? 185 GLU V N   1 
ATOM   9756  C CA  . GLU D 1 184 ? 76.520  45.898  -15.002 1.00 29.25  ? 185 GLU V CA  1 
ATOM   9757  C C   . GLU D 1 184 ? 76.788  45.073  -13.743 1.00 29.25  ? 185 GLU V C   1 
ATOM   9758  O O   . GLU D 1 184 ? 75.889  44.798  -12.950 1.00 68.44  ? 185 GLU V O   1 
ATOM   9759  C CB  . GLU D 1 184 ? 76.919  45.103  -16.252 1.00 68.44  ? 185 GLU V CB  1 
ATOM   9760  C CG  . GLU D 1 184 ? 76.550  45.778  -17.572 1.00 68.44  ? 185 GLU V CG  1 
ATOM   9761  C CD  . GLU D 1 184 ? 75.075  45.637  -17.913 1.00 68.44  ? 185 GLU V CD  1 
ATOM   9762  O OE1 . GLU D 1 184 ? 74.271  45.410  -16.982 1.00 68.44  ? 185 GLU V OE1 1 
ATOM   9763  O OE2 . GLU D 1 184 ? 74.721  45.755  -19.109 1.00 68.44  ? 185 GLU V OE2 1 
ATOM   9764  N N   . ASN D 1 185 ? 78.051  44.713  -13.562 1.00 19.10  ? 186 ASN V N   1 
ATOM   9765  C CA  . ASN D 1 185 ? 78.480  43.913  -12.437 1.00 19.10  ? 186 ASN V CA  1 
ATOM   9766  C C   . ASN D 1 185 ? 77.982  44.425  -11.116 1.00 19.10  ? 186 ASN V C   1 
ATOM   9767  O O   . ASN D 1 185 ? 77.981  43.696  -10.137 1.00 15.02  ? 186 ASN V O   1 
ATOM   9768  C CB  . ASN D 1 185 ? 79.996  43.831  -12.436 1.00 15.02  ? 186 ASN V CB  1 
ATOM   9769  C CG  . ASN D 1 185 ? 80.506  42.859  -13.470 1.00 15.02  ? 186 ASN V CG  1 
ATOM   9770  O OD1 . ASN D 1 185 ? 81.029  41.816  -13.124 1.00 15.02  ? 186 ASN V OD1 1 
ATOM   9771  N ND2 . ASN D 1 185 ? 80.346  43.186  -14.746 1.00 15.02  ? 186 ASN V ND2 1 
ATOM   9772  N N   . THR D 1 186 ? 77.561  45.679  -11.072 1.00 9.50   ? 187 THR V N   1 
ATOM   9773  C CA  . THR D 1 186 ? 77.052  46.228  -9.823  1.00 9.50   ? 187 THR V CA  1 
ATOM   9774  C C   . THR D 1 186 ? 75.587  45.890  -9.742  1.00 9.50   ? 187 THR V C   1 
ATOM   9775  O O   . THR D 1 186 ? 75.087  45.479  -8.687  1.00 11.94  ? 187 THR V O   1 
ATOM   9776  C CB  . THR D 1 186 ? 77.186  47.752  -9.769  1.00 11.94  ? 187 THR V CB  1 
ATOM   9777  O OG1 . THR D 1 186 ? 78.573  48.103  -9.753  1.00 11.94  ? 187 THR V OG1 1 
ATOM   9778  C CG2 . THR D 1 186 ? 76.500  48.302  -8.526  1.00 11.94  ? 187 THR V CG2 1 
ATOM   9779  N N   . LYS D 1 187 ? 74.905  46.060  -10.872 1.00 13.29  ? 188 LYS V N   1 
ATOM   9780  C CA  . LYS D 1 187 ? 73.483  45.788  -10.937 1.00 13.29  ? 188 LYS V CA  1 
ATOM   9781  C C   . LYS D 1 187 ? 73.221  44.341  -10.528 1.00 13.29  ? 188 LYS V C   1 
ATOM   9782  O O   . LYS D 1 187 ? 72.178  44.026  -9.950  1.00 23.06  ? 188 LYS V O   1 
ATOM   9783  C CB  . LYS D 1 187 ? 72.960  46.068  -12.347 1.00 23.06  ? 188 LYS V CB  1 
ATOM   9784  C CG  . LYS D 1 187 ? 72.998  47.554  -12.749 1.00 23.06  ? 188 LYS V CG  1 
ATOM   9785  C CD  . LYS D 1 187 ? 71.979  47.883  -13.851 1.00 23.06  ? 188 LYS V CD  1 
ATOM   9786  C CE  . LYS D 1 187 ? 72.661  48.199  -15.179 1.00 23.06  ? 188 LYS V CE  1 
ATOM   9787  N NZ  . LYS D 1 187 ? 71.672  48.397  -16.267 1.00 23.06  ? 188 LYS V NZ  1 
ATOM   9788  N N   . LYS D 1 188 ? 74.178  43.464  -10.817 1.00 4.47   ? 189 LYS V N   1 
ATOM   9789  C CA  . LYS D 1 188 ? 74.034  42.059  -10.454 1.00 4.47   ? 189 LYS V CA  1 
ATOM   9790  C C   . LYS D 1 188 ? 74.157  41.911  -8.953  1.00 4.47   ? 189 LYS V C   1 
ATOM   9791  O O   . LYS D 1 188 ? 73.259  41.383  -8.305  1.00 10.23  ? 189 LYS V O   1 
ATOM   9792  C CB  . LYS D 1 188 ? 75.092  41.224  -11.152 1.00 10.23  ? 189 LYS V CB  1 
ATOM   9793  C CG  . LYS D 1 188 ? 75.106  41.439  -12.663 1.00 10.23  ? 189 LYS V CG  1 
ATOM   9794  C CD  . LYS D 1 188 ? 73.969  40.700  -13.348 1.00 10.23  ? 189 LYS V CD  1 
ATOM   9795  C CE  . LYS D 1 188 ? 73.313  41.567  -14.405 1.00 10.23  ? 189 LYS V CE  1 
ATOM   9796  N NZ  . LYS D 1 188 ? 71.814  41.521  -14.294 1.00 10.23  ? 189 LYS V NZ  1 
ATOM   9797  N N   . VAL D 1 189 ? 75.263  42.390  -8.401  1.00 2.00   ? 190 VAL V N   1 
ATOM   9798  C CA  . VAL D 1 189 ? 75.478  42.336  -6.961  1.00 2.00   ? 190 VAL V CA  1 
ATOM   9799  C C   . VAL D 1 189 ? 74.234  42.747  -6.173  1.00 2.00   ? 190 VAL V C   1 
ATOM   9800  O O   . VAL D 1 189 ? 73.945  42.176  -5.109  1.00 2.00   ? 190 VAL V O   1 
ATOM   9801  C CB  . VAL D 1 189 ? 76.615  43.245  -6.548  1.00 2.00   ? 190 VAL V CB  1 
ATOM   9802  C CG1 . VAL D 1 189 ? 76.884  43.123  -5.056  1.00 2.00   ? 190 VAL V CG1 1 
ATOM   9803  C CG2 . VAL D 1 189 ? 77.821  42.876  -7.338  1.00 2.00   ? 190 VAL V CG2 1 
ATOM   9804  N N   . ILE D 1 190 ? 73.496  43.741  -6.672  1.00 14.90  ? 191 ILE V N   1 
ATOM   9805  C CA  . ILE D 1 190 ? 72.295  44.148  -5.967  1.00 14.90  ? 191 ILE V CA  1 
ATOM   9806  C C   . ILE D 1 190 ? 71.250  43.112  -6.263  1.00 14.90  ? 191 ILE V C   1 
ATOM   9807  O O   . ILE D 1 190 ? 70.569  42.644  -5.369  1.00 2.00   ? 191 ILE V O   1 
ATOM   9808  C CB  . ILE D 1 190 ? 71.770  45.501  -6.423  1.00 2.00   ? 191 ILE V CB  1 
ATOM   9809  C CG1 . ILE D 1 190 ? 72.894  46.549  -6.353  1.00 2.00   ? 191 ILE V CG1 1 
ATOM   9810  C CG2 . ILE D 1 190 ? 70.582  45.891  -5.536  1.00 2.00   ? 191 ILE V CG2 1 
ATOM   9811  C CD1 . ILE D 1 190 ? 72.430  48.007  -6.181  1.00 2.00   ? 191 ILE V CD1 1 
ATOM   9812  N N   . GLN D 1 191 ? 71.161  42.751  -7.536  1.00 2.00   ? 192 GLN V N   1 
ATOM   9813  C CA  . GLN D 1 191 ? 70.205  41.759  -8.032  1.00 2.00   ? 192 GLN V CA  1 
ATOM   9814  C C   . GLN D 1 191 ? 70.198  40.495  -7.176  1.00 2.00   ? 192 GLN V C   1 
ATOM   9815  O O   . GLN D 1 191 ? 69.148  39.985  -6.777  1.00 29.94  ? 192 GLN V O   1 
ATOM   9816  C CB  . GLN D 1 191 ? 70.542  41.433  -9.496  1.00 29.94  ? 192 GLN V CB  1 
ATOM   9817  C CG  . GLN D 1 191 ? 69.920  40.156  -10.045 1.00 29.94  ? 192 GLN V CG  1 
ATOM   9818  C CD  . GLN D 1 191 ? 70.594  39.674  -11.335 1.00 29.94  ? 192 GLN V CD  1 
ATOM   9819  O OE1 . GLN D 1 191 ? 71.611  40.223  -11.765 1.00 29.94  ? 192 GLN V OE1 1 
ATOM   9820  N NE2 . GLN D 1 191 ? 70.022  38.645  -11.956 1.00 29.94  ? 192 GLN V NE2 1 
ATOM   9821  N N   . TYR D 1 192 ? 71.396  40.013  -6.898  1.00 17.91  ? 193 TYR V N   1 
ATOM   9822  C CA  . TYR D 1 192 ? 71.591  38.832  -6.091  1.00 17.91  ? 193 TYR V CA  1 
ATOM   9823  C C   . TYR D 1 192 ? 71.179  39.126  -4.642  1.00 17.91  ? 193 TYR V C   1 
ATOM   9824  O O   . TYR D 1 192 ? 70.214  38.568  -4.128  1.00 4.92   ? 193 TYR V O   1 
ATOM   9825  C CB  . TYR D 1 192 ? 73.057  38.424  -6.169  1.00 4.92   ? 193 TYR V CB  1 
ATOM   9826  C CG  . TYR D 1 192 ? 73.429  37.229  -5.337  1.00 4.92   ? 193 TYR V CG  1 
ATOM   9827  C CD1 . TYR D 1 192 ? 73.555  37.342  -3.967  1.00 4.92   ? 193 TYR V CD1 1 
ATOM   9828  C CD2 . TYR D 1 192 ? 73.730  36.000  -5.918  1.00 4.92   ? 193 TYR V CD2 1 
ATOM   9829  C CE1 . TYR D 1 192 ? 73.984  36.265  -3.188  1.00 4.92   ? 193 TYR V CE1 1 
ATOM   9830  C CE2 . TYR D 1 192 ? 74.158  34.923  -5.139  1.00 4.92   ? 193 TYR V CE2 1 
ATOM   9831  C CZ  . TYR D 1 192 ? 74.281  35.076  -3.776  1.00 4.92   ? 193 TYR V CZ  1 
ATOM   9832  O OH  . TYR D 1 192 ? 74.701  34.073  -2.968  1.00 4.92   ? 193 TYR V OH  1 
ATOM   9833  N N   . LEU D 1 193 ? 71.900  40.017  -3.983  1.00 17.31  ? 194 LEU V N   1 
ATOM   9834  C CA  . LEU D 1 193 ? 71.577  40.379  -2.609  1.00 17.31  ? 194 LEU V CA  1 
ATOM   9835  C C   . LEU D 1 193 ? 70.103  40.782  -2.384  1.00 17.31  ? 194 LEU V C   1 
ATOM   9836  O O   . LEU D 1 193 ? 69.594  40.754  -1.270  1.00 2.00   ? 194 LEU V O   1 
ATOM   9837  C CB  . LEU D 1 193 ? 72.505  41.517  -2.174  1.00 2.00   ? 194 LEU V CB  1 
ATOM   9838  C CG  . LEU D 1 193 ? 73.735  41.041  -1.406  1.00 2.00   ? 194 LEU V CG  1 
ATOM   9839  C CD1 . LEU D 1 193 ? 74.973  41.278  -2.210  1.00 2.00   ? 194 LEU V CD1 1 
ATOM   9840  C CD2 . LEU D 1 193 ? 73.799  41.765  -0.098  1.00 2.00   ? 194 LEU V CD2 1 
ATOM   9841  N N   . ALA D 1 194 ? 69.415  41.155  -3.449  1.00 36.91  ? 195 ALA V N   1 
ATOM   9842  C CA  . ALA D 1 194 ? 68.024  41.561  -3.325  1.00 36.91  ? 195 ALA V CA  1 
ATOM   9843  C C   . ALA D 1 194 ? 67.104  40.375  -3.071  1.00 36.91  ? 195 ALA V C   1 
ATOM   9844  O O   . ALA D 1 194 ? 65.969  40.531  -2.614  1.00 50.82  ? 195 ALA V O   1 
ATOM   9845  C CB  . ALA D 1 194 ? 67.587  42.277  -4.581  1.00 50.82  ? 195 ALA V CB  1 
ATOM   9846  N N   . VAL D 1 195 ? 67.594  39.184  -3.375  1.00 29.88  ? 196 VAL V N   1 
ATOM   9847  C CA  . VAL D 1 195 ? 66.802  37.984  -3.190  1.00 29.88  ? 196 VAL V CA  1 
ATOM   9848  C C   . VAL D 1 195 ? 67.447  37.073  -2.168  1.00 29.88  ? 196 VAL V C   1 
ATOM   9849  O O   . VAL D 1 195 ? 66.783  36.524  -1.303  1.00 17.60  ? 196 VAL V O   1 
ATOM   9850  C CB  . VAL D 1 195 ? 66.626  37.241  -4.539  1.00 17.60  ? 196 VAL V CB  1 
ATOM   9851  C CG1 . VAL D 1 195 ? 67.809  36.365  -4.830  1.00 17.60  ? 196 VAL V CG1 1 
ATOM   9852  C CG2 . VAL D 1 195 ? 65.359  36.428  -4.510  1.00 17.60  ? 196 VAL V CG2 1 
ATOM   9853  N N   . VAL D 1 196 ? 68.760  36.947  -2.253  1.00 2.00   ? 197 VAL V N   1 
ATOM   9854  C CA  . VAL D 1 196 ? 69.482  36.097  -1.355  1.00 2.00   ? 197 VAL V CA  1 
ATOM   9855  C C   . VAL D 1 196 ? 69.499  36.601  0.075   1.00 2.00   ? 197 VAL V C   1 
ATOM   9856  O O   . VAL D 1 196 ? 69.706  35.820  0.993   1.00 13.12  ? 197 VAL V O   1 
ATOM   9857  C CB  . VAL D 1 196 ? 70.919  35.914  -1.832  1.00 13.12  ? 197 VAL V CB  1 
ATOM   9858  C CG1 . VAL D 1 196 ? 71.707  35.076  -0.824  1.00 13.12  ? 197 VAL V CG1 1 
ATOM   9859  C CG2 . VAL D 1 196 ? 70.926  35.248  -3.188  1.00 13.12  ? 197 VAL V CG2 1 
ATOM   9860  N N   . ALA D 1 197 ? 69.273  37.890  0.291   1.00 61.77  ? 198 ALA V N   1 
ATOM   9861  C CA  . ALA D 1 197 ? 69.322  38.397  1.662   1.00 61.77  ? 198 ALA V CA  1 
ATOM   9862  C C   . ALA D 1 197 ? 68.061  39.077  2.140   1.00 61.77  ? 198 ALA V C   1 
ATOM   9863  O O   . ALA D 1 197 ? 67.931  39.385  3.318   1.00 15.36  ? 198 ALA V O   1 
ATOM   9864  C CB  . ALA D 1 197 ? 70.512  39.349  1.830   1.00 15.36  ? 198 ALA V CB  1 
ATOM   9865  N N   . SER D 1 198 ? 67.132  39.310  1.226   1.00 26.52  ? 199 SER V N   1 
ATOM   9866  C CA  . SER D 1 198 ? 65.884  39.970  1.574   1.00 26.52  ? 199 SER V CA  1 
ATOM   9867  C C   . SER D 1 198 ? 65.042  39.123  2.501   1.00 26.52  ? 199 SER V C   1 
ATOM   9868  O O   . SER D 1 198 ? 65.322  37.946  2.709   1.00 33.32  ? 199 SER V O   1 
ATOM   9869  C CB  . SER D 1 198 ? 65.073  40.254  0.312   1.00 33.32  ? 199 SER V CB  1 
ATOM   9870  O OG  . SER D 1 198 ? 64.071  39.273  0.108   1.00 33.32  ? 199 SER V OG  1 
ATOM   9871  N N   . SER D 1 199 ? 64.016  39.733  3.074   1.00 47.38  ? 200 SER V N   1 
ATOM   9872  C CA  . SER D 1 199 ? 63.108  38.983  3.923   1.00 47.38  ? 200 SER V CA  1 
ATOM   9873  C C   . SER D 1 199 ? 61.888  38.762  3.038   1.00 47.38  ? 200 SER V C   1 
ATOM   9874  O O   . SER D 1 199 ? 61.546  39.614  2.202   1.00 67.74  ? 200 SER V O   1 
ATOM   9875  C CB  . SER D 1 199 ? 62.739  39.767  5.181   1.00 67.74  ? 200 SER V CB  1 
ATOM   9876  O OG  . SER D 1 199 ? 62.485  38.871  6.253   1.00 67.74  ? 200 SER V OG  1 
ATOM   9877  N N   . HIS D 1 200 ? 61.232  37.623  3.214   1.00 100.00 ? 201 HIS V N   1 
ATOM   9878  C CA  . HIS D 1 200 ? 60.078  37.267  2.395   1.00 100.00 ? 201 HIS V CA  1 
ATOM   9879  C C   . HIS D 1 200 ? 58.724  37.438  3.083   1.00 100.00 ? 201 HIS V C   1 
ATOM   9880  O O   . HIS D 1 200 ? 58.634  37.437  4.316   1.00 100.00 ? 201 HIS V O   1 
ATOM   9881  C CB  . HIS D 1 200 ? 60.235  35.814  1.947   1.00 100.00 ? 201 HIS V CB  1 
ATOM   9882  C CG  . HIS D 1 200 ? 61.001  34.972  2.924   1.00 100.00 ? 201 HIS V CG  1 
ATOM   9883  N ND1 . HIS D 1 200 ? 62.146  34.287  2.581   1.00 100.00 ? 201 HIS V ND1 1 
ATOM   9884  C CD2 . HIS D 1 200 ? 60.801  34.737  4.245   1.00 100.00 ? 201 HIS V CD2 1 
ATOM   9885  C CE1 . HIS D 1 200 ? 62.620  33.665  3.648   1.00 100.00 ? 201 HIS V CE1 1 
ATOM   9886  N NE2 . HIS D 1 200 ? 61.823  33.923  4.671   1.00 100.00 ? 201 HIS V NE2 1 
ATOM   9887  N N   . LYS D 1 201 ? 57.677  37.589  2.269   1.00 100.00 ? 202 LYS V N   1 
ATOM   9888  C CA  . LYS D 1 201 ? 56.302  37.726  2.759   1.00 100.00 ? 202 LYS V CA  1 
ATOM   9889  C C   . LYS D 1 201 ? 55.754  36.299  2.897   1.00 100.00 ? 202 LYS V C   1 
ATOM   9890  O O   . LYS D 1 201 ? 54.580  36.017  2.612   1.00 100.00 ? 202 LYS V O   1 
ATOM   9891  C CB  . LYS D 1 201 ? 55.455  38.521  1.753   1.00 100.00 ? 202 LYS V CB  1 
ATOM   9892  C CG  . LYS D 1 201 ? 54.016  38.807  2.206   1.00 100.00 ? 202 LYS V CG  1 
ATOM   9893  C CD  . LYS D 1 201 ? 53.612  40.254  1.906   1.00 100.00 ? 202 LYS V CD  1 
ATOM   9894  C CE  . LYS D 1 201 ? 52.087  40.421  1.858   1.00 100.00 ? 202 LYS V CE  1 
ATOM   9895  N NZ  . LYS D 1 201 ? 51.651  41.862  1.850   1.00 100.00 ? 202 LYS V NZ  1 
ATOM   9896  N N   . GLY D 1 202 ? 56.634  35.407  3.351   1.00 100.00 ? 203 GLY V N   1 
ATOM   9897  C CA  . GLY D 1 202 ? 56.289  34.007  3.501   1.00 100.00 ? 203 GLY V CA  1 
ATOM   9898  C C   . GLY D 1 202 ? 56.766  33.328  2.233   1.00 100.00 ? 203 GLY V C   1 
ATOM   9899  O O   . GLY D 1 202 ? 57.964  33.348  1.914   1.00 23.74  ? 203 GLY V O   1 
ATOM   9900  N N   . LYS D 1 203 ? 55.822  32.750  1.493   1.00 89.24  ? 204 LYS V N   1 
ATOM   9901  C CA  . LYS D 1 203 ? 56.133  32.072  0.237   1.00 89.24  ? 204 LYS V CA  1 
ATOM   9902  C C   . LYS D 1 203 ? 57.019  30.851  0.474   1.00 89.24  ? 204 LYS V C   1 
ATOM   9903  O O   . LYS D 1 203 ? 58.081  30.742  -0.182  1.00 99.39  ? 204 LYS V O   1 
ATOM   9904  C CB  . LYS D 1 203 ? 56.820  33.050  -0.734  1.00 99.39  ? 204 LYS V CB  1 
ATOM   9905  C CG  . LYS D 1 203 ? 56.238  34.470  -0.731  1.00 99.39  ? 204 LYS V CG  1 
ATOM   9906  C CD  . LYS D 1 203 ? 54.828  34.510  -1.334  1.00 99.39  ? 204 LYS V CD  1 
ATOM   9907  C CE  . LYS D 1 203 ? 54.281  35.943  -1.420  1.00 99.39  ? 204 LYS V CE  1 
ATOM   9908  N NZ  . LYS D 1 203 ? 54.054  36.400  -2.831  1.00 99.39  ? 204 LYS V NZ  1 
ATOM   9909  N N   . GLN D 1 210 ? 62.698  30.923  -12.036 1.00 100.00 ? 211 GLN V N   1 
ATOM   9910  C CA  . GLN D 1 210 ? 62.924  30.882  -13.515 1.00 100.00 ? 211 GLN V CA  1 
ATOM   9911  C C   . GLN D 1 210 ? 63.416  32.240  -13.987 1.00 100.00 ? 211 GLN V C   1 
ATOM   9912  O O   . GLN D 1 210 ? 62.634  33.176  -14.171 1.00 100.00 ? 211 GLN V O   1 
ATOM   9913  C CB  . GLN D 1 210 ? 61.628  30.521  -14.252 1.00 100.00 ? 211 GLN V CB  1 
ATOM   9914  C CG  . GLN D 1 210 ? 60.396  30.424  -13.355 1.00 100.00 ? 211 GLN V CG  1 
ATOM   9915  C CD  . GLN D 1 210 ? 59.087  30.613  -14.115 1.00 100.00 ? 211 GLN V CD  1 
ATOM   9916  O OE1 . GLN D 1 210 ? 59.078  31.001  -15.294 1.00 100.00 ? 211 GLN V OE1 1 
ATOM   9917  N NE2 . GLN D 1 210 ? 57.971  30.337  -13.441 1.00 100.00 ? 211 GLN V NE2 1 
ATOM   9918  N N   . GLY D 1 211 ? 64.721  32.341  -14.202 1.00 75.90  ? 212 GLY V N   1 
ATOM   9919  C CA  . GLY D 1 211 ? 65.265  33.611  -14.616 1.00 75.90  ? 212 GLY V CA  1 
ATOM   9920  C C   . GLY D 1 211 ? 64.808  34.590  -13.559 1.00 75.90  ? 212 GLY V C   1 
ATOM   9921  O O   . GLY D 1 211 ? 64.837  34.276  -12.360 1.00 2.00   ? 212 GLY V O   1 
ATOM   9922  N N   . PRO D 1 212 ? 64.339  35.769  -13.972 1.00 45.55  ? 213 PRO V N   1 
ATOM   9923  C CA  . PRO D 1 212 ? 63.865  36.815  -13.054 1.00 45.55  ? 213 PRO V CA  1 
ATOM   9924  C C   . PRO D 1 212 ? 62.585  36.493  -12.283 1.00 45.55  ? 213 PRO V C   1 
ATOM   9925  O O   . PRO D 1 212 ? 62.204  37.223  -11.368 1.00 100.00 ? 213 PRO V O   1 
ATOM   9926  C CB  . PRO D 1 212 ? 63.698  38.035  -13.959 1.00 100.00 ? 213 PRO V CB  1 
ATOM   9927  C CG  . PRO D 1 212 ? 63.462  37.457  -15.326 1.00 100.00 ? 213 PRO V CG  1 
ATOM   9928  C CD  . PRO D 1 212 ? 64.246  36.176  -15.384 1.00 100.00 ? 213 PRO V CD  1 
ATOM   9929  N N   . SER D 1 213 ? 61.931  35.394  -12.648 1.00 100.00 ? 214 SER V N   1 
ATOM   9930  C CA  . SER D 1 213 ? 60.690  34.988  -11.993 1.00 100.00 ? 214 SER V CA  1 
ATOM   9931  C C   . SER D 1 213 ? 60.845  34.781  -10.483 1.00 100.00 ? 214 SER V C   1 
ATOM   9932  O O   . SER D 1 213 ? 61.440  33.794  -10.031 1.00 100.00 ? 214 SER V O   1 
ATOM   9933  C CB  . SER D 1 213 ? 60.157  33.708  -12.645 1.00 100.00 ? 214 SER V CB  1 
ATOM   9934  O OG  . SER D 1 213 ? 59.768  33.951  -13.988 1.00 100.00 ? 214 SER V OG  1 
ATOM   9935  N N   . PHE D 1 214 ? 60.292  35.723  -9.714  1.00 100.00 ? 215 PHE V N   1 
ATOM   9936  C CA  . PHE D 1 214 ? 60.350  35.705  -8.251  1.00 100.00 ? 215 PHE V CA  1 
ATOM   9937  C C   . PHE D 1 214 ? 59.716  36.967  -7.649  1.00 100.00 ? 215 PHE V C   1 
ATOM   9938  O O   . PHE D 1 214 ? 59.980  38.082  -8.104  1.00 100.00 ? 215 PHE V O   1 
ATOM   9939  C CB  . PHE D 1 214 ? 61.805  35.629  -7.791  1.00 100.00 ? 215 PHE V CB  1 
ATOM   9940  C CG  . PHE D 1 214 ? 61.981  35.104  -6.397  1.00 100.00 ? 215 PHE V CG  1 
ATOM   9941  C CD1 . PHE D 1 214 ? 61.397  35.756  -5.315  1.00 100.00 ? 215 PHE V CD1 1 
ATOM   9942  C CD2 . PHE D 1 214 ? 62.740  33.958  -6.166  1.00 100.00 ? 215 PHE V CD2 1 
ATOM   9943  C CE1 . PHE D 1 214 ? 61.560  35.276  -4.023  1.00 100.00 ? 215 PHE V CE1 1 
ATOM   9944  C CE2 . PHE D 1 214 ? 62.911  33.468  -4.879  1.00 100.00 ? 215 PHE V CE2 1 
ATOM   9945  C CZ  . PHE D 1 214 ? 62.319  34.130  -3.802  1.00 100.00 ? 215 PHE V CZ  1 
ATOM   9946  N N   . SER D 1 215 ? 58.889  36.795  -6.624  1.00 98.45  ? 216 SER V N   1 
ATOM   9947  C CA  . SER D 1 215 ? 58.260  37.939  -5.974  1.00 98.45  ? 216 SER V CA  1 
ATOM   9948  C C   . SER D 1 215 ? 59.129  38.345  -4.790  1.00 98.45  ? 216 SER V C   1 
ATOM   9949  O O   . SER D 1 215 ? 59.187  37.640  -3.776  1.00 100.00 ? 216 SER V O   1 
ATOM   9950  C CB  . SER D 1 215 ? 56.839  37.587  -5.505  1.00 100.00 ? 216 SER V CB  1 
ATOM   9951  O OG  . SER D 1 215 ? 56.766  37.437  -4.095  1.00 100.00 ? 216 SER V OG  1 
ATOM   9952  N N   . TYR D 1 216 ? 59.814  39.479  -4.934  1.00 100.00 ? 217 TYR V N   1 
ATOM   9953  C CA  . TYR D 1 216 ? 60.702  39.991  -3.888  1.00 100.00 ? 217 TYR V CA  1 
ATOM   9954  C C   . TYR D 1 216 ? 59.936  40.720  -2.789  1.00 100.00 ? 217 TYR V C   1 
ATOM   9955  O O   . TYR D 1 216 ? 58.720  40.902  -2.883  1.00 63.40  ? 217 TYR V O   1 
ATOM   9956  C CB  . TYR D 1 216 ? 61.744  40.938  -4.488  1.00 63.40  ? 217 TYR V CB  1 
ATOM   9957  C CG  . TYR D 1 216 ? 62.429  40.394  -5.712  1.00 63.40  ? 217 TYR V CG  1 
ATOM   9958  C CD1 . TYR D 1 216 ? 61.779  40.389  -6.935  1.00 63.40  ? 217 TYR V CD1 1 
ATOM   9959  C CD2 . TYR D 1 216 ? 63.729  39.891  -5.648  1.00 63.40  ? 217 TYR V CD2 1 
ATOM   9960  C CE1 . TYR D 1 216 ? 62.407  39.898  -8.068  1.00 63.40  ? 217 TYR V CE1 1 
ATOM   9961  C CE2 . TYR D 1 216 ? 64.366  39.398  -6.773  1.00 63.40  ? 217 TYR V CE2 1 
ATOM   9962  C CZ  . TYR D 1 216 ? 63.707  39.405  -7.982  1.00 63.40  ? 217 TYR V CZ  1 
ATOM   9963  O OH  . TYR D 1 216 ? 64.343  38.938  -9.117  1.00 63.40  ? 217 TYR V OH  1 
ATOM   9964  N N   . GLY D 1 217 ? 60.661  41.131  -1.747  1.00 100.00 ? 218 GLY V N   1 
ATOM   9965  C CA  . GLY D 1 217 ? 60.043  41.850  -0.649  1.00 100.00 ? 218 GLY V CA  1 
ATOM   9966  C C   . GLY D 1 217 ? 59.438  43.143  -1.160  1.00 100.00 ? 218 GLY V C   1 
ATOM   9967  O O   . GLY D 1 217 ? 59.335  43.356  -2.366  1.00 2.00   ? 218 GLY V O   1 
ATOM   9968  N N   . GLU D 1 218 ? 59.040  44.021  -0.250  1.00 77.51  ? 219 GLU V N   1 
ATOM   9969  C CA  . GLU D 1 218 ? 58.425  45.281  -0.647  1.00 77.51  ? 219 GLU V CA  1 
ATOM   9970  C C   . GLU D 1 218 ? 59.473  46.351  -0.945  1.00 77.51  ? 219 GLU V C   1 
ATOM   9971  O O   . GLU D 1 218 ? 59.330  47.135  -1.879  1.00 91.54  ? 219 GLU V O   1 
ATOM   9972  C CB  . GLU D 1 218 ? 57.470  45.761  0.456   1.00 91.54  ? 219 GLU V CB  1 
ATOM   9973  C CG  . GLU D 1 218 ? 56.239  44.857  0.677   1.00 91.54  ? 219 GLU V CG  1 
ATOM   9974  C CD  . GLU D 1 218 ? 56.433  43.814  1.779   1.00 91.54  ? 219 GLU V CD  1 
ATOM   9975  O OE1 . GLU D 1 218 ? 57.151  44.104  2.762   1.00 91.54  ? 219 GLU V OE1 1 
ATOM   9976  O OE2 . GLU D 1 218 ? 55.867  42.702  1.659   1.00 91.54  ? 219 GLU V OE2 1 
ATOM   9977  N N   . LEU D 1 219 ? 60.524  46.364  -0.141  1.00 100.00 ? 220 LEU V N   1 
ATOM   9978  C CA  . LEU D 1 219 ? 61.597  47.347  -0.306  1.00 100.00 ? 220 LEU V CA  1 
ATOM   9979  C C   . LEU D 1 219 ? 62.592  46.898  -1.373  1.00 100.00 ? 220 LEU V C   1 
ATOM   9980  O O   . LEU D 1 219 ? 63.072  47.716  -2.144  1.00 25.48  ? 220 LEU V O   1 
ATOM   9981  C CB  . LEU D 1 219 ? 62.312  47.568  1.031   1.00 25.48  ? 220 LEU V CB  1 
ATOM   9982  C CG  . LEU D 1 219 ? 63.307  48.729  1.088   1.00 25.48  ? 220 LEU V CG  1 
ATOM   9983  C CD1 . LEU D 1 219 ? 62.575  50.061  1.050   1.00 25.48  ? 220 LEU V CD1 1 
ATOM   9984  C CD2 . LEU D 1 219 ? 64.175  48.629  2.333   1.00 25.48  ? 220 LEU V CD2 1 
ATOM   9985  N N   . GLU D 1 220 ? 62.894  45.606  -1.378  1.00 42.80  ? 221 GLU V N   1 
ATOM   9986  C CA  . GLU D 1 220 ? 63.827  45.058  -2.349  1.00 42.80  ? 221 GLU V CA  1 
ATOM   9987  C C   . GLU D 1 220 ? 63.257  45.310  -3.735  1.00 42.80  ? 221 GLU V C   1 
ATOM   9988  O O   . GLU D 1 220 ? 63.978  45.331  -4.736  1.00 64.30  ? 221 GLU V O   1 
ATOM   9989  C CB  . GLU D 1 220 ? 63.999  43.570  -2.096  1.00 64.30  ? 221 GLU V CB  1 
ATOM   9990  C CG  . GLU D 1 220 ? 64.498  43.268  -0.692  1.00 64.30  ? 221 GLU V CG  1 
ATOM   9991  C CD  . GLU D 1 220 ? 63.372  43.121  0.321   1.00 64.30  ? 221 GLU V CD  1 
ATOM   9992  O OE1 . GLU D 1 220 ? 62.222  43.453  -0.032  1.00 64.30  ? 221 GLU V OE1 1 
ATOM   9993  O OE2 . GLU D 1 220 ? 63.637  42.678  1.464   1.00 64.30  ? 221 GLU V OE2 1 
ATOM   9994  N N   . LYS D 1 221 ? 61.945  45.518  -3.770  1.00 32.31  ? 222 LYS V N   1 
ATOM   9995  C CA  . LYS D 1 221 ? 61.232  45.810  -5.008  1.00 32.31  ? 222 LYS V CA  1 
ATOM   9996  C C   . LYS D 1 221 ? 61.766  47.120  -5.542  1.00 32.31  ? 222 LYS V C   1 
ATOM   9997  O O   . LYS D 1 221 ? 62.147  47.232  -6.702  1.00 100.00 ? 222 LYS V O   1 
ATOM   9998  C CB  . LYS D 1 221 ? 59.738  45.949  -4.723  1.00 100.00 ? 222 LYS V CB  1 
ATOM   9999  C CG  . LYS D 1 221 ? 58.837  45.248  -5.727  1.00 100.00 ? 222 LYS V CG  1 
ATOM   10000 C CD  . LYS D 1 221 ? 57.718  44.487  -5.023  1.00 100.00 ? 222 LYS V CD  1 
ATOM   10001 C CE  . LYS D 1 221 ? 57.360  43.204  -5.771  1.00 100.00 ? 222 LYS V CE  1 
ATOM   10002 N NZ  . LYS D 1 221 ? 58.226  42.043  -5.397  1.00 100.00 ? 222 LYS V NZ  1 
ATOM   10003 N N   . GLN D 1 222 ? 61.781  48.113  -4.663  1.00 11.62  ? 223 GLN V N   1 
ATOM   10004 C CA  . GLN D 1 222 ? 62.284  49.439  -4.991  1.00 11.62  ? 223 GLN V CA  1 
ATOM   10005 C C   . GLN D 1 222 ? 63.810  49.441  -5.185  1.00 11.62  ? 223 GLN V C   1 
ATOM   10006 O O   . GLN D 1 222 ? 64.312  49.974  -6.173  1.00 45.97  ? 223 GLN V O   1 
ATOM   10007 C CB  . GLN D 1 222 ? 61.920  50.418  -3.875  1.00 45.97  ? 223 GLN V CB  1 
ATOM   10008 C CG  . GLN D 1 222 ? 60.610  51.130  -4.075  1.00 45.97  ? 223 GLN V CG  1 
ATOM   10009 C CD  . GLN D 1 222 ? 59.892  51.388  -2.771  1.00 45.97  ? 223 GLN V CD  1 
ATOM   10010 O OE1 . GLN D 1 222 ? 58.659  51.436  -2.734  1.00 45.97  ? 223 GLN V OE1 1 
ATOM   10011 N NE2 . GLN D 1 222 ? 60.656  51.557  -1.689  1.00 45.97  ? 223 GLN V NE2 1 
ATOM   10012 N N   . LEU D 1 223 ? 64.534  48.849  -4.227  1.00 25.88  ? 224 LEU V N   1 
ATOM   10013 C CA  . LEU D 1 223 ? 65.991  48.783  -4.282  1.00 25.88  ? 224 LEU V CA  1 
ATOM   10014 C C   . LEU D 1 223 ? 66.405  48.373  -5.690  1.00 25.88  ? 224 LEU V C   1 
ATOM   10015 O O   . LEU D 1 223 ? 67.485  48.738  -6.191  1.00 2.00   ? 224 LEU V O   1 
ATOM   10016 C CB  . LEU D 1 223 ? 66.511  47.775  -3.241  1.00 2.00   ? 224 LEU V CB  1 
ATOM   10017 C CG  . LEU D 1 223 ? 68.009  47.418  -3.276  1.00 2.00   ? 224 LEU V CG  1 
ATOM   10018 C CD1 . LEU D 1 223 ? 68.895  48.636  -3.577  1.00 2.00   ? 224 LEU V CD1 1 
ATOM   10019 C CD2 . LEU D 1 223 ? 68.377  46.824  -1.955  1.00 2.00   ? 224 LEU V CD2 1 
ATOM   10020 N N   . LEU D 1 224 ? 65.510  47.637  -6.338  1.00 28.20  ? 225 LEU V N   1 
ATOM   10021 C CA  . LEU D 1 224 ? 65.732  47.144  -7.690  1.00 28.20  ? 225 LEU V CA  1 
ATOM   10022 C C   . LEU D 1 224 ? 65.433  48.159  -8.794  1.00 28.20  ? 225 LEU V C   1 
ATOM   10023 O O   . LEU D 1 224 ? 66.153  48.236  -9.793  1.00 35.29  ? 225 LEU V O   1 
ATOM   10024 C CB  . LEU D 1 224 ? 64.877  45.898  -7.915  1.00 35.29  ? 225 LEU V CB  1 
ATOM   10025 C CG  . LEU D 1 224 ? 65.607  44.673  -8.462  1.00 35.29  ? 225 LEU V CG  1 
ATOM   10026 C CD1 . LEU D 1 224 ? 66.903  44.455  -7.682  1.00 35.29  ? 225 LEU V CD1 1 
ATOM   10027 C CD2 . LEU D 1 224 ? 64.686  43.461  -8.360  1.00 35.29  ? 225 LEU V CD2 1 
ATOM   10028 N N   . GLN D 1 225 ? 64.364  48.927  -8.602  1.00 98.31  ? 226 GLN V N   1 
ATOM   10029 C CA  . GLN D 1 225 ? 63.929  49.927  -9.571  1.00 98.31  ? 226 GLN V CA  1 
ATOM   10030 C C   . GLN D 1 225 ? 64.639  51.280  -9.481  1.00 98.31  ? 226 GLN V C   1 
ATOM   10031 O O   . GLN D 1 225 ? 64.356  52.179  -10.275 1.00 100.00 ? 226 GLN V O   1 
ATOM   10032 C CB  . GLN D 1 225 ? 62.421  50.144  -9.433  1.00 100.00 ? 226 GLN V CB  1 
ATOM   10033 C CG  . GLN D 1 225 ? 61.667  50.108  -10.750 1.00 100.00 ? 226 GLN V CG  1 
ATOM   10034 C CD  . GLN D 1 225 ? 61.942  48.847  -11.550 1.00 100.00 ? 226 GLN V CD  1 
ATOM   10035 O OE1 . GLN D 1 225 ? 61.971  48.871  -12.780 1.00 100.00 ? 226 GLN V OE1 1 
ATOM   10036 N NE2 . GLN D 1 225 ? 62.145  47.736  -10.852 1.00 100.00 ? 226 GLN V NE2 1 
ATOM   10037 N N   . ALA D 1 226 ? 65.563  51.423  -8.533  1.00 8.93   ? 227 ALA V N   1 
ATOM   10038 C CA  . ALA D 1 226 ? 66.301  52.677  -8.344  1.00 8.93   ? 227 ALA V CA  1 
ATOM   10039 C C   . ALA D 1 226 ? 67.312  52.932  -9.447  1.00 8.93   ? 227 ALA V C   1 
ATOM   10040 O O   . ALA D 1 226 ? 67.194  53.898  -10.185 1.00 45.87  ? 227 ALA V O   1 
ATOM   10041 C CB  . ALA D 1 226 ? 67.002  52.679  -6.981  1.00 45.87  ? 227 ALA V CB  1 
ATOM   10042 N N   . ASN D 1 227 ? 68.312  52.071  -9.542  1.00 17.54  ? 228 ASN V N   1 
ATOM   10043 C CA  . ASN D 1 227 ? 69.339  52.180  -10.577 1.00 17.54  ? 228 ASN V CA  1 
ATOM   10044 C C   . ASN D 1 227 ? 68.802  52.450  -11.997 1.00 17.54  ? 228 ASN V C   1 
ATOM   10045 O O   . ASN D 1 227 ? 69.458  53.123  -12.794 1.00 17.63  ? 228 ASN V O   1 
ATOM   10046 C CB  . ASN D 1 227 ? 70.190  50.911  -10.584 1.00 17.63  ? 228 ASN V CB  1 
ATOM   10047 C CG  . ASN D 1 227 ? 71.653  51.206  -10.426 1.00 17.63  ? 228 ASN V CG  1 
ATOM   10048 O OD1 . ASN D 1 227 ? 72.292  51.736  -11.343 1.00 17.63  ? 228 ASN V OD1 1 
ATOM   10049 N ND2 . ASN D 1 227 ? 72.203  50.878  -9.255  1.00 17.63  ? 228 ASN V ND2 1 
ATOM   10050 N N   . PRO D 1 228 ? 67.627  51.886  -12.348 1.00 44.75  ? 229 PRO V N   1 
ATOM   10051 C CA  . PRO D 1 228 ? 67.084  52.138  -13.691 1.00 44.75  ? 229 PRO V CA  1 
ATOM   10052 C C   . PRO D 1 228 ? 66.550  53.569  -13.831 1.00 44.75  ? 229 PRO V C   1 
ATOM   10053 O O   . PRO D 1 228 ? 66.198  54.005  -14.922 1.00 83.95  ? 229 PRO V O   1 
ATOM   10054 C CB  . PRO D 1 228 ? 65.971  51.105  -13.827 1.00 83.95  ? 229 PRO V CB  1 
ATOM   10055 C CG  . PRO D 1 228 ? 65.526  50.865  -12.434 1.00 83.95  ? 229 PRO V CG  1 
ATOM   10056 C CD  . PRO D 1 228 ? 66.775  50.950  -11.593 1.00 83.95  ? 229 PRO V CD  1 
ATOM   10057 N N   . ILE D 1 229 ? 66.484  54.291  -12.719 1.00 35.21  ? 230 ILE V N   1 
ATOM   10058 C CA  . ILE D 1 229 ? 66.026  55.670  -12.720 1.00 35.21  ? 230 ILE V CA  1 
ATOM   10059 C C   . ILE D 1 229 ? 67.231  56.581  -12.921 1.00 35.21  ? 230 ILE V C   1 
ATOM   10060 O O   . ILE D 1 229 ? 67.311  57.293  -13.918 1.00 2.00   ? 230 ILE V O   1 
ATOM   10061 C CB  . ILE D 1 229 ? 65.330  55.999  -11.407 1.00 2.00   ? 230 ILE V CB  1 
ATOM   10062 C CG1 . ILE D 1 229 ? 63.837  55.856  -11.616 1.00 2.00   ? 230 ILE V CG1 1 
ATOM   10063 C CG2 . ILE D 1 229 ? 65.729  57.373  -10.900 1.00 2.00   ? 230 ILE V CG2 1 
ATOM   10064 C CD1 . ILE D 1 229 ? 63.153  55.066  -10.522 1.00 2.00   ? 230 ILE V CD1 1 
ATOM   10065 N N   . LEU D 1 230 ? 68.175  56.542  -11.990 1.00 6.03   ? 231 LEU V N   1 
ATOM   10066 C CA  . LEU D 1 230 ? 69.372  57.366  -12.103 1.00 6.03   ? 231 LEU V CA  1 
ATOM   10067 C C   . LEU D 1 230 ? 70.029  57.144  -13.454 1.00 6.03   ? 231 LEU V C   1 
ATOM   10068 O O   . LEU D 1 230 ? 70.808  57.970  -13.930 1.00 13.53  ? 231 LEU V O   1 
ATOM   10069 C CB  . LEU D 1 230 ? 70.384  57.020  -11.009 1.00 13.53  ? 231 LEU V CB  1 
ATOM   10070 C CG  . LEU D 1 230 ? 69.897  56.848  -9.565  1.00 13.53  ? 231 LEU V CG  1 
ATOM   10071 C CD1 . LEU D 1 230 ? 71.064  57.140  -8.631  1.00 13.53  ? 231 LEU V CD1 1 
ATOM   10072 C CD2 . LEU D 1 230 ? 68.717  57.774  -9.265  1.00 13.53  ? 231 LEU V CD2 1 
ATOM   10073 N N   . GLU D 1 231 ? 69.717  56.017  -14.072 1.00 39.67  ? 232 GLU V N   1 
ATOM   10074 C CA  . GLU D 1 231 ? 70.312  55.715  -15.357 1.00 39.67  ? 232 GLU V CA  1 
ATOM   10075 C C   . GLU D 1 231 ? 69.745  56.624  -16.430 1.00 39.67  ? 232 GLU V C   1 
ATOM   10076 O O   . GLU D 1 231 ? 70.393  56.880  -17.453 1.00 54.40  ? 232 GLU V O   1 
ATOM   10077 C CB  . GLU D 1 231 ? 70.101  54.231  -15.719 1.00 54.40  ? 232 GLU V CB  1 
ATOM   10078 C CG  . GLU D 1 231 ? 71.287  53.322  -15.325 1.00 54.40  ? 232 GLU V CG  1 
ATOM   10079 C CD  . GLU D 1 231 ? 71.381  52.045  -16.152 1.00 54.40  ? 232 GLU V CD  1 
ATOM   10080 O OE1 . GLU D 1 231 ? 71.558  52.136  -17.384 1.00 54.40  ? 232 GLU V OE1 1 
ATOM   10081 O OE2 . GLU D 1 231 ? 71.282  50.950  -15.559 1.00 54.40  ? 232 GLU V OE2 1 
ATOM   10082 N N   . ALA D 1 232 ? 68.535  57.115  -16.184 1.00 53.43  ? 233 ALA V N   1 
ATOM   10083 C CA  . ALA D 1 232 ? 67.883  58.019  -17.118 1.00 53.43  ? 233 ALA V CA  1 
ATOM   10084 C C   . ALA D 1 232 ? 68.639  59.353  -17.088 1.00 53.43  ? 233 ALA V C   1 
ATOM   10085 O O   . ALA D 1 232 ? 69.499  59.614  -17.939 1.00 61.36  ? 233 ALA V O   1 
ATOM   10086 C CB  . ALA D 1 232 ? 66.430  58.221  -16.722 1.00 61.36  ? 233 ALA V CB  1 
ATOM   10087 N N   . PHE D 1 233 ? 68.326  60.194  -16.103 1.00 2.00   ? 234 PHE V N   1 
ATOM   10088 C CA  . PHE D 1 233 ? 69.006  61.471  -15.977 1.00 2.00   ? 234 PHE V CA  1 
ATOM   10089 C C   . PHE D 1 233 ? 70.395  61.202  -15.406 1.00 2.00   ? 234 PHE V C   1 
ATOM   10090 O O   . PHE D 1 233 ? 70.627  61.432  -14.233 1.00 29.13  ? 234 PHE V O   1 
ATOM   10091 C CB  . PHE D 1 233 ? 68.253  62.375  -15.005 1.00 29.13  ? 234 PHE V CB  1 
ATOM   10092 C CG  . PHE D 1 233 ? 66.797  62.025  -14.816 1.00 29.13  ? 234 PHE V CG  1 
ATOM   10093 C CD1 . PHE D 1 233 ? 65.888  62.197  -15.858 1.00 29.13  ? 234 PHE V CD1 1 
ATOM   10094 C CD2 . PHE D 1 233 ? 66.320  61.621  -13.571 1.00 29.13  ? 234 PHE V CD2 1 
ATOM   10095 C CE1 . PHE D 1 233 ? 64.531  61.981  -15.676 1.00 29.13  ? 234 PHE V CE1 1 
ATOM   10096 C CE2 . PHE D 1 233 ? 64.962  61.400  -13.368 1.00 29.13  ? 234 PHE V CE2 1 
ATOM   10097 C CZ  . PHE D 1 233 ? 64.063  61.582  -14.428 1.00 29.13  ? 234 PHE V CZ  1 
ATOM   10098 N N   . GLY D 1 234 ? 71.328  60.711  -16.204 1.00 2.00   ? 235 GLY V N   1 
ATOM   10099 C CA  . GLY D 1 234 ? 72.631  60.442  -15.634 1.00 2.00   ? 235 GLY V CA  1 
ATOM   10100 C C   . GLY D 1 234 ? 73.526  59.643  -16.543 1.00 2.00   ? 235 GLY V C   1 
ATOM   10101 O O   . GLY D 1 234 ? 74.743  59.679  -16.393 1.00 6.04   ? 235 GLY V O   1 
ATOM   10102 N N   . ASN D 1 235 ? 72.932  58.925  -17.491 1.00 2.00   ? 236 ASN V N   1 
ATOM   10103 C CA  . ASN D 1 235 ? 73.689  58.102  -18.434 1.00 2.00   ? 236 ASN V CA  1 
ATOM   10104 C C   . ASN D 1 235 ? 73.496  58.599  -19.841 1.00 2.00   ? 236 ASN V C   1 
ATOM   10105 O O   . ASN D 1 235 ? 72.423  59.085  -20.173 1.00 33.80  ? 236 ASN V O   1 
ATOM   10106 C CB  . ASN D 1 235 ? 73.212  56.660  -18.370 1.00 33.80  ? 236 ASN V CB  1 
ATOM   10107 C CG  . ASN D 1 235 ? 73.618  55.976  -17.094 1.00 33.80  ? 236 ASN V CG  1 
ATOM   10108 O OD1 . ASN D 1 235 ? 72.838  55.913  -16.151 1.00 33.80  ? 236 ASN V OD1 1 
ATOM   10109 N ND2 . ASN D 1 235 ? 74.844  55.456  -17.053 1.00 33.80  ? 236 ASN V ND2 1 
ATOM   10110 N N   . ALA D 1 236 ? 74.513  58.450  -20.684 1.00 19.58  ? 237 ALA V N   1 
ATOM   10111 C CA  . ALA D 1 236 ? 74.386  58.907  -22.064 1.00 19.58  ? 237 ALA V CA  1 
ATOM   10112 C C   . ALA D 1 236 ? 75.420  58.350  -23.037 1.00 19.58  ? 237 ALA V C   1 
ATOM   10113 O O   . ALA D 1 236 ? 76.568  58.112  -22.670 1.00 44.83  ? 237 ALA V O   1 
ATOM   10114 C CB  . ALA D 1 236 ? 74.411  60.417  -22.099 1.00 44.83  ? 237 ALA V CB  1 
ATOM   10115 N N   . LYS D 1 237 ? 74.994  58.178  -24.289 1.00 2.00   ? 238 LYS V N   1 
ATOM   10116 C CA  . LYS D 1 237 ? 75.832  57.616  -25.342 1.00 2.00   ? 238 LYS V CA  1 
ATOM   10117 C C   . LYS D 1 237 ? 77.124  58.333  -25.619 1.00 2.00   ? 238 LYS V C   1 
ATOM   10118 O O   . LYS D 1 237 ? 77.146  59.521  -25.862 1.00 6.27   ? 238 LYS V O   1 
ATOM   10119 C CB  . LYS D 1 237 ? 75.043  57.499  -26.647 1.00 6.27   ? 238 LYS V CB  1 
ATOM   10120 C CG  . LYS D 1 237 ? 75.876  57.696  -27.905 1.00 6.27   ? 238 LYS V CG  1 
ATOM   10121 C CD  . LYS D 1 237 ? 75.736  56.520  -28.845 1.00 6.27   ? 238 LYS V CD  1 
ATOM   10122 C CE  . LYS D 1 237 ? 77.018  56.332  -29.662 1.00 6.27   ? 238 LYS V CE  1 
ATOM   10123 N NZ  . LYS D 1 237 ? 77.996  55.386  -29.008 1.00 6.27   ? 238 LYS V NZ  1 
ATOM   10124 N N   . THR D 1 238 ? 78.213  57.584  -25.596 1.00 2.00   ? 239 THR V N   1 
ATOM   10125 C CA  . THR D 1 238 ? 79.510  58.157  -25.876 1.00 2.00   ? 239 THR V CA  1 
ATOM   10126 C C   . THR D 1 238 ? 80.342  57.243  -26.756 1.00 2.00   ? 239 THR V C   1 
ATOM   10127 O O   . THR D 1 238 ? 80.048  56.060  -26.903 1.00 18.66  ? 239 THR V O   1 
ATOM   10128 C CB  . THR D 1 238 ? 80.270  58.462  -24.597 1.00 18.66  ? 239 THR V CB  1 
ATOM   10129 O OG1 . THR D 1 238 ? 81.403  57.600  -24.504 1.00 18.66  ? 239 THR V OG1 1 
ATOM   10130 C CG2 . THR D 1 238 ? 79.371  58.270  -23.397 1.00 18.66  ? 239 THR V CG2 1 
ATOM   10131 N N   . VAL D 1 239 ? 81.380  57.818  -27.349 1.00 2.00   ? 240 VAL V N   1 
ATOM   10132 C CA  . VAL D 1 239 ? 82.276  57.115  -28.260 1.00 2.00   ? 240 VAL V CA  1 
ATOM   10133 C C   . VAL D 1 239 ? 82.904  55.895  -27.614 1.00 2.00   ? 240 VAL V C   1 
ATOM   10134 O O   . VAL D 1 239 ? 83.714  55.208  -28.227 1.00 71.06  ? 240 VAL V O   1 
ATOM   10135 C CB  . VAL D 1 239 ? 83.388  58.055  -28.747 1.00 71.06  ? 240 VAL V CB  1 
ATOM   10136 C CG1 . VAL D 1 239 ? 82.774  59.306  -29.353 1.00 71.06  ? 240 VAL V CG1 1 
ATOM   10137 C CG2 . VAL D 1 239 ? 84.292  58.431  -27.585 1.00 71.06  ? 240 VAL V CG2 1 
ATOM   10138 N N   . LYS D 1 240 ? 82.535  55.630  -26.370 1.00 15.31  ? 241 LYS V N   1 
ATOM   10139 C CA  . LYS D 1 240 ? 83.069  54.483  -25.664 1.00 15.31  ? 241 LYS V CA  1 
ATOM   10140 C C   . LYS D 1 240 ? 81.938  53.608  -25.095 1.00 15.31  ? 241 LYS V C   1 
ATOM   10141 O O   . LYS D 1 240 ? 82.159  52.450  -24.741 1.00 27.15  ? 241 LYS V O   1 
ATOM   10142 C CB  . LYS D 1 240 ? 83.993  54.964  -24.553 1.00 27.15  ? 241 LYS V CB  1 
ATOM   10143 C CG  . LYS D 1 240 ? 85.097  55.852  -25.042 1.00 27.15  ? 241 LYS V CG  1 
ATOM   10144 C CD  . LYS D 1 240 ? 86.345  55.629  -24.235 1.00 27.15  ? 241 LYS V CD  1 
ATOM   10145 C CE  . LYS D 1 240 ? 87.620  55.976  -25.019 1.00 27.15  ? 241 LYS V CE  1 
ATOM   10146 N NZ  . LYS D 1 240 ? 88.877  55.595  -24.236 1.00 27.15  ? 241 LYS V NZ  1 
ATOM   10147 N N   . ASN D 1 241 ? 80.723  54.143  -25.016 1.00 6.46   ? 242 ASN V N   1 
ATOM   10148 C CA  . ASN D 1 241 ? 79.619  53.362  -24.484 1.00 6.46   ? 242 ASN V CA  1 
ATOM   10149 C C   . ASN D 1 241 ? 78.232  53.961  -24.689 1.00 6.46   ? 242 ASN V C   1 
ATOM   10150 O O   . ASN D 1 241 ? 77.897  54.990  -24.128 1.00 25.13  ? 242 ASN V O   1 
ATOM   10151 C CB  . ASN D 1 241 ? 79.836  53.109  -22.999 1.00 25.13  ? 242 ASN V CB  1 
ATOM   10152 C CG  . ASN D 1 241 ? 78.564  52.714  -22.302 1.00 25.13  ? 242 ASN V CG  1 
ATOM   10153 O OD1 . ASN D 1 241 ? 77.528  52.509  -22.934 1.00 25.13  ? 242 ASN V OD1 1 
ATOM   10154 N ND2 . ASN D 1 241 ? 78.628  52.604  -20.988 1.00 25.13  ? 242 ASN V ND2 1 
ATOM   10155 N N   . ASP D 1 242 ? 77.426  53.260  -25.473 1.00 2.00   ? 243 ASP V N   1 
ATOM   10156 C CA  . ASP D 1 242 ? 76.055  53.651  -25.773 1.00 2.00   ? 243 ASP V CA  1 
ATOM   10157 C C   . ASP D 1 242 ? 75.261  54.058  -24.533 1.00 2.00   ? 243 ASP V C   1 
ATOM   10158 O O   . ASP D 1 242 ? 74.366  54.897  -24.620 1.00 82.58  ? 243 ASP V O   1 
ATOM   10159 C CB  . ASP D 1 242 ? 75.326  52.504  -26.481 1.00 82.58  ? 243 ASP V CB  1 
ATOM   10160 C CG  . ASP D 1 242 ? 76.096  51.964  -27.665 1.00 82.58  ? 243 ASP V CG  1 
ATOM   10161 O OD1 . ASP D 1 242 ? 76.723  52.770  -28.382 1.00 82.58  ? 243 ASP V OD1 1 
ATOM   10162 O OD2 . ASP D 1 242 ? 76.067  50.733  -27.871 1.00 82.58  ? 243 ASP V OD2 1 
ATOM   10163 N N   . ASN D 1 243 ? 75.548  53.453  -23.391 1.00 2.46   ? 244 ASN V N   1 
ATOM   10164 C CA  . ASN D 1 243 ? 74.853  53.821  -22.171 1.00 2.46   ? 244 ASN V CA  1 
ATOM   10165 C C   . ASN D 1 243 ? 75.871  53.988  -21.058 1.00 2.46   ? 244 ASN V C   1 
ATOM   10166 O O   . ASN D 1 243 ? 75.941  53.177  -20.124 1.00 2.00   ? 244 ASN V O   1 
ATOM   10167 C CB  . ASN D 1 243 ? 73.848  52.769  -21.759 1.00 2.00   ? 244 ASN V CB  1 
ATOM   10168 C CG  . ASN D 1 243 ? 73.375  52.962  -20.333 1.00 2.00   ? 244 ASN V CG  1 
ATOM   10169 O OD1 . ASN D 1 243 ? 72.387  53.641  -20.105 1.00 2.00   ? 244 ASN V OD1 1 
ATOM   10170 N ND2 . ASN D 1 243 ? 74.077  52.374  -19.367 1.00 2.00   ? 244 ASN V ND2 1 
ATOM   10171 N N   . SER D 1 244 ? 76.665  55.052  -21.162 1.00 47.78  ? 245 SER V N   1 
ATOM   10172 C CA  . SER D 1 244 ? 77.698  55.321  -20.180 1.00 47.78  ? 245 SER V CA  1 
ATOM   10173 C C   . SER D 1 244 ? 77.187  55.995  -18.947 1.00 47.78  ? 245 SER V C   1 
ATOM   10174 O O   . SER D 1 244 ? 76.295  56.839  -19.014 1.00 26.28  ? 245 SER V O   1 
ATOM   10175 C CB  . SER D 1 244 ? 78.801  56.185  -20.774 1.00 26.28  ? 245 SER V CB  1 
ATOM   10176 O OG  . SER D 1 244 ? 79.935  56.165  -19.927 1.00 26.28  ? 245 SER V OG  1 
ATOM   10177 N N   . SER D 1 245 ? 77.766  55.595  -17.822 1.00 45.73  ? 246 SER V N   1 
ATOM   10178 C CA  . SER D 1 245 ? 77.432  56.173  -16.536 1.00 45.73  ? 246 SER V CA  1 
ATOM   10179 C C   . SER D 1 245 ? 78.185  57.517  -16.454 1.00 45.73  ? 246 SER V C   1 
ATOM   10180 O O   . SER D 1 245 ? 79.420  57.554  -16.367 1.00 45.84  ? 246 SER V O   1 
ATOM   10181 C CB  . SER D 1 245 ? 77.922  55.259  -15.404 1.00 45.84  ? 246 SER V CB  1 
ATOM   10182 O OG  . SER D 1 245 ? 77.111  54.097  -15.332 1.00 45.84  ? 246 SER V OG  1 
ATOM   10183 N N   . ARG D 1 246 ? 77.437  58.607  -16.493 1.00 21.48  ? 247 ARG V N   1 
ATOM   10184 C CA  . ARG D 1 246 ? 78.027  59.964  -16.509 1.00 21.48  ? 247 ARG V CA  1 
ATOM   10185 C C   . ARG D 1 246 ? 78.213  60.545  -15.100 1.00 21.48  ? 247 ARG V C   1 
ATOM   10186 O O   . ARG D 1 246 ? 78.081  61.757  -14.886 1.00 2.00   ? 247 ARG V O   1 
ATOM   10187 C CB  . ARG D 1 246 ? 77.121  60.924  -17.280 1.00 2.00   ? 247 ARG V CB  1 
ATOM   10188 C CG  . ARG D 1 246 ? 77.799  61.515  -18.517 1.00 2.00   ? 247 ARG V CG  1 
ATOM   10189 C CD  . ARG D 1 246 ? 78.418  60.448  -19.422 1.00 2.00   ? 247 ARG V CD  1 
ATOM   10190 N NE  . ARG D 1 246 ? 79.694  60.864  -20.019 1.00 2.00   ? 247 ARG V NE  1 
ATOM   10191 C CZ  . ARG D 1 246 ? 80.892  60.652  -19.455 1.00 2.00   ? 247 ARG V CZ  1 
ATOM   10192 N NH1 . ARG D 1 246 ? 80.998  60.028  -18.273 1.00 2.00   ? 247 ARG V NH1 1 
ATOM   10193 N NH2 . ARG D 1 246 ? 82.055  61.031  -20.001 1.00 2.00   ? 247 ARG V NH2 1 
ATOM   10194 N N   . PHE D 1 247 ? 78.531  59.676  -14.162 1.00 3.65   ? 248 PHE V N   1 
ATOM   10195 C CA  . PHE D 1 247 ? 78.738  60.088  -12.764 1.00 3.65   ? 248 PHE V CA  1 
ATOM   10196 C C   . PHE D 1 247 ? 79.022  58.883  -11.878 1.00 3.65   ? 248 PHE V C   1 
ATOM   10197 O O   . PHE D 1 247 ? 78.313  57.868  -11.934 1.00 6.03   ? 248 PHE V O   1 
ATOM   10198 C CB  . PHE D 1 247 ? 77.475  60.750  -12.222 1.00 6.03   ? 248 PHE V CB  1 
ATOM   10199 C CG  . PHE D 1 247 ? 76.281  59.799  -12.243 1.00 6.03   ? 248 PHE V CG  1 
ATOM   10200 C CD1 . PHE D 1 247 ? 76.047  58.943  -11.160 1.00 6.03   ? 248 PHE V CD1 1 
ATOM   10201 C CD2 . PHE D 1 247 ? 75.428  59.780  -13.350 1.00 6.03   ? 248 PHE V CD2 1 
ATOM   10202 C CE1 . PHE D 1 247 ? 74.960  58.062  -11.187 1.00 6.03   ? 248 PHE V CE1 1 
ATOM   10203 C CE2 . PHE D 1 247 ? 74.341  58.897  -13.378 1.00 6.03   ? 248 PHE V CE2 1 
ATOM   10204 C CZ  . PHE D 1 247 ? 74.107  58.039  -12.298 1.00 6.03   ? 248 PHE V CZ  1 
ATOM   10205 N N   . GLY D 1 248 ? 80.056  59.032  -11.080 1.00 19.77  ? 249 GLY V N   1 
ATOM   10206 C CA  . GLY D 1 248 ? 80.443  58.000  -10.120 1.00 19.77  ? 249 GLY V CA  1 
ATOM   10207 C C   . GLY D 1 248 ? 79.260  57.742  -9.224  1.00 19.77  ? 249 GLY V C   1 
ATOM   10208 O O   . GLY D 1 248 ? 78.399  58.603  -9.105  1.00 9.13   ? 249 GLY V O   1 
ATOM   10209 N N   . LYS D 1 249 ? 79.214  56.566  -8.610  1.00 2.00   ? 250 LYS V N   1 
ATOM   10210 C CA  . LYS D 1 249 ? 78.123  56.200  -7.716  1.00 2.00   ? 250 LYS V CA  1 
ATOM   10211 C C   . LYS D 1 249 ? 78.577  55.158  -6.701  1.00 2.00   ? 250 LYS V C   1 
ATOM   10212 O O   . LYS D 1 249 ? 79.240  54.203  -7.063  1.00 5.74   ? 250 LYS V O   1 
ATOM   10213 C CB  . LYS D 1 249 ? 76.937  55.676  -8.528  1.00 5.74   ? 250 LYS V CB  1 
ATOM   10214 C CG  . LYS D 1 249 ? 76.825  54.164  -8.685  1.00 5.74   ? 250 LYS V CG  1 
ATOM   10215 C CD  . LYS D 1 249 ? 75.399  53.812  -9.086  1.00 5.74   ? 250 LYS V CD  1 
ATOM   10216 C CE  . LYS D 1 249 ? 75.342  52.828  -10.221 1.00 5.74   ? 250 LYS V CE  1 
ATOM   10217 N NZ  . LYS D 1 249 ? 75.118  53.433  -11.583 1.00 5.74   ? 250 LYS V NZ  1 
ATOM   10218 N N   . PHE D 1 250 ? 78.225  55.353  -5.434  1.00 7.18   ? 251 PHE V N   1 
ATOM   10219 C CA  . PHE D 1 250 ? 78.613  54.433  -4.366  1.00 7.18   ? 251 PHE V CA  1 
ATOM   10220 C C   . PHE D 1 250 ? 77.349  54.041  -3.579  1.00 7.18   ? 251 PHE V C   1 
ATOM   10221 O O   . PHE D 1 250 ? 76.895  54.784  -2.715  1.00 2.00   ? 251 PHE V O   1 
ATOM   10222 C CB  . PHE D 1 250 ? 79.639  55.119  -3.445  1.00 2.00   ? 251 PHE V CB  1 
ATOM   10223 C CG  . PHE D 1 250 ? 79.893  54.393  -2.163  1.00 2.00   ? 251 PHE V CG  1 
ATOM   10224 C CD1 . PHE D 1 250 ? 79.045  54.528  -1.081  1.00 2.00   ? 251 PHE V CD1 1 
ATOM   10225 C CD2 . PHE D 1 250 ? 81.008  53.597  -2.022  1.00 2.00   ? 251 PHE V CD2 1 
ATOM   10226 C CE1 . PHE D 1 250 ? 79.303  53.883  0.123   1.00 2.00   ? 251 PHE V CE1 1 
ATOM   10227 C CE2 . PHE D 1 250 ? 81.271  52.945  -0.816  1.00 2.00   ? 251 PHE V CE2 1 
ATOM   10228 C CZ  . PHE D 1 250 ? 80.420  53.093  0.252   1.00 2.00   ? 251 PHE V CZ  1 
ATOM   10229 N N   . ILE D 1 251 ? 76.778  52.875  -3.882  1.00 2.00   ? 252 ILE V N   1 
ATOM   10230 C CA  . ILE D 1 251 ? 75.569  52.385  -3.204  1.00 2.00   ? 252 ILE V CA  1 
ATOM   10231 C C   . ILE D 1 251 ? 75.854  51.706  -1.883  1.00 2.00   ? 252 ILE V C   1 
ATOM   10232 O O   . ILE D 1 251 ? 76.746  50.895  -1.792  1.00 2.00   ? 252 ILE V O   1 
ATOM   10233 C CB  . ILE D 1 251 ? 74.838  51.355  -4.041  1.00 2.00   ? 252 ILE V CB  1 
ATOM   10234 C CG1 . ILE D 1 251 ? 74.786  51.804  -5.497  1.00 2.00   ? 252 ILE V CG1 1 
ATOM   10235 C CG2 . ILE D 1 251 ? 73.452  51.155  -3.486  1.00 2.00   ? 252 ILE V CG2 1 
ATOM   10236 C CD1 . ILE D 1 251 ? 75.778  51.112  -6.404  1.00 2.00   ? 252 ILE V CD1 1 
ATOM   10237 N N   . ARG D 1 252 ? 75.066  52.003  -0.867  1.00 2.00   ? 253 ARG V N   1 
ATOM   10238 C CA  . ARG D 1 252 ? 75.268  51.404  0.447   1.00 2.00   ? 253 ARG V CA  1 
ATOM   10239 C C   . ARG D 1 252 ? 74.033  50.641  0.902   1.00 2.00   ? 253 ARG V C   1 
ATOM   10240 O O   . ARG D 1 252 ? 72.957  51.208  1.043   1.00 43.21  ? 253 ARG V O   1 
ATOM   10241 C CB  . ARG D 1 252 ? 75.575  52.492  1.458   1.00 43.21  ? 253 ARG V CB  1 
ATOM   10242 C CG  . ARG D 1 252 ? 76.567  52.107  2.500   1.00 43.21  ? 253 ARG V CG  1 
ATOM   10243 C CD  . ARG D 1 252 ? 76.695  53.211  3.522   1.00 43.21  ? 253 ARG V CD  1 
ATOM   10244 N NE  . ARG D 1 252 ? 75.748  53.008  4.610   1.00 43.21  ? 253 ARG V NE  1 
ATOM   10245 C CZ  . ARG D 1 252 ? 76.103  52.779  5.869   1.00 43.21  ? 253 ARG V CZ  1 
ATOM   10246 N NH1 . ARG D 1 252 ? 77.386  52.725  6.195   1.00 43.21  ? 253 ARG V NH1 1 
ATOM   10247 N NH2 . ARG D 1 252 ? 75.182  52.590  6.806   1.00 43.21  ? 253 ARG V NH2 1 
ATOM   10248 N N   . ILE D 1 253 ? 74.180  49.343  1.132   1.00 2.00   ? 254 ILE V N   1 
ATOM   10249 C CA  . ILE D 1 253 ? 73.061  48.527  1.586   1.00 2.00   ? 254 ILE V CA  1 
ATOM   10250 C C   . ILE D 1 253 ? 73.223  48.178  3.061   1.00 2.00   ? 254 ILE V C   1 
ATOM   10251 O O   . ILE D 1 253 ? 74.301  47.750  3.507   1.00 2.00   ? 254 ILE V O   1 
ATOM   10252 C CB  . ILE D 1 253 ? 72.934  47.232  0.759   1.00 2.00   ? 254 ILE V CB  1 
ATOM   10253 C CG1 . ILE D 1 253 ? 72.037  47.465  -0.456  1.00 2.00   ? 254 ILE V CG1 1 
ATOM   10254 C CG2 . ILE D 1 253 ? 72.281  46.168  1.588   1.00 2.00   ? 254 ILE V CG2 1 
ATOM   10255 C CD1 . ILE D 1 253 ? 72.606  46.976  -1.735  1.00 2.00   ? 254 ILE V CD1 1 
ATOM   10256 N N   . ASN D 1 254 ? 72.128  48.345  3.797   1.00 2.66   ? 255 ASN V N   1 
ATOM   10257 C CA  . ASN D 1 254 ? 72.099  48.121  5.239   1.00 2.66   ? 255 ASN V CA  1 
ATOM   10258 C C   . ASN D 1 254 ? 71.378  46.861  5.721   1.00 2.66   ? 255 ASN V C   1 
ATOM   10259 O O   . ASN D 1 254 ? 70.212  46.643  5.376   1.00 56.01  ? 255 ASN V O   1 
ATOM   10260 C CB  . ASN D 1 254 ? 71.474  49.343  5.913   1.00 56.01  ? 255 ASN V CB  1 
ATOM   10261 C CG  . ASN D 1 254 ? 72.329  50.600  5.765   1.00 56.01  ? 255 ASN V CG  1 
ATOM   10262 O OD1 . ASN D 1 254 ? 73.502  50.625  6.150   1.00 56.01  ? 255 ASN V OD1 1 
ATOM   10263 N ND2 . ASN D 1 254 ? 71.737  51.655  5.211   1.00 56.01  ? 255 ASN V ND2 1 
ATOM   10264 N N   . PHE D 1 255 ? 72.070  46.059  6.543   1.00 2.00   ? 256 PHE V N   1 
ATOM   10265 C CA  . PHE D 1 255 ? 71.509  44.809  7.074   1.00 2.00   ? 256 PHE V CA  1 
ATOM   10266 C C   . PHE D 1 255 ? 71.331  44.821  8.588   1.00 2.00   ? 256 PHE V C   1 
ATOM   10267 O O   . PHE D 1 255 ? 72.119  45.459  9.306   1.00 2.00   ? 256 PHE V O   1 
ATOM   10268 C CB  . PHE D 1 255 ? 72.406  43.619  6.734   1.00 2.00   ? 256 PHE V CB  1 
ATOM   10269 C CG  . PHE D 1 255 ? 72.842  43.560  5.306   1.00 2.00   ? 256 PHE V CG  1 
ATOM   10270 C CD1 . PHE D 1 255 ? 71.951  43.219  4.324   1.00 2.00   ? 256 PHE V CD1 1 
ATOM   10271 C CD2 . PHE D 1 255 ? 74.148  43.832  4.954   1.00 2.00   ? 256 PHE V CD2 1 
ATOM   10272 C CE1 . PHE D 1 255 ? 72.354  43.149  3.022   1.00 2.00   ? 256 PHE V CE1 1 
ATOM   10273 C CE2 . PHE D 1 255 ? 74.555  43.767  3.657   1.00 2.00   ? 256 PHE V CE2 1 
ATOM   10274 C CZ  . PHE D 1 255 ? 73.660  43.426  2.693   1.00 2.00   ? 256 PHE V CZ  1 
ATOM   10275 N N   . ASP D 1 256 ? 70.317  44.097  9.073   1.00 2.00   ? 257 ASP V N   1 
ATOM   10276 C CA  . ASP D 1 256 ? 70.077  44.021  10.504  1.00 2.00   ? 257 ASP V CA  1 
ATOM   10277 C C   . ASP D 1 256 ? 71.006  42.971  11.091  1.00 2.00   ? 257 ASP V C   1 
ATOM   10278 O O   . ASP D 1 256 ? 71.983  42.571  10.458  1.00 72.11  ? 257 ASP V O   1 
ATOM   10279 C CB  . ASP D 1 256 ? 68.629  43.645  10.783  1.00 72.11  ? 257 ASP V CB  1 
ATOM   10280 C CG  . ASP D 1 256 ? 68.305  42.231  10.363  1.00 72.11  ? 257 ASP V CG  1 
ATOM   10281 O OD1 . ASP D 1 256 ? 69.228  41.498  9.955   1.00 72.11  ? 257 ASP V OD1 1 
ATOM   10282 O OD2 . ASP D 1 256 ? 67.118  41.854  10.441  1.00 72.11  ? 257 ASP V OD2 1 
ATOM   10283 N N   . VAL D 1 257 ? 70.695  42.510  12.296  1.00 58.51  ? 258 VAL V N   1 
ATOM   10284 C CA  . VAL D 1 257 ? 71.507  41.484  12.946  1.00 58.51  ? 258 VAL V CA  1 
ATOM   10285 C C   . VAL D 1 257 ? 71.199  40.093  12.387  1.00 58.51  ? 258 VAL V C   1 
ATOM   10286 O O   . VAL D 1 257 ? 72.086  39.249  12.286  1.00 72.47  ? 258 VAL V O   1 
ATOM   10287 C CB  . VAL D 1 257 ? 71.264  41.442  14.466  1.00 72.47  ? 258 VAL V CB  1 
ATOM   10288 C CG1 . VAL D 1 257 ? 72.584  41.449  15.206  1.00 72.47  ? 258 VAL V CG1 1 
ATOM   10289 C CG2 . VAL D 1 257 ? 70.414  42.618  14.881  1.00 72.47  ? 258 VAL V CG2 1 
ATOM   10290 N N   . THR D 1 258 ? 69.938  39.853  12.031  1.00 2.00   ? 259 THR V N   1 
ATOM   10291 C CA  . THR D 1 258 ? 69.532  38.567  11.489  1.00 2.00   ? 259 THR V CA  1 
ATOM   10292 C C   . THR D 1 258 ? 70.082  38.358  10.087  1.00 2.00   ? 259 THR V C   1 
ATOM   10293 O O   . THR D 1 258 ? 70.003  37.256  9.545   1.00 86.41  ? 259 THR V O   1 
ATOM   10294 C CB  . THR D 1 258 ? 68.008  38.435  11.453  1.00 86.41  ? 259 THR V CB  1 
ATOM   10295 O OG1 . THR D 1 258 ? 67.408  39.676  11.833  1.00 86.41  ? 259 THR V OG1 1 
ATOM   10296 C CG2 . THR D 1 258 ? 67.559  37.352  12.407  1.00 86.41  ? 259 THR V CG2 1 
ATOM   10297 N N   . GLY D 1 259 ? 70.636  39.417  9.502   1.00 10.35  ? 260 GLY V N   1 
ATOM   10298 C CA  . GLY D 1 259 ? 71.219  39.312  8.178   1.00 10.35  ? 260 GLY V CA  1 
ATOM   10299 C C   . GLY D 1 259 ? 70.323  39.753  7.049   1.00 10.35  ? 260 GLY V C   1 
ATOM   10300 O O   . GLY D 1 259 ? 70.568  39.398  5.895   1.00 84.04  ? 260 GLY V O   1 
ATOM   10301 N N   . TYR D 1 260 ? 69.286  40.529  7.358   1.00 25.40  ? 261 TYR V N   1 
ATOM   10302 C CA  . TYR D 1 260 ? 68.374  40.985  6.311   1.00 25.40  ? 261 TYR V CA  1 
ATOM   10303 C C   . TYR D 1 260 ? 68.561  42.425  5.847   1.00 25.40  ? 261 TYR V C   1 
ATOM   10304 O O   . TYR D 1 260 ? 68.987  43.294  6.616   1.00 49.07  ? 261 TYR V O   1 
ATOM   10305 C CB  . TYR D 1 260 ? 66.941  40.787  6.764   1.00 49.07  ? 261 TYR V CB  1 
ATOM   10306 C CG  . TYR D 1 260 ? 66.669  39.370  7.143   1.00 49.07  ? 261 TYR V CG  1 
ATOM   10307 C CD1 . TYR D 1 260 ? 67.236  38.823  8.280   1.00 49.07  ? 261 TYR V CD1 1 
ATOM   10308 C CD2 . TYR D 1 260 ? 65.883  38.560  6.336   1.00 49.07  ? 261 TYR V CD2 1 
ATOM   10309 C CE1 . TYR D 1 260 ? 67.037  37.507  8.607   1.00 49.07  ? 261 TYR V CE1 1 
ATOM   10310 C CE2 . TYR D 1 260 ? 65.672  37.237  6.654   1.00 49.07  ? 261 TYR V CE2 1 
ATOM   10311 C CZ  . TYR D 1 260 ? 66.258  36.711  7.796   1.00 49.07  ? 261 TYR V CZ  1 
ATOM   10312 O OH  . TYR D 1 260 ? 66.088  35.379  8.118   1.00 49.07  ? 261 TYR V OH  1 
ATOM   10313 N N   . ILE D 1 261 ? 68.232  42.659  4.579   1.00 11.36  ? 262 ILE V N   1 
ATOM   10314 C CA  . ILE D 1 261 ? 68.350  43.980  3.989   1.00 11.36  ? 262 ILE V CA  1 
ATOM   10315 C C   . ILE D 1 261 ? 67.273  44.826  4.621   1.00 11.36  ? 262 ILE V C   1 
ATOM   10316 O O   . ILE D 1 261 ? 66.137  44.364  4.791   1.00 5.64   ? 262 ILE V O   1 
ATOM   10317 C CB  . ILE D 1 261 ? 68.154  43.930  2.443   1.00 5.64   ? 262 ILE V CB  1 
ATOM   10318 C CG1 . ILE D 1 261 ? 69.398  44.461  1.751   1.00 5.64   ? 262 ILE V CG1 1 
ATOM   10319 C CG2 . ILE D 1 261 ? 67.008  44.787  2.011   1.00 5.64   ? 262 ILE V CG2 1 
ATOM   10320 C CD1 . ILE D 1 261 ? 69.313  44.401  0.268   1.00 5.64   ? 262 ILE V CD1 1 
ATOM   10321 N N   . VAL D 1 262 ? 67.625  46.059  4.973   1.00 56.49  ? 263 VAL V N   1 
ATOM   10322 C CA  . VAL D 1 262 ? 66.663  46.946  5.588   1.00 56.49  ? 263 VAL V CA  1 
ATOM   10323 C C   . VAL D 1 262 ? 66.766  48.368  5.048   1.00 56.49  ? 263 VAL V C   1 
ATOM   10324 O O   . VAL D 1 262 ? 65.795  49.103  5.057   1.00 20.33  ? 263 VAL V O   1 
ATOM   10325 C CB  . VAL D 1 262 ? 66.848  46.955  7.101   1.00 20.33  ? 263 VAL V CB  1 
ATOM   10326 C CG1 . VAL D 1 262 ? 68.323  46.855  7.443   1.00 20.33  ? 263 VAL V CG1 1 
ATOM   10327 C CG2 . VAL D 1 262 ? 66.261  48.214  7.675   1.00 20.33  ? 263 VAL V CG2 1 
ATOM   10328 N N   . GLY D 1 263 ? 67.936  48.755  4.568   1.00 30.76  ? 264 GLY V N   1 
ATOM   10329 C CA  . GLY D 1 263 ? 68.080  50.103  4.048   1.00 30.76  ? 264 GLY V CA  1 
ATOM   10330 C C   . GLY D 1 263 ? 69.044  50.232  2.880   1.00 30.76  ? 264 GLY V C   1 
ATOM   10331 O O   . GLY D 1 263 ? 69.724  49.269  2.524   1.00 59.77  ? 264 GLY V O   1 
ATOM   10332 N N   . ALA D 1 264 ? 69.132  51.428  2.303   1.00 2.00   ? 265 ALA V N   1 
ATOM   10333 C CA  . ALA D 1 264 ? 70.001  51.668  1.156   1.00 2.00   ? 265 ALA V CA  1 
ATOM   10334 C C   . ALA D 1 264 ? 70.162  53.150  0.827   1.00 2.00   ? 265 ALA V C   1 
ATOM   10335 O O   . ALA D 1 264 ? 69.207  53.880  0.596   1.00 4.88   ? 265 ALA V O   1 
ATOM   10336 C CB  . ALA D 1 264 ? 69.472  50.928  -0.060  1.00 4.88   ? 265 ALA V CB  1 
ATOM   10337 N N   . ASN D 1 265 ? 71.409  53.565  0.778   1.00 2.00   ? 266 ASN V N   1 
ATOM   10338 C CA  . ASN D 1 265 ? 71.791  54.931  0.506   1.00 2.00   ? 266 ASN V CA  1 
ATOM   10339 C C   . ASN D 1 265 ? 72.498  54.965  -0.827  1.00 2.00   ? 266 ASN V C   1 
ATOM   10340 O O   . ASN D 1 265 ? 72.947  53.937  -1.322  1.00 65.35  ? 266 ASN V O   1 
ATOM   10341 C CB  . ASN D 1 265 ? 72.770  55.365  1.583   1.00 65.35  ? 266 ASN V CB  1 
ATOM   10342 C CG  . ASN D 1 265 ? 72.441  56.696  2.159   1.00 65.35  ? 266 ASN V CG  1 
ATOM   10343 O OD1 . ASN D 1 265 ? 72.371  56.865  3.384   1.00 65.35  ? 266 ASN V OD1 1 
ATOM   10344 N ND2 . ASN D 1 265 ? 72.240  57.667  1.285   1.00 65.35  ? 266 ASN V ND2 1 
ATOM   10345 N N   . ILE D 1 266 ? 72.624  56.148  -1.405  1.00 7.43   ? 267 ILE V N   1 
ATOM   10346 C CA  . ILE D 1 266 ? 73.337  56.289  -2.675  1.00 7.43   ? 267 ILE V CA  1 
ATOM   10347 C C   . ILE D 1 266 ? 74.091  57.627  -2.717  1.00 7.43   ? 267 ILE V C   1 
ATOM   10348 O O   . ILE D 1 266 ? 73.486  58.704  -2.749  1.00 2.00   ? 267 ILE V O   1 
ATOM   10349 C CB  . ILE D 1 266 ? 72.372  56.263  -3.902  1.00 2.00   ? 267 ILE V CB  1 
ATOM   10350 C CG1 . ILE D 1 266 ? 71.712  54.900  -4.104  1.00 2.00   ? 267 ILE V CG1 1 
ATOM   10351 C CG2 . ILE D 1 266 ? 73.081  56.582  -5.218  1.00 2.00   ? 267 ILE V CG2 1 
ATOM   10352 C CD1 . ILE D 1 266 ? 70.238  54.889  -3.706  1.00 2.00   ? 267 ILE V CD1 1 
ATOM   10353 N N   . GLU D 1 267 ? 75.414  57.542  -2.717  1.00 2.00   ? 268 GLU V N   1 
ATOM   10354 C CA  . GLU D 1 267 ? 76.275  58.739  -2.776  1.00 2.00   ? 268 GLU V CA  1 
ATOM   10355 C C   . GLU D 1 267 ? 76.747  58.972  -4.219  1.00 2.00   ? 268 GLU V C   1 
ATOM   10356 O O   . GLU D 1 267 ? 77.679  58.314  -4.699  1.00 98.21  ? 268 GLU V O   1 
ATOM   10357 C CB  . GLU D 1 267 ? 77.498  58.564  -1.868  1.00 98.21  ? 268 GLU V CB  1 
ATOM   10358 C CG  . GLU D 1 267 ? 78.310  59.854  -1.703  1.00 98.21  ? 268 GLU V CG  1 
ATOM   10359 C CD  . GLU D 1 267 ? 77.567  60.928  -0.907  1.00 98.21  ? 268 GLU V CD  1 
ATOM   10360 O OE1 . GLU D 1 267 ? 76.391  60.682  -0.440  1.00 98.21  ? 268 GLU V OE1 1 
ATOM   10361 O OE2 . GLU D 1 267 ? 78.118  62.076  -0.704  1.00 98.21  ? 268 GLU V OE2 1 
ATOM   10362 N N   . THR D 1 268 ? 76.078  59.906  -4.876  1.00 10.20  ? 269 THR V N   1 
ATOM   10363 C CA  . THR D 1 268 ? 76.371  60.286  -6.277  1.00 10.20  ? 269 THR V CA  1 
ATOM   10364 C C   . THR D 1 268 ? 77.542  61.278  -6.297  1.00 10.20  ? 269 THR V C   1 
ATOM   10365 O O   . THR D 1 268 ? 77.785  62.006  -5.332  1.00 6.58   ? 269 THR V O   1 
ATOM   10366 C CB  . THR D 1 268 ? 75.131  60.934  -6.881  1.00 6.58   ? 269 THR V CB  1 
ATOM   10367 O OG1 . THR D 1 268 ? 75.509  61.858  -7.886  1.00 6.58   ? 269 THR V OG1 1 
ATOM   10368 C CG2 . THR D 1 268 ? 74.300  61.689  -5.841  1.00 6.58   ? 269 THR V CG2 1 
ATOM   10369 N N   . TYR D 1 269 ? 78.277  61.331  -7.403  1.00 56.38  ? 270 TYR V N   1 
ATOM   10370 C CA  . TYR D 1 269 ? 79.457  62.217  -7.456  1.00 56.38  ? 270 TYR V CA  1 
ATOM   10371 C C   . TYR D 1 269 ? 79.431  63.207  -8.641  1.00 56.38  ? 270 TYR V C   1 
ATOM   10372 O O   . TYR D 1 269 ? 78.461  63.949  -8.839  1.00 29.85  ? 270 TYR V O   1 
ATOM   10373 C CB  . TYR D 1 269 ? 80.740  61.384  -7.518  1.00 29.85  ? 270 TYR V CB  1 
ATOM   10374 C CG  . TYR D 1 269 ? 80.912  60.465  -6.298  1.00 29.85  ? 270 TYR V CG  1 
ATOM   10375 C CD1 . TYR D 1 269 ? 81.544  60.934  -5.136  1.00 29.85  ? 270 TYR V CD1 1 
ATOM   10376 C CD2 . TYR D 1 269 ? 80.437  59.151  -6.344  1.00 29.85  ? 270 TYR V CD2 1 
ATOM   10377 C CE1 . TYR D 1 269 ? 81.698  60.091  -4.030  1.00 29.85  ? 270 TYR V CE1 1 
ATOM   10378 C CE2 . TYR D 1 269 ? 80.590  58.309  -5.236  1.00 29.85  ? 270 TYR V CE2 1 
ATOM   10379 C CZ  . TYR D 1 269 ? 81.221  58.777  -4.081  1.00 29.85  ? 270 TYR V CZ  1 
ATOM   10380 O OH  . TYR D 1 269 ? 81.370  57.955  -3.008  1.00 29.85  ? 270 TYR V OH  1 
ATOM   10381 N N   . LEU D 1 270 ? 80.524  63.176  -9.383  1.00 2.00   ? 271 LEU V N   1 
ATOM   10382 C CA  . LEU D 1 270 ? 80.818  64.116  -10.489 1.00 2.00   ? 271 LEU V CA  1 
ATOM   10383 C C   . LEU D 1 270 ? 79.877  64.020  -11.686 1.00 2.00   ? 271 LEU V C   1 
ATOM   10384 O O   . LEU D 1 270 ? 80.245  63.455  -12.714 1.00 100.00 ? 271 LEU V O   1 
ATOM   10385 C CB  . LEU D 1 270 ? 82.234  63.874  -10.974 1.00 100.00 ? 271 LEU V CB  1 
ATOM   10386 C CG  . LEU D 1 270 ? 83.193  63.658  -9.809  1.00 100.00 ? 271 LEU V CG  1 
ATOM   10387 C CD1 . LEU D 1 270 ? 84.077  62.429  -9.990  1.00 100.00 ? 271 LEU V CD1 1 
ATOM   10388 C CD2 . LEU D 1 270 ? 84.127  64.843  -9.589  1.00 100.00 ? 271 LEU V CD2 1 
ATOM   10389 N N   . LEU D 1 271 ? 78.690  64.603  -11.573 1.00 2.00   ? 272 LEU V N   1 
ATOM   10390 C CA  . LEU D 1 271 ? 77.733  64.555  -12.673 1.00 2.00   ? 272 LEU V CA  1 
ATOM   10391 C C   . LEU D 1 271 ? 78.090  65.484  -13.842 1.00 2.00   ? 272 LEU V C   1 
ATOM   10392 O O   . LEU D 1 271 ? 77.737  66.651  -13.816 1.00 14.75  ? 272 LEU V O   1 
ATOM   10393 C CB  . LEU D 1 271 ? 76.325  64.906  -12.172 1.00 14.75  ? 272 LEU V CB  1 
ATOM   10394 C CG  . LEU D 1 271 ? 75.252  65.306  -13.205 1.00 14.75  ? 272 LEU V CG  1 
ATOM   10395 C CD1 . LEU D 1 271 ? 75.488  64.668  -14.574 1.00 14.75  ? 272 LEU V CD1 1 
ATOM   10396 C CD2 . LEU D 1 271 ? 73.907  64.879  -12.674 1.00 14.75  ? 272 LEU V CD2 1 
ATOM   10397 N N   . GLU D 1 272 ? 78.754  64.969  -14.874 1.00 14.65  ? 273 GLU V N   1 
ATOM   10398 C CA  . GLU D 1 272 ? 79.143  65.783  -16.040 1.00 14.65  ? 273 GLU V CA  1 
ATOM   10399 C C   . GLU D 1 272 ? 77.915  66.369  -16.749 1.00 14.65  ? 273 GLU V C   1 
ATOM   10400 O O   . GLU D 1 272 ? 77.597  66.018  -17.885 1.00 51.42  ? 273 GLU V O   1 
ATOM   10401 C CB  . GLU D 1 272 ? 79.978  64.920  -17.001 1.00 51.42  ? 273 GLU V CB  1 
ATOM   10402 C CG  . GLU D 1 272 ? 80.267  65.515  -18.376 1.00 51.42  ? 273 GLU V CG  1 
ATOM   10403 C CD  . GLU D 1 272 ? 80.698  64.456  -19.408 1.00 51.42  ? 273 GLU V CD  1 
ATOM   10404 O OE1 . GLU D 1 272 ? 81.877  64.031  -19.392 1.00 51.42  ? 273 GLU V OE1 1 
ATOM   10405 O OE2 . GLU D 1 272 ? 79.852  64.046  -20.240 1.00 51.42  ? 273 GLU V OE2 1 
ATOM   10406 N N   . LYS D 1 273 ? 77.230  67.272  -16.057 1.00 12.62  ? 274 LYS V N   1 
ATOM   10407 C CA  . LYS D 1 273 ? 76.035  67.917  -16.581 1.00 12.62  ? 274 LYS V CA  1 
ATOM   10408 C C   . LYS D 1 273 ? 76.380  68.954  -17.634 1.00 12.62  ? 274 LYS V C   1 
ATOM   10409 O O   . LYS D 1 273 ? 75.500  69.620  -18.182 1.00 96.44  ? 274 LYS V O   1 
ATOM   10410 C CB  . LYS D 1 273 ? 75.225  68.580  -15.464 1.00 96.44  ? 274 LYS V CB  1 
ATOM   10411 C CG  . LYS D 1 273 ? 76.055  69.322  -14.438 1.00 96.44  ? 274 LYS V CG  1 
ATOM   10412 C CD  . LYS D 1 273 ? 76.811  70.501  -15.047 1.00 96.44  ? 274 LYS V CD  1 
ATOM   10413 C CE  . LYS D 1 273 ? 77.677  71.199  -14.001 1.00 96.44  ? 274 LYS V CE  1 
ATOM   10414 N NZ  . LYS D 1 273 ? 76.919  72.204  -13.193 1.00 96.44  ? 274 LYS V NZ  1 
ATOM   10415 N N   . SER D 1 274 ? 77.668  69.108  -17.899 1.00 3.39   ? 275 SER V N   1 
ATOM   10416 C CA  . SER D 1 274 ? 78.085  70.030  -18.931 1.00 3.39   ? 275 SER V CA  1 
ATOM   10417 C C   . SER D 1 274 ? 77.294  69.629  -20.191 1.00 3.39   ? 275 SER V C   1 
ATOM   10418 O O   . SER D 1 274 ? 76.420  70.373  -20.652 1.00 52.18  ? 275 SER V O   1 
ATOM   10419 C CB  . SER D 1 274 ? 79.586  69.886  -19.174 1.00 52.18  ? 275 SER V CB  1 
ATOM   10420 O OG  . SER D 1 274 ? 80.277  69.773  -17.939 1.00 52.18  ? 275 SER V OG  1 
ATOM   10421 N N   . ARG D 1 275 ? 77.579  68.433  -20.705 1.00 38.25  ? 276 ARG V N   1 
ATOM   10422 C CA  . ARG D 1 275 ? 76.942  67.886  -21.907 1.00 38.25  ? 276 ARG V CA  1 
ATOM   10423 C C   . ARG D 1 275 ? 75.444  68.100  -22.049 1.00 38.25  ? 276 ARG V C   1 
ATOM   10424 O O   . ARG D 1 275 ? 74.865  67.756  -23.081 1.00 44.46  ? 276 ARG V O   1 
ATOM   10425 C CB  . ARG D 1 275 ? 77.233  66.382  -22.015 1.00 44.46  ? 276 ARG V CB  1 
ATOM   10426 C CG  . ARG D 1 275 ? 76.228  65.464  -21.304 1.00 44.46  ? 276 ARG V CG  1 
ATOM   10427 C CD  . ARG D 1 275 ? 76.396  63.994  -21.713 1.00 44.46  ? 276 ARG V CD  1 
ATOM   10428 N NE  . ARG D 1 275 ? 77.805  63.605  -21.819 1.00 44.46  ? 276 ARG V NE  1 
ATOM   10429 C CZ  . ARG D 1 275 ? 78.374  63.101  -22.914 1.00 44.46  ? 276 ARG V CZ  1 
ATOM   10430 N NH1 . ARG D 1 275 ? 77.661  62.916  -24.017 1.00 44.46  ? 276 ARG V NH1 1 
ATOM   10431 N NH2 . ARG D 1 275 ? 79.665  62.798  -22.915 1.00 44.46  ? 276 ARG V NH2 1 
ATOM   10432 N N   . ALA D 1 276 ? 74.811  68.643  -21.018 1.00 25.49  ? 277 ALA V N   1 
ATOM   10433 C CA  . ALA D 1 276 ? 73.382  68.892  -21.073 1.00 25.49  ? 277 ALA V CA  1 
ATOM   10434 C C   . ALA D 1 276 ? 73.080  70.011  -22.073 1.00 25.49  ? 277 ALA V C   1 
ATOM   10435 O O   . ALA D 1 276 ? 71.928  70.175  -22.513 1.00 15.88  ? 277 ALA V O   1 
ATOM   10436 C CB  . ALA D 1 276 ? 72.881  69.277  -19.712 1.00 15.88  ? 277 ALA V CB  1 
ATOM   10437 N N   . ILE D 1 277 ? 74.123  70.767  -22.429 1.00 37.41  ? 278 ILE V N   1 
ATOM   10438 C CA  . ILE D 1 277 ? 74.007  71.892  -23.359 1.00 37.41  ? 278 ILE V CA  1 
ATOM   10439 C C   . ILE D 1 277 ? 74.636  71.636  -24.714 1.00 37.41  ? 278 ILE V C   1 
ATOM   10440 O O   . ILE D 1 277 ? 74.100  72.067  -25.733 1.00 19.48  ? 278 ILE V O   1 
ATOM   10441 C CB  . ILE D 1 277 ? 74.668  73.158  -22.792 1.00 19.48  ? 278 ILE V CB  1 
ATOM   10442 C CG1 . ILE D 1 277 ? 76.111  72.856  -22.430 1.00 19.48  ? 278 ILE V CG1 1 
ATOM   10443 C CG2 . ILE D 1 277 ? 73.922  73.642  -21.556 1.00 19.48  ? 278 ILE V CG2 1 
ATOM   10444 C CD1 . ILE D 1 277 ? 76.929  74.087  -22.199 1.00 19.48  ? 278 ILE V CD1 1 
ATOM   10445 N N   . ARG D 1 278 ? 75.787  70.972  -24.723 1.00 2.00   ? 279 ARG V N   1 
ATOM   10446 C CA  . ARG D 1 278 ? 76.468  70.666  -25.976 1.00 2.00   ? 279 ARG V CA  1 
ATOM   10447 C C   . ARG D 1 278 ? 77.199  69.326  -25.890 1.00 2.00   ? 279 ARG V C   1 
ATOM   10448 O O   . ARG D 1 278 ? 78.106  69.146  -25.065 1.00 99.99  ? 279 ARG V O   1 
ATOM   10449 C CB  . ARG D 1 278 ? 77.459  71.775  -26.317 1.00 99.99  ? 279 ARG V CB  1 
ATOM   10450 C CG  . ARG D 1 278 ? 76.795  73.143  -26.475 1.00 99.99  ? 279 ARG V CG  1 
ATOM   10451 C CD  . ARG D 1 278 ? 77.506  74.244  -25.691 1.00 99.99  ? 279 ARG V CD  1 
ATOM   10452 N NE  . ARG D 1 278 ? 76.611  75.341  -25.301 1.00 99.99  ? 279 ARG V NE  1 
ATOM   10453 C CZ  . ARG D 1 278 ? 77.032  76.518  -24.822 1.00 99.99  ? 279 ARG V CZ  1 
ATOM   10454 N NH1 . ARG D 1 278 ? 78.340  76.768  -24.667 1.00 99.99  ? 279 ARG V NH1 1 
ATOM   10455 N NH2 . ARG D 1 278 ? 76.218  77.518  -24.468 1.00 99.99  ? 279 ARG V NH2 1 
ATOM   10456 N N   . GLN D 1 279 ? 76.764  68.436  -26.767 1.00 2.00   ? 280 GLN V N   1 
ATOM   10457 C CA  . GLN D 1 279 ? 77.315  67.079  -26.880 1.00 2.00   ? 280 GLN V CA  1 
ATOM   10458 C C   . GLN D 1 279 ? 78.304  67.003  -28.038 1.00 2.00   ? 280 GLN V C   1 
ATOM   10459 O O   . GLN D 1 279 ? 78.080  67.587  -29.109 1.00 33.92  ? 280 GLN V O   1 
ATOM   10460 C CB  . GLN D 1 279 ? 76.196  66.069  -27.139 1.00 33.92  ? 280 GLN V CB  1 
ATOM   10461 C CG  . GLN D 1 279 ? 75.002  66.243  -26.198 1.00 33.92  ? 280 GLN V CG  1 
ATOM   10462 C CD  . GLN D 1 279 ? 74.135  67.452  -26.552 1.00 33.92  ? 280 GLN V CD  1 
ATOM   10463 O OE1 . GLN D 1 279 ? 73.395  67.408  -27.534 1.00 33.92  ? 280 GLN V OE1 1 
ATOM   10464 N NE2 . GLN D 1 279 ? 74.184  68.541  -25.808 1.00 33.92  ? 280 GLN V NE2 1 
ATOM   10465 N N   . ALA D 1 280 ? 79.372  66.278  -27.775 1.00 45.03  ? 281 ALA V N   1 
ATOM   10466 C CA  . ALA D 1 280 ? 80.447  66.063  -28.746 1.00 45.03  ? 281 ALA V CA  1 
ATOM   10467 C C   . ALA D 1 280 ? 79.916  65.257  -29.929 1.00 45.03  ? 281 ALA V C   1 
ATOM   10468 O O   . ALA D 1 280 ? 78.749  64.839  -29.949 1.00 99.41  ? 281 ALA V O   1 
ATOM   10469 C CB  . ALA D 1 280 ? 81.597  65.295  -28.091 1.00 99.41  ? 281 ALA V CB  1 
ATOM   10470 N N   . LYS D 1 281 ? 80.802  65.070  -30.884 1.00 77.14  ? 282 LYS V N   1 
ATOM   10471 C CA  . LYS D 1 281 ? 80.519  64.315  -32.107 1.00 77.14  ? 282 LYS V CA  1 
ATOM   10472 C C   . LYS D 1 281 ? 80.190  62.856  -31.761 1.00 77.14  ? 282 LYS V C   1 
ATOM   10473 O O   . LYS D 1 281 ? 80.914  62.208  -30.993 1.00 100.00 ? 282 LYS V O   1 
ATOM   10474 C CB  . LYS D 1 281 ? 81.745  64.341  -33.023 1.00 100.00 ? 282 LYS V CB  1 
ATOM   10475 C CG  . LYS D 1 281 ? 81.388  64.294  -34.509 1.00 100.00 ? 282 LYS V CG  1 
ATOM   10476 C CD  . LYS D 1 281 ? 81.569  62.906  -35.123 1.00 100.00 ? 282 LYS V CD  1 
ATOM   10477 C CE  . LYS D 1 281 ? 81.967  62.950  -36.600 1.00 100.00 ? 282 LYS V CE  1 
ATOM   10478 N NZ  . LYS D 1 281 ? 83.021  61.984  -36.941 1.00 100.00 ? 282 LYS V NZ  1 
ATOM   10479 N N   . ASP D 1 282 ? 79.091  62.408  -32.345 1.00 11.81  ? 283 ASP V N   1 
ATOM   10480 C CA  . ASP D 1 282 ? 78.570  61.026  -32.221 1.00 11.81  ? 283 ASP V CA  1 
ATOM   10481 C C   . ASP D 1 282 ? 78.194  60.657  -30.774 1.00 11.81  ? 283 ASP V C   1 
ATOM   10482 O O   . ASP D 1 282 ? 78.077  59.472  -30.424 1.00 96.69  ? 283 ASP V O   1 
ATOM   10483 C CB  . ASP D 1 282 ? 79.601  60.020  -32.729 1.00 96.69  ? 283 ASP V CB  1 
ATOM   10484 C CG  . ASP D 1 282 ? 79.672  59.981  -34.258 1.00 96.69  ? 283 ASP V CG  1 
ATOM   10485 O OD1 . ASP D 1 282 ? 78.696  60.451  -34.960 1.00 96.69  ? 283 ASP V OD1 1 
ATOM   10486 O OD2 . ASP D 1 282 ? 80.706  59.482  -34.844 1.00 96.69  ? 283 ASP V OD2 1 
ATOM   10487 N N   . GLU D 1 283 ? 78.001  61.672  -29.955 1.00 4.33   ? 284 GLU V N   1 
ATOM   10488 C CA  . GLU D 1 283 ? 77.577  61.484  -28.554 1.00 4.33   ? 284 GLU V CA  1 
ATOM   10489 C C   . GLU D 1 283 ? 76.171  62.060  -28.381 1.00 4.33   ? 284 GLU V C   1 
ATOM   10490 O O   . GLU D 1 283 ? 75.679  62.794  -29.251 1.00 40.27  ? 284 GLU V O   1 
ATOM   10491 C CB  . GLU D 1 283 ? 78.539  62.189  -27.603 1.00 40.27  ? 284 GLU V CB  1 
ATOM   10492 C CG  . GLU D 1 283 ? 79.928  61.556  -27.582 1.00 40.27  ? 284 GLU V CG  1 
ATOM   10493 C CD  . GLU D 1 283 ? 80.697  61.851  -26.296 1.00 40.27  ? 284 GLU V CD  1 
ATOM   10494 O OE1 . GLU D 1 283 ? 80.193  62.643  -25.412 1.00 40.27  ? 284 GLU V OE1 1 
ATOM   10495 O OE2 . GLU D 1 283 ? 81.849  61.308  -26.096 1.00 40.27  ? 284 GLU V OE2 1 
ATOM   10496 N N   . ARG D 1 284 ? 75.568  61.712  -27.258 1.00 2.00   ? 285 ARG V N   1 
ATOM   10497 C CA  . ARG D 1 284 ? 74.205  62.156  -26.907 1.00 2.00   ? 285 ARG V CA  1 
ATOM   10498 C C   . ARG D 1 284 ? 74.181  62.777  -25.509 1.00 2.00   ? 285 ARG V C   1 
ATOM   10499 O O   . ARG D 1 284 ? 75.175  62.728  -24.770 1.00 58.71  ? 285 ARG V O   1 
ATOM   10500 C CB  . ARG D 1 284 ? 73.250  60.957  -26.882 1.00 58.71  ? 285 ARG V CB  1 
ATOM   10501 C CG  . ARG D 1 284 ? 72.723  60.564  -28.261 1.00 58.71  ? 285 ARG V CG  1 
ATOM   10502 C CD  . ARG D 1 284 ? 72.098  59.163  -28.283 1.00 58.71  ? 285 ARG V CD  1 
ATOM   10503 N NE  . ARG D 1 284 ? 71.260  58.885  -27.106 1.00 58.71  ? 285 ARG V NE  1 
ATOM   10504 C CZ  . ARG D 1 284 ? 69.989  58.460  -27.173 1.00 58.71  ? 285 ARG V CZ  1 
ATOM   10505 N NH1 . ARG D 1 284 ? 69.391  58.260  -28.356 1.00 58.71  ? 285 ARG V NH1 1 
ATOM   10506 N NH2 . ARG D 1 284 ? 69.224  58.203  -26.103 1.00 58.71  ? 285 ARG V NH2 1 
ATOM   10507 N N   . THR D 1 285 ? 73.029  63.350  -25.199 1.00 2.79   ? 286 THR V N   1 
ATOM   10508 C CA  . THR D 1 285 ? 72.764  63.944  -23.881 1.00 2.79   ? 286 THR V CA  1 
ATOM   10509 C C   . THR D 1 285 ? 72.184  62.863  -22.995 1.00 2.79   ? 286 THR V C   1 
ATOM   10510 O O   . THR D 1 285 ? 72.121  61.686  -23.374 1.00 61.79  ? 286 THR V O   1 
ATOM   10511 C CB  . THR D 1 285 ? 71.766  65.098  -23.999 1.00 61.79  ? 286 THR V CB  1 
ATOM   10512 O OG1 . THR D 1 285 ? 71.119  65.060  -25.260 1.00 61.79  ? 286 THR V OG1 1 
ATOM   10513 C CG2 . THR D 1 285 ? 72.424  66.473  -23.859 1.00 61.79  ? 286 THR V CG2 1 
ATOM   10514 N N   . PHE D 1 286 ? 71.736  63.289  -21.823 1.00 3.03   ? 287 PHE V N   1 
ATOM   10515 C CA  . PHE D 1 286 ? 71.171  62.387  -20.847 1.00 3.03   ? 287 PHE V CA  1 
ATOM   10516 C C   . PHE D 1 286 ? 69.908  61.718  -21.364 1.00 3.03   ? 287 PHE V C   1 
ATOM   10517 O O   . PHE D 1 286 ? 68.883  62.366  -21.557 1.00 10.73  ? 287 PHE V O   1 
ATOM   10518 C CB  . PHE D 1 286 ? 70.926  63.150  -19.535 1.00 10.73  ? 287 PHE V CB  1 
ATOM   10519 C CG  . PHE D 1 286 ? 72.170  63.780  -18.986 1.00 10.73  ? 287 PHE V CG  1 
ATOM   10520 C CD1 . PHE D 1 286 ? 72.663  64.939  -19.541 1.00 10.73  ? 287 PHE V CD1 1 
ATOM   10521 C CD2 . PHE D 1 286 ? 72.906  63.153  -17.999 1.00 10.73  ? 287 PHE V CD2 1 
ATOM   10522 C CE1 . PHE D 1 286 ? 73.873  65.456  -19.131 1.00 10.73  ? 287 PHE V CE1 1 
ATOM   10523 C CE2 . PHE D 1 286 ? 74.122  63.667  -17.584 1.00 10.73  ? 287 PHE V CE2 1 
ATOM   10524 C CZ  . PHE D 1 286 ? 74.607  64.815  -18.150 1.00 10.73  ? 287 PHE V CZ  1 
ATOM   10525 N N   . HIS D 1 287 ? 70.016  60.410  -21.596 1.00 47.87  ? 288 HIS V N   1 
ATOM   10526 C CA  . HIS D 1 287 ? 68.923  59.582  -22.094 1.00 47.87  ? 288 HIS V CA  1 
ATOM   10527 C C   . HIS D 1 287 ? 67.547  60.234  -21.939 1.00 47.87  ? 288 HIS V C   1 
ATOM   10528 O O   . HIS D 1 287 ? 66.890  60.579  -22.930 1.00 31.13  ? 288 HIS V O   1 
ATOM   10529 C CB  . HIS D 1 287 ? 68.940  58.220  -21.375 1.00 31.13  ? 288 HIS V CB  1 
ATOM   10530 C CG  . HIS D 1 287 ? 70.054  57.310  -21.808 1.00 31.13  ? 288 HIS V CG  1 
ATOM   10531 N ND1 . HIS D 1 287 ? 70.010  55.943  -21.621 1.00 31.13  ? 288 HIS V ND1 1 
ATOM   10532 C CD2 . HIS D 1 287 ? 71.241  57.569  -22.413 1.00 31.13  ? 288 HIS V CD2 1 
ATOM   10533 C CE1 . HIS D 1 287 ? 71.121  55.404  -22.092 1.00 31.13  ? 288 HIS V CE1 1 
ATOM   10534 N NE2 . HIS D 1 287 ? 71.884  56.367  -22.577 1.00 31.13  ? 288 HIS V NE2 1 
ATOM   10535 N N   . ILE D 1 288 ? 67.129  60.414  -20.691 1.00 5.37   ? 289 ILE V N   1 
ATOM   10536 C CA  . ILE D 1 288 ? 65.832  61.013  -20.402 1.00 5.37   ? 289 ILE V CA  1 
ATOM   10537 C C   . ILE D 1 288 ? 65.375  62.060  -21.412 1.00 5.37   ? 289 ILE V C   1 
ATOM   10538 O O   . ILE D 1 288 ? 64.197  62.098  -21.757 1.00 2.00   ? 289 ILE V O   1 
ATOM   10539 C CB  . ILE D 1 288 ? 65.819  61.650  -19.018 1.00 2.00   ? 289 ILE V CB  1 
ATOM   10540 C CG1 . ILE D 1 288 ? 64.532  62.453  -18.831 1.00 2.00   ? 289 ILE V CG1 1 
ATOM   10541 C CG2 . ILE D 1 288 ? 67.065  62.508  -18.842 1.00 2.00   ? 289 ILE V CG2 1 
ATOM   10542 C CD1 . ILE D 1 288 ? 63.251  61.620  -18.798 1.00 2.00   ? 289 ILE V CD1 1 
ATOM   10543 N N   . PHE D 1 289 ? 66.291  62.905  -21.881 1.00 56.69  ? 290 PHE V N   1 
ATOM   10544 C CA  . PHE D 1 289 ? 65.937  63.941  -22.854 1.00 56.69  ? 290 PHE V CA  1 
ATOM   10545 C C   . PHE D 1 289 ? 65.236  63.309  -24.052 1.00 56.69  ? 290 PHE V C   1 
ATOM   10546 O O   . PHE D 1 289 ? 64.041  63.557  -24.303 1.00 22.51  ? 290 PHE V O   1 
ATOM   10547 C CB  . PHE D 1 289 ? 67.188  64.702  -23.336 1.00 22.51  ? 290 PHE V CB  1 
ATOM   10548 C CG  . PHE D 1 289 ? 67.640  65.816  -22.398 1.00 22.51  ? 290 PHE V CG  1 
ATOM   10549 C CD1 . PHE D 1 289 ? 66.726  66.453  -21.542 1.00 22.51  ? 290 PHE V CD1 1 
ATOM   10550 C CD2 . PHE D 1 289 ? 68.989  66.201  -22.344 1.00 22.51  ? 290 PHE V CD2 1 
ATOM   10551 C CE1 . PHE D 1 289 ? 67.143  67.445  -20.648 1.00 22.51  ? 290 PHE V CE1 1 
ATOM   10552 C CE2 . PHE D 1 289 ? 69.415  67.192  -21.455 1.00 22.51  ? 290 PHE V CE2 1 
ATOM   10553 C CZ  . PHE D 1 289 ? 68.486  67.813  -20.603 1.00 22.51  ? 290 PHE V CZ  1 
ATOM   10554 N N   . TYR D 1 290 ? 65.990  62.496  -24.787 1.00 2.00   ? 291 TYR V N   1 
ATOM   10555 C CA  . TYR D 1 290 ? 65.455  61.811  -25.950 1.00 2.00   ? 291 TYR V CA  1 
ATOM   10556 C C   . TYR D 1 290 ? 64.208  61.024  -25.563 1.00 2.00   ? 291 TYR V C   1 
ATOM   10557 O O   . TYR D 1 290 ? 63.191  61.075  -26.262 1.00 30.90  ? 291 TYR V O   1 
ATOM   10558 C CB  . TYR D 1 290 ? 66.506  60.878  -26.524 1.00 30.90  ? 291 TYR V CB  1 
ATOM   10559 C CG  . TYR D 1 290 ? 67.796  61.575  -26.884 1.00 30.90  ? 291 TYR V CG  1 
ATOM   10560 C CD1 . TYR D 1 290 ? 68.817  61.728  -25.947 1.00 30.90  ? 291 TYR V CD1 1 
ATOM   10561 C CD2 . TYR D 1 290 ? 68.015  62.058  -28.176 1.00 30.90  ? 291 TYR V CD2 1 
ATOM   10562 C CE1 . TYR D 1 290 ? 70.039  62.346  -26.289 1.00 30.90  ? 291 TYR V CE1 1 
ATOM   10563 C CE2 . TYR D 1 290 ? 69.224  62.675  -28.535 1.00 30.90  ? 291 TYR V CE2 1 
ATOM   10564 C CZ  . TYR D 1 290 ? 70.231  62.816  -27.590 1.00 30.90  ? 291 TYR V CZ  1 
ATOM   10565 O OH  . TYR D 1 290 ? 71.417  63.421  -27.961 1.00 30.90  ? 291 TYR V OH  1 
ATOM   10566 N N   . TYR D 1 291 ? 64.271  60.303  -24.446 1.00 77.31  ? 292 TYR V N   1 
ATOM   10567 C CA  . TYR D 1 291 ? 63.116  59.530  -24.003 1.00 77.31  ? 292 TYR V CA  1 
ATOM   10568 C C   . TYR D 1 291 ? 61.893  60.446  -24.043 1.00 77.31  ? 292 TYR V C   1 
ATOM   10569 O O   . TYR D 1 291 ? 60.880  60.118  -24.653 1.00 90.60  ? 292 TYR V O   1 
ATOM   10570 C CB  . TYR D 1 291 ? 63.299  59.007  -22.569 1.00 90.60  ? 292 TYR V CB  1 
ATOM   10571 C CG  . TYR D 1 291 ? 64.358  57.921  -22.392 1.00 90.60  ? 292 TYR V CG  1 
ATOM   10572 C CD1 . TYR D 1 291 ? 65.440  57.830  -23.276 1.00 90.60  ? 292 TYR V CD1 1 
ATOM   10573 C CD2 . TYR D 1 291 ? 64.244  57.015  -21.328 1.00 90.60  ? 292 TYR V CD2 1 
ATOM   10574 C CE1 . TYR D 1 291 ? 66.412  56.839  -23.090 1.00 90.60  ? 292 TYR V CE1 1 
ATOM   10575 C CE2 . TYR D 1 291 ? 65.218  56.027  -21.141 1.00 90.60  ? 292 TYR V CE2 1 
ATOM   10576 C CZ  . TYR D 1 291 ? 66.303  55.940  -22.021 1.00 90.60  ? 292 TYR V CZ  1 
ATOM   10577 O OH  . TYR D 1 291 ? 67.254  54.984  -21.836 1.00 90.60  ? 292 TYR V OH  1 
ATOM   10578 N N   . LEU D 1 292 ? 62.009  61.611  -23.410 1.00 2.00   ? 293 LEU V N   1 
ATOM   10579 C CA  . LEU D 1 292 ? 60.908  62.557  -23.353 1.00 2.00   ? 293 LEU V CA  1 
ATOM   10580 C C   . LEU D 1 292 ? 60.464  63.090  -24.683 1.00 2.00   ? 293 LEU V C   1 
ATOM   10581 O O   . LEU D 1 292 ? 59.274  63.064  -24.989 1.00 23.27  ? 293 LEU V O   1 
ATOM   10582 C CB  . LEU D 1 292 ? 61.248  63.733  -22.456 1.00 23.27  ? 293 LEU V CB  1 
ATOM   10583 C CG  . LEU D 1 292 ? 60.044  64.634  -22.133 1.00 23.27  ? 293 LEU V CG  1 
ATOM   10584 C CD1 . LEU D 1 292 ? 58.758  63.807  -22.010 1.00 23.27  ? 293 LEU V CD1 1 
ATOM   10585 C CD2 . LEU D 1 292 ? 60.320  65.395  -20.839 1.00 23.27  ? 293 LEU V CD2 1 
ATOM   10586 N N   . ILE D 1 293 ? 61.404  63.599  -25.467 1.00 13.44  ? 294 ILE V N   1 
ATOM   10587 C CA  . ILE D 1 293 ? 61.044  64.116  -26.784 1.00 13.44  ? 294 ILE V CA  1 
ATOM   10588 C C   . ILE D 1 293 ? 60.281  63.075  -27.597 1.00 13.44  ? 294 ILE V C   1 
ATOM   10589 O O   . ILE D 1 293 ? 59.618  63.415  -28.573 1.00 82.08  ? 294 ILE V O   1 
ATOM   10590 C CB  . ILE D 1 293 ? 62.274  64.522  -27.621 1.00 82.08  ? 294 ILE V CB  1 
ATOM   10591 C CG1 . ILE D 1 293 ? 63.157  65.488  -26.832 1.00 82.08  ? 294 ILE V CG1 1 
ATOM   10592 C CG2 . ILE D 1 293 ? 61.820  65.195  -28.912 1.00 82.08  ? 294 ILE V CG2 1 
ATOM   10593 C CD1 . ILE D 1 293 ? 64.371  65.984  -27.611 1.00 82.08  ? 294 ILE V CD1 1 
ATOM   10594 N N   . ALA D 1 294 ? 60.363  61.807  -27.188 1.00 66.81  ? 295 ALA V N   1 
ATOM   10595 C CA  . ALA D 1 294 ? 59.685  60.736  -27.913 1.00 66.81  ? 295 ALA V CA  1 
ATOM   10596 C C   . ALA D 1 294 ? 58.573  60.039  -27.144 1.00 66.81  ? 295 ALA V C   1 
ATOM   10597 O O   . ALA D 1 294 ? 57.463  59.902  -27.637 1.00 30.30  ? 295 ALA V O   1 
ATOM   10598 C CB  . ALA D 1 294 ? 60.692  59.717  -28.367 1.00 30.30  ? 295 ALA V CB  1 
ATOM   10599 N N   . GLY D 1 295 ? 58.877  59.593  -25.935 1.00 8.68   ? 296 GLY V N   1 
ATOM   10600 C CA  . GLY D 1 295 ? 57.889  58.890  -25.133 1.00 8.68   ? 296 GLY V CA  1 
ATOM   10601 C C   . GLY D 1 295 ? 56.793  59.795  -24.646 1.00 8.68   ? 296 GLY V C   1 
ATOM   10602 O O   . GLY D 1 295 ? 55.850  59.362  -23.981 1.00 11.46  ? 296 GLY V O   1 
ATOM   10603 N N   . ALA D 1 296 ? 56.928  61.067  -24.979 1.00 81.84  ? 297 ALA V N   1 
ATOM   10604 C CA  . ALA D 1 296 ? 55.949  62.057  -24.590 1.00 81.84  ? 297 ALA V CA  1 
ATOM   10605 C C   . ALA D 1 296 ? 54.577  61.737  -25.188 1.00 81.84  ? 297 ALA V C   1 
ATOM   10606 O O   . ALA D 1 296 ? 54.449  61.435  -26.386 1.00 38.68  ? 297 ALA V O   1 
ATOM   10607 C CB  . ALA D 1 296 ? 56.415  63.437  -25.040 1.00 38.68  ? 297 ALA V CB  1 
ATOM   10608 N N   . SER D 1 297 ? 53.555  61.796  -24.339 1.00 79.37  ? 298 SER V N   1 
ATOM   10609 C CA  . SER D 1 297 ? 52.190  61.537  -24.770 1.00 79.37  ? 298 SER V CA  1 
ATOM   10610 C C   . SER D 1 297 ? 51.694  62.740  -25.574 1.00 79.37  ? 298 SER V C   1 
ATOM   10611 O O   . SER D 1 297 ? 52.047  63.877  -25.273 1.00 61.06  ? 298 SER V O   1 
ATOM   10612 C CB  . SER D 1 297 ? 51.286  61.321  -23.552 1.00 61.06  ? 298 SER V CB  1 
ATOM   10613 O OG  . SER D 1 297 ? 50.285  62.324  -23.468 1.00 61.06  ? 298 SER V OG  1 
ATOM   10614 N N   . GLU D 1 298 ? 50.884  62.485  -26.597 1.00 100.00 ? 299 GLU V N   1 
ATOM   10615 C CA  . GLU D 1 298 ? 50.344  63.559  -27.429 1.00 100.00 ? 299 GLU V CA  1 
ATOM   10616 C C   . GLU D 1 298 ? 49.939  64.751  -26.562 1.00 100.00 ? 299 GLU V C   1 
ATOM   10617 O O   . GLU D 1 298 ? 50.419  65.871  -26.747 1.00 100.00 ? 299 GLU V O   1 
ATOM   10618 C CB  . GLU D 1 298 ? 49.126  63.055  -28.217 1.00 100.00 ? 299 GLU V CB  1 
ATOM   10619 C CG  . GLU D 1 298 ? 48.917  63.744  -29.561 1.00 100.00 ? 299 GLU V CG  1 
ATOM   10620 C CD  . GLU D 1 298 ? 49.074  65.255  -29.473 1.00 100.00 ? 299 GLU V CD  1 
ATOM   10621 O OE1 . GLU D 1 298 ? 50.236  65.731  -29.463 1.00 100.00 ? 299 GLU V OE1 1 
ATOM   10622 O OE2 . GLU D 1 298 ? 48.035  65.962  -29.410 1.00 100.00 ? 299 GLU V OE2 1 
ATOM   10623 N N   . GLN D 1 299 ? 49.048  64.501  -25.609 1.00 66.99  ? 300 GLN V N   1 
ATOM   10624 C CA  . GLN D 1 299 ? 48.582  65.546  -24.719 1.00 66.99  ? 300 GLN V CA  1 
ATOM   10625 C C   . GLN D 1 299 ? 49.760  66.218  -24.020 1.00 66.99  ? 300 GLN V C   1 
ATOM   10626 O O   . GLN D 1 299 ? 50.138  67.338  -24.362 1.00 100.00 ? 300 GLN V O   1 
ATOM   10627 C CB  . GLN D 1 299 ? 47.622  64.951  -23.691 1.00 100.00 ? 300 GLN V CB  1 
ATOM   10628 C CG  . GLN D 1 299 ? 46.485  65.878  -23.309 1.00 100.00 ? 300 GLN V CG  1 
ATOM   10629 C CD  . GLN D 1 299 ? 46.594  66.354  -21.871 1.00 100.00 ? 300 GLN V CD  1 
ATOM   10630 O OE1 . GLN D 1 299 ? 47.575  66.056  -21.181 1.00 100.00 ? 300 GLN V OE1 1 
ATOM   10631 N NE2 . GLN D 1 299 ? 45.589  67.099  -21.410 1.00 100.00 ? 300 GLN V NE2 1 
ATOM   10632 N N   . MET D 1 300 ? 50.343  65.531  -23.044 1.00 46.02  ? 301 MET V N   1 
ATOM   10633 C CA  . MET D 1 300 ? 51.479  66.069  -22.310 1.00 46.02  ? 301 MET V CA  1 
ATOM   10634 C C   . MET D 1 300 ? 52.550  66.563  -23.276 1.00 46.02  ? 301 MET V C   1 
ATOM   10635 O O   . MET D 1 300 ? 53.439  67.328  -22.891 1.00 94.33  ? 301 MET V O   1 
ATOM   10636 C CB  . MET D 1 300 ? 52.075  64.998  -21.392 1.00 94.33  ? 301 MET V CB  1 
ATOM   10637 C CG  . MET D 1 300 ? 53.038  64.042  -22.094 1.00 94.33  ? 301 MET V CG  1 
ATOM   10638 S SD  . MET D 1 300 ? 54.422  63.499  -21.068 1.00 94.33  ? 301 MET V SD  1 
ATOM   10639 C CE  . MET D 1 300 ? 55.696  64.631  -21.571 1.00 94.33  ? 301 MET V CE  1 
ATOM   10640 N N   . ARG D 1 301 ? 52.457  66.126  -24.530 1.00 2.00   ? 302 ARG V N   1 
ATOM   10641 C CA  . ARG D 1 301 ? 53.425  66.527  -25.535 1.00 2.00   ? 302 ARG V CA  1 
ATOM   10642 C C   . ARG D 1 301 ? 53.496  68.043  -25.523 1.00 2.00   ? 302 ARG V C   1 
ATOM   10643 O O   . ARG D 1 301 ? 54.545  68.635  -25.250 1.00 100.00 ? 302 ARG V O   1 
ATOM   10644 C CB  . ARG D 1 301 ? 53.014  66.017  -26.925 1.00 100.00 ? 302 ARG V CB  1 
ATOM   10645 C CG  . ARG D 1 301 ? 54.158  65.780  -27.905 1.00 100.00 ? 302 ARG V CG  1 
ATOM   10646 C CD  . ARG D 1 301 ? 54.249  66.919  -28.917 1.00 100.00 ? 302 ARG V CD  1 
ATOM   10647 N NE  . ARG D 1 301 ? 54.774  68.148  -28.315 1.00 100.00 ? 302 ARG V NE  1 
ATOM   10648 C CZ  . ARG D 1 301 ? 54.142  69.321  -28.302 1.00 100.00 ? 302 ARG V CZ  1 
ATOM   10649 N NH1 . ARG D 1 301 ? 52.943  69.448  -28.863 1.00 100.00 ? 302 ARG V NH1 1 
ATOM   10650 N NH2 . ARG D 1 301 ? 54.708  70.373  -27.716 1.00 100.00 ? 302 ARG V NH2 1 
ATOM   10651 N N   . ASN D 1 302 ? 52.368  68.677  -25.808 1.00 90.43  ? 303 ASN V N   1 
ATOM   10652 C CA  . ASN D 1 302 ? 52.311  70.129  -25.824 1.00 90.43  ? 303 ASN V CA  1 
ATOM   10653 C C   . ASN D 1 302 ? 52.454  70.683  -24.414 1.00 90.43  ? 303 ASN V C   1 
ATOM   10654 O O   . ASN D 1 302 ? 53.136  71.688  -24.204 1.00 100.00 ? 303 ASN V O   1 
ATOM   10655 C CB  . ASN D 1 302 ? 50.992  70.606  -26.442 1.00 100.00 ? 303 ASN V CB  1 
ATOM   10656 C CG  . ASN D 1 302 ? 49.799  69.782  -25.987 1.00 100.00 ? 303 ASN V CG  1 
ATOM   10657 O OD1 . ASN D 1 302 ? 49.329  69.918  -24.854 1.00 100.00 ? 303 ASN V OD1 1 
ATOM   10658 N ND2 . ASN D 1 302 ? 49.302  68.919  -26.872 1.00 100.00 ? 303 ASN V ND2 1 
ATOM   10659 N N   . ASP D 1 303 ? 51.820  70.014  -23.453 1.00 24.42  ? 304 ASP V N   1 
ATOM   10660 C CA  . ASP D 1 303 ? 51.852  70.435  -22.054 1.00 24.42  ? 304 ASP V CA  1 
ATOM   10661 C C   . ASP D 1 303 ? 53.208  70.931  -21.548 1.00 24.42  ? 304 ASP V C   1 
ATOM   10662 O O   . ASP D 1 303 ? 53.274  71.677  -20.567 1.00 100.00 ? 304 ASP V O   1 
ATOM   10663 C CB  . ASP D 1 303 ? 51.367  69.297  -21.163 1.00 100.00 ? 304 ASP V CB  1 
ATOM   10664 C CG  . ASP D 1 303 ? 49.862  69.218  -21.098 1.00 100.00 ? 304 ASP V CG  1 
ATOM   10665 O OD1 . ASP D 1 303 ? 49.207  69.648  -22.073 1.00 100.00 ? 304 ASP V OD1 1 
ATOM   10666 O OD2 . ASP D 1 303 ? 49.339  68.733  -20.075 1.00 100.00 ? 304 ASP V OD2 1 
ATOM   10667 N N   . LEU D 1 304 ? 54.287  70.514  -22.203 1.00 66.14  ? 305 LEU V N   1 
ATOM   10668 C CA  . LEU D 1 304 ? 55.620  70.948  -21.807 1.00 66.14  ? 305 LEU V CA  1 
ATOM   10669 C C   . LEU D 1 304 ? 56.300  71.600  -22.995 1.00 66.14  ? 305 LEU V C   1 
ATOM   10670 O O   . LEU D 1 304 ? 57.502  71.862  -22.970 1.00 59.66  ? 305 LEU V O   1 
ATOM   10671 C CB  . LEU D 1 304 ? 56.449  69.756  -21.335 1.00 59.66  ? 305 LEU V CB  1 
ATOM   10672 C CG  . LEU D 1 304 ? 55.719  68.609  -20.638 1.00 59.66  ? 305 LEU V CG  1 
ATOM   10673 C CD1 . LEU D 1 304 ? 56.732  67.539  -20.249 1.00 59.66  ? 305 LEU V CD1 1 
ATOM   10674 C CD2 . LEU D 1 304 ? 54.992  69.131  -19.408 1.00 59.66  ? 305 LEU V CD2 1 
ATOM   10675 N N   . LEU D 1 305 ? 55.516  71.856  -24.037 1.00 95.83  ? 306 LEU V N   1 
ATOM   10676 C CA  . LEU D 1 305 ? 56.011  72.475  -25.264 1.00 95.83  ? 306 LEU V CA  1 
ATOM   10677 C C   . LEU D 1 305 ? 57.183  71.651  -25.769 1.00 95.83  ? 306 LEU V C   1 
ATOM   10678 O O   . LEU D 1 305 ? 58.318  72.127  -25.889 1.00 72.49  ? 306 LEU V O   1 
ATOM   10679 C CB  . LEU D 1 305 ? 56.433  73.914  -24.985 1.00 72.49  ? 306 LEU V CB  1 
ATOM   10680 C CG  . LEU D 1 305 ? 55.295  74.767  -24.418 1.00 72.49  ? 306 LEU V CG  1 
ATOM   10681 C CD1 . LEU D 1 305 ? 55.772  75.572  -23.214 1.00 72.49  ? 306 LEU V CD1 1 
ATOM   10682 C CD2 . LEU D 1 305 ? 54.782  75.673  -25.513 1.00 72.49  ? 306 LEU V CD2 1 
ATOM   10683 N N   . LEU D 1 306 ? 56.880  70.395  -26.065 1.00 96.11  ? 307 LEU V N   1 
ATOM   10684 C CA  . LEU D 1 306 ? 57.876  69.454  -26.528 1.00 96.11  ? 307 LEU V CA  1 
ATOM   10685 C C   . LEU D 1 306 ? 57.889  69.277  -28.040 1.00 96.11  ? 307 LEU V C   1 
ATOM   10686 O O   . LEU D 1 306 ? 57.411  68.275  -28.569 1.00 100.00 ? 307 LEU V O   1 
ATOM   10687 C CB  . LEU D 1 306 ? 57.654  68.106  -25.835 1.00 100.00 ? 307 LEU V CB  1 
ATOM   10688 C CG  . LEU D 1 306 ? 57.577  68.194  -24.306 1.00 100.00 ? 307 LEU V CG  1 
ATOM   10689 C CD1 . LEU D 1 306 ? 56.484  67.284  -23.765 1.00 100.00 ? 307 LEU V CD1 1 
ATOM   10690 C CD2 . LEU D 1 306 ? 58.923  67.813  -23.724 1.00 100.00 ? 307 LEU V CD2 1 
ATOM   10691 N N   . GLU D 1 307 ? 58.435  70.266  -28.734 1.00 45.31  ? 308 GLU V N   1 
ATOM   10692 C CA  . GLU D 1 307 ? 58.547  70.207  -30.183 1.00 45.31  ? 308 GLU V CA  1 
ATOM   10693 C C   . GLU D 1 307 ? 59.400  68.985  -30.508 1.00 45.31  ? 308 GLU V C   1 
ATOM   10694 O O   . GLU D 1 307 ? 60.110  68.471  -29.641 1.00 100.00 ? 308 GLU V O   1 
ATOM   10695 C CB  . GLU D 1 307 ? 59.221  71.479  -30.698 1.00 100.00 ? 308 GLU V CB  1 
ATOM   10696 C CG  . GLU D 1 307 ? 59.140  72.654  -29.714 1.00 100.00 ? 308 GLU V CG  1 
ATOM   10697 C CD  . GLU D 1 307 ? 59.933  73.870  -30.173 1.00 100.00 ? 308 GLU V CD  1 
ATOM   10698 O OE1 . GLU D 1 307 ? 60.878  73.698  -30.975 1.00 100.00 ? 308 GLU V OE1 1 
ATOM   10699 O OE2 . GLU D 1 307 ? 59.614  74.997  -29.733 1.00 100.00 ? 308 GLU V OE2 1 
ATOM   10700 N N   . GLY D 1 308 ? 59.326  68.513  -31.747 1.00 93.97  ? 309 GLY V N   1 
ATOM   10701 C CA  . GLY D 1 308 ? 60.094  67.343  -32.135 1.00 93.97  ? 309 GLY V CA  1 
ATOM   10702 C C   . GLY D 1 308 ? 61.601  67.489  -32.005 1.00 93.97  ? 309 GLY V C   1 
ATOM   10703 O O   . GLY D 1 308 ? 62.104  68.474  -31.465 1.00 5.43   ? 309 GLY V O   1 
ATOM   10704 N N   . PHE D 1 309 ? 62.330  66.500  -32.508 1.00 55.58  ? 310 PHE V N   1 
ATOM   10705 C CA  . PHE D 1 309 ? 63.784  66.534  -32.445 1.00 55.58  ? 310 PHE V CA  1 
ATOM   10706 C C   . PHE D 1 309 ? 64.320  67.557  -33.444 1.00 55.58  ? 310 PHE V C   1 
ATOM   10707 O O   . PHE D 1 309 ? 63.671  67.861  -34.447 1.00 98.39  ? 310 PHE V O   1 
ATOM   10708 C CB  . PHE D 1 309 ? 64.362  65.146  -32.757 1.00 98.39  ? 310 PHE V CB  1 
ATOM   10709 C CG  . PHE D 1 309 ? 64.247  64.168  -31.623 1.00 98.39  ? 310 PHE V CG  1 
ATOM   10710 C CD1 . PHE D 1 309 ? 63.072  63.459  -31.418 1.00 98.39  ? 310 PHE V CD1 1 
ATOM   10711 C CD2 . PHE D 1 309 ? 65.313  63.956  -30.758 1.00 98.39  ? 310 PHE V CD2 1 
ATOM   10712 C CE1 . PHE D 1 309 ? 62.956  62.551  -30.367 1.00 98.39  ? 310 PHE V CE1 1 
ATOM   10713 C CE2 . PHE D 1 309 ? 65.205  63.052  -29.706 1.00 98.39  ? 310 PHE V CE2 1 
ATOM   10714 C CZ  . PHE D 1 309 ? 64.024  62.349  -29.510 1.00 98.39  ? 310 PHE V CZ  1 
ATOM   10715 N N   . ASN D 1 310 ? 65.501  68.084  -33.159 1.00 88.43  ? 311 ASN V N   1 
ATOM   10716 C CA  . ASN D 1 310 ? 66.133  69.069  -34.029 1.00 88.43  ? 311 ASN V CA  1 
ATOM   10717 C C   . ASN D 1 310 ? 65.409  70.407  -34.031 1.00 88.43  ? 311 ASN V C   1 
ATOM   10718 O O   . ASN D 1 310 ? 65.624  71.251  -34.905 1.00 100.00 ? 311 ASN V O   1 
ATOM   10719 C CB  . ASN D 1 310 ? 66.236  68.516  -35.450 1.00 100.00 ? 311 ASN V CB  1 
ATOM   10720 C CG  . ASN D 1 310 ? 67.286  67.436  -35.568 1.00 100.00 ? 311 ASN V CG  1 
ATOM   10721 O OD1 . ASN D 1 310 ? 68.090  67.430  -36.506 1.00 100.00 ? 311 ASN V OD1 1 
ATOM   10722 N ND2 . ASN D 1 310 ? 67.294  66.512  -34.607 1.00 100.00 ? 311 ASN V ND2 1 
ATOM   10723 N N   . ASN D 1 311 ? 64.537  70.586  -33.046 1.00 100.00 ? 312 ASN V N   1 
ATOM   10724 C CA  . ASN D 1 311 ? 63.799  71.830  -32.884 1.00 100.00 ? 312 ASN V CA  1 
ATOM   10725 C C   . ASN D 1 311 ? 64.442  72.484  -31.666 1.00 100.00 ? 312 ASN V C   1 
ATOM   10726 O O   . ASN D 1 311 ? 64.131  73.621  -31.308 1.00 100.00 ? 312 ASN V O   1 
ATOM   10727 C CB  . ASN D 1 311 ? 62.317  71.543  -32.620 1.00 100.00 ? 312 ASN V CB  1 
ATOM   10728 C CG  . ASN D 1 311 ? 61.606  70.971  -33.836 1.00 100.00 ? 312 ASN V CG  1 
ATOM   10729 O OD1 . ASN D 1 311 ? 60.399  71.148  -34.006 1.00 100.00 ? 312 ASN V OD1 1 
ATOM   10730 N ND2 . ASN D 1 311 ? 62.354  70.282  -34.689 1.00 100.00 ? 312 ASN V ND2 1 
ATOM   10731 N N   . TYR D 1 312 ? 65.352  71.733  -31.043 1.00 48.59  ? 313 TYR V N   1 
ATOM   10732 C CA  . TYR D 1 312 ? 66.093  72.164  -29.858 1.00 48.59  ? 313 TYR V CA  1 
ATOM   10733 C C   . TYR D 1 312 ? 67.579  72.205  -30.200 1.00 48.59  ? 313 TYR V C   1 
ATOM   10734 O O   . TYR D 1 312 ? 68.089  71.336  -30.911 1.00 9.24   ? 313 TYR V O   1 
ATOM   10735 C CB  . TYR D 1 312 ? 65.840  71.193  -28.704 1.00 9.24   ? 313 TYR V CB  1 
ATOM   10736 C CG  . TYR D 1 312 ? 64.374  71.024  -28.364 1.00 9.24   ? 313 TYR V CG  1 
ATOM   10737 C CD1 . TYR D 1 312 ? 63.456  70.589  -29.317 1.00 9.24   ? 313 TYR V CD1 1 
ATOM   10738 C CD2 . TYR D 1 312 ? 63.911  71.315  -27.093 1.00 9.24   ? 313 TYR V CD2 1 
ATOM   10739 C CE1 . TYR D 1 312 ? 62.114  70.453  -29.006 1.00 9.24   ? 313 TYR V CE1 1 
ATOM   10740 C CE2 . TYR D 1 312 ? 62.581  71.185  -26.763 1.00 9.24   ? 313 TYR V CE2 1 
ATOM   10741 C CZ  . TYR D 1 312 ? 61.680  70.757  -27.717 1.00 9.24   ? 313 TYR V CZ  1 
ATOM   10742 O OH  . TYR D 1 312 ? 60.345  70.659  -27.366 1.00 9.24   ? 313 TYR V OH  1 
ATOM   10743 N N   . THR D 1 313 ? 68.278  73.210  -29.691 1.00 51.47  ? 314 THR V N   1 
ATOM   10744 C CA  . THR D 1 313 ? 69.694  73.360  -30.007 1.00 51.47  ? 314 THR V CA  1 
ATOM   10745 C C   . THR D 1 313 ? 70.651  72.725  -29.013 1.00 51.47  ? 314 THR V C   1 
ATOM   10746 O O   . THR D 1 313 ? 71.857  72.669  -29.253 1.00 100.00 ? 314 THR V O   1 
ATOM   10747 C CB  . THR D 1 313 ? 70.074  74.850  -30.173 1.00 100.00 ? 314 THR V CB  1 
ATOM   10748 O OG1 . THR D 1 313 ? 68.887  75.632  -30.357 1.00 100.00 ? 314 THR V OG1 1 
ATOM   10749 C CG2 . THR D 1 313 ? 70.987  75.034  -31.382 1.00 100.00 ? 314 THR V CG2 1 
ATOM   10750 N N   . PHE D 1 314 ? 70.121  72.244  -27.898 1.00 71.00  ? 315 PHE V N   1 
ATOM   10751 C CA  . PHE D 1 314 ? 70.965  71.605  -26.900 1.00 71.00  ? 315 PHE V CA  1 
ATOM   10752 C C   . PHE D 1 314 ? 71.330  70.187  -27.330 1.00 71.00  ? 315 PHE V C   1 
ATOM   10753 O O   . PHE D 1 314 ? 72.162  69.538  -26.702 1.00 73.39  ? 315 PHE V O   1 
ATOM   10754 C CB  . PHE D 1 314 ? 70.245  71.565  -25.555 1.00 73.39  ? 315 PHE V CB  1 
ATOM   10755 C CG  . PHE D 1 314 ? 70.425  72.808  -24.739 1.00 73.39  ? 315 PHE V CG  1 
ATOM   10756 C CD1 . PHE D 1 314 ? 71.643  73.479  -24.736 1.00 73.39  ? 315 PHE V CD1 1 
ATOM   10757 C CD2 . PHE D 1 314 ? 69.376  73.305  -23.968 1.00 73.39  ? 315 PHE V CD2 1 
ATOM   10758 C CE1 . PHE D 1 314 ? 71.818  74.620  -23.977 1.00 73.39  ? 315 PHE V CE1 1 
ATOM   10759 C CE2 . PHE D 1 314 ? 69.541  74.453  -23.202 1.00 73.39  ? 315 PHE V CE2 1 
ATOM   10760 C CZ  . PHE D 1 314 ? 70.765  75.110  -23.207 1.00 73.39  ? 315 PHE V CZ  1 
ATOM   10761 N N   . LEU D 1 315 ? 70.704  69.719  -28.406 1.00 5.49   ? 316 LEU V N   1 
ATOM   10762 C CA  . LEU D 1 315 ? 70.950  68.389  -28.928 1.00 5.49   ? 316 LEU V CA  1 
ATOM   10763 C C   . LEU D 1 315 ? 71.829  68.436  -30.167 1.00 5.49   ? 316 LEU V C   1 
ATOM   10764 O O   . LEU D 1 315 ? 71.338  68.498  -31.287 1.00 32.71  ? 316 LEU V O   1 
ATOM   10765 C CB  . LEU D 1 315 ? 69.620  67.697  -29.244 1.00 32.71  ? 316 LEU V CB  1 
ATOM   10766 C CG  . LEU D 1 315 ? 68.471  68.120  -28.316 1.00 32.71  ? 316 LEU V CG  1 
ATOM   10767 C CD1 . LEU D 1 315 ? 67.218  68.350  -29.136 1.00 32.71  ? 316 LEU V CD1 1 
ATOM   10768 C CD2 . LEU D 1 315 ? 68.230  67.059  -27.263 1.00 32.71  ? 316 LEU V CD2 1 
ATOM   10769 N N   . SER D 1 316 ? 73.141  68.426  -29.945 1.00 32.25  ? 317 SER V N   1 
ATOM   10770 C CA  . SER D 1 316 ? 74.121  68.425  -31.023 1.00 32.25  ? 317 SER V CA  1 
ATOM   10771 C C   . SER D 1 316 ? 73.957  67.094  -31.741 1.00 32.25  ? 317 SER V C   1 
ATOM   10772 O O   . SER D 1 316 ? 73.467  66.119  -31.159 1.00 84.78  ? 317 SER V O   1 
ATOM   10773 C CB  . SER D 1 316 ? 75.533  68.530  -30.451 1.00 84.78  ? 317 SER V CB  1 
ATOM   10774 O OG  . SER D 1 316 ? 75.525  68.399  -29.041 1.00 84.78  ? 317 SER V OG  1 
ATOM   10775 N N   . ASN D 1 317 ? 74.380  67.041  -32.998 1.00 44.98  ? 318 ASN V N   1 
ATOM   10776 C CA  . ASN D 1 317 ? 74.240  65.815  -33.781 1.00 44.98  ? 318 ASN V CA  1 
ATOM   10777 C C   . ASN D 1 317 ? 72.749  65.470  -33.856 1.00 44.98  ? 318 ASN V C   1 
ATOM   10778 O O   . ASN D 1 317 ? 72.380  64.302  -33.954 1.00 61.22  ? 318 ASN V O   1 
ATOM   10779 C CB  . ASN D 1 317 ? 74.978  64.618  -33.136 1.00 61.22  ? 318 ASN V CB  1 
ATOM   10780 C CG  . ASN D 1 317 ? 76.353  64.971  -32.598 1.00 61.22  ? 318 ASN V CG  1 
ATOM   10781 O OD1 . ASN D 1 317 ? 77.336  65.026  -33.347 1.00 61.22  ? 318 ASN V OD1 1 
ATOM   10782 N ND2 . ASN D 1 317 ? 76.435  65.191  -31.287 1.00 61.22  ? 318 ASN V ND2 1 
ATOM   10783 N N   . GLY D 1 318 ? 71.894  66.486  -33.797 1.00 100.00 ? 319 GLY V N   1 
ATOM   10784 C CA  . GLY D 1 318 ? 70.464  66.234  -33.852 1.00 100.00 ? 319 GLY V CA  1 
ATOM   10785 C C   . GLY D 1 318 ? 70.056  65.009  -33.050 1.00 100.00 ? 319 GLY V C   1 
ATOM   10786 O O   . GLY D 1 318 ? 70.572  64.790  -31.954 1.00 2.00   ? 319 GLY V O   1 
ATOM   10787 N N   . HIS D 1 319 ? 69.135  64.214  -33.590 1.00 50.80  ? 320 HIS V N   1 
ATOM   10788 C CA  . HIS D 1 319 ? 68.690  63.004  -32.910 1.00 50.80  ? 320 HIS V CA  1 
ATOM   10789 C C   . HIS D 1 319 ? 69.492  61.788  -33.361 1.00 50.80  ? 320 HIS V C   1 
ATOM   10790 O O   . HIS D 1 319 ? 69.305  61.292  -34.474 1.00 52.46  ? 320 HIS V O   1 
ATOM   10791 C CB  . HIS D 1 319 ? 67.201  62.751  -33.174 1.00 52.46  ? 320 HIS V CB  1 
ATOM   10792 C CG  . HIS D 1 319 ? 66.767  61.338  -32.905 1.00 52.46  ? 320 HIS V CG  1 
ATOM   10793 N ND1 . HIS D 1 319 ? 67.503  60.239  -33.301 1.00 52.46  ? 320 HIS V ND1 1 
ATOM   10794 C CD2 . HIS D 1 319 ? 65.659  60.846  -32.295 1.00 52.46  ? 320 HIS V CD2 1 
ATOM   10795 C CE1 . HIS D 1 319 ? 66.870  59.136  -32.948 1.00 52.46  ? 320 HIS V CE1 1 
ATOM   10796 N NE2 . HIS D 1 319 ? 65.750  59.475  -32.335 1.00 52.46  ? 320 HIS V NE2 1 
ATOM   10797 N N   . VAL D 1 320 ? 70.381  61.313  -32.492 1.00 24.63  ? 321 VAL V N   1 
ATOM   10798 C CA  . VAL D 1 320 ? 71.188  60.141  -32.783 1.00 24.63  ? 321 VAL V CA  1 
ATOM   10799 C C   . VAL D 1 320 ? 70.505  58.966  -32.096 1.00 24.63  ? 321 VAL V C   1 
ATOM   10800 O O   . VAL D 1 320 ? 69.969  59.103  -30.994 1.00 30.66  ? 321 VAL V O   1 
ATOM   10801 C CB  . VAL D 1 320 ? 72.612  60.296  -32.246 1.00 30.66  ? 321 VAL V CB  1 
ATOM   10802 C CG1 . VAL D 1 320 ? 73.211  58.930  -31.932 1.00 30.66  ? 321 VAL V CG1 1 
ATOM   10803 C CG2 . VAL D 1 320 ? 73.458  61.007  -33.264 1.00 30.66  ? 321 VAL V CG2 1 
ATOM   10804 N N   . PRO D 1 321 ? 70.525  57.795  -32.735 1.00 32.62  ? 322 PRO V N   1 
ATOM   10805 C CA  . PRO D 1 321 ? 69.900  56.600  -32.189 1.00 32.62  ? 322 PRO V CA  1 
ATOM   10806 C C   . PRO D 1 321 ? 70.892  55.702  -31.456 1.00 32.62  ? 322 PRO V C   1 
ATOM   10807 O O   . PRO D 1 321 ? 72.105  55.745  -31.697 1.00 37.34  ? 322 PRO V O   1 
ATOM   10808 C CB  . PRO D 1 321 ? 69.345  55.929  -33.425 1.00 37.34  ? 322 PRO V CB  1 
ATOM   10809 C CG  . PRO D 1 321 ? 70.434  56.213  -34.455 1.00 37.34  ? 322 PRO V CG  1 
ATOM   10810 C CD  . PRO D 1 321 ? 71.133  57.499  -34.040 1.00 37.34  ? 322 PRO V CD  1 
ATOM   10811 N N   . ILE D 1 322 ? 70.349  54.870  -30.575 1.00 51.54  ? 323 ILE V N   1 
ATOM   10812 C CA  . ILE D 1 322 ? 71.141  53.942  -29.789 1.00 51.54  ? 323 ILE V CA  1 
ATOM   10813 C C   . ILE D 1 322 ? 70.839  52.493  -30.188 1.00 51.54  ? 323 ILE V C   1 
ATOM   10814 O O   . ILE D 1 322 ? 69.689  52.042  -30.144 1.00 75.05  ? 323 ILE V O   1 
ATOM   10815 C CB  . ILE D 1 322 ? 70.852  54.142  -28.297 1.00 75.05  ? 323 ILE V CB  1 
ATOM   10816 C CG1 . ILE D 1 322 ? 71.769  53.244  -27.475 1.00 75.05  ? 323 ILE V CG1 1 
ATOM   10817 C CG2 . ILE D 1 322 ? 69.375  53.891  -28.006 1.00 75.05  ? 323 ILE V CG2 1 
ATOM   10818 C CD1 . ILE D 1 322 ? 72.508  53.997  -26.404 1.00 75.05  ? 323 ILE V CD1 1 
ATOM   10819 N N   . PRO D 1 323 ? 71.877  51.748  -30.588 1.00 37.51  ? 324 PRO V N   1 
ATOM   10820 C CA  . PRO D 1 323 ? 71.737  50.346  -31.000 1.00 37.51  ? 324 PRO V CA  1 
ATOM   10821 C C   . PRO D 1 323 ? 71.081  49.440  -29.974 1.00 37.51  ? 324 PRO V C   1 
ATOM   10822 O O   . PRO D 1 323 ? 71.383  49.508  -28.783 1.00 93.43  ? 324 PRO V O   1 
ATOM   10823 C CB  . PRO D 1 323 ? 73.171  49.909  -31.305 1.00 93.43  ? 324 PRO V CB  1 
ATOM   10824 C CG  . PRO D 1 323 ? 74.045  50.932  -30.656 1.00 93.43  ? 324 PRO V CG  1 
ATOM   10825 C CD  . PRO D 1 323 ? 73.269  52.212  -30.675 1.00 93.43  ? 324 PRO V CD  1 
ATOM   10826 N N   . ALA D 1 324 ? 70.174  48.597  -30.455 1.00 12.14  ? 325 ALA V N   1 
ATOM   10827 C CA  . ALA D 1 324 ? 69.464  47.634  -29.611 1.00 12.14  ? 325 ALA V CA  1 
ATOM   10828 C C   . ALA D 1 324 ? 68.562  48.236  -28.544 1.00 12.14  ? 325 ALA V C   1 
ATOM   10829 O O   . ALA D 1 324 ? 67.942  47.512  -27.759 1.00 64.90  ? 325 ALA V O   1 
ATOM   10830 C CB  . ALA D 1 324 ? 70.470  46.703  -28.951 1.00 64.90  ? 325 ALA V CB  1 
ATOM   10831 N N   . GLN D 1 325 ? 68.494  49.561  -28.511 1.00 91.05  ? 326 GLN V N   1 
ATOM   10832 C CA  . GLN D 1 325 ? 67.674  50.239  -27.525 1.00 91.05  ? 326 GLN V CA  1 
ATOM   10833 C C   . GLN D 1 325 ? 66.637  51.126  -28.203 1.00 91.05  ? 326 GLN V C   1 
ATOM   10834 O O   . GLN D 1 325 ? 66.952  51.859  -29.136 1.00 99.96  ? 326 GLN V O   1 
ATOM   10835 C CB  . GLN D 1 325 ? 68.566  51.072  -26.603 1.00 99.96  ? 326 GLN V CB  1 
ATOM   10836 C CG  . GLN D 1 325 ? 67.929  51.456  -25.281 1.00 99.96  ? 326 GLN V CG  1 
ATOM   10837 C CD  . GLN D 1 325 ? 68.633  52.630  -24.622 1.00 99.96  ? 326 GLN V CD  1 
ATOM   10838 O OE1 . GLN D 1 325 ? 69.597  52.453  -23.867 1.00 99.96  ? 326 GLN V OE1 1 
ATOM   10839 N NE2 . GLN D 1 325 ? 68.151  53.841  -24.901 1.00 99.96  ? 326 GLN V NE2 1 
ATOM   10840 N N   . GLN D 1 326 ? 65.394  51.037  -27.739 1.00 100.00 ? 327 GLN V N   1 
ATOM   10841 C CA  . GLN D 1 326 ? 64.313  51.840  -28.296 1.00 100.00 ? 327 GLN V CA  1 
ATOM   10842 C C   . GLN D 1 326 ? 63.847  52.880  -27.277 1.00 100.00 ? 327 GLN V C   1 
ATOM   10843 O O   . GLN D 1 326 ? 63.134  52.564  -26.324 1.00 100.00 ? 327 GLN V O   1 
ATOM   10844 C CB  . GLN D 1 326 ? 63.137  50.947  -28.706 1.00 100.00 ? 327 GLN V CB  1 
ATOM   10845 C CG  . GLN D 1 326 ? 61.965  51.704  -29.327 1.00 100.00 ? 327 GLN V CG  1 
ATOM   10846 C CD  . GLN D 1 326 ? 61.410  51.021  -30.567 1.00 100.00 ? 327 GLN V CD  1 
ATOM   10847 O OE1 . GLN D 1 326 ? 62.163  50.597  -31.450 1.00 100.00 ? 327 GLN V OE1 1 
ATOM   10848 N NE2 . GLN D 1 326 ? 60.084  50.913  -30.639 1.00 100.00 ? 327 GLN V NE2 1 
ATOM   10849 N N   . ASP D 1 327 ? 64.265  54.122  -27.497 1.00 70.97  ? 328 ASP V N   1 
ATOM   10850 C CA  . ASP D 1 327 ? 63.916  55.229  -26.617 1.00 70.97  ? 328 ASP V CA  1 
ATOM   10851 C C   . ASP D 1 327 ? 62.408  55.301  -26.426 1.00 70.97  ? 328 ASP V C   1 
ATOM   10852 O O   . ASP D 1 327 ? 61.922  55.592  -25.332 1.00 72.15  ? 328 ASP V O   1 
ATOM   10853 C CB  . ASP D 1 327 ? 64.445  56.545  -27.202 1.00 72.15  ? 328 ASP V CB  1 
ATOM   10854 C CG  . ASP D 1 327 ? 65.971  56.556  -27.346 1.00 72.15  ? 328 ASP V CG  1 
ATOM   10855 O OD1 . ASP D 1 327 ? 66.661  55.974  -26.478 1.00 72.15  ? 328 ASP V OD1 1 
ATOM   10856 O OD2 . ASP D 1 327 ? 66.483  57.144  -28.324 1.00 72.15  ? 328 ASP V OD2 1 
ATOM   10857 N N   . ASP D 1 328 ? 61.677  55.018  -27.501 1.00 53.62  ? 329 ASP V N   1 
ATOM   10858 C CA  . ASP D 1 328 ? 60.216  55.032  -27.485 1.00 53.62  ? 329 ASP V CA  1 
ATOM   10859 C C   . ASP D 1 328 ? 59.694  54.349  -26.229 1.00 53.62  ? 329 ASP V C   1 
ATOM   10860 O O   . ASP D 1 328 ? 59.003  54.959  -25.414 1.00 100.00 ? 329 ASP V O   1 
ATOM   10861 C CB  . ASP D 1 328 ? 59.651  54.302  -28.715 1.00 100.00 ? 329 ASP V CB  1 
ATOM   10862 C CG  . ASP D 1 328 ? 60.437  54.581  -29.990 1.00 100.00 ? 329 ASP V CG  1 
ATOM   10863 O OD1 . ASP D 1 328 ? 61.660  54.850  -29.925 1.00 100.00 ? 329 ASP V OD1 1 
ATOM   10864 O OD2 . ASP D 1 328 ? 59.824  54.526  -31.072 1.00 100.00 ? 329 ASP V OD2 1 
ATOM   10865 N N   . GLU D 1 329 ? 60.032  53.070  -26.087 1.00 100.00 ? 330 GLU V N   1 
ATOM   10866 C CA  . GLU D 1 329 ? 59.607  52.272  -24.940 1.00 100.00 ? 330 GLU V CA  1 
ATOM   10867 C C   . GLU D 1 329 ? 60.385  52.684  -23.701 1.00 100.00 ? 330 GLU V C   1 
ATOM   10868 O O   . GLU D 1 329 ? 59.822  52.809  -22.610 1.00 91.40  ? 330 GLU V O   1 
ATOM   10869 C CB  . GLU D 1 329 ? 59.838  50.783  -25.223 1.00 91.40  ? 330 GLU V CB  1 
ATOM   10870 C CG  . GLU D 1 329 ? 61.036  50.498  -26.128 1.00 91.40  ? 330 GLU V CG  1 
ATOM   10871 C CD  . GLU D 1 329 ? 61.085  49.061  -26.636 1.00 91.40  ? 330 GLU V CD  1 
ATOM   10872 O OE1 . GLU D 1 329 ? 60.079  48.606  -27.232 1.00 91.40  ? 330 GLU V OE1 1 
ATOM   10873 O OE2 . GLU D 1 329 ? 62.128  48.389  -26.440 1.00 91.40  ? 330 GLU V OE2 1 
ATOM   10874 N N   . MET D 1 330 ? 61.684  52.884  -23.889 1.00 45.65  ? 331 MET V N   1 
ATOM   10875 C CA  . MET D 1 330 ? 62.578  53.289  -22.820 1.00 45.65  ? 331 MET V CA  1 
ATOM   10876 C C   . MET D 1 330 ? 61.853  54.205  -21.863 1.00 45.65  ? 331 MET V C   1 
ATOM   10877 O O   . MET D 1 330 ? 62.002  54.098  -20.652 1.00 32.65  ? 331 MET V O   1 
ATOM   10878 C CB  . MET D 1 330 ? 63.788  54.005  -23.409 1.00 32.65  ? 331 MET V CB  1 
ATOM   10879 C CG  . MET D 1 330 ? 64.958  53.074  -23.625 1.00 32.65  ? 331 MET V CG  1 
ATOM   10880 S SD  . MET D 1 330 ? 65.015  51.834  -22.315 1.00 32.65  ? 331 MET V SD  1 
ATOM   10881 C CE  . MET D 1 330 ? 65.466  50.380  -23.213 1.00 32.65  ? 331 MET V CE  1 
ATOM   10882 N N   . PHE D 1 331 ? 61.052  55.097  -22.427 1.00 31.52  ? 332 PHE V N   1 
ATOM   10883 C CA  . PHE D 1 331 ? 60.278  56.033  -21.633 1.00 31.52  ? 332 PHE V CA  1 
ATOM   10884 C C   . PHE D 1 331 ? 59.484  55.277  -20.572 1.00 31.52  ? 332 PHE V C   1 
ATOM   10885 O O   . PHE D 1 331 ? 59.784  55.349  -19.383 1.00 36.53  ? 332 PHE V O   1 
ATOM   10886 C CB  . PHE D 1 331 ? 59.333  56.809  -22.549 1.00 36.53  ? 332 PHE V CB  1 
ATOM   10887 C CG  . PHE D 1 331 ? 58.862  58.114  -21.978 1.00 36.53  ? 332 PHE V CG  1 
ATOM   10888 C CD1 . PHE D 1 331 ? 59.701  59.219  -21.961 1.00 36.53  ? 332 PHE V CD1 1 
ATOM   10889 C CD2 . PHE D 1 331 ? 57.569  58.240  -21.476 1.00 36.53  ? 332 PHE V CD2 1 
ATOM   10890 C CE1 . PHE D 1 331 ? 59.265  60.430  -21.453 1.00 36.53  ? 332 PHE V CE1 1 
ATOM   10891 C CE2 . PHE D 1 331 ? 57.116  59.446  -20.964 1.00 36.53  ? 332 PHE V CE2 1 
ATOM   10892 C CZ  . PHE D 1 331 ? 57.967  60.548  -20.951 1.00 36.53  ? 332 PHE V CZ  1 
ATOM   10893 N N   . GLN D 1 332 ? 58.478  54.535  -21.016 1.00 28.06  ? 333 GLN V N   1 
ATOM   10894 C CA  . GLN D 1 332 ? 57.629  53.778  -20.107 1.00 28.06  ? 333 GLN V CA  1 
ATOM   10895 C C   . GLN D 1 332 ? 58.429  53.026  -19.060 1.00 28.06  ? 333 GLN V C   1 
ATOM   10896 O O   . GLN D 1 332 ? 58.144  53.114  -17.869 1.00 100.00 ? 333 GLN V O   1 
ATOM   10897 C CB  . GLN D 1 332 ? 56.758  52.794  -20.890 1.00 1