data_1IAO
# 
_entry.id   1IAO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IAO         
WWPDB D_1000174093 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IAO 
_pdbx_database_status.recvd_initial_deposition_date   1998-03-13 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scott, C.A.'    1 
'Peterson, P.A.' 2 
'Teyton, L.'     3 
'Wilson, I.A.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Crystal structures of two I-Ad-peptide complexes reveal that high affinity can be achieved without large anchor residues.' 
Immunity       8   319  329 1998 IUNIEH US 1074-7613 2048 ? 9529149 '10.1016/S1074-7613(00)80537-3' 
1       
'Erratum. Crystal Structures of Two I-Ad-Peptide Complexes Reveal that High Affinity Can be Achieved without Large Anchor Residues' 
Immunity       8   531  ?   1998 IUNIEH US 1074-7613 2048 ? ?       ?                               
2       'Engineering Protein for X-Ray Crystallography: The Murine Major Histocompatibility Complex Class II Molecule I-Ad' 
'Protein Sci.' 7   413  ?   1998 PRCIEI US 0961-8368 0795 ? ?       ?                               
3       'Role of Chain Pairing for the Production of Functional Soluble Ia Major Histocompatibility Complex Class II Molecules' 
J.Exp.Med.     183 2087 ?   1996 JEMEAV US 0022-1007 0774 ? ?       ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Scott, C.A.'    1  ? 
primary 'Peterson, P.A.' 2  ? 
primary 'Teyton, L.'     3  ? 
primary 'Wilson, I.A.'   4  ? 
1       'Scott, C.A.'    5  ? 
1       'Peterson, P.A.' 6  ? 
1       'Teyton, L.'     7  ? 
1       'Wilson, I.A.'   8  ? 
2       'Scott, C.A.'    9  ? 
2       'Garcia, K.C.'   10 ? 
2       'Stura, E.A.'    11 ? 
2       'Peterson, P.A.' 12 ? 
2       'Wilson, I.A.'   13 ? 
2       'Teyton, L.'     14 ? 
3       'Scott, C.A.'    15 ? 
3       'Garcia, K.C.'   16 ? 
3       'Carbone, F.R.'  17 ? 
3       'Wilson, I.A.'   18 ? 
3       'Teyton, L.'     19 ? 
# 
_cell.entry_id           1IAO 
_cell.length_a           101.300 
_cell.length_b           101.300 
_cell.length_c           92.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IAO 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MHC CLASS II I-AD'                      22091.631 1 ? ? ? 
;BOTH THE A AND B CHAINS HAVE AN 8-RESIDUE (SSADLVPR) PEPTIDE BOUND TO THE C-TERMINUS. THE B CHAIN ALSO HAS A 24-RESIDUE PEPTIDE CONSISTING OF A 2-RESIDUE (RG) SIGNAL SEQUENCE, RESIDUES 323 - 339 OF HEN EGG OVALBUMIN AND A 6-RESIDUE (GSGSGS) LINKER, COVALENTLY BONDED TO THE N-TERMINUS.
;
2 polymer     man 'MHC CLASS II I-AD'                      25324.998 1 ? ? ? 
;BOTH THE A AND B CHAINS HAVE AN 8-RESIDUE (SSADLVPR) PEPTIDE BOUND TO THE C-TERMINUS. THE B CHAIN ALSO HAS A 24-RESIDUE PEPTIDE CONSISTING OF A 2-RESIDUE (RG) SIGNAL SEQUENCE, RESIDUES 323 - 339 OF HEN EGG OVALBUMIN AND A 6-RESIDUE (GSGSGS) LINKER, COVALENTLY BONDED TO THE N-TERMINUS.
;
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1 ? ? ? ? 
4 water       nat water                                    18.015    8 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWEPEISSADLVPR
;
;EDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKR
SNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPS
DDDIYDCKVEHWGLEEPVLKHWEPEISSADLVPR
;
A ? 
2 'polypeptide(L)' no no 
;RGISQAVHAAHAEINEAGRGSGSGSGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTELGR
PDAEYWNSQPEILDRTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRN
GQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSSADLVPR
;
;RGISQAVHAAHAEINEAGRGSGSGSGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTELGR
PDAEYWNSQPEILDRTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRN
GQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWSSADLVPR
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   GLU n 
1 6   ALA n 
1 7   ASP n 
1 8   HIS n 
1 9   VAL n 
1 10  GLY n 
1 11  PHE n 
1 12  TYR n 
1 13  GLY n 
1 14  THR n 
1 15  THR n 
1 16  VAL n 
1 17  TYR n 
1 18  GLN n 
1 19  SER n 
1 20  PRO n 
1 21  GLY n 
1 22  ASP n 
1 23  ILE n 
1 24  GLY n 
1 25  GLN n 
1 26  TYR n 
1 27  THR n 
1 28  HIS n 
1 29  GLU n 
1 30  PHE n 
1 31  ASP n 
1 32  GLY n 
1 33  ASP n 
1 34  GLU n 
1 35  LEU n 
1 36  PHE n 
1 37  TYR n 
1 38  VAL n 
1 39  ASP n 
1 40  LEU n 
1 41  ASP n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  THR n 
1 46  VAL n 
1 47  TRP n 
1 48  ARG n 
1 49  LEU n 
1 50  PRO n 
1 51  GLU n 
1 52  PHE n 
1 53  GLY n 
1 54  GLN n 
1 55  LEU n 
1 56  ILE n 
1 57  LEU n 
1 58  PHE n 
1 59  GLU n 
1 60  PRO n 
1 61  GLN n 
1 62  GLY n 
1 63  GLY n 
1 64  LEU n 
1 65  GLN n 
1 66  ASN n 
1 67  ILE n 
1 68  ALA n 
1 69  ALA n 
1 70  GLU n 
1 71  LYS n 
1 72  HIS n 
1 73  ASN n 
1 74  LEU n 
1 75  GLY n 
1 76  ILE n 
1 77  LEU n 
1 78  THR n 
1 79  LYS n 
1 80  ARG n 
1 81  SER n 
1 82  ASN n 
1 83  PHE n 
1 84  THR n 
1 85  PRO n 
1 86  ALA n 
1 87  THR n 
1 88  ASN n 
1 89  GLU n 
1 90  ALA n 
1 91  PRO n 
1 92  GLN n 
1 93  ALA n 
1 94  THR n 
1 95  VAL n 
1 96  PHE n 
1 97  PRO n 
1 98  LYS n 
1 99  SER n 
1 100 PRO n 
1 101 VAL n 
1 102 LEU n 
1 103 LEU n 
1 104 GLY n 
1 105 GLN n 
1 106 PRO n 
1 107 ASN n 
1 108 THR n 
1 109 LEU n 
1 110 ILE n 
1 111 CYS n 
1 112 PHE n 
1 113 VAL n 
1 114 ASP n 
1 115 ASN n 
1 116 ILE n 
1 117 PHE n 
1 118 PRO n 
1 119 PRO n 
1 120 VAL n 
1 121 ILE n 
1 122 ASN n 
1 123 ILE n 
1 124 THR n 
1 125 TRP n 
1 126 LEU n 
1 127 ARG n 
1 128 ASN n 
1 129 SER n 
1 130 LYS n 
1 131 SER n 
1 132 VAL n 
1 133 THR n 
1 134 ASP n 
1 135 GLY n 
1 136 VAL n 
1 137 TYR n 
1 138 GLU n 
1 139 THR n 
1 140 SER n 
1 141 PHE n 
1 142 LEU n 
1 143 VAL n 
1 144 ASN n 
1 145 ARG n 
1 146 ASP n 
1 147 HIS n 
1 148 SER n 
1 149 PHE n 
1 150 HIS n 
1 151 LYS n 
1 152 LEU n 
1 153 SER n 
1 154 TYR n 
1 155 LEU n 
1 156 THR n 
1 157 PHE n 
1 158 ILE n 
1 159 PRO n 
1 160 SER n 
1 161 ASP n 
1 162 ASP n 
1 163 ASP n 
1 164 ILE n 
1 165 TYR n 
1 166 ASP n 
1 167 CYS n 
1 168 LYS n 
1 169 VAL n 
1 170 GLU n 
1 171 HIS n 
1 172 TRP n 
1 173 GLY n 
1 174 LEU n 
1 175 GLU n 
1 176 GLU n 
1 177 PRO n 
1 178 VAL n 
1 179 LEU n 
1 180 LYS n 
1 181 HIS n 
1 182 TRP n 
1 183 GLU n 
1 184 PRO n 
1 185 GLU n 
1 186 ILE n 
1 187 SER n 
1 188 SER n 
1 189 ALA n 
1 190 ASP n 
1 191 LEU n 
1 192 VAL n 
1 193 PRO n 
1 194 ARG n 
2 1   ARG n 
2 2   GLY n 
2 3   ILE n 
2 4   SER n 
2 5   GLN n 
2 6   ALA n 
2 7   VAL n 
2 8   HIS n 
2 9   ALA n 
2 10  ALA n 
2 11  HIS n 
2 12  ALA n 
2 13  GLU n 
2 14  ILE n 
2 15  ASN n 
2 16  GLU n 
2 17  ALA n 
2 18  GLY n 
2 19  ARG n 
2 20  GLY n 
2 21  SER n 
2 22  GLY n 
2 23  SER n 
2 24  GLY n 
2 25  SER n 
2 26  GLY n 
2 27  ASN n 
2 28  SER n 
2 29  GLU n 
2 30  ARG n 
2 31  HIS n 
2 32  PHE n 
2 33  VAL n 
2 34  VAL n 
2 35  GLN n 
2 36  PHE n 
2 37  LYS n 
2 38  GLY n 
2 39  GLU n 
2 40  CYS n 
2 41  TYR n 
2 42  TYR n 
2 43  THR n 
2 44  ASN n 
2 45  GLY n 
2 46  THR n 
2 47  GLN n 
2 48  ARG n 
2 49  ILE n 
2 50  ARG n 
2 51  LEU n 
2 52  VAL n 
2 53  THR n 
2 54  ARG n 
2 55  TYR n 
2 56  ILE n 
2 57  TYR n 
2 58  ASN n 
2 59  ARG n 
2 60  GLU n 
2 61  GLU n 
2 62  TYR n 
2 63  VAL n 
2 64  ARG n 
2 65  TYR n 
2 66  ASP n 
2 67  SER n 
2 68  ASP n 
2 69  VAL n 
2 70  GLY n 
2 71  GLU n 
2 72  TYR n 
2 73  ARG n 
2 74  ALA n 
2 75  VAL n 
2 76  THR n 
2 77  GLU n 
2 78  LEU n 
2 79  GLY n 
2 80  ARG n 
2 81  PRO n 
2 82  ASP n 
2 83  ALA n 
2 84  GLU n 
2 85  TYR n 
2 86  TRP n 
2 87  ASN n 
2 88  SER n 
2 89  GLN n 
2 90  PRO n 
2 91  GLU n 
2 92  ILE n 
2 93  LEU n 
2 94  ASP n 
2 95  ARG n 
2 96  THR n 
2 97  ARG n 
2 98  ALA n 
2 99  GLU n 
2 100 VAL n 
2 101 ASP n 
2 102 THR n 
2 103 ALA n 
2 104 CYS n 
2 105 ARG n 
2 106 HIS n 
2 107 ASN n 
2 108 TYR n 
2 109 GLU n 
2 110 GLY n 
2 111 PRO n 
2 112 GLU n 
2 113 THR n 
2 114 SER n 
2 115 THR n 
2 116 SER n 
2 117 LEU n 
2 118 ARG n 
2 119 ARG n 
2 120 LEU n 
2 121 GLU n 
2 122 GLN n 
2 123 PRO n 
2 124 ASN n 
2 125 VAL n 
2 126 ALA n 
2 127 ILE n 
2 128 SER n 
2 129 LEU n 
2 130 SER n 
2 131 ARG n 
2 132 THR n 
2 133 GLU n 
2 134 ALA n 
2 135 LEU n 
2 136 ASN n 
2 137 HIS n 
2 138 HIS n 
2 139 ASN n 
2 140 THR n 
2 141 LEU n 
2 142 VAL n 
2 143 CYS n 
2 144 SER n 
2 145 VAL n 
2 146 THR n 
2 147 ASP n 
2 148 PHE n 
2 149 TYR n 
2 150 PRO n 
2 151 ALA n 
2 152 LYS n 
2 153 ILE n 
2 154 LYS n 
2 155 VAL n 
2 156 ARG n 
2 157 TRP n 
2 158 PHE n 
2 159 ARG n 
2 160 ASN n 
2 161 GLY n 
2 162 GLN n 
2 163 GLU n 
2 164 GLU n 
2 165 THR n 
2 166 VAL n 
2 167 GLY n 
2 168 VAL n 
2 169 SER n 
2 170 SER n 
2 171 THR n 
2 172 GLN n 
2 173 LEU n 
2 174 ILE n 
2 175 ARG n 
2 176 ASN n 
2 177 GLY n 
2 178 ASP n 
2 179 TRP n 
2 180 THR n 
2 181 PHE n 
2 182 GLN n 
2 183 VAL n 
2 184 LEU n 
2 185 VAL n 
2 186 MET n 
2 187 LEU n 
2 188 GLU n 
2 189 MET n 
2 190 THR n 
2 191 PRO n 
2 192 HIS n 
2 193 GLN n 
2 194 GLY n 
2 195 GLU n 
2 196 VAL n 
2 197 TYR n 
2 198 THR n 
2 199 CYS n 
2 200 HIS n 
2 201 VAL n 
2 202 GLU n 
2 203 HIS n 
2 204 PRO n 
2 205 SER n 
2 206 LEU n 
2 207 LYS n 
2 208 SER n 
2 209 PRO n 
2 210 ILE n 
2 211 THR n 
2 212 VAL n 
2 213 GLU n 
2 214 TRP n 
2 215 SER n 
2 216 SER n 
2 217 ALA n 
2 218 ASP n 
2 219 LEU n 
2 220 VAL n 
2 221 PRO n 
2 222 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? BALB/C ? ? ? ? 'Mus musculus' 10090 ? S2 ? EGG ? ? ? 'fruit fly' 'Drosophila melanogaster' 
7227 Drosophila ? ? ? ? ? ? ? S2 ? ? ? ? ? ? ? ? ? ? ? 'HETEROLOGOUS EXPRESSION' 
2 1 sample ? ? ? 'house mouse' Mus ? ? BALB/C ? ? ? ? 'Mus musculus' 10090 ? S2 ? EGG ? ? ? 'fruit fly' 'Drosophila melanogaster' 
7227 Drosophila ? ? ? ? ? ? ? S2 ? ? ? ? ? ? ? ? ? ? ? 'HETEROLOGOUS EXPRESSION' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP HA2D_MOUSE 1 P04228 1 
;MPCSRALILGVLALNTMLSLCGGEDDIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLIL
FEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVY
ETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTIFI
IQGLRSGGTSRHPGPL
;
? 
2 UNP HA2D_MOUSE 2 P04228 1 
;MALQIPSLLLSAAVVVLMVLSSPRTEGGNSERHFVVQFKGECYYTNGTQRIRLVTRYIYNREEYVRYDSDVGEYRAVTEL
GRPDAEYWNSQPEILERTRAEVDTACRHNYEGPETSTSLRRLEQPNVAISLSRTEALNHHNTLVCSVTDFYPAKIKVRWF
RNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWRAQSESARSKMLSGIGGCVLGVIF
LGLGLFIRHRSQKGPRGPPPAGLLQ
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IAO A 1  ? 186 ? P04228 24 ? 209 ? -3 182 
2 2 1IAO B 26 ? 214 ? P04228 28 ? 216 ? 1  188 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IAO 
_struct_ref_seq_dif.mon_id                       ASP 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      94 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P04228 
_struct_ref_seq_dif.db_mon_id                    GLU 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          96 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            69 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IAO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   56. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '32% PEG 600, 0.1 IMIDAZOLE MALATE, PH 5.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-04 
_diffrn_detector.details                '58 CM LONG, PT-COATED, FUSED SILICA, VERTICAL FOCUS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'CYLINDRICALLY BENT TRIANGULAR SI(111) ASYMMETRIC CUT, HORIZONTAL FOCUS' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IAO 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             27.0 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   14777 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99. 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        10. 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.0 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   91. 
_reflns_shell.Rmerge_I_obs           0.383 
_reflns_shell.pdbx_Rsym_value        0.383 
_reflns_shell.meanI_over_sigI_obs    2. 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IAO 
_refine.ls_number_reflns_obs                     14777 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1000000. 
_refine.pdbx_data_cutoff_low_absF                0.01 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.0 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    99. 
_refine.ls_R_factor_obs                          0.255 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.255 
_refine.ls_R_factor_R_free                       0.32 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  1464 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               51. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1DLH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3013 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               3035 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        27.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.6   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      29.2  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.60 
_refine_ls_shell.d_res_low                        2.72 
_refine_ls_shell.number_reflns_R_work             1513 
_refine_ls_shell.R_factor_R_work                  0.412 
_refine_ls_shell.percent_reflns_obs               91. 
_refine_ls_shell.R_factor_R_free                  0.456 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10. 
_refine_ls_shell.number_reflns_R_free             176 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IAO 
_struct.title                     'CLASS II MHC I-AD IN COMPLEX WITH OVALBUMIN PEPTIDE 323-339' 
_struct.pdbx_descriptor           'MHC CLASS II I-AD' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IAO 
_struct_keywords.pdbx_keywords   'MHC II' 
_struct_keywords.text            'MHC II, CLASS II MHC, I-A, OVALBUMIN PEPTIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 50  ? GLY A 53  ? PRO A 46 GLY A 49 1 ? 4  
HELX_P HELX_P2 2 PRO A 60  ? ARG A 80  ? PRO A 56 ARG A 76 1 ? 21 
HELX_P HELX_P3 3 GLU B 77  ? SER B 88  ? GLU B 52 SER B 63 5 ? 12 
HELX_P HELX_P4 4 PRO B 90  ? THR B 102 ? PRO B 65 THR B 77 1 ? 13 
HELX_P HELX_P5 5 CYS B 104 ? GLU B 109 ? CYS B 79 GLU B 84 1 ? 6  
HELX_P HELX_P6 6 GLU B 112 ? SER B 114 ? GLU B 87 SER B 89 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 111 SG  ? ? ? 1_555 A CYS 167 SG ? ? A CYS 107 A CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf2 disulf ?   ? B CYS 40  SG  ? ? ? 1_555 B CYS 104 SG ? ? B CYS 15  B CYS 79  1_555 ? ? ? ? ? ? ? 2.012 ? ?               
disulf3 disulf ?   ? B CYS 143 SG  ? ? ? 1_555 B CYS 199 SG ? ? B CYS 117 B CYS 173 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
covale1 covale one ? B ASN 44  ND2 ? ? ? 1_555 C NAG .   C1 ? ? B ASN 19  B NAG 495 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 117 A . ? PHE 113 A PRO 118 A ? PRO 114 A 1 -2.61 
2 TYR 149 B . ? TYR 123 B PRO 150 B ? PRO 124 B 1 -1.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 44  ? TRP A 47  ? LYS A 40  TRP A 43  
A 2 ASP A 33  ? ASP A 39  ? ASP A 29  ASP A 35  
A 3 ILE A 23  ? PHE A 30  ? ILE A 19  PHE A 26  
A 4 GLY A 10  ? GLN A 18  ? GLY A 6   GLN A 14  
B 1 VAL A 95  ? PRO A 97  ? VAL A 91  PRO A 93  
B 2 PRO A 106 ? VAL A 113 ? PRO A 102 VAL A 109 
B 3 LYS A 151 ? ILE A 158 ? LYS A 147 ILE A 154 
C 1 ASN A 122 ? TRP A 125 ? ASN A 118 TRP A 121 
C 2 TYR A 165 ? GLU A 170 ? TYR A 161 GLU A 166 
C 3 VAL A 178 ? TRP A 182 ? VAL A 174 TRP A 178 
D 1 VAL B 34  ? THR B 43  ? VAL B 9   THR B 18  
D 2 ARG B 48  ? TYR B 57  ? ARG B 23  TYR B 32  
D 3 GLU B 60  ? ASP B 66  ? GLU B 35  ASP B 41  
D 4 TYR B 72  ? ALA B 74  ? TYR B 47  ALA B 49  
E 1 ILE B 127 ? LEU B 129 ? ILE B 101 LEU B 103 
E 2 ASN B 139 ? PHE B 148 ? ASN B 113 PHE B 122 
E 3 PHE B 181 ? MET B 189 ? PHE B 155 MET B 163 
E 4 VAL B 168 ? SER B 170 ? VAL B 142 SER B 144 
F 1 GLN B 162 ? GLU B 164 ? GLN B 136 GLU B 138 
F 2 ILE B 153 ? ARG B 159 ? ILE B 127 ARG B 133 
F 3 VAL B 196 ? HIS B 203 ? VAL B 170 HIS B 177 
F 4 ILE B 210 ? SER B 215 T ILE B 184 SER B 1   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 44  ? O LYS A 40  N ASP A 39  ? N ASP A 35  
A 2 3 O ASP A 33  ? O ASP A 29  N PHE A 30  ? N PHE A 26  
A 3 4 O ILE A 23  ? O ILE A 19  N GLN A 18  ? N GLN A 14  
B 1 2 O PHE A 96  ? O PHE A 92  N ILE A 110 ? N ILE A 106 
B 2 3 O ASN A 107 ? O ASN A 103 N PHE A 157 ? N PHE A 153 
C 1 2 O ASN A 122 ? O ASN A 118 N GLU A 170 ? N GLU A 166 
C 2 3 O TYR A 165 ? O TYR A 161 N TRP A 182 ? N TRP A 178 
D 1 2 O GLN B 35  ? O GLN B 10  N ILE B 56  ? N ILE B 31  
D 2 3 O THR B 53  ? O THR B 28  N TYR B 65  ? N TYR B 40  
D 3 4 O ARG B 64  ? O ARG B 39  N ARG B 73  ? N ARG B 48  
E 1 2 O SER B 128 ? O SER B 102 N VAL B 142 ? N VAL B 116 
E 2 3 O ASN B 139 ? O ASN B 113 N MET B 189 ? N MET B 163 
E 3 4 O MET B 186 ? O MET B 160 N SER B 169 ? N SER B 143 
F 1 2 O GLN B 162 ? O GLN B 136 N ARG B 159 ? N ARG B 133 
F 2 3 O LYS B 154 ? O LYS B 128 N GLU B 202 ? N GLU B 176 
F 3 4 O TYR B 197 ? O TYR B 171 N TRP B 214 ? N TRP B 188 
# 
_database_PDB_matrix.entry_id          1IAO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IAO 
_atom_sites.fract_transf_matrix[1][1]   0.009872 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009872 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010799 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 5   ? -4.279  83.527  40.408 1.00 53.85  ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 5   ? -2.968  84.142  40.048 1.00 58.44  ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 5   ? -2.292  83.255  39.036 1.00 60.51  ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 5   ? -2.735  83.092  37.899 1.00 65.03  ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 5   ? -2.042  84.197  41.258 1.00 58.09  ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 5   ? -2.225  85.368  42.166 1.00 68.16  ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 5   ? -1.103  85.463  43.176 1.00 72.73  ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 5   ? -0.080  84.772  42.977 1.00 75.25  ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 5   ? -1.246  86.220  44.160 1.00 73.84  ? 1    GLU A OE2 1 
ATOM   10   N N   . ALA A 1 6   ? -1.194  82.678  39.503 1.00 59.70  ? 2    ALA A N   1 
ATOM   11   C CA  . ALA A 1 6   ? -0.390  81.767  38.734 1.00 54.19  ? 2    ALA A CA  1 
ATOM   12   C C   . ALA A 1 6   ? -0.412  80.485  39.512 1.00 53.25  ? 2    ALA A C   1 
ATOM   13   O O   . ALA A 1 6   ? -1.006  80.392  40.594 1.00 52.93  ? 2    ALA A O   1 
ATOM   14   C CB  . ALA A 1 6   ? 1.025   82.269  38.633 1.00 46.42  ? 2    ALA A CB  1 
ATOM   15   N N   . ASP A 1 7   ? 0.250   79.496  38.947 1.00 47.90  ? 3    ASP A N   1 
ATOM   16   C CA  . ASP A 1 7   ? 0.332   78.218  39.580 1.00 45.05  ? 3    ASP A CA  1 
ATOM   17   C C   . ASP A 1 7   ? 1.167   78.419  40.804 1.00 40.80  ? 3    ASP A C   1 
ATOM   18   O O   . ASP A 1 7   ? 2.145   79.161  40.779 1.00 34.99  ? 3    ASP A O   1 
ATOM   19   C CB  . ASP A 1 7   ? 1.005   77.226  38.654 1.00 54.66  ? 3    ASP A CB  1 
ATOM   20   C CG  . ASP A 1 7   ? 0.285   77.098  37.340 1.00 60.60  ? 3    ASP A CG  1 
ATOM   21   O OD1 . ASP A 1 7   ? -0.746  77.775  37.166 1.00 67.54  ? 3    ASP A OD1 1 
ATOM   22   O OD2 . ASP A 1 7   ? 0.745   76.322  36.486 1.00 60.04  ? 3    ASP A OD2 1 
ATOM   23   N N   . HIS A 1 8   ? 0.757   77.767  41.880 1.00 42.12  ? 4    HIS A N   1 
ATOM   24   C CA  . HIS A 1 8   ? 1.463   77.822  43.149 1.00 35.88  ? 4    HIS A CA  1 
ATOM   25   C C   . HIS A 1 8   ? 1.323   76.430  43.729 1.00 32.32  ? 4    HIS A C   1 
ATOM   26   O O   . HIS A 1 8   ? 0.286   75.795  43.578 1.00 36.04  ? 4    HIS A O   1 
ATOM   27   C CB  . HIS A 1 8   ? 0.820   78.857  44.076 1.00 37.99  ? 4    HIS A CB  1 
ATOM   28   C CG  . HIS A 1 8   ? 1.161   80.270  43.725 1.00 42.66  ? 4    HIS A CG  1 
ATOM   29   N ND1 . HIS A 1 8   ? 2.358   80.625  43.127 1.00 47.83  ? 4    HIS A ND1 1 
ATOM   30   C CD2 . HIS A 1 8   ? 0.468   81.422  43.870 1.00 40.88  ? 4    HIS A CD2 1 
ATOM   31   C CE1 . HIS A 1 8   ? 2.380   81.924  42.922 1.00 44.06  ? 4    HIS A CE1 1 
ATOM   32   N NE2 . HIS A 1 8   ? 1.241   82.437  43.365 1.00 43.94  ? 4    HIS A NE2 1 
ATOM   33   N N   . VAL A 1 9   ? 2.370   75.927  44.357 1.00 27.88  ? 5    VAL A N   1 
ATOM   34   C CA  . VAL A 1 9   ? 2.281   74.610  44.951 1.00 23.01  ? 5    VAL A CA  1 
ATOM   35   C C   . VAL A 1 9   ? 2.945   74.691  46.292 1.00 19.91  ? 5    VAL A C   1 
ATOM   36   O O   . VAL A 1 9   ? 4.084   75.144  46.401 1.00 17.75  ? 5    VAL A O   1 
ATOM   37   C CB  . VAL A 1 9   ? 2.987   73.544  44.100 1.00 26.19  ? 5    VAL A CB  1 
ATOM   38   C CG1 . VAL A 1 9   ? 4.185   74.152  43.412 1.00 30.54  ? 5    VAL A CG1 1 
ATOM   39   C CG2 . VAL A 1 9   ? 3.390   72.354  44.971 1.00 23.25  ? 5    VAL A CG2 1 
ATOM   40   N N   . GLY A 1 10  ? 2.211   74.279  47.315 1.00 23.08  ? 6    GLY A N   1 
ATOM   41   C CA  . GLY A 1 10  ? 2.756   74.297  48.651 1.00 20.11  ? 6    GLY A CA  1 
ATOM   42   C C   . GLY A 1 10  ? 3.218   72.904  49.016 1.00 24.71  ? 6    GLY A C   1 
ATOM   43   O O   . GLY A 1 10  ? 2.604   71.916  48.611 1.00 23.36  ? 6    GLY A O   1 
ATOM   44   N N   . PHE A 1 11  ? 4.317   72.825  49.760 1.00 32.83  ? 7    PHE A N   1 
ATOM   45   C CA  . PHE A 1 11  ? 4.871   71.552  50.219 1.00 34.16  ? 7    PHE A CA  1 
ATOM   46   C C   . PHE A 1 11  ? 4.790   71.619  51.733 1.00 36.27  ? 7    PHE A C   1 
ATOM   47   O O   . PHE A 1 11  ? 5.704   72.111  52.395 1.00 44.16  ? 7    PHE A O   1 
ATOM   48   C CB  . PHE A 1 11  ? 6.323   71.403  49.758 1.00 33.70  ? 7    PHE A CB  1 
ATOM   49   C CG  . PHE A 1 11  ? 6.457   70.857  48.360 1.00 33.81  ? 7    PHE A CG  1 
ATOM   50   C CD1 . PHE A 1 11  ? 5.375   70.241  47.728 1.00 34.30  ? 7    PHE A CD1 1 
ATOM   51   C CD2 . PHE A 1 11  ? 7.667   70.929  47.684 1.00 36.78  ? 7    PHE A CD2 1 
ATOM   52   C CE1 . PHE A 1 11  ? 5.505   69.714  46.458 1.00 29.84  ? 7    PHE A CE1 1 
ATOM   53   C CE2 . PHE A 1 11  ? 7.801   70.400  46.407 1.00 26.84  ? 7    PHE A CE2 1 
ATOM   54   C CZ  . PHE A 1 11  ? 6.722   69.790  45.797 1.00 27.81  ? 7    PHE A CZ  1 
ATOM   55   N N   . TYR A 1 12  ? 3.682   71.105  52.265 1.00 36.68  ? 8    TYR A N   1 
ATOM   56   C CA  . TYR A 1 12  ? 3.379   71.154  53.692 1.00 33.66  ? 8    TYR A CA  1 
ATOM   57   C C   . TYR A 1 12  ? 3.263   69.812  54.438 1.00 28.31  ? 8    TYR A C   1 
ATOM   58   O O   . TYR A 1 12  ? 2.215   69.190  54.446 1.00 45.80  ? 8    TYR A O   1 
ATOM   59   C CB  . TYR A 1 12  ? 2.071   71.963  53.885 1.00 29.14  ? 8    TYR A CB  1 
ATOM   60   C CG  . TYR A 1 12  ? 1.956   73.265  53.084 1.00 28.75  ? 8    TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 12  ? 2.941   74.251  53.177 1.00 26.28  ? 8    TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 12  ? 0.830   73.538  52.289 1.00 18.56  ? 8    TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 12  ? 2.810   75.478  52.508 1.00 27.98  ? 8    TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 12  ? 0.693   74.767  51.618 1.00 22.20  ? 8    TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 12  ? 1.687   75.732  51.739 1.00 29.50  ? 8    TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 12  ? 1.548   76.968  51.139 1.00 35.32  ? 8    TYR A OH  1 
ATOM   67   N N   . GLY A 1 13  ? 4.328   69.380  55.089 1.00 27.57  ? 9    GLY A N   1 
ATOM   68   C CA  . GLY A 1 13  ? 4.253   68.137  55.829 1.00 22.77  ? 9    GLY A CA  1 
ATOM   69   C C   . GLY A 1 13  ? 5.416   67.226  55.511 1.00 30.95  ? 9    GLY A C   1 
ATOM   70   O O   . GLY A 1 13  ? 5.558   66.156  56.109 1.00 25.24  ? 9    GLY A O   1 
ATOM   71   N N   . THR A 1 14  ? 6.254   67.672  54.574 1.00 32.75  ? 10   THR A N   1 
ATOM   72   C CA  . THR A 1 14  ? 7.418   66.924  54.101 1.00 33.99  ? 10   THR A CA  1 
ATOM   73   C C   . THR A 1 14  ? 8.337   66.390  55.190 1.00 29.03  ? 10   THR A C   1 
ATOM   74   O O   . THR A 1 14  ? 9.001   67.143  55.907 1.00 29.74  ? 10   THR A O   1 
ATOM   75   C CB  . THR A 1 14  ? 8.223   67.767  53.117 1.00 40.17  ? 10   THR A CB  1 
ATOM   76   O OG1 . THR A 1 14  ? 7.327   68.615  52.385 1.00 44.41  ? 10   THR A OG1 1 
ATOM   77   C CG2 . THR A 1 14  ? 8.975   66.862  52.146 1.00 30.01  ? 10   THR A CG2 1 
ATOM   78   N N   . THR A 1 15  ? 8.397   65.067  55.255 1.00 23.95  ? 11   THR A N   1 
ATOM   79   C CA  . THR A 1 15  ? 9.150   64.356  56.278 1.00 28.67  ? 11   THR A CA  1 
ATOM   80   C C   . THR A 1 15  ? 10.087  63.316  55.692 1.00 27.65  ? 11   THR A C   1 
ATOM   81   O O   . THR A 1 15  ? 9.715   62.609  54.757 1.00 32.92  ? 11   THR A O   1 
ATOM   82   C CB  . THR A 1 15  ? 8.158   63.606  57.232 1.00 30.99  ? 11   THR A CB  1 
ATOM   83   O OG1 . THR A 1 15  ? 7.177   64.526  57.727 1.00 27.27  ? 11   THR A OG1 1 
ATOM   84   C CG2 . THR A 1 15  ? 8.889   62.943  58.399 1.00 23.17  ? 11   THR A CG2 1 
ATOM   85   N N   . VAL A 1 16  ? 11.289  63.212  56.252 1.00 23.49  ? 12   VAL A N   1 
ATOM   86   C CA  . VAL A 1 16  ? 12.247  62.213  55.799 1.00 23.38  ? 12   VAL A CA  1 
ATOM   87   C C   . VAL A 1 16  ? 12.814  61.461  56.973 1.00 25.16  ? 12   VAL A C   1 
ATOM   88   O O   . VAL A 1 16  ? 13.014  62.023  58.039 1.00 21.73  ? 12   VAL A O   1 
ATOM   89   C CB  . VAL A 1 16  ? 13.442  62.805  55.073 1.00 18.10  ? 12   VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 16  ? 14.132  61.706  54.288 1.00 18.94  ? 12   VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 16  ? 13.003  63.897  54.157 1.00 23.56  ? 12   VAL A CG2 1 
ATOM   92   N N   . TYR A 1 17  ? 13.109  60.189  56.773 1.00 34.61  ? 13   TYR A N   1 
ATOM   93   C CA  . TYR A 1 17  ? 13.658  59.406  57.858 1.00 40.28  ? 13   TYR A CA  1 
ATOM   94   C C   . TYR A 1 17  ? 14.521  58.269  57.344 1.00 41.60  ? 13   TYR A C   1 
ATOM   95   O O   . TYR A 1 17  ? 14.133  57.551  56.419 1.00 37.97  ? 13   TYR A O   1 
ATOM   96   C CB  . TYR A 1 17  ? 12.524  58.861  58.734 1.00 47.99  ? 13   TYR A CB  1 
ATOM   97   C CG  . TYR A 1 17  ? 12.909  58.748  60.186 1.00 58.13  ? 13   TYR A CG  1 
ATOM   98   C CD1 . TYR A 1 17  ? 12.864  59.860  61.028 1.00 65.47  ? 13   TYR A CD1 1 
ATOM   99   C CD2 . TYR A 1 17  ? 13.415  57.555  60.698 1.00 57.68  ? 13   TYR A CD2 1 
ATOM   100  C CE1 . TYR A 1 17  ? 13.326  59.786  62.341 1.00 63.43  ? 13   TYR A CE1 1 
ATOM   101  C CE2 . TYR A 1 17  ? 13.879  57.471  62.003 1.00 58.01  ? 13   TYR A CE2 1 
ATOM   102  C CZ  . TYR A 1 17  ? 13.836  58.589  62.814 1.00 60.39  ? 13   TYR A CZ  1 
ATOM   103  O OH  . TYR A 1 17  ? 14.338  58.512  64.089 1.00 69.90  ? 13   TYR A OH  1 
ATOM   104  N N   . GLN A 1 18  ? 15.694  58.121  57.956 1.00 48.66  ? 14   GLN A N   1 
ATOM   105  C CA  . GLN A 1 18  ? 16.646  57.079  57.588 1.00 58.09  ? 14   GLN A CA  1 
ATOM   106  C C   . GLN A 1 18  ? 17.025  56.207  58.770 1.00 63.26  ? 14   GLN A C   1 
ATOM   107  O O   . GLN A 1 18  ? 17.325  56.717  59.863 1.00 62.40  ? 14   GLN A O   1 
ATOM   108  C CB  . GLN A 1 18  ? 17.899  57.696  57.014 1.00 56.67  ? 14   GLN A CB  1 
ATOM   109  C CG  . GLN A 1 18  ? 17.646  58.605  55.871 1.00 53.60  ? 14   GLN A CG  1 
ATOM   110  C CD  . GLN A 1 18  ? 18.935  59.023  55.262 1.00 57.96  ? 14   GLN A CD  1 
ATOM   111  O OE1 . GLN A 1 18  ? 19.267  60.203  55.243 1.00 52.37  ? 14   GLN A OE1 1 
ATOM   112  N NE2 . GLN A 1 18  ? 19.696  58.051  54.773 1.00 58.58  ? 14   GLN A NE2 1 
ATOM   113  N N   . SER A 1 19  ? 17.066  54.896  58.518 1.00 67.89  ? 15   SER A N   1 
ATOM   114  C CA  . SER A 1 19  ? 17.335  53.912  59.556 1.00 68.89  ? 15   SER A CA  1 
ATOM   115  C C   . SER A 1 19  ? 18.688  53.776  60.225 1.00 71.15  ? 15   SER A C   1 
ATOM   116  O O   . SER A 1 19  ? 18.760  53.911  61.447 1.00 76.91  ? 15   SER A O   1 
ATOM   117  C CB  . SER A 1 19  ? 16.894  52.522  59.103 1.00 68.67  ? 15   SER A CB  1 
ATOM   118  O OG  . SER A 1 19  ? 16.265  51.873  60.196 1.00 77.86  ? 15   SER A OG  1 
ATOM   119  N N   . PRO A 1 20  ? 19.756  53.396  59.499 1.00 67.65  ? 16   PRO A N   1 
ATOM   120  C CA  . PRO A 1 20  ? 20.714  53.444  60.599 1.00 63.74  ? 16   PRO A CA  1 
ATOM   121  C C   . PRO A 1 20  ? 21.147  54.889  60.870 1.00 60.24  ? 16   PRO A C   1 
ATOM   122  O O   . PRO A 1 20  ? 21.766  55.532  60.022 1.00 61.92  ? 16   PRO A O   1 
ATOM   123  C CB  . PRO A 1 20  ? 21.824  52.518  60.133 1.00 64.57  ? 16   PRO A CB  1 
ATOM   124  C CG  . PRO A 1 20  ? 21.275  51.828  58.858 1.00 68.06  ? 16   PRO A CG  1 
ATOM   125  C CD  . PRO A 1 20  ? 20.344  52.841  58.265 1.00 68.32  ? 16   PRO A CD  1 
ATOM   126  N N   . GLY A 1 21  ? 20.789  55.398  62.052 1.00 52.79  ? 17   GLY A N   1 
ATOM   127  C CA  . GLY A 1 21  ? 21.132  56.761  62.433 1.00 48.84  ? 17   GLY A CA  1 
ATOM   128  C C   . GLY A 1 21  ? 19.954  57.578  62.965 1.00 50.66  ? 17   GLY A C   1 
ATOM   129  O O   . GLY A 1 21  ? 20.124  58.645  63.573 1.00 49.79  ? 17   GLY A O   1 
ATOM   130  N N   . ASP A 1 22  ? 18.747  57.074  62.746 1.00 48.71  ? 18   ASP A N   1 
ATOM   131  C CA  . ASP A 1 22  ? 17.553  57.757  63.196 1.00 47.46  ? 18   ASP A CA  1 
ATOM   132  C C   . ASP A 1 22  ? 17.654  59.193  62.810 1.00 44.52  ? 18   ASP A C   1 
ATOM   133  O O   . ASP A 1 22  ? 17.377  60.085  63.608 1.00 46.01  ? 18   ASP A O   1 
ATOM   134  C CB  . ASP A 1 22  ? 17.411  57.630  64.700 1.00 57.79  ? 18   ASP A CB  1 
ATOM   135  C CG  . ASP A 1 22  ? 17.289  56.197  65.133 1.00 70.92  ? 18   ASP A CG  1 
ATOM   136  O OD1 . ASP A 1 22  ? 17.465  55.308  64.273 1.00 82.24  ? 18   ASP A OD1 1 
ATOM   137  O OD2 . ASP A 1 22  ? 17.018  55.955  66.324 1.00 80.43  ? 18   ASP A OD2 1 
ATOM   138  N N   . ILE A 1 23  ? 18.083  59.410  61.577 1.00 45.26  ? 19   ILE A N   1 
ATOM   139  C CA  . ILE A 1 23  ? 18.200  60.761  61.068 1.00 49.94  ? 19   ILE A CA  1 
ATOM   140  C C   . ILE A 1 23  ? 16.923  61.128  60.314 1.00 45.97  ? 19   ILE A C   1 
ATOM   141  O O   . ILE A 1 23  ? 16.470  60.394  59.432 1.00 49.82  ? 19   ILE A O   1 
ATOM   142  C CB  . ILE A 1 23  ? 19.429  60.910  60.151 1.00 52.20  ? 19   ILE A CB  1 
ATOM   143  C CG1 . ILE A 1 23  ? 19.795  62.397  60.019 1.00 57.04  ? 19   ILE A CG1 1 
ATOM   144  C CG2 . ILE A 1 23  ? 19.181  60.220  58.818 1.00 53.53  ? 19   ILE A CG2 1 
ATOM   145  C CD1 . ILE A 1 23  ? 18.883  63.218  59.115 1.00 60.78  ? 19   ILE A CD1 1 
ATOM   146  N N   . GLY A 1 24  ? 16.337  62.260  60.688 1.00 37.37  ? 20   GLY A N   1 
ATOM   147  C CA  . GLY A 1 24  ? 15.111  62.691  60.056 1.00 33.22  ? 20   GLY A CA  1 
ATOM   148  C C   . GLY A 1 24  ? 15.099  64.183  59.850 1.00 32.90  ? 20   GLY A C   1 
ATOM   149  O O   . GLY A 1 24  ? 15.948  64.899  60.389 1.00 29.20  ? 20   GLY A O   1 
ATOM   150  N N   . GLN A 1 25  ? 14.126  64.647  59.073 1.00 28.79  ? 21   GLN A N   1 
ATOM   151  C CA  . GLN A 1 25  ? 13.991  66.058  58.769 1.00 27.85  ? 21   GLN A CA  1 
ATOM   152  C C   . GLN A 1 25  ? 12.549  66.355  58.457 1.00 26.43  ? 21   GLN A C   1 
ATOM   153  O O   . GLN A 1 25  ? 11.803  65.466  58.063 1.00 30.42  ? 21   GLN A O   1 
ATOM   154  C CB  . GLN A 1 25  ? 14.877  66.410  57.575 1.00 33.77  ? 21   GLN A CB  1 
ATOM   155  C CG  . GLN A 1 25  ? 14.208  67.123  56.407 1.00 42.41  ? 21   GLN A CG  1 
ATOM   156  C CD  . GLN A 1 25  ? 15.238  67.686  55.430 1.00 47.20  ? 21   GLN A CD  1 
ATOM   157  O OE1 . GLN A 1 25  ? 15.032  68.736  54.829 1.00 52.69  ? 21   GLN A OE1 1 
ATOM   158  N NE2 . GLN A 1 25  ? 16.360  66.988  55.281 1.00 52.93  ? 21   GLN A NE2 1 
ATOM   159  N N   . TYR A 1 26  ? 12.165  67.611  58.636 1.00 25.91  ? 22   TYR A N   1 
ATOM   160  C CA  . TYR A 1 26  ? 10.807  68.042  58.377 1.00 28.99  ? 22   TYR A CA  1 
ATOM   161  C C   . TYR A 1 26  ? 10.887  69.449  57.845 1.00 25.93  ? 22   TYR A C   1 
ATOM   162  O O   . TYR A 1 26  ? 11.583  70.267  58.416 1.00 25.62  ? 22   TYR A O   1 
ATOM   163  C CB  . TYR A 1 26  ? 9.985   68.032  59.671 1.00 26.33  ? 22   TYR A CB  1 
ATOM   164  C CG  . TYR A 1 26  ? 8.543   68.426  59.451 1.00 27.00  ? 22   TYR A CG  1 
ATOM   165  C CD1 . TYR A 1 26  ? 8.181   69.767  59.306 1.00 29.55  ? 22   TYR A CD1 1 
ATOM   166  C CD2 . TYR A 1 26  ? 7.545   67.460  59.333 1.00 23.34  ? 22   TYR A CD2 1 
ATOM   167  C CE1 . TYR A 1 26  ? 6.872   70.134  59.043 1.00 26.55  ? 22   TYR A CE1 1 
ATOM   168  C CE2 . TYR A 1 26  ? 6.231   67.821  59.069 1.00 21.43  ? 22   TYR A CE2 1 
ATOM   169  C CZ  . TYR A 1 26  ? 5.908   69.159  58.923 1.00 24.76  ? 22   TYR A CZ  1 
ATOM   170  O OH  . TYR A 1 26  ? 4.622   69.529  58.625 1.00 37.15  ? 22   TYR A OH  1 
ATOM   171  N N   . THR A 1 27  ? 10.171  69.736  56.764 1.00 28.63  ? 23   THR A N   1 
ATOM   172  C CA  . THR A 1 27  ? 10.198  71.074  56.188 1.00 26.07  ? 23   THR A CA  1 
ATOM   173  C C   . THR A 1 27  ? 8.882   71.498  55.546 1.00 30.71  ? 23   THR A C   1 
ATOM   174  O O   . THR A 1 27  ? 7.927   70.723  55.447 1.00 34.77  ? 23   THR A O   1 
ATOM   175  C CB  . THR A 1 27  ? 11.280  71.193  55.103 1.00 25.65  ? 23   THR A CB  1 
ATOM   176  O OG1 . THR A 1 27  ? 10.980  70.283  54.035 1.00 25.82  ? 23   THR A OG1 1 
ATOM   177  C CG2 . THR A 1 27  ? 12.649  70.880  55.670 1.00 12.75  ? 23   THR A CG2 1 
ATOM   178  N N   . HIS A 1 28  ? 8.867   72.746  55.095 1.00 27.20  ? 24   HIS A N   1 
ATOM   179  C CA  . HIS A 1 28  ? 7.721   73.344  54.433 1.00 27.30  ? 24   HIS A CA  1 
ATOM   180  C C   . HIS A 1 28  ? 8.284   74.266  53.372 1.00 25.20  ? 24   HIS A C   1 
ATOM   181  O O   . HIS A 1 28  ? 9.216   75.021  53.643 1.00 25.74  ? 24   HIS A O   1 
ATOM   182  C CB  . HIS A 1 28  ? 6.919   74.191  55.411 1.00 27.58  ? 24   HIS A CB  1 
ATOM   183  C CG  . HIS A 1 28  ? 5.773   73.470  56.034 1.00 26.44  ? 24   HIS A CG  1 
ATOM   184  N ND1 . HIS A 1 28  ? 5.886   72.197  56.545 1.00 25.72  ? 24   HIS A ND1 1 
ATOM   185  C CD2 . HIS A 1 28  ? 4.490   73.852  56.237 1.00 26.25  ? 24   HIS A CD2 1 
ATOM   186  C CE1 . HIS A 1 28  ? 4.718   71.822  57.038 1.00 29.32  ? 24   HIS A CE1 1 
ATOM   187  N NE2 . HIS A 1 28  ? 3.856   72.806  56.864 1.00 34.54  ? 24   HIS A NE2 1 
ATOM   188  N N   . GLU A 1 29  ? 7.735   74.210  52.169 1.00 23.41  ? 25   GLU A N   1 
ATOM   189  C CA  . GLU A 1 29  ? 8.206   75.092  51.109 1.00 26.38  ? 25   GLU A CA  1 
ATOM   190  C C   . GLU A 1 29  ? 7.043   75.618  50.314 1.00 25.78  ? 25   GLU A C   1 
ATOM   191  O O   . GLU A 1 29  ? 5.936   75.095  50.379 1.00 27.85  ? 25   GLU A O   1 
ATOM   192  C CB  . GLU A 1 29  ? 9.151   74.386  50.131 1.00 27.03  ? 25   GLU A CB  1 
ATOM   193  C CG  . GLU A 1 29  ? 9.698   73.027  50.552 1.00 37.79  ? 25   GLU A CG  1 
ATOM   194  C CD  . GLU A 1 29  ? 10.529  72.375  49.445 1.00 38.69  ? 25   GLU A CD  1 
ATOM   195  O OE1 . GLU A 1 29  ? 10.788  73.036  48.411 1.00 48.10  ? 25   GLU A OE1 1 
ATOM   196  O OE2 . GLU A 1 29  ? 10.925  71.202  49.606 1.00 35.74  ? 25   GLU A OE2 1 
ATOM   197  N N   . PHE A 1 30  ? 7.307   76.668  49.559 1.00 24.06  ? 26   PHE A N   1 
ATOM   198  C CA  . PHE A 1 30  ? 6.298   77.259  48.711 1.00 25.85  ? 26   PHE A CA  1 
ATOM   199  C C   . PHE A 1 30  ? 6.992   77.606  47.414 1.00 29.24  ? 26   PHE A C   1 
ATOM   200  O O   . PHE A 1 30  ? 7.993   78.330  47.401 1.00 27.07  ? 26   PHE A O   1 
ATOM   201  C CB  . PHE A 1 30  ? 5.715   78.519  49.334 1.00 24.70  ? 26   PHE A CB  1 
ATOM   202  C CG  . PHE A 1 30  ? 4.483   79.002  48.644 1.00 19.96  ? 26   PHE A CG  1 
ATOM   203  C CD1 . PHE A 1 30  ? 3.320   78.251  48.679 1.00 23.87  ? 26   PHE A CD1 1 
ATOM   204  C CD2 . PHE A 1 30  ? 4.491   80.191  47.932 1.00 26.72  ? 26   PHE A CD2 1 
ATOM   205  C CE1 . PHE A 1 30  ? 2.179   78.672  48.005 1.00 27.95  ? 26   PHE A CE1 1 
ATOM   206  C CE2 . PHE A 1 30  ? 3.353   80.624  47.252 1.00 30.40  ? 26   PHE A CE2 1 
ATOM   207  C CZ  . PHE A 1 30  ? 2.194   79.862  47.289 1.00 26.99  ? 26   PHE A CZ  1 
ATOM   208  N N   . ASP A 1 31  ? 6.470   77.067  46.321 1.00 28.32  ? 27   ASP A N   1 
ATOM   209  C CA  . ASP A 1 31  ? 7.052   77.320  45.017 1.00 27.17  ? 27   ASP A CA  1 
ATOM   210  C C   . ASP A 1 31  ? 8.537   77.023  45.016 1.00 25.34  ? 27   ASP A C   1 
ATOM   211  O O   . ASP A 1 31  ? 9.330   77.835  44.554 1.00 29.43  ? 27   ASP A O   1 
ATOM   212  C CB  . ASP A 1 31  ? 6.825   78.772  44.603 1.00 20.76  ? 27   ASP A CB  1 
ATOM   213  C CG  . ASP A 1 31  ? 5.365   79.078  44.358 1.00 25.54  ? 27   ASP A CG  1 
ATOM   214  O OD1 . ASP A 1 31  ? 4.541   78.131  44.362 1.00 28.77  ? 27   ASP A OD1 1 
ATOM   215  O OD2 . ASP A 1 31  ? 5.038   80.268  44.164 1.00 32.19  ? 27   ASP A OD2 1 
ATOM   216  N N   . GLY A 1 32  ? 8.901   75.862  45.554 1.00 23.56  ? 28   GLY A N   1 
ATOM   217  C CA  . GLY A 1 32  ? 10.289  75.440  45.573 1.00 20.57  ? 28   GLY A CA  1 
ATOM   218  C C   . GLY A 1 32  ? 11.215  76.146  46.532 1.00 26.63  ? 28   GLY A C   1 
ATOM   219  O O   . GLY A 1 32  ? 12.408  75.840  46.580 1.00 23.84  ? 28   GLY A O   1 
ATOM   220  N N   . ASP A 1 33  ? 10.690  77.100  47.288 1.00 28.07  ? 29   ASP A N   1 
ATOM   221  C CA  . ASP A 1 33  ? 11.524  77.802  48.250 1.00 30.47  ? 29   ASP A CA  1 
ATOM   222  C C   . ASP A 1 33  ? 11.211  77.355  49.681 1.00 31.79  ? 29   ASP A C   1 
ATOM   223  O O   . ASP A 1 33  ? 10.050  77.299  50.099 1.00 36.38  ? 29   ASP A O   1 
ATOM   224  C CB  . ASP A 1 33  ? 11.335  79.301  48.099 1.00 30.04  ? 29   ASP A CB  1 
ATOM   225  C CG  . ASP A 1 33  ? 11.812  79.810  46.765 1.00 35.39  ? 29   ASP A CG  1 
ATOM   226  O OD1 . ASP A 1 33  ? 12.940  79.454  46.368 1.00 22.30  ? 29   ASP A OD1 1 
ATOM   227  O OD2 . ASP A 1 33  ? 11.054  80.566  46.115 1.00 43.24  ? 29   ASP A OD2 1 
ATOM   228  N N   . GLU A 1 34  ? 12.264  77.029  50.421 1.00 29.77  ? 30   GLU A N   1 
ATOM   229  C CA  . GLU A 1 34  ? 12.141  76.562  51.797 1.00 31.66  ? 30   GLU A CA  1 
ATOM   230  C C   . GLU A 1 34  ? 11.584  77.612  52.756 1.00 36.26  ? 30   GLU A C   1 
ATOM   231  O O   . GLU A 1 34  ? 12.214  78.649  52.992 1.00 36.78  ? 30   GLU A O   1 
ATOM   232  C CB  . GLU A 1 34  ? 13.508  76.081  52.287 1.00 26.85  ? 30   GLU A CB  1 
ATOM   233  C CG  . GLU A 1 34  ? 13.631  75.932  53.787 1.00 34.67  ? 30   GLU A CG  1 
ATOM   234  C CD  . GLU A 1 34  ? 14.734  74.971  54.186 1.00 41.00  ? 30   GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 34  ? 15.828  75.007  53.580 1.00 50.24  ? 30   GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 34  ? 14.492  74.174  55.110 1.00 45.43  ? 30   GLU A OE2 1 
ATOM   237  N N   . LEU A 1 35  ? 10.397  77.342  53.302 1.00 40.10  ? 31   LEU A N   1 
ATOM   238  C CA  . LEU A 1 35  ? 9.767   78.262  54.250 1.00 38.84  ? 31   LEU A CA  1 
ATOM   239  C C   . LEU A 1 35  ? 10.538  78.168  55.548 1.00 39.49  ? 31   LEU A C   1 
ATOM   240  O O   . LEU A 1 35  ? 11.084  79.163  56.036 1.00 46.76  ? 31   LEU A O   1 
ATOM   241  C CB  . LEU A 1 35  ? 8.316   77.870  54.505 1.00 33.91  ? 31   LEU A CB  1 
ATOM   242  C CG  . LEU A 1 35  ? 7.380   78.133  53.332 1.00 35.03  ? 31   LEU A CG  1 
ATOM   243  C CD1 . LEU A 1 35  ? 6.024   77.530  53.640 1.00 32.91  ? 31   LEU A CD1 1 
ATOM   244  C CD2 . LEU A 1 35  ? 7.281   79.631  53.076 1.00 31.65  ? 31   LEU A CD2 1 
ATOM   245  N N   . PHE A 1 36  ? 10.595  76.951  56.082 1.00 35.02  ? 32   PHE A N   1 
ATOM   246  C CA  . PHE A 1 36  ? 11.291  76.674  57.330 1.00 31.21  ? 32   PHE A CA  1 
ATOM   247  C C   . PHE A 1 36  ? 11.513  75.179  57.453 1.00 31.89  ? 32   PHE A C   1 
ATOM   248  O O   . PHE A 1 36  ? 10.974  74.397  56.674 1.00 33.33  ? 32   PHE A O   1 
ATOM   249  C CB  . PHE A 1 36  ? 10.435  77.116  58.516 1.00 24.04  ? 32   PHE A CB  1 
ATOM   250  C CG  . PHE A 1 36  ? 9.163   76.316  58.669 1.00 18.84  ? 32   PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 36  ? 9.207   74.977  59.059 1.00 21.79  ? 32   PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 36  ? 7.929   76.878  58.366 1.00 19.69  ? 32   PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 36  ? 8.050   74.202  59.133 1.00 22.21  ? 32   PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 36  ? 6.761   76.114  58.438 1.00 29.87  ? 32   PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 36  ? 6.825   74.772  58.823 1.00 31.88  ? 32   PHE A CZ  1 
ATOM   256  N N   . TYR A 1 37  ? 12.299  74.802  58.457 1.00 39.55  ? 33   TYR A N   1 
ATOM   257  C CA  . TYR A 1 37  ? 12.579  73.404  58.800 1.00 42.84  ? 33   TYR A CA  1 
ATOM   258  C C   . TYR A 1 37  ? 12.415  73.376  60.324 1.00 46.38  ? 33   TYR A C   1 
ATOM   259  O O   . TYR A 1 37  ? 12.522  74.423  60.962 1.00 55.78  ? 33   TYR A O   1 
ATOM   260  C CB  . TYR A 1 37  ? 14.009  72.992  58.404 1.00 40.03  ? 33   TYR A CB  1 
ATOM   261  C CG  . TYR A 1 37  ? 15.122  73.562  59.264 1.00 44.67  ? 33   TYR A CG  1 
ATOM   262  C CD1 . TYR A 1 37  ? 15.680  74.812  58.984 1.00 45.58  ? 33   TYR A CD1 1 
ATOM   263  C CD2 . TYR A 1 37  ? 15.618  72.859  60.357 1.00 43.95  ? 33   TYR A CD2 1 
ATOM   264  C CE1 . TYR A 1 37  ? 16.704  75.344  59.771 1.00 43.00  ? 33   TYR A CE1 1 
ATOM   265  C CE2 . TYR A 1 37  ? 16.644  73.389  61.153 1.00 49.29  ? 33   TYR A CE2 1 
ATOM   266  C CZ  . TYR A 1 37  ? 17.177  74.631  60.859 1.00 46.57  ? 33   TYR A CZ  1 
ATOM   267  O OH  . TYR A 1 37  ? 18.157  75.160  61.675 1.00 48.43  ? 33   TYR A OH  1 
ATOM   268  N N   . VAL A 1 38  ? 12.128  72.218  60.913 1.00 43.59  ? 34   VAL A N   1 
ATOM   269  C CA  . VAL A 1 38  ? 11.972  72.150  62.368 1.00 45.72  ? 34   VAL A CA  1 
ATOM   270  C C   . VAL A 1 38  ? 13.178  71.448  62.972 1.00 50.35  ? 34   VAL A C   1 
ATOM   271  O O   . VAL A 1 38  ? 13.453  70.293  62.642 1.00 49.09  ? 34   VAL A O   1 
ATOM   272  C CB  . VAL A 1 38  ? 10.672  71.376  62.799 1.00 44.05  ? 34   VAL A CB  1 
ATOM   273  C CG1 . VAL A 1 38  ? 10.637  71.183  64.323 1.00 32.09  ? 34   VAL A CG1 1 
ATOM   274  C CG2 . VAL A 1 38  ? 9.427   72.145  62.358 1.00 44.47  ? 34   VAL A CG2 1 
ATOM   275  N N   . ASP A 1 39  ? 13.910  72.150  63.838 1.00 54.36  ? 35   ASP A N   1 
ATOM   276  C CA  . ASP A 1 39  ? 15.063  71.542  64.488 1.00 58.01  ? 35   ASP A CA  1 
ATOM   277  C C   . ASP A 1 39  ? 14.520  70.463  65.394 1.00 54.53  ? 35   ASP A C   1 
ATOM   278  O O   . ASP A 1 39  ? 13.868  70.747  66.398 1.00 52.84  ? 35   ASP A O   1 
ATOM   279  C CB  . ASP A 1 39  ? 15.854  72.542  65.332 1.00 69.24  ? 35   ASP A CB  1 
ATOM   280  C CG  . ASP A 1 39  ? 17.045  71.884  66.043 1.00 76.62  ? 35   ASP A CG  1 
ATOM   281  O OD1 . ASP A 1 39  ? 18.100  71.692  65.402 1.00 79.93  ? 35   ASP A OD1 1 
ATOM   282  O OD2 . ASP A 1 39  ? 16.923  71.551  67.237 1.00 80.20  ? 35   ASP A OD2 1 
ATOM   283  N N   . LEU A 1 40  ? 14.795  69.221  65.030 1.00 54.24  ? 36   LEU A N   1 
ATOM   284  C CA  . LEU A 1 40  ? 14.303  68.086  65.783 1.00 54.43  ? 36   LEU A CA  1 
ATOM   285  C C   . LEU A 1 40  ? 15.020  67.786  67.085 1.00 59.29  ? 36   LEU A C   1 
ATOM   286  O O   . LEU A 1 40  ? 14.373  67.615  68.125 1.00 58.36  ? 36   LEU A O   1 
ATOM   287  C CB  . LEU A 1 40  ? 14.328  66.855  64.892 1.00 45.60  ? 36   LEU A CB  1 
ATOM   288  C CG  . LEU A 1 40  ? 13.603  67.061  63.566 1.00 40.77  ? 36   LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 40  ? 13.497  65.731  62.893 1.00 39.39  ? 36   LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 40  ? 12.218  67.663  63.790 1.00 38.92  ? 36   LEU A CD2 1 
ATOM   291  N N   . ASP A 1 41  ? 16.344  67.717  67.053 1.00 64.04  ? 37   ASP A N   1 
ATOM   292  C CA  . ASP A 1 41  ? 17.019  67.399  68.281 1.00 63.68  ? 37   ASP A CA  1 
ATOM   293  C C   . ASP A 1 41  ? 16.768  68.458  69.330 1.00 62.13  ? 37   ASP A C   1 
ATOM   294  O O   . ASP A 1 41  ? 16.906  68.180  70.510 1.00 70.84  ? 37   ASP A O   1 
ATOM   295  C CB  . ASP A 1 41  ? 18.499  67.115  68.020 1.00 66.36  ? 37   ASP A CB  1 
ATOM   296  C CG  . ASP A 1 41  ? 18.723  65.659  67.600 1.00 75.35  ? 37   ASP A CG  1 
ATOM   297  O OD1 . ASP A 1 41  ? 17.710  64.977  67.301 1.00 67.65  ? 37   ASP A OD1 1 
ATOM   298  O OD2 . ASP A 1 41  ? 19.886  65.198  67.573 1.00 83.71  ? 37   ASP A OD2 1 
ATOM   299  N N   . LYS A 1 42  ? 16.342  69.648  68.919 1.00 53.60  ? 38   LYS A N   1 
ATOM   300  C CA  . LYS A 1 42  ? 16.046  70.677  69.900 1.00 51.89  ? 38   LYS A CA  1 
ATOM   301  C C   . LYS A 1 42  ? 14.600  71.199  69.826 1.00 54.35  ? 38   LYS A C   1 
ATOM   302  O O   . LYS A 1 42  ? 14.238  72.176  70.486 1.00 60.40  ? 38   LYS A O   1 
ATOM   303  C CB  . LYS A 1 42  ? 17.054  71.826  69.810 1.00 55.71  ? 38   LYS A CB  1 
ATOM   304  C CG  . LYS A 1 42  ? 18.337  71.521  70.601 1.00 65.04  ? 38   LYS A CG  1 
ATOM   305  C CD  . LYS A 1 42  ? 19.581  72.190  70.010 1.00 74.17  ? 38   LYS A CD  1 
ATOM   306  C CE  . LYS A 1 42  ? 20.688  71.187  69.628 1.00 74.37  ? 38   LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 42  ? 21.038  70.207  70.703 1.00 77.33  ? 38   LYS A NZ  1 
ATOM   308  N N   . LYS A 1 43  ? 13.775  70.529  69.026 1.00 55.03  ? 39   LYS A N   1 
ATOM   309  C CA  . LYS A 1 43  ? 12.326  70.790  68.941 1.00 52.95  ? 39   LYS A CA  1 
ATOM   310  C C   . LYS A 1 43  ? 11.874  72.241  68.679 1.00 54.45  ? 39   LYS A C   1 
ATOM   311  O O   . LYS A 1 43  ? 10.989  72.750  69.371 1.00 49.35  ? 39   LYS A O   1 
ATOM   312  C CB  . LYS A 1 43  ? 11.593  70.230  70.162 1.00 50.02  ? 39   LYS A CB  1 
ATOM   313  C CG  . LYS A 1 43  ? 11.952  68.774  70.453 1.00 52.91  ? 39   LYS A CG  1 
ATOM   314  C CD  . LYS A 1 43  ? 10.943  68.127  71.377 1.00 60.12  ? 39   LYS A CD  1 
ATOM   315  C CE  . LYS A 1 43  ? 11.378  66.732  71.781 1.00 68.06  ? 39   LYS A CE  1 
ATOM   316  N NZ  . LYS A 1 43  ? 11.203  66.507  73.257 1.00 83.22  ? 39   LYS A NZ  1 
ATOM   317  N N   . LYS A 1 44  ? 12.450  72.895  67.668 1.00 56.53  ? 40   LYS A N   1 
ATOM   318  C CA  . LYS A 1 44  ? 12.069  74.279  67.342 1.00 58.84  ? 40   LYS A CA  1 
ATOM   319  C C   . LYS A 1 44  ? 12.053  74.607  65.835 1.00 58.24  ? 40   LYS A C   1 
ATOM   320  O O   . LYS A 1 44  ? 12.905  74.138  65.069 1.00 62.06  ? 40   LYS A O   1 
ATOM   321  C CB  . LYS A 1 44  ? 12.984  75.270  68.078 1.00 61.16  ? 40   LYS A CB  1 
ATOM   322  C CG  . LYS A 1 44  ? 12.218  76.422  68.749 1.00 60.61  ? 40   LYS A CG  1 
ATOM   323  C CD  . LYS A 1 44  ? 12.674  76.646  70.186 1.00 56.96  ? 40   LYS A CD  1 
ATOM   324  C CE  . LYS A 1 44  ? 11.612  76.218  71.189 1.00 61.28  ? 40   LYS A CE  1 
ATOM   325  N NZ  . LYS A 1 44  ? 10.520  77.226  71.354 1.00 65.23  ? 40   LYS A NZ  1 
ATOM   326  N N   . THR A 1 45  ? 11.076  75.421  65.428 1.00 49.71  ? 41   THR A N   1 
ATOM   327  C CA  . THR A 1 45  ? 10.886  75.842  64.030 1.00 41.61  ? 41   THR A CA  1 
ATOM   328  C C   . THR A 1 45  ? 11.847  76.947  63.586 1.00 41.36  ? 41   THR A C   1 
ATOM   329  O O   . THR A 1 45  ? 11.768  78.074  64.076 1.00 48.21  ? 41   THR A O   1 
ATOM   330  C CB  . THR A 1 45  ? 9.422   76.362  63.807 1.00 38.34  ? 41   THR A CB  1 
ATOM   331  O OG1 . THR A 1 45  ? 8.527   75.259  63.625 1.00 49.14  ? 41   THR A OG1 1 
ATOM   332  C CG2 . THR A 1 45  ? 9.327   77.257  62.586 1.00 26.43  ? 41   THR A CG2 1 
ATOM   333  N N   . VAL A 1 46  ? 12.720  76.632  62.631 1.00 41.86  ? 42   VAL A N   1 
ATOM   334  C CA  . VAL A 1 46  ? 13.706  77.586  62.113 1.00 41.12  ? 42   VAL A CA  1 
ATOM   335  C C   . VAL A 1 46  ? 13.356  78.149  60.719 1.00 45.68  ? 42   VAL A C   1 
ATOM   336  O O   . VAL A 1 46  ? 13.577  77.497  59.694 1.00 45.37  ? 42   VAL A O   1 
ATOM   337  C CB  . VAL A 1 46  ? 15.083  76.926  62.051 1.00 36.02  ? 42   VAL A CB  1 
ATOM   338  C CG1 . VAL A 1 46  ? 16.071  77.835  61.386 1.00 36.98  ? 42   VAL A CG1 1 
ATOM   339  C CG2 . VAL A 1 46  ? 15.540  76.597  63.452 1.00 44.14  ? 42   VAL A CG2 1 
ATOM   340  N N   . TRP A 1 47  ? 12.830  79.375  60.699 1.00 49.73  ? 43   TRP A N   1 
ATOM   341  C CA  . TRP A 1 47  ? 12.429  80.053  59.472 1.00 46.79  ? 43   TRP A CA  1 
ATOM   342  C C   . TRP A 1 47  ? 13.618  80.532  58.670 1.00 49.25  ? 43   TRP A C   1 
ATOM   343  O O   . TRP A 1 47  ? 14.502  81.195  59.205 1.00 51.28  ? 43   TRP A O   1 
ATOM   344  C CB  . TRP A 1 47  ? 11.534  81.245  59.807 1.00 46.26  ? 43   TRP A CB  1 
ATOM   345  C CG  . TRP A 1 47  ? 10.235  80.818  60.348 1.00 48.39  ? 43   TRP A CG  1 
ATOM   346  C CD1 . TRP A 1 47  ? 9.961   80.484  61.640 1.00 50.00  ? 43   TRP A CD1 1 
ATOM   347  C CD2 . TRP A 1 47  ? 9.026   80.603  59.610 1.00 55.14  ? 43   TRP A CD2 1 
ATOM   348  N NE1 . TRP A 1 47  ? 8.654   80.069  61.756 1.00 60.50  ? 43   TRP A NE1 1 
ATOM   349  C CE2 . TRP A 1 47  ? 8.057   80.132  60.524 1.00 57.62  ? 43   TRP A CE2 1 
ATOM   350  C CE3 . TRP A 1 47  ? 8.667   80.759  58.265 1.00 56.00  ? 43   TRP A CE3 1 
ATOM   351  C CZ2 . TRP A 1 47  ? 6.748   79.815  60.133 1.00 53.51  ? 43   TRP A CZ2 1 
ATOM   352  C CZ3 . TRP A 1 47  ? 7.364   80.444  57.880 1.00 53.67  ? 43   TRP A CZ3 1 
ATOM   353  C CH2 . TRP A 1 47  ? 6.424   79.978  58.812 1.00 54.97  ? 43   TRP A CH2 1 
ATOM   354  N N   . ARG A 1 48  ? 13.626  80.192  57.382 1.00 50.25  ? 44   ARG A N   1 
ATOM   355  C CA  . ARG A 1 48  ? 14.698  80.592  56.477 1.00 44.11  ? 44   ARG A CA  1 
ATOM   356  C C   . ARG A 1 48  ? 14.637  82.110  56.330 1.00 44.05  ? 44   ARG A C   1 
ATOM   357  O O   . ARG A 1 48  ? 15.670  82.779  56.247 1.00 40.88  ? 44   ARG A O   1 
ATOM   358  C CB  . ARG A 1 48  ? 14.516  79.917  55.121 1.00 45.79  ? 44   ARG A CB  1 
ATOM   359  C CG  . ARG A 1 48  ? 15.573  80.290  54.100 1.00 49.17  ? 44   ARG A CG  1 
ATOM   360  C CD  . ARG A 1 48  ? 15.827  79.174  53.089 1.00 52.57  ? 44   ARG A CD  1 
ATOM   361  N NE  . ARG A 1 48  ? 17.245  79.043  52.754 1.00 53.52  ? 44   ARG A NE  1 
ATOM   362  C CZ  . ARG A 1 48  ? 18.042  80.062  52.436 1.00 61.40  ? 44   ARG A CZ  1 
ATOM   363  N NH1 . ARG A 1 48  ? 17.572  81.303  52.406 1.00 60.75  ? 44   ARG A NH1 1 
ATOM   364  N NH2 . ARG A 1 48  ? 19.320  79.843  52.155 1.00 60.33  ? 44   ARG A NH2 1 
ATOM   365  N N   . LEU A 1 49  ? 13.420  82.643  56.290 1.00 41.06  ? 45   LEU A N   1 
ATOM   366  C CA  . LEU A 1 49  ? 13.213  84.076  56.215 1.00 44.51  ? 45   LEU A CA  1 
ATOM   367  C C   . LEU A 1 49  ? 12.690  84.440  57.602 1.00 46.44  ? 45   LEU A C   1 
ATOM   368  O O   . LEU A 1 49  ? 11.520  84.229  57.911 1.00 45.28  ? 45   LEU A O   1 
ATOM   369  C CB  . LEU A 1 49  ? 12.178  84.415  55.136 1.00 49.28  ? 45   LEU A CB  1 
ATOM   370  C CG  . LEU A 1 49  ? 12.772  84.766  53.763 1.00 46.50  ? 45   LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 49  ? 13.904  83.807  53.440 1.00 51.60  ? 45   LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 49  ? 11.700  84.691  52.695 1.00 45.17  ? 45   LEU A CD2 1 
ATOM   373  N N   . PRO A 1 50  ? 13.556  84.999  58.456 1.00 46.51  ? 46   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 13.160  85.372  59.816 1.00 45.29  ? 46   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 11.919  86.232  59.876 1.00 44.59  ? 46   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 11.023  85.995  60.684 1.00 41.86  ? 46   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 14.389  86.089  60.366 1.00 42.48  ? 46   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 15.515  85.640  59.507 1.00 42.34  ? 46   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 14.938  85.398  58.159 1.00 49.48  ? 46   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 11.883  87.234  59.014 1.00 48.73  ? 47   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 10.759  88.146  58.937 1.00 52.26  ? 47   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 9.468   87.359  58.803 1.00 52.69  ? 47   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 8.395   87.824  59.196 1.00 50.57  ? 47   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 10.921  89.030  57.719 1.00 52.48  ? 47   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 11.320  88.231  56.496 1.00 57.74  ? 47   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 11.340  89.065  55.243 1.00 63.56  ? 47   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 10.283  89.641  54.892 1.00 66.14  ? 47   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 12.419  89.143  54.616 1.00 60.92  ? 47   GLU A OE2 1 
ATOM   389  N N   . PHE A 1 52  ? 9.583   86.167  58.223 1.00 59.92  ? 48   PHE A N   1 
ATOM   390  C CA  . PHE A 1 52  ? 8.435   85.279  58.019 1.00 64.40  ? 48   PHE A CA  1 
ATOM   391  C C   . PHE A 1 52  ? 8.032   84.623  59.346 1.00 60.35  ? 48   PHE A C   1 
ATOM   392  O O   . PHE A 1 52  ? 6.842   84.509  59.660 1.00 50.20  ? 48   PHE A O   1 
ATOM   393  C CB  . PHE A 1 52  ? 8.778   84.186  56.987 1.00 65.28  ? 48   PHE A CB  1 
ATOM   394  C CG  . PHE A 1 52  ? 8.572   84.599  55.543 1.00 63.30  ? 48   PHE A CG  1 
ATOM   395  C CD1 . PHE A 1 52  ? 8.294   85.918  55.200 1.00 63.83  ? 48   PHE A CD1 1 
ATOM   396  C CD2 . PHE A 1 52  ? 8.667   83.653  54.523 1.00 64.72  ? 48   PHE A CD2 1 
ATOM   397  C CE1 . PHE A 1 52  ? 8.116   86.289  53.865 1.00 65.38  ? 48   PHE A CE1 1 
ATOM   398  C CE2 . PHE A 1 52  ? 8.490   84.014  53.184 1.00 63.24  ? 48   PHE A CE2 1 
ATOM   399  C CZ  . PHE A 1 52  ? 8.214   85.333  52.857 1.00 62.83  ? 48   PHE A CZ  1 
ATOM   400  N N   . GLY A 1 53  ? 9.035   84.198  60.113 1.00 61.21  ? 49   GLY A N   1 
ATOM   401  C CA  . GLY A 1 53  ? 8.782   83.569  61.392 1.00 63.21  ? 49   GLY A CA  1 
ATOM   402  C C   . GLY A 1 53  ? 8.200   84.519  62.420 1.00 66.68  ? 49   GLY A C   1 
ATOM   403  O O   . GLY A 1 53  ? 7.880   84.109  63.534 1.00 69.51  ? 49   GLY A O   1 
ATOM   404  N N   . GLN A 1 54  ? 8.054   85.787  62.050 1.00 67.82  ? 50   GLN A N   1 
ATOM   405  C CA  . GLN A 1 54  ? 7.504   86.775  62.961 1.00 66.35  ? 50   GLN A CA  1 
ATOM   406  C C   . GLN A 1 54  ? 6.078   87.141  62.613 1.00 66.18  ? 50   GLN A C   1 
ATOM   407  O O   . GLN A 1 54  ? 5.438   87.874  63.356 1.00 69.85  ? 50   GLN A O   1 
ATOM   408  C CB  . GLN A 1 54  ? 8.363   88.031  62.962 1.00 68.57  ? 50   GLN A CB  1 
ATOM   409  C CG  . GLN A 1 54  ? 9.785   87.767  63.373 1.00 83.20  ? 50   GLN A CG  1 
ATOM   410  C CD  . GLN A 1 54  ? 10.652  88.999  63.237 1.00 95.37  ? 50   GLN A CD  1 
ATOM   411  O OE1 . GLN A 1 54  ? 10.268  90.087  63.667 1.00 99.75  ? 50   GLN A OE1 1 
ATOM   412  N NE2 . GLN A 1 54  ? 11.830  88.838  62.633 1.00 100.00 ? 50   GLN A NE2 1 
ATOM   413  N N   . LEU A 1 55  ? 5.581   86.643  61.484 1.00 67.37  ? 51   LEU A N   1 
ATOM   414  C CA  . LEU A 1 55  ? 4.206   86.930  61.083 1.00 68.25  ? 51   LEU A CA  1 
ATOM   415  C C   . LEU A 1 55  ? 3.316   85.676  60.954 1.00 66.46  ? 51   LEU A C   1 
ATOM   416  O O   . LEU A 1 55  ? 2.094   85.773  60.803 1.00 68.23  ? 51   LEU A O   1 
ATOM   417  C CB  . LEU A 1 55  ? 4.188   87.728  59.774 1.00 71.34  ? 51   LEU A CB  1 
ATOM   418  C CG  . LEU A 1 55  ? 2.787   88.206  59.369 1.00 79.92  ? 51   LEU A CG  1 
ATOM   419  C CD1 . LEU A 1 55  ? 2.209   89.071  60.490 1.00 83.23  ? 51   LEU A CD1 1 
ATOM   420  C CD2 . LEU A 1 55  ? 2.849   88.973  58.059 1.00 80.41  ? 51   LEU A CD2 1 
ATOM   421  N N   . ILE A 1 56  ? 3.925   84.499  61.017 1.00 61.27  ? 52   ILE A N   1 
ATOM   422  C CA  . ILE A 1 56  ? 3.198   83.253  60.831 1.00 54.02  ? 52   ILE A CA  1 
ATOM   423  C C   . ILE A 1 56  ? 3.841   82.273  61.785 1.00 54.32  ? 52   ILE A C   1 
ATOM   424  O O   . ILE A 1 56  ? 5.050   82.311  61.997 1.00 58.60  ? 52   ILE A O   1 
ATOM   425  C CB  . ILE A 1 56  ? 3.270   82.731  59.412 1.00 42.08  ? 52   ILE A CB  1 
ATOM   426  N N   . LEU A 1 57  ? 3.037   81.397  62.369 1.00 55.69  ? 53   LEU A N   1 
ATOM   427  C CA  . LEU A 1 57  ? 3.561   80.430  63.318 1.00 48.24  ? 53   LEU A CA  1 
ATOM   428  C C   . LEU A 1 57  ? 3.237   78.986  62.958 1.00 45.76  ? 53   LEU A C   1 
ATOM   429  O O   . LEU A 1 57  ? 2.178   78.673  62.415 1.00 46.03  ? 53   LEU A O   1 
ATOM   430  C CB  . LEU A 1 57  ? 3.030   80.749  64.723 1.00 45.82  ? 53   LEU A CB  1 
ATOM   431  C CG  . LEU A 1 57  ? 2.427   79.617  65.566 1.00 49.96  ? 53   LEU A CG  1 
ATOM   432  C CD1 . LEU A 1 57  ? 3.389   79.195  66.674 1.00 49.97  ? 53   LEU A CD1 1 
ATOM   433  C CD2 . LEU A 1 57  ? 1.123   80.087  66.163 1.00 50.46  ? 53   LEU A CD2 1 
ATOM   434  N N   . PHE A 1 58  ? 4.175   78.104  63.254 1.00 42.31  ? 54   PHE A N   1 
ATOM   435  C CA  . PHE A 1 58  ? 3.975   76.697  63.003 1.00 40.58  ? 54   PHE A CA  1 
ATOM   436  C C   . PHE A 1 58  ? 4.476   75.971  64.237 1.00 42.68  ? 54   PHE A C   1 
ATOM   437  O O   . PHE A 1 58  ? 5.673   75.968  64.518 1.00 42.07  ? 54   PHE A O   1 
ATOM   438  C CB  . PHE A 1 58  ? 4.765   76.223  61.780 1.00 36.52  ? 54   PHE A CB  1 
ATOM   439  C CG  . PHE A 1 58  ? 4.769   74.738  61.635 1.00 31.84  ? 54   PHE A CG  1 
ATOM   440  C CD1 . PHE A 1 58  ? 3.636   74.078  61.174 1.00 29.71  ? 54   PHE A CD1 1 
ATOM   441  C CD2 . PHE A 1 58  ? 5.849   73.981  62.091 1.00 33.11  ? 54   PHE A CD2 1 
ATOM   442  C CE1 . PHE A 1 58  ? 3.570   72.680  61.183 1.00 26.58  ? 54   PHE A CE1 1 
ATOM   443  C CE2 . PHE A 1 58  ? 5.796   72.574  62.105 1.00 30.58  ? 54   PHE A CE2 1 
ATOM   444  C CZ  . PHE A 1 58  ? 4.655   71.927  61.654 1.00 23.81  ? 54   PHE A CZ  1 
ATOM   445  N N   . GLU A 1 59  ? 3.563   75.372  64.988 1.00 44.51  ? 55   GLU A N   1 
ATOM   446  C CA  . GLU A 1 59  ? 3.960   74.645  66.187 1.00 46.12  ? 55   GLU A CA  1 
ATOM   447  C C   . GLU A 1 59  ? 4.773   73.423  65.766 1.00 41.87  ? 55   GLU A C   1 
ATOM   448  O O   . GLU A 1 59  ? 4.351   72.641  64.916 1.00 40.34  ? 55   GLU A O   1 
ATOM   449  C CB  . GLU A 1 59  ? 2.730   74.204  66.980 1.00 50.43  ? 55   GLU A CB  1 
ATOM   450  C CG  . GLU A 1 59  ? 2.107   75.284  67.855 1.00 58.97  ? 55   GLU A CG  1 
ATOM   451  C CD  . GLU A 1 59  ? 0.590   75.149  67.946 1.00 73.55  ? 55   GLU A CD  1 
ATOM   452  O OE1 . GLU A 1 59  ? 0.093   74.435  68.848 1.00 74.94  ? 55   GLU A OE1 1 
ATOM   453  O OE2 . GLU A 1 59  ? -0.107  75.760  67.108 1.00 85.94  ? 55   GLU A OE2 1 
ATOM   454  N N   . PRO A 1 60  ? 5.956   73.249  66.362 1.00 38.52  ? 56   PRO A N   1 
ATOM   455  C CA  . PRO A 1 60  ? 6.844   72.128  66.058 1.00 35.72  ? 56   PRO A CA  1 
ATOM   456  C C   . PRO A 1 60  ? 6.201   70.768  66.220 1.00 38.93  ? 56   PRO A C   1 
ATOM   457  O O   . PRO A 1 60  ? 6.485   69.861  65.448 1.00 38.98  ? 56   PRO A O   1 
ATOM   458  C CB  . PRO A 1 60  ? 8.012   72.313  67.024 1.00 34.38  ? 56   PRO A CB  1 
ATOM   459  C CG  . PRO A 1 60  ? 7.958   73.727  67.425 1.00 31.69  ? 56   PRO A CG  1 
ATOM   460  C CD  . PRO A 1 60  ? 6.525   74.130  67.393 1.00 35.18  ? 56   PRO A CD  1 
ATOM   461  N N   . GLN A 1 61  ? 5.344   70.621  67.229 1.00 45.77  ? 57   GLN A N   1 
ATOM   462  C CA  . GLN A 1 61  ? 4.682   69.341  67.478 1.00 48.55  ? 57   GLN A CA  1 
ATOM   463  C C   . GLN A 1 61  ? 4.198   68.725  66.176 1.00 46.54  ? 57   GLN A C   1 
ATOM   464  O O   . GLN A 1 61  ? 4.405   67.533  65.934 1.00 47.11  ? 57   GLN A O   1 
ATOM   465  C CB  . GLN A 1 61  ? 3.491   69.502  68.425 1.00 47.54  ? 57   GLN A CB  1 
ATOM   466  C CG  . GLN A 1 61  ? 3.773   70.331  69.649 1.00 57.96  ? 57   GLN A CG  1 
ATOM   467  C CD  . GLN A 1 61  ? 3.074   71.672  69.601 1.00 62.33  ? 57   GLN A CD  1 
ATOM   468  O OE1 . GLN A 1 61  ? 3.645   72.662  69.145 1.00 69.32  ? 57   GLN A OE1 1 
ATOM   469  N NE2 . GLN A 1 61  ? 1.829   71.713  70.070 1.00 66.00  ? 57   GLN A NE2 1 
ATOM   470  N N   . GLY A 1 62  ? 3.550   69.539  65.345 1.00 43.47  ? 58   GLY A N   1 
ATOM   471  C CA  . GLY A 1 62  ? 3.058   69.050  64.068 1.00 36.19  ? 58   GLY A CA  1 
ATOM   472  C C   . GLY A 1 62  ? 4.144   68.301  63.320 1.00 31.91  ? 58   GLY A C   1 
ATOM   473  O O   . GLY A 1 62  ? 3.971   67.143  62.934 1.00 32.47  ? 58   GLY A O   1 
ATOM   474  N N   . GLY A 1 63  ? 5.279   68.961  63.120 1.00 28.77  ? 59   GLY A N   1 
ATOM   475  C CA  . GLY A 1 63  ? 6.367   68.315  62.421 1.00 30.44  ? 59   GLY A CA  1 
ATOM   476  C C   . GLY A 1 63  ? 6.762   67.047  63.138 1.00 32.95  ? 59   GLY A C   1 
ATOM   477  O O   . GLY A 1 63  ? 6.934   65.993  62.524 1.00 30.73  ? 59   GLY A O   1 
ATOM   478  N N   . LEU A 1 64  ? 6.883   67.165  64.460 1.00 41.56  ? 60   LEU A N   1 
ATOM   479  C CA  . LEU A 1 64  ? 7.278   66.062  65.337 1.00 41.07  ? 60   LEU A CA  1 
ATOM   480  C C   . LEU A 1 64  ? 6.393   64.828  65.209 1.00 39.86  ? 60   LEU A C   1 
ATOM   481  O O   . LEU A 1 64  ? 6.880   63.699  65.312 1.00 35.98  ? 60   LEU A O   1 
ATOM   482  C CB  . LEU A 1 64  ? 7.296   66.532  66.798 1.00 49.68  ? 60   LEU A CB  1 
ATOM   483  C CG  . LEU A 1 64  ? 8.125   67.777  67.145 1.00 53.59  ? 60   LEU A CG  1 
ATOM   484  C CD1 . LEU A 1 64  ? 7.697   68.288  68.518 1.00 56.15  ? 60   LEU A CD1 1 
ATOM   485  C CD2 . LEU A 1 64  ? 9.621   67.449  67.126 1.00 54.60  ? 60   LEU A CD2 1 
ATOM   486  N N   . GLN A 1 65  ? 5.097   65.042  64.992 1.00 39.97  ? 61   GLN A N   1 
ATOM   487  C CA  . GLN A 1 65  ? 4.153   63.938  64.838 1.00 43.66  ? 61   GLN A CA  1 
ATOM   488  C C   . GLN A 1 65  ? 4.489   63.129  63.585 1.00 46.76  ? 61   GLN A C   1 
ATOM   489  O O   . GLN A 1 65  ? 4.625   61.902  63.634 1.00 51.99  ? 61   GLN A O   1 
ATOM   490  C CB  . GLN A 1 65  ? 2.725   64.469  64.724 1.00 43.49  ? 61   GLN A CB  1 
ATOM   491  C CG  . GLN A 1 65  ? 2.219   65.175  65.963 1.00 53.65  ? 61   GLN A CG  1 
ATOM   492  C CD  . GLN A 1 65  ? 0.917   65.905  65.710 1.00 57.49  ? 61   GLN A CD  1 
ATOM   493  O OE1 . GLN A 1 65  ? 0.197   65.598  64.758 1.00 58.39  ? 61   GLN A OE1 1 
ATOM   494  N NE2 . GLN A 1 65  ? 0.607   66.878  66.561 1.00 61.93  ? 61   GLN A NE2 1 
ATOM   495  N N   . ASN A 1 66  ? 4.625   63.828  62.463 1.00 42.70  ? 62   ASN A N   1 
ATOM   496  C CA  . ASN A 1 66  ? 4.945   63.185  61.198 1.00 33.30  ? 62   ASN A CA  1 
ATOM   497  C C   . ASN A 1 66  ? 6.253   62.391  61.268 1.00 30.19  ? 62   ASN A C   1 
ATOM   498  O O   . ASN A 1 66  ? 6.346   61.279  60.735 1.00 23.22  ? 62   ASN A O   1 
ATOM   499  C CB  . ASN A 1 66  ? 5.003   64.245  60.107 1.00 26.99  ? 62   ASN A CB  1 
ATOM   500  C CG  . ASN A 1 66  ? 3.641   64.560  59.553 1.00 22.71  ? 62   ASN A CG  1 
ATOM   501  O OD1 . ASN A 1 66  ? 2.623   64.161  60.117 1.00 27.64  ? 62   ASN A OD1 1 
ATOM   502  N ND2 . ASN A 1 66  ? 3.608   65.269  58.441 1.00 28.47  ? 62   ASN A ND2 1 
ATOM   503  N N   . ILE A 1 67  ? 7.258   62.953  61.933 1.00 22.46  ? 63   ILE A N   1 
ATOM   504  C CA  . ILE A 1 67  ? 8.530   62.250  62.078 1.00 27.27  ? 63   ILE A CA  1 
ATOM   505  C C   . ILE A 1 67  ? 8.261   60.911  62.771 1.00 25.73  ? 63   ILE A C   1 
ATOM   506  O O   . ILE A 1 67  ? 8.812   59.871  62.402 1.00 28.83  ? 63   ILE A O   1 
ATOM   507  C CB  . ILE A 1 67  ? 9.539   63.035  62.958 1.00 28.03  ? 63   ILE A CB  1 
ATOM   508  C CG1 . ILE A 1 67  ? 9.838   64.409  62.349 1.00 25.88  ? 63   ILE A CG1 1 
ATOM   509  C CG2 . ILE A 1 67  ? 10.812  62.211  63.129 1.00 23.35  ? 63   ILE A CG2 1 
ATOM   510  C CD1 . ILE A 1 67  ? 10.535  64.357  61.000 1.00 27.50  ? 63   ILE A CD1 1 
ATOM   511  N N   . ALA A 1 68  ? 7.417   60.949  63.792 1.00 23.12  ? 64   ALA A N   1 
ATOM   512  C CA  . ALA A 1 68  ? 7.085   59.748  64.526 1.00 22.89  ? 64   ALA A CA  1 
ATOM   513  C C   . ALA A 1 68  ? 6.295   58.817  63.605 1.00 26.52  ? 64   ALA A C   1 
ATOM   514  O O   . ALA A 1 68  ? 6.547   57.611  63.544 1.00 31.38  ? 64   ALA A O   1 
ATOM   515  C CB  . ALA A 1 68  ? 6.269   60.112  65.769 1.00 17.48  ? 64   ALA A CB  1 
ATOM   516  N N   . ALA A 1 69  ? 5.346   59.385  62.872 1.00 26.62  ? 65   ALA A N   1 
ATOM   517  C CA  . ALA A 1 69  ? 4.528   58.600  61.965 1.00 23.77  ? 65   ALA A CA  1 
ATOM   518  C C   . ALA A 1 69  ? 5.424   57.871  60.979 1.00 26.91  ? 65   ALA A C   1 
ATOM   519  O O   . ALA A 1 69  ? 5.171   56.720  60.646 1.00 28.25  ? 65   ALA A O   1 
ATOM   520  C CB  . ALA A 1 69  ? 3.552   59.501  61.229 1.00 19.28  ? 65   ALA A CB  1 
ATOM   521  N N   . GLU A 1 70  ? 6.484   58.534  60.526 1.00 30.81  ? 66   GLU A N   1 
ATOM   522  C CA  . GLU A 1 70  ? 7.402   57.920  59.568 1.00 28.90  ? 66   GLU A CA  1 
ATOM   523  C C   . GLU A 1 70  ? 8.350   56.916  60.223 1.00 28.08  ? 66   GLU A C   1 
ATOM   524  O O   . GLU A 1 70  ? 8.670   55.888  59.627 1.00 30.17  ? 66   GLU A O   1 
ATOM   525  C CB  . GLU A 1 70  ? 8.191   59.000  58.818 1.00 35.18  ? 66   GLU A CB  1 
ATOM   526  C CG  . GLU A 1 70  ? 7.401   59.691  57.682 1.00 36.34  ? 66   GLU A CG  1 
ATOM   527  C CD  . GLU A 1 70  ? 6.987   58.743  56.564 1.00 33.80  ? 66   GLU A CD  1 
ATOM   528  O OE1 . GLU A 1 70  ? 6.009   57.995  56.753 1.00 31.73  ? 66   GLU A OE1 1 
ATOM   529  O OE2 . GLU A 1 70  ? 7.635   58.744  55.495 1.00 43.44  ? 66   GLU A OE2 1 
ATOM   530  N N   . LYS A 1 71  ? 8.816   57.212  61.433 1.00 29.13  ? 67   LYS A N   1 
ATOM   531  C CA  . LYS A 1 71  ? 9.673   56.266  62.148 1.00 27.65  ? 67   LYS A CA  1 
ATOM   532  C C   . LYS A 1 71  ? 8.874   54.974  62.142 1.00 24.51  ? 67   LYS A C   1 
ATOM   533  O O   . LYS A 1 71  ? 9.373   53.906  61.793 1.00 25.67  ? 67   LYS A O   1 
ATOM   534  C CB  . LYS A 1 71  ? 9.856   56.701  63.595 1.00 25.23  ? 67   LYS A CB  1 
ATOM   535  C CG  . LYS A 1 71  ? 11.219  57.252  63.938 1.00 50.25  ? 67   LYS A CG  1 
ATOM   536  C CD  . LYS A 1 71  ? 11.323  57.657  65.429 1.00 66.21  ? 67   LYS A CD  1 
ATOM   537  C CE  . LYS A 1 71  ? 12.057  59.005  65.635 1.00 71.51  ? 67   LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 71  ? 13.298  58.914  66.481 1.00 74.53  ? 67   LYS A NZ  1 
ATOM   539  N N   . HIS A 1 72  ? 7.609   55.113  62.531 1.00 26.46  ? 68   HIS A N   1 
ATOM   540  C CA  . HIS A 1 72  ? 6.659   54.015  62.603 1.00 32.22  ? 68   HIS A CA  1 
ATOM   541  C C   . HIS A 1 72  ? 6.567   53.323  61.256 1.00 39.11  ? 68   HIS A C   1 
ATOM   542  O O   . HIS A 1 72  ? 6.825   52.131  61.133 1.00 46.11  ? 68   HIS A O   1 
ATOM   543  C CB  . HIS A 1 72  ? 5.273   54.547  63.001 1.00 32.91  ? 68   HIS A CB  1 
ATOM   544  C CG  . HIS A 1 72  ? 4.223   53.482  63.134 1.00 36.77  ? 68   HIS A CG  1 
ATOM   545  N ND1 . HIS A 1 72  ? 4.010   52.790  64.306 1.00 51.12  ? 68   HIS A ND1 1 
ATOM   546  C CD2 . HIS A 1 72  ? 3.325   52.998  62.243 1.00 38.50  ? 68   HIS A CD2 1 
ATOM   547  C CE1 . HIS A 1 72  ? 3.022   51.926  64.133 1.00 47.24  ? 68   HIS A CE1 1 
ATOM   548  N NE2 . HIS A 1 72  ? 2.590   52.033  62.890 1.00 38.83  ? 68   HIS A NE2 1 
ATOM   549  N N   . ASN A 1 73  ? 6.211   54.085  60.235 1.00 40.39  ? 69   ASN A N   1 
ATOM   550  C CA  . ASN A 1 73  ? 6.058   53.515  58.915 1.00 37.47  ? 69   ASN A CA  1 
ATOM   551  C C   . ASN A 1 73  ? 7.309   52.889  58.335 1.00 37.24  ? 69   ASN A C   1 
ATOM   552  O O   . ASN A 1 73  ? 7.215   51.926  57.572 1.00 45.82  ? 69   ASN A O   1 
ATOM   553  C CB  . ASN A 1 73  ? 5.518   54.575  57.963 1.00 36.28  ? 69   ASN A CB  1 
ATOM   554  C CG  . ASN A 1 73  ? 4.094   54.949  58.281 1.00 37.09  ? 69   ASN A CG  1 
ATOM   555  O OD1 . ASN A 1 73  ? 3.392   54.217  58.977 1.00 39.89  ? 69   ASN A OD1 1 
ATOM   556  N ND2 . ASN A 1 73  ? 3.659   56.093  57.782 1.00 35.34  ? 69   ASN A ND2 1 
ATOM   557  N N   . LEU A 1 74  ? 8.480   53.412  58.683 1.00 32.56  ? 70   LEU A N   1 
ATOM   558  C CA  . LEU A 1 74  ? 9.708   52.859  58.131 1.00 34.72  ? 70   LEU A CA  1 
ATOM   559  C C   . LEU A 1 74  ? 9.876   51.429  58.588 1.00 42.08  ? 70   LEU A C   1 
ATOM   560  O O   . LEU A 1 74  ? 10.050  50.521  57.769 1.00 47.44  ? 70   LEU A O   1 
ATOM   561  C CB  . LEU A 1 74  ? 10.919  53.678  58.570 1.00 31.78  ? 70   LEU A CB  1 
ATOM   562  C CG  . LEU A 1 74  ? 12.292  53.162  58.122 1.00 26.55  ? 70   LEU A CG  1 
ATOM   563  C CD1 . LEU A 1 74  ? 12.287  52.834  56.630 1.00 13.78  ? 70   LEU A CD1 1 
ATOM   564  C CD2 . LEU A 1 74  ? 13.334  54.214  58.432 1.00 16.20  ? 70   LEU A CD2 1 
ATOM   565  N N   . GLY A 1 75  ? 9.812   51.238  59.905 1.00 41.92  ? 71   GLY A N   1 
ATOM   566  C CA  . GLY A 1 75  ? 9.959   49.915  60.481 1.00 36.06  ? 71   GLY A CA  1 
ATOM   567  C C   . GLY A 1 75  ? 9.007   48.909  59.880 1.00 36.22  ? 71   GLY A C   1 
ATOM   568  O O   . GLY A 1 75  ? 9.361   47.747  59.716 1.00 43.11  ? 71   GLY A O   1 
ATOM   569  N N   . ILE A 1 76  ? 7.801   49.359  59.550 1.00 39.90  ? 72   ILE A N   1 
ATOM   570  C CA  . ILE A 1 76  ? 6.775   48.505  58.953 1.00 41.85  ? 72   ILE A CA  1 
ATOM   571  C C   . ILE A 1 76  ? 7.073   48.230  57.470 1.00 46.79  ? 72   ILE A C   1 
ATOM   572  O O   . ILE A 1 76  ? 6.983   47.088  57.001 1.00 50.45  ? 72   ILE A O   1 
ATOM   573  C CB  . ILE A 1 76  ? 5.381   49.167  59.060 1.00 41.34  ? 72   ILE A CB  1 
ATOM   574  C CG1 . ILE A 1 76  ? 5.105   49.610  60.504 1.00 44.30  ? 72   ILE A CG1 1 
ATOM   575  C CG2 . ILE A 1 76  ? 4.324   48.215  58.561 1.00 51.95  ? 72   ILE A CG2 1 
ATOM   576  C CD1 . ILE A 1 76  ? 4.440   48.555  61.394 1.00 51.57  ? 72   ILE A CD1 1 
ATOM   577  N N   . LEU A 1 77  ? 7.429   49.278  56.731 1.00 45.54  ? 73   LEU A N   1 
ATOM   578  C CA  . LEU A 1 77  ? 7.730   49.122  55.312 1.00 42.96  ? 73   LEU A CA  1 
ATOM   579  C C   . LEU A 1 77  ? 8.998   48.303  55.095 1.00 37.54  ? 73   LEU A C   1 
ATOM   580  O O   . LEU A 1 77  ? 9.027   47.400  54.263 1.00 36.09  ? 73   LEU A O   1 
ATOM   581  C CB  . LEU A 1 77  ? 7.859   50.494  54.639 1.00 32.30  ? 73   LEU A CB  1 
ATOM   582  C CG  . LEU A 1 77  ? 6.694   50.833  53.712 1.00 26.03  ? 73   LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 77  ? 6.880   50.114  52.420 1.00 24.32  ? 73   LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 77  ? 5.382   50.413  54.330 1.00 23.77  ? 73   LEU A CD2 1 
ATOM   585  N N   . THR A 1 78  ? 10.039  48.606  55.857 1.00 33.13  ? 74   THR A N   1 
ATOM   586  C CA  . THR A 1 78  ? 11.288  47.879  55.722 1.00 39.38  ? 74   THR A CA  1 
ATOM   587  C C   . THR A 1 78  ? 11.040  46.386  55.791 1.00 41.10  ? 74   THR A C   1 
ATOM   588  O O   . THR A 1 78  ? 11.617  45.609  55.042 1.00 45.79  ? 74   THR A O   1 
ATOM   589  C CB  . THR A 1 78  ? 12.273  48.250  56.825 1.00 39.91  ? 74   THR A CB  1 
ATOM   590  O OG1 . THR A 1 78  ? 12.275  49.672  57.017 1.00 34.77  ? 74   THR A OG1 1 
ATOM   591  C CG2 . THR A 1 78  ? 13.666  47.789  56.438 1.00 49.32  ? 74   THR A CG2 1 
ATOM   592  N N   . LYS A 1 79  ? 10.175  45.987  56.706 1.00 47.00  ? 75   LYS A N   1 
ATOM   593  C CA  . LYS A 1 79  ? 9.850   44.586  56.864 1.00 44.70  ? 75   LYS A CA  1 
ATOM   594  C C   . LYS A 1 79  ? 9.087   44.147  55.633 1.00 43.07  ? 75   LYS A C   1 
ATOM   595  O O   . LYS A 1 79  ? 9.478   43.201  54.959 1.00 44.49  ? 75   LYS A O   1 
ATOM   596  C CB  . LYS A 1 79  ? 8.991   44.380  58.121 1.00 48.26  ? 75   LYS A CB  1 
ATOM   597  C CG  . LYS A 1 79  ? 9.654   44.859  59.421 1.00 47.30  ? 75   LYS A CG  1 
ATOM   598  C CD  . LYS A 1 79  ? 8.764   44.647  60.643 1.00 43.28  ? 75   LYS A CD  1 
ATOM   599  C CE  . LYS A 1 79  ? 9.596   44.446  61.911 1.00 44.03  ? 75   LYS A CE  1 
ATOM   600  N NZ  . LYS A 1 79  ? 10.509  45.591  62.199 1.00 38.53  ? 75   LYS A NZ  1 
ATOM   601  N N   . ARG A 1 80  ? 8.006   44.859  55.336 1.00 42.18  ? 76   ARG A N   1 
ATOM   602  C CA  . ARG A 1 80  ? 7.164   44.530  54.197 1.00 46.94  ? 76   ARG A CA  1 
ATOM   603  C C   . ARG A 1 80  ? 7.950   44.314  52.909 1.00 47.24  ? 76   ARG A C   1 
ATOM   604  O O   . ARG A 1 80  ? 7.603   43.467  52.081 1.00 40.34  ? 76   ARG A O   1 
ATOM   605  C CB  . ARG A 1 80  ? 6.131   45.630  53.984 1.00 44.37  ? 76   ARG A CB  1 
ATOM   606  C CG  . ARG A 1 80  ? 5.254   45.386  52.778 1.00 46.99  ? 76   ARG A CG  1 
ATOM   607  C CD  . ARG A 1 80  ? 3.995   46.215  52.839 1.00 49.90  ? 76   ARG A CD  1 
ATOM   608  N NE  . ARG A 1 80  ? 3.725   46.711  54.182 1.00 49.29  ? 76   ARG A NE  1 
ATOM   609  C CZ  . ARG A 1 80  ? 3.189   47.898  54.441 1.00 54.29  ? 76   ARG A CZ  1 
ATOM   610  N NH1 . ARG A 1 80  ? 2.863   48.714  53.450 1.00 53.73  ? 76   ARG A NH1 1 
ATOM   611  N NH2 . ARG A 1 80  ? 2.976   48.274  55.692 1.00 56.95  ? 76   ARG A NH2 1 
ATOM   612  N N   . SER A 1 81  ? 9.011   45.091  52.750 1.00 53.39  ? 77   SER A N   1 
ATOM   613  C CA  . SER A 1 81  ? 9.856   45.012  51.567 1.00 58.48  ? 77   SER A CA  1 
ATOM   614  C C   . SER A 1 81  ? 10.851  43.868  51.680 1.00 64.00  ? 77   SER A C   1 
ATOM   615  O O   . SER A 1 81  ? 11.655  43.637  50.775 1.00 64.33  ? 77   SER A O   1 
ATOM   616  C CB  . SER A 1 81  ? 10.625  46.318  51.408 1.00 58.58  ? 77   SER A CB  1 
ATOM   617  O OG  . SER A 1 81  ? 11.617  46.434  52.418 1.00 56.05  ? 77   SER A OG  1 
ATOM   618  N N   . ASN A 1 82  ? 10.787  43.149  52.793 1.00 66.19  ? 78   ASN A N   1 
ATOM   619  C CA  . ASN A 1 82  ? 11.702  42.053  53.049 1.00 62.73  ? 78   ASN A CA  1 
ATOM   620  C C   . ASN A 1 82  ? 13.103  42.626  53.095 1.00 59.46  ? 78   ASN A C   1 
ATOM   621  O O   . ASN A 1 82  ? 14.066  42.033  52.618 1.00 58.50  ? 78   ASN A O   1 
ATOM   622  C CB  . ASN A 1 82  ? 11.568  40.975  51.983 1.00 69.96  ? 78   ASN A CB  1 
ATOM   623  C CG  . ASN A 1 82  ? 10.567  39.913  52.379 1.00 80.78  ? 78   ASN A CG  1 
ATOM   624  O OD1 . ASN A 1 82  ? 10.804  39.151  53.320 1.00 83.47  ? 78   ASN A OD1 1 
ATOM   625  N ND2 . ASN A 1 82  ? 9.438   39.871  51.675 1.00 87.15  ? 78   ASN A ND2 1 
ATOM   626  N N   . PHE A 1 83  ? 13.170  43.823  53.663 1.00 58.08  ? 79   PHE A N   1 
ATOM   627  C CA  . PHE A 1 83  ? 14.401  44.559  53.879 1.00 58.46  ? 79   PHE A CA  1 
ATOM   628  C C   . PHE A 1 83  ? 15.239  45.030  52.700 1.00 60.45  ? 79   PHE A C   1 
ATOM   629  O O   . PHE A 1 83  ? 16.467  45.040  52.789 1.00 64.16  ? 79   PHE A O   1 
ATOM   630  C CB  . PHE A 1 83  ? 15.283  43.767  54.837 1.00 60.79  ? 79   PHE A CB  1 
ATOM   631  C CG  . PHE A 1 83  ? 14.752  43.720  56.234 1.00 62.34  ? 79   PHE A CG  1 
ATOM   632  C CD1 . PHE A 1 83  ? 13.738  42.830  56.576 1.00 61.77  ? 79   PHE A CD1 1 
ATOM   633  C CD2 . PHE A 1 83  ? 15.249  44.581  57.206 1.00 65.43  ? 79   PHE A CD2 1 
ATOM   634  C CE1 . PHE A 1 83  ? 13.225  42.796  57.873 1.00 66.46  ? 79   PHE A CE1 1 
ATOM   635  C CE2 . PHE A 1 83  ? 14.744  44.559  58.509 1.00 69.14  ? 79   PHE A CE2 1 
ATOM   636  C CZ  . PHE A 1 83  ? 13.729  43.667  58.844 1.00 67.57  ? 79   PHE A CZ  1 
ATOM   637  N N   . THR A 1 84  ? 14.603  45.429  51.603 1.00 60.30  ? 80   THR A N   1 
ATOM   638  C CA  . THR A 1 84  ? 15.373  45.934  50.468 1.00 56.53  ? 80   THR A CA  1 
ATOM   639  C C   . THR A 1 84  ? 15.866  47.324  50.883 1.00 56.52  ? 80   THR A C   1 
ATOM   640  O O   . THR A 1 84  ? 15.098  48.132  51.403 1.00 62.78  ? 80   THR A O   1 
ATOM   641  C CB  . THR A 1 84  ? 14.517  46.062  49.179 1.00 57.10  ? 80   THR A CB  1 
ATOM   642  O OG1 . THR A 1 84  ? 13.400  45.163  49.234 1.00 56.65  ? 80   THR A OG1 1 
ATOM   643  C CG2 . THR A 1 84  ? 15.364  45.729  47.953 1.00 58.93  ? 80   THR A CG2 1 
ATOM   644  N N   . PRO A 1 85  ? 17.158  47.618  50.675 1.00 53.31  ? 81   PRO A N   1 
ATOM   645  C CA  . PRO A 1 85  ? 17.728  48.915  51.041 1.00 47.03  ? 81   PRO A CA  1 
ATOM   646  C C   . PRO A 1 85  ? 17.729  49.899  49.884 1.00 47.76  ? 81   PRO A C   1 
ATOM   647  O O   . PRO A 1 85  ? 17.326  49.578  48.762 1.00 43.11  ? 81   PRO A O   1 
ATOM   648  C CB  . PRO A 1 85  ? 19.139  48.562  51.452 1.00 48.84  ? 81   PRO A CB  1 
ATOM   649  C CG  . PRO A 1 85  ? 19.486  47.416  50.488 1.00 53.23  ? 81   PRO A CG  1 
ATOM   650  C CD  . PRO A 1 85  ? 18.181  46.744  50.080 1.00 53.43  ? 81   PRO A CD  1 
ATOM   651  N N   . ALA A 1 86  ? 18.217  51.096  50.167 1.00 49.44  ? 82   ALA A N   1 
ATOM   652  C CA  . ALA A 1 86  ? 18.273  52.146  49.169 1.00 55.96  ? 82   ALA A CA  1 
ATOM   653  C C   . ALA A 1 86  ? 19.424  51.949  48.192 1.00 59.00  ? 82   ALA A C   1 
ATOM   654  O O   . ALA A 1 86  ? 20.547  51.682  48.603 1.00 61.95  ? 82   ALA A O   1 
ATOM   655  C CB  . ALA A 1 86  ? 18.403  53.497  49.862 1.00 55.28  ? 82   ALA A CB  1 
ATOM   656  N N   . THR A 1 87  ? 19.141  52.071  46.899 1.00 62.46  ? 83   THR A N   1 
ATOM   657  C CA  . THR A 1 87  ? 20.177  51.945  45.879 1.00 66.40  ? 83   THR A CA  1 
ATOM   658  C C   . THR A 1 87  ? 20.768  53.346  45.731 1.00 66.88  ? 83   THR A C   1 
ATOM   659  O O   . THR A 1 87  ? 20.030  54.325  45.637 1.00 68.31  ? 83   THR A O   1 
ATOM   660  C CB  . THR A 1 87  ? 19.588  51.474  44.530 1.00 68.95  ? 83   THR A CB  1 
ATOM   661  O OG1 . THR A 1 87  ? 18.528  50.540  44.770 1.00 76.16  ? 83   THR A OG1 1 
ATOM   662  C CG2 . THR A 1 87  ? 20.651  50.785  43.699 1.00 72.85  ? 83   THR A CG2 1 
ATOM   663  N N   . ASN A 1 88  ? 22.094  53.439  45.707 1.00 69.66  ? 84   ASN A N   1 
ATOM   664  C CA  . ASN A 1 88  ? 22.777  54.731  45.625 1.00 73.00  ? 84   ASN A CA  1 
ATOM   665  C C   . ASN A 1 88  ? 22.855  55.477  44.295 1.00 74.34  ? 84   ASN A C   1 
ATOM   666  O O   . ASN A 1 88  ? 23.060  54.880  43.238 1.00 77.45  ? 84   ASN A O   1 
ATOM   667  C CB  . ASN A 1 88  ? 24.186  54.587  46.178 1.00 73.47  ? 84   ASN A CB  1 
ATOM   668  C CG  . ASN A 1 88  ? 24.244  54.863  47.654 1.00 74.72  ? 84   ASN A CG  1 
ATOM   669  O OD1 . ASN A 1 88  ? 24.254  56.018  48.085 1.00 72.71  ? 84   ASN A OD1 1 
ATOM   670  N ND2 . ASN A 1 88  ? 24.272  53.802  48.446 1.00 72.73  ? 84   ASN A ND2 1 
ATOM   671  N N   . GLU A 1 89  ? 22.718  56.801  44.383 1.00 74.85  ? 85   GLU A N   1 
ATOM   672  C CA  . GLU A 1 89  ? 22.765  57.701  43.227 1.00 75.26  ? 85   GLU A CA  1 
ATOM   673  C C   . GLU A 1 89  ? 23.936  58.685  43.335 1.00 75.69  ? 85   GLU A C   1 
ATOM   674  O O   . GLU A 1 89  ? 24.325  59.095  44.434 1.00 77.21  ? 85   GLU A O   1 
ATOM   675  C CB  . GLU A 1 89  ? 21.461  58.499  43.123 1.00 76.45  ? 85   GLU A CB  1 
ATOM   676  C CG  . GLU A 1 89  ? 20.211  57.652  43.008 1.00 79.41  ? 85   GLU A CG  1 
ATOM   677  C CD  . GLU A 1 89  ? 20.114  56.961  41.674 1.00 85.76  ? 85   GLU A CD  1 
ATOM   678  O OE1 . GLU A 1 89  ? 20.799  57.406  40.724 1.00 86.74  ? 85   GLU A OE1 1 
ATOM   679  O OE2 . GLU A 1 89  ? 19.354  55.975  41.580 1.00 88.03  ? 85   GLU A OE2 1 
ATOM   680  N N   . ALA A 1 90  ? 24.481  59.078  42.187 1.00 72.32  ? 86   ALA A N   1 
ATOM   681  C CA  . ALA A 1 90  ? 25.606  60.005  42.144 1.00 66.72  ? 86   ALA A CA  1 
ATOM   682  C C   . ALA A 1 90  ? 25.164  61.441  41.857 1.00 65.76  ? 86   ALA A C   1 
ATOM   683  O O   . ALA A 1 90  ? 24.609  61.727  40.793 1.00 67.94  ? 86   ALA A O   1 
ATOM   684  C CB  . ALA A 1 90  ? 26.595  59.552  41.084 1.00 60.17  ? 86   ALA A CB  1 
ATOM   685  N N   . PRO A 1 91  ? 25.416  62.369  42.802 1.00 62.26  ? 87   PRO A N   1 
ATOM   686  C CA  . PRO A 1 91  ? 25.042  63.786  42.654 1.00 60.29  ? 87   PRO A CA  1 
ATOM   687  C C   . PRO A 1 91  ? 25.857  64.621  41.658 1.00 62.88  ? 87   PRO A C   1 
ATOM   688  O O   . PRO A 1 91  ? 27.015  64.329  41.373 1.00 65.74  ? 87   PRO A O   1 
ATOM   689  C CB  . PRO A 1 91  ? 25.167  64.338  44.073 1.00 56.29  ? 87   PRO A CB  1 
ATOM   690  C CG  . PRO A 1 91  ? 26.218  63.489  44.699 1.00 55.62  ? 87   PRO A CG  1 
ATOM   691  C CD  . PRO A 1 91  ? 26.089  62.114  44.087 1.00 56.32  ? 87   PRO A CD  1 
ATOM   692  N N   . GLN A 1 92  ? 25.234  65.668  41.131 1.00 60.18  ? 88   GLN A N   1 
ATOM   693  C CA  . GLN A 1 92  ? 25.906  66.557  40.198 1.00 55.10  ? 88   GLN A CA  1 
ATOM   694  C C   . GLN A 1 92  ? 25.798  67.965  40.749 1.00 53.71  ? 88   GLN A C   1 
ATOM   695  O O   . GLN A 1 92  ? 24.702  68.451  41.008 1.00 53.05  ? 88   GLN A O   1 
ATOM   696  C CB  . GLN A 1 92  ? 25.245  66.490  38.835 1.00 60.91  ? 88   GLN A CB  1 
ATOM   697  C CG  . GLN A 1 92  ? 24.334  65.304  38.674 1.00 69.06  ? 88   GLN A CG  1 
ATOM   698  C CD  . GLN A 1 92  ? 24.973  64.182  37.880 1.00 81.80  ? 88   GLN A CD  1 
ATOM   699  O OE1 . GLN A 1 92  ? 24.321  63.187  37.566 1.00 86.82  ? 88   GLN A OE1 1 
ATOM   700  N NE2 . GLN A 1 92  ? 26.252  64.337  37.545 1.00 87.60  ? 88   GLN A NE2 1 
ATOM   701  N N   . ALA A 1 93  ? 26.935  68.626  40.922 1.00 53.42  ? 89   ALA A N   1 
ATOM   702  C CA  . ALA A 1 93  ? 26.931  69.969  41.474 1.00 53.91  ? 89   ALA A CA  1 
ATOM   703  C C   . ALA A 1 93  ? 27.211  71.049  40.454 1.00 55.84  ? 89   ALA A C   1 
ATOM   704  O O   . ALA A 1 93  ? 27.725  70.784  39.367 1.00 59.84  ? 89   ALA A O   1 
ATOM   705  C CB  . ALA A 1 93  ? 27.923  70.062  42.606 1.00 59.99  ? 89   ALA A CB  1 
ATOM   706  N N   . THR A 1 94  ? 26.885  72.277  40.836 1.00 55.41  ? 90   THR A N   1 
ATOM   707  C CA  . THR A 1 94  ? 27.063  73.435  39.975 1.00 51.55  ? 90   THR A CA  1 
ATOM   708  C C   . THR A 1 94  ? 27.402  74.640  40.866 1.00 54.98  ? 90   THR A C   1 
ATOM   709  O O   . THR A 1 94  ? 26.706  74.921  41.841 1.00 56.18  ? 90   THR A O   1 
ATOM   710  C CB  . THR A 1 94  ? 25.767  73.700  39.166 1.00 50.10  ? 90   THR A CB  1 
ATOM   711  O OG1 . THR A 1 94  ? 25.515  72.585  38.302 1.00 37.29  ? 90   THR A OG1 1 
ATOM   712  C CG2 . THR A 1 94  ? 25.899  74.953  38.337 1.00 50.88  ? 90   THR A CG2 1 
ATOM   713  N N   . VAL A 1 95  ? 28.486  75.341  40.547 1.00 53.87  ? 91   VAL A N   1 
ATOM   714  C CA  . VAL A 1 95  ? 28.895  76.498  41.339 1.00 51.19  ? 91   VAL A CA  1 
ATOM   715  C C   . VAL A 1 95  ? 28.659  77.802  40.581 1.00 48.47  ? 91   VAL A C   1 
ATOM   716  O O   . VAL A 1 95  ? 29.053  77.932  39.434 1.00 50.06  ? 91   VAL A O   1 
ATOM   717  C CB  . VAL A 1 95  ? 30.399  76.428  41.701 1.00 49.56  ? 91   VAL A CB  1 
ATOM   718  C CG1 . VAL A 1 95  ? 30.738  77.539  42.694 1.00 47.26  ? 91   VAL A CG1 1 
ATOM   719  C CG2 . VAL A 1 95  ? 30.738  75.065  42.265 1.00 51.60  ? 91   VAL A CG2 1 
ATOM   720  N N   . PHE A 1 96  ? 28.040  78.774  41.222 1.00 48.11  ? 92   PHE A N   1 
ATOM   721  C CA  . PHE A 1 96  ? 27.812  80.015  40.516 1.00 51.50  ? 92   PHE A CA  1 
ATOM   722  C C   . PHE A 1 96  ? 27.509  81.156  41.463 1.00 57.82  ? 92   PHE A C   1 
ATOM   723  O O   . PHE A 1 96  ? 26.943  80.968  42.539 1.00 65.52  ? 92   PHE A O   1 
ATOM   724  C CB  . PHE A 1 96  ? 26.648  79.866  39.552 1.00 51.80  ? 92   PHE A CB  1 
ATOM   725  C CG  . PHE A 1 96  ? 25.385  79.466  40.217 1.00 49.08  ? 92   PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 96  ? 25.147  78.127  40.510 1.00 46.52  ? 92   PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 96  ? 24.475  80.428  40.631 1.00 45.60  ? 92   PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 96  ? 24.020  77.743  41.227 1.00 43.24  ? 92   PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 96  ? 23.342  80.057  41.351 1.00 49.25  ? 92   PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 96  ? 23.116  78.704  41.650 1.00 46.63  ? 92   PHE A CZ  1 
ATOM   731  N N   . PRO A 1 97  ? 27.940  82.364  41.066 1.00 60.53  ? 93   PRO A N   1 
ATOM   732  C CA  . PRO A 1 97  ? 27.698  83.579  41.847 1.00 61.19  ? 93   PRO A CA  1 
ATOM   733  C C   . PRO A 1 97  ? 26.253  83.987  41.884 1.00 60.08  ? 93   PRO A C   1 
ATOM   734  O O   . PRO A 1 97  ? 25.508  83.787  40.928 1.00 57.91  ? 93   PRO A O   1 
ATOM   735  C CB  . PRO A 1 97  ? 28.572  84.619  41.138 1.00 62.56  ? 93   PRO A CB  1 
ATOM   736  C CG  . PRO A 1 97  ? 28.693  84.114  39.739 1.00 67.42  ? 93   PRO A CG  1 
ATOM   737  C CD  . PRO A 1 97  ? 28.724  82.621  39.867 1.00 63.37  ? 93   PRO A CD  1 
ATOM   738  N N   . LYS A 1 98  ? 25.864  84.553  43.025 1.00 61.06  ? 94   LYS A N   1 
ATOM   739  C CA  . LYS A 1 98  ? 24.512  85.013  43.258 1.00 64.88  ? 94   LYS A CA  1 
ATOM   740  C C   . LYS A 1 98  ? 24.375  86.398  42.662 1.00 68.07  ? 94   LYS A C   1 
ATOM   741  O O   . LYS A 1 98  ? 23.270  86.919  42.488 1.00 74.47  ? 94   LYS A O   1 
ATOM   742  C CB  . LYS A 1 98  ? 24.230  85.075  44.761 1.00 63.41  ? 94   LYS A CB  1 
ATOM   743  C CG  . LYS A 1 98  ? 23.328  86.225  45.203 1.00 54.28  ? 94   LYS A CG  1 
ATOM   744  C CD  . LYS A 1 98  ? 23.166  86.243  46.715 1.00 55.14  ? 94   LYS A CD  1 
ATOM   745  C CE  . LYS A 1 98  ? 22.020  87.148  47.141 1.00 59.11  ? 94   LYS A CE  1 
ATOM   746  N NZ  . LYS A 1 98  ? 20.721  86.746  46.518 1.00 55.71  ? 94   LYS A NZ  1 
ATOM   747  N N   . SER A 1 99  ? 25.511  86.993  42.341 1.00 68.03  ? 95   SER A N   1 
ATOM   748  C CA  . SER A 1 99  ? 25.498  88.332  41.802 1.00 67.80  ? 95   SER A CA  1 
ATOM   749  C C   . SER A 1 99  ? 26.634  88.550  40.823 1.00 71.72  ? 95   SER A C   1 
ATOM   750  O O   . SER A 1 99  ? 27.504  87.688  40.668 1.00 65.82  ? 95   SER A O   1 
ATOM   751  C CB  . SER A 1 99  ? 25.598  89.328  42.961 1.00 64.76  ? 95   SER A CB  1 
ATOM   752  O OG  . SER A 1 99  ? 25.050  88.775  44.148 1.00 53.37  ? 95   SER A OG  1 
ATOM   753  N N   . PRO A 1 100 ? 26.614  89.696  40.112 1.00 77.17  ? 96   PRO A N   1 
ATOM   754  C CA  . PRO A 1 100 ? 27.659  90.033  39.142 1.00 78.13  ? 96   PRO A CA  1 
ATOM   755  C C   . PRO A 1 100 ? 29.015  90.132  39.836 1.00 75.01  ? 96   PRO A C   1 
ATOM   756  O O   . PRO A 1 100 ? 29.184  90.893  40.798 1.00 71.37  ? 96   PRO A O   1 
ATOM   757  C CB  . PRO A 1 100 ? 27.205  91.378  38.570 1.00 80.53  ? 96   PRO A CB  1 
ATOM   758  C CG  . PRO A 1 100 ? 25.736  91.428  38.824 1.00 79.09  ? 96   PRO A CG  1 
ATOM   759  C CD  . PRO A 1 100 ? 25.558  90.726  40.137 1.00 79.79  ? 96   PRO A CD  1 
ATOM   760  N N   . VAL A 1 101 ? 29.970  89.349  39.345 1.00 71.93  ? 97   VAL A N   1 
ATOM   761  C CA  . VAL A 1 101 ? 31.304  89.324  39.912 1.00 73.70  ? 97   VAL A CA  1 
ATOM   762  C C   . VAL A 1 101 ? 32.055  90.596  39.608 1.00 78.26  ? 97   VAL A C   1 
ATOM   763  O O   . VAL A 1 101 ? 32.354  90.895  38.447 1.00 77.68  ? 97   VAL A O   1 
ATOM   764  C CB  . VAL A 1 101 ? 32.125  88.160  39.367 1.00 70.39  ? 97   VAL A CB  1 
ATOM   765  C CG1 . VAL A 1 101 ? 33.372  87.988  40.197 1.00 73.06  ? 97   VAL A CG1 1 
ATOM   766  C CG2 . VAL A 1 101 ? 31.303  86.905  39.398 1.00 73.26  ? 97   VAL A CG2 1 
ATOM   767  N N   . LEU A 1 102 ? 32.344  91.353  40.657 1.00 83.12  ? 98   LEU A N   1 
ATOM   768  C CA  . LEU A 1 102 ? 33.094  92.574  40.489 1.00 85.84  ? 98   LEU A CA  1 
ATOM   769  C C   . LEU A 1 102 ? 34.366  92.465  41.285 1.00 89.73  ? 98   LEU A C   1 
ATOM   770  O O   . LEU A 1 102 ? 34.382  91.953  42.407 1.00 93.25  ? 98   LEU A O   1 
ATOM   771  C CB  . LEU A 1 102 ? 32.282  93.797  40.913 1.00 78.76  ? 98   LEU A CB  1 
ATOM   772  C CG  . LEU A 1 102 ? 32.135  94.681  39.671 1.00 78.17  ? 98   LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 102 ? 31.472  93.870  38.561 1.00 72.93  ? 98   LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 102 ? 31.337  95.917  39.985 1.00 81.39  ? 98   LEU A CD2 1 
ATOM   775  N N   . LEU A 1 103 ? 35.445  92.918  40.667 1.00 95.08  ? 99   LEU A N   1 
ATOM   776  C CA  . LEU A 1 103 ? 36.748  92.872  41.282 1.00 98.97  ? 99   LEU A CA  1 
ATOM   777  C C   . LEU A 1 103 ? 36.714  93.650  42.605 1.00 100.00 ? 99   LEU A C   1 
ATOM   778  O O   . LEU A 1 103 ? 36.356  94.835  42.642 1.00 100.00 ? 99   LEU A O   1 
ATOM   779  C CB  . LEU A 1 103 ? 37.778  93.410  40.277 1.00 99.38  ? 99   LEU A CB  1 
ATOM   780  C CG  . LEU A 1 103 ? 37.788  92.506  39.023 1.00 97.90  ? 99   LEU A CG  1 
ATOM   781  C CD1 . LEU A 1 103 ? 37.529  93.312  37.755 1.00 94.63  ? 99   LEU A CD1 1 
ATOM   782  C CD2 . LEU A 1 103 ? 39.109  91.769  38.934 1.00 95.15  ? 99   LEU A CD2 1 
ATOM   783  N N   . GLY A 1 104 ? 37.031  92.944  43.693 1.00 98.69  ? 100  GLY A N   1 
ATOM   784  C CA  . GLY A 1 104 ? 37.035  93.543  45.015 1.00 96.96  ? 100  GLY A CA  1 
ATOM   785  C C   . GLY A 1 104 ? 35.658  93.596  45.641 1.00 98.46  ? 100  GLY A C   1 
ATOM   786  O O   . GLY A 1 104 ? 35.532  93.820  46.841 1.00 96.96  ? 100  GLY A O   1 
ATOM   787  N N   . GLN A 1 105 ? 34.628  93.363  44.830 1.00 100.00 ? 101  GLN A N   1 
ATOM   788  C CA  . GLN A 1 105 ? 33.236  93.407  45.292 1.00 100.00 ? 101  GLN A CA  1 
ATOM   789  C C   . GLN A 1 105 ? 32.695  92.137  45.977 1.00 100.00 ? 101  GLN A C   1 
ATOM   790  O O   . GLN A 1 105 ? 32.592  91.077  45.350 1.00 99.16  ? 101  GLN A O   1 
ATOM   791  C CB  . GLN A 1 105 ? 32.326  93.773  44.120 1.00 98.65  ? 101  GLN A CB  1 
ATOM   792  C CG  . GLN A 1 105 ? 31.184  94.690  44.493 1.00 100.00 ? 101  GLN A CG  1 
ATOM   793  C CD  . GLN A 1 105 ? 30.225  94.914  43.344 1.00 100.00 ? 101  GLN A CD  1 
ATOM   794  O OE1 . GLN A 1 105 ? 30.365  95.875  42.586 1.00 100.00 ? 101  GLN A OE1 1 
ATOM   795  N NE2 . GLN A 1 105 ? 29.241  94.028  43.208 1.00 100.00 ? 101  GLN A NE2 1 
ATOM   796  N N   . PRO A 1 106 ? 32.323  92.243  47.276 1.00 99.81  ? 102  PRO A N   1 
ATOM   797  C CA  . PRO A 1 106 ? 31.790  91.105  48.039 1.00 94.77  ? 102  PRO A CA  1 
ATOM   798  C C   . PRO A 1 106 ? 30.626  90.431  47.338 1.00 92.13  ? 102  PRO A C   1 
ATOM   799  O O   . PRO A 1 106 ? 29.689  91.078  46.849 1.00 90.78  ? 102  PRO A O   1 
ATOM   800  C CB  . PRO A 1 106 ? 31.367  91.692  49.385 1.00 96.45  ? 102  PRO A CB  1 
ATOM   801  C CG  . PRO A 1 106 ? 31.839  93.086  49.411 1.00 98.28  ? 102  PRO A CG  1 
ATOM   802  C CD  . PRO A 1 106 ? 32.406  93.474  48.082 1.00 100.00 ? 102  PRO A CD  1 
ATOM   803  N N   . ASN A 1 107 ? 30.702  89.110  47.326 1.00 90.04  ? 103  ASN A N   1 
ATOM   804  C CA  . ASN A 1 107 ? 29.726  88.264  46.674 1.00 86.69  ? 103  ASN A CA  1 
ATOM   805  C C   . ASN A 1 107 ? 29.566  86.990  47.488 1.00 79.40  ? 103  ASN A C   1 
ATOM   806  O O   . ASN A 1 107 ? 30.306  86.741  48.448 1.00 72.92  ? 103  ASN A O   1 
ATOM   807  C CB  . ASN A 1 107 ? 30.240  87.905  45.275 1.00 94.37  ? 103  ASN A CB  1 
ATOM   808  C CG  . ASN A 1 107 ? 29.142  87.861  44.224 1.00 97.51  ? 103  ASN A CG  1 
ATOM   809  O OD1 . ASN A 1 107 ? 29.338  88.319  43.098 1.00 100.00 ? 103  ASN A OD1 1 
ATOM   810  N ND2 . ASN A 1 107 ? 27.989  87.298  44.578 1.00 96.28  ? 103  ASN A ND2 1 
ATOM   811  N N   . THR A 1 108 ? 28.594  86.188  47.071 1.00 73.10  ? 104  THR A N   1 
ATOM   812  C CA  . THR A 1 108 ? 28.289  84.910  47.686 1.00 66.48  ? 104  THR A CA  1 
ATOM   813  C C   . THR A 1 108 ? 28.322  83.876  46.569 1.00 65.29  ? 104  THR A C   1 
ATOM   814  O O   . THR A 1 108 ? 27.668  84.045  45.542 1.00 66.27  ? 104  THR A O   1 
ATOM   815  C CB  . THR A 1 108 ? 26.894  84.913  48.314 1.00 61.91  ? 104  THR A CB  1 
ATOM   816  O OG1 . THR A 1 108 ? 26.781  86.031  49.200 1.00 63.44  ? 104  THR A OG1 1 
ATOM   817  C CG2 . THR A 1 108 ? 26.653  83.620  49.083 1.00 61.53  ? 104  THR A CG2 1 
ATOM   818  N N   . LEU A 1 109 ? 29.099  82.817  46.759 1.00 65.16  ? 105  LEU A N   1 
ATOM   819  C CA  . LEU A 1 109 ? 29.205  81.772  45.751 1.00 63.25  ? 105  LEU A CA  1 
ATOM   820  C C   . LEU A 1 109 ? 28.284  80.616  46.117 1.00 60.17  ? 105  LEU A C   1 
ATOM   821  O O   . LEU A 1 109 ? 28.239  80.176  47.267 1.00 61.36  ? 105  LEU A O   1 
ATOM   822  C CB  . LEU A 1 109 ? 30.658  81.287  45.622 1.00 65.16  ? 105  LEU A CB  1 
ATOM   823  C CG  . LEU A 1 109 ? 31.104  80.774  44.241 1.00 62.84  ? 105  LEU A CG  1 
ATOM   824  C CD1 . LEU A 1 109 ? 30.436  81.596  43.149 1.00 60.55  ? 105  LEU A CD1 1 
ATOM   825  C CD2 . LEU A 1 109 ? 32.620  80.848  44.122 1.00 58.96  ? 105  LEU A CD2 1 
ATOM   826  N N   . ILE A 1 110 ? 27.558  80.124  45.124 1.00 54.45  ? 106  ILE A N   1 
ATOM   827  C CA  . ILE A 1 110 ? 26.605  79.054  45.340 1.00 52.28  ? 106  ILE A CA  1 
ATOM   828  C C   . ILE A 1 110 ? 26.970  77.734  44.676 1.00 51.42  ? 106  ILE A C   1 
ATOM   829  O O   . ILE A 1 110 ? 27.418  77.719  43.534 1.00 48.87  ? 106  ILE A O   1 
ATOM   830  C CB  . ILE A 1 110 ? 25.215  79.496  44.836 1.00 48.88  ? 106  ILE A CB  1 
ATOM   831  C CG1 . ILE A 1 110 ? 24.861  80.859  45.446 1.00 45.18  ? 106  ILE A CG1 1 
ATOM   832  C CG2 . ILE A 1 110 ? 24.179  78.437  45.170 1.00 50.33  ? 106  ILE A CG2 1 
ATOM   833  C CD1 . ILE A 1 110 ? 23.679  81.554  44.807 1.00 29.41  ? 106  ILE A CD1 1 
ATOM   834  N N   . CYS A 1 111 ? 26.780  76.633  45.403 1.00 52.48  ? 107  CYS A N   1 
ATOM   835  C CA  . CYS A 1 111 ? 27.036  75.292  44.870 1.00 59.27  ? 107  CYS A CA  1 
ATOM   836  C C   . CYS A 1 111 ? 25.709  74.516  44.865 1.00 59.63  ? 107  CYS A C   1 
ATOM   837  O O   . CYS A 1 111 ? 25.093  74.288  45.907 1.00 65.83  ? 107  CYS A O   1 
ATOM   838  C CB  . CYS A 1 111 ? 28.080  74.547  45.712 1.00 60.34  ? 107  CYS A CB  1 
ATOM   839  S SG  . CYS A 1 111 ? 28.641  72.975  44.972 1.00 59.80  ? 107  CYS A SG  1 
ATOM   840  N N   . PHE A 1 112 ? 25.281  74.110  43.678 1.00 53.00  ? 108  PHE A N   1 
ATOM   841  C CA  . PHE A 1 112 ? 24.023  73.406  43.501 1.00 47.63  ? 108  PHE A CA  1 
ATOM   842  C C   . PHE A 1 112 ? 24.210  71.913  43.287 1.00 48.54  ? 108  PHE A C   1 
ATOM   843  O O   . PHE A 1 112 ? 24.568  71.480  42.192 1.00 48.24  ? 108  PHE A O   1 
ATOM   844  C CB  . PHE A 1 112 ? 23.295  74.027  42.308 1.00 47.44  ? 108  PHE A CB  1 
ATOM   845  C CG  . PHE A 1 112 ? 22.052  73.306  41.903 1.00 42.68  ? 108  PHE A CG  1 
ATOM   846  C CD1 . PHE A 1 112 ? 20.883  73.445  42.638 1.00 42.17  ? 108  PHE A CD1 1 
ATOM   847  C CD2 . PHE A 1 112 ? 22.041  72.512  40.767 1.00 39.67  ? 108  PHE A CD2 1 
ATOM   848  C CE1 . PHE A 1 112 ? 19.717  72.802  42.249 1.00 42.80  ? 108  PHE A CE1 1 
ATOM   849  C CE2 . PHE A 1 112 ? 20.882  71.864  40.368 1.00 43.92  ? 108  PHE A CE2 1 
ATOM   850  C CZ  . PHE A 1 112 ? 19.716  72.009  41.109 1.00 45.56  ? 108  PHE A CZ  1 
ATOM   851  N N   . VAL A 1 113 ? 23.963  71.130  44.334 1.00 46.94  ? 109  VAL A N   1 
ATOM   852  C CA  . VAL A 1 113 ? 24.100  69.683  44.250 1.00 44.94  ? 109  VAL A CA  1 
ATOM   853  C C   . VAL A 1 113 ? 22.731  69.077  44.095 1.00 39.94  ? 109  VAL A C   1 
ATOM   854  O O   . VAL A 1 113 ? 21.854  69.325  44.904 1.00 45.39  ? 109  VAL A O   1 
ATOM   855  C CB  . VAL A 1 113 ? 24.730  69.106  45.503 1.00 51.75  ? 109  VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 113 ? 25.059  67.625  45.275 1.00 54.71  ? 109  VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 113 ? 25.969  69.917  45.866 1.00 50.46  ? 109  VAL A CG2 1 
ATOM   858  N N   . ASP A 1 114 ? 22.567  68.278  43.050 1.00 39.40  ? 110  ASP A N   1 
ATOM   859  C CA  . ASP A 1 114 ? 21.303  67.637  42.730 1.00 33.92  ? 110  ASP A CA  1 
ATOM   860  C C   . ASP A 1 114 ? 21.537  66.142  42.690 1.00 36.80  ? 110  ASP A C   1 
ATOM   861  O O   . ASP A 1 114 ? 22.669  65.674  42.813 1.00 37.94  ? 110  ASP A O   1 
ATOM   862  C CB  . ASP A 1 114 ? 20.823  68.133  41.358 1.00 40.27  ? 110  ASP A CB  1 
ATOM   863  C CG  . ASP A 1 114 ? 19.323  67.921  41.119 1.00 42.01  ? 110  ASP A CG  1 
ATOM   864  O OD1 . ASP A 1 114 ? 18.840  66.796  41.315 1.00 50.42  ? 110  ASP A OD1 1 
ATOM   865  O OD2 . ASP A 1 114 ? 18.629  68.882  40.716 1.00 38.57  ? 110  ASP A OD2 1 
ATOM   866  N N   . ASN A 1 115 ? 20.456  65.400  42.509 1.00 42.73  ? 111  ASN A N   1 
ATOM   867  C CA  . ASN A 1 115 ? 20.489  63.948  42.460 1.00 44.71  ? 111  ASN A CA  1 
ATOM   868  C C   . ASN A 1 115 ? 21.016  63.308  43.730 1.00 47.18  ? 111  ASN A C   1 
ATOM   869  O O   . ASN A 1 115 ? 21.660  62.255  43.688 1.00 48.72  ? 111  ASN A O   1 
ATOM   870  C CB  . ASN A 1 115 ? 21.310  63.454  41.284 1.00 42.21  ? 111  ASN A CB  1 
ATOM   871  C CG  . ASN A 1 115 ? 20.982  62.021  40.943 1.00 51.08  ? 111  ASN A CG  1 
ATOM   872  O OD1 . ASN A 1 115 ? 19.896  61.726  40.431 1.00 52.40  ? 111  ASN A OD1 1 
ATOM   873  N ND2 . ASN A 1 115 ? 21.903  61.114  41.241 1.00 54.15  ? 111  ASN A ND2 1 
ATOM   874  N N   . ILE A 1 116 ? 20.720  63.938  44.864 1.00 47.37  ? 112  ILE A N   1 
ATOM   875  C CA  . ILE A 1 116 ? 21.169  63.428  46.147 1.00 43.33  ? 112  ILE A CA  1 
ATOM   876  C C   . ILE A 1 116 ? 20.284  62.381  46.823 1.00 46.01  ? 112  ILE A C   1 
ATOM   877  O O   . ILE A 1 116 ? 19.231  62.704  47.360 1.00 44.11  ? 112  ILE A O   1 
ATOM   878  C CB  . ILE A 1 116 ? 21.357  64.555  47.187 1.00 38.65  ? 112  ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 116 ? 22.236  65.670  46.633 1.00 37.31  ? 112  ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 116 ? 22.012  63.993  48.433 1.00 27.40  ? 112  ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 116 ? 22.542  66.743  47.669 1.00 18.25  ? 112  ILE A CD1 1 
ATOM   882  N N   . PHE A 1 117 ? 20.694  61.122  46.750 1.00 52.62  ? 113  PHE A N   1 
ATOM   883  C CA  . PHE A 1 117 ? 20.010  60.066  47.483 1.00 58.11  ? 113  PHE A CA  1 
ATOM   884  C C   . PHE A 1 117 ? 21.073  59.115  47.991 1.00 62.38  ? 113  PHE A C   1 
ATOM   885  O O   . PHE A 1 117 ? 21.847  58.563  47.204 1.00 65.24  ? 113  PHE A O   1 
ATOM   886  C CB  . PHE A 1 117 ? 18.991  59.264  46.684 1.00 56.96  ? 113  PHE A CB  1 
ATOM   887  C CG  . PHE A 1 117 ? 18.014  58.534  47.578 1.00 61.88  ? 113  PHE A CG  1 
ATOM   888  C CD1 . PHE A 1 117 ? 17.276  59.253  48.510 1.00 60.97  ? 113  PHE A CD1 1 
ATOM   889  C CD2 . PHE A 1 117 ? 17.851  57.150  47.524 1.00 65.33  ? 113  PHE A CD2 1 
ATOM   890  C CE1 . PHE A 1 117 ? 16.411  58.624  49.387 1.00 62.01  ? 113  PHE A CE1 1 
ATOM   891  C CE2 . PHE A 1 117 ? 16.973  56.500  48.411 1.00 64.27  ? 113  PHE A CE2 1 
ATOM   892  C CZ  . PHE A 1 117 ? 16.250  57.248  49.336 1.00 65.67  ? 113  PHE A CZ  1 
ATOM   893  N N   . PRO A 1 118 ? 21.084  58.881  49.300 1.00 65.17  ? 114  PRO A N   1 
ATOM   894  C CA  . PRO A 1 118 ? 20.206  59.492  50.301 1.00 64.03  ? 114  PRO A CA  1 
ATOM   895  C C   . PRO A 1 118 ? 20.563  60.888  50.765 1.00 62.21  ? 114  PRO A C   1 
ATOM   896  O O   . PRO A 1 118 ? 21.605  61.442  50.412 1.00 70.38  ? 114  PRO A O   1 
ATOM   897  C CB  . PRO A 1 118 ? 20.239  58.515  51.463 1.00 65.91  ? 114  PRO A CB  1 
ATOM   898  C CG  . PRO A 1 118 ? 20.949  57.279  50.914 1.00 68.39  ? 114  PRO A CG  1 
ATOM   899  C CD  . PRO A 1 118 ? 21.901  57.820  49.920 1.00 69.66  ? 114  PRO A CD  1 
ATOM   900  N N   . PRO A 1 119 ? 19.679  61.478  51.572 1.00 54.10  ? 115  PRO A N   1 
ATOM   901  C CA  . PRO A 1 119 ? 19.870  62.811  52.136 1.00 57.56  ? 115  PRO A CA  1 
ATOM   902  C C   . PRO A 1 119 ? 21.088  62.808  53.040 1.00 63.05  ? 115  PRO A C   1 
ATOM   903  O O   . PRO A 1 119 ? 21.015  63.215  54.204 1.00 61.02  ? 115  PRO A O   1 
ATOM   904  C CB  . PRO A 1 119 ? 18.581  63.063  52.916 1.00 52.13  ? 115  PRO A CB  1 
ATOM   905  C CG  . PRO A 1 119 ? 17.598  62.105  52.346 1.00 46.02  ? 115  PRO A CG  1 
ATOM   906  C CD  . PRO A 1 119 ? 18.381  60.908  51.965 1.00 46.60  ? 115  PRO A CD  1 
ATOM   907  N N   . VAL A 1 120 ? 22.205  62.319  52.511 1.00 66.16  ? 116  VAL A N   1 
ATOM   908  C CA  . VAL A 1 120 ? 23.442  62.283  53.278 1.00 66.05  ? 116  VAL A CA  1 
ATOM   909  C C   . VAL A 1 120 ? 24.558  62.862  52.465 1.00 64.74  ? 116  VAL A C   1 
ATOM   910  O O   . VAL A 1 120 ? 25.054  62.262  51.497 1.00 59.24  ? 116  VAL A O   1 
ATOM   911  C CB  . VAL A 1 120 ? 23.878  60.885  53.694 1.00 65.70  ? 116  VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 120 ? 24.728  60.998  54.943 1.00 62.13  ? 116  VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 120 ? 22.670  60.006  53.930 1.00 61.69  ? 116  VAL A CG2 1 
ATOM   914  N N   . ILE A 1 121 ? 24.981  64.037  52.883 1.00 65.83  ? 117  ILE A N   1 
ATOM   915  C CA  . ILE A 1 121 ? 26.014  64.666  52.140 1.00 65.52  ? 117  ILE A CA  1 
ATOM   916  C C   . ILE A 1 121 ? 26.891  65.603  52.915 1.00 69.24  ? 117  ILE A C   1 
ATOM   917  O O   . ILE A 1 121 ? 26.510  66.204  53.927 1.00 64.52  ? 117  ILE A O   1 
ATOM   918  C CB  . ILE A 1 121 ? 25.403  65.373  50.924 1.00 61.65  ? 117  ILE A CB  1 
ATOM   919  C CG1 . ILE A 1 121 ? 25.743  64.566  49.668 1.00 56.65  ? 117  ILE A CG1 1 
ATOM   920  C CG2 . ILE A 1 121 ? 25.864  66.820  50.854 1.00 63.10  ? 117  ILE A CG2 1 
ATOM   921  C CD1 . ILE A 1 121 ? 25.447  65.275  48.375 1.00 54.39  ? 117  ILE A CD1 1 
ATOM   922  N N   . ASN A 1 122 ? 28.101  65.670  52.394 1.00 73.78  ? 118  ASN A N   1 
ATOM   923  C CA  . ASN A 1 122 ? 29.147  66.505  52.893 1.00 77.59  ? 118  ASN A CA  1 
ATOM   924  C C   . ASN A 1 122 ? 29.546  67.251  51.632 1.00 77.43  ? 118  ASN A C   1 
ATOM   925  O O   . ASN A 1 122 ? 30.140  66.677  50.716 1.00 73.21  ? 118  ASN A O   1 
ATOM   926  C CB  . ASN A 1 122 ? 30.311  65.647  53.395 1.00 82.97  ? 118  ASN A CB  1 
ATOM   927  C CG  . ASN A 1 122 ? 30.750  66.013  54.802 1.00 85.59  ? 118  ASN A CG  1 
ATOM   928  O OD1 . ASN A 1 122 ? 30.581  67.153  55.243 1.00 87.91  ? 118  ASN A OD1 1 
ATOM   929  N ND2 . ASN A 1 122 ? 31.329  65.044  55.513 1.00 83.78  ? 118  ASN A ND2 1 
ATOM   930  N N   . ILE A 1 123 ? 29.130  68.504  51.550 1.00 78.09  ? 119  ILE A N   1 
ATOM   931  C CA  . ILE A 1 123 ? 29.498  69.338  50.427 1.00 83.57  ? 119  ILE A CA  1 
ATOM   932  C C   . ILE A 1 123 ? 30.423  70.289  51.138 1.00 83.35  ? 119  ILE A C   1 
ATOM   933  O O   . ILE A 1 123 ? 30.059  70.863  52.166 1.00 82.74  ? 119  ILE A O   1 
ATOM   934  C CB  . ILE A 1 123 ? 28.302  70.093  49.817 1.00 87.82  ? 119  ILE A CB  1 
ATOM   935  C CG1 . ILE A 1 123 ? 27.148  70.186  50.818 1.00 92.94  ? 119  ILE A CG1 1 
ATOM   936  C CG2 . ILE A 1 123 ? 27.860  69.381  48.548 1.00 93.53  ? 119  ILE A CG2 1 
ATOM   937  C CD1 . ILE A 1 123 ? 25.872  70.764  50.219 1.00 91.36  ? 119  ILE A CD1 1 
ATOM   938  N N   . THR A 1 124 ? 31.619  70.457  50.594 1.00 83.86  ? 120  THR A N   1 
ATOM   939  C CA  . THR A 1 124 ? 32.627  71.273  51.246 1.00 84.48  ? 120  THR A CA  1 
ATOM   940  C C   . THR A 1 124 ? 33.420  72.197  50.291 1.00 87.09  ? 120  THR A C   1 
ATOM   941  O O   . THR A 1 124 ? 33.878  71.755  49.242 1.00 84.22  ? 120  THR A O   1 
ATOM   942  C CB  . THR A 1 124 ? 33.552  70.288  52.008 1.00 83.66  ? 120  THR A CB  1 
ATOM   943  O OG1 . THR A 1 124 ? 33.244  68.935  51.605 1.00 83.16  ? 120  THR A OG1 1 
ATOM   944  C CG2 . THR A 1 124 ? 33.298  70.381  53.505 1.00 83.33  ? 120  THR A CG2 1 
ATOM   945  N N   . TRP A 1 125 ? 33.555  73.477  50.666 1.00 91.03  ? 121  TRP A N   1 
ATOM   946  C CA  . TRP A 1 125 ? 34.280  74.524  49.893 1.00 94.89  ? 121  TRP A CA  1 
ATOM   947  C C   . TRP A 1 125 ? 35.763  74.693  50.296 1.00 97.00  ? 121  TRP A C   1 
ATOM   948  O O   . TRP A 1 125 ? 36.086  74.624  51.485 1.00 95.10  ? 121  TRP A O   1 
ATOM   949  C CB  . TRP A 1 125 ? 33.748  75.949  50.156 1.00 95.24  ? 121  TRP A CB  1 
ATOM   950  C CG  . TRP A 1 125 ? 32.388  76.396  49.745 1.00 93.32  ? 121  TRP A CG  1 
ATOM   951  C CD1 . TRP A 1 125 ? 31.399  76.830  50.587 1.00 92.14  ? 121  TRP A CD1 1 
ATOM   952  C CD2 . TRP A 1 125 ? 31.907  76.627  48.419 1.00 90.99  ? 121  TRP A CD2 1 
ATOM   953  N NE1 . TRP A 1 125 ? 30.341  77.323  49.873 1.00 88.09  ? 121  TRP A NE1 1 
ATOM   954  C CE2 . TRP A 1 125 ? 30.623  77.211  48.528 1.00 86.49  ? 121  TRP A CE2 1 
ATOM   955  C CE3 . TRP A 1 125 ? 32.434  76.407  47.134 1.00 88.92  ? 121  TRP A CE3 1 
ATOM   956  C CZ2 . TRP A 1 125 ? 29.855  77.576  47.424 1.00 81.96  ? 121  TRP A CZ2 1 
ATOM   957  C CZ3 . TRP A 1 125 ? 31.671  76.768  46.029 1.00 83.55  ? 121  TRP A CZ3 1 
ATOM   958  C CH2 . TRP A 1 125 ? 30.395  77.346  46.183 1.00 83.94  ? 121  TRP A CH2 1 
ATOM   959  N N   . LEU A 1 126 ? 36.641  74.993  49.327 1.00 100.00 ? 122  LEU A N   1 
ATOM   960  C CA  . LEU A 1 126 ? 38.067  75.284  49.624 1.00 99.42  ? 122  LEU A CA  1 
ATOM   961  C C   . LEU A 1 126 ? 38.919  75.866  48.459 1.00 99.35  ? 122  LEU A C   1 
ATOM   962  O O   . LEU A 1 126 ? 38.876  75.335  47.337 1.00 99.06  ? 122  LEU A O   1 
ATOM   963  C CB  . LEU A 1 126 ? 38.770  74.049  50.229 1.00 100.00 ? 122  LEU A CB  1 
ATOM   964  C CG  . LEU A 1 126 ? 38.324  72.598  49.973 1.00 100.00 ? 122  LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 126 ? 38.550  72.283  48.513 1.00 99.86  ? 122  LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 126 ? 39.113  71.614  50.849 1.00 100.00 ? 122  LEU A CD2 1 
ATOM   967  N N   . ARG A 1 127 ? 39.657  76.967  48.718 1.00 97.06  ? 123  ARG A N   1 
ATOM   968  C CA  . ARG A 1 127 ? 40.550  77.648  47.730 1.00 92.00  ? 123  ARG A CA  1 
ATOM   969  C C   . ARG A 1 127 ? 41.782  76.782  47.756 1.00 89.20  ? 123  ARG A C   1 
ATOM   970  O O   . ARG A 1 127 ? 42.483  76.521  46.745 1.00 84.70  ? 123  ARG A O   1 
ATOM   971  C CB  . ARG A 1 127 ? 41.064  79.015  48.242 1.00 93.62  ? 123  ARG A CB  1 
ATOM   972  C CG  . ARG A 1 127 ? 42.571  79.318  47.862 1.00 95.65  ? 123  ARG A CG  1 
ATOM   973  C CD  . ARG A 1 127 ? 43.634  79.099  48.997 1.00 95.81  ? 123  ARG A CD  1 
ATOM   974  N NE  . ARG A 1 127 ? 44.780  80.029  48.900 1.00 99.82  ? 123  ARG A NE  1 
ATOM   975  C CZ  . ARG A 1 127 ? 46.013  79.819  49.382 1.00 100.00 ? 123  ARG A CZ  1 
ATOM   976  N NH1 . ARG A 1 127 ? 46.314  78.694  50.018 1.00 100.00 ? 123  ARG A NH1 1 
ATOM   977  N NH2 . ARG A 1 127 ? 46.961  80.743  49.222 1.00 96.09  ? 123  ARG A NH2 1 
ATOM   978  N N   . ASN A 1 128 ? 42.023  76.414  49.011 1.00 87.81  ? 124  ASN A N   1 
ATOM   979  C CA  . ASN A 1 128 ? 43.153  75.645  49.490 1.00 90.83  ? 124  ASN A CA  1 
ATOM   980  C C   . ASN A 1 128 ? 43.246  74.248  48.935 1.00 93.75  ? 124  ASN A C   1 
ATOM   981  O O   . ASN A 1 128 ? 44.085  73.916  48.086 1.00 95.76  ? 124  ASN A O   1 
ATOM   982  C CB  . ASN A 1 128 ? 43.066  75.469  51.018 1.00 88.55  ? 124  ASN A CB  1 
ATOM   983  C CG  . ASN A 1 128 ? 42.380  76.626  51.711 1.00 87.08  ? 124  ASN A CG  1 
ATOM   984  O OD1 . ASN A 1 128 ? 42.624  77.793  51.403 1.00 89.25  ? 124  ASN A OD1 1 
ATOM   985  N ND2 . ASN A 1 128 ? 41.543  76.312  52.689 1.00 83.19  ? 124  ASN A ND2 1 
ATOM   986  N N   . SER A 1 129 ? 42.426  73.422  49.577 1.00 94.70  ? 125  SER A N   1 
ATOM   987  C CA  . SER A 1 129 ? 42.304  71.994  49.357 1.00 96.16  ? 125  SER A CA  1 
ATOM   988  C C   . SER A 1 129 ? 42.358  71.527  50.781 1.00 99.93  ? 125  SER A C   1 
ATOM   989  O O   . SER A 1 129 ? 43.013  70.554  51.080 1.00 100.00 ? 125  SER A O   1 
ATOM   990  N N   . LYS A 1 130 ? 41.747  72.343  51.638 1.00 100.00 ? 126  LYS A N   1 
ATOM   991  C CA  . LYS A 1 130 ? 41.669  72.138  53.080 1.00 100.00 ? 126  LYS A CA  1 
ATOM   992  C C   . LYS A 1 130 ? 40.608  73.197  53.339 1.00 100.00 ? 126  LYS A C   1 
ATOM   993  O O   . LYS A 1 130 ? 40.695  74.235  52.704 1.00 100.00 ? 126  LYS A O   1 
ATOM   994  N N   . SER A 1 131 ? 39.636  73.015  54.226 1.00 99.94  ? 127  SER A N   1 
ATOM   995  C CA  . SER A 1 131 ? 38.578  74.021  54.350 1.00 99.42  ? 127  SER A CA  1 
ATOM   996  C C   . SER A 1 131 ? 38.782  75.447  54.850 1.00 99.13  ? 127  SER A C   1 
ATOM   997  O O   . SER A 1 131 ? 39.806  75.804  55.443 1.00 96.33  ? 127  SER A O   1 
ATOM   998  C CB  . SER A 1 131 ? 37.405  73.421  55.128 1.00 97.80  ? 127  SER A CB  1 
ATOM   999  O OG  . SER A 1 131 ? 36.285  74.293  55.114 1.00 100.00 ? 127  SER A OG  1 
ATOM   1000 N N   . VAL A 1 132 ? 37.759  76.252  54.562 1.00 99.96  ? 128  VAL A N   1 
ATOM   1001 C CA  . VAL A 1 132 ? 37.660  77.636  55.004 1.00 100.00 ? 128  VAL A CA  1 
ATOM   1002 C C   . VAL A 1 132 ? 36.157  77.908  55.148 1.00 100.00 ? 128  VAL A C   1 
ATOM   1003 O O   . VAL A 1 132 ? 35.356  77.702  54.227 1.00 99.25  ? 128  VAL A O   1 
ATOM   1004 C CB  . VAL A 1 132 ? 38.392  78.642  54.082 1.00 100.00 ? 128  VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 132 ? 39.837  78.749  54.561 1.00 96.75  ? 128  VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 132 ? 38.344  78.209  52.635 1.00 100.00 ? 128  VAL A CG2 1 
ATOM   1007 N N   . THR A 1 133 ? 35.815  78.347  56.359 1.00 100.00 ? 129  THR A N   1 
ATOM   1008 C CA  . THR A 1 133 ? 34.452  78.569  56.821 1.00 99.03  ? 129  THR A CA  1 
ATOM   1009 C C   . THR A 1 133 ? 34.011  79.868  57.464 1.00 98.59  ? 129  THR A C   1 
ATOM   1010 O O   . THR A 1 133 ? 34.329  80.159  58.616 1.00 98.89  ? 129  THR A O   1 
ATOM   1011 C CB  . THR A 1 133 ? 34.065  77.497  57.858 1.00 100.00 ? 129  THR A CB  1 
ATOM   1012 O OG1 . THR A 1 133 ? 33.465  78.134  58.995 1.00 99.03  ? 129  THR A OG1 1 
ATOM   1013 C CG2 . THR A 1 133 ? 35.311  76.757  58.332 1.00 100.00 ? 129  THR A CG2 1 
ATOM   1014 N N   . ASP A 1 134 ? 33.285  80.664  56.717 1.00 95.44  ? 130  ASP A N   1 
ATOM   1015 C CA  . ASP A 1 134 ? 32.661  81.835  57.294 1.00 97.38  ? 130  ASP A CA  1 
ATOM   1016 C C   . ASP A 1 134 ? 31.817  82.206  56.126 1.00 98.96  ? 130  ASP A C   1 
ATOM   1017 O O   . ASP A 1 134 ? 32.308  82.295  55.010 1.00 100.00 ? 130  ASP A O   1 
ATOM   1018 C CB  . ASP A 1 134 ? 33.592  82.978  57.714 1.00 95.54  ? 130  ASP A CB  1 
ATOM   1019 C CG  . ASP A 1 134 ? 32.934  83.868  58.767 1.00 99.01  ? 130  ASP A CG  1 
ATOM   1020 O OD1 . ASP A 1 134 ? 31.670  83.893  58.811 1.00 100.00 ? 130  ASP A OD1 1 
ATOM   1021 O OD2 . ASP A 1 134 ? 33.614  84.544  59.582 1.00 95.56  ? 130  ASP A OD2 1 
ATOM   1022 N N   . GLY A 1 135 ? 30.532  82.353  56.392 1.00 100.00 ? 131  GLY A N   1 
ATOM   1023 C CA  . GLY A 1 135 ? 29.606  82.639  55.329 1.00 100.00 ? 131  GLY A CA  1 
ATOM   1024 C C   . GLY A 1 135 ? 29.199  81.293  54.759 1.00 98.97  ? 131  GLY A C   1 
ATOM   1025 O O   . GLY A 1 135 ? 28.435  81.241  53.803 1.00 100.00 ? 131  GLY A O   1 
ATOM   1026 N N   . VAL A 1 136 ? 29.719  80.195  55.313 1.00 94.07  ? 132  VAL A N   1 
ATOM   1027 C CA  . VAL A 1 136 ? 29.332  78.867  54.814 1.00 90.76  ? 132  VAL A CA  1 
ATOM   1028 C C   . VAL A 1 136 ? 27.922  78.601  55.336 1.00 90.83  ? 132  VAL A C   1 
ATOM   1029 O O   . VAL A 1 136 ? 27.688  78.591  56.543 1.00 90.65  ? 132  VAL A O   1 
ATOM   1030 C CB  . VAL A 1 136 ? 30.253  77.720  55.320 1.00 87.51  ? 132  VAL A CB  1 
ATOM   1031 C CG1 . VAL A 1 136 ? 29.678  76.366  54.908 1.00 83.87  ? 132  VAL A CG1 1 
ATOM   1032 C CG2 . VAL A 1 136 ? 31.645  77.881  54.753 1.00 83.97  ? 132  VAL A CG2 1 
ATOM   1033 N N   . TYR A 1 137 ? 26.986  78.406  54.418 1.00 91.55  ? 133  TYR A N   1 
ATOM   1034 C CA  . TYR A 1 137 ? 25.599  78.165  54.773 1.00 88.56  ? 133  TYR A CA  1 
ATOM   1035 C C   . TYR A 1 137 ? 25.093  76.985  53.962 1.00 88.10  ? 133  TYR A C   1 
ATOM   1036 O O   . TYR A 1 137 ? 25.660  76.639  52.924 1.00 88.26  ? 133  TYR A O   1 
ATOM   1037 C CB  . TYR A 1 137 ? 24.770  79.413  54.471 1.00 86.30  ? 133  TYR A CB  1 
ATOM   1038 C CG  . TYR A 1 137 ? 23.397  79.420  55.091 1.00 90.43  ? 133  TYR A CG  1 
ATOM   1039 C CD1 . TYR A 1 137 ? 22.368  78.648  54.561 1.00 91.13  ? 133  TYR A CD1 1 
ATOM   1040 C CD2 . TYR A 1 137 ? 23.111  80.230  56.187 1.00 94.96  ? 133  TYR A CD2 1 
ATOM   1041 C CE1 . TYR A 1 137 ? 21.085  78.682  55.104 1.00 90.05  ? 133  TYR A CE1 1 
ATOM   1042 C CE2 . TYR A 1 137 ? 21.826  80.273  56.741 1.00 94.44  ? 133  TYR A CE2 1 
ATOM   1043 C CZ  . TYR A 1 137 ? 20.819  79.497  56.193 1.00 92.86  ? 133  TYR A CZ  1 
ATOM   1044 O OH  . TYR A 1 137 ? 19.549  79.546  56.727 1.00 93.24  ? 133  TYR A OH  1 
ATOM   1045 N N   . GLU A 1 138 ? 24.020  76.372  54.442 1.00 85.94  ? 134  GLU A N   1 
ATOM   1046 C CA  . GLU A 1 138 ? 23.440  75.212  53.784 1.00 81.39  ? 134  GLU A CA  1 
ATOM   1047 C C   . GLU A 1 138 ? 21.917  75.254  53.905 1.00 76.47  ? 134  GLU A C   1 
ATOM   1048 O O   . GLU A 1 138 ? 21.374  75.841  54.840 1.00 77.06  ? 134  GLU A O   1 
ATOM   1049 C CB  . GLU A 1 138 ? 23.985  73.948  54.452 1.00 79.35  ? 134  GLU A CB  1 
ATOM   1050 C CG  . GLU A 1 138 ? 24.125  72.736  53.564 1.00 80.90  ? 134  GLU A CG  1 
ATOM   1051 C CD  . GLU A 1 138 ? 24.750  71.568  54.308 1.00 80.62  ? 134  GLU A CD  1 
ATOM   1052 O OE1 . GLU A 1 138 ? 24.015  70.814  54.975 1.00 79.59  ? 134  GLU A OE1 1 
ATOM   1053 O OE2 . GLU A 1 138 ? 25.981  71.412  54.232 1.00 80.67  ? 134  GLU A OE2 1 
ATOM   1054 N N   . THR A 1 139 ? 21.229  74.646  52.949 1.00 68.96  ? 135  THR A N   1 
ATOM   1055 C CA  . THR A 1 139 ? 19.775  74.591  52.985 1.00 59.17  ? 135  THR A CA  1 
ATOM   1056 C C   . THR A 1 139 ? 19.470  73.172  53.413 1.00 56.95  ? 135  THR A C   1 
ATOM   1057 O O   . THR A 1 139 ? 20.383  72.347  53.519 1.00 57.13  ? 135  THR A O   1 
ATOM   1058 C CB  . THR A 1 139 ? 19.151  74.789  51.597 1.00 56.67  ? 135  THR A CB  1 
ATOM   1059 O OG1 . THR A 1 139 ? 19.190  73.550  50.879 1.00 51.97  ? 135  THR A OG1 1 
ATOM   1060 C CG2 . THR A 1 139 ? 19.912  75.818  50.813 1.00 60.46  ? 135  THR A CG2 1 
ATOM   1061 N N   . SER A 1 140 ? 18.200  72.882  53.666 1.00 49.53  ? 136  SER A N   1 
ATOM   1062 C CA  . SER A 1 140 ? 17.821  71.532  54.051 1.00 43.94  ? 136  SER A CA  1 
ATOM   1063 C C   . SER A 1 140 ? 17.836  70.706  52.783 1.00 42.31  ? 136  SER A C   1 
ATOM   1064 O O   . SER A 1 140 ? 18.048  71.236  51.695 1.00 47.50  ? 136  SER A O   1 
ATOM   1065 C CB  . SER A 1 140 ? 16.417  71.508  54.650 1.00 40.40  ? 136  SER A CB  1 
ATOM   1066 O OG  . SER A 1 140 ? 16.111  72.731  55.276 1.00 32.39  ? 136  SER A OG  1 
ATOM   1067 N N   . PHE A 1 141 ? 17.629  69.406  52.912 1.00 41.79  ? 137  PHE A N   1 
ATOM   1068 C CA  . PHE A 1 141 ? 17.584  68.570  51.728 1.00 47.96  ? 137  PHE A CA  1 
ATOM   1069 C C   . PHE A 1 141 ? 16.268  68.903  51.007 1.00 48.59  ? 137  PHE A C   1 
ATOM   1070 O O   . PHE A 1 141 ? 15.186  68.519  51.454 1.00 53.14  ? 137  PHE A O   1 
ATOM   1071 C CB  . PHE A 1 141 ? 17.650  67.091  52.122 1.00 51.40  ? 137  PHE A CB  1 
ATOM   1072 C CG  . PHE A 1 141 ? 19.053  66.572  52.267 1.00 58.75  ? 137  PHE A CG  1 
ATOM   1073 C CD1 . PHE A 1 141 ? 19.751  66.119  51.153 1.00 58.77  ? 137  PHE A CD1 1 
ATOM   1074 C CD2 . PHE A 1 141 ? 19.701  66.595  53.504 1.00 61.31  ? 137  PHE A CD2 1 
ATOM   1075 C CE1 . PHE A 1 141 ? 21.073  65.699  51.265 1.00 61.06  ? 137  PHE A CE1 1 
ATOM   1076 C CE2 . PHE A 1 141 ? 21.026  66.175  53.624 1.00 63.80  ? 137  PHE A CE2 1 
ATOM   1077 C CZ  . PHE A 1 141 ? 21.713  65.730  52.502 1.00 58.15  ? 137  PHE A CZ  1 
ATOM   1078 N N   . LEU A 1 142 ? 16.364  69.648  49.906 1.00 44.59  ? 138  LEU A N   1 
ATOM   1079 C CA  . LEU A 1 142 ? 15.181  70.041  49.149 1.00 30.76  ? 138  LEU A CA  1 
ATOM   1080 C C   . LEU A 1 142 ? 14.665  68.857  48.339 1.00 22.36  ? 138  LEU A C   1 
ATOM   1081 O O   . LEU A 1 142 ? 15.423  68.104  47.744 1.00 24.99  ? 138  LEU A O   1 
ATOM   1082 C CB  . LEU A 1 142 ? 15.502  71.250  48.259 1.00 32.36  ? 138  LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 142 ? 16.093  72.472  48.989 1.00 29.38  ? 138  LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 142 ? 16.496  73.525  47.978 1.00 30.96  ? 138  LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 142 ? 15.085  73.054  49.972 1.00 29.49  ? 138  LEU A CD2 1 
ATOM   1086 N N   . VAL A 1 143 ? 13.357  68.703  48.319 1.00 21.05  ? 139  VAL A N   1 
ATOM   1087 C CA  . VAL A 1 143 ? 12.749  67.570  47.662 1.00 23.61  ? 139  VAL A CA  1 
ATOM   1088 C C   . VAL A 1 143 ? 12.563  67.639  46.151 1.00 27.54  ? 139  VAL A C   1 
ATOM   1089 O O   . VAL A 1 143 ? 12.175  68.676  45.601 1.00 30.08  ? 139  VAL A O   1 
ATOM   1090 C CB  . VAL A 1 143 ? 11.405  67.259  48.370 1.00 28.64  ? 139  VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 143 ? 10.242  67.897  47.626 1.00 24.62  ? 139  VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 143 ? 11.235  65.760  48.512 1.00 35.31  ? 139  VAL A CG2 1 
ATOM   1093 N N   . ASN A 1 144 ? 12.844  66.516  45.488 1.00 27.03  ? 140  ASN A N   1 
ATOM   1094 C CA  . ASN A 1 144 ? 12.709  66.404  44.036 1.00 24.83  ? 140  ASN A CA  1 
ATOM   1095 C C   . ASN A 1 144 ? 11.597  65.429  43.674 1.00 26.30  ? 140  ASN A C   1 
ATOM   1096 O O   . ASN A 1 144 ? 11.410  64.421  44.340 1.00 33.29  ? 140  ASN A O   1 
ATOM   1097 C CB  . ASN A 1 144 ? 14.011  65.911  43.409 1.00 26.89  ? 140  ASN A CB  1 
ATOM   1098 C CG  . ASN A 1 144 ? 15.110  66.936  43.473 1.00 22.60  ? 140  ASN A CG  1 
ATOM   1099 O OD1 . ASN A 1 144 ? 14.859  68.137  43.383 1.00 30.91  ? 140  ASN A OD1 1 
ATOM   1100 N ND2 . ASN A 1 144 ? 16.344  66.469  43.633 1.00 26.54  ? 140  ASN A ND2 1 
ATOM   1101 N N   . ARG A 1 145 ? 10.875  65.727  42.603 1.00 31.12  ? 141  ARG A N   1 
ATOM   1102 C CA  . ARG A 1 145 ? 9.766   64.892  42.152 1.00 33.70  ? 141  ARG A CA  1 
ATOM   1103 C C   . ARG A 1 145 ? 10.116  63.430  42.103 1.00 33.19  ? 141  ARG A C   1 
ATOM   1104 O O   . ARG A 1 145 ? 9.322   62.587  42.496 1.00 40.19  ? 141  ARG A O   1 
ATOM   1105 C CB  . ARG A 1 145 ? 9.309   65.316  40.762 1.00 36.61  ? 141  ARG A CB  1 
ATOM   1106 C CG  . ARG A 1 145 ? 8.102   66.215  40.761 1.00 49.18  ? 141  ARG A CG  1 
ATOM   1107 C CD  . ARG A 1 145 ? 7.627   66.450  39.347 1.00 66.84  ? 141  ARG A CD  1 
ATOM   1108 N NE  . ARG A 1 145 ? 8.536   67.322  38.607 1.00 73.86  ? 141  ARG A NE  1 
ATOM   1109 C CZ  . ARG A 1 145 ? 8.241   67.884  37.439 1.00 79.66  ? 141  ARG A CZ  1 
ATOM   1110 N NH1 . ARG A 1 145 ? 7.061   67.665  36.872 1.00 80.35  ? 141  ARG A NH1 1 
ATOM   1111 N NH2 . ARG A 1 145 ? 9.125   68.669  36.841 1.00 83.12  ? 141  ARG A NH2 1 
ATOM   1112 N N   . ASP A 1 146 ? 11.304  63.134  41.592 1.00 39.12  ? 142  ASP A N   1 
ATOM   1113 C CA  . ASP A 1 146 ? 11.776  61.763  41.463 1.00 39.68  ? 142  ASP A CA  1 
ATOM   1114 C C   . ASP A 1 146 ? 12.216  61.193  42.806 1.00 42.27  ? 142  ASP A C   1 
ATOM   1115 O O   . ASP A 1 146 ? 12.814  60.119  42.878 1.00 50.23  ? 142  ASP A O   1 
ATOM   1116 C CB  . ASP A 1 146 ? 12.921  61.692  40.438 1.00 41.03  ? 142  ASP A CB  1 
ATOM   1117 C CG  . ASP A 1 146 ? 14.201  62.363  40.927 1.00 45.76  ? 142  ASP A CG  1 
ATOM   1118 O OD1 . ASP A 1 146 ? 14.309  62.648  42.133 1.00 55.34  ? 142  ASP A OD1 1 
ATOM   1119 O OD2 . ASP A 1 146 ? 15.101  62.600  40.101 1.00 49.53  ? 142  ASP A OD2 1 
ATOM   1120 N N   . HIS A 1 147 ? 11.927  61.933  43.870 1.00 40.28  ? 143  HIS A N   1 
ATOM   1121 C CA  . HIS A 1 147 ? 12.224  61.500  45.222 1.00 27.80  ? 143  HIS A CA  1 
ATOM   1122 C C   . HIS A 1 147 ? 13.688  61.437  45.525 1.00 27.32  ? 143  HIS A C   1 
ATOM   1123 O O   . HIS A 1 147 ? 14.151  60.676  46.370 1.00 34.75  ? 143  HIS A O   1 
ATOM   1124 C CB  . HIS A 1 147 ? 11.498  60.203  45.486 1.00 25.54  ? 143  HIS A CB  1 
ATOM   1125 C CG  . HIS A 1 147 ? 10.044  60.318  45.182 1.00 22.39  ? 143  HIS A CG  1 
ATOM   1126 N ND1 . HIS A 1 147 ? 9.424   61.545  45.036 1.00 28.95  ? 143  HIS A ND1 1 
ATOM   1127 C CD2 . HIS A 1 147 ? 9.096   59.393  44.925 1.00 17.18  ? 143  HIS A CD2 1 
ATOM   1128 C CE1 . HIS A 1 147 ? 8.162   61.364  44.702 1.00 25.45  ? 143  HIS A CE1 1 
ATOM   1129 N NE2 . HIS A 1 147 ? 7.935   60.064  44.626 1.00 19.67  ? 143  HIS A NE2 1 
ATOM   1130 N N   . SER A 1 148 ? 14.419  62.266  44.804 1.00 29.90  ? 144  SER A N   1 
ATOM   1131 C CA  . SER A 1 148 ? 15.842  62.436  45.007 1.00 34.42  ? 144  SER A CA  1 
ATOM   1132 C C   . SER A 1 148 ? 15.805  63.804  45.698 1.00 31.29  ? 144  SER A C   1 
ATOM   1133 O O   . SER A 1 148 ? 14.727  64.397  45.848 1.00 31.11  ? 144  SER A O   1 
ATOM   1134 C CB  . SER A 1 148 ? 16.573  62.504  43.658 1.00 37.31  ? 144  SER A CB  1 
ATOM   1135 O OG  . SER A 1 148 ? 16.426  63.777  43.052 1.00 38.30  ? 144  SER A OG  1 
ATOM   1136 N N   . PHE A 1 149 ? 16.953  64.299  46.130 1.00 31.97  ? 145  PHE A N   1 
ATOM   1137 C CA  . PHE A 1 149 ? 16.998  65.592  46.805 1.00 31.63  ? 145  PHE A CA  1 
ATOM   1138 C C   . PHE A 1 149 ? 18.059  66.462  46.179 1.00 31.95  ? 145  PHE A C   1 
ATOM   1139 O O   . PHE A 1 149 ? 18.821  66.027  45.314 1.00 31.85  ? 145  PHE A O   1 
ATOM   1140 C CB  . PHE A 1 149 ? 17.342  65.439  48.297 1.00 26.70  ? 145  PHE A CB  1 
ATOM   1141 C CG  . PHE A 1 149 ? 16.353  64.622  49.073 1.00 28.33  ? 145  PHE A CG  1 
ATOM   1142 C CD1 . PHE A 1 149 ? 16.305  63.247  48.928 1.00 25.77  ? 145  PHE A CD1 1 
ATOM   1143 C CD2 . PHE A 1 149 ? 15.457  65.229  49.944 1.00 31.12  ? 145  PHE A CD2 1 
ATOM   1144 C CE1 . PHE A 1 149 ? 15.382  62.490  49.636 1.00 26.72  ? 145  PHE A CE1 1 
ATOM   1145 C CE2 . PHE A 1 149 ? 14.529  64.474  50.655 1.00 21.71  ? 145  PHE A CE2 1 
ATOM   1146 C CZ  . PHE A 1 149 ? 14.491  63.106  50.498 1.00 29.12  ? 145  PHE A CZ  1 
ATOM   1147 N N   . HIS A 1 150 ? 18.094  67.703  46.630 1.00 28.74  ? 146  HIS A N   1 
ATOM   1148 C CA  . HIS A 1 150 ? 19.090  68.633  46.168 1.00 35.03  ? 146  HIS A CA  1 
ATOM   1149 C C   . HIS A 1 150 ? 19.379  69.610  47.297 1.00 40.96  ? 146  HIS A C   1 
ATOM   1150 O O   . HIS A 1 150 ? 18.490  69.980  48.062 1.00 44.07  ? 146  HIS A O   1 
ATOM   1151 C CB  . HIS A 1 150 ? 18.651  69.316  44.849 1.00 34.53  ? 146  HIS A CB  1 
ATOM   1152 C CG  . HIS A 1 150 ? 17.598  70.373  44.991 1.00 33.76  ? 146  HIS A CG  1 
ATOM   1153 N ND1 . HIS A 1 150 ? 16.250  70.112  44.836 1.00 30.24  ? 146  HIS A ND1 1 
ATOM   1154 C CD2 . HIS A 1 150 ? 17.694  71.713  45.175 1.00 35.78  ? 146  HIS A CD2 1 
ATOM   1155 C CE1 . HIS A 1 150 ? 15.569  71.239  44.919 1.00 22.90  ? 146  HIS A CE1 1 
ATOM   1156 N NE2 . HIS A 1 150 ? 16.421  72.231  45.125 1.00 22.48  ? 146  HIS A NE2 1 
ATOM   1157 N N   . LYS A 1 151 ? 20.648  69.972  47.435 1.00 46.93  ? 147  LYS A N   1 
ATOM   1158 C CA  . LYS A 1 151 ? 21.078  70.879  48.483 1.00 48.75  ? 147  LYS A CA  1 
ATOM   1159 C C   . LYS A 1 151 ? 21.955  71.983  47.908 1.00 51.73  ? 147  LYS A C   1 
ATOM   1160 O O   . LYS A 1 151 ? 22.698  71.775  46.946 1.00 54.91  ? 147  LYS A O   1 
ATOM   1161 C CB  . LYS A 1 151 ? 21.851  70.100  49.548 1.00 45.63  ? 147  LYS A CB  1 
ATOM   1162 C CG  . LYS A 1 151 ? 22.065  70.852  50.849 1.00 50.89  ? 147  LYS A CG  1 
ATOM   1163 C CD  . LYS A 1 151 ? 22.578  69.922  51.947 1.00 54.00  ? 147  LYS A CD  1 
ATOM   1164 C CE  . LYS A 1 151 ? 21.487  69.600  52.952 1.00 51.58  ? 147  LYS A CE  1 
ATOM   1165 N NZ  . LYS A 1 151 ? 22.035  69.289  54.297 1.00 54.62  ? 147  LYS A NZ  1 
ATOM   1166 N N   . LEU A 1 152 ? 21.851  73.165  48.497 1.00 53.72  ? 148  LEU A N   1 
ATOM   1167 C CA  . LEU A 1 152 ? 22.645  74.297  48.058 1.00 57.30  ? 148  LEU A CA  1 
ATOM   1168 C C   . LEU A 1 152 ? 23.493  74.816  49.220 1.00 59.87  ? 148  LEU A C   1 
ATOM   1169 O O   . LEU A 1 152 ? 23.088  74.756  50.384 1.00 56.83  ? 148  LEU A O   1 
ATOM   1170 C CB  . LEU A 1 152 ? 21.738  75.421  47.550 1.00 57.55  ? 148  LEU A CB  1 
ATOM   1171 C CG  . LEU A 1 152 ? 20.927  75.157  46.285 1.00 57.55  ? 148  LEU A CG  1 
ATOM   1172 C CD1 . LEU A 1 152 ? 19.550  74.632  46.662 1.00 62.23  ? 148  LEU A CD1 1 
ATOM   1173 C CD2 . LEU A 1 152 ? 20.807  76.440  45.484 1.00 57.47  ? 148  LEU A CD2 1 
ATOM   1174 N N   . SER A 1 153 ? 24.686  75.301  48.900 1.00 60.88  ? 149  SER A N   1 
ATOM   1175 C CA  . SER A 1 153 ? 25.558  75.861  49.908 1.00 61.02  ? 149  SER A CA  1 
ATOM   1176 C C   . SER A 1 153 ? 25.980  77.202  49.392 1.00 61.71  ? 149  SER A C   1 
ATOM   1177 O O   . SER A 1 153 ? 25.884  77.481  48.200 1.00 57.03  ? 149  SER A O   1 
ATOM   1178 C CB  . SER A 1 153 ? 26.798  75.011  50.135 1.00 62.68  ? 149  SER A CB  1 
ATOM   1179 O OG  . SER A 1 153 ? 27.666  75.686  51.030 1.00 70.98  ? 149  SER A OG  1 
ATOM   1180 N N   . TYR A 1 154 ? 26.461  78.036  50.293 1.00 68.24  ? 150  TYR A N   1 
ATOM   1181 C CA  . TYR A 1 154 ? 26.881  79.358  49.899 1.00 75.95  ? 150  TYR A CA  1 
ATOM   1182 C C   . TYR A 1 154 ? 28.241  79.652  50.458 1.00 81.14  ? 150  TYR A C   1 
ATOM   1183 O O   . TYR A 1 154 ? 28.731  78.958  51.347 1.00 80.31  ? 150  TYR A O   1 
ATOM   1184 C CB  . TYR A 1 154 ? 25.882  80.394  50.419 1.00 71.71  ? 150  TYR A CB  1 
ATOM   1185 C CG  . TYR A 1 154 ? 24.485  80.084  49.992 1.00 72.86  ? 150  TYR A CG  1 
ATOM   1186 C CD1 . TYR A 1 154 ? 23.746  79.096  50.638 1.00 79.75  ? 150  TYR A CD1 1 
ATOM   1187 C CD2 . TYR A 1 154 ? 23.931  80.702  48.879 1.00 74.13  ? 150  TYR A CD2 1 
ATOM   1188 C CE1 . TYR A 1 154 ? 22.486  78.719  50.172 1.00 84.73  ? 150  TYR A CE1 1 
ATOM   1189 C CE2 . TYR A 1 154 ? 22.675  80.338  48.405 1.00 78.95  ? 150  TYR A CE2 1 
ATOM   1190 C CZ  . TYR A 1 154 ? 21.956  79.343  49.051 1.00 82.15  ? 150  TYR A CZ  1 
ATOM   1191 O OH  . TYR A 1 154 ? 20.723  78.961  48.566 1.00 77.69  ? 150  TYR A OH  1 
ATOM   1192 N N   . LEU A 1 155 ? 28.862  80.660  49.871 1.00 86.10  ? 151  LEU A N   1 
ATOM   1193 C CA  . LEU A 1 155 ? 30.123  81.154  50.342 1.00 91.48  ? 151  LEU A CA  1 
ATOM   1194 C C   . LEU A 1 155 ? 30.118  82.618  50.036 1.00 94.16  ? 151  LEU A C   1 
ATOM   1195 O O   . LEU A 1 155 ? 29.740  83.076  48.967 1.00 95.67  ? 151  LEU A O   1 
ATOM   1196 C CB  . LEU A 1 155 ? 31.357  80.497  49.730 1.00 92.55  ? 151  LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 155 ? 32.636  80.937  50.485 1.00 91.75  ? 151  LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 155 ? 33.165  82.235  49.882 1.00 90.91  ? 151  LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 155 ? 32.354  81.133  51.983 1.00 90.85  ? 151  LEU A CD2 1 
ATOM   1200 N N   . THR A 1 156 ? 30.560  83.335  51.040 1.00 95.37  ? 152  THR A N   1 
ATOM   1201 C CA  . THR A 1 156 ? 30.606  84.764  51.078 1.00 95.43  ? 152  THR A CA  1 
ATOM   1202 C C   . THR A 1 156 ? 32.044  85.150  50.817 1.00 95.70  ? 152  THR A C   1 
ATOM   1203 O O   . THR A 1 156 ? 32.924  84.831  51.608 1.00 99.54  ? 152  THR A O   1 
ATOM   1204 C CB  . THR A 1 156 ? 30.101  85.117  52.464 1.00 95.74  ? 152  THR A CB  1 
ATOM   1205 O OG1 . THR A 1 156 ? 30.952  84.506  53.443 1.00 99.16  ? 152  THR A OG1 1 
ATOM   1206 C CG2 . THR A 1 156 ? 28.713  84.489  52.659 1.00 99.49  ? 152  THR A CG2 1 
ATOM   1207 N N   . PHE A 1 157 ? 32.280  85.828  49.701 1.00 93.50  ? 153  PHE A N   1 
ATOM   1208 C CA  . PHE A 1 157 ? 33.639  86.191  49.324 1.00 90.73  ? 153  PHE A CA  1 
ATOM   1209 C C   . PHE A 1 157 ? 33.696  87.480  48.508 1.00 87.74  ? 153  PHE A C   1 
ATOM   1210 O O   . PHE A 1 157 ? 32.672  87.984  48.071 1.00 85.79  ? 153  PHE A O   1 
ATOM   1211 C CB  . PHE A 1 157 ? 34.240  85.047  48.494 1.00 92.81  ? 153  PHE A CB  1 
ATOM   1212 C CG  . PHE A 1 157 ? 33.595  84.887  47.136 1.00 93.88  ? 153  PHE A CG  1 
ATOM   1213 C CD1 . PHE A 1 157 ? 32.277  84.460  47.021 1.00 97.86  ? 153  PHE A CD1 1 
ATOM   1214 C CD2 . PHE A 1 157 ? 34.288  85.221  45.975 1.00 96.75  ? 153  PHE A CD2 1 
ATOM   1215 C CE1 . PHE A 1 157 ? 31.660  84.374  45.768 1.00 100.00 ? 153  PHE A CE1 1 
ATOM   1216 C CE2 . PHE A 1 157 ? 33.678  85.136  44.716 1.00 99.56  ? 153  PHE A CE2 1 
ATOM   1217 C CZ  . PHE A 1 157 ? 32.363  84.714  44.615 1.00 100.00 ? 153  PHE A CZ  1 
ATOM   1218 N N   . ILE A 1 158 ? 34.854  88.015  48.378 1.00 86.56  ? 154  ILE A N   1 
ATOM   1219 C CA  . ILE A 1 158 ? 35.222  89.138  47.516 1.00 85.24  ? 154  ILE A CA  1 
ATOM   1220 C C   . ILE A 1 158 ? 36.366  88.679  46.619 1.00 83.82  ? 154  ILE A C   1 
ATOM   1221 O O   . ILE A 1 158 ? 37.419  88.337  47.182 1.00 84.61  ? 154  ILE A O   1 
ATOM   1222 C CB  . ILE A 1 158 ? 35.664  90.316  48.389 1.00 83.81  ? 154  ILE A CB  1 
ATOM   1223 C CG1 . ILE A 1 158 ? 37.182  90.485  48.458 1.00 20.00  ? 154  ILE A CG1 1 
ATOM   1224 C CG2 . ILE A 1 158 ? 35.198  90.189  49.841 1.00 85.77  ? 154  ILE A CG2 1 
ATOM   1225 C CD1 . ILE A 1 158 ? 37.609  91.670  49.330 1.00 20.00  ? 154  ILE A CD1 1 
ATOM   1226 N N   . PRO A 1 159 ? 36.129  88.447  45.321 1.00 82.28  ? 155  PRO A N   1 
ATOM   1227 C CA  . PRO A 1 159 ? 36.922  87.907  44.177 1.00 82.62  ? 155  PRO A CA  1 
ATOM   1228 C C   . PRO A 1 159 ? 38.372  87.982  43.639 1.00 83.51  ? 155  PRO A C   1 
ATOM   1229 O O   . PRO A 1 159 ? 38.697  87.151  42.806 1.00 80.87  ? 155  PRO A O   1 
ATOM   1230 C CB  . PRO A 1 159 ? 36.007  88.100  42.964 1.00 82.74  ? 155  PRO A CB  1 
ATOM   1231 C CG  . PRO A 1 159 ? 34.865  88.852  43.376 1.00 81.92  ? 155  PRO A CG  1 
ATOM   1232 C CD  . PRO A 1 159 ? 34.834  88.999  44.859 1.00 82.56  ? 155  PRO A CD  1 
ATOM   1233 N N   . SER A 1 160 ? 39.242  88.889  44.049 1.00 85.32  ? 156  SER A N   1 
ATOM   1234 C CA  . SER A 1 160 ? 40.591  88.908  43.450 1.00 91.55  ? 156  SER A CA  1 
ATOM   1235 C C   . SER A 1 160 ? 41.522  87.697  43.697 1.00 93.29  ? 156  SER A C   1 
ATOM   1236 O O   . SER A 1 160 ? 42.044  87.028  42.778 1.00 90.85  ? 156  SER A O   1 
ATOM   1237 C CB  . SER A 1 160 ? 41.366  90.126  43.950 1.00 94.74  ? 156  SER A CB  1 
ATOM   1238 O OG  . SER A 1 160 ? 41.417  90.127  45.375 1.00 96.77  ? 156  SER A OG  1 
ATOM   1239 N N   . ASP A 1 161 ? 41.747  87.514  44.989 1.00 98.55  ? 157  ASP A N   1 
ATOM   1240 C CA  . ASP A 1 161 ? 42.631  86.558  45.621 1.00 100.00 ? 157  ASP A CA  1 
ATOM   1241 C C   . ASP A 1 161 ? 42.372  85.091  45.683 1.00 100.00 ? 157  ASP A C   1 
ATOM   1242 O O   . ASP A 1 161 ? 41.234  84.606  45.625 1.00 100.00 ? 157  ASP A O   1 
ATOM   1243 C CB  . ASP A 1 161 ? 42.824  86.966  47.068 1.00 100.00 ? 157  ASP A CB  1 
ATOM   1244 C CG  . ASP A 1 161 ? 41.712  86.408  47.971 1.00 100.00 ? 157  ASP A CG  1 
ATOM   1245 O OD1 . ASP A 1 161 ? 41.810  85.234  48.403 1.00 100.00 ? 157  ASP A OD1 1 
ATOM   1246 O OD2 . ASP A 1 161 ? 40.736  87.145  48.235 1.00 99.54  ? 157  ASP A OD2 1 
ATOM   1247 N N   . ASP A 1 162 ? 43.502  84.423  45.934 1.00 100.00 ? 158  ASP A N   1 
ATOM   1248 C CA  . ASP A 1 162 ? 43.643  82.972  46.120 1.00 100.00 ? 158  ASP A CA  1 
ATOM   1249 C C   . ASP A 1 162 ? 42.688  82.324  45.183 1.00 98.23  ? 158  ASP A C   1 
ATOM   1250 O O   . ASP A 1 162 ? 42.659  81.127  45.038 1.00 94.70  ? 158  ASP A O   1 
ATOM   1251 C CB  . ASP A 1 162 ? 43.266  82.592  47.560 1.00 100.00 ? 158  ASP A CB  1 
ATOM   1252 N N   . ASP A 1 163 ? 41.966  83.196  44.505 1.00 99.57  ? 159  ASP A N   1 
ATOM   1253 C CA  . ASP A 1 163 ? 40.866  82.890  43.652 1.00 100.00 ? 159  ASP A CA  1 
ATOM   1254 C C   . ASP A 1 163 ? 40.624  81.477  43.248 1.00 100.00 ? 159  ASP A C   1 
ATOM   1255 O O   . ASP A 1 163 ? 39.807  81.289  42.431 1.00 100.00 ? 159  ASP A O   1 
ATOM   1256 C CB  . ASP A 1 163 ? 40.826  83.796  42.456 1.00 99.79  ? 159  ASP A CB  1 
ATOM   1257 N N   . ILE A 1 164 ? 41.266  80.439  43.747 1.00 99.45  ? 160  ILE A N   1 
ATOM   1258 C CA  . ILE A 1 164 ? 40.713  79.201  43.246 1.00 99.20  ? 160  ILE A CA  1 
ATOM   1259 C C   . ILE A 1 164 ? 39.777  78.692  44.321 1.00 99.20  ? 160  ILE A C   1 
ATOM   1260 O O   . ILE A 1 164 ? 40.048  78.814  45.511 1.00 100.00 ? 160  ILE A O   1 
ATOM   1261 C CB  . ILE A 1 164 ? 41.775  78.210  42.891 1.00 98.60  ? 160  ILE A CB  1 
ATOM   1262 N N   . TYR A 1 165 ? 38.626  78.213  43.875 1.00 96.26  ? 161  TYR A N   1 
ATOM   1263 C CA  . TYR A 1 165 ? 37.643  77.676  44.781 1.00 90.50  ? 161  TYR A CA  1 
ATOM   1264 C C   . TYR A 1 165 ? 37.290  76.277  44.351 1.00 88.89  ? 161  TYR A C   1 
ATOM   1265 O O   . TYR A 1 165 ? 37.631  75.822  43.252 1.00 89.56  ? 161  TYR A O   1 
ATOM   1266 C CB  . TYR A 1 165 ? 36.367  78.485  44.789 1.00 86.79  ? 161  TYR A CB  1 
ATOM   1267 C CG  . TYR A 1 165 ? 36.546  79.796  45.479 1.00 79.15  ? 161  TYR A CG  1 
ATOM   1268 C CD1 . TYR A 1 165 ? 36.671  79.847  46.855 1.00 76.43  ? 161  TYR A CD1 1 
ATOM   1269 C CD2 . TYR A 1 165 ? 36.589  80.989  44.762 1.00 76.91  ? 161  TYR A CD2 1 
ATOM   1270 C CE1 . TYR A 1 165 ? 36.833  81.039  47.508 1.00 76.64  ? 161  TYR A CE1 1 
ATOM   1271 C CE2 . TYR A 1 165 ? 36.752  82.194  45.406 1.00 75.33  ? 161  TYR A CE2 1 
ATOM   1272 C CZ  . TYR A 1 165 ? 36.873  82.215  46.792 1.00 76.07  ? 161  TYR A CZ  1 
ATOM   1273 O OH  . TYR A 1 165 ? 37.041  83.405  47.475 1.00 71.36  ? 161  TYR A OH  1 
ATOM   1274 N N   . ASP A 1 166 ? 36.594  75.593  45.242 1.00 85.88  ? 162  ASP A N   1 
ATOM   1275 C CA  . ASP A 1 166 ? 36.178  74.247  44.998 1.00 85.94  ? 162  ASP A CA  1 
ATOM   1276 C C   . ASP A 1 166 ? 35.054  73.866  45.930 1.00 83.49  ? 162  ASP A C   1 
ATOM   1277 O O   . ASP A 1 166 ? 35.036  74.235  47.106 1.00 84.36  ? 162  ASP A O   1 
ATOM   1278 C CB  . ASP A 1 166 ? 37.370  73.308  45.164 1.00 87.13  ? 162  ASP A CB  1 
ATOM   1279 C CG  . ASP A 1 166 ? 37.062  71.918  44.687 1.00 88.93  ? 162  ASP A CG  1 
ATOM   1280 O OD1 . ASP A 1 166 ? 35.931  71.704  44.188 1.00 89.96  ? 162  ASP A OD1 1 
ATOM   1281 O OD2 . ASP A 1 166 ? 37.936  71.042  44.807 1.00 85.84  ? 162  ASP A OD2 1 
ATOM   1282 N N   . CYS A 1 167 ? 34.102  73.128  45.389 1.00 79.17  ? 163  CYS A N   1 
ATOM   1283 C CA  . CYS A 1 167 ? 32.977  72.654  46.167 1.00 76.59  ? 163  CYS A CA  1 
ATOM   1284 C C   . CYS A 1 167 ? 33.257  71.151  46.210 1.00 79.07  ? 163  CYS A C   1 
ATOM   1285 O O   . CYS A 1 167 ? 33.268  70.502  45.165 1.00 81.55  ? 163  CYS A O   1 
ATOM   1286 C CB  . CYS A 1 167 ? 31.677  72.952  45.415 1.00 75.95  ? 163  CYS A CB  1 
ATOM   1287 S SG  . CYS A 1 167 ? 30.143  72.367  46.197 1.00 73.82  ? 163  CYS A SG  1 
ATOM   1288 N N   . LYS A 1 168 ? 33.541  70.604  47.392 1.00 78.74  ? 164  LYS A N   1 
ATOM   1289 C CA  . LYS A 1 168 ? 33.813  69.169  47.517 1.00 80.03  ? 164  LYS A CA  1 
ATOM   1290 C C   . LYS A 1 168 ? 32.544  68.421  47.891 1.00 79.15  ? 164  LYS A C   1 
ATOM   1291 O O   . LYS A 1 168 ? 31.943  68.666  48.935 1.00 81.57  ? 164  LYS A O   1 
ATOM   1292 C CB  . LYS A 1 168 ? 34.880  68.882  48.570 1.00 83.09  ? 164  LYS A CB  1 
ATOM   1293 C CG  . LYS A 1 168 ? 35.219  67.399  48.686 1.00 79.67  ? 164  LYS A CG  1 
ATOM   1294 C CD  . LYS A 1 168 ? 36.371  67.167  49.653 1.00 84.43  ? 164  LYS A CD  1 
ATOM   1295 C CE  . LYS A 1 168 ? 37.129  65.890  49.327 1.00 82.28  ? 164  LYS A CE  1 
ATOM   1296 N NZ  . LYS A 1 168 ? 38.603  65.866  49.576 1.00 78.89  ? 164  LYS A NZ  1 
ATOM   1297 N N   . VAL A 1 169 ? 32.163  67.479  47.041 1.00 76.16  ? 165  VAL A N   1 
ATOM   1298 C CA  . VAL A 1 169 ? 30.941  66.721  47.241 1.00 75.91  ? 165  VAL A CA  1 
ATOM   1299 C C   . VAL A 1 169 ? 31.192  65.252  47.603 1.00 82.05  ? 165  VAL A C   1 
ATOM   1300 O O   . VAL A 1 169 ? 31.487  64.416  46.739 1.00 83.56  ? 165  VAL A O   1 
ATOM   1301 C CB  . VAL A 1 169 ? 30.064  66.821  45.967 1.00 72.32  ? 165  VAL A CB  1 
ATOM   1302 C CG1 . VAL A 1 169 ? 28.617  66.534  46.297 1.00 66.08  ? 165  VAL A CG1 1 
ATOM   1303 C CG2 . VAL A 1 169 ? 30.202  68.221  45.356 1.00 65.10  ? 165  VAL A CG2 1 
ATOM   1304 N N   . GLU A 1 170 ? 31.071  64.947  48.893 1.00 84.01  ? 166  GLU A N   1 
ATOM   1305 C CA  . GLU A 1 170 ? 31.268  63.589  49.392 1.00 82.91  ? 166  GLU A CA  1 
ATOM   1306 C C   . GLU A 1 170 ? 29.906  62.914  49.556 1.00 83.43  ? 166  GLU A C   1 
ATOM   1307 O O   . GLU A 1 170 ? 29.048  63.417  50.271 1.00 81.44  ? 166  GLU A O   1 
ATOM   1308 C CB  . GLU A 1 170 ? 31.985  63.608  50.750 1.00 86.16  ? 166  GLU A CB  1 
ATOM   1309 C CG  . GLU A 1 170 ? 33.307  64.367  50.779 1.00 93.04  ? 166  GLU A CG  1 
ATOM   1310 C CD  . GLU A 1 170 ? 33.999  64.301  52.134 1.00 96.10  ? 166  GLU A CD  1 
ATOM   1311 O OE1 . GLU A 1 170 ? 33.585  65.036  53.053 1.00 100.00 ? 166  GLU A OE1 1 
ATOM   1312 O OE2 . GLU A 1 170 ? 34.955  63.514  52.277 1.00 97.33  ? 166  GLU A OE2 1 
ATOM   1313 N N   . HIS A 1 171 ? 29.723  61.776  48.896 1.00 83.78  ? 167  HIS A N   1 
ATOM   1314 C CA  . HIS A 1 171 ? 28.484  61.016  48.958 1.00 84.68  ? 167  HIS A CA  1 
ATOM   1315 C C   . HIS A 1 171 ? 28.860  59.628  48.492 1.00 84.55  ? 167  HIS A C   1 
ATOM   1316 O O   . HIS A 1 171 ? 29.537  59.499  47.474 1.00 83.02  ? 167  HIS A O   1 
ATOM   1317 C CB  . HIS A 1 171 ? 27.441  61.638  48.022 1.00 84.66  ? 167  HIS A CB  1 
ATOM   1318 C CG  . HIS A 1 171 ? 26.268  60.752  47.766 1.00 84.61  ? 167  HIS A CG  1 
ATOM   1319 N ND1 . HIS A 1 171 ? 25.155  60.735  48.582 1.00 83.15  ? 167  HIS A ND1 1 
ATOM   1320 C CD2 . HIS A 1 171 ? 26.043  59.821  46.811 1.00 79.62  ? 167  HIS A CD2 1 
ATOM   1321 C CE1 . HIS A 1 171 ? 24.302  59.836  48.141 1.00 80.91  ? 167  HIS A CE1 1 
ATOM   1322 N NE2 . HIS A 1 171 ? 24.816  59.264  47.064 1.00 79.16  ? 167  HIS A NE2 1 
ATOM   1323 N N   . TRP A 1 172 ? 28.433  58.563  49.167 1.00 88.68  ? 168  TRP A N   1 
ATOM   1324 C CA  . TRP A 1 172 ? 28.897  57.250  48.708 1.00 91.75  ? 168  TRP A CA  1 
ATOM   1325 C C   . TRP A 1 172 ? 28.307  56.575  47.505 1.00 92.28  ? 168  TRP A C   1 
ATOM   1326 O O   . TRP A 1 172 ? 28.696  55.464  47.208 1.00 95.09  ? 168  TRP A O   1 
ATOM   1327 C CB  . TRP A 1 172 ? 28.940  56.247  49.843 1.00 95.38  ? 168  TRP A CB  1 
ATOM   1328 C CG  . TRP A 1 172 ? 27.637  56.004  50.440 1.00 98.56  ? 168  TRP A CG  1 
ATOM   1329 C CD1 . TRP A 1 172 ? 26.494  55.582  49.811 1.00 100.00 ? 168  TRP A CD1 1 
ATOM   1330 C CD2 . TRP A 1 172 ? 27.324  56.114  51.811 1.00 100.00 ? 168  TRP A CD2 1 
ATOM   1331 N NE1 . TRP A 1 172 ? 25.484  55.416  50.726 1.00 100.00 ? 168  TRP A NE1 1 
ATOM   1332 C CE2 . TRP A 1 172 ? 25.973  55.740  51.979 1.00 100.00 ? 168  TRP A CE2 1 
ATOM   1333 C CE3 . TRP A 1 172 ? 28.061  56.493  52.943 1.00 100.00 ? 168  TRP A CE3 1 
ATOM   1334 C CZ2 . TRP A 1 172 ? 25.335  55.730  53.223 1.00 98.21  ? 168  TRP A CZ2 1 
ATOM   1335 C CZ3 . TRP A 1 172 ? 27.438  56.487  54.182 1.00 100.00 ? 168  TRP A CZ3 1 
ATOM   1336 C CH2 . TRP A 1 172 ? 26.087  56.108  54.314 1.00 99.07  ? 168  TRP A CH2 1 
ATOM   1337 N N   . GLY A 1 173 ? 27.346  57.194  46.839 1.00 92.58  ? 169  GLY A N   1 
ATOM   1338 C CA  . GLY A 1 173 ? 26.887  56.568  45.623 1.00 96.00  ? 169  GLY A CA  1 
ATOM   1339 C C   . GLY A 1 173 ? 27.867  57.367  44.809 1.00 95.92  ? 169  GLY A C   1 
ATOM   1340 O O   . GLY A 1 173 ? 27.570  57.823  43.717 1.00 99.71  ? 169  GLY A O   1 
ATOM   1341 N N   . LEU A 1 174 ? 29.068  57.535  45.365 1.00 95.84  ? 170  LEU A N   1 
ATOM   1342 C CA  . LEU A 1 174 ? 30.050  58.398  44.724 1.00 97.86  ? 170  LEU A CA  1 
ATOM   1343 C C   . LEU A 1 174 ? 31.516  58.308  45.179 1.00 99.60  ? 170  LEU A C   1 
ATOM   1344 O O   . LEU A 1 174 ? 31.805  58.013  46.344 1.00 100.00 ? 170  LEU A O   1 
ATOM   1345 C CB  . LEU A 1 174 ? 29.493  59.815  44.869 1.00 98.93  ? 170  LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 174 ? 30.467  60.961  44.954 1.00 98.20  ? 170  LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 174 ? 30.960  61.205  43.554 1.00 100.00 ? 170  LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 174 ? 29.806  62.197  45.526 1.00 95.04  ? 170  LEU A CD2 1 
ATOM   1349 N N   . GLU A 1 175 ? 32.434  58.639  44.270 1.00 100.00 ? 171  GLU A N   1 
ATOM   1350 C CA  . GLU A 1 175 ? 33.852  58.508  44.591 1.00 96.50  ? 171  GLU A CA  1 
ATOM   1351 C C   . GLU A 1 175 ? 34.813  59.649  44.721 1.00 96.38  ? 171  GLU A C   1 
ATOM   1352 O O   . GLU A 1 175 ? 35.387  59.862  45.778 1.00 92.49  ? 171  GLU A O   1 
ATOM   1353 C CB  . GLU A 1 175 ? 34.494  57.581  43.626 1.00 92.76  ? 171  GLU A CB  1 
ATOM   1354 C CG  . GLU A 1 175 ? 33.645  56.420  43.445 1.00 86.94  ? 171  GLU A CG  1 
ATOM   1355 C CD  . GLU A 1 175 ? 34.240  55.545  42.455 1.00 88.82  ? 171  GLU A CD  1 
ATOM   1356 O OE1 . GLU A 1 175 ? 34.369  56.017  41.304 1.00 90.54  ? 171  GLU A OE1 1 
ATOM   1357 O OE2 . GLU A 1 175 ? 34.599  54.414  42.831 1.00 90.66  ? 171  GLU A OE2 1 
ATOM   1358 N N   . GLU A 1 176 ? 35.107  60.357  43.654 1.00 97.67  ? 172  GLU A N   1 
ATOM   1359 C CA  . GLU A 1 176 ? 36.049  61.374  43.950 1.00 99.34  ? 172  GLU A CA  1 
ATOM   1360 C C   . GLU A 1 176 ? 35.132  62.270  44.686 1.00 96.94  ? 172  GLU A C   1 
ATOM   1361 O O   . GLU A 1 176 ? 33.924  62.245  44.435 1.00 95.40  ? 172  GLU A O   1 
ATOM   1362 C CB  . GLU A 1 176 ? 36.566  62.047  42.700 1.00 100.00 ? 172  GLU A CB  1 
ATOM   1363 N N   . PRO A 1 177 ? 35.616  62.894  45.758 1.00 94.23  ? 173  PRO A N   1 
ATOM   1364 C CA  . PRO A 1 177 ? 34.533  63.744  46.226 1.00 93.93  ? 173  PRO A CA  1 
ATOM   1365 C C   . PRO A 1 177 ? 34.302  64.463  44.880 1.00 93.14  ? 173  PRO A C   1 
ATOM   1366 O O   . PRO A 1 177 ? 35.008  64.201  43.891 1.00 96.66  ? 173  PRO A O   1 
ATOM   1367 C CB  . PRO A 1 177 ? 35.212  64.657  47.216 1.00 91.50  ? 173  PRO A CB  1 
ATOM   1368 C CG  . PRO A 1 177 ? 36.481  63.945  47.588 1.00 91.42  ? 173  PRO A CG  1 
ATOM   1369 C CD  . PRO A 1 177 ? 36.789  62.884  46.641 1.00 92.20  ? 173  PRO A CD  1 
ATOM   1370 N N   . VAL A 1 178 ? 33.341  65.342  44.767 1.00 87.18  ? 174  VAL A N   1 
ATOM   1371 C CA  . VAL A 1 178 ? 33.245  65.925  43.466 1.00 77.74  ? 174  VAL A CA  1 
ATOM   1372 C C   . VAL A 1 178 ? 33.764  67.303  43.660 1.00 78.65  ? 174  VAL A C   1 
ATOM   1373 O O   . VAL A 1 178 ? 33.170  68.133  44.335 1.00 80.78  ? 174  VAL A O   1 
ATOM   1374 C CB  . VAL A 1 178 ? 31.826  65.866  42.942 1.00 75.14  ? 174  VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 178 ? 31.485  67.106  42.188 1.00 78.51  ? 174  VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 178 ? 31.693  64.646  42.041 1.00 75.45  ? 174  VAL A CG2 1 
ATOM   1377 N N   . LEU A 1 179 ? 34.953  67.497  43.130 1.00 82.96  ? 175  LEU A N   1 
ATOM   1378 C CA  . LEU A 1 179 ? 35.632  68.760  43.213 1.00 86.67  ? 175  LEU A CA  1 
ATOM   1379 C C   . LEU A 1 179 ? 35.097  69.508  41.995 1.00 86.98  ? 175  LEU A C   1 
ATOM   1380 O O   . LEU A 1 179 ? 35.360  69.114  40.858 1.00 88.38  ? 175  LEU A O   1 
ATOM   1381 C CB  . LEU A 1 179 ? 37.140  68.464  43.160 1.00 87.87  ? 175  LEU A CB  1 
ATOM   1382 C CG  . LEU A 1 179 ? 37.365  67.024  43.685 1.00 93.78  ? 175  LEU A CG  1 
ATOM   1383 C CD1 . LEU A 1 179 ? 38.656  66.434  43.149 1.00 88.78  ? 175  LEU A CD1 1 
ATOM   1384 C CD2 . LEU A 1 179 ? 37.358  67.030  45.215 1.00 99.28  ? 175  LEU A CD2 1 
ATOM   1385 N N   . LYS A 1 180 ? 34.272  70.529  42.239 1.00 83.96  ? 176  LYS A N   1 
ATOM   1386 C CA  . LYS A 1 180 ? 33.709  71.335  41.155 1.00 77.07  ? 176  LYS A CA  1 
ATOM   1387 C C   . LYS A 1 180 ? 34.264  72.719  41.351 1.00 76.48  ? 176  LYS A C   1 
ATOM   1388 O O   . LYS A 1 180 ? 33.827  73.476  42.222 1.00 73.13  ? 176  LYS A O   1 
ATOM   1389 C CB  . LYS A 1 180 ? 32.179  71.350  41.174 1.00 70.98  ? 176  LYS A CB  1 
ATOM   1390 C CG  . LYS A 1 180 ? 31.559  70.991  39.813 1.00 65.50  ? 176  LYS A CG  1 
ATOM   1391 C CD  . LYS A 1 180 ? 32.404  69.988  39.014 1.00 64.80  ? 176  LYS A CD  1 
ATOM   1392 C CE  . LYS A 1 180 ? 32.428  68.600  39.658 1.00 74.62  ? 176  LYS A CE  1 
ATOM   1393 N NZ  . LYS A 1 180 ? 31.179  67.807  39.398 1.00 78.49  ? 176  LYS A NZ  1 
ATOM   1394 N N   . HIS A 1 181 ? 35.254  73.001  40.511 1.00 79.55  ? 177  HIS A N   1 
ATOM   1395 C CA  . HIS A 1 181 ? 36.053  74.211  40.502 1.00 80.99  ? 177  HIS A CA  1 
ATOM   1396 C C   . HIS A 1 181 ? 35.522  75.481  39.891 1.00 80.86  ? 177  HIS A C   1 
ATOM   1397 O O   . HIS A 1 181 ? 34.964  75.495  38.792 1.00 81.29  ? 177  HIS A O   1 
ATOM   1398 C CB  . HIS A 1 181 ? 37.396  73.886  39.856 1.00 81.74  ? 177  HIS A CB  1 
ATOM   1399 C CG  . HIS A 1 181 ? 38.123  72.771  40.531 1.00 85.14  ? 177  HIS A CG  1 
ATOM   1400 N ND1 . HIS A 1 181 ? 38.496  71.611  39.877 1.00 85.21  ? 177  HIS A ND1 1 
ATOM   1401 C CD2 . HIS A 1 181 ? 38.525  72.622  41.813 1.00 83.44  ? 177  HIS A CD2 1 
ATOM   1402 C CE1 . HIS A 1 181 ? 39.091  70.803  40.729 1.00 86.08  ? 177  HIS A CE1 1 
ATOM   1403 N NE2 . HIS A 1 181 ? 39.123  71.392  41.915 1.00 86.60  ? 177  HIS A NE2 1 
ATOM   1404 N N   . TRP A 1 182 ? 35.765  76.559  40.628 1.00 81.24  ? 178  TRP A N   1 
ATOM   1405 C CA  . TRP A 1 182 ? 35.362  77.901  40.251 1.00 81.41  ? 178  TRP A CA  1 
ATOM   1406 C C   . TRP A 1 182 ? 36.079  78.950  41.088 1.00 85.74  ? 178  TRP A C   1 
ATOM   1407 O O   . TRP A 1 182 ? 36.400  78.750  42.252 1.00 88.31  ? 178  TRP A O   1 
ATOM   1408 C CB  . TRP A 1 182 ? 33.872  78.091  40.449 1.00 73.55  ? 178  TRP A CB  1 
ATOM   1409 C CG  . TRP A 1 182 ? 33.281  79.219  39.683 1.00 67.09  ? 178  TRP A CG  1 
ATOM   1410 C CD1 . TRP A 1 182 ? 32.599  79.117  38.515 1.00 66.57  ? 178  TRP A CD1 1 
ATOM   1411 C CD2 . TRP A 1 182 ? 33.232  80.608  40.055 1.00 65.18  ? 178  TRP A CD2 1 
ATOM   1412 N NE1 . TRP A 1 182 ? 32.118  80.341  38.131 1.00 67.72  ? 178  TRP A NE1 1 
ATOM   1413 C CE2 . TRP A 1 182 ? 32.493  81.284  39.064 1.00 65.07  ? 178  TRP A CE2 1 
ATOM   1414 C CE3 . TRP A 1 182 ? 33.735  81.356  41.138 1.00 57.93  ? 178  TRP A CE3 1 
ATOM   1415 C CZ2 . TRP A 1 182 ? 32.238  82.660  39.106 1.00 60.87  ? 178  TRP A CZ2 1 
ATOM   1416 C CZ3 . TRP A 1 182 ? 33.486  82.732  41.183 1.00 45.15  ? 178  TRP A CZ3 1 
ATOM   1417 C CH2 . TRP A 1 182 ? 32.745  83.364  40.175 1.00 53.92  ? 178  TRP A CH2 1 
ATOM   1418 N N   . ARG B 2 1   S -5.426  83.690  60.444 1.00 78.68  ? 1    ARG B N   1 
ATOM   1419 C CA  . ARG B 2 1   S -4.478  83.847  59.302 1.00 80.94  ? 1    ARG B CA  1 
ATOM   1420 C C   . ARG B 2 1   S -2.981  83.940  59.691 1.00 82.25  ? 1    ARG B C   1 
ATOM   1421 O O   . ARG B 2 1   S -2.142  84.430  58.912 1.00 82.41  ? 1    ARG B O   1 
ATOM   1422 C CB  . ARG B 2 1   S -4.875  85.072  58.468 1.00 79.38  ? 1    ARG B CB  1 
ATOM   1423 N N   . GLY B 2 2   S -2.640  83.475  60.889 1.00 80.10  ? 2    GLY B N   1 
ATOM   1424 C CA  . GLY B 2 2   S -1.252  83.525  61.333 1.00 70.56  ? 2    GLY B CA  1 
ATOM   1425 C C   . GLY B 2 2   S -0.702  82.180  61.789 1.00 64.51  ? 2    GLY B C   1 
ATOM   1426 O O   . GLY B 2 2   S 0.352   82.117  62.428 1.00 65.17  ? 2    GLY B O   1 
ATOM   1427 N N   . ILE B 2 3   P -1.411  81.102  61.452 1.00 61.42  ? 323  ILE B N   1 
ATOM   1428 C CA  . ILE B 2 3   P -1.016  79.738  61.833 1.00 55.12  ? 323  ILE B CA  1 
ATOM   1429 C C   . ILE B 2 3   P -0.856  78.791  60.634 1.00 52.60  ? 323  ILE B C   1 
ATOM   1430 O O   . ILE B 2 3   P -1.831  78.474  59.955 1.00 52.30  ? 323  ILE B O   1 
ATOM   1431 C CB  . ILE B 2 3   P -2.054  79.116  62.790 1.00 54.91  ? 323  ILE B CB  1 
ATOM   1432 C CG1 . ILE B 2 3   P -2.451  80.128  63.868 1.00 50.74  ? 323  ILE B CG1 1 
ATOM   1433 C CG2 . ILE B 2 3   P -1.486  77.851  63.412 1.00 47.47  ? 323  ILE B CG2 1 
ATOM   1434 C CD1 . ILE B 2 3   P -3.931  80.099  64.242 1.00 55.62  ? 323  ILE B CD1 1 
ATOM   1435 N N   . SER B 2 4   P 0.368   78.324  60.398 1.00 50.00  ? 324  SER B N   1 
ATOM   1436 C CA  . SER B 2 4   P 0.653   77.435  59.273 1.00 48.47  ? 324  SER B CA  1 
ATOM   1437 C C   . SER B 2 4   P 0.366   75.970  59.577 1.00 49.68  ? 324  SER B C   1 
ATOM   1438 O O   . SER B 2 4   P 0.994   75.382  60.470 1.00 48.32  ? 324  SER B O   1 
ATOM   1439 C CB  . SER B 2 4   P 2.112   77.586  58.837 1.00 49.69  ? 324  SER B CB  1 
ATOM   1440 O OG  . SER B 2 4   P 2.640   76.358  58.354 1.00 53.75  ? 324  SER B OG  1 
ATOM   1441 N N   . GLN B 2 5   P -0.561  75.384  58.820 1.00 47.56  ? 325  GLN B N   1 
ATOM   1442 C CA  . GLN B 2 5   P -0.941  73.984  59.015 1.00 49.76  ? 325  GLN B CA  1 
ATOM   1443 C C   . GLN B 2 5   P -0.181  72.953  58.185 1.00 48.00  ? 325  GLN B C   1 
ATOM   1444 O O   . GLN B 2 5   P 0.173   73.207  57.019 1.00 44.92  ? 325  GLN B O   1 
ATOM   1445 C CB  . GLN B 2 5   P -2.444  73.806  58.720 1.00 56.48  ? 325  GLN B CB  1 
ATOM   1446 C CG  . GLN B 2 5   P -3.183  73.075  59.805 1.00 59.40  ? 325  GLN B CG  1 
ATOM   1447 C CD  . GLN B 2 5   P -3.680  74.037  60.840 1.00 66.52  ? 325  GLN B CD  1 
ATOM   1448 O OE1 . GLN B 2 5   P -4.642  74.770  60.607 1.00 65.44  ? 325  GLN B OE1 1 
ATOM   1449 N NE2 . GLN B 2 5   P -3.013  74.065  61.990 1.00 69.49  ? 325  GLN B NE2 1 
ATOM   1450 N N   . ALA B 2 6   P 0.037   71.772  58.761 1.00 40.42  ? 326  ALA B N   1 
ATOM   1451 C CA  . ALA B 2 6   P 0.717   70.691  58.080 1.00 35.62  ? 326  ALA B CA  1 
ATOM   1452 C C   . ALA B 2 6   P -0.252  69.656  57.614 1.00 36.59  ? 326  ALA B C   1 
ATOM   1453 O O   . ALA B 2 6   P -1.423  69.746  57.937 1.00 31.84  ? 326  ALA B O   1 
ATOM   1454 C CB  . ALA B 2 6   P 1.761   70.062  59.036 1.00 26.43  ? 326  ALA B CB  1 
ATOM   1455 N N   . VAL B 2 7   P 0.276   68.704  56.848 1.00 32.99  ? 327  VAL B N   1 
ATOM   1456 C CA  . VAL B 2 7   P -0.522  67.608  56.332 1.00 26.02  ? 327  VAL B CA  1 
ATOM   1457 C C   . VAL B 2 7   P -0.059  66.423  57.160 1.00 31.55  ? 327  VAL B C   1 
ATOM   1458 O O   . VAL B 2 7   P 1.129   66.099  57.168 1.00 29.61  ? 327  VAL B O   1 
ATOM   1459 C CB  . VAL B 2 7   P -0.217  67.315  54.846 1.00 23.86  ? 327  VAL B CB  1 
ATOM   1460 C CG1 . VAL B 2 7   P -0.832  65.981  54.447 1.00 31.24  ? 327  VAL B CG1 1 
ATOM   1461 C CG2 . VAL B 2 7   P -0.746  68.436  53.958 1.00 9.75   ? 327  VAL B CG2 1 
ATOM   1462 N N   . HIS B 2 8   P -0.997  65.795  57.862 1.00 34.48  ? 328  HIS B N   1 
ATOM   1463 C CA  . HIS B 2 8   P -0.715  64.676  58.748 1.00 30.56  ? 328  HIS B CA  1 
ATOM   1464 C C   . HIS B 2 8   P -0.347  63.381  58.045 1.00 29.18  ? 328  HIS B C   1 
ATOM   1465 O O   . HIS B 2 8   P -1.051  62.936  57.143 1.00 37.74  ? 328  HIS B O   1 
ATOM   1466 C CB  . HIS B 2 8   P -1.933  64.437  59.656 1.00 39.98  ? 328  HIS B CB  1 
ATOM   1467 C CG  . HIS B 2 8   P -1.610  63.739  60.941 1.00 58.78  ? 328  HIS B CG  1 
ATOM   1468 N ND1 . HIS B 2 8   P -1.141  64.406  62.059 1.00 64.21  ? 328  HIS B ND1 1 
ATOM   1469 C CD2 . HIS B 2 8   P -1.672  62.433  61.293 1.00 64.32  ? 328  HIS B CD2 1 
ATOM   1470 C CE1 . HIS B 2 8   P -0.932  63.544  63.030 1.00 65.82  ? 328  HIS B CE1 1 
ATOM   1471 N NE2 . HIS B 2 8   P -1.246  62.334  62.594 1.00 68.08  ? 328  HIS B NE2 1 
ATOM   1472 N N   . ALA B 2 9   P 0.764   62.786  58.467 1.00 21.53  ? 329  ALA B N   1 
ATOM   1473 C CA  . ALA B 2 9   P 1.210   61.518  57.922 1.00 18.37  ? 329  ALA B CA  1 
ATOM   1474 C C   . ALA B 2 9   P 0.517   60.434  58.715 1.00 21.23  ? 329  ALA B C   1 
ATOM   1475 O O   . ALA B 2 9   P 0.564   60.429  59.948 1.00 34.57  ? 329  ALA B O   1 
ATOM   1476 C CB  . ALA B 2 9   P 2.704   61.369  58.061 1.00 5.88   ? 329  ALA B CB  1 
ATOM   1477 N N   . ALA B 2 10  P -0.131  59.523  58.003 1.00 23.18  ? 330  ALA B N   1 
ATOM   1478 C CA  . ALA B 2 10  P -0.859  58.426  58.613 1.00 17.10  ? 330  ALA B CA  1 
ATOM   1479 C C   . ALA B 2 10  P 0.055   57.362  59.208 1.00 19.98  ? 330  ALA B C   1 
ATOM   1480 O O   . ALA B 2 10  P 1.252   57.333  58.950 1.00 22.46  ? 330  ALA B O   1 
ATOM   1481 C CB  . ALA B 2 10  P -1.809  57.805  57.578 1.00 22.78  ? 330  ALA B CB  1 
ATOM   1482 N N   . HIS B 2 11  P -0.531  56.488  60.013 1.00 21.64  ? 331  HIS B N   1 
ATOM   1483 C CA  . HIS B 2 11  P 0.213   55.426  60.648 1.00 19.38  ? 331  HIS B CA  1 
ATOM   1484 C C   . HIS B 2 11  P -0.166  54.114  59.990 1.00 24.65  ? 331  HIS B C   1 
ATOM   1485 O O   . HIS B 2 11  P -1.341  53.821  59.780 1.00 26.86  ? 331  HIS B O   1 
ATOM   1486 C CB  . HIS B 2 11  P -0.119  55.384  62.140 1.00 25.15  ? 331  HIS B CB  1 
ATOM   1487 C CG  . HIS B 2 11  P 0.844   56.147  62.994 1.00 24.31  ? 331  HIS B CG  1 
ATOM   1488 N ND1 . HIS B 2 11  P 0.739   57.507  63.212 1.00 19.41  ? 331  HIS B ND1 1 
ATOM   1489 C CD2 . HIS B 2 11  P 1.947   55.739  63.664 1.00 15.88  ? 331  HIS B CD2 1 
ATOM   1490 C CE1 . HIS B 2 11  P 1.740   57.901  63.979 1.00 23.34  ? 331  HIS B CE1 1 
ATOM   1491 N NE2 . HIS B 2 11  P 2.486   56.848  64.268 1.00 24.54  ? 331  HIS B NE2 1 
ATOM   1492 N N   . ALA B 2 12  P 0.836   53.323  59.646 1.00 28.20  ? 332  ALA B N   1 
ATOM   1493 C CA  . ALA B 2 12  P 0.578   52.049  59.020 1.00 33.04  ? 332  ALA B CA  1 
ATOM   1494 C C   . ALA B 2 12  P 0.069   51.152  60.126 1.00 43.29  ? 332  ALA B C   1 
ATOM   1495 O O   . ALA B 2 12  P 0.182   51.493  61.308 1.00 51.78  ? 332  ALA B O   1 
ATOM   1496 C CB  . ALA B 2 12  P 1.854   51.491  58.439 1.00 27.52  ? 332  ALA B CB  1 
ATOM   1497 N N   . GLU B 2 13  P -0.502  50.014  59.754 1.00 43.72  ? 333  GLU B N   1 
ATOM   1498 C CA  . GLU B 2 13  P -0.997  49.078  60.742 1.00 39.38  ? 333  GLU B CA  1 
ATOM   1499 C C   . GLU B 2 13  P 0.181   48.222  61.175 1.00 43.52  ? 333  GLU B C   1 
ATOM   1500 O O   . GLU B 2 13  P 1.020   47.846  60.353 1.00 39.89  ? 333  GLU B O   1 
ATOM   1501 C CB  . GLU B 2 13  P -2.083  48.201  60.134 1.00 32.36  ? 333  GLU B CB  1 
ATOM   1502 C CG  . GLU B 2 13  P -2.809  47.332  61.124 1.00 43.14  ? 333  GLU B CG  1 
ATOM   1503 C CD  . GLU B 2 13  P -3.787  46.392  60.449 1.00 50.14  ? 333  GLU B CD  1 
ATOM   1504 O OE1 . GLU B 2 13  P -3.385  45.725  59.476 1.00 52.04  ? 333  GLU B OE1 1 
ATOM   1505 O OE2 . GLU B 2 13  P -4.958  46.319  60.884 1.00 60.61  ? 333  GLU B OE2 1 
ATOM   1506 N N   . ILE B 2 14  P 0.276   47.961  62.474 1.00 49.32  ? 334  ILE B N   1 
ATOM   1507 C CA  . ILE B 2 14  P 1.338   47.102  62.980 1.00 52.50  ? 334  ILE B CA  1 
ATOM   1508 C C   . ILE B 2 14  P 0.776   45.707  62.772 1.00 60.11  ? 334  ILE B C   1 
ATOM   1509 O O   . ILE B 2 14  P -0.387  45.459  63.112 1.00 58.07  ? 334  ILE B O   1 
ATOM   1510 C CB  . ILE B 2 14  P 1.577   47.290  64.476 1.00 48.51  ? 334  ILE B CB  1 
ATOM   1511 C CG1 . ILE B 2 14  P 2.036   48.717  64.750 1.00 36.16  ? 334  ILE B CG1 1 
ATOM   1512 C CG2 . ILE B 2 14  P 2.622   46.274  64.963 1.00 52.55  ? 334  ILE B CG2 1 
ATOM   1513 C CD1 . ILE B 2 14  P 1.990   49.077  66.202 1.00 26.65  ? 334  ILE B CD1 1 
ATOM   1514 N N   . HIS B 2 31  ? 21.082  51.148  55.238 1.00 47.44  ? 6    HIS B N   1 
ATOM   1515 C CA  . HIS B 2 31  ? 20.582  52.366  54.524 1.00 46.37  ? 6    HIS B CA  1 
ATOM   1516 C C   . HIS B 2 31  ? 19.126  52.217  54.099 1.00 44.51  ? 6    HIS B C   1 
ATOM   1517 O O   . HIS B 2 31  ? 18.822  51.692  53.021 1.00 35.01  ? 6    HIS B O   1 
ATOM   1518 C CB  . HIS B 2 31  ? 21.449  52.652  53.307 1.00 43.99  ? 6    HIS B CB  1 
ATOM   1519 N N   . PHE B 2 32  ? 18.229  52.678  54.964 1.00 45.56  ? 7    PHE B N   1 
ATOM   1520 C CA  . PHE B 2 32  ? 16.805  52.614  54.690 1.00 45.61  ? 7    PHE B CA  1 
ATOM   1521 C C   . PHE B 2 32  ? 16.206  53.993  54.859 1.00 45.25  ? 7    PHE B C   1 
ATOM   1522 O O   . PHE B 2 32  ? 16.445  54.667  55.863 1.00 43.27  ? 7    PHE B O   1 
ATOM   1523 C CB  . PHE B 2 32  ? 16.154  51.606  55.619 1.00 47.30  ? 7    PHE B CB  1 
ATOM   1524 C CG  . PHE B 2 32  ? 16.711  50.235  55.462 1.00 48.66  ? 7    PHE B CG  1 
ATOM   1525 C CD1 . PHE B 2 32  ? 16.327  49.434  54.389 1.00 51.07  ? 7    PHE B CD1 1 
ATOM   1526 C CD2 . PHE B 2 32  ? 17.664  49.754  56.357 1.00 50.15  ? 7    PHE B CD2 1 
ATOM   1527 C CE1 . PHE B 2 32  ? 16.887  48.168  54.208 1.00 53.62  ? 7    PHE B CE1 1 
ATOM   1528 C CE2 . PHE B 2 32  ? 18.232  48.490  56.186 1.00 46.16  ? 7    PHE B CE2 1 
ATOM   1529 C CZ  . PHE B 2 32  ? 17.841  47.695  55.110 1.00 49.44  ? 7    PHE B CZ  1 
ATOM   1530 N N   . VAL B 2 33  ? 15.432  54.406  53.861 1.00 40.19  ? 8    VAL B N   1 
ATOM   1531 C CA  . VAL B 2 33  ? 14.829  55.728  53.849 1.00 36.58  ? 8    VAL B CA  1 
ATOM   1532 C C   . VAL B 2 33  ? 13.341  55.711  53.544 1.00 34.64  ? 8    VAL B C   1 
ATOM   1533 O O   . VAL B 2 33  ? 12.851  54.817  52.859 1.00 34.86  ? 8    VAL B O   1 
ATOM   1534 C CB  . VAL B 2 33  ? 15.514  56.608  52.786 1.00 34.74  ? 8    VAL B CB  1 
ATOM   1535 C CG1 . VAL B 2 33  ? 15.064  58.043  52.921 1.00 43.73  ? 8    VAL B CG1 1 
ATOM   1536 C CG2 . VAL B 2 33  ? 17.017  56.504  52.923 1.00 35.38  ? 8    VAL B CG2 1 
ATOM   1537 N N   . VAL B 2 34  ? 12.625  56.695  54.081 1.00 31.64  ? 9    VAL B N   1 
ATOM   1538 C CA  . VAL B 2 34  ? 11.195  56.854  53.825 1.00 27.68  ? 9    VAL B CA  1 
ATOM   1539 C C   . VAL B 2 34  ? 10.940  58.352  53.728 1.00 26.21  ? 9    VAL B C   1 
ATOM   1540 O O   . VAL B 2 34  ? 11.675  59.155  54.303 1.00 28.84  ? 9    VAL B O   1 
ATOM   1541 C CB  . VAL B 2 34  ? 10.301  56.263  54.953 1.00 29.81  ? 9    VAL B CB  1 
ATOM   1542 C CG1 . VAL B 2 34  ? 10.154  54.770  54.777 1.00 29.04  ? 9    VAL B CG1 1 
ATOM   1543 C CG2 . VAL B 2 34  ? 10.880  56.581  56.311 1.00 30.54  ? 9    VAL B CG2 1 
ATOM   1544 N N   . GLN B 2 35  ? 9.919   58.728  52.977 1.00 17.81  ? 10   GLN B N   1 
ATOM   1545 C CA  . GLN B 2 35  ? 9.582   60.128  52.830 1.00 20.82  ? 10   GLN B CA  1 
ATOM   1546 C C   . GLN B 2 35  ? 8.078   60.209  52.764 1.00 23.75  ? 10   GLN B C   1 
ATOM   1547 O O   . GLN B 2 35  ? 7.419   59.304  52.251 1.00 23.29  ? 10   GLN B O   1 
ATOM   1548 C CB  . GLN B 2 35  ? 10.146  60.724  51.530 1.00 28.45  ? 10   GLN B CB  1 
ATOM   1549 C CG  . GLN B 2 35  ? 11.591  60.380  51.186 1.00 35.69  ? 10   GLN B CG  1 
ATOM   1550 C CD  . GLN B 2 35  ? 11.941  60.755  49.759 1.00 40.83  ? 10   GLN B CD  1 
ATOM   1551 O OE1 . GLN B 2 35  ? 11.353  61.665  49.180 1.00 58.75  ? 10   GLN B OE1 1 
ATOM   1552 N NE2 . GLN B 2 35  ? 12.901  60.053  49.185 1.00 49.22  ? 10   GLN B NE2 1 
ATOM   1553 N N   . PHE B 2 36  ? 7.526   61.280  53.308 1.00 21.00  ? 11   PHE B N   1 
ATOM   1554 C CA  . PHE B 2 36  ? 6.093   61.476  53.243 1.00 20.13  ? 11   PHE B CA  1 
ATOM   1555 C C   . PHE B 2 36  ? 5.972   62.859  52.646 1.00 23.80  ? 11   PHE B C   1 
ATOM   1556 O O   . PHE B 2 36  ? 6.577   63.805  53.142 1.00 23.35  ? 11   PHE B O   1 
ATOM   1557 C CB  . PHE B 2 36  ? 5.445   61.456  54.621 1.00 18.16  ? 11   PHE B CB  1 
ATOM   1558 C CG  . PHE B 2 36  ? 4.111   62.128  54.651 1.00 12.38  ? 11   PHE B CG  1 
ATOM   1559 C CD1 . PHE B 2 36  ? 3.004   61.521  54.059 1.00 11.02  ? 11   PHE B CD1 1 
ATOM   1560 C CD2 . PHE B 2 36  ? 3.980   63.412  55.177 1.00 13.68  ? 11   PHE B CD2 1 
ATOM   1561 C CE1 . PHE B 2 36  ? 1.781   62.182  53.975 1.00 10.51  ? 11   PHE B CE1 1 
ATOM   1562 C CE2 . PHE B 2 36  ? 2.770   64.085  55.103 1.00 13.87  ? 11   PHE B CE2 1 
ATOM   1563 C CZ  . PHE B 2 36  ? 1.661   63.470  54.496 1.00 19.25  ? 11   PHE B CZ  1 
ATOM   1564 N N   . LYS B 2 37  ? 5.198   62.973  51.578 1.00 18.78  ? 12   LYS B N   1 
ATOM   1565 C CA  . LYS B 2 37  ? 5.049   64.242  50.917 1.00 18.52  ? 12   LYS B CA  1 
ATOM   1566 C C   . LYS B 2 37  ? 3.623   64.776  50.888 1.00 22.94  ? 12   LYS B C   1 
ATOM   1567 O O   . LYS B 2 37  ? 2.715   64.158  50.332 1.00 25.46  ? 12   LYS B O   1 
ATOM   1568 C CB  . LYS B 2 37  ? 5.604   64.138  49.489 1.00 21.73  ? 12   LYS B CB  1 
ATOM   1569 C CG  . LYS B 2 37  ? 7.034   63.613  49.415 1.00 14.47  ? 12   LYS B CG  1 
ATOM   1570 C CD  . LYS B 2 37  ? 7.774   64.120  48.176 1.00 20.37  ? 12   LYS B CD  1 
ATOM   1571 C CE  . LYS B 2 37  ? 9.126   63.428  48.004 1.00 20.79  ? 12   LYS B CE  1 
ATOM   1572 N NZ  . LYS B 2 37  ? 9.894   63.911  46.824 1.00 27.04  ? 12   LYS B NZ  1 
ATOM   1573 N N   . GLY B 2 38  ? 3.441   65.930  51.521 1.00 25.60  ? 13   GLY B N   1 
ATOM   1574 C CA  . GLY B 2 38  ? 2.153   66.591  51.530 1.00 26.96  ? 13   GLY B CA  1 
ATOM   1575 C C   . GLY B 2 38  ? 2.299   67.622  50.427 1.00 28.86  ? 13   GLY B C   1 
ATOM   1576 O O   . GLY B 2 38  ? 3.171   68.490  50.498 1.00 33.42  ? 13   GLY B O   1 
ATOM   1577 N N   . GLU B 2 39  ? 1.465   67.539  49.399 1.00 24.09  ? 14   GLU B N   1 
ATOM   1578 C CA  . GLU B 2 39  ? 1.601   68.461  48.287 1.00 22.17  ? 14   GLU B CA  1 
ATOM   1579 C C   . GLU B 2 39  ? 0.296   69.096  47.873 1.00 25.35  ? 14   GLU B C   1 
ATOM   1580 O O   . GLU B 2 39  ? -0.683  68.396  47.594 1.00 30.60  ? 14   GLU B O   1 
ATOM   1581 C CB  . GLU B 2 39  ? 2.216   67.723  47.098 1.00 20.43  ? 14   GLU B CB  1 
ATOM   1582 C CG  . GLU B 2 39  ? 3.589   67.141  47.401 1.00 25.96  ? 14   GLU B CG  1 
ATOM   1583 C CD  . GLU B 2 39  ? 4.059   66.180  46.348 1.00 23.43  ? 14   GLU B CD  1 
ATOM   1584 O OE1 . GLU B 2 39  ? 3.250   65.868  45.451 1.00 29.44  ? 14   GLU B OE1 1 
ATOM   1585 O OE2 . GLU B 2 39  ? 5.230   65.741  46.416 1.00 33.46  ? 14   GLU B OE2 1 
ATOM   1586 N N   . CYS B 2 40  ? 0.285   70.426  47.822 1.00 26.33  ? 15   CYS B N   1 
ATOM   1587 C CA  . CYS B 2 40  ? -0.919  71.143  47.424 1.00 29.91  ? 15   CYS B CA  1 
ATOM   1588 C C   . CYS B 2 40  ? -0.761  72.089  46.239 1.00 26.84  ? 15   CYS B C   1 
ATOM   1589 O O   . CYS B 2 40  ? -0.022  73.079  46.278 1.00 24.26  ? 15   CYS B O   1 
ATOM   1590 C CB  . CYS B 2 40  ? -1.545  71.846  48.634 1.00 35.22  ? 15   CYS B CB  1 
ATOM   1591 S SG  . CYS B 2 40  ? -3.130  71.008  48.988 1.00 56.30  ? 15   CYS B SG  1 
ATOM   1592 N N   . TYR B 2 41  ? -1.484  71.733  45.180 1.00 28.04  ? 16   TYR B N   1 
ATOM   1593 C CA  . TYR B 2 41  ? -1.473  72.434  43.907 1.00 29.59  ? 16   TYR B CA  1 
ATOM   1594 C C   . TYR B 2 41  ? -2.626  73.408  43.694 1.00 34.26  ? 16   TYR B C   1 
ATOM   1595 O O   . TYR B 2 41  ? -3.792  72.999  43.539 1.00 28.68  ? 16   TYR B O   1 
ATOM   1596 C CB  . TYR B 2 41  ? -1.465  71.406  42.780 1.00 26.14  ? 16   TYR B CB  1 
ATOM   1597 C CG  . TYR B 2 41  ? -0.383  70.364  42.923 1.00 29.72  ? 16   TYR B CG  1 
ATOM   1598 C CD1 . TYR B 2 41  ? -0.592  69.208  43.686 1.00 31.95  ? 16   TYR B CD1 1 
ATOM   1599 C CD2 . TYR B 2 41  ? 0.859   70.541  42.309 1.00 24.57  ? 16   TYR B CD2 1 
ATOM   1600 C CE1 . TYR B 2 41  ? 0.418   68.253  43.836 1.00 33.89  ? 16   TYR B CE1 1 
ATOM   1601 C CE2 . TYR B 2 41  ? 1.873   69.598  42.448 1.00 27.61  ? 16   TYR B CE2 1 
ATOM   1602 C CZ  . TYR B 2 41  ? 1.655   68.458  43.211 1.00 36.41  ? 16   TYR B CZ  1 
ATOM   1603 O OH  . TYR B 2 41  ? 2.686   67.549  43.354 1.00 25.22  ? 16   TYR B OH  1 
ATOM   1604 N N   . TYR B 2 42  ? -2.269  74.694  43.648 1.00 36.83  ? 17   TYR B N   1 
ATOM   1605 C CA  . TYR B 2 42  ? -3.220  75.787  43.462 1.00 37.57  ? 17   TYR B CA  1 
ATOM   1606 C C   . TYR B 2 42  ? -3.302  76.344  42.034 1.00 41.24  ? 17   TYR B C   1 
ATOM   1607 O O   . TYR B 2 42  ? -2.359  76.970  41.519 1.00 38.13  ? 17   TYR B O   1 
ATOM   1608 C CB  . TYR B 2 42  ? -2.889  76.926  44.421 1.00 30.79  ? 17   TYR B CB  1 
ATOM   1609 C CG  . TYR B 2 42  ? -2.574  76.484  45.826 1.00 36.10  ? 17   TYR B CG  1 
ATOM   1610 C CD1 . TYR B 2 42  ? -3.584  76.364  46.786 1.00 39.48  ? 17   TYR B CD1 1 
ATOM   1611 C CD2 . TYR B 2 42  ? -1.258  76.250  46.219 1.00 36.96  ? 17   TYR B CD2 1 
ATOM   1612 C CE1 . TYR B 2 42  ? -3.286  76.032  48.109 1.00 43.69  ? 17   TYR B CE1 1 
ATOM   1613 C CE2 . TYR B 2 42  ? -0.946  75.919  47.536 1.00 44.95  ? 17   TYR B CE2 1 
ATOM   1614 C CZ  . TYR B 2 42  ? -1.962  75.816  48.478 1.00 44.54  ? 17   TYR B CZ  1 
ATOM   1615 O OH  . TYR B 2 42  ? -1.645  75.539  49.790 1.00 49.79  ? 17   TYR B OH  1 
ATOM   1616 N N   . THR B 2 43  ? -4.450  76.108  41.409 1.00 43.53  ? 18   THR B N   1 
ATOM   1617 C CA  . THR B 2 43  ? -4.714  76.581  40.060 1.00 43.69  ? 18   THR B CA  1 
ATOM   1618 C C   . THR B 2 43  ? -5.473  77.891  40.235 1.00 46.59  ? 18   THR B C   1 
ATOM   1619 O O   . THR B 2 43  ? -6.509  77.941  40.904 1.00 47.03  ? 18   THR B O   1 
ATOM   1620 C CB  . THR B 2 43  ? -5.557  75.561  39.273 1.00 47.80  ? 18   THR B CB  1 
ATOM   1621 O OG1 . THR B 2 43  ? -5.202  74.232  39.682 1.00 54.32  ? 18   THR B OG1 1 
ATOM   1622 C CG2 . THR B 2 43  ? -5.294  75.694  37.790 1.00 48.73  ? 18   THR B CG2 1 
ATOM   1623 N N   . ASN B 2 44  ? -4.946  78.946  39.620 1.00 51.91  ? 19   ASN B N   1 
ATOM   1624 C CA  . ASN B 2 44  ? -5.500  80.283  39.741 1.00 50.74  ? 19   ASN B CA  1 
ATOM   1625 C C   . ASN B 2 44  ? -5.825  80.491  41.188 1.00 49.43  ? 19   ASN B C   1 
ATOM   1626 O O   . ASN B 2 44  ? -6.984  80.387  41.596 1.00 46.73  ? 19   ASN B O   1 
ATOM   1627 C CB  . ASN B 2 44  ? -6.773  80.490  38.943 1.00 56.69  ? 19   ASN B CB  1 
ATOM   1628 C CG  . ASN B 2 44  ? -7.243  81.924  39.019 1.00 68.21  ? 19   ASN B CG  1 
ATOM   1629 O OD1 . ASN B 2 44  ? -6.607  82.813  38.454 1.00 70.74  ? 19   ASN B OD1 1 
ATOM   1630 N ND2 . ASN B 2 44  ? -8.337  82.166  39.732 1.00 77.71  ? 19   ASN B ND2 1 
ATOM   1631 N N   . GLY B 2 45  ? -4.793  80.775  41.968 1.00 51.78  ? 20   GLY B N   1 
ATOM   1632 C CA  . GLY B 2 45  ? -5.007  80.979  43.381 1.00 51.25  ? 20   GLY B CA  1 
ATOM   1633 C C   . GLY B 2 45  ? -5.814  79.813  43.905 1.00 49.24  ? 20   GLY B C   1 
ATOM   1634 O O   . GLY B 2 45  ? -5.653  78.679  43.447 1.00 49.10  ? 20   GLY B O   1 
ATOM   1635 N N   . THR B 2 46  ? -6.709  80.093  44.843 1.00 49.28  ? 21   THR B N   1 
ATOM   1636 C CA  . THR B 2 46  ? -7.516  79.045  45.437 1.00 47.16  ? 21   THR B CA  1 
ATOM   1637 C C   . THR B 2 46  ? -8.758  78.660  44.660 1.00 44.68  ? 21   THR B C   1 
ATOM   1638 O O   . THR B 2 46  ? -9.670  78.060  45.219 1.00 46.33  ? 21   THR B O   1 
ATOM   1639 C CB  . THR B 2 46  ? -7.935  79.404  46.875 1.00 49.36  ? 21   THR B CB  1 
ATOM   1640 O OG1 . THR B 2 46  ? -7.413  80.694  47.230 1.00 56.78  ? 21   THR B OG1 1 
ATOM   1641 C CG2 . THR B 2 46  ? -7.398  78.355  47.844 1.00 47.10  ? 21   THR B CG2 1 
ATOM   1642 N N   . GLN B 2 47  ? -8.813  78.985  43.376 1.00 42.32  ? 22   GLN B N   1 
ATOM   1643 C CA  . GLN B 2 47  ? -9.995  78.601  42.639 1.00 40.43  ? 22   GLN B CA  1 
ATOM   1644 C C   . GLN B 2 47  ? -10.034 77.087  42.626 1.00 41.16  ? 22   GLN B C   1 
ATOM   1645 O O   . GLN B 2 47  ? -11.003 76.497  43.083 1.00 49.22  ? 22   GLN B O   1 
ATOM   1646 C CB  . GLN B 2 47  ? -9.983  79.141  41.217 1.00 47.99  ? 22   GLN B CB  1 
ATOM   1647 C CG  . GLN B 2 47  ? -11.369 79.098  40.582 1.00 56.70  ? 22   GLN B CG  1 
ATOM   1648 C CD  . GLN B 2 47  ? -11.679 80.336  39.787 1.00 63.97  ? 22   GLN B CD  1 
ATOM   1649 O OE1 . GLN B 2 47  ? -10.823 81.190  39.614 1.00 71.02  ? 22   GLN B OE1 1 
ATOM   1650 N NE2 . GLN B 2 47  ? -12.907 80.442  39.297 1.00 65.00  ? 22   GLN B NE2 1 
ATOM   1651 N N   . ARG B 2 48  ? -8.991  76.444  42.116 1.00 39.27  ? 23   ARG B N   1 
ATOM   1652 C CA  . ARG B 2 48  ? -8.985  74.989  42.122 1.00 39.79  ? 23   ARG B CA  1 
ATOM   1653 C C   . ARG B 2 48  ? -7.832  74.498  42.966 1.00 38.84  ? 23   ARG B C   1 
ATOM   1654 O O   . ARG B 2 48  ? -6.671  74.689  42.614 1.00 42.47  ? 23   ARG B O   1 
ATOM   1655 C CB  . ARG B 2 48  ? -8.858  74.412  40.712 1.00 40.07  ? 23   ARG B CB  1 
ATOM   1656 C CG  . ARG B 2 48  ? -8.531  72.919  40.712 1.00 42.74  ? 23   ARG B CG  1 
ATOM   1657 C CD  . ARG B 2 48  ? -8.338  72.388  39.306 1.00 54.27  ? 23   ARG B CD  1 
ATOM   1658 N NE  . ARG B 2 48  ? -9.541  72.586  38.504 1.00 69.66  ? 23   ARG B NE  1 
ATOM   1659 C CZ  . ARG B 2 48  ? -9.675  72.212  37.236 1.00 66.09  ? 23   ARG B CZ  1 
ATOM   1660 N NH1 . ARG B 2 48  ? -8.675  71.612  36.608 1.00 64.85  ? 23   ARG B NH1 1 
ATOM   1661 N NH2 . ARG B 2 48  ? -10.821 72.425  36.601 1.00 69.37  ? 23   ARG B NH2 1 
ATOM   1662 N N   . ILE B 2 49  ? -8.160  73.865  44.080 1.00 36.25  ? 24   ILE B N   1 
ATOM   1663 C CA  . ILE B 2 49  ? -7.119  73.344  44.978 1.00 34.31  ? 24   ILE B CA  1 
ATOM   1664 C C   . ILE B 2 49  ? -7.055  71.817  44.865 1.00 35.61  ? 24   ILE B C   1 
ATOM   1665 O O   . ILE B 2 49  ? -8.086  71.148  44.871 1.00 41.07  ? 24   ILE B O   1 
ATOM   1666 C CB  . ILE B 2 49  ? -7.431  73.750  46.419 1.00 32.49  ? 24   ILE B CB  1 
ATOM   1667 C CG1 . ILE B 2 49  ? -7.495  75.264  46.615 1.00 20.00  ? 24   ILE B CG1 1 
ATOM   1668 C CG2 . ILE B 2 49  ? -6.387  73.245  47.418 1.00 26.44  ? 24   ILE B CG2 1 
ATOM   1669 C CD1 . ILE B 2 49  ? -7.798  75.666  48.059 1.00 20.00  ? 24   ILE B CD1 1 
ATOM   1670 N N   . ARG B 2 50  ? -5.837  71.292  44.774 1.00 32.57  ? 25   ARG B N   1 
ATOM   1671 C CA  . ARG B 2 50  ? -5.651  69.846  44.684 1.00 29.44  ? 25   ARG B CA  1 
ATOM   1672 C C   . ARG B 2 50  ? -4.639  69.329  45.709 1.00 23.79  ? 25   ARG B C   1 
ATOM   1673 O O   . ARG B 2 50  ? -3.532  69.836  45.817 1.00 25.91  ? 25   ARG B O   1 
ATOM   1674 C CB  . ARG B 2 50  ? -5.220  69.444  43.272 1.00 22.62  ? 25   ARG B CB  1 
ATOM   1675 C CG  . ARG B 2 50  ? -5.052  67.947  43.118 1.00 26.34  ? 25   ARG B CG  1 
ATOM   1676 C CD  . ARG B 2 50  ? -4.224  67.598  41.898 1.00 32.58  ? 25   ARG B CD  1 
ATOM   1677 N NE  . ARG B 2 50  ? -4.181  66.152  41.646 1.00 44.30  ? 25   ARG B NE  1 
ATOM   1678 C CZ  . ARG B 2 50  ? -4.106  65.600  40.433 1.00 43.95  ? 25   ARG B CZ  1 
ATOM   1679 N NH1 . ARG B 2 50  ? -4.066  66.366  39.353 1.00 40.05  ? 25   ARG B NH1 1 
ATOM   1680 N NH2 . ARG B 2 50  ? -4.062  64.281  40.295 1.00 43.35  ? 25   ARG B NH2 1 
ATOM   1681 N N   . LEU B 2 51  ? -5.030  68.289  46.436 1.00 27.74  ? 26   LEU B N   1 
ATOM   1682 C CA  . LEU B 2 51  ? -4.198  67.699  47.476 1.00 24.81  ? 26   LEU B CA  1 
ATOM   1683 C C   . LEU B 2 51  ? -3.608  66.344  47.109 1.00 26.22  ? 26   LEU B C   1 
ATOM   1684 O O   . LEU B 2 51  ? -4.343  65.400  46.811 1.00 35.22  ? 26   LEU B O   1 
ATOM   1685 C CB  . LEU B 2 51  ? -5.041  67.531  48.739 1.00 22.71  ? 26   LEU B CB  1 
ATOM   1686 C CG  . LEU B 2 51  ? -4.446  67.493  50.148 1.00 16.74  ? 26   LEU B CG  1 
ATOM   1687 C CD1 . LEU B 2 51  ? -5.222  66.464  50.921 1.00 16.34  ? 26   LEU B CD1 1 
ATOM   1688 C CD2 . LEU B 2 51  ? -2.977  67.150  50.164 1.00 7.86   ? 26   LEU B CD2 1 
ATOM   1689 N N   . VAL B 2 52  ? -2.285  66.231  47.147 1.00 22.40  ? 27   VAL B N   1 
ATOM   1690 C CA  . VAL B 2 52  ? -1.655  64.948  46.849 1.00 16.77  ? 27   VAL B CA  1 
ATOM   1691 C C   . VAL B 2 52  ? -0.646  64.595  47.913 1.00 16.47  ? 27   VAL B C   1 
ATOM   1692 O O   . VAL B 2 52  ? 0.311   65.337  48.150 1.00 18.73  ? 27   VAL B O   1 
ATOM   1693 C CB  . VAL B 2 52  ? -0.926  64.958  45.498 1.00 18.14  ? 27   VAL B CB  1 
ATOM   1694 C CG1 . VAL B 2 52  ? -0.333  63.613  45.232 1.00 9.99   ? 27   VAL B CG1 1 
ATOM   1695 C CG2 . VAL B 2 52  ? -1.888  65.324  44.393 1.00 32.81  ? 27   VAL B CG2 1 
ATOM   1696 N N   . THR B 2 53  ? -0.865  63.466  48.566 1.00 13.62  ? 28   THR B N   1 
ATOM   1697 C CA  . THR B 2 53  ? 0.061   63.013  49.595 1.00 14.90  ? 28   THR B CA  1 
ATOM   1698 C C   . THR B 2 53  ? 0.695   61.752  49.054 1.00 20.55  ? 28   THR B C   1 
ATOM   1699 O O   . THR B 2 53  ? 0.034   60.941  48.413 1.00 23.90  ? 28   THR B O   1 
ATOM   1700 C CB  . THR B 2 53  ? -0.645  62.694  50.940 1.00 13.15  ? 28   THR B CB  1 
ATOM   1701 O OG1 . THR B 2 53  ? -1.501  61.558  50.791 1.00 20.53  ? 28   THR B OG1 1 
ATOM   1702 C CG2 . THR B 2 53  ? -1.481  63.861  51.387 1.00 17.07  ? 28   THR B CG2 1 
ATOM   1703 N N   . ARG B 2 54  ? 1.980   61.583  49.307 1.00 22.96  ? 29   ARG B N   1 
ATOM   1704 C CA  . ARG B 2 54  ? 2.677   60.421  48.804 1.00 21.11  ? 29   ARG B CA  1 
ATOM   1705 C C   . ARG B 2 54  ? 3.551   59.829  49.880 1.00 25.64  ? 29   ARG B C   1 
ATOM   1706 O O   . ARG B 2 54  ? 4.219   60.557  50.614 1.00 28.87  ? 29   ARG B O   1 
ATOM   1707 C CB  . ARG B 2 54  ? 3.563   60.812  47.625 1.00 22.99  ? 29   ARG B CB  1 
ATOM   1708 C CG  . ARG B 2 54  ? 2.987   61.871  46.709 1.00 22.21  ? 29   ARG B CG  1 
ATOM   1709 C CD  . ARG B 2 54  ? 4.080   62.390  45.807 1.00 24.78  ? 29   ARG B CD  1 
ATOM   1710 N NE  . ARG B 2 54  ? 3.563   63.234  44.739 1.00 32.35  ? 29   ARG B NE  1 
ATOM   1711 C CZ  . ARG B 2 54  ? 3.113   62.775  43.580 1.00 31.75  ? 29   ARG B CZ  1 
ATOM   1712 N NH1 . ARG B 2 54  ? 3.116   61.474  43.339 1.00 33.83  ? 29   ARG B NH1 1 
ATOM   1713 N NH2 . ARG B 2 54  ? 2.658   63.619  42.664 1.00 36.41  ? 29   ARG B NH2 1 
ATOM   1714 N N   . TYR B 2 55  ? 3.562   58.506  49.965 1.00 25.75  ? 30   TYR B N   1 
ATOM   1715 C CA  . TYR B 2 55  ? 4.391   57.832  50.946 1.00 26.73  ? 30   TYR B CA  1 
ATOM   1716 C C   . TYR B 2 55  ? 5.502   57.134  50.188 1.00 26.29  ? 30   TYR B C   1 
ATOM   1717 O O   . TYR B 2 55  ? 5.257   56.291  49.331 1.00 28.39  ? 30   TYR B O   1 
ATOM   1718 C CB  . TYR B 2 55  ? 3.558   56.840  51.744 1.00 23.45  ? 30   TYR B CB  1 
ATOM   1719 C CG  . TYR B 2 55  ? 2.505   57.518  52.595 1.00 33.21  ? 30   TYR B CG  1 
ATOM   1720 C CD1 . TYR B 2 55  ? 1.314   57.996  52.023 1.00 31.34  ? 30   TYR B CD1 1 
ATOM   1721 C CD2 . TYR B 2 55  ? 2.693   57.685  53.969 1.00 28.52  ? 30   TYR B CD2 1 
ATOM   1722 C CE1 . TYR B 2 55  ? 0.339   58.618  52.799 1.00 31.97  ? 30   TYR B CE1 1 
ATOM   1723 C CE2 . TYR B 2 55  ? 1.725   58.304  54.755 1.00 33.09  ? 30   TYR B CE2 1 
ATOM   1724 C CZ  . TYR B 2 55  ? 0.552   58.767  54.168 1.00 36.60  ? 30   TYR B CZ  1 
ATOM   1725 O OH  . TYR B 2 55  ? -0.410  59.370  54.948 1.00 37.03  ? 30   TYR B OH  1 
ATOM   1726 N N   . ILE B 2 56  ? 6.733   57.500  50.504 1.00 26.94  ? 31   ILE B N   1 
ATOM   1727 C CA  . ILE B 2 56  ? 7.867   56.937  49.813 1.00 25.55  ? 31   ILE B CA  1 
ATOM   1728 C C   . ILE B 2 56  ? 8.758   56.102  50.681 1.00 30.88  ? 31   ILE B C   1 
ATOM   1729 O O   . ILE B 2 56  ? 9.037   56.451  51.826 1.00 31.97  ? 31   ILE B O   1 
ATOM   1730 C CB  . ILE B 2 56  ? 8.741   58.037  49.201 1.00 24.29  ? 31   ILE B CB  1 
ATOM   1731 C CG1 . ILE B 2 56  ? 7.925   58.850  48.199 1.00 21.91  ? 31   ILE B CG1 1 
ATOM   1732 C CG2 . ILE B 2 56  ? 9.915   57.423  48.491 1.00 16.02  ? 31   ILE B CG2 1 
ATOM   1733 C CD1 . ILE B 2 56  ? 7.374   60.109  48.755 1.00 27.61  ? 31   ILE B CD1 1 
ATOM   1734 N N   . TYR B 2 57  ? 9.205   54.993  50.106 1.00 36.06  ? 32   TYR B N   1 
ATOM   1735 C CA  . TYR B 2 57  ? 10.122  54.075  50.760 1.00 38.92  ? 32   TYR B CA  1 
ATOM   1736 C C   . TYR B 2 57  ? 11.359  54.131  49.878 1.00 40.71  ? 32   TYR B C   1 
ATOM   1737 O O   . TYR B 2 57  ? 11.392  53.535  48.800 1.00 42.87  ? 32   TYR B O   1 
ATOM   1738 C CB  . TYR B 2 57  ? 9.551   52.652  50.794 1.00 38.53  ? 32   TYR B CB  1 
ATOM   1739 C CG  . TYR B 2 57  ? 10.493  51.639  51.416 1.00 45.71  ? 32   TYR B CG  1 
ATOM   1740 C CD1 . TYR B 2 57  ? 11.181  51.928  52.594 1.00 37.70  ? 32   TYR B CD1 1 
ATOM   1741 C CD2 . TYR B 2 57  ? 10.744  50.414  50.794 1.00 50.28  ? 32   TYR B CD2 1 
ATOM   1742 C CE1 . TYR B 2 57  ? 12.098  51.028  53.134 1.00 40.81  ? 32   TYR B CE1 1 
ATOM   1743 C CE2 . TYR B 2 57  ? 11.661  49.508  51.330 1.00 47.52  ? 32   TYR B CE2 1 
ATOM   1744 C CZ  . TYR B 2 57  ? 12.334  49.824  52.494 1.00 40.80  ? 32   TYR B CZ  1 
ATOM   1745 O OH  . TYR B 2 57  ? 13.251  48.942  53.010 1.00 40.94  ? 32   TYR B OH  1 
ATOM   1746 N N   . ASN B 2 58  ? 12.363  54.877  50.328 1.00 44.76  ? 33   ASN B N   1 
ATOM   1747 C CA  . ASN B 2 58  ? 13.604  55.052  49.580 1.00 46.65  ? 33   ASN B CA  1 
ATOM   1748 C C   . ASN B 2 58  ? 13.344  55.999  48.405 1.00 45.50  ? 33   ASN B C   1 
ATOM   1749 O O   . ASN B 2 58  ? 13.487  57.213  48.540 1.00 53.59  ? 33   ASN B O   1 
ATOM   1750 C CB  . ASN B 2 58  ? 14.127  53.699  49.084 1.00 51.15  ? 33   ASN B CB  1 
ATOM   1751 C CG  . ASN B 2 58  ? 14.818  52.893  50.188 1.00 53.38  ? 33   ASN B CG  1 
ATOM   1752 O OD1 . ASN B 2 58  ? 15.513  53.446  51.048 1.00 58.32  ? 33   ASN B OD1 1 
ATOM   1753 N ND2 . ASN B 2 58  ? 14.630  51.580  50.161 1.00 49.49  ? 33   ASN B ND2 1 
ATOM   1754 N N   . ARG B 2 59  ? 12.962  55.457  47.254 1.00 42.90  ? 34   ARG B N   1 
ATOM   1755 C CA  . ARG B 2 59  ? 12.668  56.301  46.103 1.00 37.99  ? 34   ARG B CA  1 
ATOM   1756 C C   . ARG B 2 59  ? 11.428  55.782  45.420 1.00 36.43  ? 34   ARG B C   1 
ATOM   1757 O O   . ARG B 2 59  ? 11.065  56.252  44.342 1.00 41.84  ? 34   ARG B O   1 
ATOM   1758 C CB  . ARG B 2 59  ? 13.828  56.316  45.111 1.00 39.45  ? 34   ARG B CB  1 
ATOM   1759 C CG  . ARG B 2 59  ? 14.837  57.407  45.374 1.00 48.19  ? 34   ARG B CG  1 
ATOM   1760 C CD  . ARG B 2 59  ? 16.175  57.057  44.772 1.00 61.47  ? 34   ARG B CD  1 
ATOM   1761 N NE  . ARG B 2 59  ? 16.152  57.172  43.318 1.00 75.04  ? 34   ARG B NE  1 
ATOM   1762 C CZ  . ARG B 2 59  ? 15.906  58.303  42.667 1.00 83.03  ? 34   ARG B CZ  1 
ATOM   1763 N NH1 . ARG B 2 59  ? 15.664  59.422  43.347 1.00 88.26  ? 34   ARG B NH1 1 
ATOM   1764 N NH2 . ARG B 2 59  ? 15.899  58.317  41.338 1.00 82.84  ? 34   ARG B NH2 1 
ATOM   1765 N N   . GLU B 2 60  ? 10.782  54.805  46.049 1.00 30.05  ? 35   GLU B N   1 
ATOM   1766 C CA  . GLU B 2 60  ? 9.562   54.234  45.499 1.00 29.12  ? 35   GLU B CA  1 
ATOM   1767 C C   . GLU B 2 60  ? 8.320   54.733  46.223 1.00 35.64  ? 35   GLU B C   1 
ATOM   1768 O O   . GLU B 2 60  ? 8.157   54.512  47.428 1.00 46.85  ? 35   GLU B O   1 
ATOM   1769 C CB  . GLU B 2 60  ? 9.602   52.716  45.585 1.00 24.68  ? 35   GLU B CB  1 
ATOM   1770 C CG  . GLU B 2 60  ? 8.406   52.043  44.952 1.00 28.07  ? 35   GLU B CG  1 
ATOM   1771 C CD  . GLU B 2 60  ? 8.363   50.554  45.258 1.00 37.31  ? 35   GLU B CD  1 
ATOM   1772 O OE1 . GLU B 2 60  ? 9.448   49.943  45.386 1.00 33.81  ? 35   GLU B OE1 1 
ATOM   1773 O OE2 . GLU B 2 60  ? 7.247   49.995  45.374 1.00 35.10  ? 35   GLU B OE2 1 
ATOM   1774 N N   . GLU B 2 61  ? 7.449   55.428  45.499 1.00 36.18  ? 36   GLU B N   1 
ATOM   1775 C CA  . GLU B 2 61  ? 6.210   55.901  46.103 1.00 34.61  ? 36   GLU B CA  1 
ATOM   1776 C C   . GLU B 2 61  ? 5.399   54.610  46.167 1.00 36.53  ? 36   GLU B C   1 
ATOM   1777 O O   . GLU B 2 61  ? 5.361   53.893  45.168 1.00 35.43  ? 36   GLU B O   1 
ATOM   1778 C CB  . GLU B 2 61  ? 5.524   56.922  45.190 1.00 26.45  ? 36   GLU B CB  1 
ATOM   1779 C CG  . GLU B 2 61  ? 4.361   57.657  45.841 1.00 30.98  ? 36   GLU B CG  1 
ATOM   1780 C CD  . GLU B 2 61  ? 3.546   58.477  44.854 1.00 28.90  ? 36   GLU B CD  1 
ATOM   1781 O OE1 . GLU B 2 61  ? 4.078   58.811  43.775 1.00 39.39  ? 36   GLU B OE1 1 
ATOM   1782 O OE2 . GLU B 2 61  ? 2.373   58.793  45.158 1.00 31.28  ? 36   GLU B OE2 1 
ATOM   1783 N N   . TYR B 2 62  ? 4.801   54.285  47.319 1.00 30.73  ? 37   TYR B N   1 
ATOM   1784 C CA  . TYR B 2 62  ? 4.013   53.058  47.429 1.00 25.08  ? 37   TYR B CA  1 
ATOM   1785 C C   . TYR B 2 62  ? 2.506   53.282  47.561 1.00 24.36  ? 37   TYR B C   1 
ATOM   1786 O O   . TYR B 2 62  ? 1.704   52.443  47.147 1.00 23.55  ? 37   TYR B O   1 
ATOM   1787 C CB  . TYR B 2 62  ? 4.527   52.162  48.577 1.00 28.29  ? 37   TYR B CB  1 
ATOM   1788 C CG  . TYR B 2 62  ? 4.773   52.835  49.910 1.00 33.51  ? 37   TYR B CG  1 
ATOM   1789 C CD1 . TYR B 2 62  ? 5.866   53.676  50.091 1.00 35.95  ? 37   TYR B CD1 1 
ATOM   1790 C CD2 . TYR B 2 62  ? 3.953   52.571  51.012 1.00 27.39  ? 37   TYR B CD2 1 
ATOM   1791 C CE1 . TYR B 2 62  ? 6.139   54.235  51.335 1.00 41.22  ? 37   TYR B CE1 1 
ATOM   1792 C CE2 . TYR B 2 62  ? 4.218   53.126  52.259 1.00 29.95  ? 37   TYR B CE2 1 
ATOM   1793 C CZ  . TYR B 2 62  ? 5.314   53.956  52.414 1.00 38.87  ? 37   TYR B CZ  1 
ATOM   1794 O OH  . TYR B 2 62  ? 5.597   54.517  53.640 1.00 38.16  ? 37   TYR B OH  1 
ATOM   1795 N N   . VAL B 2 63  ? 2.125   54.412  48.140 1.00 19.81  ? 38   VAL B N   1 
ATOM   1796 C CA  . VAL B 2 63  ? 0.715   54.728  48.315 1.00 16.45  ? 38   VAL B CA  1 
ATOM   1797 C C   . VAL B 2 63  ? 0.557   56.208  48.084 1.00 18.74  ? 38   VAL B C   1 
ATOM   1798 O O   . VAL B 2 63  ? 1.487   56.997  48.303 1.00 14.50  ? 38   VAL B O   1 
ATOM   1799 C CB  . VAL B 2 63  ? 0.167   54.464  49.692 1.00 21.53  ? 38   VAL B CB  1 
ATOM   1800 C CG1 . VAL B 2 63  ? -1.107  53.643  49.577 1.00 19.49  ? 38   VAL B CG1 1 
ATOM   1801 C CG2 . VAL B 2 63  ? 1.223   53.777  50.520 1.00 27.88  ? 38   VAL B CG2 1 
ATOM   1802 N N   . ARG B 2 64  ? -0.654  56.591  47.706 1.00 25.10  ? 39   ARG B N   1 
ATOM   1803 C CA  . ARG B 2 64  ? -0.957  57.971  47.393 1.00 24.07  ? 39   ARG B CA  1 
ATOM   1804 C C   . ARG B 2 64  ? -2.410  58.311  47.671 1.00 25.45  ? 39   ARG B C   1 
ATOM   1805 O O   . ARG B 2 64  ? -3.305  57.469  47.545 1.00 26.34  ? 39   ARG B O   1 
ATOM   1806 C CB  . ARG B 2 64  ? -0.649  58.214  45.906 1.00 26.61  ? 39   ARG B CB  1 
ATOM   1807 C CG  . ARG B 2 64  ? -0.884  59.631  45.403 1.00 28.76  ? 39   ARG B CG  1 
ATOM   1808 C CD  . ARG B 2 64  ? -0.834  59.700  43.884 1.00 36.36  ? 39   ARG B CD  1 
ATOM   1809 N NE  . ARG B 2 64  ? 0.433   59.208  43.333 1.00 51.42  ? 39   ARG B NE  1 
ATOM   1810 C CZ  . ARG B 2 64  ? 0.691   59.062  42.030 1.00 50.37  ? 39   ARG B CZ  1 
ATOM   1811 N NH1 . ARG B 2 64  ? -0.230  59.368  41.119 1.00 45.31  ? 39   ARG B NH1 1 
ATOM   1812 N NH2 . ARG B 2 64  ? 1.873   58.601  41.630 1.00 41.06  ? 39   ARG B NH2 1 
ATOM   1813 N N   . TYR B 2 65  ? -2.634  59.556  48.068 1.00 23.71  ? 40   TYR B N   1 
ATOM   1814 C CA  . TYR B 2 65  ? -3.981  60.031  48.272 1.00 24.30  ? 40   TYR B CA  1 
ATOM   1815 C C   . TYR B 2 65  ? -4.078  61.240  47.364 1.00 27.26  ? 40   TYR B C   1 
ATOM   1816 O O   . TYR B 2 65  ? -3.221  62.129  47.422 1.00 26.29  ? 40   TYR B O   1 
ATOM   1817 C CB  . TYR B 2 65  ? -4.243  60.485  49.696 1.00 25.47  ? 40   TYR B CB  1 
ATOM   1818 C CG  . TYR B 2 65  ? -5.580  61.181  49.752 1.00 22.82  ? 40   TYR B CG  1 
ATOM   1819 C CD1 . TYR B 2 65  ? -6.749  60.442  49.881 1.00 20.95  ? 40   TYR B CD1 1 
ATOM   1820 C CD2 . TYR B 2 65  ? -5.690  62.565  49.546 1.00 23.34  ? 40   TYR B CD2 1 
ATOM   1821 C CE1 . TYR B 2 65  ? -7.998  61.040  49.799 1.00 17.79  ? 40   TYR B CE1 1 
ATOM   1822 C CE2 . TYR B 2 65  ? -6.944  63.179  49.461 1.00 21.29  ? 40   TYR B CE2 1 
ATOM   1823 C CZ  . TYR B 2 65  ? -8.096  62.402  49.584 1.00 18.93  ? 40   TYR B CZ  1 
ATOM   1824 O OH  . TYR B 2 65  ? -9.353  62.960  49.481 1.00 27.89  ? 40   TYR B OH  1 
ATOM   1825 N N   . ASP B 2 66  ? -5.121  61.276  46.539 1.00 25.85  ? 41   ASP B N   1 
ATOM   1826 C CA  . ASP B 2 66  ? -5.312  62.375  45.605 1.00 21.87  ? 41   ASP B CA  1 
ATOM   1827 C C   . ASP B 2 66  ? -6.701  62.951  45.702 1.00 24.80  ? 41   ASP B C   1 
ATOM   1828 O O   . ASP B 2 66  ? -7.677  62.211  45.707 1.00 25.51  ? 41   ASP B O   1 
ATOM   1829 C CB  . ASP B 2 66  ? -5.086  61.881  44.180 1.00 31.94  ? 41   ASP B CB  1 
ATOM   1830 C CG  . ASP B 2 66  ? -5.179  62.989  43.149 1.00 33.69  ? 41   ASP B CG  1 
ATOM   1831 O OD1 . ASP B 2 66  ? -5.516  64.138  43.504 1.00 33.70  ? 41   ASP B OD1 1 
ATOM   1832 O OD2 . ASP B 2 66  ? -4.906  62.699  41.969 1.00 39.61  ? 41   ASP B OD2 1 
ATOM   1833 N N   . SER B 2 67  ? -6.779  64.276  45.772 1.00 30.97  ? 42   SER B N   1 
ATOM   1834 C CA  . SER B 2 67  ? -8.048  64.993  45.846 1.00 31.62  ? 42   SER B CA  1 
ATOM   1835 C C   . SER B 2 67  ? -8.948  64.511  44.719 1.00 35.32  ? 42   SER B C   1 
ATOM   1836 O O   . SER B 2 67  ? -10.099 64.146  44.941 1.00 36.41  ? 42   SER B O   1 
ATOM   1837 C CB  . SER B 2 67  ? -7.816  66.497  45.683 1.00 26.68  ? 42   SER B CB  1 
ATOM   1838 O OG  . SER B 2 67  ? -7.608  67.110  46.937 1.00 27.34  ? 42   SER B OG  1 
ATOM   1839 N N   . ASP B 2 68  ? -8.407  64.514  43.507 1.00 34.44  ? 43   ASP B N   1 
ATOM   1840 C CA  . ASP B 2 68  ? -9.144  64.076  42.334 1.00 38.49  ? 43   ASP B CA  1 
ATOM   1841 C C   . ASP B 2 68  ? -9.699  62.666  42.485 1.00 43.59  ? 43   ASP B C   1 
ATOM   1842 O O   . ASP B 2 68  ? -10.732 62.333  41.942 1.00 53.41  ? 43   ASP B O   1 
ATOM   1843 C CB  . ASP B 2 68  ? -8.246  64.099  41.100 1.00 35.50  ? 43   ASP B CB  1 
ATOM   1844 C CG  . ASP B 2 68  ? -7.840  65.496  40.689 1.00 40.43  ? 43   ASP B CG  1 
ATOM   1845 O OD1 . ASP B 2 68  ? -8.504  66.487  41.083 1.00 34.28  ? 43   ASP B OD1 1 
ATOM   1846 O OD2 . ASP B 2 68  ? -6.835  65.591  39.954 1.00 50.68  ? 43   ASP B OD2 1 
ATOM   1847 N N   . VAL B 2 69  ? -9.014  61.802  43.202 1.00 47.39  ? 44   VAL B N   1 
ATOM   1848 C CA  . VAL B 2 69  ? -9.540  60.458  43.315 1.00 42.47  ? 44   VAL B CA  1 
ATOM   1849 C C   . VAL B 2 69  ? -10.385 60.311  44.568 1.00 37.66  ? 44   VAL B C   1 
ATOM   1850 O O   . VAL B 2 69  ? -11.271 59.470  44.627 1.00 44.35  ? 44   VAL B O   1 
ATOM   1851 C CB  . VAL B 2 69  ? -8.386  59.442  43.283 1.00 45.65  ? 44   VAL B CB  1 
ATOM   1852 C CG1 . VAL B 2 69  ? -8.895  58.045  43.567 1.00 46.37  ? 44   VAL B CG1 1 
ATOM   1853 C CG2 . VAL B 2 69  ? -7.715  59.495  41.915 1.00 46.01  ? 44   VAL B CG2 1 
ATOM   1854 N N   . GLY B 2 70  ? -10.114 61.142  45.566 1.00 36.60  ? 45   GLY B N   1 
ATOM   1855 C CA  . GLY B 2 70  ? -10.876 61.087  46.798 1.00 32.17  ? 45   GLY B CA  1 
ATOM   1856 C C   . GLY B 2 70  ? -10.431 60.053  47.817 1.00 33.19  ? 45   GLY B C   1 
ATOM   1857 O O   . GLY B 2 70  ? -10.835 60.130  48.980 1.00 34.53  ? 45   GLY B O   1 
ATOM   1858 N N   . GLU B 2 71  ? -9.619  59.081  47.410 1.00 23.99  ? 46   GLU B N   1 
ATOM   1859 C CA  . GLU B 2 71  ? -9.170  58.087  48.366 1.00 23.33  ? 46   GLU B CA  1 
ATOM   1860 C C   . GLU B 2 71  ? -7.759  57.598  48.130 1.00 30.74  ? 46   GLU B C   1 
ATOM   1861 O O   . GLU B 2 71  ? -7.119  57.933  47.130 1.00 38.91  ? 46   GLU B O   1 
ATOM   1862 C CB  . GLU B 2 71  ? -10.121 56.901  48.391 1.00 26.42  ? 46   GLU B CB  1 
ATOM   1863 C CG  . GLU B 2 71  ? -10.496 56.389  47.029 1.00 39.68  ? 46   GLU B CG  1 
ATOM   1864 C CD  . GLU B 2 71  ? -11.086 55.000  47.084 1.00 45.51  ? 46   GLU B CD  1 
ATOM   1865 O OE1 . GLU B 2 71  ? -11.819 54.695  48.061 1.00 38.27  ? 46   GLU B OE1 1 
ATOM   1866 O OE2 . GLU B 2 71  ? -10.808 54.219  46.146 1.00 48.54  ? 46   GLU B OE2 1 
ATOM   1867 N N   . TYR B 2 72  ? -7.271  56.811  49.083 1.00 31.69  ? 47   TYR B N   1 
ATOM   1868 C CA  . TYR B 2 72  ? -5.926  56.266  49.026 1.00 26.58  ? 47   TYR B CA  1 
ATOM   1869 C C   . TYR B 2 72  ? -5.891  55.194  47.957 1.00 26.77  ? 47   TYR B C   1 
ATOM   1870 O O   . TYR B 2 72  ? -6.845  54.434  47.803 1.00 27.72  ? 47   TYR B O   1 
ATOM   1871 C CB  . TYR B 2 72  ? -5.541  55.646  50.376 1.00 27.43  ? 47   TYR B CB  1 
ATOM   1872 C CG  . TYR B 2 72  ? -5.142  56.632  51.452 1.00 25.94  ? 47   TYR B CG  1 
ATOM   1873 C CD1 . TYR B 2 72  ? -6.101  57.236  52.273 1.00 22.97  ? 47   TYR B CD1 1 
ATOM   1874 C CD2 . TYR B 2 72  ? -3.806  56.967  51.648 1.00 27.54  ? 47   TYR B CD2 1 
ATOM   1875 C CE1 . TYR B 2 72  ? -5.734  58.152  53.257 1.00 25.98  ? 47   TYR B CE1 1 
ATOM   1876 C CE2 . TYR B 2 72  ? -3.431  57.880  52.627 1.00 30.65  ? 47   TYR B CE2 1 
ATOM   1877 C CZ  . TYR B 2 72  ? -4.397  58.471  53.425 1.00 27.75  ? 47   TYR B CZ  1 
ATOM   1878 O OH  . TYR B 2 72  ? -4.024  59.412  54.363 1.00 30.04  ? 47   TYR B OH  1 
ATOM   1879 N N   . ARG B 2 73  ? -4.795  55.144  47.211 1.00 24.06  ? 48   ARG B N   1 
ATOM   1880 C CA  . ARG B 2 73  ? -4.626  54.145  46.169 1.00 22.88  ? 48   ARG B CA  1 
ATOM   1881 C C   . ARG B 2 73  ? -3.175  53.710  46.209 1.00 27.53  ? 48   ARG B C   1 
ATOM   1882 O O   . ARG B 2 73  ? -2.270  54.524  46.367 1.00 29.59  ? 48   ARG B O   1 
ATOM   1883 C CB  . ARG B 2 73  ? -4.952  54.719  44.782 1.00 31.26  ? 48   ARG B CB  1 
ATOM   1884 C CG  . ARG B 2 73  ? -6.429  55.032  44.531 1.00 40.46  ? 48   ARG B CG  1 
ATOM   1885 C CD  . ARG B 2 73  ? -7.300  53.775  44.442 1.00 54.68  ? 48   ARG B CD  1 
ATOM   1886 N NE  . ARG B 2 73  ? -8.722  54.101  44.312 1.00 67.92  ? 48   ARG B NE  1 
ATOM   1887 C CZ  . ARG B 2 73  ? -9.250  54.754  43.277 1.00 76.02  ? 48   ARG B CZ  1 
ATOM   1888 N NH1 . ARG B 2 73  ? -8.473  55.154  42.275 1.00 71.55  ? 48   ARG B NH1 1 
ATOM   1889 N NH2 . ARG B 2 73  ? -10.554 55.018  43.247 1.00 74.46  ? 48   ARG B NH2 1 
ATOM   1890 N N   . ALA B 2 74  ? -2.955  52.414  46.086 1.00 30.56  ? 49   ALA B N   1 
ATOM   1891 C CA  . ALA B 2 74  ? -1.608  51.876  46.108 1.00 35.99  ? 49   ALA B CA  1 
ATOM   1892 C C   . ALA B 2 74  ? -0.935  52.142  44.774 1.00 39.20  ? 49   ALA B C   1 
ATOM   1893 O O   . ALA B 2 74  ? -1.496  51.854  43.718 1.00 45.16  ? 49   ALA B O   1 
ATOM   1894 C CB  . ALA B 2 74  ? -1.648  50.374  46.381 1.00 33.26  ? 49   ALA B CB  1 
ATOM   1895 N N   . VAL B 2 75  ? 0.269   52.691  44.812 1.00 33.58  ? 50   VAL B N   1 
ATOM   1896 C CA  . VAL B 2 75  ? 0.956   52.956  43.570 1.00 36.55  ? 50   VAL B CA  1 
ATOM   1897 C C   . VAL B 2 75  ? 1.748   51.715  43.178 1.00 37.82  ? 50   VAL B C   1 
ATOM   1898 O O   . VAL B 2 75  ? 1.899   51.429  41.986 1.00 45.53  ? 50   VAL B O   1 
ATOM   1899 C CB  . VAL B 2 75  ? 1.854   54.197  43.687 1.00 35.40  ? 50   VAL B CB  1 
ATOM   1900 C CG1 . VAL B 2 75  ? 1.046   55.369  44.218 1.00 34.32  ? 50   VAL B CG1 1 
ATOM   1901 C CG2 . VAL B 2 75  ? 2.976   53.914  44.590 1.00 40.91  ? 50   VAL B CG2 1 
ATOM   1902 N N   . THR B 2 76  ? 2.222   50.972  44.180 1.00 29.67  ? 51   THR B N   1 
ATOM   1903 C CA  . THR B 2 76  ? 2.960   49.724  43.960 1.00 25.37  ? 51   THR B CA  1 
ATOM   1904 C C   . THR B 2 76  ? 2.481   48.653  44.941 1.00 29.09  ? 51   THR B C   1 
ATOM   1905 O O   . THR B 2 76  ? 1.622   48.926  45.770 1.00 42.17  ? 51   THR B O   1 
ATOM   1906 C CB  . THR B 2 76  ? 4.461   49.920  44.138 1.00 19.00  ? 51   THR B CB  1 
ATOM   1907 O OG1 . THR B 2 76  ? 4.805   49.805  45.519 1.00 26.13  ? 51   THR B OG1 1 
ATOM   1908 C CG2 . THR B 2 76  ? 4.868   51.280  43.636 1.00 28.51  ? 51   THR B CG2 1 
ATOM   1909 N N   . GLU B 2 77  ? 3.007   47.434  44.850 1.00 38.15  ? 52   GLU B N   1 
ATOM   1910 C CA  . GLU B 2 77  ? 2.586   46.372  45.778 1.00 44.33  ? 52   GLU B CA  1 
ATOM   1911 C C   . GLU B 2 77  ? 2.792   46.786  47.238 1.00 40.64  ? 52   GLU B C   1 
ATOM   1912 O O   . GLU B 2 77  ? 1.944   46.539  48.097 1.00 31.80  ? 52   GLU B O   1 
ATOM   1913 C CB  . GLU B 2 77  ? 3.378   45.083  45.560 1.00 52.49  ? 52   GLU B CB  1 
ATOM   1914 C CG  . GLU B 2 77  ? 3.560   44.642  44.135 1.00 67.36  ? 52   GLU B CG  1 
ATOM   1915 C CD  . GLU B 2 77  ? 4.840   43.844  43.965 1.00 74.56  ? 52   GLU B CD  1 
ATOM   1916 O OE1 . GLU B 2 77  ? 5.927   44.457  44.014 1.00 75.54  ? 52   GLU B OE1 1 
ATOM   1917 O OE2 . GLU B 2 77  ? 4.755   42.610  43.796 1.00 74.31  ? 52   GLU B OE2 1 
ATOM   1918 N N   . LEU B 2 78  ? 3.943   47.385  47.517 1.00 36.68  ? 53   LEU B N   1 
ATOM   1919 C CA  . LEU B 2 78  ? 4.251   47.822  48.864 1.00 35.64  ? 53   LEU B CA  1 
ATOM   1920 C C   . LEU B 2 78  ? 3.141   48.695  49.463 1.00 37.85  ? 53   LEU B C   1 
ATOM   1921 O O   . LEU B 2 78  ? 3.060   48.856  50.680 1.00 45.16  ? 53   LEU B O   1 
ATOM   1922 C CB  . LEU B 2 78  ? 5.579   48.580  48.865 1.00 36.42  ? 53   LEU B CB  1 
ATOM   1923 C CG  . LEU B 2 78  ? 6.822   47.686  48.815 1.00 38.40  ? 53   LEU B CG  1 
ATOM   1924 C CD1 . LEU B 2 78  ? 8.027   48.525  48.449 1.00 41.58  ? 53   LEU B CD1 1 
ATOM   1925 C CD2 . LEU B 2 78  ? 7.038   47.007  50.164 1.00 44.40  ? 53   LEU B CD2 1 
ATOM   1926 N N   . GLY B 2 79  ? 2.270   49.237  48.619 1.00 31.46  ? 54   GLY B N   1 
ATOM   1927 C CA  . GLY B 2 79  ? 1.219   50.100  49.122 1.00 28.35  ? 54   GLY B CA  1 
ATOM   1928 C C   . GLY B 2 79  ? -0.147  49.474  49.276 1.00 32.53  ? 54   GLY B C   1 
ATOM   1929 O O   . GLY B 2 79  ? -1.007  50.033  49.950 1.00 37.43  ? 54   GLY B O   1 
ATOM   1930 N N   . ARG B 2 80  ? -0.358  48.313  48.670 1.00 38.06  ? 55   ARG B N   1 
ATOM   1931 C CA  . ARG B 2 80  ? -1.656  47.638  48.744 1.00 39.00  ? 55   ARG B CA  1 
ATOM   1932 C C   . ARG B 2 80  ? -2.289  47.566  50.130 1.00 34.66  ? 55   ARG B C   1 
ATOM   1933 O O   . ARG B 2 80  ? -3.500  47.723  50.267 1.00 30.74  ? 55   ARG B O   1 
ATOM   1934 C CB  . ARG B 2 80  ? -1.550  46.217  48.192 1.00 46.35  ? 55   ARG B CB  1 
ATOM   1935 C CG  . ARG B 2 80  ? -0.806  46.114  46.874 1.00 57.86  ? 55   ARG B CG  1 
ATOM   1936 C CD  . ARG B 2 80  ? -1.064  44.778  46.183 1.00 61.39  ? 55   ARG B CD  1 
ATOM   1937 N NE  . ARG B 2 80  ? -1.504  44.949  44.797 1.00 57.96  ? 55   ARG B NE  1 
ATOM   1938 C CZ  . ARG B 2 80  ? -2.744  45.272  44.432 1.00 59.00  ? 55   ARG B CZ  1 
ATOM   1939 N NH1 . ARG B 2 80  ? -3.687  45.463  45.342 1.00 63.52  ? 55   ARG B NH1 1 
ATOM   1940 N NH2 . ARG B 2 80  ? -3.051  45.410  43.151 1.00 65.38  ? 55   ARG B NH2 1 
ATOM   1941 N N   . PRO B 2 81  ? -1.483  47.293  51.169 1.00 35.99  ? 56   PRO B N   1 
ATOM   1942 C CA  . PRO B 2 81  ? -1.997  47.198  52.540 1.00 36.76  ? 56   PRO B CA  1 
ATOM   1943 C C   . PRO B 2 81  ? -2.429  48.523  53.161 1.00 37.13  ? 56   PRO B C   1 
ATOM   1944 O O   . PRO B 2 81  ? -3.515  48.620  53.729 1.00 47.32  ? 56   PRO B O   1 
ATOM   1945 C CB  . PRO B 2 81  ? -0.844  46.555  53.323 1.00 35.40  ? 56   PRO B CB  1 
ATOM   1946 C CG  . PRO B 2 81  ? 0.192   46.161  52.299 1.00 29.97  ? 56   PRO B CG  1 
ATOM   1947 C CD  . PRO B 2 81  ? -0.034  47.033  51.114 1.00 38.52  ? 56   PRO B CD  1 
ATOM   1948 N N   . ASP B 2 82  ? -1.579  49.540  53.064 1.00 32.95  ? 57   ASP B N   1 
ATOM   1949 C CA  . ASP B 2 82  ? -1.893  50.841  53.636 1.00 27.21  ? 57   ASP B CA  1 
ATOM   1950 C C   . ASP B 2 82  ? -3.156  51.429  53.040 1.00 27.14  ? 57   ASP B C   1 
ATOM   1951 O O   . ASP B 2 82  ? -3.907  52.109  53.726 1.00 34.57  ? 57   ASP B O   1 
ATOM   1952 C CB  . ASP B 2 82  ? -0.739  51.815  53.419 1.00 27.00  ? 57   ASP B CB  1 
ATOM   1953 C CG  . ASP B 2 82  ? 0.573   51.280  53.930 1.00 23.37  ? 57   ASP B CG  1 
ATOM   1954 O OD1 . ASP B 2 82  ? 0.547   50.397  54.805 1.00 29.89  ? 57   ASP B OD1 1 
ATOM   1955 O OD2 . ASP B 2 82  ? 1.632   51.742  53.466 1.00 30.32  ? 57   ASP B OD2 1 
ATOM   1956 N N   . ALA B 2 83  ? -3.397  51.182  51.761 1.00 30.07  ? 58   ALA B N   1 
ATOM   1957 C CA  . ALA B 2 83  ? -4.592  51.723  51.122 1.00 31.99  ? 58   ALA B CA  1 
ATOM   1958 C C   . ALA B 2 83  ? -5.860  51.063  51.662 1.00 28.85  ? 58   ALA B C   1 
ATOM   1959 O O   . ALA B 2 83  ? -6.808  51.745  52.075 1.00 26.94  ? 58   ALA B O   1 
ATOM   1960 C CB  . ALA B 2 83  ? -4.510  51.534  49.606 1.00 35.28  ? 58   ALA B CB  1 
ATOM   1961 N N   . GLU B 2 84  ? -5.863  49.747  51.653 1.00 33.69  ? 59   GLU B N   1 
ATOM   1962 C CA  . GLU B 2 84  ? -7.019  48.982  52.132 1.00 38.67  ? 59   GLU B CA  1 
ATOM   1963 C C   . GLU B 2 84  ? -7.288  49.290  53.611 1.00 39.42  ? 59   GLU B C   1 
ATOM   1964 O O   . GLU B 2 84  ? -8.422  49.293  54.079 1.00 43.75  ? 59   GLU B O   1 
ATOM   1965 C CB  . GLU B 2 84  ? -6.789  47.480  51.973 1.00 58.00  ? 59   GLU B CB  1 
ATOM   1966 C CG  . GLU B 2 84  ? -8.020  46.653  52.362 1.00 76.15  ? 59   GLU B CG  1 
ATOM   1967 C CD  . GLU B 2 84  ? -7.838  45.156  52.117 1.00 20.00  ? 59   GLU B CD  1 
ATOM   1968 O OE1 . GLU B 2 84  ? -6.764  44.723  51.549 1.00 20.00  ? 59   GLU B OE1 1 
ATOM   1969 O OE2 . GLU B 2 84  ? -8.757  44.326  52.478 1.00 20.00  ? 59   GLU B OE2 1 
ATOM   1970 N N   . TYR B 2 85  ? -6.247  49.561  54.359 1.00 32.97  ? 60   TYR B N   1 
ATOM   1971 C CA  . TYR B 2 85  ? -6.398  49.856  55.799 1.00 30.46  ? 60   TYR B CA  1 
ATOM   1972 C C   . TYR B 2 85  ? -6.904  51.281  56.035 1.00 31.08  ? 60   TYR B C   1 
ATOM   1973 O O   . TYR B 2 85  ? -7.987  51.479  56.585 1.00 34.36  ? 60   TYR B O   1 
ATOM   1974 C CB  . TYR B 2 85  ? -5.029  49.668  56.462 1.00 34.65  ? 60   TYR B CB  1 
ATOM   1975 C CG  . TYR B 2 85  ? -4.998  50.018  57.944 1.00 41.71  ? 60   TYR B CG  1 
ATOM   1976 C CD1 . TYR B 2 85  ? -6.026  49.590  58.789 1.00 47.22  ? 60   TYR B CD1 1 
ATOM   1977 C CD2 . TYR B 2 85  ? -3.928  50.759  58.454 1.00 41.44  ? 60   TYR B CD2 1 
ATOM   1978 C CE1 . TYR B 2 85  ? -5.993  49.920  60.147 1.00 41.80  ? 60   TYR B CE1 1 
ATOM   1979 C CE2 . TYR B 2 85  ? -3.897  51.094  59.811 1.00 45.69  ? 60   TYR B CE2 1 
ATOM   1980 C CZ  . TYR B 2 85  ? -4.931  50.676  60.657 1.00 46.67  ? 60   TYR B CZ  1 
ATOM   1981 O OH  . TYR B 2 85  ? -4.908  51.011  61.973 1.00 53.50  ? 60   TYR B OH  1 
ATOM   1982 N N   . TRP B 2 86  ? -6.122  52.270  55.615 1.00 29.58  ? 61   TRP B N   1 
ATOM   1983 C CA  . TRP B 2 86  ? -6.482  53.671  55.790 1.00 29.15  ? 61   TRP B CA  1 
ATOM   1984 C C   . TRP B 2 86  ? -7.849  54.047  55.244 1.00 34.87  ? 61   TRP B C   1 
ATOM   1985 O O   . TRP B 2 86  ? -8.553  54.865  55.844 1.00 38.60  ? 61   TRP B O   1 
ATOM   1986 C CB  . TRP B 2 86  ? -5.419  54.561  55.149 1.00 28.40  ? 61   TRP B CB  1 
ATOM   1987 C CG  . TRP B 2 86  ? -4.103  54.464  55.837 1.00 26.85  ? 61   TRP B CG  1 
ATOM   1988 C CD1 . TRP B 2 86  ? -3.883  54.050  57.116 1.00 27.66  ? 61   TRP B CD1 1 
ATOM   1989 C CD2 . TRP B 2 86  ? -2.820  54.790  55.294 1.00 23.58  ? 61   TRP B CD2 1 
ATOM   1990 N NE1 . TRP B 2 86  ? -2.542  54.097  57.406 1.00 25.03  ? 61   TRP B NE1 1 
ATOM   1991 C CE2 . TRP B 2 86  ? -1.867  54.549  56.305 1.00 19.22  ? 61   TRP B CE2 1 
ATOM   1992 C CE3 . TRP B 2 86  ? -2.380  55.264  54.052 1.00 29.43  ? 61   TRP B CE3 1 
ATOM   1993 C CZ2 . TRP B 2 86  ? -0.500  54.765  56.111 1.00 24.91  ? 61   TRP B CZ2 1 
ATOM   1994 C CZ3 . TRP B 2 86  ? -1.019  55.478  53.860 1.00 33.23  ? 61   TRP B CZ3 1 
ATOM   1995 C CH2 . TRP B 2 86  ? -0.096  55.229  54.886 1.00 25.21  ? 61   TRP B CH2 1 
ATOM   1996 N N   . ASN B 2 87  ? -8.221  53.468  54.103 1.00 37.13  ? 62   ASN B N   1 
ATOM   1997 C CA  . ASN B 2 87  ? -9.520  53.759  53.490 1.00 41.45  ? 62   ASN B CA  1 
ATOM   1998 C C   . ASN B 2 87  ? -10.657 53.228  54.367 1.00 41.50  ? 62   ASN B C   1 
ATOM   1999 O O   . ASN B 2 87  ? -11.766 53.762  54.353 1.00 42.11  ? 62   ASN B O   1 
ATOM   2000 C CB  . ASN B 2 87  ? -9.609  53.139  52.087 1.00 41.16  ? 62   ASN B CB  1 
ATOM   2001 C CG  . ASN B 2 87  ? -8.907  53.988  51.016 1.00 45.38  ? 62   ASN B CG  1 
ATOM   2002 O OD1 . ASN B 2 87  ? -8.595  55.166  51.230 1.00 41.73  ? 62   ASN B OD1 1 
ATOM   2003 N ND2 . ASN B 2 87  ? -8.659  53.384  49.856 1.00 37.04  ? 62   ASN B ND2 1 
ATOM   2004 N N   . SER B 2 88  ? -10.366 52.191  55.146 1.00 38.37  ? 63   SER B N   1 
ATOM   2005 C CA  . SER B 2 88  ? -11.358 51.589  56.028 1.00 34.64  ? 63   SER B CA  1 
ATOM   2006 C C   . SER B 2 88  ? -11.397 52.214  57.425 1.00 38.23  ? 63   SER B C   1 
ATOM   2007 O O   . SER B 2 88  ? -12.302 51.931  58.205 1.00 38.27  ? 63   SER B O   1 
ATOM   2008 C CB  . SER B 2 88  ? -11.081 50.104  56.151 1.00 36.16  ? 63   SER B CB  1 
ATOM   2009 O OG  . SER B 2 88  ? -9.725  49.888  56.497 1.00 36.47  ? 63   SER B OG  1 
ATOM   2010 N N   . GLN B 2 89  ? -10.401 53.038  57.743 1.00 36.35  ? 64   GLN B N   1 
ATOM   2011 C CA  . GLN B 2 89  ? -10.325 53.729  59.031 1.00 27.92  ? 64   GLN B CA  1 
ATOM   2012 C C   . GLN B 2 89  ? -10.937 55.106  58.795 1.00 23.81  ? 64   GLN B C   1 
ATOM   2013 O O   . GLN B 2 89  ? -10.240 56.056  58.426 1.00 23.66  ? 64   GLN B O   1 
ATOM   2014 C CB  . GLN B 2 89  ? -8.869  53.875  59.463 1.00 32.62  ? 64   GLN B CB  1 
ATOM   2015 C CG  . GLN B 2 89  ? -8.167  52.545  59.682 1.00 40.00  ? 64   GLN B CG  1 
ATOM   2016 C CD  . GLN B 2 89  ? -8.803  51.730  60.788 1.00 45.95  ? 64   GLN B CD  1 
ATOM   2017 O OE1 . GLN B 2 89  ? -9.148  52.260  61.845 1.00 53.74  ? 64   GLN B OE1 1 
ATOM   2018 N NE2 . GLN B 2 89  ? -8.963  50.435  60.553 1.00 47.84  ? 64   GLN B NE2 1 
ATOM   2019 N N   . PRO B 2 90  ? -12.246 55.239  59.047 1.00 19.65  ? 65   PRO B N   1 
ATOM   2020 C CA  . PRO B 2 90  ? -13.053 56.462  58.875 1.00 21.03  ? 65   PRO B CA  1 
ATOM   2021 C C   . PRO B 2 90  ? -12.381 57.729  59.356 1.00 28.88  ? 65   PRO B C   1 
ATOM   2022 O O   . PRO B 2 90  ? -12.452 58.776  58.717 1.00 26.94  ? 65   PRO B O   1 
ATOM   2023 C CB  . PRO B 2 90  ? -14.327 56.178  59.658 1.00 17.68  ? 65   PRO B CB  1 
ATOM   2024 C CG  . PRO B 2 90  ? -14.390 54.693  59.753 1.00 26.32  ? 65   PRO B CG  1 
ATOM   2025 C CD  . PRO B 2 90  ? -13.013 54.147  59.661 1.00 13.48  ? 65   PRO B CD  1 
ATOM   2026 N N   . GLU B 2 91  ? -11.741 57.612  60.509 1.00 34.99  ? 66   GLU B N   1 
ATOM   2027 C CA  . GLU B 2 91  ? -11.034 58.714  61.114 1.00 36.15  ? 66   GLU B CA  1 
ATOM   2028 C C   . GLU B 2 91  ? -9.936  59.175  60.164 1.00 32.47  ? 66   GLU B C   1 
ATOM   2029 O O   . GLU B 2 91  ? -9.842  60.357  59.858 1.00 35.68  ? 66   GLU B O   1 
ATOM   2030 C CB  . GLU B 2 91  ? -10.451 58.275  62.478 1.00 27.02  ? 66   GLU B CB  1 
ATOM   2031 C CG  . GLU B 2 91  ? -9.513  57.067  62.434 1.00 29.71  ? 66   GLU B CG  1 
ATOM   2032 C CD  . GLU B 2 91  ? -10.234 55.736  62.571 1.00 40.44  ? 66   GLU B CD  1 
ATOM   2033 O OE1 . GLU B 2 91  ? -11.477 55.733  62.692 1.00 50.17  ? 66   GLU B OE1 1 
ATOM   2034 O OE2 . GLU B 2 91  ? -9.552  54.691  62.557 1.00 51.27  ? 66   GLU B OE2 1 
ATOM   2035 N N   . ILE B 2 92  ? -9.134  58.229  59.682 1.00 30.28  ? 67   ILE B N   1 
ATOM   2036 C CA  . ILE B 2 92  ? -8.023  58.523  58.778 1.00 29.16  ? 67   ILE B CA  1 
ATOM   2037 C C   . ILE B 2 92  ? -8.474  59.037  57.423 1.00 32.80  ? 67   ILE B C   1 
ATOM   2038 O O   . ILE B 2 92  ? -8.120  60.143  57.012 1.00 33.02  ? 67   ILE B O   1 
ATOM   2039 C CB  . ILE B 2 92  ? -7.167  57.276  58.521 1.00 26.35  ? 67   ILE B CB  1 
ATOM   2040 C CG1 . ILE B 2 92  ? -6.823  56.608  59.844 1.00 24.06  ? 67   ILE B CG1 1 
ATOM   2041 C CG2 . ILE B 2 92  ? -5.893  57.660  57.759 1.00 25.20  ? 67   ILE B CG2 1 
ATOM   2042 C CD1 . ILE B 2 92  ? -5.664  55.639  59.744 1.00 19.82  ? 67   ILE B CD1 1 
ATOM   2043 N N   . LEU B 2 93  ? -9.249  58.219  56.723 1.00 33.99  ? 68   LEU B N   1 
ATOM   2044 C CA  . LEU B 2 93  ? -9.725  58.595  55.410 1.00 34.84  ? 68   LEU B CA  1 
ATOM   2045 C C   . LEU B 2 93  ? -10.462 59.926  55.401 1.00 36.13  ? 68   LEU B C   1 
ATOM   2046 O O   . LEU B 2 93  ? -10.348 60.692  54.442 1.00 41.60  ? 68   LEU B O   1 
ATOM   2047 C CB  . LEU B 2 93  ? -10.632 57.507  54.837 1.00 33.23  ? 68   LEU B CB  1 
ATOM   2048 C CG  . LEU B 2 93  ? -11.292 57.888  53.506 1.00 36.77  ? 68   LEU B CG  1 
ATOM   2049 C CD1 . LEU B 2 93  ? -10.244 58.409  52.535 1.00 26.52  ? 68   LEU B CD1 1 
ATOM   2050 C CD2 . LEU B 2 93  ? -11.991 56.683  52.918 1.00 40.37  ? 68   LEU B CD2 1 
ATOM   2051 N N   . ASP B 2 94  ? -11.200 60.235  56.463 1.00 39.96  ? 69   ASP B N   1 
ATOM   2052 C CA  . ASP B 2 94  ? -11.989 61.475  56.492 1.00 42.60  ? 69   ASP B CA  1 
ATOM   2053 C C   . ASP B 2 94  ? -11.114 62.642  56.960 1.00 38.39  ? 69   ASP B C   1 
ATOM   2054 O O   . ASP B 2 94  ? -11.462 63.816  56.685 1.00 35.67  ? 69   ASP B O   1 
ATOM   2055 C CB  . ASP B 2 94  ? -13.174 61.319  57.446 1.00 40.96  ? 69   ASP B CB  1 
ATOM   2056 C CG  . ASP B 2 94  ? -14.114 60.181  57.050 1.00 54.89  ? 69   ASP B CG  1 
ATOM   2057 O OD1 . ASP B 2 94  ? -13.861 59.472  56.003 1.00 20.00  ? 69   ASP B OD1 1 
ATOM   2058 O OD2 . ASP B 2 94  ? -15.159 59.932  57.762 1.00 20.00  ? 69   ASP B OD2 1 
ATOM   2059 N N   . ARG B 2 95  ? -10.032 62.403  57.662 1.00 34.14  ? 70   ARG B N   1 
ATOM   2060 C CA  . ARG B 2 95  ? -9.173  63.483  58.109 1.00 35.01  ? 70   ARG B CA  1 
ATOM   2061 C C   . ARG B 2 95  ? -8.348  63.950  56.915 1.00 41.11  ? 70   ARG B C   1 
ATOM   2062 O O   . ARG B 2 95  ? -8.110  65.145  56.732 1.00 44.60  ? 70   ARG B O   1 
ATOM   2063 C CB  . ARG B 2 95  ? -8.238  63.002  59.211 1.00 28.70  ? 70   ARG B CB  1 
ATOM   2064 C CG  . ARG B 2 95  ? -7.077  63.942  59.477 1.00 29.85  ? 70   ARG B CG  1 
ATOM   2065 C CD  . ARG B 2 95  ? -6.638  63.814  60.909 1.00 44.70  ? 70   ARG B CD  1 
ATOM   2066 N NE  . ARG B 2 95  ? -5.476  64.637  61.214 1.00 52.92  ? 70   ARG B NE  1 
ATOM   2067 C CZ  . ARG B 2 95  ? -4.778  64.540  62.342 1.00 54.94  ? 70   ARG B CZ  1 
ATOM   2068 N NH1 . ARG B 2 95  ? -5.131  63.654  63.268 1.00 56.86  ? 70   ARG B NH1 1 
ATOM   2069 N NH2 . ARG B 2 95  ? -3.725  65.322  62.542 1.00 54.54  ? 70   ARG B NH2 1 
ATOM   2070 N N   . THR B 2 96  ? -7.905  62.989  56.108 1.00 41.87  ? 71   THR B N   1 
ATOM   2071 C CA  . THR B 2 96  ? -7.109  63.276  54.925 1.00 32.42  ? 71   THR B CA  1 
ATOM   2072 C C   . THR B 2 96  ? -7.953  64.037  53.894 1.00 34.47  ? 71   THR B C   1 
ATOM   2073 O O   . THR B 2 96  ? -7.506  65.023  53.304 1.00 32.60  ? 71   THR B O   1 
ATOM   2074 C CB  . THR B 2 96  ? -6.595  61.967  54.291 1.00 32.07  ? 71   THR B CB  1 
ATOM   2075 O OG1 . THR B 2 96  ? -5.876  61.205  55.273 1.00 30.65  ? 71   THR B OG1 1 
ATOM   2076 C CG2 . THR B 2 96  ? -5.691  62.266  53.105 1.00 26.05  ? 71   THR B CG2 1 
ATOM   2077 N N   . ARG B 2 97  ? -9.185  63.589  53.683 1.00 27.95  ? 72   ARG B N   1 
ATOM   2078 C CA  . ARG B 2 97  ? -10.047 64.240  52.710 1.00 24.13  ? 72   ARG B CA  1 
ATOM   2079 C C   . ARG B 2 97  ? -10.166 65.728  52.949 1.00 28.38  ? 72   ARG B C   1 
ATOM   2080 O O   . ARG B 2 97  ? -9.991  66.529  52.038 1.00 27.31  ? 72   ARG B O   1 
ATOM   2081 C CB  . ARG B 2 97  ? -11.433 63.632  52.752 1.00 28.63  ? 72   ARG B CB  1 
ATOM   2082 C CG  . ARG B 2 97  ? -11.474 62.222  52.279 1.00 26.84  ? 72   ARG B CG  1 
ATOM   2083 C CD  . ARG B 2 97  ? -12.878 61.845  51.955 1.00 26.12  ? 72   ARG B CD  1 
ATOM   2084 N NE  . ARG B 2 97  ? -12.886 60.623  51.176 1.00 35.08  ? 72   ARG B NE  1 
ATOM   2085 C CZ  . ARG B 2 97  ? -13.939 59.828  51.065 1.00 47.14  ? 72   ARG B CZ  1 
ATOM   2086 N NH1 . ARG B 2 97  ? -15.067 60.142  51.697 1.00 55.86  ? 72   ARG B NH1 1 
ATOM   2087 N NH2 . ARG B 2 97  ? -13.871 58.741  50.304 1.00 49.08  ? 72   ARG B NH2 1 
ATOM   2088 N N   . ALA B 2 98  ? -10.468 66.091  54.188 1.00 31.99  ? 73   ALA B N   1 
ATOM   2089 C CA  . ALA B 2 98  ? -10.637 67.488  54.559 1.00 30.92  ? 73   ALA B CA  1 
ATOM   2090 C C   . ALA B 2 98  ? -9.317  68.226  54.696 1.00 29.20  ? 73   ALA B C   1 
ATOM   2091 O O   . ALA B 2 98  ? -9.281  69.437  54.886 1.00 34.81  ? 73   ALA B O   1 
ATOM   2092 C CB  . ALA B 2 98  ? -11.418 67.575  55.847 1.00 34.09  ? 73   ALA B CB  1 
ATOM   2093 N N   . GLU B 2 99  ? -8.227  67.491  54.589 1.00 29.29  ? 74   GLU B N   1 
ATOM   2094 C CA  . GLU B 2 99  ? -6.916  68.092  54.705 1.00 25.87  ? 74   GLU B CA  1 
ATOM   2095 C C   . GLU B 2 99  ? -6.673  69.129  53.615 1.00 29.45  ? 74   GLU B C   1 
ATOM   2096 O O   . GLU B 2 99  ? -5.768  69.946  53.733 1.00 33.76  ? 74   GLU B O   1 
ATOM   2097 C CB  . GLU B 2 99  ? -5.854  67.006  54.611 1.00 25.55  ? 74   GLU B CB  1 
ATOM   2098 C CG  . GLU B 2 99  ? -4.673  67.231  55.488 1.00 27.42  ? 74   GLU B CG  1 
ATOM   2099 C CD  . GLU B 2 99  ? -4.142  65.957  56.077 1.00 34.26  ? 74   GLU B CD  1 
ATOM   2100 O OE1 . GLU B 2 99  ? -3.712  65.068  55.306 1.00 41.63  ? 74   GLU B OE1 1 
ATOM   2101 O OE2 . GLU B 2 99  ? -4.156  65.853  57.320 1.00 42.87  ? 74   GLU B OE2 1 
ATOM   2102 N N   . VAL B 2 100 ? -7.465  69.096  52.547 1.00 33.55  ? 75   VAL B N   1 
ATOM   2103 C CA  . VAL B 2 100 ? -7.269  70.050  51.457 1.00 37.39  ? 75   VAL B CA  1 
ATOM   2104 C C   . VAL B 2 100 ? -7.781  71.398  51.902 1.00 43.38  ? 75   VAL B C   1 
ATOM   2105 O O   . VAL B 2 100 ? -7.331  72.439  51.429 1.00 43.90  ? 75   VAL B O   1 
ATOM   2106 C CB  . VAL B 2 100 ? -8.015  69.620  50.162 1.00 37.02  ? 75   VAL B CB  1 
ATOM   2107 C CG1 . VAL B 2 100 ? -9.451  69.319  50.475 1.00 42.86  ? 75   VAL B CG1 1 
ATOM   2108 C CG2 . VAL B 2 100 ? -7.937  70.712  49.108 1.00 27.91  ? 75   VAL B CG2 1 
ATOM   2109 N N   . ASP B 2 101 ? -8.726  71.377  52.828 1.00 46.46  ? 76   ASP B N   1 
ATOM   2110 C CA  . ASP B 2 101 ? -9.279  72.616  53.325 1.00 51.14  ? 76   ASP B CA  1 
ATOM   2111 C C   . ASP B 2 101 ? -8.542  73.034  54.589 1.00 52.28  ? 76   ASP B C   1 
ATOM   2112 O O   . ASP B 2 101 ? -8.134  74.191  54.727 1.00 56.09  ? 76   ASP B O   1 
ATOM   2113 C CB  . ASP B 2 101 ? -10.772 72.447  53.613 1.00 62.56  ? 76   ASP B CB  1 
ATOM   2114 C CG  . ASP B 2 101 ? -11.655 73.237  52.649 1.00 74.68  ? 76   ASP B CG  1 
ATOM   2115 O OD1 . ASP B 2 101 ? -11.761 72.841  51.466 1.00 83.26  ? 76   ASP B OD1 1 
ATOM   2116 O OD2 . ASP B 2 101 ? -12.249 74.251  53.080 1.00 80.63  ? 76   ASP B OD2 1 
ATOM   2117 N N   . THR B 2 102 ? -8.354  72.086  55.505 1.00 45.13  ? 77   THR B N   1 
ATOM   2118 C CA  . THR B 2 102 ? -7.689  72.391  56.765 1.00 38.93  ? 77   THR B CA  1 
ATOM   2119 C C   . THR B 2 102 ? -6.277  72.923  56.580 1.00 41.49  ? 77   THR B C   1 
ATOM   2120 O O   . THR B 2 102 ? -5.905  73.909  57.213 1.00 37.94  ? 77   THR B O   1 
ATOM   2121 C CB  . THR B 2 102 ? -7.654  71.167  57.716 1.00 33.62  ? 77   THR B CB  1 
ATOM   2122 O OG1 . THR B 2 102 ? -7.762  69.945  56.971 1.00 34.78  ? 77   THR B OG1 1 
ATOM   2123 C CG2 . THR B 2 102 ? -8.801  71.259  58.682 1.00 33.94  ? 77   THR B CG2 1 
ATOM   2124 N N   . ALA B 2 103 ? -5.506  72.291  55.696 1.00 39.31  ? 78   ALA B N   1 
ATOM   2125 C CA  . ALA B 2 103 ? -4.123  72.696  55.456 1.00 33.27  ? 78   ALA B CA  1 
ATOM   2126 C C   . ALA B 2 103 ? -3.872  73.571  54.224 1.00 32.27  ? 78   ALA B C   1 
ATOM   2127 O O   . ALA B 2 103 ? -3.156  74.573  54.296 1.00 39.06  ? 78   ALA B O   1 
ATOM   2128 C CB  . ALA B 2 103 ? -3.232  71.461  55.388 1.00 27.02  ? 78   ALA B CB  1 
ATOM   2129 N N   . CYS B 2 104 ? -4.452  73.211  53.092 1.00 25.41  ? 79   CYS B N   1 
ATOM   2130 C CA  . CYS B 2 104 ? -4.210  73.967  51.873 1.00 33.69  ? 79   CYS B CA  1 
ATOM   2131 C C   . CYS B 2 104 ? -4.961  75.259  51.730 1.00 41.79  ? 79   CYS B C   1 
ATOM   2132 O O   . CYS B 2 104 ? -4.357  76.323  51.552 1.00 46.47  ? 79   CYS B O   1 
ATOM   2133 C CB  . CYS B 2 104 ? -4.502  73.083  50.681 1.00 37.77  ? 79   CYS B CB  1 
ATOM   2134 S SG  . CYS B 2 104 ? -3.628  71.514  50.871 1.00 47.00  ? 79   CYS B SG  1 
ATOM   2135 N N   . ARG B 2 105 ? -6.283  75.159  51.758 1.00 43.07  ? 80   ARG B N   1 
ATOM   2136 C CA  . ARG B 2 105 ? -7.123  76.331  51.631 1.00 44.81  ? 80   ARG B CA  1 
ATOM   2137 C C   . ARG B 2 105 ? -6.631  77.274  52.719 1.00 46.77  ? 80   ARG B C   1 
ATOM   2138 O O   . ARG B 2 105 ? -6.369  78.458  52.476 1.00 47.41  ? 80   ARG B O   1 
ATOM   2139 C CB  . ARG B 2 105 ? -8.575  75.953  51.897 1.00 50.77  ? 80   ARG B CB  1 
ATOM   2140 C CG  . ARG B 2 105 ? -9.590  76.977  51.424 1.00 54.55  ? 80   ARG B CG  1 
ATOM   2141 C CD  . ARG B 2 105 ? -10.951 76.323  51.213 1.00 56.94  ? 80   ARG B CD  1 
ATOM   2142 N NE  . ARG B 2 105 ? -11.024 75.575  49.953 1.00 56.67  ? 80   ARG B NE  1 
ATOM   2143 C CZ  . ARG B 2 105 ? -11.158 76.133  48.750 1.00 55.03  ? 80   ARG B CZ  1 
ATOM   2144 N NH1 . ARG B 2 105 ? -11.231 77.457  48.640 1.00 50.68  ? 80   ARG B NH1 1 
ATOM   2145 N NH2 . ARG B 2 105 ? -11.214 75.373  47.657 1.00 46.49  ? 80   ARG B NH2 1 
ATOM   2146 N N   . HIS B 2 106 ? -6.481  76.722  53.920 1.00 41.49  ? 81   HIS B N   1 
ATOM   2147 C CA  . HIS B 2 106 ? -6.026  77.506  55.054 1.00 36.63  ? 81   HIS B CA  1 
ATOM   2148 C C   . HIS B 2 106 ? -4.662  78.131  54.846 1.00 33.96  ? 81   HIS B C   1 
ATOM   2149 O O   . HIS B 2 106 ? -4.508  79.343  54.969 1.00 42.95  ? 81   HIS B O   1 
ATOM   2150 C CB  . HIS B 2 106 ? -5.980  76.657  56.313 1.00 32.07  ? 81   HIS B CB  1 
ATOM   2151 C CG  . HIS B 2 106 ? -5.483  77.403  57.510 1.00 34.21  ? 81   HIS B CG  1 
ATOM   2152 N ND1 . HIS B 2 106 ? -6.136  78.505  58.021 1.00 38.28  ? 81   HIS B ND1 1 
ATOM   2153 C CD2 . HIS B 2 106 ? -4.382  77.229  58.275 1.00 33.87  ? 81   HIS B CD2 1 
ATOM   2154 C CE1 . HIS B 2 106 ? -5.457  78.980  59.050 1.00 35.09  ? 81   HIS B CE1 1 
ATOM   2155 N NE2 . HIS B 2 106 ? -4.389  78.224  59.225 1.00 36.67  ? 81   HIS B NE2 1 
ATOM   2156 N N   . ASN B 2 107 ? -3.673  77.317  54.520 1.00 36.09  ? 82   ASN B N   1 
ATOM   2157 C CA  . ASN B 2 107 ? -2.283  77.769  54.360 1.00 31.99  ? 82   ASN B CA  1 
ATOM   2158 C C   . ASN B 2 107 ? -2.187  78.760  53.197 1.00 38.24  ? 82   ASN B C   1 
ATOM   2159 O O   . ASN B 2 107 ? -1.345  79.691  53.258 1.00 38.16  ? 82   ASN B O   1 
ATOM   2160 C CB  . ASN B 2 107 ? -1.374  76.572  54.079 1.00 20.71  ? 82   ASN B CB  1 
ATOM   2161 C CG  . ASN B 2 107 ? -0.802  75.946  55.350 1.00 20.00  ? 82   ASN B CG  1 
ATOM   2162 O OD1 . ASN B 2 107 ? -1.114  76.395  56.451 1.00 20.00  ? 82   ASN B OD1 1 
ATOM   2163 N ND2 . ASN B 2 107 ? 0.029   74.923  55.265 1.00 20.00  ? 82   ASN B ND2 1 
ATOM   2164 N N   . TYR B 2 108 ? -2.954  78.585  52.143 1.00 41.35  ? 83   TYR B N   1 
ATOM   2165 C CA  . TYR B 2 108 ? -2.862  79.491  51.007 1.00 44.52  ? 83   TYR B CA  1 
ATOM   2166 C C   . TYR B 2 108 ? -3.416  80.862  51.366 1.00 43.91  ? 83   TYR B C   1 
ATOM   2167 O O   . TYR B 2 108 ? -2.689  81.842  51.384 1.00 45.34  ? 83   TYR B O   1 
ATOM   2168 C CB  . TYR B 2 108 ? -3.651  78.971  49.807 1.00 49.51  ? 83   TYR B CB  1 
ATOM   2169 C CG  . TYR B 2 108 ? -3.476  79.851  48.585 1.00 50.61  ? 83   TYR B CG  1 
ATOM   2170 C CD1 . TYR B 2 108 ? -2.310  79.771  47.823 1.00 42.56  ? 83   TYR B CD1 1 
ATOM   2171 C CD2 . TYR B 2 108 ? -4.449  80.798  48.217 1.00 44.67  ? 83   TYR B CD2 1 
ATOM   2172 C CE1 . TYR B 2 108 ? -2.107  80.606  46.738 1.00 44.88  ? 83   TYR B CE1 1 
ATOM   2173 C CE2 . TYR B 2 108 ? -4.249  81.644  47.121 1.00 41.09  ? 83   TYR B CE2 1 
ATOM   2174 C CZ  . TYR B 2 108 ? -3.073  81.537  46.393 1.00 41.80  ? 83   TYR B CZ  1 
ATOM   2175 O OH  . TYR B 2 108 ? -2.837  82.366  45.327 1.00 42.89  ? 83   TYR B OH  1 
ATOM   2176 N N   . GLU B 2 109 ? -4.724  80.887  51.611 1.00 41.28  ? 84   GLU B N   1 
ATOM   2177 C CA  . GLU B 2 109 ? -5.452  82.095  51.955 1.00 44.72  ? 84   GLU B CA  1 
ATOM   2178 C C   . GLU B 2 109 ? -4.921  82.760  53.223 1.00 47.13  ? 84   GLU B C   1 
ATOM   2179 O O   . GLU B 2 109 ? -4.976  83.993  53.367 1.00 49.12  ? 84   GLU B O   1 
ATOM   2180 C CB  . GLU B 2 109 ? -6.937  81.777  52.150 1.00 43.62  ? 84   GLU B CB  1 
ATOM   2181 C CG  . GLU B 2 109 ? -7.648  81.281  50.898 1.00 52.62  ? 84   GLU B CG  1 
ATOM   2182 C CD  . GLU B 2 109 ? -9.054  80.777  51.196 1.00 59.83  ? 84   GLU B CD  1 
ATOM   2183 O OE1 . GLU B 2 109 ? -9.350  80.531  52.388 1.00 61.06  ? 84   GLU B OE1 1 
ATOM   2184 O OE2 . GLU B 2 109 ? -9.862  80.631  50.248 1.00 60.42  ? 84   GLU B OE2 1 
ATOM   2185 N N   . GLY B 2 110 ? -4.408  81.955  54.148 1.00 45.02  ? 85   GLY B N   1 
ATOM   2186 C CA  . GLY B 2 110 ? -3.892  82.497  55.390 1.00 36.95  ? 85   GLY B CA  1 
ATOM   2187 C C   . GLY B 2 110 ? -2.428  82.888  55.416 1.00 37.73  ? 85   GLY B C   1 
ATOM   2188 O O   . GLY B 2 110 ? -2.059  84.004  55.057 1.00 37.63  ? 85   GLY B O   1 
ATOM   2189 N N   . PRO B 2 111 ? -1.556  81.964  55.827 1.00 42.10  ? 86   PRO B N   1 
ATOM   2190 C CA  . PRO B 2 111 ? -0.112  82.212  55.916 1.00 45.63  ? 86   PRO B CA  1 
ATOM   2191 C C   . PRO B 2 111 ? 0.538   82.720  54.639 1.00 48.13  ? 86   PRO B C   1 
ATOM   2192 O O   . PRO B 2 111 ? 1.088   83.823  54.609 1.00 46.17  ? 86   PRO B O   1 
ATOM   2193 C CB  . PRO B 2 111 ? 0.470   80.862  56.350 1.00 45.51  ? 86   PRO B CB  1 
ATOM   2194 C CG  . PRO B 2 111 ? -0.687  80.105  56.924 1.00 47.38  ? 86   PRO B CG  1 
ATOM   2195 C CD  . PRO B 2 111 ? -1.907  80.582  56.194 1.00 43.16  ? 86   PRO B CD  1 
ATOM   2196 N N   . GLU B 2 112 ? 0.472   81.911  53.586 1.00 50.55  ? 87   GLU B N   1 
ATOM   2197 C CA  . GLU B 2 112 ? 1.078   82.274  52.312 1.00 50.99  ? 87   GLU B CA  1 
ATOM   2198 C C   . GLU B 2 112 ? 0.702   83.644  51.741 1.00 51.28  ? 87   GLU B C   1 
ATOM   2199 O O   . GLU B 2 112 ? 1.538   84.319  51.135 1.00 52.23  ? 87   GLU B O   1 
ATOM   2200 C CB  . GLU B 2 112 ? 0.812   81.181  51.274 1.00 48.01  ? 87   GLU B CB  1 
ATOM   2201 C CG  . GLU B 2 112 ? 1.655   79.931  51.485 1.00 43.69  ? 87   GLU B CG  1 
ATOM   2202 C CD  . GLU B 2 112 ? 3.078   80.227  51.931 1.00 43.50  ? 87   GLU B CD  1 
ATOM   2203 O OE1 . GLU B 2 112 ? 3.447   81.396  52.154 1.00 47.03  ? 87   GLU B OE1 1 
ATOM   2204 O OE2 . GLU B 2 112 ? 3.848   79.266  52.063 1.00 48.37  ? 87   GLU B OE2 1 
ATOM   2205 N N   . THR B 2 113 ? -0.536  84.073  51.942 1.00 49.11  ? 88   THR B N   1 
ATOM   2206 C CA  . THR B 2 113 ? -0.947  85.362  51.412 1.00 46.53  ? 88   THR B CA  1 
ATOM   2207 C C   . THR B 2 113 ? -0.255  86.531  52.111 1.00 47.10  ? 88   THR B C   1 
ATOM   2208 O O   . THR B 2 113 ? -0.012  87.568  51.493 1.00 46.80  ? 88   THR B O   1 
ATOM   2209 C CB  . THR B 2 113 ? -2.475  85.560  51.519 1.00 49.40  ? 88   THR B CB  1 
ATOM   2210 O OG1 . THR B 2 113 ? -3.158  84.600  50.699 1.00 50.83  ? 88   THR B OG1 1 
ATOM   2211 C CG2 . THR B 2 113 ? -2.849  86.944  51.041 1.00 53.69  ? 88   THR B CG2 1 
ATOM   2212 N N   . SER B 2 114 ? 0.068   86.371  53.392 1.00 46.09  ? 89   SER B N   1 
ATOM   2213 C CA  . SER B 2 114 ? 0.714   87.451  54.139 1.00 43.69  ? 89   SER B CA  1 
ATOM   2214 C C   . SER B 2 114 ? 2.210   87.288  54.149 1.00 42.17  ? 89   SER B C   1 
ATOM   2215 O O   . SER B 2 114 ? 2.916   87.938  54.912 1.00 37.02  ? 89   SER B O   1 
ATOM   2216 C CB  . SER B 2 114 ? 0.219   87.496  55.596 1.00 44.40  ? 89   SER B CB  1 
ATOM   2217 O OG  . SER B 2 114 ? -0.618  86.400  55.932 1.00 43.95  ? 89   SER B OG  1 
ATOM   2218 N N   . THR B 2 115 ? 2.712   86.427  53.288 1.00 47.25  ? 90   THR B N   1 
ATOM   2219 C CA  . THR B 2 115 ? 4.131   86.217  53.306 1.00 51.27  ? 90   THR B CA  1 
ATOM   2220 C C   . THR B 2 115 ? 4.788   85.974  51.949 1.00 51.96  ? 90   THR B C   1 
ATOM   2221 O O   . THR B 2 115 ? 5.456   86.864  51.416 1.00 58.30  ? 90   THR B O   1 
ATOM   2222 C CB  . THR B 2 115 ? 4.433   85.094  54.327 1.00 49.70  ? 90   THR B CB  1 
ATOM   2223 O OG1 . THR B 2 115 ? 5.050   85.674  55.482 1.00 59.12  ? 90   THR B OG1 1 
ATOM   2224 C CG2 . THR B 2 115 ? 5.330   84.025  53.747 1.00 54.41  ? 90   THR B CG2 1 
ATOM   2225 N N   . SER B 2 116 ? 4.597   84.790  51.382 1.00 48.17  ? 91   SER B N   1 
ATOM   2226 C CA  . SER B 2 116 ? 5.207   84.462  50.101 1.00 50.04  ? 91   SER B CA  1 
ATOM   2227 C C   . SER B 2 116 ? 4.602   85.289  48.978 1.00 49.70  ? 91   SER B C   1 
ATOM   2228 O O   . SER B 2 116 ? 5.310   85.863  48.153 1.00 44.47  ? 91   SER B O   1 
ATOM   2229 C CB  . SER B 2 116 ? 5.024   82.971  49.789 1.00 47.51  ? 91   SER B CB  1 
ATOM   2230 O OG  . SER B 2 116 ? 5.861   82.165  50.604 1.00 52.41  ? 91   SER B OG  1 
ATOM   2231 N N   . LEU B 2 117 ? 3.281   85.363  48.972 1.00 52.63  ? 92   LEU B N   1 
ATOM   2232 C CA  . LEU B 2 117 ? 2.570   86.081  47.934 1.00 56.74  ? 92   LEU B CA  1 
ATOM   2233 C C   . LEU B 2 117 ? 2.726   87.583  47.951 1.00 59.50  ? 92   LEU B C   1 
ATOM   2234 O O   . LEU B 2 117 ? 2.426   88.248  46.964 1.00 66.89  ? 92   LEU B O   1 
ATOM   2235 C CB  . LEU B 2 117 ? 1.090   85.734  47.995 1.00 54.89  ? 92   LEU B CB  1 
ATOM   2236 C CG  . LEU B 2 117 ? 0.554   84.836  46.883 1.00 53.26  ? 92   LEU B CG  1 
ATOM   2237 C CD1 . LEU B 2 117 ? 1.667   84.045  46.223 1.00 50.08  ? 92   LEU B CD1 1 
ATOM   2238 C CD2 . LEU B 2 117 ? -0.472  83.908  47.487 1.00 56.41  ? 92   LEU B CD2 1 
ATOM   2239 N N   . ARG B 2 118 ? 3.192   88.133  49.057 1.00 62.64  ? 93   ARG B N   1 
ATOM   2240 C CA  . ARG B 2 118 ? 3.341   89.573  49.106 1.00 65.94  ? 93   ARG B CA  1 
ATOM   2241 C C   . ARG B 2 118 ? 4.784   90.000  48.879 1.00 60.85  ? 93   ARG B C   1 
ATOM   2242 O O   . ARG B 2 118 ? 5.073   91.188  48.735 1.00 65.59  ? 93   ARG B O   1 
ATOM   2243 C CB  . ARG B 2 118 ? 2.811   90.105  50.441 1.00 75.26  ? 93   ARG B CB  1 
ATOM   2244 C CG  . ARG B 2 118 ? 1.284   90.208  50.487 1.00 80.98  ? 93   ARG B CG  1 
ATOM   2245 C CD  . ARG B 2 118 ? 0.811   91.151  51.581 1.00 86.91  ? 93   ARG B CD  1 
ATOM   2246 N NE  . ARG B 2 118 ? 0.935   92.552  51.183 1.00 94.41  ? 93   ARG B NE  1 
ATOM   2247 C CZ  . ARG B 2 118 ? 1.908   93.365  51.591 1.00 94.29  ? 93   ARG B CZ  1 
ATOM   2248 N NH1 . ARG B 2 118 ? 2.847   92.918  52.416 1.00 97.03  ? 93   ARG B NH1 1 
ATOM   2249 N NH2 . ARG B 2 118 ? 1.942   94.626  51.175 1.00 92.47  ? 93   ARG B NH2 1 
ATOM   2250 N N   . ARG B 2 119 ? 5.687   89.030  48.816 1.00 53.09  ? 94   ARG B N   1 
ATOM   2251 C CA  . ARG B 2 119 ? 7.088   89.345  48.610 1.00 49.29  ? 94   ARG B CA  1 
ATOM   2252 C C   . ARG B 2 119 ? 7.395   89.861  47.204 1.00 46.37  ? 94   ARG B C   1 
ATOM   2253 O O   . ARG B 2 119 ? 7.035   89.235  46.200 1.00 39.73  ? 94   ARG B O   1 
ATOM   2254 C CB  . ARG B 2 119 ? 7.947   88.127  48.909 1.00 47.48  ? 94   ARG B CB  1 
ATOM   2255 C CG  . ARG B 2 119 ? 9.417   88.416  48.802 1.00 52.15  ? 94   ARG B CG  1 
ATOM   2256 C CD  . ARG B 2 119 ? 10.124  88.123  50.099 1.00 56.18  ? 94   ARG B CD  1 
ATOM   2257 N NE  . ARG B 2 119 ? 11.576  88.012  49.933 1.00 58.61  ? 94   ARG B NE  1 
ATOM   2258 C CZ  . ARG B 2 119 ? 12.191  87.196  49.077 1.00 49.80  ? 94   ARG B CZ  1 
ATOM   2259 N NH1 . ARG B 2 119 ? 11.487  86.400  48.287 1.00 63.36  ? 94   ARG B NH1 1 
ATOM   2260 N NH2 . ARG B 2 119 ? 13.516  87.166  49.014 1.00 31.40  ? 94   ARG B NH2 1 
ATOM   2261 N N   . LEU B 2 120 A 8.065   91.013  47.156 1.00 47.82  ? 94   LEU B N   1 
ATOM   2262 C CA  . LEU B 2 120 A 8.455   91.666  45.907 1.00 46.74  ? 94   LEU B CA  1 
ATOM   2263 C C   . LEU B 2 120 A 9.909   92.109  45.990 1.00 48.47  ? 94   LEU B C   1 
ATOM   2264 O O   . LEU B 2 120 A 10.275  92.953  46.809 1.00 47.70  ? 94   LEU B O   1 
ATOM   2265 C CB  . LEU B 2 120 A 7.552   92.866  45.637 1.00 38.33  ? 94   LEU B CB  1 
ATOM   2266 C CG  . LEU B 2 120 A 6.120   92.435  45.318 1.00 37.41  ? 94   LEU B CG  1 
ATOM   2267 C CD1 . LEU B 2 120 A 5.145   93.515  45.736 1.00 29.43  ? 94   LEU B CD1 1 
ATOM   2268 C CD2 . LEU B 2 120 A 6.002   92.118  43.828 1.00 41.09  ? 94   LEU B CD2 1 
ATOM   2269 N N   . GLU B 2 121 ? 10.738  91.521  45.139 1.00 52.66  ? 95   GLU B N   1 
ATOM   2270 C CA  . GLU B 2 121 ? 12.158  91.830  45.113 1.00 57.39  ? 95   GLU B CA  1 
ATOM   2271 C C   . GLU B 2 121 ? 12.554  92.461  43.793 1.00 64.30  ? 95   GLU B C   1 
ATOM   2272 O O   . GLU B 2 121 ? 12.464  91.833  42.739 1.00 68.90  ? 95   GLU B O   1 
ATOM   2273 C CB  . GLU B 2 121 ? 12.971  90.558  45.342 1.00 54.44  ? 95   GLU B CB  1 
ATOM   2274 C CG  . GLU B 2 121 ? 13.013  90.125  46.789 1.00 47.27  ? 95   GLU B CG  1 
ATOM   2275 C CD  . GLU B 2 121 ? 13.168  91.298  47.722 1.00 51.48  ? 95   GLU B CD  1 
ATOM   2276 O OE1 . GLU B 2 121 ? 14.202  91.988  47.621 1.00 60.14  ? 95   GLU B OE1 1 
ATOM   2277 O OE2 . GLU B 2 121 ? 12.262  91.537  48.549 1.00 49.07  ? 95   GLU B OE2 1 
ATOM   2278 N N   . GLN B 2 122 ? 12.995  93.711  43.860 1.00 68.96  ? 96   GLN B N   1 
ATOM   2279 C CA  . GLN B 2 122 ? 13.411  94.454  42.678 1.00 69.31  ? 96   GLN B CA  1 
ATOM   2280 C C   . GLN B 2 122 ? 14.772  93.944  42.193 1.00 65.19  ? 96   GLN B C   1 
ATOM   2281 O O   . GLN B 2 122 ? 15.753  93.970  42.940 1.00 58.51  ? 96   GLN B O   1 
ATOM   2282 C CB  . GLN B 2 122 ? 13.466  95.941  43.026 1.00 72.84  ? 96   GLN B CB  1 
ATOM   2283 C CG  . GLN B 2 122 ? 12.608  96.284  44.241 1.00 84.75  ? 96   GLN B CG  1 
ATOM   2284 C CD  . GLN B 2 122 ? 11.859  97.594  44.099 1.00 90.67  ? 96   GLN B CD  1 
ATOM   2285 O OE1 . GLN B 2 122 ? 11.408  97.953  43.011 1.00 96.30  ? 96   GLN B OE1 1 
ATOM   2286 N NE2 . GLN B 2 122 ? 11.718  98.316  45.206 1.00 95.75  ? 96   GLN B NE2 1 
ATOM   2287 N N   . PRO B 2 123 ? 14.842  93.484  40.924 1.00 63.25  ? 97   PRO B N   1 
ATOM   2288 C CA  . PRO B 2 123 ? 16.049  92.947  40.279 1.00 61.58  ? 97   PRO B CA  1 
ATOM   2289 C C   . PRO B 2 123 ? 17.146  93.973  40.106 1.00 64.16  ? 97   PRO B C   1 
ATOM   2290 O O   . PRO B 2 123 ? 16.921  95.164  40.291 1.00 65.77  ? 97   PRO B O   1 
ATOM   2291 C CB  . PRO B 2 123 ? 15.546  92.447  38.930 1.00 63.35  ? 97   PRO B CB  1 
ATOM   2292 C CG  . PRO B 2 123 ? 14.369  93.301  38.641 1.00 64.03  ? 97   PRO B CG  1 
ATOM   2293 C CD  . PRO B 2 123 ? 13.705  93.504  39.986 1.00 64.55  ? 97   PRO B CD  1 
ATOM   2294 N N   . ASN B 2 124 ? 18.334  93.508  39.737 1.00 67.33  ? 98   ASN B N   1 
ATOM   2295 C CA  . ASN B 2 124 ? 19.460  94.408  39.545 1.00 70.52  ? 98   ASN B CA  1 
ATOM   2296 C C   . ASN B 2 124 ? 20.084  94.219  38.163 1.00 73.49  ? 98   ASN B C   1 
ATOM   2297 O O   . ASN B 2 124 ? 20.870  93.296  37.921 1.00 75.31  ? 98   ASN B O   1 
ATOM   2298 C CB  . ASN B 2 124 ? 20.493  94.198  40.661 1.00 70.57  ? 98   ASN B CB  1 
ATOM   2299 C CG  . ASN B 2 124 ? 19.947  94.570  42.045 1.00 72.27  ? 98   ASN B CG  1 
ATOM   2300 O OD1 . ASN B 2 124 ? 19.583  95.724  42.301 1.00 67.53  ? 98   ASN B OD1 1 
ATOM   2301 N ND2 . ASN B 2 124 ? 19.887  93.589  42.941 1.00 69.91  ? 98   ASN B ND2 1 
ATOM   2302 N N   . VAL B 2 125 ? 19.699  95.116  37.263 1.00 72.81  ? 99   VAL B N   1 
ATOM   2303 C CA  . VAL B 2 125 ? 20.155  95.116  35.884 1.00 71.65  ? 99   VAL B CA  1 
ATOM   2304 C C   . VAL B 2 125 ? 21.594  95.600  35.745 1.00 69.62  ? 99   VAL B C   1 
ATOM   2305 O O   . VAL B 2 125 ? 21.970  96.633  36.304 1.00 68.31  ? 99   VAL B O   1 
ATOM   2306 C CB  . VAL B 2 125 ? 19.245  96.019  35.041 1.00 69.80  ? 99   VAL B CB  1 
ATOM   2307 C CG1 . VAL B 2 125 ? 18.010  95.268  34.637 1.00 70.79  ? 99   VAL B CG1 1 
ATOM   2308 C CG2 . VAL B 2 125 ? 18.853  97.243  35.846 1.00 69.08  ? 99   VAL B CG2 1 
ATOM   2309 N N   . ALA B 2 126 ? 22.389  94.849  34.990 1.00 66.36  ? 100  ALA B N   1 
ATOM   2310 C CA  . ALA B 2 126 ? 23.785  95.197  34.766 1.00 67.15  ? 100  ALA B CA  1 
ATOM   2311 C C   . ALA B 2 126 ? 24.313  94.575  33.475 1.00 68.90  ? 100  ALA B C   1 
ATOM   2312 O O   . ALA B 2 126 ? 24.282  93.358  33.315 1.00 75.27  ? 100  ALA B O   1 
ATOM   2313 C CB  . ALA B 2 126 ? 24.622  94.736  35.937 1.00 61.10  ? 100  ALA B CB  1 
ATOM   2314 N N   . ILE B 2 127 ? 24.777  95.409  32.548 1.00 67.68  ? 101  ILE B N   1 
ATOM   2315 C CA  . ILE B 2 127 ? 25.283  94.897  31.283 1.00 65.72  ? 101  ILE B CA  1 
ATOM   2316 C C   . ILE B 2 127 ? 26.785  94.890  31.449 1.00 62.57  ? 101  ILE B C   1 
ATOM   2317 O O   . ILE B 2 127 ? 27.402  95.873  31.862 1.00 60.57  ? 101  ILE B O   1 
ATOM   2318 C CB  . ILE B 2 127 ? 24.924  95.753  30.045 1.00 66.69  ? 101  ILE B CB  1 
ATOM   2319 C CG1 . ILE B 2 127 ? 25.371  97.203  30.229 1.00 73.58  ? 101  ILE B CG1 1 
ATOM   2320 C CG2 . ILE B 2 127 ? 23.428  95.707  29.802 1.00 66.49  ? 101  ILE B CG2 1 
ATOM   2321 C CD1 . ILE B 2 127 ? 24.977  97.863  31.529 1.00 71.29  ? 101  ILE B CD1 1 
ATOM   2322 N N   . SER B 2 128 ? 27.374  93.755  31.148 1.00 60.87  ? 102  SER B N   1 
ATOM   2323 C CA  . SER B 2 128 ? 28.797  93.605  31.247 1.00 63.54  ? 102  SER B CA  1 
ATOM   2324 C C   . SER B 2 128 ? 29.173  93.120  29.861 1.00 69.21  ? 102  SER B C   1 
ATOM   2325 O O   . SER B 2 128 ? 28.309  92.959  29.000 1.00 69.38  ? 102  SER B O   1 
ATOM   2326 C CB  . SER B 2 128 ? 29.120  92.544  32.295 1.00 59.25  ? 102  SER B CB  1 
ATOM   2327 O OG  . SER B 2 128 ? 28.471  91.318  31.979 1.00 65.22  ? 102  SER B OG  1 
ATOM   2328 N N   . LEU B 2 129 ? 30.462  92.922  29.638 1.00 76.32  ? 103  LEU B N   1 
ATOM   2329 C CA  . LEU B 2 129 ? 30.940  92.407  28.370 1.00 81.62  ? 103  LEU B CA  1 
ATOM   2330 C C   . LEU B 2 129 ? 31.556  91.051  28.715 1.00 86.40  ? 103  LEU B C   1 
ATOM   2331 O O   . LEU B 2 129 ? 32.242  90.928  29.733 1.00 95.05  ? 103  LEU B O   1 
ATOM   2332 C CB  . LEU B 2 129 ? 31.978  93.332  27.767 1.00 76.43  ? 103  LEU B CB  1 
ATOM   2333 N N   . SER B 2 130 ? 31.298  90.032  27.896 1.00 86.48  ? 104  SER B N   1 
ATOM   2334 C CA  . SER B 2 130 ? 31.828  88.692  28.157 1.00 87.31  ? 104  SER B CA  1 
ATOM   2335 C C   . SER B 2 130 ? 33.242  88.787  28.694 1.00 89.83  ? 104  SER B C   1 
ATOM   2336 O O   . SER B 2 130 ? 34.094  89.426  28.086 1.00 91.80  ? 104  SER B O   1 
ATOM   2337 C CB  . SER B 2 130 ? 31.799  87.867  26.885 1.00 80.74  ? 104  SER B CB  1 
ATOM   2338 N N   . ARG B 2 131 ? 33.474  88.150  29.843 1.00 93.32  ? 105  ARG B N   1 
ATOM   2339 C CA  . ARG B 2 131 ? 34.782  88.165  30.491 1.00 95.05  ? 105  ARG B CA  1 
ATOM   2340 C C   . ARG B 2 131 ? 35.875  87.886  29.480 1.00 97.30  ? 105  ARG B C   1 
ATOM   2341 O O   . ARG B 2 131 ? 36.260  86.739  29.232 1.00 98.81  ? 105  ARG B O   1 
ATOM   2342 C CB  . ARG B 2 131 ? 34.869  87.137  31.623 1.00 87.31  ? 105  ARG B CB  1 
ATOM   2343 N N   . THR B 2 132 ? 36.322  88.960  28.847 1.00 98.88  ? 106  THR B N   1 
ATOM   2344 C CA  . THR B 2 132 ? 37.443  88.889  27.935 1.00 100.00 ? 106  THR B CA  1 
ATOM   2345 C C   . THR B 2 132 ? 37.377  88.616  26.431 1.00 100.00 ? 106  THR B C   1 
ATOM   2346 O O   . THR B 2 132 ? 38.402  88.210  25.879 1.00 100.00 ? 106  THR B O   1 
ATOM   2347 C CB  . THR B 2 132 ? 38.458  87.937  28.553 1.00 100.00 ? 106  THR B CB  1 
ATOM   2348 N N   . GLU B 2 133 ? 36.272  88.792  25.721 1.00 100.00 ? 107  GLU B N   1 
ATOM   2349 C CA  . GLU B 2 133 ? 36.444  88.529  24.318 1.00 100.00 ? 107  GLU B CA  1 
ATOM   2350 C C   . GLU B 2 133 ? 35.789  89.477  23.331 1.00 100.00 ? 107  GLU B C   1 
ATOM   2351 O O   . GLU B 2 133 ? 36.420  90.438  22.866 1.00 100.00 ? 107  GLU B O   1 
ATOM   2352 C CB  . GLU B 2 133 ? 36.074  87.095  23.966 1.00 100.00 ? 107  GLU B CB  1 
ATOM   2353 N N   . ALA B 2 134 ? 34.522  89.223  22.996 1.00 100.00 ? 108  ALA B N   1 
ATOM   2354 C CA  . ALA B 2 134 ? 33.902  90.044  21.974 1.00 100.00 ? 108  ALA B CA  1 
ATOM   2355 C C   . ALA B 2 134 ? 34.939  89.739  20.927 1.00 100.00 ? 108  ALA B C   1 
ATOM   2356 O O   . ALA B 2 134 ? 35.479  90.638  20.311 1.00 100.00 ? 108  ALA B O   1 
ATOM   2357 C CB  . ALA B 2 134 ? 33.984  91.520  22.431 1.00 98.91  ? 108  ALA B CB  1 
ATOM   2358 N N   . LEU B 2 135 ? 35.252  88.452  20.812 1.00 99.61  ? 109  LEU B N   1 
ATOM   2359 C CA  . LEU B 2 135 ? 36.257  88.026  19.869 1.00 95.73  ? 109  LEU B CA  1 
ATOM   2360 C C   . LEU B 2 135 ? 35.754  86.824  19.138 1.00 96.43  ? 109  LEU B C   1 
ATOM   2361 O O   . LEU B 2 135 ? 34.609  86.405  19.333 1.00 98.38  ? 109  LEU B O   1 
ATOM   2362 C CB  . LEU B 2 135 ? 37.546  87.677  20.574 1.00 90.41  ? 109  LEU B CB  1 
ATOM   2363 N N   . ASN B 2 136 ? 36.605  86.267  18.305 1.00 98.45  ? 110  ASN B N   1 
ATOM   2364 C CA  . ASN B 2 136 ? 36.248  85.064  17.549 1.00 99.32  ? 110  ASN B CA  1 
ATOM   2365 C C   . ASN B 2 136 ? 34.889  85.313  16.910 1.00 100.00 ? 110  ASN B C   1 
ATOM   2366 O O   . ASN B 2 136 ? 34.025  84.439  17.010 1.00 100.00 ? 110  ASN B O   1 
ATOM   2367 C CB  . ASN B 2 136 ? 36.187  83.863  18.495 1.00 98.63  ? 110  ASN B CB  1 
ATOM   2368 C CG  . ASN B 2 136 ? 37.512  83.584  19.205 1.00 97.71  ? 110  ASN B CG  1 
ATOM   2369 O OD1 . ASN B 2 136 ? 37.569  83.613  20.434 1.00 20.00  ? 110  ASN B OD1 1 
ATOM   2370 N ND2 . ASN B 2 136 ? 38.594  83.311  18.501 1.00 20.00  ? 110  ASN B ND2 1 
ATOM   2371 N N   . HIS B 2 137 ? 34.624  86.454  16.289 1.00 100.00 ? 111  HIS B N   1 
ATOM   2372 C CA  . HIS B 2 137 ? 33.367  86.606  15.565 1.00 100.00 ? 111  HIS B CA  1 
ATOM   2373 C C   . HIS B 2 137 ? 32.005  86.917  16.313 1.00 100.00 ? 111  HIS B C   1 
ATOM   2374 O O   . HIS B 2 137 ? 31.325  86.048  16.785 1.00 100.00 ? 111  HIS B O   1 
ATOM   2375 C CB  . HIS B 2 137 ? 33.205  85.335  14.703 1.00 97.23  ? 111  HIS B CB  1 
ATOM   2376 C CG  . HIS B 2 137 ? 31.985  85.335  13.847 1.00 99.48  ? 111  HIS B CG  1 
ATOM   2377 N ND1 . HIS B 2 137 ? 30.788  84.806  14.281 1.00 98.39  ? 111  HIS B ND1 1 
ATOM   2378 C CD2 . HIS B 2 137 ? 31.777  85.743  12.573 1.00 99.99  ? 111  HIS B CD2 1 
ATOM   2379 C CE1 . HIS B 2 137 ? 29.902  84.883  13.312 1.00 98.64  ? 111  HIS B CE1 1 
ATOM   2380 N NE2 . HIS B 2 137 ? 30.474  85.449  12.260 1.00 100.00 ? 111  HIS B NE2 1 
ATOM   2381 N N   . HIS B 2 138 ? 31.677  88.200  16.366 1.00 99.66  ? 112  HIS B N   1 
ATOM   2382 C CA  . HIS B 2 138 ? 30.451  88.822  16.858 1.00 97.71  ? 112  HIS B CA  1 
ATOM   2383 C C   . HIS B 2 138 ? 30.374  89.111  18.409 1.00 98.30  ? 112  HIS B C   1 
ATOM   2384 O O   . HIS B 2 138 ? 29.920  88.288  19.169 1.00 100.00 ? 112  HIS B O   1 
ATOM   2385 C CB  . HIS B 2 138 ? 29.267  87.922  16.497 1.00 95.76  ? 112  HIS B CB  1 
ATOM   2386 C CG  . HIS B 2 138 ? 28.178  88.552  15.671 1.00 100.00 ? 112  HIS B CG  1 
ATOM   2387 N ND1 . HIS B 2 138 ? 27.365  89.554  16.163 1.00 100.00 ? 112  HIS B ND1 1 
ATOM   2388 C CD2 . HIS B 2 138 ? 27.639  88.197  14.476 1.00 100.00 ? 112  HIS B CD2 1 
ATOM   2389 C CE1 . HIS B 2 138 ? 26.386  89.794  15.310 1.00 100.00 ? 112  HIS B CE1 1 
ATOM   2390 N NE2 . HIS B 2 138 ? 26.529  88.984  14.276 1.00 100.00 ? 112  HIS B NE2 1 
ATOM   2391 N N   . ASN B 2 139 ? 30.679  90.347  18.824 1.00 98.77  ? 113  ASN B N   1 
ATOM   2392 C CA  . ASN B 2 139 ? 30.639  90.799  20.223 1.00 96.69  ? 113  ASN B CA  1 
ATOM   2393 C C   . ASN B 2 139 ? 29.415  90.373  21.013 1.00 94.12  ? 113  ASN B C   1 
ATOM   2394 O O   . ASN B 2 139 ? 28.314  90.594  20.516 1.00 95.80  ? 113  ASN B O   1 
ATOM   2395 C CB  . ASN B 2 139 ? 30.668  92.345  20.293 1.00 97.99  ? 113  ASN B CB  1 
ATOM   2396 C CG  . ASN B 2 139 ? 31.867  92.883  21.047 1.00 98.05  ? 113  ASN B CG  1 
ATOM   2397 O OD1 . ASN B 2 139 ? 31.843  93.026  22.270 1.00 100.00 ? 113  ASN B OD1 1 
ATOM   2398 N ND2 . ASN B 2 139 ? 32.866  93.344  20.300 1.00 96.63  ? 113  ASN B ND2 1 
ATOM   2399 N N   . THR B 2 140 ? 29.556  89.837  22.226 1.00 91.58  ? 114  THR B N   1 
ATOM   2400 C CA  . THR B 2 140 ? 28.366  89.410  23.006 1.00 88.96  ? 114  THR B CA  1 
ATOM   2401 C C   . THR B 2 140 ? 28.133  90.192  24.308 1.00 83.81  ? 114  THR B C   1 
ATOM   2402 O O   . THR B 2 140 ? 28.929  90.133  25.251 1.00 84.33  ? 114  THR B O   1 
ATOM   2403 C CB  . THR B 2 140 ? 28.413  87.884  23.301 1.00 91.49  ? 114  THR B CB  1 
ATOM   2404 O OG1 . THR B 2 140 ? 28.431  87.148  22.063 1.00 92.41  ? 114  THR B OG1 1 
ATOM   2405 C CG2 . THR B 2 140 ? 27.180  87.447  24.098 1.00 85.59  ? 114  THR B CG2 1 
ATOM   2406 N N   . LEU B 2 141 ? 27.023  90.929  24.318 1.00 75.89  ? 115  LEU B N   1 
ATOM   2407 C CA  . LEU B 2 141 ? 26.594  91.731  25.455 1.00 62.74  ? 115  LEU B CA  1 
ATOM   2408 C C   . LEU B 2 141 ? 25.753  90.867  26.379 1.00 58.58  ? 115  LEU B C   1 
ATOM   2409 O O   . LEU B 2 141 ? 24.886  90.116  25.918 1.00 55.36  ? 115  LEU B O   1 
ATOM   2410 C CB  . LEU B 2 141 ? 25.724  92.890  24.988 1.00 60.09  ? 115  LEU B CB  1 
ATOM   2411 C CG  . LEU B 2 141 ? 26.390  94.180  24.535 1.00 55.82  ? 115  LEU B CG  1 
ATOM   2412 C CD1 . LEU B 2 141 ? 25.314  95.233  24.276 1.00 52.79  ? 115  LEU B CD1 1 
ATOM   2413 C CD2 . LEU B 2 141 ? 27.368  94.638  25.593 1.00 44.64  ? 115  LEU B CD2 1 
ATOM   2414 N N   . VAL B 2 142 ? 25.992  90.988  27.678 1.00 54.09  ? 116  VAL B N   1 
ATOM   2415 C CA  . VAL B 2 142 ? 25.244  90.205  28.649 1.00 53.77  ? 116  VAL B CA  1 
ATOM   2416 C C   . VAL B 2 142 ? 24.514  91.064  29.669 1.00 53.55  ? 116  VAL B C   1 
ATOM   2417 O O   . VAL B 2 142 ? 25.129  91.891  30.345 1.00 56.74  ? 116  VAL B O   1 
ATOM   2418 C CB  . VAL B 2 142 ? 26.165  89.245  29.435 1.00 54.01  ? 116  VAL B CB  1 
ATOM   2419 C CG1 . VAL B 2 142 ? 25.331  88.369  30.367 1.00 48.86  ? 116  VAL B CG1 1 
ATOM   2420 C CG2 . VAL B 2 142 ? 26.971  88.392  28.479 1.00 57.67  ? 116  VAL B CG2 1 
ATOM   2421 N N   . CYS B 2 143 ? 23.202  90.871  29.774 1.00 50.91  ? 117  CYS B N   1 
ATOM   2422 C CA  . CYS B 2 143 ? 22.421  91.597  30.761 1.00 49.72  ? 117  CYS B CA  1 
ATOM   2423 C C   . CYS B 2 143 ? 22.159  90.665  31.946 1.00 53.00  ? 117  CYS B C   1 
ATOM   2424 O O   . CYS B 2 143 ? 21.652  89.553  31.782 1.00 56.49  ? 117  CYS B O   1 
ATOM   2425 C CB  . CYS B 2 143 ? 21.103  92.072  30.177 1.00 47.48  ? 117  CYS B CB  1 
ATOM   2426 S SG  . CYS B 2 143 ? 20.386  93.397  31.194 1.00 54.60  ? 117  CYS B SG  1 
ATOM   2427 N N   . SER B 2 144 ? 22.515  91.113  33.143 1.00 50.10  ? 118  SER B N   1 
ATOM   2428 C CA  . SER B 2 144 ? 22.327  90.294  34.325 1.00 45.86  ? 118  SER B CA  1 
ATOM   2429 C C   . SER B 2 144 ? 21.276  90.846  35.279 1.00 45.59  ? 118  SER B C   1 
ATOM   2430 O O   . SER B 2 144 ? 21.527  91.778  36.048 1.00 36.96  ? 118  SER B O   1 
ATOM   2431 C CB  . SER B 2 144 ? 23.660  90.129  35.044 1.00 44.78  ? 118  SER B CB  1 
ATOM   2432 O OG  . SER B 2 144 ? 24.634  89.648  34.138 1.00 47.11  ? 118  SER B OG  1 
ATOM   2433 N N   . VAL B 2 145 ? 20.086  90.263  35.204 1.00 46.09  ? 119  VAL B N   1 
ATOM   2434 C CA  . VAL B 2 145 ? 18.980  90.649  36.057 1.00 39.09  ? 119  VAL B CA  1 
ATOM   2435 C C   . VAL B 2 145 ? 18.986  89.623  37.169 1.00 43.65  ? 119  VAL B C   1 
ATOM   2436 O O   . VAL B 2 145 ? 18.618  88.463  36.965 1.00 40.51  ? 119  VAL B O   1 
ATOM   2437 C CB  . VAL B 2 145 ? 17.651  90.583  35.304 1.00 34.41  ? 119  VAL B CB  1 
ATOM   2438 C CG1 . VAL B 2 145 ? 16.623  91.455  36.001 1.00 29.97  ? 119  VAL B CG1 1 
ATOM   2439 C CG2 . VAL B 2 145 ? 17.848  91.037  33.866 1.00 25.56  ? 119  VAL B CG2 1 
ATOM   2440 N N   . THR B 2 146 ? 19.420  90.055  38.347 1.00 44.52  ? 120  THR B N   1 
ATOM   2441 C CA  . THR B 2 146 ? 19.516  89.153  39.479 1.00 44.83  ? 120  THR B CA  1 
ATOM   2442 C C   . THR B 2 146 ? 18.846  89.665  40.734 1.00 45.84  ? 120  THR B C   1 
ATOM   2443 O O   . THR B 2 146 ? 18.546  90.850  40.843 1.00 43.74  ? 120  THR B O   1 
ATOM   2444 C CB  . THR B 2 146 ? 20.984  88.868  39.814 1.00 42.76  ? 120  THR B CB  1 
ATOM   2445 O OG1 . THR B 2 146 ? 21.571  90.039  40.393 1.00 41.90  ? 120  THR B OG1 1 
ATOM   2446 C CG2 . THR B 2 146 ? 21.751  88.497  38.547 1.00 44.05  ? 120  THR B CG2 1 
ATOM   2447 N N   . ASP B 2 147 ? 18.619  88.738  41.666 1.00 50.65  ? 121  ASP B N   1 
ATOM   2448 C CA  . ASP B 2 147 ? 18.013  88.995  42.971 1.00 50.99  ? 121  ASP B CA  1 
ATOM   2449 C C   . ASP B 2 147 ? 16.564  89.472  43.026 1.00 52.69  ? 121  ASP B C   1 
ATOM   2450 O O   . ASP B 2 147 ? 16.194  90.308  43.867 1.00 53.40  ? 121  ASP B O   1 
ATOM   2451 C CB  . ASP B 2 147 ? 18.902  89.943  43.761 1.00 47.49  ? 121  ASP B CB  1 
ATOM   2452 C CG  . ASP B 2 147 ? 20.209  89.296  44.148 1.00 53.31  ? 121  ASP B CG  1 
ATOM   2453 O OD1 . ASP B 2 147 ? 20.306  88.053  44.012 1.00 52.75  ? 121  ASP B OD1 1 
ATOM   2454 O OD2 . ASP B 2 147 ? 21.133  90.020  44.584 1.00 48.83  ? 121  ASP B OD2 1 
ATOM   2455 N N   . PHE B 2 148 ? 15.728  88.927  42.148 1.00 47.34  ? 122  PHE B N   1 
ATOM   2456 C CA  . PHE B 2 148 ? 14.309  89.277  42.129 1.00 39.31  ? 122  PHE B CA  1 
ATOM   2457 C C   . PHE B 2 148 ? 13.462  88.105  42.590 1.00 40.80  ? 122  PHE B C   1 
ATOM   2458 O O   . PHE B 2 148 ? 13.877  86.934  42.521 1.00 34.02  ? 122  PHE B O   1 
ATOM   2459 C CB  . PHE B 2 148 ? 13.911  89.731  40.695 1.00 33.11  ? 122  PHE B CB  1 
ATOM   2460 C CG  . PHE B 2 148 ? 14.197  88.694  39.615 1.00 35.91  ? 122  PHE B CG  1 
ATOM   2461 C CD1 . PHE B 2 148 ? 15.468  88.578  39.048 1.00 41.92  ? 122  PHE B CD1 1 
ATOM   2462 C CD2 . PHE B 2 148 ? 13.190  87.828  39.173 1.00 35.61  ? 122  PHE B CD2 1 
ATOM   2463 C CE1 . PHE B 2 148 ? 15.731  87.617  38.058 1.00 40.72  ? 122  PHE B CE1 1 
ATOM   2464 C CE2 . PHE B 2 148 ? 13.442  86.864  38.186 1.00 34.34  ? 122  PHE B CE2 1 
ATOM   2465 C CZ  . PHE B 2 148 ? 14.712  86.759  37.630 1.00 43.33  ? 122  PHE B CZ  1 
ATOM   2466 N N   . TYR B 2 149 ? 12.308  88.456  43.124 1.00 42.28  ? 123  TYR B N   1 
ATOM   2467 C CA  . TYR B 2 149 ? 11.338  87.492  43.579 1.00 48.41  ? 123  TYR B CA  1 
ATOM   2468 C C   . TYR B 2 149 ? 10.100  88.365  43.312 1.00 51.87  ? 123  TYR B C   1 
ATOM   2469 O O   . TYR B 2 149 ? 10.074  89.553  43.698 1.00 54.55  ? 123  TYR B O   1 
ATOM   2470 C CB  . TYR B 2 149 ? 11.299  87.189  45.072 1.00 54.53  ? 123  TYR B CB  1 
ATOM   2471 C CG  . TYR B 2 149 ? 10.103  86.335  45.442 1.00 62.51  ? 123  TYR B CG  1 
ATOM   2472 C CD1 . TYR B 2 149 ? 10.110  84.974  45.160 1.00 66.58  ? 123  TYR B CD1 1 
ATOM   2473 C CD2 . TYR B 2 149 ? 8.947   86.891  45.992 1.00 71.08  ? 123  TYR B CD2 1 
ATOM   2474 C CE1 . TYR B 2 149 ? 9.010   84.184  45.401 1.00 73.26  ? 123  TYR B CE1 1 
ATOM   2475 C CE2 . TYR B 2 149 ? 7.818   86.103  46.246 1.00 81.52  ? 123  TYR B CE2 1 
ATOM   2476 C CZ  . TYR B 2 149 ? 7.871   84.746  45.947 1.00 79.07  ? 123  TYR B CZ  1 
ATOM   2477 O OH  . TYR B 2 149 ? 6.809   83.919  46.193 1.00 90.48  ? 123  TYR B OH  1 
ATOM   2478 N N   . PRO B 2 150 ? 9.105   87.809  42.732 1.00 50.74  ? 124  PRO B N   1 
ATOM   2479 C CA  . PRO B 2 150 ? 8.878   86.414  42.199 1.00 51.33  ? 124  PRO B CA  1 
ATOM   2480 C C   . PRO B 2 150 ? 9.474   86.316  40.840 1.00 53.81  ? 124  PRO B C   1 
ATOM   2481 O O   . PRO B 2 150 ? 10.026  87.250  40.305 1.00 58.39  ? 124  PRO B O   1 
ATOM   2482 C CB  . PRO B 2 150 ? 7.318   86.224  42.167 1.00 52.58  ? 124  PRO B CB  1 
ATOM   2483 C CG  . PRO B 2 150 ? 6.840   87.705  42.210 1.00 45.34  ? 124  PRO B CG  1 
ATOM   2484 C CD  . PRO B 2 150 ? 8.038   88.590  42.110 1.00 42.75  ? 124  PRO B CD  1 
ATOM   2485 N N   . ALA B 2 151 ? 9.316   85.094  40.326 1.00 50.24  ? 125  ALA B N   1 
ATOM   2486 C CA  . ALA B 2 151 ? 9.841   84.716  39.058 1.00 48.39  ? 125  ALA B CA  1 
ATOM   2487 C C   . ALA B 2 151 ? 9.279   85.372  37.825 1.00 50.21  ? 125  ALA B C   1 
ATOM   2488 O O   . ALA B 2 151 ? 9.986   85.375  36.832 1.00 52.09  ? 125  ALA B O   1 
ATOM   2489 C CB  . ALA B 2 151 ? 9.745   83.275  38.973 1.00 51.01  ? 125  ALA B CB  1 
ATOM   2490 N N   . LYS B 2 152 ? 8.067   85.929  37.818 1.00 49.32  ? 126  LYS B N   1 
ATOM   2491 C CA  . LYS B 2 152 ? 7.602   86.521  36.570 1.00 44.70  ? 126  LYS B CA  1 
ATOM   2492 C C   . LYS B 2 152 ? 8.377   87.788  36.282 1.00 43.09  ? 126  LYS B C   1 
ATOM   2493 O O   . LYS B 2 152 ? 8.311   88.756  37.042 1.00 39.44  ? 126  LYS B O   1 
ATOM   2494 C CB  . LYS B 2 152 ? 6.118   86.833  36.618 1.00 47.48  ? 126  LYS B CB  1 
ATOM   2495 C CG  . LYS B 2 152 ? 5.659   87.672  35.449 1.00 55.98  ? 126  LYS B CG  1 
ATOM   2496 C CD  . LYS B 2 152 ? 4.829   88.846  35.917 1.00 59.44  ? 126  LYS B CD  1 
ATOM   2497 C CE  . LYS B 2 152 ? 3.374   88.452  36.072 1.00 56.78  ? 126  LYS B CE  1 
ATOM   2498 N NZ  . LYS B 2 152 ? 2.473   89.596  35.772 1.00 66.64  ? 126  LYS B NZ  1 
ATOM   2499 N N   . ILE B 2 153 ? 9.129   87.768  35.187 1.00 42.08  ? 127  ILE B N   1 
ATOM   2500 C CA  . ILE B 2 153 ? 9.926   88.920  34.781 1.00 42.56  ? 127  ILE B CA  1 
ATOM   2501 C C   . ILE B 2 153 ? 10.033  88.990  33.272 1.00 43.56  ? 127  ILE B C   1 
ATOM   2502 O O   . ILE B 2 153 ? 10.103  87.963  32.592 1.00 42.48  ? 127  ILE B O   1 
ATOM   2503 C CB  . ILE B 2 153 ? 11.373  88.874  35.355 1.00 40.11  ? 127  ILE B CB  1 
ATOM   2504 C CG1 . ILE B 2 153 ? 12.059  90.232  35.141 1.00 40.14  ? 127  ILE B CG1 1 
ATOM   2505 C CG2 . ILE B 2 153 ? 12.187  87.806  34.647 1.00 34.76  ? 127  ILE B CG2 1 
ATOM   2506 C CD1 . ILE B 2 153 ? 13.164  90.564  36.127 1.00 32.20  ? 127  ILE B CD1 1 
ATOM   2507 N N   . LYS B 2 154 ? 10.050  90.213  32.755 1.00 48.09  ? 128  LYS B N   1 
ATOM   2508 C CA  . LYS B 2 154 ? 10.178  90.432  31.321 1.00 55.26  ? 128  LYS B CA  1 
ATOM   2509 C C   . LYS B 2 154 ? 11.428  91.272  31.028 1.00 55.07  ? 128  LYS B C   1 
ATOM   2510 O O   . LYS B 2 154 ? 11.488  92.456  31.363 1.00 55.10  ? 128  LYS B O   1 
ATOM   2511 C CB  . LYS B 2 154 ? 8.931   91.128  30.782 1.00 56.70  ? 128  LYS B CB  1 
ATOM   2512 C CG  . LYS B 2 154 ? 8.770   91.079  29.274 1.00 54.99  ? 128  LYS B CG  1 
ATOM   2513 C CD  . LYS B 2 154 ? 7.562   91.899  28.885 1.00 56.73  ? 128  LYS B CD  1 
ATOM   2514 C CE  . LYS B 2 154 ? 7.555   92.242  27.420 1.00 59.49  ? 128  LYS B CE  1 
ATOM   2515 N NZ  . LYS B 2 154 ? 6.156   92.456  26.965 1.00 59.85  ? 128  LYS B NZ  1 
ATOM   2516 N N   . VAL B 2 155 ? 12.421  90.635  30.405 1.00 56.26  ? 129  VAL B N   1 
ATOM   2517 C CA  . VAL B 2 155 ? 13.689  91.271  30.052 1.00 49.99  ? 129  VAL B CA  1 
ATOM   2518 C C   . VAL B 2 155 ? 13.908  91.293  28.522 1.00 48.03  ? 129  VAL B C   1 
ATOM   2519 O O   . VAL B 2 155 ? 14.038  90.243  27.892 1.00 43.43  ? 129  VAL B O   1 
ATOM   2520 C CB  . VAL B 2 155 ? 14.867  90.526  30.733 1.00 44.64  ? 129  VAL B CB  1 
ATOM   2521 C CG1 . VAL B 2 155 ? 16.063  91.439  30.829 1.00 49.36  ? 129  VAL B CG1 1 
ATOM   2522 C CG2 . VAL B 2 155 ? 14.459  90.052  32.127 1.00 30.41  ? 129  VAL B CG2 1 
ATOM   2523 N N   . ARG B 2 156 ? 13.949  92.490  27.935 1.00 47.51  ? 130  ARG B N   1 
ATOM   2524 C CA  . ARG B 2 156 ? 14.144  92.642  26.488 1.00 50.07  ? 130  ARG B CA  1 
ATOM   2525 C C   . ARG B 2 156 ? 15.362  93.475  26.105 1.00 51.34  ? 130  ARG B C   1 
ATOM   2526 O O   . ARG B 2 156 ? 15.674  94.462  26.767 1.00 54.97  ? 130  ARG B O   1 
ATOM   2527 C CB  . ARG B 2 156 ? 12.917  93.290  25.861 1.00 48.75  ? 130  ARG B CB  1 
ATOM   2528 C CG  . ARG B 2 156 ? 11.642  92.580  26.177 1.00 56.15  ? 130  ARG B CG  1 
ATOM   2529 C CD  . ARG B 2 156 ? 10.480  93.318  25.582 1.00 64.66  ? 130  ARG B CD  1 
ATOM   2530 N NE  . ARG B 2 156 ? 10.206  94.551  26.309 1.00 75.28  ? 130  ARG B NE  1 
ATOM   2531 C CZ  . ARG B 2 156 ? 9.027   95.164  26.314 1.00 77.36  ? 130  ARG B CZ  1 
ATOM   2532 N NH1 . ARG B 2 156 ? 8.011   94.656  25.629 1.00 80.84  ? 130  ARG B NH1 1 
ATOM   2533 N NH2 . ARG B 2 156 ? 8.861   96.291  26.993 1.00 77.66  ? 130  ARG B NH2 1 
ATOM   2534 N N   . TRP B 2 157 ? 16.042  93.080  25.029 1.00 50.93  ? 131  TRP B N   1 
ATOM   2535 C CA  . TRP B 2 157 ? 17.209  93.819  24.552 1.00 51.63  ? 131  TRP B CA  1 
ATOM   2536 C C   . TRP B 2 157 ? 16.724  94.767  23.458 1.00 54.88  ? 131  TRP B C   1 
ATOM   2537 O O   . TRP B 2 157 ? 15.941  94.376  22.592 1.00 56.87  ? 131  TRP B O   1 
ATOM   2538 C CB  . TRP B 2 157 ? 18.271  92.870  23.990 1.00 49.02  ? 131  TRP B CB  1 
ATOM   2539 C CG  . TRP B 2 157 ? 19.451  92.606  24.909 1.00 50.39  ? 131  TRP B CG  1 
ATOM   2540 C CD1 . TRP B 2 157 ? 19.928  91.386  25.291 1.00 51.26  ? 131  TRP B CD1 1 
ATOM   2541 C CD2 . TRP B 2 157 ? 20.326  93.578  25.508 1.00 53.72  ? 131  TRP B CD2 1 
ATOM   2542 N NE1 . TRP B 2 157 ? 21.042  91.533  26.085 1.00 50.75  ? 131  TRP B NE1 1 
ATOM   2543 C CE2 . TRP B 2 157 ? 21.309  92.866  26.235 1.00 47.96  ? 131  TRP B CE2 1 
ATOM   2544 C CE3 . TRP B 2 157 ? 20.376  94.978  25.502 1.00 56.10  ? 131  TRP B CE3 1 
ATOM   2545 C CZ2 . TRP B 2 157 ? 22.329  93.505  26.948 1.00 43.99  ? 131  TRP B CZ2 1 
ATOM   2546 C CZ3 . TRP B 2 157 ? 21.395  95.613  26.212 1.00 50.34  ? 131  TRP B CZ3 1 
ATOM   2547 C CH2 . TRP B 2 157 ? 22.356  94.871  26.923 1.00 42.75  ? 131  TRP B CH2 1 
ATOM   2548 N N   . PHE B 2 158 ? 17.194  96.012  23.516 1.00 59.88  ? 132  PHE B N   1 
ATOM   2549 C CA  . PHE B 2 158 ? 16.821  97.065  22.566 1.00 55.76  ? 132  PHE B CA  1 
ATOM   2550 C C   . PHE B 2 158 ? 18.024  97.693  21.887 1.00 55.28  ? 132  PHE B C   1 
ATOM   2551 O O   . PHE B 2 158 ? 19.091  97.801  22.482 1.00 53.12  ? 132  PHE B O   1 
ATOM   2552 C CB  . PHE B 2 158 ? 16.101  98.193  23.294 1.00 53.16  ? 132  PHE B CB  1 
ATOM   2553 C CG  . PHE B 2 158 ? 14.667  97.930  23.547 1.00 55.09  ? 132  PHE B CG  1 
ATOM   2554 C CD1 . PHE B 2 158 ? 13.723  98.227  22.584 1.00 53.57  ? 132  PHE B CD1 1 
ATOM   2555 C CD2 . PHE B 2 158 ? 14.251  97.403  24.759 1.00 58.84  ? 132  PHE B CD2 1 
ATOM   2556 C CE1 . PHE B 2 158 ? 12.380  98.007  22.820 1.00 55.90  ? 132  PHE B CE1 1 
ATOM   2557 C CE2 . PHE B 2 158 ? 12.906  97.177  25.004 1.00 61.88  ? 132  PHE B CE2 1 
ATOM   2558 C CZ  . PHE B 2 158 ? 11.968  97.482  24.030 1.00 57.28  ? 132  PHE B CZ  1 
ATOM   2559 N N   . ARG B 2 159 ? 17.833  98.135  20.647 1.00 62.97  ? 133  ARG B N   1 
ATOM   2560 C CA  . ARG B 2 159 ? 18.887  98.815  19.892 1.00 67.80  ? 133  ARG B CA  1 
ATOM   2561 C C   . ARG B 2 159 ? 18.318  100.146 19.430 1.00 68.76  ? 133  ARG B C   1 
ATOM   2562 O O   . ARG B 2 159 ? 17.413  100.195 18.600 1.00 67.35  ? 133  ARG B O   1 
ATOM   2563 C CB  . ARG B 2 159 ? 19.332  98.000  18.675 1.00 75.21  ? 133  ARG B CB  1 
ATOM   2564 C CG  . ARG B 2 159 ? 20.648  98.489  18.057 1.00 77.67  ? 133  ARG B CG  1 
ATOM   2565 C CD  . ARG B 2 159 ? 20.513  98.808  16.561 1.00 76.38  ? 133  ARG B CD  1 
ATOM   2566 N NE  . ARG B 2 159 ? 20.107  97.646  15.766 1.00 75.22  ? 133  ARG B NE  1 
ATOM   2567 C CZ  . ARG B 2 159 ? 20.637  96.428  15.871 1.00 72.17  ? 133  ARG B CZ  1 
ATOM   2568 N NH1 . ARG B 2 159 ? 21.608  96.188  16.745 1.00 64.65  ? 133  ARG B NH1 1 
ATOM   2569 N NH2 . ARG B 2 159 ? 20.186  95.444  15.101 1.00 67.32  ? 133  ARG B NH2 1 
ATOM   2570 N N   . ASN B 2 160 ? 18.847  101.227 19.984 1.00 71.55  ? 134  ASN B N   1 
ATOM   2571 C CA  . ASN B 2 160 ? 18.381  102.564 19.648 1.00 76.43  ? 134  ASN B CA  1 
ATOM   2572 C C   . ASN B 2 160 ? 16.869  102.702 19.619 1.00 73.88  ? 134  ASN B C   1 
ATOM   2573 O O   . ASN B 2 160 ? 16.325  103.404 18.774 1.00 76.97  ? 134  ASN B O   1 
ATOM   2574 C CB  . ASN B 2 160 ? 18.927  103.016 18.296 1.00 83.69  ? 134  ASN B CB  1 
ATOM   2575 C CG  . ASN B 2 160 ? 18.610  104.478 18.012 1.00 97.71  ? 134  ASN B CG  1 
ATOM   2576 O OD1 . ASN B 2 160 ? 18.276  105.240 18.933 1.00 99.46  ? 134  ASN B OD1 1 
ATOM   2577 N ND2 . ASN B 2 160 ? 18.708  104.879 16.743 1.00 100.00 ? 134  ASN B ND2 1 
ATOM   2578 N N   . GLY B 2 161 ? 16.180  102.040 20.532 1.00 68.48  ? 135  GLY B N   1 
ATOM   2579 C CA  . GLY B 2 161 ? 14.744  102.165 20.535 1.00 67.29  ? 135  GLY B CA  1 
ATOM   2580 C C   . GLY B 2 161 ? 14.087  100.964 19.912 1.00 69.29  ? 135  GLY B C   1 
ATOM   2581 O O   . GLY B 2 161 ? 13.027  100.553 20.367 1.00 75.12  ? 135  GLY B O   1 
ATOM   2582 N N   . GLN B 2 162 ? 14.692  100.396 18.876 1.00 70.24  ? 136  GLN B N   1 
ATOM   2583 C CA  . GLN B 2 162 ? 14.097  99.223  18.259 1.00 70.34  ? 136  GLN B CA  1 
ATOM   2584 C C   . GLN B 2 162 ? 14.371  98.006  19.155 1.00 68.41  ? 136  GLN B C   1 
ATOM   2585 O O   . GLN B 2 162 ? 15.485  97.827  19.657 1.00 61.61  ? 136  GLN B O   1 
ATOM   2586 C CB  . GLN B 2 162 ? 14.666  99.015  16.851 1.00 74.22  ? 136  GLN B CB  1 
ATOM   2587 C CG  . GLN B 2 162 ? 16.114  98.561  16.835 1.00 89.61  ? 136  GLN B CG  1 
ATOM   2588 C CD  . GLN B 2 162 ? 16.536  97.937  15.513 1.00 96.41  ? 136  GLN B CD  1 
ATOM   2589 O OE1 . GLN B 2 162 ? 17.611  98.245  14.984 1.00 94.81  ? 136  GLN B OE1 1 
ATOM   2590 N NE2 . GLN B 2 162 ? 15.692  97.054  14.972 1.00 100.00 ? 136  GLN B NE2 1 
ATOM   2591 N N   . GLU B 2 163 ? 13.336  97.198  19.382 1.00 66.84  ? 137  GLU B N   1 
ATOM   2592 C CA  . GLU B 2 163 ? 13.450  95.998  20.206 1.00 60.44  ? 137  GLU B CA  1 
ATOM   2593 C C   . GLU B 2 163 ? 14.231  94.941  19.431 1.00 59.02  ? 137  GLU B C   1 
ATOM   2594 O O   . GLU B 2 163 ? 13.859  94.583  18.306 1.00 56.21  ? 137  GLU B O   1 
ATOM   2595 C CB  . GLU B 2 163 ? 12.060  95.458  20.555 1.00 54.12  ? 137  GLU B CB  1 
ATOM   2596 C CG  . GLU B 2 163 ? 12.079  94.067  21.167 1.00 59.32  ? 137  GLU B CG  1 
ATOM   2597 C CD  . GLU B 2 163 ? 10.777  93.704  21.852 1.00 64.85  ? 137  GLU B CD  1 
ATOM   2598 O OE1 . GLU B 2 163 ? 9.782   94.437  21.677 1.00 66.04  ? 137  GLU B OE1 1 
ATOM   2599 O OE2 . GLU B 2 163 ? 10.749  92.681  22.568 1.00 67.58  ? 137  GLU B OE2 1 
ATOM   2600 N N   . GLU B 2 164 ? 15.313  94.447  20.030 1.00 56.67  ? 138  GLU B N   1 
ATOM   2601 C CA  . GLU B 2 164 ? 16.142  93.430  19.382 1.00 55.46  ? 138  GLU B CA  1 
ATOM   2602 C C   . GLU B 2 164 ? 15.743  92.039  19.826 1.00 49.39  ? 138  GLU B C   1 
ATOM   2603 O O   . GLU B 2 164 ? 15.759  91.737  21.020 1.00 49.47  ? 138  GLU B O   1 
ATOM   2604 C CB  . GLU B 2 164 ? 17.619  93.649  19.695 1.00 62.38  ? 138  GLU B CB  1 
ATOM   2605 C CG  . GLU B 2 164 ? 18.554  92.912  18.746 1.00 66.83  ? 138  GLU B CG  1 
ATOM   2606 C CD  . GLU B 2 164 ? 18.476  93.441  17.333 1.00 66.49  ? 138  GLU B CD  1 
ATOM   2607 O OE1 . GLU B 2 164 ? 18.632  94.669  17.149 1.00 66.01  ? 138  GLU B OE1 1 
ATOM   2608 O OE2 . GLU B 2 164 ? 18.259  92.623  16.414 1.00 67.91  ? 138  GLU B OE2 1 
ATOM   2609 N N   . THR B 2 165 ? 15.415  91.191  18.859 1.00 44.01  ? 139  THR B N   1 
ATOM   2610 C CA  . THR B 2 165 ? 14.974  89.836  19.151 1.00 44.29  ? 139  THR B CA  1 
ATOM   2611 C C   . THR B 2 165 ? 15.853  88.788  18.509 1.00 40.75  ? 139  THR B C   1 
ATOM   2612 O O   . THR B 2 165 ? 15.892  87.657  18.957 1.00 45.96  ? 139  THR B O   1 
ATOM   2613 C CB  . THR B 2 165 ? 13.565  89.607  18.634 1.00 48.55  ? 139  THR B CB  1 
ATOM   2614 O OG1 . THR B 2 165 ? 13.460  90.140  17.310 1.00 58.59  ? 139  THR B OG1 1 
ATOM   2615 C CG2 . THR B 2 165 ? 12.558  90.299  19.527 1.00 53.09  ? 139  THR B CG2 1 
ATOM   2616 N N   . VAL B 2 166 ? 16.539  89.168  17.442 1.00 38.62  ? 140  VAL B N   1 
ATOM   2617 C CA  . VAL B 2 166 ? 17.415  88.249  16.734 1.00 33.45  ? 140  VAL B CA  1 
ATOM   2618 C C   . VAL B 2 166 ? 18.808  88.294  17.357 1.00 31.49  ? 140  VAL B C   1 
ATOM   2619 O O   . VAL B 2 166 ? 19.299  89.358  17.726 1.00 38.47  ? 140  VAL B O   1 
ATOM   2620 C CB  . VAL B 2 166 ? 17.476  88.630  15.241 1.00 34.09  ? 140  VAL B CB  1 
ATOM   2621 C CG1 . VAL B 2 166 ? 18.591  87.886  14.551 1.00 37.08  ? 140  VAL B CG1 1 
ATOM   2622 C CG2 . VAL B 2 166 ? 16.142  88.318  14.589 1.00 26.62  ? 140  VAL B CG2 1 
ATOM   2623 N N   . GLY B 2 167 ? 19.452  87.143  17.464 1.00 31.89  ? 141  GLY B N   1 
ATOM   2624 C CA  . GLY B 2 167 ? 20.772  87.098  18.070 1.00 35.35  ? 141  GLY B CA  1 
ATOM   2625 C C   . GLY B 2 167 ? 20.707  87.127  19.592 1.00 40.00  ? 141  GLY B C   1 
ATOM   2626 O O   . GLY B 2 167 ? 21.739  87.100  20.279 1.00 42.21  ? 141  GLY B O   1 
ATOM   2627 N N   . VAL B 2 168 ? 19.484  87.175  20.118 1.00 41.18  ? 142  VAL B N   1 
ATOM   2628 C CA  . VAL B 2 168 ? 19.246  87.225  21.561 1.00 36.37  ? 142  VAL B CA  1 
ATOM   2629 C C   . VAL B 2 168 ? 19.056  85.835  22.132 1.00 34.96  ? 142  VAL B C   1 
ATOM   2630 O O   . VAL B 2 168 ? 18.399  84.994  21.530 1.00 38.57  ? 142  VAL B O   1 
ATOM   2631 C CB  . VAL B 2 168 ? 17.973  88.037  21.899 1.00 35.54  ? 142  VAL B CB  1 
ATOM   2632 C CG1 . VAL B 2 168 ? 17.820  88.158  23.402 1.00 26.46  ? 142  VAL B CG1 1 
ATOM   2633 C CG2 . VAL B 2 168 ? 18.041  89.409  21.264 1.00 34.27  ? 142  VAL B CG2 1 
ATOM   2634 N N   . SER B 2 169 ? 19.621  85.598  23.304 1.00 33.67  ? 143  SER B N   1 
ATOM   2635 C CA  . SER B 2 169 ? 19.492  84.301  23.945 1.00 38.10  ? 143  SER B CA  1 
ATOM   2636 C C   . SER B 2 169 ? 19.396  84.470  25.442 1.00 38.56  ? 143  SER B C   1 
ATOM   2637 O O   . SER B 2 169 ? 20.245  85.109  26.061 1.00 38.75  ? 143  SER B O   1 
ATOM   2638 C CB  . SER B 2 169 ? 20.687  83.416  23.605 1.00 42.95  ? 143  SER B CB  1 
ATOM   2639 O OG  . SER B 2 169 ? 20.550  82.878  22.301 1.00 52.30  ? 143  SER B OG  1 
ATOM   2640 N N   . SER B 2 170 ? 18.351  83.893  26.021 1.00 43.51  ? 144  SER B N   1 
ATOM   2641 C CA  . SER B 2 170 ? 18.133  83.976  27.456 1.00 43.45  ? 144  SER B CA  1 
ATOM   2642 C C   . SER B 2 170 ? 18.321  82.640  28.149 1.00 41.92  ? 144  SER B C   1 
ATOM   2643 O O   . SER B 2 170 ? 17.961  81.594  27.621 1.00 47.99  ? 144  SER B O   1 
ATOM   2644 C CB  . SER B 2 170 ? 16.727  84.486  27.747 1.00 43.81  ? 144  SER B CB  1 
ATOM   2645 O OG  . SER B 2 170 ? 16.627  84.910  29.096 1.00 60.78  ? 144  SER B OG  1 
ATOM   2646 N N   . THR B 2 171 ? 18.895  82.674  29.340 1.00 44.22  ? 145  THR B N   1 
ATOM   2647 C CA  . THR B 2 171 ? 19.084  81.445  30.089 1.00 43.69  ? 145  THR B CA  1 
ATOM   2648 C C   . THR B 2 171 ? 17.730  81.070  30.657 1.00 44.31  ? 145  THR B C   1 
ATOM   2649 O O   . THR B 2 171 ? 16.747  81.814  30.524 1.00 36.51  ? 145  THR B O   1 
ATOM   2650 C CB  . THR B 2 171 ? 20.059  81.622  31.297 1.00 44.58  ? 145  THR B CB  1 
ATOM   2651 O OG1 . THR B 2 171 ? 19.388  82.299  32.371 1.00 44.31  ? 145  THR B OG1 1 
ATOM   2652 C CG2 . THR B 2 171 ? 21.279  82.420  30.898 1.00 43.15  ? 145  THR B CG2 1 
ATOM   2653 N N   . GLN B 2 172 ? 17.677  79.900  31.276 1.00 49.29  ? 146  GLN B N   1 
ATOM   2654 C CA  . GLN B 2 172 ? 16.449  79.476  31.913 1.00 47.59  ? 146  GLN B CA  1 
ATOM   2655 C C   . GLN B 2 172 ? 16.505  80.205  33.258 1.00 49.42  ? 146  GLN B C   1 
ATOM   2656 O O   . GLN B 2 172 ? 17.486  80.900  33.553 1.00 53.79  ? 146  GLN B O   1 
ATOM   2657 C CB  . GLN B 2 172 ? 16.438  77.962  32.118 1.00 38.06  ? 146  GLN B CB  1 
ATOM   2658 C CG  . GLN B 2 172 ? 15.044  77.405  32.266 1.00 47.02  ? 146  GLN B CG  1 
ATOM   2659 C CD  . GLN B 2 172 ? 14.244  77.483  30.984 1.00 45.19  ? 146  GLN B CD  1 
ATOM   2660 O OE1 . GLN B 2 172 ? 14.575  76.824  29.998 1.00 48.42  ? 146  GLN B OE1 1 
ATOM   2661 N NE2 . GLN B 2 172 ? 13.184  78.287  30.989 1.00 35.27  ? 146  GLN B NE2 1 
ATOM   2662 N N   . LEU B 2 173 ? 15.461  80.071  34.068 1.00 51.42  ? 147  LEU B N   1 
ATOM   2663 C CA  . LEU B 2 173 ? 15.449  80.732  35.367 1.00 42.27  ? 147  LEU B CA  1 
ATOM   2664 C C   . LEU B 2 173 ? 16.419  80.076  36.326 1.00 39.77  ? 147  LEU B C   1 
ATOM   2665 O O   . LEU B 2 173 ? 16.551  78.856  36.362 1.00 43.48  ? 147  LEU B O   1 
ATOM   2666 C CB  . LEU B 2 173 ? 14.052  80.721  35.970 1.00 38.70  ? 147  LEU B CB  1 
ATOM   2667 C CG  . LEU B 2 173 ? 13.407  82.103  35.910 1.00 41.21  ? 147  LEU B CG  1 
ATOM   2668 C CD1 . LEU B 2 173 ? 12.101  82.113  36.675 1.00 44.15  ? 147  LEU B CD1 1 
ATOM   2669 C CD2 . LEU B 2 173 ? 14.367  83.119  36.490 1.00 50.79  ? 147  LEU B CD2 1 
ATOM   2670 N N   . ILE B 2 174 ? 17.108  80.897  37.101 1.00 40.10  ? 148  ILE B N   1 
ATOM   2671 C CA  . ILE B 2 174 ? 18.076  80.391  38.048 1.00 42.44  ? 148  ILE B CA  1 
ATOM   2672 C C   . ILE B 2 174 ? 17.556  80.677  39.434 1.00 41.98  ? 148  ILE B C   1 
ATOM   2673 O O   . ILE B 2 174 ? 17.435  81.828  39.847 1.00 45.13  ? 148  ILE B O   1 
ATOM   2674 C CB  . ILE B 2 174 ? 19.453  81.054  37.835 1.00 45.99  ? 148  ILE B CB  1 
ATOM   2675 C CG1 . ILE B 2 174 ? 20.025  80.600  36.485 1.00 50.69  ? 148  ILE B CG1 1 
ATOM   2676 C CG2 . ILE B 2 174 ? 20.398  80.686  38.969 1.00 44.40  ? 148  ILE B CG2 1 
ATOM   2677 C CD1 . ILE B 2 174 ? 21.278  81.341  36.053 1.00 50.65  ? 148  ILE B CD1 1 
ATOM   2678 N N   . ARG B 2 175 ? 17.218  79.609  40.135 1.00 39.74  ? 149  ARG B N   1 
ATOM   2679 C CA  . ARG B 2 175 ? 16.700  79.720  41.477 1.00 41.53  ? 149  ARG B CA  1 
ATOM   2680 C C   . ARG B 2 175 ? 17.885  79.715  42.442 1.00 43.10  ? 149  ARG B C   1 
ATOM   2681 O O   . ARG B 2 175 ? 18.541  78.691  42.610 1.00 39.65  ? 149  ARG B O   1 
ATOM   2682 C CB  . ARG B 2 175 ? 15.766  78.542  41.753 1.00 38.33  ? 149  ARG B CB  1 
ATOM   2683 C CG  . ARG B 2 175 ? 15.143  78.535  43.136 1.00 34.39  ? 149  ARG B CG  1 
ATOM   2684 C CD  . ARG B 2 175 ? 13.958  77.595  43.201 1.00 31.22  ? 149  ARG B CD  1 
ATOM   2685 N NE  . ARG B 2 175 ? 12.701  78.329  43.317 1.00 38.18  ? 149  ARG B NE  1 
ATOM   2686 C CZ  . ARG B 2 175 ? 11.634  78.100  42.558 1.00 38.89  ? 149  ARG B CZ  1 
ATOM   2687 N NH1 . ARG B 2 175 ? 11.679  77.157  41.631 1.00 42.34  ? 149  ARG B NH1 1 
ATOM   2688 N NH2 . ARG B 2 175 ? 10.523  78.813  42.716 1.00 45.35  ? 149  ARG B NH2 1 
ATOM   2689 N N   . ASN B 2 176 ? 18.147  80.865  43.067 1.00 48.58  ? 150  ASN B N   1 
ATOM   2690 C CA  . ASN B 2 176 ? 19.256  81.027  44.014 1.00 47.88  ? 150  ASN B CA  1 
ATOM   2691 C C   . ASN B 2 176 ? 19.126  80.191  45.293 1.00 47.43  ? 150  ASN B C   1 
ATOM   2692 O O   . ASN B 2 176 ? 20.130  79.726  45.840 1.00 40.91  ? 150  ASN B O   1 
ATOM   2693 C CB  . ASN B 2 176 ? 19.419  82.511  44.366 1.00 49.40  ? 150  ASN B CB  1 
ATOM   2694 C CG  . ASN B 2 176 ? 19.921  83.333  43.190 1.00 46.59  ? 150  ASN B CG  1 
ATOM   2695 O OD1 . ASN B 2 176 ? 20.724  82.859  42.384 1.00 42.79  ? 150  ASN B OD1 1 
ATOM   2696 N ND2 . ASN B 2 176 ? 19.447  84.570  43.083 1.00 50.85  ? 150  ASN B ND2 1 
ATOM   2697 N N   . GLY B 2 177 ? 17.898  80.003  45.772 1.00 47.65  ? 151  GLY B N   1 
ATOM   2698 C CA  . GLY B 2 177 ? 17.695  79.196  46.963 1.00 48.31  ? 151  GLY B CA  1 
ATOM   2699 C C   . GLY B 2 177 ? 17.379  80.005  48.201 1.00 50.76  ? 151  GLY B C   1 
ATOM   2700 O O   . GLY B 2 177 ? 17.022  79.451  49.241 1.00 52.81  ? 151  GLY B O   1 
ATOM   2701 N N   . ASP B 2 178 ? 17.502  81.321  48.086 1.00 49.16  ? 152  ASP B N   1 
ATOM   2702 C CA  . ASP B 2 178 ? 17.235  82.216  49.198 1.00 42.98  ? 152  ASP B CA  1 
ATOM   2703 C C   . ASP B 2 178 ? 15.997  83.052  48.897 1.00 42.61  ? 152  ASP B C   1 
ATOM   2704 O O   . ASP B 2 178 ? 15.850  84.165  49.389 1.00 43.81  ? 152  ASP B O   1 
ATOM   2705 C CB  . ASP B 2 178 ? 18.432  83.128  49.404 1.00 44.87  ? 152  ASP B CB  1 
ATOM   2706 C CG  . ASP B 2 178 ? 19.190  83.379  48.123 1.00 48.75  ? 152  ASP B CG  1 
ATOM   2707 O OD1 . ASP B 2 178 ? 18.536  83.626  47.088 1.00 52.45  ? 152  ASP B OD1 1 
ATOM   2708 O OD2 . ASP B 2 178 ? 20.435  83.323  48.160 1.00 50.63  ? 152  ASP B OD2 1 
ATOM   2709 N N   . TRP B 2 179 ? 15.103  82.504  48.085 1.00 42.96  ? 153  TRP B N   1 
ATOM   2710 C CA  . TRP B 2 179 ? 13.876  83.190  47.705 1.00 42.91  ? 153  TRP B CA  1 
ATOM   2711 C C   . TRP B 2 179 ? 14.142  84.323  46.696 1.00 46.00  ? 153  TRP B C   1 
ATOM   2712 O O   . TRP B 2 179 ? 13.403  85.318  46.625 1.00 42.96  ? 153  TRP B O   1 
ATOM   2713 C CB  . TRP B 2 179 ? 13.145  83.695  48.964 1.00 33.48  ? 153  TRP B CB  1 
ATOM   2714 C CG  . TRP B 2 179 ? 12.502  82.588  49.749 1.00 25.58  ? 153  TRP B CG  1 
ATOM   2715 C CD1 . TRP B 2 179 ? 13.133  81.687  50.568 1.00 30.32  ? 153  TRP B CD1 1 
ATOM   2716 C CD2 . TRP B 2 179 ? 11.123  82.226  49.751 1.00 30.17  ? 153  TRP B CD2 1 
ATOM   2717 N NE1 . TRP B 2 179 ? 12.232  80.784  51.068 1.00 30.42  ? 153  TRP B NE1 1 
ATOM   2718 C CE2 . TRP B 2 179 ? 10.979  81.093  50.582 1.00 36.64  ? 153  TRP B CE2 1 
ATOM   2719 C CE3 . TRP B 2 179 ? 9.981   82.742  49.124 1.00 34.08  ? 153  TRP B CE3 1 
ATOM   2720 C CZ2 . TRP B 2 179 ? 9.746   80.462  50.804 1.00 38.78  ? 153  TRP B CZ2 1 
ATOM   2721 C CZ3 . TRP B 2 179 ? 8.753   82.120  49.345 1.00 40.26  ? 153  TRP B CZ3 1 
ATOM   2722 C CH2 . TRP B 2 179 ? 8.648   80.993  50.177 1.00 38.80  ? 153  TRP B CH2 1 
ATOM   2723 N N   . THR B 2 180 ? 15.202  84.137  45.905 1.00 47.55  ? 154  THR B N   1 
ATOM   2724 C CA  . THR B 2 180 ? 15.609  85.083  44.860 1.00 44.21  ? 154  THR B CA  1 
ATOM   2725 C C   . THR B 2 180 ? 16.055  84.293  43.632 1.00 44.86  ? 154  THR B C   1 
ATOM   2726 O O   . THR B 2 180 ? 16.642  83.214  43.763 1.00 38.62  ? 154  THR B O   1 
ATOM   2727 C CB  . THR B 2 180 ? 16.804  85.954  45.281 1.00 43.99  ? 154  THR B CB  1 
ATOM   2728 O OG1 . THR B 2 180 ? 17.974  85.134  45.372 1.00 35.59  ? 154  THR B OG1 1 
ATOM   2729 C CG2 . THR B 2 180 ? 16.534  86.624  46.612 1.00 44.99  ? 154  THR B CG2 1 
ATOM   2730 N N   . PHE B 2 181 ? 15.765  84.838  42.451 1.00 44.28  ? 155  PHE B N   1 
ATOM   2731 C CA  . PHE B 2 181 ? 16.147  84.223  41.175 1.00 40.88  ? 155  PHE B CA  1 
ATOM   2732 C C   . PHE B 2 181 ? 17.086  85.180  40.466 1.00 44.99  ? 155  PHE B C   1 
ATOM   2733 O O   . PHE B 2 181 ? 17.373  86.275  40.950 1.00 50.78  ? 155  PHE B O   1 
ATOM   2734 C CB  . PHE B 2 181 ? 14.955  84.058  40.231 1.00 33.74  ? 155  PHE B CB  1 
ATOM   2735 C CG  . PHE B 2 181 ? 13.886  83.161  40.733 1.00 35.98  ? 155  PHE B CG  1 
ATOM   2736 C CD1 . PHE B 2 181 ? 13.958  81.794  40.523 1.00 34.56  ? 155  PHE B CD1 1 
ATOM   2737 C CD2 . PHE B 2 181 ? 12.747  83.695  41.325 1.00 32.33  ? 155  PHE B CD2 1 
ATOM   2738 C CE1 . PHE B 2 181 ? 12.904  80.973  40.884 1.00 37.72  ? 155  PHE B CE1 1 
ATOM   2739 C CE2 . PHE B 2 181 ? 11.687  82.883  41.691 1.00 29.47  ? 155  PHE B CE2 1 
ATOM   2740 C CZ  . PHE B 2 181 ? 11.761  81.522  41.469 1.00 38.48  ? 155  PHE B CZ  1 
ATOM   2741 N N   . GLN B 2 182 ? 17.533  84.768  39.285 1.00 47.81  ? 156  GLN B N   1 
ATOM   2742 C CA  . GLN B 2 182 ? 18.372  85.609  38.427 1.00 48.09  ? 156  GLN B CA  1 
ATOM   2743 C C   . GLN B 2 182 ? 18.245  85.127  36.993 1.00 42.07  ? 156  GLN B C   1 
ATOM   2744 O O   . GLN B 2 182 ? 17.772  84.023  36.736 1.00 43.25  ? 156  GLN B O   1 
ATOM   2745 C CB  . GLN B 2 182 ? 19.829  85.534  38.903 1.00 52.51  ? 156  GLN B CB  1 
ATOM   2746 C CG  . GLN B 2 182 ? 20.584  84.272  38.536 1.00 55.16  ? 156  GLN B CG  1 
ATOM   2747 C CD  . GLN B 2 182 ? 22.048  84.352  38.902 1.00 57.86  ? 156  GLN B CD  1 
ATOM   2748 O OE1 . GLN B 2 182 ? 22.784  85.177  38.364 1.00 62.37  ? 156  GLN B OE1 1 
ATOM   2749 N NE2 . GLN B 2 182 ? 22.480  83.493  39.824 1.00 52.93  ? 156  GLN B NE2 1 
ATOM   2750 N N   . VAL B 2 183 ? 18.647  85.965  36.056 1.00 37.07  ? 157  VAL B N   1 
ATOM   2751 C CA  . VAL B 2 183 ? 18.565  85.572  34.665 1.00 35.17  ? 157  VAL B CA  1 
ATOM   2752 C C   . VAL B 2 183 ? 19.516  86.390  33.829 1.00 33.88  ? 157  VAL B C   1 
ATOM   2753 O O   . VAL B 2 183 ? 19.650  87.594  34.020 1.00 44.33  ? 157  VAL B O   1 
ATOM   2754 C CB  . VAL B 2 183 ? 17.130  85.742  34.106 1.00 31.04  ? 157  VAL B CB  1 
ATOM   2755 C CG1 . VAL B 2 183 ? 16.852  87.195  33.755 1.00 29.56  ? 157  VAL B CG1 1 
ATOM   2756 C CG2 . VAL B 2 183 ? 16.962  84.867  32.888 1.00 26.03  ? 157  VAL B CG2 1 
ATOM   2757 N N   . LEU B 2 184 ? 20.192  85.723  32.911 1.00 34.13  ? 158  LEU B N   1 
ATOM   2758 C CA  . LEU B 2 184 ? 21.133  86.397  32.034 1.00 36.77  ? 158  LEU B CA  1 
ATOM   2759 C C   . LEU B 2 184 ? 20.667  86.299  30.569 1.00 35.29  ? 158  LEU B C   1 
ATOM   2760 O O   . LEU B 2 184 ? 20.305  85.218  30.093 1.00 28.88  ? 158  LEU B O   1 
ATOM   2761 C CB  . LEU B 2 184 ? 22.521  85.773  32.213 1.00 40.64  ? 158  LEU B CB  1 
ATOM   2762 C CG  . LEU B 2 184 ? 23.137  85.809  33.620 1.00 40.10  ? 158  LEU B CG  1 
ATOM   2763 C CD1 . LEU B 2 184 ? 22.557  86.954  34.445 1.00 42.41  ? 158  LEU B CD1 1 
ATOM   2764 C CD2 . LEU B 2 184 ? 22.890  84.486  34.296 1.00 38.45  ? 158  LEU B CD2 1 
ATOM   2765 N N   . VAL B 2 185 ? 20.655  87.432  29.871 1.00 35.18  ? 159  VAL B N   1 
ATOM   2766 C CA  . VAL B 2 185 ? 20.234  87.478  28.469 1.00 39.65  ? 159  VAL B CA  1 
ATOM   2767 C C   . VAL B 2 185 ? 21.391  87.946  27.594 1.00 38.75  ? 159  VAL B C   1 
ATOM   2768 O O   . VAL B 2 185 ? 21.881  89.050  27.766 1.00 42.68  ? 159  VAL B O   1 
ATOM   2769 C CB  . VAL B 2 185 ? 19.052  88.451  28.280 1.00 38.85  ? 159  VAL B CB  1 
ATOM   2770 C CG1 . VAL B 2 185 ? 18.400  88.216  26.926 1.00 32.26  ? 159  VAL B CG1 1 
ATOM   2771 C CG2 . VAL B 2 185 ? 18.046  88.277  29.416 1.00 32.41  ? 159  VAL B CG2 1 
ATOM   2772 N N   . MET B 2 186 ? 21.825  87.112  26.657 1.00 44.74  ? 160  MET B N   1 
ATOM   2773 C CA  . MET B 2 186 ? 22.942  87.473  25.782 1.00 56.46  ? 160  MET B CA  1 
ATOM   2774 C C   . MET B 2 186 ? 22.466  88.116  24.482 1.00 60.03  ? 160  MET B C   1 
ATOM   2775 O O   . MET B 2 186 ? 21.322  87.931  24.068 1.00 61.30  ? 160  MET B O   1 
ATOM   2776 C CB  . MET B 2 186 ? 23.781  86.226  25.430 1.00 60.77  ? 160  MET B CB  1 
ATOM   2777 C CG  . MET B 2 186 ? 24.513  85.542  26.597 1.00 71.88  ? 160  MET B CG  1 
ATOM   2778 S SD  . MET B 2 186 ? 23.496  85.220  28.086 1.00 79.76  ? 160  MET B SD  1 
ATOM   2779 C CE  . MET B 2 186 ? 23.924  83.513  28.486 1.00 68.19  ? 160  MET B CE  1 
ATOM   2780 N N   . LEU B 2 187 ? 23.349  88.885  23.854 1.00 63.27  ? 161  LEU B N   1 
ATOM   2781 C CA  . LEU B 2 187 ? 23.059  89.497  22.563 1.00 65.58  ? 161  LEU B CA  1 
ATOM   2782 C C   . LEU B 2 187 ? 24.357  89.562  21.779 1.00 66.15  ? 161  LEU B C   1 
ATOM   2783 O O   . LEU B 2 187 ? 25.303  90.223  22.193 1.00 63.30  ? 161  LEU B O   1 
ATOM   2784 C CB  . LEU B 2 187 ? 22.486  90.919  22.684 1.00 64.53  ? 161  LEU B CB  1 
ATOM   2785 C CG  . LEU B 2 187 ? 22.436  91.694  21.343 1.00 62.85  ? 161  LEU B CG  1 
ATOM   2786 C CD1 . LEU B 2 187 ? 21.629  90.907  20.307 1.00 63.53  ? 161  LEU B CD1 1 
ATOM   2787 C CD2 . LEU B 2 187 ? 21.827  93.076  21.543 1.00 50.46  ? 161  LEU B CD2 1 
ATOM   2788 N N   . GLU B 2 188 ? 24.416  88.857  20.660 1.00 69.49  ? 162  GLU B N   1 
ATOM   2789 C CA  . GLU B 2 188 ? 25.609  88.885  19.829 1.00 77.89  ? 162  GLU B CA  1 
ATOM   2790 C C   . GLU B 2 188 ? 25.414  90.004  18.812 1.00 81.11  ? 162  GLU B C   1 
ATOM   2791 O O   . GLU B 2 188 ? 24.556  89.919  17.933 1.00 83.77  ? 162  GLU B O   1 
ATOM   2792 C CB  . GLU B 2 188 ? 25.769  87.538  19.150 1.00 78.01  ? 162  GLU B CB  1 
ATOM   2793 C CG  . GLU B 2 188 ? 26.046  86.444  20.149 1.00 87.60  ? 162  GLU B CG  1 
ATOM   2794 C CD  . GLU B 2 188 ? 26.407  85.140  19.484 1.00 97.28  ? 162  GLU B CD  1 
ATOM   2795 O OE1 . GLU B 2 188 ? 25.483  84.356  19.178 1.00 100.00 ? 162  GLU B OE1 1 
ATOM   2796 O OE2 . GLU B 2 188 ? 27.614  84.911  19.256 1.00 100.00 ? 162  GLU B OE2 1 
ATOM   2797 N N   . MET B 2 189 ? 26.232  91.044  18.937 1.00 82.60  ? 163  MET B N   1 
ATOM   2798 C CA  . MET B 2 189 ? 26.142  92.219  18.092 1.00 83.06  ? 163  MET B CA  1 
ATOM   2799 C C   . MET B 2 189 ? 27.302  92.476  17.165 1.00 84.20  ? 163  MET B C   1 
ATOM   2800 O O   . MET B 2 189 ? 28.475  92.196  17.457 1.00 80.95  ? 163  MET B O   1 
ATOM   2801 C CB  . MET B 2 189 ? 25.942  93.443  18.962 1.00 86.77  ? 163  MET B CB  1 
ATOM   2802 C CG  . MET B 2 189 ? 27.079  93.634  19.963 1.00 90.89  ? 163  MET B CG  1 
ATOM   2803 S SD  . MET B 2 189 ? 27.001  95.223  20.762 1.00 100.00 ? 163  MET B SD  1 
ATOM   2804 C CE  . MET B 2 189 ? 28.756  95.535  21.126 1.00 95.91  ? 163  MET B CE  1 
ATOM   2805 N N   . THR B 2 190 ? 26.947  93.064  16.024 1.00 88.10  ? 164  THR B N   1 
ATOM   2806 C CA  . THR B 2 190 ? 27.895  93.447  14.962 1.00 89.18  ? 164  THR B CA  1 
ATOM   2807 C C   . THR B 2 190 ? 27.381  94.871  14.794 1.00 88.94  ? 164  THR B C   1 
ATOM   2808 O O   . THR B 2 190 ? 26.622  95.203  13.884 1.00 90.75  ? 164  THR B O   1 
ATOM   2809 C CB  . THR B 2 190 ? 27.658  92.655  13.727 1.00 92.48  ? 164  THR B CB  1 
ATOM   2810 O OG1 . THR B 2 190 ? 26.293  92.253  13.645 1.00 89.87  ? 164  THR B OG1 1 
ATOM   2811 C CG2 . THR B 2 190 ? 28.560  91.420  13.749 1.00 94.03  ? 164  THR B CG2 1 
ATOM   2812 N N   . PRO B 2 191 ? 27.851  95.750  15.717 1.00 88.30  ? 165  PRO B N   1 
ATOM   2813 C CA  . PRO B 2 191 ? 27.693  97.153  16.019 1.00 89.74  ? 165  PRO B CA  1 
ATOM   2814 C C   . PRO B 2 191 ? 28.210  98.275  15.140 1.00 92.93  ? 165  PRO B C   1 
ATOM   2815 O O   . PRO B 2 191 ? 29.139  98.189  14.347 1.00 93.23  ? 165  PRO B O   1 
ATOM   2816 C CB  . PRO B 2 191 ? 28.264  97.274  17.427 1.00 85.53  ? 165  PRO B CB  1 
ATOM   2817 C CG  . PRO B 2 191 ? 28.851  95.960  17.773 1.00 77.02  ? 165  PRO B CG  1 
ATOM   2818 C CD  . PRO B 2 191 ? 28.903  95.134  16.568 1.00 78.27  ? 165  PRO B CD  1 
ATOM   2819 N N   . HIS B 2 192 ? 27.550  99.382  15.398 1.00 95.27  ? 166  HIS B N   1 
ATOM   2820 C CA  . HIS B 2 192 ? 27.853  100.583 14.701 1.00 99.22  ? 166  HIS B CA  1 
ATOM   2821 C C   . HIS B 2 192 ? 27.425  101.998 14.983 1.00 100.00 ? 166  HIS B C   1 
ATOM   2822 O O   . HIS B 2 192 ? 26.492  102.513 14.391 1.00 100.00 ? 166  HIS B O   1 
ATOM   2823 C CB  . HIS B 2 192 ? 27.502  100.471 13.229 1.00 100.00 ? 166  HIS B CB  1 
ATOM   2824 C CG  . HIS B 2 192 ? 28.004  101.638 12.389 1.00 100.00 ? 166  HIS B CG  1 
ATOM   2825 N ND1 . HIS B 2 192 ? 27.867  101.802 11.025 1.00 100.00 ? 166  HIS B ND1 1 
ATOM   2826 C CD2 . HIS B 2 192 ? 28.812  102.649 12.798 1.00 100.00 ? 166  HIS B CD2 1 
ATOM   2827 C CE1 . HIS B 2 192 ? 28.586  102.838 10.632 1.00 100.00 ? 166  HIS B CE1 1 
ATOM   2828 N NE2 . HIS B 2 192 ? 29.163  103.362 11.685 1.00 100.00 ? 166  HIS B NE2 1 
ATOM   2829 N N   . GLN B 2 193 ? 28.200  102.757 15.743 1.00 100.00 ? 167  GLN B N   1 
ATOM   2830 C CA  . GLN B 2 193 ? 27.778  104.130 15.814 1.00 100.00 ? 167  GLN B CA  1 
ATOM   2831 C C   . GLN B 2 193 ? 27.394  104.620 17.159 1.00 100.00 ? 167  GLN B C   1 
ATOM   2832 O O   . GLN B 2 193 ? 27.967  104.168 18.125 1.00 100.00 ? 167  GLN B O   1 
ATOM   2833 N N   . GLY B 2 194 ? 26.471  105.575 17.200 1.00 100.00 ? 168  GLY B N   1 
ATOM   2834 C CA  . GLY B 2 194 ? 26.064  106.112 18.470 1.00 100.00 ? 168  GLY B CA  1 
ATOM   2835 C C   . GLY B 2 194 ? 24.976  105.205 18.971 1.00 100.00 ? 168  GLY B C   1 
ATOM   2836 O O   . GLY B 2 194 ? 24.105  105.638 19.722 1.00 100.00 ? 168  GLY B O   1 
ATOM   2837 N N   . GLU B 2 195 ? 25.010  103.941 18.553 1.00 99.96  ? 169  GLU B N   1 
ATOM   2838 C CA  . GLU B 2 195 ? 23.981  103.003 18.966 1.00 95.28  ? 169  GLU B CA  1 
ATOM   2839 C C   . GLU B 2 195 ? 23.864  102.890 20.464 1.00 94.82  ? 169  GLU B C   1 
ATOM   2840 O O   . GLU B 2 195 ? 24.843  103.025 21.201 1.00 94.38  ? 169  GLU B O   1 
ATOM   2841 C CB  . GLU B 2 195 ? 24.191  101.614 18.344 1.00 89.61  ? 169  GLU B CB  1 
ATOM   2842 C CG  . GLU B 2 195 ? 22.980  101.098 17.564 1.00 89.20  ? 169  GLU B CG  1 
ATOM   2843 C CD  . GLU B 2 195 ? 22.064  102.206 17.030 1.00 92.09  ? 169  GLU B CD  1 
ATOM   2844 O OE1 . GLU B 2 195 ? 22.255  103.397 17.350 1.00 95.94  ? 169  GLU B OE1 1 
ATOM   2845 O OE2 . GLU B 2 195 ? 21.132  101.877 16.276 1.00 91.04  ? 169  GLU B OE2 1 
ATOM   2846 N N   . VAL B 2 196 ? 22.636  102.690 20.914 1.00 90.47  ? 170  VAL B N   1 
ATOM   2847 C CA  . VAL B 2 196 ? 22.391  102.538 22.321 1.00 83.92  ? 170  VAL B CA  1 
ATOM   2848 C C   . VAL B 2 196 ? 21.824  101.148 22.444 1.00 77.35  ? 170  VAL B C   1 
ATOM   2849 O O   . VAL B 2 196 ? 21.126  100.657 21.549 1.00 71.61  ? 170  VAL B O   1 
ATOM   2850 C CB  . VAL B 2 196 ? 21.395  103.597 22.854 1.00 86.49  ? 170  VAL B CB  1 
ATOM   2851 C CG1 . VAL B 2 196 ? 21.595  103.785 24.356 1.00 85.07  ? 170  VAL B CG1 1 
ATOM   2852 C CG2 . VAL B 2 196 ? 21.610  104.925 22.145 1.00 91.23  ? 170  VAL B CG2 1 
ATOM   2853 N N   . TYR B 2 197 ? 22.189  100.504 23.539 1.00 70.61  ? 171  TYR B N   1 
ATOM   2854 C CA  . TYR B 2 197 ? 21.749  99.164  23.828 1.00 65.90  ? 171  TYR B CA  1 
ATOM   2855 C C   . TYR B 2 197 ? 21.097  99.279  25.184 1.00 64.84  ? 171  TYR B C   1 
ATOM   2856 O O   . TYR B 2 197 ? 21.759  99.455  26.204 1.00 69.40  ? 171  TYR B O   1 
ATOM   2857 C CB  . TYR B 2 197 ? 22.953  98.226  23.849 1.00 67.60  ? 171  TYR B CB  1 
ATOM   2858 C CG  . TYR B 2 197 ? 23.586  98.075  22.482 1.00 68.24  ? 171  TYR B CG  1 
ATOM   2859 C CD1 . TYR B 2 197 ? 22.840  97.606  21.398 1.00 68.81  ? 171  TYR B CD1 1 
ATOM   2860 C CD2 . TYR B 2 197 ? 24.915  98.434  22.260 1.00 68.41  ? 171  TYR B CD2 1 
ATOM   2861 C CE1 . TYR B 2 197 ? 23.397  97.498  20.125 1.00 76.68  ? 171  TYR B CE1 1 
ATOM   2862 C CE2 . TYR B 2 197 ? 25.487  98.331  20.988 1.00 78.27  ? 171  TYR B CE2 1 
ATOM   2863 C CZ  . TYR B 2 197 ? 24.720  97.862  19.922 1.00 82.61  ? 171  TYR B CZ  1 
ATOM   2864 O OH  . TYR B 2 197 ? 25.265  97.763  18.656 1.00 87.74  ? 171  TYR B OH  1 
ATOM   2865 N N   . THR B 2 198 ? 19.778  99.208  25.175 1.00 63.50  ? 172  THR B N   1 
ATOM   2866 C CA  . THR B 2 198 ? 19.005  99.340  26.387 1.00 61.48  ? 172  THR B CA  1 
ATOM   2867 C C   . THR B 2 198 ? 18.454  97.994  26.815 1.00 62.66  ? 172  THR B C   1 
ATOM   2868 O O   . THR B 2 198 ? 17.769  97.323  26.041 1.00 62.96  ? 172  THR B O   1 
ATOM   2869 C CB  . THR B 2 198 ? 17.844  100.329 26.159 1.00 60.22  ? 172  THR B CB  1 
ATOM   2870 O OG1 . THR B 2 198 ? 18.363  101.661 26.111 1.00 62.96  ? 172  THR B OG1 1 
ATOM   2871 C CG2 . THR B 2 198 ? 16.821  100.235 27.265 1.00 56.57  ? 172  THR B CG2 1 
ATOM   2872 N N   . CYS B 2 199 ? 18.772  97.597  28.044 1.00 62.08  ? 173  CYS B N   1 
ATOM   2873 C CA  . CYS B 2 199 ? 18.279  96.344  28.599 1.00 59.56  ? 173  CYS B CA  1 
ATOM   2874 C C   . CYS B 2 199 ? 17.006  96.641  29.385 1.00 56.75  ? 173  CYS B C   1 
ATOM   2875 O O   . CYS B 2 199 ? 17.060  97.081  30.533 1.00 58.07  ? 173  CYS B O   1 
ATOM   2876 C CB  . CYS B 2 199 ? 19.317  95.711  29.524 1.00 58.10  ? 173  CYS B CB  1 
ATOM   2877 S SG  . CYS B 2 199 ? 18.816  94.058  30.095 1.00 57.10  ? 173  CYS B SG  1 
ATOM   2878 N N   . HIS B 2 200 ? 15.865  96.410  28.747 1.00 53.97  ? 174  HIS B N   1 
ATOM   2879 C CA  . HIS B 2 200 ? 14.568  96.649  29.355 1.00 51.17  ? 174  HIS B CA  1 
ATOM   2880 C C   . HIS B 2 200 ? 14.196  95.498  30.280 1.00 53.33  ? 174  HIS B C   1 
ATOM   2881 O O   . HIS B 2 200 ? 14.307  94.331  29.911 1.00 52.21  ? 174  HIS B O   1 
ATOM   2882 C CB  . HIS B 2 200 ? 13.514  96.792  28.263 1.00 53.40  ? 174  HIS B CB  1 
ATOM   2883 C CG  . HIS B 2 200 ? 12.203  97.323  28.750 1.00 63.79  ? 174  HIS B CG  1 
ATOM   2884 N ND1 . HIS B 2 200 ? 11.814  98.630  28.556 1.00 64.02  ? 174  HIS B ND1 1 
ATOM   2885 C CD2 . HIS B 2 200 ? 11.182  96.716  29.401 1.00 70.41  ? 174  HIS B CD2 1 
ATOM   2886 C CE1 . HIS B 2 200 ? 10.606  98.809  29.065 1.00 68.15  ? 174  HIS B CE1 1 
ATOM   2887 N NE2 . HIS B 2 200 ? 10.201  97.664  29.583 1.00 74.84  ? 174  HIS B NE2 1 
ATOM   2888 N N   . VAL B 2 201 ? 13.758  95.835  31.486 1.00 52.66  ? 175  VAL B N   1 
ATOM   2889 C CA  . VAL B 2 201 ? 13.361  94.832  32.461 1.00 47.09  ? 175  VAL B CA  1 
ATOM   2890 C C   . VAL B 2 201 ? 12.024  95.223  33.034 1.00 48.44  ? 175  VAL B C   1 
ATOM   2891 O O   . VAL B 2 201 ? 11.770  96.395  33.271 1.00 53.14  ? 175  VAL B O   1 
ATOM   2892 C CB  . VAL B 2 201 ? 14.364  94.743  33.599 1.00 48.78  ? 175  VAL B CB  1 
ATOM   2893 C CG1 . VAL B 2 201 ? 13.749  93.989  34.785 1.00 46.36  ? 175  VAL B CG1 1 
ATOM   2894 C CG2 . VAL B 2 201 ? 15.625  94.065  33.098 1.00 47.90  ? 175  VAL B CG2 1 
ATOM   2895 N N   . GLU B 2 202 ? 11.169  94.240  33.264 1.00 48.91  ? 176  GLU B N   1 
ATOM   2896 C CA  . GLU B 2 202 ? 9.850   94.514  33.803 1.00 51.33  ? 176  GLU B CA  1 
ATOM   2897 C C   . GLU B 2 202 ? 9.485   93.532  34.884 1.00 54.95  ? 176  GLU B C   1 
ATOM   2898 O O   . GLU B 2 202 ? 9.163   92.375  34.610 1.00 53.79  ? 176  GLU B O   1 
ATOM   2899 C CB  . GLU B 2 202 ? 8.807   94.436  32.705 1.00 53.34  ? 176  GLU B CB  1 
ATOM   2900 C CG  . GLU B 2 202 ? 8.555   95.741  32.019 1.00 58.43  ? 176  GLU B CG  1 
ATOM   2901 C CD  . GLU B 2 202 ? 7.371   95.658  31.097 1.00 61.37  ? 176  GLU B CD  1 
ATOM   2902 O OE1 . GLU B 2 202 ? 6.245   95.917  31.567 1.00 72.53  ? 176  GLU B OE1 1 
ATOM   2903 O OE2 . GLU B 2 202 ? 7.563   95.325  29.909 1.00 57.98  ? 176  GLU B OE2 1 
ATOM   2904 N N   . HIS B 2 203 ? 9.523   94.002  36.119 1.00 60.08  ? 177  HIS B N   1 
ATOM   2905 C CA  . HIS B 2 203 ? 9.194   93.148  37.235 1.00 60.37  ? 177  HIS B CA  1 
ATOM   2906 C C   . HIS B 2 203 ? 8.049   93.691  38.072 1.00 61.93  ? 177  HIS B C   1 
ATOM   2907 O O   . HIS B 2 203 ? 7.963   94.891  38.329 1.00 64.05  ? 177  HIS B O   1 
ATOM   2908 C CB  . HIS B 2 203 ? 10.416  92.944  38.109 1.00 60.20  ? 177  HIS B CB  1 
ATOM   2909 C CG  . HIS B 2 203 ? 10.299  91.763  39.002 1.00 62.71  ? 177  HIS B CG  1 
ATOM   2910 N ND1 . HIS B 2 203 ? 10.231  91.872  40.374 1.00 69.09  ? 177  HIS B ND1 1 
ATOM   2911 C CD2 . HIS B 2 203 ? 10.203  90.443  38.723 1.00 64.37  ? 177  HIS B CD2 1 
ATOM   2912 C CE1 . HIS B 2 203 ? 10.101  90.670  40.900 1.00 72.87  ? 177  HIS B CE1 1 
ATOM   2913 N NE2 . HIS B 2 203 ? 10.080  89.783  39.919 1.00 71.52  ? 177  HIS B NE2 1 
ATOM   2914 N N   . PRO B 2 204 ? 7.143   92.800  38.498 1.00 63.24  ? 178  PRO B N   1 
ATOM   2915 C CA  . PRO B 2 204 ? 5.974   93.134  39.314 1.00 60.00  ? 178  PRO B CA  1 
ATOM   2916 C C   . PRO B 2 204 ? 6.306   93.999  40.519 1.00 58.07  ? 178  PRO B C   1 
ATOM   2917 O O   . PRO B 2 204 ? 5.485   94.808  40.946 1.00 59.64  ? 178  PRO B O   1 
ATOM   2918 C CB  . PRO B 2 204 ? 5.407   91.771  39.721 1.00 62.06  ? 178  PRO B CB  1 
ATOM   2919 C CG  . PRO B 2 204 ? 6.447   90.755  39.320 1.00 67.80  ? 178  PRO B CG  1 
ATOM   2920 C CD  . PRO B 2 204 ? 7.190   91.364  38.184 1.00 67.71  ? 178  PRO B CD  1 
ATOM   2921 N N   . SER B 2 205 ? 7.507   93.826  41.064 1.00 53.54  ? 179  SER B N   1 
ATOM   2922 C CA  . SER B 2 205 ? 7.945   94.603  42.219 1.00 52.10  ? 179  SER B CA  1 
ATOM   2923 C C   . SER B 2 205 ? 8.215   96.067  41.848 1.00 57.02  ? 179  SER B C   1 
ATOM   2924 O O   . SER B 2 205 ? 8.240   96.945  42.714 1.00 55.88  ? 179  SER B O   1 
ATOM   2925 C CB  . SER B 2 205 ? 9.207   93.982  42.807 1.00 47.61  ? 179  SER B CB  1 
ATOM   2926 O OG  . SER B 2 205 ? 10.369  94.532  42.211 1.00 44.68  ? 179  SER B OG  1 
ATOM   2927 N N   . LEU B 2 206 ? 8.407   96.319  40.554 1.00 64.43  ? 180  LEU B N   1 
ATOM   2928 C CA  . LEU B 2 206 ? 8.686   97.662  40.035 1.00 68.66  ? 180  LEU B CA  1 
ATOM   2929 C C   . LEU B 2 206 ? 7.445   98.450  39.638 1.00 72.30  ? 180  LEU B C   1 
ATOM   2930 O O   . LEU B 2 206 ? 6.456   97.885  39.164 1.00 67.61  ? 180  LEU B O   1 
ATOM   2931 C CB  . LEU B 2 206 ? 9.594   97.577  38.808 1.00 62.68  ? 180  LEU B CB  1 
ATOM   2932 C CG  . LEU B 2 206 ? 11.095  97.516  39.037 1.00 52.42  ? 180  LEU B CG  1 
ATOM   2933 C CD1 . LEU B 2 206 ? 11.452  96.401  40.013 1.00 53.00  ? 180  LEU B CD1 1 
ATOM   2934 C CD2 . LEU B 2 206 ? 11.744  97.280  37.700 1.00 47.69  ? 180  LEU B CD2 1 
ATOM   2935 N N   . LYS B 2 207 ? 7.518   99.766  39.815 1.00 77.96  ? 181  LYS B N   1 
ATOM   2936 C CA  . LYS B 2 207 ? 6.417   100.647 39.459 1.00 84.60  ? 181  LYS B CA  1 
ATOM   2937 C C   . LYS B 2 207 ? 6.432   100.812 37.945 1.00 85.51  ? 181  LYS B C   1 
ATOM   2938 O O   . LYS B 2 207 ? 5.458   100.490 37.260 1.00 84.18  ? 181  LYS B O   1 
ATOM   2939 C CB  . LYS B 2 207 ? 6.588   102.004 40.140 1.00 90.32  ? 181  LYS B CB  1 
ATOM   2940 C CG  . LYS B 2 207 ? 5.335   102.508 40.856 1.00 97.91  ? 181  LYS B CG  1 
ATOM   2941 C CD  . LYS B 2 207 ? 4.750   101.468 41.816 1.00 96.70  ? 181  LYS B CD  1 
ATOM   2942 C CE  . LYS B 2 207 ? 3.248   101.665 42.008 1.00 96.36  ? 181  LYS B CE  1 
ATOM   2943 N NZ  . LYS B 2 207 ? 2.462   101.328 40.780 1.00 93.92  ? 181  LYS B NZ  1 
ATOM   2944 N N   . SER B 2 208 ? 7.529   101.325 37.453 1.00 86.21  ? 182  SER B N   1 
ATOM   2945 C CA  . SER B 2 208 ? 7.748   101.494 36.008 1.00 86.46  ? 182  SER B CA  1 
ATOM   2946 C C   . SER B 2 208 ? 9.065   100.829 35.614 1.00 81.08  ? 182  SER B C   1 
ATOM   2947 O O   . SER B 2 208 ? 10.011  100.872 36.416 1.00 84.28  ? 182  SER B O   1 
ATOM   2948 C CB  . SER B 2 208 ? 7.808   102.980 35.655 1.00 92.58  ? 182  SER B CB  1 
ATOM   2949 O OG  . SER B 2 208 ? 6.589   103.614 36.015 1.00 20.00  ? 182  SER B OG  1 
ATOM   2950 N N   . PRO B 2 209 ? 9.127   100.189 34.451 1.00 73.13  ? 183  PRO B N   1 
ATOM   2951 C CA  . PRO B 2 209 ? 10.299  99.467  33.924 1.00 66.02  ? 183  PRO B CA  1 
ATOM   2952 C C   . PRO B 2 209 ? 11.700  100.035 34.157 1.00 64.12  ? 183  PRO B C   1 
ATOM   2953 O O   . PRO B 2 209 ? 12.001  101.149 33.743 1.00 67.39  ? 183  PRO B O   1 
ATOM   2954 C CB  . PRO B 2 209 ? 10.005  99.323  32.424 1.00 62.83  ? 183  PRO B CB  1 
ATOM   2955 C CG  . PRO B 2 209 ? 8.683   99.995  32.179 1.00 61.85  ? 183  PRO B CG  1 
ATOM   2956 C CD  . PRO B 2 209 ? 8.004   100.155 33.498 1.00 67.84  ? 183  PRO B CD  1 
ATOM   2957 N N   . ILE B 2 210 ? 12.562  99.268  34.817 1.00 62.88  ? 184  ILE B N   1 
ATOM   2958 C CA  . ILE B 2 210 ? 13.930  99.729  35.031 1.00 63.17  ? 184  ILE B CA  1 
ATOM   2959 C C   . ILE B 2 210 ? 14.647  99.452  33.709 1.00 62.87  ? 184  ILE B C   1 
ATOM   2960 O O   . ILE B 2 210 ? 14.294  98.517  32.981 1.00 62.04  ? 184  ILE B O   1 
ATOM   2961 C CB  . ILE B 2 210 ? 14.641  98.985  36.217 1.00 61.90  ? 184  ILE B CB  1 
ATOM   2962 C CG1 . ILE B 2 210 ? 16.074  99.514  36.407 1.00 61.16  ? 184  ILE B CG1 1 
ATOM   2963 C CG2 . ILE B 2 210 ? 14.674  97.484  35.958 1.00 65.10  ? 184  ILE B CG2 1 
ATOM   2964 C CD1 . ILE B 2 210 ? 16.190  101.022 36.627 1.00 54.94  ? 184  ILE B CD1 1 
ATOM   2965 N N   . THR B 2 211 ? 15.643  100.273 33.397 1.00 64.30  ? 185  THR B N   1 
ATOM   2966 C CA  . THR B 2 211 ? 16.376  100.146 32.147 1.00 57.16  ? 185  THR B CA  1 
ATOM   2967 C C   . THR B 2 211 ? 17.828  100.524 32.322 1.00 52.07  ? 185  THR B C   1 
ATOM   2968 O O   . THR B 2 211 ? 18.142  101.469 33.038 1.00 48.48  ? 185  THR B O   1 
ATOM   2969 C CB  . THR B 2 211 ? 15.780  101.086 31.067 1.00 57.77  ? 185  THR B CB  1 
ATOM   2970 O OG1 . THR B 2 211 ? 16.691  101.203 29.969 1.00 60.08  ? 185  THR B OG1 1 
ATOM   2971 C CG2 . THR B 2 211 ? 15.538  102.482 31.651 1.00 49.48  ? 185  THR B CG2 1 
ATOM   2972 N N   . VAL B 2 212 ? 18.714  99.784  31.672 1.00 50.24  ? 186  VAL B N   1 
ATOM   2973 C CA  . VAL B 2 212 ? 20.124  100.119 31.734 1.00 56.03  ? 186  VAL B CA  1 
ATOM   2974 C C   . VAL B 2 212 ? 20.591  100.470 30.318 1.00 62.09  ? 186  VAL B C   1 
ATOM   2975 O O   . VAL B 2 212 ? 20.092  99.923  29.331 1.00 63.74  ? 186  VAL B O   1 
ATOM   2976 C CB  . VAL B 2 212 ? 20.951  98.974  32.317 1.00 49.60  ? 186  VAL B CB  1 
ATOM   2977 C CG1 . VAL B 2 212 ? 22.411  99.329  32.290 1.00 45.68  ? 186  VAL B CG1 1 
ATOM   2978 C CG2 . VAL B 2 212 ? 20.534  98.736  33.739 1.00 49.50  ? 186  VAL B CG2 1 
ATOM   2979 N N   . GLU B 2 213 ? 21.528  101.408 30.218 1.00 69.26  ? 187  GLU B N   1 
ATOM   2980 C CA  . GLU B 2 213 ? 22.023  101.833 28.919 1.00 74.12  ? 187  GLU B CA  1 
ATOM   2981 C C   . GLU B 2 213 ? 23.500  101.545 28.727 1.00 74.03  ? 187  GLU B C   1 
ATOM   2982 O O   . GLU B 2 213 ? 24.278  101.461 29.678 1.00 76.87  ? 187  GLU B O   1 
ATOM   2983 C CB  . GLU B 2 213 ? 21.753  103.329 28.712 1.00 79.24  ? 187  GLU B CB  1 
ATOM   2984 C CG  . GLU B 2 213 ? 20.391  103.640 28.095 1.00 89.21  ? 187  GLU B CG  1 
ATOM   2985 C CD  . GLU B 2 213 ? 19.266  103.629 29.120 1.00 97.44  ? 187  GLU B CD  1 
ATOM   2986 O OE1 . GLU B 2 213 ? 19.514  104.008 30.288 1.00 98.69  ? 187  GLU B OE1 1 
ATOM   2987 O OE2 . GLU B 2 213 ? 18.132  103.242 28.756 1.00 100.00 ? 187  GLU B OE2 1 
ATOM   2988 N N   . TRP B 2 214 ? 23.873  101.403 27.467 1.00 74.71  ? 188  TRP B N   1 
ATOM   2989 C CA  . TRP B 2 214 ? 25.242  101.116 27.089 1.00 77.13  ? 188  TRP B CA  1 
ATOM   2990 C C   . TRP B 2 214 ? 25.353  101.607 25.651 1.00 80.47  ? 188  TRP B C   1 
ATOM   2991 O O   . TRP B 2 214 ? 24.383  101.524 24.893 1.00 80.27  ? 188  TRP B O   1 
ATOM   2992 C CB  . TRP B 2 214 ? 25.458  99.612  27.170 1.00 75.14  ? 188  TRP B CB  1 
ATOM   2993 C CG  . TRP B 2 214 ? 26.831  99.137  26.886 1.00 75.85  ? 188  TRP B CG  1 
ATOM   2994 C CD1 . TRP B 2 214 ? 27.384  98.900  25.654 1.00 75.84  ? 188  TRP B CD1 1 
ATOM   2995 C CD2 . TRP B 2 214 ? 27.773  98.657  27.845 1.00 75.10  ? 188  TRP B CD2 1 
ATOM   2996 N NE1 . TRP B 2 214 ? 28.606  98.284  25.794 1.00 75.81  ? 188  TRP B NE1 1 
ATOM   2997 C CE2 . TRP B 2 214 ? 28.869  98.122  27.133 1.00 77.56  ? 188  TRP B CE2 1 
ATOM   2998 C CE3 . TRP B 2 214 ? 27.796  98.616  29.247 1.00 78.32  ? 188  TRP B CE3 1 
ATOM   2999 C CZ2 . TRP B 2 214 ? 29.976  97.550  27.774 1.00 79.01  ? 188  TRP B CZ2 1 
ATOM   3000 C CZ3 . TRP B 2 214 ? 28.895  98.047  29.888 1.00 76.88  ? 188  TRP B CZ3 1 
ATOM   3001 C CH2 . TRP B 2 214 ? 29.968  97.522  29.150 1.00 76.03  ? 188  TRP B CH2 1 
ATOM   3002 N N   . SER B 2 215 T 26.515  102.138 25.279 1.00 84.06  ? 1    SER B N   1 
ATOM   3003 C CA  . SER B 2 215 T 26.701  102.630 23.920 1.00 86.07  ? 1    SER B CA  1 
ATOM   3004 C C   . SER B 2 215 T 28.087  102.304 23.352 1.00 89.75  ? 1    SER B C   1 
ATOM   3005 O O   . SER B 2 215 T 29.059  102.116 24.097 1.00 85.78  ? 1    SER B O   1 
ATOM   3006 C CB  . SER B 2 215 T 26.423  104.142 23.863 1.00 83.43  ? 1    SER B CB  1 
ATOM   3007 O OG  . SER B 2 215 T 27.485  104.900 24.411 1.00 79.05  ? 1    SER B OG  1 
ATOM   3008 N N   . SER B 2 216 T 28.155  102.230 22.022 1.00 93.79  ? 2    SER B N   1 
ATOM   3009 C CA  . SER B 2 216 T 29.388  101.915 21.298 1.00 94.19  ? 2    SER B CA  1 
ATOM   3010 C C   . SER B 2 216 T 30.511  102.938 21.522 1.00 90.11  ? 2    SER B C   1 
ATOM   3011 O O   . SER B 2 216 T 30.257  104.150 21.364 1.00 86.84  ? 2    SER B O   1 
ATOM   3012 C CB  . SER B 2 216 T 29.098  101.778 19.787 1.00 98.40  ? 2    SER B CB  1 
ATOM   3013 O OG  . SER B 2 216 T 27.706  101.751 19.501 1.00 100.00 ? 2    SER B OG  1 
HETATM 3014 C C1  . NAG C 3 .   ? -9.349  83.073  39.222 1.00 84.10  ? 495  NAG B C1  1 
HETATM 3015 C C2  . NAG C 3 .   ? -9.298  84.433  39.921 1.00 87.24  ? 495  NAG B C2  1 
HETATM 3016 C C3  . NAG C 3 .   ? -10.529 85.224  39.446 1.00 88.32  ? 495  NAG B C3  1 
HETATM 3017 C C4  . NAG C 3 .   ? -10.491 85.366  37.913 1.00 90.56  ? 495  NAG B C4  1 
HETATM 3018 C C5  . NAG C 3 .   ? -10.349 83.980  37.233 1.00 86.66  ? 495  NAG B C5  1 
HETATM 3019 C C6  . NAG C 3 .   ? -10.068 84.087  35.745 1.00 84.79  ? 495  NAG B C6  1 
HETATM 3020 C C7  . NAG C 3 .   ? -8.301  84.777  42.101 1.00 86.33  ? 495  NAG B C7  1 
HETATM 3021 C C8  . NAG C 3 .   ? -8.364  84.560  43.606 1.00 88.23  ? 495  NAG B C8  1 
HETATM 3022 N N2  . NAG C 3 .   ? -9.291  84.266  41.367 1.00 86.17  ? 495  NAG B N2  1 
HETATM 3023 O O3  . NAG C 3 .   ? -10.565 86.509  40.053 1.00 82.19  ? 495  NAG B O3  1 
HETATM 3024 O O4  . NAG C 3 .   ? -11.676 86.015  37.459 1.00 91.48  ? 495  NAG B O4  1 
HETATM 3025 O O5  . NAG C 3 .   ? -9.242  83.240  37.800 1.00 86.48  ? 495  NAG B O5  1 
HETATM 3026 O O6  . NAG C 3 .   ? -8.675  84.235  35.492 1.00 81.51  ? 495  NAG B O6  1 
HETATM 3027 O O7  . NAG C 3 .   ? -7.358  85.407  41.617 1.00 82.89  ? 495  NAG B O7  1 
HETATM 3028 O O   . HOH D 4 .   ? 16.099  69.880  40.318 1.00 33.61  ? 1004 HOH A O   1 
HETATM 3029 O O   . HOH D 4 .   ? 2.558   84.949  64.644 1.00 40.87  ? 1026 HOH A O   1 
HETATM 3030 O O   . HOH D 4 .   ? 14.290  77.421  46.950 1.00 21.40  ? 1032 HOH A O   1 
HETATM 3031 O O   . HOH D 4 .   ? 11.637  68.201  40.823 1.00 50.07  ? 1036 HOH A O   1 
HETATM 3032 O O   . HOH E 4 .   ? -10.963 60.068  39.790 1.00 43.70  ? 1023 HOH B O   1 
HETATM 3033 O O   . HOH E 4 .   ? 7.455   65.857  44.850 1.00 31.85  ? 1025 HOH B O   1 
HETATM 3034 O O   . HOH E 4 .   ? 4.182   98.466  42.862 1.00 38.66  ? 1042 HOH B O   1 
HETATM 3035 O O   . HOH E 4 .   ? 32.688  82.888  16.976 1.00 61.37  ? 1043 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   -3  ?   ?   ?   A . n 
A 1 2   ASP 2   -2  ?   ?   ?   A . n 
A 1 3   ASP 3   -1  ?   ?   ?   A . n 
A 1 4   ILE 4   0   ?   ?   ?   A . n 
A 1 5   GLU 5   1   1   GLU GLU A . n 
A 1 6   ALA 6   2   2   ALA ALA A . n 
A 1 7   ASP 7   3   3   ASP ASP A . n 
A 1 8   HIS 8   4   4   HIS HIS A . n 
A 1 9   VAL 9   5   5   VAL VAL A . n 
A 1 10  GLY 10  6   6   GLY GLY A . n 
A 1 11  PHE 11  7   7   PHE PHE A . n 
A 1 12  TYR 12  8   8   TYR TYR A . n 
A 1 13  GLY 13  9   9   GLY GLY A . n 
A 1 14  THR 14  10  10  THR THR A . n 
A 1 15  THR 15  11  11  THR THR A . n 
A 1 16  VAL 16  12  12  VAL VAL A . n 
A 1 17  TYR 17  13  13  TYR TYR A . n 
A 1 18  GLN 18  14  14  GLN GLN A . n 
A 1 19  SER 19  15  15  SER SER A . n 
A 1 20  PRO 20  16  16  PRO PRO A . n 
A 1 21  GLY 21  17  17  GLY GLY A . n 
A 1 22  ASP 22  18  18  ASP ASP A . n 
A 1 23  ILE 23  19  19  ILE ILE A . n 
A 1 24  GLY 24  20  20  GLY GLY A . n 
A 1 25  GLN 25  21  21  GLN GLN A . n 
A 1 26  TYR 26  22  22  TYR TYR A . n 
A 1 27  THR 27  23  23  THR THR A . n 
A 1 28  HIS 28  24  24  HIS HIS A . n 
A 1 29  GLU 29  25  25  GLU GLU A . n 
A 1 30  PHE 30  26  26  PHE PHE A . n 
A 1 31  ASP 31  27  27  ASP ASP A . n 
A 1 32  GLY 32  28  28  GLY GLY A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  LEU 35  31  31  LEU LEU A . n 
A 1 36  PHE 36  32  32  PHE PHE A . n 
A 1 37  TYR 37  33  33  TYR TYR A . n 
A 1 38  VAL 38  34  34  VAL VAL A . n 
A 1 39  ASP 39  35  35  ASP ASP A . n 
A 1 40  LEU 40  36  36  LEU LEU A . n 
A 1 41  ASP 41  37  37  ASP ASP A . n 
A 1 42  LYS 42  38  38  LYS LYS A . n 
A 1 43  LYS 43  39  39  LYS LYS A . n 
A 1 44  LYS 44  40  40  LYS LYS A . n 
A 1 45  THR 45  41  41  THR THR A . n 
A 1 46  VAL 46  42  42  VAL VAL A . n 
A 1 47  TRP 47  43  43  TRP TRP A . n 
A 1 48  ARG 48  44  44  ARG ARG A . n 
A 1 49  LEU 49  45  45  LEU LEU A . n 
A 1 50  PRO 50  46  46  PRO PRO A . n 
A 1 51  GLU 51  47  47  GLU GLU A . n 
A 1 52  PHE 52  48  48  PHE PHE A . n 
A 1 53  GLY 53  49  49  GLY GLY A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  LEU 55  51  51  LEU LEU A . n 
A 1 56  ILE 56  52  52  ILE ILE A . n 
A 1 57  LEU 57  53  53  LEU LEU A . n 
A 1 58  PHE 58  54  54  PHE PHE A . n 
A 1 59  GLU 59  55  55  GLU GLU A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  GLN 61  57  57  GLN GLN A . n 
A 1 62  GLY 62  58  58  GLY GLY A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  LEU 64  60  60  LEU LEU A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  ASN 66  62  62  ASN ASN A . n 
A 1 67  ILE 67  63  63  ILE ILE A . n 
A 1 68  ALA 68  64  64  ALA ALA A . n 
A 1 69  ALA 69  65  65  ALA ALA A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  LYS 71  67  67  LYS LYS A . n 
A 1 72  HIS 72  68  68  HIS HIS A . n 
A 1 73  ASN 73  69  69  ASN ASN A . n 
A 1 74  LEU 74  70  70  LEU LEU A . n 
A 1 75  GLY 75  71  71  GLY GLY A . n 
A 1 76  ILE 76  72  72  ILE ILE A . n 
A 1 77  LEU 77  73  73  LEU LEU A . n 
A 1 78  THR 78  74  74  THR THR A . n 
A 1 79  LYS 79  75  75  LYS LYS A . n 
A 1 80  ARG 80  76  76  ARG ARG A . n 
A 1 81  SER 81  77  77  SER SER A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  PHE 83  79  79  PHE PHE A . n 
A 1 84  THR 84  80  80  THR THR A . n 
A 1 85  PRO 85  81  81  PRO PRO A . n 
A 1 86  ALA 86  82  82  ALA ALA A . n 
A 1 87  THR 87  83  83  THR THR A . n 
A 1 88  ASN 88  84  84  ASN ASN A . n 
A 1 89  GLU 89  85  85  GLU GLU A . n 
A 1 90  ALA 90  86  86  ALA ALA A . n 
A 1 91  PRO 91  87  87  PRO PRO A . n 
A 1 92  GLN 92  88  88  GLN GLN A . n 
A 1 93  ALA 93  89  89  ALA ALA A . n 
A 1 94  THR 94  90  90  THR THR A . n 
A 1 95  VAL 95  91  91  VAL VAL A . n 
A 1 96  PHE 96  92  92  PHE PHE A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  LYS 98  94  94  LYS LYS A . n 
A 1 99  SER 99  95  95  SER SER A . n 
A 1 100 PRO 100 96  96  PRO PRO A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 LEU 102 98  98  LEU LEU A . n 
A 1 103 LEU 103 99  99  LEU LEU A . n 
A 1 104 GLY 104 100 100 GLY GLY A . n 
A 1 105 GLN 105 101 101 GLN GLN A . n 
A 1 106 PRO 106 102 102 PRO PRO A . n 
A 1 107 ASN 107 103 103 ASN ASN A . n 
A 1 108 THR 108 104 104 THR THR A . n 
A 1 109 LEU 109 105 105 LEU LEU A . n 
A 1 110 ILE 110 106 106 ILE ILE A . n 
A 1 111 CYS 111 107 107 CYS CYS A . n 
A 1 112 PHE 112 108 108 PHE PHE A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 ASP 114 110 110 ASP ASP A . n 
A 1 115 ASN 115 111 111 ASN ASN A . n 
A 1 116 ILE 116 112 112 ILE ILE A . n 
A 1 117 PHE 117 113 113 PHE PHE A . n 
A 1 118 PRO 118 114 114 PRO PRO A . n 
A 1 119 PRO 119 115 115 PRO PRO A . n 
A 1 120 VAL 120 116 116 VAL VAL A . n 
A 1 121 ILE 121 117 117 ILE ILE A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ILE 123 119 119 ILE ILE A . n 
A 1 124 THR 124 120 120 THR THR A . n 
A 1 125 TRP 125 121 121 TRP TRP A . n 
A 1 126 LEU 126 122 122 LEU LEU A . n 
A 1 127 ARG 127 123 123 ARG ARG A . n 
A 1 128 ASN 128 124 124 ASN ASN A . n 
A 1 129 SER 129 125 125 SER SER A . n 
A 1 130 LYS 130 126 126 LYS LYS A . n 
A 1 131 SER 131 127 127 SER SER A . n 
A 1 132 VAL 132 128 128 VAL VAL A . n 
A 1 133 THR 133 129 129 THR THR A . n 
A 1 134 ASP 134 130 130 ASP ASP A . n 
A 1 135 GLY 135 131 131 GLY GLY A . n 
A 1 136 VAL 136 132 132 VAL VAL A . n 
A 1 137 TYR 137 133 133 TYR TYR A . n 
A 1 138 GLU 138 134 134 GLU GLU A . n 
A 1 139 THR 139 135 135 THR THR A . n 
A 1 140 SER 140 136 136 SER SER A . n 
A 1 141 PHE 141 137 137 PHE PHE A . n 
A 1 142 LEU 142 138 138 LEU LEU A . n 
A 1 143 VAL 143 139 139 VAL VAL A . n 
A 1 144 ASN 144 140 140 ASN ASN A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 ASP 146 142 142 ASP ASP A . n 
A 1 147 HIS 147 143 143 HIS HIS A . n 
A 1 148 SER 148 144 144 SER SER A . n 
A 1 149 PHE 149 145 145 PHE PHE A . n 
A 1 150 HIS 150 146 146 HIS HIS A . n 
A 1 151 LYS 151 147 147 LYS LYS A . n 
A 1 152 LEU 152 148 148 LEU LEU A . n 
A 1 153 SER 153 149 149 SER SER A . n 
A 1 154 TYR 154 150 150 TYR TYR A . n 
A 1 155 LEU 155 151 151 LEU LEU A . n 
A 1 156 THR 156 152 152 THR THR A . n 
A 1 157 PHE 157 153 153 PHE PHE A . n 
A 1 158 ILE 158 154 154 ILE ILE A . n 
A 1 159 PRO 159 155 155 PRO PRO A . n 
A 1 160 SER 160 156 156 SER SER A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 ASP 162 158 158 ASP ASP A . n 
A 1 163 ASP 163 159 159 ASP ASP A . n 
A 1 164 ILE 164 160 160 ILE ILE A . n 
A 1 165 TYR 165 161 161 TYR TYR A . n 
A 1 166 ASP 166 162 162 ASP ASP A . n 
A 1 167 CYS 167 163 163 CYS CYS A . n 
A 1 168 LYS 168 164 164 LYS LYS A . n 
A 1 169 VAL 169 165 165 VAL VAL A . n 
A 1 170 GLU 170 166 166 GLU GLU A . n 
A 1 171 HIS 171 167 167 HIS HIS A . n 
A 1 172 TRP 172 168 168 TRP TRP A . n 
A 1 173 GLY 173 169 169 GLY GLY A . n 
A 1 174 LEU 174 170 170 LEU LEU A . n 
A 1 175 GLU 175 171 171 GLU GLU A . n 
A 1 176 GLU 176 172 172 GLU GLU A . n 
A 1 177 PRO 177 173 173 PRO PRO A . n 
A 1 178 VAL 178 174 174 VAL VAL A . n 
A 1 179 LEU 179 175 175 LEU LEU A . n 
A 1 180 LYS 180 176 176 LYS LYS A . n 
A 1 181 HIS 181 177 177 HIS HIS A . n 
A 1 182 TRP 182 178 178 TRP TRP A . n 
A 1 183 GLU 183 179 ?   ?   ?   A . n 
A 1 184 PRO 184 180 ?   ?   ?   A . n 
A 1 185 GLU 185 181 ?   ?   ?   A . n 
A 1 186 ILE 186 182 ?   ?   ?   A . n 
A 1 187 SER 187 183 ?   ?   ?   A . n 
A 1 188 SER 188 184 ?   ?   ?   A . n 
A 1 189 ALA 189 185 ?   ?   ?   A . n 
A 1 190 ASP 190 186 ?   ?   ?   A . n 
A 1 191 LEU 191 187 ?   ?   ?   A . n 
A 1 192 VAL 192 188 ?   ?   ?   A . n 
A 1 193 PRO 193 189 ?   ?   ?   A . n 
A 1 194 ARG 194 190 ?   ?   ?   A . n 
B 2 1   ARG 1   1   1   ARG ARG B S n 
B 2 2   GLY 2   2   2   GLY GLY B S n 
B 2 3   ILE 3   323 323 ILE ILE B P n 
B 2 4   SER 4   324 324 SER SER B P n 
B 2 5   GLN 5   325 325 GLN GLN B P n 
B 2 6   ALA 6   326 326 ALA ALA B P n 
B 2 7   VAL 7   327 327 VAL VAL B P n 
B 2 8   HIS 8   328 328 HIS HIS B P n 
B 2 9   ALA 9   329 329 ALA ALA B P n 
B 2 10  ALA 10  330 330 ALA ALA B P n 
B 2 11  HIS 11  331 331 HIS HIS B P n 
B 2 12  ALA 12  332 332 ALA ALA B P n 
B 2 13  GLU 13  333 333 GLU GLU B P n 
B 2 14  ILE 14  334 334 ILE ILE B P n 
B 2 15  ASN 15  -10 ?   ?   ?   B . n 
B 2 16  GLU 16  -9  ?   ?   ?   B . n 
B 2 17  ALA 17  -8  ?   ?   ?   B . n 
B 2 18  GLY 18  -7  ?   ?   ?   B . n 
B 2 19  ARG 19  -6  ?   ?   ?   B . n 
B 2 20  GLY 20  -5  ?   ?   ?   B . n 
B 2 21  SER 21  -4  ?   ?   ?   B . n 
B 2 22  GLY 22  -3  ?   ?   ?   B . n 
B 2 23  SER 23  -2  ?   ?   ?   B . n 
B 2 24  GLY 24  -1  ?   ?   ?   B . n 
B 2 25  SER 25  0   ?   ?   ?   B . n 
B 2 26  GLY 26  1   ?   ?   ?   B . n 
B 2 27  ASN 27  2   ?   ?   ?   B . n 
B 2 28  SER 28  3   ?   ?   ?   B . n 
B 2 29  GLU 29  4   ?   ?   ?   B . n 
B 2 30  ARG 30  5   ?   ?   ?   B . n 
B 2 31  HIS 31  6   6   HIS HIS B . n 
B 2 32  PHE 32  7   7   PHE PHE B . n 
B 2 33  VAL 33  8   8   VAL VAL B . n 
B 2 34  VAL 34  9   9   VAL VAL B . n 
B 2 35  GLN 35  10  10  GLN GLN B . n 
B 2 36  PHE 36  11  11  PHE PHE B . n 
B 2 37  LYS 37  12  12  LYS LYS B . n 
B 2 38  GLY 38  13  13  GLY GLY B . n 
B 2 39  GLU 39  14  14  GLU GLU B . n 
B 2 40  CYS 40  15  15  CYS CYS B . n 
B 2 41  TYR 41  16  16  TYR TYR B . n 
B 2 42  TYR 42  17  17  TYR TYR B . n 
B 2 43  THR 43  18  18  THR THR B . n 
B 2 44  ASN 44  19  19  ASN ASN B . n 
B 2 45  GLY 45  20  20  GLY GLY B . n 
B 2 46  THR 46  21  21  THR THR B . n 
B 2 47  GLN 47  22  22  GLN GLN B . n 
B 2 48  ARG 48  23  23  ARG ARG B . n 
B 2 49  ILE 49  24  24  ILE ILE B . n 
B 2 50  ARG 50  25  25  ARG ARG B . n 
B 2 51  LEU 51  26  26  LEU LEU B . n 
B 2 52  VAL 52  27  27  VAL VAL B . n 
B 2 53  THR 53  28  28  THR THR B . n 
B 2 54  ARG 54  29  29  ARG ARG B . n 
B 2 55  TYR 55  30  30  TYR TYR B . n 
B 2 56  ILE 56  31  31  ILE ILE B . n 
B 2 57  TYR 57  32  32  TYR TYR B . n 
B 2 58  ASN 58  33  33  ASN ASN B . n 
B 2 59  ARG 59  34  34  ARG ARG B . n 
B 2 60  GLU 60  35  35  GLU GLU B . n 
B 2 61  GLU 61  36  36  GLU GLU B . n 
B 2 62  TYR 62  37  37  TYR TYR B . n 
B 2 63  VAL 63  38  38  VAL VAL B . n 
B 2 64  ARG 64  39  39  ARG ARG B . n 
B 2 65  TYR 65  40  40  TYR TYR B . n 
B 2 66  ASP 66  41  41  ASP ASP B . n 
B 2 67  SER 67  42  42  SER SER B . n 
B 2 68  ASP 68  43  43  ASP ASP B . n 
B 2 69  VAL 69  44  44  VAL VAL B . n 
B 2 70  GLY 70  45  45  GLY GLY B . n 
B 2 71  GLU 71  46  46  GLU GLU B . n 
B 2 72  TYR 72  47  47  TYR TYR B . n 
B 2 73  ARG 73  48  48  ARG ARG B . n 
B 2 74  ALA 74  49  49  ALA ALA B . n 
B 2 75  VAL 75  50  50  VAL VAL B . n 
B 2 76  THR 76  51  51  THR THR B . n 
B 2 77  GLU 77  52  52  GLU GLU B . n 
B 2 78  LEU 78  53  53  LEU LEU B . n 
B 2 79  GLY 79  54  54  GLY GLY B . n 
B 2 80  ARG 80  55  55  ARG ARG B . n 
B 2 81  PRO 81  56  56  PRO PRO B . n 
B 2 82  ASP 82  57  57  ASP ASP B . n 
B 2 83  ALA 83  58  58  ALA ALA B . n 
B 2 84  GLU 84  59  59  GLU GLU B . n 
B 2 85  TYR 85  60  60  TYR TYR B . n 
B 2 86  TRP 86  61  61  TRP TRP B . n 
B 2 87  ASN 87  62  62  ASN ASN B . n 
B 2 88  SER 88  63  63  SER SER B . n 
B 2 89  GLN 89  64  64  GLN GLN B . n 
B 2 90  PRO 90  65  65  PRO PRO B . n 
B 2 91  GLU 91  66  66  GLU GLU B . n 
B 2 92  ILE 92  67  67  ILE ILE B . n 
B 2 93  LEU 93  68  68  LEU LEU B . n 
B 2 94  ASP 94  69  69  ASP ASP B . n 
B 2 95  ARG 95  70  70  ARG ARG B . n 
B 2 96  THR 96  71  71  THR THR B . n 
B 2 97  ARG 97  72  72  ARG ARG B . n 
B 2 98  ALA 98  73  73  ALA ALA B . n 
B 2 99  GLU 99  74  74  GLU GLU B . n 
B 2 100 VAL 100 75  75  VAL VAL B . n 
B 2 101 ASP 101 76  76  ASP ASP B . n 
B 2 102 THR 102 77  77  THR THR B . n 
B 2 103 ALA 103 78  78  ALA ALA B . n 
B 2 104 CYS 104 79  79  CYS CYS B . n 
B 2 105 ARG 105 80  80  ARG ARG B . n 
B 2 106 HIS 106 81  81  HIS HIS B . n 
B 2 107 ASN 107 82  82  ASN ASN B . n 
B 2 108 TYR 108 83  83  TYR TYR B . n 
B 2 109 GLU 109 84  84  GLU GLU B . n 
B 2 110 GLY 110 85  85  GLY GLY B . n 
B 2 111 PRO 111 86  86  PRO PRO B . n 
B 2 112 GLU 112 87  87  GLU GLU B . n 
B 2 113 THR 113 88  88  THR THR B . n 
B 2 114 SER 114 89  89  SER SER B . n 
B 2 115 THR 115 90  90  THR THR B . n 
B 2 116 SER 116 91  91  SER SER B . n 
B 2 117 LEU 117 92  92  LEU LEU B . n 
B 2 118 ARG 118 93  93  ARG ARG B . n 
B 2 119 ARG 119 94  94  ARG ARG B . n 
B 2 120 LEU 120 94  94  LEU LEU B A n 
B 2 121 GLU 121 95  95  GLU GLU B . n 
B 2 122 GLN 122 96  96  GLN GLN B . n 
B 2 123 PRO 123 97  97  PRO PRO B . n 
B 2 124 ASN 124 98  98  ASN ASN B . n 
B 2 125 VAL 125 99  99  VAL VAL B . n 
B 2 126 ALA 126 100 100 ALA ALA B . n 
B 2 127 ILE 127 101 101 ILE ILE B . n 
B 2 128 SER 128 102 102 SER SER B . n 
B 2 129 LEU 129 103 103 LEU LEU B . n 
B 2 130 SER 130 104 104 SER SER B . n 
B 2 131 ARG 131 105 105 ARG ARG B . n 
B 2 132 THR 132 106 106 THR THR B . n 
B 2 133 GLU 133 107 107 GLU GLU B . n 
B 2 134 ALA 134 108 108 ALA ALA B . n 
B 2 135 LEU 135 109 109 LEU LEU B . n 
B 2 136 ASN 136 110 110 ASN ASN B . n 
B 2 137 HIS 137 111 111 HIS HIS B . n 
B 2 138 HIS 138 112 112 HIS HIS B . n 
B 2 139 ASN 139 113 113 ASN ASN B . n 
B 2 140 THR 140 114 114 THR THR B . n 
B 2 141 LEU 141 115 115 LEU LEU B . n 
B 2 142 VAL 142 116 116 VAL VAL B . n 
B 2 143 CYS 143 117 117 CYS CYS B . n 
B 2 144 SER 144 118 118 SER SER B . n 
B 2 145 VAL 145 119 119 VAL VAL B . n 
B 2 146 THR 146 120 120 THR THR B . n 
B 2 147 ASP 147 121 121 ASP ASP B . n 
B 2 148 PHE 148 122 122 PHE PHE B . n 
B 2 149 TYR 149 123 123 TYR TYR B . n 
B 2 150 PRO 150 124 124 PRO PRO B . n 
B 2 151 ALA 151 125 125 ALA ALA B . n 
B 2 152 LYS 152 126 126 LYS LYS B . n 
B 2 153 ILE 153 127 127 ILE ILE B . n 
B 2 154 LYS 154 128 128 LYS LYS B . n 
B 2 155 VAL 155 129 129 VAL VAL B . n 
B 2 156 ARG 156 130 130 ARG ARG B . n 
B 2 157 TRP 157 131 131 TRP TRP B . n 
B 2 158 PHE 158 132 132 PHE PHE B . n 
B 2 159 ARG 159 133 133 ARG ARG B . n 
B 2 160 ASN 160 134 134 ASN ASN B . n 
B 2 161 GLY 161 135 135 GLY GLY B . n 
B 2 162 GLN 162 136 136 GLN GLN B . n 
B 2 163 GLU 163 137 137 GLU GLU B . n 
B 2 164 GLU 164 138 138 GLU GLU B . n 
B 2 165 THR 165 139 139 THR THR B . n 
B 2 166 VAL 166 140 140 VAL VAL B . n 
B 2 167 GLY 167 141 141 GLY GLY B . n 
B 2 168 VAL 168 142 142 VAL VAL B . n 
B 2 169 SER 169 143 143 SER SER B . n 
B 2 170 SER 170 144 144 SER SER B . n 
B 2 171 THR 171 145 145 THR THR B . n 
B 2 172 GLN 172 146 146 GLN GLN B . n 
B 2 173 LEU 173 147 147 LEU LEU B . n 
B 2 174 ILE 174 148 148 ILE ILE B . n 
B 2 175 ARG 175 149 149 ARG ARG B . n 
B 2 176 ASN 176 150 150 ASN ASN B . n 
B 2 177 GLY 177 151 151 GLY GLY B . n 
B 2 178 ASP 178 152 152 ASP ASP B . n 
B 2 179 TRP 179 153 153 TRP TRP B . n 
B 2 180 THR 180 154 154 THR THR B . n 
B 2 181 PHE 181 155 155 PHE PHE B . n 
B 2 182 GLN 182 156 156 GLN GLN B . n 
B 2 183 VAL 183 157 157 VAL VAL B . n 
B 2 184 LEU 184 158 158 LEU LEU B . n 
B 2 185 VAL 185 159 159 VAL VAL B . n 
B 2 186 MET 186 160 160 MET MET B . n 
B 2 187 LEU 187 161 161 LEU LEU B . n 
B 2 188 GLU 188 162 162 GLU GLU B . n 
B 2 189 MET 189 163 163 MET MET B . n 
B 2 190 THR 190 164 164 THR THR B . n 
B 2 191 PRO 191 165 165 PRO PRO B . n 
B 2 192 HIS 192 166 166 HIS HIS B . n 
B 2 193 GLN 193 167 167 GLN GLN B . n 
B 2 194 GLY 194 168 168 GLY GLY B . n 
B 2 195 GLU 195 169 169 GLU GLU B . n 
B 2 196 VAL 196 170 170 VAL VAL B . n 
B 2 197 TYR 197 171 171 TYR TYR B . n 
B 2 198 THR 198 172 172 THR THR B . n 
B 2 199 CYS 199 173 173 CYS CYS B . n 
B 2 200 HIS 200 174 174 HIS HIS B . n 
B 2 201 VAL 201 175 175 VAL VAL B . n 
B 2 202 GLU 202 176 176 GLU GLU B . n 
B 2 203 HIS 203 177 177 HIS HIS B . n 
B 2 204 PRO 204 178 178 PRO PRO B . n 
B 2 205 SER 205 179 179 SER SER B . n 
B 2 206 LEU 206 180 180 LEU LEU B . n 
B 2 207 LYS 207 181 181 LYS LYS B . n 
B 2 208 SER 208 182 182 SER SER B . n 
B 2 209 PRO 209 183 183 PRO PRO B . n 
B 2 210 ILE 210 184 184 ILE ILE B . n 
B 2 211 THR 211 185 185 THR THR B . n 
B 2 212 VAL 212 186 186 VAL VAL B . n 
B 2 213 GLU 213 187 187 GLU GLU B . n 
B 2 214 TRP 214 188 188 TRP TRP B . n 
B 2 215 SER 215 1   1   SER SER B T n 
B 2 216 SER 216 2   2   SER SER B T n 
B 2 217 ALA 217 3   ?   ?   ?   B T n 
B 2 218 ASP 218 4   ?   ?   ?   B T n 
B 2 219 LEU 219 5   ?   ?   ?   B T n 
B 2 220 VAL 220 6   ?   ?   ?   B T n 
B 2 221 PRO 221 7   ?   ?   ?   B T n 
B 2 222 ARG 222 8   ?   ?   ?   B T n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1 495  495  NAG NAG B . 
D 4 HOH 1 1004 1004 HOH HOH A . 
D 4 HOH 2 1026 1026 HOH HOH A . 
D 4 HOH 3 1032 1032 HOH HOH A . 
D 4 HOH 4 1036 1036 HOH HOH A . 
E 4 HOH 1 1023 1023 HOH HOH B . 
E 4 HOH 2 1025 1025 HOH HOH B . 
E 4 HOH 3 1042 1042 HOH HOH B . 
E 4 HOH 4 1043 1043 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    ASN 
_pdbx_struct_mod_residue.label_seq_id     44 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     ASN 
_pdbx_struct_mod_residue.auth_seq_id      19 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   ASN 
_pdbx_struct_mod_residue.details          'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  tetrameric 4 
2 software_defined_assembly            PISA dimeric    2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2 A,B,C,D,E 
2 1   A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 5770  ? 
2 MORE         -23   ? 
2 'SSA (A^2)'  18360 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 101.3000000000 -1.0000000000 
0.0000000000 0.0000000000 101.3000000000 0.0000000000 0.0000000000 -1.0000000000 46.3000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-11-04 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp                 
2 4 'Structure model' entity                    
3 4 'Structure model' pdbx_chem_comp_identifier 
4 4 'Structure model' pdbx_entity_nonpoly       
5 4 'Structure model' struct_conn               
6 4 'Structure model' struct_ref_seq_dif        
7 4 'Structure model' struct_site               
8 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_chem_comp.name'                     
2  4 'Structure model' '_chem_comp.type'                     
3  4 'Structure model' '_entity.pdbx_description'            
4  4 'Structure model' '_pdbx_entity_nonpoly.name'           
5  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6  4 'Structure model' '_struct_conn.pdbx_role'              
7  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
8  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
9  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
11 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
12 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
13 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
14 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
15 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
16 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
17 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
18 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
19 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
X-PLOR    refinement       3.8 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A ASP 157 ? ? N  A ASP 159  ? ? 1.94 
2 1 O   A ASP 158 ? ? N  A ILE 160  ? ? 2.02 
3 1 O   B ASN 110 ? ? O  B HOH 1043 ? ? 2.05 
4 1 OE2 A GLU 30  ? ? OG A SER 136  ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 C A SER 15  ? ? N  A PRO 16  ? ? CA A PRO 16  ? ? 96.03  119.30 -23.27 1.50 Y 
2  1 C A SER 15  ? ? N  A PRO 16  ? ? CD A PRO 16  ? ? 150.87 128.40 22.47  2.10 Y 
3  1 C A ILE 154 ? ? N  A PRO 155 ? ? CA A PRO 155 ? ? 135.32 119.30 16.02  1.50 Y 
4  1 C A ILE 154 ? ? N  A PRO 155 ? ? CD A PRO 155 ? ? 113.09 128.40 -15.31 2.10 Y 
5  1 N A PRO 155 ? ? CA A PRO 155 ? ? C  A PRO 155 ? ? 138.25 112.10 26.15  2.60 N 
6  1 N A GLY 169 ? ? CA A GLY 169 ? ? C  A GLY 169 ? ? 91.05  113.10 -22.05 2.50 N 
7  1 C A GLU 172 ? ? N  A PRO 173 ? ? CA A PRO 173 ? ? 105.21 119.30 -14.09 1.50 Y 
8  1 N A PRO 173 ? ? CA A PRO 173 ? ? C  A PRO 173 ? ? 95.92  112.10 -16.18 2.60 N 
9  1 N B ALA 108 ? ? CA B ALA 108 ? ? C  B ALA 108 ? ? 94.64  111.00 -16.36 2.70 N 
10 1 C B THR 164 ? ? N  B PRO 165 ? ? CA B PRO 165 ? ? 137.14 119.30 17.84  1.50 Y 
11 1 C B THR 164 ? ? N  B PRO 165 ? ? CD B PRO 165 ? ? 111.45 128.40 -16.95 2.10 Y 
12 1 N B HIS 166 ? ? CA B HIS 166 ? ? C  B HIS 166 ? ? 129.94 111.00 18.94  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 115 ? ? -63.10  51.64   
2  1 ASN A 124 ? ? -62.85  -80.31  
3  1 SER A 125 ? ? 132.26  36.41   
4  1 ASP A 130 ? ? -170.84 126.45  
5  1 PRO A 155 ? ? -38.21  -15.07  
6  1 ASP A 158 ? ? 36.50   -2.41   
7  1 ASP A 159 ? ? -12.59  8.33    
8  1 PRO A 173 ? ? -53.92  177.46  
9  1 ASN B 19  ? ? 43.89   78.25   
10 1 ASN B 33  ? ? 74.46   -90.11  
11 1 THR B 90  ? ? -144.17 -74.12  
12 1 SER B 104 ? ? -38.82  126.56  
13 1 ARG B 105 ? ? -46.37  86.95   
14 1 THR B 106 ? ? 89.95   20.18   
15 1 GLU B 107 ? ? -138.28 -86.59  
16 1 HIS B 111 ? ? 79.00   95.38   
17 1 HIS B 112 ? ? 85.31   97.15   
18 1 HIS B 166 ? ? -167.70 91.66   
19 1 GLN B 167 ? ? 117.68  -149.92 
20 1 PRO B 183 ? ? -37.78  120.79  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ILE 52  ? CG1 ? A ILE 56  CG1 
2  1 Y 1 A ILE 52  ? CG2 ? A ILE 56  CG2 
3  1 Y 1 A ILE 52  ? CD1 ? A ILE 56  CD1 
4  1 Y 1 A SER 125 ? CB  ? A SER 129 CB  
5  1 Y 1 A SER 125 ? OG  ? A SER 129 OG  
6  1 Y 1 A LYS 126 ? CB  ? A LYS 130 CB  
7  1 Y 1 A LYS 126 ? CG  ? A LYS 130 CG  
8  1 Y 1 A LYS 126 ? CD  ? A LYS 130 CD  
9  1 Y 1 A LYS 126 ? CE  ? A LYS 130 CE  
10 1 Y 1 A LYS 126 ? NZ  ? A LYS 130 NZ  
11 1 Y 1 A ASP 158 ? CG  ? A ASP 162 CG  
12 1 Y 1 A ASP 158 ? OD1 ? A ASP 162 OD1 
13 1 Y 1 A ASP 158 ? OD2 ? A ASP 162 OD2 
14 1 Y 1 A ASP 159 ? CG  ? A ASP 163 CG  
15 1 Y 1 A ASP 159 ? OD1 ? A ASP 163 OD1 
16 1 Y 1 A ASP 159 ? OD2 ? A ASP 163 OD2 
17 1 Y 1 A ILE 160 ? CG1 ? A ILE 164 CG1 
18 1 Y 1 A ILE 160 ? CG2 ? A ILE 164 CG2 
19 1 Y 1 A ILE 160 ? CD1 ? A ILE 164 CD1 
20 1 Y 1 A GLU 172 ? CG  ? A GLU 176 CG  
21 1 Y 1 A GLU 172 ? CD  ? A GLU 176 CD  
22 1 Y 1 A GLU 172 ? OE1 ? A GLU 176 OE1 
23 1 Y 1 A GLU 172 ? OE2 ? A GLU 176 OE2 
24 1 Y 1 B ARG 1   S CG  ? B ARG 1   CG  
25 1 Y 1 B ARG 1   S CD  ? B ARG 1   CD  
26 1 Y 1 B ARG 1   S NE  ? B ARG 1   NE  
27 1 Y 1 B ARG 1   S CZ  ? B ARG 1   CZ  
28 1 Y 1 B ARG 1   S NH1 ? B ARG 1   NH1 
29 1 Y 1 B ARG 1   S NH2 ? B ARG 1   NH2 
30 1 Y 1 B HIS 6   ? CG  ? B HIS 31  CG  
31 1 Y 1 B HIS 6   ? ND1 ? B HIS 31  ND1 
32 1 Y 1 B HIS 6   ? CD2 ? B HIS 31  CD2 
33 1 Y 1 B HIS 6   ? CE1 ? B HIS 31  CE1 
34 1 Y 1 B HIS 6   ? NE2 ? B HIS 31  NE2 
35 1 Y 1 B LEU 103 ? CG  ? B LEU 129 CG  
36 1 Y 1 B LEU 103 ? CD1 ? B LEU 129 CD1 
37 1 Y 1 B LEU 103 ? CD2 ? B LEU 129 CD2 
38 1 Y 1 B SER 104 ? OG  ? B SER 130 OG  
39 1 Y 1 B ARG 105 ? CG  ? B ARG 131 CG  
40 1 Y 1 B ARG 105 ? CD  ? B ARG 131 CD  
41 1 Y 1 B ARG 105 ? NE  ? B ARG 131 NE  
42 1 Y 1 B ARG 105 ? CZ  ? B ARG 131 CZ  
43 1 Y 1 B ARG 105 ? NH1 ? B ARG 131 NH1 
44 1 Y 1 B ARG 105 ? NH2 ? B ARG 131 NH2 
45 1 Y 1 B THR 106 ? OG1 ? B THR 132 OG1 
46 1 Y 1 B THR 106 ? CG2 ? B THR 132 CG2 
47 1 Y 1 B GLU 107 ? CG  ? B GLU 133 CG  
48 1 Y 1 B GLU 107 ? CD  ? B GLU 133 CD  
49 1 Y 1 B GLU 107 ? OE1 ? B GLU 133 OE1 
50 1 Y 1 B GLU 107 ? OE2 ? B GLU 133 OE2 
51 1 Y 1 B LEU 109 ? CG  ? B LEU 135 CG  
52 1 Y 1 B LEU 109 ? CD1 ? B LEU 135 CD1 
53 1 Y 1 B LEU 109 ? CD2 ? B LEU 135 CD2 
54 1 Y 1 B GLN 167 ? CB  ? B GLN 193 CB  
55 1 Y 1 B GLN 167 ? CG  ? B GLN 193 CG  
56 1 Y 1 B GLN 167 ? CD  ? B GLN 193 CD  
57 1 Y 1 B GLN 167 ? OE1 ? B GLN 193 OE1 
58 1 Y 1 B GLN 167 ? NE2 ? B GLN 193 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU -3  ? A GLU 1   
2  1 Y 1 A ASP -2  ? A ASP 2   
3  1 Y 1 A ASP -1  ? A ASP 3   
4  1 Y 1 A ILE 0   ? A ILE 4   
5  1 Y 1 A GLU 179 ? A GLU 183 
6  1 Y 1 A PRO 180 ? A PRO 184 
7  1 Y 1 A GLU 181 ? A GLU 185 
8  1 Y 1 A ILE 182 ? A ILE 186 
9  1 Y 1 A SER 183 ? A SER 187 
10 1 Y 1 A SER 184 ? A SER 188 
11 1 Y 1 A ALA 185 ? A ALA 189 
12 1 Y 1 A ASP 186 ? A ASP 190 
13 1 Y 1 A LEU 187 ? A LEU 191 
14 1 Y 1 A VAL 188 ? A VAL 192 
15 1 Y 1 A PRO 189 ? A PRO 193 
16 1 Y 1 A ARG 190 ? A ARG 194 
17 1 Y 1 B ASN -10 ? B ASN 15  
18 1 Y 1 B GLU -9  ? B GLU 16  
19 1 Y 1 B ALA -8  ? B ALA 17  
20 1 Y 1 B GLY -7  ? B GLY 18  
21 1 Y 1 B ARG -6  ? B ARG 19  
22 1 Y 1 B GLY -5  ? B GLY 20  
23 1 Y 1 B SER -4  ? B SER 21  
24 1 Y 1 B GLY -3  ? B GLY 22  
25 1 Y 1 B SER -2  ? B SER 23  
26 1 Y 1 B GLY -1  ? B GLY 24  
27 1 Y 1 B SER 0   ? B SER 25  
28 1 Y 1 B GLY 1   ? B GLY 26  
29 1 Y 1 B ASN 2   ? B ASN 27  
30 1 Y 1 B SER 3   ? B SER 28  
31 1 Y 1 B GLU 4   ? B GLU 29  
32 1 Y 1 B ARG 5   ? B ARG 30  
33 1 Y 1 B ALA 3   T B ALA 217 
34 1 Y 1 B ASP 4   T B ASP 218 
35 1 Y 1 B LEU 5   T B LEU 219 
36 1 Y 1 B VAL 6   T B VAL 220 
37 1 Y 1 B PRO 7   T B PRO 221 
38 1 Y 1 B ARG 8   T B ARG 222 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 water                                    HOH 
#