data_1I9D
# 
_entry.id   1I9D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1I9D         
RCSB  RCSB013068   
WWPDB D_1000013068 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1I9D 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Martin, P.'    1 
'Edwards, B.F.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Insights into the structure, solvation, and mechanism of ArsC arsenate reductase, a novel arsenic detoxification enzyme.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1071 
_citation.page_last                 1081 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11709171 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00672-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Martin, P.'     1 
primary 'DeMel, S.'      2 
primary 'Shi, J.'        3 
primary 'Gladysheva, T.' 4 
primary 'Gatti, D.L.'    5 
primary 'Rosen, B.P.'    6 
primary 'Edwards, B.F.'  7 
# 
_cell.entry_id           1I9D 
_cell.length_a           86.726 
_cell.length_b           86.726 
_cell.length_c           116.170 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1I9D 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ARSENATE REDUCTASE' 15849.241 1   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'        96.063    3   ? ? ? ? 
3 non-polymer syn 'SULFITE ION'        80.063    1   ? ? ? ? 
4 non-polymer syn 'CESIUM ION'         132.905   10  ? ? ? ? 
5 water       nat water                18.015    385 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   ILE n 
1 5   THR n 
1 6   ILE n 
1 7   TYR n 
1 8   HIS n 
1 9   ASN n 
1 10  PRO n 
1 11  ALA n 
1 12  CYS n 
1 13  GLY n 
1 14  THR n 
1 15  SER n 
1 16  ARG n 
1 17  ASN n 
1 18  THR n 
1 19  LEU n 
1 20  GLU n 
1 21  MET n 
1 22  ILE n 
1 23  ARG n 
1 24  ASN n 
1 25  SER n 
1 26  GLY n 
1 27  THR n 
1 28  GLU n 
1 29  PRO n 
1 30  THR n 
1 31  ILE n 
1 32  ILE n 
1 33  LEU n 
1 34  TYR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASN n 
1 38  PRO n 
1 39  PRO n 
1 40  SER n 
1 41  ARG n 
1 42  ASP n 
1 43  GLU n 
1 44  LEU n 
1 45  VAL n 
1 46  LYS n 
1 47  LEU n 
1 48  ILE n 
1 49  ALA n 
1 50  ASP n 
1 51  MET n 
1 52  GLY n 
1 53  ILE n 
1 54  SER n 
1 55  VAL n 
1 56  ARG n 
1 57  ALA n 
1 58  LEU n 
1 59  LEU n 
1 60  ARG n 
1 61  LYS n 
1 62  ASN n 
1 63  VAL n 
1 64  GLU n 
1 65  PRO n 
1 66  TYR n 
1 67  GLU n 
1 68  GLN n 
1 69  LEU n 
1 70  GLY n 
1 71  LEU n 
1 72  ALA n 
1 73  GLU n 
1 74  ASP n 
1 75  LYS n 
1 76  PHE n 
1 77  THR n 
1 78  ASP n 
1 79  ASP n 
1 80  GLN n 
1 81  LEU n 
1 82  ILE n 
1 83  ASP n 
1 84  PHE n 
1 85  MET n 
1 86  LEU n 
1 87  GLN n 
1 88  HIS n 
1 89  PRO n 
1 90  ILE n 
1 91  LEU n 
1 92  ILE n 
1 93  ASN n 
1 94  ARG n 
1 95  PRO n 
1 96  ILE n 
1 97  VAL n 
1 98  VAL n 
1 99  THR n 
1 100 PRO n 
1 101 LEU n 
1 102 GLY n 
1 103 THR n 
1 104 ARG n 
1 105 LEU n 
1 106 CYS n 
1 107 ARG n 
1 108 PRO n 
1 109 SER n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 LEU n 
1 114 ASP n 
1 115 ILE n 
1 116 LEU n 
1 117 GLN n 
1 118 ASP n 
1 119 ALA n 
1 120 GLN n 
1 121 LYS n 
1 122 GLY n 
1 123 ALA n 
1 124 PHE n 
1 125 THR n 
1 126 LYS n 
1 127 GLU n 
1 128 ASP n 
1 129 GLY n 
1 130 GLU n 
1 131 LYS n 
1 132 VAL n 
1 133 VAL n 
1 134 ASP n 
1 135 GLU n 
1 136 ALA n 
1 137 GLY n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARSC1_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQ
LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRLK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P08692 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1I9D 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 141 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08692 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  141 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       141 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CS  non-polymer         . 'CESIUM ION'    ? 'Cs 1'           132.905 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO3 non-polymer         . 'SULFITE ION'   ? 'O3 S -2'        80.063  
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1I9D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   69.07 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.pdbx_details    
'50% Saturated48% Cesium Sulfate, 100 mM Acetate, pH 4.8, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-05-17 
_diffrn_detector.details                OSMIC 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Osmic Mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1I9D 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.65 
_reflns.number_obs                   55121 
_reflns.number_all                   55121 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.1370000 
_reflns.pdbx_Rsym_value              0.1370000 
_reflns.pdbx_netI_over_sigmaI        209.1 
_reflns.B_iso_Wilson_estimate        22.7 
_reflns.pdbx_redundancy              24.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.65 
_reflns_shell.d_res_low              1.70 
_reflns_shell.percent_possible_all   87.8 
_reflns_shell.Rmerge_I_obs           0.7000000 
_reflns_shell.pdbx_Rsym_value        0.7000000 
_reflns_shell.meanI_over_sigI_obs    6.2 
_reflns_shell.pdbx_redundancy        7.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1I9D 
_refine.ls_number_reflns_obs                     55121 
_refine.ls_number_reflns_all                     55121 
_refine.pdbx_ls_sigma_I                          -3.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.65 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.1290000 
_refine.ls_R_factor_all                          0.1340000 
_refine.ls_R_factor_R_work                       0.1340000 
_refine.ls_R_factor_R_free                       0.1910000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2878 
_refine.ls_number_parameters                     1386 
_refine.ls_number_restraints                     1583 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  
;Used full anisotropic refinement 
with Friedel pairs unmerged.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1I9D 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          1111. 
_refine_analyze.occupancy_sum_non_hydrogen      1416. 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1085 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             385 
_refine_hist.number_atoms_total               1499 
_refine_hist.d_res_high                       1.65 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d  0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d 0.03 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1I9D 
_pdbx_refine.R_factor_all_no_cutoff                      0.1340000 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1400000 
_pdbx_refine.free_R_factor_no_cutoff                     0.2030000 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5. 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            287 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1280000 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1350000 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1970000 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   5. 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          273 
_pdbx_refine.number_reflns_obs_4sig_cutoff               5208 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1I9D 
_struct.title                     'ARSENATE REDUCTASE FROM E. COLI' 
_struct.pdbx_descriptor           'ARSENATE REDUCTASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1I9D 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARSENIC, ARSENATE, REDUCTASE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 12  ? SER A 25  ? CYS A 12  SER A 25  1 ? 14 
HELX_P HELX_P2 2 SER A 40  ? GLY A 52  ? SER A 40  GLY A 52  1 ? 13 
HELX_P HELX_P3 3 SER A 54  ? LEU A 59  ? SER A 54  LEU A 59  1 ? 6  
HELX_P HELX_P4 4 VAL A 63  ? LEU A 69  ? VAL A 63  LEU A 69  1 ? 7  
HELX_P HELX_P5 5 THR A 77  ? HIS A 88  ? THR A 77  HIS A 88  1 ? 12 
HELX_P HELX_P6 6 PRO A 89  ? LEU A 91  ? PRO A 89  LEU A 91  5 ? 3  
HELX_P HELX_P7 7 PRO A 108 ? ILE A 115 ? PRO A 108 ILE A 115 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? F CS . CS ? ? ? 1_555 A LEU 113 O   ? ? A CS 602 A LEU 113 1_555  ? ? ? ? ? ? ? 3.109 ? 
metalc2  metalc ? ? F CS . CS ? ? ? 1_555 A ASP 114 O   ? ? A CS 602 A ASP 114 1_555  ? ? ? ? ? ? ? 3.308 ? 
metalc3  metalc ? ? F CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 602 A HOH 625 1_555  ? ? ? ? ? ? ? 3.117 ? 
metalc4  metalc ? ? F CS . CS ? ? ? 1_555 A LEU 116 O   ? ? A CS 602 A LEU 116 1_555  ? ? ? ? ? ? ? 3.056 ? 
metalc5  metalc ? ? G CS . CS ? ? ? 1_555 A ASP 128 OD2 ? ? A CS 603 A ASP 128 1_555  ? ? ? ? ? ? ? 3.790 ? 
metalc6  metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 695 1_555  ? ? ? ? ? ? ? 3.303 ? 
metalc7  metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 739 1_555  ? ? ? ? ? ? ? 3.661 ? 
metalc8  metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 857 1_555  ? ? ? ? ? ? ? 3.042 ? 
metalc9  metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 627 1_555  ? ? ? ? ? ? ? 3.181 ? 
metalc10 metalc ? ? H CS . CS ? ? ? 1_555 A SER 40  N   ? ? A CS 604 A SER 40  1_555  ? ? ? ? ? ? ? 3.710 ? 
metalc11 metalc ? ? H CS . CS ? ? ? 1_555 A PRO 38  O   ? ? A CS 604 A PRO 38  1_555  ? ? ? ? ? ? ? 3.157 ? 
metalc12 metalc ? ? H CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 604 A HOH 651 1_555  ? ? ? ? ? ? ? 3.200 ? 
metalc13 metalc ? ? H CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 604 A HOH 751 1_555  ? ? ? ? ? ? ? 3.374 ? 
metalc14 metalc ? ? H CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 604 A HOH 905 1_555  ? ? ? ? ? ? ? 2.654 ? 
metalc15 metalc ? ? H CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 604 A HOH 971 1_555  ? ? ? ? ? ? ? 3.382 ? 
metalc16 metalc ? ? H CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 604 A HOH 967 1_555  ? ? ? ? ? ? ? 3.828 ? 
metalc17 metalc ? ? I CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 605 A HOH 686 1_555  ? ? ? ? ? ? ? 3.092 ? 
metalc18 metalc ? ? I CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 605 A HOH 879 1_555  ? ? ? ? ? ? ? 2.879 ? 
metalc19 metalc ? ? I CS . CS ? ? ? 1_555 A THR 27  OG1 ? ? A CS 605 A THR 27  1_555  ? ? ? ? ? ? ? 3.404 ? 
metalc20 metalc ? ? I CS . CS ? ? ? 1_555 A GLY 26  O   ? ? A CS 605 A GLY 26  1_555  ? ? ? ? ? ? ? 3.104 ? 
metalc21 metalc ? ? I CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 605 A HOH 992 1_555  ? ? ? ? ? ? ? 3.673 ? 
metalc22 metalc ? ? I CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 605 A HOH 915 1_555  ? ? ? ? ? ? ? 2.485 ? 
metalc23 metalc ? ? J CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 606 A HOH 680 1_555  ? ? ? ? ? ? ? 3.094 ? 
metalc24 metalc ? ? J CS . CS ? ? ? 1_555 A GLU 64  OE2 ? ? A CS 606 A GLU 64  1_555  ? ? ? ? ? ? ? 3.254 ? 
metalc25 metalc ? ? J CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 606 A HOH 717 1_555  ? ? ? ? ? ? ? 3.077 ? 
metalc26 metalc ? ? J CS . CS ? ? ? 1_555 L CS  .   CS  ? ? A CS 606 A CS  608 1_555  ? ? ? ? ? ? ? 2.596 ? 
metalc27 metalc ? ? J CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 606 A HOH 973 1_555  ? ? ? ? ? ? ? 3.103 ? 
metalc28 metalc ? ? K CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 607 A HOH 658 1_555  ? ? ? ? ? ? ? 3.119 ? 
metalc29 metalc ? ? K CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 607 A HOH 782 1_555  ? ? ? ? ? ? ? 2.283 ? 
metalc30 metalc ? ? K CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 607 A HOH 807 1_555  ? ? ? ? ? ? ? 3.613 ? 
metalc31 metalc ? ? K CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 607 A HOH 811 1_555  ? ? ? ? ? ? ? 2.589 ? 
metalc32 metalc ? ? K CS . CS ? ? ? 1_555 A GLY 122 N   ? ? A CS 607 A GLY 122 1_555  ? ? ? ? ? ? ? 3.919 ? 
metalc33 metalc ? ? K CS . CS ? ? ? 1_555 A GLU 135 O   ? ? A CS 607 A GLU 135 1_555  ? ? ? ? ? ? ? 3.244 ? 
metalc34 metalc ? ? K CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 607 A HOH 731 1_555  ? ? ? ? ? ? ? 2.561 ? 
metalc35 metalc ? ? K CS . CS ? ? ? 1_555 A LYS 121 O   ? ? A CS 607 A LYS 121 1_555  ? ? ? ? ? ? ? 3.789 ? 
metalc36 metalc ? ? K CS . CS ? ? ? 1_555 A GLN 120 O   ? ? A CS 607 A GLN 120 1_555  ? ? ? ? ? ? ? 3.266 ? 
metalc37 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 771 1_555  ? ? ? ? ? ? ? 2.938 ? 
metalc38 metalc ? ? L CS . CS ? ? ? 1_555 A GLU 64  OE2 ? ? A CS 608 A GLU 64  1_555  ? ? ? ? ? ? ? 3.098 ? 
metalc39 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 733 1_555  ? ? ? ? ? ? ? 2.794 ? 
metalc40 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 734 1_555  ? ? ? ? ? ? ? 3.478 ? 
metalc41 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 963 1_555  ? ? ? ? ? ? ? 3.746 ? 
metalc42 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 973 1_555  ? ? ? ? ? ? ? 2.603 ? 
metalc43 metalc ? ? L CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 608 A HOH 680 1_555  ? ? ? ? ? ? ? 3.681 ? 
metalc44 metalc ? ? M CS . CS ? ? ? 1_555 A GLU 73  OE1 ? ? A CS 609 A GLU 73  1_555  ? ? ? ? ? ? ? 3.421 ? 
metalc45 metalc ? ? M CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 609 A HOH 677 1_555  ? ? ? ? ? ? ? 2.749 ? 
metalc46 metalc ? ? N CS . CS ? ? ? 1_555 A ASN 62  O   ? ? A CS 610 A ASN 62  1_555  ? ? ? ? ? ? ? 3.417 ? 
metalc47 metalc ? ? N CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 610 A HOH 789 1_555  ? ? ? ? ? ? ? 3.304 ? 
metalc48 metalc ? ? O CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 611 A HOH 875 1_555  ? ? ? ? ? ? ? 3.022 ? 
metalc49 metalc ? ? O CS . CS ? ? ? 1_555 A ILE 4   N   ? ? A CS 611 A ILE 4   1_555  ? ? ? ? ? ? ? 3.648 ? 
metalc50 metalc ? ? O CS . CS ? ? ? 1_555 A ILE 4   O   ? ? A CS 611 A ILE 4   1_555  ? ? ? ? ? ? ? 3.245 ? 
metalc51 metalc ? ? O CS . CS ? ? ? 1_555 A THR 30  N   ? ? A CS 611 A THR 30  1_555  ? ? ? ? ? ? ? 3.725 ? 
metalc52 metalc ? ? O CS . CS ? ? ? 1_555 A THR 30  OG1 ? ? A CS 611 A THR 30  1_555  ? ? ? ? ? ? ? 2.684 ? 
metalc53 metalc ? ? O CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 611 A HOH 643 1_555  ? ? ? ? ? ? ? 2.714 ? 
metalc54 metalc ? ? O CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 611 A HOH 979 1_555  ? ? ? ? ? ? ? 3.539 ? 
metalc55 metalc ? ? O CS . CS ? ? ? 1_555 A ASN 3   ND2 ? ? A CS 611 A ASN 3   1_555  ? ? ? ? ? ? ? 3.695 ? 
metalc56 metalc ? ? F CS . CS ? ? ? 1_555 A LEU 113 O   ? ? A CS 602 A LEU 113 10_665 ? ? ? ? ? ? ? 3.109 ? 
metalc57 metalc ? ? F CS . CS ? ? ? 1_555 A ASP 114 O   ? ? A CS 602 A ASP 114 10_665 ? ? ? ? ? ? ? 3.308 ? 
metalc58 metalc ? ? F CS . CS ? ? ? 1_555 A LEU 116 O   ? ? A CS 602 A LEU 116 10_665 ? ? ? ? ? ? ? 3.055 ? 
metalc59 metalc ? ? F CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 602 A HOH 625 10_665 ? ? ? ? ? ? ? 3.117 ? 
metalc60 metalc ? ? G CS . CS ? ? ? 1_555 A ASN 62  OD1 ? ? A CS 603 A ASN 62  12_566 ? ? ? ? ? ? ? 3.907 ? 
metalc61 metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 936 12_566 ? ? ? ? ? ? ? 3.672 ? 
metalc62 metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 667 12_566 ? ? ? ? ? ? ? 3.709 ? 
metalc63 metalc ? ? G CS . CS ? ? ? 1_555 A GLU 67  OE1 ? ? A CS 603 A GLU 67  12_566 ? ? ? ? ? ? ? 3.537 ? 
metalc64 metalc ? ? G CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 603 A HOH 664 12_566 ? ? ? ? ? ? ? 3.661 ? 
metalc65 metalc ? ? J CS . CS ? ? ? 1_555 A GLN 87  NE2 ? ? A CS 606 A GLN 87  8_676  ? ? ? ? ? ? ? 3.254 ? 
metalc66 metalc ? ? M CS . CS ? ? ? 1_555 A ASP 128 O   ? ? A CS 609 A ASP 128 12_566 ? ? ? ? ? ? ? 3.338 ? 
metalc67 metalc ? ? M CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 609 A HOH 622 12_566 ? ? ? ? ? ? ? 3.174 ? 
metalc68 metalc ? ? M CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 609 A HOH 894 8_676  ? ? ? ? ? ? ? 3.246 ? 
metalc69 metalc ? ? N CS . CS ? ? ? 1_555 B SO4 .   O4  ? ? A CS 610 A SO4 402 12_566 ? ? ? ? ? ? ? 3.299 ? 
metalc70 metalc ? ? N CS . CS ? ? ? 1_555 B SO4 .   O3  ? ? A CS 610 A SO4 402 12_566 ? ? ? ? ? ? ? 2.984 ? 
metalc71 metalc ? ? N CS . CS ? ? ? 1_555 P HOH .   O   ? ? A CS 610 A HOH 866 12_566 ? ? ? ? ? ? ? 2.812 ? 
metalc72 metalc ? ? N CS . CS ? ? ? 1_555 E SO3 .   S   ? ? A CS 610 A SO3 502 12_566 ? ? ? ? ? ? ? 3.757 ? 
metalc73 metalc ? ? N CS . CS ? ? ? 1_555 E SO3 .   O3  ? ? A CS 610 A SO3 502 12_566 ? ? ? ? ? ? ? 2.821 ? 
metalc74 metalc ? ? N CS . CS ? ? ? 1_555 B SO4 .   S   ? ? A CS 610 A SO4 402 12_566 ? ? ? ? ? ? ? 3.725 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 94  A . ? ARG 94  A PRO 95  A ? PRO 95  A 1 -5.81 
2 ARG 107 A . ? ARG 107 A PRO 108 A ? PRO 108 A 1 2.11  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 30  ? ILE A 32  ? THR A 30  ILE A 32  
A 2 THR A 5   ? TYR A 7   ? THR A 5   TYR A 7   
A 3 ILE A 96  ? THR A 99  ? ILE A 96  THR A 99  
A 4 GLY A 102 ? LEU A 105 ? GLY A 102 LEU A 105 
B 1 PHE A 124 ? THR A 125 ? PHE A 124 THR A 125 
B 2 LYS A 131 ? VAL A 133 ? LYS A 131 VAL A 133 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 32  ? N ILE A 32  O ILE A 6   ? O ILE A 6   
A 2 3 N TYR A 7   ? N TYR A 7   O ILE A 96  ? O ILE A 96  
A 3 4 N THR A 99  ? N THR A 99  O GLY A 102 ? O GLY A 102 
B 1 2 O PHE A 124 ? O PHE A 124 N VAL A 132 ? N VAL A 132 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SO4 A 402' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A 403' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 404' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO3 A 502' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CS A 602'  
AC6 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CS A 603'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CS A 604'  
AC8 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CS A 605'  
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CS A 606'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CS A 607'  
BC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CS A 608'  
BC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CS A 609'  
BC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CS A 610'  
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CS A 611'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 CYS A 12  ? CYS A 12  . ? 1_555  ? 
2  AC1 11 GLY A 13  ? GLY A 13  . ? 1_555  ? 
3  AC1 11 THR A 14  ? THR A 14  . ? 1_555  ? 
4  AC1 11 ASN A 62  ? ASN A 62  . ? 12_566 ? 
5  AC1 11 GLU A 67  ? GLU A 67  . ? 12_566 ? 
6  AC1 11 SO3 E .   ? SO3 A 502 . ? 1_555  ? 
7  AC1 11 CS  N .   ? CS  A 610 . ? 12_566 ? 
8  AC1 11 HOH P .   ? HOH A 627 . ? 1_555  ? 
9  AC1 11 HOH P .   ? HOH A 675 . ? 1_555  ? 
10 AC1 11 HOH P .   ? HOH A 719 . ? 1_555  ? 
11 AC1 11 HOH P .   ? HOH A 866 . ? 1_555  ? 
12 AC2 6  ARG A 107 ? ARG A 107 . ? 1_555  ? 
13 AC2 6  HOH P .   ? HOH A 698 . ? 1_555  ? 
14 AC2 6  HOH P .   ? HOH A 711 . ? 1_555  ? 
15 AC2 6  HOH P .   ? HOH A 785 . ? 1_555  ? 
16 AC2 6  HOH P .   ? HOH A 792 . ? 1_555  ? 
17 AC2 6  HOH P .   ? HOH A 822 . ? 1_555  ? 
18 AC3 10 THR A 14  ? THR A 14  . ? 1_555  ? 
19 AC3 10 ASN A 17  ? ASN A 17  . ? 1_555  ? 
20 AC3 10 PRO A 108 ? PRO A 108 . ? 1_555  ? 
21 AC3 10 SER A 109 ? SER A 109 . ? 1_555  ? 
22 AC3 10 LYS A 126 ? LYS A 126 . ? 1_555  ? 
23 AC3 10 HOH P .   ? HOH A 627 . ? 1_555  ? 
24 AC3 10 HOH P .   ? HOH A 695 . ? 1_555  ? 
25 AC3 10 HOH P .   ? HOH A 739 . ? 1_555  ? 
26 AC3 10 HOH P .   ? HOH A 766 . ? 1_555  ? 
27 AC3 10 HOH P .   ? HOH A 843 . ? 1_555  ? 
28 AC4 6  ARG A 94  ? ARG A 94  . ? 1_555  ? 
29 AC4 6  ARG A 107 ? ARG A 107 . ? 1_555  ? 
30 AC4 6  SO4 B .   ? SO4 A 402 . ? 1_555  ? 
31 AC4 6  CS  N .   ? CS  A 610 . ? 12_566 ? 
32 AC4 6  HOH P .   ? HOH A 711 . ? 1_555  ? 
33 AC4 6  HOH P .   ? HOH A 858 . ? 1_555  ? 
34 AC5 6  LEU A 113 ? LEU A 113 . ? 10_665 ? 
35 AC5 6  LEU A 113 ? LEU A 113 . ? 1_555  ? 
36 AC5 6  ASP A 114 ? ASP A 114 . ? 1_555  ? 
37 AC5 6  ASP A 114 ? ASP A 114 . ? 10_665 ? 
38 AC5 6  LEU A 116 ? LEU A 116 . ? 1_555  ? 
39 AC5 6  LEU A 116 ? LEU A 116 . ? 10_665 ? 
40 AC6 2  GLU A 67  ? GLU A 67  . ? 12_566 ? 
41 AC6 2  HOH P .   ? HOH A 857 . ? 1_555  ? 
42 AC7 3  PRO A 38  ? PRO A 38  . ? 1_555  ? 
43 AC7 3  GLU A 43  ? GLU A 43  . ? 1_555  ? 
44 AC7 3  HOH P .   ? HOH A 905 . ? 1_555  ? 
45 AC8 5  GLY A 26  ? GLY A 26  . ? 1_555  ? 
46 AC8 5  THR A 27  ? THR A 27  . ? 1_555  ? 
47 AC8 5  HOH P .   ? HOH A 686 . ? 1_555  ? 
48 AC8 5  HOH P .   ? HOH A 879 . ? 1_555  ? 
49 AC8 5  HOH P .   ? HOH A 915 . ? 1_555  ? 
50 AC9 5  GLU A 64  ? GLU A 64  . ? 1_555  ? 
51 AC9 5  GLN A 87  ? GLN A 87  . ? 8_676  ? 
52 AC9 5  CS  L .   ? CS  A 608 . ? 1_555  ? 
53 AC9 5  HOH P .   ? HOH A 680 . ? 1_555  ? 
54 AC9 5  HOH P .   ? HOH A 717 . ? 1_555  ? 
55 BC1 5  GLN A 120 ? GLN A 120 . ? 1_555  ? 
56 BC1 5  GLU A 135 ? GLU A 135 . ? 1_555  ? 
57 BC1 5  HOH P .   ? HOH A 731 . ? 1_555  ? 
58 BC1 5  HOH P .   ? HOH A 782 . ? 1_555  ? 
59 BC1 5  HOH P .   ? HOH A 811 . ? 1_555  ? 
60 BC2 5  GLU A 64  ? GLU A 64  . ? 1_555  ? 
61 BC2 5  CS  J .   ? CS  A 606 . ? 1_555  ? 
62 BC2 5  HOH P .   ? HOH A 733 . ? 1_555  ? 
63 BC2 5  HOH P .   ? HOH A 771 . ? 1_555  ? 
64 BC2 5  HOH P .   ? HOH A 973 . ? 1_555  ? 
65 BC3 3  GLU A 73  ? GLU A 73  . ? 1_555  ? 
66 BC3 3  ASP A 128 ? ASP A 128 . ? 12_566 ? 
67 BC3 3  HOH P .   ? HOH A 677 . ? 1_555  ? 
68 BC4 4  ASN A 62  ? ASN A 62  . ? 1_555  ? 
69 BC4 4  SO4 B .   ? SO4 A 402 . ? 12_566 ? 
70 BC4 4  SO3 E .   ? SO3 A 502 . ? 12_566 ? 
71 BC4 4  HOH P .   ? HOH A 866 . ? 12_566 ? 
72 BC5 5  ASN A 3   ? ASN A 3   . ? 1_555  ? 
73 BC5 5  ILE A 4   ? ILE A 4   . ? 1_555  ? 
74 BC5 5  THR A 30  ? THR A 30  . ? 1_555  ? 
75 BC5 5  HOH P .   ? HOH A 643 . ? 1_555  ? 
76 BC5 5  HOH P .   ? HOH A 875 . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          1I9D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1I9D 
_atom_sites.fract_transf_matrix[1][1]   0.011531 
_atom_sites.fract_transf_matrix[1][2]   0.006657 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013314 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008608 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CS 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 3   ? 32.269 45.742 45.848 1.00 41.94  ? 3   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 3   ? 31.979 47.178 45.628 1.00 32.71  ? 3   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 3   ? 30.657 47.519 46.310 1.00 27.53  ? 3   ASN A C   1 
ATOM   4    O  O   . ASN A 1 3   ? 29.581 47.394 45.725 1.00 36.26  ? 3   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 3   ? 31.891 47.483 44.131 1.00 40.37  ? 3   ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 3   ? 31.688 48.939 43.727 1.00 55.81  ? 3   ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 3   ? 31.521 49.296 42.540 1.00 76.53  ? 3   ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 3   ? 31.709 49.835 44.744 1.00 58.55  ? 3   ASN A ND2 1 
ATOM   9    N  N   . ILE A 1 4   ? 30.742 47.972 47.559 1.00 25.29  ? 4   ILE A N   1 
ATOM   10   C  CA  . ILE A 1 4   ? 29.566 48.242 48.368 1.00 23.33  ? 4   ILE A CA  1 
ATOM   11   C  C   . ILE A 1 4   ? 29.759 49.632 48.994 1.00 23.78  ? 4   ILE A C   1 
ATOM   12   O  O   . ILE A 1 4   ? 30.850 49.998 49.456 1.00 25.10  ? 4   ILE A O   1 
ATOM   13   C  CB  . ILE A 1 4   ? 29.423 47.169 49.438 1.00 25.46  ? 4   ILE A CB  1 
ATOM   14   C  CG1 . ILE A 1 4   ? 29.310 45.732 48.928 1.00 24.96  ? 4   ILE A CG1 1 
ATOM   15   C  CG2 . ILE A 1 4   ? 28.251 47.525 50.389 1.00 26.22  ? 4   ILE A CG2 1 
ATOM   16   C  CD1 . ILE A 1 4   ? 29.076 44.677 49.976 1.00 28.69  ? 4   ILE A CD1 1 
ATOM   17   N  N   . THR A 1 5   ? 28.689 50.385 49.020 1.00 24.05  ? 5   THR A N   1 
ATOM   18   C  CA  . THR A 1 5   ? 28.650 51.676 49.660 1.00 23.00  ? 5   THR A CA  1 
ATOM   19   C  C   . THR A 1 5   ? 27.577 51.720 50.687 1.00 23.71  ? 5   THR A C   1 
ATOM   20   O  O   . THR A 1 5   ? 26.476 51.287 50.375 1.00 23.17  ? 5   THR A O   1 
ATOM   21   C  CB  . THR A 1 5   ? 28.385 52.783 48.638 1.00 26.32  ? 5   THR A CB  1 
ATOM   22   O  OG1 . THR A 1 5   ? 29.518 52.829 47.765 1.00 27.65  ? 5   THR A OG1 1 
ATOM   23   C  CG2 . THR A 1 5   ? 28.355 54.104 49.358 1.00 27.63  ? 5   THR A CG2 1 
ATOM   24   N  N   . ILE A 1 6   ? 27.824 52.262 51.865 1.00 23.00  ? 6   ILE A N   1 
ATOM   25   C  CA  . ILE A 1 6   ? 26.771 52.438 52.865 1.00 21.09  ? 6   ILE A CA  1 
ATOM   26   C  C   . ILE A 1 6   ? 26.672 53.919 53.224 1.00 22.30  ? 6   ILE A C   1 
ATOM   27   O  O   . ILE A 1 6   ? 27.745 54.478 53.540 1.00 22.58  ? 6   ILE A O   1 
ATOM   28   C  CB  . ILE A 1 6   ? 27.001 51.544 54.114 1.00 24.27  ? 6   ILE A CB  1 
ATOM   29   C  CG1 . ILE A 1 6   ? 25.906 51.861 55.148 1.00 24.26  ? 6   ILE A CG1 1 
ATOM   30   C  CG2 . ILE A 1 6   ? 28.339 51.595 54.800 1.00 23.67  ? 6   ILE A CG2 1 
ATOM   31   C  CD1 . ILE A 1 6   ? 25.829 50.917 56.328 1.00 24.40  ? 6   ILE A CD1 1 
ATOM   32   N  N   . TYR A 1 7   ? 25.519 54.532 53.184 1.00 22.41  ? 7   TYR A N   1 
ATOM   33   C  CA  . TYR A 1 7   ? 25.264 55.860 53.767 1.00 21.36  ? 7   TYR A CA  1 
ATOM   34   C  C   . TYR A 1 7   ? 24.927 55.608 55.215 1.00 20.67  ? 7   TYR A C   1 
ATOM   35   O  O   . TYR A 1 7   ? 23.821 55.131 55.512 1.00 22.44  ? 7   TYR A O   1 
ATOM   36   C  CB  . TYR A 1 7   ? 24.154 56.558 52.971 1.00 24.40  ? 7   TYR A CB  1 
ATOM   37   C  CG  . TYR A 1 7   ? 24.559 56.842 51.536 1.00 22.57  ? 7   TYR A CG  1 
ATOM   38   C  CD1 . TYR A 1 7   ? 24.461 55.899 50.493 1.00 22.75  ? 7   TYR A CD1 1 
ATOM   39   C  CD2 . TYR A 1 7   ? 25.053 58.077 51.170 1.00 24.64  ? 7   TYR A CD2 1 
ATOM   40   C  CE1 . TYR A 1 7   ? 24.850 56.223 49.197 1.00 26.32  ? 7   TYR A CE1 1 
ATOM   41   C  CE2 . TYR A 1 7   ? 25.439 58.423 49.887 1.00 26.11  ? 7   TYR A CE2 1 
ATOM   42   C  CZ  . TYR A 1 7   ? 25.321 57.470 48.904 1.00 23.96  ? 7   TYR A CZ  1 
ATOM   43   O  OH  . TYR A 1 7   ? 25.711 57.766 47.625 1.00 27.65  ? 7   TYR A OH  1 
ATOM   44   N  N   . HIS A 1 8   ? 25.888 55.917 56.090 1.00 22.42  ? 8   HIS A N   1 
ATOM   45   C  CA  . HIS A 1 8   ? 25.944 55.478 57.456 1.00 21.09  ? 8   HIS A CA  1 
ATOM   46   C  C   . HIS A 1 8   ? 25.776 56.619 58.425 1.00 23.98  ? 8   HIS A C   1 
ATOM   47   O  O   . HIS A 1 8   ? 26.250 57.746 58.215 1.00 24.65  ? 8   HIS A O   1 
ATOM   48   C  CB  . HIS A 1 8   ? 27.269 54.773 57.751 1.00 23.87  ? 8   HIS A CB  1 
ATOM   49   C  CG  . HIS A 1 8   ? 27.492 54.219 59.104 1.00 22.75  ? 8   HIS A CG  1 
ATOM   50   N  ND1 . HIS A 1 8   ? 26.636 53.383 59.753 1.00 25.73  ? 8   HIS A ND1 1 
ATOM   51   C  CD2 . HIS A 1 8   ? 28.535 54.315 59.965 1.00 25.82  ? 8   HIS A CD2 1 
ATOM   52   C  CE1 . HIS A 1 8   ? 27.119 53.033 60.943 1.00 32.96  ? 8   HIS A CE1 1 
ATOM   53   N  NE2 . HIS A 1 8   ? 28.293 53.591 61.103 1.00 27.03  ? 8   HIS A NE2 1 
ATOM   54   N  N   . ASN A 1 9   ? 25.170 56.591 59.572 1.00 26.87  ? 9   ASN A N   1 
ATOM   55   C  CA  . ASN A 1 9   ? 24.932 57.298 60.758 1.00 24.88  ? 9   ASN A CA  1 
ATOM   56   C  C   . ASN A 1 9   ? 25.342 56.401 61.917 1.00 25.24  ? 9   ASN A C   1 
ATOM   57   O  O   . ASN A 1 9   ? 24.609 55.539 62.359 1.00 25.01  ? 9   ASN A O   1 
ATOM   58   C  CB  . ASN A 1 9   ? 23.468 57.663 60.855 1.00 25.58  ? 9   ASN A CB  1 
ATOM   59   C  CG  . ASN A 1 9   ? 23.283 58.709 61.930 1.00 27.54  ? 9   ASN A CG  1 
ATOM   60   O  OD1 . ASN A 1 9   ? 24.086 58.714 62.859 1.00 29.28  ? 9   ASN A OD1 1 
ATOM   61   N  ND2 . ASN A 1 9   ? 22.272 59.557 61.734 1.00 31.48  ? 9   ASN A ND2 1 
ATOM   62   N  N   . PRO A 1 10  ? 26.567 56.606 62.379 1.00 27.91  ? 10  PRO A N   1 
ATOM   63   C  CA  . PRO A 1 10  ? 27.060 55.857 63.532 1.00 26.66  ? 10  PRO A CA  1 
ATOM   64   C  C   . PRO A 1 10  ? 26.189 55.992 64.781 1.00 26.60  ? 10  PRO A C   1 
ATOM   65   O  O   . PRO A 1 10  ? 26.400 55.130 65.649 1.00 27.23  ? 10  PRO A O   1 
ATOM   66   C  CB  . PRO A 1 10  ? 28.434 56.475 63.847 1.00 33.66  ? 10  PRO A CB  1 
ATOM   67   C  CG  . PRO A 1 10  ? 28.842 57.118 62.563 1.00 36.59  ? 10  PRO A CG  1 
ATOM   68   C  CD  . PRO A 1 10  ? 27.572 57.551 61.864 1.00 28.74  ? 10  PRO A CD  1 
ATOM   69   N  N   . ALA A 1 11  ? 25.333 56.983 64.863 1.00 27.15  ? 11  ALA A N   1 
ATOM   70   C  CA  . ALA A 1 11  ? 24.493 57.128 66.061 1.00 26.86  ? 11  ALA A CA  1 
ATOM   71   C  C   . ALA A 1 11  ? 23.236 56.290 66.023 1.00 30.85  ? 11  ALA A C   1 
ATOM   72   O  O   . ALA A 1 11  ? 22.422 56.384 66.935 1.00 32.74  ? 11  ALA A O   1 
ATOM   73   C  CB  . ALA A 1 11  ? 24.149 58.616 66.193 1.00 33.06  ? 11  ALA A CB  1 
ATOM   74   N  N   . CYS A 1 12  ? 23.063 55.489 64.978 1.00 27.63  ? 12  CYS A N   1 
ATOM   75   C  CA  . CYS A 1 12  ? 21.810 54.791 64.681 1.00 25.12  ? 12  CYS A CA  1 
ATOM   76   C  C   . CYS A 1 12  ? 22.064 53.299 64.755 1.00 24.45  ? 12  CYS A C   1 
ATOM   77   O  O   . CYS A 1 12  ? 22.891 52.798 63.957 1.00 24.97  ? 12  CYS A O   1 
ATOM   78   C  CB  . CYS A 1 12  ? 21.265 55.137 63.304 1.00 25.58  ? 12  CYS A CB  1 
ATOM   79   S  SG  . CYS A 1 12  ? 19.743 54.227 62.876 1.00 33.25  ? 12  CYS A SG  1 
ATOM   80   N  N   . GLY A 1 13  ? 21.403 52.603 65.661 1.00 23.81  ? 13  GLY A N   1 
ATOM   81   C  CA  . GLY A 1 13  ? 21.659 51.162 65.804 1.00 20.93  ? 13  GLY A CA  1 
ATOM   82   C  C   . GLY A 1 13  ? 21.326 50.431 64.534 1.00 20.21  ? 13  GLY A C   1 
ATOM   83   O  O   . GLY A 1 13  ? 22.008 49.498 64.150 1.00 22.63  ? 13  GLY A O   1 
ATOM   84   N  N   . THR A 1 14  ? 20.294 50.777 63.775 1.00 22.26  ? 14  THR A N   1 
ATOM   85   C  CA  . THR A 1 14  ? 19.964 50.150 62.475 1.00 20.95  ? 14  THR A CA  1 
ATOM   86   C  C   . THR A 1 14  ? 21.138 50.215 61.519 1.00 21.57  ? 14  THR A C   1 
ATOM   87   O  O   . THR A 1 14  ? 21.533 49.239 60.845 1.00 21.76  ? 14  THR A O   1 
ATOM   88   C  CB  . THR A 1 14  ? 18.672 50.765 61.880 1.00 23.38  ? 14  THR A CB  1 
ATOM   89   O  OG1 . THR A 1 14  ? 17.583 50.714 62.838 1.00 24.89  ? 14  THR A OG1 1 
ATOM   90   C  CG2 . THR A 1 14  ? 18.303 50.024 60.628 1.00 23.32  ? 14  THR A CG2 1 
ATOM   91   N  N   . SER A 1 15  ? 21.752 51.414 61.473 1.00 22.52  ? 15  SER A N   1 
ATOM   92   C  CA  . SER A 1 15  ? 22.917 51.636 60.655 1.00 21.62  ? 15  SER A CA  1 
ATOM   93   C  C   . SER A 1 15  ? 24.142 50.836 61.115 1.00 22.46  ? 15  SER A C   1 
ATOM   94   O  O   . SER A 1 15  ? 24.840 50.191 60.267 1.00 21.99  ? 15  SER A O   1 
ATOM   95   C  CB  . SER A 1 15  ? 23.216 53.148 60.602 1.00 21.72  ? 15  SER A CB  1 
ATOM   96   O  OG  . SER A 1 15  ? 23.939 53.371 59.371 1.00 24.25  ? 15  SER A OG  1 
ATOM   97   N  N   . ARG A 1 16  ? 24.393 50.788 62.428 1.00 20.51  ? 16  ARG A N   1 
ATOM   98   C  CA  . ARG A 1 16  ? 25.484 49.933 62.947 1.00 21.41  ? 16  ARG A CA  1 
ATOM   99   C  C   . ARG A 1 16  ? 25.265 48.466 62.614 1.00 19.66  ? 16  ARG A C   1 
ATOM   100  O  O   . ARG A 1 16  ? 26.192 47.772 62.161 1.00 22.66  ? 16  ARG A O   1 
ATOM   101  C  CB  . ARG A 1 16  ? 25.601 50.171 64.439 1.00 21.84  ? 16  ARG A CB  1 
ATOM   102  C  CG  . ARG A 1 16  ? 26.058 51.542 64.879 1.00 23.15  ? 16  ARG A CG  1 
ATOM   103  C  CD  . ARG A 1 16  ? 26.330 51.549 66.362 1.00 23.32  ? 16  ARG A CD  1 
ATOM   104  N  NE  . ARG A 1 16  ? 25.189 51.380 67.206 1.00 25.41  ? 16  ARG A NE  1 
ATOM   105  C  CZ  . ARG A 1 16  ? 24.376 52.336 67.654 1.00 26.03  ? 16  ARG A CZ  1 
ATOM   106  N  NH1 . ARG A 1 16  ? 24.517 53.609 67.362 1.00 26.11  ? 16  ARG A NH1 1 
ATOM   107  N  NH2 . ARG A 1 16  ? 23.373 51.953 68.434 1.00 25.06  ? 16  ARG A NH2 1 
ATOM   108  N  N   . ASN A 1 17  ? 24.078 47.949 62.848 1.00 22.51  ? 17  ASN A N   1 
ATOM   109  C  CA  . ASN A 1 17  ? 23.815 46.535 62.564 1.00 23.02  ? 17  ASN A CA  1 
ATOM   110  C  C   . ASN A 1 17  ? 24.029 46.234 61.077 1.00 22.77  ? 17  ASN A C   1 
ATOM   111  O  O   . ASN A 1 17  ? 24.581 45.218 60.687 1.00 22.89  ? 17  ASN A O   1 
ATOM   112  C  CB  . ASN A 1 17  ? 22.385 46.152 62.991 1.00 22.86  ? 17  ASN A CB  1 
ATOM   113  C  CG  . ASN A 1 17  ? 22.205 45.942 64.488 1.00 21.55  ? 17  ASN A CG  1 
ATOM   114  O  OD1 . ASN A 1 17  ? 23.041 45.379 65.219 1.00 23.50  ? 17  ASN A OD1 1 
ATOM   115  N  ND2 . ASN A 1 17  ? 21.021 46.365 64.896 1.00 23.32  ? 17  ASN A ND2 1 
ATOM   116  N  N   . THR A 1 18  ? 23.548 47.160 60.209 1.00 20.86  ? 18  THR A N   1 
ATOM   117  C  CA  . THR A 1 18  ? 23.709 46.968 58.760 1.00 21.63  ? 18  THR A CA  1 
ATOM   118  C  C   . THR A 1 18  ? 25.199 46.907 58.402 1.00 19.89  ? 18  THR A C   1 
ATOM   119  O  O   . THR A 1 18  ? 25.581 45.971 57.676 1.00 22.01  ? 18  THR A O   1 
ATOM   120  C  CB  . THR A 1 18  ? 22.987 48.052 57.974 1.00 20.90  ? 18  THR A CB  1 
ATOM   121  O  OG1 . THR A 1 18  ? 21.545 48.103 58.257 1.00 21.75  ? 18  THR A OG1 1 
ATOM   122  C  CG2 . THR A 1 18  ? 23.161 47.824 56.478 1.00 24.96  ? 18  THR A CG2 1 
ATOM   123  N  N   . LEU A 1 19  ? 25.985 47.866 58.894 1.00 21.38  ? 19  LEU A N   1 
ATOM   124  C  CA  . LEU A 1 19  ? 27.416 47.901 58.577 1.00 21.95  ? 19  LEU A CA  1 
ATOM   125  C  C   . LEU A 1 19  ? 28.069 46.572 58.996 1.00 20.58  ? 19  LEU A C   1 
ATOM   126  O  O   . LEU A 1 19  ? 28.896 45.947 58.315 1.00 21.53  ? 19  LEU A O   1 
ATOM   127  C  CB  . LEU A 1 19  ? 28.062 49.086 59.256 1.00 20.90  ? 19  LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 19  ? 29.563 49.306 59.156 1.00 21.05  ? 19  LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 19  ? 29.975 49.150 57.687 1.00 22.02  ? 19  LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 19  ? 29.948 50.607 59.840 1.00 25.79  ? 19  LEU A CD2 1 
ATOM   131  N  N   . GLU A 1 20  ? 27.693 46.088 60.206 1.00 22.84  ? 20  GLU A N   1 
ATOM   132  C  CA  . GLU A 1 20  ? 28.318 44.840 60.675 1.00 20.83  ? 20  GLU A CA  1 
ATOM   133  C  C   . GLU A 1 20  ? 27.839 43.677 59.846 1.00 19.73  ? 20  GLU A C   1 
ATOM   134  O  O   . GLU A 1 20  ? 28.630 42.742 59.643 1.00 20.84  ? 20  GLU A O   1 
ATOM   135  C  CB  . GLU A 1 20  ? 28.096 44.626 62.171 1.00 21.91  ? 20  GLU A CB  1 
ATOM   136  C  CG  . GLU A 1 20  ? 28.614 45.726 63.102 1.00 23.22  ? 20  GLU A CG  1 
ATOM   137  C  CD  . GLU A 1 20  ? 30.075 46.042 63.125 1.00 23.42  ? 20  GLU A CD  1 
ATOM   138  O  OE1 . GLU A 1 20  ? 30.692 45.979 62.045 1.00 25.67  ? 20  GLU A OE1 1 
ATOM   139  O  OE2 . GLU A 1 20  ? 30.597 46.375 64.233 1.00 23.52  ? 20  GLU A OE2 1 
ATOM   140  N  N   . MET A 1 21  ? 26.572 43.661 59.374 1.00 21.95  ? 21  MET A N   1 
ATOM   141  C  CA  . MET A 1 21  ? 26.220 42.541 58.495 1.00 23.38  ? 21  MET A CA  1 
ATOM   142  C  C   . MET A 1 21  ? 26.988 42.615 57.191 1.00 22.47  ? 21  MET A C   1 
ATOM   143  O  O   . MET A 1 21  ? 27.379 41.579 56.652 1.00 23.09  ? 21  MET A O   1 
ATOM   144  C  CB  . MET A 1 21  ? 24.686 42.497 58.256 1.00 21.76  ? 21  MET A CB  1 
ATOM   145  C  CG  . MET A 1 21  ? 23.936 41.709 59.321 1.00 24.51  ? 21  MET A CG  1 
ATOM   146  S  SD  . MET A 1 21  ? 22.162 41.557 59.046 1.00 24.55  ? 21  MET A SD  1 
ATOM   147  C  CE  . MET A 1 21  ? 21.613 43.148 59.676 1.00 28.24  ? 21  MET A CE  1 
ATOM   148  N  N   . ILE A 1 22  ? 27.183 43.792 56.637 1.00 21.20  ? 22  ILE A N   1 
ATOM   149  C  CA  . ILE A 1 22  ? 28.016 43.909 55.435 1.00 21.58  ? 22  ILE A CA  1 
ATOM   150  C  C   . ILE A 1 22  ? 29.392 43.236 55.662 1.00 20.60  ? 22  ILE A C   1 
ATOM   151  O  O   . ILE A 1 22  ? 29.882 42.399 54.911 1.00 23.34  ? 22  ILE A O   1 
ATOM   152  C  CB  . ILE A 1 22  ? 28.171 45.366 54.948 1.00 21.04  ? 22  ILE A CB  1 
ATOM   153  C  CG1 . ILE A 1 22  ? 26.844 46.039 54.588 1.00 21.72  ? 22  ILE A CG1 1 
ATOM   154  C  CG2 . ILE A 1 22  ? 29.191 45.417 53.836 1.00 22.59  ? 22  ILE A CG2 1 
ATOM   155  C  CD1 . ILE A 1 22  ? 26.830 47.548 54.359 1.00 24.35  ? 22  ILE A CD1 1 
ATOM   156  N  N   . ARG A 1 23  ? 30.001 43.631 56.773 1.00 22.75  ? 23  ARG A N   1 
ATOM   157  C  CA  . ARG A 1 23  ? 31.335 43.131 57.120 1.00 20.64  ? 23  ARG A CA  1 
ATOM   158  C  C   . ARG A 1 23  ? 31.297 41.640 57.294 1.00 20.97  ? 23  ARG A C   1 
ATOM   159  O  O   . ARG A 1 23  ? 32.287 40.968 56.911 1.00 23.19  ? 23  ARG A O   1 
ATOM   160  C  CB  . ARG A 1 23  ? 31.834 43.845 58.355 1.00 21.94  ? 23  ARG A CB  1 
ATOM   161  C  CG  . ARG A 1 23  ? 32.219 45.282 58.107 1.00 22.70  ? 23  ARG A CG  1 
ATOM   162  C  CD  . ARG A 1 23  ? 32.676 46.005 59.346 1.00 26.49  ? 23  ARG A CD  1 
ATOM   163  N  NE  . ARG A 1 23  ? 33.276 47.298 59.024 1.00 24.39  ? 23  ARG A NE  1 
ATOM   164  C  CZ  . ARG A 1 23  ? 33.189 48.381 59.782 1.00 24.15  ? 23  ARG A CZ  1 
ATOM   165  N  NH1 . ARG A 1 23  ? 32.514 48.447 60.933 1.00 24.31  ? 23  ARG A NH1 1 
ATOM   166  N  NH2 . ARG A 1 23  ? 33.767 49.556 59.456 1.00 24.80  ? 23  ARG A NH2 1 
ATOM   167  N  N   . ASN A 1 24  ? 30.236 41.118 57.875 1.00 22.22  ? 24  ASN A N   1 
ATOM   168  C  CA  . ASN A 1 24  ? 30.117 39.687 58.131 1.00 22.80  ? 24  ASN A CA  1 
ATOM   169  C  C   . ASN A 1 24  ? 29.975 38.902 56.835 1.00 22.22  ? 24  ASN A C   1 
ATOM   170  O  O   . ASN A 1 24  ? 30.085 37.664 56.863 1.00 24.42  ? 24  ASN A O   1 
ATOM   171  C  CB  . ASN A 1 24  ? 28.994 39.347 59.122 1.00 23.37  ? 24  ASN A CB  1 
ATOM   172  C  CG  . ASN A 1 24  ? 28.975 37.932 59.667 1.00 21.09  ? 24  ASN A CG  1 
ATOM   173  O  OD1 . ASN A 1 24  ? 27.888 37.254 59.786 1.00 28.84  ? 24  ASN A OD1 1 
ATOM   174  N  ND2 . ASN A 1 24  ? 30.140 37.419 60.039 1.00 22.53  ? 24  ASN A ND2 1 
ATOM   175  N  N   . SER A 1 25  ? 29.729 39.558 55.718 1.00 22.78  ? 25  SER A N   1 
ATOM   176  C  CA  . SER A 1 25  ? 29.733 38.889 54.408 1.00 22.61  ? 25  SER A CA  1 
ATOM   177  C  C   . SER A 1 25  ? 31.106 38.872 53.768 1.00 24.74  ? 25  SER A C   1 
ATOM   178  O  O   . SER A 1 25  ? 31.271 38.275 52.683 1.00 25.32  ? 25  SER A O   1 
ATOM   179  C  CB  . SER A 1 25  ? 28.748 39.524 53.446 1.00 23.22  ? 25  SER A CB  1 
ATOM   180  O  OG  . SER A 1 25  ? 29.256 40.743 52.893 1.00 21.89  ? 25  SER A OG  1 
ATOM   181  N  N   . GLY A 1 26  ? 32.047 39.520 54.472 1.00 24.98  ? 26  GLY A N   1 
ATOM   182  C  CA  . GLY A 1 26  ? 33.433 39.545 54.076 1.00 26.38  ? 26  GLY A CA  1 
ATOM   183  C  C   . GLY A 1 26  ? 33.890 40.733 53.240 1.00 25.86  ? 26  GLY A C   1 
ATOM   184  O  O   . GLY A 1 26  ? 34.974 40.724 52.627 1.00 27.96  ? 26  GLY A O   1 
ATOM   185  N  N   . THR A 1 27  ? 33.084 41.780 53.229 1.00 25.77  ? 27  THR A N   1 
ATOM   186  C  CA  . THR A 1 27  ? 33.488 42.967 52.538 1.00 25.02  ? 27  THR A CA  1 
ATOM   187  C  C   . THR A 1 27  ? 33.503 44.205 53.418 1.00 24.03  ? 27  THR A C   1 
ATOM   188  O  O   . THR A 1 27  ? 32.563 44.376 54.194 1.00 25.11  ? 27  THR A O   1 
ATOM   189  C  CB  . THR A 1 27  ? 32.483 43.276 51.412 1.00 27.62  ? 27  THR A CB  1 
ATOM   190  O  OG1 . THR A 1 27  ? 32.639 42.289 50.416 1.00 30.03  ? 27  THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 27  ? 32.798 44.632 50.806 1.00 29.22  ? 27  THR A CG2 1 
ATOM   192  N  N   . GLU A 1 28  ? 34.524 45.033 53.257 1.00 26.14  ? 28  GLU A N   1 
ATOM   193  C  CA  . GLU A 1 28  ? 34.515 46.321 53.954 1.00 23.92  ? 28  GLU A CA  1 
ATOM   194  C  C   . GLU A 1 28  ? 33.961 47.340 52.973 1.00 25.86  ? 28  GLU A C   1 
ATOM   195  O  O   . GLU A 1 28  ? 34.580 47.578 51.882 1.00 28.13  ? 28  GLU A O   1 
ATOM   196  C  CB  . GLU A 1 28  ? 35.892 46.749 54.404 1.00 25.58  ? 28  GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 28  ? 36.009 48.140 54.978 1.00 27.08  ? 28  GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 28  ? 35.367 48.241 56.358 1.00 24.17  ? 28  GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 28  ? 35.187 49.370 56.897 1.00 28.39  ? 28  GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 28  ? 35.043 47.173 56.903 1.00 28.77  ? 28  GLU A OE2 1 
ATOM   201  N  N   . PRO A 1 29  ? 32.840 47.973 53.295 1.00 24.56  ? 29  PRO A N   1 
ATOM   202  C  CA  . PRO A 1 29  ? 32.259 48.897 52.308 1.00 23.50  ? 29  PRO A CA  1 
ATOM   203  C  C   . PRO A 1 29  ? 32.907 50.280 52.365 1.00 25.35  ? 29  PRO A C   1 
ATOM   204  O  O   . PRO A 1 29  ? 33.564 50.566 53.384 1.00 26.86  ? 29  PRO A O   1 
ATOM   205  C  CB  . PRO A 1 29  ? 30.832 49.020 52.832 1.00 24.01  ? 29  PRO A CB  1 
ATOM   206  C  CG  . PRO A 1 29  ? 30.996 48.901 54.311 1.00 24.96  ? 29  PRO A CG  1 
ATOM   207  C  CD  . PRO A 1 29  ? 32.104 47.888 54.524 1.00 24.38  ? 29  PRO A CD  1 
ATOM   208  N  N   . THR A 1 30  ? 32.662 51.078 51.316 1.00 23.99  ? 30  THR A N   1 
ATOM   209  C  CA  . THR A 1 30  ? 32.940 52.512 51.339 1.00 26.05  ? 30  THR A CA  1 
ATOM   210  C  C   . THR A 1 30  ? 31.893 53.116 52.266 1.00 25.42  ? 30  THR A C   1 
ATOM   211  O  O   . THR A 1 30  ? 30.705 52.811 52.089 1.00 24.30  ? 30  THR A O   1 
ATOM   212  C  CB  . THR A 1 30  ? 32.792 53.125 49.936 1.00 30.62  ? 30  THR A CB  1 
ATOM   213  O  OG1 . THR A 1 30  ? 33.764 52.532 49.039 1.00 30.31  ? 30  THR A OG1 1 
ATOM   214  C  CG2 . THR A 1 30  ? 32.967 54.629 50.004 1.00 31.70  ? 30  THR A CG2 1 
ATOM   215  N  N   . ILE A 1 31  ? 32.318 53.899 53.228 1.00 25.20  ? 31  ILE A N   1 
ATOM   216  C  CA  . ILE A 1 31  ? 31.392 54.465 54.192 1.00 22.50  ? 31  ILE A CA  1 
ATOM   217  C  C   . ILE A 1 31  ? 31.239 55.968 53.935 1.00 24.32  ? 31  ILE A C   1 
ATOM   218  O  O   . ILE A 1 31  ? 32.220 56.704 53.953 1.00 26.97  ? 31  ILE A O   1 
ATOM   219  C  CB  . ILE A 1 31  ? 31.910 54.216 55.613 1.00 26.41  ? 31  ILE A CB  1 
ATOM   220  C  CG1 . ILE A 1 31  ? 31.987 52.709 55.952 1.00 26.76  ? 31  ILE A CG1 1 
ATOM   221  C  CG2 . ILE A 1 31  ? 31.099 54.962 56.645 1.00 27.75  ? 31  ILE A CG2 1 
ATOM   222  C  CD1 . ILE A 1 31  ? 32.646 52.395 57.257 1.00 27.20  ? 31  ILE A CD1 1 
ATOM   223  N  N   . ILE A 1 32  ? 29.996 56.394 53.678 1.00 23.61  ? 32  ILE A N   1 
ATOM   224  C  CA  . ILE A 1 32  ? 29.675 57.811 53.477 1.00 24.76  ? 32  ILE A CA  1 
ATOM   225  C  C   . ILE A 1 32  ? 28.866 58.291 54.677 1.00 23.25  ? 32  ILE A C   1 
ATOM   226  O  O   . ILE A 1 32  ? 27.756 57.770 54.946 1.00 23.05  ? 32  ILE A O   1 
ATOM   227  C  CB  . ILE A 1 32  ? 28.933 58.083 52.148 1.00 24.76  ? 32  ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 32  ? 29.735 57.665 50.916 1.00 24.04  ? 32  ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 32  ? 28.499 59.533 52.020 1.00 26.63  ? 32  ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 32  ? 28.941 57.831 49.615 1.00 31.84  ? 32  ILE A CD1 1 
ATOM   231  N  N   . LEU A 1 33  ? 29.432 59.275 55.387 1.00 24.91  ? 33  LEU A N   1 
ATOM   232  C  CA  . LEU A 1 33  ? 28.755 59.900 56.524 1.00 25.94  ? 33  LEU A CA  1 
ATOM   233  C  C   . LEU A 1 33  ? 27.819 60.939 55.919 1.00 24.45  ? 33  LEU A C   1 
ATOM   234  O  O   . LEU A 1 33  ? 28.244 62.085 55.807 1.00 26.04  ? 33  LEU A O   1 
ATOM   235  C  CB  . LEU A 1 33  ? 29.762 60.477 57.532 1.00 27.12  ? 33  LEU A CB  1 
ATOM   236  C  CG  . LEU A 1 33  ? 30.742 59.472 58.097 1.00 28.89  ? 33  LEU A CG  1 
ATOM   237  C  CD1 . LEU A 1 33  ? 31.762 60.092 59.029 1.00 28.10  ? 33  LEU A CD1 1 
ATOM   238  C  CD2 . LEU A 1 33  ? 30.029 58.364 58.879 1.00 30.16  ? 33  LEU A CD2 1 
ATOM   239  N  N   . TYR A 1 34  ? 26.629 60.517 55.509 1.00 24.28  ? 34  TYR A N   1 
ATOM   240  C  CA  . TYR A 1 34  ? 25.690 61.328 54.694 1.00 25.61  ? 34  TYR A CA  1 
ATOM   241  C  C   . TYR A 1 34  ? 25.347 62.621 55.395 1.00 25.23  ? 34  TYR A C   1 
ATOM   242  O  O   . TYR A 1 34  ? 24.959 63.609 54.776 1.00 28.32  ? 34  TYR A O   1 
ATOM   243  C  CB  . TYR A 1 34  ? 24.444 60.522 54.258 1.00 23.11  ? 34  TYR A CB  1 
ATOM   244  C  CG  . TYR A 1 34  ? 23.563 60.256 55.405 1.00 22.09  ? 34  TYR A CG  1 
ATOM   245  C  CD1 . TYR A 1 34  ? 22.487 61.076 55.714 1.00 25.29  ? 34  TYR A CD1 1 
ATOM   246  C  CD2 . TYR A 1 34  ? 23.838 59.181 56.210 1.00 24.60  ? 34  TYR A CD2 1 
ATOM   247  C  CE1 . TYR A 1 34  ? 21.697 60.839 56.786 1.00 27.11  ? 34  TYR A CE1 1 
ATOM   248  C  CE2 . TYR A 1 34  ? 23.013 58.943 57.319 1.00 25.43  ? 34  TYR A CE2 1 
ATOM   249  C  CZ  . TYR A 1 34  ? 21.956 59.749 57.595 1.00 26.59  ? 34  TYR A CZ  1 
ATOM   250  O  OH  . TYR A 1 34  ? 21.151 59.524 58.679 1.00 26.65  ? 34  TYR A OH  1 
ATOM   251  N  N   . LEU A 1 35  ? 25.437 62.697 56.727 1.00 27.24  ? 35  LEU A N   1 
ATOM   252  C  CA  . LEU A 1 35  ? 25.052 63.934 57.409 1.00 25.74  ? 35  LEU A CA  1 
ATOM   253  C  C   . LEU A 1 35  ? 25.999 65.067 57.057 1.00 26.61  ? 35  LEU A C   1 
ATOM   254  O  O   . LEU A 1 35  ? 25.506 66.194 56.989 1.00 31.36  ? 35  LEU A O   1 
ATOM   255  C  CB  . LEU A 1 35  ? 24.981 63.794 58.950 1.00 26.58  ? 35  LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 35  ? 23.869 62.859 59.427 1.00 26.27  ? 35  LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 35  ? 24.005 62.529 60.894 1.00 32.58  ? 35  LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 35  ? 22.473 63.429 59.175 1.00 27.71  ? 35  LEU A CD2 1 
ATOM   259  N  N   . GLU A 1 36  ? 27.223 64.683 56.846 1.00 27.19  ? 36  GLU A N   1 
ATOM   260  C  CA  . GLU A 1 36  ? 28.345 65.556 56.508 1.00 31.45  ? 36  GLU A CA  1 
ATOM   261  C  C   . GLU A 1 36  ? 28.549 65.701 55.004 1.00 33.30  ? 36  GLU A C   1 
ATOM   262  O  O   . GLU A 1 36  ? 28.932 66.761 54.465 1.00 33.59  ? 36  GLU A O   1 
ATOM   263  C  CB  A GLU A 1 36  ? 29.584 65.017 57.236 0.41 41.56  ? 36  GLU A CB  1 
ATOM   264  C  CB  B GLU A 1 36  ? 29.654 64.986 57.066 0.59 38.60  ? 36  GLU A CB  1 
ATOM   265  C  CG  A GLU A 1 36  ? 29.428 65.306 58.733 0.41 48.44  ? 36  GLU A CG  1 
ATOM   266  C  CG  B GLU A 1 36  ? 29.770 64.822 58.558 0.59 47.97  ? 36  GLU A CG  1 
ATOM   267  C  CD  A GLU A 1 36  ? 29.506 64.087 59.630 0.41 47.23  ? 36  GLU A CD  1 
ATOM   268  C  CD  B GLU A 1 36  ? 31.086 64.322 59.118 0.59 52.87  ? 36  GLU A CD  1 
ATOM   269  O  OE1 A GLU A 1 36  ? 30.650 63.785 60.074 0.41 49.57  ? 36  GLU A OE1 1 
ATOM   270  O  OE1 B GLU A 1 36  ? 32.064 64.087 58.378 0.59 49.32  ? 36  GLU A OE1 1 
ATOM   271  O  OE2 A GLU A 1 36  ? 28.467 63.447 59.924 0.41 49.78  ? 36  GLU A OE2 1 
ATOM   272  O  OE2 B GLU A 1 36  ? 31.204 64.140 60.363 0.59 53.65  ? 36  GLU A OE2 1 
ATOM   273  N  N   . ASN A 1 37  ? 28.311 64.575 54.340 1.00 29.29  ? 37  ASN A N   1 
ATOM   274  C  CA  . ASN A 1 37  ? 28.606 64.423 52.917 1.00 28.41  ? 37  ASN A CA  1 
ATOM   275  C  C   . ASN A 1 37  ? 27.441 63.818 52.170 1.00 30.54  ? 37  ASN A C   1 
ATOM   276  O  O   . ASN A 1 37  ? 27.552 62.675 51.702 1.00 28.15  ? 37  ASN A O   1 
ATOM   277  C  CB  . ASN A 1 37  ? 29.818 63.530 52.694 1.00 32.94  ? 37  ASN A CB  1 
ATOM   278  C  CG  . ASN A 1 37  ? 31.104 63.989 53.288 1.00 40.41  ? 37  ASN A CG  1 
ATOM   279  O  OD1 . ASN A 1 37  ? 31.531 65.096 52.906 1.00 49.96  ? 37  ASN A OD1 1 
ATOM   280  N  ND2 . ASN A 1 37  ? 31.748 63.219 54.152 1.00 51.16  ? 37  ASN A ND2 1 
ATOM   281  N  N   . PRO A 1 38  ? 26.359 64.563 52.114 1.00 29.26  ? 38  PRO A N   1 
ATOM   282  C  CA  . PRO A 1 38  ? 25.146 64.003 51.525 1.00 29.40  ? 38  PRO A CA  1 
ATOM   283  C  C   . PRO A 1 38  ? 25.342 63.748 50.041 1.00 24.97  ? 38  PRO A C   1 
ATOM   284  O  O   . PRO A 1 38  ? 26.205 64.363 49.409 1.00 27.73  ? 38  PRO A O   1 
ATOM   285  C  CB  . PRO A 1 38  ? 24.074 65.088 51.694 1.00 30.57  ? 38  PRO A CB  1 
ATOM   286  C  CG  . PRO A 1 38  ? 24.897 66.350 51.797 1.00 31.34  ? 38  PRO A CG  1 
ATOM   287  C  CD  . PRO A 1 38  ? 26.145 65.936 52.575 1.00 30.47  ? 38  PRO A CD  1 
ATOM   288  N  N   . PRO A 1 39  ? 24.535 62.891 49.451 1.00 28.09  ? 39  PRO A N   1 
ATOM   289  C  CA  . PRO A 1 39  ? 24.596 62.675 47.983 1.00 26.38  ? 39  PRO A CA  1 
ATOM   290  C  C   . PRO A 1 39  ? 24.257 63.954 47.262 1.00 26.06  ? 39  PRO A C   1 
ATOM   291  O  O   . PRO A 1 39  ? 23.608 64.857 47.770 1.00 27.64  ? 39  PRO A O   1 
ATOM   292  C  CB  . PRO A 1 39  ? 23.502 61.616 47.745 1.00 26.18  ? 39  PRO A CB  1 
ATOM   293  C  CG  . PRO A 1 39  ? 22.585 61.805 48.915 1.00 24.52  ? 39  PRO A CG  1 
ATOM   294  C  CD  . PRO A 1 39  ? 23.468 62.112 50.074 1.00 27.61  ? 39  PRO A CD  1 
ATOM   295  N  N   . SER A 1 40  ? 24.686 64.065 46.008 1.00 26.39  ? 40  SER A N   1 
ATOM   296  C  CA  . SER A 1 40  ? 24.249 65.146 45.168 1.00 25.40  ? 40  SER A CA  1 
ATOM   297  C  C   . SER A 1 40  ? 22.782 64.897 44.730 1.00 23.90  ? 40  SER A C   1 
ATOM   298  O  O   . SER A 1 40  ? 22.239 63.831 44.949 1.00 25.71  ? 40  SER A O   1 
ATOM   299  C  CB  . SER A 1 40  ? 25.091 65.220 43.932 1.00 28.21  ? 40  SER A CB  1 
ATOM   300  O  OG  . SER A 1 40  ? 24.986 64.109 43.104 1.00 28.32  ? 40  SER A OG  1 
ATOM   301  N  N   . ARG A 1 41  ? 22.176 65.924 44.131 1.00 26.38  ? 41  ARG A N   1 
ATOM   302  C  CA  . ARG A 1 41  ? 20.776 65.721 43.715 1.00 25.14  ? 41  ARG A CA  1 
ATOM   303  C  C   . ARG A 1 41  ? 20.659 64.540 42.764 1.00 24.41  ? 41  ARG A C   1 
ATOM   304  O  O   . ARG A 1 41  ? 19.817 63.663 42.959 1.00 26.93  ? 41  ARG A O   1 
ATOM   305  C  CB  . ARG A 1 41  ? 20.233 66.999 43.044 1.00 27.46  ? 41  ARG A CB  1 
ATOM   306  C  CG  . ARG A 1 41  ? 18.738 67.094 42.914 1.00 27.38  ? 41  ARG A CG  1 
ATOM   307  C  CD  . ARG A 1 41  ? 18.126 68.406 42.545 1.00 25.98  ? 41  ARG A CD  1 
ATOM   308  N  NE  . ARG A 1 41  ? 16.722 68.538 42.988 1.00 26.97  ? 41  ARG A NE  1 
ATOM   309  C  CZ  . ARG A 1 41  ? 15.718 67.862 42.484 1.00 25.88  ? 41  ARG A CZ  1 
ATOM   310  N  NH1 . ARG A 1 41  ? 15.926 66.984 41.484 1.00 26.78  ? 41  ARG A NH1 1 
ATOM   311  N  NH2 . ARG A 1 41  ? 14.467 68.000 42.908 1.00 26.60  ? 41  ARG A NH2 1 
ATOM   312  N  N   . ASP A 1 42  ? 21.507 64.508 41.770 1.00 27.50  ? 42  ASP A N   1 
ATOM   313  C  CA  . ASP A 1 42  ? 21.423 63.444 40.787 1.00 26.61  ? 42  ASP A CA  1 
ATOM   314  C  C   . ASP A 1 42  ? 21.547 62.095 41.445 1.00 27.74  ? 42  ASP A C   1 
ATOM   315  O  O   . ASP A 1 42  ? 20.832 61.115 41.206 1.00 28.31  ? 42  ASP A O   1 
ATOM   316  C  CB  . ASP A 1 42  ? 22.469 63.625 39.686 1.00 35.28  ? 42  ASP A CB  1 
ATOM   317  C  CG  . ASP A 1 42  ? 22.158 64.749 38.728 1.00 41.26  ? 42  ASP A CG  1 
ATOM   318  O  OD1 . ASP A 1 42  ? 21.031 65.269 38.665 1.00 47.40  ? 42  ASP A OD1 1 
ATOM   319  O  OD2 . ASP A 1 42  ? 23.120 65.127 38.002 1.00 47.96  ? 42  ASP A OD2 1 
ATOM   320  N  N   . GLU A 1 43  ? 22.429 61.953 42.381 1.00 26.58  ? 43  GLU A N   1 
ATOM   321  C  CA  . GLU A 1 43  ? 22.711 60.697 43.037 1.00 28.87  ? 43  GLU A CA  1 
ATOM   322  C  C   . GLU A 1 43  ? 21.530 60.265 43.922 1.00 26.08  ? 43  GLU A C   1 
ATOM   323  O  O   . GLU A 1 43  ? 21.201 59.085 43.944 1.00 29.50  ? 43  GLU A O   1 
ATOM   324  C  CB  A GLU A 1 43  ? 23.950 60.839 43.926 0.48 31.88  ? 43  GLU A CB  1 
ATOM   325  C  CB  B GLU A 1 43  ? 23.961 60.643 43.894 0.52 29.66  ? 43  GLU A CB  1 
ATOM   326  C  CG  A GLU A 1 43  ? 25.288 61.298 43.416 0.48 32.70  ? 43  GLU A CG  1 
ATOM   327  C  CG  B GLU A 1 43  ? 24.020 59.260 44.538 0.52 27.70  ? 43  GLU A CG  1 
ATOM   328  C  CD  A GLU A 1 43  ? 26.484 61.510 44.329 0.48 33.92  ? 43  GLU A CD  1 
ATOM   329  C  CD  B GLU A 1 43  ? 24.319 58.101 43.621 0.52 35.31  ? 43  GLU A CD  1 
ATOM   330  O  OE1 A GLU A 1 43  ? 26.475 61.756 45.530 0.48 37.95  ? 43  GLU A OE1 1 
ATOM   331  O  OE1 B GLU A 1 43  ? 24.625 58.326 42.449 0.52 35.78  ? 43  GLU A OE1 1 
ATOM   332  O  OE2 A GLU A 1 43  ? 27.614 61.457 43.754 0.48 37.50  ? 43  GLU A OE2 1 
ATOM   333  O  OE2 B GLU A 1 43  ? 24.268 56.957 44.086 0.52 33.16  ? 43  GLU A OE2 1 
ATOM   334  N  N   . LEU A 1 44  ? 21.063 61.337 44.599 1.00 26.09  ? 44  LEU A N   1 
ATOM   335  C  CA  . LEU A 1 44  ? 19.892 61.073 45.473 1.00 23.75  ? 44  LEU A CA  1 
ATOM   336  C  C   . LEU A 1 44  ? 18.688 60.575 44.666 1.00 22.57  ? 44  LEU A C   1 
ATOM   337  O  O   . LEU A 1 44  ? 18.037 59.601 45.034 1.00 26.20  ? 44  LEU A O   1 
ATOM   338  C  CB  . LEU A 1 44  ? 19.501 62.277 46.319 1.00 24.38  ? 44  LEU A CB  1 
ATOM   339  C  CG  . LEU A 1 44  ? 18.357 62.107 47.324 1.00 23.09  ? 44  LEU A CG  1 
ATOM   340  C  CD1 . LEU A 1 44  ? 18.516 60.926 48.296 1.00 28.43  ? 44  LEU A CD1 1 
ATOM   341  C  CD2 . LEU A 1 44  ? 18.240 63.449 48.041 1.00 24.78  ? 44  LEU A CD2 1 
ATOM   342  N  N   . VAL A 1 45  ? 18.418 61.239 43.552 1.00 26.35  ? 45  VAL A N   1 
ATOM   343  C  CA  . VAL A 1 45  ? 17.334 60.829 42.646 1.00 25.74  ? 45  VAL A CA  1 
ATOM   344  C  C   . VAL A 1 45  ? 17.509 59.393 42.180 1.00 25.89  ? 45  VAL A C   1 
ATOM   345  O  O   . VAL A 1 45  ? 16.599 58.537 42.139 1.00 28.05  ? 45  VAL A O   1 
ATOM   346  C  CB  . VAL A 1 45  ? 17.248 61.764 41.445 1.00 28.20  ? 45  VAL A CB  1 
ATOM   347  C  CG1 . VAL A 1 45  ? 16.453 61.121 40.294 1.00 26.55  ? 45  VAL A CG1 1 
ATOM   348  C  CG2 . VAL A 1 45  ? 16.657 63.141 41.828 1.00 33.85  ? 45  VAL A CG2 1 
ATOM   349  N  N   . LYS A 1 46  ? 18.754 59.033 41.879 1.00 26.55  ? 46  LYS A N   1 
ATOM   350  C  CA  . LYS A 1 46  ? 19.084 57.681 41.433 1.00 26.00  ? 46  LYS A CA  1 
ATOM   351  C  C   . LYS A 1 46  ? 18.924 56.645 42.538 1.00 24.01  ? 46  LYS A C   1 
ATOM   352  O  O   . LYS A 1 46  ? 18.348 55.554 42.364 1.00 29.41  ? 46  LYS A O   1 
ATOM   353  C  CB  A LYS A 1 46  ? 20.517 57.637 40.894 0.51 32.60  ? 46  LYS A CB  1 
ATOM   354  C  CB  B LYS A 1 46  ? 20.523 57.666 40.918 0.49 32.54  ? 46  LYS A CB  1 
ATOM   355  C  CG  A LYS A 1 46  ? 20.928 56.305 40.296 0.51 38.55  ? 46  LYS A CG  1 
ATOM   356  C  CG  B LYS A 1 46  ? 20.961 56.314 40.385 0.49 37.20  ? 46  LYS A CG  1 
ATOM   357  C  CD  A LYS A 1 46  ? 22.400 56.268 39.884 0.51 42.26  ? 46  LYS A CD  1 
ATOM   358  C  CD  B LYS A 1 46  ? 22.379 56.353 39.819 0.49 42.16  ? 46  LYS A CD  1 
ATOM   359  C  CE  A LYS A 1 46  ? 22.989 54.874 40.009 0.51 44.12  ? 46  LYS A CE  1 
ATOM   360  C  CE  B LYS A 1 46  ? 23.049 54.990 39.922 0.49 43.88  ? 46  LYS A CE  1 
ATOM   361  N  NZ  A LYS A 1 46  ? 24.402 54.765 39.549 0.51 48.88  ? 46  LYS A NZ  1 
ATOM   362  N  NZ  B LYS A 1 46  ? 22.331 53.946 39.130 0.49 57.94  ? 46  LYS A NZ  1 
ATOM   363  N  N   . LEU A 1 47  ? 19.423 57.004 43.726 1.00 25.09  ? 47  LEU A N   1 
ATOM   364  C  CA  . LEU A 1 47  ? 19.268 56.104 44.870 1.00 23.29  ? 47  LEU A CA  1 
ATOM   365  C  C   . LEU A 1 47  ? 17.815 55.774 45.108 1.00 22.85  ? 47  LEU A C   1 
ATOM   366  O  O   . LEU A 1 47  ? 17.396 54.643 45.321 1.00 25.28  ? 47  LEU A O   1 
ATOM   367  C  CB  . LEU A 1 47  ? 19.851 56.753 46.127 1.00 23.52  ? 47  LEU A CB  1 
ATOM   368  C  CG  . LEU A 1 47  ? 21.369 56.847 46.180 1.00 23.62  ? 47  LEU A CG  1 
ATOM   369  C  CD1 . LEU A 1 47  ? 21.746 57.751 47.366 1.00 25.75  ? 47  LEU A CD1 1 
ATOM   370  C  CD2 . LEU A 1 47  ? 22.102 55.511 46.293 1.00 23.86  ? 47  LEU A CD2 1 
ATOM   371  N  N   . ILE A 1 48  ? 16.963 56.780 45.087 1.00 24.82  ? 48  ILE A N   1 
ATOM   372  C  CA  . ILE A 1 48  ? 15.546 56.564 45.329 1.00 24.38  ? 48  ILE A CA  1 
ATOM   373  C  C   . ILE A 1 48  ? 14.914 55.671 44.275 1.00 25.55  ? 48  ILE A C   1 
ATOM   374  O  O   . ILE A 1 48  ? 14.171 54.737 44.581 1.00 29.23  ? 48  ILE A O   1 
ATOM   375  C  CB  . ILE A 1 48  ? 14.849 57.941 45.388 1.00 24.92  ? 48  ILE A CB  1 
ATOM   376  C  CG1 . ILE A 1 48  ? 15.191 58.744 46.621 1.00 23.41  ? 48  ILE A CG1 1 
ATOM   377  C  CG2 . ILE A 1 48  ? 13.344 57.755 45.283 1.00 27.34  ? 48  ILE A CG2 1 
ATOM   378  C  CD1 . ILE A 1 48  ? 14.805 60.194 46.652 1.00 28.47  ? 48  ILE A CD1 1 
ATOM   379  N  N   . ALA A 1 49  ? 15.210 55.954 42.999 1.00 27.22  ? 49  ALA A N   1 
ATOM   380  C  CA  . ALA A 1 49  ? 14.717 55.069 41.927 1.00 28.43  ? 49  ALA A CA  1 
ATOM   381  C  C   . ALA A 1 49  ? 15.164 53.624 42.157 1.00 28.47  ? 49  ALA A C   1 
ATOM   382  O  O   . ALA A 1 49  ? 14.399 52.652 42.065 1.00 31.50  ? 49  ALA A O   1 
ATOM   383  C  CB  . ALA A 1 49  ? 15.245 55.602 40.628 1.00 33.25  ? 49  ALA A CB  1 
ATOM   384  N  N   . ASP A 1 50  ? 16.444 53.439 42.481 1.00 28.15  ? 50  ASP A N   1 
ATOM   385  C  CA  . ASP A 1 50  ? 16.925 52.068 42.611 1.00 26.77  ? 50  ASP A CA  1 
ATOM   386  C  C   . ASP A 1 50  ? 16.310 51.374 43.823 1.00 29.39  ? 50  ASP A C   1 
ATOM   387  O  O   . ASP A 1 50  ? 16.146 50.137 43.759 1.00 29.06  ? 50  ASP A O   1 
ATOM   388  C  CB  . ASP A 1 50  ? 18.440 52.088 42.643 1.00 24.72  ? 50  ASP A CB  1 
ATOM   389  C  CG  . ASP A 1 50  ? 19.051 52.502 41.333 1.00 26.91  ? 50  ASP A CG  1 
ATOM   390  O  OD1 . ASP A 1 50  ? 20.290 52.705 41.305 1.00 34.78  ? 50  ASP A OD1 1 
ATOM   391  O  OD2 . ASP A 1 50  ? 18.353 52.612 40.289 1.00 31.84  ? 50  ASP A OD2 1 
ATOM   392  N  N   . MET A 1 51  ? 15.999 52.156 44.851 1.00 26.85  ? 51  MET A N   1 
ATOM   393  C  CA  . MET A 1 51  ? 15.489 51.586 46.077 1.00 27.76  ? 51  MET A CA  1 
ATOM   394  C  C   . MET A 1 51  ? 14.036 51.114 45.946 1.00 28.91  ? 51  MET A C   1 
ATOM   395  O  O   . MET A 1 51  ? 13.587 50.383 46.826 1.00 33.09  ? 51  MET A O   1 
ATOM   396  C  CB  A MET A 1 51  ? 15.518 52.608 47.223 0.36 31.14  ? 51  MET A CB  1 
ATOM   397  C  CB  B MET A 1 51  ? 15.468 52.597 47.248 0.64 30.51  ? 51  MET A CB  1 
ATOM   398  C  CG  A MET A 1 51  ? 16.855 52.511 47.941 0.36 30.91  ? 51  MET A CG  1 
ATOM   399  C  CG  B MET A 1 51  ? 16.883 52.747 47.762 0.64 28.76  ? 51  MET A CG  1 
ATOM   400  S  SD  A MET A 1 51  ? 16.906 53.584 49.382 0.36 29.97  ? 51  MET A SD  1 
ATOM   401  S  SD  B MET A 1 51  ? 17.019 53.744 49.257 0.64 30.11  ? 51  MET A SD  1 
ATOM   402  C  CE  A MET A 1 51  ? 15.918 54.964 48.830 0.36 33.58  ? 51  MET A CE  1 
ATOM   403  C  CE  B MET A 1 51  ? 16.938 55.360 48.541 0.64 26.38  ? 51  MET A CE  1 
ATOM   404  N  N   . GLY A 1 52  ? 13.422 51.643 44.921 1.00 30.24  ? 52  GLY A N   1 
ATOM   405  C  CA  . GLY A 1 52  ? 12.045 51.373 44.596 1.00 33.24  ? 52  GLY A CA  1 
ATOM   406  C  C   . GLY A 1 52  ? 11.095 51.795 45.689 1.00 34.38  ? 52  GLY A C   1 
ATOM   407  O  O   . GLY A 1 52  ? 10.055 51.155 45.886 1.00 38.43  ? 52  GLY A O   1 
ATOM   408  N  N   . ILE A 1 53  ? 11.383 52.842 46.442 1.00 32.39  ? 53  ILE A N   1 
ATOM   409  C  CA  . ILE A 1 53  ? 10.354 53.310 47.372 1.00 26.05  ? 53  ILE A CA  1 
ATOM   410  C  C   . ILE A 1 53  ? 10.028 54.736 46.984 1.00 26.72  ? 53  ILE A C   1 
ATOM   411  O  O   . ILE A 1 53  ? 10.734 55.321 46.153 1.00 28.83  ? 53  ILE A O   1 
ATOM   412  C  CB  . ILE A 1 53  ? 10.855 53.319 48.813 1.00 29.80  ? 53  ILE A CB  1 
ATOM   413  C  CG1 . ILE A 1 53  ? 12.034 54.300 48.915 1.00 34.82  ? 53  ILE A CG1 1 
ATOM   414  C  CG2 . ILE A 1 53  ? 11.180 51.921 49.294 1.00 34.49  ? 53  ILE A CG2 1 
ATOM   415  C  CD1 . ILE A 1 53  ? 12.630 54.312 50.336 1.00 35.71  ? 53  ILE A CD1 1 
ATOM   416  N  N   . SER A 1 54  ? 8.995  55.325 47.579 1.00 27.57  ? 54  SER A N   1 
ATOM   417  C  CA  . SER A 1 54  ? 8.645  56.679 47.228 1.00 24.33  ? 54  SER A CA  1 
ATOM   418  C  C   . SER A 1 54  ? 9.583  57.725 47.796 1.00 24.82  ? 54  SER A C   1 
ATOM   419  O  O   . SER A 1 54  ? 10.238 57.340 48.749 1.00 25.18  ? 54  SER A O   1 
ATOM   420  C  CB  . SER A 1 54  ? 7.254  57.054 47.755 1.00 26.69  ? 54  SER A CB  1 
ATOM   421  O  OG  . SER A 1 54  ? 7.240  56.981 49.181 1.00 28.66  ? 54  SER A OG  1 
ATOM   422  N  N   . VAL A 1 55  ? 9.579  58.961 47.289 1.00 24.81  ? 55  VAL A N   1 
ATOM   423  C  CA  . VAL A 1 55  ? 10.414 59.942 47.947 1.00 23.27  ? 55  VAL A CA  1 
ATOM   424  C  C   . VAL A 1 55  ? 10.022 60.121 49.405 1.00 23.49  ? 55  VAL A C   1 
ATOM   425  O  O   . VAL A 1 55  ? 10.857 60.119 50.344 1.00 24.29  ? 55  VAL A O   1 
ATOM   426  C  CB  . VAL A 1 55  ? 10.347 61.268 47.184 1.00 24.92  ? 55  VAL A CB  1 
ATOM   427  C  CG1 . VAL A 1 55  ? 11.085 62.377 47.941 1.00 27.04  ? 55  VAL A CG1 1 
ATOM   428  C  CG2 . VAL A 1 55  ? 10.908 61.141 45.762 1.00 30.95  ? 55  VAL A CG2 1 
ATOM   429  N  N   . ARG A 1 56  ? 8.724  60.236 49.634 1.00 23.53  ? 56  ARG A N   1 
ATOM   430  C  CA  . ARG A 1 56  ? 8.267  60.486 51.007 1.00 23.82  ? 56  ARG A CA  1 
ATOM   431  C  C   . ARG A 1 56  ? 8.666  59.325 51.904 1.00 24.26  ? 56  ARG A C   1 
ATOM   432  O  O   . ARG A 1 56  ? 8.950  59.555 53.083 1.00 25.83  ? 56  ARG A O   1 
ATOM   433  C  CB  . ARG A 1 56  ? 6.769  60.715 51.052 1.00 24.36  ? 56  ARG A CB  1 
ATOM   434  C  CG  . ARG A 1 56  ? 6.268  60.760 52.513 1.00 24.60  ? 56  ARG A CG  1 
ATOM   435  C  CD  . ARG A 1 56  ? 4.803  61.192 52.460 1.00 25.22  ? 56  ARG A CD  1 
ATOM   436  N  NE  . ARG A 1 56  ? 4.635  62.631 52.183 1.00 26.89  ? 56  ARG A NE  1 
ATOM   437  C  CZ  . ARG A 1 56  ? 4.803  63.617 53.081 1.00 23.56  ? 56  ARG A CZ  1 
ATOM   438  N  NH1 . ARG A 1 56  ? 4.627  64.884 52.712 1.00 23.37  ? 56  ARG A NH1 1 
ATOM   439  N  NH2 . ARG A 1 56  ? 5.150  63.346 54.323 1.00 26.29  ? 56  ARG A NH2 1 
ATOM   440  N  N   . ALA A 1 57  ? 8.689  58.095 51.418 1.00 24.28  ? 57  ALA A N   1 
ATOM   441  C  CA  . ALA A 1 57  ? 9.079  56.962 52.257 1.00 24.56  ? 57  ALA A CA  1 
ATOM   442  C  C   . ALA A 1 57  ? 10.536 57.018 52.729 1.00 23.15  ? 57  ALA A C   1 
ATOM   443  O  O   . ALA A 1 57  ? 10.943 56.380 53.707 1.00 24.57  ? 57  ALA A O   1 
ATOM   444  C  CB  . ALA A 1 57  ? 8.883  55.657 51.513 1.00 28.71  ? 57  ALA A CB  1 
ATOM   445  N  N   . LEU A 1 58  ? 11.377 57.794 52.077 1.00 24.77  ? 58  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 58  ? 12.765 57.983 52.533 1.00 28.12  ? 58  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 58  ? 12.894 59.030 53.631 1.00 26.09  ? 58  LEU A C   1 
ATOM   448  O  O   . LEU A 1 58  ? 13.938 59.157 54.299 1.00 23.85  ? 58  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 58  ? 13.665 58.401 51.357 1.00 26.14  ? 58  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 58  ? 15.178 58.496 51.571 1.00 23.00  ? 58  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 58  ? 15.676 57.182 52.176 1.00 23.29  ? 58  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 58  ? 15.900 58.824 50.273 1.00 26.37  ? 58  LEU A CD2 1 
ATOM   453  N  N   . LEU A 1 59  ? 11.883 59.876 53.858 1.00 24.29  ? 59  LEU A N   1 
ATOM   454  C  CA  . LEU A 1 59  ? 11.995 60.949 54.826 1.00 26.81  ? 59  LEU A CA  1 
ATOM   455  C  C   . LEU A 1 59  ? 12.034 60.461 56.268 1.00 23.33  ? 59  LEU A C   1 
ATOM   456  O  O   . LEU A 1 59  ? 11.120 59.698 56.635 1.00 27.19  ? 59  LEU A O   1 
ATOM   457  C  CB  . LEU A 1 59  ? 10.767 61.878 54.777 1.00 26.98  ? 59  LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 59  ? 10.641 62.850 53.635 1.00 24.56  ? 59  LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 59  ? 9.333  63.583 53.676 1.00 23.36  ? 59  LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 59  ? 11.800 63.826 53.720 1.00 28.01  ? 59  LEU A CD2 1 
ATOM   461  N  N   . ARG A 1 60  ? 12.980 60.805 57.109 1.00 25.34  ? 60  ARG A N   1 
ATOM   462  C  CA  . ARG A 1 60  ? 12.954 60.431 58.503 1.00 25.79  ? 60  ARG A CA  1 
ATOM   463  C  C   . ARG A 1 60  ? 12.049 61.405 59.216 1.00 26.82  ? 60  ARG A C   1 
ATOM   464  O  O   . ARG A 1 60  ? 12.217 62.622 59.038 1.00 27.09  ? 60  ARG A O   1 
ATOM   465  C  CB  . ARG A 1 60  ? 14.383 60.469 59.043 1.00 28.14  ? 60  ARG A CB  1 
ATOM   466  C  CG  . ARG A 1 60  ? 14.619 60.025 60.464 1.00 34.31  ? 60  ARG A CG  1 
ATOM   467  C  CD  . ARG A 1 60  ? 16.107 60.070 60.753 1.00 35.70  ? 60  ARG A CD  1 
ATOM   468  N  NE  . ARG A 1 60  ? 16.370 60.270 62.172 1.00 36.29  ? 60  ARG A NE  1 
ATOM   469  C  CZ  . ARG A 1 60  ? 17.513 60.518 62.779 1.00 36.10  ? 60  ARG A CZ  1 
ATOM   470  N  NH1 . ARG A 1 60  ? 18.582 60.561 61.967 1.00 51.39  ? 60  ARG A NH1 1 
ATOM   471  N  NH2 . ARG A 1 60  ? 17.679 60.700 64.096 1.00 42.83  ? 60  ARG A NH2 1 
ATOM   472  N  N   . LYS A 1 61  ? 11.127 60.859 59.985 1.00 27.40  ? 61  LYS A N   1 
ATOM   473  C  CA  . LYS A 1 61  ? 10.247 61.680 60.784 1.00 26.47  ? 61  LYS A CA  1 
ATOM   474  C  C   . LYS A 1 61  ? 10.916 62.049 62.087 1.00 31.18  ? 61  LYS A C   1 
ATOM   475  O  O   . LYS A 1 61  ? 11.943 61.504 62.482 1.00 36.83  ? 61  LYS A O   1 
ATOM   476  C  CB  . LYS A 1 61  ? 9.016  60.857 61.069 1.00 26.19  ? 61  LYS A CB  1 
ATOM   477  C  CG  . LYS A 1 61  ? 8.362  60.307 59.840 1.00 26.66  ? 61  LYS A CG  1 
ATOM   478  C  CD  . LYS A 1 61  ? 7.078  59.563 60.142 1.00 33.24  ? 61  LYS A CD  1 
ATOM   479  C  CE  . LYS A 1 61  ? 6.410  59.050 58.872 1.00 36.71  ? 61  LYS A CE  1 
ATOM   480  N  NZ  . LYS A 1 61  ? 5.120  58.447 59.346 1.00 46.43  ? 61  LYS A NZ  1 
ATOM   481  N  N   . ASN A 1 62  ? 10.456 62.963 62.848 1.00 34.66  ? 62  ASN A N   1 
ATOM   482  C  CA  . ASN A 1 62  ? 10.978 62.989 64.262 1.00 31.93  ? 62  ASN A CA  1 
ATOM   483  C  C   . ASN A 1 62  ? 12.426 63.517 64.338 1.00 29.39  ? 62  ASN A C   1 
ATOM   484  O  O   . ASN A 1 62  ? 13.241 63.212 65.209 1.00 32.86  ? 62  ASN A O   1 
ATOM   485  C  CB  . ASN A 1 62  ? 10.832 61.672 65.022 1.00 45.18  ? 62  ASN A CB  1 
ATOM   486  C  CG  . ASN A 1 62  ? 9.413  61.200 65.241 1.00 48.29  ? 62  ASN A CG  1 
ATOM   487  O  OD1 . ASN A 1 62  ? 8.575  61.844 65.892 1.00 60.03  ? 62  ASN A OD1 1 
ATOM   488  N  ND2 . ASN A 1 62  ? 9.030  60.007 64.757 1.00 51.69  ? 62  ASN A ND2 1 
ATOM   489  N  N   . VAL A 1 63  ? 12.706 64.375 63.384 1.00 25.85  ? 63  VAL A N   1 
ATOM   490  C  CA  . VAL A 1 63  ? 13.897 65.206 63.352 1.00 22.70  ? 63  VAL A CA  1 
ATOM   491  C  C   . VAL A 1 63  ? 13.461 66.657 63.145 1.00 23.25  ? 63  VAL A C   1 
ATOM   492  O  O   . VAL A 1 63  ? 12.388 66.891 62.578 1.00 22.99  ? 63  VAL A O   1 
ATOM   493  C  CB  . VAL A 1 63  ? 14.884 64.734 62.298 1.00 22.87  ? 63  VAL A CB  1 
ATOM   494  C  CG1 . VAL A 1 63  ? 15.410 63.353 62.627 1.00 25.97  ? 63  VAL A CG1 1 
ATOM   495  C  CG2 . VAL A 1 63  ? 14.291 64.757 60.877 1.00 24.39  ? 63  VAL A CG2 1 
ATOM   496  N  N   . GLU A 1 64  ? 14.227 67.594 63.629 1.00 22.85  ? 64  GLU A N   1 
ATOM   497  C  CA  . GLU A 1 64  ? 13.864 69.011 63.673 1.00 22.03  ? 64  GLU A CA  1 
ATOM   498  C  C   . GLU A 1 64  ? 13.320 69.571 62.352 1.00 21.57  ? 64  GLU A C   1 
ATOM   499  O  O   . GLU A 1 64  ? 12.268 70.231 62.345 1.00 24.42  ? 64  GLU A O   1 
ATOM   500  C  CB  . GLU A 1 64  ? 15.008 69.886 64.190 1.00 24.96  ? 64  GLU A CB  1 
ATOM   501  C  CG  . GLU A 1 64  ? 14.620 71.314 64.444 1.00 25.82  ? 64  GLU A CG  1 
ATOM   502  C  CD  . GLU A 1 64  ? 15.637 72.041 65.314 1.00 28.94  ? 64  GLU A CD  1 
ATOM   503  O  OE1 . GLU A 1 64  ? 15.359 73.209 65.655 1.00 30.37  ? 64  GLU A OE1 1 
ATOM   504  O  OE2 . GLU A 1 64  ? 16.698 71.557 65.707 1.00 30.38  ? 64  GLU A OE2 1 
ATOM   505  N  N   . PRO A 1 65  ? 13.954 69.439 61.200 1.00 23.01  ? 65  PRO A N   1 
ATOM   506  C  CA  . PRO A 1 65  ? 13.426 69.978 59.949 1.00 24.05  ? 65  PRO A CA  1 
ATOM   507  C  C   . PRO A 1 65  ? 12.105 69.307 59.561 1.00 23.98  ? 65  PRO A C   1 
ATOM   508  O  O   . PRO A 1 65  ? 11.208 69.955 59.001 1.00 23.17  ? 65  PRO A O   1 
ATOM   509  C  CB  . PRO A 1 65  ? 14.517 69.730 58.896 1.00 25.28  ? 65  PRO A CB  1 
ATOM   510  C  CG  . PRO A 1 65  ? 15.363 68.675 59.511 1.00 29.13  ? 65  PRO A CG  1 
ATOM   511  C  CD  . PRO A 1 65  ? 15.280 68.861 60.990 1.00 25.54  ? 65  PRO A CD  1 
ATOM   512  N  N   . TYR A 1 66  ? 11.962 68.008 59.826 1.00 22.15  ? 66  TYR A N   1 
ATOM   513  C  CA  . TYR A 1 66  ? 10.667 67.392 59.453 1.00 23.53  ? 66  TYR A CA  1 
ATOM   514  C  C   . TYR A 1 66  ? 9.529  68.067 60.212 1.00 21.48  ? 66  TYR A C   1 
ATOM   515  O  O   . TYR A 1 66  ? 8.459  68.301 59.639 1.00 21.98  ? 66  TYR A O   1 
ATOM   516  C  CB  . TYR A 1 66  ? 10.738 65.910 59.688 1.00 23.65  ? 66  TYR A CB  1 
ATOM   517  C  CG  . TYR A 1 66  ? 9.534  65.120 59.265 1.00 22.12  ? 66  TYR A CG  1 
ATOM   518  C  CD1 . TYR A 1 66  ? 8.403  65.009 60.046 1.00 26.43  ? 66  TYR A CD1 1 
ATOM   519  C  CD2 . TYR A 1 66  ? 9.563  64.472 58.043 1.00 23.17  ? 66  TYR A CD2 1 
ATOM   520  C  CE1 . TYR A 1 66  ? 7.284  64.274 59.638 1.00 28.36  ? 66  TYR A CE1 1 
ATOM   521  C  CE2 . TYR A 1 66  ? 8.486  63.726 57.607 1.00 22.76  ? 66  TYR A CE2 1 
ATOM   522  C  CZ  . TYR A 1 66  ? 7.348  63.623 58.408 1.00 28.93  ? 66  TYR A CZ  1 
ATOM   523  O  OH  . TYR A 1 66  ? 6.236  62.893 58.018 1.00 26.82  ? 66  TYR A OH  1 
ATOM   524  N  N   . GLU A 1 67  ? 9.756  68.279 61.497 1.00 22.64  ? 67  GLU A N   1 
ATOM   525  C  CA  . GLU A 1 67  ? 8.827  68.885 62.437 1.00 23.75  ? 67  GLU A CA  1 
ATOM   526  C  C   . GLU A 1 67  ? 8.584  70.337 61.978 1.00 21.66  ? 67  GLU A C   1 
ATOM   527  O  O   . GLU A 1 67  ? 7.388  70.723 61.775 1.00 23.88  ? 67  GLU A O   1 
ATOM   528  C  CB  . GLU A 1 67  ? 9.337  68.744 63.866 1.00 22.32  ? 67  GLU A CB  1 
ATOM   529  C  CG  . GLU A 1 67  ? 9.418  67.278 64.298 1.00 27.64  ? 67  GLU A CG  1 
ATOM   530  C  CD  . GLU A 1 67  ? 10.401 66.907 65.388 1.00 27.06  ? 67  GLU A CD  1 
ATOM   531  O  OE1 . GLU A 1 67  ? 10.256 65.830 66.042 1.00 31.94  ? 67  GLU A OE1 1 
ATOM   532  O  OE2 . GLU A 1 67  ? 11.375 67.657 65.637 1.00 31.25  ? 67  GLU A OE2 1 
ATOM   533  N  N   . GLN A 1 68  ? 9.605  71.133 61.866 1.00 22.35  ? 68  GLN A N   1 
ATOM   534  C  CA  . GLN A 1 68  ? 9.437  72.568 61.709 1.00 22.08  ? 68  GLN A CA  1 
ATOM   535  C  C   . GLN A 1 68  ? 8.986  72.960 60.315 1.00 20.74  ? 68  GLN A C   1 
ATOM   536  O  O   . GLN A 1 68  ? 8.299  73.975 60.175 1.00 25.03  ? 68  GLN A O   1 
ATOM   537  C  CB  . GLN A 1 68  ? 10.714 73.329 62.092 1.00 21.60  ? 68  GLN A CB  1 
ATOM   538  C  CG  . GLN A 1 68  ? 11.013 73.211 63.588 1.00 25.24  ? 68  GLN A CG  1 
ATOM   539  C  CD  . GLN A 1 68  ? 12.291 73.905 63.982 1.00 22.47  ? 68  GLN A CD  1 
ATOM   540  O  OE1 . GLN A 1 68  ? 13.089 74.258 63.097 1.00 26.52  ? 68  GLN A OE1 1 
ATOM   541  N  NE2 . GLN A 1 68  ? 12.483 74.117 65.274 1.00 24.53  ? 68  GLN A NE2 1 
ATOM   542  N  N   . LEU A 1 69  ? 9.388  72.162 59.327 1.00 21.84  ? 69  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 69  ? 8.977  72.438 57.953 1.00 23.68  ? 69  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 69  ? 7.599  71.869 57.666 1.00 21.34  ? 69  LEU A C   1 
ATOM   545  O  O   . LEU A 1 69  ? 7.064  72.022 56.546 1.00 24.79  ? 69  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 69  ? 9.996  71.866 56.954 1.00 25.07  ? 69  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 69  ? 11.343 72.591 56.965 1.00 21.57  ? 69  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 69  ? 12.439 71.768 56.318 1.00 28.46  ? 69  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 69  ? 11.276 73.994 56.350 1.00 30.49  ? 69  LEU A CD2 1 
ATOM   550  N  N   . GLY A 1 70  ? 6.995  71.193 58.646 1.00 24.14  ? 70  GLY A N   1 
ATOM   551  C  CA  . GLY A 1 70  ? 5.639  70.662 58.488 1.00 24.85  ? 70  GLY A CA  1 
ATOM   552  C  C   . GLY A 1 70  ? 5.469  69.558 57.482 1.00 22.67  ? 70  GLY A C   1 
ATOM   553  O  O   . GLY A 1 70  ? 4.428  69.406 56.822 1.00 25.23  ? 70  GLY A O   1 
ATOM   554  N  N   . LEU A 1 71  ? 6.498  68.735 57.325 1.00 22.68  ? 71  LEU A N   1 
ATOM   555  C  CA  . LEU A 1 71  ? 6.562  67.745 56.276 1.00 22.17  ? 71  LEU A CA  1 
ATOM   556  C  C   . LEU A 1 71  ? 5.566  66.605 56.471 1.00 21.40  ? 71  LEU A C   1 
ATOM   557  O  O   . LEU A 1 71  ? 5.327  65.868 55.493 1.00 24.52  ? 71  LEU A O   1 
ATOM   558  C  CB  . LEU A 1 71  ? 8.000  67.231 56.067 1.00 22.65  ? 71  LEU A CB  1 
ATOM   559  C  CG  . LEU A 1 71  ? 9.030  68.277 55.688 1.00 22.07  ? 71  LEU A CG  1 
ATOM   560  C  CD1 . LEU A 1 71  ? 10.359 67.601 55.302 1.00 24.79  ? 71  LEU A CD1 1 
ATOM   561  C  CD2 . LEU A 1 71  ? 8.643  69.222 54.556 1.00 23.50  ? 71  LEU A CD2 1 
ATOM   562  N  N   . ALA A 1 72  ? 4.989  66.481 57.638 1.00 22.81  ? 72  ALA A N   1 
ATOM   563  C  CA  . ALA A 1 72  ? 3.971  65.497 57.872 1.00 23.79  ? 72  ALA A CA  1 
ATOM   564  C  C   . ALA A 1 72  ? 2.752  65.719 56.963 1.00 23.08  ? 72  ALA A C   1 
ATOM   565  O  O   . ALA A 1 72  ? 2.022  64.758 56.631 1.00 27.81  ? 72  ALA A O   1 
ATOM   566  C  CB  . ALA A 1 72  ? 3.522  65.488 59.318 1.00 24.80  ? 72  ALA A CB  1 
ATOM   567  N  N   . GLU A 1 73  ? 2.530  66.952 56.585 1.00 24.58  ? 73  GLU A N   1 
ATOM   568  C  CA  . GLU A 1 73  ? 1.344  67.270 55.831 1.00 25.13  ? 73  GLU A CA  1 
ATOM   569  C  C   . GLU A 1 73  ? 1.556  66.979 54.337 1.00 24.58  ? 73  GLU A C   1 
ATOM   570  O  O   . GLU A 1 73  ? 2.700  67.170 53.883 1.00 24.34  ? 73  GLU A O   1 
ATOM   571  C  CB  . GLU A 1 73  ? 1.009  68.733 55.991 1.00 29.19  ? 73  GLU A CB  1 
ATOM   572  C  CG  . GLU A 1 73  ? 0.839  69.238 57.420 1.00 39.51  ? 73  GLU A CG  1 
ATOM   573  C  CD  . GLU A 1 73  ? 0.458  70.720 57.212 1.00 57.02  ? 73  GLU A CD  1 
ATOM   574  O  OE1 . GLU A 1 73  ? 1.363  71.595 57.161 1.00 72.68  ? 73  GLU A OE1 1 
ATOM   575  O  OE2 . GLU A 1 73  ? -0.765 70.880 57.062 1.00 76.39  ? 73  GLU A OE2 1 
ATOM   576  N  N   . ASP A 1 74  ? 0.462  66.557 53.698 1.00 23.42  ? 74  ASP A N   1 
ATOM   577  C  CA  . ASP A 1 74  ? 0.501  66.200 52.270 1.00 24.96  ? 74  ASP A CA  1 
ATOM   578  C  C   . ASP A 1 74  ? 0.443  67.419 51.360 1.00 27.45  ? 74  ASP A C   1 
ATOM   579  O  O   . ASP A 1 74  ? -0.541 67.590 50.631 1.00 29.39  ? 74  ASP A O   1 
ATOM   580  C  CB  . ASP A 1 74  ? -0.607 65.219 51.896 1.00 28.08  ? 74  ASP A CB  1 
ATOM   581  C  CG  . ASP A 1 74  ? -0.416 64.633 50.529 1.00 29.24  ? 74  ASP A CG  1 
ATOM   582  O  OD1 . ASP A 1 74  ? -1.300 63.894 50.060 1.00 37.23  ? 74  ASP A OD1 1 
ATOM   583  O  OD2 . ASP A 1 74  ? 0.621  64.891 49.847 1.00 31.65  ? 74  ASP A OD2 1 
ATOM   584  N  N   . LYS A 1 75  ? 1.443  68.289 51.396 1.00 23.24  ? 75  LYS A N   1 
ATOM   585  C  CA  . LYS A 1 75  ? 1.449  69.586 50.707 1.00 23.29  ? 75  LYS A CA  1 
ATOM   586  C  C   . LYS A 1 75  ? 2.749  69.799 49.910 1.00 23.08  ? 75  LYS A C   1 
ATOM   587  O  O   . LYS A 1 75  ? 3.062  70.951 49.599 1.00 23.58  ? 75  LYS A O   1 
ATOM   588  C  CB  . LYS A 1 75  ? 1.309  70.744 51.699 1.00 29.96  ? 75  LYS A CB  1 
ATOM   589  C  CG  . LYS A 1 75  ? 0.075  70.709 52.549 1.00 36.71  ? 75  LYS A CG  1 
ATOM   590  C  CD  . LYS A 1 75  ? -0.048 71.894 53.494 1.00 42.15  ? 75  LYS A CD  1 
ATOM   591  C  CE  . LYS A 1 75  ? -1.407 71.954 54.176 1.00 54.14  ? 75  LYS A CE  1 
ATOM   592  N  NZ  . LYS A 1 75  ? -1.588 72.874 55.327 1.00 55.08  ? 75  LYS A NZ  1 
ATOM   593  N  N   . PHE A 1 76  ? 3.482  68.703 49.634 1.00 22.49  ? 76  PHE A N   1 
ATOM   594  C  CA  . PHE A 1 76  ? 4.802  68.778 49.034 1.00 22.66  ? 76  PHE A CA  1 
ATOM   595  C  C   . PHE A 1 76  ? 4.955  67.816 47.860 1.00 22.35  ? 76  PHE A C   1 
ATOM   596  O  O   . PHE A 1 76  ? 4.601  66.649 47.983 1.00 22.61  ? 76  PHE A O   1 
ATOM   597  C  CB  . PHE A 1 76  ? 5.871  68.459 50.076 1.00 22.51  ? 76  PHE A CB  1 
ATOM   598  C  CG  . PHE A 1 76  ? 5.758  69.322 51.296 1.00 21.66  ? 76  PHE A CG  1 
ATOM   599  C  CD1 . PHE A 1 76  ? 5.072  68.869 52.394 1.00 23.77  ? 76  PHE A CD1 1 
ATOM   600  C  CD2 . PHE A 1 76  ? 6.348  70.569 51.304 1.00 24.47  ? 76  PHE A CD2 1 
ATOM   601  C  CE1 . PHE A 1 76  ? 4.947  69.667 53.523 1.00 23.77  ? 76  PHE A CE1 1 
ATOM   602  C  CE2 . PHE A 1 76  ? 6.228  71.395 52.398 1.00 25.19  ? 76  PHE A CE2 1 
ATOM   603  C  CZ  . PHE A 1 76  ? 5.492  70.931 53.503 1.00 24.58  ? 76  PHE A CZ  1 
ATOM   604  N  N   . THR A 1 77  ? 5.458  68.321 46.726 1.00 22.70  ? 77  THR A N   1 
ATOM   605  C  CA  . THR A 1 77  ? 5.710  67.430 45.619 1.00 23.18  ? 77  THR A CA  1 
ATOM   606  C  C   . THR A 1 77  ? 6.987  66.607 45.915 1.00 24.06  ? 77  THR A C   1 
ATOM   607  O  O   . THR A 1 77  ? 7.737  66.941 46.828 1.00 22.88  ? 77  THR A O   1 
ATOM   608  C  CB  . THR A 1 77  ? 5.957  68.149 44.309 1.00 21.96  ? 77  THR A CB  1 
ATOM   609  O  OG1 . THR A 1 77  ? 7.087  69.001 44.526 1.00 23.70  ? 77  THR A OG1 1 
ATOM   610  C  CG2 . THR A 1 77  ? 4.881  69.128 43.936 1.00 22.82  ? 77  THR A CG2 1 
ATOM   611  N  N   . ASP A 1 78  ? 7.218  65.570 45.129 1.00 24.77  ? 78  ASP A N   1 
ATOM   612  C  CA  . ASP A 1 78  ? 8.390  64.764 45.321 1.00 22.74  ? 78  ASP A CA  1 
ATOM   613  C  C   . ASP A 1 78  ? 9.629  65.623 45.201 1.00 21.82  ? 78  ASP A C   1 
ATOM   614  O  O   . ASP A 1 78  ? 10.564 65.431 45.986 1.00 23.22  ? 78  ASP A O   1 
ATOM   615  C  CB  . ASP A 1 78  ? 8.447  63.642 44.294 1.00 24.16  ? 78  ASP A CB  1 
ATOM   616  C  CG  . ASP A 1 78  ? 7.527  62.490 44.633 1.00 24.65  ? 78  ASP A CG  1 
ATOM   617  O  OD1 . ASP A 1 78  ? 7.391  61.557 43.814 1.00 27.67  ? 78  ASP A OD1 1 
ATOM   618  O  OD2 . ASP A 1 78  ? 6.926  62.490 45.716 1.00 25.57  ? 78  ASP A OD2 1 
ATOM   619  N  N   . ASP A 1 79  ? 9.672  66.532 44.224 1.00 23.30  ? 79  ASP A N   1 
ATOM   620  C  CA  . ASP A 1 79  ? 10.948 67.306 44.061 1.00 22.57  ? 79  ASP A CA  1 
ATOM   621  C  C   . ASP A 1 79  ? 11.190 68.259 45.170 1.00 19.50  ? 79  ASP A C   1 
ATOM   622  O  O   . ASP A 1 79  ? 12.279 68.573 45.603 1.00 24.30  ? 79  ASP A O   1 
ATOM   623  C  CB  . ASP A 1 79  ? 10.966 68.016 42.690 1.00 22.13  ? 79  ASP A CB  1 
ATOM   624  C  CG  . ASP A 1 79  ? 11.314 66.945 41.662 1.00 24.13  ? 79  ASP A CG  1 
ATOM   625  O  OD1 . ASP A 1 79  ? 10.423 66.463 40.931 1.00 24.39  ? 79  ASP A OD1 1 
ATOM   626  O  OD2 . ASP A 1 79  ? 12.511 66.561 41.605 1.00 27.09  ? 79  ASP A OD2 1 
ATOM   627  N  N   . GLN A 1 80  ? 10.207 68.895 45.781 1.00 21.06  ? 80  GLN A N   1 
ATOM   628  C  CA  . GLN A 1 80  ? 10.202 69.751 46.939 1.00 21.33  ? 80  GLN A CA  1 
ATOM   629  C  C   . GLN A 1 80  ? 10.843 68.954 48.066 1.00 20.02  ? 80  GLN A C   1 
ATOM   630  O  O   . GLN A 1 80  ? 11.784 69.338 48.794 1.00 21.33  ? 80  GLN A O   1 
ATOM   631  C  CB  . GLN A 1 80  ? 8.863  70.295 47.390 1.00 20.51  ? 80  GLN A CB  1 
ATOM   632  C  CG  . GLN A 1 80  ? 8.316  71.375 46.429 1.00 20.89  ? 80  GLN A CG  1 
ATOM   633  C  CD  . GLN A 1 80  ? 6.928  71.871 46.712 1.00 21.90  ? 80  GLN A CD  1 
ATOM   634  O  OE1 . GLN A 1 80  ? 6.040  71.113 47.127 1.00 23.59  ? 80  GLN A OE1 1 
ATOM   635  N  NE2 . GLN A 1 80  ? 6.756  73.176 46.472 1.00 21.84  ? 80  GLN A NE2 1 
ATOM   636  N  N   . LEU A 1 81  ? 10.339 67.726 48.234 1.00 21.75  ? 81  LEU A N   1 
ATOM   637  C  CA  . LEU A 1 81  ? 10.879 66.793 49.280 1.00 21.43  ? 81  LEU A CA  1 
ATOM   638  C  C   . LEU A 1 81  ? 12.347 66.404 49.025 1.00 22.21  ? 81  LEU A C   1 
ATOM   639  O  O   . LEU A 1 81  ? 13.143 66.429 49.975 1.00 23.77  ? 81  LEU A O   1 
ATOM   640  C  CB  . LEU A 1 81  ? 10.013 65.556 49.463 1.00 22.73  ? 81  LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 81  ? 8.583  65.790 49.932 1.00 23.43  ? 81  LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 81  ? 7.790  64.480 50.058 1.00 22.27  ? 81  LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 81  ? 8.556  66.541 51.271 1.00 23.52  ? 81  LEU A CD2 1 
ATOM   644  N  N   . ILE A 1 82  ? 12.727 66.100 47.799 1.00 22.12  ? 82  ILE A N   1 
ATOM   645  C  CA  . ILE A 1 82  ? 14.113 65.888 47.434 1.00 21.01  ? 82  ILE A CA  1 
ATOM   646  C  C   . ILE A 1 82  ? 15.007 67.066 47.785 1.00 20.99  ? 82  ILE A C   1 
ATOM   647  O  O   . ILE A 1 82  ? 16.036 66.961 48.441 1.00 22.49  ? 82  ILE A O   1 
ATOM   648  C  CB  . ILE A 1 82  ? 14.253 65.523 45.940 1.00 23.32  ? 82  ILE A CB  1 
ATOM   649  C  CG1 . ILE A 1 82  ? 13.651 64.156 45.632 1.00 27.02  ? 82  ILE A CG1 1 
ATOM   650  C  CG2 . ILE A 1 82  ? 15.683 65.622 45.477 1.00 25.26  ? 82  ILE A CG2 1 
ATOM   651  C  CD1 . ILE A 1 82  ? 13.456 63.948 44.157 1.00 27.70  ? 82  ILE A CD1 1 
ATOM   652  N  N   . ASP A 1 83  ? 14.590 68.254 47.401 1.00 22.11  ? 83  ASP A N   1 
ATOM   653  C  CA  . ASP A 1 83  ? 15.366 69.436 47.731 1.00 22.18  ? 83  ASP A CA  1 
ATOM   654  C  C   . ASP A 1 83  ? 15.395 69.648 49.244 1.00 23.19  ? 83  ASP A C   1 
ATOM   655  O  O   . ASP A 1 83  ? 16.457 70.118 49.721 1.00 23.16  ? 83  ASP A O   1 
ATOM   656  C  CB  . ASP A 1 83  ? 14.802 70.611 46.963 1.00 23.35  ? 83  ASP A CB  1 
ATOM   657  C  CG  . ASP A 1 83  ? 15.219 70.425 45.484 1.00 23.74  ? 83  ASP A CG  1 
ATOM   658  O  OD1 . ASP A 1 83  ? 14.367 70.503 44.561 1.00 24.99  ? 83  ASP A OD1 1 
ATOM   659  O  OD2 . ASP A 1 83  ? 16.447 70.233 45.224 1.00 27.73  ? 83  ASP A OD2 1 
ATOM   660  N  N   . PHE A 1 84  ? 14.384 69.315 50.014 1.00 23.09  ? 84  PHE A N   1 
ATOM   661  C  CA  . PHE A 1 84  ? 14.526 69.422 51.465 1.00 23.03  ? 84  PHE A CA  1 
ATOM   662  C  C   . PHE A 1 84  ? 15.570 68.430 51.981 1.00 24.00  ? 84  PHE A C   1 
ATOM   663  O  O   . PHE A 1 84  ? 16.377 68.818 52.843 1.00 22.76  ? 84  PHE A O   1 
ATOM   664  C  CB  . PHE A 1 84  ? 13.224 69.215 52.216 1.00 24.00  ? 84  PHE A CB  1 
ATOM   665  C  CG  . PHE A 1 84  ? 12.285 70.400 52.148 1.00 22.68  ? 84  PHE A CG  1 
ATOM   666  C  CD1 . PHE A 1 84  ? 12.736 71.660 52.482 1.00 23.82  ? 84  PHE A CD1 1 
ATOM   667  C  CD2 . PHE A 1 84  ? 10.960 70.261 51.781 1.00 25.92  ? 84  PHE A CD2 1 
ATOM   668  C  CE1 . PHE A 1 84  ? 11.836 72.720 52.443 1.00 23.13  ? 84  PHE A CE1 1 
ATOM   669  C  CE2 . PHE A 1 84  ? 10.074 71.318 51.741 1.00 23.94  ? 84  PHE A CE2 1 
ATOM   670  C  CZ  . PHE A 1 84  ? 10.510 72.591 52.088 1.00 21.62  ? 84  PHE A CZ  1 
ATOM   671  N  N   . MET A 1 85  ? 15.573 67.210 51.469 1.00 22.16  ? 85  MET A N   1 
ATOM   672  C  CA  . MET A 1 85  ? 16.574 66.247 51.902 1.00 21.52  ? 85  MET A CA  1 
ATOM   673  C  C   . MET A 1 85  ? 17.986 66.756 51.618 1.00 22.36  ? 85  MET A C   1 
ATOM   674  O  O   . MET A 1 85  ? 18.879 66.621 52.468 1.00 25.59  ? 85  MET A O   1 
ATOM   675  C  CB  A MET A 1 85  ? 16.260 64.886 51.264 0.39 23.98  ? 85  MET A CB  1 
ATOM   676  C  CB  B MET A 1 85  ? 16.399 64.908 51.198 0.61 24.73  ? 85  MET A CB  1 
ATOM   677  C  CG  A MET A 1 85  ? 15.153 64.175 52.056 0.39 26.34  ? 85  MET A CG  1 
ATOM   678  C  CG  B MET A 1 85  ? 15.240 64.167 51.855 0.61 21.92  ? 85  MET A CG  1 
ATOM   679  S  SD  A MET A 1 85  ? 14.168 62.997 51.078 0.39 26.64  ? 85  MET A SD  1 
ATOM   680  S  SD  B MET A 1 85  ? 15.021 62.530 51.161 0.61 21.73  ? 85  MET A SD  1 
ATOM   681  C  CE  A MET A 1 85  ? 15.376 62.268 50.124 0.39 53.38  ? 85  MET A CE  1 
ATOM   682  C  CE  B MET A 1 85  ? 13.535 62.722 50.200 0.61 44.33  ? 85  MET A CE  1 
ATOM   683  N  N   . LEU A 1 86  ? 18.219 67.330 50.466 1.00 23.54  ? 86  LEU A N   1 
ATOM   684  C  CA  . LEU A 1 86  ? 19.540 67.826 50.146 1.00 23.50  ? 86  LEU A CA  1 
ATOM   685  C  C   . LEU A 1 86  ? 19.944 69.005 51.017 1.00 25.16  ? 86  LEU A C   1 
ATOM   686  O  O   . LEU A 1 86  ? 21.105 69.092 51.380 1.00 26.40  ? 86  LEU A O   1 
ATOM   687  C  CB  . LEU A 1 86  ? 19.542 68.346 48.716 1.00 27.67  ? 86  LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 86  ? 19.409 67.244 47.678 1.00 27.64  ? 86  LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 86  ? 19.231 67.791 46.277 1.00 38.83  ? 86  LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 86  ? 20.635 66.333 47.701 1.00 29.52  ? 86  LEU A CD2 1 
ATOM   691  N  N   . GLN A 1 87  ? 19.032 69.909 51.336 1.00 24.64  ? 87  GLN A N   1 
ATOM   692  C  CA  . GLN A 1 87  ? 19.293 71.060 52.181 1.00 23.08  ? 87  GLN A CA  1 
ATOM   693  C  C   . GLN A 1 87  ? 19.340 70.716 53.665 1.00 22.61  ? 87  GLN A C   1 
ATOM   694  O  O   . GLN A 1 87  ? 19.855 71.487 54.542 1.00 28.16  ? 87  GLN A O   1 
ATOM   695  C  CB  . GLN A 1 87  ? 18.247 72.154 51.922 1.00 26.35  ? 87  GLN A CB  1 
ATOM   696  C  CG  . GLN A 1 87  ? 18.382 72.676 50.500 1.00 28.69  ? 87  GLN A CG  1 
ATOM   697  C  CD  . GLN A 1 87  ? 19.765 73.185 50.171 1.00 36.66  ? 87  GLN A CD  1 
ATOM   698  O  OE1 . GLN A 1 87  ? 20.237 72.857 49.069 1.00 48.56  ? 87  GLN A OE1 1 
ATOM   699  N  NE2 . GLN A 1 87  ? 20.393 73.960 51.030 1.00 49.52  ? 87  GLN A NE2 1 
ATOM   700  N  N   . HIS A 1 88  ? 18.840 69.565 54.088 1.00 23.20  ? 88  HIS A N   1 
ATOM   701  C  CA  . HIS A 1 88  ? 18.727 69.112 55.474 1.00 23.64  ? 88  HIS A CA  1 
ATOM   702  C  C   . HIS A 1 88  ? 18.923 67.597 55.546 1.00 22.30  ? 88  HIS A C   1 
ATOM   703  O  O   . HIS A 1 88  ? 17.923 66.873 55.676 1.00 25.13  ? 88  HIS A O   1 
ATOM   704  C  CB  . HIS A 1 88  ? 17.376 69.471 56.094 1.00 27.16  ? 88  HIS A CB  1 
ATOM   705  C  CG  . HIS A 1 88  ? 16.924 70.887 55.838 1.00 24.98  ? 88  HIS A CG  1 
ATOM   706  N  ND1 . HIS A 1 88  ? 17.243 71.961 56.582 1.00 29.75  ? 88  HIS A ND1 1 
ATOM   707  C  CD2 . HIS A 1 88  ? 16.218 71.364 54.790 1.00 27.51  ? 88  HIS A CD2 1 
ATOM   708  C  CE1 . HIS A 1 88  ? 16.707 73.093 56.051 1.00 30.80  ? 88  HIS A CE1 1 
ATOM   709  N  NE2 . HIS A 1 88  ? 16.071 72.720 54.922 1.00 26.03  ? 88  HIS A NE2 1 
ATOM   710  N  N   . PRO A 1 89  ? 20.168 67.168 55.394 1.00 23.99  ? 89  PRO A N   1 
ATOM   711  C  CA  . PRO A 1 89  ? 20.461 65.738 55.244 1.00 24.43  ? 89  PRO A CA  1 
ATOM   712  C  C   . PRO A 1 89  ? 19.968 64.822 56.344 1.00 23.93  ? 89  PRO A C   1 
ATOM   713  O  O   . PRO A 1 89  ? 19.813 63.597 56.100 1.00 24.81  ? 89  PRO A O   1 
ATOM   714  C  CB  . PRO A 1 89  ? 22.001 65.651 55.175 1.00 27.91  ? 89  PRO A CB  1 
ATOM   715  C  CG  . PRO A 1 89  ? 22.446 67.016 54.725 1.00 31.78  ? 89  PRO A CG  1 
ATOM   716  C  CD  . PRO A 1 89  ? 21.407 67.999 55.255 1.00 28.23  ? 89  PRO A CD  1 
ATOM   717  N  N   . ILE A 1 90  ? 19.679 65.365 57.544 1.00 23.08  ? 90  ILE A N   1 
ATOM   718  C  CA  . ILE A 1 90  ? 19.171 64.465 58.589 1.00 25.33  ? 90  ILE A CA  1 
ATOM   719  C  C   . ILE A 1 90  ? 17.803 63.952 58.222 1.00 22.79  ? 90  ILE A C   1 
ATOM   720  O  O   . ILE A 1 90  ? 17.294 62.963 58.750 1.00 25.62  ? 90  ILE A O   1 
ATOM   721  C  CB  . ILE A 1 90  ? 19.099 65.192 59.925 1.00 25.58  ? 90  ILE A CB  1 
ATOM   722  C  CG1 . ILE A 1 90  ? 18.956 64.233 61.105 1.00 25.25  ? 90  ILE A CG1 1 
ATOM   723  C  CG2 . ILE A 1 90  ? 18.003 66.256 59.886 1.00 27.36  ? 90  ILE A CG2 1 
ATOM   724  C  CD1 . ILE A 1 90  ? 18.988 65.009 62.445 1.00 32.98  ? 90  ILE A CD1 1 
ATOM   725  N  N   . LEU A 1 91  ? 17.136 64.574 57.251 1.00 22.49  ? 91  LEU A N   1 
ATOM   726  C  CA  . LEU A 1 91  ? 15.869 64.032 56.733 1.00 22.15  ? 91  LEU A CA  1 
ATOM   727  C  C   . LEU A 1 91  ? 16.016 62.751 55.912 1.00 23.07  ? 91  LEU A C   1 
ATOM   728  O  O   . LEU A 1 91  ? 15.034 62.061 55.617 1.00 25.40  ? 91  LEU A O   1 
ATOM   729  C  CB  . LEU A 1 91  ? 15.227 65.064 55.814 1.00 20.95  ? 91  LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 91  ? 14.607 66.343 56.378 1.00 22.76  ? 91  LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 91  ? 14.169 67.338 55.325 1.00 22.26  ? 91  LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 91  ? 13.404 66.023 57.305 1.00 24.53  ? 91  LEU A CD2 1 
ATOM   733  N  N   . ILE A 1 92  ? 17.220 62.411 55.459 1.00 22.89  ? 92  ILE A N   1 
ATOM   734  C  CA  . ILE A 1 92  ? 17.405 61.199 54.659 1.00 23.72  ? 92  ILE A CA  1 
ATOM   735  C  C   . ILE A 1 92  ? 17.448 60.010 55.614 1.00 22.46  ? 92  ILE A C   1 
ATOM   736  O  O   . ILE A 1 92  ? 18.414 59.955 56.434 1.00 26.19  ? 92  ILE A O   1 
ATOM   737  C  CB  . ILE A 1 92  ? 18.676 61.324 53.801 1.00 21.45  ? 92  ILE A CB  1 
ATOM   738  C  CG1 . ILE A 1 92  ? 18.744 62.498 52.837 1.00 23.96  ? 92  ILE A CG1 1 
ATOM   739  C  CG2 . ILE A 1 92  ? 18.902 60.029 53.008 1.00 25.01  ? 92  ILE A CG2 1 
ATOM   740  C  CD1 . ILE A 1 92  ? 20.078 62.709 52.169 1.00 24.16  ? 92  ILE A CD1 1 
ATOM   741  N  N   . ASN A 1 93  ? 16.471 59.106 55.513 1.00 23.17  ? 93  ASN A N   1 
ATOM   742  C  CA  . ASN A 1 93  ? 16.501 57.975 56.449 1.00 21.28  ? 93  ASN A CA  1 
ATOM   743  C  C   . ASN A 1 93  ? 17.714 57.081 56.128 1.00 25.14  ? 93  ASN A C   1 
ATOM   744  O  O   . ASN A 1 93  ? 18.408 57.229 55.084 1.00 23.98  ? 93  ASN A O   1 
ATOM   745  C  CB  . ASN A 1 93  ? 15.196 57.182 56.502 1.00 21.97  ? 93  ASN A CB  1 
ATOM   746  C  CG  . ASN A 1 93  ? 14.867 56.639 57.882 1.00 22.59  ? 93  ASN A CG  1 
ATOM   747  O  OD1 . ASN A 1 93  ? 15.772 56.548 58.701 1.00 25.83  ? 93  ASN A OD1 1 
ATOM   748  N  ND2 . ASN A 1 93  ? 13.594 56.303 58.135 1.00 25.78  ? 93  ASN A ND2 1 
ATOM   749  N  N   . ARG A 1 94  ? 18.017 56.119 56.981 1.00 21.79  ? 94  ARG A N   1 
ATOM   750  C  CA  . ARG A 1 94  ? 19.324 55.474 56.958 1.00 22.28  ? 94  ARG A CA  1 
ATOM   751  C  C   . ARG A 1 94  ? 19.202 54.079 57.527 1.00 25.05  ? 94  ARG A C   1 
ATOM   752  O  O   . ARG A 1 94  ? 18.301 53.822 58.334 1.00 24.16  ? 94  ARG A O   1 
ATOM   753  C  CB  . ARG A 1 94  ? 20.270 56.364 57.772 1.00 25.29  ? 94  ARG A CB  1 
ATOM   754  C  CG  . ARG A 1 94  ? 20.082 56.246 59.270 1.00 25.36  ? 94  ARG A CG  1 
ATOM   755  C  CD  . ARG A 1 94  ? 18.919 57.069 59.764 1.00 27.64  ? 94  ARG A CD  1 
ATOM   756  N  NE  . ARG A 1 94  ? 18.820 57.329 61.210 1.00 29.60  ? 94  ARG A NE  1 
ATOM   757  C  CZ  . ARG A 1 94  ? 17.782 57.201 62.008 1.00 30.88  ? 94  ARG A CZ  1 
ATOM   758  N  NH1 . ARG A 1 94  ? 16.585 56.759 61.577 1.00 30.40  ? 94  ARG A NH1 1 
ATOM   759  N  NH2 . ARG A 1 94  ? 17.938 57.510 63.322 1.00 35.15  ? 94  ARG A NH2 1 
ATOM   760  N  N   . PRO A 1 95  ? 20.082 53.150 57.185 1.00 22.58  ? 95  PRO A N   1 
ATOM   761  C  CA  . PRO A 1 95  ? 21.113 53.367 56.177 1.00 22.92  ? 95  PRO A CA  1 
ATOM   762  C  C   . PRO A 1 95  ? 20.673 53.034 54.750 1.00 20.93  ? 95  PRO A C   1 
ATOM   763  O  O   . PRO A 1 95  ? 19.895 52.073 54.660 1.00 24.47  ? 95  PRO A O   1 
ATOM   764  C  CB  . PRO A 1 95  ? 22.163 52.308 56.570 1.00 24.12  ? 95  PRO A CB  1 
ATOM   765  C  CG  . PRO A 1 95  ? 21.436 51.152 57.192 1.00 21.56  ? 95  PRO A CG  1 
ATOM   766  C  CD  . PRO A 1 95  ? 20.200 51.797 57.791 1.00 23.20  ? 95  PRO A CD  1 
ATOM   767  N  N   . ILE A 1 96  ? 21.186 53.708 53.752 1.00 22.74  ? 96  ILE A N   1 
ATOM   768  C  CA  . ILE A 1 96  ? 21.035 53.260 52.365 1.00 22.68  ? 96  ILE A CA  1 
ATOM   769  C  C   . ILE A 1 96  ? 22.270 52.468 51.992 1.00 23.26  ? 96  ILE A C   1 
ATOM   770  O  O   . ILE A 1 96  ? 23.373 52.935 52.287 1.00 23.89  ? 96  ILE A O   1 
ATOM   771  C  CB  . ILE A 1 96  ? 20.878 54.461 51.460 1.00 22.17  ? 96  ILE A CB  1 
ATOM   772  C  CG1 . ILE A 1 96  ? 19.685 55.321 51.858 1.00 23.61  ? 96  ILE A CG1 1 
ATOM   773  C  CG2 . ILE A 1 96  ? 20.858 54.055 49.980 1.00 23.23  ? 96  ILE A CG2 1 
ATOM   774  C  CD1 . ILE A 1 96  ? 19.610 56.693 51.275 1.00 26.61  ? 96  ILE A CD1 1 
ATOM   775  N  N   . VAL A 1 97  ? 22.091 51.312 51.364 1.00 23.39  ? 97  VAL A N   1 
ATOM   776  C  CA  . VAL A 1 97  ? 23.223 50.496 50.948 1.00 19.29  ? 97  VAL A CA  1 
ATOM   777  C  C   . VAL A 1 97  ? 23.143 50.228 49.448 1.00 21.44  ? 97  VAL A C   1 
ATOM   778  O  O   . VAL A 1 97  ? 22.071 49.868 48.998 1.00 21.33  ? 97  VAL A O   1 
ATOM   779  C  CB  . VAL A 1 97  ? 23.322 49.193 51.731 1.00 21.53  ? 97  VAL A CB  1 
ATOM   780  C  CG1 . VAL A 1 97  ? 24.510 48.349 51.284 1.00 23.64  ? 97  VAL A CG1 1 
ATOM   781  C  CG2 . VAL A 1 97  ? 23.441 49.480 53.240 1.00 23.11  ? 97  VAL A CG2 1 
ATOM   782  N  N   . VAL A 1 98  ? 24.269 50.369 48.749 1.00 21.77  ? 98  VAL A N   1 
ATOM   783  C  CA  . VAL A 1 98  ? 24.439 50.086 47.330 1.00 20.66  ? 98  VAL A CA  1 
ATOM   784  C  C   . VAL A 1 98  ? 25.414 48.906 47.195 1.00 20.81  ? 98  VAL A C   1 
ATOM   785  O  O   . VAL A 1 98  ? 26.530 48.990 47.704 1.00 23.81  ? 98  VAL A O   1 
ATOM   786  C  CB  . VAL A 1 98  ? 24.949 51.285 46.496 1.00 22.72  ? 98  VAL A CB  1 
ATOM   787  C  CG1 . VAL A 1 98  ? 24.944 50.903 45.011 1.00 27.69  ? 98  VAL A CG1 1 
ATOM   788  C  CG2 . VAL A 1 98  ? 24.135 52.549 46.811 1.00 24.31  ? 98  VAL A CG2 1 
ATOM   789  N  N   . THR A 1 99  ? 24.967 47.848 46.488 1.00 23.32  ? 99  THR A N   1 
ATOM   790  C  CA  . THR A 1 99  ? 25.883 46.788 46.098 1.00 23.96  ? 99  THR A CA  1 
ATOM   791  C  C   . THR A 1 99  ? 25.729 46.481 44.611 1.00 24.08  ? 99  THR A C   1 
ATOM   792  O  O   . THR A 1 99  ? 24.830 47.076 43.969 1.00 26.00  ? 99  THR A O   1 
ATOM   793  C  CB  . THR A 1 99  ? 25.636 45.496 46.928 1.00 23.63  ? 99  THR A CB  1 
ATOM   794  O  OG1 . THR A 1 99  ? 24.479 44.862 46.367 1.00 25.73  ? 99  THR A OG1 1 
ATOM   795  C  CG2 . THR A 1 99  ? 25.286 45.756 48.370 1.00 28.63  ? 99  THR A CG2 1 
ATOM   796  N  N   . PRO A 1 100 ? 26.558 45.636 43.996 1.00 25.17  ? 100 PRO A N   1 
ATOM   797  C  CA  . PRO A 1 100 ? 26.369 45.337 42.570 1.00 25.66  ? 100 PRO A CA  1 
ATOM   798  C  C   . PRO A 1 100 ? 25.036 44.730 42.197 1.00 26.90  ? 100 PRO A C   1 
ATOM   799  O  O   . PRO A 1 100 ? 24.541 44.676 41.076 1.00 26.69  ? 100 PRO A O   1 
ATOM   800  C  CB  . PRO A 1 100 ? 27.453 44.310 42.294 1.00 27.25  ? 100 PRO A CB  1 
ATOM   801  C  CG  . PRO A 1 100 ? 28.534 44.687 43.280 1.00 27.63  ? 100 PRO A CG  1 
ATOM   802  C  CD  . PRO A 1 100 ? 27.788 45.030 44.526 1.00 25.16  ? 100 PRO A CD  1 
ATOM   803  N  N   . LEU A 1 101 ? 24.306 44.154 43.096 1.00 24.35  ? 101 LEU A N   1 
ATOM   804  C  CA  . LEU A 1 101 ? 22.970 43.598 43.062 1.00 26.99  ? 101 LEU A CA  1 
ATOM   805  C  C   . LEU A 1 101 ? 21.850 44.578 43.235 1.00 25.15  ? 101 LEU A C   1 
ATOM   806  O  O   . LEU A 1 101 ? 20.751 44.221 42.794 1.00 27.42  ? 101 LEU A O   1 
ATOM   807  C  CB  . LEU A 1 101 ? 22.740 42.460 44.090 1.00 25.10  ? 101 LEU A CB  1 
ATOM   808  C  CG  . LEU A 1 101 ? 23.555 41.185 43.854 1.00 25.12  ? 101 LEU A CG  1 
ATOM   809  C  CD1 . LEU A 1 101 ? 23.254 40.176 44.936 1.00 26.73  ? 101 LEU A CD1 1 
ATOM   810  C  CD2 . LEU A 1 101 ? 23.238 40.589 42.473 1.00 28.40  ? 101 LEU A CD2 1 
ATOM   811  N  N   . GLY A 1 102 ? 22.067 45.714 43.889 1.00 23.71  ? 102 GLY A N   1 
ATOM   812  C  CA  . GLY A 1 102 ? 20.934 46.634 44.028 1.00 25.36  ? 102 GLY A CA  1 
ATOM   813  C  C   . GLY A 1 102 ? 21.164 47.586 45.167 1.00 23.24  ? 102 GLY A C   1 
ATOM   814  O  O   . GLY A 1 102 ? 22.217 47.612 45.806 1.00 23.96  ? 102 GLY A O   1 
ATOM   815  N  N   . THR A 1 103 ? 20.156 48.415 45.376 1.00 22.59  ? 103 THR A N   1 
ATOM   816  C  CA  . THR A 1 103 ? 20.212 49.442 46.409 1.00 22.49  ? 103 THR A CA  1 
ATOM   817  C  C   . THR A 1 103 ? 19.016 49.285 47.355 1.00 22.67  ? 103 THR A C   1 
ATOM   818  O  O   . THR A 1 103 ? 17.910 49.065 46.838 1.00 22.46  ? 103 THR A O   1 
ATOM   819  C  CB  . THR A 1 103 ? 20.233 50.830 45.770 1.00 22.75  ? 103 THR A CB  1 
ATOM   820  O  OG1 . THR A 1 103 ? 21.396 51.001 44.935 1.00 27.75  ? 103 THR A OG1 1 
ATOM   821  C  CG2 . THR A 1 103 ? 20.284 51.918 46.808 1.00 22.71  ? 103 THR A CG2 1 
ATOM   822  N  N   . ARG A 1 104 ? 19.131 49.399 48.654 1.00 22.91  ? 104 ARG A N   1 
ATOM   823  C  CA  . ARG A 1 104 ? 18.044 49.270 49.598 1.00 21.59  ? 104 ARG A CA  1 
ATOM   824  C  C   . ARG A 1 104 ? 18.167 50.286 50.733 1.00 22.22  ? 104 ARG A C   1 
ATOM   825  O  O   . ARG A 1 104 ? 19.279 50.528 51.145 1.00 23.45  ? 104 ARG A O   1 
ATOM   826  C  CB  A ARG A 1 104 ? 17.937 47.867 50.227 0.47 22.45  ? 104 ARG A CB  1 
ATOM   827  C  CB  B ARG A 1 104 ? 17.946 47.878 50.256 0.53 22.60  ? 104 ARG A CB  1 
ATOM   828  C  CG  A ARG A 1 104 ? 17.585 46.787 49.248 0.47 24.99  ? 104 ARG A CG  1 
ATOM   829  C  CG  B ARG A 1 104 ? 17.644 46.822 49.238 0.53 24.92  ? 104 ARG A CG  1 
ATOM   830  C  CD  A ARG A 1 104 ? 16.178 46.918 48.648 0.47 30.28  ? 104 ARG A CD  1 
ATOM   831  C  CD  B ARG A 1 104 ? 16.196 46.880 48.699 0.53 30.13  ? 104 ARG A CD  1 
ATOM   832  N  NE  A ARG A 1 104 ? 16.022 45.808 47.696 0.47 34.86  ? 104 ARG A NE  1 
ATOM   833  N  NE  B ARG A 1 104 ? 16.023 45.521 48.135 0.53 36.79  ? 104 ARG A NE  1 
ATOM   834  C  CZ  A ARG A 1 104 ? 15.564 44.594 47.968 0.47 40.67  ? 104 ARG A CZ  1 
ATOM   835  C  CZ  B ARG A 1 104 ? 16.535 45.135 46.968 0.53 39.37  ? 104 ARG A CZ  1 
ATOM   836  N  NH1 A ARG A 1 104 ? 15.175 44.266 49.199 0.47 45.17  ? 104 ARG A NH1 1 
ATOM   837  N  NH1 B ARG A 1 104 ? 17.238 46.005 46.237 0.53 43.44  ? 104 ARG A NH1 1 
ATOM   838  N  NH2 A ARG A 1 104 ? 15.486 43.685 46.994 0.47 50.48  ? 104 ARG A NH2 1 
ATOM   839  N  NH2 B ARG A 1 104 ? 16.362 43.893 46.514 0.53 37.47  ? 104 ARG A NH2 1 
ATOM   840  N  N   . LEU A 1 105 ? 17.021 50.790 51.147 1.00 22.71  ? 105 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 105 ? 16.895 51.366 52.458 1.00 20.61  ? 105 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 105 ? 16.804 50.181 53.434 1.00 20.73  ? 105 LEU A C   1 
ATOM   843  O  O   . LEU A 1 105 ? 15.786 49.472 53.435 1.00 21.87  ? 105 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 105 ? 15.658 52.292 52.564 1.00 23.75  ? 105 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 105 ? 15.401 52.919 53.922 1.00 23.46  ? 105 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 105 ? 16.594 53.758 54.363 1.00 24.54  ? 105 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 105 ? 14.124 53.739 53.923 1.00 24.63  ? 105 LEU A CD2 1 
ATOM   848  N  N   . CYS A 1 106 ? 17.881 49.999 54.210 1.00 23.14  ? 106 CYS A N   1 
ATOM   849  C  CA  . CYS A 1 106 ? 17.967 48.795 55.041 1.00 22.42  ? 106 CYS A CA  1 
ATOM   850  C  C   . CYS A 1 106 ? 17.343 49.055 56.405 1.00 22.81  ? 106 CYS A C   1 
ATOM   851  O  O   . CYS A 1 106 ? 17.996 49.134 57.432 1.00 23.98  ? 106 CYS A O   1 
ATOM   852  C  CB  . CYS A 1 106 ? 19.384 48.272 55.121 1.00 21.62  ? 106 CYS A CB  1 
ATOM   853  S  SG  . CYS A 1 106 ? 20.140 47.881 53.529 1.00 24.94  ? 106 CYS A SG  1 
ATOM   854  N  N   . ARG A 1 107 ? 15.999 49.123 56.317 1.00 23.87  ? 107 ARG A N   1 
ATOM   855  C  CA  . ARG A 1 107 ? 15.156 49.270 57.509 1.00 23.17  ? 107 ARG A CA  1 
ATOM   856  C  C   . ARG A 1 107 ? 14.078 48.204 57.436 1.00 23.49  ? 107 ARG A C   1 
ATOM   857  O  O   . ARG A 1 107 ? 13.246 48.428 56.536 1.00 24.62  ? 107 ARG A O   1 
ATOM   858  C  CB  . ARG A 1 107 ? 14.561 50.675 57.610 1.00 24.94  ? 107 ARG A CB  1 
ATOM   859  C  CG  . ARG A 1 107 ? 15.632 51.758 57.742 1.00 24.76  ? 107 ARG A CG  1 
ATOM   860  C  CD  . ARG A 1 107 ? 15.084 53.164 58.021 1.00 23.96  ? 107 ARG A CD  1 
ATOM   861  N  NE  . ARG A 1 107 ? 14.509 53.172 59.371 1.00 26.15  ? 107 ARG A NE  1 
ATOM   862  C  CZ  . ARG A 1 107 ? 15.225 53.303 60.482 1.00 24.24  ? 107 ARG A CZ  1 
ATOM   863  N  NH1 . ARG A 1 107 ? 16.544 53.463 60.576 1.00 24.42  ? 107 ARG A NH1 1 
ATOM   864  N  NH2 . ARG A 1 107 ? 14.556 53.284 61.638 1.00 30.24  ? 107 ARG A NH2 1 
ATOM   865  N  N   . PRO A 1 108 ? 14.081 47.130 58.203 1.00 24.11  ? 108 PRO A N   1 
ATOM   866  C  CA  . PRO A 1 108 ? 15.080 46.840 59.245 1.00 22.65  ? 108 PRO A CA  1 
ATOM   867  C  C   . PRO A 1 108 ? 16.418 46.436 58.613 1.00 24.18  ? 108 PRO A C   1 
ATOM   868  O  O   . PRO A 1 108 ? 16.523 46.157 57.400 1.00 23.47  ? 108 PRO A O   1 
ATOM   869  C  CB  . PRO A 1 108 ? 14.478 45.686 60.016 1.00 22.72  ? 108 PRO A CB  1 
ATOM   870  C  CG  . PRO A 1 108 ? 13.606 45.018 59.042 1.00 24.04  ? 108 PRO A CG  1 
ATOM   871  C  CD  . PRO A 1 108 ? 13.144 46.019 58.078 1.00 24.92  ? 108 PRO A CD  1 
ATOM   872  N  N   . SER A 1 109 ? 17.480 46.402 59.432 1.00 22.90  ? 109 SER A N   1 
ATOM   873  C  CA  . SER A 1 109 ? 18.815 46.190 58.949 1.00 22.03  ? 109 SER A CA  1 
ATOM   874  C  C   . SER A 1 109 ? 18.948 44.913 58.119 1.00 23.76  ? 109 SER A C   1 
ATOM   875  O  O   . SER A 1 109 ? 19.737 44.883 57.159 1.00 24.06  ? 109 SER A O   1 
ATOM   876  C  CB  . SER A 1 109 ? 19.815 46.069 60.095 1.00 22.40  ? 109 SER A CB  1 
ATOM   877  O  OG  . SER A 1 109 ? 19.530 45.214 61.153 1.00 23.75  ? 109 SER A OG  1 
ATOM   878  N  N   . GLU A 1 110 ? 18.239 43.859 58.451 1.00 21.92  ? 110 GLU A N   1 
ATOM   879  C  CA  . GLU A 1 110 ? 18.428 42.580 57.775 1.00 22.38  ? 110 GLU A CA  1 
ATOM   880  C  C   . GLU A 1 110 ? 17.989 42.627 56.309 1.00 22.17  ? 110 GLU A C   1 
ATOM   881  O  O   . GLU A 1 110 ? 18.245 41.684 55.558 1.00 23.32  ? 110 GLU A O   1 
ATOM   882  C  CB  . GLU A 1 110 ? 17.711 41.461 58.498 1.00 23.70  ? 110 GLU A CB  1 
ATOM   883  C  CG  . GLU A 1 110 ? 16.220 41.567 58.646 1.00 25.26  ? 110 GLU A CG  1 
ATOM   884  C  CD  . GLU A 1 110 ? 15.745 42.237 59.923 1.00 25.84  ? 110 GLU A CD  1 
ATOM   885  O  OE1 . GLU A 1 110 ? 14.577 41.955 60.294 1.00 27.01  ? 110 GLU A OE1 1 
ATOM   886  O  OE2 . GLU A 1 110 ? 16.529 43.008 60.488 1.00 22.49  ? 110 GLU A OE2 1 
ATOM   887  N  N   . VAL A 1 111 ? 17.322 43.714 55.880 1.00 23.12  ? 111 VAL A N   1 
ATOM   888  C  CA  . VAL A 1 111 ? 17.053 43.901 54.452 1.00 21.47  ? 111 VAL A CA  1 
ATOM   889  C  C   . VAL A 1 111 ? 18.334 43.776 53.615 1.00 20.57  ? 111 VAL A C   1 
ATOM   890  O  O   . VAL A 1 111 ? 18.314 43.391 52.442 1.00 23.91  ? 111 VAL A O   1 
ATOM   891  C  CB  . VAL A 1 111 ? 16.371 45.251 54.260 1.00 21.81  ? 111 VAL A CB  1 
ATOM   892  C  CG1 . VAL A 1 111 ? 16.327 45.742 52.819 1.00 25.84  ? 111 VAL A CG1 1 
ATOM   893  C  CG2 . VAL A 1 111 ? 14.922 45.256 54.765 1.00 24.92  ? 111 VAL A CG2 1 
ATOM   894  N  N   . VAL A 1 112 ? 19.491 44.185 54.237 1.00 20.35  ? 112 VAL A N   1 
ATOM   895  C  CA  . VAL A 1 112 ? 20.738 44.215 53.513 1.00 23.30  ? 112 VAL A CA  1 
ATOM   896  C  C   . VAL A 1 112 ? 21.067 42.821 53.002 1.00 21.89  ? 112 VAL A C   1 
ATOM   897  O  O   . VAL A 1 112 ? 21.833 42.708 52.046 1.00 22.53  ? 112 VAL A O   1 
ATOM   898  C  CB  . VAL A 1 112 ? 21.854 44.824 54.383 1.00 22.32  ? 112 VAL A CB  1 
ATOM   899  C  CG1 . VAL A 1 112 ? 22.318 43.837 55.429 1.00 24.39  ? 112 VAL A CG1 1 
ATOM   900  C  CG2 . VAL A 1 112 ? 23.015 45.296 53.520 1.00 23.39  ? 112 VAL A CG2 1 
ATOM   901  N  N   . LEU A 1 113 ? 20.559 41.731 53.608 1.00 21.09  ? 113 LEU A N   1 
ATOM   902  C  CA  . LEU A 1 113 ? 20.865 40.365 53.194 1.00 21.55  ? 113 LEU A CA  1 
ATOM   903  C  C   . LEU A 1 113 ? 20.413 40.112 51.781 1.00 20.46  ? 113 LEU A C   1 
ATOM   904  O  O   . LEU A 1 113 ? 20.944 39.292 51.010 1.00 23.34  ? 113 LEU A O   1 
ATOM   905  C  CB  . LEU A 1 113 ? 20.242 39.391 54.172 1.00 20.91  ? 113 LEU A CB  1 
ATOM   906  C  CG  . LEU A 1 113 ? 20.763 39.441 55.638 1.00 22.23  ? 113 LEU A CG  1 
ATOM   907  C  CD1 . LEU A 1 113 ? 20.093 38.421 56.528 1.00 25.25  ? 113 LEU A CD1 1 
ATOM   908  C  CD2 . LEU A 1 113 ? 22.286 39.206 55.645 1.00 24.56  ? 113 LEU A CD2 1 
ATOM   909  N  N   . ASP A 1 114 ? 19.392 40.882 51.397 1.00 21.43  ? 114 ASP A N   1 
ATOM   910  C  CA  . ASP A 1 114 ? 18.898 40.758 50.041 1.00 22.99  ? 114 ASP A CA  1 
ATOM   911  C  C   . ASP A 1 114 ? 19.913 41.118 48.952 1.00 24.38  ? 114 ASP A C   1 
ATOM   912  O  O   . ASP A 1 114 ? 19.922 40.546 47.821 1.00 24.97  ? 114 ASP A O   1 
ATOM   913  C  CB  . ASP A 1 114 ? 17.634 41.617 49.789 1.00 24.67  ? 114 ASP A CB  1 
ATOM   914  C  CG  . ASP A 1 114 ? 16.382 41.155 50.491 1.00 26.45  ? 114 ASP A CG  1 
ATOM   915  O  OD1 . ASP A 1 114 ? 15.340 41.795 50.214 1.00 34.38  ? 114 ASP A OD1 1 
ATOM   916  O  OD2 . ASP A 1 114 ? 16.420 40.216 51.315 1.00 28.99  ? 114 ASP A OD2 1 
ATOM   917  N  N   . ILE A 1 115 ? 20.791 42.100 49.203 1.00 21.93  ? 115 ILE A N   1 
ATOM   918  C  CA  . ILE A 1 115 ? 21.663 42.645 48.175 1.00 23.87  ? 115 ILE A CA  1 
ATOM   919  C  C   . ILE A 1 115 ? 23.140 42.315 48.419 1.00 23.04  ? 115 ILE A C   1 
ATOM   920  O  O   . ILE A 1 115 ? 23.983 42.637 47.580 1.00 24.12  ? 115 ILE A O   1 
ATOM   921  C  CB  . ILE A 1 115 ? 21.433 44.159 48.035 1.00 23.49  ? 115 ILE A CB  1 
ATOM   922  C  CG1 . ILE A 1 115 ? 21.576 44.929 49.341 1.00 22.87  ? 115 ILE A CG1 1 
ATOM   923  C  CG2 . ILE A 1 115 ? 20.089 44.445 47.367 1.00 23.59  ? 115 ILE A CG2 1 
ATOM   924  C  CD1 . ILE A 1 115 ? 21.501 46.463 49.200 1.00 24.13  ? 115 ILE A CD1 1 
ATOM   925  N  N   . LEU A 1 116 ? 23.484 41.690 49.546 1.00 23.73  ? 116 LEU A N   1 
ATOM   926  C  CA  . LEU A 1 116 ? 24.834 41.130 49.705 1.00 22.98  ? 116 LEU A CA  1 
ATOM   927  C  C   . LEU A 1 116 ? 25.003 39.915 48.846 1.00 21.51  ? 116 LEU A C   1 
ATOM   928  O  O   . LEU A 1 116 ? 24.206 38.932 48.906 1.00 24.55  ? 116 LEU A O   1 
ATOM   929  C  CB  . LEU A 1 116 ? 25.114 40.835 51.192 1.00 21.69  ? 116 LEU A CB  1 
ATOM   930  C  CG  . LEU A 1 116 ? 25.126 42.087 52.065 1.00 18.95  ? 116 LEU A CG  1 
ATOM   931  C  CD1 . LEU A 1 116 ? 25.273 41.794 53.559 1.00 22.01  ? 116 LEU A CD1 1 
ATOM   932  C  CD2 . LEU A 1 116 ? 26.309 42.991 51.730 1.00 22.73  ? 116 LEU A CD2 1 
ATOM   933  N  N   . GLN A 1 117 ? 26.041 39.956 48.019 1.00 24.24  ? 117 GLN A N   1 
ATOM   934  C  CA  . GLN A 1 117 ? 26.344 38.855 47.100 1.00 24.50  ? 117 GLN A CA  1 
ATOM   935  C  C   . GLN A 1 117 ? 26.824 37.616 47.830 1.00 26.76  ? 117 GLN A C   1 
ATOM   936  O  O   . GLN A 1 117 ? 26.441 36.497 47.459 1.00 26.50  ? 117 GLN A O   1 
ATOM   937  C  CB  . GLN A 1 117 ? 27.404 39.305 46.089 1.00 24.66  ? 117 GLN A CB  1 
ATOM   938  C  CG  . GLN A 1 117 ? 26.872 40.282 45.051 1.00 26.39  ? 117 GLN A CG  1 
ATOM   939  C  CD  . GLN A 1 117 ? 28.001 41.017 44.366 1.00 28.56  ? 117 GLN A CD  1 
ATOM   940  O  OE1 . GLN A 1 117 ? 28.771 41.759 45.022 1.00 31.95  ? 117 GLN A OE1 1 
ATOM   941  N  NE2 . GLN A 1 117 ? 28.130 40.824 43.071 1.00 31.55  ? 117 GLN A NE2 1 
ATOM   942  N  N   . ASP A 1 118 ? 27.668 37.813 48.842 1.00 24.09  ? 118 ASP A N   1 
ATOM   943  C  CA  . ASP A 1 118 ? 28.217 36.694 49.605 1.00 24.75  ? 118 ASP A CA  1 
ATOM   944  C  C   . ASP A 1 118 ? 27.451 36.456 50.901 1.00 24.61  ? 118 ASP A C   1 
ATOM   945  O  O   . ASP A 1 118 ? 27.080 37.433 51.564 1.00 23.81  ? 118 ASP A O   1 
ATOM   946  C  CB  . ASP A 1 118 ? 29.726 36.873 49.835 1.00 28.00  ? 118 ASP A CB  1 
ATOM   947  C  CG  . ASP A 1 118 ? 30.456 37.161 48.525 1.00 30.25  ? 118 ASP A CG  1 
ATOM   948  O  OD1 . ASP A 1 118 ? 30.175 36.525 47.487 1.00 29.87  ? 118 ASP A OD1 1 
ATOM   949  O  OD2 . ASP A 1 118 ? 31.332 38.034 48.504 1.00 31.13  ? 118 ASP A OD2 1 
ATOM   950  N  N   . ALA A 1 119 ? 27.235 35.156 51.201 1.00 24.18  ? 119 ALA A N   1 
ATOM   951  C  CA  . ALA A 1 119 ? 26.520 34.775 52.394 1.00 22.86  ? 119 ALA A CA  1 
ATOM   952  C  C   . ALA A 1 119 ? 27.221 35.255 53.666 1.00 21.42  ? 119 ALA A C   1 
ATOM   953  O  O   . ALA A 1 119 ? 28.465 35.288 53.733 1.00 24.92  ? 119 ALA A O   1 
ATOM   954  C  CB  . ALA A 1 119 ? 26.328 33.238 52.539 1.00 25.72  ? 119 ALA A CB  1 
ATOM   955  N  N   . GLN A 1 120 ? 26.473 35.505 54.705 1.00 22.46  ? 120 GLN A N   1 
ATOM   956  C  CA  . GLN A 1 120 ? 27.068 35.723 56.029 1.00 23.67  ? 120 GLN A CA  1 
ATOM   957  C  C   . GLN A 1 120 ? 28.053 34.619 56.410 1.00 24.73  ? 120 GLN A C   1 
ATOM   958  O  O   . GLN A 1 120 ? 27.731 33.426 56.210 1.00 24.55  ? 120 GLN A O   1 
ATOM   959  C  CB  . GLN A 1 120 ? 25.977 35.762 57.092 1.00 24.28  ? 120 GLN A CB  1 
ATOM   960  C  CG  . GLN A 1 120 ? 24.965 36.866 56.940 1.00 23.87  ? 120 GLN A CG  1 
ATOM   961  C  CD  . GLN A 1 120 ? 25.631 38.217 57.297 1.00 23.60  ? 120 GLN A CD  1 
ATOM   962  O  OE1 . GLN A 1 120 ? 25.880 38.564 58.450 1.00 23.50  ? 120 GLN A OE1 1 
ATOM   963  N  NE2 . GLN A 1 120 ? 25.849 38.934 56.195 1.00 22.71  ? 120 GLN A NE2 1 
ATOM   964  N  N   . LYS A 1 121 ? 29.219 34.967 56.932 1.00 23.61  ? 121 LYS A N   1 
ATOM   965  C  CA  . LYS A 1 121 ? 30.278 33.978 57.161 1.00 23.92  ? 121 LYS A CA  1 
ATOM   966  C  C   . LYS A 1 121 ? 30.092 33.142 58.398 1.00 24.63  ? 121 LYS A C   1 
ATOM   967  O  O   . LYS A 1 121 ? 30.725 32.107 58.630 1.00 32.03  ? 121 LYS A O   1 
ATOM   968  C  CB  . LYS A 1 121 ? 31.599 34.737 57.192 1.00 25.47  ? 121 LYS A CB  1 
ATOM   969  C  CG  . LYS A 1 121 ? 32.107 35.195 55.834 1.00 31.17  ? 121 LYS A CG  1 
ATOM   970  C  CD  . LYS A 1 121 ? 33.183 36.264 55.943 1.00 34.05  ? 121 LYS A CD  1 
ATOM   971  C  CE  . LYS A 1 121 ? 34.403 35.814 56.690 1.00 42.86  ? 121 LYS A CE  1 
ATOM   972  N  NZ  . LYS A 1 121 ? 35.576 36.730 56.349 1.00 45.15  ? 121 LYS A NZ  1 
ATOM   973  N  N   . GLY A 1 122 ? 29.172 33.547 59.212 1.00 26.23  ? 122 GLY A N   1 
ATOM   974  C  CA  . GLY A 1 122 ? 28.773 32.882 60.448 1.00 26.91  ? 122 GLY A CA  1 
ATOM   975  C  C   . GLY A 1 122 ? 27.559 33.566 61.052 1.00 22.79  ? 122 GLY A C   1 
ATOM   976  O  O   . GLY A 1 122 ? 26.966 34.477 60.440 1.00 26.36  ? 122 GLY A O   1 
ATOM   977  N  N   . ALA A 1 123 ? 27.182 33.096 62.231 1.00 23.64  ? 123 ALA A N   1 
ATOM   978  C  CA  . ALA A 1 123 ? 25.938 33.585 62.840 1.00 24.47  ? 123 ALA A CA  1 
ATOM   979  C  C   . ALA A 1 123 ? 26.042 35.090 63.003 1.00 24.93  ? 123 ALA A C   1 
ATOM   980  O  O   . ALA A 1 123 ? 27.125 35.672 63.196 1.00 25.17  ? 123 ALA A O   1 
ATOM   981  C  CB  . ALA A 1 123 ? 25.762 32.874 64.167 1.00 28.75  ? 123 ALA A CB  1 
ATOM   982  N  N   . PHE A 1 124 ? 24.902 35.746 62.865 1.00 24.04  ? 124 PHE A N   1 
ATOM   983  C  CA  . PHE A 1 124 ? 24.799 37.170 63.097 1.00 21.99  ? 124 PHE A CA  1 
ATOM   984  C  C   . PHE A 1 124 ? 23.664 37.445 64.121 1.00 23.87  ? 124 PHE A C   1 
ATOM   985  O  O   . PHE A 1 124 ? 22.551 37.014 63.850 1.00 23.33  ? 124 PHE A O   1 
ATOM   986  C  CB  . PHE A 1 124 ? 24.543 38.030 61.861 1.00 21.97  ? 124 PHE A CB  1 
ATOM   987  C  CG  . PHE A 1 124 ? 24.712 39.515 62.158 1.00 19.74  ? 124 PHE A CG  1 
ATOM   988  C  CD1 . PHE A 1 124 ? 23.643 40.295 62.541 1.00 24.18  ? 124 PHE A CD1 1 
ATOM   989  C  CD2 . PHE A 1 124 ? 25.908 40.162 62.078 1.00 22.31  ? 124 PHE A CD2 1 
ATOM   990  C  CE1 . PHE A 1 124 ? 23.744 41.620 62.887 1.00 22.78  ? 124 PHE A CE1 1 
ATOM   991  C  CE2 . PHE A 1 124 ? 26.074 41.494 62.401 1.00 24.38  ? 124 PHE A CE2 1 
ATOM   992  C  CZ  . PHE A 1 124 ? 24.992 42.229 62.804 1.00 24.58  ? 124 PHE A CZ  1 
ATOM   993  N  N   . THR A 1 125 ? 24.010 38.206 65.168 1.00 21.65  ? 125 THR A N   1 
ATOM   994  C  CA  . THR A 1 125 ? 23.088 38.659 66.219 1.00 23.68  ? 125 THR A CA  1 
ATOM   995  C  C   . THR A 1 125 ? 23.204 40.178 66.308 1.00 21.80  ? 125 THR A C   1 
ATOM   996  O  O   . THR A 1 125 ? 24.357 40.646 66.430 1.00 21.79  ? 125 THR A O   1 
ATOM   997  C  CB  . THR A 1 125 ? 23.409 37.990 67.559 1.00 24.56  ? 125 THR A CB  1 
ATOM   998  O  OG1 . THR A 1 125 ? 23.189 36.567 67.456 1.00 23.24  ? 125 THR A OG1 1 
ATOM   999  C  CG2 . THR A 1 125 ? 22.466 38.482 68.643 1.00 24.38  ? 125 THR A CG2 1 
ATOM   1000 N  N   . LYS A 1 126 ? 22.086 40.856 66.182 1.00 22.12  ? 126 LYS A N   1 
ATOM   1001 C  CA  . LYS A 1 126 ? 22.047 42.303 66.333 1.00 20.74  ? 126 LYS A CA  1 
ATOM   1002 C  C   . LYS A 1 126 ? 22.626 42.780 67.673 1.00 20.34  ? 126 LYS A C   1 
ATOM   1003 O  O   . LYS A 1 126 ? 22.780 41.993 68.594 1.00 22.36  ? 126 LYS A O   1 
ATOM   1004 C  CB  . LYS A 1 126 ? 20.639 42.858 66.174 1.00 21.49  ? 126 LYS A CB  1 
ATOM   1005 C  CG  . LYS A 1 126 ? 20.046 42.599 64.796 1.00 23.47  ? 126 LYS A CG  1 
ATOM   1006 C  CD  . LYS A 1 126 ? 18.661 43.245 64.677 1.00 24.81  ? 126 LYS A CD  1 
ATOM   1007 C  CE  . LYS A 1 126 ? 17.982 42.903 63.386 1.00 24.86  ? 126 LYS A CE  1 
ATOM   1008 N  NZ  . LYS A 1 126 ? 16.632 43.474 63.199 1.00 22.93  ? 126 LYS A NZ  1 
ATOM   1009 N  N   . GLU A 1 127 ? 22.959 44.074 67.724 1.00 22.42  ? 127 GLU A N   1 
ATOM   1010 C  CA  . GLU A 1 127 ? 23.605 44.498 68.965 1.00 22.86  ? 127 GLU A CA  1 
ATOM   1011 C  C   . GLU A 1 127 ? 22.650 44.432 70.146 1.00 23.12  ? 127 GLU A C   1 
ATOM   1012 O  O   . GLU A 1 127 ? 23.186 44.354 71.258 1.00 25.37  ? 127 GLU A O   1 
ATOM   1013 C  CB  . GLU A 1 127 ? 24.203 45.885 68.773 1.00 27.13  ? 127 GLU A CB  1 
ATOM   1014 C  CG  . GLU A 1 127 ? 23.247 46.972 68.463 1.00 26.15  ? 127 GLU A CG  1 
ATOM   1015 C  CD  . GLU A 1 127 ? 23.819 48.365 68.310 1.00 24.22  ? 127 GLU A CD  1 
ATOM   1016 O  OE1 . GLU A 1 127 ? 22.965 49.282 68.369 1.00 26.20  ? 127 GLU A OE1 1 
ATOM   1017 O  OE2 . GLU A 1 127 ? 25.008 48.657 68.142 1.00 25.74  ? 127 GLU A OE2 1 
ATOM   1018 N  N   . ASP A 1 128 ? 21.338 44.480 70.019 1.00 23.47  ? 128 ASP A N   1 
ATOM   1019 C  CA  . ASP A 1 128 ? 20.451 44.271 71.146 1.00 24.49  ? 128 ASP A CA  1 
ATOM   1020 C  C   . ASP A 1 128 ? 20.149 42.791 71.468 1.00 23.10  ? 128 ASP A C   1 
ATOM   1021 O  O   . ASP A 1 128 ? 19.280 42.519 72.326 1.00 28.11  ? 128 ASP A O   1 
ATOM   1022 C  CB  . ASP A 1 128 ? 19.097 44.996 70.920 1.00 24.74  ? 128 ASP A CB  1 
ATOM   1023 C  CG  . ASP A 1 128 ? 18.152 44.385 69.932 1.00 27.07  ? 128 ASP A CG  1 
ATOM   1024 O  OD1 . ASP A 1 128 ? 18.580 43.424 69.247 1.00 25.72  ? 128 ASP A OD1 1 
ATOM   1025 O  OD2 . ASP A 1 128 ? 16.957 44.781 69.805 1.00 30.69  ? 128 ASP A OD2 1 
ATOM   1026 N  N   . GLY A 1 129 ? 20.805 41.888 70.792 1.00 23.44  ? 129 GLY A N   1 
ATOM   1027 C  CA  . GLY A 1 129 ? 20.635 40.456 70.986 1.00 25.52  ? 129 GLY A CA  1 
ATOM   1028 C  C   . GLY A 1 129 ? 19.655 39.734 70.093 1.00 28.08  ? 129 GLY A C   1 
ATOM   1029 O  O   . GLY A 1 129 ? 19.503 38.520 70.249 1.00 25.95  ? 129 GLY A O   1 
ATOM   1030 N  N   . GLU A 1 130 ? 18.981 40.451 69.205 1.00 25.23  ? 130 GLU A N   1 
ATOM   1031 C  CA  . GLU A 1 130 ? 18.071 39.777 68.262 1.00 23.31  ? 130 GLU A CA  1 
ATOM   1032 C  C   . GLU A 1 130 ? 18.860 38.950 67.249 1.00 23.16  ? 130 GLU A C   1 
ATOM   1033 O  O   . GLU A 1 130 ? 19.701 39.475 66.554 1.00 22.75  ? 130 GLU A O   1 
ATOM   1034 C  CB  A GLU A 1 130 ? 17.175 40.727 67.491 0.53 27.79  ? 130 GLU A CB  1 
ATOM   1035 C  CB  B GLU A 1 130 ? 17.161 40.758 67.543 0.47 29.48  ? 130 GLU A CB  1 
ATOM   1036 C  CG  A GLU A 1 130 ? 16.213 40.164 66.470 0.53 30.33  ? 130 GLU A CG  1 
ATOM   1037 C  CG  B GLU A 1 130 ? 16.267 41.696 68.357 0.47 34.53  ? 130 GLU A CG  1 
ATOM   1038 C  CD  A GLU A 1 130 ? 15.663 41.170 65.483 0.53 34.70  ? 130 GLU A CD  1 
ATOM   1039 C  CD  B GLU A 1 130 ? 15.630 42.771 67.484 0.47 43.29  ? 130 GLU A CD  1 
ATOM   1040 O  OE1 A GLU A 1 130 ? 15.460 42.341 65.827 0.53 44.63  ? 130 GLU A OE1 1 
ATOM   1041 O  OE1 B GLU A 1 130 ? 15.345 42.384 66.314 0.47 45.23  ? 130 GLU A OE1 1 
ATOM   1042 O  OE2 A GLU A 1 130 ? 15.398 40.851 64.308 0.53 41.50  ? 130 GLU A OE2 1 
ATOM   1043 O  OE2 B GLU A 1 130 ? 15.424 43.914 67.949 0.47 38.82  ? 130 GLU A OE2 1 
ATOM   1044 N  N   . LYS A 1 131 ? 18.589 37.674 67.219 1.00 24.66  ? 131 LYS A N   1 
ATOM   1045 C  CA  . LYS A 1 131 ? 19.298 36.763 66.311 1.00 24.10  ? 131 LYS A CA  1 
ATOM   1046 C  C   . LYS A 1 131 ? 18.812 36.977 64.894 1.00 25.27  ? 131 LYS A C   1 
ATOM   1047 O  O   . LYS A 1 131 ? 17.566 37.076 64.701 1.00 31.05  ? 131 LYS A O   1 
ATOM   1048 C  CB  A LYS A 1 131 ? 19.076 35.309 66.735 0.48 26.17  ? 131 LYS A CB  1 
ATOM   1049 C  CB  B LYS A 1 131 ? 19.111 35.321 66.762 0.52 26.05  ? 131 LYS A CB  1 
ATOM   1050 C  CG  A LYS A 1 131 ? 19.430 34.959 68.165 0.48 28.30  ? 131 LYS A CG  1 
ATOM   1051 C  CG  B LYS A 1 131 ? 19.577 34.978 68.159 0.52 28.40  ? 131 LYS A CG  1 
ATOM   1052 C  CD  A LYS A 1 131 ? 19.153 33.524 68.582 0.48 31.91  ? 131 LYS A CD  1 
ATOM   1053 C  CD  B LYS A 1 131 ? 19.264 33.558 68.619 0.52 30.98  ? 131 LYS A CD  1 
ATOM   1054 C  CE  A LYS A 1 131 ? 19.730 33.135 69.921 0.48 35.40  ? 131 LYS A CE  1 
ATOM   1055 C  CE  B LYS A 1 131 ? 19.427 33.401 70.121 0.52 33.85  ? 131 LYS A CE  1 
ATOM   1056 N  NZ  A LYS A 1 131 ? 19.674 34.186 70.971 0.48 51.47  ? 131 LYS A NZ  1 
ATOM   1057 N  NZ  B LYS A 1 131 ? 19.658 31.992 70.515 0.52 37.71  ? 131 LYS A NZ  1 
ATOM   1058 N  N   . VAL A 1 132 ? 19.699 37.060 63.921 1.00 24.58  ? 132 VAL A N   1 
ATOM   1059 C  CA  . VAL A 1 132 ? 19.315 37.234 62.536 1.00 25.20  ? 132 VAL A CA  1 
ATOM   1060 C  C   . VAL A 1 132 ? 19.532 35.982 61.715 1.00 23.99  ? 132 VAL A C   1 
ATOM   1061 O  O   . VAL A 1 132 ? 18.570 35.466 61.113 1.00 25.31  ? 132 VAL A O   1 
ATOM   1062 C  CB  . VAL A 1 132 ? 20.085 38.425 61.914 1.00 27.35  ? 132 VAL A CB  1 
ATOM   1063 C  CG1 . VAL A 1 132 ? 19.686 38.612 60.461 1.00 26.04  ? 132 VAL A CG1 1 
ATOM   1064 C  CG2 . VAL A 1 132 ? 19.799 39.637 62.799 1.00 26.50  ? 132 VAL A CG2 1 
ATOM   1065 N  N   . VAL A 1 133 ? 20.778 35.496 61.709 1.00 23.99  ? 133 VAL A N   1 
ATOM   1066 C  CA  . VAL A 1 133 ? 21.025 34.194 61.042 1.00 23.96  ? 133 VAL A CA  1 
ATOM   1067 C  C   . VAL A 1 133 ? 21.839 33.341 62.003 1.00 22.52  ? 133 VAL A C   1 
ATOM   1068 O  O   . VAL A 1 133 ? 22.671 33.866 62.757 1.00 24.25  ? 133 VAL A O   1 
ATOM   1069 C  CB  . VAL A 1 133 ? 21.756 34.294 59.700 1.00 29.50  ? 133 VAL A CB  1 
ATOM   1070 C  CG1 . VAL A 1 133 ? 20.978 35.093 58.638 1.00 37.50  ? 133 VAL A CG1 1 
ATOM   1071 C  CG2 . VAL A 1 133 ? 23.088 34.929 59.940 1.00 29.43  ? 133 VAL A CG2 1 
ATOM   1072 N  N   . ASP A 1 134 ? 21.585 32.044 61.951 1.00 25.34  ? 134 ASP A N   1 
ATOM   1073 C  CA  . ASP A 1 134 ? 22.338 31.102 62.781 1.00 25.12  ? 134 ASP A CA  1 
ATOM   1074 C  C   . ASP A 1 134 ? 23.641 30.704 62.089 1.00 25.05  ? 134 ASP A C   1 
ATOM   1075 O  O   . ASP A 1 134 ? 23.970 31.205 61.024 1.00 28.00  ? 134 ASP A O   1 
ATOM   1076 C  CB  . ASP A 1 134 ? 21.430 29.938 63.166 1.00 25.51  ? 134 ASP A CB  1 
ATOM   1077 C  CG  . ASP A 1 134 ? 21.047 28.978 62.074 1.00 31.79  ? 134 ASP A CG  1 
ATOM   1078 O  OD1 . ASP A 1 134 ? 20.117 28.144 62.217 1.00 34.95  ? 134 ASP A OD1 1 
ATOM   1079 O  OD2 . ASP A 1 134 ? 21.677 29.067 61.002 1.00 31.04  ? 134 ASP A OD2 1 
ATOM   1080 N  N   . GLU A 1 135 ? 24.354 29.778 62.736 1.00 28.14  ? 135 GLU A N   1 
ATOM   1081 C  CA  . GLU A 1 135 ? 25.697 29.460 62.299 1.00 31.01  ? 135 GLU A CA  1 
ATOM   1082 C  C   . GLU A 1 135 ? 25.619 28.769 60.956 1.00 32.29  ? 135 GLU A C   1 
ATOM   1083 O  O   . GLU A 1 135 ? 26.487 28.783 60.096 1.00 38.34  ? 135 GLU A O   1 
ATOM   1084 C  CB  . GLU A 1 135 ? 26.402 28.589 63.344 1.00 33.21  ? 135 GLU A CB  1 
ATOM   1085 C  CG  . GLU A 1 135 ? 27.861 28.380 63.039 1.00 43.97  ? 135 GLU A CG  1 
ATOM   1086 C  CD  . GLU A 1 135 ? 28.763 29.553 62.699 1.00 47.86  ? 135 GLU A CD  1 
ATOM   1087 O  OE1 . GLU A 1 135 ? 29.649 29.304 61.828 1.00 51.53  ? 135 GLU A OE1 1 
ATOM   1088 O  OE2 . GLU A 1 135 ? 28.673 30.704 63.214 1.00 35.94  ? 135 GLU A OE2 1 
ATOM   1089 N  N   . ALA A 1 136 ? 24.503 28.082 60.792 1.00 30.67  ? 136 ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 136 ? 24.361 27.385 59.532 1.00 32.88  ? 136 ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 136 ? 23.878 28.327 58.428 1.00 35.97  ? 136 ALA A C   1 
ATOM   1092 O  O   . ALA A 1 136 ? 23.872 27.859 57.270 1.00 37.63  ? 136 ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 136 ? 23.387 26.218 59.700 1.00 42.43  ? 136 ALA A CB  1 
ATOM   1094 N  N   . GLY A 1 137 ? 23.492 29.529 58.707 1.00 30.67  ? 137 GLY A N   1 
ATOM   1095 C  CA  . GLY A 1 137 ? 23.094 30.552 57.726 1.00 29.17  ? 137 GLY A CA  1 
ATOM   1096 C  C   . GLY A 1 137 ? 21.619 30.757 57.476 1.00 26.93  ? 137 GLY A C   1 
ATOM   1097 O  O   . GLY A 1 137 ? 21.178 31.545 56.637 1.00 29.96  ? 137 GLY A O   1 
ATOM   1098 N  N   . LYS A 1 138 ? 20.793 30.069 58.243 1.00 25.94  ? 138 LYS A N   1 
ATOM   1099 C  CA  . LYS A 1 138 ? 19.359 30.206 58.154 1.00 28.58  ? 138 LYS A CA  1 
ATOM   1100 C  C   . LYS A 1 138 ? 18.889 31.423 58.919 1.00 26.74  ? 138 LYS A C   1 
ATOM   1101 O  O   . LYS A 1 138 ? 19.274 31.723 60.043 1.00 26.78  ? 138 LYS A O   1 
ATOM   1102 C  CB  . LYS A 1 138 ? 18.687 28.952 58.716 1.00 33.97  ? 138 LYS A CB  1 
ATOM   1103 C  CG  . LYS A 1 138 ? 17.188 29.006 58.769 1.00 35.27  ? 138 LYS A CG  1 
ATOM   1104 C  CD  . LYS A 1 138 ? 16.580 27.793 59.460 1.00 42.68  ? 138 LYS A CD  1 
ATOM   1105 C  CE  . LYS A 1 138 ? 16.567 27.973 60.976 1.00 68.16  ? 138 LYS A CE  1 
ATOM   1106 N  NZ  . LYS A 1 138 ? 16.451 26.668 61.725 1.00 72.96  ? 138 LYS A NZ  1 
ATOM   1107 N  N   . ARG A 1 139 ? 18.009 32.174 58.297 1.00 28.17  ? 139 ARG A N   1 
ATOM   1108 C  CA  . ARG A 1 139 ? 17.357 33.258 58.979 1.00 31.10  ? 139 ARG A CA  1 
ATOM   1109 C  C   . ARG A 1 139 ? 16.436 32.779 60.105 1.00 32.43  ? 139 ARG A C   1 
ATOM   1110 O  O   . ARG A 1 139 ? 15.680 31.809 59.883 1.00 39.74  ? 139 ARG A O   1 
ATOM   1111 C  CB  . ARG A 1 139 ? 16.389 33.946 58.017 1.00 36.05  ? 139 ARG A CB  1 
ATOM   1112 C  CG  . ARG A 1 139 ? 16.976 35.034 57.199 1.00 39.85  ? 139 ARG A CG  1 
ATOM   1113 C  CD  . ARG A 1 139 ? 17.355 36.228 58.037 1.00 39.35  ? 139 ARG A CD  1 
ATOM   1114 N  NE  . ARG A 1 139 ? 16.174 37.054 58.272 1.00 45.16  ? 139 ARG A NE  1 
ATOM   1115 C  CZ  . ARG A 1 139 ? 15.602 37.415 59.398 1.00 43.09  ? 139 ARG A CZ  1 
ATOM   1116 N  NH1 . ARG A 1 139 ? 16.084 37.040 60.598 1.00 41.37  ? 139 ARG A NH1 1 
ATOM   1117 N  NH2 . ARG A 1 139 ? 14.508 38.192 59.338 1.00 43.72  ? 139 ARG A NH2 1 
ATOM   1118 N  N   . LEU A 1 140 ? 16.416 33.435 61.231 1.00 34.01  ? 140 LEU A N   1 
ATOM   1119 C  CA  . LEU A 1 140 ? 15.539 32.970 62.307 1.00 41.28  ? 140 LEU A CA  1 
ATOM   1120 C  C   . LEU A 1 140 ? 14.169 33.614 62.327 1.00 45.61  ? 140 LEU A C   1 
ATOM   1121 O  O   . LEU A 1 140 ? 14.049 34.650 61.686 1.00 49.85  ? 140 LEU A O   1 
ATOM   1122 C  CB  . LEU A 1 140 ? 16.346 33.233 63.588 1.00 42.64  ? 140 LEU A CB  1 
ATOM   1123 C  CG  . LEU A 1 140 ? 17.726 32.565 63.628 1.00 40.24  ? 140 LEU A CG  1 
ATOM   1124 C  CD1 . LEU A 1 140 ? 18.148 32.355 65.035 1.00 59.14  ? 140 LEU A CD1 1 
ATOM   1125 C  CD2 . LEU A 1 140 ? 17.757 31.151 62.992 1.00 61.53  ? 140 LEU A CD2 1 
HETATM 1126 S  S   . SO4 B 2 .   ? 18.189 53.073 66.689 1.00 41.91  ? 402 SO4 A S   1 
HETATM 1127 O  O1  . SO4 B 2 .   ? 18.202 51.969 65.709 1.00 33.20  ? 402 SO4 A O1  1 
HETATM 1128 O  O2  . SO4 B 2 .   ? 19.388 53.061 67.615 1.00 47.71  ? 402 SO4 A O2  1 
HETATM 1129 O  O3  . SO4 B 2 .   ? 18.190 54.419 66.042 1.00 51.36  ? 402 SO4 A O3  1 
HETATM 1130 O  O4  . SO4 B 2 .   ? 16.996 52.948 67.583 1.00 49.83  ? 402 SO4 A O4  1 
HETATM 1131 S  S   . SO4 C 2 .   ? 10.684 52.839 60.357 1.00 51.17  ? 403 SO4 A S   1 
HETATM 1132 O  O1  . SO4 C 2 .   ? 10.733 51.376 60.396 1.00 69.69  ? 403 SO4 A O1  1 
HETATM 1133 O  O2  . SO4 C 2 .   ? 9.282  53.331 60.123 1.00 71.74  ? 403 SO4 A O2  1 
HETATM 1134 O  O3  . SO4 C 2 .   ? 11.186 53.478 61.553 1.00 59.17  ? 403 SO4 A O3  1 
HETATM 1135 O  O4  . SO4 C 2 .   ? 11.338 53.306 59.096 1.00 64.99  ? 403 SO4 A O4  1 
HETATM 1136 S  S   . SO4 D 2 .   ? 17.328 47.117 63.431 1.00 25.91  ? 404 SO4 A S   1 
HETATM 1137 O  O1  . SO4 D 2 .   ? 17.251 48.517 63.964 1.00 31.67  ? 404 SO4 A O1  1 
HETATM 1138 O  O2  . SO4 D 2 .   ? 16.626 47.200 62.133 1.00 30.25  ? 404 SO4 A O2  1 
HETATM 1139 O  O3  . SO4 D 2 .   ? 18.716 46.789 63.173 1.00 30.42  ? 404 SO4 A O3  1 
HETATM 1140 O  O4  . SO4 D 2 .   ? 16.618 46.145 64.261 1.00 24.98  ? 404 SO4 A O4  1 
HETATM 1141 S  S   . SO3 E 3 .   ? 14.428 56.524 64.378 0.40 62.19  ? 502 SO3 A S   1 
HETATM 1142 O  O1  . SO3 E 3 .   ? 14.502 57.005 62.915 0.40 47.14  ? 502 SO3 A O1  1 
HETATM 1143 O  O2  . SO3 E 3 .   ? 13.600 55.321 64.239 0.40 49.27  ? 502 SO3 A O2  1 
HETATM 1144 O  O3  . SO3 E 3 .   ? 15.775 56.148 64.828 0.40 55.89  ? 502 SO3 A O3  1 
HETATM 1145 CS CS  . CS  F 4 .   ? 21.465 37.678 48.404 0.50 24.83  ? 602 CS  A CS  1 
HETATM 1146 CS CS  . CS  G 4 .   ? 16.556 48.410 68.789 0.40 43.17  ? 603 CS  A CS  1 
HETATM 1147 CS CS  . CS  H 4 .   ? 28.255 64.159 47.017 0.24 41.65  ? 604 CS  A CS  1 
HETATM 1148 CS CS  . CS  I 4 .   ? 35.126 40.117 49.587 0.19 44.97  ? 605 CS  A CS  1 
HETATM 1149 CS CS  . CS  J 4 .   ? 19.500 73.125 65.182 0.21 48.98  ? 606 CS  A CS  1 
HETATM 1150 CS CS  . CS  K 4 .   ? 27.519 30.433 57.500 0.19 51.06  ? 607 CS  A CS  1 
HETATM 1151 CS CS  . CS  L 4 .   ? 18.917 71.166 63.581 0.17 53.70  ? 608 CS  A CS  1 
HETATM 1152 CS CS  . CS  M 4 .   ? 2.601  72.122 60.306 0.16 39.55  ? 609 CS  A CS  1 
HETATM 1153 CS CS  . CS  N 4 .   ? 13.465 61.172 67.941 0.15 108.19 ? 610 CS  A CS  1 
HETATM 1154 CS CS  . CS  O 4 .   ? 33.673 50.122 47.861 0.20 61.11  ? 611 CS  A CS  1 
HETATM 1155 O  O   . HOH P 5 .   ? 5.827  67.607 60.296 1.00 26.95  ? 612 HOH A O   1 
HETATM 1156 O  O   . HOH P 5 .   ? 25.239 38.262 53.517 1.00 22.55  ? 613 HOH A O   1 
HETATM 1157 O  O   . HOH P 5 .   ? 25.845 45.080 65.033 1.00 21.73  ? 614 HOH A O   1 
HETATM 1158 O  O   . HOH P 5 .   ? 4.766  73.116 49.544 1.00 26.26  ? 615 HOH A O   1 
HETATM 1159 O  O   . HOH P 5 .   ? 19.963 45.812 67.703 1.00 24.21  ? 616 HOH A O   1 
HETATM 1160 O  O   . HOH P 5 .   ? 22.892 37.462 52.339 1.00 23.61  ? 617 HOH A O   1 
HETATM 1161 O  O   . HOH P 5 .   ? 28.828 40.537 50.063 1.00 27.69  ? 618 HOH A O   1 
HETATM 1162 O  O   . HOH P 5 .   ? 28.984 33.992 47.170 1.00 27.35  ? 619 HOH A O   1 
HETATM 1163 O  O   . HOH P 5 .   ? 7.503  76.186 61.392 1.00 25.63  ? 620 HOH A O   1 
HETATM 1164 O  O   . HOH P 5 .   ? 28.036 36.003 65.987 1.00 25.17  ? 621 HOH A O   1 
HETATM 1165 O  O   . HOH P 5 .   ? 18.354 43.651 74.623 1.00 27.96  ? 622 HOH A O   1 
HETATM 1166 O  O   . HOH P 5 .   ? 31.782 60.736 54.457 1.00 28.75  ? 623 HOH A O   1 
HETATM 1167 O  O   . HOH P 5 .   ? 18.823 60.719 58.960 1.00 26.25  ? 624 HOH A O   1 
HETATM 1168 O  O   . HOH P 5 .   ? 23.835 36.490 50.043 1.00 25.80  ? 625 HOH A O   1 
HETATM 1169 O  O   . HOH P 5 .   ? 7.608  73.425 49.921 1.00 23.33  ? 626 HOH A O   1 
HETATM 1170 O  O   . HOH P 5 .   ? 18.537 49.366 66.491 1.00 27.23  ? 627 HOH A O   1 
HETATM 1171 O  O   . HOH P 5 .   ? 7.894  69.728 42.112 1.00 24.10  ? 628 HOH A O   1 
HETATM 1172 O  O   . HOH P 5 .   ? 25.884 44.366 71.557 1.00 24.81  ? 629 HOH A O   1 
HETATM 1173 O  O   . HOH P 5 .   ? 25.427 35.191 66.846 1.00 26.30  ? 630 HOH A O   1 
HETATM 1174 O  O   . HOH P 5 .   ? 5.071  64.082 47.399 1.00 29.94  ? 631 HOH A O   1 
HETATM 1175 O  O   . HOH P 5 .   ? 26.365 60.548 58.713 1.00 25.11  ? 632 HOH A O   1 
HETATM 1176 O  O   . HOH P 5 .   ? 23.627 35.329 54.125 1.00 27.82  ? 633 HOH A O   1 
HETATM 1177 O  O   . HOH P 5 .   ? 22.057 34.446 65.542 1.00 29.72  ? 634 HOH A O   1 
HETATM 1178 O  O   . HOH P 5 .   ? 3.301  65.722 50.268 1.00 24.50  ? 635 HOH A O   1 
HETATM 1179 O  O   . HOH P 5 .   ? 26.756 47.307 66.494 1.00 21.90  ? 636 HOH A O   1 
HETATM 1180 O  O   . HOH P 5 .   ? 16.870 72.257 43.275 1.00 28.32  ? 637 HOH A O   1 
HETATM 1181 O  O   . HOH P 5 .   ? 27.779 42.228 47.807 1.00 29.49  ? 638 HOH A O   1 
HETATM 1182 O  O   . HOH P 5 .   ? 7.954  66.924 41.761 1.00 23.82  ? 639 HOH A O   1 
HETATM 1183 O  O   . HOH P 5 .   ? 6.389  61.092 55.960 1.00 26.83  ? 640 HOH A O   1 
HETATM 1184 O  O   . HOH P 5 .   ? 15.275 74.259 52.795 1.00 27.20  ? 641 HOH A O   1 
HETATM 1185 O  O   . HOH P 5 .   ? 24.034 40.832 71.143 1.00 27.58  ? 642 HOH A O   1 
HETATM 1186 O  O   . HOH P 5 .   ? 33.439 47.657 48.972 1.00 29.67  ? 643 HOH A O   1 
HETATM 1187 O  O   . HOH P 5 .   ? 10.005 73.491 48.565 1.00 23.21  ? 644 HOH A O   1 
HETATM 1188 O  O   . HOH P 5 .   ? 12.261 72.134 48.897 1.00 23.61  ? 645 HOH A O   1 
HETATM 1189 O  O   . HOH P 5 .   ? 8.517  59.342 55.776 1.00 27.08  ? 646 HOH A O   1 
HETATM 1190 O  O   . HOH P 5 .   ? 3.355  71.242 46.483 1.00 23.34  ? 647 HOH A O   1 
HETATM 1191 O  O   . HOH P 5 .   ? 11.418 56.904 56.391 1.00 26.91  ? 648 HOH A O   1 
HETATM 1192 O  O   . HOH P 5 .   ? 22.876 32.854 55.004 1.00 27.16  ? 649 HOH A O   1 
HETATM 1193 O  O   . HOH P 5 .   ? 29.192 48.666 66.037 1.00 30.60  ? 650 HOH A O   1 
HETATM 1194 O  O   . HOH P 5 .   ? 28.271 61.808 49.188 1.00 26.97  ? 651 HOH A O   1 
HETATM 1195 O  O   . HOH P 5 .   ? 27.026 60.107 47.230 1.00 29.93  ? 652 HOH A O   1 
HETATM 1196 O  O   . HOH P 5 .   ? 16.855 66.964 64.643 1.00 32.73  ? 653 HOH A O   1 
HETATM 1197 O  O   . HOH P 5 .   ? 14.754 49.988 49.610 1.00 27.34  ? 654 HOH A O   1 
HETATM 1198 O  O   . HOH P 5 .   ? 21.111 56.790 54.512 1.00 30.40  ? 655 HOH A O   1 
HETATM 1199 O  O   . HOH P 5 .   ? 22.195 31.915 66.499 1.00 34.29  ? 656 HOH A O   1 
HETATM 1200 O  O   . HOH P 5 .   ? 32.802 37.897 59.925 1.00 27.81  ? 657 HOH A O   1 
HETATM 1201 O  O   . HOH P 5 .   ? 25.410 32.101 55.919 1.00 30.59  ? 658 HOH A O   1 
HETATM 1202 O  O   . HOH P 5 .   ? 20.902 36.636 71.479 1.00 30.67  ? 659 HOH A O   1 
HETATM 1203 O  O   . HOH P 5 .   ? 4.093  62.453 49.376 1.00 27.49  ? 660 HOH A O   1 
HETATM 1204 O  O   . HOH P 5 .   ? 6.613  60.503 47.608 1.00 26.39  ? 661 HOH A O   1 
HETATM 1205 O  O   . HOH P 5 .   ? 14.234 73.129 60.869 1.00 30.97  ? 662 HOH A O   1 
HETATM 1206 O  O   . HOH P 5 .   ? 14.544 73.306 50.286 1.00 35.82  ? 663 HOH A O   1 
HETATM 1207 O  O   . HOH P 5 .   ? 8.725  68.344 67.205 1.00 27.97  ? 664 HOH A O   1 
HETATM 1208 O  O   . HOH P 5 .   ? 21.156 61.699 63.722 1.00 39.19  ? 665 HOH A O   1 
HETATM 1209 O  O   . HOH P 5 .   ? 22.666 35.244 69.833 1.00 28.85  ? 666 HOH A O   1 
HETATM 1210 O  O   . HOH P 5 .   ? 7.615  63.939 63.357 1.00 34.41  ? 667 HOH A O   1 
HETATM 1211 O  O   . HOH P 5 .   ? 10.882 58.107 60.434 1.00 30.75  ? 668 HOH A O   1 
HETATM 1212 O  O   . HOH P 5 .   ? 21.920 27.741 55.279 1.00 29.91  ? 669 HOH A O   1 
HETATM 1213 O  O   . HOH P 5 .   ? 24.417 67.424 48.084 1.00 32.74  ? 670 HOH A O   1 
HETATM 1214 O  O   . HOH P 5 .   ? 8.079  59.031 44.794 1.00 27.52  ? 671 HOH A O   1 
HETATM 1215 O  O   . HOH P 5 .   ? 25.724 60.831 63.656 1.00 34.31  ? 672 HOH A O   1 
HETATM 1216 O  O   . HOH P 5 .   ? 5.165  64.632 43.464 1.00 28.57  ? 673 HOH A O   1 
HETATM 1217 O  O   . HOH P 5 .   ? 19.195 70.998 59.333 1.00 44.37  ? 674 HOH A O   1 
HETATM 1218 O  O   . HOH P 5 .   ? 21.545 54.201 68.810 1.00 33.65  ? 675 HOH A O   1 
HETATM 1219 O  O   . HOH P 5 .   ? 7.419  53.466 48.979 1.00 31.18  ? 676 HOH A O   1 
HETATM 1220 O  O   . HOH P 5 .   ? 5.124  72.576 61.299 1.00 28.74  ? 677 HOH A O   1 
HETATM 1221 O  O   . HOH P 5 .   ? 16.472 36.568 68.972 1.00 34.11  ? 678 HOH A O   1 
HETATM 1222 O  O   . HOH P 5 .   ? 35.056 54.428 53.349 1.00 31.93  ? 679 HOH A O   1 
HETATM 1223 O  O   . HOH P 5 .   ? 17.567 74.575 63.250 1.00 33.79  ? 680 HOH A O   1 
HETATM 1224 O  O   . HOH P 5 .   ? 13.613 48.974 52.051 1.00 40.98  ? 681 HOH A O   1 
HETATM 1225 O  O   . HOH P 5 .   ? 10.268 53.912 54.587 1.00 32.82  ? 682 HOH A O   1 
HETATM 1226 O  O   . HOH P 5 .   ? 13.925 59.058 41.601 1.00 33.15  ? 683 HOH A O   1 
HETATM 1227 O  O   . HOH P 5 .   ? 33.710 57.474 56.167 1.00 36.99  ? 684 HOH A O   1 
HETATM 1228 O  O   . HOH P 5 .   ? 23.890 29.981 65.633 1.00 33.83  ? 685 HOH A O   1 
HETATM 1229 O  O   . HOH P 5 .   ? 32.227 39.524 50.484 1.00 37.42  ? 686 HOH A O   1 
HETATM 1230 O  O   . HOH P 5 .   ? 20.545 67.950 58.575 1.00 33.87  ? 687 HOH A O   1 
HETATM 1231 O  O   . HOH P 5 .   ? 27.631 61.172 61.069 1.00 33.71  ? 688 HOH A O   1 
HETATM 1232 O  O   . HOH P 5 .   ? 23.337 66.547 41.023 1.00 34.69  ? 689 HOH A O   1 
HETATM 1233 O  O   . HOH P 5 .   ? 0.650  66.584 47.446 1.00 37.54  ? 690 HOH A O   1 
HETATM 1234 O  O   . HOH P 5 .   ? 11.426 47.017 55.016 1.00 36.73  ? 691 HOH A O   1 
HETATM 1235 O  O   . HOH P 5 .   ? 32.497 60.652 51.878 1.00 36.86  ? 692 HOH A O   1 
HETATM 1236 O  O   . HOH P 5 .   ? 30.641 35.439 61.562 1.00 44.33  ? 693 HOH A O   1 
HETATM 1237 O  O   . HOH P 5 .   ? 21.720 53.221 43.535 1.00 30.70  ? 694 HOH A O   1 
HETATM 1238 O  O   . HOH P 5 .   ? 17.322 45.757 66.976 1.00 29.15  ? 695 HOH A O   1 
HETATM 1239 O  O   . HOH P 5 .   ? 5.893  66.138 62.528 1.00 29.86  ? 696 HOH A O   1 
HETATM 1240 O  O   . HOH P 5 .   ? -1.933 69.116 48.934 1.00 30.74  ? 697 HOH A O   1 
HETATM 1241 O  O   . HOH P 5 .   ? 11.723 52.896 56.791 1.00 36.60  ? 698 HOH A O   1 
HETATM 1242 O  O   . HOH P 5 .   ? 17.516 37.908 51.627 1.00 35.82  ? 699 HOH A O   1 
HETATM 1243 O  O   . HOH P 5 .   ? 24.090 54.820 43.175 1.00 36.85  ? 700 HOH A O   1 
HETATM 1244 O  O   . HOH P 5 .   ? 18.275 71.680 46.682 1.00 42.91  ? 701 HOH A O   1 
HETATM 1245 O  O   . HOH P 5 .   ? 26.217 30.573 67.016 1.00 35.52  ? 702 HOH A O   1 
HETATM 1246 O  O   . HOH P 5 .   ? 12.399 61.157 42.310 1.00 40.89  ? 703 HOH A O   1 
HETATM 1247 O  O   . HOH P 5 .   ? 21.393 49.927 42.518 1.00 42.16  ? 704 HOH A O   1 
HETATM 1248 O  O   . HOH P 5 .   ? 33.576 56.440 58.738 1.00 35.75  ? 705 HOH A O   1 
HETATM 1249 O  O   . HOH P 5 .   ? 11.738 57.191 41.735 1.00 32.83  ? 706 HOH A O   1 
HETATM 1250 O  O   . HOH P 5 .   ? 19.637 41.775 42.280 1.00 38.35  ? 707 HOH A O   1 
HETATM 1251 O  O   . HOH P 5 .   ? 13.364 43.256 62.252 1.00 33.40  ? 708 HOH A O   1 
HETATM 1252 O  O   . HOH P 5 .   ? 30.247 60.807 62.273 1.00 40.56  ? 709 HOH A O   1 
HETATM 1253 O  O   . HOH P 5 .   ? 33.574 52.216 60.686 1.00 33.22  ? 710 HOH A O   1 
HETATM 1254 O  O   . HOH P 5 .   ? 12.534 55.989 60.829 1.00 32.03  ? 711 HOH A O   1 
HETATM 1255 O  O   . HOH P 5 .   ? -1.976 66.294 55.044 1.00 43.59  ? 712 HOH A O   1 
HETATM 1256 O  O   . HOH P 5 .   ? 35.719 51.463 55.280 1.00 38.70  ? 713 HOH A O   1 
HETATM 1257 O  O   . HOH P 5 .   ? 3.884  59.438 48.523 1.00 41.80  ? 714 HOH A O   1 
HETATM 1258 O  O   . HOH P 5 .   ? 17.977 48.009 43.513 1.00 34.79  ? 715 HOH A O   1 
HETATM 1259 O  O   . HOH P 5 .   ? 16.279 40.150 54.361 1.00 35.68  ? 716 HOH A O   1 
HETATM 1260 O  O   . HOH P 5 .   ? 17.300 74.278 66.998 1.00 33.83  ? 717 HOH A O   1 
HETATM 1261 O  O   . HOH P 5 .   ? 29.808 53.199 63.407 1.00 40.24  ? 718 HOH A O   1 
HETATM 1262 O  O   . HOH P 5 .   ? 16.545 53.349 63.568 1.00 33.84  ? 719 HOH A O   1 
HETATM 1263 O  O   . HOH P 5 .   ? 24.241 41.681 73.550 1.00 38.87  ? 720 HOH A O   1 
HETATM 1264 O  O   . HOH P 5 .   ? 36.679 44.242 51.175 1.00 41.10  ? 721 HOH A O   1 
HETATM 1265 O  O   . HOH P 5 .   ? 33.468 57.963 51.774 1.00 34.78  ? 722 HOH A O   1 
HETATM 1266 O  O   . HOH P 5 .   ? 16.016 74.211 47.919 1.00 44.46  ? 723 HOH A O   1 
HETATM 1267 O  O   . HOH P 5 .   ? 23.714 67.411 58.512 1.00 40.78  ? 724 HOH A O   1 
HETATM 1268 O  O   . HOH P 5 .   ? 31.111 44.495 40.347 1.00 58.60  ? 725 HOH A O   1 
HETATM 1269 O  O   . HOH P 5 .   ? 21.495 57.753 69.349 1.00 44.14  ? 726 HOH A O   1 
HETATM 1270 O  O   . HOH P 5 .   ? 23.522 68.530 43.745 1.00 41.69  ? 727 HOH A O   1 
HETATM 1271 O  O   . HOH P 5 .   ? 23.211 26.681 63.030 1.00 42.90  ? 728 HOH A O   1 
HETATM 1272 O  O   . HOH P 5 .   ? 13.777 65.042 40.142 1.00 36.83  ? 729 HOH A O   1 
HETATM 1273 O  O   . HOH P 5 .   ? 1.085  62.814 48.537 1.00 55.02  ? 730 HOH A O   1 
HETATM 1274 O  O   . HOH P 5 .   ? 25.952 31.879 58.918 1.00 39.02  ? 731 HOH A O   1 
HETATM 1275 O  O   . HOH P 5 .   ? 34.502 38.892 57.721 1.00 48.77  ? 732 HOH A O   1 
HETATM 1276 O  O   . HOH P 5 .   ? 18.761 68.464 62.888 1.00 44.29  ? 733 HOH A O   1 
HETATM 1277 O  O   . HOH P 5 .   ? 17.874 69.216 66.266 1.00 39.10  ? 734 HOH A O   1 
HETATM 1278 O  O   . HOH P 5 .   ? 4.129  61.961 59.788 1.00 37.66  ? 735 HOH A O   1 
HETATM 1279 O  O   . HOH P 5 .   ? 31.044 61.324 49.624 1.00 39.62  ? 736 HOH A O   1 
HETATM 1280 O  O   . HOH P 5 .   ? 30.158 33.867 52.314 1.00 39.91  ? 737 HOH A O   1 
HETATM 1281 O  O   . HOH P 5 .   ? 33.048 58.022 49.111 1.00 51.74  ? 738 HOH A O   1 
HETATM 1282 O  O   . HOH P 5 .   ? 15.143 49.417 65.565 1.00 51.90  ? 739 HOH A O   1 
HETATM 1283 O  O   . HOH P 5 .   ? 31.974 58.804 62.511 1.00 41.13  ? 740 HOH A O   1 
HETATM 1284 O  O   . HOH P 5 .   ? 23.929 47.194 39.753 1.00 47.10  ? 741 HOH A O   1 
HETATM 1285 O  O   . HOH P 5 .   ? 18.124 66.646 39.520 1.00 48.56  ? 742 HOH A O   1 
HETATM 1286 O  O   . HOH P 5 .   ? 12.366 41.419 58.682 1.00 37.76  ? 743 HOH A O   1 
HETATM 1287 O  O   . HOH P 5 .   ? 22.994 70.688 52.811 1.00 47.39  ? 744 HOH A O   1 
HETATM 1288 O  O   . HOH P 5 .   ? 11.258 49.942 52.786 0.50 36.55  ? 745 HOH A O   1 
HETATM 1289 O  O   . HOH P 5 .   ? 29.589 34.777 63.491 1.00 46.45  ? 746 HOH A O   1 
HETATM 1290 O  O   . HOH P 5 .   ? 24.364 62.655 64.773 1.00 53.62  ? 747 HOH A O   1 
HETATM 1291 O  O   . HOH P 5 .   ? 23.314 32.710 69.617 1.00 41.10  ? 748 HOH A O   1 
HETATM 1292 O  O   . HOH P 5 .   ? 11.306 50.307 56.419 1.00 48.16  ? 749 HOH A O   1 
HETATM 1293 O  O   . HOH P 5 .   ? 30.453 43.602 46.267 1.00 46.13  ? 750 HOH A O   1 
HETATM 1294 O  O   . HOH P 5 .   ? 28.199 66.020 49.831 1.00 42.02  ? 751 HOH A O   1 
HETATM 1295 O  O   . HOH P 5 .   ? 15.223 74.206 58.881 1.00 50.83  ? 752 HOH A O   1 
HETATM 1296 O  O   . HOH P 5 .   ? 22.998 27.316 66.140 1.00 53.38  ? 753 HOH A O   1 
HETATM 1297 O  O   . HOH P 5 .   ? 34.846 41.962 56.322 1.00 48.77  ? 754 HOH A O   1 
HETATM 1298 O  O   . HOH P 5 .   ? 28.025 48.696 44.036 1.00 42.16  ? 755 HOH A O   1 
HETATM 1299 O  O   . HOH P 5 .   ? 12.837 62.650 40.470 1.00 47.78  ? 756 HOH A O   1 
HETATM 1300 O  O   . HOH P 5 .   ? 17.983 44.252 44.187 1.00 54.65  ? 757 HOH A O   1 
HETATM 1301 O  O   . HOH P 5 .   ? 1.113  63.152 54.418 1.00 45.37  ? 758 HOH A O   1 
HETATM 1302 O  O   . HOH P 5 .   ? -2.011 63.537 47.704 1.00 50.80  ? 759 HOH A O   1 
HETATM 1303 O  O   . HOH P 5 .   ? 11.383 54.788 43.578 1.00 45.14  ? 760 HOH A O   1 
HETATM 1304 O  O   . HOH P 5 .   ? 3.883  59.986 56.059 1.00 40.24  ? 761 HOH A O   1 
HETATM 1305 O  O   . HOH P 5 .   ? 7.622  52.091 51.173 1.00 43.23  ? 762 HOH A O   1 
HETATM 1306 O  O   . HOH P 5 .   ? 25.905 68.641 55.756 1.00 50.68  ? 763 HOH A O   1 
HETATM 1307 O  O   . HOH P 5 .   ? 21.653 70.648 43.115 1.00 41.23  ? 764 HOH A O   1 
HETATM 1308 O  O   . HOH P 5 .   ? 20.855 67.714 61.528 1.00 49.37  ? 765 HOH A O   1 
HETATM 1309 O  O   . HOH P 5 .   ? 14.638 49.478 61.901 1.00 46.52  ? 766 HOH A O   1 
HETATM 1310 O  O   . HOH P 5 .   ? 19.493 26.144 61.308 1.00 50.63  ? 767 HOH A O   1 
HETATM 1311 O  O   . HOH P 5 .   ? 14.273 47.900 43.926 0.50 33.77  ? 768 HOH A O   1 
HETATM 1312 O  O   . HOH P 5 .   ? 30.184 51.141 64.349 1.00 55.47  ? 769 HOH A O   1 
HETATM 1313 O  O   . HOH P 5 .   ? 32.048 54.591 60.360 1.00 38.71  ? 770 HOH A O   1 
HETATM 1314 O  O   . HOH P 5 .   ? 16.709 72.190 61.935 1.00 41.36  ? 771 HOH A O   1 
HETATM 1315 O  O   . HOH P 5 .   ? 37.119 42.412 54.570 1.00 50.36  ? 772 HOH A O   1 
HETATM 1316 O  O   . HOH P 5 .   ? 14.074 58.795 38.793 1.00 51.79  ? 773 HOH A O   1 
HETATM 1317 O  O   . HOH P 5 .   ? 35.807 44.615 57.134 1.00 51.92  ? 774 HOH A O   1 
HETATM 1318 O  O   . HOH P 5 .   ? 23.334 69.193 49.820 1.00 37.67  ? 775 HOH A O   1 
HETATM 1319 O  O   . HOH P 5 .   ? 11.481 48.340 47.335 1.00 53.98  ? 776 HOH A O   1 
HETATM 1320 O  O   . HOH P 5 .   ? 4.376  57.715 49.907 1.00 47.76  ? 777 HOH A O   1 
HETATM 1321 O  O   . HOH P 5 .   ? 7.131  56.997 56.200 1.00 45.17  ? 778 HOH A O   1 
HETATM 1322 O  O   . HOH P 5 .   ? 23.525 60.321 69.600 1.00 49.52  ? 779 HOH A O   1 
HETATM 1323 O  O   . HOH P 5 .   ? 13.502 46.081 50.703 1.00 40.58  ? 780 HOH A O   1 
HETATM 1324 O  O   . HOH P 5 .   ? 35.764 54.733 58.285 1.00 49.83  ? 781 HOH A O   1 
HETATM 1325 O  O   . HOH P 5 .   ? 28.997 30.888 55.821 1.00 47.53  ? 782 HOH A O   1 
HETATM 1326 O  O   . HOH P 5 .   ? 9.983  63.738 40.072 1.00 44.28  ? 783 HOH A O   1 
HETATM 1327 O  O   . HOH P 5 .   ? 2.395  62.152 57.529 1.00 47.78  ? 784 HOH A O   1 
HETATM 1328 O  O   . HOH P 5 .   ? 12.612 49.302 60.344 1.00 37.06  ? 785 HOH A O   1 
HETATM 1329 O  O   . HOH P 5 .   ? 20.554 70.539 40.497 1.00 45.19  ? 786 HOH A O   1 
HETATM 1330 O  O   . HOH P 5 .   ? 9.874  51.961 52.601 1.00 47.60  ? 787 HOH A O   1 
HETATM 1331 O  O   . HOH P 5 .   ? 22.656 61.772 67.389 1.00 49.35  ? 788 HOH A O   1 
HETATM 1332 O  O   . HOH P 5 .   ? 15.632 63.285 66.616 1.00 53.55  ? 789 HOH A O   1 
HETATM 1333 O  O   . HOH P 5 .   ? 19.935 60.997 38.623 1.00 41.64  ? 790 HOH A O   1 
HETATM 1334 O  O   . HOH P 5 .   ? 6.055  57.141 44.355 1.00 62.64  ? 791 HOH A O   1 
HETATM 1335 O  O   . HOH P 5 .   ? 9.795  55.610 58.159 1.00 44.40  ? 792 HOH A O   1 
HETATM 1336 O  O   . HOH P 5 .   ? 29.882 47.051 40.605 1.00 50.76  ? 793 HOH A O   1 
HETATM 1337 O  O   . HOH P 5 .   ? 22.883 66.256 62.651 1.00 54.70  ? 794 HOH A O   1 
HETATM 1338 O  O   . HOH P 5 .   ? 7.988  62.106 41.095 0.50 37.64  ? 795 HOH A O   1 
HETATM 1339 O  O   . HOH P 5 .   ? 19.217 27.882 64.701 1.00 47.13  ? 796 HOH A O   1 
HETATM 1340 O  O   . HOH P 5 .   ? 26.363 65.118 40.388 0.50 48.70  ? 797 HOH A O   1 
HETATM 1341 O  O   . HOH P 5 .   ? 33.972 60.150 55.779 1.00 46.85  ? 798 HOH A O   1 
HETATM 1342 O  O   . HOH P 5 .   ? 17.305 35.800 71.490 0.50 43.96  ? 799 HOH A O   1 
HETATM 1343 O  O   . HOH P 5 .   ? 31.382 36.929 45.274 1.00 54.91  ? 800 HOH A O   1 
HETATM 1344 O  O   . HOH P 5 .   ? 19.089 45.912 40.772 1.00 58.40  ? 801 HOH A O   1 
HETATM 1345 O  O   . HOH P 5 .   ? 18.107 73.004 59.574 0.50 44.70  ? 802 HOH A O   1 
HETATM 1346 O  O   . HOH P 5 .   ? 33.084 33.391 60.850 1.00 54.99  ? 803 HOH A O   1 
HETATM 1347 O  O   . HOH P 5 .   ? 12.177 40.794 64.009 0.50 40.13  ? 804 HOH A O   1 
HETATM 1348 O  O   . HOH P 5 .   ? 5.325  57.138 52.909 1.00 51.27  ? 805 HOH A O   1 
HETATM 1349 O  O   . HOH P 5 .   ? 20.562 58.176 64.296 1.00 42.64  ? 806 HOH A O   1 
HETATM 1350 O  O   . HOH P 5 .   ? 26.041 29.757 54.273 0.50 43.19  ? 807 HOH A O   1 
HETATM 1351 O  O   . HOH P 5 .   ? 32.045 39.882 46.675 1.00 45.41  ? 808 HOH A O   1 
HETATM 1352 O  O   . HOH P 5 .   ? 26.415 54.376 44.591 0.50 40.81  ? 809 HOH A O   1 
HETATM 1353 O  O   . HOH P 5 .   ? 28.706 31.331 65.675 1.00 45.27  ? 810 HOH A O   1 
HETATM 1354 O  O   . HOH P 5 .   ? 29.513 29.093 58.466 1.00 61.82  ? 811 HOH A O   1 
HETATM 1355 O  O   . HOH P 5 .   ? 16.210 41.203 71.742 0.50 50.26  ? 812 HOH A O   1 
HETATM 1356 O  O   . HOH P 5 .   ? 27.878 60.178 65.102 1.00 47.89  ? 813 HOH A O   1 
HETATM 1357 O  O   . HOH P 5 .   ? 28.911 51.188 45.561 1.00 38.56  ? 814 HOH A O   1 
HETATM 1358 O  O   . HOH P 5 .   ? 22.281 64.060 63.917 1.00 43.48  ? 815 HOH A O   1 
HETATM 1359 O  O   . HOH P 5 .   ? 13.811 59.928 63.830 1.00 52.30  ? 816 HOH A O   1 
HETATM 1360 O  O   . HOH P 5 .   ? 20.390 72.246 44.912 1.00 60.75  ? 817 HOH A O   1 
HETATM 1361 O  O   . HOH P 5 .   ? 7.737  54.267 55.591 1.00 54.47  ? 818 HOH A O   1 
HETATM 1362 O  O   . HOH P 5 .   ? 10.530 59.356 42.467 1.00 64.45  ? 819 HOH A O   1 
HETATM 1363 O  O   . HOH P 5 .   ? 26.055 52.546 37.775 0.50 60.69  ? 820 HOH A O   1 
HETATM 1364 O  O   . HOH P 5 .   ? 27.891 57.958 67.076 0.50 39.45  ? 821 HOH A O   1 
HETATM 1365 O  O   . HOH P 5 .   ? 7.614  52.940 57.968 1.00 57.69  ? 822 HOH A O   1 
HETATM 1366 O  O   . HOH P 5 .   ? 24.512 50.954 41.454 1.00 49.42  ? 823 HOH A O   1 
HETATM 1367 O  O   . HOH P 5 .   ? 3.397  62.593 45.002 1.00 55.33  ? 824 HOH A O   1 
HETATM 1368 O  O   . HOH P 5 .   ? 3.209  58.539 54.344 1.00 57.45  ? 825 HOH A O   1 
HETATM 1369 O  O   . HOH P 5 .   ? 29.437 59.166 45.853 1.00 40.40  ? 826 HOH A O   1 
HETATM 1370 O  O   . HOH P 5 .   ? 25.778 69.737 51.217 0.50 37.36  ? 827 HOH A O   1 
HETATM 1371 O  O   . HOH P 5 .   ? 1.133  61.732 52.159 0.50 37.03  ? 828 HOH A O   1 
HETATM 1372 O  O   . HOH P 5 .   ? 13.143 42.129 51.717 0.50 39.60  ? 829 HOH A O   1 
HETATM 1373 O  O   . HOH P 5 .   ? 30.826 41.706 48.178 1.00 46.74  ? 830 HOH A O   1 
HETATM 1374 O  O   . HOH P 5 .   ? 30.760 55.070 46.702 1.00 47.05  ? 831 HOH A O   1 
HETATM 1375 O  O   . HOH P 5 .   ? 5.687  62.852 40.994 1.00 50.00  ? 832 HOH A O   1 
HETATM 1376 O  O   . HOH P 5 .   ? 14.000 49.871 41.351 1.00 59.71  ? 833 HOH A O   1 
HETATM 1377 O  O   . HOH P 5 .   ? 6.056  61.909 63.850 0.50 39.94  ? 834 HOH A O   1 
HETATM 1378 O  O   . HOH P 5 .   ? 15.194 36.203 65.880 1.00 56.42  ? 835 HOH A O   1 
HETATM 1379 O  O   . HOH P 5 .   ? 36.151 57.232 51.887 1.00 60.63  ? 836 HOH A O   1 
HETATM 1380 O  O   . HOH P 5 .   ? 12.537 35.095 59.262 0.50 41.54  ? 837 HOH A O   1 
HETATM 1381 O  O   . HOH P 5 .   ? 26.167 55.770 45.713 0.50 35.68  ? 838 HOH A O   1 
HETATM 1382 O  O   . HOH P 5 .   ? 35.702 56.660 62.452 0.50 37.33  ? 839 HOH A O   1 
HETATM 1383 O  O   . HOH P 5 .   ? 24.203 59.869 39.744 1.00 55.45  ? 840 HOH A O   1 
HETATM 1384 O  O   . HOH P 5 .   ? 18.609 48.685 40.815 0.50 49.02  ? 841 HOH A O   1 
HETATM 1385 O  O   . HOH P 5 .   ? 33.254 44.369 42.476 0.50 66.69  ? 842 HOH A O   1 
HETATM 1386 O  O   . HOH P 5 .   ? 13.919 45.676 63.570 1.00 44.94  ? 843 HOH A O   1 
HETATM 1387 O  O   . HOH P 5 .   ? 6.031  53.428 53.013 0.50 47.16  ? 844 HOH A O   1 
HETATM 1388 O  O   . HOH P 5 .   ? 14.345 38.897 56.579 0.50 42.74  ? 845 HOH A O   1 
HETATM 1389 O  O   . HOH P 5 .   ? 12.360 46.415 48.332 1.00 53.74  ? 846 HOH A O   1 
HETATM 1390 O  O   . HOH P 5 .   ? 16.031 39.179 63.220 0.50 37.99  ? 847 HOH A O   1 
HETATM 1391 O  O   . HOH P 5 .   ? 20.036 68.380 39.011 1.00 59.60  ? 848 HOH A O   1 
HETATM 1392 O  O   . HOH P 5 .   ? 34.688 62.239 51.563 0.50 39.36  ? 849 HOH A O   1 
HETATM 1393 O  O   . HOH P 5 .   ? 22.870 73.211 52.291 0.50 44.56  ? 850 HOH A O   1 
HETATM 1394 O  O   . HOH P 5 .   ? 31.909 57.151 47.094 1.00 51.75  ? 851 HOH A O   1 
HETATM 1395 O  O   . HOH P 5 .   ? 25.702 53.125 41.831 0.50 40.94  ? 852 HOH A O   1 
HETATM 1396 O  O   . HOH P 5 .   ? 11.804 47.115 62.810 0.50 47.42  ? 853 HOH A O   1 
HETATM 1397 O  O   . HOH P 5 .   ? 23.594 48.901 42.239 1.00 45.38  ? 854 HOH A O   1 
HETATM 1398 O  O   . HOH P 5 .   ? 36.689 49.473 51.381 0.50 36.92  ? 855 HOH A O   1 
HETATM 1399 O  O   . HOH P 5 .   ? 23.739 70.357 55.193 0.50 38.35  ? 856 HOH A O   1 
HETATM 1400 O  O   . HOH P 5 .   ? 14.234 46.783 69.892 0.50 38.52  ? 857 HOH A O   1 
HETATM 1401 O  O   . HOH P 5 .   ? 12.053 58.852 62.653 1.00 51.10  ? 858 HOH A O   1 
HETATM 1402 O  O   . HOH P 5 .   ? 20.485 60.750 65.705 0.50 48.13  ? 859 HOH A O   1 
HETATM 1403 O  O   . HOH P 5 .   ? 13.810 39.570 61.810 0.50 47.97  ? 860 HOH A O   1 
HETATM 1404 O  O   . HOH P 5 .   ? 36.692 52.752 50.685 0.50 51.77  ? 861 HOH A O   1 
HETATM 1405 O  O   . HOH P 5 .   ? 13.046 42.562 56.498 0.50 39.93  ? 862 HOH A O   1 
HETATM 1406 O  O   . HOH P 5 .   ? 16.178 42.276 74.749 1.00 51.15  ? 863 HOH A O   1 
HETATM 1407 O  O   . HOH P 5 .   ? 19.420 74.579 54.389 1.00 51.42  ? 864 HOH A O   1 
HETATM 1408 O  O   . HOH P 5 .   ? 4.727  54.681 49.213 0.50 36.96  ? 865 HOH A O   1 
HETATM 1409 O  O   . HOH P 5 .   ? 18.928 56.534 66.535 1.00 51.51  ? 866 HOH A O   1 
HETATM 1410 O  O   . HOH P 5 .   ? 28.119 52.903 43.852 1.00 55.71  ? 867 HOH A O   1 
HETATM 1411 O  O   . HOH P 5 .   ? 31.413 59.750 47.461 0.50 42.62  ? 868 HOH A O   1 
HETATM 1412 O  O   . HOH P 5 .   ? 31.788 48.504 39.209 0.50 51.29  ? 869 HOH A O   1 
HETATM 1413 O  O   . HOH P 5 .   ? 31.154 56.790 66.536 0.50 37.42  ? 870 HOH A O   1 
HETATM 1414 O  O   . HOH P 5 .   ? 11.303 55.739 39.763 0.50 37.40  ? 871 HOH A O   1 
HETATM 1415 O  O   . HOH P 5 .   ? 9.842  57.923 62.887 0.50 40.70  ? 872 HOH A O   1 
HETATM 1416 O  O   . HOH P 5 .   ? 9.217  59.365 40.409 0.50 41.92  ? 873 HOH A O   1 
HETATM 1417 O  O   . HOH P 5 .   ? 11.675 38.584 56.019 0.50 56.84  ? 874 HOH A O   1 
HETATM 1418 O  O   . HOH P 5 .   ? 32.244 52.342 46.390 0.50 44.13  ? 875 HOH A O   1 
HETATM 1419 O  O   . HOH P 5 .   ? 21.497 24.698 62.632 0.50 47.74  ? 876 HOH A O   1 
HETATM 1420 O  O   . HOH P 5 .   ? 21.823 67.728 37.559 0.50 42.37  ? 877 HOH A O   1 
HETATM 1421 O  O   . HOH P 5 .   ? 21.476 23.608 57.162 0.50 45.87  ? 878 HOH A O   1 
HETATM 1422 O  O   . HOH P 5 .   ? 34.910 40.178 46.717 1.00 58.22  ? 879 HOH A O   1 
HETATM 1423 O  O   . HOH P 5 .   ? 32.066 54.949 63.220 0.50 40.30  ? 880 HOH A O   1 
HETATM 1424 O  O   . HOH P 5 .   ? 11.333 44.150 55.351 0.50 37.47  ? 881 HOH A O   1 
HETATM 1425 O  O   . HOH P 5 .   ? 34.690 46.316 45.657 0.50 48.87  ? 882 HOH A O   1 
HETATM 1426 O  O   . HOH P 5 .   ? 2.751  73.699 54.041 0.50 38.02  ? 883 HOH A O   1 
HETATM 1427 O  O   . HOH P 5 .   ? 10.829 47.484 60.705 0.50 46.77  ? 884 HOH A O   1 
HETATM 1428 O  O   . HOH P 5 .   ? 3.613  62.793 61.900 0.50 46.93  ? 885 HOH A O   1 
HETATM 1429 O  O   . HOH P 5 .   ? 5.675  58.394 63.966 0.50 56.54  ? 886 HOH A O   1 
HETATM 1430 O  O   . HOH P 5 .   ? 11.937 34.226 64.944 0.50 48.07  ? 887 HOH A O   1 
HETATM 1431 O  O   . HOH P 5 .   ? 15.910 52.301 38.825 0.50 44.44  ? 888 HOH A O   1 
HETATM 1432 O  O   . HOH P 5 .   ? 9.884  61.552 42.165 0.50 41.41  ? 889 HOH A O   1 
HETATM 1433 O  O   . HOH P 5 .   ? 29.830 68.361 51.937 0.50 44.84  ? 890 HOH A O   1 
HETATM 1434 O  O   . HOH P 5 .   ? 13.193 61.525 37.866 0.50 51.80  ? 891 HOH A O   1 
HETATM 1435 O  O   . HOH P 5 .   ? 34.759 45.237 47.918 0.50 39.42  ? 892 HOH A O   1 
HETATM 1436 O  O   . HOH P 5 .   ? 0.251  74.915 54.326 1.00 53.95  ? 893 HOH A O   1 
HETATM 1437 O  O   . HOH P 5 .   ? -0.436 77.845 54.745 0.50 49.27  ? 894 HOH A O   1 
HETATM 1438 O  O   . HOH P 5 .   ? 38.104 51.564 54.241 1.00 53.32  ? 895 HOH A O   1 
HETATM 1439 O  O   . HOH P 5 .   ? 35.979 54.213 56.017 0.50 34.42  ? 896 HOH A O   1 
HETATM 1440 O  O   . HOH P 5 .   ? 4.397  57.137 57.008 1.00 65.05  ? 897 HOH A O   1 
HETATM 1441 O  O   . HOH P 5 .   ? 29.088 49.295 63.611 1.00 56.87  ? 898 HOH A O   1 
HETATM 1442 O  O   . HOH P 5 .   ? 18.108 58.643 38.009 1.00 56.88  ? 899 HOH A O   1 
HETATM 1443 O  O   . HOH P 5 .   ? 20.181 29.898 66.842 1.00 49.18  ? 900 HOH A O   1 
HETATM 1444 O  O   . HOH P 5 .   ? 32.495 30.972 56.840 1.00 54.41  ? 901 HOH A O   1 
HETATM 1445 O  O   . HOH P 5 .   ? 8.053  55.007 43.132 0.50 42.82  ? 902 HOH A O   1 
HETATM 1446 O  O   . HOH P 5 .   ? 15.539 32.323 67.223 0.50 42.62  ? 903 HOH A O   1 
HETATM 1447 O  O   . HOH P 5 .   ? 4.629  60.727 43.923 1.00 46.97  ? 904 HOH A O   1 
HETATM 1448 O  O   . HOH P 5 .   ? 27.244 66.606 46.832 0.50 40.00  ? 905 HOH A O   1 
HETATM 1449 O  O   . HOH P 5 .   ? 4.069  58.268 62.182 0.50 54.06  ? 906 HOH A O   1 
HETATM 1450 O  O   . HOH P 5 .   ? 22.337 59.492 37.452 0.50 39.80  ? 907 HOH A O   1 
HETATM 1451 O  O   . HOH P 5 .   ? 10.075 60.166 37.844 0.50 51.95  ? 908 HOH A O   1 
HETATM 1452 O  O   . HOH P 5 .   ? 25.612 25.117 62.612 1.00 54.28  ? 909 HOH A O   1 
HETATM 1453 O  O   . HOH P 5 .   ? 16.060 33.493 71.043 0.50 43.44  ? 910 HOH A O   1 
HETATM 1454 O  O   . HOH P 5 .   ? 19.523 24.647 58.915 1.00 59.06  ? 911 HOH A O   1 
HETATM 1455 O  O   . HOH P 5 .   ? 28.848 54.097 66.190 1.00 55.60  ? 912 HOH A O   1 
HETATM 1456 O  O   . HOH P 5 .   ? 27.658 57.418 42.110 0.50 57.00  ? 913 HOH A O   1 
HETATM 1457 O  O   . HOH P 5 .   ? 31.844 62.743 62.086 1.00 56.94  ? 914 HOH A O   1 
HETATM 1458 O  O   . HOH P 5 .   ? 36.566 42.042 50.215 1.00 62.61  ? 915 HOH A O   1 
HETATM 1459 O  O   . HOH P 5 .   ? 20.771 31.982 73.057 1.00 63.18  ? 916 HOH A O   1 
HETATM 1460 O  O   . HOH P 5 .   ? 14.890 45.242 72.392 1.00 52.59  ? 917 HOH A O   1 
HETATM 1461 O  O   . HOH P 5 .   ? 25.747 62.497 67.416 0.50 43.72  ? 918 HOH A O   1 
HETATM 1462 O  O   . HOH P 5 .   ? -7.569 65.225 46.602 0.50 51.96  ? 919 HOH A O   1 
HETATM 1463 O  O   . HOH P 5 .   ? 12.151 43.991 47.595 0.50 44.39  ? 920 HOH A O   1 
HETATM 1464 O  O   . HOH P 5 .   ? 10.425 47.475 50.234 0.50 47.43  ? 921 HOH A O   1 
HETATM 1465 O  O   . HOH P 5 .   ? 31.330 67.552 59.949 0.50 53.45  ? 922 HOH A O   1 
HETATM 1466 O  O   . HOH P 5 .   ? 34.063 58.189 61.125 0.50 46.72  ? 923 HOH A O   1 
HETATM 1467 O  O   . HOH P 5 .   ? 33.541 35.496 49.819 0.50 53.44  ? 924 HOH A O   1 
HETATM 1468 O  O   . HOH P 5 .   ? 13.906 29.080 63.743 0.50 44.45  ? 925 HOH A O   1 
HETATM 1469 O  O   . HOH P 5 .   ? 9.896  57.322 44.018 1.00 49.01  ? 926 HOH A O   1 
HETATM 1470 O  O   . HOH P 5 .   ? 27.369 71.004 48.081 0.50 46.27  ? 927 HOH A O   1 
HETATM 1471 O  O   . HOH P 5 .   ? 11.906 50.674 63.559 0.50 56.69  ? 928 HOH A O   1 
HETATM 1472 O  O   . HOH P 5 .   ? 38.283 46.229 49.023 0.50 57.06  ? 929 HOH A O   1 
HETATM 1473 O  O   . HOH P 5 .   ? 25.279 69.896 61.834 0.50 53.20  ? 930 HOH A O   1 
HETATM 1474 O  O   . HOH P 5 .   ? 8.087  50.198 55.107 0.50 44.56  ? 931 HOH A O   1 
HETATM 1475 O  O   . HOH P 5 .   ? 2.402  55.805 59.434 0.50 47.76  ? 932 HOH A O   1 
HETATM 1476 O  O   . HOH P 5 .   ? 23.962 72.696 49.807 0.50 58.14  ? 933 HOH A O   1 
HETATM 1477 O  O   . HOH P 5 .   ? 23.887 51.516 38.753 0.50 46.48  ? 934 HOH A O   1 
HETATM 1478 O  O   . HOH P 5 .   ? 26.654 24.631 60.631 0.50 52.43  ? 935 HOH A O   1 
HETATM 1479 O  O   . HOH P 5 .   ? 6.181  61.635 66.500 0.50 48.49  ? 936 HOH A O   1 
HETATM 1480 O  O   . HOH P 5 .   ? 10.360 43.357 64.948 0.50 60.40  ? 937 HOH A O   1 
HETATM 1481 O  O   . HOH P 5 .   ? 35.782 45.340 43.024 0.50 56.77  ? 938 HOH A O   1 
HETATM 1482 O  O   . HOH P 5 .   ? 17.390 30.816 67.661 0.50 47.08  ? 939 HOH A O   1 
HETATM 1483 O  O   . HOH P 5 .   ? 24.220 53.809 35.588 0.50 57.28  ? 940 HOH A O   1 
HETATM 1484 O  O   . HOH P 5 .   ? 27.162 65.924 61.205 0.50 46.67  ? 941 HOH A O   1 
HETATM 1485 O  O   . HOH P 5 .   ? 10.629 54.270 64.518 0.50 50.18  ? 942 HOH A O   1 
HETATM 1486 O  O   . HOH P 5 .   ? 9.374  47.418 58.434 0.50 56.82  ? 943 HOH A O   1 
HETATM 1487 O  O   . HOH P 5 .   ? 13.261 44.653 66.048 0.50 47.26  ? 944 HOH A O   1 
HETATM 1488 O  O   . HOH P 5 .   ? 23.830 22.930 58.521 0.50 44.76  ? 945 HOH A O   1 
HETATM 1489 O  O   . HOH P 5 .   ? 1.783  60.517 63.657 0.50 56.85  ? 946 HOH A O   1 
HETATM 1490 O  O   . HOH P 5 .   ? 21.994 30.953 68.987 0.50 44.03  ? 947 HOH A O   1 
HETATM 1491 O  O   . HOH P 5 .   ? 8.447  49.446 47.439 0.50 48.32  ? 948 HOH A O   1 
HETATM 1492 O  O   . HOH P 5 .   ? 24.957 66.898 61.057 0.50 49.64  ? 949 HOH A O   1 
HETATM 1493 O  O   . HOH P 5 .   ? 26.266 68.405 42.107 0.50 53.66  ? 950 HOH A O   1 
HETATM 1494 O  O   . HOH P 5 .   ? 23.814 68.862 35.470 0.50 51.06  ? 951 HOH A O   1 
HETATM 1495 O  O   . HOH P 5 .   ? 7.361  59.668 68.120 0.50 55.02  ? 952 HOH A O   1 
HETATM 1496 O  O   . HOH P 5 .   ? 24.913 56.351 37.595 0.50 53.42  ? 953 HOH A O   1 
HETATM 1497 O  O   . HOH P 5 .   ? 10.793 44.581 61.211 0.50 42.69  ? 954 HOH A O   1 
HETATM 1498 O  O   . HOH P 5 .   ? -2.228 61.412 51.453 0.50 46.31  ? 955 HOH A O   1 
HETATM 1499 O  O   . HOH P 5 .   ? -4.814 63.130 46.871 0.50 50.19  ? 956 HOH A O   1 
HETATM 1500 O  O   . HOH P 5 .   ? 35.021 60.474 60.333 0.50 52.87  ? 957 HOH A O   1 
HETATM 1501 O  O   . HOH P 5 .   ? -9.055 65.828 49.309 0.50 64.99  ? 958 HOH A O   1 
HETATM 1502 O  O   . HOH P 5 .   ? 37.431 35.015 58.216 0.50 56.68  ? 959 HOH A O   1 
HETATM 1503 O  O   . HOH P 5 .   ? -0.731 62.644 45.952 0.50 48.55  ? 960 HOH A O   1 
HETATM 1504 O  O   . HOH P 5 .   ? 37.605 32.099 58.963 0.50 63.24  ? 961 HOH A O   1 
HETATM 1505 O  O   . HOH P 5 .   ? 4.089  59.246 42.183 0.50 42.73  ? 962 HOH A O   1 
HETATM 1506 O  O   . HOH P 5 .   ? 20.867 68.785 65.717 0.50 57.19  ? 963 HOH A O   1 
HETATM 1507 O  O   . HOH P 5 .   ? 10.983 44.777 67.345 0.50 49.76  ? 964 HOH A O   1 
HETATM 1508 O  O   . HOH P 5 .   ? 34.971 33.403 59.352 0.50 42.51  ? 965 HOH A O   1 
HETATM 1509 O  O   . HOH P 5 .   ? 23.618 28.250 69.963 0.50 53.14  ? 966 HOH A O   1 
HETATM 1510 O  O   . HOH P 5 .   ? 29.923 67.564 47.543 0.50 46.71  ? 967 HOH A O   1 
HETATM 1511 O  O   . HOH P 5 .   ? 9.924  44.207 58.691 0.50 43.52  ? 968 HOH A O   1 
HETATM 1512 O  O   . HOH P 5 .   ? 1.725  58.369 41.502 0.50 53.27  ? 969 HOH A O   1 
HETATM 1513 O  O   . HOH P 5 .   ? -2.771 68.650 55.911 0.50 47.76  ? 970 HOH A O   1 
HETATM 1514 O  O   . HOH P 5 .   ? 31.143 64.197 48.777 0.50 53.58  ? 971 HOH A O   1 
HETATM 1515 O  O   . HOH P 5 .   ? 8.832  49.834 43.807 0.50 48.98  ? 972 HOH A O   1 
HETATM 1516 O  O   . HOH P 5 .   ? 21.393 70.826 64.309 0.50 47.26  ? 973 HOH A O   1 
HETATM 1517 O  O   . HOH P 5 .   ? 5.612  53.933 58.496 0.50 46.01  ? 974 HOH A O   1 
HETATM 1518 O  O   . HOH P 5 .   ? 23.529 76.362 53.430 0.50 60.90  ? 975 HOH A O   1 
HETATM 1519 O  O   . HOH P 5 .   ? 10.330 49.722 41.688 0.50 52.52  ? 976 HOH A O   1 
HETATM 1520 O  O   . HOH P 5 .   ? 7.760  57.559 40.639 0.50 52.86  ? 977 HOH A O   1 
HETATM 1521 O  O   . HOH P 5 .   ? 25.998 56.008 40.635 0.50 51.73  ? 978 HOH A O   1 
HETATM 1522 O  O   . HOH P 5 .   ? 36.677 48.260 47.670 0.50 51.66  ? 979 HOH A O   1 
HETATM 1523 O  O   . HOH P 5 .   ? 8.295  56.825 66.577 0.50 55.27  ? 980 HOH A O   1 
HETATM 1524 O  O   . HOH P 5 .   ? 21.637 73.669 54.993 0.50 58.35  ? 981 HOH A O   1 
HETATM 1525 O  O   . HOH P 5 .   ? 5.692  47.740 57.391 0.50 45.18  ? 982 HOH A O   1 
HETATM 1526 O  O   . HOH P 5 .   ? 5.068  57.508 41.220 0.50 60.13  ? 983 HOH A O   1 
HETATM 1527 O  O   . HOH P 5 .   ? 21.793 64.320 34.622 0.50 53.14  ? 984 HOH A O   1 
HETATM 1528 O  O   . HOH P 5 .   ? 13.834 41.656 76.173 0.50 52.18  ? 985 HOH A O   1 
HETATM 1529 O  O   . HOH P 5 .   ? 22.859 22.615 60.926 0.50 45.60  ? 986 HOH A O   1 
HETATM 1530 O  O   . HOH P 5 .   ? 33.964 37.444 45.685 0.50 38.64  ? 987 HOH A O   1 
HETATM 1531 O  O   . HOH P 5 .   ? 25.038 76.832 56.423 0.50 66.21  ? 988 HOH A O   1 
HETATM 1532 O  O   . HOH P 5 .   ? 22.679 25.201 71.454 0.50 53.19  ? 989 HOH A O   1 
HETATM 1533 O  O   . HOH P 5 .   ? -3.644 69.449 58.090 0.50 60.69  ? 990 HOH A O   1 
HETATM 1534 O  O   . HOH P 5 .   ? 3.158  55.301 42.057 0.50 48.97  ? 991 HOH A O   1 
HETATM 1535 O  O   . HOH P 5 .   ? 36.979 38.959 52.539 0.50 45.39  ? 992 HOH A O   1 
HETATM 1536 O  O   . HOH P 5 .   ? -4.934 70.237 60.340 0.50 61.42  ? 993 HOH A O   1 
HETATM 1537 O  O   . HOH P 5 .   ? 38.319 56.732 58.769 0.50 44.62  ? 994 HOH A O   1 
HETATM 1538 O  O   . HOH P 5 .   ? 9.570  44.878 45.467 0.50 53.67  ? 995 HOH A O   1 
HETATM 1539 O  O   . HOH P 5 .   ? 29.465 64.435 64.365 0.50 46.32  ? 996 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASN A 3   ? 0.6210  0.4363 0.5363 0.1604  0.1028  -0.1153 3   ASN A N   
2    C CA  . ASN A 3   ? 0.4267  0.4176 0.3986 0.0615  0.1182  -0.0759 3   ASN A CA  
3    C C   . ASN A 3   ? 0.3527  0.3717 0.3215 0.0248  0.0312  -0.0889 3   ASN A C   
4    O O   . ASN A 3   ? 0.3876  0.6782 0.3118 -0.0827 0.0306  -0.1142 3   ASN A O   
5    C CB  . ASN A 3   ? 0.3989  0.7175 0.4176 0.0157  0.1223  -0.0023 3   ASN A CB  
6    C CG  . ASN A 3   ? 0.9450  0.7433 0.4322 -0.0853 -0.0344 0.0957  3   ASN A CG  
7    O OD1 . ASN A 3   ? 1.2385  1.1589 0.5103 0.0228  -0.0630 0.2676  3   ASN A OD1 
8    N ND2 . ASN A 3   ? 0.9055  0.7013 0.6178 -0.0543 0.3110  -0.0047 3   ASN A ND2 
9    N N   . ILE A 4   ? 0.3257  0.3358 0.2996 -0.0074 0.0307  -0.0530 4   ILE A N   
10   C CA  . ILE A 4   ? 0.3319  0.2879 0.2665 -0.0008 0.0250  -0.0209 4   ILE A CA  
11   C C   . ILE A 4   ? 0.2898  0.2806 0.3333 0.0001  0.0054  -0.0232 4   ILE A C   
12   O O   . ILE A 4   ? 0.2813  0.3291 0.3433 -0.0004 0.0064  -0.0397 4   ILE A O   
13   C CB  . ILE A 4   ? 0.3619  0.2930 0.3123 0.0122  0.0096  0.0099  4   ILE A CB  
14   C CG1 . ILE A 4   ? 0.2990  0.2901 0.3592 0.0126  -0.0355 0.0248  4   ILE A CG1 
15   C CG2 . ILE A 4   ? 0.3760  0.3763 0.2440 -0.0613 0.0111  -0.0225 4   ILE A CG2 
16   C CD1 . ILE A 4   ? 0.4675  0.3064 0.3162 -0.0219 -0.0250 0.0149  4   ILE A CD1 
17   N N   . THR A 5   ? 0.2699  0.3025 0.3413 -0.0070 0.0354  -0.0435 5   THR A N   
18   C CA  . THR A 5   ? 0.2769  0.3178 0.2791 0.0038  -0.0098 -0.0443 5   THR A CA  
19   C C   . THR A 5   ? 0.3137  0.2956 0.2916 -0.0310 0.0153  -0.0578 5   THR A C   
20   O O   . THR A 5   ? 0.2836  0.3215 0.2753 0.0115  0.0041  -0.0531 5   THR A O   
21   C CB  . THR A 5   ? 0.3700  0.3101 0.3198 0.0061  0.0246  -0.0168 5   THR A CB  
22   O OG1 . THR A 5   ? 0.3757  0.3220 0.3530 0.0264  0.0346  0.0178  5   THR A OG1 
23   C CG2 . THR A 5   ? 0.3605  0.3163 0.3728 -0.0351 0.0353  -0.0334 5   THR A CG2 
24   N N   . ILE A 6   ? 0.2982  0.2949 0.2807 -0.0099 0.0047  -0.0327 6   ILE A N   
25   C CA  . ILE A 6   ? 0.2696  0.2815 0.2504 -0.0016 -0.0230 -0.0246 6   ILE A CA  
26   C C   . ILE A 6   ? 0.2792  0.2887 0.2794 -0.0064 -0.0110 -0.0347 6   ILE A C   
27   O O   . ILE A 6   ? 0.2867  0.2541 0.3172 -0.0084 -0.0503 0.0255  6   ILE A O   
28   C CB  . ILE A 6   ? 0.3033  0.3297 0.2892 0.0360  0.0015  0.0121  6   ILE A CB  
29   C CG1 . ILE A 6   ? 0.3282  0.3279 0.2656 -0.0254 0.0184  -0.0376 6   ILE A CG1 
30   C CG2 . ILE A 6   ? 0.3264  0.3138 0.2590 0.0386  -0.0125 0.0251  6   ILE A CG2 
31   C CD1 . ILE A 6   ? 0.2794  0.3048 0.3429 -0.0176 0.0283  0.0041  6   ILE A CD1 
32   N N   . TYR A 7   ? 0.2923  0.2820 0.2773 0.0067  -0.0483 -0.0650 7   TYR A N   
33   C CA  . TYR A 7   ? 0.3418  0.2358 0.2340 -0.0091 0.0120  0.0068  7   TYR A CA  
34   C C   . TYR A 7   ? 0.2758  0.2767 0.2328 -0.0363 0.0042  -0.0098 7   TYR A C   
35   O O   . TYR A 7   ? 0.2554  0.2818 0.3152 -0.0102 0.0272  0.0250  7   TYR A O   
36   C CB  . TYR A 7   ? 0.3898  0.2594 0.2779 0.0069  -0.0183 0.0320  7   TYR A CB  
37   C CG  . TYR A 7   ? 0.2535  0.3474 0.2566 -0.0693 -0.0620 0.0148  7   TYR A CG  
38   C CD1 . TYR A 7   ? 0.3059  0.3340 0.2247 -0.0445 -0.1212 0.0519  7   TYR A CD1 
39   C CD2 . TYR A 7   ? 0.3351  0.2971 0.3041 -0.0041 0.0114  0.0216  7   TYR A CD2 
40   C CE1 . TYR A 7   ? 0.4428  0.3289 0.2283 -0.0507 -0.0838 0.0476  7   TYR A CE1 
41   C CE2 . TYR A 7   ? 0.3582  0.3037 0.3302 -0.0220 0.0301  0.0277  7   TYR A CE2 
42   C CZ  . TYR A 7   ? 0.2799  0.3281 0.3022 -0.0069 0.0311  0.0235  7   TYR A CZ  
43   O OH  . TYR A 7   ? 0.3448  0.3912 0.3144 -0.0433 0.0233  0.0494  7   TYR A OH  
44   N N   . HIS A 8   ? 0.3011  0.2874 0.2634 -0.0094 -0.0338 0.0137  8   HIS A N   
45   C CA  . HIS A 8   ? 0.2511  0.3062 0.2441 -0.0168 0.0022  0.0042  8   HIS A CA  
46   C C   . HIS A 8   ? 0.3072  0.3249 0.2789 -0.0193 0.0277  -0.0241 8   HIS A C   
47   O O   . HIS A 8   ? 0.3367  0.3006 0.2992 -0.0185 -0.0350 0.0128  8   HIS A O   
48   C CB  . HIS A 8   ? 0.3111  0.2801 0.3158 0.0065  -0.0579 0.0141  8   HIS A CB  
49   C CG  . HIS A 8   ? 0.3185  0.2765 0.2694 0.0196  -0.0333 -0.0353 8   HIS A CG  
50   N ND1 . HIS A 8   ? 0.3690  0.3004 0.3083 -0.0083 -0.0329 0.0032  8   HIS A ND1 
51   C CD2 . HIS A 8   ? 0.3606  0.3232 0.2973 0.0044  -0.0708 -0.0221 8   HIS A CD2 
52   C CE1 . HIS A 8   ? 0.5134  0.4069 0.3321 -0.0881 -0.0870 0.0530  8   HIS A CE1 
53   N NE2 . HIS A 8   ? 0.4078  0.3012 0.3179 0.0501  -0.0756 0.0032  8   HIS A NE2 
54   N N   . ASN A 9   ? 0.3492  0.4110 0.2607 -0.0041 0.0290  -0.0082 9   ASN A N   
55   C CA  . ASN A 9   ? 0.3927  0.3200 0.2326 0.0084  0.0071  0.0163  9   ASN A CA  
56   C C   . ASN A 9   ? 0.4318  0.2378 0.2896 -0.0197 -0.0761 0.0115  9   ASN A C   
57   O O   . ASN A 9   ? 0.3810  0.2532 0.3160 0.0114  -0.0255 0.0232  9   ASN A O   
58   C CB  . ASN A 9   ? 0.4091  0.2850 0.2777 0.0429  -0.0110 -0.0017 9   ASN A CB  
59   C CG  . ASN A 9   ? 0.4346  0.3375 0.2745 0.0598  -0.0303 -0.0254 9   ASN A CG  
60   O OD1 . ASN A 9   ? 0.4203  0.4091 0.2833 0.0198  -0.0334 -0.0236 9   ASN A OD1 
61   N ND2 . ASN A 9   ? 0.4671  0.3792 0.3500 0.1084  -0.0287 -0.0578 9   ASN A ND2 
62   N N   . PRO A 10  ? 0.4373  0.3046 0.3184 -0.0570 -0.0709 0.0251  10  PRO A N   
63   C CA  . PRO A 10  ? 0.3254  0.3659 0.3215 0.0318  -0.0280 0.0154  10  PRO A CA  
64   C C   . PRO A 10  ? 0.3736  0.3530 0.2841 0.0423  -0.0464 -0.0247 10  PRO A C   
65   O O   . PRO A 10  ? 0.3731  0.3528 0.3088 0.0202  -0.0350 0.0044  10  PRO A O   
66   C CB  . PRO A 10  ? 0.3621  0.4659 0.4509 -0.0248 -0.0653 0.0208  10  PRO A CB  
67   C CG  . PRO A 10  ? 0.4503  0.4244 0.5157 -0.1166 -0.0500 0.0452  10  PRO A CG  
68   C CD  . PRO A 10  ? 0.4520  0.3134 0.3265 -0.0500 0.0200  -0.0427 10  PRO A CD  
69   N N   . ALA A 11  ? 0.4073  0.2996 0.3245 0.0177  0.0063  -0.0096 11  ALA A N   
70   C CA  . ALA A 11  ? 0.4120  0.2773 0.3313 0.0111  0.0066  -0.0356 11  ALA A CA  
71   C C   . ALA A 11  ? 0.3650  0.4057 0.4013 0.0096  0.0215  -0.1014 11  ALA A C   
72   O O   . ALA A 11  ? 0.4043  0.4310 0.4089 -0.0458 0.0408  -0.1236 11  ALA A O   
73   C CB  . ALA A 11  ? 0.6538  0.2884 0.3139 0.0886  0.0172  0.0005  11  ALA A CB  
74   N N   . CYS A 12  ? 0.3727  0.2851 0.3920 0.0199  0.0186  -0.0562 12  CYS A N   
75   C CA  . CYS A 12  ? 0.3675  0.2530 0.3341 0.0343  -0.0138 0.0296  12  CYS A CA  
76   C C   . CYS A 12  ? 0.3728  0.2506 0.3054 0.0390  0.0128  0.0126  12  CYS A C   
77   O O   . CYS A 12  ? 0.3667  0.3016 0.2804 0.0546  -0.0175 -0.0011 12  CYS A O   
78   C CB  . CYS A 12  ? 0.4239  0.2496 0.2984 0.0236  0.0166  0.0244  12  CYS A CB  
79   S SG  . CYS A 12  ? 0.4734  0.3306 0.4592 0.0179  -0.1044 -0.0209 12  CYS A SG  
80   N N   . GLY A 13  ? 0.3760  0.2457 0.2832 0.0023  -0.0119 -0.0068 13  GLY A N   
81   C CA  . GLY A 13  ? 0.2821  0.2578 0.2553 0.0150  -0.0279 0.0068  13  GLY A CA  
82   C C   . GLY A 13  ? 0.2722  0.2406 0.2551 0.0054  -0.0238 0.0101  13  GLY A C   
83   O O   . GLY A 13  ? 0.2695  0.3177 0.2727 0.0315  -0.0146 -0.0234 13  GLY A O   
84   N N   . THR A 14  ? 0.2873  0.2759 0.2824 0.0267  -0.0434 -0.0399 14  THR A N   
85   C CA  . THR A 14  ? 0.2694  0.2778 0.2487 0.0287  -0.0137 -0.0186 14  THR A CA  
86   C C   . THR A 14  ? 0.3131  0.2041 0.3024 0.0469  0.0241  0.0249  14  THR A C   
87   O O   . THR A 14  ? 0.2685  0.2578 0.3004 0.0083  0.0322  -0.0232 14  THR A O   
88   C CB  . THR A 14  ? 0.2845  0.3784 0.2253 0.0360  -0.0169 0.0075  14  THR A CB  
89   O OG1 . THR A 14  ? 0.2582  0.3867 0.3010 0.0055  0.0055  -0.0451 14  THR A OG1 
90   C CG2 . THR A 14  ? 0.2911  0.3474 0.2475 -0.0092 -0.0285 0.0147  14  THR A CG2 
91   N N   . SER A 15  ? 0.3377  0.2407 0.2773 -0.0012 -0.0131 0.0160  15  SER A N   
92   C CA  . SER A 15  ? 0.2991  0.2427 0.2796 0.0019  -0.0447 0.0113  15  SER A CA  
93   C C   . SER A 15  ? 0.3526  0.2535 0.2472 0.0519  -0.0629 -0.0227 15  SER A C   
94   O O   . SER A 15  ? 0.3162  0.2466 0.2726 0.0005  -0.0383 -0.0351 15  SER A O   
95   C CB  . SER A 15  ? 0.2917  0.2327 0.3008 0.0195  -0.0111 -0.0063 15  SER A CB  
96   O OG  . SER A 15  ? 0.2868  0.2764 0.3580 -0.0260 0.0211  -0.0011 15  SER A OG  
97   N N   . ARG A 16  ? 0.3292  0.2069 0.2433 0.0001  -0.0230 0.0321  16  ARG A N   
98   C CA  . ARG A 16  ? 0.3616  0.2082 0.2439 -0.0013 -0.0535 0.0302  16  ARG A CA  
99   C C   . ARG A 16  ? 0.2493  0.2193 0.2782 0.0086  -0.0105 -0.0059 16  ARG A C   
100  O O   . ARG A 16  ? 0.2616  0.2883 0.3109 0.0280  0.0047  -0.0301 16  ARG A O   
101  C CB  . ARG A 16  ? 0.3153  0.2609 0.2534 0.0142  -0.0428 -0.0127 16  ARG A CB  
102  C CG  . ARG A 16  ? 0.3772  0.2575 0.2449 0.0138  -0.0444 -0.0043 16  ARG A CG  
103  C CD  . ARG A 16  ? 0.3263  0.3112 0.2486 -0.0155 -0.0610 -0.0077 16  ARG A CD  
104  N NE  . ARG A 16  ? 0.3955  0.2999 0.2699 -0.0265 -0.0005 -0.0334 16  ARG A NE  
105  C CZ  . ARG A 16  ? 0.3898  0.3038 0.2954 -0.0320 0.0070  -0.0314 16  ARG A CZ  
106  N NH1 . ARG A 16  ? 0.3951  0.3039 0.2932 -0.0133 0.0112  -0.0296 16  ARG A NH1 
107  N NH2 . ARG A 16  ? 0.3251  0.3338 0.2933 0.0140  -0.0357 0.0298  16  ARG A NH2 
108  N N   . ASN A 17  ? 0.2353  0.3074 0.3126 -0.0226 -0.0289 -0.0278 17  ASN A N   
109  C CA  . ASN A 17  ? 0.3144  0.3222 0.2380 -0.0843 -0.0279 -0.0006 17  ASN A CA  
110  C C   . ASN A 17  ? 0.3253  0.2985 0.2414 0.0021  -0.0040 0.0137  17  ASN A C   
111  O O   . ASN A 17  ? 0.2760  0.2943 0.2994 -0.0119 -0.0369 -0.0129 17  ASN A O   
112  C CB  . ASN A 17  ? 0.3092  0.2873 0.2722 -0.0336 0.0016  0.0570  17  ASN A CB  
113  C CG  . ASN A 17  ? 0.3134  0.2384 0.2669 0.0107  -0.0021 0.0401  17  ASN A CG  
114  O OD1 . ASN A 17  ? 0.3381  0.2784 0.2763 0.0314  -0.0370 0.0228  17  ASN A OD1 
115  N ND2 . ASN A 17  ? 0.3071  0.3090 0.2699 0.0179  -0.0149 -0.0048 17  ASN A ND2 
116  N N   . THR A 18  ? 0.2218  0.3242 0.2463 -0.0173 0.0136  0.0308  18  THR A N   
117  C CA  . THR A 18  ? 0.2591  0.3136 0.2490 0.0133  0.0131  0.0416  18  THR A CA  
118  C C   . THR A 18  ? 0.2692  0.2299 0.2567 0.0050  0.0324  0.0031  18  THR A C   
119  O O   . THR A 18  ? 0.2891  0.2840 0.2631 0.0411  -0.0247 -0.0424 18  THR A O   
120  C CB  . THR A 18  ? 0.2671  0.2750 0.2519 -0.0049 -0.0077 0.0202  18  THR A CB  
121  O OG1 . THR A 18  ? 0.2674  0.2831 0.2759 0.0055  -0.0021 0.0247  18  THR A OG1 
122  C CG2 . THR A 18  ? 0.3496  0.3657 0.2330 -0.0436 0.0249  0.0573  18  THR A CG2 
123  N N   . LEU A 19  ? 0.2607  0.2343 0.3172 0.0375  -0.0176 -0.0174 19  LEU A N   
124  C CA  . LEU A 19  ? 0.2625  0.2475 0.3240 0.0169  -0.0374 0.0097  19  LEU A CA  
125  C C   . LEU A 19  ? 0.2612  0.2567 0.2639 0.0376  -0.0150 0.0034  19  LEU A C   
126  O O   . LEU A 19  ? 0.2985  0.2677 0.2518 0.0374  -0.0118 -0.0145 19  LEU A O   
127  C CB  . LEU A 19  ? 0.2745  0.2565 0.2629 0.0133  -0.0179 0.0032  19  LEU A CB  
128  C CG  . LEU A 19  ? 0.2838  0.2122 0.3037 0.0009  0.0131  0.0026  19  LEU A CG  
129  C CD1 . LEU A 19  ? 0.2849  0.2685 0.2833 0.0140  -0.0038 0.0520  19  LEU A CD1 
130  C CD2 . LEU A 19  ? 0.3736  0.2396 0.3668 -0.0487 -0.0323 -0.0066 19  LEU A CD2 
131  N N   . GLU A 20  ? 0.3856  0.2343 0.2481 0.0283  0.0095  -0.0233 20  GLU A N   
132  C CA  . GLU A 20  ? 0.3115  0.2253 0.2545 -0.0079 -0.0046 -0.0081 20  GLU A CA  
133  C C   . GLU A 20  ? 0.2528  0.2310 0.2657 0.0277  -0.0216 -0.0087 20  GLU A C   
134  O O   . GLU A 20  ? 0.2762  0.2499 0.2657 0.0402  -0.0169 -0.0257 20  GLU A O   
135  C CB  . GLU A 20  ? 0.2488  0.3293 0.2545 0.0261  -0.0393 0.0004  20  GLU A CB  
136  C CG  . GLU A 20  ? 0.3008  0.3794 0.2021 -0.0344 -0.0592 0.0394  20  GLU A CG  
137  C CD  . GLU A 20  ? 0.2862  0.2912 0.3127 0.0128  -0.0192 -0.0580 20  GLU A CD  
138  O OE1 . GLU A 20  ? 0.3133  0.3345 0.3277 -0.0116 0.0029  -0.0439 20  GLU A OE1 
139  O OE2 . GLU A 20  ? 0.2361  0.3417 0.3159 0.0127  -0.0288 -0.0328 20  GLU A OE2 
140  N N   . MET A 21  ? 0.2593  0.2859 0.2890 0.0106  -0.0301 0.0014  21  MET A N   
141  C CA  . MET A 21  ? 0.2958  0.3378 0.2547 -0.0637 -0.0195 0.0163  21  MET A CA  
142  C C   . MET A 21  ? 0.3129  0.2485 0.2923 -0.0233 0.0195  0.0108  21  MET A C   
143  O O   . MET A 21  ? 0.3205  0.2629 0.2941 -0.0002 -0.0538 -0.0210 21  MET A O   
144  C CB  . MET A 21  ? 0.2873  0.2950 0.2444 0.0040  -0.0217 -0.0170 21  MET A CB  
145  C CG  . MET A 21  ? 0.2705  0.3664 0.2943 -0.0229 0.0131  -0.0052 21  MET A CG  
146  S SD  . MET A 21  ? 0.2759  0.3247 0.3321 0.0117  -0.0281 -0.0230 21  MET A SD  
147  C CE  . MET A 21  ? 0.3331  0.3273 0.4126 0.0163  -0.0411 -0.0526 21  MET A CE  
148  N N   . ILE A 22  ? 0.2742  0.2528 0.2787 -0.0246 -0.0005 0.0103  22  ILE A N   
149  C CA  . ILE A 22  ? 0.2778  0.2765 0.2657 0.0268  -0.0189 0.0593  22  ILE A CA  
150  C C   . ILE A 22  ? 0.2589  0.2235 0.3001 -0.0023 -0.0340 -0.0145 22  ILE A C   
151  O O   . ILE A 22  ? 0.2803  0.2944 0.3120 -0.0007 -0.0129 -0.0468 22  ILE A O   
152  C CB  . ILE A 22  ? 0.2274  0.2693 0.3029 0.0295  0.0376  0.0342  22  ILE A CB  
153  C CG1 . ILE A 22  ? 0.2839  0.2456 0.2959 0.0604  -0.0208 -0.0054 22  ILE A CG1 
154  C CG2 . ILE A 22  ? 0.2556  0.3274 0.2755 -0.0475 0.0352  -0.0058 22  ILE A CG2 
155  C CD1 . ILE A 22  ? 0.4052  0.2465 0.2736 0.0675  0.0098  0.0043  22  ILE A CD1 
156  N N   . ARG A 23  ? 0.2609  0.3111 0.2926 0.0160  -0.0431 -0.0292 23  ARG A N   
157  C CA  . ARG A 23  ? 0.2350  0.2750 0.2743 -0.0026 -0.0060 -0.0494 23  ARG A CA  
158  C C   . ARG A 23  ? 0.2520  0.2754 0.2695 -0.0016 -0.0131 -0.0449 23  ARG A C   
159  O O   . ARG A 23  ? 0.2508  0.2825 0.3479 0.0187  0.0047  -0.0044 23  ARG A O   
160  C CB  . ARG A 23  ? 0.2515  0.2892 0.2929 -0.0344 -0.0248 -0.0419 23  ARG A CB  
161  C CG  . ARG A 23  ? 0.2881  0.2409 0.3335 0.0256  -0.0118 -0.0696 23  ARG A CG  
162  C CD  . ARG A 23  ? 0.3263  0.3333 0.3470 -0.0886 0.0287  -0.0962 23  ARG A CD  
163  N NE  . ARG A 23  ? 0.2617  0.3055 0.3593 -0.0401 -0.0153 -0.0575 23  ARG A NE  
164  C CZ  . ARG A 23  ? 0.3933  0.2582 0.2660 0.0010  -0.0501 0.0114  23  ARG A CZ  
165  N NH1 . ARG A 23  ? 0.4050  0.2789 0.2398 -0.0325 -0.0659 0.0008  23  ARG A NH1 
166  N NH2 . ARG A 23  ? 0.3599  0.2606 0.3219 0.0088  0.0010  -0.0122 23  ARG A NH2 
167  N N   . ASN A 24  ? 0.2449  0.2827 0.3168 0.0021  -0.0057 -0.0310 24  ASN A N   
168  C CA  . ASN A 24  ? 0.2999  0.2833 0.2829 0.0083  0.0124  -0.0169 24  ASN A CA  
169  C C   . ASN A 24  ? 0.2891  0.2762 0.2791 0.0147  0.0010  -0.0152 24  ASN A C   
170  O O   . ASN A 24  ? 0.3706  0.2805 0.2768 0.0124  -0.0019 -0.0080 24  ASN A O   
171  C CB  . ASN A 24  ? 0.3190  0.2427 0.3261 0.0587  0.0526  -0.0092 24  ASN A CB  
172  C CG  . ASN A 24  ? 0.3113  0.2134 0.2766 -0.0046 -0.0150 -0.0520 24  ASN A CG  
173  O OD1 . ASN A 24  ? 0.3369  0.3728 0.3859 -0.0782 -0.0557 0.0391  24  ASN A OD1 
174  N ND2 . ASN A 24  ? 0.3177  0.2467 0.2917 -0.0199 -0.0190 0.0438  24  ASN A ND2 
175  N N   . SER A 25  ? 0.3016  0.2716 0.2921 0.0224  -0.0121 -0.0171 25  SER A N   
176  C CA  . SER A 25  ? 0.2911  0.2815 0.2864 0.0316  -0.0265 -0.0131 25  SER A CA  
177  C C   . SER A 25  ? 0.3073  0.3176 0.3151 0.0135  0.0088  -0.0118 25  SER A C   
178  O O   . SER A 25  ? 0.2834  0.3430 0.3355 0.0237  0.0054  -0.0260 25  SER A O   
179  C CB  . SER A 25  ? 0.3459  0.2218 0.3145 0.0395  -0.0509 -0.0063 25  SER A CB  
180  O OG  . SER A 25  ? 0.2919  0.2368 0.3029 0.0294  -0.0116 -0.0312 25  SER A OG  
181  N N   . GLY A 26  ? 0.2908  0.3208 0.3375 0.0292  0.0166  -0.0321 26  GLY A N   
182  C CA  . GLY A 26  ? 0.2945  0.2982 0.4096 0.0214  0.0264  -0.0117 26  GLY A CA  
183  C C   . GLY A 26  ? 0.3089  0.2981 0.3756 0.0103  0.0115  -0.0236 26  GLY A C   
184  O O   . GLY A 26  ? 0.3525  0.3336 0.3762 0.0532  0.0403  0.0307  26  GLY A O   
185  N N   . THR A 27  ? 0.3541  0.2851 0.3400 0.0241  0.0369  -0.0337 27  THR A N   
186  C CA  . THR A 27  ? 0.3079  0.2988 0.3439 -0.0002 -0.0026 -0.0321 27  THR A CA  
187  C C   . THR A 27  ? 0.3013  0.3022 0.3096 -0.0192 0.0225  -0.0282 27  THR A C   
188  O O   . THR A 27  ? 0.2637  0.3681 0.3223 0.0360  0.0027  -0.0096 27  THR A O   
189  C CB  . THR A 27  ? 0.3684  0.3645 0.3166 -0.0483 -0.0199 -0.0084 27  THR A CB  
190  O OG1 . THR A 27  ? 0.4361  0.3825 0.3225 -0.0561 -0.0108 -0.0199 27  THR A OG1 
191  C CG2 . THR A 27  ? 0.3021  0.3661 0.4423 -0.0635 -0.0927 0.0302  27  THR A CG2 
192  N N   . GLU A 28  ? 0.2963  0.3055 0.3915 -0.0122 0.0297  -0.0369 28  GLU A N   
193  C CA  . GLU A 28  ? 0.2833  0.2765 0.3491 0.0002  -0.0051 -0.0036 28  GLU A CA  
194  C C   . GLU A 28  ? 0.3195  0.3413 0.3218 0.0405  0.0252  0.0214  28  GLU A C   
195  O O   . GLU A 28  ? 0.3083  0.4308 0.3299 -0.0196 0.0219  0.0235  28  GLU A O   
196  C CB  . GLU A 28  ? 0.2798  0.3187 0.3735 0.0026  0.0050  -0.0238 28  GLU A CB  
197  C CG  . GLU A 28  ? 0.3412  0.3482 0.3395 -0.0684 0.0323  -0.0376 28  GLU A CG  
198  C CD  . GLU A 28  ? 0.2739  0.3132 0.3313 -0.0001 0.0091  0.0062  28  GLU A CD  
199  O OE1 . GLU A 28  ? 0.3506  0.3510 0.3771 -0.0141 0.0227  -0.0516 28  GLU A OE1 
200  O OE2 . GLU A 28  ? 0.3749  0.3553 0.3631 -0.1111 0.0122  0.0049  28  GLU A OE2 
201  N N   . PRO A 29  ? 0.2993  0.3382 0.2955 0.0255  -0.0103 0.0080  29  PRO A N   
202  C CA  . PRO A 29  ? 0.2765  0.3053 0.3110 0.0041  -0.0052 0.0034  29  PRO A CA  
203  C C   . PRO A 29  ? 0.3132  0.3406 0.3094 -0.0302 -0.0512 0.0240  29  PRO A C   
204  O O   . PRO A 29  ? 0.2915  0.4086 0.3204 -0.0565 -0.0502 0.0210  29  PRO A O   
205  C CB  . PRO A 29  ? 0.2905  0.3211 0.3005 0.0185  0.0150  0.0197  29  PRO A CB  
206  C CG  . PRO A 29  ? 0.2989  0.3504 0.2990 0.0276  -0.0062 0.0091  29  PRO A CG  
207  C CD  . PRO A 29  ? 0.3212  0.3234 0.2815 0.0351  -0.0079 -0.0243 29  PRO A CD  
208  N N   . THR A 30  ? 0.2939  0.3085 0.3092 0.0041  -0.0228 0.0116  30  THR A N   
209  C CA  . THR A 30  ? 0.3373  0.3120 0.3405 0.0039  0.0279  0.0005  30  THR A CA  
210  C C   . THR A 30  ? 0.3126  0.3315 0.3218 -0.0195 0.0073  -0.0282 30  THR A C   
211  O O   . THR A 30  ? 0.3134  0.3008 0.3091 -0.0165 -0.0093 -0.0303 30  THR A O   
212  C CB  . THR A 30  ? 0.4035  0.3702 0.3896 0.0469  0.1129  0.0875  30  THR A CB  
213  O OG1 . THR A 30  ? 0.3559  0.4178 0.3779 -0.0130 0.0881  0.0087  30  THR A OG1 
214  C CG2 . THR A 30  ? 0.4263  0.3711 0.4069 0.0453  0.0178  0.0660  30  THR A CG2 
215  N N   . ILE A 31  ? 0.3247  0.2811 0.3516 -0.0317 -0.0021 -0.0219 31  ILE A N   
216  C CA  . ILE A 31  ? 0.2644  0.2814 0.3089 0.0068  -0.0435 -0.0018 31  ILE A CA  
217  C C   . ILE A 31  ? 0.2652  0.2865 0.3722 -0.0097 -0.0205 0.0151  31  ILE A C   
218  O O   . ILE A 31  ? 0.2866  0.3082 0.4301 -0.0337 -0.0091 -0.0087 31  ILE A O   
219  C CB  . ILE A 31  ? 0.4044  0.2705 0.3286 0.0466  -0.1044 -0.0561 31  ILE A CB  
220  C CG1 . ILE A 31  ? 0.3971  0.3098 0.3098 0.0251  -0.0289 0.0201  31  ILE A CG1 
221  C CG2 . ILE A 31  ? 0.3984  0.3285 0.3272 -0.0198 -0.0841 -0.0943 31  ILE A CG2 
222  C CD1 . ILE A 31  ? 0.2887  0.3556 0.3891 0.0184  -0.0781 0.0349  31  ILE A CD1 
223  N N   . ILE A 32  ? 0.2824  0.2896 0.3253 0.0076  -0.0379 0.0142  32  ILE A N   
224  C CA  . ILE A 32  ? 0.3081  0.2958 0.3370 0.0047  -0.0305 0.0190  32  ILE A CA  
225  C C   . ILE A 32  ? 0.2768  0.2842 0.3224 0.0267  -0.0614 0.0274  32  ILE A C   
226  O O   . ILE A 32  ? 0.3141  0.2854 0.2761 -0.0077 -0.0452 -0.0097 32  ILE A O   
227  C CB  . ILE A 32  ? 0.3020  0.3213 0.3176 -0.0070 0.0109  0.0763  32  ILE A CB  
228  C CG1 . ILE A 32  ? 0.3214  0.2703 0.3219 0.0019  0.0132  0.0799  32  ILE A CG1 
229  C CG2 . ILE A 32  ? 0.3582  0.3313 0.3223 0.0291  -0.0161 0.0253  32  ILE A CG2 
230  C CD1 . ILE A 32  ? 0.5377  0.3366 0.3354 -0.0440 -0.0901 -0.0125 32  ILE A CD1 
231  N N   . LEU A 33  ? 0.3095  0.3199 0.3170 -0.0435 -0.0062 0.0230  33  LEU A N   
232  C CA  . LEU A 33  ? 0.3438  0.3460 0.2959 -0.0209 -0.0296 0.0163  33  LEU A CA  
233  C C   . LEU A 33  ? 0.3516  0.3171 0.2602 -0.0265 -0.0336 -0.0050 33  LEU A C   
234  O O   . LEU A 33  ? 0.3689  0.3129 0.3077 -0.0321 -0.0059 -0.0190 33  LEU A O   
235  C CB  . LEU A 33  ? 0.3851  0.3297 0.3155 -0.0230 -0.0701 0.0391  33  LEU A CB  
236  C CG  . LEU A 33  ? 0.4427  0.2792 0.3756 -0.0300 -0.1226 0.0175  33  LEU A CG  
237  C CD1 . LEU A 33  ? 0.4160  0.3782 0.2734 -0.0260 -0.0800 0.0112  33  LEU A CD1 
238  C CD2 . LEU A 33  ? 0.4192  0.3332 0.3936 -0.0058 -0.1019 0.0581  33  LEU A CD2 
239  N N   . TYR A 34  ? 0.3277  0.3103 0.2845 -0.0032 -0.0173 -0.0354 34  TYR A N   
240  C CA  . TYR A 34  ? 0.3077  0.3198 0.3456 0.0217  -0.0115 -0.0370 34  TYR A CA  
241  C C   . TYR A 34  ? 0.3564  0.2923 0.3099 -0.0073 -0.0164 -0.0185 34  TYR A C   
242  O O   . TYR A 34  ? 0.4530  0.2791 0.3442 -0.0137 -0.0132 0.0074  34  TYR A O   
243  C CB  . TYR A 34  ? 0.3438  0.2598 0.2744 0.0191  -0.0283 -0.0011 34  TYR A CB  
244  C CG  . TYR A 34  ? 0.3001  0.2967 0.2427 0.0180  -0.0676 -0.0151 34  TYR A CG  
245  C CD1 . TYR A 34  ? 0.3148  0.3166 0.3295 0.0251  -0.0237 0.0053  34  TYR A CD1 
246  C CD2 . TYR A 34  ? 0.3180  0.3057 0.3110 0.0030  -0.0318 0.0400  34  TYR A CD2 
247  C CE1 . TYR A 34  ? 0.3093  0.3330 0.3877 0.0168  0.0096  0.0382  34  TYR A CE1 
248  C CE2 . TYR A 34  ? 0.2586  0.3398 0.3679 -0.0130 -0.0214 0.0524  34  TYR A CE2 
249  C CZ  . TYR A 34  ? 0.2636  0.3690 0.3777 0.0116  -0.0378 0.0555  34  TYR A CZ  
250  O OH  . TYR A 34  ? 0.3742  0.3103 0.3280 0.0490  -0.0057 0.0070  34  TYR A OH  
251  N N   . LEU A 35  ? 0.3772  0.3419 0.3158 0.0077  -0.0342 -0.0307 35  LEU A N   
252  C CA  . LEU A 35  ? 0.3201  0.3384 0.3194 -0.0255 -0.0263 -0.0407 35  LEU A CA  
253  C C   . LEU A 35  ? 0.3234  0.3243 0.3632 -0.0004 -0.0401 0.0246  35  LEU A C   
254  O O   . LEU A 35  ? 0.4164  0.3351 0.4401 0.0419  0.0027  0.0379  35  LEU A O   
255  C CB  . LEU A 35  ? 0.3243  0.3603 0.3254 -0.0111 0.0004  -0.0363 35  LEU A CB  
256  C CG  . LEU A 35  ? 0.3046  0.3884 0.3051 -0.0121 -0.0487 -0.0002 35  LEU A CG  
257  C CD1 . LEU A 35  ? 0.4842  0.4149 0.3387 0.0188  -0.0554 0.0788  35  LEU A CD1 
258  C CD2 . LEU A 35  ? 0.3126  0.3559 0.3843 -0.0208 -0.0776 -0.0192 35  LEU A CD2 
259  N N   . GLU A 36  ? 0.3450  0.2946 0.3934 -0.0143 0.0098  -0.0090 36  GLU A N   
260  C CA  . GLU A 36  ? 0.3715  0.4166 0.4069 -0.0742 0.0397  -0.0431 36  GLU A CA  
261  C C   . GLU A 36  ? 0.4934  0.3506 0.4214 -0.0791 0.0682  -0.0225 36  GLU A C   
262  O O   . GLU A 36  ? 0.5168  0.3275 0.4319 -0.0698 -0.0463 0.0064  36  GLU A O   
263  C CB  A GLU A 36  ? 0.4161  0.5786 0.5842 -0.1442 -0.1181 -0.0089 36  GLU A CB  
264  C CB  B GLU A 36  ? 0.3751  0.5496 0.5419 -0.1034 -0.0389 -0.0213 36  GLU A CB  
265  C CG  A GLU A 36  ? 0.6137  0.6619 0.5651 -0.1648 -0.1779 0.0096  36  GLU A CG  
266  C CG  B GLU A 36  ? 0.5967  0.6501 0.5757 -0.1669 -0.1788 0.0319  36  GLU A CG  
267  C CD  A GLU A 36  ? 0.5120  0.6858 0.5966 -0.0723 -0.2262 0.0314  36  GLU A CD  
268  C CD  B GLU A 36  ? 0.6235  0.6846 0.7008 -0.1651 -0.2527 0.0076  36  GLU A CD  
269  O OE1 A GLU A 36  ? 0.4423  0.6895 0.7516 -0.0230 -0.1758 -0.0761 36  GLU A OE1 
270  O OE1 B GLU A 36  ? 0.6423  0.6651 0.5666 -0.0604 -0.3525 -0.0982 36  GLU A OE1 
271  O OE2 A GLU A 36  ? 0.4203  0.6312 0.8399 0.0552  -0.2347 0.2404  36  GLU A OE2 
272  O OE2 B GLU A 36  ? 0.5633  0.7699 0.7054 -0.0115 -0.2001 0.0349  36  GLU A OE2 
273  N N   . ASN A 37  ? 0.4343  0.3015 0.3771 -0.0263 0.0258  0.0204  37  ASN A N   
274  C CA  . ASN A 37  ? 0.3914  0.2826 0.4053 -0.0430 0.0903  0.0161  37  ASN A CA  
275  C C   . ASN A 37  ? 0.4507  0.3177 0.3920 0.0027  -0.0111 0.0263  37  ASN A C   
276  O O   . ASN A 37  ? 0.3751  0.3420 0.3525 0.0176  -0.0126 0.0163  37  ASN A O   
277  C CB  . ASN A 37  ? 0.4194  0.3328 0.4993 0.0083  0.0492  -0.0078 37  ASN A CB  
278  C CG  . ASN A 37  ? 0.4167  0.4275 0.6911 -0.0175 0.0102  -0.0012 37  ASN A CG  
279  O OD1 . ASN A 37  ? 0.5844  0.4867 0.8272 -0.1358 -0.1033 0.0499  37  ASN A OD1 
280  N ND2 . ASN A 37  ? 0.5725  0.5415 0.8300 -0.1115 -0.1912 0.0771  37  ASN A ND2 
281  N N   . PRO A 38  ? 0.4499  0.2992 0.3625 -0.0011 0.0205  0.0008  38  PRO A N   
282  C CA  . PRO A 38  ? 0.3930  0.3102 0.4141 0.0059  0.0836  -0.0534 38  PRO A CA  
283  C C   . PRO A 38  ? 0.2932  0.2809 0.3746 0.0449  0.0181  0.0191  38  PRO A C   
284  O O   . PRO A 38  ? 0.3407  0.3238 0.3892 0.0048  0.0154  0.0339  38  PRO A O   
285  C CB  . PRO A 38  ? 0.4560  0.2988 0.4067 0.0390  0.0341  -0.0531 38  PRO A CB  
286  C CG  . PRO A 38  ? 0.5306  0.2958 0.3643 0.0183  -0.0391 0.0136  38  PRO A CG  
287  C CD  . PRO A 38  ? 0.5365  0.2917 0.3296 0.0069  -0.0401 0.0184  38  PRO A CD  
288  N N   . PRO A 39  ? 0.3630  0.3507 0.3533 -0.0196 -0.0372 0.0674  39  PRO A N   
289  C CA  . PRO A 39  ? 0.2948  0.3354 0.3721 0.0195  0.0013  0.0293  39  PRO A CA  
290  C C   . PRO A 39  ? 0.3815  0.3124 0.2961 0.0189  -0.0246 -0.0091 39  PRO A C   
291  O O   . PRO A 39  ? 0.3954  0.3141 0.3406 0.0200  0.0544  0.0211  39  PRO A O   
292  C CB  . PRO A 39  ? 0.3062  0.3461 0.3424 0.0019  0.0242  0.0265  39  PRO A CB  
293  C CG  . PRO A 39  ? 0.3261  0.3157 0.2897 0.0145  -0.0004 0.0475  39  PRO A CG  
294  C CD  . PRO A 39  ? 0.3415  0.3699 0.3377 -0.0212 -0.0243 0.0298  39  PRO A CD  
295  N N   . SER A 40  ? 0.3055  0.3635 0.3338 0.0661  0.0025  0.0120  40  SER A N   
296  C CA  . SER A 40  ? 0.2870  0.3583 0.3198 0.0683  0.0479  0.0232  40  SER A CA  
297  C C   . SER A 40  ? 0.3040  0.2913 0.3128 0.0687  0.0315  0.0268  40  SER A C   
298  O O   . SER A 40  ? 0.3526  0.2961 0.3280 0.0422  -0.0207 0.0484  40  SER A O   
299  C CB  . SER A 40  ? 0.3407  0.3665 0.3645 0.0724  0.0999  0.0010  40  SER A CB  
300  O OG  . SER A 40  ? 0.3651  0.4120 0.2989 0.0461  0.0368  0.0013  40  SER A OG  
301  N N   . ARG A 41  ? 0.3541  0.2955 0.3526 0.0512  -0.0306 0.0444  41  ARG A N   
302  C CA  . ARG A 41  ? 0.3508  0.3298 0.2744 0.0498  -0.0228 0.0156  41  ARG A CA  
303  C C   . ARG A 41  ? 0.3691  0.2968 0.2615 0.0448  -0.0034 0.0445  41  ARG A C   
304  O O   . ARG A 41  ? 0.3745  0.3132 0.3355 0.0308  0.0067  0.0169  41  ARG A O   
305  C CB  . ARG A 41  ? 0.3618  0.3027 0.3787 0.0322  -0.0867 0.0003  41  ARG A CB  
306  C CG  . ARG A 41  ? 0.3544  0.3341 0.3519 0.0020  -0.0874 0.0763  41  ARG A CG  
307  C CD  . ARG A 41  ? 0.3522  0.2976 0.3372 0.0250  -0.0430 0.0073  41  ARG A CD  
308  N NE  . ARG A 41  ? 0.3616  0.2873 0.3760 -0.0099 -0.0180 0.0523  41  ARG A NE  
309  C CZ  . ARG A 41  ? 0.3266  0.2696 0.3869 0.0684  -0.0439 0.0195  41  ARG A CZ  
310  N NH1 . ARG A 41  ? 0.3394  0.2730 0.4050 0.0355  -0.0037 0.0153  41  ARG A NH1 
311  N NH2 . ARG A 41  ? 0.3369  0.3303 0.3437 0.0413  -0.0217 0.0223  41  ARG A NH2 
312  N N   . ASP A 42  ? 0.4107  0.3204 0.3136 0.0422  0.0400  0.0075  42  ASP A N   
313  C CA  . ASP A 42  ? 0.3657  0.3312 0.3140 0.0610  0.0220  0.0096  42  ASP A CA  
314  C C   . ASP A 42  ? 0.4197  0.3204 0.3138 0.0462  -0.0167 0.0138  42  ASP A C   
315  O O   . ASP A 42  ? 0.4279  0.3379 0.3098 0.0302  -0.0019 -0.0186 42  ASP A O   
316  C CB  . ASP A 42  ? 0.5743  0.3651 0.4009 0.0626  0.1705  0.0059  42  ASP A CB  
317  C CG  . ASP A 42  ? 0.7231  0.4561 0.3885 0.0345  0.1443  0.0620  42  ASP A CG  
318  O OD1 . ASP A 42  ? 0.7474  0.5942 0.4592 0.0769  0.0338  0.1759  42  ASP A OD1 
319  O OD2 . ASP A 42  ? 0.8278  0.5808 0.4136 -0.0644 0.1729  0.0834  42  ASP A OD2 
320  N N   . GLU A 43  ? 0.3281  0.3203 0.3616 0.0655  0.0037  0.0099  43  GLU A N   
321  C CA  . GLU A 43  ? 0.2918  0.3596 0.4457 0.0938  0.0204  0.0696  43  GLU A CA  
322  C C   . GLU A 43  ? 0.3439  0.3436 0.3036 0.0191  0.0037  -0.0311 43  GLU A C   
323  O O   . GLU A 43  ? 0.3576  0.3259 0.4373 0.0353  0.0764  -0.0533 43  GLU A O   
324  C CB  A GLU A 43  ? 0.3283  0.4258 0.4573 0.0420  -0.0105 0.1151  43  GLU A CB  
325  C CB  B GLU A 43  ? 0.3351  0.3648 0.4270 0.0383  -0.0041 0.0917  43  GLU A CB  
326  C CG  A GLU A 43  ? 0.3333  0.4932 0.4160 0.0205  -0.0478 0.1740  43  GLU A CG  
327  C CG  B GLU A 43  ? 0.2620  0.3628 0.4278 0.1679  0.1308  0.0882  43  GLU A CG  
328  C CD  A GLU A 43  ? 0.3425  0.4873 0.4589 0.0161  -0.0830 0.2910  43  GLU A CD  
329  C CD  B GLU A 43  ? 0.3288  0.4191 0.5938 0.1424  0.1453  -0.0209 43  GLU A CD  
330  O OE1 A GLU A 43  ? 0.3601  0.4719 0.6098 0.2513  -0.1739 -0.1228 43  GLU A OE1 
331  O OE1 B GLU A 43  ? 0.5881  0.3911 0.3801 0.2443  -0.1558 -0.0768 43  GLU A OE1 
332  O OE2 A GLU A 43  ? 0.3343  0.4165 0.6741 -0.0678 -0.0378 0.0979  43  GLU A OE2 
333  O OE2 B GLU A 43  ? 0.3283  0.3709 0.5607 -0.0600 -0.0068 -0.0987 43  GLU A OE2 
334  N N   . LEU A 44  ? 0.4141  0.3107 0.2666 -0.0111 -0.0020 -0.0252 44  LEU A N   
335  C CA  . LEU A 44  ? 0.3366  0.2631 0.3025 0.0859  -0.0229 0.0251  44  LEU A CA  
336  C C   . LEU A 44  ? 0.3606  0.2239 0.2732 0.0810  -0.0130 0.0031  44  LEU A C   
337  O O   . LEU A 44  ? 0.4149  0.3128 0.2677 0.0097  0.0102  0.0129  44  LEU A O   
338  C CB  . LEU A 44  ? 0.3509  0.2611 0.3144 -0.0091 0.0039  -0.0013 44  LEU A CB  
339  C CG  . LEU A 44  ? 0.3248  0.2996 0.2529 -0.0057 -0.0353 -0.0229 44  LEU A CG  
340  C CD1 . LEU A 44  ? 0.4479  0.3206 0.3116 0.0641  0.0851  0.0238  44  LEU A CD1 
341  C CD2 . LEU A 44  ? 0.3833  0.2934 0.2648 -0.0073 -0.0242 -0.0153 44  LEU A CD2 
342  N N   . VAL A 45  ? 0.4412  0.2825 0.2775 0.0359  -0.0475 0.0246  45  VAL A N   
343  C CA  . VAL A 45  ? 0.3631  0.2970 0.3178 0.0805  -0.0423 0.0311  45  VAL A CA  
344  C C   . VAL A 45  ? 0.3341  0.3228 0.3269 0.0762  -0.0945 -0.0095 45  VAL A C   
345  O O   . VAL A 45  ? 0.3772  0.3317 0.3569 0.0460  -0.0574 -0.0124 45  VAL A O   
346  C CB  . VAL A 45  ? 0.4101  0.3461 0.3155 0.0666  -0.0581 0.0403  45  VAL A CB  
347  C CG1 . VAL A 45  ? 0.3758  0.3278 0.3054 0.0674  -0.0310 0.0388  45  VAL A CG1 
348  C CG2 . VAL A 45  ? 0.5526  0.2465 0.4870 0.0211  -0.1325 0.0393  45  VAL A CG2 
349  N N   . LYS A 46  ? 0.3899  0.3130 0.3058 0.0816  0.0385  0.0583  46  LYS A N   
350  C CA  . LYS A 46  ? 0.3513  0.3147 0.3219 0.0913  -0.0577 0.0450  46  LYS A CA  
351  C C   . LYS A 46  ? 0.2593  0.3075 0.3455 0.0644  -0.1205 0.0578  46  LYS A C   
352  O O   . LYS A 46  ? 0.4235  0.3482 0.3456 -0.0259 0.0319  -0.0361 46  LYS A O   
353  C CB  A LYS A 46  ? 0.4295  0.3625 0.4468 0.1205  0.0682  0.0408  46  LYS A CB  
354  C CB  B LYS A 46  ? 0.4246  0.3645 0.4474 0.1198  0.0692  0.0421  46  LYS A CB  
355  C CG  A LYS A 46  ? 0.5766  0.3989 0.4892 0.0907  0.1707  -0.0110 46  LYS A CG  
356  C CG  B LYS A 46  ? 0.5396  0.3880 0.4859 0.1168  0.1353  0.0106  46  LYS A CG  
357  C CD  A LYS A 46  ? 0.6154  0.4404 0.5498 0.1328  0.2411  -0.0220 46  LYS A CD  
358  C CD  B LYS A 46  ? 0.6099  0.4463 0.5459 0.1315  0.2333  -0.0132 46  LYS A CD  
359  C CE  A LYS A 46  ? 0.6508  0.4362 0.5895 0.1393  0.2450  -0.0225 46  LYS A CE  
360  C CE  B LYS A 46  ? 0.6292  0.4474 0.5906 0.1467  0.2940  -0.0234 46  LYS A CE  
361  N NZ  A LYS A 46  ? 0.5817  0.4887 0.7869 0.1418  0.1656  -0.0593 46  LYS A NZ  
362  N NZ  B LYS A 46  ? 0.9097  0.5626 0.7292 -0.0332 0.5364  -0.2402 46  LYS A NZ  
363  N N   . LEU A 47  ? 0.2954  0.3467 0.3112 0.0418  -0.0563 0.0269  47  LEU A N   
364  C CA  . LEU A 47  ? 0.3103  0.3022 0.2725 0.0539  -0.0374 -0.0146 47  LEU A CA  
365  C C   . LEU A 47  ? 0.3198  0.2614 0.2869 0.0464  -0.0155 -0.0530 47  LEU A C   
366  O O   . LEU A 47  ? 0.3643  0.2844 0.3120 0.0402  -0.0061 -0.0014 47  LEU A O   
367  C CB  . LEU A 47  ? 0.3022  0.3168 0.2746 0.0246  0.0207  -0.0567 47  LEU A CB  
368  C CG  . LEU A 47  ? 0.2971  0.2485 0.3521 0.0355  -0.0494 0.0193  47  LEU A CG  
369  C CD1 . LEU A 47  ? 0.3379  0.2428 0.3976 0.0064  -0.0374 -0.0071 47  LEU A CD1 
370  C CD2 . LEU A 47  ? 0.3255  0.2274 0.3536 0.0151  0.0145  0.0249  47  LEU A CD2 
371  N N   . ILE A 48  ? 0.3273  0.2855 0.3304 0.0599  0.0064  -0.0517 48  ILE A N   
372  C CA  . ILE A 48  ? 0.3208  0.3254 0.2803 0.0687  -0.0254 -0.0343 48  ILE A CA  
373  C C   . ILE A 48  ? 0.3724  0.3013 0.2972 0.0696  -0.0834 -0.0116 48  ILE A C   
374  O O   . ILE A 48  ? 0.4302  0.3281 0.3523 0.0300  -0.0479 -0.0345 48  ILE A O   
375  C CB  . ILE A 48  ? 0.2918  0.3058 0.3491 0.0515  -0.0618 -0.0343 48  ILE A CB  
376  C CG1 . ILE A 48  ? 0.3158  0.2503 0.3235 0.0238  -0.0484 0.0023  48  ILE A CG1 
377  C CG2 . ILE A 48  ? 0.2936  0.3268 0.4183 0.0401  -0.0793 -0.0309 48  ILE A CG2 
378  C CD1 . ILE A 48  ? 0.3964  0.2651 0.4205 0.0530  -0.0008 -0.0238 48  ILE A CD1 
379  N N   . ALA A 49  ? 0.4307  0.3143 0.2892 0.0902  -0.0819 -0.0137 49  ALA A N   
380  C CA  . ALA A 49  ? 0.3999  0.3711 0.3091 0.1155  -0.0526 -0.0681 49  ALA A CA  
381  C C   . ALA A 49  ? 0.3445  0.3303 0.4071 0.0594  -0.0157 -0.0542 49  ALA A C   
382  O O   . ALA A 49  ? 0.4084  0.4151 0.3733 -0.0094 -0.0684 -0.0380 49  ALA A O   
383  C CB  . ALA A 49  ? 0.5482  0.4208 0.2943 0.1185  -0.0706 -0.0308 49  ALA A CB  
384  N N   . ASP A 50  ? 0.3639  0.3329 0.3728 0.0585  -0.0526 -0.0175 50  ASP A N   
385  C CA  . ASP A 50  ? 0.3535  0.3434 0.3201 0.0491  -0.0630 -0.0176 50  ASP A CA  
386  C C   . ASP A 50  ? 0.4150  0.3410 0.3606 -0.0129 -0.0268 -0.0219 50  ASP A C   
387  O O   . ASP A 50  ? 0.3510  0.3374 0.4158 0.0184  -0.0271 -0.0376 50  ASP A O   
388  C CB  . ASP A 50  ? 0.3492  0.3436 0.2463 0.0391  -0.0869 -0.0133 50  ASP A CB  
389  C CG  . ASP A 50  ? 0.3955  0.3472 0.2796 0.0633  -0.0470 0.0064  50  ASP A CG  
390  O OD1 . ASP A 50  ? 0.4043  0.5730 0.3443 0.0364  0.0058  0.0007  50  ASP A OD1 
391  O OD2 . ASP A 50  ? 0.5054  0.4496 0.2550 0.0730  -0.0685 0.0066  50  ASP A OD2 
392  N N   . MET A 51  ? 0.3911  0.2954 0.3337 -0.0209 -0.0350 0.0106  51  MET A N   
393  C CA  . MET A 51  ? 0.3566  0.3363 0.3617 0.0398  -0.0160 0.0361  51  MET A CA  
394  C C   . MET A 51  ? 0.3285  0.3863 0.3836 0.0534  0.0284  -0.0099 51  MET A C   
395  O O   . MET A 51  ? 0.4229  0.3911 0.4432 -0.0228 0.0227  0.0053  51  MET A O   
396  C CB  A MET A 51  ? 0.4757  0.3819 0.3257 0.0122  -0.0286 0.0361  51  MET A CB  
397  C CB  B MET A 51  ? 0.4348  0.3944 0.3300 0.0275  -0.0294 0.0301  51  MET A CB  
398  C CG  A MET A 51  ? 0.4982  0.3430 0.3333 0.0309  -0.0499 0.0433  51  MET A CG  
399  C CG  B MET A 51  ? 0.4443  0.2972 0.3510 0.0993  -0.0729 0.0331  51  MET A CG  
400  S SD  A MET A 51  ? 0.3941  0.3899 0.3545 0.0184  -0.0079 0.0114  51  MET A SD  
401  S SD  B MET A 51  ? 0.4089  0.3903 0.3446 0.0140  0.0014  0.0066  51  MET A SD  
402  C CE  A MET A 51  ? 0.5817  0.2884 0.4060 -0.0189 -0.1264 0.0020  51  MET A CE  
403  C CE  B MET A 51  ? 0.3387  0.3480 0.3155 0.1107  -0.0823 -0.0554 51  MET A CE  
404  N N   . GLY A 52  ? 0.3469  0.4096 0.3925 0.0684  -0.0134 -0.0381 52  GLY A N   
405  C CA  . GLY A 52  ? 0.3535  0.4002 0.5091 0.0958  -0.0405 -0.1280 52  GLY A CA  
406  C C   . GLY A 52  ? 0.3343  0.4444 0.5278 -0.0030 -0.0087 -0.1587 52  GLY A C   
407  O O   . GLY A 52  ? 0.3143  0.5313 0.6145 -0.0212 -0.0567 -0.1454 52  GLY A O   
408  N N   . ILE A 53  ? 0.4016  0.3384 0.4907 0.0361  -0.0009 -0.0977 53  ILE A N   
409  C CA  . ILE A 53  ? 0.3076  0.2816 0.4006 0.0134  -0.0659 -0.0332 53  ILE A CA  
410  C C   . ILE A 53  ? 0.3515  0.2742 0.3894 0.0047  -0.0482 -0.0336 53  ILE A C   
411  O O   . ILE A 53  ? 0.4018  0.2953 0.3985 -0.0165 -0.0269 -0.0349 53  ILE A O   
412  C CB  . ILE A 53  ? 0.4356  0.2884 0.4084 -0.0546 -0.0927 -0.0014 53  ILE A CB  
413  C CG1 . ILE A 53  ? 0.4264  0.3502 0.5463 -0.0654 -0.1542 -0.0494 53  ILE A CG1 
414  C CG2 . ILE A 53  ? 0.4603  0.3590 0.4911 0.0038  -0.0332 0.0993  53  ILE A CG2 
415  C CD1 . ILE A 53  ? 0.4146  0.3445 0.5978 0.0509  -0.2175 -0.0403 53  ILE A CD1 
416  N N   . SER A 54  ? 0.3689  0.2520 0.4268 0.0130  -0.0342 -0.0121 54  SER A N   
417  C CA  . SER A 54  ? 0.3342  0.2642 0.3259 -0.0055 -0.0127 0.0247  54  SER A CA  
418  C C   . SER A 54  ? 0.3421  0.2305 0.3705 0.0495  -0.0681 -0.0075 54  SER A C   
419  O O   . SER A 54  ? 0.3571  0.2739 0.3256 0.0217  -0.0345 0.0095  54  SER A O   
420  C CB  . SER A 54  ? 0.3436  0.3031 0.3672 0.0273  -0.0102 0.0289  54  SER A CB  
421  O OG  . SER A 54  ? 0.3458  0.3845 0.3585 0.0456  0.0032  -0.0262 54  SER A OG  
422  N N   . VAL A 55  ? 0.3565  0.2235 0.3628 0.0403  -0.0234 -0.0077 55  VAL A N   
423  C CA  . VAL A 55  ? 0.2702  0.2663 0.3475 0.0082  -0.0012 0.0282  55  VAL A CA  
424  C C   . VAL A 55  ? 0.2760  0.2714 0.3452 -0.0309 -0.0024 0.0068  55  VAL A C   
425  O O   . VAL A 55  ? 0.2845  0.2755 0.3630 -0.0257 -0.0228 -0.0221 55  VAL A O   
426  C CB  . VAL A 55  ? 0.3560  0.2448 0.3461 0.0091  0.0029  0.0069  55  VAL A CB  
427  C CG1 . VAL A 55  ? 0.3741  0.2932 0.3600 -0.0527 0.0222  0.0068  55  VAL A CG1 
428  C CG2 . VAL A 55  ? 0.5260  0.3626 0.2875 0.0846  -0.0368 0.0416  55  VAL A CG2 
429  N N   . ARG A 56  ? 0.2880  0.2846 0.3216 0.0213  -0.0124 0.0229  56  ARG A N   
430  C CA  . ARG A 56  ? 0.2777  0.3054 0.3219 -0.0354 0.0057  0.0444  56  ARG A CA  
431  C C   . ARG A 56  ? 0.3255  0.2801 0.3163 -0.0665 -0.0405 0.0201  56  ARG A C   
432  O O   . ARG A 56  ? 0.3605  0.3006 0.3204 0.0045  -0.0526 -0.0018 56  ARG A O   
433  C CB  . ARG A 56  ? 0.2705  0.3428 0.3124 -0.0612 -0.0020 0.0138  56  ARG A CB  
434  C CG  . ARG A 56  ? 0.3012  0.3082 0.3253 0.0228  0.0099  0.0158  56  ARG A CG  
435  C CD  . ARG A 56  ? 0.3190  0.2861 0.3530 0.0471  -0.0074 -0.0298 56  ARG A CD  
436  N NE  . ARG A 56  ? 0.3853  0.2814 0.3549 0.0445  -0.0637 -0.0218 56  ARG A NE  
437  C CZ  . ARG A 56  ? 0.3109  0.2620 0.3224 0.0276  -0.0559 0.0131  56  ARG A CZ  
438  N NH1 . ARG A 56  ? 0.3093  0.2543 0.3243 0.0028  -0.0185 0.0260  56  ARG A NH1 
439  N NH2 . ARG A 56  ? 0.3947  0.2687 0.3354 -0.0004 -0.0877 0.0287  56  ARG A NH2 
440  N N   . ALA A 57  ? 0.3068  0.2988 0.3170 0.0130  -0.0341 -0.0022 57  ALA A N   
441  C CA  . ALA A 57  ? 0.3028  0.3143 0.3160 0.0512  0.0127  0.0079  57  ALA A CA  
442  C C   . ALA A 57  ? 0.3015  0.3005 0.2776 0.0328  0.0241  0.0411  57  ALA A C   
443  O O   . ALA A 57  ? 0.3634  0.2822 0.2880 0.0010  -0.0165 0.0405  57  ALA A O   
444  C CB  . ALA A 57  ? 0.4140  0.2983 0.3788 0.0077  -0.0555 0.0317  57  ALA A CB  
445  N N   . LEU A 58  ? 0.3685  0.2973 0.2754 -0.0325 0.0230  0.0129  58  LEU A N   
446  C CA  . LEU A 58  ? 0.3467  0.3627 0.3590 -0.0309 0.0394  -0.0331 58  LEU A CA  
447  C C   . LEU A 58  ? 0.3096  0.3036 0.3780 0.0259  -0.0292 -0.0137 58  LEU A C   
448  O O   . LEU A 58  ? 0.2840  0.2846 0.3374 0.0136  0.0039  0.0417  58  LEU A O   
449  C CB  . LEU A 58  ? 0.3238  0.3094 0.3602 0.0302  0.0056  0.0594  58  LEU A CB  
450  C CG  . LEU A 58  ? 0.3362  0.2813 0.2565 -0.0018 -0.0076 0.0581  58  LEU A CG  
451  C CD1 . LEU A 58  ? 0.3226  0.2637 0.2985 0.0075  0.0017  0.0435  58  LEU A CD1 
452  C CD2 . LEU A 58  ? 0.3983  0.3173 0.2864 -0.0295 0.0369  0.0472  58  LEU A CD2 
453  N N   . LEU A 59  ? 0.2752  0.3006 0.3471 0.0032  -0.0074 0.0252  59  LEU A N   
454  C CA  . LEU A 59  ? 0.3478  0.2905 0.3805 0.0513  -0.0234 0.0112  59  LEU A CA  
455  C C   . LEU A 59  ? 0.2308  0.2948 0.3608 0.0566  0.0375  -0.0125 59  LEU A C   
456  O O   . LEU A 59  ? 0.3408  0.2792 0.4130 -0.0238 0.0068  -0.0295 59  LEU A O   
457  C CB  . LEU A 59  ? 0.3174  0.3336 0.3743 0.0408  -0.0153 0.0128  59  LEU A CB  
458  C CG  . LEU A 59  ? 0.1763  0.3687 0.3883 0.0203  -0.0372 0.0357  59  LEU A CG  
459  C CD1 . LEU A 59  ? 0.2159  0.3069 0.3647 0.0361  0.0258  -0.0292 59  LEU A CD1 
460  C CD2 . LEU A 59  ? 0.2296  0.3765 0.4581 -0.0126 -0.0674 0.0321  59  LEU A CD2 
461  N N   . ARG A 60  ? 0.2730  0.3200 0.3700 0.0009  0.0105  0.0438  60  ARG A N   
462  C CA  . ARG A 60  ? 0.3094  0.2956 0.3747 0.0000  0.0001  0.0375  60  ARG A CA  
463  C C   . ARG A 60  ? 0.3217  0.3337 0.3636 -0.0014 -0.0074 0.0079  60  ARG A C   
464  O O   . ARG A 60  ? 0.3656  0.3286 0.3352 -0.0116 0.0733  -0.0398 60  ARG A O   
465  C CB  . ARG A 60  ? 0.3122  0.3679 0.3893 -0.0060 -0.0125 0.0471  60  ARG A CB  
466  C CG  . ARG A 60  ? 0.4179  0.4997 0.3860 0.0059  -0.0561 0.0390  60  ARG A CG  
467  C CD  . ARG A 60  ? 0.4377  0.4402 0.4786 0.0719  -0.1238 -0.0611 60  ARG A CD  
468  N NE  . ARG A 60  ? 0.4012  0.5003 0.4775 0.0863  -0.0827 -0.0948 60  ARG A NE  
469  C CZ  . ARG A 60  ? 0.4333  0.4462 0.4921 0.1729  -0.1785 0.0187  60  ARG A CZ  
470  N NH1 . ARG A 60  ? 0.4421  0.8739 0.6368 -0.0974 -0.1435 0.2068  60  ARG A NH1 
471  N NH2 . ARG A 60  ? 0.8339  0.2905 0.5031 -0.0510 -0.2493 0.0391  60  ARG A NH2 
472  N N   . LYS A 61  ? 0.3779  0.3184 0.3446 0.0007  0.0256  -0.0011 61  LYS A N   
473  C CA  . LYS A 61  ? 0.3525  0.2949 0.3585 -0.0348 0.0041  -0.0442 61  LYS A CA  
474  C C   . LYS A 61  ? 0.3652  0.4530 0.3665 -0.0665 0.0060  -0.0711 61  LYS A C   
475  O O   . LYS A 61  ? 0.5274  0.4322 0.4398 -0.0307 -0.1152 0.0206  61  LYS A O   
476  C CB  . LYS A 61  ? 0.3377  0.3413 0.3160 -0.0312 -0.0209 0.0378  61  LYS A CB  
477  C CG  . LYS A 61  ? 0.3562  0.3177 0.3391 -0.0620 -0.0009 0.0059  61  LYS A CG  
478  C CD  . LYS A 61  ? 0.3218  0.4304 0.5108 -0.0752 0.0062  -0.0241 61  LYS A CD  
479  C CE  . LYS A 61  ? 0.3674  0.4482 0.5793 -0.0997 -0.0837 0.0081  61  LYS A CE  
480  N NZ  . LYS A 61  ? 0.4050  0.7349 0.6241 -0.2077 -0.0642 -0.0152 61  LYS A NZ  
481  N N   . ASN A 62  ? 0.4358  0.5954 0.2859 -0.0847 0.0964  -0.0943 62  ASN A N   
482  C CA  . ASN A 62  ? 0.5106  0.4209 0.2816 -0.1275 0.0670  0.0357  62  ASN A CA  
483  C C   . ASN A 62  ? 0.4324  0.3897 0.2946 -0.0208 0.0392  0.0816  62  ASN A C   
484  O O   . ASN A 62  ? 0.5675  0.3475 0.3336 -0.0146 -0.0426 0.0448  62  ASN A O   
485  C CB  . ASN A 62  ? 0.9478  0.3873 0.3817 -0.2082 0.2310  0.0010  62  ASN A CB  
486  C CG  . ASN A 62  ? 0.9333  0.3585 0.5431 -0.2186 0.1220  0.1474  62  ASN A CG  
487  O OD1 . ASN A 62  ? 0.7670  0.6870 0.8270 -0.2842 0.0873  -0.1577 62  ASN A OD1 
488  N ND2 . ASN A 62  ? 0.9778  0.4432 0.5429 -0.2100 -0.0922 0.1018  62  ASN A ND2 
489  N N   . VAL A 63  ? 0.4288  0.2815 0.2718 -0.0359 0.0524  0.0111  63  VAL A N   
490  C CA  . VAL A 63  ? 0.3661  0.2560 0.2405 0.0172  0.0202  -0.0069 63  VAL A CA  
491  C C   . VAL A 63  ? 0.2821  0.2620 0.3392 0.0131  0.0428  0.0029  63  VAL A C   
492  O O   . VAL A 63  ? 0.3113  0.2617 0.3006 -0.0071 0.0182  0.0127  63  VAL A O   
493  C CB  . VAL A 63  ? 0.3562  0.2680 0.2447 0.0486  0.0009  0.0035  63  VAL A CB  
494  C CG1 . VAL A 63  ? 0.3793  0.2633 0.3443 0.0527  -0.0070 0.0110  63  VAL A CG1 
495  C CG2 . VAL A 63  ? 0.4517  0.2593 0.2159 -0.0216 0.0105  0.0104  63  VAL A CG2 
496  N N   . GLU A 64  ? 0.3133  0.2536 0.3016 0.0177  -0.0108 0.0325  64  GLU A N   
497  C CA  . GLU A 64  ? 0.3171  0.2619 0.2579 0.0174  0.0023  0.0088  64  GLU A CA  
498  C C   . GLU A 64  ? 0.3377  0.2213 0.2604 0.0029  0.0021  0.0192  64  GLU A C   
499  O O   . GLU A 64  ? 0.3306  0.3085 0.2886 0.0269  0.0023  0.0407  64  GLU A O   
500  C CB  . GLU A 64  ? 0.4052  0.2829 0.2603 -0.0527 -0.0296 0.0579  64  GLU A CB  
501  C CG  . GLU A 64  ? 0.3928  0.2878 0.3007 -0.0602 -0.0136 0.0431  64  GLU A CG  
502  C CD  . GLU A 64  ? 0.3986  0.2946 0.4065 -0.0321 -0.0476 -0.0060 64  GLU A CD  
503  O OE1 . GLU A 64  ? 0.4467  0.3248 0.3822 -0.0012 -0.0352 -0.0371 64  GLU A OE1 
504  O OE2 . GLU A 64  ? 0.4021  0.3366 0.4154 -0.0095 -0.0639 -0.0490 64  GLU A OE2 
505  N N   . PRO A 65  ? 0.3454  0.2680 0.2609 -0.0064 0.0142  0.0230  65  PRO A N   
506  C CA  . PRO A 65  ? 0.3668  0.2891 0.2579 -0.0182 0.0006  0.0182  65  PRO A CA  
507  C C   . PRO A 65  ? 0.3657  0.2783 0.2673 -0.0189 -0.0061 0.0574  65  PRO A C   
508  O O   . PRO A 65  ? 0.3735  0.2579 0.2490 0.0297  0.0044  0.0018  65  PRO A O   
509  C CB  . PRO A 65  ? 0.3882  0.3001 0.2721 -0.0251 0.0266  0.0485  65  PRO A CB  
510  C CG  . PRO A 65  ? 0.3887  0.4638 0.2542 0.0519  0.0711  0.0950  65  PRO A CG  
511  C CD  . PRO A 65  ? 0.3769  0.3279 0.2658 0.0277  0.0250  0.0243  65  PRO A CD  
512  N N   . TYR A 66  ? 0.3002  0.2585 0.2828 0.0206  0.0338  0.0211  66  TYR A N   
513  C CA  . TYR A 66  ? 0.3455  0.2748 0.2737 -0.0083 0.0222  -0.0330 66  TYR A CA  
514  C C   . TYR A 66  ? 0.2973  0.2826 0.2361 -0.0182 0.0008  -0.0294 66  TYR A C   
515  O O   . TYR A 66  ? 0.3363  0.2271 0.2719 -0.0156 -0.0326 -0.0105 66  TYR A O   
516  C CB  . TYR A 66  ? 0.3625  0.2787 0.2575 -0.0072 0.0209  -0.0367 66  TYR A CB  
517  C CG  . TYR A 66  ? 0.3285  0.2269 0.2851 0.0256  -0.0133 0.0184  66  TYR A CG  
518  C CD1 . TYR A 66  ? 0.3957  0.2700 0.3385 -0.0323 0.0383  0.0281  66  TYR A CD1 
519  C CD2 . TYR A 66  ? 0.3302  0.2937 0.2563 0.0078  -0.0614 0.0283  66  TYR A CD2 
520  C CE1 . TYR A 66  ? 0.3920  0.2374 0.4480 -0.0320 0.0899  -0.0417 66  TYR A CE1 
521  C CE2 . TYR A 66  ? 0.3038  0.2304 0.3307 0.0438  -0.0382 0.0033  66  TYR A CE2 
522  C CZ  . TYR A 66  ? 0.3985  0.3003 0.4006 -0.0469 0.0457  -0.0174 66  TYR A CZ  
523  O OH  . TYR A 66  ? 0.3430  0.2814 0.3948 0.0093  0.0098  0.0193  66  TYR A OH  
524  N N   . GLU A 67  ? 0.3439  0.2684 0.2479 0.0174  -0.0220 -0.0221 67  GLU A N   
525  C CA  . GLU A 67  ? 0.4294  0.2327 0.2402 -0.0326 0.0331  -0.0317 67  GLU A CA  
526  C C   . GLU A 67  ? 0.2948  0.2389 0.2894 -0.0333 0.0340  -0.0176 67  GLU A C   
527  O O   . GLU A 67  ? 0.2770  0.3094 0.3211 -0.0469 0.0233  -0.0245 67  GLU A O   
528  C CB  . GLU A 67  ? 0.3137  0.2628 0.2716 0.0036  0.0185  -0.0381 67  GLU A CB  
529  C CG  . GLU A 67  ? 0.4839  0.2719 0.2943 0.0149  -0.0315 -0.0227 67  GLU A CG  
530  C CD  . GLU A 67  ? 0.4450  0.2993 0.2840 -0.0098 0.0003  0.0162  67  GLU A CD  
531  O OE1 . GLU A 67  ? 0.5311  0.2910 0.3916 0.0235  -0.0026 0.0584  67  GLU A OE1 
532  O OE2 . GLU A 67  ? 0.5007  0.3270 0.3596 -0.0331 -0.0570 -0.0166 67  GLU A OE2 
533  N N   . GLN A 68  ? 0.2687  0.2604 0.3201 -0.0338 -0.0242 0.0254  68  GLN A N   
534  C CA  . GLN A 68  ? 0.3231  0.2583 0.2575 -0.0531 0.0163  0.0172  68  GLN A CA  
535  C C   . GLN A 68  ? 0.2858  0.2462 0.2559 -0.0058 0.0067  -0.0087 68  GLN A C   
536  O O   . GLN A 68  ? 0.3515  0.2837 0.3157 0.0451  0.0159  -0.0096 68  GLN A O   
537  C CB  . GLN A 68  ? 0.3000  0.2232 0.2977 0.0017  -0.0121 -0.0239 68  GLN A CB  
538  C CG  . GLN A 68  ? 0.3514  0.2755 0.3319 -0.0525 -0.0560 0.0665  68  GLN A CG  
539  C CD  . GLN A 68  ? 0.2806  0.2690 0.3040 0.0126  -0.0140 -0.0131 68  GLN A CD  
540  O OE1 . GLN A 68  ? 0.3555  0.3506 0.3018 -0.0643 0.0131  -0.0376 68  GLN A OE1 
541  N NE2 . GLN A 68  ? 0.3370  0.2994 0.2957 -0.0136 -0.0211 0.0304  68  GLN A NE2 
542  N N   . LEU A 69  ? 0.2944  0.2750 0.2606 0.0326  0.0103  0.0047  69  LEU A N   
543  C CA  . LEU A 69  ? 0.2962  0.3656 0.2379 -0.0289 0.0316  0.0129  69  LEU A CA  
544  C C   . LEU A 69  ? 0.2827  0.2654 0.2627 0.0041  0.0242  0.0191  69  LEU A C   
545  O O   . LEU A 69  ? 0.3073  0.3265 0.3082 -0.0398 -0.0082 0.0538  69  LEU A O   
546  C CB  . LEU A 69  ? 0.2992  0.3940 0.2593 0.0045  0.0517  0.0592  69  LEU A CB  
547  C CG  . LEU A 69  ? 0.2751  0.3144 0.2299 0.0442  0.0086  0.0747  69  LEU A CG  
548  C CD1 . LEU A 69  ? 0.2892  0.4121 0.3800 0.0837  0.0328  0.0313  69  LEU A CD1 
549  C CD2 . LEU A 69  ? 0.4478  0.2978 0.4128 0.0215  -0.0290 0.0948  69  LEU A CD2 
550  N N   . GLY A 70  ? 0.3569  0.2667 0.2937 -0.0502 0.0471  0.0102  70  GLY A N   
551  C CA  . GLY A 70  ? 0.3475  0.2406 0.3562 -0.0360 0.0666  -0.0277 70  GLY A CA  
552  C C   . GLY A 70  ? 0.3509  0.2279 0.2826 0.0348  -0.0371 0.0172  70  GLY A C   
553  O O   . GLY A 70  ? 0.3282  0.3058 0.3247 0.0189  -0.0209 0.0205  70  GLY A O   
554  N N   . LEU A 71  ? 0.3244  0.2508 0.2866 0.0185  -0.0027 -0.0022 71  LEU A N   
555  C CA  . LEU A 71  ? 0.2802  0.3028 0.2592 -0.0162 0.0283  -0.0132 71  LEU A CA  
556  C C   . LEU A 71  ? 0.2678  0.2865 0.2590 -0.0092 0.0101  -0.0020 71  LEU A C   
557  O O   . LEU A 71  ? 0.3533  0.2860 0.2925 -0.0149 0.0024  -0.0158 71  LEU A O   
558  C CB  . LEU A 71  ? 0.2738  0.3294 0.2572 -0.0168 0.0221  -0.0258 71  LEU A CB  
559  C CG  . LEU A 71  ? 0.2235  0.2447 0.3702 0.0394  -0.0220 -0.0147 71  LEU A CG  
560  C CD1 . LEU A 71  ? 0.2105  0.3539 0.3773 0.0536  -0.0181 -0.0196 71  LEU A CD1 
561  C CD2 . LEU A 71  ? 0.2608  0.2526 0.3794 0.0127  -0.0298 0.0037  71  LEU A CD2 
562  N N   . ALA A 72  ? 0.3019  0.2780 0.2865 -0.0028 0.0280  0.0168  72  ALA A N   
563  C CA  . ALA A 72  ? 0.3004  0.3074 0.2960 -0.0067 0.0271  0.0478  72  ALA A CA  
564  C C   . ALA A 72  ? 0.3063  0.2894 0.2813 -0.0050 0.0211  0.0165  72  ALA A C   
565  O O   . ALA A 72  ? 0.3457  0.2672 0.4438 0.0207  -0.0309 -0.0340 72  ALA A O   
566  C CB  . ALA A 72  ? 0.3486  0.3161 0.2776 -0.0680 0.0147  0.0028  72  ALA A CB  
567  N N   . GLU A 73  ? 0.3119  0.2834 0.3386 -0.0235 -0.0269 0.0224  73  GLU A N   
568  C CA  . GLU A 73  ? 0.3167  0.3139 0.3244 0.0564  0.0084  -0.0280 73  GLU A CA  
569  C C   . GLU A 73  ? 0.3359  0.2936 0.3044 -0.0088 0.0135  -0.0081 73  GLU A C   
570  O O   . GLU A 73  ? 0.3152  0.2959 0.3136 -0.0071 0.0035  -0.0076 73  GLU A O   
571  C CB  . GLU A 73  ? 0.3621  0.3340 0.4131 0.0987  0.1278  -0.0171 73  GLU A CB  
572  C CG  . GLU A 73  ? 0.6619  0.3625 0.4769 0.0376  0.1361  -0.1092 73  GLU A CG  
573  C CD  . GLU A 73  ? 1.1057  0.3726 0.6881 0.1498  0.2277  -0.1283 73  GLU A CD  
574  O OE1 . GLU A 73  ? 1.5646  0.3934 0.8033 -0.1034 -0.1159 0.0477  73  GLU A OE1 
575  O OE2 . GLU A 73  ? 1.1644  0.5413 1.1969 0.4173  0.2375  -0.1079 73  GLU A OE2 
576  N N   . ASP A 74  ? 0.3268  0.2455 0.3174 -0.0320 0.0314  0.0159  74  ASP A N   
577  C CA  . ASP A 74  ? 0.3307  0.3053 0.3123 -0.0374 0.0013  0.0102  74  ASP A CA  
578  C C   . ASP A 74  ? 0.4330  0.3125 0.2976 -0.0666 -0.0566 0.0065  74  ASP A C   
579  O O   . ASP A 74  ? 0.3839  0.3324 0.4002 -0.0710 -0.0555 0.0645  74  ASP A O   
580  C CB  . ASP A 74  ? 0.3601  0.3720 0.3347 -0.0828 -0.0585 0.0581  74  ASP A CB  
581  C CG  . ASP A 74  ? 0.3844  0.3900 0.3365 -0.1214 -0.0745 0.0423  74  ASP A CG  
582  O OD1 . ASP A 74  ? 0.4147  0.5357 0.4644 -0.1484 -0.1046 -0.0457 74  ASP A OD1 
583  O OD2 . ASP A 74  ? 0.4015  0.3969 0.4043 -0.0653 -0.0070 -0.0031 74  ASP A OD2 
584  N N   . LYS A 75  ? 0.2863  0.2836 0.3131 0.0288  0.0119  0.0375  75  LYS A N   
585  C CA  . LYS A 75  ? 0.2631  0.3114 0.3103 0.0243  -0.0038 0.0696  75  LYS A CA  
586  C C   . LYS A 75  ? 0.2713  0.2606 0.3449 -0.0047 0.0131  0.0004  75  LYS A C   
587  O O   . LYS A 75  ? 0.2852  0.2692 0.3416 0.0243  0.0310  0.0327  75  LYS A O   
588  C CB  . LYS A 75  ? 0.5281  0.2663 0.3439 0.0869  0.1324  0.1084  75  LYS A CB  
589  C CG  . LYS A 75  ? 0.4428  0.3444 0.6075 0.1015  0.1523  -0.0217 75  LYS A CG  
590  C CD  . LYS A 75  ? 0.5301  0.4230 0.6484 0.1480  0.1604  -0.0878 75  LYS A CD  
591  C CE  . LYS A 75  ? 0.6223  0.6187 0.8161 0.0482  0.2938  -0.2385 75  LYS A CE  
592  N NZ  . LYS A 75  ? 0.7525  0.6659 0.6742 -0.0431 0.3576  -0.1677 75  LYS A NZ  
593  N N   . PHE A 76  ? 0.2833  0.2701 0.3010 0.0204  -0.0120 0.0215  76  PHE A N   
594  C CA  . PHE A 76  ? 0.2734  0.3004 0.2871 0.0156  -0.0163 -0.0202 76  PHE A CA  
595  C C   . PHE A 76  ? 0.3041  0.2719 0.2731 -0.0303 -0.0081 0.0003  76  PHE A C   
596  O O   . PHE A 76  ? 0.3089  0.2702 0.2800 -0.0135 0.0023  0.0198  76  PHE A O   
597  C CB  . PHE A 76  ? 0.2778  0.2908 0.2867 -0.0320 -0.0176 0.0055  76  PHE A CB  
598  C CG  . PHE A 76  ? 0.2799  0.2808 0.2624 0.0169  -0.0252 0.0310  76  PHE A CG  
599  C CD1 . PHE A 76  ? 0.3218  0.3358 0.2454 -0.0215 -0.0464 0.0403  76  PHE A CD1 
600  C CD2 . PHE A 76  ? 0.3618  0.3324 0.2356 -0.0536 -0.0136 -0.0107 76  PHE A CD2 
601  C CE1 . PHE A 76  ? 0.2487  0.3883 0.2660 -0.0234 -0.0268 0.0082  76  PHE A CE1 
602  C CE2 . PHE A 76  ? 0.3826  0.3359 0.2388 -0.0162 0.0123  -0.0114 76  PHE A CE2 
603  C CZ  . PHE A 76  ? 0.3079  0.3667 0.2593 -0.0204 -0.0003 -0.0023 76  PHE A CZ  
604  N N   . THR A 77  ? 0.3100  0.2786 0.2739 -0.0262 -0.0120 0.0161  77  THR A N   
605  C CA  . THR A 77  ? 0.3342  0.2833 0.2633 -0.0103 -0.0028 0.0334  77  THR A CA  
606  C C   . THR A 77  ? 0.3402  0.2818 0.2923 -0.0032 -0.0079 0.0349  77  THR A C   
607  O O   . THR A 77  ? 0.3277  0.2425 0.2993 0.0254  0.0028  0.0019  77  THR A O   
608  C CB  . THR A 77  ? 0.3004  0.2313 0.3026 -0.0058 0.0391  0.0437  77  THR A CB  
609  O OG1 . THR A 77  ? 0.3308  0.2439 0.3257 -0.0107 0.0193  0.0127  77  THR A OG1 
610  C CG2 . THR A 77  ? 0.3406  0.2317 0.2946 0.0253  0.0120  0.0140  77  THR A CG2 
611  N N   . ASP A 78  ? 0.3337  0.3249 0.2827 0.0141  -0.0494 0.0032  78  ASP A N   
612  C CA  . ASP A 78  ? 0.3100  0.2874 0.2666 -0.0161 0.0005  0.0156  78  ASP A CA  
613  C C   . ASP A 78  ? 0.3354  0.2632 0.2306 -0.0249 -0.0058 0.0097  78  ASP A C   
614  O O   . ASP A 78  ? 0.3539  0.2491 0.2791 -0.0396 -0.0404 0.0222  78  ASP A O   
615  C CB  . ASP A 78  ? 0.3414  0.2909 0.2856 -0.0293 -0.0358 -0.0029 78  ASP A CB  
616  C CG  . ASP A 78  ? 0.4143  0.2997 0.2225 -0.0529 -0.0523 0.0299  78  ASP A CG  
617  O OD1 . ASP A 78  ? 0.3804  0.3242 0.3468 -0.0450 -0.0268 -0.0483 78  ASP A OD1 
618  O OD2 . ASP A 78  ? 0.3283  0.3547 0.2885 -0.0112 -0.0213 0.0207  78  ASP A OD2 
619  N N   . ASP A 79  ? 0.3638  0.2699 0.2517 -0.0301 -0.0162 0.0216  79  ASP A N   
620  C CA  . ASP A 79  ? 0.3424  0.2371 0.2780 -0.0026 0.0154  0.0171  79  ASP A CA  
621  C C   . ASP A 79  ? 0.2690  0.1954 0.2767 0.0345  -0.0081 0.0329  79  ASP A C   
622  O O   . ASP A 79  ? 0.2644  0.3250 0.3340 0.0059  -0.0195 0.0136  79  ASP A O   
623  C CB  . ASP A 79  ? 0.3186  0.2491 0.2734 0.0069  0.0141  0.0144  79  ASP A CB  
624  C CG  . ASP A 79  ? 0.2988  0.3231 0.2950 0.0297  0.0004  -0.0356 79  ASP A CG  
625  O OD1 . ASP A 79  ? 0.3652  0.2714 0.2901 0.0137  -0.0430 0.0111  79  ASP A OD1 
626  O OD2 . ASP A 79  ? 0.3035  0.3783 0.3475 0.0432  0.0355  -0.0105 79  ASP A OD2 
627  N N   . GLN A 80  ? 0.2876  0.2296 0.2831 0.0511  -0.0024 0.0392  80  GLN A N   
628  C CA  . GLN A 80  ? 0.2770  0.2317 0.3016 0.0397  -0.0028 0.0113  80  GLN A CA  
629  C C   . GLN A 80  ? 0.2666  0.2015 0.2927 0.0009  -0.0080 0.0138  80  GLN A C   
630  O O   . GLN A 80  ? 0.2690  0.2872 0.2543 -0.0235 0.0078  0.0211  80  GLN A O   
631  C CB  . GLN A 80  ? 0.2436  0.2895 0.2461 0.0140  -0.0235 0.0132  80  GLN A CB  
632  C CG  . GLN A 80  ? 0.2583  0.2313 0.3042 0.0177  -0.0334 0.0048  80  GLN A CG  
633  C CD  . GLN A 80  ? 0.2811  0.2394 0.3115 0.0250  0.0017  0.0352  80  GLN A CD  
634  O OE1 . GLN A 80  ? 0.2763  0.2786 0.3415 0.0178  0.0052  0.0681  80  GLN A OE1 
635  N NE2 . GLN A 80  ? 0.2543  0.2186 0.3570 0.0127  -0.0259 -0.0185 80  GLN A NE2 
636  N N   . LEU A 81  ? 0.3219  0.1904 0.3143 0.0075  0.0171  -0.0080 81  LEU A N   
637  C CA  . LEU A 81  ? 0.2662  0.2097 0.3382 -0.0050 0.0357  0.0278  81  LEU A CA  
638  C C   . LEU A 81  ? 0.2485  0.3036 0.2917 -0.0035 -0.0039 -0.0532 81  LEU A C   
639  O O   . LEU A 81  ? 0.3061  0.2970 0.3001 -0.0381 -0.0384 -0.0213 81  LEU A O   
640  C CB  . LEU A 81  ? 0.3070  0.2686 0.2881 -0.0562 0.0132  0.0298  81  LEU A CB  
641  C CG  . LEU A 81  ? 0.2891  0.3356 0.2657 -0.0691 0.0102  0.0319  81  LEU A CG  
642  C CD1 . LEU A 81  ? 0.2620  0.2868 0.2975 -0.0203 0.0087  0.0224  81  LEU A CD1 
643  C CD2 . LEU A 81  ? 0.2935  0.2884 0.3119 0.0182  -0.0272 0.0044  81  LEU A CD2 
644  N N   . ILE A 82  ? 0.2575  0.3067 0.2764 0.0075  -0.0094 -0.0162 82  ILE A N   
645  C CA  . ILE A 82  ? 0.2705  0.2411 0.2868 0.0017  0.0327  0.0325  82  ILE A CA  
646  C C   . ILE A 82  ? 0.2620  0.2385 0.2972 0.0151  0.0196  0.0307  82  ILE A C   
647  O O   . ILE A 82  ? 0.2956  0.2428 0.3162 0.0363  -0.0161 -0.0031 82  ILE A O   
648  C CB  . ILE A 82  ? 0.2594  0.3213 0.3052 0.0258  0.0031  -0.0056 82  ILE A CB  
649  C CG1 . ILE A 82  ? 0.3445  0.3155 0.3665 0.0248  -0.0412 -0.0351 82  ILE A CG1 
650  C CG2 . ILE A 82  ? 0.2677  0.4054 0.2867 0.0492  0.0209  -0.0712 82  ILE A CG2 
651  C CD1 . ILE A 82  ? 0.3432  0.3480 0.3613 -0.0031 -0.0037 -0.0363 82  ILE A CD1 
652  N N   . ASP A 83  ? 0.2876  0.2311 0.3212 0.0242  -0.0166 0.0088  83  ASP A N   
653  C CA  . ASP A 83  ? 0.3193  0.2417 0.2817 -0.0024 -0.0128 0.0329  83  ASP A CA  
654  C C   . ASP A 83  ? 0.3217  0.2815 0.2780 -0.0219 -0.0028 0.0206  83  ASP A C   
655  O O   . ASP A 83  ? 0.2953  0.3034 0.2815 0.0060  -0.0016 0.0233  83  ASP A O   
656  C CB  . ASP A 83  ? 0.3424  0.2538 0.2908 0.0307  0.0425  0.0504  83  ASP A CB  
657  C CG  . ASP A 83  ? 0.2752  0.3442 0.2826 0.0050  0.0381  0.0580  83  ASP A CG  
658  O OD1 . ASP A 83  ? 0.2978  0.3428 0.3090 0.0418  0.0120  0.0039  83  ASP A OD1 
659  O OD2 . ASP A 83  ? 0.2884  0.4411 0.3243 0.0528  0.0291  0.0225  83  ASP A OD2 
660  N N   . PHE A 84  ? 0.2603  0.3259 0.2912 0.0302  -0.0088 -0.0045 84  PHE A N   
661  C CA  . PHE A 84  ? 0.2923  0.2953 0.2874 0.0438  0.0180  0.0127  84  PHE A CA  
662  C C   . PHE A 84  ? 0.3149  0.2668 0.3304 0.0269  -0.0301 0.0119  84  PHE A C   
663  O O   . PHE A 84  ? 0.3051  0.2709 0.2887 0.0072  0.0032  0.0084  84  PHE A O   
664  C CB  . PHE A 84  ? 0.3222  0.2622 0.3274 0.0174  0.0426  -0.0026 84  PHE A CB  
665  C CG  . PHE A 84  ? 0.3113  0.2738 0.2765 0.0291  0.0495  -0.0116 84  PHE A CG  
666  C CD1 . PHE A 84  ? 0.3387  0.2532 0.3131 0.0267  0.0030  0.0450  84  PHE A CD1 
667  C CD2 . PHE A 84  ? 0.3244  0.3241 0.3364 0.0328  0.0257  -0.0505 84  PHE A CD2 
668  C CE1 . PHE A 84  ? 0.2737  0.2714 0.3336 0.0088  -0.0306 -0.0375 84  PHE A CE1 
669  C CE2 . PHE A 84  ? 0.2799  0.2755 0.3542 -0.0152 0.0124  -0.0432 84  PHE A CE2 
670  C CZ  . PHE A 84  ? 0.2514  0.2888 0.2811 -0.0533 0.0212  -0.0164 84  PHE A CZ  
671  N N   . MET A 85  ? 0.2423  0.2726 0.3271 -0.0021 0.0087  0.0009  85  MET A N   
672  C CA  . MET A 85  ? 0.2614  0.2762 0.2802 0.0281  -0.0012 -0.0582 85  MET A CA  
673  C C   . MET A 85  ? 0.2593  0.2789 0.3114 0.0371  -0.0223 0.0255  85  MET A C   
674  O O   . MET A 85  ? 0.2633  0.4204 0.2885 0.0132  -0.0167 0.0453  85  MET A O   
675  C CB  A MET A 85  ? 0.3103  0.2934 0.3076 0.0145  0.0276  -0.0851 85  MET A CB  
676  C CB  B MET A 85  ? 0.3531  0.2934 0.2930 0.0217  -0.0237 -0.0775 85  MET A CB  
677  C CG  A MET A 85  ? 0.4241  0.2019 0.3748 0.0409  0.1293  -0.0894 85  MET A CG  
678  C CG  B MET A 85  ? 0.2200  0.3228 0.2901 0.0041  -0.1345 -0.1148 85  MET A CG  
679  S SD  A MET A 85  ? -0.0653 0.2299 0.8474 0.2569  -0.0474 -0.1330 85  MET A SD  
680  S SD  B MET A 85  ? -0.0204 0.2083 0.6377 0.2113  -0.0121 -0.1143 85  MET A SD  
681  C CE  A MET A 85  ? 0.3548  0.3370 1.3362 0.0852  0.2224  -0.6784 85  MET A CE  
682  C CE  B MET A 85  ? 0.2260  0.5630 0.8955 -0.1412 -0.3592 -0.1866 85  MET A CE  
683  N N   . LEU A 86  ? 0.3082  0.2972 0.2892 0.0054  -0.0305 0.0082  86  LEU A N   
684  C CA  . LEU A 86  ? 0.3302  0.2943 0.2683 -0.0079 -0.0283 0.0292  86  LEU A CA  
685  C C   . LEU A 86  ? 0.2970  0.3162 0.3427 0.0214  -0.0847 -0.0029 86  LEU A C   
686  O O   . LEU A 86  ? 0.2860  0.3591 0.3580 -0.0038 -0.0548 0.0078  86  LEU A O   
687  C CB  . LEU A 86  ? 0.4427  0.3458 0.2628 0.1077  0.0456  0.0370  86  LEU A CB  
688  C CG  . LEU A 86  ? 0.3488  0.4300 0.2715 0.1321  0.0355  -0.0124 86  LEU A CG  
689  C CD1 . LEU A 86  ? 0.6772  0.4971 0.3010 0.1592  -0.0880 0.0018  86  LEU A CD1 
690  C CD2 . LEU A 86  ? 0.3247  0.3394 0.4576 0.0818  -0.0308 -0.0343 86  LEU A CD2 
691  N N   . GLN A 87  ? 0.3006  0.3423 0.2934 0.0142  -0.0455 -0.0145 87  GLN A N   
692  C CA  . GLN A 87  ? 0.2880  0.2905 0.2983 -0.0160 -0.0530 0.0241  87  GLN A CA  
693  C C   . GLN A 87  ? 0.3238  0.2484 0.2868 0.0145  -0.0124 -0.0059 87  GLN A C   
694  O O   . GLN A 87  ? 0.4954  0.2653 0.3094 -0.0068 -0.0838 0.0000  87  GLN A O   
695  C CB  . GLN A 87  ? 0.3338  0.2676 0.4000 -0.0222 -0.0837 0.0495  87  GLN A CB  
696  C CG  . GLN A 87  ? 0.3357  0.3043 0.4502 -0.0603 -0.0661 0.1212  87  GLN A CG  
697  C CD  . GLN A 87  ? 0.3865  0.4106 0.5959 -0.1396 -0.0219 0.0933  87  GLN A CD  
698  O OE1 . GLN A 87  ? 0.3783  0.7956 0.6712 -0.0237 0.0571  0.0913  87  GLN A OE1 
699  N NE2 . GLN A 87  ? 0.6484  0.6171 0.6160 -0.3696 -0.2521 0.2555  87  GLN A NE2 
700  N N   . HIS A 88  ? 0.3011  0.2772 0.3030 0.0075  -0.0262 0.0258  88  HIS A N   
701  C CA  . HIS A 88  ? 0.3271  0.2697 0.3013 0.0212  0.0183  0.0035  88  HIS A CA  
702  C C   . HIS A 88  ? 0.3070  0.2712 0.2693 0.0172  -0.0287 0.0139  88  HIS A C   
703  O O   . HIS A 88  ? 0.3235  0.2765 0.3548 -0.0027 -0.0186 -0.0097 88  HIS A O   
704  C CB  . HIS A 88  ? 0.3432  0.3328 0.3560 0.0505  0.0354  -0.0071 88  HIS A CB  
705  C CG  . HIS A 88  ? 0.3449  0.3110 0.2933 0.0375  0.0507  -0.0185 88  HIS A CG  
706  N ND1 . HIS A 88  ? 0.4635  0.3218 0.3451 -0.0150 -0.0627 0.0046  88  HIS A ND1 
707  C CD2 . HIS A 88  ? 0.3878  0.2999 0.3575 0.0108  -0.0326 -0.0321 88  HIS A CD2 
708  C CE1 . HIS A 88  ? 0.4627  0.3075 0.4001 0.0136  -0.0945 -0.0414 88  HIS A CE1 
709  N NE2 . HIS A 88  ? 0.3238  0.3148 0.3504 0.0440  -0.0178 -0.0376 88  HIS A NE2 
710  N N   . PRO A 89  ? 0.3120  0.2851 0.3146 0.0307  -0.0254 0.0448  89  PRO A N   
711  C CA  . PRO A 89  ? 0.3134  0.2930 0.3219 0.0351  0.0027  0.0287  89  PRO A CA  
712  C C   . PRO A 89  ? 0.3549  0.2570 0.2975 0.0493  0.0147  0.0059  89  PRO A C   
713  O O   . PRO A 89  ? 0.3594  0.2684 0.3148 0.0263  -0.0119 -0.0106 89  PRO A O   
714  C CB  . PRO A 89  ? 0.3115  0.3220 0.4271 0.0441  -0.0095 0.0654  89  PRO A CB  
715  C CG  . PRO A 89  ? 0.3383  0.3455 0.5237 0.0182  0.0544  0.0693  89  PRO A CG  
716  C CD  . PRO A 89  ? 0.2944  0.3160 0.4623 0.0144  -0.0855 -0.0144 89  PRO A CD  
717  N N   . ILE A 90  ? 0.2939  0.2756 0.3074 0.0579  -0.0063 -0.0036 90  ILE A N   
718  C CA  . ILE A 90  ? 0.2968  0.3811 0.2844 0.0274  -0.0152 0.0203  90  ILE A CA  
719  C C   . ILE A 90  ? 0.2784  0.2640 0.3235 0.0683  -0.0071 0.0233  90  ILE A C   
720  O O   . ILE A 90  ? 0.3715  0.2903 0.3117 0.0260  0.0195  0.0279  90  ILE A O   
721  C CB  . ILE A 90  ? 0.3495  0.3149 0.3074 0.0240  -0.0024 0.0174  90  ILE A CB  
722  C CG1 . ILE A 90  ? 0.3513  0.3149 0.2932 0.0754  0.0407  0.0113  90  ILE A CG1 
723  C CG2 . ILE A 90  ? 0.3928  0.3617 0.2852 0.0640  0.0047  0.0514  90  ILE A CG2 
724  C CD1 . ILE A 90  ? 0.3658  0.5858 0.3013 -0.0464 0.0524  -0.0713 90  ILE A CD1 
725  N N   . LEU A 91  ? 0.2857  0.2532 0.3155 0.0634  -0.0224 0.0030  91  LEU A N   
726  C CA  . LEU A 91  ? 0.2703  0.2665 0.3048 0.0362  0.0074  0.0099  91  LEU A CA  
727  C C   . LEU A 91  ? 0.3034  0.2756 0.2976 0.0308  -0.0100 0.0109  91  LEU A C   
728  O O   . LEU A 91  ? 0.3197  0.2283 0.4173 0.0116  0.0435  -0.0013 91  LEU A O   
729  C CB  . LEU A 91  ? 0.2718  0.2879 0.2363 0.0413  0.0037  -0.0097 91  LEU A CB  
730  C CG  . LEU A 91  ? 0.3754  0.2825 0.2069 0.0772  0.0337  0.0312  91  LEU A CG  
731  C CD1 . LEU A 91  ? 0.3778  0.2550 0.2129 0.0095  -0.0587 0.0050  91  LEU A CD1 
732  C CD2 . LEU A 91  ? 0.3582  0.3073 0.2665 0.0787  0.0507  0.0243  91  LEU A CD2 
733  N N   . ILE A 92  ? 0.3087  0.2823 0.2789 0.0336  -0.0005 -0.0094 92  ILE A N   
734  C CA  . ILE A 92  ? 0.3548  0.2981 0.2483 0.0006  0.0287  -0.0044 92  ILE A CA  
735  C C   . ILE A 92  ? 0.2603  0.2760 0.3170 0.0359  0.0464  -0.0011 92  ILE A C   
736  O O   . ILE A 92  ? 0.2756  0.2799 0.4396 -0.0059 -0.0149 0.0793  92  ILE A O   
737  C CB  . ILE A 92  ? 0.2883  0.2145 0.3122 0.0438  0.0065  0.0147  92  ILE A CB  
738  C CG1 . ILE A 92  ? 0.3297  0.2931 0.2874 0.0308  0.0182  0.0501  92  ILE A CG1 
739  C CG2 . ILE A 92  ? 0.2943  0.2846 0.3714 0.0483  -0.0462 -0.0780 92  ILE A CG2 
740  C CD1 . ILE A 92  ? 0.3139  0.3303 0.2738 -0.0081 -0.0138 0.0304  92  ILE A CD1 
741  N N   . ASN A 93  ? 0.2866  0.2503 0.3437 0.0338  -0.0051 -0.0055 93  ASN A N   
742  C CA  . ASN A 93  ? 0.2514  0.2657 0.2913 0.0094  -0.0536 -0.0077 93  ASN A CA  
743  C C   . ASN A 93  ? 0.2751  0.3024 0.3777 0.0438  -0.0071 0.0287  93  ASN A C   
744  O O   . ASN A 93  ? 0.3029  0.2732 0.3350 0.0680  -0.0278 0.0339  93  ASN A O   
745  C CB  . ASN A 93  ? 0.2778  0.2600 0.2970 0.0048  -0.0073 -0.0478 93  ASN A CB  
746  C CG  . ASN A 93  ? 0.2475  0.2703 0.3405 0.0525  -0.0007 0.0154  93  ASN A CG  
747  O OD1 . ASN A 93  ? 0.2786  0.3616 0.3410 0.0341  -0.0208 0.0213  93  ASN A OD1 
748  N ND2 . ASN A 93  ? 0.2607  0.3606 0.3583 0.0249  0.0102  0.0076  93  ASN A ND2 
749  N N   . ARG A 94  ? 0.2791  0.2736 0.2751 0.0586  0.0272  -0.0362 94  ARG A N   
750  C CA  . ARG A 94  ? 0.2482  0.2732 0.3251 0.0252  0.0072  0.0234  94  ARG A CA  
751  C C   . ARG A 94  ? 0.3289  0.2872 0.3359 0.0395  0.0203  0.0482  94  ARG A C   
752  O O   . ARG A 94  ? 0.4044  0.2605 0.2530 0.0219  0.0344  0.0045  94  ARG A O   
753  C CB  . ARG A 94  ? 0.3052  0.3220 0.3338 0.0269  -0.0155 -0.0150 94  ARG A CB  
754  C CG  . ARG A 94  ? 0.2421  0.3858 0.3354 0.0412  -0.0581 0.0462  94  ARG A CG  
755  C CD  . ARG A 94  ? 0.3018  0.3986 0.3497 0.0247  0.0108  -0.0068 94  ARG A CD  
756  N NE  . ARG A 94  ? 0.4304  0.3653 0.3289 0.0450  -0.0193 0.0414  94  ARG A NE  
757  C CZ  . ARG A 94  ? 0.4713  0.4613 0.2405 0.0081  -0.0409 0.0425  94  ARG A CZ  
758  N NH1 . ARG A 94  ? 0.4415  0.3753 0.3383 0.0301  -0.0227 0.0118  94  ARG A NH1 
759  N NH2 . ARG A 94  ? 0.6598  0.4171 0.2588 0.0760  -0.0732 -0.0003 94  ARG A NH2 
760  N N   . PRO A 95  ? 0.3185  0.2505 0.2888 0.0033  -0.0171 -0.0148 95  PRO A N   
761  C CA  . PRO A 95  ? 0.3223  0.2756 0.2729 0.0377  -0.0204 0.0239  95  PRO A CA  
762  C C   . PRO A 95  ? 0.3041  0.2076 0.2833 0.0344  -0.0166 0.0272  95  PRO A C   
763  O O   . PRO A 95  ? 0.3050  0.3011 0.3235 -0.0370 0.0057  0.0250  95  PRO A O   
764  C CB  . PRO A 95  ? 0.2864  0.2978 0.3320 0.0149  -0.0424 0.0534  95  PRO A CB  
765  C CG  . PRO A 95  ? 0.3053  0.2582 0.2556 0.0041  -0.0476 -0.0007 95  PRO A CG  
766  C CD  . PRO A 95  ? 0.3327  0.2941 0.2547 0.0356  -0.0189 0.0287  95  PRO A CD  
767  N N   . ILE A 96  ? 0.3367  0.2517 0.2756 0.0007  0.0234  0.0089  96  ILE A N   
768  C CA  . ILE A 96  ? 0.3220  0.2553 0.2845 0.0329  0.0119  -0.0153 96  ILE A CA  
769  C C   . ILE A 96  ? 0.3120  0.2816 0.2904 0.0392  -0.0252 -0.0264 96  ILE A C   
770  O O   . ILE A 96  ? 0.3167  0.3050 0.2860 0.0069  0.0120  -0.0233 96  ILE A O   
771  C CB  . ILE A 96  ? 0.2829  0.2926 0.2668 0.0345  0.0216  -0.0052 96  ILE A CB  
772  C CG1 . ILE A 96  ? 0.3356  0.2371 0.3242 0.0483  0.0035  -0.0663 96  ILE A CG1 
773  C CG2 . ILE A 96  ? 0.3036  0.3041 0.2751 0.0302  0.0424  -0.0218 96  ILE A CG2 
774  C CD1 . ILE A 96  ? 0.2662  0.2372 0.5077 -0.0207 -0.0091 -0.0232 96  ILE A CD1 
775  N N   . VAL A 97  ? 0.3055  0.2653 0.3179 0.0436  -0.0118 -0.0263 97  VAL A N   
776  C CA  . VAL A 97  ? 0.2318  0.2454 0.2559 -0.0160 -0.0114 -0.0109 97  VAL A CA  
777  C C   . VAL A 97  ? 0.2649  0.2969 0.2526 -0.0442 -0.0056 -0.0151 97  VAL A C   
778  O O   . VAL A 97  ? 0.2540  0.2801 0.2762 0.0146  -0.0411 -0.0082 97  VAL A O   
779  C CB  . VAL A 97  ? 0.3025  0.2455 0.2700 0.0106  -0.0224 -0.0108 97  VAL A CB  
780  C CG1 . VAL A 97  ? 0.3620  0.2222 0.3139 0.0196  -0.0340 -0.0795 97  VAL A CG1 
781  C CG2 . VAL A 97  ? 0.2840  0.3418 0.2522 0.0525  -0.0001 0.0098  97  VAL A CG2 
782  N N   . VAL A 98  ? 0.2777  0.2777 0.2718 -0.0056 0.0149  -0.0140 98  VAL A N   
783  C CA  . VAL A 98  ? 0.2427  0.2586 0.2838 0.0232  0.0195  -0.0138 98  VAL A CA  
784  C C   . VAL A 98  ? 0.2109  0.2444 0.3354 -0.0071 0.0199  -0.0150 98  VAL A C   
785  O O   . VAL A 98  ? 0.2231  0.3360 0.3457 0.0236  -0.0085 -0.0540 98  VAL A O   
786  C CB  . VAL A 98  ? 0.3351  0.2612 0.2669 0.0167  0.0057  -0.0048 98  VAL A CB  
787  C CG1 . VAL A 98  ? 0.4506  0.3212 0.2802 0.0066  0.0714  -0.0278 98  VAL A CG1 
788  C CG2 . VAL A 98  ? 0.3921  0.2571 0.2743 0.0251  0.0022  -0.0150 98  VAL A CG2 
789  N N   . THR A 99  ? 0.3151  0.2506 0.3202 0.0130  -0.0284 -0.0333 99  THR A N   
790  C CA  . THR A 99  ? 0.3544  0.2618 0.2941 0.0328  -0.0016 -0.0103 99  THR A CA  
791  C C   . THR A 99  ? 0.2839  0.3375 0.2935 0.0148  0.0115  -0.0201 99  THR A C   
792  O O   . THR A 99  ? 0.3610  0.3154 0.3116 0.0291  -0.0328 -0.0303 99  THR A O   
793  C CB  . THR A 99  ? 0.2764  0.2843 0.3370 0.0320  0.0008  0.0184  99  THR A CB  
794  O OG1 . THR A 99  ? 0.4129  0.2723 0.2925 -0.0067 -0.0588 -0.0066 99  THR A OG1 
795  C CG2 . THR A 99  ? 0.4712  0.3569 0.2598 0.0093  -0.0785 0.0280  99  THR A CG2 
796  N N   . PRO A 100 ? 0.3060  0.3221 0.3282 -0.0016 0.0121  -0.0514 100 PRO A N   
797  C CA  . PRO A 100 ? 0.3401  0.2985 0.3365 -0.0233 -0.0048 -0.0739 100 PRO A CA  
798  C C   . PRO A 100 ? 0.3297  0.3520 0.3404 -0.0486 -0.0431 0.0414  100 PRO A C   
799  O O   . PRO A 100 ? 0.3396  0.3530 0.3214 0.0127  -0.0466 0.0108  100 PRO A O   
800  C CB  . PRO A 100 ? 0.3427  0.3644 0.3281 0.0125  -0.0108 -0.0750 100 PRO A CB  
801  C CG  . PRO A 100 ? 0.3506  0.3563 0.3430 0.0265  0.0036  -0.1586 100 PRO A CG  
802  C CD  . PRO A 100 ? 0.3669  0.2778 0.3115 0.0509  0.0197  -0.0501 100 PRO A CD  
803  N N   . LEU A 101 ? 0.3318  0.2755 0.3179 0.0074  0.0033  -0.0333 101 LEU A N   
804  C CA  . LEU A 101 ? 0.3292  0.2834 0.4130 0.0127  0.0720  -0.0018 101 LEU A CA  
805  C C   . LEU A 101 ? 0.3243  0.2779 0.3535 0.0035  0.0082  -0.0241 101 LEU A C   
806  O O   . LEU A 101 ? 0.3650  0.3125 0.3644 0.0355  -0.0592 -0.0901 101 LEU A O   
807  C CB  . LEU A 101 ? 0.3196  0.2967 0.3375 0.0102  0.0105  -0.0257 101 LEU A CB  
808  C CG  . LEU A 101 ? 0.4000  0.2800 0.2743 0.0198  -0.0093 -0.0241 101 LEU A CG  
809  C CD1 . LEU A 101 ? 0.3540  0.3164 0.3452 -0.0421 -0.0030 0.0165  101 LEU A CD1 
810  C CD2 . LEU A 101 ? 0.4118  0.3518 0.3155 0.0493  -0.0548 -0.0667 101 LEU A CD2 
811  N N   . GLY A 102 ? 0.2964  0.3019 0.3024 0.0353  -0.0484 -0.0271 102 GLY A N   
812  C CA  . GLY A 102 ? 0.3408  0.3127 0.3101 0.0671  -0.0590 -0.0229 102 GLY A CA  
813  C C   . GLY A 102 ? 0.3459  0.2559 0.2814 0.0405  -0.0454 0.0174  102 GLY A C   
814  O O   . GLY A 102 ? 0.3327  0.3103 0.2672 0.0329  -0.0324 0.0046  102 GLY A O   
815  N N   . THR A 103 ? 0.3256  0.2725 0.2602 0.0213  -0.0459 -0.0024 103 THR A N   
816  C CA  . THR A 103 ? 0.2997  0.2855 0.2694 -0.0198 -0.0081 -0.0118 103 THR A CA  
817  C C   . THR A 103 ? 0.2845  0.3074 0.2697 -0.0136 -0.0196 0.0074  103 THR A C   
818  O O   . THR A 103 ? 0.2746  0.2607 0.3179 0.0019  -0.0271 -0.0120 103 THR A O   
819  C CB  . THR A 103 ? 0.3026  0.2749 0.2869 -0.0227 0.0017  -0.0164 103 THR A CB  
820  O OG1 . THR A 103 ? 0.3876  0.3974 0.2696 -0.0524 0.0511  0.0062  103 THR A OG1 
821  C CG2 . THR A 103 ? 0.2684  0.2909 0.3037 -0.0051 -0.0299 -0.0384 103 THR A CG2 
822  N N   . ARG A 104 ? 0.3354  0.2670 0.2680 -0.0336 -0.0006 -0.0193 104 ARG A N   
823  C CA  . ARG A 104 ? 0.2981  0.2458 0.2763 0.0211  -0.0089 -0.0208 104 ARG A CA  
824  C C   . ARG A 104 ? 0.2594  0.2591 0.3256 -0.0186 0.0209  -0.0486 104 ARG A C   
825  O O   . ARG A 104 ? 0.2698  0.2970 0.3243 -0.0266 -0.0054 -0.0370 104 ARG A O   
826  C CB  A ARG A 104 ? 0.3418  0.2480 0.2632 -0.0063 0.0184  -0.0277 104 ARG A CB  
827  C CB  B ARG A 104 ? 0.3470  0.2480 0.2637 -0.0067 0.0191  -0.0273 104 ARG A CB  
828  C CG  A ARG A 104 ? 0.3861  0.2625 0.3010 0.0054  -0.0359 -0.0433 104 ARG A CG  
829  C CG  B ARG A 104 ? 0.3916  0.2605 0.2945 0.0055  -0.0501 -0.0356 104 ARG A CG  
830  C CD  A ARG A 104 ? 0.3732  0.3929 0.3845 0.0081  -0.0425 -0.1113 104 ARG A CD  
831  C CD  B ARG A 104 ? 0.3656  0.3845 0.3945 0.0042  -0.0352 -0.1127 104 ARG A CD  
832  N NE  A ARG A 104 ? 0.3927  0.4225 0.5092 0.0111  -0.0913 -0.1788 104 ARG A NE  
833  N NE  B ARG A 104 ? 0.4457  0.4328 0.5191 -0.0148 -0.0990 -0.1877 104 ARG A NE  
834  C CZ  A ARG A 104 ? 0.5345  0.4692 0.5417 -0.0873 -0.2165 -0.1505 104 ARG A CZ  
835  C CZ  B ARG A 104 ? 0.4970  0.4649 0.5338 -0.0408 -0.1038 -0.2487 104 ARG A CZ  
836  N NH1 A ARG A 104 ? 0.6838  0.4977 0.5350 -0.0279 -0.3277 0.0260  104 ARG A NH1 
837  N NH1 B ARG A 104 ? 0.6338  0.5764 0.4404 -0.1511 -0.0841 -0.2915 104 ARG A NH1 
838  N NH2 A ARG A 104 ? 0.7859  0.4484 0.6838 -0.0215 -0.2511 -0.2205 104 ARG A NH2 
839  N NH2 B ARG A 104 ? 0.4229  0.4108 0.5901 0.0892  -0.2381 -0.2203 104 ARG A NH2 
840  N N   . LEU A 105 ? 0.2736  0.2989 0.2902 0.0019  0.0238  -0.0409 105 LEU A N   
841  C CA  . LEU A 105 ? 0.2623  0.2424 0.2784 0.0266  -0.0106 -0.0216 105 LEU A CA  
842  C C   . LEU A 105 ? 0.2491  0.2422 0.2964 0.0399  0.0007  -0.0202 105 LEU A C   
843  O O   . LEU A 105 ? 0.2869  0.2641 0.2798 0.0028  -0.0317 0.0074  105 LEU A O   
844  C CB  . LEU A 105 ? 0.3196  0.2577 0.3252 0.0703  -0.0030 -0.0187 105 LEU A CB  
845  C CG  . LEU A 105 ? 0.3109  0.2455 0.3352 0.0338  0.0420  -0.0122 105 LEU A CG  
846  C CD1 . LEU A 105 ? 0.3025  0.3147 0.3153 0.0290  0.0302  -0.0337 105 LEU A CD1 
847  C CD2 . LEU A 105 ? 0.3045  0.2867 0.3445 0.0458  0.0086  -0.0541 105 LEU A CD2 
848  N N   . CYS A 106 ? 0.3018  0.2831 0.2941 -0.0074 -0.0445 0.0011  106 CYS A N   
849  C CA  . CYS A 106 ? 0.2680  0.3098 0.2741 -0.0041 -0.0272 0.0131  106 CYS A CA  
850  C C   . CYS A 106 ? 0.2972  0.2794 0.2902 -0.0111 -0.0137 -0.0227 106 CYS A C   
851  O O   . CYS A 106 ? 0.3111  0.3214 0.2788 0.0503  -0.0154 0.0041  106 CYS A O   
852  C CB  . CYS A 106 ? 0.2803  0.2489 0.2924 -0.0120 -0.0296 -0.0239 106 CYS A CB  
853  S SG  . CYS A 106 ? 0.3331  0.3107 0.3038 0.0005  0.0067  -0.0207 106 CYS A SG  
854  N N   . ARG A 107 ? 0.3022  0.3100 0.2949 0.0154  -0.0068 -0.0312 107 ARG A N   
855  C CA  . ARG A 107 ? 0.3134  0.2536 0.3135 -0.0060 0.0105  -0.0374 107 ARG A CA  
856  C C   . ARG A 107 ? 0.3200  0.2576 0.3150 -0.0134 -0.0387 0.0043  107 ARG A C   
857  O O   . ARG A 107 ? 0.3326  0.3269 0.2760 -0.0232 -0.0222 0.0103  107 ARG A O   
858  C CB  . ARG A 107 ? 0.3588  0.2555 0.3331 0.0055  -0.0029 -0.0489 107 ARG A CB  
859  C CG  . ARG A 107 ? 0.3370  0.2431 0.3605 0.0147  -0.0015 -0.0205 107 ARG A CG  
860  C CD  . ARG A 107 ? 0.4042  0.2302 0.2759 0.0384  -0.0500 0.0188  107 ARG A CD  
861  N NE  . ARG A 107 ? 0.3715  0.3004 0.3215 -0.0024 -0.0074 -0.0519 107 ARG A NE  
862  C CZ  . ARG A 107 ? 0.3543  0.2905 0.2762 0.0372  0.0274  -0.0479 107 ARG A CZ  
863  N NH1 . ARG A 107 ? 0.3592  0.3083 0.2603 0.0099  0.0122  -0.0161 107 ARG A NH1 
864  N NH2 . ARG A 107 ? 0.4025  0.4296 0.3167 -0.0143 0.0644  -0.0036 107 ARG A NH2 
865  N N   . PRO A 108 ? 0.2793  0.2685 0.3682 0.0043  -0.0338 0.0233  108 PRO A N   
866  C CA  . PRO A 108 ? 0.2825  0.2286 0.3495 0.0365  -0.0259 -0.0064 108 PRO A CA  
867  C C   . PRO A 108 ? 0.2522  0.3390 0.3276 -0.0115 -0.0397 -0.0648 108 PRO A C   
868  O O   . PRO A 108 ? 0.3113  0.2718 0.3088 0.0089  -0.0270 -0.0208 108 PRO A O   
869  C CB  . PRO A 108 ? 0.3074  0.2591 0.2967 0.0072  -0.0342 -0.0191 108 PRO A CB  
870  C CG  . PRO A 108 ? 0.3392  0.2577 0.3163 -0.0016 -0.0893 0.0180  108 PRO A CG  
871  C CD  . PRO A 108 ? 0.3483  0.2845 0.3141 -0.0318 -0.0506 0.0506  108 PRO A CD  
872  N N   . SER A 109 ? 0.2722  0.2997 0.2980 0.0140  -0.0273 0.0304  109 SER A N   
873  C CA  . SER A 109 ? 0.2538  0.2635 0.3198 0.0111  -0.0491 0.0089  109 SER A CA  
874  C C   . SER A 109 ? 0.3277  0.2614 0.3137 -0.0114 -0.0099 0.0088  109 SER A C   
875  O O   . SER A 109 ? 0.3305  0.2732 0.3106 0.0083  -0.0115 0.0158  109 SER A O   
876  C CB  . SER A 109 ? 0.2872  0.2712 0.2928 0.0225  -0.0451 0.0451  109 SER A CB  
877  O OG  . SER A 109 ? 0.3340  0.2904 0.2781 -0.0029 0.0159  0.0203  109 SER A OG  
878  N N   . GLU A 110 ? 0.2641  0.2421 0.3265 0.0297  -0.0413 0.0344  110 GLU A N   
879  C CA  . GLU A 110 ? 0.3091  0.2383 0.3032 0.0227  -0.0129 0.0434  110 GLU A CA  
880  C C   . GLU A 110 ? 0.3116  0.2206 0.3101 -0.0099 -0.0133 0.0505  110 GLU A C   
881  O O   . GLU A 110 ? 0.2719  0.2774 0.3367 -0.0051 -0.0160 0.0013  110 GLU A O   
882  C CB  . GLU A 110 ? 0.3695  0.2680 0.2632 -0.0472 -0.0471 0.0177  110 GLU A CB  
883  C CG  . GLU A 110 ? 0.3704  0.2650 0.3243 -0.0588 -0.0108 0.0037  110 GLU A CG  
884  C CD  . GLU A 110 ? 0.3984  0.3092 0.2744 -0.0799 0.0074  0.0409  110 GLU A CD  
885  O OE1 . GLU A 110 ? 0.3744  0.2997 0.3523 -0.0669 0.0048  -0.0062 110 GLU A OE1 
886  O OE2 . GLU A 110 ? 0.2691  0.3023 0.2832 0.0349  -0.0124 -0.0069 110 GLU A OE2 
887  N N   . VAL A 111 ? 0.3245  0.2609 0.2931 0.0138  0.0064  0.0749  111 VAL A N   
888  C CA  . VAL A 111 ? 0.2621  0.2635 0.2903 0.0180  -0.0239 0.0176  111 VAL A CA  
889  C C   . VAL A 111 ? 0.2575  0.2711 0.2530 0.0231  -0.0523 0.0010  111 VAL A C   
890  O O   . VAL A 111 ? 0.3073  0.3653 0.2360 -0.0288 -0.0398 -0.0055 111 VAL A O   
891  C CB  . VAL A 111 ? 0.2563  0.2926 0.2799 0.0354  -0.0390 0.0371  111 VAL A CB  
892  C CG1 . VAL A 111 ? 0.4021  0.3018 0.2777 0.0013  -0.0444 0.0390  111 VAL A CG1 
893  C CG2 . VAL A 111 ? 0.2855  0.3227 0.3384 0.0423  0.0040  -0.0735 111 VAL A CG2 
894  N N   . VAL A 112 ? 0.2557  0.2540 0.2634 0.0287  -0.0500 -0.0110 112 VAL A N   
895  C CA  . VAL A 112 ? 0.2621  0.2496 0.3735 0.0244  -0.0043 -0.0066 112 VAL A CA  
896  C C   . VAL A 112 ? 0.3128  0.2467 0.2720 0.0453  -0.0061 0.0252  112 VAL A C   
897  O O   . VAL A 112 ? 0.3349  0.2425 0.2785 -0.0221 0.0053  -0.0144 112 VAL A O   
898  C CB  . VAL A 112 ? 0.2708  0.2679 0.3093 -0.0125 0.0246  0.0171  112 VAL A CB  
899  C CG1 . VAL A 112 ? 0.3875  0.2067 0.3327 -0.0773 -0.0370 0.0086  112 VAL A CG1 
900  C CG2 . VAL A 112 ? 0.2626  0.3906 0.2356 -0.0115 0.0080  0.0108  112 VAL A CG2 
901  N N   . LEU A 113 ? 0.2569  0.2501 0.2941 0.0125  -0.0114 -0.0002 113 LEU A N   
902  C CA  . LEU A 113 ? 0.2649  0.2529 0.3010 0.0260  -0.0009 -0.0024 113 LEU A CA  
903  C C   . LEU A 113 ? 0.2138  0.2652 0.2983 0.0142  0.0270  -0.0147 113 LEU A C   
904  O O   . LEU A 113 ? 0.2677  0.3011 0.3181 0.0598  0.0059  -0.0356 113 LEU A O   
905  C CB  . LEU A 113 ? 0.2478  0.2499 0.2969 0.0092  -0.0463 -0.0033 113 LEU A CB  
906  C CG  . LEU A 113 ? 0.2710  0.2957 0.2780 0.0175  -0.0333 -0.0258 113 LEU A CG  
907  C CD1 . LEU A 113 ? 0.3756  0.3098 0.2740 0.0091  0.0026  -0.0284 113 LEU A CD1 
908  C CD2 . LEU A 113 ? 0.2838  0.3365 0.3128 0.0335  -0.0783 -0.0213 113 LEU A CD2 
909  N N   . ASP A 114 ? 0.2147  0.2697 0.3296 0.0190  0.0008  -0.0173 114 ASP A N   
910  C CA  . ASP A 114 ? 0.2700  0.2576 0.3458 0.0337  -0.0312 -0.0485 114 ASP A CA  
911  C C   . ASP A 114 ? 0.2213  0.4257 0.2791 -0.0223 -0.1066 -0.0218 114 ASP A C   
912  O O   . ASP A 114 ? 0.3138  0.3443 0.2908 -0.0218 -0.0772 -0.0162 114 ASP A O   
913  C CB  . ASP A 114 ? 0.3034  0.2928 0.3412 0.0501  -0.0341 -0.0269 114 ASP A CB  
914  C CG  . ASP A 114 ? 0.3201  0.2447 0.4402 0.1093  0.0617  -0.0701 114 ASP A CG  
915  O OD1 . ASP A 114 ? 0.3089  0.4623 0.5350 0.1053  -0.0327 -0.0159 114 ASP A OD1 
916  O OD2 . ASP A 114 ? 0.3350  0.3608 0.4055 0.0297  0.0226  -0.0124 114 ASP A OD2 
917  N N   . ILE A 115 ? 0.2844  0.2804 0.2683 0.0296  -0.0413 -0.0331 115 ILE A N   
918  C CA  . ILE A 115 ? 0.3350  0.2421 0.3301 0.0199  -0.0036 -0.0365 115 ILE A CA  
919  C C   . ILE A 115 ? 0.3254  0.2235 0.3265 0.0039  0.0080  0.0046  115 ILE A C   
920  O O   . ILE A 115 ? 0.3284  0.3321 0.2559 0.0003  -0.0196 -0.0144 115 ILE A O   
921  C CB  . ILE A 115 ? 0.2990  0.2307 0.3628 -0.0061 -0.0532 -0.0625 115 ILE A CB  
922  C CG1 . ILE A 115 ? 0.2918  0.2370 0.3402 0.0246  -0.0341 -0.0485 115 ILE A CG1 
923  C CG2 . ILE A 115 ? 0.2921  0.2952 0.3090 0.0055  -0.0176 -0.0186 115 ILE A CG2 
924  C CD1 . ILE A 115 ? 0.4072  0.2322 0.2773 0.0072  -0.0186 -0.0390 115 ILE A CD1 
925  N N   . LEU A 116 ? 0.3329  0.2678 0.3010 -0.0044 0.0006  -0.0069 116 LEU A N   
926  C CA  . LEU A 116 ? 0.3416  0.2778 0.2536 0.0136  -0.0035 -0.0228 116 LEU A CA  
927  C C   . LEU A 116 ? 0.2179  0.3484 0.2510 -0.0231 -0.0438 -0.0757 116 LEU A C   
928  O O   . LEU A 116 ? 0.3232  0.3111 0.2985 -0.0378 -0.0471 -0.0241 116 LEU A O   
929  C CB  . LEU A 116 ? 0.3092  0.2748 0.2402 0.0091  0.0266  -0.0402 116 LEU A CB  
930  C CG  . LEU A 116 ? 0.2130  0.2585 0.2483 0.0115  -0.0289 -0.0221 116 LEU A CG  
931  C CD1 . LEU A 116 ? 0.2281  0.3715 0.2366 0.0245  -0.0272 -0.0277 116 LEU A CD1 
932  C CD2 . LEU A 116 ? 0.2407  0.3310 0.2918 -0.0356 -0.0295 -0.0210 116 LEU A CD2 
933  N N   . GLN A 117 ? 0.3191  0.3371 0.2648 0.0226  0.0196  -0.0184 117 GLN A N   
934  C CA  . GLN A 117 ? 0.3191  0.3511 0.2605 0.0533  0.0134  -0.0178 117 GLN A CA  
935  C C   . GLN A 117 ? 0.4252  0.3294 0.2621 0.0328  -0.0337 -0.0289 117 GLN A C   
936  O O   . GLN A 117 ? 0.3339  0.3405 0.3325 0.0284  -0.0254 -0.0310 117 GLN A O   
937  C CB  . GLN A 117 ? 0.3009  0.3420 0.2941 0.0515  0.0223  -0.0266 117 GLN A CB  
938  C CG  . GLN A 117 ? 0.3902  0.2921 0.3205 0.0238  0.0132  -0.0088 117 GLN A CG  
939  C CD  . GLN A 117 ? 0.4397  0.3116 0.3338 -0.0091 0.0479  -0.0417 117 GLN A CD  
940  O OE1 . GLN A 117 ? 0.4475  0.3848 0.3816 -0.0479 -0.0429 0.0241  117 GLN A OE1 
941  N NE2 . GLN A 117 ? 0.4621  0.3858 0.3509 0.0600  0.0927  -0.0706 117 GLN A NE2 
942  N N   . ASP A 118 ? 0.3052  0.3161 0.2939 0.0369  -0.0028 -0.0158 118 ASP A N   
943  C CA  . ASP A 118 ? 0.2928  0.3353 0.3123 0.0127  0.0063  0.0258  118 ASP A CA  
944  C C   . ASP A 118 ? 0.3322  0.3147 0.2881 -0.0403 0.0066  -0.0237 118 ASP A C   
945  O O   . ASP A 118 ? 0.2541  0.3354 0.3151 -0.0046 -0.0343 -0.0278 118 ASP A O   
946  C CB  . ASP A 118 ? 0.2811  0.4392 0.3434 0.0532  0.0041  -0.0292 118 ASP A CB  
947  C CG  . ASP A 118 ? 0.2930  0.4993 0.3570 -0.0363 0.0220  -0.0731 118 ASP A CG  
948  O OD1 . ASP A 118 ? 0.3393  0.4289 0.3668 -0.0310 0.0335  -0.0759 118 ASP A OD1 
949  O OD2 . ASP A 118 ? 0.3647  0.4326 0.3853 -0.0432 0.0005  -0.0602 118 ASP A OD2 
950  N N   . ALA A 119 ? 0.2781  0.3235 0.3171 -0.0214 0.0175  -0.0041 119 ALA A N   
951  C CA  . ALA A 119 ? 0.2709  0.3054 0.2923 -0.0279 -0.0032 -0.0210 119 ALA A CA  
952  C C   . ALA A 119 ? 0.2575  0.2413 0.3152 0.0274  -0.0150 -0.0494 119 ALA A C   
953  O O   . ALA A 119 ? 0.2591  0.3640 0.3235 -0.0119 -0.0138 -0.0181 119 ALA A O   
954  C CB  . ALA A 119 ? 0.3006  0.3319 0.3448 -0.1198 -0.0034 -0.0355 119 ALA A CB  
955  N N   . GLN A 120 ? 0.2729  0.2833 0.2973 0.0466  -0.0202 -0.0287 120 GLN A N   
956  C CA  . GLN A 120 ? 0.2820  0.3158 0.3016 0.0338  -0.0215 -0.0283 120 GLN A CA  
957  C C   . GLN A 120 ? 0.3181  0.3134 0.3083 0.0534  -0.0468 -0.0338 120 GLN A C   
958  O O   . GLN A 120 ? 0.3010  0.3136 0.3180 0.0307  0.0057  -0.0116 120 GLN A O   
959  C CB  . GLN A 120 ? 0.3456  0.2691 0.3077 0.0206  0.0187  -0.0483 120 GLN A CB  
960  C CG  . GLN A 120 ? 0.3054  0.2665 0.3349 -0.0038 0.0360  -0.0496 120 GLN A CG  
961  C CD  . GLN A 120 ? 0.3246  0.2501 0.3220 -0.0067 -0.0379 0.0007  120 GLN A CD  
962  O OE1 . GLN A 120 ? 0.2762  0.2937 0.3232 0.0096  -0.0054 -0.0336 120 GLN A OE1 
963  N NE2 . GLN A 120 ? 0.2224  0.2945 0.3462 0.0393  -0.0029 0.0295  120 GLN A NE2 
964  N N   . LYS A 121 ? 0.3096  0.2939 0.2938 0.0529  -0.0228 -0.0229 121 LYS A N   
965  C CA  . LYS A 121 ? 0.2732  0.3117 0.3239 0.0275  -0.0073 0.0202  121 LYS A CA  
966  C C   . LYS A 121 ? 0.3266  0.2471 0.3622 0.0355  0.0230  0.0161  121 LYS A C   
967  O O   . LYS A 121 ? 0.5117  0.2890 0.4162 0.1256  0.0129  0.0320  121 LYS A O   
968  C CB  . LYS A 121 ? 0.3038  0.3138 0.3501 -0.0075 -0.0165 0.0205  121 LYS A CB  
969  C CG  . LYS A 121 ? 0.3705  0.4084 0.4055 -0.0615 -0.0524 0.1523  121 LYS A CG  
970  C CD  . LYS A 121 ? 0.2983  0.5216 0.4737 -0.0806 0.0349  0.0453  121 LYS A CD  
971  C CE  . LYS A 121 ? 0.3265  0.7110 0.5912 -0.0538 -0.0295 0.0432  121 LYS A CE  
972  N NZ  . LYS A 121 ? 0.2634  0.6593 0.7926 0.0026  0.0154  -0.0095 121 LYS A NZ  
973  N N   . GLY A 122 ? 0.3127  0.3244 0.3594 0.0079  0.0380  0.0101  122 GLY A N   
974  C CA  . GLY A 122 ? 0.3186  0.3302 0.3738 0.0606  0.0328  0.0422  122 GLY A CA  
975  C C   . GLY A 122 ? 0.2803  0.2808 0.3049 0.0216  -0.0084 -0.0055 122 GLY A C   
976  O O   . GLY A 122 ? 0.3094  0.3831 0.3091 0.0770  -0.0123 0.0212  122 GLY A O   
977  N N   . ALA A 123 ? 0.3193  0.2850 0.2939 0.0179  -0.0138 -0.0165 123 ALA A N   
978  C CA  . ALA A 123 ? 0.3855  0.2376 0.3067 0.0490  0.0490  0.0712  123 ALA A CA  
979  C C   . ALA A 123 ? 0.3395  0.2450 0.3630 0.0391  -0.0123 0.0464  123 ALA A C   
980  O O   . ALA A 123 ? 0.3204  0.3084 0.3275 0.0315  0.0398  -0.0150 123 ALA A O   
981  C CB  . ALA A 123 ? 0.4942  0.3115 0.2866 -0.0268 0.0265  0.0703  123 ALA A CB  
982  N N   . PHE A 124 ? 0.3331  0.2408 0.3396 0.0383  -0.0043 0.0137  124 PHE A N   
983  C CA  . PHE A 124 ? 0.2887  0.2389 0.3080 0.0138  -0.0044 0.0095  124 PHE A CA  
984  C C   . PHE A 124 ? 0.3270  0.2532 0.3269 -0.0539 0.0359  -0.0468 124 PHE A C   
985  O O   . PHE A 124 ? 0.2847  0.2695 0.3323 0.0050  -0.0026 -0.0428 124 PHE A O   
986  C CB  . PHE A 124 ? 0.3121  0.2312 0.2914 0.0403  -0.0180 -0.0139 124 PHE A CB  
987  C CG  . PHE A 124 ? 0.3061  0.2385 0.2053 0.0247  0.0120  -0.0075 124 PHE A CG  
988  C CD1 . PHE A 124 ? 0.3272  0.2267 0.3649 0.0325  0.0045  -0.0375 124 PHE A CD1 
989  C CD2 . PHE A 124 ? 0.3332  0.2329 0.2814 0.0080  0.0265  0.0824  124 PHE A CD2 
990  C CE1 . PHE A 124 ? 0.3629  0.1933 0.3092 0.0082  0.0382  0.0146  124 PHE A CE1 
991  C CE2 . PHE A 124 ? 0.3249  0.2333 0.3680 0.0140  -0.0371 0.0801  124 PHE A CE2 
992  C CZ  . PHE A 124 ? 0.3284  0.2353 0.3704 0.0200  -0.0605 0.0402  124 PHE A CZ  
993  N N   . THR A 125 ? 0.3052  0.2539 0.2636 0.0112  -0.0369 0.0207  125 THR A N   
994  C CA  . THR A 125 ? 0.3986  0.2562 0.2450 -0.0239 -0.0080 -0.0074 125 THR A CA  
995  C C   . THR A 125 ? 0.3022  0.2532 0.2728 -0.0171 -0.0113 0.0084  125 THR A C   
996  O O   . THR A 125 ? 0.2856  0.2784 0.2638 -0.0127 0.0163  -0.0185 125 THR A O   
997  C CB  . THR A 125 ? 0.3681  0.2823 0.2826 -0.0176 0.0043  0.0391  125 THR A CB  
998  O OG1 . THR A 125 ? 0.3031  0.2951 0.2846 -0.0140 -0.0065 0.0262  125 THR A OG1 
999  C CG2 . THR A 125 ? 0.3957  0.2494 0.2812 -0.0844 0.0441  0.0324  125 THR A CG2 
1000 N N   . LYS A 126 ? 0.2759  0.2618 0.3026 -0.0356 -0.0111 -0.0102 126 LYS A N   
1001 C CA  . LYS A 126 ? 0.2223  0.2708 0.2950 -0.0178 -0.0546 -0.0055 126 LYS A CA  
1002 C C   . LYS A 126 ? 0.2392  0.2260 0.3076 0.0849  -0.0855 -0.0189 126 LYS A C   
1003 O O   . LYS A 126 ? 0.2882  0.2599 0.3016 0.0428  -0.0639 0.0041  126 LYS A O   
1004 C CB  . LYS A 126 ? 0.2126  0.3121 0.2916 -0.0194 -0.0681 -0.0335 126 LYS A CB  
1005 C CG  . LYS A 126 ? 0.2286  0.3736 0.2894 -0.0041 -0.0624 -0.0360 126 LYS A CG  
1006 C CD  . LYS A 126 ? 0.2344  0.3863 0.3220 0.0032  -0.0757 0.0489  126 LYS A CD  
1007 C CE  . LYS A 126 ? 0.2125  0.3816 0.3506 -0.0397 -0.0675 0.0161  126 LYS A CE  
1008 N NZ  . LYS A 126 ? 0.2302  0.3771 0.2639 -0.0172 -0.0615 0.0097  126 LYS A NZ  
1009 N N   . GLU A 127 ? 0.3324  0.2588 0.2606 -0.0081 -0.0230 -0.0230 127 GLU A N   
1010 C CA  . GLU A 127 ? 0.3104  0.2737 0.2846 0.0080  -0.0212 -0.0442 127 GLU A CA  
1011 C C   . GLU A 127 ? 0.3150  0.2805 0.2829 0.0447  -0.0151 -0.0864 127 GLU A C   
1012 O O   . GLU A 127 ? 0.2892  0.3855 0.2894 0.0044  -0.0050 -0.0401 127 GLU A O   
1013 C CB  . GLU A 127 ? 0.4036  0.2867 0.3407 -0.0365 -0.1338 0.0194  127 GLU A CB  
1014 C CG  . GLU A 127 ? 0.3849  0.2922 0.3164 -0.0045 -0.0777 -0.0257 127 GLU A CG  
1015 C CD  . GLU A 127 ? 0.3478  0.2852 0.2871 0.0087  -0.0991 -0.0121 127 GLU A CD  
1016 O OE1 . GLU A 127 ? 0.3491  0.3129 0.3334 0.0201  -0.0641 0.0315  127 GLU A OE1 
1017 O OE2 . GLU A 127 ? 0.3429  0.2963 0.3388 0.0185  -0.0963 -0.0006 127 GLU A OE2 
1018 N N   . ASP A 128 ? 0.3170  0.3018 0.2731 0.0318  -0.0178 0.0099  128 ASP A N   
1019 C CA  . ASP A 128 ? 0.3304  0.3062 0.2938 0.0171  -0.0048 0.0160  128 ASP A CA  
1020 C C   . ASP A 128 ? 0.2643  0.2997 0.3135 0.0120  -0.0269 -0.0018 128 ASP A C   
1021 O O   . ASP A 128 ? 0.3759  0.2853 0.4070 -0.0411 0.0759  -0.0616 128 ASP A O   
1022 C CB  . ASP A 128 ? 0.3316  0.3125 0.2958 0.0236  0.0098  0.0318  128 ASP A CB  
1023 C CG  . ASP A 128 ? 0.3262  0.3723 0.3301 0.0408  -0.0090 0.0029  128 ASP A CG  
1024 O OD1 . ASP A 128 ? 0.2987  0.3239 0.3548 0.0163  -0.0280 0.0100  128 ASP A OD1 
1025 O OD2 . ASP A 128 ? 0.3000  0.4595 0.4065 0.0347  0.0152  -0.0556 128 ASP A OD2 
1026 N N   . GLY A 129 ? 0.3161  0.3163 0.2582 0.0105  -0.0247 -0.0147 129 GLY A N   
1027 C CA  . GLY A 129 ? 0.3569  0.3143 0.2986 0.0115  0.0116  -0.0391 129 GLY A CA  
1028 C C   . GLY A 129 ? 0.4200  0.3228 0.3242 -0.0461 -0.0300 0.0172  129 GLY A C   
1029 O O   . GLY A 129 ? 0.3371  0.3121 0.3368 -0.0140 0.0035  0.0086  129 GLY A O   
1030 N N   . GLU A 130 ? 0.3377  0.3078 0.3129 0.0077  0.0156  -0.0141 130 GLU A N   
1031 C CA  . GLU A 130 ? 0.2507  0.3076 0.3274 0.0079  0.0402  -0.0023 130 GLU A CA  
1032 C C   . GLU A 130 ? 0.2652  0.3115 0.3034 -0.0081 0.0253  -0.0138 130 GLU A C   
1033 O O   . GLU A 130 ? 0.2385  0.3220 0.3039 0.0055  0.0253  -0.0223 130 GLU A O   
1034 C CB  A GLU A 130 ? 0.2160  0.4678 0.3720 0.0616  0.0747  0.0647  130 GLU A CB  
1035 C CB  B GLU A 130 ? 0.2172  0.4774 0.4254 0.0615  0.0541  0.0809  130 GLU A CB  
1036 C CG  A GLU A 130 ? 0.2649  0.5442 0.3431 0.0970  0.0451  0.0457  130 GLU A CG  
1037 C CG  B GLU A 130 ? 0.2810  0.5345 0.4963 0.1508  0.0315  0.0715  130 GLU A CG  
1038 C CD  A GLU A 130 ? 0.2164  0.6519 0.4502 0.1711  0.0537  0.1105  130 GLU A CD  
1039 C CD  B GLU A 130 ? 0.3605  0.5789 0.7054 0.1703  -0.1116 0.1110  130 GLU A CD  
1040 O OE1 A GLU A 130 ? 0.3925  0.5599 0.7435 0.0682  -0.1729 0.1165  130 GLU A OE1 
1041 O OE1 B GLU A 130 ? 0.4491  0.5068 0.7627 0.1011  -0.2604 0.1552  130 GLU A OE1 
1042 O OE2 A GLU A 130 ? 0.4265  0.6595 0.4910 -0.0236 -0.1079 0.2008  130 GLU A OE2 
1043 O OE2 B GLU A 130 ? 0.1874  0.5461 0.7414 0.1103  -0.0811 0.1301  130 GLU A OE2 
1044 N N   . LYS A 131 ? 0.3216  0.2984 0.3169 0.0017  0.0336  -0.0052 131 LYS A N   
1045 C CA  . LYS A 131 ? 0.3046  0.3072 0.3038 0.0233  0.0277  0.0100  131 LYS A CA  
1046 C C   . LYS A 131 ? 0.2737  0.3759 0.3105 -0.0157 -0.0013 -0.0072 131 LYS A C   
1047 O O   . LYS A 131 ? 0.2767  0.4915 0.4115 -0.0416 -0.0324 -0.0573 131 LYS A O   
1048 C CB  A LYS A 131 ? 0.3236  0.2978 0.3728 0.0158  0.0386  -0.0008 131 LYS A CB  
1049 C CB  B LYS A 131 ? 0.3179  0.2975 0.3744 0.0165  0.0390  0.0039  131 LYS A CB  
1050 C CG  A LYS A 131 ? 0.4082  0.2707 0.3963 0.0694  0.0202  0.0312  131 LYS A CG  
1051 C CG  B LYS A 131 ? 0.4048  0.2667 0.4075 0.0825  0.0039  0.0256  131 LYS A CG  
1052 C CD  A LYS A 131 ? 0.5256  0.2664 0.4205 0.0520  0.0308  0.0101  131 LYS A CD  
1053 C CD  B LYS A 131 ? 0.4988  0.2673 0.4111 0.0653  0.0185  0.0104  131 LYS A CD  
1054 C CE  A LYS A 131 ? 0.5872  0.2712 0.4868 0.1003  -0.0110 0.0661  131 LYS A CE  
1055 C CE  B LYS A 131 ? 0.5548  0.3081 0.4232 0.1041  0.0060  0.0486  131 LYS A CE  
1056 N NZ  A LYS A 131 ? 0.9883  0.5127 0.4548 -0.0038 -0.0444 -0.0551 131 LYS A NZ  
1057 N NZ  B LYS A 131 ? 0.5379  0.3543 0.5406 0.1618  0.0354  0.1121  131 LYS A NZ  
1058 N N   . VAL A 132 ? 0.3196  0.3269 0.2876 -0.0036 0.0024  0.0079  132 VAL A N   
1059 C CA  . VAL A 132 ? 0.3696  0.2824 0.3056 -0.0091 -0.0334 0.0125  132 VAL A CA  
1060 C C   . VAL A 132 ? 0.3390  0.2822 0.2903 0.0142  -0.0551 0.0219  132 VAL A C   
1061 O O   . VAL A 132 ? 0.2839  0.3493 0.3286 -0.0010 0.0028  -0.0459 132 VAL A O   
1062 C CB  . VAL A 132 ? 0.4495  0.3121 0.2775 -0.0661 -0.0864 0.0237  132 VAL A CB  
1063 C CG1 . VAL A 132 ? 0.2852  0.4047 0.2994 -0.0063 -0.0895 0.0500  132 VAL A CG1 
1064 C CG2 . VAL A 132 ? 0.3360  0.3105 0.3604 -0.0743 -0.0722 0.0028  132 VAL A CG2 
1065 N N   . VAL A 133 ? 0.3162  0.2967 0.2986 -0.0113 -0.0631 0.0145  133 VAL A N   
1066 C CA  . VAL A 133 ? 0.3067  0.3069 0.2968 0.0077  -0.0274 0.0182  133 VAL A CA  
1067 C C   . VAL A 133 ? 0.2456  0.3056 0.3045 -0.0057 -0.0213 0.0096  133 VAL A C   
1068 O O   . VAL A 133 ? 0.2653  0.3279 0.3283 -0.0021 -0.0349 -0.0139 133 VAL A O   
1069 C CB  . VAL A 133 ? 0.4462  0.3697 0.3047 -0.0167 0.0117  0.0323  133 VAL A CB  
1070 C CG1 . VAL A 133 ? 0.4860  0.6330 0.3058 0.0032  -0.0314 0.0896  133 VAL A CG1 
1071 C CG2 . VAL A 133 ? 0.4028  0.3584 0.3570 0.0012  0.0292  0.1499  133 VAL A CG2 
1072 N N   . ASP A 134 ? 0.3748  0.3001 0.2881 -0.0133 -0.0567 0.0131  134 ASP A N   
1073 C CA  . ASP A 134 ? 0.3247  0.3153 0.3144 -0.0369 -0.0435 0.0492  134 ASP A CA  
1074 C C   . ASP A 134 ? 0.2984  0.3273 0.3261 -0.0660 -0.0609 0.0473  134 ASP A C   
1075 O O   . ASP A 134 ? 0.4128  0.3658 0.2854 -0.0176 -0.0101 0.0071  134 ASP A O   
1076 C CB  . ASP A 134 ? 0.3057  0.3549 0.3088 -0.0518 -0.0479 0.0553  134 ASP A CB  
1077 C CG  . ASP A 134 ? 0.4688  0.3509 0.3882 -0.0877 -0.0612 0.0144  134 ASP A CG  
1078 O OD1 . ASP A 134 ? 0.4763  0.3742 0.4773 -0.1046 -0.0660 -0.0093 134 ASP A OD1 
1079 O OD2 . ASP A 134 ? 0.5128  0.2965 0.3700 -0.0388 -0.0532 -0.0104 134 ASP A OD2 
1080 N N   . GLU A 135 ? 0.3743  0.3015 0.3935 -0.0015 -0.0461 0.0309  135 GLU A N   
1081 C CA  . GLU A 135 ? 0.3899  0.3878 0.4004 0.0317  -0.0600 -0.0259 135 GLU A CA  
1082 C C   . GLU A 135 ? 0.4179  0.4189 0.3900 0.0052  -0.0476 -0.0155 135 GLU A C   
1083 O O   . GLU A 135 ? 0.4335  0.5501 0.4734 0.0133  -0.0013 -0.1262 135 GLU A O   
1084 C CB  . GLU A 135 ? 0.4380  0.3961 0.4277 0.0830  -0.1061 -0.0538 135 GLU A CB  
1085 C CG  . GLU A 135 ? 0.4136  0.4675 0.7895 0.0637  -0.1145 -0.0093 135 GLU A CG  
1086 C CD  . GLU A 135 ? 0.5322  0.4645 0.8216 0.0679  0.1149  -0.0515 135 GLU A CD  
1087 O OE1 . GLU A 135 ? 0.5406  0.5053 0.9119 0.1765  0.1343  -0.0515 135 GLU A OE1 
1088 O OE2 . GLU A 135 ? 0.5015  0.4286 0.4352 0.0833  -0.0215 0.0612  135 GLU A OE2 
1089 N N   . ALA A 136 ? 0.4024  0.3106 0.4523 0.0536  -0.0863 -0.0312 136 ALA A N   
1090 C CA  . ALA A 136 ? 0.4171  0.3549 0.4774 0.0993  -0.0751 -0.0720 136 ALA A CA  
1091 C C   . ALA A 136 ? 0.5418  0.4084 0.4167 0.0908  -0.0370 -0.0471 136 ALA A C   
1092 O O   . ALA A 136 ? 0.4298  0.5373 0.4625 0.1330  -0.0966 -0.1257 136 ALA A O   
1093 C CB  . ALA A 136 ? 0.7635  0.3412 0.5074 -0.0406 -0.0748 -0.1080 136 ALA A CB  
1094 N N   . GLY A 137 ? 0.3893  0.3875 0.3886 0.0708  -0.0312 -0.0046 137 GLY A N   
1095 C CA  . GLY A 137 ? 0.3438  0.4355 0.3289 0.0490  -0.0086 0.0017  137 GLY A CA  
1096 C C   . GLY A 137 ? 0.3356  0.3615 0.3262 0.0384  0.0078  -0.0011 137 GLY A C   
1097 O O   . GLY A 137 ? 0.3294  0.4190 0.3901 0.0071  -0.0151 0.0640  137 GLY A O   
1098 N N   . LYS A 138 ? 0.3760  0.3176 0.2920 -0.0427 -0.0359 -0.0418 138 LYS A N   
1099 C CA  . LYS A 138 ? 0.3624  0.3418 0.3817 -0.0724 -0.0172 -0.0680 138 LYS A CA  
1100 C C   . LYS A 138 ? 0.3568  0.3436 0.3156 -0.0449 -0.0236 -0.0241 138 LYS A C   
1101 O O   . LYS A 138 ? 0.3037  0.3486 0.3651 -0.0207 -0.0576 -0.0594 138 LYS A O   
1102 C CB  . LYS A 138 ? 0.4215  0.3473 0.5219 -0.0503 0.0999  -0.0594 138 LYS A CB  
1103 C CG  . LYS A 138 ? 0.4144  0.3996 0.5262 -0.0749 0.0571  0.0558  138 LYS A CG  
1104 C CD  . LYS A 138 ? 0.4590  0.5555 0.6072 -0.1295 -0.0283 0.2217  138 LYS A CD  
1105 C CE  . LYS A 138 ? 1.0978  0.8755 0.6164 -0.4834 0.0906  0.1876  138 LYS A CE  
1106 N NZ  . LYS A 138 ? 1.1340  1.0190 0.6191 -0.3126 -0.1133 0.3484  138 LYS A NZ  
1107 N N   . ARG A 139 ? 0.3677  0.4000 0.3025 -0.0206 -0.0250 -0.0155 139 ARG A N   
1108 C CA  . ARG A 139 ? 0.2812  0.4763 0.4239 -0.0030 -0.0061 -0.0651 139 ARG A CA  
1109 C C   . ARG A 139 ? 0.3144  0.4741 0.4437 -0.0603 0.0180  -0.0942 139 ARG A C   
1110 O O   . ARG A 139 ? 0.3592  0.5750 0.5760 -0.1348 0.0597  -0.1743 139 ARG A O   
1111 C CB  . ARG A 139 ? 0.4988  0.4032 0.4677 0.0407  -0.1084 -0.0937 139 ARG A CB  
1112 C CG  . ARG A 139 ? 0.5926  0.5060 0.4154 -0.0627 -0.1514 -0.0706 139 ARG A CG  
1113 C CD  . ARG A 139 ? 0.7073  0.3857 0.4021 0.0215  -0.1039 -0.0460 139 ARG A CD  
1114 N NE  . ARG A 139 ? 0.6192  0.5455 0.5512 0.0172  -0.1234 -0.0721 139 ARG A NE  
1115 C CZ  . ARG A 139 ? 0.5964  0.4851 0.5557 0.0645  -0.1519 -0.0867 139 ARG A CZ  
1116 N NH1 . ARG A 139 ? 0.3742  0.6328 0.5648 -0.0803 -0.0181 0.1221  139 ARG A NH1 
1117 N NH2 . ARG A 139 ? 0.5318  0.4232 0.7059 -0.0079 -0.0116 0.1551  139 ARG A NH2 
1118 N N   . LEU A 140 ? 0.3467  0.5099 0.4356 -0.0573 0.0214  -0.0985 140 LEU A N   
1119 C CA  . LEU A 140 ? 0.4650  0.5487 0.5548 0.0166  0.1766  -0.0855 140 LEU A CA  
1120 C C   . LEU A 140 ? 0.4389  0.6341 0.6598 0.0182  0.1593  -0.0084 140 LEU A C   
1121 O O   . LEU A 140 ? 0.5761  0.6741 0.6440 0.0621  0.0424  -0.0011 140 LEU A O   
1122 C CB  . LEU A 140 ? 0.5020  0.6439 0.4742 0.0086  0.1679  0.0746  140 LEU A CB  
1123 C CG  . LEU A 140 ? 0.5837  0.5053 0.4401 0.0703  0.1325  -0.1281 140 LEU A CG  
1124 C CD1 . LEU A 140 ? 1.0218  0.5540 0.6715 0.0424  -0.3173 -0.1476 140 LEU A CD1 
1125 C CD2 . LEU A 140 ? 0.8159  0.6800 0.8420 -0.0162 0.0302  -0.4238 140 LEU A CD2 
1155 O O   . HOH P .   ? 0.3298  0.3872 0.3069 0.0077  -0.0076 -0.0122 612 HOH A O   
1156 O O   . HOH P .   ? 0.2661  0.2946 0.2962 0.0024  -0.0299 -0.0267 613 HOH A O   
1157 O O   . HOH P .   ? 0.2821  0.2797 0.2639 0.0116  0.0171  -0.0070 614 HOH A O   
1158 O O   . HOH P .   ? 0.2855  0.3529 0.3592 0.0321  0.0024  0.0049  615 HOH A O   
1159 O O   . HOH P .   ? 0.3305  0.2979 0.2915 0.0355  -0.0158 -0.0274 616 HOH A O   
1160 O O   . HOH P .   ? 0.2768  0.3150 0.3051 0.0399  -0.0339 0.0114  617 HOH A O   
1161 O O   . HOH P .   ? 0.3971  0.3016 0.3532 0.0500  -0.0163 0.0201  618 HOH A O   
1162 O O   . HOH P .   ? 0.2954  0.3926 0.3514 0.0590  0.0328  -0.0492 619 HOH A O   
1163 O O   . HOH P .   ? 0.3834  0.2708 0.3198 -0.0245 0.0001  -0.0304 620 HOH A O   
1164 O O   . HOH P .   ? 0.3444  0.2896 0.3223 0.0373  -0.0323 -0.0226 621 HOH A O   
1165 O O   . HOH P .   ? 0.3466  0.3811 0.3348 0.0205  -0.0198 -0.0521 622 HOH A O   
1166 O O   . HOH P .   ? 0.3872  0.3568 0.3486 -0.0287 0.0107  -0.0102 623 HOH A O   
1167 O O   . HOH P .   ? 0.3315  0.3454 0.3204 0.0620  -0.0069 0.0185  624 HOH A O   
1168 O O   . HOH P .   ? 0.3378  0.3223 0.3202 -0.0472 0.0438  -0.0248 625 HOH A O   
1169 O O   . HOH P .   ? 0.2821  0.2265 0.3779 0.0298  -0.0087 0.0005  626 HOH A O   
1170 O O   . HOH P .   ? 0.3335  0.3805 0.3208 0.0312  -0.0220 -0.0481 627 HOH A O   
1171 O O   . HOH P .   ? 0.3100  0.2926 0.3130 0.0165  0.0106  0.0001  628 HOH A O   
1172 O O   . HOH P .   ? 0.3328  0.3377 0.2721 0.0356  -0.0287 -0.0025 629 HOH A O   
1173 O O   . HOH P .   ? 0.3221  0.3310 0.3462 0.0388  -0.0338 -0.0183 630 HOH A O   
1174 O O   . HOH P .   ? 0.4481  0.3659 0.3237 -0.0168 0.0187  0.0057  631 HOH A O   
1175 O O   . HOH P .   ? 0.3603  0.2958 0.2979 -0.0018 -0.0119 -0.0187 632 HOH A O   
1176 O O   . HOH P .   ? 0.2496  0.3497 0.4576 0.0157  -0.0404 -0.0210 633 HOH A O   
1177 O O   . HOH P .   ? 0.3879  0.4371 0.3040 -0.0329 -0.0662 0.0231  634 HOH A O   
1178 O O   . HOH P .   ? 0.3685  0.2877 0.2745 0.0382  0.0065  0.0121  635 HOH A O   
1179 O O   . HOH P .   ? 0.2633  0.2788 0.2900 0.0171  -0.0225 -0.0153 636 HOH A O   
1180 O O   . HOH P .   ? 0.3492  0.3792 0.3477 -0.0565 -0.0761 0.0815  637 HOH A O   
1181 O O   . HOH P .   ? 0.3252  0.3914 0.4037 -0.0441 -0.0360 -0.0041 638 HOH A O   
1182 O O   . HOH P .   ? 0.3387  0.2750 0.2915 0.0306  0.0024  -0.0102 639 HOH A O   
1183 O O   . HOH P .   ? 0.3753  0.2904 0.3538 0.0065  0.0042  0.0458  640 HOH A O   
1184 O O   . HOH P .   ? 0.3712  0.3020 0.3601 0.0299  -0.0114 -0.0079 641 HOH A O   
1185 O O   . HOH P .   ? 0.3475  0.4384 0.2621 -0.0475 0.0463  -0.0377 642 HOH A O   
1186 O O   . HOH P .   ? 0.3849  0.4071 0.3352 0.0127  0.0467  -0.0377 643 HOH A O   
1187 O O   . HOH P .   ? 0.3084  0.2671 0.3064 0.0151  -0.0248 -0.0037 644 HOH A O   
1188 O O   . HOH P .   ? 0.2798  0.2926 0.3248 0.0414  0.0099  -0.0112 645 HOH A O   
1189 O O   . HOH P .   ? 0.3813  0.3231 0.3244 -0.0327 0.0042  -0.0106 646 HOH A O   
1190 O O   . HOH P .   ? 0.2880  0.2863 0.3126 0.0040  0.0005  -0.0224 647 HOH A O   
1191 O O   . HOH P .   ? 0.3128  0.3187 0.3908 0.0427  0.0116  0.0268  648 HOH A O   
1192 O O   . HOH P .   ? 0.3465  0.2893 0.3962 -0.0059 -0.0575 -0.0249 649 HOH A O   
1193 O O   . HOH P .   ? 0.4169  0.4013 0.3445 -0.0339 0.0186  -0.0423 650 HOH A O   
1194 O O   . HOH P .   ? 0.3715  0.3290 0.3243 0.0499  0.0314  0.0411  651 HOH A O   
1195 O O   . HOH P .   ? 0.4202  0.3271 0.3900 0.0231  -0.0315 0.0344  652 HOH A O   
1196 O O   . HOH P .   ? 0.3879  0.4124 0.4435 0.0344  -0.1103 -0.0287 653 HOH A O   
1197 O O   . HOH P .   ? 0.3538  0.3374 0.3474 -0.0489 -0.0197 -0.0383 654 HOH A O   
1198 O O   . HOH P .   ? 0.3998  0.3855 0.3698 0.0206  -0.0014 -0.0107 655 HOH A O   
1199 O O   . HOH P .   ? 0.5140  0.3952 0.3937 0.0095  -0.0002 0.0528  656 HOH A O   
1200 O O   . HOH P .   ? 0.2900  0.3574 0.4092 0.0534  -0.0275 -0.0356 657 HOH A O   
1201 O O   . HOH P .   ? 0.3380  0.3390 0.4854 0.0116  -0.0279 0.0259  658 HOH A O   
1202 O O   . HOH P .   ? 0.3987  0.4100 0.3565 0.0601  -0.0387 0.1167  659 HOH A O   
1203 O O   . HOH P .   ? 0.4156  0.2606 0.3681 -0.0390 -0.0180 0.0116  660 HOH A O   
1204 O O   . HOH P .   ? 0.3508  0.3233 0.3284 -0.0010 -0.0455 0.0114  661 HOH A O   
1205 O O   . HOH P .   ? 0.3632  0.3985 0.4151 -0.0765 0.0494  -0.0713 662 HOH A O   
1206 O O   . HOH P .   ? 0.4295  0.4991 0.4324 -0.1707 0.0819  -0.1032 663 HOH A O   
1207 O O   . HOH P .   ? 0.3934  0.3498 0.3195 0.0309  0.0183  0.0959  664 HOH A O   
1208 O O   . HOH P .   ? 0.4498  0.4783 0.5609 0.0538  -0.0175 0.1045  665 HOH A O   
1209 O O   . HOH P .   ? 0.3681  0.3580 0.3703 0.0167  0.0066  0.0066  666 HOH A O   
1210 O O   . HOH P .   ? 0.4663  0.4448 0.3964 -0.0203 -0.0020 0.0512  667 HOH A O   
1211 O O   . HOH P .   ? 0.3711  0.3264 0.4709 -0.0258 0.0873  0.0186  668 HOH A O   
1212 O O   . HOH P .   ? 0.3645  0.4014 0.3706 0.0070  -0.0297 -0.0370 669 HOH A O   
1213 O O   . HOH P .   ? 0.5153  0.3230 0.4055 0.0015  -0.0199 0.0151  670 HOH A O   
1214 O O   . HOH P .   ? 0.4194  0.2962 0.3301 0.0091  -0.0498 0.0089  671 HOH A O   
1215 O O   . HOH P .   ? 0.4753  0.3837 0.4445 -0.0107 -0.1321 -0.0250 672 HOH A O   
1216 O O   . HOH P .   ? 0.3676  0.3739 0.3438 -0.0559 -0.0534 0.0017  673 HOH A O   
1217 O O   . HOH P .   ? 0.5823  0.4993 0.6044 0.0195  -0.1988 -0.0449 674 HOH A O   
1218 O O   . HOH P .   ? 0.4651  0.4755 0.3381 0.0979  -0.0235 -0.0418 675 HOH A O   
1219 O O   . HOH P .   ? 0.3939  0.3859 0.4049 -0.0425 -0.0543 -0.0039 676 HOH A O   
1220 O O   . HOH P .   ? 0.3958  0.3500 0.3462 -0.0028 -0.0508 0.0738  677 HOH A O   
1221 O O   . HOH P .   ? 0.4585  0.4541 0.3833 -0.0866 0.1041  -0.0121 678 HOH A O   
1222 O O   . HOH P .   ? 0.3602  0.4309 0.4219 0.0355  -0.0062 -0.0235 679 HOH A O   
1223 O O   . HOH P .   ? 0.3820  0.3586 0.5431 0.0208  -0.0012 -0.0143 680 HOH A O   
1224 O O   . HOH P .   ? 0.4444  0.7086 0.4039 -0.0411 -0.0106 -0.0137 681 HOH A O   
1225 O O   . HOH P .   ? 0.4230  0.3488 0.4754 -0.0111 -0.0297 0.1367  682 HOH A O   
1226 O O   . HOH P .   ? 0.4327  0.4556 0.3712 0.0716  -0.1145 0.0087  683 HOH A O   
1227 O O   . HOH P .   ? 0.4539  0.5004 0.4512 -0.0823 -0.0696 -0.0518 684 HOH A O   
1228 O O   . HOH P .   ? 0.4111  0.4479 0.4264 -0.0021 -0.0817 0.0800  685 HOH A O   
1229 O O   . HOH P .   ? 0.5428  0.4848 0.3942 -0.0915 -0.0486 0.0419  686 HOH A O   
1230 O O   . HOH P .   ? 0.4558  0.4012 0.4301 -0.0671 -0.0037 -0.1490 687 HOH A O   
1231 O O   . HOH P .   ? 0.3567  0.4640 0.4603 0.0185  -0.0847 0.0264  688 HOH A O   
1232 O O   . HOH P .   ? 0.4918  0.3636 0.4625 0.0408  0.0082  0.0689  689 HOH A O   
1233 O O   . HOH P .   ? 0.5958  0.4067 0.4240 -0.1089 -0.1316 0.0385  690 HOH A O   
1234 O O   . HOH P .   ? 0.3470  0.5517 0.4970 -0.0144 -0.0873 0.0289  691 HOH A O   
1235 O O   . HOH P .   ? 0.4477  0.4810 0.4717 -0.0640 0.1209  0.0590  692 HOH A O   
1236 O O   . HOH P .   ? 0.8796  0.3685 0.4363 0.0637  -0.1913 0.0760  693 HOH A O   
1237 O O   . HOH P .   ? 0.4593  0.3796 0.3276 -0.0453 -0.0744 0.0071  694 HOH A O   
1238 O O   . HOH P .   ? 0.3005  0.4443 0.3627 0.0287  0.0092  0.0042  695 HOH A O   
1239 O O   . HOH P .   ? 0.3943  0.3742 0.3660 -0.0473 0.0403  0.0747  696 HOH A O   
1240 O O   . HOH P .   ? 0.4129  0.3918 0.3634 -0.0306 -0.0181 0.0529  697 HOH A O   
1241 O O   . HOH P .   ? 0.3821  0.4418 0.5669 0.0877  0.0527  0.1248  698 HOH A O   
1242 O O   . HOH P .   ? 0.5411  0.4393 0.3806 -0.0732 0.0694  -0.0552 699 HOH A O   
1243 O O   . HOH P .   ? 0.4227  0.4018 0.5756 0.0053  0.0803  0.0323  700 HOH A O   
1244 O O   . HOH P .   ? 0.3546  0.6651 0.6105 -0.1338 -0.0786 0.0093  701 HOH A O   
1245 O O   . HOH P .   ? 0.5094  0.4451 0.3950 0.0220  -0.0448 -0.0034 702 HOH A O   
1246 O O   . HOH P .   ? 0.6220  0.4508 0.4807 -0.0062 0.1154  0.0235  703 HOH A O   
1247 O O   . HOH P .   ? 0.7559  0.4073 0.4388 0.0256  0.1702  -0.1096 704 HOH A O   
1248 O O   . HOH P .   ? 0.4856  0.3300 0.5428 0.0148  -0.0905 0.0365  705 HOH A O   
1249 O O   . HOH P .   ? 0.3887  0.3817 0.4769 0.0064  -0.0950 0.0132  706 HOH A O   
1250 O O   . HOH P .   ? 0.4322  0.4950 0.5299 0.0154  0.0053  -0.0555 707 HOH A O   
1251 O O   . HOH P .   ? 0.3735  0.5336 0.3621 -0.0552 -0.0016 -0.0209 708 HOH A O   
1252 O O   . HOH P .   ? 0.5761  0.4850 0.4802 -0.0283 -0.1111 -0.0369 709 HOH A O   
1253 O O   . HOH P .   ? 0.4713  0.3682 0.4229 0.0316  -0.0532 0.0464  710 HOH A O   
1254 O O   . HOH P .   ? 0.3900  0.4271 0.3998 0.0482  0.0200  0.1137  711 HOH A O   
1255 O O   . HOH P .   ? 0.4141  0.7247 0.5173 -0.1391 0.0458  -0.0947 712 HOH A O   
1256 O O   . HOH P .   ? 0.5357  0.3655 0.5691 0.0166  0.1198  0.0253  713 HOH A O   
1257 O O   . HOH P .   ? 0.4032  0.6096 0.5753 0.1054  -0.2114 -0.0651 714 HOH A O   
1258 O O   . HOH P .   ? 0.4188  0.4546 0.4485 0.0844  -0.1496 -0.1409 715 HOH A O   
1259 O O   . HOH P .   ? 0.4561  0.4135 0.4860 -0.0649 -0.0544 -0.0597 716 HOH A O   
1260 O O   . HOH P .   ? 0.4709  0.3619 0.4527 0.0016  -0.0369 0.0578  717 HOH A O   
1261 O O   . HOH P .   ? 0.5283  0.5874 0.4131 0.0749  -0.0885 0.0224  718 HOH A O   
1262 O O   . HOH P .   ? 0.4018  0.5132 0.3706 -0.0145 -0.0511 0.0283  719 HOH A O   
1263 O O   . HOH P .   ? 0.4123  0.4616 0.6028 0.0209  0.1634  -0.0243 720 HOH A O   
1264 O O   . HOH P .   ? 0.5657  0.4079 0.5882 -0.0240 0.1266  0.0332  721 HOH A O   
1265 O O   . HOH P .   ? 0.4206  0.3679 0.5329 -0.0259 0.1135  -0.0030 722 HOH A O   
1266 O O   . HOH P .   ? 0.7771  0.4789 0.4333 -0.0259 -0.1988 0.0671  723 HOH A O   
1267 O O   . HOH P .   ? 0.5129  0.4020 0.6346 0.0744  -0.1261 -0.0422 724 HOH A O   
1268 O O   . HOH P .   ? 0.7977  0.5694 0.8596 -0.0617 0.0668  -0.0715 725 HOH A O   
1269 O O   . HOH P .   ? 0.7466  0.4870 0.4436 0.0236  0.0147  0.1330  726 HOH A O   
1270 O O   . HOH P .   ? 0.4577  0.4897 0.6365 -0.0059 -0.1304 0.0417  727 HOH A O   
1271 O O   . HOH P .   ? 0.7526  0.3747 0.5027 -0.0063 -0.0184 0.0936  728 HOH A O   
1272 O O   . HOH P .   ? 0.5331  0.3841 0.4823 0.0941  -0.0433 -0.0413 729 HOH A O   
1273 O O   . HOH P .   ? 0.5999  0.7066 0.7840 -0.0307 0.1097  -0.1974 730 HOH A O   
1274 O O   . HOH P .   ? 0.4444  0.6210 0.4172 -0.0422 -0.0332 0.0294  731 HOH A O   
1275 O O   . HOH P .   ? 0.5913  0.6042 0.6575 0.1012  -0.0604 0.0587  732 HOH A O   
1276 O O   . HOH P .   ? 0.4563  0.7046 0.5218 -0.0160 0.0241  -0.0619 733 HOH A O   
1277 O O   . HOH P .   ? 0.4959  0.5102 0.4793 0.0292  -0.0070 0.0744  734 HOH A O   
1278 O O   . HOH P .   ? 0.5378  0.3904 0.5027 0.0131  -0.0023 0.0521  735 HOH A O   
1279 O O   . HOH P .   ? 0.4567  0.5678 0.4807 0.0441  0.0772  0.1068  736 HOH A O   
1280 O O   . HOH P .   ? 0.4908  0.5694 0.4561 0.1582  0.0968  -0.0366 737 HOH A O   
1281 O O   . HOH P .   ? 0.8785  0.5705 0.5168 -0.0845 0.0451  0.1159  738 HOH A O   
1282 O O   . HOH P .   ? 0.5200  0.9361 0.5157 -0.0662 0.1026  -0.3228 739 HOH A O   
1283 O O   . HOH P .   ? 0.4205  0.5259 0.6162 -0.0821 0.0329  0.0840  740 HOH A O   
1284 O O   . HOH P .   ? 0.8447  0.4481 0.4970 0.0264  -0.1232 0.0212  741 HOH A O   
1285 O O   . HOH P .   ? 0.6356  0.6478 0.5617 -0.1814 0.1612  -0.1910 742 HOH A O   
1286 O O   . HOH P .   ? 0.5186  0.4471 0.4689 -0.0833 -0.0236 0.0378  743 HOH A O   
1287 O O   . HOH P .   ? 0.5287  0.6456 0.6265 -0.1398 -0.1162 0.0797  744 HOH A O   
1288 O O   . HOH P .   ? 0.2391  0.5816 0.5682 0.0539  -0.1479 0.1130  745 HOH A O   
1289 O O   . HOH P .   ? 0.3595  0.5915 0.8138 0.0204  0.1510  -0.1753 746 HOH A O   
1290 O O   . HOH P .   ? 0.8797  0.5808 0.5769 0.2384  -0.1641 -0.0969 747 HOH A O   
1291 O O   . HOH P .   ? 0.4853  0.3685 0.7079 -0.0318 -0.0358 0.0946  748 HOH A O   
1292 O O   . HOH P .   ? 0.3796  0.4999 0.9505 0.0493  -0.1964 0.0984  749 HOH A O   
1293 O O   . HOH P .   ? 0.6989  0.5426 0.5114 0.0712  -0.1288 -0.1183 750 HOH A O   
1294 O O   . HOH P .   ? 0.5088  0.6279 0.4598 -0.0047 -0.0377 -0.0740 751 HOH A O   
1295 O O   . HOH P .   ? 0.7510  0.6280 0.5524 -0.1175 0.2634  0.0136  752 HOH A O   
1296 O O   . HOH P .   ? 0.8771  0.4538 0.6972 -0.0777 -0.1696 0.0389  753 HOH A O   
1297 O O   . HOH P .   ? 0.5020  0.6580 0.6930 0.0681  0.0545  -0.0701 754 HOH A O   
1298 O O   . HOH P .   ? 0.5167  0.4887 0.5965 -0.0860 -0.1110 0.1799  755 HOH A O   
1299 O O   . HOH P .   ? 0.6464  0.4992 0.6696 -0.1794 0.1423  -0.0737 756 HOH A O   
1300 O O   . HOH P .   ? 0.6056  0.8139 0.6571 -0.1563 0.0140  -0.2218 757 HOH A O   
1301 O O   . HOH P .   ? 0.7419  0.3984 0.5836 -0.0866 -0.1453 0.0034  758 HOH A O   
1302 O O   . HOH P .   ? 0.6534  0.6062 0.6704 -0.1383 0.0183  0.0902  759 HOH A O   
1303 O O   . HOH P .   ? 0.7051  0.5965 0.4134 -0.1016 0.1059  -0.1133 760 HOH A O   
1304 O O   . HOH P .   ? 0.4933  0.5192 0.5163 -0.0802 -0.0026 0.0368  761 HOH A O   
1305 O O   . HOH P .   ? 0.4827  0.4388 0.7212 -0.0450 -0.1712 0.0518  762 HOH A O   
1306 O O   . HOH P .   ? 0.6962  0.5220 0.7075 -0.0987 -0.2166 0.1155  763 HOH A O   
1307 O O   . HOH P .   ? 0.6010  0.3502 0.6151 -0.0366 -0.0875 0.0818  764 HOH A O   
1308 O O   . HOH P .   ? 0.5816  0.7225 0.5715 -0.0543 0.0890  -0.0673 765 HOH A O   
1309 O O   . HOH P .   ? 0.5678  0.5811 0.6187 0.0860  -0.0370 -0.1304 766 HOH A O   
1310 O O   . HOH P .   ? 0.5885  0.6797 0.6555 -0.0630 -0.1401 -0.0005 767 HOH A O   
1311 O O   . HOH P .   ? 0.3199  0.4313 0.5320 -0.0286 0.0489  -0.0699 768 HOH A O   
1312 O O   . HOH P .   ? 0.6756  0.6517 0.7801 0.0699  -0.0829 -0.0063 769 HOH A O   
1313 O O   . HOH P .   ? 0.3589  0.4922 0.6195 -0.0122 -0.1036 -0.0913 770 HOH A O   
1314 O O   . HOH P .   ? 0.5608  0.3738 0.6369 -0.0281 0.0380  -0.0808 771 HOH A O   
1315 O O   . HOH P .   ? 0.4937  0.6992 0.7205 0.0155  -0.0846 0.1943  772 HOH A O   
1316 O O   . HOH P .   ? 0.8818  0.5061 0.5797 0.0113  -0.2803 0.0029  773 HOH A O   
1317 O O   . HOH P .   ? 0.6733  0.5631 0.7363 0.1121  0.0670  -0.0353 774 HOH A O   
1318 O O   . HOH P .   ? 0.3577  0.4662 0.6073 0.0583  0.0398  -0.0382 775 HOH A O   
1319 O O   . HOH P .   ? 0.7746  0.5720 0.7046 -0.1202 -0.0054 0.0633  776 HOH A O   
1320 O O   . HOH P .   ? 0.7334  0.4792 0.6022 -0.2397 0.2280  -0.1669 777 HOH A O   
1321 O O   . HOH P .   ? 0.4375  0.4639 0.8150 -0.0150 0.1689  0.0207  778 HOH A O   
1322 O O   . HOH P .   ? 1.0103  0.3883 0.4829 0.0171  0.1583  -0.0832 779 HOH A O   
1323 O O   . HOH P .   ? 0.5430  0.5073 0.4917 -0.0039 -0.0336 -0.0349 780 HOH A O   
1324 O O   . HOH P .   ? 0.6489  0.6784 0.5660 -0.1159 -0.1440 0.1003  781 HOH A O   
1325 O O   . HOH P .   ? 0.5822  0.4768 0.7468 0.0608  -0.0575 -0.1090 782 HOH A O   
1326 O O   . HOH P .   ? 0.5895  0.5771 0.5156 0.0462  0.0351  -0.0391 783 HOH A O   
1327 O O   . HOH P .   ? 0.6934  0.4552 0.6668 -0.0127 -0.1682 0.0555  784 HOH A O   
1328 O O   . HOH P .   ? 0.4224  0.4821 0.5037 0.0585  -0.0171 0.0241  785 HOH A O   
1329 O O   . HOH P .   ? 0.6416  0.5455 0.5298 -0.1125 0.0796  -0.0469 786 HOH A O   
1330 O O   . HOH P .   ? 0.7139  0.5364 0.5583 -0.0604 -0.0979 -0.0161 787 HOH A O   
1331 O O   . HOH P .   ? 0.8314  0.3634 0.6801 0.1117  0.0085  -0.0181 788 HOH A O   
1332 O O   . HOH P .   ? 0.5394  0.8475 0.6478 -0.0324 -0.1330 0.0422  789 HOH A O   
1333 O O   . HOH P .   ? 0.6438  0.6057 0.3328 0.0811  -0.0349 -0.0540 790 HOH A O   
1334 O O   . HOH P .   ? 1.0912  0.6689 0.6200 -0.2339 -0.4723 0.0675  791 HOH A O   
1335 O O   . HOH P .   ? 0.5192  0.6764 0.4916 -0.1610 -0.0711 0.1886  792 HOH A O   
1336 O O   . HOH P .   ? 0.8718  0.5657 0.4911 -0.1080 -0.0551 0.0587  793 HOH A O   
1337 O O   . HOH P .   ? 0.7791  0.5614 0.7378 0.1557  -0.0171 0.0378  794 HOH A O   
1338 O O   . HOH P .   ? 0.6620  0.3038 0.4642 0.0675  -0.1335 -0.0706 795 HOH A O   
1339 O O   . HOH P .   ? 0.5556  0.6162 0.6189 -0.0895 0.0056  0.2014  796 HOH A O   
1340 O O   . HOH P .   ? 0.4539  0.9045 0.4920 -0.1067 0.0893  -0.1494 797 HOH A O   
1341 O O   . HOH P .   ? 0.5671  0.6152 0.5977 -0.1330 -0.0874 0.1150  798 HOH A O   
1342 O O   . HOH P .   ? 0.4693  0.6296 0.5713 0.0296  0.0394  -0.0365 799 HOH A O   
1343 O O   . HOH P .   ? 0.7083  0.7881 0.5900 -0.2629 0.0947  -0.0399 800 HOH A O   
1344 O O   . HOH P .   ? 0.6487  0.8514 0.7187 0.0472  -0.1305 -0.1348 801 HOH A O   
1345 O O   . HOH P .   ? 0.5596  0.7063 0.4325 0.0130  -0.1440 0.0002  802 HOH A O   
1346 O O   . HOH P .   ? 0.6805  0.6006 0.8084 0.1938  -0.1568 -0.0618 803 HOH A O   
1347 O O   . HOH P .   ? 0.3759  0.6658 0.4829 0.0213  0.0091  0.0816  804 HOH A O   
1348 O O   . HOH P .   ? 0.7175  0.5094 0.7213 -0.0503 0.0836  0.0272  805 HOH A O   
1349 O O   . HOH P .   ? 0.6207  0.4306 0.5689 0.0272  -0.0573 -0.0268 806 HOH A O   
1350 O O   . HOH P .   ? 0.5815  0.2960 0.7635 -0.0278 -0.0562 0.0242  807 HOH A O   
1351 O O   . HOH P .   ? 0.5807  0.6228 0.5218 -0.0827 0.1274  -0.0748 808 HOH A O   
1352 O O   . HOH P .   ? 0.3950  0.5921 0.5635 -0.0508 0.0762  -0.0869 809 HOH A O   
1353 O O   . HOH P .   ? 0.5502  0.5990 0.5710 0.0804  -0.1310 -0.1067 810 HOH A O   
1354 O O   . HOH P .   ? 0.9757  0.6935 0.6795 0.1340  0.0589  0.0539  811 HOH A O   
1355 O O   . HOH P .   ? 0.7819  0.6036 0.5241 -0.1952 0.3225  -0.1532 812 HOH A O   
1356 O O   . HOH P .   ? 0.5547  0.4718 0.7931 0.0048  -0.2230 -0.0151 813 HOH A O   
1357 O O   . HOH P .   ? 0.5378  0.4623 0.4652 0.0233  0.0017  -0.0965 814 HOH A O   
1358 O O   . HOH P .   ? 0.4647  0.6867 0.5008 0.0629  -0.0250 -0.2143 815 HOH A O   
1359 O O   . HOH P .   ? 0.7921  0.8300 0.3651 -0.2005 -0.0642 0.0877  816 HOH A O   
1360 O O   . HOH P .   ? 0.7944  0.7047 0.8092 0.0683  0.2193  -0.1438 817 HOH A O   
1361 O O   . HOH P .   ? 0.5877  0.6057 0.8762 -0.0860 0.2173  -0.0348 818 HOH A O   
1362 O O   . HOH P .   ? 1.0169  0.7365 0.6953 -0.0072 0.0143  -0.0337 819 HOH A O   
1363 O O   . HOH P .   ? 0.7290  0.8102 0.7667 0.0620  -0.0210 0.0841  820 HOH A O   
1364 O O   . HOH P .   ? 0.5168  0.5095 0.4725 0.0019  -0.0326 0.0433  821 HOH A O   
1365 O O   . HOH P .   ? 0.6705  0.8123 0.7092 0.0387  0.1500  0.1386  822 HOH A O   
1366 O O   . HOH P .   ? 0.9543  0.4883 0.4350 -0.1449 0.0118  0.0235  823 HOH A O   
1367 O O   . HOH P .   ? 0.6500  0.5848 0.8676 -0.1305 -0.1997 0.0936  824 HOH A O   
1368 O O   . HOH P .   ? 0.8435  0.5396 0.7996 -0.1443 0.2570  -0.0274 825 HOH A O   
1369 O O   . HOH P .   ? 0.5757  0.5043 0.4550 0.0691  0.0250  0.0520  826 HOH A O   
1370 O O   . HOH P .   ? 0.3483  0.4384 0.6327 -0.0932 -0.0475 0.0761  827 HOH A O   
1371 O O   . HOH P .   ? 0.4352  0.4006 0.5710 -0.0899 0.0471  -0.0761 828 HOH A O   
1372 O O   . HOH P .   ? 0.3276  0.6824 0.4947 0.0428  0.1193  -0.1917 829 HOH A O   
1373 O O   . HOH P .   ? 0.5286  0.7213 0.5261 -0.1269 -0.0646 -0.1142 830 HOH A O   
1374 O O   . HOH P .   ? 0.6626  0.5570 0.5681 -0.2022 0.0694  0.0572  831 HOH A O   
1375 O O   . HOH P .   ? 0.6224  0.6980 0.5793 -0.2689 0.0707  -0.0176 832 HOH A O   
1376 O O   . HOH P .   ? 0.8078  0.7681 0.6929 -0.1781 -0.1693 0.0015  833 HOH A O   
1377 O O   . HOH P .   ? 0.4820  0.4031 0.6326 -0.1252 0.1587  -0.1606 834 HOH A O   
1378 O O   . HOH P .   ? 0.4615  0.9320 0.7504 -0.0494 0.0498  -0.0926 835 HOH A O   
1379 O O   . HOH P .   ? 0.7550  0.7230 0.8259 0.0141  -0.1895 0.1190  836 HOH A O   
1380 O O   . HOH P .   ? 0.3964  0.6411 0.5411 0.0184  -0.0745 -0.0877 837 HOH A O   
1381 O O   . HOH P .   ? 0.5467  0.4197 0.3894 -0.0552 0.0489  -0.0428 838 HOH A O   
1382 O O   . HOH P .   ? 0.5043  0.3442 0.5700 0.0978  -0.1139 -0.0334 839 HOH A O   
1383 O O   . HOH P .   ? 0.7450  0.7012 0.6605 0.0577  0.1948  0.0304  840 HOH A O   
1384 O O   . HOH P .   ? 0.7380  0.6079 0.5166 0.0377  0.2964  -0.1941 841 HOH A O   
1385 O O   . HOH P .   ? 0.9107  0.7822 0.8409 0.0239  -0.2682 -0.0229 842 HOH A O   
1386 O O   . HOH P .   ? 0.6682  0.5378 0.5015 0.0439  -0.0224 -0.0250 843 HOH A O   
1387 O O   . HOH P .   ? 0.3660  0.7173 0.7084 -0.0003 0.0243  0.0577  844 HOH A O   
1388 O O   . HOH P .   ? 0.6379  0.4583 0.5277 -0.1417 -0.0548 -0.0679 845 HOH A O   
1389 O O   . HOH P .   ? 0.6525  0.5339 0.8555 -0.0795 -0.2155 -0.0319 846 HOH A O   
1390 O O   . HOH P .   ? 0.3171  0.6773 0.4493 0.0603  -0.0567 -0.1150 847 HOH A O   
1391 O O   . HOH P .   ? 0.9130  0.5990 0.7524 -0.0361 0.1613  -0.2356 848 HOH A O   
1392 O O   . HOH P .   ? 0.4729  0.4403 0.5822 -0.0384 0.0258  0.0034  849 HOH A O   
1393 O O   . HOH P .   ? 0.7210  0.3571 0.6150 -0.1297 -0.2493 0.1014  850 HOH A O   
1394 O O   . HOH P .   ? 0.6432  0.5539 0.7690 -0.0493 0.2674  -0.0643 851 HOH A O   
1395 O O   . HOH P .   ? 0.4857  0.5682 0.5015 -0.0719 0.0641  0.0671  852 HOH A O   
1396 O O   . HOH P .   ? 0.3305  0.7768 0.6943 0.1024  0.1913  -0.0574 853 HOH A O   
1397 O O   . HOH P .   ? 0.6049  0.4925 0.6271 -0.0225 -0.2368 0.0811  854 HOH A O   
1398 O O   . HOH P .   ? 0.2651  0.6594 0.4781 -0.0542 0.0540  0.1752  855 HOH A O   
1399 O O   . HOH P .   ? 0.4554  0.4416 0.5602 -0.1097 -0.2170 0.0734  856 HOH A O   
1400 O O   . HOH P .   ? 0.4161  0.5830 0.4646 0.1008  0.0093  0.0928  857 HOH A O   
1401 O O   . HOH P .   ? 0.7006  0.6626 0.5782 0.0410  0.0352  0.0917  858 HOH A O   
1402 O O   . HOH P .   ? 0.3953  0.6989 0.7344 -0.0419 -0.0376 0.0284  859 HOH A O   
1403 O O   . HOH P .   ? 0.5544  0.5512 0.7170 -0.1101 -0.0609 -0.0588 860 HOH A O   
1404 O O   . HOH P .   ? 0.2832  0.7680 0.9159 0.0638  0.1621  -0.0491 861 HOH A O   
1405 O O   . HOH P .   ? 0.5192  0.5353 0.4626 -0.1870 -0.0150 0.0083  862 HOH A O   
1406 O O   . HOH P .   ? 0.5436  0.6800 0.7197 -0.0960 0.0025  -0.1761 863 HOH A O   
1407 O O   . HOH P .   ? 0.6217  0.6154 0.7166 -0.0959 0.0314  -0.0141 864 HOH A O   
1408 O O   . HOH P .   ? 0.4341  0.4781 0.4922 -0.0778 -0.0516 0.0165  865 HOH A O   
1409 O O   . HOH P .   ? 0.6057  0.7282 0.6232 0.0620  -0.0160 -0.0916 866 HOH A O   
1410 O O   . HOH P .   ? 0.7901  0.6931 0.6335 -0.1215 -0.1292 0.1148  867 HOH A O   
1411 O O   . HOH P .   ? 0.6635  0.4097 0.5464 -0.0669 0.1431  0.0194  868 HOH A O   
1412 O O   . HOH P .   ? 0.8593  0.4420 0.6475 -0.0208 0.1860  -0.1168 869 HOH A O   
1413 O O   . HOH P .   ? 0.4820  0.5294 0.4104 0.0165  -0.0694 0.0901  870 HOH A O   
1414 O O   . HOH P .   ? 0.4934  0.5494 0.3781 0.0401  -0.1374 -0.0249 871 HOH A O   
1415 O O   . HOH P .   ? 0.7668  0.3067 0.4729 0.1508  0.1335  0.0242  872 HOH A O   
1416 O O   . HOH P .   ? 0.6158  0.4700 0.5070 -0.0370 -0.1063 -0.0348 873 HOH A O   
1417 O O   . HOH P .   ? 0.9208  0.6191 0.6199 0.0352  -0.0039 0.0557  874 HOH A O   
1418 O O   . HOH P .   ? 0.4160  0.6980 0.5628 0.1411  0.0149  -0.0777 875 HOH A O   
1419 O O   . HOH P .   ? 0.6052  0.4683 0.7405 -0.1512 -0.2642 0.0015  876 HOH A O   
1420 O O   . HOH P .   ? 0.5178  0.4402 0.6520 0.0969  0.1260  0.1247  877 HOH A O   
1421 O O   . HOH P .   ? 0.5291  0.5162 0.6976 0.1180  0.1661  -0.1993 878 HOH A O   
1422 O O   . HOH P .   ? 0.6894  0.7831 0.7398 -0.0646 -0.1072 -0.0143 879 HOH A O   
1423 O O   . HOH P .   ? 0.3845  0.5606 0.5859 0.0709  0.0871  -0.0725 880 HOH A O   
1424 O O   . HOH P .   ? 0.3071  0.4532 0.6633 -0.0280 -0.0141 -0.1358 881 HOH A O   
1425 O O   . HOH P .   ? 0.8070  0.7025 0.3473 -0.0580 -0.1376 -0.0620 882 HOH A O   
1426 O O   . HOH P .   ? 0.4269  0.4131 0.6046 0.0212  0.0655  0.0518  883 HOH A O   
1427 O O   . HOH P .   ? 0.4787  0.6611 0.6372 0.0442  0.2731  -0.1093 884 HOH A O   
1428 O O   . HOH P .   ? 0.9873  0.4264 0.3694 -0.1533 -0.0406 0.1905  885 HOH A O   
1429 O O   . HOH P .   ? 0.8248  0.7653 0.5582 -0.1653 0.1538  -0.0301 886 HOH A O   
1430 O O   . HOH P .   ? 0.6778  0.6706 0.4780 0.0461  0.0428  0.0530  887 HOH A O   
1431 O O   . HOH P .   ? 0.6314  0.6037 0.4536 0.0861  0.1521  -0.0807 888 HOH A O   
1432 O O   . HOH P .   ? 0.6772  0.3624 0.5340 -0.0021 -0.1052 0.0296  889 HOH A O   
1433 O O   . HOH P .   ? 0.6959  0.3926 0.6151 -0.1297 0.1712  0.0934  890 HOH A O   
1434 O O   . HOH P .   ? 0.7040  0.6497 0.6145 -0.1239 -0.3165 0.0143  891 HOH A O   
1435 O O   . HOH P .   ? 0.4948  0.4504 0.5525 0.1346  0.1541  -0.0365 892 HOH A O   
1436 O O   . HOH P .   ? 0.6739  0.7085 0.6675 0.0412  0.0664  0.1618  893 HOH A O   
1437 O O   . HOH P .   ? 0.7031  0.5266 0.6424 0.0917  0.0056  -0.0176 894 HOH A O   
1438 O O   . HOH P .   ? 0.5946  0.5643 0.8670 0.0047  0.2094  -0.0216 895 HOH A O   
1439 O O   . HOH P .   ? 0.3133  0.5233 0.4711 -0.0393 0.0407  0.0194  896 HOH A O   
1440 O O   . HOH P .   ? 0.7188  0.9444 0.8086 -0.0795 0.1050  0.1142  897 HOH A O   
1441 O O   . HOH P .   ? 0.7803  0.6777 0.7026 0.1661  -0.0329 -0.0258 898 HOH A O   
1442 O O   . HOH P .   ? 0.7130  0.7903 0.6579 0.0680  0.0068  -0.2659 899 HOH A O   
1443 O O   . HOH P .   ? 0.7008  0.5615 0.6062 -0.1169 0.0134  0.1179  900 HOH A O   
1444 O O   . HOH P .   ? 0.7223  0.4944 0.8506 0.2141  0.0187  0.0879  901 HOH A O   
1445 O O   . HOH P .   ? 0.7638  0.4905 0.3727 -0.0360 -0.0441 -0.1574 902 HOH A O   
1446 O O   . HOH P .   ? 0.4371  0.6812 0.5010 -0.0682 0.1252  -0.0204 903 HOH A O   
1447 O O   . HOH P .   ? 0.4385  0.7224 0.6239 -0.0290 -0.0944 -0.0057 904 HOH A O   
1448 O O   . HOH P .   ? 0.6977  0.4321 0.3899 -0.1654 -0.0378 0.0575  905 HOH A O   
1449 O O   . HOH P .   ? 0.6596  0.6900 0.7045 0.0145  0.0742  -0.1164 906 HOH A O   
1450 O O   . HOH P .   ? 0.6242  0.4325 0.4554 -0.0402 0.0536  0.0635  907 HOH A O   
1451 O O   . HOH P .   ? 0.8146  0.6483 0.5111 -0.0852 0.2985  -0.1817 908 HOH A O   
1452 O O   . HOH P .   ? 0.8196  0.5367 0.7061 -0.0889 -0.0925 -0.0347 909 HOH A O   
1453 O O   . HOH P .   ? 0.4348  0.7025 0.5133 0.0058  0.0171  -0.0506 910 HOH A O   
1454 O O   . HOH P .   ? 0.9128  0.5778 0.7535 0.1568  -0.1519 -0.0304 911 HOH A O   
1455 O O   . HOH P .   ? 0.4565  0.8262 0.8299 -0.0988 -0.0424 0.3834  912 HOH A O   
1456 O O   . HOH P .   ? 0.7565  0.7438 0.6656 0.0009  0.2348  -0.0305 913 HOH A O   
1457 O O   . HOH P .   ? 0.6253  0.7800 0.7582 0.0590  -0.1147 0.1560  914 HOH A O   
1458 O O   . HOH P .   ? 0.7706  0.8952 0.7130 -0.0807 0.3722  -0.1311 915 HOH A O   
1459 O O   . HOH P .   ? 0.8705  0.8437 0.6865 -0.0868 -0.3055 0.1219  916 HOH A O   
1460 O O   . HOH P .   ? 0.6141  0.8782 0.5057 -0.2093 -0.1442 -0.1017 917 HOH A O   
1461 O O   . HOH P .   ? 0.6839  0.6040 0.3731 -0.1292 0.1228  -0.0626 918 HOH A O   
1462 O O   . HOH P .   ? 0.5992  0.6729 0.7022 -0.0093 -0.2730 0.1539  919 HOH A O   
1463 O O   . HOH P .   ? 0.5153  0.5080 0.6635 0.0653  0.0126  -0.1129 920 HOH A O   
1464 O O   . HOH P .   ? 0.5392  0.6537 0.6092 -0.0910 -0.2962 -0.0328 921 HOH A O   
1465 O O   . HOH P .   ? 0.6926  0.5806 0.7575 -0.1043 0.0605  -0.2172 922 HOH A O   
1466 O O   . HOH P .   ? 0.7213  0.5352 0.5188 0.0190  -0.1956 -0.0326 923 HOH A O   
1467 O O   . HOH P .   ? 0.6625  0.6360 0.7318 0.1111  0.0922  0.1527  924 HOH A O   
1468 O O   . HOH P .   ? 0.4941  0.5458 0.6492 0.0307  -0.0850 0.1552  925 HOH A O   
1469 O O   . HOH P .   ? 0.6488  0.5889 0.6245 -0.0602 0.1122  0.0551  926 HOH A O   
1470 O O   . HOH P .   ? 0.5929  0.5405 0.6245 -0.1894 0.0351  -0.0036 927 HOH A O   
1471 O O   . HOH P .   ? 1.0317  0.6298 0.4924 -0.1341 0.1410  -0.0293 928 HOH A O   
1472 O O   . HOH P .   ? 0.6719  0.7427 0.7536 -0.1129 0.0227  0.1898  929 HOH A O   
1473 O O   . HOH P .   ? 0.5148  0.7247 0.7819 0.0153  0.0416  -0.0537 930 HOH A O   
1474 O O   . HOH P .   ? 0.6448  0.4230 0.6254 -0.0252 0.1254  -0.0010 931 HOH A O   
1475 O O   . HOH P .   ? 0.6801  0.5385 0.5962 -0.1301 -0.0002 0.0184  932 HOH A O   
1476 O O   . HOH P .   ? 0.7515  0.7424 0.7152 -0.0520 0.0082  0.1175  933 HOH A O   
1477 O O   . HOH P .   ? 0.8308  0.4881 0.4470 -0.0006 -0.1896 0.0332  934 HOH A O   
1478 O O   . HOH P .   ? 0.7792  0.5554 0.6577 0.0829  -0.0189 0.0550  935 HOH A O   
1479 O O   . HOH P .   ? 0.6173  0.6921 0.5328 -0.0455 0.1447  -0.2060 936 HOH A O   
1480 O O   . HOH P .   ? 0.5657  0.8138 0.9154 0.0857  0.3219  -0.1623 937 HOH A O   
1481 O O   . HOH P .   ? 0.6663  0.6077 0.8829 0.2203  0.1633  -0.0633 938 HOH A O   
1482 O O   . HOH P .   ? 0.6087  0.5419 0.6381 -0.1844 0.0785  -0.0748 939 HOH A O   
1483 O O   . HOH P .   ? 0.7324  0.7276 0.7165 0.0242  0.1540  -0.1210 940 HOH A O   
1484 O O   . HOH P .   ? 0.7729  0.4660 0.5341 0.0357  -0.2832 -0.0463 941 HOH A O   
1485 O O   . HOH P .   ? 0.6553  0.5669 0.6842 0.0089  -0.0596 0.1781  942 HOH A O   
1486 O O   . HOH P .   ? 0.3202  0.9049 0.9337 0.0427  0.2290  0.0320  943 HOH A O   
1487 O O   . HOH P .   ? 0.3939  0.6413 0.7604 0.1607  -0.1639 0.2038  944 HOH A O   
1488 O O   . HOH P .   ? 0.6554  0.4579 0.5876 0.0180  -0.0294 -0.0946 945 HOH A O   
1489 O O   . HOH P .   ? 0.6347  0.7455 0.7799 -0.1003 0.0509  0.0682  946 HOH A O   
1490 O O   . HOH P .   ? 0.4295  0.5235 0.7198 0.0727  0.1091  0.0790  947 HOH A O   
1491 O O   . HOH P .   ? 0.6727  0.4804 0.6828 -0.2363 0.3545  -0.1013 948 HOH A O   
1492 O O   . HOH P .   ? 0.4879  0.6260 0.7721 0.0327  0.0880  -0.1532 949 HOH A O   
1493 O O   . HOH P .   ? 0.9358  0.6002 0.5029 -0.1455 0.0373  0.0992  950 HOH A O   
1494 O O   . HOH P .   ? 0.5904  0.6884 0.6612 0.0758  0.0302  0.1344  951 HOH A O   
1495 O O   . HOH P .   ? 0.7949  0.6940 0.6015 -0.0607 0.1266  -0.0816 952 HOH A O   
1496 O O   . HOH P .   ? 0.5482  0.7213 0.7602 0.0786  0.2729  -0.0836 953 HOH A O   
1497 O O   . HOH P .   ? 0.5154  0.6566 0.4499 -0.0165 0.0688  0.1601  954 HOH A O   
1498 O O   . HOH P .   ? 0.5002  0.5982 0.6614 -0.0430 -0.0125 0.1480  955 HOH A O   
1499 O O   . HOH P .   ? 0.5303  0.6103 0.7663 0.0113  0.0207  0.0655  956 HOH A O   
1500 O O   . HOH P .   ? 0.5936  0.7237 0.6915 -0.0255 -0.3132 0.1860  957 HOH A O   
1501 O O   . HOH P .   ? 0.7500  0.9026 0.8169 0.0370  0.1309  -0.0768 958 HOH A O   
1502 O O   . HOH P .   ? 0.4944  0.8275 0.8318 -0.0111 -0.1850 0.0923  959 HOH A O   
1503 O O   . HOH P .   ? 0.8033  0.5530 0.4882 0.0200  0.1138  0.1036  960 HOH A O   
1504 O O   . HOH P .   ? 0.9443  0.7791 0.6795 -0.0733 0.0796  0.0389  961 HOH A O   
1505 O O   . HOH P .   ? 0.5694  0.3998 0.6544 -0.0144 -0.0764 -0.0576 962 HOH A O   
1506 O O   . HOH P .   ? 0.5285  0.8460 0.7985 -0.0524 -0.2116 0.1796  963 HOH A O   
1507 O O   . HOH P .   ? 0.3364  0.7604 0.7938 -0.0076 0.0522  -0.0806 964 HOH A O   
1508 O O   . HOH P .   ? 0.5250  0.7067 0.3834 -0.0574 0.0463  0.1596  965 HOH A O   
1509 O O   . HOH P .   ? 0.6085  0.7454 0.6651 0.0391  -0.0328 -0.0168 966 HOH A O   
1510 O O   . HOH P .   ? 0.8014  0.4348 0.5384 0.0305  -0.0174 0.0660  967 HOH A O   
1511 O O   . HOH P .   ? 0.3112  0.6920 0.6502 -0.1236 0.0330  -0.0607 968 HOH A O   
1512 O O   . HOH P .   ? 0.7348  0.6278 0.6614 0.0012  -0.1408 0.2090  969 HOH A O   
1513 O O   . HOH P .   ? 0.3871  0.6438 0.7839 0.0004  0.0098  0.0766  970 HOH A O   
1514 O O   . HOH P .   ? 0.6425  0.6621 0.7313 -0.1089 0.0020  0.0095  971 HOH A O   
1515 O O   . HOH P .   ? 0.7745  0.5211 0.5655 -0.1832 -0.1592 -0.1434 972 HOH A O   
1516 O O   . HOH P .   ? 0.6246  0.6393 0.5317 0.0732  -0.0262 0.0623  973 HOH A O   
1517 O O   . HOH P .   ? 0.4825  0.6278 0.6379 -0.0879 -0.0191 0.0024  974 HOH A O   
1518 O O   . HOH P .   ? 0.6397  0.7874 0.8866 0.1162  0.3754  -0.1433 975 HOH A O   
1519 O O   . HOH P .   ? 0.7152  0.7293 0.5509 -0.1066 -0.0958 -0.1680 976 HOH A O   
1520 O O   . HOH P .   ? 0.6579  0.6568 0.6935 0.0160  -0.2265 -0.0182 977 HOH A O   
1521 O O   . HOH P .   ? 0.6683  0.6287 0.6685 -0.0391 0.0092  -0.0504 978 HOH A O   
1522 O O   . HOH P .   ? 0.6185  0.8615 0.4830 -0.0145 0.1277  0.0578  979 HOH A O   
1523 O O   . HOH P .   ? 0.9096  0.6755 0.5147 -0.1872 0.0198  0.1272  980 HOH A O   
1524 O O   . HOH P .   ? 0.9897  0.4095 0.8180 -0.0172 -0.0435 -0.1462 981 HOH A O   
1525 O O   . HOH P .   ? 0.5344  0.5996 0.5827 -0.0056 0.0853  -0.1044 982 HOH A O   
1526 O O   . HOH P .   ? 0.8261  0.8232 0.6352 -0.0706 0.2712  -0.1499 983 HOH A O   
1527 O O   . HOH P .   ? 0.7921  0.5905 0.6363 0.2327  0.0086  0.0732  984 HOH A O   
1528 O O   . HOH P .   ? 0.4545  0.8266 0.7014 -0.0700 0.0101  0.0868  985 HOH A O   
1529 O O   . HOH P .   ? 0.7758  0.3598 0.5968 -0.0841 -0.0409 -0.0670 986 HOH A O   
1530 O O   . HOH P .   ? 0.3960  0.5105 0.5617 -0.0307 -0.1245 -0.0095 987 HOH A O   
1531 O O   . HOH P .   ? 0.8048  0.8204 0.8905 0.1087  0.0630  0.0459  988 HOH A O   
1532 O O   . HOH P .   ? 0.8016  0.5588 0.6605 0.0542  0.1049  -0.0766 989 HOH A O   
1533 O O   . HOH P .   ? 0.9141  0.8350 0.5569 -0.1305 0.2164  -0.2609 990 HOH A O   
1534 O O   . HOH P .   ? 0.4778  0.6586 0.7243 -0.0395 0.0709  -0.0577 991 HOH A O   
1535 O O   . HOH P .   ? 0.4530  0.4915 0.7800 0.2779  0.0946  0.0801  992 HOH A O   
1536 O O   . HOH P .   ? 0.8062  0.9052 0.6224 -0.0303 -0.1832 0.1670  993 HOH A O   
1537 O O   . HOH P .   ? 0.3810  0.6012 0.7131 0.1890  0.0509  -0.0370 994 HOH A O   
1538 O O   . HOH P .   ? 0.5100  0.7409 0.7883 0.1601  0.0694  -0.0160 995 HOH A O   
1539 O O   . HOH P .   ? 0.7174  0.5646 0.4779 -0.0779 0.0650  0.0191  996 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   ILE 4   4   4   ILE ILE A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PRO 10  10  10  PRO PRO A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  CYS 12  12  12  CYS CYS A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  ARG 16  16  16  ARG ARG A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ARG 41  41  41  ARG ARG A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  ASN 62  62  62  ASN ASN A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  THR 99  99  99  THR THR A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 CYS 106 106 106 CYS CYS A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LYS 141 141 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   402 2   SO4 SO4 A . 
C 2 SO4 1   403 3   SO4 SO4 A . 
D 2 SO4 1   404 4   SO4 SO4 A . 
E 3 SO3 1   502 2   SO3 SO3 A . 
F 4 CS  1   602 2   CS  CS  A . 
G 4 CS  1   603 3   CS  CS  A . 
H 4 CS  1   604 4   CS  CS  A . 
I 4 CS  1   605 5   CS  CS  A . 
J 4 CS  1   606 6   CS  CS  A . 
K 4 CS  1   607 7   CS  CS  A . 
L 4 CS  1   608 8   CS  CS  A . 
M 4 CS  1   609 9   CS  CS  A . 
N 4 CS  1   610 10  CS  CS  A . 
O 4 CS  1   611 11  CS  CS  A . 
P 5 HOH 1   612 2   HOH HOH A . 
P 5 HOH 2   613 3   HOH HOH A . 
P 5 HOH 3   614 4   HOH HOH A . 
P 5 HOH 4   615 5   HOH HOH A . 
P 5 HOH 5   616 6   HOH HOH A . 
P 5 HOH 6   617 7   HOH HOH A . 
P 5 HOH 7   618 8   HOH HOH A . 
P 5 HOH 8   619 9   HOH HOH A . 
P 5 HOH 9   620 10  HOH HOH A . 
P 5 HOH 10  621 11  HOH HOH A . 
P 5 HOH 11  622 12  HOH HOH A . 
P 5 HOH 12  623 13  HOH HOH A . 
P 5 HOH 13  624 14  HOH HOH A . 
P 5 HOH 14  625 15  HOH HOH A . 
P 5 HOH 15  626 16  HOH HOH A . 
P 5 HOH 16  627 17  HOH HOH A . 
P 5 HOH 17  628 18  HOH HOH A . 
P 5 HOH 18  629 19  HOH HOH A . 
P 5 HOH 19  630 20  HOH HOH A . 
P 5 HOH 20  631 21  HOH HOH A . 
P 5 HOH 21  632 22  HOH HOH A . 
P 5 HOH 22  633 23  HOH HOH A . 
P 5 HOH 23  634 24  HOH HOH A . 
P 5 HOH 24  635 25  HOH HOH A . 
P 5 HOH 25  636 26  HOH HOH A . 
P 5 HOH 26  637 27  HOH HOH A . 
P 5 HOH 27  638 28  HOH HOH A . 
P 5 HOH 28  639 29  HOH HOH A . 
P 5 HOH 29  640 30  HOH HOH A . 
P 5 HOH 30  641 31  HOH HOH A . 
P 5 HOH 31  642 32  HOH HOH A . 
P 5 HOH 32  643 33  HOH HOH A . 
P 5 HOH 33  644 34  HOH HOH A . 
P 5 HOH 34  645 35  HOH HOH A . 
P 5 HOH 35  646 36  HOH HOH A . 
P 5 HOH 36  647 37  HOH HOH A . 
P 5 HOH 37  648 38  HOH HOH A . 
P 5 HOH 38  649 39  HOH HOH A . 
P 5 HOH 39  650 40  HOH HOH A . 
P 5 HOH 40  651 41  HOH HOH A . 
P 5 HOH 41  652 42  HOH HOH A . 
P 5 HOH 42  653 43  HOH HOH A . 
P 5 HOH 43  654 44  HOH HOH A . 
P 5 HOH 44  655 45  HOH HOH A . 
P 5 HOH 45  656 46  HOH HOH A . 
P 5 HOH 46  657 47  HOH HOH A . 
P 5 HOH 47  658 48  HOH HOH A . 
P 5 HOH 48  659 49  HOH HOH A . 
P 5 HOH 49  660 50  HOH HOH A . 
P 5 HOH 50  661 51  HOH HOH A . 
P 5 HOH 51  662 52  HOH HOH A . 
P 5 HOH 52  663 53  HOH HOH A . 
P 5 HOH 53  664 54  HOH HOH A . 
P 5 HOH 54  665 55  HOH HOH A . 
P 5 HOH 55  666 56  HOH HOH A . 
P 5 HOH 56  667 57  HOH HOH A . 
P 5 HOH 57  668 58  HOH HOH A . 
P 5 HOH 58  669 59  HOH HOH A . 
P 5 HOH 59  670 60  HOH HOH A . 
P 5 HOH 60  671 61  HOH HOH A . 
P 5 HOH 61  672 62  HOH HOH A . 
P 5 HOH 62  673 63  HOH HOH A . 
P 5 HOH 63  674 64  HOH HOH A . 
P 5 HOH 64  675 65  HOH HOH A . 
P 5 HOH 65  676 66  HOH HOH A . 
P 5 HOH 66  677 67  HOH HOH A . 
P 5 HOH 67  678 68  HOH HOH A . 
P 5 HOH 68  679 69  HOH HOH A . 
P 5 HOH 69  680 70  HOH HOH A . 
P 5 HOH 70  681 71  HOH HOH A . 
P 5 HOH 71  682 72  HOH HOH A . 
P 5 HOH 72  683 73  HOH HOH A . 
P 5 HOH 73  684 74  HOH HOH A . 
P 5 HOH 74  685 75  HOH HOH A . 
P 5 HOH 75  686 76  HOH HOH A . 
P 5 HOH 76  687 77  HOH HOH A . 
P 5 HOH 77  688 78  HOH HOH A . 
P 5 HOH 78  689 79  HOH HOH A . 
P 5 HOH 79  690 80  HOH HOH A . 
P 5 HOH 80  691 81  HOH HOH A . 
P 5 HOH 81  692 82  HOH HOH A . 
P 5 HOH 82  693 83  HOH HOH A . 
P 5 HOH 83  694 84  HOH HOH A . 
P 5 HOH 84  695 85  HOH HOH A . 
P 5 HOH 85  696 86  HOH HOH A . 
P 5 HOH 86  697 87  HOH HOH A . 
P 5 HOH 87  698 88  HOH HOH A . 
P 5 HOH 88  699 89  HOH HOH A . 
P 5 HOH 89  700 90  HOH HOH A . 
P 5 HOH 90  701 91  HOH HOH A . 
P 5 HOH 91  702 92  HOH HOH A . 
P 5 HOH 92  703 93  HOH HOH A . 
P 5 HOH 93  704 94  HOH HOH A . 
P 5 HOH 94  705 95  HOH HOH A . 
P 5 HOH 95  706 96  HOH HOH A . 
P 5 HOH 96  707 97  HOH HOH A . 
P 5 HOH 97  708 98  HOH HOH A . 
P 5 HOH 98  709 99  HOH HOH A . 
P 5 HOH 99  710 100 HOH HOH A . 
P 5 HOH 100 711 101 HOH HOH A . 
P 5 HOH 101 712 102 HOH HOH A . 
P 5 HOH 102 713 103 HOH HOH A . 
P 5 HOH 103 714 104 HOH HOH A . 
P 5 HOH 104 715 105 HOH HOH A . 
P 5 HOH 105 716 106 HOH HOH A . 
P 5 HOH 106 717 107 HOH HOH A . 
P 5 HOH 107 718 108 HOH HOH A . 
P 5 HOH 108 719 109 HOH HOH A . 
P 5 HOH 109 720 110 HOH HOH A . 
P 5 HOH 110 721 111 HOH HOH A . 
P 5 HOH 111 722 112 HOH HOH A . 
P 5 HOH 112 723 113 HOH HOH A . 
P 5 HOH 113 724 114 HOH HOH A . 
P 5 HOH 114 725 115 HOH HOH A . 
P 5 HOH 115 726 116 HOH HOH A . 
P 5 HOH 116 727 117 HOH HOH A . 
P 5 HOH 117 728 118 HOH HOH A . 
P 5 HOH 118 729 119 HOH HOH A . 
P 5 HOH 119 730 120 HOH HOH A . 
P 5 HOH 120 731 121 HOH HOH A . 
P 5 HOH 121 732 122 HOH HOH A . 
P 5 HOH 122 733 123 HOH HOH A . 
P 5 HOH 123 734 124 HOH HOH A . 
P 5 HOH 124 735 125 HOH HOH A . 
P 5 HOH 125 736 126 HOH HOH A . 
P 5 HOH 126 737 127 HOH HOH A . 
P 5 HOH 127 738 128 HOH HOH A . 
P 5 HOH 128 739 129 HOH HOH A . 
P 5 HOH 129 740 130 HOH HOH A . 
P 5 HOH 130 741 131 HOH HOH A . 
P 5 HOH 131 742 132 HOH HOH A . 
P 5 HOH 132 743 133 HOH HOH A . 
P 5 HOH 133 744 134 HOH HOH A . 
P 5 HOH 134 745 135 HOH HOH A . 
P 5 HOH 135 746 136 HOH HOH A . 
P 5 HOH 136 747 137 HOH HOH A . 
P 5 HOH 137 748 138 HOH HOH A . 
P 5 HOH 138 749 139 HOH HOH A . 
P 5 HOH 139 750 140 HOH HOH A . 
P 5 HOH 140 751 141 HOH HOH A . 
P 5 HOH 141 752 142 HOH HOH A . 
P 5 HOH 142 753 143 HOH HOH A . 
P 5 HOH 143 754 144 HOH HOH A . 
P 5 HOH 144 755 145 HOH HOH A . 
P 5 HOH 145 756 146 HOH HOH A . 
P 5 HOH 146 757 147 HOH HOH A . 
P 5 HOH 147 758 148 HOH HOH A . 
P 5 HOH 148 759 149 HOH HOH A . 
P 5 HOH 149 760 150 HOH HOH A . 
P 5 HOH 150 761 151 HOH HOH A . 
P 5 HOH 151 762 152 HOH HOH A . 
P 5 HOH 152 763 153 HOH HOH A . 
P 5 HOH 153 764 154 HOH HOH A . 
P 5 HOH 154 765 155 HOH HOH A . 
P 5 HOH 155 766 156 HOH HOH A . 
P 5 HOH 156 767 157 HOH HOH A . 
P 5 HOH 157 768 158 HOH HOH A . 
P 5 HOH 158 769 159 HOH HOH A . 
P 5 HOH 159 770 160 HOH HOH A . 
P 5 HOH 160 771 161 HOH HOH A . 
P 5 HOH 161 772 162 HOH HOH A . 
P 5 HOH 162 773 163 HOH HOH A . 
P 5 HOH 163 774 164 HOH HOH A . 
P 5 HOH 164 775 165 HOH HOH A . 
P 5 HOH 165 776 166 HOH HOH A . 
P 5 HOH 166 777 167 HOH HOH A . 
P 5 HOH 167 778 168 HOH HOH A . 
P 5 HOH 168 779 169 HOH HOH A . 
P 5 HOH 169 780 170 HOH HOH A . 
P 5 HOH 170 781 171 HOH HOH A . 
P 5 HOH 171 782 172 HOH HOH A . 
P 5 HOH 172 783 173 HOH HOH A . 
P 5 HOH 173 784 174 HOH HOH A . 
P 5 HOH 174 785 175 HOH HOH A . 
P 5 HOH 175 786 176 HOH HOH A . 
P 5 HOH 176 787 177 HOH HOH A . 
P 5 HOH 177 788 178 HOH HOH A . 
P 5 HOH 178 789 179 HOH HOH A . 
P 5 HOH 179 790 180 HOH HOH A . 
P 5 HOH 180 791 181 HOH HOH A . 
P 5 HOH 181 792 182 HOH HOH A . 
P 5 HOH 182 793 183 HOH HOH A . 
P 5 HOH 183 794 184 HOH HOH A . 
P 5 HOH 184 795 185 HOH HOH A . 
P 5 HOH 185 796 186 HOH HOH A . 
P 5 HOH 186 797 187 HOH HOH A . 
P 5 HOH 187 798 188 HOH HOH A . 
P 5 HOH 188 799 189 HOH HOH A . 
P 5 HOH 189 800 190 HOH HOH A . 
P 5 HOH 190 801 191 HOH HOH A . 
P 5 HOH 191 802 192 HOH HOH A . 
P 5 HOH 192 803 193 HOH HOH A . 
P 5 HOH 193 804 194 HOH HOH A . 
P 5 HOH 194 805 195 HOH HOH A . 
P 5 HOH 195 806 196 HOH HOH A . 
P 5 HOH 196 807 197 HOH HOH A . 
P 5 HOH 197 808 198 HOH HOH A . 
P 5 HOH 198 809 199 HOH HOH A . 
P 5 HOH 199 810 200 HOH HOH A . 
P 5 HOH 200 811 201 HOH HOH A . 
P 5 HOH 201 812 202 HOH HOH A . 
P 5 HOH 202 813 203 HOH HOH A . 
P 5 HOH 203 814 204 HOH HOH A . 
P 5 HOH 204 815 205 HOH HOH A . 
P 5 HOH 205 816 206 HOH HOH A . 
P 5 HOH 206 817 207 HOH HOH A . 
P 5 HOH 207 818 208 HOH HOH A . 
P 5 HOH 208 819 209 HOH HOH A . 
P 5 HOH 209 820 210 HOH HOH A . 
P 5 HOH 210 821 211 HOH HOH A . 
P 5 HOH 211 822 212 HOH HOH A . 
P 5 HOH 212 823 213 HOH HOH A . 
P 5 HOH 213 824 214 HOH HOH A . 
P 5 HOH 214 825 215 HOH HOH A . 
P 5 HOH 215 826 216 HOH HOH A . 
P 5 HOH 216 827 217 HOH HOH A . 
P 5 HOH 217 828 218 HOH HOH A . 
P 5 HOH 218 829 219 HOH HOH A . 
P 5 HOH 219 830 220 HOH HOH A . 
P 5 HOH 220 831 221 HOH HOH A . 
P 5 HOH 221 832 222 HOH HOH A . 
P 5 HOH 222 833 223 HOH HOH A . 
P 5 HOH 223 834 224 HOH HOH A . 
P 5 HOH 224 835 225 HOH HOH A . 
P 5 HOH 225 836 226 HOH HOH A . 
P 5 HOH 226 837 227 HOH HOH A . 
P 5 HOH 227 838 228 HOH HOH A . 
P 5 HOH 228 839 229 HOH HOH A . 
P 5 HOH 229 840 230 HOH HOH A . 
P 5 HOH 230 841 231 HOH HOH A . 
P 5 HOH 231 842 232 HOH HOH A . 
P 5 HOH 232 843 233 HOH HOH A . 
P 5 HOH 233 844 234 HOH HOH A . 
P 5 HOH 234 845 235 HOH HOH A . 
P 5 HOH 235 846 236 HOH HOH A . 
P 5 HOH 236 847 237 HOH HOH A . 
P 5 HOH 237 848 238 HOH HOH A . 
P 5 HOH 238 849 239 HOH HOH A . 
P 5 HOH 239 850 240 HOH HOH A . 
P 5 HOH 240 851 241 HOH HOH A . 
P 5 HOH 241 852 242 HOH HOH A . 
P 5 HOH 242 853 243 HOH HOH A . 
P 5 HOH 243 854 244 HOH HOH A . 
P 5 HOH 244 855 245 HOH HOH A . 
P 5 HOH 245 856 246 HOH HOH A . 
P 5 HOH 246 857 247 HOH HOH A . 
P 5 HOH 247 858 248 HOH HOH A . 
P 5 HOH 248 859 249 HOH HOH A . 
P 5 HOH 249 860 250 HOH HOH A . 
P 5 HOH 250 861 251 HOH HOH A . 
P 5 HOH 251 862 252 HOH HOH A . 
P 5 HOH 252 863 253 HOH HOH A . 
P 5 HOH 253 864 254 HOH HOH A . 
P 5 HOH 254 865 255 HOH HOH A . 
P 5 HOH 255 866 256 HOH HOH A . 
P 5 HOH 256 867 257 HOH HOH A . 
P 5 HOH 257 868 258 HOH HOH A . 
P 5 HOH 258 869 259 HOH HOH A . 
P 5 HOH 259 870 260 HOH HOH A . 
P 5 HOH 260 871 261 HOH HOH A . 
P 5 HOH 261 872 262 HOH HOH A . 
P 5 HOH 262 873 263 HOH HOH A . 
P 5 HOH 263 874 264 HOH HOH A . 
P 5 HOH 264 875 265 HOH HOH A . 
P 5 HOH 265 876 266 HOH HOH A . 
P 5 HOH 266 877 267 HOH HOH A . 
P 5 HOH 267 878 268 HOH HOH A . 
P 5 HOH 268 879 269 HOH HOH A . 
P 5 HOH 269 880 270 HOH HOH A . 
P 5 HOH 270 881 271 HOH HOH A . 
P 5 HOH 271 882 272 HOH HOH A . 
P 5 HOH 272 883 273 HOH HOH A . 
P 5 HOH 273 884 274 HOH HOH A . 
P 5 HOH 274 885 275 HOH HOH A . 
P 5 HOH 275 886 276 HOH HOH A . 
P 5 HOH 276 887 277 HOH HOH A . 
P 5 HOH 277 888 278 HOH HOH A . 
P 5 HOH 278 889 279 HOH HOH A . 
P 5 HOH 279 890 280 HOH HOH A . 
P 5 HOH 280 891 281 HOH HOH A . 
P 5 HOH 281 892 282 HOH HOH A . 
P 5 HOH 282 893 283 HOH HOH A . 
P 5 HOH 283 894 284 HOH HOH A . 
P 5 HOH 284 895 285 HOH HOH A . 
P 5 HOH 285 896 286 HOH HOH A . 
P 5 HOH 286 897 287 HOH HOH A . 
P 5 HOH 287 898 288 HOH HOH A . 
P 5 HOH 288 899 289 HOH HOH A . 
P 5 HOH 289 900 290 HOH HOH A . 
P 5 HOH 290 901 291 HOH HOH A . 
P 5 HOH 291 902 292 HOH HOH A . 
P 5 HOH 292 903 293 HOH HOH A . 
P 5 HOH 293 904 294 HOH HOH A . 
P 5 HOH 294 905 295 HOH HOH A . 
P 5 HOH 295 906 296 HOH HOH A . 
P 5 HOH 296 907 297 HOH HOH A . 
P 5 HOH 297 908 298 HOH HOH A . 
P 5 HOH 298 909 299 HOH HOH A . 
P 5 HOH 299 910 300 HOH HOH A . 
P 5 HOH 300 911 301 HOH HOH A . 
P 5 HOH 301 912 302 HOH HOH A . 
P 5 HOH 302 913 303 HOH HOH A . 
P 5 HOH 303 914 304 HOH HOH A . 
P 5 HOH 304 915 305 HOH HOH A . 
P 5 HOH 305 916 306 HOH HOH A . 
P 5 HOH 306 917 307 HOH HOH A . 
P 5 HOH 307 918 308 HOH HOH A . 
P 5 HOH 308 919 309 HOH HOH A . 
P 5 HOH 309 920 310 HOH HOH A . 
P 5 HOH 310 921 311 HOH HOH A . 
P 5 HOH 311 922 312 HOH HOH A . 
P 5 HOH 312 923 313 HOH HOH A . 
P 5 HOH 313 924 314 HOH HOH A . 
P 5 HOH 314 925 315 HOH HOH A . 
P 5 HOH 315 926 316 HOH HOH A . 
P 5 HOH 316 927 317 HOH HOH A . 
P 5 HOH 317 928 318 HOH HOH A . 
P 5 HOH 318 929 319 HOH HOH A . 
P 5 HOH 319 930 320 HOH HOH A . 
P 5 HOH 320 931 321 HOH HOH A . 
P 5 HOH 321 932 322 HOH HOH A . 
P 5 HOH 322 933 323 HOH HOH A . 
P 5 HOH 323 934 324 HOH HOH A . 
P 5 HOH 324 935 325 HOH HOH A . 
P 5 HOH 325 936 326 HOH HOH A . 
P 5 HOH 326 937 327 HOH HOH A . 
P 5 HOH 327 938 328 HOH HOH A . 
P 5 HOH 328 939 329 HOH HOH A . 
P 5 HOH 329 940 330 HOH HOH A . 
P 5 HOH 330 941 331 HOH HOH A . 
P 5 HOH 331 942 332 HOH HOH A . 
P 5 HOH 332 943 333 HOH HOH A . 
P 5 HOH 333 944 334 HOH HOH A . 
P 5 HOH 334 945 335 HOH HOH A . 
P 5 HOH 335 946 336 HOH HOH A . 
P 5 HOH 336 947 337 HOH HOH A . 
P 5 HOH 337 948 338 HOH HOH A . 
P 5 HOH 338 949 339 HOH HOH A . 
P 5 HOH 339 950 340 HOH HOH A . 
P 5 HOH 340 951 341 HOH HOH A . 
P 5 HOH 341 952 342 HOH HOH A . 
P 5 HOH 342 953 343 HOH HOH A . 
P 5 HOH 343 954 344 HOH HOH A . 
P 5 HOH 344 955 345 HOH HOH A . 
P 5 HOH 345 956 346 HOH HOH A . 
P 5 HOH 346 957 347 HOH HOH A . 
P 5 HOH 347 958 348 HOH HOH A . 
P 5 HOH 348 959 349 HOH HOH A . 
P 5 HOH 349 960 350 HOH HOH A . 
P 5 HOH 350 961 351 HOH HOH A . 
P 5 HOH 351 962 352 HOH HOH A . 
P 5 HOH 352 963 353 HOH HOH A . 
P 5 HOH 353 964 354 HOH HOH A . 
P 5 HOH 354 965 355 HOH HOH A . 
P 5 HOH 355 966 356 HOH HOH A . 
P 5 HOH 356 967 357 HOH HOH A . 
P 5 HOH 357 968 358 HOH HOH A . 
P 5 HOH 358 969 359 HOH HOH A . 
P 5 HOH 359 970 360 HOH HOH A . 
P 5 HOH 360 971 361 HOH HOH A . 
P 5 HOH 361 972 362 HOH HOH A . 
P 5 HOH 362 973 363 HOH HOH A . 
P 5 HOH 363 974 364 HOH HOH A . 
P 5 HOH 364 975 365 HOH HOH A . 
P 5 HOH 365 976 366 HOH HOH A . 
P 5 HOH 366 977 367 HOH HOH A . 
P 5 HOH 367 978 368 HOH HOH A . 
P 5 HOH 368 979 369 HOH HOH A . 
P 5 HOH 369 980 370 HOH HOH A . 
P 5 HOH 370 981 371 HOH HOH A . 
P 5 HOH 371 982 372 HOH HOH A . 
P 5 HOH 372 983 373 HOH HOH A . 
P 5 HOH 373 984 374 HOH HOH A . 
P 5 HOH 374 985 375 HOH HOH A . 
P 5 HOH 375 986 376 HOH HOH A . 
P 5 HOH 376 987 377 HOH HOH A . 
P 5 HOH 377 988 378 HOH HOH A . 
P 5 HOH 378 989 379 HOH HOH A . 
P 5 HOH 379 990 380 HOH HOH A . 
P 5 HOH 380 991 381 HOH HOH A . 
P 5 HOH 381 992 382 HOH HOH A . 
P 5 HOH 382 993 383 HOH HOH A . 
P 5 HOH 383 994 384 HOH HOH A . 
P 5 HOH 384 995 385 HOH HOH A . 
P 5 HOH 385 996 386 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        monomeric 1 
2 software_defined_assembly PISA     dimeric   2 
3 software_defined_assembly PISA,PQS dimeric   2 
4 software_defined_assembly PISA     dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
2 1,2 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
3 1,3 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
4 1,4 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 6660  ? 
2 MORE         -658  ? 
2 'SSA (A^2)'  13210 ? 
3 'ABSA (A^2)' 5030  ? 
3 MORE         -493  ? 
3 'SSA (A^2)'  13900 ? 
4 'ABSA (A^2)' 4350  ? 
4 MORE         -478  ? 
4 'SSA (A^2)'  14370 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_566 x,x-y+1,-z+7/6   0.5000000000 0.8660254038  0.0000000000 -43.3630000000 0.8660254038  
-0.5000000000 0.0000000000 75.1069191686  0.0000000000 0.0000000000 -1.0000000000 135.5316666667 
3 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+5/6 0.5000000000 -0.8660254038 0.0000000000 43.3630000000  -0.8660254038 
-0.5000000000 0.0000000000 75.1069191686  0.0000000000 0.0000000000 -1.0000000000 96.8083333333  
4 'crystal symmetry operation' 8_676  x-y+1,-y+2,-z+1  1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 150.2138383372 0.0000000000 0.0000000000 -1.0000000000 116.1700000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CS 
_pdbx_struct_special_symmetry.auth_seq_id     602 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   CS 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 1_555  67.6  ? 
2   O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 1_555  83.4  ? 
3   O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 1_555  141.1 ? 
4   O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 1_555  78.4  ? 
5   O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 1_555  95.3  ? 
6   O   ? P HOH .   ? A HOH 625 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 1_555  52.3  ? 
7   O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 113 ? A LEU 113 ? 10_665 132.3 ? 
8   O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 113 ? A LEU 113 ? 10_665 72.7  ? 
9   O   ? P HOH .   ? A HOH 625 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 113 ? A LEU 113 ? 10_665 143.4 ? 
10  O   ? A LEU 116 ? A LEU 116 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 113 ? A LEU 113 ? 10_665 131.5 ? 
11  O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 10_665 72.7  ? 
12  O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 10_665 66.3  ? 
13  O   ? P HOH .   ? A HOH 625 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 10_665 130.1 ? 
14  O   ? A LEU 116 ? A LEU 116 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 10_665 150.0 ? 
15  O   ? A LEU 113 ? A LEU 113 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? A ASP 114 ? A ASP 114 ? 10_665 67.7  ? 
16  O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 131.5 ? 
17  O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 150.0 ? 
18  O   ? P HOH .   ? A HOH 625 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 69.0  ? 
19  O   ? A LEU 116 ? A LEU 116 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 110.3 ? 
20  O   ? A LEU 113 ? A LEU 113 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 78.5  ? 
21  O   ? A ASP 114 ? A ASP 114 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? A LEU 116 ? A LEU 116 ? 10_665 95.3  ? 
22  O   ? A LEU 113 ? A LEU 113 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 143.4 ? 
23  O   ? A ASP 114 ? A ASP 114 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 130.1 ? 
24  O   ? P HOH .   ? A HOH 625 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 63.8  ? 
25  O   ? A LEU 116 ? A LEU 116 ? 1_555  CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 69.0  ? 
26  O   ? A LEU 113 ? A LEU 113 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 83.4  ? 
27  O   ? A ASP 114 ? A ASP 114 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 141.1 ? 
28  O   ? A LEU 116 ? A LEU 116 ? 10_665 CS ? F CS . ? A CS 602 ? 1_555 O   ? P HOH .   ? A HOH 625 ? 10_665 52.3  ? 
29  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 695 ? 1_555  49.7  ? 
30  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 739 ? 1_555  122.7 ? 
31  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 739 ? 1_555  80.0  ? 
32  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 857 ? 1_555  58.1  ? 
33  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 857 ? 1_555  86.9  ? 
34  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 857 ? 1_555  99.9  ? 
35  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 627 ? 1_555  114.6 ? 
36  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 627 ? 1_555  72.6  ? 
37  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 627 ? 1_555  61.4  ? 
38  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 627 ? 1_555  153.9 ? 
39  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OD1 ? A ASN 62  ? A ASN 62  ? 12_566 141.5 ? 
40  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OD1 ? A ASN 62  ? A ASN 62  ? 12_566 154.2 ? 
41  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OD1 ? A ASN 62  ? A ASN 62  ? 12_566 76.2  ? 
42  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OD1 ? A ASN 62  ? A ASN 62  ? 12_566 87.4  ? 
43  O   ? P HOH .   ? A HOH 627 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OD1 ? A ASN 62  ? A ASN 62  ? 12_566 104.0 ? 
44  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 113.8 ? 
45  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 121.6 ? 
46  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 66.6  ? 
47  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 55.8  ? 
48  O   ? P HOH .   ? A HOH 627 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 122.1 ? 
49  OD1 ? A ASN 62  ? A ASN 62  ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 936 ? 12_566 38.0  ? 
50  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 96.8  ? 
51  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 146.5 ? 
52  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 129.0 ? 
53  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 73.0  ? 
54  O   ? P HOH .   ? A HOH 627 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 132.6 ? 
55  OD1 ? A ASN 62  ? A ASN 62  ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 53.4  ? 
56  O   ? P HOH .   ? A HOH 936 ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 667 ? 12_566 68.5  ? 
57  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 127.0 ? 
58  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 124.6 ? 
59  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 102.1 ? 
60  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 144.1 ? 
61  O   ? P HOH .   ? A HOH 627 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 61.7  ? 
62  OD1 ? A ASN 62  ? A ASN 62  ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 70.9  ? 
63  O   ? P HOH .   ? A HOH 936 ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 108.9 ? 
64  O   ? P HOH .   ? A HOH 667 ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 12_566 71.1  ? 
65  OD2 ? A ASP 128 ? A ASP 128 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 87.1  ? 
66  O   ? P HOH .   ? A HOH 695 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 73.6  ? 
67  O   ? P HOH .   ? A HOH 739 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 105.4 ? 
68  O   ? P HOH .   ? A HOH 857 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 144.5 ? 
69  O   ? P HOH .   ? A HOH 627 ? 1_555  CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 44.3  ? 
70  OD1 ? A ASN 62  ? A ASN 62  ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 122.4 ? 
71  O   ? P HOH .   ? A HOH 936 ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 158.9 ? 
72  O   ? P HOH .   ? A HOH 667 ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 107.8 ? 
73  OE1 ? A GLU 67  ? A GLU 67  ? 12_566 CS ? G CS . ? A CS 603 ? 1_555 O   ? P HOH .   ? A HOH 664 ? 12_566 52.1  ? 
74  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? A PRO 38  ? A PRO 38  ? 1_555  65.4  ? 
75  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 651 ? 1_555  99.8  ? 
76  O   ? A PRO 38  ? A PRO 38  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 651 ? 1_555  62.4  ? 
77  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 751 ? 1_555  103.0 ? 
78  O   ? A PRO 38  ? A PRO 38  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 751 ? 1_555  47.3  ? 
79  O   ? P HOH .   ? A HOH 651 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 751 ? 1_555  80.8  ? 
80  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 905 ? 1_555  68.8  ? 
81  O   ? A PRO 38  ? A PRO 38  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 905 ? 1_555  75.3  ? 
82  O   ? P HOH .   ? A HOH 651 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 905 ? 1_555  136.6 ? 
83  O   ? P HOH .   ? A HOH 751 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 905 ? 1_555  62.8  ? 
84  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 971 ? 1_555  164.4 ? 
85  O   ? A PRO 38  ? A PRO 38  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 971 ? 1_555  99.2  ? 
86  O   ? P HOH .   ? A HOH 651 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 971 ? 1_555  69.6  ? 
87  O   ? P HOH .   ? A HOH 751 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 971 ? 1_555  64.8  ? 
88  O   ? P HOH .   ? A HOH 905 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 971 ? 1_555  110.6 ? 
89  N   ? A SER 40  ? A SER 40  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  118.6 ? 
90  O   ? A PRO 38  ? A PRO 38  ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  97.0  ? 
91  O   ? P HOH .   ? A HOH 651 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  123.9 ? 
92  O   ? P HOH .   ? A HOH 751 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  53.3  ? 
93  O   ? P HOH .   ? A HOH 905 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  49.9  ? 
94  O   ? P HOH .   ? A HOH 971 ? 1_555  CS ? H CS . ? A CS 604 ? 1_555 O   ? P HOH .   ? A HOH 967 ? 1_555  63.0  ? 
95  O   ? P HOH .   ? A HOH 686 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 879 ? 1_555  102.9 ? 
96  O   ? P HOH .   ? A HOH 686 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 OG1 ? A THR 27  ? A THR 27  ? 1_555  50.7  ? 
97  O   ? P HOH .   ? A HOH 879 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 OG1 ? A THR 27  ? A THR 27  ? 1_555  100.0 ? 
98  O   ? P HOH .   ? A HOH 686 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? A GLY 26  ? A GLY 26  ? 1_555  73.0  ? 
99  O   ? P HOH .   ? A HOH 879 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? A GLY 26  ? A GLY 26  ? 1_555  165.6 ? 
100 OG1 ? A THR 27  ? A THR 27  ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? A GLY 26  ? A GLY 26  ? 1_555  66.5  ? 
101 O   ? P HOH .   ? A HOH 686 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 992 ? 1_555  100.3 ? 
102 O   ? P HOH .   ? A HOH 879 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 992 ? 1_555  147.8 ? 
103 OG1 ? A THR 27  ? A THR 27  ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 992 ? 1_555  112.0 ? 
104 O   ? A GLY 26  ? A GLY 26  ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 992 ? 1_555  45.5  ? 
105 O   ? P HOH .   ? A HOH 686 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 915 ? 1_555  128.2 ? 
106 O   ? P HOH .   ? A HOH 879 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 915 ? 1_555  106.2 ? 
107 OG1 ? A THR 27  ? A THR 27  ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 915 ? 1_555  82.4  ? 
108 O   ? A GLY 26  ? A GLY 26  ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 915 ? 1_555  68.2  ? 
109 O   ? P HOH .   ? A HOH 992 ? 1_555  CS ? I CS . ? A CS 605 ? 1_555 O   ? P HOH .   ? A HOH 915 ? 1_555  75.4  ? 
110 O   ? P HOH .   ? A HOH 680 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  77.8  ? 
111 O   ? P HOH .   ? A HOH 680 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 717 ? 1_555  75.3  ? 
112 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 717 ? 1_555  58.0  ? 
113 O   ? P HOH .   ? A HOH 680 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 CS  ? L CS  .   ? A CS  608 ? 1_555  80.1  ? 
114 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 CS  ? L CS  .   ? A CS  608 ? 1_555  62.8  ? 
115 O   ? P HOH .   ? A HOH 717 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 CS  ? L CS  .   ? A CS  608 ? 1_555  119.1 ? 
116 O   ? P HOH .   ? A HOH 680 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  123.5 ? 
117 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  102.3 ? 
118 O   ? P HOH .   ? A HOH 717 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  151.6 ? 
119 CS  ? L CS  .   ? A CS  608 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  53.5  ? 
120 O   ? P HOH .   ? A HOH 680 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 NE2 ? A GLN 87  ? A GLN 87  ? 8_676  73.3  ? 
121 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 NE2 ? A GLN 87  ? A GLN 87  ? 8_676  134.6 ? 
122 O   ? P HOH .   ? A HOH 717 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 NE2 ? A GLN 87  ? A GLN 87  ? 8_676  81.0  ? 
123 CS  ? L CS  .   ? A CS  608 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 NE2 ? A GLN 87  ? A GLN 87  ? 8_676  141.2 ? 
124 O   ? P HOH .   ? A HOH 973 ? 1_555  CS ? J CS . ? A CS 606 ? 1_555 NE2 ? A GLN 87  ? A GLN 87  ? 8_676  122.8 ? 
125 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 782 ? 1_555  87.6  ? 
126 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 807 ? 1_555  51.0  ? 
127 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 807 ? 1_555  69.2  ? 
128 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 811 ? 1_555  170.6 ? 
129 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 811 ? 1_555  83.0  ? 
130 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 811 ? 1_555  123.5 ? 
131 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 N   ? A GLY 122 ? A GLY 122 ? 1_555  94.7  ? 
132 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 N   ? A GLY 122 ? A GLY 122 ? 1_555  83.7  ? 
133 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 N   ? A GLY 122 ? A GLY 122 ? 1_555  135.3 ? 
134 O   ? P HOH .   ? A HOH 811 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 N   ? A GLY 122 ? A GLY 122 ? 1_555  85.6  ? 
135 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLU 135 ? A GLU 135 ? 1_555  117.5 ? 
136 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLU 135 ? A GLU 135 ? 1_555  153.6 ? 
137 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLU 135 ? A GLU 135 ? 1_555  119.3 ? 
138 O   ? P HOH .   ? A HOH 811 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLU 135 ? A GLU 135 ? 1_555  71.5  ? 
139 N   ? A GLY 122 ? A GLY 122 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLU 135 ? A GLU 135 ? 1_555  100.9 ? 
140 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  64.2  ? 
141 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  133.7 ? 
142 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  110.5 ? 
143 O   ? P HOH .   ? A HOH 811 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  123.8 ? 
144 N   ? A GLY 122 ? A GLY 122 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  64.4  ? 
145 O   ? A GLU 135 ? A GLU 135 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? P HOH .   ? A HOH 731 ? 1_555  69.5  ? 
146 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  119.1 ? 
147 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  65.4  ? 
148 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  134.0 ? 
149 O   ? P HOH .   ? A HOH 811 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  57.7  ? 
150 N   ? A GLY 122 ? A GLY 122 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  33.1  ? 
151 O   ? A GLU 135 ? A GLU 135 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  104.8 ? 
152 O   ? P HOH .   ? A HOH 731 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A LYS 121 ? A LYS 121 ? 1_555  95.9  ? 
153 O   ? P HOH .   ? A HOH 658 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  49.7  ? 
154 O   ? P HOH .   ? A HOH 782 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  59.0  ? 
155 O   ? P HOH .   ? A HOH 807 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  81.1  ? 
156 O   ? P HOH .   ? A HOH 811 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  124.9 ? 
157 N   ? A GLY 122 ? A GLY 122 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  54.3  ? 
158 O   ? A GLU 135 ? A GLU 135 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  143.4 ? 
159 O   ? P HOH .   ? A HOH 731 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  75.0  ? 
160 O   ? A LYS 121 ? A LYS 121 ? 1_555  CS ? K CS . ? A CS 607 ? 1_555 O   ? A GLN 120 ? A GLN 120 ? 1_555  70.0  ? 
161 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  78.6  ? 
162 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 733 ? 1_555  99.0  ? 
163 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 733 ? 1_555  104.6 ? 
164 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 734 ? 1_555  113.7 ? 
165 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 734 ? 1_555  47.6  ? 
166 O   ? P HOH .   ? A HOH 733 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 734 ? 1_555  68.4  ? 
167 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 963 ? 1_555  158.8 ? 
168 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 963 ? 1_555  93.5  ? 
169 O   ? P HOH .   ? A HOH 733 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 963 ? 1_555  63.6  ? 
170 O   ? P HOH .   ? A HOH 734 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 963 ? 1_555  50.2  ? 
171 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  156.5 ? 
172 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  120.4 ? 
173 O   ? P HOH .   ? A HOH 733 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  89.8  ? 
174 O   ? P HOH .   ? A HOH 734 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  89.8  ? 
175 O   ? P HOH .   ? A HOH 963 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 973 ? 1_555  42.5  ? 
176 O   ? P HOH .   ? A HOH 771 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  49.6  ? 
177 OE2 ? A GLU 64  ? A GLU 64  ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  71.5  ? 
178 O   ? P HOH .   ? A HOH 733 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  148.5 ? 
179 O   ? P HOH .   ? A HOH 734 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  118.6 ? 
180 O   ? P HOH .   ? A HOH 963 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  146.2 ? 
181 O   ? P HOH .   ? A HOH 973 ? 1_555  CS ? L CS . ? A CS 608 ? 1_555 O   ? P HOH .   ? A HOH 680 ? 1_555  119.7 ? 
182 OE1 ? A GLU 73  ? A GLU 73  ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 677 ? 1_555  133.6 ? 
183 OE1 ? A GLU 73  ? A GLU 73  ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? A ASP 128 ? A ASP 128 ? 12_566 141.2 ? 
184 O   ? P HOH .   ? A HOH 677 ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? A ASP 128 ? A ASP 128 ? 12_566 68.1  ? 
185 OE1 ? A GLU 73  ? A GLU 73  ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 622 ? 12_566 98.5  ? 
186 O   ? P HOH .   ? A HOH 677 ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 622 ? 12_566 77.9  ? 
187 O   ? A ASP 128 ? A ASP 128 ? 12_566 CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 622 ? 12_566 49.4  ? 
188 OE1 ? A GLU 73  ? A GLU 73  ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 894 ? 8_676  89.4  ? 
189 O   ? P HOH .   ? A HOH 677 ? 1_555  CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 894 ? 8_676  136.2 ? 
190 O   ? A ASP 128 ? A ASP 128 ? 12_566 CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 894 ? 8_676  82.9  ? 
191 O   ? P HOH .   ? A HOH 622 ? 12_566 CS ? M CS . ? A CS 609 ? 1_555 O   ? P HOH .   ? A HOH 894 ? 8_676  107.7 ? 
192 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O   ? P HOH .   ? A HOH 789 ? 1_555  48.7  ? 
193 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O4  ? B SO4 .   ? A SO4 402 ? 12_566 63.8  ? 
194 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O4  ? B SO4 .   ? A SO4 402 ? 12_566 94.0  ? 
195 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O3  ? B SO4 .   ? A SO4 402 ? 12_566 84.6  ? 
196 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O3  ? B SO4 .   ? A SO4 402 ? 12_566 79.0  ? 
197 O4  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O3  ? B SO4 .   ? A SO4 402 ? 12_566 45.4  ? 
198 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O   ? P HOH .   ? A HOH 866 ? 12_566 84.3  ? 
199 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O   ? P HOH .   ? A HOH 866 ? 12_566 46.3  ? 
200 O4  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O   ? P HOH .   ? A HOH 866 ? 12_566 86.6  ? 
201 O3  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O   ? P HOH .   ? A HOH 866 ? 12_566 46.5  ? 
202 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 S   ? E SO3 .   ? A SO3 502 ? 12_566 164.4 ? 
203 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 S   ? E SO3 .   ? A SO3 502 ? 12_566 140.4 ? 
204 O4  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? E SO3 .   ? A SO3 502 ? 12_566 100.8 ? 
205 O3  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? E SO3 .   ? A SO3 502 ? 12_566 85.7  ? 
206 O   ? P HOH .   ? A HOH 866 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? E SO3 .   ? A SO3 502 ? 12_566 97.8  ? 
207 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 151.2 ? 
208 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 125.0 ? 
209 O4  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 91.5  ? 
210 O3  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 67.0  ? 
211 O   ? P HOH .   ? A HOH 866 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 79.6  ? 
212 S   ? E SO3 .   ? A SO3 502 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 O3  ? E SO3 .   ? A SO3 502 ? 12_566 20.0  ? 
213 O   ? A ASN 62  ? A ASN 62  ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 70.0  ? 
214 O   ? P HOH .   ? A HOH 789 ? 1_555  CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 82.4  ? 
215 O4  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 23.6  ? 
216 O3  ? B SO4 .   ? A SO4 402 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 22.4  ? 
217 O   ? P HOH .   ? A HOH 866 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 63.8  ? 
218 S   ? E SO3 .   ? A SO3 502 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 97.0  ? 
219 O3  ? E SO3 .   ? A SO3 502 ? 12_566 CS ? N CS . ? A CS 610 ? 1_555 S   ? B SO4 .   ? A SO4 402 ? 12_566 81.6  ? 
220 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 N   ? A ILE 4   ? A ILE 4   ? 1_555  90.7  ? 
221 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? A ILE 4   ? A ILE 4   ? 1_555  81.7  ? 
222 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? A ILE 4   ? A ILE 4   ? 1_555  47.1  ? 
223 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 N   ? A THR 30  ? A THR 30  ? 1_555  97.7  ? 
224 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 N   ? A THR 30  ? A THR 30  ? 1_555  90.6  ? 
225 O   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 N   ? A THR 30  ? A THR 30  ? 1_555  47.0  ? 
226 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 OG1 ? A THR 30  ? A THR 30  ? 1_555  64.5  ? 
227 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 OG1 ? A THR 30  ? A THR 30  ? 1_555  126.4 ? 
228 O   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 OG1 ? A THR 30  ? A THR 30  ? 1_555  81.3  ? 
229 N   ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 OG1 ? A THR 30  ? A THR 30  ? 1_555  51.1  ? 
230 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 643 ? 1_555  145.7 ? 
231 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 643 ? 1_555  55.2  ? 
232 O   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 643 ? 1_555  71.9  ? 
233 N   ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 643 ? 1_555  80.2  ? 
234 OG1 ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 643 ? 1_555  129.7 ? 
235 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  139.6 ? 
236 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  111.6 ? 
237 O   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  138.1 ? 
238 N   ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  114.5 ? 
239 OG1 ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  117.9 ? 
240 O   ? P HOH .   ? A HOH 643 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 O   ? P HOH .   ? A HOH 979 ? 1_555  67.5  ? 
241 O   ? P HOH .   ? A HOH 875 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  52.8  ? 
242 N   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  57.1  ? 
243 O   ? A ILE 4   ? A ILE 4   ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  87.1  ? 
244 N   ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  131.2 ? 
245 OG1 ? A THR 30  ? A THR 30  ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  117.3 ? 
246 O   ? P HOH .   ? A HOH 643 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  103.2 ? 
247 O   ? P HOH .   ? A HOH 979 ? 1_555  CS ? O CS . ? A CS 611 ? 1_555 ND2 ? A ASN 3   ? A ASN 3   ? 1_555  111.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-12-05 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SOLVE    phasing          . ? 1 
PHASES   phasing          . ? 2 
ARP/wARP 'model building' . ? 3 
SHELXL   refinement       . ? 4 
X-GEN    'data reduction' . ? 5 
X-GEN    'data scaling'   . ? 6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 O   A HIS 8   ? ? C  A HIS 8   ? ? N   A ASN 9   ? ? 110.35 122.70 -12.35 1.60 Y 
2  1 C   A HIS 8   ? ? N  A ASN 9   ? ? CA  A ASN 9   ? ? 144.76 121.70 23.06  2.50 Y 
3  1 NE  A ARG 16  ? ? CZ A ARG 16  ? ? NH1 A ARG 16  ? ? 123.71 120.30 3.41   0.50 N 
4  1 NE  A ARG 16  ? ? CZ A ARG 16  ? ? NH2 A ARG 16  ? ? 116.85 120.30 -3.45  0.50 N 
5  1 NH1 A ARG 23  ? ? CZ A ARG 23  ? ? NH2 A ARG 23  ? ? 112.43 119.40 -6.97  1.10 N 
6  1 NE  A ARG 23  ? ? CZ A ARG 23  ? ? NH1 A ARG 23  ? ? 124.51 120.30 4.21   0.50 N 
7  1 NE  A ARG 60  ? ? CZ A ARG 60  ? ? NH1 A ARG 60  ? ? 114.70 120.30 -5.60  0.50 N 
8  1 NE  A ARG 60  ? ? CZ A ARG 60  ? ? NH2 A ARG 60  ? ? 125.86 120.30 5.56   0.50 N 
9  1 O   A ASP 79  ? ? C  A ASP 79  ? ? N   A GLN 80  ? ? 112.23 122.70 -10.47 1.60 Y 
10 1 O   A PRO 100 ? ? C  A PRO 100 ? ? N   A LEU 101 ? ? 112.82 122.70 -9.88  1.60 Y 
11 1 NE  A ARG 107 ? ? CZ A ARG 107 ? ? NH1 A ARG 107 ? ? 127.21 120.30 6.91   0.50 N 
12 1 NE  A ARG 107 ? ? CZ A ARG 107 ? ? NH2 A ARG 107 ? ? 116.90 120.30 -3.40  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A SER 2   ? A SER 2   
3 1 Y 1 A LYS 141 ? A LYS 141 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'SULFITE ION' SO3 
4 'CESIUM ION'  CS  
5 water         HOH 
#