data_1IAT
# 
_entry.id   1IAT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IAT         
RCSB  RCSB013106   
WWPDB D_1000013106 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1DQR 
_pdbx_database_related.details        
;CRYSTAL STRUCTURE OF RABBIT PHOSPHOGLUCOSE ISOMERASE, A GLYCOLYTIC ENZYME THAT MOONLIGHTS AS NEUROLEUKIN, AUTOCRINE MOTILITY FACTOR, AND DIFFERENTIATION MEDIATOR
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IAT 
_pdbx_database_status.recvd_initial_deposition_date   2001-03-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Read, J.A.'   1 
'Pearce, J.'   2 
'Li, X.'       3 
'Muirhead, H.' 4 
'Chirgwin, J.' 5 
'Davies, C.'   6 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of human phosphoglucose isomerase at 1.6 A resolution: implications for catalytic mechanism, cytokine activity and haemolytic anaemia.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            309 
_citation.page_first                447 
_citation.page_last                 463 
_citation.year                      2001 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11371164 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.4680 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Read, J.'     1 
primary 'Pearce, J.'   2 
primary 'Li, X.'       3 
primary 'Muirhead, H.' 4 
primary 'Chirgwin, J.' 5 
primary 'Davies, C.'   6 
# 
_cell.entry_id           1IAT 
_cell.length_a           94.183 
_cell.length_b           94.183 
_cell.length_c           136.138 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IAT 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PHOSPHOGLUCOSE ISOMERASE' 63098.746 1   5.3.1.9 ? ? ? 
2 non-polymer syn 'SULFATE ION'              96.063    2   ?       ? ? ? 
3 non-polymer syn BETA-MERCAPTOETHANOL       78.133    1   ?       ? ? ? 
4 water       nat water                      18.015    581 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GLUCOSE-6-PHOSPHATE ISOMERASE, GLUCOSE PHOSPHATE ISOMERASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAK
HFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
LLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTK
LTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAK
HFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
LLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTK
LTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   LEU n 
1 4   THR n 
1 5   ARG n 
1 6   ASP n 
1 7   PRO n 
1 8   GLN n 
1 9   PHE n 
1 10  GLN n 
1 11  LYS n 
1 12  LEU n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  ARG n 
1 18  GLU n 
1 19  HIS n 
1 20  ARG n 
1 21  SER n 
1 22  GLU n 
1 23  LEU n 
1 24  ASN n 
1 25  LEU n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  PHE n 
1 30  ASP n 
1 31  ALA n 
1 32  ASN n 
1 33  LYS n 
1 34  ASP n 
1 35  ARG n 
1 36  PHE n 
1 37  ASN n 
1 38  HIS n 
1 39  PHE n 
1 40  SER n 
1 41  LEU n 
1 42  THR n 
1 43  LEU n 
1 44  ASN n 
1 45  THR n 
1 46  ASN n 
1 47  HIS n 
1 48  GLY n 
1 49  HIS n 
1 50  ILE n 
1 51  LEU n 
1 52  VAL n 
1 53  ASP n 
1 54  TYR n 
1 55  SER n 
1 56  LYS n 
1 57  ASN n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  GLU n 
1 62  ASP n 
1 63  VAL n 
1 64  MET n 
1 65  ARG n 
1 66  MET n 
1 67  LEU n 
1 68  VAL n 
1 69  ASP n 
1 70  LEU n 
1 71  ALA n 
1 72  LYS n 
1 73  SER n 
1 74  ARG n 
1 75  GLY n 
1 76  VAL n 
1 77  GLU n 
1 78  ALA n 
1 79  ALA n 
1 80  ARG n 
1 81  GLU n 
1 82  ARG n 
1 83  MET n 
1 84  PHE n 
1 85  ASN n 
1 86  GLY n 
1 87  GLU n 
1 88  LYS n 
1 89  ILE n 
1 90  ASN n 
1 91  TYR n 
1 92  THR n 
1 93  GLU n 
1 94  GLY n 
1 95  ARG n 
1 96  ALA n 
1 97  VAL n 
1 98  LEU n 
1 99  HIS n 
1 100 VAL n 
1 101 ALA n 
1 102 LEU n 
1 103 ARG n 
1 104 ASN n 
1 105 ARG n 
1 106 SER n 
1 107 ASN n 
1 108 THR n 
1 109 PRO n 
1 110 ILE n 
1 111 LEU n 
1 112 VAL n 
1 113 ASP n 
1 114 GLY n 
1 115 LYS n 
1 116 ASP n 
1 117 VAL n 
1 118 MET n 
1 119 PRO n 
1 120 GLU n 
1 121 VAL n 
1 122 ASN n 
1 123 LYS n 
1 124 VAL n 
1 125 LEU n 
1 126 ASP n 
1 127 LYS n 
1 128 MET n 
1 129 LYS n 
1 130 SER n 
1 131 PHE n 
1 132 CYS n 
1 133 GLN n 
1 134 ARG n 
1 135 VAL n 
1 136 ARG n 
1 137 SER n 
1 138 GLY n 
1 139 ASP n 
1 140 TRP n 
1 141 LYS n 
1 142 GLY n 
1 143 TYR n 
1 144 THR n 
1 145 GLY n 
1 146 LYS n 
1 147 THR n 
1 148 ILE n 
1 149 THR n 
1 150 ASP n 
1 151 VAL n 
1 152 ILE n 
1 153 ASN n 
1 154 ILE n 
1 155 GLY n 
1 156 ILE n 
1 157 GLY n 
1 158 GLY n 
1 159 SER n 
1 160 ASP n 
1 161 LEU n 
1 162 GLY n 
1 163 PRO n 
1 164 LEU n 
1 165 MET n 
1 166 VAL n 
1 167 THR n 
1 168 GLU n 
1 169 ALA n 
1 170 LEU n 
1 171 LYS n 
1 172 PRO n 
1 173 TYR n 
1 174 SER n 
1 175 SER n 
1 176 GLY n 
1 177 GLY n 
1 178 PRO n 
1 179 ARG n 
1 180 VAL n 
1 181 TRP n 
1 182 TYR n 
1 183 VAL n 
1 184 SER n 
1 185 ASN n 
1 186 ILE n 
1 187 ASP n 
1 188 GLY n 
1 189 THR n 
1 190 HIS n 
1 191 ILE n 
1 192 ALA n 
1 193 LYS n 
1 194 THR n 
1 195 LEU n 
1 196 ALA n 
1 197 GLN n 
1 198 LEU n 
1 199 ASN n 
1 200 PRO n 
1 201 GLU n 
1 202 SER n 
1 203 SER n 
1 204 LEU n 
1 205 PHE n 
1 206 ILE n 
1 207 ILE n 
1 208 ALA n 
1 209 SER n 
1 210 LYS n 
1 211 THR n 
1 212 PHE n 
1 213 THR n 
1 214 THR n 
1 215 GLN n 
1 216 GLU n 
1 217 THR n 
1 218 ILE n 
1 219 THR n 
1 220 ASN n 
1 221 ALA n 
1 222 GLU n 
1 223 THR n 
1 224 ALA n 
1 225 LYS n 
1 226 GLU n 
1 227 TRP n 
1 228 PHE n 
1 229 LEU n 
1 230 GLN n 
1 231 ALA n 
1 232 ALA n 
1 233 LYS n 
1 234 ASP n 
1 235 PRO n 
1 236 SER n 
1 237 ALA n 
1 238 VAL n 
1 239 ALA n 
1 240 LYS n 
1 241 HIS n 
1 242 PHE n 
1 243 VAL n 
1 244 ALA n 
1 245 LEU n 
1 246 SER n 
1 247 THR n 
1 248 ASN n 
1 249 THR n 
1 250 THR n 
1 251 LYS n 
1 252 VAL n 
1 253 LYS n 
1 254 GLU n 
1 255 PHE n 
1 256 GLY n 
1 257 ILE n 
1 258 ASP n 
1 259 PRO n 
1 260 GLN n 
1 261 ASN n 
1 262 MET n 
1 263 PHE n 
1 264 GLU n 
1 265 PHE n 
1 266 TRP n 
1 267 ASP n 
1 268 TRP n 
1 269 VAL n 
1 270 GLY n 
1 271 GLY n 
1 272 ARG n 
1 273 TYR n 
1 274 SER n 
1 275 LEU n 
1 276 TRP n 
1 277 SER n 
1 278 ALA n 
1 279 ILE n 
1 280 GLY n 
1 281 LEU n 
1 282 SER n 
1 283 ILE n 
1 284 ALA n 
1 285 LEU n 
1 286 HIS n 
1 287 VAL n 
1 288 GLY n 
1 289 PHE n 
1 290 ASP n 
1 291 ASN n 
1 292 PHE n 
1 293 GLU n 
1 294 GLN n 
1 295 LEU n 
1 296 LEU n 
1 297 SER n 
1 298 GLY n 
1 299 ALA n 
1 300 HIS n 
1 301 TRP n 
1 302 MET n 
1 303 ASP n 
1 304 GLN n 
1 305 HIS n 
1 306 PHE n 
1 307 ARG n 
1 308 THR n 
1 309 THR n 
1 310 PRO n 
1 311 LEU n 
1 312 GLU n 
1 313 LYS n 
1 314 ASN n 
1 315 ALA n 
1 316 PRO n 
1 317 VAL n 
1 318 LEU n 
1 319 LEU n 
1 320 ALA n 
1 321 LEU n 
1 322 LEU n 
1 323 GLY n 
1 324 ILE n 
1 325 TRP n 
1 326 TYR n 
1 327 ILE n 
1 328 ASN n 
1 329 CYS n 
1 330 PHE n 
1 331 GLY n 
1 332 CYS n 
1 333 GLU n 
1 334 THR n 
1 335 HIS n 
1 336 ALA n 
1 337 MET n 
1 338 LEU n 
1 339 PRO n 
1 340 TYR n 
1 341 ASP n 
1 342 GLN n 
1 343 TYR n 
1 344 LEU n 
1 345 HIS n 
1 346 ARG n 
1 347 PHE n 
1 348 ALA n 
1 349 ALA n 
1 350 TYR n 
1 351 PHE n 
1 352 GLN n 
1 353 GLN n 
1 354 GLY n 
1 355 ASP n 
1 356 MET n 
1 357 GLU n 
1 358 SER n 
1 359 ASN n 
1 360 GLY n 
1 361 LYS n 
1 362 TYR n 
1 363 ILE n 
1 364 THR n 
1 365 LYS n 
1 366 SER n 
1 367 GLY n 
1 368 THR n 
1 369 ARG n 
1 370 VAL n 
1 371 ASP n 
1 372 HIS n 
1 373 GLN n 
1 374 THR n 
1 375 GLY n 
1 376 PRO n 
1 377 ILE n 
1 378 VAL n 
1 379 TRP n 
1 380 GLY n 
1 381 GLU n 
1 382 PRO n 
1 383 GLY n 
1 384 THR n 
1 385 ASN n 
1 386 GLY n 
1 387 GLN n 
1 388 HIS n 
1 389 ALA n 
1 390 PHE n 
1 391 TYR n 
1 392 GLN n 
1 393 LEU n 
1 394 ILE n 
1 395 HIS n 
1 396 GLN n 
1 397 GLY n 
1 398 THR n 
1 399 LYS n 
1 400 MET n 
1 401 ILE n 
1 402 PRO n 
1 403 CYS n 
1 404 ASP n 
1 405 PHE n 
1 406 LEU n 
1 407 ILE n 
1 408 PRO n 
1 409 VAL n 
1 410 GLN n 
1 411 THR n 
1 412 GLN n 
1 413 HIS n 
1 414 PRO n 
1 415 ILE n 
1 416 ARG n 
1 417 LYS n 
1 418 GLY n 
1 419 LEU n 
1 420 HIS n 
1 421 HIS n 
1 422 LYS n 
1 423 ILE n 
1 424 LEU n 
1 425 LEU n 
1 426 ALA n 
1 427 ASN n 
1 428 PHE n 
1 429 LEU n 
1 430 ALA n 
1 431 GLN n 
1 432 THR n 
1 433 GLU n 
1 434 ALA n 
1 435 LEU n 
1 436 MET n 
1 437 ARG n 
1 438 GLY n 
1 439 LYS n 
1 440 SER n 
1 441 THR n 
1 442 GLU n 
1 443 GLU n 
1 444 ALA n 
1 445 ARG n 
1 446 LYS n 
1 447 GLU n 
1 448 LEU n 
1 449 GLN n 
1 450 ALA n 
1 451 ALA n 
1 452 GLY n 
1 453 LYS n 
1 454 SER n 
1 455 PRO n 
1 456 GLU n 
1 457 ASP n 
1 458 LEU n 
1 459 GLU n 
1 460 ARG n 
1 461 LEU n 
1 462 LEU n 
1 463 PRO n 
1 464 HIS n 
1 465 LYS n 
1 466 VAL n 
1 467 PHE n 
1 468 GLU n 
1 469 GLY n 
1 470 ASN n 
1 471 ARG n 
1 472 PRO n 
1 473 THR n 
1 474 ASN n 
1 475 SER n 
1 476 ILE n 
1 477 VAL n 
1 478 PHE n 
1 479 THR n 
1 480 LYS n 
1 481 LEU n 
1 482 THR n 
1 483 PRO n 
1 484 PHE n 
1 485 MET n 
1 486 LEU n 
1 487 GLY n 
1 488 ALA n 
1 489 LEU n 
1 490 VAL n 
1 491 ALA n 
1 492 MET n 
1 493 TYR n 
1 494 GLU n 
1 495 HIS n 
1 496 LYS n 
1 497 ILE n 
1 498 PHE n 
1 499 VAL n 
1 500 GLN n 
1 501 GLY n 
1 502 ILE n 
1 503 ILE n 
1 504 TRP n 
1 505 ASP n 
1 506 ILE n 
1 507 ASN n 
1 508 SER n 
1 509 PHE n 
1 510 ASP n 
1 511 GLN n 
1 512 TRP n 
1 513 GLY n 
1 514 VAL n 
1 515 GLU n 
1 516 LEU n 
1 517 GLY n 
1 518 LYS n 
1 519 GLN n 
1 520 LEU n 
1 521 ALA n 
1 522 LYS n 
1 523 LYS n 
1 524 ILE n 
1 525 GLU n 
1 526 PRO n 
1 527 GLU n 
1 528 LEU n 
1 529 ASP n 
1 530 GLY n 
1 531 SER n 
1 532 ALA n 
1 533 GLN n 
1 534 VAL n 
1 535 THR n 
1 536 SER n 
1 537 HIS n 
1 538 ASP n 
1 539 ALA n 
1 540 SER n 
1 541 THR n 
1 542 ASN n 
1 543 GLY n 
1 544 LEU n 
1 545 ILE n 
1 546 ASN n 
1 547 PHE n 
1 548 ILE n 
1 549 LYS n 
1 550 GLN n 
1 551 GLN n 
1 552 ARG n 
1 553 GLU n 
1 554 ALA n 
1 555 ARG n 
1 556 VAL n 
1 557 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GPI 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSD
LGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAK
HFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLA
LLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKM
IPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFTK
LTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDASTNGLINFIKQQREARVQ
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_accession          P06744 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IAT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 557 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06744 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       557 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ? 'C2 H6 O S'      78.133  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IAT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.57 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'Ammonium sulphate, tris-HCl, Na Hepes, beta-mercaptoethanol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.488 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX7.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX7.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.488 
# 
_reflns.entry_id                     1IAT 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.62 
_reflns.number_obs                   75504 
_reflns.number_all                   75504 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.0480000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        30.65 
_reflns.B_iso_Wilson_estimate        14.3 
_reflns.pdbx_redundancy              5.13 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.62 
_reflns_shell.d_res_low              1.69 
_reflns_shell.percent_possible_all   88.4 
_reflns_shell.Rmerge_I_obs           0.1730000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    7.33 
_reflns_shell.pdbx_redundancy        4.52 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IAT 
_refine.ls_number_reflns_obs                     70947 
_refine.ls_number_reflns_all                     70947 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             29.88 
_refine.ls_d_res_high                            1.62 
_refine.ls_percent_reflns_obs                    95.50 
_refine.ls_R_factor_obs                          0.1466000 
_refine.ls_R_factor_all                          0.1466000 
_refine.ls_R_factor_R_work                       0.1440000 
_refine.ls_R_factor_R_free                       0.1700000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3766 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               17.1 
_refine.aniso_B[1][1]                            -0 
_refine.aniso_B[2][2]                            -0 
_refine.aniso_B[3][3]                            0 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PIG MUSCLE PGI (unpublished)' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4437 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             581 
_refine_hist.number_atoms_total               5032 
_refine_hist.d_res_high                       1.62 
_refine_hist.d_res_low                        29.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_mcbond_it  2760 1.163 ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it 4449 1.858 ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it  1796 2.772 ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it 1719 4.228 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.620 
_refine_ls_shell.d_res_low                        1.662 
_refine_ls_shell.number_reflns_R_work             4277 
_refine_ls_shell.R_factor_R_work                  0.2100000 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.223 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             231 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IAT 
_struct.title                     
'CRYSTAL STRUCTURE OF HUMAN PHOSPHOGLUCOSE ISOMERASE/NEUROLEUKIN/AUTOCRINE MOTILITY FACTOR/MATURATION FACTOR' 
_struct.pdbx_descriptor           'PHOSPHOGLUCOSE ISOMERASE, BETA-MERCAPTOETHANOL' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IAT 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'isomerase, glycolysis enzyme/neurotrophic growth factor/cytokine, two alpha/beta domains' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 1   ? ASP A 6   ? ALA A 1   ASP A 6   1 ? 6  
HELX_P HELX_P2  2  ASP A 6   ? ARG A 20  ? ASP A 6   ARG A 20  1 ? 15 
HELX_P HELX_P3  3  SER A 21  ? LEU A 23  ? SER A 21  LEU A 23  5 ? 3  
HELX_P HELX_P4  4  ASN A 24  ? ASN A 32  ? ASN A 24  ASN A 32  1 ? 9  
HELX_P HELX_P5  5  ASP A 34  ? PHE A 39  ? ASP A 34  PHE A 39  1 ? 6  
HELX_P HELX_P6  6  THR A 60  ? ARG A 74  ? THR A 60  ARG A 74  1 ? 15 
HELX_P HELX_P7  7  GLY A 75  ? ASN A 85  ? GLY A 75  ASN A 85  1 ? 11 
HELX_P HELX_P8  8  LEU A 98  ? ARG A 103 ? LEU A 98  ARG A 103 1 ? 6  
HELX_P HELX_P9  9  VAL A 117 ? SER A 137 ? VAL A 117 SER A 137 1 ? 21 
HELX_P HELX_P10 10 ILE A 156 ? SER A 159 ? ILE A 156 SER A 159 5 ? 4  
HELX_P HELX_P11 11 ASP A 160 ? LEU A 170 ? ASP A 160 LEU A 170 1 ? 11 
HELX_P HELX_P12 12 LYS A 171 ? SER A 174 ? LYS A 171 SER A 174 5 ? 4  
HELX_P HELX_P13 13 ASP A 187 ? ALA A 196 ? ASP A 187 ALA A 196 1 ? 10 
HELX_P HELX_P14 14 GLN A 197 ? LEU A 198 ? GLN A 197 LEU A 198 5 ? 2  
HELX_P HELX_P15 15 ASN A 199 ? GLU A 201 ? ASN A 199 GLU A 201 5 ? 3  
HELX_P HELX_P16 16 THR A 214 ? LYS A 233 ? THR A 214 LYS A 233 1 ? 20 
HELX_P HELX_P17 17 ASP A 234 ? SER A 236 ? ASP A 234 SER A 236 5 ? 3  
HELX_P HELX_P18 18 ALA A 237 ? HIS A 241 ? ALA A 237 HIS A 241 1 ? 5  
HELX_P HELX_P19 19 ASN A 248 ? GLY A 256 ? ASN A 248 GLY A 256 1 ? 9  
HELX_P HELX_P20 20 ASP A 258 ? GLN A 260 ? ASP A 258 GLN A 260 5 ? 3  
HELX_P HELX_P21 21 GLY A 270 ? SER A 274 ? GLY A 270 SER A 274 5 ? 5  
HELX_P HELX_P22 22 SER A 277 ? ILE A 279 ? SER A 277 ILE A 279 5 ? 3  
HELX_P HELX_P23 23 GLY A 280 ? GLY A 288 ? GLY A 280 GLY A 288 1 ? 9  
HELX_P HELX_P24 24 GLY A 288 ? THR A 309 ? GLY A 288 THR A 309 1 ? 22 
HELX_P HELX_P25 25 PRO A 310 ? LYS A 313 ? PRO A 310 LYS A 313 5 ? 4  
HELX_P HELX_P26 26 ASN A 314 ? CYS A 329 ? ASN A 314 CYS A 329 1 ? 16 
HELX_P HELX_P27 27 ASP A 341 ? HIS A 345 ? ASP A 341 HIS A 345 5 ? 5  
HELX_P HELX_P28 28 ARG A 346 ? GLY A 360 ? ARG A 346 GLY A 360 1 ? 15 
HELX_P HELX_P29 29 THR A 384 ? ALA A 389 ? THR A 384 ALA A 389 5 ? 6  
HELX_P HELX_P30 30 PHE A 390 ? GLY A 397 ? PHE A 390 GLY A 397 1 ? 8  
HELX_P HELX_P31 31 PRO A 414 ? LYS A 417 ? PRO A 414 LYS A 417 5 ? 4  
HELX_P HELX_P32 32 GLY A 418 ? GLY A 438 ? GLY A 418 GLY A 438 1 ? 21 
HELX_P HELX_P33 33 SER A 440 ? ALA A 451 ? SER A 440 ALA A 451 1 ? 12 
HELX_P HELX_P34 34 SER A 454 ? LEU A 462 ? SER A 454 LEU A 462 1 ? 9  
HELX_P HELX_P35 35 PRO A 463 ? VAL A 466 ? PRO A 463 VAL A 466 5 ? 4  
HELX_P HELX_P36 36 THR A 482 ? ASP A 505 ? THR A 482 ASP A 505 1 ? 24 
HELX_P HELX_P37 37 GLN A 511 ? GLY A 513 ? GLN A 511 GLY A 513 5 ? 3  
HELX_P HELX_P38 38 VAL A 514 ? LEU A 528 ? VAL A 514 LEU A 528 1 ? 15 
HELX_P HELX_P39 39 ASP A 538 ? ARG A 552 ? ASP A 538 ARG A 552 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           383 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            383 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   THR 
_struct_mon_prot_cis.pdbx_label_seq_id_2    384 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    THR 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     384 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 40  ? ASN A 44  ? SER A 40  ASN A 44  
A 2 HIS A 49  ? ASP A 53  ? HIS A 49  ASP A 53  
A 3 THR A 473 ? LYS A 480 ? THR A 473 LYS A 480 
A 4 CYS A 403 ? GLN A 410 ? CYS A 403 GLN A 410 
A 5 THR A 334 ? PRO A 339 ? THR A 334 PRO A 339 
A 6 ILE A 377 ? TRP A 379 ? ILE A 377 TRP A 379 
B 1 LEU A 111 ? VAL A 112 ? LEU A 111 VAL A 112 
B 2 LYS A 115 ? ASP A 116 ? LYS A 115 ASP A 116 
C 1 ARG A 179 ? VAL A 183 ? ARG A 179 VAL A 183 
C 2 ASP A 150 ? ILE A 154 ? ASP A 150 ILE A 154 
C 3 SER A 203 ? ALA A 208 ? SER A 203 ALA A 208 
C 4 PHE A 242 ? SER A 246 ? PHE A 242 SER A 246 
C 5 MET A 262 ? GLU A 264 ? MET A 262 GLU A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 43  ? N LEU A 43  O ILE A 50  ? O ILE A 50  
A 2 3 N ASP A 53  ? N ASP A 53  O SER A 475 ? O SER A 475 
A 3 4 N ASN A 474 ? N ASN A 474 O CYS A 403 ? O CYS A 403 
A 4 5 N ASP A 404 ? N ASP A 404 O ALA A 336 ? O ALA A 336 
A 5 6 N HIS A 335 ? N HIS A 335 O ILE A 377 ? O ILE A 377 
B 1 2 N VAL A 112 ? N VAL A 112 O LYS A 115 ? O LYS A 115 
C 1 2 O ARG A 179 ? O ARG A 179 N VAL A 151 ? N VAL A 151 
C 2 3 N ILE A 152 ? N ILE A 152 O LEU A 204 ? O LEU A 204 
C 3 4 N ILE A 207 ? N ILE A 207 O VAL A 243 ? O VAL A 243 
C 4 5 O ALA A 244 ? O ALA A 244 N PHE A 263 ? N PHE A 263 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 A 602' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 A 603' 
AC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BME A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 SER A 159 ? SER A 159  . ? 1_555 ? 
2  AC1 10 SER A 209 ? SER A 209  . ? 1_555 ? 
3  AC1 10 LYS A 210 ? LYS A 210  . ? 1_555 ? 
4  AC1 10 THR A 211 ? THR A 211  . ? 1_555 ? 
5  AC1 10 THR A 214 ? THR A 214  . ? 1_555 ? 
6  AC1 10 BME D .   ? BME A 601  . ? 1_555 ? 
7  AC1 10 HOH E .   ? HOH A 627  . ? 1_555 ? 
8  AC1 10 HOH E .   ? HOH A 747  . ? 1_555 ? 
9  AC1 10 HOH E .   ? HOH A 925  . ? 1_555 ? 
10 AC1 10 HOH E .   ? HOH A 973  . ? 1_555 ? 
11 AC2 7  ARG A 27  ? ARG A 27   . ? 1_555 ? 
12 AC2 7  ASN A 46  ? ASN A 46   . ? 5_654 ? 
13 AC2 7  HIS A 47  ? HIS A 47   . ? 5_654 ? 
14 AC2 7  HOH E .   ? HOH A 985  . ? 1_555 ? 
15 AC2 7  HOH E .   ? HOH A 1056 . ? 1_555 ? 
16 AC2 7  HOH E .   ? HOH A 1070 . ? 1_555 ? 
17 AC2 7  HOH E .   ? HOH A 1161 . ? 1_555 ? 
18 AC3 8  GLY A 158 ? GLY A 158  . ? 1_555 ? 
19 AC3 8  GLY A 271 ? GLY A 271  . ? 1_555 ? 
20 AC3 8  GLN A 353 ? GLN A 353  . ? 1_555 ? 
21 AC3 8  SO4 B .   ? SO4 A 602  . ? 1_555 ? 
22 AC3 8  HOH E .   ? HOH A 710  . ? 1_555 ? 
23 AC3 8  HOH E .   ? HOH A 747  . ? 1_555 ? 
24 AC3 8  HOH E .   ? HOH A 866  . ? 1_555 ? 
25 AC3 8  HOH E .   ? HOH A 973  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IAT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IAT 
_atom_sites.fract_transf_matrix[1][1]   0.010618 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010618 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007345 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 85.350 61.217 9.742   1.00 18.07 ? 1    ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 84.668 60.017 9.133   1.00 16.88 ? 1    ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 85.513 59.468 7.987   1.00 16.51 ? 1    ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 86.095 60.231 7.194   1.00 16.94 ? 1    ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 83.249 60.414 8.614   1.00 17.29 ? 1    ALA A CB  1 
ATOM   6    N N   . ALA A 1 2   ? 85.562 58.142 7.883   1.00 15.37 ? 2    ALA A N   1 
ATOM   7    C CA  . ALA A 1 2   ? 86.378 57.519 6.863   1.00 15.43 ? 2    ALA A CA  1 
ATOM   8    C C   . ALA A 1 2   ? 86.100 57.964 5.452   1.00 15.51 ? 2    ALA A C   1 
ATOM   9    O O   . ALA A 1 2   ? 87.023 58.150 4.670   1.00 15.50 ? 2    ALA A O   1 
ATOM   10   C CB  . ALA A 1 2   ? 86.252 56.001 6.952   1.00 15.50 ? 2    ALA A CB  1 
ATOM   11   N N   . LEU A 1 3   ? 84.828 58.053 5.064   1.00 14.40 ? 3    LEU A N   1 
ATOM   12   C CA  . LEU A 1 3   ? 84.561 58.357 3.673   1.00 14.49 ? 3    LEU A CA  1 
ATOM   13   C C   . LEU A 1 3   ? 85.116 59.702 3.233   1.00 14.37 ? 3    LEU A C   1 
ATOM   14   O O   . LEU A 1 3   ? 85.767 59.810 2.181   1.00 13.95 ? 3    LEU A O   1 
ATOM   15   C CB  . LEU A 1 3   ? 83.049 58.269 3.360   1.00 13.92 ? 3    LEU A CB  1 
ATOM   16   C CG  . LEU A 1 3   ? 82.703 58.689 1.919   1.00 14.36 ? 3    LEU A CG  1 
ATOM   17   C CD1 . LEU A 1 3   ? 83.393 57.730 0.950   1.00 16.35 ? 3    LEU A CD1 1 
ATOM   18   C CD2 . LEU A 1 3   ? 81.166 58.601 1.711   1.00 15.36 ? 3    LEU A CD2 1 
ATOM   19   N N   . THR A 1 4   ? 84.899 60.732 4.059   1.00 14.80 ? 4    THR A N   1 
ATOM   20   C CA  . THR A 1 4   ? 85.343 62.063 3.664   1.00 16.17 ? 4    THR A CA  1 
ATOM   21   C C   . THR A 1 4   ? 86.864 62.187 3.707   1.00 16.62 ? 4    THR A C   1 
ATOM   22   O O   . THR A 1 4   ? 87.401 63.067 3.046   1.00 17.32 ? 4    THR A O   1 
ATOM   23   C CB  . THR A 1 4   ? 84.663 63.141 4.500   1.00 18.13 ? 4    THR A CB  1 
ATOM   24   O OG1 . THR A 1 4   ? 84.512 62.677 5.829   1.00 20.87 ? 4    THR A OG1 1 
ATOM   25   C CG2 . THR A 1 4   ? 83.214 63.260 4.108   1.00 17.91 ? 4    THR A CG2 1 
ATOM   26   N N   . ARG A 1 5   ? 87.540 61.305 4.440   1.00 15.57 ? 5    ARG A N   1 
ATOM   27   C CA  . ARG A 1 5   ? 89.009 61.330 4.478   1.00 16.59 ? 5    ARG A CA  1 
ATOM   28   C C   . ARG A 1 5   ? 89.599 60.518 3.329   1.00 16.40 ? 5    ARG A C   1 
ATOM   29   O O   . ARG A 1 5   ? 90.812 60.531 3.115   1.00 17.85 ? 5    ARG A O   1 
ATOM   30   C CB  . ARG A 1 5   ? 89.503 60.753 5.816   1.00 17.25 ? 5    ARG A CB  1 
ATOM   31   C CG  . ARG A 1 5   ? 89.145 61.637 7.026   1.00 20.21 ? 5    ARG A CG  1 
ATOM   32   C CD  . ARG A 1 5   ? 89.665 61.116 8.390   1.00 26.85 ? 5    ARG A CD  1 
ATOM   33   N NE  . ARG A 1 5   ? 91.109 61.328 8.502   1.00 32.71 ? 5    ARG A NE  1 
ATOM   34   C CZ  . ARG A 1 5   ? 91.687 62.457 8.910   1.00 34.16 ? 5    ARG A CZ  1 
ATOM   35   N NH1 . ARG A 1 5   ? 93.012 62.538 8.943   1.00 35.16 ? 5    ARG A NH1 1 
ATOM   36   N NH2 . ARG A 1 5   ? 90.956 63.504 9.280   1.00 35.55 ? 5    ARG A NH2 1 
ATOM   37   N N   . ASP A 1 6   ? 88.763 59.801 2.580   1.00 16.17 ? 6    ASP A N   1 
ATOM   38   C CA  . ASP A 1 6   ? 89.294 58.915 1.542   1.00 16.57 ? 6    ASP A CA  1 
ATOM   39   C C   . ASP A 1 6   ? 89.717 59.721 0.300   1.00 16.46 ? 6    ASP A C   1 
ATOM   40   O O   . ASP A 1 6   ? 88.945 60.499 -0.224  1.00 14.99 ? 6    ASP A O   1 
ATOM   41   C CB  . ASP A 1 6   ? 88.224 57.847 1.217   1.00 16.08 ? 6    ASP A CB  1 
ATOM   42   C CG  . ASP A 1 6   ? 88.660 56.867 0.132   1.00 16.96 ? 6    ASP A CG  1 
ATOM   43   O OD1 . ASP A 1 6   ? 88.960 55.696 0.453   1.00 16.44 ? 6    ASP A OD1 1 
ATOM   44   O OD2 . ASP A 1 6   ? 88.628 57.163 -1.075  1.00 17.22 ? 6    ASP A OD2 1 
ATOM   45   N N   . PRO A 1 7   ? 90.941 59.543 -0.195  1.00 17.71 ? 7    PRO A N   1 
ATOM   46   C CA  . PRO A 1 7   ? 91.392 60.341 -1.354  1.00 17.96 ? 7    PRO A CA  1 
ATOM   47   C C   . PRO A 1 7   ? 90.633 60.085 -2.640  1.00 17.23 ? 7    PRO A C   1 
ATOM   48   O O   . PRO A 1 7   ? 90.541 60.992 -3.485  1.00 16.77 ? 7    PRO A O   1 
ATOM   49   C CB  . PRO A 1 7   ? 92.855 59.900 -1.577  1.00 18.85 ? 7    PRO A CB  1 
ATOM   50   C CG  . PRO A 1 7   ? 93.196 59.001 -0.486  1.00 20.66 ? 7    PRO A CG  1 
ATOM   51   C CD  . PRO A 1 7   ? 91.948 58.575 0.268   1.00 18.89 ? 7    PRO A CD  1 
ATOM   52   N N   . GLN A 1 8   ? 90.124 58.871 -2.823  1.00 16.83 ? 8    GLN A N   1 
ATOM   53   C CA  . GLN A 1 8   ? 89.324 58.629 -4.018  1.00 16.79 ? 8    GLN A CA  1 
ATOM   54   C C   . GLN A 1 8   ? 87.984 59.376 -3.920  1.00 15.79 ? 8    GLN A C   1 
ATOM   55   O O   . GLN A 1 8   ? 87.468 59.852 -4.935  1.00 15.54 ? 8    GLN A O   1 
ATOM   56   C CB  . GLN A 1 8   ? 89.075 57.130 -4.260  1.00 17.55 ? 8    GLN A CB  1 
ATOM   57   C CG  . GLN A 1 8   ? 90.341 56.345 -4.601  1.00 21.10 ? 8    GLN A CG  1 
ATOM   58   C CD  . GLN A 1 8   ? 90.983 56.764 -5.905  1.00 27.90 ? 8    GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 8   ? 90.341 57.346 -6.773  1.00 30.01 ? 8    GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 8   ? 92.262 56.434 -6.055  1.00 33.31 ? 8    GLN A NE2 1 
ATOM   61   N N   . PHE A 1 9   ? 87.405 59.441 -2.715  1.00 14.46 ? 9    PHE A N   1 
ATOM   62   C CA  . PHE A 1 9   ? 86.168 60.188 -2.537  1.00 14.74 ? 9    PHE A CA  1 
ATOM   63   C C   . PHE A 1 9   ? 86.434 61.663 -2.795  1.00 15.19 ? 9    PHE A C   1 
ATOM   64   O O   . PHE A 1 9   ? 85.671 62.315 -3.489  1.00 15.34 ? 9    PHE A O   1 
ATOM   65   C CB  . PHE A 1 9   ? 85.606 60.016 -1.138  1.00 14.42 ? 9    PHE A CB  1 
ATOM   66   C CG  . PHE A 1 9   ? 84.306 60.770 -0.934  1.00 15.38 ? 9    PHE A CG  1 
ATOM   67   C CD1 . PHE A 1 9   ? 84.293 61.953 -0.210  1.00 15.65 ? 9    PHE A CD1 1 
ATOM   68   C CD2 . PHE A 1 9   ? 83.136 60.332 -1.536  1.00 17.89 ? 9    PHE A CD2 1 
ATOM   69   C CE1 . PHE A 1 9   ? 83.115 62.651 -0.040  1.00 18.11 ? 9    PHE A CE1 1 
ATOM   70   C CE2 . PHE A 1 9   ? 81.970 61.023 -1.377  1.00 19.25 ? 9    PHE A CE2 1 
ATOM   71   C CZ  . PHE A 1 9   ? 81.950 62.183 -0.630  1.00 21.04 ? 9    PHE A CZ  1 
ATOM   72   N N   . GLN A 1 10  ? 87.529 62.187 -2.248  1.00 16.22 ? 10   GLN A N   1 
ATOM   73   C CA  . GLN A 1 10  ? 87.884 63.588 -2.501  1.00 16.72 ? 10   GLN A CA  1 
ATOM   74   C C   . GLN A 1 10  ? 88.078 63.917 -3.991  1.00 17.16 ? 10   GLN A C   1 
ATOM   75   O O   . GLN A 1 10  ? 87.664 65.002 -4.475  1.00 17.88 ? 10   GLN A O   1 
ATOM   76   C CB  . GLN A 1 10  ? 89.142 63.945 -1.698  1.00 17.23 ? 10   GLN A CB  1 
ATOM   77   C CG  . GLN A 1 10  ? 88.881 63.959 -0.180  1.00 18.26 ? 10   GLN A CG  1 
ATOM   78   C CD  . GLN A 1 10  ? 90.148 64.112 0.685   1.00 22.78 ? 10   GLN A CD  1 
ATOM   79   O OE1 . GLN A 1 10  ? 91.251 64.296 0.151   1.00 26.11 ? 10   GLN A OE1 1 
ATOM   80   N NE2 . GLN A 1 10  ? 89.988 64.017 2.017   1.00 21.77 ? 10   GLN A NE2 1 
ATOM   81   N N   . LYS A 1 11  ? 88.694 62.988 -4.722  1.00 17.32 ? 11   LYS A N   1 
ATOM   82   C CA  . LYS A 1 11  ? 88.893 63.135 -6.153  1.00 18.22 ? 11   LYS A CA  1 
ATOM   83   C C   . LYS A 1 11  ? 87.549 63.160 -6.882  1.00 17.82 ? 11   LYS A C   1 
ATOM   84   O O   . LYS A 1 11  ? 87.326 63.961 -7.770  1.00 18.03 ? 11   LYS A O   1 
ATOM   85   C CB  . LYS A 1 11  ? 89.794 62.004 -6.656  1.00 19.30 ? 11   LYS A CB  1 
ATOM   86   C CG  . LYS A 1 11  ? 89.958 61.899 -8.157  1.00 23.96 ? 11   LYS A CG  1 
ATOM   87   C CD  . LYS A 1 11  ? 90.930 60.751 -8.483  1.00 29.50 ? 11   LYS A CD  1 
ATOM   88   C CE  . LYS A 1 11  ? 91.154 60.543 -10.000 1.00 33.10 ? 11   LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 11  ? 91.828 59.207 -10.240 1.00 35.36 ? 11   LYS A NZ  1 
ATOM   90   N N   . LEU A 1 12  ? 86.638 62.270 -6.481  1.00 16.85 ? 12   LEU A N   1 
ATOM   91   C CA  . LEU A 1 12  ? 85.311 62.235 -7.085  1.00 16.43 ? 12   LEU A CA  1 
ATOM   92   C C   . LEU A 1 12  ? 84.553 63.533 -6.850  1.00 17.13 ? 12   LEU A C   1 
ATOM   93   O O   . LEU A 1 12  ? 83.925 64.077 -7.770  1.00 16.42 ? 12   LEU A O   1 
ATOM   94   C CB  . LEU A 1 12  ? 84.517 61.067 -6.484  1.00 15.66 ? 12   LEU A CB  1 
ATOM   95   C CG  . LEU A 1 12  ? 83.145 60.765 -7.056  1.00 16.41 ? 12   LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 12  ? 83.285 60.067 -8.443  1.00 16.14 ? 12   LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 12  ? 82.350 59.862 -6.062  1.00 17.09 ? 12   LEU A CD2 1 
ATOM   98   N N   . GLN A 1 13  ? 84.615 64.034 -5.618  1.00 18.16 ? 13   GLN A N   1 
ATOM   99   C CA  . GLN A 1 13  ? 83.917 65.276 -5.276  1.00 19.81 ? 13   GLN A CA  1 
ATOM   100  C C   . GLN A 1 13  ? 84.470 66.463 -6.057  1.00 19.66 ? 13   GLN A C   1 
ATOM   101  O O   . GLN A 1 13  ? 83.697 67.316 -6.499  1.00 19.63 ? 13   GLN A O   1 
ATOM   102  C CB  . GLN A 1 13  ? 83.980 65.545 -3.755  1.00 21.61 ? 13   GLN A CB  1 
ATOM   103  C CG  . GLN A 1 13  ? 82.974 64.715 -2.986  1.00 24.83 ? 13   GLN A CG  1 
ATOM   104  C CD  . GLN A 1 13  ? 82.308 65.487 -1.829  1.00 30.44 ? 13   GLN A CD  1 
ATOM   105  O OE1 . GLN A 1 13  ? 81.051 65.543 -1.703  1.00 33.95 ? 13   GLN A OE1 1 
ATOM   106  N NE2 . GLN A 1 13  ? 83.131 66.049 -0.973  1.00 28.69 ? 13   GLN A NE2 1 
ATOM   107  N N   . GLN A 1 14  ? 85.789 66.502 -6.246  1.00 20.18 ? 14   GLN A N   1 
ATOM   108  C CA  . GLN A 1 14  ? 86.413 67.632 -6.945  1.00 21.50 ? 14   GLN A CA  1 
ATOM   109  C C   . GLN A 1 14  ? 86.023 67.581 -8.409  1.00 20.93 ? 14   GLN A C   1 
ATOM   110  O O   . GLN A 1 14  ? 85.700 68.614 -8.994  1.00 21.64 ? 14   GLN A O   1 
ATOM   111  C CB  . GLN A 1 14  ? 87.935 67.611 -6.785  1.00 22.78 ? 14   GLN A CB  1 
ATOM   112  C CG  . GLN A 1 14  ? 88.654 68.754 -7.540  1.00 27.15 ? 14   GLN A CG  1 
ATOM   113  C CD  . GLN A 1 14  ? 88.326 70.147 -7.008  1.00 33.66 ? 14   GLN A CD  1 
ATOM   114  O OE1 . GLN A 1 14  ? 87.957 70.316 -5.831  1.00 36.99 ? 14   GLN A OE1 1 
ATOM   115  N NE2 . GLN A 1 14  ? 88.460 71.160 -7.881  1.00 35.43 ? 14   GLN A NE2 1 
ATOM   116  N N   . TRP A 1 15  ? 85.959 66.376 -8.983  1.00 19.50 ? 15   TRP A N   1 
ATOM   117  C CA  . TRP A 1 15  ? 85.565 66.253 -10.384 1.00 18.77 ? 15   TRP A CA  1 
ATOM   118  C C   . TRP A 1 15  ? 84.114 66.704 -10.571 1.00 18.32 ? 15   TRP A C   1 
ATOM   119  O O   . TRP A 1 15  ? 83.769 67.447 -11.505 1.00 18.44 ? 15   TRP A O   1 
ATOM   120  C CB  . TRP A 1 15  ? 85.764 64.810 -10.840 1.00 18.53 ? 15   TRP A CB  1 
ATOM   121  C CG  . TRP A 1 15  ? 85.645 64.585 -12.327 1.00 18.57 ? 15   TRP A CG  1 
ATOM   122  C CD1 . TRP A 1 15  ? 86.682 64.433 -13.222 1.00 19.34 ? 15   TRP A CD1 1 
ATOM   123  C CD2 . TRP A 1 15  ? 84.439 64.452 -13.094 1.00 18.11 ? 15   TRP A CD2 1 
ATOM   124  N NE1 . TRP A 1 15  ? 86.189 64.218 -14.488 1.00 19.20 ? 15   TRP A NE1 1 
ATOM   125  C CE2 . TRP A 1 15  ? 84.816 64.245 -14.444 1.00 18.72 ? 15   TRP A CE2 1 
ATOM   126  C CE3 . TRP A 1 15  ? 83.069 64.505 -12.782 1.00 17.32 ? 15   TRP A CE3 1 
ATOM   127  C CZ2 . TRP A 1 15  ? 83.879 64.082 -15.469 1.00 18.61 ? 15   TRP A CZ2 1 
ATOM   128  C CZ3 . TRP A 1 15  ? 82.137 64.357 -13.803 1.00 17.93 ? 15   TRP A CZ3 1 
ATOM   129  C CH2 . TRP A 1 15  ? 82.550 64.131 -15.132 1.00 18.20 ? 15   TRP A CH2 1 
ATOM   130  N N   . TYR A 1 16  ? 83.254 66.266 -9.649  1.00 17.91 ? 16   TYR A N   1 
ATOM   131  C CA  . TYR A 1 16  ? 81.858 66.659 -9.669  1.00 18.38 ? 16   TYR A CA  1 
ATOM   132  C C   . TYR A 1 16  ? 81.745 68.187 -9.654  1.00 20.01 ? 16   TYR A C   1 
ATOM   133  O O   . TYR A 1 16  ? 81.003 68.757 -10.459 1.00 19.50 ? 16   TYR A O   1 
ATOM   134  C CB  . TYR A 1 16  ? 81.135 66.052 -8.454  1.00 18.18 ? 16   TYR A CB  1 
ATOM   135  C CG  . TYR A 1 16  ? 79.771 66.673 -8.199  1.00 16.92 ? 16   TYR A CG  1 
ATOM   136  C CD1 . TYR A 1 16  ? 78.660 66.301 -8.953  1.00 15.97 ? 16   TYR A CD1 1 
ATOM   137  C CD2 . TYR A 1 16  ? 79.596 67.634 -7.217  1.00 17.61 ? 16   TYR A CD2 1 
ATOM   138  C CE1 . TYR A 1 16  ? 77.400 66.868 -8.730  1.00 15.54 ? 16   TYR A CE1 1 
ATOM   139  C CE2 . TYR A 1 16  ? 78.353 68.235 -7.013  1.00 18.15 ? 16   TYR A CE2 1 
ATOM   140  C CZ  . TYR A 1 16  ? 77.252 67.832 -7.774  1.00 16.30 ? 16   TYR A CZ  1 
ATOM   141  O OH  . TYR A 1 16  ? 76.000 68.384 -7.561  1.00 16.65 ? 16   TYR A OH  1 
ATOM   142  N N   . ARG A 1 17  ? 82.477 68.832 -8.748  1.00 21.24 ? 17   ARG A N   1 
ATOM   143  C CA  . ARG A 1 17  ? 82.424 70.298 -8.637  1.00 24.25 ? 17   ARG A CA  1 
ATOM   144  C C   . ARG A 1 17  ? 82.885 70.959 -9.950  1.00 24.96 ? 17   ARG A C   1 
ATOM   145  O O   . ARG A 1 17  ? 82.262 71.922 -10.425 1.00 24.53 ? 17   ARG A O   1 
ATOM   146  C CB  . ARG A 1 17  ? 83.276 70.754 -7.433  1.00 25.46 ? 17   ARG A CB  1 
ATOM   147  C CG  . ARG A 1 17  ? 83.381 72.259 -7.239  1.00 31.15 ? 17   ARG A CG  1 
ATOM   148  C CD  . ARG A 1 17  ? 84.224 72.703 -6.021  1.00 38.03 ? 17   ARG A CD  1 
ATOM   149  N NE  . ARG A 1 17  ? 85.670 72.626 -6.254  1.00 42.05 ? 17   ARG A NE  1 
ATOM   150  C CZ  . ARG A 1 17  ? 86.564 73.392 -5.636  1.00 44.71 ? 17   ARG A CZ  1 
ATOM   151  N NH1 . ARG A 1 17  ? 87.855 73.256 -5.908  1.00 46.66 ? 17   ARG A NH1 1 
ATOM   152  N NH2 . ARG A 1 17  ? 86.170 74.310 -4.758  1.00 45.61 ? 17   ARG A NH2 1 
ATOM   153  N N   . GLU A 1 18  ? 83.928 70.403 -10.558 1.00 25.76 ? 18   GLU A N   1 
ATOM   154  C CA  . GLU A 1 18  ? 84.499 70.945 -11.797 1.00 27.84 ? 18   GLU A CA  1 
ATOM   155  C C   . GLU A 1 18  ? 83.661 70.708 -13.042 1.00 27.76 ? 18   GLU A C   1 
ATOM   156  O O   . GLU A 1 18  ? 83.602 71.570 -13.926 1.00 28.49 ? 18   GLU A O   1 
ATOM   157  C CB  . GLU A 1 18  ? 85.910 70.377 -12.062 1.00 28.90 ? 18   GLU A CB  1 
ATOM   158  C CG  . GLU A 1 18  ? 86.973 70.789 -11.053 1.00 34.74 ? 18   GLU A CG  1 
ATOM   159  C CD  . GLU A 1 18  ? 88.247 69.926 -11.098 1.00 41.38 ? 18   GLU A CD  1 
ATOM   160  O OE1 . GLU A 1 18  ? 88.246 68.782 -11.655 1.00 44.75 ? 18   GLU A OE1 1 
ATOM   161  O OE2 . GLU A 1 18  ? 89.267 70.388 -10.541 1.00 43.44 ? 18   GLU A OE2 1 
ATOM   162  N N   . HIS A 1 19  ? 83.004 69.550 -13.122 1.00 26.68 ? 19   HIS A N   1 
ATOM   163  C CA  . HIS A 1 19  ? 82.350 69.180 -14.368 1.00 26.89 ? 19   HIS A CA  1 
ATOM   164  C C   . HIS A 1 19  ? 80.834 68.971 -14.337 1.00 26.90 ? 19   HIS A C   1 
ATOM   165  O O   . HIS A 1 19  ? 80.267 68.553 -15.342 1.00 27.10 ? 19   HIS A O   1 
ATOM   166  C CB  . HIS A 1 19  ? 83.023 67.928 -14.942 1.00 27.33 ? 19   HIS A CB  1 
ATOM   167  C CG  . HIS A 1 19  ? 84.511 68.042 -15.084 1.00 28.46 ? 19   HIS A CG  1 
ATOM   168  N ND1 . HIS A 1 19  ? 85.110 68.679 -16.155 1.00 29.63 ? 19   HIS A ND1 1 
ATOM   169  C CD2 . HIS A 1 19  ? 85.519 67.587 -14.306 1.00 28.01 ? 19   HIS A CD2 1 
ATOM   170  C CE1 . HIS A 1 19  ? 86.423 68.611 -16.022 1.00 30.04 ? 19   HIS A CE1 1 
ATOM   171  N NE2 . HIS A 1 19  ? 86.700 67.946 -14.913 1.00 28.93 ? 19   HIS A NE2 1 
ATOM   172  N N   . ARG A 1 20  ? 80.191 69.250 -13.208 1.00 27.28 ? 20   ARG A N   1 
ATOM   173  C CA  . ARG A 1 20  ? 78.745 69.034 -13.043 1.00 28.78 ? 20   ARG A CA  1 
ATOM   174  C C   . ARG A 1 20  ? 77.891 69.681 -14.146 1.00 29.58 ? 20   ARG A C   1 
ATOM   175  O O   . ARG A 1 20  ? 77.055 69.019 -14.779 1.00 29.66 ? 20   ARG A O   1 
ATOM   176  C CB  . ARG A 1 20  ? 78.303 69.538 -11.656 1.00 29.54 ? 20   ARG A CB  1 
ATOM   177  C CG  . ARG A 1 20  ? 76.833 69.409 -11.325 1.00 31.68 ? 20   ARG A CG  1 
ATOM   178  C CD  . ARG A 1 20  ? 76.380 70.332 -10.196 1.00 33.60 ? 20   ARG A CD  1 
ATOM   179  N NE  . ARG A 1 20  ? 75.077 69.946 -9.654  1.00 35.38 ? 20   ARG A NE  1 
ATOM   180  C CZ  . ARG A 1 20  ? 73.915 70.466 -10.042 1.00 35.68 ? 20   ARG A CZ  1 
ATOM   181  N NH1 . ARG A 1 20  ? 73.875 71.404 -10.991 1.00 35.86 ? 20   ARG A NH1 1 
ATOM   182  N NH2 . ARG A 1 20  ? 72.788 70.048 -9.484  1.00 35.02 ? 20   ARG A NH2 1 
ATOM   183  N N   . SER A 1 21  ? 78.120 70.969 -14.386 1.00 30.00 ? 21   SER A N   1 
ATOM   184  C CA  . SER A 1 21  ? 77.328 71.716 -15.351 1.00 30.57 ? 21   SER A CA  1 
ATOM   185  C C   . SER A 1 21  ? 77.423 71.150 -16.751 1.00 30.20 ? 21   SER A C   1 
ATOM   186  O O   . SER A 1 21  ? 76.607 71.486 -17.611 1.00 31.39 ? 21   SER A O   1 
ATOM   187  C CB  . SER A 1 21  ? 77.813 73.158 -15.390 1.00 30.80 ? 21   SER A CB  1 
ATOM   188  O OG  . SER A 1 21  ? 78.968 73.214 -16.208 1.00 31.98 ? 21   SER A OG  1 
ATOM   189  N N   . GLU A 1 22  ? 78.431 70.331 -16.998 1.00 30.01 ? 22   GLU A N   1 
ATOM   190  C CA  . GLU A 1 22  ? 78.663 69.734 -18.310 1.00 29.81 ? 22   GLU A CA  1 
ATOM   191  C C   . GLU A 1 22  ? 77.912 68.436 -18.559 1.00 28.87 ? 22   GLU A C   1 
ATOM   192  O O   . GLU A 1 22  ? 77.964 67.895 -19.669 1.00 29.35 ? 22   GLU A O   1 
ATOM   193  C CB  . GLU A 1 22  ? 80.144 69.385 -18.467 1.00 31.27 ? 22   GLU A CB  1 
ATOM   194  C CG  . GLU A 1 22  ? 81.055 70.581 -18.674 1.00 34.78 ? 22   GLU A CG  1 
ATOM   195  C CD  . GLU A 1 22  ? 82.425 70.409 -18.032 1.00 39.30 ? 22   GLU A CD  1 
ATOM   196  O OE1 . GLU A 1 22  ? 83.117 69.398 -18.336 1.00 41.39 ? 22   GLU A OE1 1 
ATOM   197  O OE2 . GLU A 1 22  ? 82.809 71.294 -17.213 1.00 41.24 ? 22   GLU A OE2 1 
ATOM   198  N N   . LEU A 1 23  ? 77.268 67.903 -17.521 1.00 25.86 ? 23   LEU A N   1 
ATOM   199  C CA  . LEU A 1 23  ? 76.623 66.596 -17.628 1.00 24.12 ? 23   LEU A CA  1 
ATOM   200  C C   . LEU A 1 23  ? 75.187 66.725 -18.117 1.00 22.50 ? 23   LEU A C   1 
ATOM   201  O O   . LEU A 1 23  ? 74.314 67.193 -17.385 1.00 23.34 ? 23   LEU A O   1 
ATOM   202  C CB  . LEU A 1 23  ? 76.631 65.899 -16.263 1.00 23.56 ? 23   LEU A CB  1 
ATOM   203  C CG  . LEU A 1 23  ? 78.037 65.548 -15.775 1.00 25.26 ? 23   LEU A CG  1 
ATOM   204  C CD1 . LEU A 1 23  ? 77.994 65.050 -14.346 1.00 25.14 ? 23   LEU A CD1 1 
ATOM   205  C CD2 . LEU A 1 23  ? 78.615 64.499 -16.718 1.00 26.22 ? 23   LEU A CD2 1 
ATOM   206  N N   . ASN A 1 24  ? 74.932 66.297 -19.338 1.00 20.13 ? 24   ASN A N   1 
ATOM   207  C CA  . ASN A 1 24  ? 73.592 66.379 -19.880 1.00 18.90 ? 24   ASN A CA  1 
ATOM   208  C C   . ASN A 1 24  ? 73.333 65.077 -20.594 1.00 18.72 ? 24   ASN A C   1 
ATOM   209  O O   . ASN A 1 24  ? 74.084 64.721 -21.511 1.00 19.42 ? 24   ASN A O   1 
ATOM   210  C CB  . ASN A 1 24  ? 73.460 67.539 -20.870 1.00 19.17 ? 24   ASN A CB  1 
ATOM   211  C CG  . ASN A 1 24  ? 72.066 67.663 -21.420 1.00 20.25 ? 24   ASN A CG  1 
ATOM   212  O OD1 . ASN A 1 24  ? 71.729 67.026 -22.419 1.00 21.02 ? 24   ASN A OD1 1 
ATOM   213  N ND2 . ASN A 1 24  ? 71.223 68.471 -20.760 1.00 20.85 ? 24   ASN A ND2 1 
ATOM   214  N N   . LEU A 1 25  ? 72.268 64.379 -20.205 1.00 17.53 ? 25   LEU A N   1 
ATOM   215  C CA  . LEU A 1 25  ? 72.002 63.054 -20.749 1.00 18.98 ? 25   LEU A CA  1 
ATOM   216  C C   . LEU A 1 25  ? 71.814 63.058 -22.262 1.00 21.20 ? 25   LEU A C   1 
ATOM   217  O O   . LEU A 1 25  ? 72.343 62.201 -22.960 1.00 21.79 ? 25   LEU A O   1 
ATOM   218  C CB  . LEU A 1 25  ? 70.745 62.468 -20.086 1.00 17.66 ? 25   LEU A CB  1 
ATOM   219  C CG  . LEU A 1 25  ? 70.859 62.167 -18.593 1.00 17.35 ? 25   LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 25  ? 69.524 61.672 -18.021 1.00 15.94 ? 25   LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 25  ? 71.919 61.115 -18.390 1.00 16.48 ? 25   LEU A CD2 1 
ATOM   222  N N   . ARG A 1 26  ? 71.034 64.001 -22.778 1.00 23.13 ? 26   ARG A N   1 
ATOM   223  C CA  . ARG A 1 26  ? 70.815 64.057 -24.227 1.00 26.29 ? 26   ARG A CA  1 
ATOM   224  C C   . ARG A 1 26  ? 72.125 64.132 -24.956 1.00 27.20 ? 26   ARG A C   1 
ATOM   225  O O   . ARG A 1 26  ? 72.363 63.388 -25.906 1.00 27.66 ? 26   ARG A O   1 
ATOM   226  C CB  . ARG A 1 26  ? 70.052 65.314 -24.582 1.00 27.68 ? 26   ARG A CB  1 
ATOM   227  C CG  . ARG A 1 26  ? 68.623 65.260 -24.193 1.00 30.85 ? 26   ARG A CG  1 
ATOM   228  C CD  . ARG A 1 26  ? 67.676 65.386 -25.355 1.00 37.56 ? 26   ARG A CD  1 
ATOM   229  N NE  . ARG A 1 26  ? 68.112 66.457 -26.230 1.00 41.87 ? 26   ARG A NE  1 
ATOM   230  C CZ  . ARG A 1 26  ? 67.444 66.886 -27.298 1.00 45.56 ? 26   ARG A CZ  1 
ATOM   231  N NH1 . ARG A 1 26  ? 66.260 66.355 -27.613 1.00 46.28 ? 26   ARG A NH1 1 
ATOM   232  N NH2 . ARG A 1 26  ? 67.961 67.867 -28.044 1.00 47.65 ? 26   ARG A NH2 1 
ATOM   233  N N   . ARG A 1 27  ? 72.983 65.025 -24.504 1.00 27.69 ? 27   ARG A N   1 
ATOM   234  C CA  . ARG A 1 27  ? 74.260 65.222 -25.152 1.00 28.87 ? 27   ARG A CA  1 
ATOM   235  C C   . ARG A 1 27  ? 75.193 64.022 -24.982 1.00 28.64 ? 27   ARG A C   1 
ATOM   236  O O   . ARG A 1 27  ? 75.983 63.686 -25.881 1.00 28.46 ? 27   ARG A O   1 
ATOM   237  C CB  . ARG A 1 27  ? 74.864 66.534 -24.664 1.00 29.99 ? 27   ARG A CB  1 
ATOM   238  C CG  . ARG A 1 27  ? 73.881 67.688 -24.904 1.00 32.47 ? 27   ARG A CG  1 
ATOM   239  C CD  . ARG A 1 27  ? 74.457 69.097 -24.683 1.00 36.30 ? 27   ARG A CD  1 
ATOM   240  N NE  . ARG A 1 27  ? 73.376 70.070 -24.487 1.00 38.60 ? 27   ARG A NE  1 
ATOM   241  C CZ  . ARG A 1 27  ? 73.187 70.758 -23.366 1.00 40.83 ? 27   ARG A CZ  1 
ATOM   242  N NH1 . ARG A 1 27  ? 74.022 70.620 -22.335 1.00 41.03 ? 27   ARG A NH1 1 
ATOM   243  N NH2 . ARG A 1 27  ? 72.171 71.612 -23.293 1.00 43.79 ? 27   ARG A NH2 1 
ATOM   244  N N   . LEU A 1 28  ? 75.105 63.355 -23.840 1.00 27.37 ? 28   LEU A N   1 
ATOM   245  C CA  . LEU A 1 28  ? 75.937 62.187 -23.633 1.00 26.36 ? 28   LEU A CA  1 
ATOM   246  C C   . LEU A 1 28  ? 75.564 61.105 -24.641 1.00 26.68 ? 28   LEU A C   1 
ATOM   247  O O   . LEU A 1 28  ? 76.431 60.372 -25.143 1.00 27.45 ? 28   LEU A O   1 
ATOM   248  C CB  . LEU A 1 28  ? 75.781 61.672 -22.217 1.00 25.15 ? 28   LEU A CB  1 
ATOM   249  C CG  . LEU A 1 28  ? 76.497 62.563 -21.216 1.00 25.10 ? 28   LEU A CG  1 
ATOM   250  C CD1 . LEU A 1 28  ? 76.037 62.190 -19.800 1.00 23.20 ? 28   LEU A CD1 1 
ATOM   251  C CD2 . LEU A 1 28  ? 78.011 62.404 -21.390 1.00 25.85 ? 28   LEU A CD2 1 
ATOM   252  N N   . PHE A 1 29  ? 74.284 61.002 -24.947 1.00 26.62 ? 29   PHE A N   1 
ATOM   253  C CA  . PHE A 1 29  ? 73.857 59.995 -25.908 1.00 27.33 ? 29   PHE A CA  1 
ATOM   254  C C   . PHE A 1 29  ? 74.225 60.390 -27.338 1.00 29.98 ? 29   PHE A C   1 
ATOM   255  O O   . PHE A 1 29  ? 74.675 59.552 -28.110 1.00 30.22 ? 29   PHE A O   1 
ATOM   256  C CB  . PHE A 1 29  ? 72.370 59.696 -25.788 1.00 25.78 ? 29   PHE A CB  1 
ATOM   257  C CG  . PHE A 1 29  ? 72.052 58.665 -24.709 1.00 22.15 ? 29   PHE A CG  1 
ATOM   258  C CD1 . PHE A 1 29  ? 71.748 59.059 -23.414 1.00 20.84 ? 29   PHE A CD1 1 
ATOM   259  C CD2 . PHE A 1 29  ? 72.054 57.318 -25.003 1.00 18.73 ? 29   PHE A CD2 1 
ATOM   260  C CE1 . PHE A 1 29  ? 71.463 58.118 -22.412 1.00 18.43 ? 29   PHE A CE1 1 
ATOM   261  C CE2 . PHE A 1 29  ? 71.777 56.374 -23.996 1.00 18.71 ? 29   PHE A CE2 1 
ATOM   262  C CZ  . PHE A 1 29  ? 71.479 56.781 -22.712 1.00 16.81 ? 29   PHE A CZ  1 
ATOM   263  N N   . ASP A 1 30  ? 74.069 61.652 -27.704 1.00 32.38 ? 30   ASP A N   1 
ATOM   264  C CA  . ASP A 1 30  ? 74.453 61.912 -29.089 1.00 34.59 ? 30   ASP A CA  1 
ATOM   265  C C   . ASP A 1 30  ? 75.958 61.907 -29.353 1.00 35.24 ? 30   ASP A C   1 
ATOM   266  O O   . ASP A 1 30  ? 76.374 61.781 -30.492 1.00 36.23 ? 30   ASP A O   1 
ATOM   267  C CB  . ASP A 1 30  ? 73.630 62.987 -29.813 1.00 36.61 ? 30   ASP A CB  1 
ATOM   268  C CG  . ASP A 1 30  ? 73.283 64.138 -28.958 1.00 39.42 ? 30   ASP A CG  1 
ATOM   269  O OD1 . ASP A 1 30  ? 72.070 64.431 -28.837 1.00 42.54 ? 30   ASP A OD1 1 
ATOM   270  O OD2 . ASP A 1 30  ? 74.151 64.842 -28.402 1.00 44.68 ? 30   ASP A OD2 1 
ATOM   271  N N   . ALA A 1 31  ? 76.767 61.986 -28.310 1.00 35.37 ? 31   ALA A N   1 
ATOM   272  C CA  . ALA A 1 31  ? 78.221 61.929 -28.446 1.00 36.27 ? 31   ALA A CA  1 
ATOM   273  C C   . ALA A 1 31  ? 78.832 60.507 -28.393 1.00 36.79 ? 31   ALA A C   1 
ATOM   274  O O   . ALA A 1 31  ? 80.014 60.316 -28.719 1.00 37.05 ? 31   ALA A O   1 
ATOM   275  C CB  . ALA A 1 31  ? 78.859 62.777 -27.389 1.00 36.34 ? 31   ALA A CB  1 
ATOM   276  N N   . ASN A 1 32  ? 78.052 59.526 -27.942 1.00 36.74 ? 32   ASN A N   1 
ATOM   277  C CA  . ASN A 1 32  ? 78.545 58.151 -27.811 1.00 36.43 ? 32   ASN A CA  1 
ATOM   278  C C   . ASN A 1 32  ? 77.514 57.176 -28.345 1.00 36.35 ? 32   ASN A C   1 
ATOM   279  O O   . ASN A 1 32  ? 76.530 56.862 -27.664 1.00 36.33 ? 32   ASN A O   1 
ATOM   280  C CB  . ASN A 1 32  ? 78.858 57.827 -26.351 1.00 36.51 ? 32   ASN A CB  1 
ATOM   281  C CG  . ASN A 1 32  ? 79.509 56.456 -26.169 1.00 36.95 ? 32   ASN A CG  1 
ATOM   282  O OD1 . ASN A 1 32  ? 79.765 55.722 -27.146 1.00 38.33 ? 32   ASN A OD1 1 
ATOM   283  N ND2 . ASN A 1 32  ? 79.780 56.097 -24.909 1.00 34.54 ? 32   ASN A ND2 1 
ATOM   284  N N   . LYS A 1 33  ? 77.722 56.691 -29.570 1.00 35.60 ? 33   LYS A N   1 
ATOM   285  C CA  . LYS A 1 33  ? 76.741 55.794 -30.185 1.00 34.60 ? 33   LYS A CA  1 
ATOM   286  C C   . LYS A 1 33  ? 76.647 54.469 -29.419 1.00 32.23 ? 33   LYS A C   1 
ATOM   287  O O   . LYS A 1 33  ? 75.622 53.793 -29.426 1.00 31.47 ? 33   LYS A O   1 
ATOM   288  C CB  . LYS A 1 33  ? 77.090 55.534 -31.655 1.00 35.84 ? 33   LYS A CB  1 
ATOM   289  C CG  . LYS A 1 33  ? 78.594 55.441 -31.931 1.00 39.18 ? 33   LYS A CG  1 
ATOM   290  C CD  . LYS A 1 33  ? 79.149 56.676 -32.677 1.00 42.65 ? 33   LYS A CD  1 
ATOM   291  C CE  . LYS A 1 33  ? 78.839 58.014 -31.969 1.00 44.22 ? 33   LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 33  ? 79.492 59.148 -32.707 1.00 46.46 ? 33   LYS A NZ  1 
ATOM   293  N N   . ASP A 1 34  ? 77.734 54.113 -28.762 1.00 30.37 ? 34   ASP A N   1 
ATOM   294  C CA  . ASP A 1 34  ? 77.754 52.871 -28.009 1.00 28.88 ? 34   ASP A CA  1 
ATOM   295  C C   . ASP A 1 34  ? 77.394 53.122 -26.540 1.00 25.44 ? 34   ASP A C   1 
ATOM   296  O O   . ASP A 1 34  ? 77.763 52.336 -25.666 1.00 24.44 ? 34   ASP A O   1 
ATOM   297  C CB  . ASP A 1 34  ? 79.110 52.177 -28.136 1.00 30.89 ? 34   ASP A CB  1 
ATOM   298  C CG  . ASP A 1 34  ? 79.112 51.103 -29.238 1.00 36.33 ? 34   ASP A CG  1 
ATOM   299  O OD1 . ASP A 1 34  ? 79.228 49.888 -28.920 1.00 39.37 ? 34   ASP A OD1 1 
ATOM   300  O OD2 . ASP A 1 34  ? 78.968 51.380 -30.459 1.00 41.98 ? 34   ASP A OD2 1 
ATOM   301  N N   . ARG A 1 35  ? 76.697 54.223 -26.267 1.00 21.87 ? 35   ARG A N   1 
ATOM   302  C CA  . ARG A 1 35  ? 76.417 54.549 -24.855 1.00 18.65 ? 35   ARG A CA  1 
ATOM   303  C C   . ARG A 1 35  ? 75.626 53.468 -24.114 1.00 17.15 ? 35   ARG A C   1 
ATOM   304  O O   . ARG A 1 35  ? 75.953 53.120 -22.986 1.00 16.13 ? 35   ARG A O   1 
ATOM   305  C CB  . ARG A 1 35  ? 75.732 55.917 -24.664 1.00 18.48 ? 35   ARG A CB  1 
ATOM   306  C CG  . ARG A 1 35  ? 75.580 56.236 -23.147 1.00 18.28 ? 35   ARG A CG  1 
ATOM   307  C CD  . ARG A 1 35  ? 75.211 57.639 -22.784 1.00 18.36 ? 35   ARG A CD  1 
ATOM   308  N NE  . ARG A 1 35  ? 75.052 57.743 -21.331 1.00 15.29 ? 35   ARG A NE  1 
ATOM   309  C CZ  . ARG A 1 35  ? 76.004 58.063 -20.448 1.00 16.08 ? 35   ARG A CZ  1 
ATOM   310  N NH1 . ARG A 1 35  ? 77.270 58.360 -20.818 1.00 17.40 ? 35   ARG A NH1 1 
ATOM   311  N NH2 . ARG A 1 35  ? 75.681 58.113 -19.148 1.00 14.48 ? 35   ARG A NH2 1 
ATOM   312  N N   . PHE A 1 36  ? 74.561 52.963 -24.721 1.00 15.63 ? 36   PHE A N   1 
ATOM   313  C CA  . PHE A 1 36  ? 73.815 51.871 -24.093 1.00 14.42 ? 36   PHE A CA  1 
ATOM   314  C C   . PHE A 1 36  ? 74.721 50.630 -23.919 1.00 15.11 ? 36   PHE A C   1 
ATOM   315  O O   . PHE A 1 36  ? 74.759 50.021 -22.855 1.00 14.67 ? 36   PHE A O   1 
ATOM   316  C CB  . PHE A 1 36  ? 72.565 51.518 -24.916 1.00 14.58 ? 36   PHE A CB  1 
ATOM   317  C CG  . PHE A 1 36  ? 71.900 50.204 -24.503 1.00 14.34 ? 36   PHE A CG  1 
ATOM   318  C CD1 . PHE A 1 36  ? 72.103 49.034 -25.231 1.00 13.98 ? 36   PHE A CD1 1 
ATOM   319  C CD2 . PHE A 1 36  ? 71.063 50.150 -23.388 1.00 14.36 ? 36   PHE A CD2 1 
ATOM   320  C CE1 . PHE A 1 36  ? 71.494 47.817 -24.837 1.00 14.69 ? 36   PHE A CE1 1 
ATOM   321  C CE2 . PHE A 1 36  ? 70.418 48.963 -22.997 1.00 14.78 ? 36   PHE A CE2 1 
ATOM   322  C CZ  . PHE A 1 36  ? 70.609 47.782 -23.734 1.00 14.12 ? 36   PHE A CZ  1 
ATOM   323  N N   . ASN A 1 37  ? 75.475 50.262 -24.960 1.00 15.76 ? 37   ASN A N   1 
ATOM   324  C CA  . ASN A 1 37  ? 76.346 49.114 -24.828 1.00 17.29 ? 37   ASN A CA  1 
ATOM   325  C C   . ASN A 1 37  ? 77.365 49.266 -23.718 1.00 17.40 ? 37   ASN A C   1 
ATOM   326  O O   . ASN A 1 37  ? 77.679 48.298 -23.032 1.00 18.56 ? 37   ASN A O   1 
ATOM   327  C CB  . ASN A 1 37  ? 77.144 48.871 -26.119 1.00 17.84 ? 37   ASN A CB  1 
ATOM   328  C CG  . ASN A 1 37  ? 76.288 48.422 -27.263 1.00 21.71 ? 37   ASN A CG  1 
ATOM   329  O OD1 . ASN A 1 37  ? 75.195 47.869 -27.079 1.00 24.87 ? 37   ASN A OD1 1 
ATOM   330  N ND2 . ASN A 1 37  ? 76.797 48.634 -28.491 1.00 24.65 ? 37   ASN A ND2 1 
ATOM   331  N N   . HIS A 1 38  ? 77.894 50.471 -23.553 1.00 17.59 ? 38   HIS A N   1 
ATOM   332  C CA  . HIS A 1 38  ? 78.946 50.663 -22.580 1.00 18.61 ? 38   HIS A CA  1 
ATOM   333  C C   . HIS A 1 38  ? 78.474 50.926 -21.152 1.00 16.77 ? 38   HIS A C   1 
ATOM   334  O O   . HIS A 1 38  ? 79.259 50.841 -20.235 1.00 16.80 ? 38   HIS A O   1 
ATOM   335  C CB  . HIS A 1 38  ? 79.861 51.802 -23.013 1.00 21.03 ? 38   HIS A CB  1 
ATOM   336  C CG  . HIS A 1 38  ? 80.796 51.423 -24.123 1.00 26.92 ? 38   HIS A CG  1 
ATOM   337  N ND1 . HIS A 1 38  ? 80.935 50.126 -24.569 1.00 31.66 ? 38   HIS A ND1 1 
ATOM   338  C CD2 . HIS A 1 38  ? 81.656 52.170 -24.860 1.00 31.09 ? 38   HIS A CD2 1 
ATOM   339  C CE1 . HIS A 1 38  ? 81.827 50.089 -25.547 1.00 32.66 ? 38   HIS A CE1 1 
ATOM   340  N NE2 . HIS A 1 38  ? 82.282 51.315 -25.739 1.00 33.35 ? 38   HIS A NE2 1 
ATOM   341  N N   . PHE A 1 39  ? 77.184 51.224 -20.969 1.00 14.06 ? 39   PHE A N   1 
ATOM   342  C CA  . PHE A 1 39  ? 76.681 51.521 -19.623 1.00 12.52 ? 39   PHE A CA  1 
ATOM   343  C C   . PHE A 1 39  ? 75.463 50.680 -19.292 1.00 12.81 ? 39   PHE A C   1 
ATOM   344  O O   . PHE A 1 39  ? 74.432 51.158 -18.787 1.00 12.24 ? 39   PHE A O   1 
ATOM   345  C CB  . PHE A 1 39  ? 76.383 53.016 -19.436 1.00 12.06 ? 39   PHE A CB  1 
ATOM   346  C CG  . PHE A 1 39  ? 77.589 53.896 -19.525 1.00 13.71 ? 39   PHE A CG  1 
ATOM   347  C CD1 . PHE A 1 39  ? 78.084 54.294 -20.761 1.00 17.60 ? 39   PHE A CD1 1 
ATOM   348  C CD2 . PHE A 1 39  ? 78.200 54.390 -18.380 1.00 16.90 ? 39   PHE A CD2 1 
ATOM   349  C CE1 . PHE A 1 39  ? 79.217 55.166 -20.846 1.00 16.96 ? 39   PHE A CE1 1 
ATOM   350  C CE2 . PHE A 1 39  ? 79.289 55.245 -18.469 1.00 18.58 ? 39   PHE A CE2 1 
ATOM   351  C CZ  . PHE A 1 39  ? 79.800 55.617 -19.712 1.00 17.52 ? 39   PHE A CZ  1 
ATOM   352  N N   . SER A 1 40  ? 75.577 49.395 -19.617 1.00 12.61 ? 40   SER A N   1 
ATOM   353  C CA  . SER A 1 40  ? 74.542 48.416 -19.254 1.00 12.60 ? 40   SER A CA  1 
ATOM   354  C C   . SER A 1 40  ? 75.205 47.060 -19.003 1.00 13.64 ? 40   SER A C   1 
ATOM   355  O O   . SER A 1 40  ? 76.332 46.798 -19.463 1.00 14.00 ? 40   SER A O   1 
ATOM   356  C CB  . SER A 1 40  ? 73.450 48.285 -20.339 1.00 13.41 ? 40   SER A CB  1 
ATOM   357  O OG  . SER A 1 40  ? 73.972 47.756 -21.588 1.00 13.67 ? 40   SER A OG  1 
ATOM   358  N N   . LEU A 1 41  ? 74.515 46.216 -18.256 1.00 13.53 ? 41   LEU A N   1 
ATOM   359  C CA  . LEU A 1 41  ? 75.006 44.872 -17.949 1.00 15.82 ? 41   LEU A CA  1 
ATOM   360  C C   . LEU A 1 41  ? 73.873 43.907 -18.198 1.00 15.14 ? 41   LEU A C   1 
ATOM   361  O O   . LEU A 1 41  ? 72.701 44.225 -17.895 1.00 14.46 ? 41   LEU A O   1 
ATOM   362  C CB  . LEU A 1 41  ? 75.371 44.721 -16.455 1.00 17.15 ? 41   LEU A CB  1 
ATOM   363  C CG  . LEU A 1 41  ? 76.378 45.543 -15.690 1.00 21.83 ? 41   LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 41  ? 76.371 45.104 -14.267 1.00 24.39 ? 41   LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 41  ? 77.754 45.336 -16.291 1.00 24.72 ? 41   LEU A CD2 1 
ATOM   366  N N   . THR A 1 42  ? 74.180 42.731 -18.756 1.00 14.84 ? 42   THR A N   1 
ATOM   367  C CA  . THR A 1 42  ? 73.149 41.704 -18.799 1.00 16.32 ? 42   THR A CA  1 
ATOM   368  C C   . THR A 1 42  ? 73.579 40.503 -17.952 1.00 16.29 ? 42   THR A C   1 
ATOM   369  O O   . THR A 1 42  ? 74.691 39.969 -18.110 1.00 17.43 ? 42   THR A O   1 
ATOM   370  C CB  . THR A 1 42  ? 72.842 41.284 -20.224 1.00 17.46 ? 42   THR A CB  1 
ATOM   371  O OG1 . THR A 1 42  ? 72.398 42.428 -20.985 1.00 18.70 ? 42   THR A OG1 1 
ATOM   372  C CG2 . THR A 1 42  ? 71.639 40.314 -20.259 1.00 20.39 ? 42   THR A CG2 1 
ATOM   373  N N   . LEU A 1 43  ? 72.689 40.072 -17.071 1.00 15.50 ? 43   LEU A N   1 
ATOM   374  C CA  . LEU A 1 43  ? 72.936 38.921 -16.191 1.00 15.52 ? 43   LEU A CA  1 
ATOM   375  C C   . LEU A 1 43  ? 72.148 37.748 -16.755 1.00 15.83 ? 43   LEU A C   1 
ATOM   376  O O   . LEU A 1 43  ? 70.940 37.874 -16.992 1.00 15.85 ? 43   LEU A O   1 
ATOM   377  C CB  . LEU A 1 43  ? 72.443 39.245 -14.779 1.00 16.86 ? 43   LEU A CB  1 
ATOM   378  C CG  . LEU A 1 43  ? 73.313 40.065 -13.795 1.00 20.50 ? 43   LEU A CG  1 
ATOM   379  C CD1 . LEU A 1 43  ? 74.233 41.060 -14.441 1.00 25.82 ? 43   LEU A CD1 1 
ATOM   380  C CD2 . LEU A 1 43  ? 72.433 40.676 -12.698 1.00 21.48 ? 43   LEU A CD2 1 
ATOM   381  N N   . ASN A 1 44  ? 72.811 36.625 -17.024 1.00 15.23 ? 44   ASN A N   1 
ATOM   382  C CA  . ASN A 1 44  ? 72.102 35.454 -17.520 1.00 15.35 ? 44   ASN A CA  1 
ATOM   383  C C   . ASN A 1 44  ? 72.077 34.429 -16.398 1.00 15.02 ? 44   ASN A C   1 
ATOM   384  O O   . ASN A 1 44  ? 73.094 33.820 -16.071 1.00 15.36 ? 44   ASN A O   1 
ATOM   385  C CB  . ASN A 1 44  ? 72.756 34.826 -18.740 1.00 17.05 ? 44   ASN A CB  1 
ATOM   386  C CG  . ASN A 1 44  ? 72.071 33.523 -19.130 1.00 18.73 ? 44   ASN A CG  1 
ATOM   387  O OD1 . ASN A 1 44  ? 70.959 33.211 -18.640 1.00 19.24 ? 44   ASN A OD1 1 
ATOM   388  N ND2 . ASN A 1 44  ? 72.688 32.768 -20.056 1.00 22.89 ? 44   ASN A ND2 1 
ATOM   389  N N   . THR A 1 45  ? 70.926 34.281 -15.766 1.00 14.73 ? 45   THR A N   1 
ATOM   390  C CA  . THR A 1 45  ? 70.825 33.424 -14.606 1.00 15.30 ? 45   THR A CA  1 
ATOM   391  C C   . THR A 1 45  ? 70.545 31.976 -14.936 1.00 15.52 ? 45   THR A C   1 
ATOM   392  O O   . THR A 1 45  ? 70.459 31.158 -13.992 1.00 16.57 ? 45   THR A O   1 
ATOM   393  C CB  . THR A 1 45  ? 69.661 33.865 -13.698 1.00 14.65 ? 45   THR A CB  1 
ATOM   394  O OG1 . THR A 1 45  ? 68.392 33.567 -14.335 1.00 13.94 ? 45   THR A OG1 1 
ATOM   395  C CG2 . THR A 1 45  ? 69.704 35.387 -13.423 1.00 15.95 ? 45   THR A CG2 1 
ATOM   396  N N   . ASN A 1 46  ? 70.353 31.689 -16.229 1.00 15.74 ? 46   ASN A N   1 
ATOM   397  C CA  . ASN A 1 46  ? 69.937 30.355 -16.715 1.00 17.26 ? 46   ASN A CA  1 
ATOM   398  C C   . ASN A 1 46  ? 68.442 30.123 -16.503 1.00 15.88 ? 46   ASN A C   1 
ATOM   399  O O   . ASN A 1 46  ? 67.883 29.137 -16.999 1.00 16.49 ? 46   ASN A O   1 
ATOM   400  C CB  . ASN A 1 46  ? 70.739 29.219 -16.046 1.00 18.63 ? 46   ASN A CB  1 
ATOM   401  C CG  . ASN A 1 46  ? 72.227 29.277 -16.346 1.00 24.45 ? 46   ASN A CG  1 
ATOM   402  O OD1 . ASN A 1 46  ? 73.030 28.724 -15.595 1.00 32.46 ? 46   ASN A OD1 1 
ATOM   403  N ND2 . ASN A 1 46  ? 72.604 29.922 -17.449 1.00 25.89 ? 46   ASN A ND2 1 
ATOM   404  N N   . HIS A 1 47  ? 67.791 31.034 -15.768 1.00 14.67 ? 47   HIS A N   1 
ATOM   405  C CA  . HIS A 1 47  ? 66.333 30.993 -15.555 1.00 14.67 ? 47   HIS A CA  1 
ATOM   406  C C   . HIS A 1 47  ? 65.737 32.362 -15.821 1.00 14.34 ? 47   HIS A C   1 
ATOM   407  O O   . HIS A 1 47  ? 64.771 32.779 -15.180 1.00 15.26 ? 47   HIS A O   1 
ATOM   408  C CB  . HIS A 1 47  ? 66.000 30.468 -14.147 1.00 15.94 ? 47   HIS A CB  1 
ATOM   409  C CG  . HIS A 1 47  ? 66.567 29.102 -13.903 1.00 18.90 ? 47   HIS A CG  1 
ATOM   410  N ND1 . HIS A 1 47  ? 66.020 27.968 -14.471 1.00 20.50 ? 47   HIS A ND1 1 
ATOM   411  C CD2 . HIS A 1 47  ? 67.703 28.705 -13.275 1.00 21.05 ? 47   HIS A CD2 1 
ATOM   412  C CE1 . HIS A 1 47  ? 66.761 26.918 -14.142 1.00 22.16 ? 47   HIS A CE1 1 
ATOM   413  N NE2 . HIS A 1 47  ? 67.783 27.335 -13.415 1.00 21.94 ? 47   HIS A NE2 1 
ATOM   414  N N   . GLY A 1 48  ? 66.289 33.034 -16.823 1.00 13.09 ? 48   GLY A N   1 
ATOM   415  C CA  . GLY A 1 48  ? 65.857 34.375 -17.177 1.00 12.11 ? 48   GLY A CA  1 
ATOM   416  C C   . GLY A 1 48  ? 67.053 35.314 -17.204 1.00 11.32 ? 48   GLY A C   1 
ATOM   417  O O   . GLY A 1 48  ? 68.074 35.085 -16.502 1.00 12.57 ? 48   GLY A O   1 
ATOM   418  N N   . HIS A 1 49  ? 66.952 36.341 -18.054 1.00 11.57 ? 49   HIS A N   1 
ATOM   419  C CA  . HIS A 1 49  ? 67.981 37.364 -18.121 1.00 12.41 ? 49   HIS A CA  1 
ATOM   420  C C   . HIS A 1 49  ? 67.524 38.614 -17.382 1.00 12.59 ? 49   HIS A C   1 
ATOM   421  O O   . HIS A 1 49  ? 66.312 38.878 -17.267 1.00 12.27 ? 49   HIS A O   1 
ATOM   422  C CB  . HIS A 1 49  ? 68.293 37.744 -19.571 1.00 13.53 ? 49   HIS A CB  1 
ATOM   423  C CG  . HIS A 1 49  ? 69.037 36.685 -20.327 1.00 16.47 ? 49   HIS A CG  1 
ATOM   424  N ND1 . HIS A 1 49  ? 68.535 35.424 -20.561 1.00 22.13 ? 49   HIS A ND1 1 
ATOM   425  C CD2 . HIS A 1 49  ? 70.251 36.721 -20.928 1.00 20.74 ? 49   HIS A CD2 1 
ATOM   426  C CE1 . HIS A 1 49  ? 69.413 34.722 -21.266 1.00 21.43 ? 49   HIS A CE1 1 
ATOM   427  N NE2 . HIS A 1 49  ? 70.466 35.480 -21.498 1.00 21.23 ? 49   HIS A NE2 1 
ATOM   428  N N   . ILE A 1 50  ? 68.491 39.354 -16.849 1.00 11.91 ? 50   ILE A N   1 
ATOM   429  C CA  . ILE A 1 50  ? 68.233 40.659 -16.240 1.00 11.76 ? 50   ILE A CA  1 
ATOM   430  C C   . ILE A 1 50  ? 69.103 41.688 -16.952 1.00 11.87 ? 50   ILE A C   1 
ATOM   431  O O   . ILE A 1 50  ? 70.340 41.592 -16.932 1.00 12.84 ? 50   ILE A O   1 
ATOM   432  C CB  . ILE A 1 50  ? 68.631 40.701 -14.738 1.00 11.63 ? 50   ILE A CB  1 
ATOM   433  C CG1 . ILE A 1 50  ? 67.974 39.564 -13.967 1.00 12.88 ? 50   ILE A CG1 1 
ATOM   434  C CG2 . ILE A 1 50  ? 68.239 42.061 -14.140 1.00 13.25 ? 50   ILE A CG2 1 
ATOM   435  C CD1 . ILE A 1 50  ? 68.484 39.442 -12.525 1.00 13.33 ? 50   ILE A CD1 1 
ATOM   436  N N   . LEU A 1 51  ? 68.469 42.659 -17.588 1.00 10.31 ? 51   LEU A N   1 
ATOM   437  C CA  . LEU A 1 51  ? 69.201 43.752 -18.190 1.00 10.45 ? 51   LEU A CA  1 
ATOM   438  C C   . LEU A 1 51  ? 69.203 44.874 -17.173 1.00 11.28 ? 51   LEU A C   1 
ATOM   439  O O   . LEU A 1 51  ? 68.148 45.345 -16.795 1.00 11.80 ? 51   LEU A O   1 
ATOM   440  C CB  . LEU A 1 51  ? 68.504 44.199 -19.476 1.00 11.19 ? 51   LEU A CB  1 
ATOM   441  C CG  . LEU A 1 51  ? 69.015 45.503 -20.102 1.00 10.63 ? 51   LEU A CG  1 
ATOM   442  C CD1 . LEU A 1 51  ? 70.559 45.517 -20.373 1.00 12.37 ? 51   LEU A CD1 1 
ATOM   443  C CD2 . LEU A 1 51  ? 68.220 45.787 -21.404 1.00 11.73 ? 51   LEU A CD2 1 
ATOM   444  N N   . VAL A 1 52  ? 70.393 45.282 -16.712 1.00 9.84  ? 52   VAL A N   1 
ATOM   445  C CA  . VAL A 1 52  ? 70.514 46.456 -15.833 1.00 10.58 ? 52   VAL A CA  1 
ATOM   446  C C   . VAL A 1 52  ? 71.053 47.589 -16.699 1.00 10.63 ? 52   VAL A C   1 
ATOM   447  O O   . VAL A 1 52  ? 72.252 47.652 -16.974 1.00 11.60 ? 52   VAL A O   1 
ATOM   448  C CB  . VAL A 1 52  ? 71.448 46.179 -14.674 1.00 10.11 ? 52   VAL A CB  1 
ATOM   449  C CG1 . VAL A 1 52  ? 71.548 47.379 -13.746 1.00 11.65 ? 52   VAL A CG1 1 
ATOM   450  C CG2 . VAL A 1 52  ? 70.913 44.944 -13.916 1.00 12.44 ? 52   VAL A CG2 1 
ATOM   451  N N   . ASP A 1 53  ? 70.147 48.453 -17.172 1.00 10.41 ? 53   ASP A N   1 
ATOM   452  C CA  . ASP A 1 53  ? 70.550 49.535 -18.076 1.00 10.76 ? 53   ASP A CA  1 
ATOM   453  C C   . ASP A 1 53  ? 70.727 50.783 -17.241 1.00 11.10 ? 53   ASP A C   1 
ATOM   454  O O   . ASP A 1 53  ? 69.742 51.350 -16.785 1.00 10.58 ? 53   ASP A O   1 
ATOM   455  C CB  . ASP A 1 53  ? 69.466 49.730 -19.143 1.00 11.33 ? 53   ASP A CB  1 
ATOM   456  C CG  . ASP A 1 53  ? 69.735 50.906 -20.052 1.00 12.18 ? 53   ASP A CG  1 
ATOM   457  O OD1 . ASP A 1 53  ? 70.795 51.563 -19.914 1.00 12.27 ? 53   ASP A OD1 1 
ATOM   458  O OD2 . ASP A 1 53  ? 68.911 51.208 -20.944 1.00 12.32 ? 53   ASP A OD2 1 
ATOM   459  N N   . TYR A 1 54  ? 71.981 51.177 -17.006 1.00 10.51 ? 54   TYR A N   1 
ATOM   460  C CA  . TYR A 1 54  ? 72.254 52.368 -16.194 1.00 11.34 ? 54   TYR A CA  1 
ATOM   461  C C   . TYR A 1 54  ? 72.790 53.488 -17.062 1.00 10.99 ? 54   TYR A C   1 
ATOM   462  O O   . TYR A 1 54  ? 73.413 54.408 -16.557 1.00 11.72 ? 54   TYR A O   1 
ATOM   463  C CB  . TYR A 1 54  ? 73.223 52.020 -15.031 1.00 11.55 ? 54   TYR A CB  1 
ATOM   464  C CG  . TYR A 1 54  ? 74.545 51.415 -15.446 1.00 12.36 ? 54   TYR A CG  1 
ATOM   465  C CD1 . TYR A 1 54  ? 74.664 50.029 -15.691 1.00 11.67 ? 54   TYR A CD1 1 
ATOM   466  C CD2 . TYR A 1 54  ? 75.663 52.220 -15.608 1.00 11.91 ? 54   TYR A CD2 1 
ATOM   467  C CE1 . TYR A 1 54  ? 75.909 49.471 -16.076 1.00 12.56 ? 54   TYR A CE1 1 
ATOM   468  C CE2 . TYR A 1 54  ? 76.909 51.675 -15.991 1.00 12.01 ? 54   TYR A CE2 1 
ATOM   469  C CZ  . TYR A 1 54  ? 77.000 50.295 -16.212 1.00 13.38 ? 54   TYR A CZ  1 
ATOM   470  O OH  . TYR A 1 54  ? 78.210 49.740 -16.610 1.00 14.27 ? 54   TYR A OH  1 
ATOM   471  N N   . SER A 1 55  ? 72.469 53.441 -18.357 1.00 10.86 ? 55   SER A N   1 
ATOM   472  C CA  . SER A 1 55  ? 73.001 54.408 -19.322 1.00 11.43 ? 55   SER A CA  1 
ATOM   473  C C   . SER A 1 55  ? 72.328 55.795 -19.251 1.00 11.51 ? 55   SER A C   1 
ATOM   474  O O   . SER A 1 55  ? 72.927 56.791 -19.625 1.00 11.72 ? 55   SER A O   1 
ATOM   475  C CB  . SER A 1 55  ? 72.992 53.808 -20.750 1.00 11.63 ? 55   SER A CB  1 
ATOM   476  O OG  . SER A 1 55  ? 71.675 53.684 -21.232 1.00 11.32 ? 55   SER A OG  1 
ATOM   477  N N   . LYS A 1 56  ? 71.108 55.869 -18.729 1.00 10.85 ? 56   LYS A N   1 
ATOM   478  C CA  . LYS A 1 56  ? 70.441 57.170 -18.561 1.00 10.65 ? 56   LYS A CA  1 
ATOM   479  C C   . LYS A 1 56  ? 70.820 57.815 -17.229 1.00 10.38 ? 56   LYS A C   1 
ATOM   480  O O   . LYS A 1 56  ? 69.969 58.292 -16.512 1.00 10.96 ? 56   LYS A O   1 
ATOM   481  C CB  . LYS A 1 56  ? 68.898 57.076 -18.684 1.00 11.11 ? 56   LYS A CB  1 
ATOM   482  C CG  . LYS A 1 56  ? 68.391 56.506 -20.019 1.00 10.96 ? 56   LYS A CG  1 
ATOM   483  C CD  . LYS A 1 56  ? 66.873 56.842 -20.195 1.00 11.26 ? 56   LYS A CD  1 
ATOM   484  C CE  . LYS A 1 56  ? 66.156 56.099 -21.354 1.00 9.34  ? 56   LYS A CE  1 
ATOM   485  N NZ  . LYS A 1 56  ? 66.011 54.615 -21.069 1.00 9.36  ? 56   LYS A NZ  1 
ATOM   486  N N   . ASN A 1 57  ? 72.095 57.758 -16.894 1.00 11.38 ? 57   ASN A N   1 
ATOM   487  C CA  . ASN A 1 57  ? 72.633 58.340 -15.663 1.00 11.92 ? 57   ASN A CA  1 
ATOM   488  C C   . ASN A 1 57  ? 73.665 59.392 -16.002 1.00 12.75 ? 57   ASN A C   1 
ATOM   489  O O   . ASN A 1 57  ? 74.274 59.343 -17.084 1.00 11.92 ? 57   ASN A O   1 
ATOM   490  C CB  . ASN A 1 57  ? 73.253 57.255 -14.761 1.00 11.98 ? 57   ASN A CB  1 
ATOM   491  C CG  . ASN A 1 57  ? 72.195 56.443 -14.025 1.00 11.66 ? 57   ASN A CG  1 
ATOM   492  O OD1 . ASN A 1 57  ? 72.022 55.218 -14.230 1.00 15.02 ? 57   ASN A OD1 1 
ATOM   493  N ND2 . ASN A 1 57  ? 71.505 57.103 -13.169 1.00 8.64  ? 57   ASN A ND2 1 
ATOM   494  N N   . LEU A 1 58  ? 73.818 60.352 -15.088 1.00 12.85 ? 58   LEU A N   1 
ATOM   495  C CA  . LEU A 1 58  ? 74.741 61.467 -15.276 1.00 13.24 ? 58   LEU A CA  1 
ATOM   496  C C   . LEU A 1 58  ? 76.166 61.048 -14.956 1.00 12.85 ? 58   LEU A C   1 
ATOM   497  O O   . LEU A 1 58  ? 76.776 61.527 -14.009 1.00 13.47 ? 58   LEU A O   1 
ATOM   498  C CB  . LEU A 1 58  ? 74.293 62.674 -14.457 1.00 13.48 ? 58   LEU A CB  1 
ATOM   499  C CG  . LEU A 1 58  ? 72.975 63.245 -14.963 1.00 15.31 ? 58   LEU A CG  1 
ATOM   500  C CD1 . LEU A 1 58  ? 72.402 64.189 -13.906 1.00 17.66 ? 58   LEU A CD1 1 
ATOM   501  C CD2 . LEU A 1 58  ? 73.223 64.010 -16.260 1.00 17.45 ? 58   LEU A CD2 1 
ATOM   502  N N   . VAL A 1 59  ? 76.664 60.114 -15.769 1.00 13.19 ? 59   VAL A N   1 
ATOM   503  C CA  . VAL A 1 59  ? 78.011 59.561 -15.601 1.00 13.04 ? 59   VAL A CA  1 
ATOM   504  C C   . VAL A 1 59  ? 78.715 59.408 -16.957 1.00 13.44 ? 59   VAL A C   1 
ATOM   505  O O   . VAL A 1 59  ? 78.069 59.284 -18.007 1.00 13.38 ? 59   VAL A O   1 
ATOM   506  C CB  . VAL A 1 59  ? 77.986 58.145 -14.941 1.00 13.43 ? 59   VAL A CB  1 
ATOM   507  C CG1 . VAL A 1 59  ? 77.362 58.213 -13.545 1.00 14.30 ? 59   VAL A CG1 1 
ATOM   508  C CG2 . VAL A 1 59  ? 77.220 57.142 -15.835 1.00 14.19 ? 59   VAL A CG2 1 
ATOM   509  N N   . THR A 1 60  ? 80.042 59.429 -16.909 1.00 14.29 ? 60   THR A N   1 
ATOM   510  C CA  . THR A 1 60  ? 80.893 59.151 -18.064 1.00 15.41 ? 60   THR A CA  1 
ATOM   511  C C   . THR A 1 60  ? 81.771 57.974 -17.683 1.00 15.10 ? 60   THR A C   1 
ATOM   512  O O   . THR A 1 60  ? 81.695 57.475 -16.548 1.00 14.39 ? 60   THR A O   1 
ATOM   513  C CB  . THR A 1 60  ? 81.836 60.328 -18.369 1.00 15.30 ? 60   THR A CB  1 
ATOM   514  O OG1 . THR A 1 60  ? 82.668 60.582 -17.231 1.00 14.86 ? 60   THR A OG1 1 
ATOM   515  C CG2 . THR A 1 60  ? 81.072 61.642 -18.598 1.00 18.39 ? 60   THR A CG2 1 
ATOM   516  N N   . GLU A 1 61  ? 82.608 57.505 -18.622 1.00 14.90 ? 61   GLU A N   1 
ATOM   517  C CA  . GLU A 1 61  ? 83.530 56.419 -18.261 1.00 15.75 ? 61   GLU A CA  1 
ATOM   518  C C   . GLU A 1 61  ? 84.433 56.805 -17.103 1.00 15.21 ? 61   GLU A C   1 
ATOM   519  O O   . GLU A 1 61  ? 84.679 55.992 -16.210 1.00 15.71 ? 61   GLU A O   1 
ATOM   520  C CB  . GLU A 1 61  ? 84.403 56.008 -19.455 1.00 16.46 ? 61   GLU A CB  1 
ATOM   521  C CG  . GLU A 1 61  ? 83.574 55.375 -20.553 1.00 21.12 ? 61   GLU A CG  1 
ATOM   522  C CD  . GLU A 1 61  ? 83.159 53.927 -20.271 1.00 27.97 ? 61   GLU A CD  1 
ATOM   523  O OE1 . GLU A 1 61  ? 83.353 53.436 -19.123 1.00 29.91 ? 61   GLU A OE1 1 
ATOM   524  O OE2 . GLU A 1 61  ? 82.646 53.261 -21.219 1.00 30.38 ? 61   GLU A OE2 1 
ATOM   525  N N   . ASP A 1 62  ? 84.927 58.049 -17.119 1.00 14.97 ? 62   ASP A N   1 
ATOM   526  C CA  . ASP A 1 62  ? 85.803 58.535 -16.047 1.00 15.88 ? 62   ASP A CA  1 
ATOM   527  C C   . ASP A 1 62  ? 85.068 58.479 -14.706 1.00 14.86 ? 62   ASP A C   1 
ATOM   528  O O   . ASP A 1 62  ? 85.661 58.091 -13.710 1.00 14.20 ? 62   ASP A O   1 
ATOM   529  C CB  . ASP A 1 62  ? 86.275 59.978 -16.298 1.00 17.96 ? 62   ASP A CB  1 
ATOM   530  C CG  . ASP A 1 62  ? 87.371 60.061 -17.347 1.00 23.46 ? 62   ASP A CG  1 
ATOM   531  O OD1 . ASP A 1 62  ? 88.014 59.026 -17.662 1.00 27.46 ? 62   ASP A OD1 1 
ATOM   532  O OD2 . ASP A 1 62  ? 87.638 61.132 -17.932 1.00 29.22 ? 62   ASP A OD2 1 
ATOM   533  N N   . VAL A 1 63  ? 83.795 58.887 -14.685 1.00 13.42 ? 63   VAL A N   1 
ATOM   534  C CA  . VAL A 1 63  ? 83.049 58.834 -13.410 1.00 13.44 ? 63   VAL A CA  1 
ATOM   535  C C   . VAL A 1 63  ? 82.927 57.409 -12.921 1.00 13.36 ? 63   VAL A C   1 
ATOM   536  O O   . VAL A 1 63  ? 83.118 57.134 -11.728 1.00 13.65 ? 63   VAL A O   1 
ATOM   537  C CB  . VAL A 1 63  ? 81.638 59.452 -13.514 1.00 13.40 ? 63   VAL A CB  1 
ATOM   538  C CG1 . VAL A 1 63  ? 80.871 59.300 -12.138 1.00 13.52 ? 63   VAL A CG1 1 
ATOM   539  C CG2 . VAL A 1 63  ? 81.736 60.955 -13.867 1.00 14.61 ? 63   VAL A CG2 1 
ATOM   540  N N   . MET A 1 64  ? 82.638 56.477 -13.831 1.00 13.88 ? 64   MET A N   1 
ATOM   541  C CA  . MET A 1 64  ? 82.464 55.108 -13.389 1.00 14.24 ? 64   MET A CA  1 
ATOM   542  C C   . MET A 1 64  ? 83.769 54.528 -12.885 1.00 14.85 ? 64   MET A C   1 
ATOM   543  O O   . MET A 1 64  ? 83.787 53.764 -11.920 1.00 14.14 ? 64   MET A O   1 
ATOM   544  C CB  . MET A 1 64  ? 81.884 54.224 -14.499 1.00 14.25 ? 64   MET A CB  1 
ATOM   545  C CG  . MET A 1 64  ? 80.446 54.587 -14.926 1.00 14.74 ? 64   MET A CG  1 
ATOM   546  S SD  . MET A 1 64  ? 79.218 54.723 -13.588 1.00 13.87 ? 64   MET A SD  1 
ATOM   547  C CE  . MET A 1 64  ? 79.232 53.067 -12.896 1.00 13.42 ? 64   MET A CE  1 
ATOM   548  N N   . ARG A 1 65  ? 84.873 54.900 -13.529 1.00 15.17 ? 65   ARG A N   1 
ATOM   549  C CA  . ARG A 1 65  ? 86.178 54.420 -13.081 1.00 16.22 ? 65   ARG A CA  1 
ATOM   550  C C   . ARG A 1 65  ? 86.462 54.923 -11.676 1.00 15.24 ? 65   ARG A C   1 
ATOM   551  O O   . ARG A 1 65  ? 86.897 54.151 -10.814 1.00 15.05 ? 65   ARG A O   1 
ATOM   552  C CB  . ARG A 1 65  ? 87.259 54.983 -14.008 1.00 18.57 ? 65   ARG A CB  1 
ATOM   553  C CG  . ARG A 1 65  ? 87.547 54.273 -15.291 1.00 25.42 ? 65   ARG A CG  1 
ATOM   554  C CD  . ARG A 1 65  ? 88.923 54.767 -15.904 1.00 31.41 ? 65   ARG A CD  1 
ATOM   555  N NE  . ARG A 1 65  ? 89.740 55.401 -14.853 1.00 35.85 ? 65   ARG A NE  1 
ATOM   556  C CZ  . ARG A 1 65  ? 89.970 56.725 -14.735 1.00 38.50 ? 65   ARG A CZ  1 
ATOM   557  N NH1 . ARG A 1 65  ? 90.715 57.185 -13.722 1.00 40.34 ? 65   ARG A NH1 1 
ATOM   558  N NH2 . ARG A 1 65  ? 89.476 57.596 -15.620 1.00 39.47 ? 65   ARG A NH2 1 
ATOM   559  N N   . MET A 1 66  ? 86.206 56.214 -11.429 1.00 14.29 ? 66   MET A N   1 
ATOM   560  C CA  . MET A 1 66  ? 86.439 56.815 -10.126 1.00 14.15 ? 66   MET A CA  1 
ATOM   561  C C   . MET A 1 66  ? 85.573 56.163 -9.064  1.00 13.76 ? 66   MET A C   1 
ATOM   562  O O   . MET A 1 66  ? 86.008 55.967 -7.939  1.00 12.80 ? 66   MET A O   1 
ATOM   563  C CB  . MET A 1 66  ? 86.177 58.343 -10.159 1.00 14.66 ? 66   MET A CB  1 
ATOM   564  C CG  . MET A 1 66  ? 87.333 59.101 -10.837 1.00 16.75 ? 66   MET A CG  1 
ATOM   565  S SD  . MET A 1 66  ? 87.089 60.875 -10.732 1.00 19.42 ? 66   MET A SD  1 
ATOM   566  C CE  . MET A 1 66  ? 85.703 61.101 -11.859 1.00 19.36 ? 66   MET A CE  1 
ATOM   567  N N   . LEU A 1 67  ? 84.328 55.854 -9.418  1.00 13.13 ? 67   LEU A N   1 
ATOM   568  C CA  . LEU A 1 67  ? 83.443 55.198 -8.450  1.00 12.41 ? 67   LEU A CA  1 
ATOM   569  C C   . LEU A 1 67  ? 83.925 53.793 -8.110  1.00 12.48 ? 67   LEU A C   1 
ATOM   570  O O   . LEU A 1 67  ? 83.906 53.383 -6.955  1.00 12.62 ? 67   LEU A O   1 
ATOM   571  C CB  . LEU A 1 67  ? 82.010 55.127 -8.989  1.00 12.05 ? 67   LEU A CB  1 
ATOM   572  C CG  . LEU A 1 67  ? 81.292 56.478 -9.022  1.00 12.40 ? 67   LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 67  ? 80.029 56.385 -9.864  1.00 13.30 ? 67   LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 67  ? 80.971 56.940 -7.602  1.00 12.82 ? 67   LEU A CD2 1 
ATOM   575  N N   . VAL A 1 68  ? 84.389 53.058 -9.117  1.00 12.15 ? 68   VAL A N   1 
ATOM   576  C CA  . VAL A 1 68  ? 84.920 51.722 -8.848  1.00 13.33 ? 68   VAL A CA  1 
ATOM   577  C C   . VAL A 1 68  ? 86.182 51.843 -7.965  1.00 13.46 ? 68   VAL A C   1 
ATOM   578  O O   . VAL A 1 68  ? 86.373 51.058 -7.028  1.00 13.54 ? 68   VAL A O   1 
ATOM   579  C CB  . VAL A 1 68  ? 85.193 50.953 -10.166 1.00 13.40 ? 68   VAL A CB  1 
ATOM   580  C CG1 . VAL A 1 68  ? 86.039 49.744 -9.880  1.00 13.76 ? 68   VAL A CG1 1 
ATOM   581  C CG2 . VAL A 1 68  ? 83.846 50.548 -10.818 1.00 14.58 ? 68   VAL A CG2 1 
ATOM   582  N N   . ASP A 1 69  ? 87.033 52.831 -8.258  1.00 14.44 ? 69   ASP A N   1 
ATOM   583  C CA  . ASP A 1 69  ? 88.240 53.029 -7.455  1.00 14.63 ? 69   ASP A CA  1 
ATOM   584  C C   . ASP A 1 69  ? 87.868 53.367 -6.001  1.00 14.82 ? 69   ASP A C   1 
ATOM   585  O O   . ASP A 1 69  ? 88.566 52.988 -5.067  1.00 14.62 ? 69   ASP A O   1 
ATOM   586  C CB  . ASP A 1 69  ? 89.110 54.136 -8.058  1.00 15.71 ? 69   ASP A CB  1 
ATOM   587  C CG  . ASP A 1 69  ? 89.828 53.697 -9.328  1.00 18.76 ? 69   ASP A CG  1 
ATOM   588  O OD1 . ASP A 1 69  ? 89.852 52.489 -9.652  1.00 21.39 ? 69   ASP A OD1 1 
ATOM   589  O OD2 . ASP A 1 69  ? 90.403 54.517 -10.075 1.00 22.42 ? 69   ASP A OD2 1 
ATOM   590  N N   . LEU A 1 70  ? 86.744 54.074 -5.817  1.00 14.07 ? 70   LEU A N   1 
ATOM   591  C CA  . LEU A 1 70  ? 86.259 54.395 -4.468  1.00 13.59 ? 70   LEU A CA  1 
ATOM   592  C C   . LEU A 1 70  ? 85.851 53.094 -3.752  1.00 13.47 ? 70   LEU A C   1 
ATOM   593  O O   . LEU A 1 70  ? 86.192 52.892 -2.600  1.00 13.15 ? 70   LEU A O   1 
ATOM   594  C CB  . LEU A 1 70  ? 85.055 55.360 -4.543  1.00 13.33 ? 70   LEU A CB  1 
ATOM   595  C CG  . LEU A 1 70  ? 84.396 55.647 -3.172  1.00 13.97 ? 70   LEU A CG  1 
ATOM   596  C CD1 . LEU A 1 70  ? 85.345 56.394 -2.239  1.00 13.82 ? 70   LEU A CD1 1 
ATOM   597  C CD2 . LEU A 1 70  ? 83.094 56.443 -3.356  1.00 14.29 ? 70   LEU A CD2 1 
ATOM   598  N N   . ALA A 1 71  ? 85.104 52.224 -4.441  1.00 13.15 ? 71   ALA A N   1 
ATOM   599  C CA  . ALA A 1 71  ? 84.731 50.954 -3.844  1.00 13.04 ? 71   ALA A CA  1 
ATOM   600  C C   . ALA A 1 71  ? 85.987 50.198 -3.407  1.00 13.70 ? 71   ALA A C   1 
ATOM   601  O O   . ALA A 1 71  ? 86.001 49.609 -2.334  1.00 13.88 ? 71   ALA A O   1 
ATOM   602  C CB  . ALA A 1 71  ? 83.935 50.110 -4.859  1.00 13.68 ? 71   ALA A CB  1 
ATOM   603  N N   . LYS A 1 72  ? 87.029 50.207 -4.240  1.00 13.85 ? 72   LYS A N   1 
ATOM   604  C CA  . LYS A 1 72  ? 88.246 49.485 -3.869  1.00 14.16 ? 72   LYS A CA  1 
ATOM   605  C C   . LYS A 1 72  ? 88.908 50.128 -2.674  1.00 14.38 ? 72   LYS A C   1 
ATOM   606  O O   . LYS A 1 72  ? 89.334 49.433 -1.730  1.00 14.77 ? 72   LYS A O   1 
ATOM   607  C CB  . LYS A 1 72  ? 89.207 49.428 -5.058  1.00 14.89 ? 72   LYS A CB  1 
ATOM   608  C CG  . LYS A 1 72  ? 88.676 48.557 -6.177  1.00 18.69 ? 72   LYS A CG  1 
ATOM   609  C CD  . LYS A 1 72  ? 89.676 48.354 -7.329  1.00 25.15 ? 72   LYS A CD  1 
ATOM   610  C CE  . LYS A 1 72  ? 89.039 47.460 -8.402  1.00 29.06 ? 72   LYS A CE  1 
ATOM   611  N NZ  . LYS A 1 72  ? 89.941 47.283 -9.586  1.00 32.99 ? 72   LYS A NZ  1 
ATOM   612  N N   . SER A 1 73  ? 88.979 51.456 -2.685  1.00 13.76 ? 73   SER A N   1 
ATOM   613  C CA  . SER A 1 73  ? 89.644 52.174 -1.617  1.00 13.88 ? 73   SER A CA  1 
ATOM   614  C C   . SER A 1 73  ? 88.926 51.978 -0.279  1.00 13.73 ? 73   SER A C   1 
ATOM   615  O O   . SER A 1 73  ? 89.557 51.960 0.796   1.00 14.30 ? 73   SER A O   1 
ATOM   616  C CB  . SER A 1 73  ? 89.767 53.670 -1.989  1.00 14.90 ? 73   SER A CB  1 
ATOM   617  O OG  . SER A 1 73  ? 90.552 54.381 -1.050  1.00 18.34 ? 73   SER A OG  1 
ATOM   618  N N   . ARG A 1 74  ? 87.600 51.829 -0.332  1.00 12.29 ? 74   ARG A N   1 
ATOM   619  C CA  . ARG A 1 74  ? 86.842 51.668 0.909   1.00 12.62 ? 74   ARG A CA  1 
ATOM   620  C C   . ARG A 1 74  ? 86.779 50.205 1.339   1.00 12.93 ? 74   ARG A C   1 
ATOM   621  O O   . ARG A 1 74  ? 86.113 49.873 2.324   1.00 13.51 ? 74   ARG A O   1 
ATOM   622  C CB  . ARG A 1 74  ? 85.405 52.258 0.731   1.00 12.38 ? 74   ARG A CB  1 
ATOM   623  C CG  . ARG A 1 74  ? 85.407 53.783 0.459   1.00 12.51 ? 74   ARG A CG  1 
ATOM   624  C CD  . ARG A 1 74  ? 85.838 54.603 1.684   1.00 12.56 ? 74   ARG A CD  1 
ATOM   625  N NE  . ARG A 1 74  ? 84.984 54.236 2.813   1.00 12.23 ? 74   ARG A NE  1 
ATOM   626  C CZ  . ARG A 1 74  ? 85.396 53.652 3.927   1.00 14.30 ? 74   ARG A CZ  1 
ATOM   627  N NH1 . ARG A 1 74  ? 84.485 53.281 4.838   1.00 14.62 ? 74   ARG A NH1 1 
ATOM   628  N NH2 . ARG A 1 74  ? 86.713 53.489 4.182   1.00 14.51 ? 74   ARG A NH2 1 
ATOM   629  N N   . GLY A 1 75  ? 87.440 49.328 0.587   1.00 12.76 ? 75   GLY A N   1 
ATOM   630  C CA  . GLY A 1 75  ? 87.555 47.929 0.995   1.00 13.70 ? 75   GLY A CA  1 
ATOM   631  C C   . GLY A 1 75  ? 86.283 47.084 0.882   1.00 14.16 ? 75   GLY A C   1 
ATOM   632  O O   . GLY A 1 75  ? 86.021 46.159 1.696   1.00 13.91 ? 75   GLY A O   1 
ATOM   633  N N   . VAL A 1 76  ? 85.474 47.399 -0.119  1.00 13.19 ? 76   VAL A N   1 
ATOM   634  C CA  . VAL A 1 76  ? 84.223 46.675 -0.345  1.00 13.39 ? 76   VAL A CA  1 
ATOM   635  C C   . VAL A 1 76  ? 84.408 45.172 -0.485  1.00 13.06 ? 76   VAL A C   1 
ATOM   636  O O   . VAL A 1 76  ? 83.678 44.410 0.138   1.00 12.46 ? 76   VAL A O   1 
ATOM   637  C CB  . VAL A 1 76  ? 83.498 47.247 -1.567  1.00 12.83 ? 76   VAL A CB  1 
ATOM   638  C CG1 . VAL A 1 76  ? 82.313 46.316 -2.051  1.00 12.73 ? 76   VAL A CG1 1 
ATOM   639  C CG2 . VAL A 1 76  ? 82.924 48.656 -1.213  1.00 12.96 ? 76   VAL A CG2 1 
ATOM   640  N N   . GLU A 1 77  ? 85.397 44.746 -1.257  1.00 13.16 ? 77   GLU A N   1 
ATOM   641  C CA  . GLU A 1 77  ? 85.589 43.307 -1.462  1.00 13.56 ? 77   GLU A CA  1 
ATOM   642  C C   . GLU A 1 77  ? 85.955 42.569 -0.184  1.00 13.36 ? 77   GLU A C   1 
ATOM   643  O O   . GLU A 1 77  ? 85.366 41.512 0.086   1.00 12.43 ? 77   GLU A O   1 
ATOM   644  C CB  . GLU A 1 77  ? 86.602 43.038 -2.594  1.00 14.79 ? 77   GLU A CB  1 
ATOM   645  C CG  . GLU A 1 77  ? 85.986 43.437 -3.935  1.00 17.47 ? 77   GLU A CG  1 
ATOM   646  C CD  . GLU A 1 77  ? 86.969 43.468 -5.084  1.00 22.54 ? 77   GLU A CD  1 
ATOM   647  O OE1 . GLU A 1 77  ? 86.742 42.719 -6.082  1.00 24.45 ? 77   GLU A OE1 1 
ATOM   648  O OE2 . GLU A 1 77  ? 87.945 44.226 -4.992  1.00 23.56 ? 77   GLU A OE2 1 
ATOM   649  N N   . ALA A 1 78  ? 86.890 43.105 0.615   1.00 13.05 ? 78   ALA A N   1 
ATOM   650  C CA  . ALA A 1 78  ? 87.259 42.404 1.848   1.00 13.69 ? 78   ALA A CA  1 
ATOM   651  C C   . ALA A 1 78  ? 86.089 42.374 2.837   1.00 13.15 ? 78   ALA A C   1 
ATOM   652  O O   . ALA A 1 78  ? 85.874 41.392 3.540   1.00 13.23 ? 78   ALA A O   1 
ATOM   653  C CB  . ALA A 1 78  ? 88.493 43.033 2.472   1.00 14.70 ? 78   ALA A CB  1 
ATOM   654  N N   . ALA A 1 79  ? 85.326 43.457 2.881   1.00 12.90 ? 79   ALA A N   1 
ATOM   655  C CA  . ALA A 1 79  ? 84.150 43.492 3.766   1.00 13.04 ? 79   ALA A CA  1 
ATOM   656  C C   . ALA A 1 79  ? 83.135 42.429 3.340   1.00 13.37 ? 79   ALA A C   1 
ATOM   657  O O   . ALA A 1 79  ? 82.543 41.758 4.188   1.00 11.96 ? 79   ALA A O   1 
ATOM   658  C CB  . ALA A 1 79  ? 83.488 44.884 3.743   1.00 13.26 ? 79   ALA A CB  1 
ATOM   659  N N   . ARG A 1 80  ? 82.926 42.327 2.024   1.00 12.42 ? 80   ARG A N   1 
ATOM   660  C CA  . ARG A 1 80  ? 82.018 41.333 1.470   1.00 11.83 ? 80   ARG A CA  1 
ATOM   661  C C   . ARG A 1 80  ? 82.418 39.925 1.910   1.00 12.03 ? 80   ARG A C   1 
ATOM   662  O O   . ARG A 1 80  ? 81.584 39.116 2.345   1.00 11.69 ? 80   ARG A O   1 
ATOM   663  C CB  . ARG A 1 80  ? 81.997 41.439 -0.061  1.00 11.50 ? 80   ARG A CB  1 
ATOM   664  C CG  . ARG A 1 80  ? 81.104 40.413 -0.750  1.00 12.92 ? 80   ARG A CG  1 
ATOM   665  C CD  . ARG A 1 80  ? 81.328 40.307 -2.266  1.00 14.93 ? 80   ARG A CD  1 
ATOM   666  N NE  . ARG A 1 80  ? 82.718 39.893 -2.495  1.00 16.07 ? 80   ARG A NE  1 
ATOM   667  C CZ  . ARG A 1 80  ? 83.431 40.220 -3.561  1.00 16.23 ? 80   ARG A CZ  1 
ATOM   668  N NH1 . ARG A 1 80  ? 82.852 40.878 -4.569  1.00 17.55 ? 80   ARG A NH1 1 
ATOM   669  N NH2 . ARG A 1 80  ? 84.723 39.841 -3.638  1.00 17.09 ? 80   ARG A NH2 1 
ATOM   670  N N   . GLU A 1 81  ? 83.714 39.644 1.823   1.00 11.07 ? 81   GLU A N   1 
ATOM   671  C CA  . GLU A 1 81  ? 84.160 38.317 2.199   1.00 12.23 ? 81   GLU A CA  1 
ATOM   672  C C   . GLU A 1 81  ? 83.947 38.090 3.686   1.00 11.87 ? 81   GLU A C   1 
ATOM   673  O O   . GLU A 1 81  ? 83.558 36.980 4.085   1.00 12.38 ? 81   GLU A O   1 
ATOM   674  C CB  . GLU A 1 81  ? 85.637 38.083 1.802   1.00 12.68 ? 81   GLU A CB  1 
ATOM   675  C CG  . GLU A 1 81  ? 85.901 38.082 0.298   1.00 14.68 ? 81   GLU A CG  1 
ATOM   676  C CD  . GLU A 1 81  ? 84.914 37.209 -0.442  1.00 16.02 ? 81   GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 81  ? 84.952 35.993 -0.209  1.00 15.70 ? 81   GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 81  ? 84.072 37.741 -1.217  1.00 17.94 ? 81   GLU A OE2 1 
ATOM   679  N N   . ARG A 1 82  ? 84.123 39.130 4.526   1.00 11.50 ? 82   ARG A N   1 
ATOM   680  C CA  . ARG A 1 82  ? 83.888 38.942 5.952   1.00 12.14 ? 82   ARG A CA  1 
ATOM   681  C C   . ARG A 1 82  ? 82.431 38.564 6.213   1.00 11.94 ? 82   ARG A C   1 
ATOM   682  O O   . ARG A 1 82  ? 82.136 37.729 7.074   1.00 12.39 ? 82   ARG A O   1 
ATOM   683  C CB  . ARG A 1 82  ? 84.264 40.194 6.722   1.00 12.12 ? 82   ARG A CB  1 
ATOM   684  C CG  . ARG A 1 82  ? 85.779 40.476 6.844   1.00 15.85 ? 82   ARG A CG  1 
ATOM   685  C CD  . ARG A 1 82  ? 86.064 41.649 7.858   1.00 21.33 ? 82   ARG A CD  1 
ATOM   686  N NE  . ARG A 1 82  ? 85.815 41.209 9.236   1.00 27.35 ? 82   ARG A NE  1 
ATOM   687  C CZ  . ARG A 1 82  ? 85.288 41.940 10.239  1.00 29.10 ? 82   ARG A CZ  1 
ATOM   688  N NH1 . ARG A 1 82  ? 84.886 43.197 10.058  1.00 31.60 ? 82   ARG A NH1 1 
ATOM   689  N NH2 . ARG A 1 82  ? 85.153 41.390 11.434  1.00 29.79 ? 82   ARG A NH2 1 
ATOM   690  N N   . MET A 1 83  ? 81.516 39.194 5.464   1.00 11.28 ? 83   MET A N   1 
ATOM   691  C CA  . MET A 1 83  ? 80.108 38.866 5.615   1.00 10.82 ? 83   MET A CA  1 
ATOM   692  C C   . MET A 1 83  ? 79.861 37.389 5.275   1.00 10.77 ? 83   MET A C   1 
ATOM   693  O O   . MET A 1 83  ? 79.293 36.621 6.074   1.00 10.67 ? 83   MET A O   1 
ATOM   694  C CB  . MET A 1 83  ? 79.248 39.735 4.692   1.00 11.18 ? 83   MET A CB  1 
ATOM   695  C CG  . MET A 1 83  ? 77.757 39.290 4.808   1.00 11.32 ? 83   MET A CG  1 
ATOM   696  S SD  . MET A 1 83  ? 76.556 40.442 4.047   1.00 12.02 ? 83   MET A SD  1 
ATOM   697  C CE  . MET A 1 83  ? 77.090 40.412 2.308   1.00 14.27 ? 83   MET A CE  1 
ATOM   698  N N   . PHE A 1 84  ? 80.254 36.997 4.074   1.00 10.69 ? 84   PHE A N   1 
ATOM   699  C CA  . PHE A 1 84  ? 80.032 35.625 3.610   1.00 10.70 ? 84   PHE A CA  1 
ATOM   700  C C   . PHE A 1 84  ? 80.735 34.569 4.439   1.00 11.90 ? 84   PHE A C   1 
ATOM   701  O O   . PHE A 1 84  ? 80.272 33.420 4.485   1.00 12.21 ? 84   PHE A O   1 
ATOM   702  C CB  . PHE A 1 84  ? 80.478 35.474 2.147   1.00 10.91 ? 84   PHE A CB  1 
ATOM   703  C CG  . PHE A 1 84  ? 79.455 35.938 1.132   1.00 11.23 ? 84   PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 84  ? 78.533 35.027 0.581   1.00 11.88 ? 84   PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 84  ? 79.431 37.282 0.709   1.00 12.76 ? 84   PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 84  ? 77.618 35.430 -0.402  1.00 11.13 ? 84   PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 84  ? 78.509 37.702 -0.271  1.00 12.09 ? 84   PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 84  ? 77.595 36.782 -0.825  1.00 12.13 ? 84   PHE A CZ  1 
ATOM   709  N N   . ASN A 1 85  ? 81.836 34.945 5.085   1.00 12.19 ? 85   ASN A N   1 
ATOM   710  C CA  . ASN A 1 85  ? 82.607 34.001 5.900   1.00 13.32 ? 85   ASN A CA  1 
ATOM   711  C C   . ASN A 1 85  ? 82.136 33.881 7.340   1.00 13.56 ? 85   ASN A C   1 
ATOM   712  O O   . ASN A 1 85  ? 82.687 33.106 8.146   1.00 14.62 ? 85   ASN A O   1 
ATOM   713  C CB  . ASN A 1 85  ? 84.103 34.290 5.789   1.00 13.98 ? 85   ASN A CB  1 
ATOM   714  C CG  . ASN A 1 85  ? 84.640 33.937 4.400   1.00 15.76 ? 85   ASN A CG  1 
ATOM   715  O OD1 . ASN A 1 85  ? 84.107 33.020 3.730   1.00 18.27 ? 85   ASN A OD1 1 
ATOM   716  N ND2 . ASN A 1 85  ? 85.666 34.654 3.948   1.00 17.07 ? 85   ASN A ND2 1 
ATOM   717  N N   . GLY A 1 86  ? 81.069 34.587 7.678   1.00 12.05 ? 86   GLY A N   1 
ATOM   718  C CA  . GLY A 1 86  ? 80.536 34.465 9.020   1.00 11.96 ? 86   GLY A CA  1 
ATOM   719  C C   . GLY A 1 86  ? 81.260 35.265 10.095  1.00 12.01 ? 86   GLY A C   1 
ATOM   720  O O   . GLY A 1 86  ? 81.072 34.991 11.300  1.00 12.67 ? 86   GLY A O   1 
ATOM   721  N N   . GLU A 1 87  ? 82.061 36.254 9.692   1.00 12.24 ? 87   GLU A N   1 
ATOM   722  C CA  . GLU A 1 87  ? 82.737 37.108 10.672  1.00 12.97 ? 87   GLU A CA  1 
ATOM   723  C C   . GLU A 1 87  ? 81.706 38.054 11.268  1.00 13.46 ? 87   GLU A C   1 
ATOM   724  O O   . GLU A 1 87  ? 80.647 38.336 10.667  1.00 12.95 ? 87   GLU A O   1 
ATOM   725  C CB  . GLU A 1 87  ? 83.945 37.837 10.074  1.00 13.31 ? 87   GLU A CB  1 
ATOM   726  C CG  . GLU A 1 87  ? 84.974 36.836 9.525   1.00 15.50 ? 87   GLU A CG  1 
ATOM   727  C CD  . GLU A 1 87  ? 86.211 37.491 8.963   1.00 19.40 ? 87   GLU A CD  1 
ATOM   728  O OE1 . GLU A 1 87  ? 86.737 36.958 7.966   1.00 23.01 ? 87   GLU A OE1 1 
ATOM   729  O OE2 . GLU A 1 87  ? 86.648 38.497 9.517   1.00 21.26 ? 87   GLU A OE2 1 
ATOM   730  N N   . LYS A 1 88  ? 81.982 38.518 12.473  1.00 13.39 ? 88   LYS A N   1 
ATOM   731  C CA  . LYS A 1 88  ? 80.970 39.293 13.186  1.00 14.18 ? 88   LYS A CA  1 
ATOM   732  C C   . LYS A 1 88  ? 80.967 40.757 12.743  1.00 14.65 ? 88   LYS A C   1 
ATOM   733  O O   . LYS A 1 88  ? 81.342 41.669 13.515  1.00 15.80 ? 88   LYS A O   1 
ATOM   734  C CB  . LYS A 1 88  ? 81.185 39.126 14.702  1.00 15.07 ? 88   LYS A CB  1 
ATOM   735  C CG  . LYS A 1 88  ? 80.912 37.686 15.132  1.00 16.43 ? 88   LYS A CG  1 
ATOM   736  C CD  . LYS A 1 88  ? 81.106 37.470 16.641  1.00 21.03 ? 88   LYS A CD  1 
ATOM   737  C CE  . LYS A 1 88  ? 80.997 35.996 16.985  1.00 23.19 ? 88   LYS A CE  1 
ATOM   738  N NZ  . LYS A 1 88  ? 81.441 35.771 18.422  1.00 27.56 ? 88   LYS A NZ  1 
ATOM   739  N N   . ILE A 1 89  ? 80.545 40.988 11.502  1.00 13.69 ? 89   ILE A N   1 
ATOM   740  C CA  . ILE A 1 89  ? 80.559 42.350 10.941  1.00 13.43 ? 89   ILE A CA  1 
ATOM   741  C C   . ILE A 1 89  ? 79.486 43.259 11.519  1.00 13.21 ? 89   ILE A C   1 
ATOM   742  O O   . ILE A 1 89  ? 79.546 44.474 11.304  1.00 14.11 ? 89   ILE A O   1 
ATOM   743  C CB  . ILE A 1 89  ? 80.523 42.362 9.412   1.00 12.96 ? 89   ILE A CB  1 
ATOM   744  C CG1 . ILE A 1 89  ? 79.183 41.812 8.891   1.00 14.17 ? 89   ILE A CG1 1 
ATOM   745  C CG2 . ILE A 1 89  ? 81.761 41.568 8.816   1.00 15.03 ? 89   ILE A CG2 1 
ATOM   746  C CD1 . ILE A 1 89  ? 78.946 42.169 7.422   1.00 14.61 ? 89   ILE A CD1 1 
ATOM   747  N N   . ASN A 1 90  ? 78.493 42.686 12.191  1.00 12.07 ? 90   ASN A N   1 
ATOM   748  C CA  . ASN A 1 90  ? 77.534 43.523 12.922  1.00 12.06 ? 90   ASN A CA  1 
ATOM   749  C C   . ASN A 1 90  ? 78.245 43.750 14.251  1.00 12.98 ? 90   ASN A C   1 
ATOM   750  O O   . ASN A 1 90  ? 77.971 43.065 15.255  1.00 12.30 ? 90   ASN A O   1 
ATOM   751  C CB  . ASN A 1 90  ? 76.188 42.821 13.058  1.00 10.96 ? 90   ASN A CB  1 
ATOM   752  C CG  . ASN A 1 90  ? 75.212 43.568 13.925  1.00 11.08 ? 90   ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 90  ? 75.540 44.614 14.479  1.00 11.72 ? 90   ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 90  ? 73.987 43.018 14.063  1.00 11.63 ? 90   ASN A ND2 1 
ATOM   755  N N   . TYR A 1 91  ? 79.123 44.757 14.246  1.00 13.86 ? 91   TYR A N   1 
ATOM   756  C CA  . TYR A 1 91  ? 80.083 44.935 15.334  1.00 14.98 ? 91   TYR A CA  1 
ATOM   757  C C   . TYR A 1 91  ? 79.460 45.510 16.581  1.00 15.78 ? 91   TYR A C   1 
ATOM   758  O O   . TYR A 1 91  ? 79.973 45.292 17.686  1.00 16.73 ? 91   TYR A O   1 
ATOM   759  C CB  . TYR A 1 91  ? 81.280 45.791 14.887  1.00 16.38 ? 91   TYR A CB  1 
ATOM   760  C CG  . TYR A 1 91  ? 80.945 46.998 14.007  1.00 17.07 ? 91   TYR A CG  1 
ATOM   761  C CD1 . TYR A 1 91  ? 80.581 48.233 14.554  1.00 19.33 ? 91   TYR A CD1 1 
ATOM   762  C CD2 . TYR A 1 91  ? 81.028 46.908 12.617  1.00 19.71 ? 91   TYR A CD2 1 
ATOM   763  C CE1 . TYR A 1 91  ? 80.268 49.325 13.723  1.00 20.10 ? 91   TYR A CE1 1 
ATOM   764  C CE2 . TYR A 1 91  ? 80.723 47.984 11.795  1.00 20.18 ? 91   TYR A CE2 1 
ATOM   765  C CZ  . TYR A 1 91  ? 80.366 49.190 12.343  1.00 20.07 ? 91   TYR A CZ  1 
ATOM   766  O OH  . TYR A 1 91  ? 80.097 50.249 11.491  1.00 19.24 ? 91   TYR A OH  1 
ATOM   767  N N   . THR A 1 92  ? 78.346 46.240 16.435  1.00 14.85 ? 92   THR A N   1 
ATOM   768  C CA  . THR A 1 92  ? 77.750 46.803 17.641  1.00 14.17 ? 92   THR A CA  1 
ATOM   769  C C   . THR A 1 92  ? 76.990 45.783 18.451  1.00 14.86 ? 92   THR A C   1 
ATOM   770  O O   . THR A 1 92  ? 76.876 45.914 19.683  1.00 16.56 ? 92   THR A O   1 
ATOM   771  C CB  . THR A 1 92  ? 76.840 47.998 17.349  1.00 13.83 ? 92   THR A CB  1 
ATOM   772  O OG1 . THR A 1 92  ? 75.739 47.522 16.565  1.00 13.33 ? 92   THR A OG1 1 
ATOM   773  C CG2 . THR A 1 92  ? 77.567 49.027 16.548  1.00 13.73 ? 92   THR A CG2 1 
ATOM   774  N N   . GLU A 1 93  ? 76.469 44.753 17.786  1.00 14.08 ? 93   GLU A N   1 
ATOM   775  C CA  . GLU A 1 93  ? 75.765 43.687 18.493  1.00 14.44 ? 93   GLU A CA  1 
ATOM   776  C C   . GLU A 1 93  ? 76.628 42.429 18.678  1.00 14.73 ? 93   GLU A C   1 
ATOM   777  O O   . GLU A 1 93  ? 76.207 41.511 19.367  1.00 15.65 ? 93   GLU A O   1 
ATOM   778  C CB  . GLU A 1 93  ? 74.458 43.346 17.736  1.00 14.28 ? 93   GLU A CB  1 
ATOM   779  C CG  . GLU A 1 93  ? 73.483 44.539 17.774  1.00 15.18 ? 93   GLU A CG  1 
ATOM   780  C CD  . GLU A 1 93  ? 72.128 44.312 17.094  1.00 19.20 ? 93   GLU A CD  1 
ATOM   781  O OE1 . GLU A 1 93  ? 72.076 43.961 15.921  1.00 18.20 ? 93   GLU A OE1 1 
ATOM   782  O OE2 . GLU A 1 93  ? 71.072 44.585 17.712  1.00 23.64 ? 93   GLU A OE2 1 
ATOM   783  N N   . GLY A 1 94  ? 77.823 42.410 18.086  1.00 15.10 ? 94   GLY A N   1 
ATOM   784  C CA  . GLY A 1 94  ? 78.695 41.237 18.144  1.00 15.83 ? 94   GLY A CA  1 
ATOM   785  C C   . GLY A 1 94  ? 78.091 40.025 17.441  1.00 15.28 ? 94   GLY A C   1 
ATOM   786  O O   . GLY A 1 94  ? 78.092 38.904 17.961  1.00 15.86 ? 94   GLY A O   1 
ATOM   787  N N   . ARG A 1 95  ? 77.546 40.261 16.256  1.00 13.50 ? 95   ARG A N   1 
ATOM   788  C CA  . ARG A 1 95  ? 76.876 39.195 15.496  1.00 12.97 ? 95   ARG A CA  1 
ATOM   789  C C   . ARG A 1 95  ? 77.402 39.053 14.094  1.00 11.94 ? 95   ARG A C   1 
ATOM   790  O O   . ARG A 1 95  ? 77.850 40.025 13.468  1.00 12.48 ? 95   ARG A O   1 
ATOM   791  C CB  . ARG A 1 95  ? 75.366 39.467 15.372  1.00 12.41 ? 95   ARG A CB  1 
ATOM   792  C CG  . ARG A 1 95  ? 74.606 39.442 16.657  1.00 12.51 ? 95   ARG A CG  1 
ATOM   793  C CD  . ARG A 1 95  ? 73.161 39.890 16.499  1.00 13.63 ? 95   ARG A CD  1 
ATOM   794  N NE  . ARG A 1 95  ? 72.436 39.866 17.785  1.00 15.26 ? 95   ARG A NE  1 
ATOM   795  C CZ  . ARG A 1 95  ? 71.176 40.266 17.898  1.00 18.84 ? 95   ARG A CZ  1 
ATOM   796  N NH1 . ARG A 1 95  ? 70.555 40.238 19.089  1.00 20.71 ? 95   ARG A NH1 1 
ATOM   797  N NH2 . ARG A 1 95  ? 70.520 40.686 16.817  1.00 19.24 ? 95   ARG A NH2 1 
ATOM   798  N N   . ALA A 1 96  ? 77.303 37.832 13.570  1.00 11.36 ? 96   ALA A N   1 
ATOM   799  C CA  . ALA A 1 96  ? 77.549 37.618 12.164  1.00 11.14 ? 96   ALA A CA  1 
ATOM   800  C C   . ALA A 1 96  ? 76.327 38.140 11.391  1.00 10.94 ? 96   ALA A C   1 
ATOM   801  O O   . ALA A 1 96  ? 75.296 38.528 11.998  1.00 11.13 ? 96   ALA A O   1 
ATOM   802  C CB  . ALA A 1 96  ? 77.740 36.135 11.895  1.00 10.91 ? 96   ALA A CB  1 
ATOM   803  N N   . VAL A 1 97  ? 76.425 38.137 10.066  1.00 9.82  ? 97   VAL A N   1 
ATOM   804  C CA  . VAL A 1 97  ? 75.373 38.671 9.183   1.00 9.35  ? 97   VAL A CA  1 
ATOM   805  C C   . VAL A 1 97  ? 75.275 37.660 8.058   1.00 10.03 ? 97   VAL A C   1 
ATOM   806  O O   . VAL A 1 97  ? 76.066 37.652 7.105   1.00 10.55 ? 97   VAL A O   1 
ATOM   807  C CB  . VAL A 1 97  ? 75.776 40.023 8.651   1.00 9.24  ? 97   VAL A CB  1 
ATOM   808  C CG1 . VAL A 1 97  ? 74.760 40.507 7.575   1.00 10.48 ? 97   VAL A CG1 1 
ATOM   809  C CG2 . VAL A 1 97  ? 75.774 41.057 9.813   1.00 10.04 ? 97   VAL A CG2 1 
ATOM   810  N N   . LEU A 1 98  ? 74.310 36.763 8.201   1.00 10.77 ? 98   LEU A N   1 
ATOM   811  C CA  . LEU A 1 98  ? 74.322 35.578 7.345   1.00 9.92  ? 98   LEU A CA  1 
ATOM   812  C C   . LEU A 1 98  ? 72.983 35.232 6.681   1.00 10.38 ? 98   LEU A C   1 
ATOM   813  O O   . LEU A 1 98  ? 72.601 34.041 6.579   1.00 9.93  ? 98   LEU A O   1 
ATOM   814  C CB  . LEU A 1 98  ? 74.897 34.388 8.146   1.00 11.24 ? 98   LEU A CB  1 
ATOM   815  C CG  . LEU A 1 98  ? 76.447 34.389 8.206   1.00 11.42 ? 98   LEU A CG  1 
ATOM   816  C CD1 . LEU A 1 98  ? 76.832 33.190 9.078   1.00 12.41 ? 98   LEU A CD1 1 
ATOM   817  C CD2 . LEU A 1 98  ? 77.089 34.308 6.838   1.00 10.83 ? 98   LEU A CD2 1 
ATOM   818  N N   . HIS A 1 99  ? 72.263 36.250 6.220   1.00 10.03 ? 99   HIS A N   1 
ATOM   819  C CA  . HIS A 1 99  ? 71.117 35.908 5.383   1.00 9.87  ? 99   HIS A CA  1 
ATOM   820  C C   . HIS A 1 99  ? 71.623 35.077 4.164   1.00 10.21 ? 99   HIS A C   1 
ATOM   821  O O   . HIS A 1 99  ? 70.858 34.268 3.628   1.00 9.95  ? 99   HIS A O   1 
ATOM   822  C CB  . HIS A 1 99  ? 70.312 37.139 4.967   1.00 9.65  ? 99   HIS A CB  1 
ATOM   823  C CG  . HIS A 1 99  ? 71.157 38.324 4.620   1.00 9.19  ? 99   HIS A CG  1 
ATOM   824  N ND1 . HIS A 1 99  ? 71.731 39.138 5.580   1.00 8.83  ? 99   HIS A ND1 1 
ATOM   825  C CD2 . HIS A 1 99  ? 71.511 38.842 3.421   1.00 11.23 ? 99   HIS A CD2 1 
ATOM   826  C CE1 . HIS A 1 99  ? 72.421 40.092 4.984   1.00 10.23 ? 99   HIS A CE1 1 
ATOM   827  N NE2 . HIS A 1 99  ? 72.299 39.940 3.675   1.00 10.72 ? 99   HIS A NE2 1 
ATOM   828  N N   . VAL A 1 100 ? 72.886 35.247 3.737   1.00 10.11 ? 100  VAL A N   1 
ATOM   829  C CA  . VAL A 1 100 ? 73.375 34.459 2.582   1.00 9.58  ? 100  VAL A CA  1 
ATOM   830  C C   . VAL A 1 100 ? 73.458 32.979 2.925   1.00 10.04 ? 100  VAL A C   1 
ATOM   831  O O   . VAL A 1 100 ? 73.329 32.128 2.036   1.00 10.22 ? 100  VAL A O   1 
ATOM   832  C CB  . VAL A 1 100 ? 74.725 34.962 2.007   1.00 9.42  ? 100  VAL A CB  1 
ATOM   833  C CG1 . VAL A 1 100 ? 74.552 36.385 1.502   1.00 10.57 ? 100  VAL A CG1 1 
ATOM   834  C CG2 . VAL A 1 100 ? 75.821 34.923 3.076   1.00 10.74 ? 100  VAL A CG2 1 
ATOM   835  N N   . ALA A 1 101 ? 73.633 32.649 4.197   1.00 9.55  ? 101  ALA A N   1 
ATOM   836  C CA  . ALA A 1 101 ? 73.671 31.227 4.567   1.00 10.46 ? 101  ALA A CA  1 
ATOM   837  C C   . ALA A 1 101 ? 72.289 30.573 4.424   1.00 10.28 ? 101  ALA A C   1 
ATOM   838  O O   . ALA A 1 101 ? 72.169 29.382 4.111   1.00 10.99 ? 101  ALA A O   1 
ATOM   839  C CB  . ALA A 1 101 ? 74.170 31.074 5.999   1.00 10.56 ? 101  ALA A CB  1 
ATOM   840  N N   . LEU A 1 102 ? 71.231 31.350 4.653   1.00 10.21 ? 102  LEU A N   1 
ATOM   841  C CA  . LEU A 1 102 ? 69.873 30.805 4.604   1.00 10.59 ? 102  LEU A CA  1 
ATOM   842  C C   . LEU A 1 102 ? 69.539 30.208 3.244   1.00 10.86 ? 102  LEU A C   1 
ATOM   843  O O   . LEU A 1 102 ? 68.750 29.248 3.150   1.00 11.19 ? 102  LEU A O   1 
ATOM   844  C CB  . LEU A 1 102 ? 68.859 31.915 4.924   1.00 10.48 ? 102  LEU A CB  1 
ATOM   845  C CG  . LEU A 1 102 ? 69.035 32.552 6.298   1.00 11.29 ? 102  LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 102 ? 68.086 33.768 6.375   1.00 10.01 ? 102  LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 102 ? 68.718 31.532 7.425   1.00 12.42 ? 102  LEU A CD2 1 
ATOM   848  N N   . ARG A 1 103 ? 70.145 30.773 2.193   1.00 10.56 ? 103  ARG A N   1 
ATOM   849  C CA  . ARG A 1 103 ? 69.864 30.324 0.836   1.00 10.77 ? 103  ARG A CA  1 
ATOM   850  C C   . ARG A 1 103 ? 71.117 29.743 0.185   1.00 11.10 ? 103  ARG A C   1 
ATOM   851  O O   . ARG A 1 103 ? 71.202 29.705 -1.040  1.00 10.29 ? 103  ARG A O   1 
ATOM   852  C CB  . ARG A 1 103 ? 69.299 31.493 -0.019  1.00 10.41 ? 103  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 103 ? 70.288 32.688 -0.207  1.00 11.67 ? 103  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 103 ? 69.841 33.993 0.486   1.00 11.06 ? 103  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 103 ? 70.689 35.113 0.019   1.00 9.71  ? 103  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 103 ? 70.377 36.401 0.277   1.00 9.52  ? 103  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 103 ? 69.310 36.681 1.012   1.00 9.05  ? 103  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 103 ? 71.142 37.395 -0.183  1.00 10.05 ? 103  ARG A NH2 1 
ATOM   859  N N   . ASN A 1 104 ? 72.076 29.289 1.004   1.00 10.43 ? 104  ASN A N   1 
ATOM   860  C CA  . ASN A 1 104 ? 73.309 28.712 0.447   1.00 10.85 ? 104  ASN A CA  1 
ATOM   861  C C   . ASN A 1 104 ? 73.050 27.290 -0.071  1.00 12.08 ? 104  ASN A C   1 
ATOM   862  O O   . ASN A 1 104 ? 73.352 26.294 0.611   1.00 12.53 ? 104  ASN A O   1 
ATOM   863  C CB  . ASN A 1 104 ? 74.373 28.690 1.533   1.00 11.69 ? 104  ASN A CB  1 
ATOM   864  C CG  . ASN A 1 104 ? 75.664 28.059 1.060   1.00 13.69 ? 104  ASN A CG  1 
ATOM   865  O OD1 . ASN A 1 104 ? 75.943 27.980 -0.149  1.00 15.02 ? 104  ASN A OD1 1 
ATOM   866  N ND2 . ASN A 1 104 ? 76.479 27.654 2.017   1.00 14.31 ? 104  ASN A ND2 1 
ATOM   867  N N   . ARG A 1 105 ? 72.479 27.212 -1.266  1.00 11.19 ? 105  ARG A N   1 
ATOM   868  C CA  . ARG A 1 105 ? 72.083 25.921 -1.846  1.00 11.80 ? 105  ARG A CA  1 
ATOM   869  C C   . ARG A 1 105 ? 73.306 25.035 -2.112  1.00 13.12 ? 105  ARG A C   1 
ATOM   870  O O   . ARG A 1 105 ? 73.170 23.784 -2.215  1.00 14.71 ? 105  ARG A O   1 
ATOM   871  C CB  . ARG A 1 105 ? 71.345 26.145 -3.177  1.00 12.15 ? 105  ARG A CB  1 
ATOM   872  C CG  . ARG A 1 105 ? 70.144 27.123 -3.113  1.00 12.23 ? 105  ARG A CG  1 
ATOM   873  C CD  . ARG A 1 105 ? 69.145 26.765 -2.040  1.00 12.64 ? 105  ARG A CD  1 
ATOM   874  N NE  . ARG A 1 105 ? 68.495 25.490 -2.332  1.00 13.94 ? 105  ARG A NE  1 
ATOM   875  C CZ  . ARG A 1 105 ? 67.685 24.829 -1.482  1.00 16.25 ? 105  ARG A CZ  1 
ATOM   876  N NH1 . ARG A 1 105 ? 67.422 25.302 -0.252  1.00 16.01 ? 105  ARG A NH1 1 
ATOM   877  N NH2 . ARG A 1 105 ? 67.110 23.684 -1.890  1.00 17.55 ? 105  ARG A NH2 1 
ATOM   878  N N   . SER A 1 106 ? 74.476 25.658 -2.237  1.00 13.23 ? 106  SER A N   1 
ATOM   879  C CA  . SER A 1 106 ? 75.720 24.904 -2.501  1.00 14.33 ? 106  SER A CA  1 
ATOM   880  C C   . SER A 1 106 ? 76.224 24.142 -1.245  1.00 15.23 ? 106  SER A C   1 
ATOM   881  O O   . SER A 1 106 ? 77.075 23.225 -1.351  1.00 16.77 ? 106  SER A O   1 
ATOM   882  C CB  . SER A 1 106 ? 76.788 25.826 -3.108  1.00 14.83 ? 106  SER A CB  1 
ATOM   883  O OG  . SER A 1 106 ? 76.387 26.383 -4.404  1.00 16.13 ? 106  SER A OG  1 
ATOM   884  N N   . ASN A 1 107 ? 75.693 24.512 -0.075  1.00 15.07 ? 107  ASN A N   1 
ATOM   885  C CA  . ASN A 1 107 ? 75.981 23.871 1.199   1.00 16.43 ? 107  ASN A CA  1 
ATOM   886  C C   . ASN A 1 107 ? 77.446 23.887 1.634   1.00 16.97 ? 107  ASN A C   1 
ATOM   887  O O   . ASN A 1 107 ? 77.850 23.085 2.483   1.00 17.91 ? 107  ASN A O   1 
ATOM   888  C CB  . ASN A 1 107 ? 75.472 22.429 1.193   1.00 16.79 ? 107  ASN A CB  1 
ATOM   889  C CG  . ASN A 1 107 ? 73.952 22.343 1.345   1.00 19.68 ? 107  ASN A CG  1 
ATOM   890  O OD1 . ASN A 1 107 ? 73.308 21.425 0.810   1.00 24.31 ? 107  ASN A OD1 1 
ATOM   891  N ND2 . ASN A 1 107 ? 73.371 23.298 2.074   1.00 16.85 ? 107  ASN A ND2 1 
ATOM   892  N N   . THR A 1 108 ? 78.230 24.806 1.091   1.00 16.45 ? 108  THR A N   1 
ATOM   893  C CA  . THR A 1 108 ? 79.596 24.961 1.580   1.00 16.64 ? 108  THR A CA  1 
ATOM   894  C C   . THR A 1 108 ? 79.509 25.405 3.057   1.00 15.62 ? 108  THR A C   1 
ATOM   895  O O   . THR A 1 108 ? 78.631 26.184 3.458   1.00 14.77 ? 108  THR A O   1 
ATOM   896  C CB  . THR A 1 108 ? 80.352 25.982 0.728   1.00 17.26 ? 108  THR A CB  1 
ATOM   897  O OG1 . THR A 1 108 ? 79.561 27.143 0.602   1.00 19.34 ? 108  THR A OG1 1 
ATOM   898  C CG2 . THR A 1 108 ? 80.444 25.539 -0.702  1.00 18.04 ? 108  THR A CG2 1 
ATOM   899  N N   . PRO A 1 109 ? 80.376 24.896 3.909   1.00 14.72 ? 109  PRO A N   1 
ATOM   900  C CA  . PRO A 1 109 ? 80.335 25.286 5.322   1.00 14.02 ? 109  PRO A CA  1 
ATOM   901  C C   . PRO A 1 109 ? 80.542 26.791 5.555   1.00 13.67 ? 109  PRO A C   1 
ATOM   902  O O   . PRO A 1 109 ? 81.433 27.409 4.941   1.00 14.60 ? 109  PRO A O   1 
ATOM   903  C CB  . PRO A 1 109 ? 81.519 24.509 5.927   1.00 14.14 ? 109  PRO A CB  1 
ATOM   904  C CG  . PRO A 1 109 ? 81.603 23.292 5.049   1.00 17.17 ? 109  PRO A CG  1 
ATOM   905  C CD  . PRO A 1 109 ? 81.424 23.889 3.622   1.00 15.77 ? 109  PRO A CD  1 
ATOM   906  N N   . ILE A 1 110 ? 79.730 27.367 6.438   1.00 13.02 ? 110  ILE A N   1 
ATOM   907  C CA  . ILE A 1 110 ? 79.879 28.775 6.809   1.00 13.01 ? 110  ILE A CA  1 
ATOM   908  C C   . ILE A 1 110 ? 79.876 28.764 8.299   1.00 13.38 ? 110  ILE A C   1 
ATOM   909  O O   . ILE A 1 110 ? 78.894 28.312 8.914   1.00 13.51 ? 110  ILE A O   1 
ATOM   910  C CB  . ILE A 1 110 ? 78.697 29.627 6.316   1.00 13.57 ? 110  ILE A CB  1 
ATOM   911  C CG1 . ILE A 1 110 ? 78.655 29.549 4.807   1.00 13.60 ? 110  ILE A CG1 1 
ATOM   912  C CG2 . ILE A 1 110 ? 78.863 31.098 6.838   1.00 13.70 ? 110  ILE A CG2 1 
ATOM   913  C CD1 . ILE A 1 110 ? 77.431 30.264 4.164   1.00 14.21 ? 110  ILE A CD1 1 
ATOM   914  N N   . LEU A 1 111 ? 80.967 29.240 8.887   1.00 12.92 ? 111  LEU A N   1 
ATOM   915  C CA  . LEU A 1 111 ? 81.157 29.119 10.313  1.00 13.37 ? 111  LEU A CA  1 
ATOM   916  C C   . LEU A 1 111 ? 80.761 30.333 11.097  1.00 13.55 ? 111  LEU A C   1 
ATOM   917  O O   . LEU A 1 111 ? 81.104 31.444 10.713  1.00 13.97 ? 111  LEU A O   1 
ATOM   918  C CB  . LEU A 1 111 ? 82.664 28.851 10.605  1.00 13.56 ? 111  LEU A CB  1 
ATOM   919  C CG  . LEU A 1 111 ? 83.295 27.776 9.724   1.00 16.33 ? 111  LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 111 ? 84.744 27.665 10.143  1.00 18.53 ? 111  LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 111 ? 82.565 26.452 9.948   1.00 17.25 ? 111  LEU A CD2 1 
ATOM   922  N N   . VAL A 1 112 ? 80.035 30.101 12.188  1.00 13.56 ? 112  VAL A N   1 
ATOM   923  C CA  . VAL A 1 112 ? 79.798 31.147 13.204  1.00 13.90 ? 112  VAL A CA  1 
ATOM   924  C C   . VAL A 1 112 ? 80.352 30.596 14.509  1.00 14.62 ? 112  VAL A C   1 
ATOM   925  O O   . VAL A 1 112 ? 79.969 29.516 14.945  1.00 14.24 ? 112  VAL A O   1 
ATOM   926  C CB  . VAL A 1 112 ? 78.313 31.524 13.337  1.00 14.60 ? 112  VAL A CB  1 
ATOM   927  C CG1 . VAL A 1 112 ? 78.123 32.473 14.521  1.00 15.62 ? 112  VAL A CG1 1 
ATOM   928  C CG2 . VAL A 1 112 ? 77.869 32.214 12.032  1.00 14.59 ? 112  VAL A CG2 1 
ATOM   929  N N   . ASP A 1 113 ? 81.269 31.340 15.107  1.00 14.92 ? 113  ASP A N   1 
ATOM   930  C CA  . ASP A 1 113 ? 81.938 30.898 16.332  1.00 16.05 ? 113  ASP A CA  1 
ATOM   931  C C   . ASP A 1 113 ? 82.466 29.475 16.142  1.00 15.20 ? 113  ASP A C   1 
ATOM   932  O O   . ASP A 1 113 ? 82.315 28.628 17.026  1.00 15.88 ? 113  ASP A O   1 
ATOM   933  C CB  . ASP A 1 113 ? 80.954 30.919 17.500  1.00 16.51 ? 113  ASP A CB  1 
ATOM   934  C CG  . ASP A 1 113 ? 80.620 32.335 17.953  1.00 18.37 ? 113  ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 113 ? 81.548 33.156 18.095  1.00 20.14 ? 113  ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 113 ? 79.448 32.679 18.251  1.00 20.62 ? 113  ASP A OD2 1 
ATOM   937  N N   . GLY A 1 114 ? 83.073 29.242 14.978  1.00 15.62 ? 114  GLY A N   1 
ATOM   938  C CA  . GLY A 1 114 ? 83.702 27.981 14.626  1.00 16.03 ? 114  GLY A CA  1 
ATOM   939  C C   . GLY A 1 114 ? 82.807 26.858 14.163  1.00 16.39 ? 114  GLY A C   1 
ATOM   940  O O   . GLY A 1 114 ? 83.316 25.821 13.706  1.00 16.89 ? 114  GLY A O   1 
ATOM   941  N N   . LYS A 1 115 ? 81.493 27.045 14.264  1.00 15.53 ? 115  LYS A N   1 
ATOM   942  C CA  . LYS A 1 115 ? 80.552 25.966 13.971  1.00 15.54 ? 115  LYS A CA  1 
ATOM   943  C C   . LYS A 1 115 ? 79.776 26.230 12.693  1.00 14.63 ? 115  LYS A C   1 
ATOM   944  O O   . LYS A 1 115 ? 79.152 27.273 12.548  1.00 14.02 ? 115  LYS A O   1 
ATOM   945  C CB  . LYS A 1 115 ? 79.548 25.829 15.114  1.00 16.77 ? 115  LYS A CB  1 
ATOM   946  C CG  . LYS A 1 115 ? 78.594 24.637 14.973  1.00 21.03 ? 115  LYS A CG  1 
ATOM   947  C CD  . LYS A 1 115 ? 77.627 24.555 16.185  1.00 25.90 ? 115  LYS A CD  1 
ATOM   948  C CE  . LYS A 1 115 ? 76.669 23.349 16.106  1.00 30.44 ? 115  LYS A CE  1 
ATOM   949  N NZ  . LYS A 1 115 ? 76.864 22.361 17.235  1.00 32.96 ? 115  LYS A NZ  1 
ATOM   950  N N   . ASP A 1 116 ? 79.779 25.276 11.788  1.00 13.81 ? 116  ASP A N   1 
ATOM   951  C CA  . ASP A 1 116 ? 79.052 25.414 10.513  1.00 13.16 ? 116  ASP A CA  1 
ATOM   952  C C   . ASP A 1 116 ? 77.568 25.576 10.787  1.00 13.97 ? 116  ASP A C   1 
ATOM   953  O O   . ASP A 1 116 ? 76.967 24.784 11.545  1.00 14.59 ? 116  ASP A O   1 
ATOM   954  C CB  . ASP A 1 116 ? 79.336 24.161 9.687   1.00 14.18 ? 116  ASP A CB  1 
ATOM   955  C CG  . ASP A 1 116 ? 78.676 24.153 8.323   1.00 14.15 ? 116  ASP A CG  1 
ATOM   956  O OD1 . ASP A 1 116 ? 78.164 25.215 7.839   1.00 13.50 ? 116  ASP A OD1 1 
ATOM   957  O OD2 . ASP A 1 116 ? 78.655 23.085 7.645   1.00 15.35 ? 116  ASP A OD2 1 
ATOM   958  N N   . VAL A 1 117 ? 76.960 26.606 10.180  1.00 12.63 ? 117  VAL A N   1 
ATOM   959  C CA  . VAL A 1 117 ? 75.547 26.839 10.388  1.00 12.49 ? 117  VAL A CA  1 
ATOM   960  C C   . VAL A 1 117 ? 74.675 26.086 9.400   1.00 13.09 ? 117  VAL A C   1 
ATOM   961  O O   . VAL A 1 117 ? 73.428 26.033 9.582   1.00 13.32 ? 117  VAL A O   1 
ATOM   962  C CB  . VAL A 1 117 ? 75.197 28.359 10.246  1.00 11.85 ? 117  VAL A CB  1 
ATOM   963  C CG1 . VAL A 1 117 ? 76.008 29.169 11.268  1.00 12.95 ? 117  VAL A CG1 1 
ATOM   964  C CG2 . VAL A 1 117 ? 75.436 28.866 8.785   1.00 12.53 ? 117  VAL A CG2 1 
ATOM   965  N N   . MET A 1 118 ? 75.287 25.494 8.371   1.00 12.81 ? 118  MET A N   1 
ATOM   966  C CA  . MET A 1 118 ? 74.458 24.871 7.329   1.00 13.47 ? 118  MET A CA  1 
ATOM   967  C C   . MET A 1 118 ? 73.564 23.713 7.798   1.00 13.95 ? 118  MET A C   1 
ATOM   968  O O   . MET A 1 118 ? 72.413 23.605 7.363   1.00 13.12 ? 118  MET A O   1 
ATOM   969  C CB  . MET A 1 118 ? 75.278 24.521 6.080   1.00 13.68 ? 118  MET A CB  1 
ATOM   970  C CG  . MET A 1 118 ? 75.847 25.764 5.355   1.00 13.90 ? 118  MET A CG  1 
ATOM   971  S SD  . MET A 1 118 ? 74.623 27.096 4.998   1.00 13.47 ? 118  MET A SD  1 
ATOM   972  C CE  . MET A 1 118 ? 73.360 26.253 4.077   1.00 14.03 ? 118  MET A CE  1 
ATOM   973  N N   . PRO A 1 119 ? 74.056 22.824 8.641   1.00 13.96 ? 119  PRO A N   1 
ATOM   974  C CA  . PRO A 1 119 ? 73.187 21.738 9.105   1.00 14.92 ? 119  PRO A CA  1 
ATOM   975  C C   . PRO A 1 119 ? 71.919 22.246 9.774   1.00 14.91 ? 119  PRO A C   1 
ATOM   976  O O   . PRO A 1 119 ? 70.824 21.694 9.526   1.00 15.60 ? 119  PRO A O   1 
ATOM   977  C CB  . PRO A 1 119 ? 74.097 20.943 10.085  1.00 14.97 ? 119  PRO A CB  1 
ATOM   978  C CG  . PRO A 1 119 ? 75.471 21.148 9.499   1.00 14.98 ? 119  PRO A CG  1 
ATOM   979  C CD  . PRO A 1 119 ? 75.460 22.657 9.081   1.00 14.67 ? 119  PRO A CD  1 
ATOM   980  N N   . GLU A 1 120 ? 72.022 23.294 10.590  1.00 15.05 ? 120  GLU A N   1 
ATOM   981  C CA  . GLU A 1 120 ? 70.811 23.773 11.237  1.00 15.85 ? 120  GLU A CA  1 
ATOM   982  C C   . GLU A 1 120 ? 69.907 24.543 10.255  1.00 14.01 ? 120  GLU A C   1 
ATOM   983  O O   . GLU A 1 120 ? 68.678 24.459 10.336  1.00 12.76 ? 120  GLU A O   1 
ATOM   984  C CB  . GLU A 1 120 ? 71.121 24.559 12.509  1.00 17.69 ? 120  GLU A CB  1 
ATOM   985  C CG  . GLU A 1 120 ? 71.452 23.643 13.693  1.00 22.57 ? 120  GLU A CG  1 
ATOM   986  C CD  . GLU A 1 120 ? 70.244 22.871 14.214  1.00 28.26 ? 120  GLU A CD  1 
ATOM   987  O OE1 . GLU A 1 120 ? 69.173 23.473 14.417  1.00 32.28 ? 120  GLU A OE1 1 
ATOM   988  O OE2 . GLU A 1 120 ? 70.358 21.639 14.417  1.00 32.78 ? 120  GLU A OE2 1 
ATOM   989  N N   . VAL A 1 121 ? 70.504 25.262 9.321   1.00 12.90 ? 121  VAL A N   1 
ATOM   990  C CA  . VAL A 1 121 ? 69.704 25.951 8.300   1.00 12.66 ? 121  VAL A CA  1 
ATOM   991  C C   . VAL A 1 121 ? 68.879 24.901 7.547   1.00 12.70 ? 121  VAL A C   1 
ATOM   992  O O   . VAL A 1 121 ? 67.664 25.055 7.341   1.00 12.63 ? 121  VAL A O   1 
ATOM   993  C CB  . VAL A 1 121 ? 70.616 26.716 7.269   1.00 12.01 ? 121  VAL A CB  1 
ATOM   994  C CG1 . VAL A 1 121 ? 69.835 27.078 5.971   1.00 12.29 ? 121  VAL A CG1 1 
ATOM   995  C CG2 . VAL A 1 121 ? 71.244 28.006 7.891   1.00 12.34 ? 121  VAL A CG2 1 
ATOM   996  N N   . ASN A 1 122 ? 69.549 23.829 7.120   1.00 12.91 ? 122  ASN A N   1 
ATOM   997  C CA  . ASN A 1 122 ? 68.867 22.795 6.360   1.00 13.36 ? 122  ASN A CA  1 
ATOM   998  C C   . ASN A 1 122 ? 67.875 21.996 7.204   1.00 13.59 ? 122  ASN A C   1 
ATOM   999  O O   . ASN A 1 122 ? 66.848 21.534 6.684   1.00 13.64 ? 122  ASN A O   1 
ATOM   1000 C CB  . ASN A 1 122 ? 69.916 21.859 5.715   1.00 14.03 ? 122  ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 122 ? 70.681 22.539 4.603   1.00 14.74 ? 122  ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 122 ? 71.874 22.278 4.370   1.00 18.61 ? 122  ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 122 ? 70.002 23.401 3.892   1.00 14.03 ? 122  ASN A ND2 1 
ATOM   1004 N N   . LYS A 1 123 ? 68.171 21.816 8.488   1.00 13.18 ? 123  LYS A N   1 
ATOM   1005 C CA  . LYS A 1 123 ? 67.237 21.083 9.349   1.00 14.09 ? 123  LYS A CA  1 
ATOM   1006 C C   . LYS A 1 123 ? 65.926 21.854 9.460   1.00 13.53 ? 123  LYS A C   1 
ATOM   1007 O O   . LYS A 1 123 ? 64.841 21.283 9.377   1.00 13.05 ? 123  LYS A O   1 
ATOM   1008 C CB  . LYS A 1 123 ? 67.861 20.914 10.743  1.00 15.84 ? 123  LYS A CB  1 
ATOM   1009 C CG  . LYS A 1 123 ? 66.979 20.147 11.725  1.00 20.06 ? 123  LYS A CG  1 
ATOM   1010 C CD  . LYS A 1 123 ? 67.577 20.202 13.140  1.00 27.29 ? 123  LYS A CD  1 
ATOM   1011 C CE  . LYS A 1 123 ? 67.331 18.935 13.979  1.00 33.26 ? 123  LYS A CE  1 
ATOM   1012 N NZ  . LYS A 1 123 ? 65.916 18.473 14.001  1.00 35.21 ? 123  LYS A NZ  1 
ATOM   1013 N N   . VAL A 1 124 ? 66.024 23.176 9.626   1.00 13.28 ? 124  VAL A N   1 
ATOM   1014 C CA  . VAL A 1 124 ? 64.799 23.977 9.691   1.00 13.09 ? 124  VAL A CA  1 
ATOM   1015 C C   . VAL A 1 124 ? 64.056 23.979 8.344   1.00 12.92 ? 124  VAL A C   1 
ATOM   1016 O O   . VAL A 1 124 ? 62.841 23.831 8.323   1.00 12.65 ? 124  VAL A O   1 
ATOM   1017 C CB  . VAL A 1 124 ? 65.074 25.419 10.214  1.00 12.97 ? 124  VAL A CB  1 
ATOM   1018 C CG1 . VAL A 1 124 ? 63.794 26.301 10.108  1.00 13.92 ? 124  VAL A CG1 1 
ATOM   1019 C CG2 . VAL A 1 124 ? 65.628 25.355 11.672  1.00 14.13 ? 124  VAL A CG2 1 
ATOM   1020 N N   . LEU A 1 125 ? 64.777 24.122 7.221   1.00 12.21 ? 125  LEU A N   1 
ATOM   1021 C CA  . LEU A 1 125 ? 64.128 24.035 5.922   1.00 12.21 ? 125  LEU A CA  1 
ATOM   1022 C C   . LEU A 1 125 ? 63.370 22.690 5.789   1.00 13.29 ? 125  LEU A C   1 
ATOM   1023 O O   . LEU A 1 125 ? 62.224 22.653 5.324   1.00 13.51 ? 125  LEU A O   1 
ATOM   1024 C CB  . LEU A 1 125 ? 65.138 24.204 4.764   1.00 12.21 ? 125  LEU A CB  1 
ATOM   1025 C CG  . LEU A 1 125 ? 65.623 25.666 4.642   1.00 11.68 ? 125  LEU A CG  1 
ATOM   1026 C CD1 . LEU A 1 125 ? 66.829 25.680 3.694   1.00 11.85 ? 125  LEU A CD1 1 
ATOM   1027 C CD2 . LEU A 1 125 ? 64.517 26.596 4.112   1.00 11.79 ? 125  LEU A CD2 1 
ATOM   1028 N N   . ASP A 1 126 ? 63.998 21.592 6.209   1.00 13.47 ? 126  ASP A N   1 
ATOM   1029 C CA  . ASP A 1 126 ? 63.327 20.297 6.097   1.00 14.16 ? 126  ASP A CA  1 
ATOM   1030 C C   . ASP A 1 126 ? 62.076 20.240 6.985   1.00 14.18 ? 126  ASP A C   1 
ATOM   1031 O O   . ASP A 1 126 ? 61.057 19.660 6.585   1.00 15.14 ? 126  ASP A O   1 
ATOM   1032 C CB  . ASP A 1 126 ? 64.283 19.177 6.515   1.00 15.29 ? 126  ASP A CB  1 
ATOM   1033 C CG  . ASP A 1 126 ? 65.366 18.907 5.493   1.00 18.46 ? 126  ASP A CG  1 
ATOM   1034 O OD1 . ASP A 1 126 ? 65.240 19.343 4.314   1.00 20.95 ? 126  ASP A OD1 1 
ATOM   1035 O OD2 . ASP A 1 126 ? 66.387 18.238 5.813   1.00 21.42 ? 126  ASP A OD2 1 
ATOM   1036 N N   . LYS A 1 127 ? 62.152 20.850 8.165   1.00 13.72 ? 127  LYS A N   1 
ATOM   1037 C CA  . LYS A 1 127 ? 61.012 20.892 9.090   1.00 14.01 ? 127  LYS A CA  1 
ATOM   1038 C C   . LYS A 1 127 ? 59.883 21.733 8.481   1.00 14.15 ? 127  LYS A C   1 
ATOM   1039 O O   . LYS A 1 127 ? 58.697 21.347 8.536   1.00 14.99 ? 127  LYS A O   1 
ATOM   1040 C CB  . LYS A 1 127 ? 61.429 21.470 10.430  1.00 15.41 ? 127  LYS A CB  1 
ATOM   1041 C CG  . LYS A 1 127 ? 60.341 21.423 11.507  1.00 17.01 ? 127  LYS A CG  1 
ATOM   1042 C CD  . LYS A 1 127 ? 60.779 22.186 12.750  1.00 20.64 ? 127  LYS A CD  1 
ATOM   1043 C CE  . LYS A 1 127 ? 59.676 22.272 13.762  1.00 23.53 ? 127  LYS A CE  1 
ATOM   1044 N NZ  . LYS A 1 127 ? 59.286 20.932 14.229  1.00 27.41 ? 127  LYS A NZ  1 
ATOM   1045 N N   . MET A 1 128 ? 60.244 22.874 7.886   1.00 13.64 ? 128  MET A N   1 
ATOM   1046 C CA  . MET A 1 128 ? 59.263 23.701 7.195   1.00 13.20 ? 128  MET A CA  1 
ATOM   1047 C C   . MET A 1 128 ? 58.583 22.926 6.078   1.00 13.59 ? 128  MET A C   1 
ATOM   1048 O O   . MET A 1 128 ? 57.366 22.958 5.940   1.00 14.16 ? 128  MET A O   1 
ATOM   1049 C CB  . MET A 1 128 ? 59.949 24.935 6.570   1.00 12.19 ? 128  MET A CB  1 
ATOM   1050 C CG  . MET A 1 128 ? 60.449 25.930 7.619   1.00 10.78 ? 128  MET A CG  1 
ATOM   1051 S SD  . MET A 1 128 ? 61.584 27.149 6.890   1.00 12.59 ? 128  MET A SD  1 
ATOM   1052 C CE  . MET A 1 128 ? 60.478 28.158 5.907   1.00 15.42 ? 128  MET A CE  1 
ATOM   1053 N N   . LYS A 1 129 ? 59.368 22.201 5.298   1.00 13.67 ? 129  LYS A N   1 
ATOM   1054 C CA  . LYS A 1 129 ? 58.783 21.485 4.167   1.00 14.51 ? 129  LYS A CA  1 
ATOM   1055 C C   . LYS A 1 129 ? 57.850 20.381 4.657   1.00 14.48 ? 129  LYS A C   1 
ATOM   1056 O O   . LYS A 1 129 ? 56.742 20.226 4.136   1.00 15.21 ? 129  LYS A O   1 
ATOM   1057 C CB  . LYS A 1 129 ? 59.877 20.871 3.301   1.00 14.59 ? 129  LYS A CB  1 
ATOM   1058 C CG  . LYS A 1 129 ? 59.274 20.143 2.127   1.00 17.10 ? 129  LYS A CG  1 
ATOM   1059 C CD  . LYS A 1 129 ? 60.340 19.590 1.205   1.00 20.96 ? 129  LYS A CD  1 
ATOM   1060 C CE  . LYS A 1 129 ? 59.653 18.998 -0.077  1.00 24.46 ? 129  LYS A CE  1 
ATOM   1061 N NZ  . LYS A 1 129 ? 60.644 18.742 -1.184  1.00 26.35 ? 129  LYS A NZ  1 
ATOM   1062 N N   . SER A 1 130 ? 58.275 19.651 5.672   1.00 14.41 ? 130  SER A N   1 
ATOM   1063 C CA  . SER A 1 130 ? 57.422 18.583 6.194   1.00 16.28 ? 130  SER A CA  1 
ATOM   1064 C C   . SER A 1 130 ? 56.090 19.135 6.734   1.00 16.54 ? 130  SER A C   1 
ATOM   1065 O O   . SER A 1 130 ? 55.008 18.620 6.409   1.00 16.15 ? 130  SER A O   1 
ATOM   1066 C CB  . SER A 1 130 ? 58.183 17.786 7.261   1.00 17.20 ? 130  SER A CB  1 
ATOM   1067 O OG  . SER A 1 130 ? 57.329 16.837 7.877   1.00 21.69 ? 130  SER A OG  1 
ATOM   1068 N N   . PHE A 1 131 ? 56.157 20.213 7.512   1.00 15.92 ? 131  PHE A N   1 
ATOM   1069 C CA  . PHE A 1 131 ? 54.948 20.827 8.033   1.00 15.51 ? 131  PHE A CA  1 
ATOM   1070 C C   . PHE A 1 131 ? 54.050 21.344 6.903   1.00 16.61 ? 131  PHE A C   1 
ATOM   1071 O O   . PHE A 1 131 ? 52.831 21.150 6.908   1.00 16.38 ? 131  PHE A O   1 
ATOM   1072 C CB  . PHE A 1 131 ? 55.338 21.960 9.002   1.00 15.85 ? 131  PHE A CB  1 
ATOM   1073 C CG  . PHE A 1 131 ? 54.170 22.726 9.524   1.00 16.16 ? 131  PHE A CG  1 
ATOM   1074 C CD1 . PHE A 1 131 ? 53.330 22.164 10.467  1.00 15.83 ? 131  PHE A CD1 1 
ATOM   1075 C CD2 . PHE A 1 131 ? 53.919 24.021 9.095   1.00 16.39 ? 131  PHE A CD2 1 
ATOM   1076 C CE1 . PHE A 1 131 ? 52.226 22.891 10.985  1.00 15.64 ? 131  PHE A CE1 1 
ATOM   1077 C CE2 . PHE A 1 131 ? 52.832 24.731 9.584   1.00 15.62 ? 131  PHE A CE2 1 
ATOM   1078 C CZ  . PHE A 1 131 ? 51.996 24.176 10.528  1.00 14.56 ? 131  PHE A CZ  1 
ATOM   1079 N N   . CYS A 1 132 ? 54.664 22.009 5.939   1.00 16.64 ? 132  CYS A N   1 
ATOM   1080 C CA  . CYS A 1 132 ? 53.952 22.569 4.813   1.00 18.17 ? 132  CYS A CA  1 
ATOM   1081 C C   . CYS A 1 132 ? 53.215 21.482 4.048   1.00 16.93 ? 132  CYS A C   1 
ATOM   1082 O O   . CYS A 1 132 ? 52.091 21.682 3.585   1.00 16.90 ? 132  CYS A O   1 
ATOM   1083 C CB  . CYS A 1 132 ? 54.953 23.211 3.871   1.00 19.98 ? 132  CYS A CB  1 
ATOM   1084 S SG  . CYS A 1 132 ? 54.065 24.107 2.661   1.00 28.66 ? 132  CYS A SG  1 
ATOM   1085 N N   . GLN A 1 133 ? 53.859 20.347 3.847   1.00 16.73 ? 133  GLN A N   1 
ATOM   1086 C CA  . GLN A 1 133 ? 53.198 19.249 3.142   1.00 17.51 ? 133  GLN A CA  1 
ATOM   1087 C C   . GLN A 1 133 ? 51.954 18.796 3.897   1.00 17.20 ? 133  GLN A C   1 
ATOM   1088 O O   . GLN A 1 133 ? 50.898 18.572 3.280   1.00 17.32 ? 133  GLN A O   1 
ATOM   1089 C CB  . GLN A 1 133 ? 54.157 18.083 2.979   1.00 17.06 ? 133  GLN A CB  1 
ATOM   1090 C CG  . GLN A 1 133 ? 55.209 18.410 1.958   1.00 22.58 ? 133  GLN A CG  1 
ATOM   1091 C CD  . GLN A 1 133 ? 56.321 17.351 1.846   1.00 27.06 ? 133  GLN A CD  1 
ATOM   1092 O OE1 . GLN A 1 133 ? 56.789 17.075 0.745   1.00 31.74 ? 133  GLN A OE1 1 
ATOM   1093 N NE2 . GLN A 1 133 ? 56.758 16.793 2.978   1.00 28.21 ? 133  GLN A NE2 1 
ATOM   1094 N N   . ARG A 1 134 ? 52.074 18.669 5.215   1.00 16.77 ? 134  ARG A N   1 
ATOM   1095 C CA  . ARG A 1 134 ? 50.930 18.202 6.016   1.00 17.00 ? 134  ARG A CA  1 
ATOM   1096 C C   . ARG A 1 134 ? 49.792 19.190 5.922   1.00 16.69 ? 134  ARG A C   1 
ATOM   1097 O O   . ARG A 1 134 ? 48.624 18.809 5.731   1.00 16.04 ? 134  ARG A O   1 
ATOM   1098 C CB  . ARG A 1 134 ? 51.338 17.933 7.463   1.00 18.06 ? 134  ARG A CB  1 
ATOM   1099 C CG  . ARG A 1 134 ? 52.290 16.741 7.583   1.00 20.98 ? 134  ARG A CG  1 
ATOM   1100 C CD  . ARG A 1 134 ? 53.038 16.607 8.917   1.00 27.79 ? 134  ARG A CD  1 
ATOM   1101 N NE  . ARG A 1 134 ? 52.132 16.263 10.015  1.00 31.72 ? 134  ARG A NE  1 
ATOM   1102 C CZ  . ARG A 1 134 ? 52.412 16.433 11.309  1.00 33.21 ? 134  ARG A CZ  1 
ATOM   1103 N NH1 . ARG A 1 134 ? 53.571 16.966 11.693  1.00 33.87 ? 134  ARG A NH1 1 
ATOM   1104 N NH2 . ARG A 1 134 ? 51.516 16.083 12.214  1.00 33.18 ? 134  ARG A NH2 1 
ATOM   1105 N N   . VAL A 1 135 ? 50.118 20.482 6.046   1.00 15.32 ? 135  VAL A N   1 
ATOM   1106 C CA  . VAL A 1 135 ? 49.055 21.472 5.992   1.00 15.58 ? 135  VAL A CA  1 
ATOM   1107 C C   . VAL A 1 135 ? 48.420 21.552 4.619   1.00 16.05 ? 135  VAL A C   1 
ATOM   1108 O O   . VAL A 1 135 ? 47.206 21.505 4.491   1.00 17.10 ? 135  VAL A O   1 
ATOM   1109 C CB  . VAL A 1 135 ? 49.557 22.866 6.462   1.00 15.06 ? 135  VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 135 ? 48.476 23.911 6.281   1.00 15.48 ? 135  VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 135 ? 49.992 22.799 7.911   1.00 14.73 ? 135  VAL A CG2 1 
ATOM   1112 N N   . ARG A 1 136 ? 49.222 21.685 3.578   1.00 16.43 ? 136  ARG A N   1 
ATOM   1113 C CA  . ARG A 1 136 ? 48.641 21.859 2.252   1.00 17.62 ? 136  ARG A CA  1 
ATOM   1114 C C   . ARG A 1 136 ? 47.868 20.641 1.752   1.00 18.56 ? 136  ARG A C   1 
ATOM   1115 O O   . ARG A 1 136 ? 46.877 20.797 1.031   1.00 20.07 ? 136  ARG A O   1 
ATOM   1116 C CB  . ARG A 1 136 ? 49.751 22.200 1.258   1.00 17.72 ? 136  ARG A CB  1 
ATOM   1117 C CG  . ARG A 1 136 ? 50.138 23.686 1.278   1.00 19.03 ? 136  ARG A CG  1 
ATOM   1118 C CD  . ARG A 1 136 ? 51.447 23.981 0.538   1.00 19.92 ? 136  ARG A CD  1 
ATOM   1119 N NE  . ARG A 1 136 ? 51.346 23.715 -0.891  1.00 22.53 ? 136  ARG A NE  1 
ATOM   1120 C CZ  . ARG A 1 136 ? 50.978 24.616 -1.790  1.00 22.05 ? 136  ARG A CZ  1 
ATOM   1121 N NH1 . ARG A 1 136 ? 50.650 25.839 -1.414  1.00 19.36 ? 136  ARG A NH1 1 
ATOM   1122 N NH2 . ARG A 1 136 ? 50.932 24.277 -3.078  1.00 24.55 ? 136  ARG A NH2 1 
ATOM   1123 N N   . SER A 1 137 ? 48.294 19.445 2.139   1.00 18.13 ? 137  SER A N   1 
ATOM   1124 C CA  . SER A 1 137 ? 47.644 18.227 1.625   1.00 19.28 ? 137  SER A CA  1 
ATOM   1125 C C   . SER A 1 137 ? 46.356 17.937 2.345   1.00 20.17 ? 137  SER A C   1 
ATOM   1126 O O   . SER A 1 137 ? 45.564 17.093 1.870   1.00 21.67 ? 137  SER A O   1 
ATOM   1127 C CB  . SER A 1 137 ? 48.518 17.019 1.841   1.00 19.27 ? 137  SER A CB  1 
ATOM   1128 O OG  . SER A 1 137 ? 48.657 16.732 3.215   1.00 19.53 ? 137  SER A OG  1 
ATOM   1129 N N   . GLY A 1 138 ? 46.163 18.586 3.492   1.00 20.16 ? 138  GLY A N   1 
ATOM   1130 C CA  . GLY A 1 138 ? 44.980 18.368 4.289   1.00 20.35 ? 138  GLY A CA  1 
ATOM   1131 C C   . GLY A 1 138 ? 45.235 17.318 5.345   1.00 21.21 ? 138  GLY A C   1 
ATOM   1132 O O   . GLY A 1 138 ? 44.316 16.988 6.100   1.00 21.94 ? 138  GLY A O   1 
ATOM   1133 N N   . ASP A 1 139 ? 46.458 16.799 5.433   1.00 20.84 ? 139  ASP A N   1 
ATOM   1134 C CA  . ASP A 1 139 ? 46.774 15.792 6.461   1.00 20.83 ? 139  ASP A CA  1 
ATOM   1135 C C   . ASP A 1 139 ? 46.731 16.399 7.874   1.00 20.60 ? 139  ASP A C   1 
ATOM   1136 O O   . ASP A 1 139 ? 46.297 15.749 8.829   1.00 20.57 ? 139  ASP A O   1 
ATOM   1137 C CB  . ASP A 1 139 ? 48.132 15.150 6.221   1.00 22.16 ? 139  ASP A CB  1 
ATOM   1138 C CG  . ASP A 1 139 ? 48.091 14.111 5.098   1.00 27.65 ? 139  ASP A CG  1 
ATOM   1139 O OD1 . ASP A 1 139 ? 49.138 13.458 4.832   1.00 31.93 ? 139  ASP A OD1 1 
ATOM   1140 O OD2 . ASP A 1 139 ? 47.050 13.890 4.425   1.00 30.29 ? 139  ASP A OD2 1 
ATOM   1141 N N   . TRP A 1 140 ? 47.179 17.651 7.994   1.00 17.91 ? 140  TRP A N   1 
ATOM   1142 C CA  . TRP A 1 140 ? 47.141 18.353 9.273   1.00 17.66 ? 140  TRP A CA  1 
ATOM   1143 C C   . TRP A 1 140 ? 45.727 18.858 9.518   1.00 17.35 ? 140  TRP A C   1 
ATOM   1144 O O   . TRP A 1 140 ? 45.217 19.701 8.759   1.00 17.63 ? 140  TRP A O   1 
ATOM   1145 C CB  . TRP A 1 140 ? 48.134 19.535 9.245   1.00 16.59 ? 140  TRP A CB  1 
ATOM   1146 C CG  . TRP A 1 140 ? 48.224 20.344 10.544  1.00 16.12 ? 140  TRP A CG  1 
ATOM   1147 C CD1 . TRP A 1 140 ? 47.322 21.244 11.020  1.00 15.93 ? 140  TRP A CD1 1 
ATOM   1148 C CD2 . TRP A 1 140 ? 49.294 20.317 11.482  1.00 16.33 ? 140  TRP A CD2 1 
ATOM   1149 N NE1 . TRP A 1 140 ? 47.774 21.778 12.203  1.00 14.49 ? 140  TRP A NE1 1 
ATOM   1150 C CE2 . TRP A 1 140 ? 48.985 21.222 12.507  1.00 17.06 ? 140  TRP A CE2 1 
ATOM   1151 C CE3 . TRP A 1 140 ? 50.501 19.617 11.557  1.00 16.68 ? 140  TRP A CE3 1 
ATOM   1152 C CZ2 . TRP A 1 140 ? 49.829 21.434 13.602  1.00 17.82 ? 140  TRP A CZ2 1 
ATOM   1153 C CZ3 . TRP A 1 140 ? 51.340 19.829 12.645  1.00 17.59 ? 140  TRP A CZ3 1 
ATOM   1154 C CH2 . TRP A 1 140 ? 50.997 20.726 13.653  1.00 18.82 ? 140  TRP A CH2 1 
ATOM   1155 N N   . LYS A 1 141 ? 45.079 18.338 10.567  1.00 17.18 ? 141  LYS A N   1 
ATOM   1156 C CA  . LYS A 1 141 ? 43.698 18.753 10.825  1.00 16.90 ? 141  LYS A CA  1 
ATOM   1157 C C   . LYS A 1 141 ? 43.570 19.701 12.005  1.00 16.35 ? 141  LYS A C   1 
ATOM   1158 O O   . LYS A 1 141 ? 44.329 19.623 12.982  1.00 16.85 ? 141  LYS A O   1 
ATOM   1159 C CB  . LYS A 1 141 ? 42.799 17.528 11.102  1.00 17.79 ? 141  LYS A CB  1 
ATOM   1160 C CG  . LYS A 1 141 ? 42.903 16.431 10.098  1.00 18.89 ? 141  LYS A CG  1 
ATOM   1161 C CD  . LYS A 1 141 ? 42.332 16.822 8.756   1.00 21.05 ? 141  LYS A CD  1 
ATOM   1162 C CE  . LYS A 1 141 ? 42.246 15.539 7.834   1.00 22.80 ? 141  LYS A CE  1 
ATOM   1163 N NZ  . LYS A 1 141 ? 41.766 15.918 6.481   1.00 25.89 ? 141  LYS A NZ  1 
ATOM   1164 N N   . GLY A 1 142 ? 42.579 20.581 11.921  1.00 15.63 ? 142  GLY A N   1 
ATOM   1165 C CA  . GLY A 1 142 ? 42.242 21.472 13.015  1.00 15.16 ? 142  GLY A CA  1 
ATOM   1166 C C   . GLY A 1 142 ? 41.514 20.702 14.121  1.00 15.32 ? 142  GLY A C   1 
ATOM   1167 O O   . GLY A 1 142 ? 41.282 19.478 14.016  1.00 16.33 ? 142  GLY A O   1 
ATOM   1168 N N   . TYR A 1 143 ? 41.125 21.426 15.156  1.00 14.36 ? 143  TYR A N   1 
ATOM   1169 C CA  . TYR A 1 143 ? 40.619 20.771 16.375  1.00 14.43 ? 143  TYR A CA  1 
ATOM   1170 C C   . TYR A 1 143 ? 39.319 20.031 16.176  1.00 15.04 ? 143  TYR A C   1 
ATOM   1171 O O   . TYR A 1 143 ? 38.987 19.144 16.982  1.00 15.47 ? 143  TYR A O   1 
ATOM   1172 C CB  . TYR A 1 143 ? 40.561 21.748 17.564  1.00 14.98 ? 143  TYR A CB  1 
ATOM   1173 C CG  . TYR A 1 143 ? 39.489 22.821 17.495  1.00 15.39 ? 143  TYR A CG  1 
ATOM   1174 C CD1 . TYR A 1 143 ? 39.698 24.046 16.837  1.00 16.11 ? 143  TYR A CD1 1 
ATOM   1175 C CD2 . TYR A 1 143 ? 38.273 22.629 18.121  1.00 15.75 ? 143  TYR A CD2 1 
ATOM   1176 C CE1 . TYR A 1 143 ? 38.705 25.017 16.810  1.00 17.51 ? 143  TYR A CE1 1 
ATOM   1177 C CE2 . TYR A 1 143 ? 37.313 23.603 18.129  1.00 17.30 ? 143  TYR A CE2 1 
ATOM   1178 C CZ  . TYR A 1 143 ? 37.505 24.778 17.461  1.00 18.27 ? 143  TYR A CZ  1 
ATOM   1179 O OH  . TYR A 1 143 ? 36.509 25.717 17.483  1.00 19.58 ? 143  TYR A OH  1 
ATOM   1180 N N   . THR A 1 144 ? 38.596 20.357 15.117  1.00 14.92 ? 144  THR A N   1 
ATOM   1181 C CA  . THR A 1 144 ? 37.358 19.637 14.820  1.00 16.35 ? 144  THR A CA  1 
ATOM   1182 C C   . THR A 1 144 ? 37.517 18.692 13.647  1.00 16.64 ? 144  THR A C   1 
ATOM   1183 O O   . THR A 1 144 ? 36.516 18.180 13.125  1.00 17.57 ? 144  THR A O   1 
ATOM   1184 C CB  . THR A 1 144 ? 36.172 20.566 14.550  1.00 16.01 ? 144  THR A CB  1 
ATOM   1185 O OG1 . THR A 1 144 ? 36.352 21.308 13.324  1.00 16.60 ? 144  THR A OG1 1 
ATOM   1186 C CG2 . THR A 1 144 ? 35.979 21.586 15.653  1.00 16.63 ? 144  THR A CG2 1 
ATOM   1187 N N   . GLY A 1 145 ? 38.752 18.466 13.225  1.00 16.37 ? 145  GLY A N   1 
ATOM   1188 C CA  . GLY A 1 145 ? 39.028 17.537 12.134  1.00 16.96 ? 145  GLY A CA  1 
ATOM   1189 C C   . GLY A 1 145 ? 39.014 18.078 10.702  1.00 17.60 ? 145  GLY A C   1 
ATOM   1190 O O   . GLY A 1 145 ? 39.067 17.276 9.740   1.00 18.55 ? 145  GLY A O   1 
ATOM   1191 N N   . LYS A 1 146 ? 38.939 19.398 10.549  1.00 17.57 ? 146  LYS A N   1 
ATOM   1192 C CA  . LYS A 1 146 ? 38.844 20.012 9.214   1.00 17.14 ? 146  LYS A CA  1 
ATOM   1193 C C   . LYS A 1 146 ? 40.210 20.405 8.693   1.00 16.68 ? 146  LYS A C   1 
ATOM   1194 O O   . LYS A 1 146 ? 41.145 20.567 9.467   1.00 16.78 ? 146  LYS A O   1 
ATOM   1195 C CB  . LYS A 1 146 ? 37.951 21.263 9.233   1.00 18.00 ? 146  LYS A CB  1 
ATOM   1196 C CG  . LYS A 1 146 ? 36.515 20.967 9.708   1.00 21.72 ? 146  LYS A CG  1 
ATOM   1197 C CD  . LYS A 1 146 ? 35.589 22.166 9.572   1.00 27.59 ? 146  LYS A CD  1 
ATOM   1198 C CE  . LYS A 1 146 ? 34.109 21.700 9.561   1.00 31.58 ? 146  LYS A CE  1 
ATOM   1199 N NZ  . LYS A 1 146 ? 33.153 22.832 9.400   1.00 34.54 ? 146  LYS A NZ  1 
ATOM   1200 N N   . THR A 1 147 ? 40.326 20.548 7.379   1.00 15.31 ? 147  THR A N   1 
ATOM   1201 C CA  . THR A 1 147 ? 41.602 21.017 6.826   1.00 15.67 ? 147  THR A CA  1 
ATOM   1202 C C   . THR A 1 147 ? 41.732 22.524 7.006   1.00 15.06 ? 147  THR A C   1 
ATOM   1203 O O   . THR A 1 147 ? 40.737 23.269 7.113   1.00 15.45 ? 147  THR A O   1 
ATOM   1204 C CB  . THR A 1 147 ? 41.737 20.705 5.348   1.00 16.30 ? 147  THR A CB  1 
ATOM   1205 O OG1 . THR A 1 147 ? 40.661 21.335 4.635   1.00 19.31 ? 147  THR A OG1 1 
ATOM   1206 C CG2 . THR A 1 147 ? 41.591 19.207 5.106   1.00 15.00 ? 147  THR A CG2 1 
ATOM   1207 N N   . ILE A 1 148 ? 42.982 22.975 6.996   1.00 14.32 ? 148  ILE A N   1 
ATOM   1208 C CA  . ILE A 1 148 ? 43.280 24.394 7.177   1.00 13.78 ? 148  ILE A CA  1 
ATOM   1209 C C   . ILE A 1 148 ? 43.038 25.136 5.879   1.00 13.90 ? 148  ILE A C   1 
ATOM   1210 O O   . ILE A 1 148 ? 43.595 24.766 4.818   1.00 14.62 ? 148  ILE A O   1 
ATOM   1211 C CB  . ILE A 1 148 ? 44.765 24.563 7.597   1.00 13.72 ? 148  ILE A CB  1 
ATOM   1212 C CG1 . ILE A 1 148 ? 45.020 23.888 8.947   1.00 14.73 ? 148  ILE A CG1 1 
ATOM   1213 C CG2 . ILE A 1 148 ? 45.188 26.064 7.561   1.00 15.11 ? 148  ILE A CG2 1 
ATOM   1214 C CD1 . ILE A 1 148 ? 44.212 24.434 10.103  1.00 16.43 ? 148  ILE A CD1 1 
ATOM   1215 N N   . THR A 1 149 ? 42.235 26.199 5.950   1.00 13.41 ? 149  THR A N   1 
ATOM   1216 C CA  . THR A 1 149 ? 41.905 26.988 4.768   1.00 14.59 ? 149  THR A CA  1 
ATOM   1217 C C   . THR A 1 149 ? 42.523 28.369 4.817   1.00 14.52 ? 149  THR A C   1 
ATOM   1218 O O   . THR A 1 149 ? 42.566 29.041 3.779   1.00 14.72 ? 149  THR A O   1 
ATOM   1219 C CB  . THR A 1 149 ? 40.362 27.190 4.644   1.00 15.26 ? 149  THR A CB  1 
ATOM   1220 O OG1 . THR A 1 149 ? 39.836 27.739 5.862   1.00 15.69 ? 149  THR A OG1 1 
ATOM   1221 C CG2 . THR A 1 149 ? 39.648 25.857 4.484   1.00 17.11 ? 149  THR A CG2 1 
ATOM   1222 N N   . ASP A 1 150 ? 42.981 28.787 6.003   1.00 13.50 ? 150  ASP A N   1 
ATOM   1223 C CA  . ASP A 1 150 ? 43.508 30.157 6.201   1.00 12.61 ? 150  ASP A CA  1 
ATOM   1224 C C   . ASP A 1 150 ? 44.701 30.121 7.099   1.00 12.96 ? 150  ASP A C   1 
ATOM   1225 O O   . ASP A 1 150 ? 44.677 29.457 8.130   1.00 13.43 ? 150  ASP A O   1 
ATOM   1226 C CB  . ASP A 1 150 ? 42.458 31.049 6.881   1.00 12.79 ? 150  ASP A CB  1 
ATOM   1227 C CG  . ASP A 1 150 ? 41.248 31.251 5.990   1.00 14.38 ? 150  ASP A CG  1 
ATOM   1228 O OD1 . ASP A 1 150 ? 41.277 32.232 5.205   1.00 15.62 ? 150  ASP A OD1 1 
ATOM   1229 O OD2 . ASP A 1 150 ? 40.253 30.485 6.018   1.00 14.98 ? 150  ASP A OD2 1 
ATOM   1230 N N   . VAL A 1 151 ? 45.738 30.822 6.677   1.00 11.49 ? 151  VAL A N   1 
ATOM   1231 C CA  . VAL A 1 151 ? 46.984 30.959 7.446   1.00 11.66 ? 151  VAL A CA  1 
ATOM   1232 C C   . VAL A 1 151 ? 47.124 32.420 7.790   1.00 12.01 ? 151  VAL A C   1 
ATOM   1233 O O   . VAL A 1 151 ? 47.029 33.271 6.905   1.00 12.11 ? 151  VAL A O   1 
ATOM   1234 C CB  . VAL A 1 151 ? 48.191 30.489 6.591   1.00 12.40 ? 151  VAL A CB  1 
ATOM   1235 C CG1 . VAL A 1 151 ? 49.502 30.857 7.264   1.00 14.50 ? 151  VAL A CG1 1 
ATOM   1236 C CG2 . VAL A 1 151 ? 48.089 28.978 6.394   1.00 15.24 ? 151  VAL A CG2 1 
ATOM   1237 N N   . ILE A 1 152 ? 47.338 32.718 9.070   1.00 10.91 ? 152  ILE A N   1 
ATOM   1238 C CA  . ILE A 1 152 ? 47.437 34.124 9.495   1.00 11.09 ? 152  ILE A CA  1 
ATOM   1239 C C   . ILE A 1 152 ? 48.789 34.339 10.125  1.00 11.18 ? 152  ILE A C   1 
ATOM   1240 O O   . ILE A 1 152 ? 49.081 33.769 11.180  1.00 11.83 ? 152  ILE A O   1 
ATOM   1241 C CB  . ILE A 1 152 ? 46.362 34.467 10.537  1.00 10.98 ? 152  ILE A CB  1 
ATOM   1242 C CG1 . ILE A 1 152 ? 44.951 34.178 10.002  1.00 10.51 ? 152  ILE A CG1 1 
ATOM   1243 C CG2 . ILE A 1 152 ? 46.463 35.945 10.945  1.00 11.06 ? 152  ILE A CG2 1 
ATOM   1244 C CD1 . ILE A 1 152 ? 44.494 32.632 10.245  1.00 12.19 ? 152  ILE A CD1 1 
ATOM   1245 N N   . ASN A 1 153 ? 49.612 35.153 9.463   1.00 10.29 ? 153  ASN A N   1 
ATOM   1246 C CA  . ASN A 1 153 ? 50.928 35.500 9.990   1.00 10.25 ? 153  ASN A CA  1 
ATOM   1247 C C   . ASN A 1 153 ? 50.725 36.728 10.876  1.00 11.45 ? 153  ASN A C   1 
ATOM   1248 O O   . ASN A 1 153 ? 50.098 37.707 10.438  1.00 12.73 ? 153  ASN A O   1 
ATOM   1249 C CB  . ASN A 1 153 ? 51.865 35.853 8.816   1.00 10.38 ? 153  ASN A CB  1 
ATOM   1250 C CG  . ASN A 1 153 ? 53.316 36.036 9.240   1.00 10.88 ? 153  ASN A CG  1 
ATOM   1251 O OD1 . ASN A 1 153 ? 54.044 35.060 9.410   1.00 13.76 ? 153  ASN A OD1 1 
ATOM   1252 N ND2 . ASN A 1 153 ? 53.751 37.309 9.418   1.00 11.72 ? 153  ASN A ND2 1 
ATOM   1253 N N   . ILE A 1 154 ? 51.217 36.653 12.108  1.00 10.33 ? 154  ILE A N   1 
ATOM   1254 C CA  . ILE A 1 154 ? 51.135 37.777 13.049  1.00 11.09 ? 154  ILE A CA  1 
ATOM   1255 C C   . ILE A 1 154 ? 52.566 38.182 13.306  1.00 11.59 ? 154  ILE A C   1 
ATOM   1256 O O   . ILE A 1 154 ? 53.373 37.394 13.844  1.00 11.14 ? 154  ILE A O   1 
ATOM   1257 C CB  . ILE A 1 154 ? 50.429 37.365 14.369  1.00 11.13 ? 154  ILE A CB  1 
ATOM   1258 C CG1 . ILE A 1 154 ? 48.992 36.964 14.076  1.00 12.18 ? 154  ILE A CG1 1 
ATOM   1259 C CG2 . ILE A 1 154 ? 50.497 38.524 15.371  1.00 11.56 ? 154  ILE A CG2 1 
ATOM   1260 C CD1 . ILE A 1 154 ? 48.169 36.517 15.328  1.00 12.09 ? 154  ILE A CD1 1 
ATOM   1261 N N   . GLY A 1 155 ? 52.920 39.402 12.889  1.00 11.47 ? 155  GLY A N   1 
ATOM   1262 C CA  . GLY A 1 155 ? 54.302 39.825 13.055  1.00 11.67 ? 155  GLY A CA  1 
ATOM   1263 C C   . GLY A 1 155 ? 54.396 41.259 12.542  1.00 12.70 ? 155  GLY A C   1 
ATOM   1264 O O   . GLY A 1 155 ? 53.489 41.739 11.856  1.00 13.11 ? 155  GLY A O   1 
ATOM   1265 N N   . ILE A 1 156 ? 55.491 41.937 12.832  1.00 13.30 ? 156  ILE A N   1 
ATOM   1266 C CA  . ILE A 1 156 ? 55.584 43.328 12.364  1.00 13.64 ? 156  ILE A CA  1 
ATOM   1267 C C   . ILE A 1 156 ? 56.992 43.577 11.855  1.00 13.50 ? 156  ILE A C   1 
ATOM   1268 O O   . ILE A 1 156 ? 57.917 42.879 12.240  1.00 12.65 ? 156  ILE A O   1 
ATOM   1269 C CB  . ILE A 1 156 ? 55.152 44.279 13.496  1.00 15.02 ? 156  ILE A CB  1 
ATOM   1270 C CG1 . ILE A 1 156 ? 54.862 45.690 12.969  1.00 15.49 ? 156  ILE A CG1 1 
ATOM   1271 C CG2 . ILE A 1 156 ? 56.175 44.242 14.642  1.00 13.97 ? 156  ILE A CG2 1 
ATOM   1272 C CD1 . ILE A 1 156 ? 54.038 46.580 13.966  1.00 15.92 ? 156  ILE A CD1 1 
ATOM   1273 N N   . GLY A 1 157 ? 57.133 44.570 10.976  1.00 13.12 ? 157  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 157 ? 58.437 44.876 10.404  1.00 12.69 ? 157  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 157 ? 59.031 43.717 9.638   1.00 11.99 ? 157  GLY A C   1 
ATOM   1276 O O   . GLY A 1 157 ? 58.433 43.220 8.692   1.00 11.84 ? 157  GLY A O   1 
ATOM   1277 N N   . GLY A 1 158 ? 60.221 43.289 10.045  1.00 11.06 ? 158  GLY A N   1 
ATOM   1278 C CA  . GLY A 1 158 ? 60.891 42.234 9.286   1.00 11.49 ? 158  GLY A CA  1 
ATOM   1279 C C   . GLY A 1 158 ? 60.145 40.909 9.360   1.00 11.97 ? 158  GLY A C   1 
ATOM   1280 O O   . GLY A 1 158 ? 60.357 40.036 8.534   1.00 11.94 ? 158  GLY A O   1 
ATOM   1281 N N   . SER A 1 159 ? 59.246 40.759 10.325  1.00 12.15 ? 159  SER A N   1 
ATOM   1282 C CA  . SER A 1 159 ? 58.478 39.529 10.434  1.00 12.35 ? 159  SER A CA  1 
ATOM   1283 C C   . SER A 1 159 ? 57.169 39.638 9.657   1.00 12.86 ? 159  SER A C   1 
ATOM   1284 O O   . SER A 1 159 ? 56.342 38.725 9.701   1.00 14.47 ? 159  SER A O   1 
ATOM   1285 C CB  . SER A 1 159 ? 58.189 39.211 11.921  1.00 11.57 ? 159  SER A CB  1 
ATOM   1286 O OG  . SER A 1 159 ? 59.408 38.892 12.573  1.00 12.34 ? 159  SER A OG  1 
ATOM   1287 N N   . ASP A 1 160 ? 57.003 40.718 8.904   1.00 10.89 ? 160  ASP A N   1 
ATOM   1288 C CA  . ASP A 1 160 ? 55.761 40.938 8.146   1.00 11.43 ? 160  ASP A CA  1 
ATOM   1289 C C   . ASP A 1 160 ? 56.012 41.334 6.683   1.00 11.34 ? 160  ASP A C   1 
ATOM   1290 O O   . ASP A 1 160 ? 55.463 40.713 5.747   1.00 11.54 ? 160  ASP A O   1 
ATOM   1291 C CB  . ASP A 1 160 ? 54.999 42.105 8.854   1.00 11.57 ? 160  ASP A CB  1 
ATOM   1292 C CG  . ASP A 1 160 ? 53.893 42.706 7.992   1.00 12.49 ? 160  ASP A CG  1 
ATOM   1293 O OD1 . ASP A 1 160 ? 52.844 42.051 7.807   1.00 11.84 ? 160  ASP A OD1 1 
ATOM   1294 O OD2 . ASP A 1 160 ? 53.961 43.863 7.507   1.00 13.64 ? 160  ASP A OD2 1 
ATOM   1295 N N   . LEU A 1 161 ? 56.852 42.348 6.476   1.00 11.05 ? 161  LEU A N   1 
ATOM   1296 C CA  . LEU A 1 161 ? 56.921 42.990 5.166   1.00 11.74 ? 161  LEU A CA  1 
ATOM   1297 C C   . LEU A 1 161 ? 57.416 42.050 4.062   1.00 11.45 ? 161  LEU A C   1 
ATOM   1298 O O   . LEU A 1 161 ? 56.914 42.094 2.943   1.00 11.01 ? 161  LEU A O   1 
ATOM   1299 C CB  . LEU A 1 161 ? 57.831 44.245 5.241   1.00 13.57 ? 161  LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 161 ? 57.373 45.700 5.245   1.00 20.32 ? 161  LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 161 ? 55.941 45.979 5.600   1.00 20.08 ? 161  LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 161 ? 58.413 46.645 5.910   1.00 17.85 ? 161  LEU A CD2 1 
ATOM   1303 N N   . GLY A 1 162 ? 58.395 41.197 4.371   1.00 10.07 ? 162  GLY A N   1 
ATOM   1304 C CA  . GLY A 1 162 ? 58.928 40.270 3.369   1.00 10.74 ? 162  GLY A CA  1 
ATOM   1305 C C   . GLY A 1 162 ? 57.912 39.232 2.945   1.00 10.46 ? 162  GLY A C   1 
ATOM   1306 O O   . GLY A 1 162 ? 57.623 39.046 1.753   1.00 10.61 ? 162  GLY A O   1 
ATOM   1307 N N   . PRO A 1 163 ? 57.402 38.461 3.894   1.00 10.68 ? 163  PRO A N   1 
ATOM   1308 C CA  . PRO A 1 163 ? 56.405 37.453 3.512   1.00 10.56 ? 163  PRO A CA  1 
ATOM   1309 C C   . PRO A 1 163 ? 55.195 38.060 2.802   1.00 10.36 ? 163  PRO A C   1 
ATOM   1310 O O   . PRO A 1 163 ? 54.707 37.452 1.834   1.00 10.24 ? 163  PRO A O   1 
ATOM   1311 C CB  . PRO A 1 163 ? 56.018 36.813 4.857   1.00 11.92 ? 163  PRO A CB  1 
ATOM   1312 C CG  . PRO A 1 163 ? 57.339 36.971 5.694   1.00 12.53 ? 163  PRO A CG  1 
ATOM   1313 C CD  . PRO A 1 163 ? 57.830 38.352 5.306   1.00 10.78 ? 163  PRO A CD  1 
ATOM   1314 N N   . LEU A 1 164 ? 54.725 39.222 3.248   1.00 9.20  ? 164  LEU A N   1 
ATOM   1315 C CA  . LEU A 1 164 ? 53.591 39.846 2.576   1.00 9.26  ? 164  LEU A CA  1 
ATOM   1316 C C   . LEU A 1 164 ? 54.017 40.265 1.153   1.00 9.83  ? 164  LEU A C   1 
ATOM   1317 O O   . LEU A 1 164 ? 53.299 39.984 0.184   1.00 9.96  ? 164  LEU A O   1 
ATOM   1318 C CB  . LEU A 1 164 ? 53.143 41.084 3.366   1.00 10.14 ? 164  LEU A CB  1 
ATOM   1319 C CG  . LEU A 1 164 ? 51.952 41.850 2.784   1.00 12.96 ? 164  LEU A CG  1 
ATOM   1320 C CD1 . LEU A 1 164 ? 51.546 42.811 3.931   1.00 18.14 ? 164  LEU A CD1 1 
ATOM   1321 C CD2 . LEU A 1 164 ? 52.342 42.660 1.652   1.00 17.39 ? 164  LEU A CD2 1 
ATOM   1322 N N   . MET A 1 165 ? 55.175 40.902 1.005   1.00 9.55  ? 165  MET A N   1 
ATOM   1323 C CA  . MET A 1 165 ? 55.570 41.357 -0.317  1.00 9.73  ? 165  MET A CA  1 
ATOM   1324 C C   . MET A 1 165 ? 55.727 40.180 -1.278  1.00 10.01 ? 165  MET A C   1 
ATOM   1325 O O   . MET A 1 165 ? 55.303 40.250 -2.433  1.00 10.09 ? 165  MET A O   1 
ATOM   1326 C CB  . MET A 1 165 ? 56.881 42.142 -0.230  1.00 9.85  ? 165  MET A CB  1 
ATOM   1327 C CG  . MET A 1 165 ? 57.409 42.615 -1.606  1.00 10.87 ? 165  MET A CG  1 
ATOM   1328 S SD  . MET A 1 165 ? 58.402 41.403 -2.515  1.00 11.55 ? 165  MET A SD  1 
ATOM   1329 C CE  . MET A 1 165 ? 59.945 41.462 -1.505  1.00 11.95 ? 165  MET A CE  1 
ATOM   1330 N N   . VAL A 1 166 ? 56.324 39.083 -0.795  1.00 9.79  ? 166  VAL A N   1 
ATOM   1331 C CA  . VAL A 1 166 ? 56.582 37.938 -1.668  1.00 9.79  ? 166  VAL A CA  1 
ATOM   1332 C C   . VAL A 1 166 ? 55.313 37.163 -2.003  1.00 10.15 ? 166  VAL A C   1 
ATOM   1333 O O   . VAL A 1 166 ? 55.115 36.755 -3.147  1.00 10.59 ? 166  VAL A O   1 
ATOM   1334 C CB  . VAL A 1 166 ? 57.628 36.996 -1.026  1.00 9.59  ? 166  VAL A CB  1 
ATOM   1335 C CG1 . VAL A 1 166 ? 57.789 35.681 -1.860  1.00 10.86 ? 166  VAL A CG1 1 
ATOM   1336 C CG2 . VAL A 1 166 ? 58.970 37.748 -0.958  1.00 9.88  ? 166  VAL A CG2 1 
ATOM   1337 N N   . THR A 1 167 ? 54.435 36.951 -1.024  1.00 9.30  ? 167  THR A N   1 
ATOM   1338 C CA  . THR A 1 167 ? 53.162 36.281 -1.376  1.00 10.09 ? 167  THR A CA  1 
ATOM   1339 C C   . THR A 1 167 ? 52.318 37.110 -2.326  1.00 9.53  ? 167  THR A C   1 
ATOM   1340 O O   . THR A 1 167 ? 51.651 36.552 -3.182  1.00 10.85 ? 167  THR A O   1 
ATOM   1341 C CB  . THR A 1 167 ? 52.321 35.846 -0.164  1.00 10.37 ? 167  THR A CB  1 
ATOM   1342 O OG1 . THR A 1 167 ? 52.108 36.970 0.716   1.00 10.53 ? 167  THR A OG1 1 
ATOM   1343 C CG2 . THR A 1 167 ? 53.121 34.777 0.629   1.00 10.96 ? 167  THR A CG2 1 
ATOM   1344 N N   . GLU A 1 168 ? 52.342 38.427 -2.199  1.00 10.14 ? 168  GLU A N   1 
ATOM   1345 C CA  . GLU A 1 168 ? 51.638 39.283 -3.151  1.00 9.91  ? 168  GLU A CA  1 
ATOM   1346 C C   . GLU A 1 168 ? 52.275 39.154 -4.533  1.00 10.00 ? 168  GLU A C   1 
ATOM   1347 O O   . GLU A 1 168 ? 51.568 39.047 -5.534  1.00 11.33 ? 168  GLU A O   1 
ATOM   1348 C CB  . GLU A 1 168 ? 51.719 40.754 -2.700  1.00 9.55  ? 168  GLU A CB  1 
ATOM   1349 C CG  . GLU A 1 168 ? 50.808 41.025 -1.500  1.00 10.85 ? 168  GLU A CG  1 
ATOM   1350 C CD  . GLU A 1 168 ? 49.345 40.797 -1.841  1.00 10.99 ? 168  GLU A CD  1 
ATOM   1351 O OE1 . GLU A 1 168 ? 48.696 39.917 -1.223  1.00 13.53 ? 168  GLU A OE1 1 
ATOM   1352 O OE2 . GLU A 1 168 ? 48.805 41.495 -2.719  1.00 11.68 ? 168  GLU A OE2 1 
ATOM   1353 N N   . ALA A 1 169 ? 53.600 39.180 -4.586  1.00 9.91  ? 169  ALA A N   1 
ATOM   1354 C CA  . ALA A 1 169 ? 54.288 39.133 -5.877  1.00 10.03 ? 169  ALA A CA  1 
ATOM   1355 C C   . ALA A 1 169 ? 54.135 37.795 -6.585  1.00 10.89 ? 169  ALA A C   1 
ATOM   1356 O O   . ALA A 1 169 ? 54.204 37.738 -7.800  1.00 11.12 ? 169  ALA A O   1 
ATOM   1357 C CB  . ALA A 1 169 ? 55.772 39.427 -5.689  1.00 10.86 ? 169  ALA A CB  1 
ATOM   1358 N N   . LEU A 1 170 ? 53.993 36.718 -5.811  1.00 10.81 ? 170  LEU A N   1 
ATOM   1359 C CA  . LEU A 1 170 ? 53.948 35.357 -6.365  1.00 11.70 ? 170  LEU A CA  1 
ATOM   1360 C C   . LEU A 1 170 ? 52.547 34.750 -6.292  1.00 12.73 ? 170  LEU A C   1 
ATOM   1361 O O   . LEU A 1 170 ? 52.377 33.521 -6.335  1.00 12.59 ? 170  LEU A O   1 
ATOM   1362 C CB  . LEU A 1 170 ? 54.968 34.462 -5.656  1.00 12.09 ? 170  LEU A CB  1 
ATOM   1363 C CG  . LEU A 1 170 ? 56.435 34.899 -5.755  1.00 10.92 ? 170  LEU A CG  1 
ATOM   1364 C CD1 . LEU A 1 170 ? 57.315 33.860 -5.063  1.00 10.76 ? 170  LEU A CD1 1 
ATOM   1365 C CD2 . LEU A 1 170 ? 56.849 35.074 -7.233  1.00 10.70 ? 170  LEU A CD2 1 
ATOM   1366 N N   . LYS A 1 171 ? 51.539 35.619 -6.255  1.00 13.84 ? 171  LYS A N   1 
ATOM   1367 C CA  . LYS A 1 171 ? 50.142 35.170 -6.207  1.00 15.05 ? 171  LYS A CA  1 
ATOM   1368 C C   . LYS A 1 171 ? 49.775 34.114 -7.268  1.00 15.60 ? 171  LYS A C   1 
ATOM   1369 O O   . LYS A 1 171 ? 49.091 33.140 -6.937  1.00 16.32 ? 171  LYS A O   1 
ATOM   1370 C CB  . LYS A 1 171 ? 49.226 36.413 -6.245  1.00 15.60 ? 171  LYS A CB  1 
ATOM   1371 C CG  . LYS A 1 171 ? 47.805 36.220 -5.683  1.00 19.38 ? 171  LYS A CG  1 
ATOM   1372 C CD  . LYS A 1 171 ? 47.780 35.679 -4.211  1.00 19.99 ? 171  LYS A CD  1 
ATOM   1373 C CE  . LYS A 1 171 ? 48.225 36.701 -3.110  1.00 19.84 ? 171  LYS A CE  1 
ATOM   1374 N NZ  . LYS A 1 171 ? 47.858 36.181 -1.712  1.00 18.82 ? 171  LYS A NZ  1 
ATOM   1375 N N   . PRO A 1 172 ? 50.281 34.214 -8.500  1.00 16.71 ? 172  PRO A N   1 
ATOM   1376 C CA  . PRO A 1 172 ? 49.949 33.207 -9.528  1.00 17.58 ? 172  PRO A CA  1 
ATOM   1377 C C   . PRO A 1 172 ? 50.427 31.811 -9.209  1.00 18.54 ? 172  PRO A C   1 
ATOM   1378 O O   . PRO A 1 172 ? 49.955 30.854 -9.858  1.00 21.00 ? 172  PRO A O   1 
ATOM   1379 C CB  . PRO A 1 172 ? 50.694 33.714 -10.786 1.00 19.09 ? 172  PRO A CB  1 
ATOM   1380 C CG  . PRO A 1 172 ? 50.873 35.158 -10.553 1.00 17.93 ? 172  PRO A CG  1 
ATOM   1381 C CD  . PRO A 1 172 ? 51.108 35.302 -9.060  1.00 15.54 ? 172  PRO A CD  1 
ATOM   1382 N N   . TYR A 1 173 ? 51.364 31.679 -8.268  1.00 16.73 ? 173  TYR A N   1 
ATOM   1383 C CA  . TYR A 1 173 ? 51.939 30.401 -7.899  1.00 16.78 ? 173  TYR A CA  1 
ATOM   1384 C C   . TYR A 1 173 ? 51.290 29.782 -6.668  1.00 16.94 ? 173  TYR A C   1 
ATOM   1385 O O   . TYR A 1 173 ? 51.827 28.803 -6.124  1.00 17.72 ? 173  TYR A O   1 
ATOM   1386 C CB  . TYR A 1 173 ? 53.435 30.593 -7.642  1.00 16.30 ? 173  TYR A CB  1 
ATOM   1387 C CG  . TYR A 1 173 ? 54.143 31.081 -8.881  1.00 14.97 ? 173  TYR A CG  1 
ATOM   1388 C CD1 . TYR A 1 173 ? 54.602 30.176 -9.851  1.00 15.41 ? 173  TYR A CD1 1 
ATOM   1389 C CD2 . TYR A 1 173 ? 54.310 32.433 -9.132  1.00 13.75 ? 173  TYR A CD2 1 
ATOM   1390 C CE1 . TYR A 1 173 ? 55.235 30.610 -11.010 1.00 13.80 ? 173  TYR A CE1 1 
ATOM   1391 C CE2 . TYR A 1 173 ? 54.945 32.878 -10.306 1.00 14.02 ? 173  TYR A CE2 1 
ATOM   1392 C CZ  . TYR A 1 173 ? 55.389 31.950 -11.241 1.00 13.92 ? 173  TYR A CZ  1 
ATOM   1393 O OH  . TYR A 1 173 ? 55.994 32.350 -12.379 1.00 13.28 ? 173  TYR A OH  1 
ATOM   1394 N N   . SER A 1 174 ? 50.128 30.291 -6.270  1.00 16.93 ? 174  SER A N   1 
ATOM   1395 C CA  . SER A 1 174 ? 49.489 29.857 -5.021  1.00 18.83 ? 174  SER A CA  1 
ATOM   1396 C C   . SER A 1 174 ? 48.352 28.848 -5.178  1.00 20.51 ? 174  SER A C   1 
ATOM   1397 O O   . SER A 1 174 ? 47.581 28.608 -4.236  1.00 19.99 ? 174  SER A O   1 
ATOM   1398 C CB  . SER A 1 174 ? 49.008 31.066 -4.218  1.00 18.67 ? 174  SER A CB  1 
ATOM   1399 O OG  . SER A 1 174 ? 47.951 31.783 -4.889  1.00 18.35 ? 174  SER A OG  1 
ATOM   1400 N N   . SER A 1 175 ? 48.247 28.253 -6.357  1.00 22.12 ? 175  SER A N   1 
ATOM   1401 C CA  . SER A 1 175 ? 47.195 27.256 -6.553  1.00 24.88 ? 175  SER A CA  1 
ATOM   1402 C C   . SER A 1 175 ? 47.346 26.129 -5.549  1.00 24.24 ? 175  SER A C   1 
ATOM   1403 O O   . SER A 1 175 ? 48.441 25.616 -5.319  1.00 25.15 ? 175  SER A O   1 
ATOM   1404 C CB  . SER A 1 175 ? 47.218 26.705 -7.992  1.00 25.92 ? 175  SER A CB  1 
ATOM   1405 O OG  . SER A 1 175 ? 46.516 25.466 -8.065  1.00 30.59 ? 175  SER A OG  1 
ATOM   1406 N N   . GLY A 1 176 ? 46.245 25.766 -4.907  1.00 24.66 ? 176  GLY A N   1 
ATOM   1407 C CA  . GLY A 1 176 ? 46.295 24.673 -3.947  1.00 24.35 ? 176  GLY A CA  1 
ATOM   1408 C C   . GLY A 1 176 ? 46.818 25.055 -2.583  1.00 24.09 ? 176  GLY A C   1 
ATOM   1409 O O   . GLY A 1 176 ? 46.959 24.200 -1.701  1.00 24.79 ? 176  GLY A O   1 
ATOM   1410 N N   . GLY A 1 177 ? 47.118 26.337 -2.385  1.00 22.12 ? 177  GLY A N   1 
ATOM   1411 C CA  . GLY A 1 177 ? 47.588 26.754 -1.076  1.00 20.15 ? 177  GLY A CA  1 
ATOM   1412 C C   . GLY A 1 177 ? 46.440 27.428 -0.324  1.00 19.14 ? 177  GLY A C   1 
ATOM   1413 O O   . GLY A 1 177 ? 45.478 27.902 -0.941  1.00 19.09 ? 177  GLY A O   1 
ATOM   1414 N N   . PRO A 1 178 ? 46.515 27.451 1.009   1.00 17.38 ? 178  PRO A N   1 
ATOM   1415 C CA  . PRO A 1 178 ? 45.503 28.147 1.810   1.00 16.42 ? 178  PRO A CA  1 
ATOM   1416 C C   . PRO A 1 178 ? 45.631 29.633 1.596   1.00 16.27 ? 178  PRO A C   1 
ATOM   1417 O O   . PRO A 1 178 ? 46.659 30.113 1.114   1.00 16.60 ? 178  PRO A O   1 
ATOM   1418 C CB  . PRO A 1 178 ? 45.904 27.812 3.259   1.00 16.10 ? 178  PRO A CB  1 
ATOM   1419 C CG  . PRO A 1 178 ? 47.390 27.549 3.172   1.00 17.10 ? 178  PRO A CG  1 
ATOM   1420 C CD  . PRO A 1 178 ? 47.563 26.829 1.836   1.00 17.36 ? 178  PRO A CD  1 
ATOM   1421 N N   . ARG A 1 179 ? 44.601 30.356 1.972   1.00 14.82 ? 179  ARG A N   1 
ATOM   1422 C CA  . ARG A 1 179 ? 44.634 31.823 1.907   1.00 14.73 ? 179  ARG A CA  1 
ATOM   1423 C C   . ARG A 1 179 ? 45.601 32.267 2.956   1.00 13.70 ? 179  ARG A C   1 
ATOM   1424 O O   . ARG A 1 179 ? 45.694 31.612 3.999   1.00 14.13 ? 179  ARG A O   1 
ATOM   1425 C CB  . ARG A 1 179 ? 43.278 32.398 2.269   1.00 15.34 ? 179  ARG A CB  1 
ATOM   1426 C CG  . ARG A 1 179 ? 42.210 32.303 1.153   1.00 17.62 ? 179  ARG A CG  1 
ATOM   1427 C CD  . ARG A 1 179 ? 40.819 32.809 1.592   1.00 20.43 ? 179  ARG A CD  1 
ATOM   1428 N NE  . ARG A 1 179 ? 40.237 31.961 2.621   1.00 19.57 ? 179  ARG A NE  1 
ATOM   1429 C CZ  . ARG A 1 179 ? 39.338 31.009 2.398   1.00 22.20 ? 179  ARG A CZ  1 
ATOM   1430 N NH1 . ARG A 1 179 ? 38.855 30.792 1.162   1.00 23.22 ? 179  ARG A NH1 1 
ATOM   1431 N NH2 . ARG A 1 179 ? 38.891 30.289 3.419   1.00 20.54 ? 179  ARG A NH2 1 
ATOM   1432 N N   . VAL A 1 180 ? 46.296 33.381 2.705   1.00 13.06 ? 180  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 180 ? 47.235 33.939 3.704   1.00 12.62 ? 180  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 180 ? 46.824 35.352 4.054   1.00 12.16 ? 180  VAL A C   1 
ATOM   1435 O O   . VAL A 1 180 ? 46.389 36.123 3.190   1.00 12.87 ? 180  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 180 ? 48.727 33.947 3.242   1.00 13.73 ? 180  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 180 ? 49.320 32.573 3.268   1.00 17.05 ? 180  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 180 ? 48.893 34.654 1.874   1.00 14.26 ? 180  VAL A CG2 1 
ATOM   1439 N N   . TRP A 1 181 ? 46.924 35.655 5.341   1.00 11.64 ? 181  TRP A N   1 
ATOM   1440 C CA  . TRP A 1 181 ? 46.599 36.950 5.896   1.00 11.13 ? 181  TRP A CA  1 
ATOM   1441 C C   . TRP A 1 181 ? 47.779 37.421 6.707   1.00 11.45 ? 181  TRP A C   1 
ATOM   1442 O O   . TRP A 1 181 ? 48.438 36.619 7.354   1.00 12.97 ? 181  TRP A O   1 
ATOM   1443 C CB  . TRP A 1 181 ? 45.409 36.834 6.868   1.00 11.45 ? 181  TRP A CB  1 
ATOM   1444 C CG  . TRP A 1 181 ? 44.198 36.203 6.295   1.00 13.39 ? 181  TRP A CG  1 
ATOM   1445 C CD1 . TRP A 1 181 ? 43.987 34.854 6.061   1.00 12.38 ? 181  TRP A CD1 1 
ATOM   1446 C CD2 . TRP A 1 181 ? 42.984 36.867 5.921   1.00 16.10 ? 181  TRP A CD2 1 
ATOM   1447 N NE1 . TRP A 1 181 ? 42.725 34.660 5.540   1.00 14.18 ? 181  TRP A NE1 1 
ATOM   1448 C CE2 . TRP A 1 181 ? 42.089 35.876 5.441   1.00 16.22 ? 181  TRP A CE2 1 
ATOM   1449 C CE3 . TRP A 1 181 ? 42.564 38.196 5.928   1.00 18.84 ? 181  TRP A CE3 1 
ATOM   1450 C CZ2 . TRP A 1 181 ? 40.799 36.182 5.003   1.00 17.73 ? 181  TRP A CZ2 1 
ATOM   1451 C CZ3 . TRP A 1 181 ? 41.283 38.503 5.471   1.00 20.33 ? 181  TRP A CZ3 1 
ATOM   1452 C CH2 . TRP A 1 181 ? 40.422 37.499 5.016   1.00 20.08 ? 181  TRP A CH2 1 
ATOM   1453 N N   . TYR A 1 182 ? 48.003 38.732 6.705   1.00 11.23 ? 182  TYR A N   1 
ATOM   1454 C CA  . TYR A 1 182 ? 49.093 39.336 7.453   1.00 11.23 ? 182  TYR A CA  1 
ATOM   1455 C C   . TYR A 1 182 ? 48.508 40.339 8.431   1.00 12.26 ? 182  TYR A C   1 
ATOM   1456 O O   . TYR A 1 182 ? 47.832 41.265 8.040   1.00 15.06 ? 182  TYR A O   1 
ATOM   1457 C CB  . TYR A 1 182 ? 50.076 40.013 6.457   1.00 11.22 ? 182  TYR A CB  1 
ATOM   1458 C CG  . TYR A 1 182 ? 50.782 38.915 5.711   1.00 11.01 ? 182  TYR A CG  1 
ATOM   1459 C CD1 . TYR A 1 182 ? 51.897 38.274 6.271   1.00 11.60 ? 182  TYR A CD1 1 
ATOM   1460 C CD2 . TYR A 1 182 ? 50.292 38.441 4.490   1.00 11.38 ? 182  TYR A CD2 1 
ATOM   1461 C CE1 . TYR A 1 182 ? 52.494 37.174 5.618   1.00 11.50 ? 182  TYR A CE1 1 
ATOM   1462 C CE2 . TYR A 1 182 ? 50.901 37.335 3.834   1.00 12.34 ? 182  TYR A CE2 1 
ATOM   1463 C CZ  . TYR A 1 182 ? 51.999 36.728 4.399   1.00 10.96 ? 182  TYR A CZ  1 
ATOM   1464 O OH  . TYR A 1 182 ? 52.555 35.635 3.771   1.00 11.72 ? 182  TYR A OH  1 
ATOM   1465 N N   . VAL A 1 183 ? 48.730 40.113 9.707   1.00 11.64 ? 183  VAL A N   1 
ATOM   1466 C CA  . VAL A 1 183 ? 48.283 41.038 10.738  1.00 11.36 ? 183  VAL A CA  1 
ATOM   1467 C C   . VAL A 1 183 ? 49.566 41.558 11.339  1.00 11.04 ? 183  VAL A C   1 
ATOM   1468 O O   . VAL A 1 183 ? 50.404 40.772 11.760  1.00 12.39 ? 183  VAL A O   1 
ATOM   1469 C CB  . VAL A 1 183 ? 47.480 40.300 11.819  1.00 11.96 ? 183  VAL A CB  1 
ATOM   1470 C CG1 . VAL A 1 183 ? 47.272 41.195 13.038  1.00 13.05 ? 183  VAL A CG1 1 
ATOM   1471 C CG2 . VAL A 1 183 ? 46.129 39.834 11.245  1.00 13.81 ? 183  VAL A CG2 1 
ATOM   1472 N N   . SER A 1 184 ? 49.714 42.876 11.436  1.00 10.38 ? 184  SER A N   1 
ATOM   1473 C CA  . SER A 1 184 ? 50.959 43.442 11.908  1.00 10.50 ? 184  SER A CA  1 
ATOM   1474 C C   . SER A 1 184 ? 50.765 44.622 12.860  1.00 10.34 ? 184  SER A C   1 
ATOM   1475 O O   . SER A 1 184 ? 51.463 44.724 13.862  1.00 10.47 ? 184  SER A O   1 
ATOM   1476 C CB  . SER A 1 184 ? 51.781 43.935 10.703  1.00 11.48 ? 184  SER A CB  1 
ATOM   1477 O OG  . SER A 1 184 ? 50.986 44.798 9.871   1.00 12.07 ? 184  SER A OG  1 
ATOM   1478 N N   . ASN A 1 185 ? 49.844 45.527 12.562  1.00 10.27 ? 185  ASN A N   1 
ATOM   1479 C CA  . ASN A 1 185 ? 49.737 46.719 13.422  1.00 9.41  ? 185  ASN A CA  1 
ATOM   1480 C C   . ASN A 1 185 ? 49.218 46.332 14.804  1.00 10.20 ? 185  ASN A C   1 
ATOM   1481 O O   . ASN A 1 185 ? 48.374 45.427 14.910  1.00 9.88  ? 185  ASN A O   1 
ATOM   1482 C CB  . ASN A 1 185 ? 48.714 47.664 12.770  1.00 9.42  ? 185  ASN A CB  1 
ATOM   1483 C CG  . ASN A 1 185 ? 48.919 49.119 13.169  1.00 9.33  ? 185  ASN A CG  1 
ATOM   1484 O OD1 . ASN A 1 185 ? 49.376 49.416 14.277  1.00 11.07 ? 185  ASN A OD1 1 
ATOM   1485 N ND2 . ASN A 1 185 ? 48.541 50.042 12.268  1.00 9.70  ? 185  ASN A ND2 1 
ATOM   1486 N N   . ILE A 1 186 ? 49.682 47.020 15.852  1.00 9.42  ? 186  ILE A N   1 
ATOM   1487 C CA  . ILE A 1 186 ? 49.021 46.868 17.150  1.00 10.06 ? 186  ILE A CA  1 
ATOM   1488 C C   . ILE A 1 186 ? 47.592 47.413 17.096  1.00 10.51 ? 186  ILE A C   1 
ATOM   1489 O O   . ILE A 1 186 ? 46.714 46.913 17.796  1.00 10.84 ? 186  ILE A O   1 
ATOM   1490 C CB  . ILE A 1 186 ? 49.850 47.489 18.310  1.00 10.31 ? 186  ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1 186 ? 49.128 47.265 19.626  1.00 12.50 ? 186  ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1 186 ? 50.047 49.030 18.118  1.00 12.32 ? 186  ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1 186 ? 49.021 45.783 20.011  1.00 13.30 ? 186  ILE A CD1 1 
ATOM   1494 N N   . ASP A 1 187 ? 47.349 48.444 16.287  1.00 9.77  ? 187  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 187 ? 45.985 48.967 16.116  1.00 10.23 ? 187  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 187 ? 45.035 47.798 16.036  1.00 10.38 ? 187  ASP A C   1 
ATOM   1497 O O   . ASP A 1 187 ? 45.130 46.942 15.143  1.00 10.50 ? 187  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 187 ? 45.948 49.796 14.809  1.00 9.75  ? 187  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 187 ? 44.595 50.382 14.525  1.00 10.69 ? 187  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 187 ? 43.626 50.142 15.297  1.00 11.15 ? 187  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 187 ? 44.416 51.101 13.534  1.00 11.74 ? 187  ASP A OD2 1 
ATOM   1502 N N   . GLY A 1 188 ? 44.070 47.767 16.946  1.00 10.65 ? 188  GLY A N   1 
ATOM   1503 C CA  . GLY A 1 188 ? 43.190 46.609 17.084  1.00 11.04 ? 188  GLY A CA  1 
ATOM   1504 C C   . GLY A 1 188 ? 42.303 46.350 15.877  1.00 11.21 ? 188  GLY A C   1 
ATOM   1505 O O   . GLY A 1 188 ? 41.778 45.241 15.680  1.00 11.00 ? 188  GLY A O   1 
ATOM   1506 N N   . THR A 1 189 ? 42.142 47.385 15.051  1.00 10.54 ? 189  THR A N   1 
ATOM   1507 C CA  . THR A 1 189 ? 41.500 47.204 13.769  1.00 10.49 ? 189  THR A CA  1 
ATOM   1508 C C   . THR A 1 189 ? 42.094 46.041 12.996  1.00 11.20 ? 189  THR A C   1 
ATOM   1509 O O   . THR A 1 189 ? 41.365 45.303 12.363  1.00 11.41 ? 189  THR A O   1 
ATOM   1510 C CB  . THR A 1 189 ? 41.678 48.493 12.945  1.00 11.48 ? 189  THR A CB  1 
ATOM   1511 O OG1 . THR A 1 189 ? 40.816 49.480 13.519  1.00 12.00 ? 189  THR A OG1 1 
ATOM   1512 C CG2 . THR A 1 189 ? 41.256 48.294 11.444  1.00 12.16 ? 189  THR A CG2 1 
ATOM   1513 N N   . HIS A 1 190 ? 43.419 45.901 13.026  1.00 10.41 ? 190  HIS A N   1 
ATOM   1514 C CA  . HIS A 1 190 ? 44.052 44.913 12.151  1.00 10.86 ? 190  HIS A CA  1 
ATOM   1515 C C   . HIS A 1 190 ? 43.650 43.492 12.488  1.00 10.97 ? 190  HIS A C   1 
ATOM   1516 O O   . HIS A 1 190 ? 43.131 42.749 11.615  1.00 11.90 ? 190  HIS A O   1 
ATOM   1517 C CB  . HIS A 1 190 ? 45.579 45.093 12.144  1.00 10.48 ? 190  HIS A CB  1 
ATOM   1518 C CG  . HIS A 1 190 ? 46.199 44.785 10.813  1.00 11.76 ? 190  HIS A CG  1 
ATOM   1519 N ND1 . HIS A 1 190 ? 47.536 44.977 10.552  1.00 12.08 ? 190  HIS A ND1 1 
ATOM   1520 C CD2 . HIS A 1 190 ? 45.646 44.309 9.666   1.00 12.95 ? 190  HIS A CD2 1 
ATOM   1521 C CE1 . HIS A 1 190 ? 47.778 44.639 9.291   1.00 12.81 ? 190  HIS A CE1 1 
ATOM   1522 N NE2 . HIS A 1 190 ? 46.648 44.246 8.728   1.00 11.80 ? 190  HIS A NE2 1 
ATOM   1523 N N   . ILE A 1 191 ? 43.864 43.092 13.727  1.00 10.66 ? 191  ILE A N   1 
ATOM   1524 C CA  . ILE A 1 191 ? 43.445 41.735 14.107  1.00 11.11 ? 191  ILE A CA  1 
ATOM   1525 C C   . ILE A 1 191 ? 41.922 41.594 14.137  1.00 11.44 ? 191  ILE A C   1 
ATOM   1526 O O   . ILE A 1 191 ? 41.406 40.541 13.776  1.00 12.58 ? 191  ILE A O   1 
ATOM   1527 C CB  . ILE A 1 191 ? 44.108 41.317 15.473  1.00 10.96 ? 191  ILE A CB  1 
ATOM   1528 C CG1 . ILE A 1 191 ? 43.923 39.810 15.794  1.00 14.78 ? 191  ILE A CG1 1 
ATOM   1529 C CG2 . ILE A 1 191 ? 43.497 42.057 16.658  1.00 12.56 ? 191  ILE A CG2 1 
ATOM   1530 C CD1 . ILE A 1 191 ? 44.451 38.890 14.785  1.00 17.42 ? 191  ILE A CD1 1 
ATOM   1531 N N   . ALA A 1 192 ? 41.198 42.621 14.581  1.00 10.89 ? 192  ALA A N   1 
ATOM   1532 C CA  . ALA A 1 192 ? 39.738 42.489 14.703  1.00 12.38 ? 192  ALA A CA  1 
ATOM   1533 C C   . ALA A 1 192 ? 39.077 42.214 13.369  1.00 13.53 ? 192  ALA A C   1 
ATOM   1534 O O   . ALA A 1 192 ? 38.225 41.300 13.254  1.00 14.22 ? 192  ALA A O   1 
ATOM   1535 C CB  . ALA A 1 192 ? 39.092 43.731 15.361  1.00 12.78 ? 192  ALA A CB  1 
ATOM   1536 N N   . LYS A 1 193 ? 39.449 43.002 12.363  1.00 13.76 ? 193  LYS A N   1 
ATOM   1537 C CA  . LYS A 1 193 ? 38.818 42.841 11.044  1.00 14.54 ? 193  LYS A CA  1 
ATOM   1538 C C   . LYS A 1 193 ? 39.238 41.542 10.354  1.00 15.02 ? 193  LYS A C   1 
ATOM   1539 O O   . LYS A 1 193 ? 38.489 41.008 9.512   1.00 16.70 ? 193  LYS A O   1 
ATOM   1540 C CB  . LYS A 1 193 ? 38.980 44.088 10.172  1.00 15.33 ? 193  LYS A CB  1 
ATOM   1541 C CG  . LYS A 1 193 ? 40.414 44.295 9.615   1.00 18.79 ? 193  LYS A CG  1 
ATOM   1542 C CD  . LYS A 1 193 ? 40.575 45.631 8.830   1.00 22.93 ? 193  LYS A CD  1 
ATOM   1543 C CE  . LYS A 1 193 ? 41.973 45.826 8.217   1.00 23.38 ? 193  LYS A CE  1 
ATOM   1544 N NZ  . LYS A 1 193 ? 42.223 45.030 6.989   1.00 25.26 ? 193  LYS A NZ  1 
ATOM   1545 N N   . THR A 1 194 ? 40.400 41.014 10.741  1.00 13.23 ? 194  THR A N   1 
ATOM   1546 C CA  . THR A 1 194 ? 40.863 39.747 10.206  1.00 13.66 ? 194  THR A CA  1 
ATOM   1547 C C   . THR A 1 194 ? 40.108 38.593 10.861  1.00 14.22 ? 194  THR A C   1 
ATOM   1548 O O   . THR A 1 194 ? 39.545 37.742 10.155  1.00 14.22 ? 194  THR A O   1 
ATOM   1549 C CB  . THR A 1 194 ? 42.386 39.607 10.452  1.00 12.97 ? 194  THR A CB  1 
ATOM   1550 O OG1 . THR A 1 194 ? 43.057 40.698 9.781   1.00 13.55 ? 194  THR A OG1 1 
ATOM   1551 C CG2 . THR A 1 194 ? 42.929 38.296 9.806   1.00 13.67 ? 194  THR A CG2 1 
ATOM   1552 N N   . LEU A 1 195 ? 40.067 38.570 12.191  1.00 13.74 ? 195  LEU A N   1 
ATOM   1553 C CA  . LEU A 1 195 ? 39.365 37.473 12.908  1.00 14.06 ? 195  LEU A CA  1 
ATOM   1554 C C   . LEU A 1 195 ? 37.880 37.372 12.506  1.00 14.47 ? 195  LEU A C   1 
ATOM   1555 O O   . LEU A 1 195 ? 37.316 36.264 12.446  1.00 14.19 ? 195  LEU A O   1 
ATOM   1556 C CB  . LEU A 1 195 ? 39.472 37.649 14.423  1.00 14.30 ? 195  LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 195 ? 40.900 37.549 14.994  1.00 14.98 ? 195  LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 195 ? 40.856 37.833 16.504  1.00 14.35 ? 195  LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 195 ? 41.483 36.166 14.731  1.00 15.56 ? 195  LEU A CD2 1 
ATOM   1560 N N   . ALA A 1 196 ? 37.267 38.505 12.199  1.00 14.72 ? 196  ALA A N   1 
ATOM   1561 C CA  . ALA A 1 196 ? 35.854 38.523 11.811  1.00 16.73 ? 196  ALA A CA  1 
ATOM   1562 C C   . ALA A 1 196 ? 35.611 37.725 10.558  1.00 17.94 ? 196  ALA A C   1 
ATOM   1563 O O   . ALA A 1 196 ? 34.473 37.298 10.305  1.00 20.36 ? 196  ALA A O   1 
ATOM   1564 C CB  . ALA A 1 196 ? 35.361 39.990 11.610  1.00 17.14 ? 196  ALA A CB  1 
ATOM   1565 N N   . GLN A 1 197 ? 36.651 37.504 9.763   1.00 18.61 ? 197  GLN A N   1 
ATOM   1566 C CA  . GLN A 1 197 ? 36.481 36.776 8.505   1.00 19.52 ? 197  GLN A CA  1 
ATOM   1567 C C   . GLN A 1 197 ? 36.869 35.310 8.589   1.00 19.08 ? 197  GLN A C   1 
ATOM   1568 O O   . GLN A 1 197 ? 36.808 34.591 7.578   1.00 20.70 ? 197  GLN A O   1 
ATOM   1569 C CB  . GLN A 1 197 ? 37.261 37.477 7.396   1.00 21.04 ? 197  GLN A CB  1 
ATOM   1570 C CG  . GLN A 1 197 ? 36.726 38.913 7.182   1.00 24.63 ? 197  GLN A CG  1 
ATOM   1571 C CD  . GLN A 1 197 ? 37.501 39.725 6.162   1.00 29.77 ? 197  GLN A CD  1 
ATOM   1572 O OE1 . GLN A 1 197 ? 38.362 40.565 6.527   1.00 32.70 ? 197  GLN A OE1 1 
ATOM   1573 N NE2 . GLN A 1 197 ? 37.191 39.522 4.892   1.00 30.33 ? 197  GLN A NE2 1 
ATOM   1574 N N   . LEU A 1 198 ? 37.208 34.839 9.791   1.00 16.55 ? 198  LEU A N   1 
ATOM   1575 C CA  . LEU A 1 198 ? 37.793 33.505 9.925   1.00 16.28 ? 198  LEU A CA  1 
ATOM   1576 C C   . LEU A 1 198 ? 36.964 32.532 10.743  1.00 16.37 ? 198  LEU A C   1 
ATOM   1577 O O   . LEU A 1 198 ? 36.174 32.952 11.597  1.00 16.64 ? 198  LEU A O   1 
ATOM   1578 C CB  . LEU A 1 198 ? 39.159 33.604 10.638  1.00 16.71 ? 198  LEU A CB  1 
ATOM   1579 C CG  . LEU A 1 198 ? 40.255 34.417 9.944   1.00 18.22 ? 198  LEU A CG  1 
ATOM   1580 C CD1 . LEU A 1 198 ? 41.441 34.614 10.898  1.00 21.26 ? 198  LEU A CD1 1 
ATOM   1581 C CD2 . LEU A 1 198 ? 40.682 33.728 8.658   1.00 18.87 ? 198  LEU A CD2 1 
ATOM   1582 N N   . ASN A 1 199 ? 37.202 31.234 10.516  1.00 15.88 ? 199  ASN A N   1 
ATOM   1583 C CA  . ASN A 1 199 ? 36.590 30.162 11.321  1.00 17.11 ? 199  ASN A CA  1 
ATOM   1584 C C   . ASN A 1 199 ? 37.740 29.572 12.133  1.00 16.66 ? 199  ASN A C   1 
ATOM   1585 O O   . ASN A 1 199 ? 38.720 29.114 11.554  1.00 15.59 ? 199  ASN A O   1 
ATOM   1586 C CB  . ASN A 1 199 ? 35.968 29.115 10.386  1.00 18.56 ? 199  ASN A CB  1 
ATOM   1587 C CG  . ASN A 1 199 ? 35.289 27.953 11.128  1.00 22.27 ? 199  ASN A CG  1 
ATOM   1588 O OD1 . ASN A 1 199 ? 35.570 27.666 12.307  1.00 24.62 ? 199  ASN A OD1 1 
ATOM   1589 N ND2 . ASN A 1 199 ? 34.389 27.251 10.403  1.00 27.01 ? 199  ASN A ND2 1 
ATOM   1590 N N   . PRO A 1 200 ? 37.648 29.561 13.456  1.00 16.23 ? 200  PRO A N   1 
ATOM   1591 C CA  . PRO A 1 200 ? 38.747 29.044 14.264  1.00 15.97 ? 200  PRO A CA  1 
ATOM   1592 C C   . PRO A 1 200 ? 39.072 27.590 13.901  1.00 15.39 ? 200  PRO A C   1 
ATOM   1593 O O   . PRO A 1 200 ? 40.232 27.192 14.047  1.00 14.25 ? 200  PRO A O   1 
ATOM   1594 C CB  . PRO A 1 200 ? 38.212 29.098 15.717  1.00 17.08 ? 200  PRO A CB  1 
ATOM   1595 C CG  . PRO A 1 200 ? 36.958 29.837 15.659  1.00 19.40 ? 200  PRO A CG  1 
ATOM   1596 C CD  . PRO A 1 200 ? 36.533 30.092 14.260  1.00 17.26 ? 200  PRO A CD  1 
ATOM   1597 N N   . GLU A 1 201 ? 38.086 26.835 13.409  1.00 15.62 ? 201  GLU A N   1 
ATOM   1598 C CA  . GLU A 1 201 ? 38.298 25.423 13.088  1.00 16.66 ? 201  GLU A CA  1 
ATOM   1599 C C   . GLU A 1 201 ? 39.247 25.188 11.930  1.00 15.75 ? 201  GLU A C   1 
ATOM   1600 O O   . GLU A 1 201 ? 39.825 24.103 11.809  1.00 14.75 ? 201  GLU A O   1 
ATOM   1601 C CB  . GLU A 1 201 ? 36.956 24.748 12.746  1.00 17.45 ? 201  GLU A CB  1 
ATOM   1602 C CG  . GLU A 1 201 ? 35.933 24.960 13.858  1.00 21.83 ? 201  GLU A CG  1 
ATOM   1603 C CD  . GLU A 1 201 ? 34.626 24.193 13.677  1.00 27.99 ? 201  GLU A CD  1 
ATOM   1604 O OE1 . GLU A 1 201 ? 33.641 24.598 14.346  1.00 31.63 ? 201  GLU A OE1 1 
ATOM   1605 O OE2 . GLU A 1 201 ? 34.582 23.183 12.921  1.00 29.32 ? 201  GLU A OE2 1 
ATOM   1606 N N   . SER A 1 202 ? 39.409 26.195 11.072  1.00 15.31 ? 202  SER A N   1 
ATOM   1607 C CA  . SER A 1 202 ? 40.185 25.975 9.862   1.00 14.79 ? 202  SER A CA  1 
ATOM   1608 C C   . SER A 1 202 ? 41.289 27.011 9.684   1.00 14.73 ? 202  SER A C   1 
ATOM   1609 O O   . SER A 1 202 ? 41.822 27.179 8.581   1.00 14.50 ? 202  SER A O   1 
ATOM   1610 C CB  . SER A 1 202 ? 39.254 25.968 8.639   1.00 15.68 ? 202  SER A CB  1 
ATOM   1611 O OG  . SER A 1 202 ? 38.408 27.115 8.648   1.00 17.72 ? 202  SER A OG  1 
ATOM   1612 N N   . SER A 1 203 ? 41.637 27.683 10.782  1.00 13.55 ? 203  SER A N   1 
ATOM   1613 C CA  . SER A 1 203 ? 42.637 28.776 10.710  1.00 13.23 ? 203  SER A CA  1 
ATOM   1614 C C   . SER A 1 203 ? 43.904 28.415 11.471  1.00 13.48 ? 203  SER A C   1 
ATOM   1615 O O   . SER A 1 203 ? 43.823 27.986 12.619  1.00 13.97 ? 203  SER A O   1 
ATOM   1616 C CB  . SER A 1 203 ? 42.063 30.062 11.317  1.00 12.86 ? 203  SER A CB  1 
ATOM   1617 O OG  . SER A 1 203 ? 40.970 30.546 10.558  1.00 14.52 ? 203  SER A OG  1 
ATOM   1618 N N   . LEU A 1 204 ? 45.064 28.613 10.836  1.00 13.14 ? 204  LEU A N   1 
ATOM   1619 C CA  . LEU A 1 204 ? 46.364 28.369 11.457  1.00 12.45 ? 204  LEU A CA  1 
ATOM   1620 C C   . LEU A 1 204 ? 47.083 29.702 11.646  1.00 12.34 ? 204  LEU A C   1 
ATOM   1621 O O   . LEU A 1 204 ? 47.272 30.436 10.676  1.00 12.07 ? 204  LEU A O   1 
ATOM   1622 C CB  . LEU A 1 204 ? 47.199 27.475 10.527  1.00 12.78 ? 204  LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 204 ? 48.707 27.384 10.840  1.00 14.27 ? 204  LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 204 ? 48.804 26.591 12.159  1.00 16.48 ? 204  LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 204 ? 49.476 26.701 9.698   1.00 17.90 ? 204  LEU A CD2 1 
ATOM   1626 N N   . PHE A 1 205 ? 47.488 29.999 12.872  1.00 11.32 ? 205  PHE A N   1 
ATOM   1627 C CA  . PHE A 1 205 ? 48.208 31.240 13.189  1.00 11.97 ? 205  PHE A CA  1 
ATOM   1628 C C   . PHE A 1 205 ? 49.680 30.985 13.307  1.00 12.11 ? 205  PHE A C   1 
ATOM   1629 O O   . PHE A 1 205 ? 50.097 29.974 13.895  1.00 11.94 ? 205  PHE A O   1 
ATOM   1630 C CB  . PHE A 1 205 ? 47.709 31.761 14.522  1.00 12.34 ? 205  PHE A CB  1 
ATOM   1631 C CG  . PHE A 1 205 ? 46.306 32.234 14.473  1.00 11.85 ? 205  PHE A CG  1 
ATOM   1632 C CD1 . PHE A 1 205 ? 45.245 31.356 14.748  1.00 12.50 ? 205  PHE A CD1 1 
ATOM   1633 C CD2 . PHE A 1 205 ? 46.026 33.531 14.074  1.00 12.94 ? 205  PHE A CD2 1 
ATOM   1634 C CE1 . PHE A 1 205 ? 43.914 31.799 14.654  1.00 13.04 ? 205  PHE A CE1 1 
ATOM   1635 C CE2 . PHE A 1 205 ? 44.717 33.990 13.978  1.00 13.74 ? 205  PHE A CE2 1 
ATOM   1636 C CZ  . PHE A 1 205 ? 43.652 33.133 14.254  1.00 13.41 ? 205  PHE A CZ  1 
ATOM   1637 N N   . ILE A 1 206 ? 50.462 31.887 12.722  1.00 10.94 ? 206  ILE A N   1 
ATOM   1638 C CA  . ILE A 1 206 ? 51.919 31.801 12.725  1.00 11.82 ? 206  ILE A CA  1 
ATOM   1639 C C   . ILE A 1 206 ? 52.390 33.027 13.493  1.00 11.97 ? 206  ILE A C   1 
ATOM   1640 O O   . ILE A 1 206 ? 52.167 34.163 13.043  1.00 13.61 ? 206  ILE A O   1 
ATOM   1641 C CB  . ILE A 1 206 ? 52.457 31.848 11.264  1.00 12.25 ? 206  ILE A CB  1 
ATOM   1642 C CG1 . ILE A 1 206 ? 51.947 30.655 10.459  1.00 13.53 ? 206  ILE A CG1 1 
ATOM   1643 C CG2 . ILE A 1 206 ? 54.016 31.918 11.240  1.00 13.96 ? 206  ILE A CG2 1 
ATOM   1644 C CD1 . ILE A 1 206 ? 52.501 30.678 9.003   1.00 15.80 ? 206  ILE A CD1 1 
ATOM   1645 N N   . ILE A 1 207 ? 53.024 32.820 14.647  1.00 11.21 ? 207  ILE A N   1 
ATOM   1646 C CA  . ILE A 1 207 ? 53.464 33.976 15.439  1.00 11.56 ? 207  ILE A CA  1 
ATOM   1647 C C   . ILE A 1 207 ? 54.933 34.191 15.093  1.00 12.77 ? 207  ILE A C   1 
ATOM   1648 O O   . ILE A 1 207 ? 55.764 33.394 15.490  1.00 13.29 ? 207  ILE A O   1 
ATOM   1649 C CB  . ILE A 1 207 ? 53.308 33.704 16.934  1.00 11.34 ? 207  ILE A CB  1 
ATOM   1650 C CG1 . ILE A 1 207 ? 51.886 33.223 17.259  1.00 12.10 ? 207  ILE A CG1 1 
ATOM   1651 C CG2 . ILE A 1 207 ? 53.636 35.018 17.719  1.00 11.68 ? 207  ILE A CG2 1 
ATOM   1652 C CD1 . ILE A 1 207 ? 50.745 34.083 16.639  1.00 12.79 ? 207  ILE A CD1 1 
ATOM   1653 N N   . ALA A 1 208 ? 55.236 35.304 14.424  1.00 12.14 ? 208  ALA A N   1 
ATOM   1654 C CA  . ALA A 1 208 ? 56.550 35.535 13.835  1.00 13.32 ? 208  ALA A CA  1 
ATOM   1655 C C   . ALA A 1 208 ? 57.229 36.669 14.562  1.00 13.46 ? 208  ALA A C   1 
ATOM   1656 O O   . ALA A 1 208 ? 56.821 37.826 14.466  1.00 13.94 ? 208  ALA A O   1 
ATOM   1657 C CB  . ALA A 1 208 ? 56.377 35.843 12.314  1.00 13.32 ? 208  ALA A CB  1 
ATOM   1658 N N   . SER A 1 209 ? 58.269 36.344 15.314  1.00 14.25 ? 209  SER A N   1 
ATOM   1659 C CA  . SER A 1 209 ? 58.985 37.398 16.048  1.00 15.18 ? 209  SER A CA  1 
ATOM   1660 C C   . SER A 1 209 ? 60.348 36.895 16.418  1.00 15.61 ? 209  SER A C   1 
ATOM   1661 O O   . SER A 1 209 ? 60.458 35.852 17.115  1.00 15.51 ? 209  SER A O   1 
ATOM   1662 C CB  . SER A 1 209 ? 58.201 37.819 17.309  1.00 15.80 ? 209  SER A CB  1 
ATOM   1663 O OG  . SER A 1 209 ? 58.979 38.723 18.078  1.00 16.20 ? 209  SER A OG  1 
ATOM   1664 N N   . LYS A 1 210 ? 61.382 37.612 15.944  1.00 15.29 ? 210  LYS A N   1 
ATOM   1665 C CA  . LYS A 1 210 ? 62.745 37.174 16.216  1.00 15.70 ? 210  LYS A CA  1 
ATOM   1666 C C   . LYS A 1 210 ? 62.980 37.032 17.721  1.00 16.50 ? 210  LYS A C   1 
ATOM   1667 O O   . LYS A 1 210 ? 63.498 35.987 18.165  1.00 16.03 ? 210  LYS A O   1 
ATOM   1668 C CB  . LYS A 1 210 ? 63.750 38.111 15.569  1.00 15.26 ? 210  LYS A CB  1 
ATOM   1669 C CG  . LYS A 1 210 ? 65.219 37.735 15.853  1.00 15.95 ? 210  LYS A CG  1 
ATOM   1670 C CD  . LYS A 1 210 ? 66.180 38.553 15.003  1.00 15.92 ? 210  LYS A CD  1 
ATOM   1671 C CE  . LYS A 1 210 ? 67.627 38.113 15.223  1.00 14.37 ? 210  LYS A CE  1 
ATOM   1672 N NZ  . LYS A 1 210 ? 68.509 39.076 14.467  1.00 14.15 ? 210  LYS A NZ  1 
ATOM   1673 N N   . THR A 1 211 ? 62.595 38.057 18.495  1.00 16.12 ? 211  THR A N   1 
ATOM   1674 C CA  . THR A 1 211 ? 62.832 38.057 19.951  1.00 16.47 ? 211  THR A CA  1 
ATOM   1675 C C   . THR A 1 211 ? 61.739 37.336 20.684  1.00 17.10 ? 211  THR A C   1 
ATOM   1676 O O   . THR A 1 211 ? 61.932 36.849 21.796  1.00 16.94 ? 211  THR A O   1 
ATOM   1677 C CB  . THR A 1 211 ? 62.832 39.494 20.518  1.00 17.14 ? 211  THR A CB  1 
ATOM   1678 O OG1 . THR A 1 211 ? 61.585 40.147 20.173  1.00 17.83 ? 211  THR A OG1 1 
ATOM   1679 C CG2 . THR A 1 211 ? 63.971 40.357 19.910  1.00 17.29 ? 211  THR A CG2 1 
ATOM   1680 N N   . PHE A 1 212 ? 60.569 37.302 20.057  1.00 17.32 ? 212  PHE A N   1 
ATOM   1681 C CA  . PHE A 1 212 ? 59.341 36.851 20.706  1.00 17.25 ? 212  PHE A CA  1 
ATOM   1682 C C   . PHE A 1 212 ? 58.937 37.729 21.911  1.00 17.87 ? 212  PHE A C   1 
ATOM   1683 O O   . PHE A 1 212 ? 58.249 37.262 22.818  1.00 18.43 ? 212  PHE A O   1 
ATOM   1684 C CB  . PHE A 1 212 ? 59.357 35.369 21.089  1.00 16.99 ? 212  PHE A CB  1 
ATOM   1685 C CG  . PHE A 1 212 ? 58.075 34.623 20.684  1.00 17.92 ? 212  PHE A CG  1 
ATOM   1686 C CD1 . PHE A 1 212 ? 57.168 34.188 21.636  1.00 16.53 ? 212  PHE A CD1 1 
ATOM   1687 C CD2 . PHE A 1 212 ? 57.795 34.363 19.340  1.00 17.64 ? 212  PHE A CD2 1 
ATOM   1688 C CE1 . PHE A 1 212 ? 56.009 33.526 21.281  1.00 16.97 ? 212  PHE A CE1 1 
ATOM   1689 C CE2 . PHE A 1 212 ? 56.646 33.682 18.961  1.00 17.19 ? 212  PHE A CE2 1 
ATOM   1690 C CZ  . PHE A 1 212 ? 55.735 33.254 19.927  1.00 16.91 ? 212  PHE A CZ  1 
ATOM   1691 N N   . THR A 1 213 ? 59.338 38.997 21.911  1.00 17.61 ? 213  THR A N   1 
ATOM   1692 C CA  . THR A 1 213 ? 58.850 39.910 22.950  1.00 18.11 ? 213  THR A CA  1 
ATOM   1693 C C   . THR A 1 213 ? 58.282 41.180 22.388  1.00 18.56 ? 213  THR A C   1 
ATOM   1694 O O   . THR A 1 213 ? 57.832 42.024 23.169  1.00 19.34 ? 213  THR A O   1 
ATOM   1695 C CB  . THR A 1 213 ? 59.985 40.311 23.939  1.00 18.78 ? 213  THR A CB  1 
ATOM   1696 O OG1 . THR A 1 213 ? 61.076 40.926 23.220  1.00 19.73 ? 213  THR A OG1 1 
ATOM   1697 C CG2 . THR A 1 213 ? 60.583 39.048 24.592  1.00 18.33 ? 213  THR A CG2 1 
ATOM   1698 N N   . THR A 1 214 ? 58.294 41.331 21.070  1.00 16.86 ? 214  THR A N   1 
ATOM   1699 C CA  . THR A 1 214 ? 57.854 42.583 20.440  1.00 17.37 ? 214  THR A CA  1 
ATOM   1700 C C   . THR A 1 214 ? 56.438 42.821 20.908  1.00 16.89 ? 214  THR A C   1 
ATOM   1701 O O   . THR A 1 214 ? 55.584 41.940 20.765  1.00 16.03 ? 214  THR A O   1 
ATOM   1702 C CB  . THR A 1 214 ? 57.899 42.433 18.957  1.00 16.35 ? 214  THR A CB  1 
ATOM   1703 O OG1 . THR A 1 214 ? 59.255 42.163 18.591  1.00 20.88 ? 214  THR A OG1 1 
ATOM   1704 C CG2 . THR A 1 214 ? 57.619 43.782 18.249  1.00 18.47 ? 214  THR A CG2 1 
ATOM   1705 N N   . GLN A 1 215 ? 56.185 43.998 21.477  1.00 16.86 ? 215  GLN A N   1 
ATOM   1706 C CA  . GLN A 1 215 ? 54.880 44.232 22.077  1.00 16.47 ? 215  GLN A CA  1 
ATOM   1707 C C   . GLN A 1 215 ? 53.723 44.060 21.141  1.00 15.76 ? 215  GLN A C   1 
ATOM   1708 O O   . GLN A 1 215 ? 52.722 43.434 21.507  1.00 15.67 ? 215  GLN A O   1 
ATOM   1709 C CB  . GLN A 1 215 ? 54.803 45.608 22.751  1.00 17.91 ? 215  GLN A CB  1 
ATOM   1710 C CG  . GLN A 1 215 ? 53.501 45.741 23.620  1.00 17.34 ? 215  GLN A CG  1 
ATOM   1711 C CD  . GLN A 1 215 ? 53.402 47.040 24.405  1.00 18.07 ? 215  GLN A CD  1 
ATOM   1712 O OE1 . GLN A 1 215 ? 52.831 47.059 25.510  1.00 20.63 ? 215  GLN A OE1 1 
ATOM   1713 N NE2 . GLN A 1 215 ? 53.887 48.130 23.817  1.00 17.94 ? 215  GLN A NE2 1 
ATOM   1714 N N   . GLU A 1 216 ? 53.818 44.619 19.947  1.00 15.22 ? 216  GLU A N   1 
ATOM   1715 C CA  . GLU A 1 216 ? 52.687 44.545 19.026  1.00 14.63 ? 216  GLU A CA  1 
ATOM   1716 C C   . GLU A 1 216 ? 52.363 43.077 18.708  1.00 13.49 ? 216  GLU A C   1 
ATOM   1717 O O   . GLU A 1 216 ? 51.214 42.674 18.695  1.00 12.99 ? 216  GLU A O   1 
ATOM   1718 C CB  . GLU A 1 216 ? 52.960 45.335 17.736  1.00 15.15 ? 216  GLU A CB  1 
ATOM   1719 C CG  . GLU A 1 216 ? 53.102 46.867 17.909  1.00 15.77 ? 216  GLU A CG  1 
ATOM   1720 C CD  . GLU A 1 216 ? 54.545 47.321 17.928  1.00 17.71 ? 216  GLU A CD  1 
ATOM   1721 O OE1 . GLU A 1 216 ? 54.817 48.414 17.374  1.00 16.65 ? 216  GLU A OE1 1 
ATOM   1722 O OE2 . GLU A 1 216 ? 55.408 46.585 18.503  1.00 17.59 ? 216  GLU A OE2 1 
ATOM   1723 N N   . THR A 1 217 ? 53.379 42.295 18.403  1.00 12.11 ? 217  THR A N   1 
ATOM   1724 C CA  . THR A 1 217 ? 53.183 40.907 17.995  1.00 11.72 ? 217  THR A CA  1 
ATOM   1725 C C   . THR A 1 217 ? 52.660 40.014 19.100  1.00 11.89 ? 217  THR A C   1 
ATOM   1726 O O   . THR A 1 217 ? 51.751 39.216 18.860  1.00 12.76 ? 217  THR A O   1 
ATOM   1727 C CB  . THR A 1 217 ? 54.512 40.371 17.448  1.00 11.56 ? 217  THR A CB  1 
ATOM   1728 O OG1 . THR A 1 217 ? 54.846 41.161 16.294  1.00 12.18 ? 217  THR A OG1 1 
ATOM   1729 C CG2 . THR A 1 217 ? 54.401 38.941 16.945  1.00 10.84 ? 217  THR A CG2 1 
ATOM   1730 N N   . ILE A 1 218 ? 53.258 40.118 20.285  1.00 12.50 ? 218  ILE A N   1 
ATOM   1731 C CA  . ILE A 1 218 ? 52.796 39.283 21.376  1.00 12.89 ? 218  ILE A CA  1 
ATOM   1732 C C   . ILE A 1 218 ? 51.391 39.663 21.800  1.00 12.96 ? 218  ILE A C   1 
ATOM   1733 O O   . ILE A 1 218 ? 50.583 38.779 22.138  1.00 13.02 ? 218  ILE A O   1 
ATOM   1734 C CB  . ILE A 1 218 ? 53.800 39.272 22.545  1.00 13.55 ? 218  ILE A CB  1 
ATOM   1735 C CG1 . ILE A 1 218 ? 55.124 38.700 22.057  1.00 16.30 ? 218  ILE A CG1 1 
ATOM   1736 C CG2 . ILE A 1 218 ? 53.273 38.374 23.650  1.00 16.69 ? 218  ILE A CG2 1 
ATOM   1737 C CD1 . ILE A 1 218 ? 54.982 37.251 21.503  1.00 18.38 ? 218  ILE A CD1 1 
ATOM   1738 N N   . THR A 1 219 ? 51.067 40.958 21.788  1.00 11.94 ? 219  THR A N   1 
ATOM   1739 C CA  . THR A 1 219 ? 49.694 41.348 22.139  1.00 11.82 ? 219  THR A CA  1 
ATOM   1740 C C   . THR A 1 219 ? 48.720 40.839 21.087  1.00 11.77 ? 219  THR A C   1 
ATOM   1741 O O   . THR A 1 219 ? 47.674 40.275 21.413  1.00 10.59 ? 219  THR A O   1 
ATOM   1742 C CB  . THR A 1 219 ? 49.603 42.866 22.240  1.00 12.28 ? 219  THR A CB  1 
ATOM   1743 O OG1 . THR A 1 219 ? 50.490 43.304 23.288  1.00 13.44 ? 219  THR A OG1 1 
ATOM   1744 C CG2 . THR A 1 219 ? 48.179 43.283 22.632  1.00 11.45 ? 219  THR A CG2 1 
ATOM   1745 N N   . ASN A 1 220 ? 49.067 40.977 19.810  1.00 10.70 ? 220  ASN A N   1 
ATOM   1746 C CA  . ASN A 1 220 ? 48.193 40.433 18.764  1.00 10.59 ? 220  ASN A CA  1 
ATOM   1747 C C   . ASN A 1 220 ? 48.031 38.926 18.908  1.00 11.45 ? 220  ASN A C   1 
ATOM   1748 O O   . ASN A 1 220 ? 46.928 38.408 18.705  1.00 11.69 ? 220  ASN A O   1 
ATOM   1749 C CB  . ASN A 1 220 ? 48.764 40.751 17.370  1.00 10.82 ? 220  ASN A CB  1 
ATOM   1750 C CG  . ASN A 1 220 ? 48.333 42.109 16.853  1.00 10.45 ? 220  ASN A CG  1 
ATOM   1751 O OD1 . ASN A 1 220 ? 47.231 42.565 17.113  1.00 10.88 ? 220  ASN A OD1 1 
ATOM   1752 N ND2 . ASN A 1 220 ? 49.212 42.760 16.088  1.00 9.91  ? 220  ASN A ND2 1 
ATOM   1753 N N   . ALA A 1 221 ? 49.138 38.238 19.226  1.00 11.01 ? 221  ALA A N   1 
ATOM   1754 C CA  . ALA A 1 221 ? 49.100 36.784 19.403  1.00 11.54 ? 221  ALA A CA  1 
ATOM   1755 C C   . ALA A 1 221 ? 48.176 36.374 20.543  1.00 12.43 ? 221  ALA A C   1 
ATOM   1756 O O   . ALA A 1 221 ? 47.410 35.395 20.425  1.00 12.29 ? 221  ALA A O   1 
ATOM   1757 C CB  . ALA A 1 221 ? 50.503 36.247 19.630  1.00 12.01 ? 221  ALA A CB  1 
ATOM   1758 N N   . GLU A 1 222 ? 48.254 37.108 21.641  1.00 12.35 ? 222  GLU A N   1 
ATOM   1759 C CA  . GLU A 1 222 ? 47.408 36.820 22.798  1.00 13.58 ? 222  GLU A CA  1 
ATOM   1760 C C   . GLU A 1 222 ? 45.937 37.077 22.462  1.00 13.13 ? 222  GLU A C   1 
ATOM   1761 O O   . GLU A 1 222 ? 45.046 36.333 22.871  1.00 14.15 ? 222  GLU A O   1 
ATOM   1762 C CB  . GLU A 1 222 ? 47.885 37.631 24.013  1.00 14.55 ? 222  GLU A CB  1 
ATOM   1763 C CG  . GLU A 1 222 ? 49.213 37.060 24.509  1.00 19.49 ? 222  GLU A CG  1 
ATOM   1764 C CD  . GLU A 1 222 ? 49.765 37.652 25.802  1.00 26.31 ? 222  GLU A CD  1 
ATOM   1765 O OE1 . GLU A 1 222 ? 50.493 36.894 26.512  1.00 27.71 ? 222  GLU A OE1 1 
ATOM   1766 O OE2 . GLU A 1 222 ? 49.514 38.846 26.090  1.00 29.07 ? 222  GLU A OE2 1 
ATOM   1767 N N   . THR A 1 223 ? 45.666 38.120 21.692  1.00 12.25 ? 223  THR A N   1 
ATOM   1768 C CA  . THR A 1 223 ? 44.303 38.375 21.294  1.00 12.08 ? 223  THR A CA  1 
ATOM   1769 C C   . THR A 1 223 ? 43.772 37.261 20.404  1.00 12.36 ? 223  THR A C   1 
ATOM   1770 O O   . THR A 1 223 ? 42.597 36.826 20.561  1.00 13.02 ? 223  THR A O   1 
ATOM   1771 C CB  . THR A 1 223 ? 44.269 39.740 20.574  1.00 12.21 ? 223  THR A CB  1 
ATOM   1772 O OG1 . THR A 1 223 ? 44.477 40.730 21.575  1.00 13.00 ? 223  THR A OG1 1 
ATOM   1773 C CG2 . THR A 1 223 ? 42.902 40.034 19.991  1.00 13.22 ? 223  THR A CG2 1 
ATOM   1774 N N   . ALA A 1 224 ? 44.613 36.786 19.480  1.00 11.41 ? 224  ALA A N   1 
ATOM   1775 C CA  . ALA A 1 224 ? 44.211 35.688 18.628  1.00 12.43 ? 224  ALA A CA  1 
ATOM   1776 C C   . ALA A 1 224 ? 43.974 34.412 19.455  1.00 13.29 ? 224  ALA A C   1 
ATOM   1777 O O   . ALA A 1 224 ? 43.015 33.681 19.181  1.00 14.22 ? 224  ALA A O   1 
ATOM   1778 C CB  . ALA A 1 224 ? 45.247 35.414 17.511  1.00 12.88 ? 224  ALA A CB  1 
ATOM   1779 N N   . LYS A 1 225 ? 44.860 34.141 20.415  1.00 12.65 ? 225  LYS A N   1 
ATOM   1780 C CA  . LYS A 1 225 ? 44.751 32.906 21.228  1.00 13.57 ? 225  LYS A CA  1 
ATOM   1781 C C   . LYS A 1 225 ? 43.472 32.960 22.071  1.00 14.06 ? 225  LYS A C   1 
ATOM   1782 O O   . LYS A 1 225 ? 42.752 31.954 22.216  1.00 14.65 ? 225  LYS A O   1 
ATOM   1783 C CB  . LYS A 1 225 ? 46.000 32.684 22.092  1.00 13.99 ? 225  LYS A CB  1 
ATOM   1784 C CG  . LYS A 1 225 ? 45.977 31.336 22.851  1.00 18.44 ? 225  LYS A CG  1 
ATOM   1785 C CD  . LYS A 1 225 ? 47.359 31.034 23.472  1.00 24.06 ? 225  LYS A CD  1 
ATOM   1786 C CE  . LYS A 1 225 ? 47.625 31.889 24.698  1.00 29.90 ? 225  LYS A CE  1 
ATOM   1787 N NZ  . LYS A 1 225 ? 49.095 32.163 24.827  1.00 34.49 ? 225  LYS A NZ  1 
ATOM   1788 N N   . GLU A 1 226 ? 43.154 34.137 22.590  1.00 13.33 ? 226  GLU A N   1 
ATOM   1789 C CA  . GLU A 1 226 ? 41.929 34.277 23.367  1.00 14.41 ? 226  GLU A CA  1 
ATOM   1790 C C   . GLU A 1 226 ? 40.686 34.014 22.500  1.00 14.89 ? 226  GLU A C   1 
ATOM   1791 O O   . GLU A 1 226 ? 39.732 33.310 22.920  1.00 15.64 ? 226  GLU A O   1 
ATOM   1792 C CB  . GLU A 1 226 ? 41.881 35.682 23.999  1.00 14.97 ? 226  GLU A CB  1 
ATOM   1793 C CG  . GLU A 1 226 ? 40.587 35.972 24.750  1.00 18.71 ? 226  GLU A CG  1 
ATOM   1794 C CD  . GLU A 1 226 ? 40.535 37.414 25.233  1.00 25.47 ? 226  GLU A CD  1 
ATOM   1795 O OE1 . GLU A 1 226 ? 40.264 38.312 24.398  1.00 25.42 ? 226  GLU A OE1 1 
ATOM   1796 O OE2 . GLU A 1 226 ? 40.744 37.628 26.453  1.00 29.99 ? 226  GLU A OE2 1 
ATOM   1797 N N   . TRP A 1 227 ? 40.672 34.580 21.295  1.00 14.04 ? 227  TRP A N   1 
ATOM   1798 C CA  . TRP A 1 227 ? 39.555 34.384 20.377  1.00 14.17 ? 227  TRP A CA  1 
ATOM   1799 C C   . TRP A 1 227 ? 39.422 32.897 20.034  1.00 14.74 ? 227  TRP A C   1 
ATOM   1800 O O   . TRP A 1 227 ? 38.308 32.336 20.012  1.00 14.41 ? 227  TRP A O   1 
ATOM   1801 C CB  . TRP A 1 227 ? 39.838 35.169 19.105  1.00 15.01 ? 227  TRP A CB  1 
ATOM   1802 C CG  . TRP A 1 227 ? 38.949 34.920 17.918  1.00 15.11 ? 227  TRP A CG  1 
ATOM   1803 C CD1 . TRP A 1 227 ? 37.792 35.572 17.594  1.00 16.60 ? 227  TRP A CD1 1 
ATOM   1804 C CD2 . TRP A 1 227 ? 39.233 34.052 16.815  1.00 13.48 ? 227  TRP A CD2 1 
ATOM   1805 N NE1 . TRP A 1 227 ? 37.310 35.132 16.386  1.00 16.36 ? 227  TRP A NE1 1 
ATOM   1806 C CE2 . TRP A 1 227 ? 38.181 34.209 15.871  1.00 15.79 ? 227  TRP A CE2 1 
ATOM   1807 C CE3 . TRP A 1 227 ? 40.278 33.169 16.517  1.00 14.58 ? 227  TRP A CE3 1 
ATOM   1808 C CZ2 . TRP A 1 227 ? 38.136 33.510 14.674  1.00 15.29 ? 227  TRP A CZ2 1 
ATOM   1809 C CZ3 . TRP A 1 227 ? 40.223 32.453 15.314  1.00 13.72 ? 227  TRP A CZ3 1 
ATOM   1810 C CH2 . TRP A 1 227 ? 39.164 32.642 14.403  1.00 16.01 ? 227  TRP A CH2 1 
ATOM   1811 N N   . PHE A 1 228 ? 40.570 32.271 19.776  1.00 14.46 ? 228  PHE A N   1 
ATOM   1812 C CA  . PHE A 1 228 ? 40.601 30.839 19.442  1.00 13.70 ? 228  PHE A CA  1 
ATOM   1813 C C   . PHE A 1 228 ? 40.051 30.014 20.596  1.00 14.68 ? 228  PHE A C   1 
ATOM   1814 O O   . PHE A 1 228 ? 39.202 29.116 20.378  1.00 14.44 ? 228  PHE A O   1 
ATOM   1815 C CB  . PHE A 1 228 ? 42.034 30.388 19.118  1.00 13.92 ? 228  PHE A CB  1 
ATOM   1816 C CG  . PHE A 1 228 ? 42.151 28.914 18.929  1.00 13.83 ? 228  PHE A CG  1 
ATOM   1817 C CD1 . PHE A 1 228 ? 41.778 28.342 17.742  1.00 14.22 ? 228  PHE A CD1 1 
ATOM   1818 C CD2 . PHE A 1 228 ? 42.629 28.106 19.959  1.00 14.15 ? 228  PHE A CD2 1 
ATOM   1819 C CE1 . PHE A 1 228 ? 41.860 26.988 17.568  1.00 15.03 ? 228  PHE A CE1 1 
ATOM   1820 C CE2 . PHE A 1 228 ? 42.710 26.731 19.792  1.00 13.98 ? 228  PHE A CE2 1 
ATOM   1821 C CZ  . PHE A 1 228 ? 42.321 26.179 18.592  1.00 15.15 ? 228  PHE A CZ  1 
ATOM   1822 N N   . LEU A 1 229 ? 40.513 30.314 21.807  1.00 15.19 ? 229  LEU A N   1 
ATOM   1823 C CA  . LEU A 1 229 ? 40.093 29.522 22.982  1.00 16.23 ? 229  LEU A CA  1 
ATOM   1824 C C   . LEU A 1 229 ? 38.628 29.718 23.356  1.00 17.38 ? 229  LEU A C   1 
ATOM   1825 O O   . LEU A 1 229 ? 38.014 28.819 23.968  1.00 17.32 ? 229  LEU A O   1 
ATOM   1826 C CB  . LEU A 1 229 ? 41.016 29.761 24.172  1.00 16.28 ? 229  LEU A CB  1 
ATOM   1827 C CG  . LEU A 1 229 ? 42.397 29.080 24.084  1.00 17.05 ? 229  LEU A CG  1 
ATOM   1828 C CD1 . LEU A 1 229 ? 43.313 29.520 25.170  1.00 18.25 ? 229  LEU A CD1 1 
ATOM   1829 C CD2 . LEU A 1 229 ? 42.293 27.498 24.061  1.00 18.82 ? 229  LEU A CD2 1 
ATOM   1830 N N   . GLN A 1 230 ? 38.053 30.855 22.981  1.00 17.05 ? 230  GLN A N   1 
ATOM   1831 C CA  . GLN A 1 230 ? 36.639 31.086 23.255  1.00 18.86 ? 230  GLN A CA  1 
ATOM   1832 C C   . GLN A 1 230 ? 35.805 30.041 22.513  1.00 18.51 ? 230  GLN A C   1 
ATOM   1833 O O   . GLN A 1 230 ? 34.748 29.620 23.008  1.00 18.63 ? 230  GLN A O   1 
ATOM   1834 C CB  . GLN A 1 230 ? 36.215 32.517 22.893  1.00 20.00 ? 230  GLN A CB  1 
ATOM   1835 C CG  . GLN A 1 230 ? 36.719 33.543 23.912  1.00 26.09 ? 230  GLN A CG  1 
ATOM   1836 C CD  . GLN A 1 230 ? 36.499 34.995 23.489  1.00 32.85 ? 230  GLN A CD  1 
ATOM   1837 O OE1 . GLN A 1 230 ? 35.926 35.261 22.421  1.00 36.95 ? 230  GLN A OE1 1 
ATOM   1838 N NE2 . GLN A 1 230 ? 36.960 35.942 24.321  1.00 34.78 ? 230  GLN A NE2 1 
ATOM   1839 N N   . ALA A 1 231 ? 36.307 29.599 21.356  1.00 17.13 ? 231  ALA A N   1 
ATOM   1840 C CA  . ALA A 1 231 ? 35.649 28.579 20.543  1.00 17.20 ? 231  ALA A CA  1 
ATOM   1841 C C   . ALA A 1 231 ? 36.126 27.160 20.925  1.00 17.16 ? 231  ALA A C   1 
ATOM   1842 O O   . ALA A 1 231 ? 35.303 26.245 21.117  1.00 18.63 ? 231  ALA A O   1 
ATOM   1843 C CB  . ALA A 1 231 ? 35.903 28.856 19.022  1.00 17.28 ? 231  ALA A CB  1 
ATOM   1844 N N   . ALA A 1 232 ? 37.434 26.957 21.045  1.00 16.11 ? 232  ALA A N   1 
ATOM   1845 C CA  . ALA A 1 232 ? 37.967 25.604 21.249  1.00 17.08 ? 232  ALA A CA  1 
ATOM   1846 C C   . ALA A 1 232 ? 37.872 25.120 22.703  1.00 18.86 ? 232  ALA A C   1 
ATOM   1847 O O   . ALA A 1 232 ? 37.743 23.927 22.968  1.00 19.47 ? 232  ALA A O   1 
ATOM   1848 C CB  . ALA A 1 232 ? 39.397 25.516 20.722  1.00 17.38 ? 232  ALA A CB  1 
ATOM   1849 N N   . LYS A 1 233 ? 37.983 26.036 23.644  1.00 19.35 ? 233  LYS A N   1 
ATOM   1850 C CA  . LYS A 1 233 ? 37.853 25.717 25.066  1.00 21.40 ? 233  LYS A CA  1 
ATOM   1851 C C   . LYS A 1 233 ? 38.735 24.587 25.573  1.00 22.97 ? 233  LYS A C   1 
ATOM   1852 O O   . LYS A 1 233 ? 38.345 23.830 26.495  1.00 24.39 ? 233  LYS A O   1 
ATOM   1853 C CB  . LYS A 1 233 ? 36.396 25.391 25.367  1.00 21.19 ? 233  LYS A CB  1 
ATOM   1854 C CG  . LYS A 1 233 ? 35.522 26.581 25.155  1.00 23.79 ? 233  LYS A CG  1 
ATOM   1855 C CD  . LYS A 1 233 ? 34.153 26.325 25.651  1.00 25.56 ? 233  LYS A CD  1 
ATOM   1856 C CE  . LYS A 1 233 ? 33.171 26.780 24.632  1.00 25.55 ? 233  LYS A CE  1 
ATOM   1857 N NZ  . LYS A 1 233 ? 31.771 26.531 25.145  1.00 23.14 ? 233  LYS A NZ  1 
ATOM   1858 N N   . ASP A 1 234 ? 39.905 24.437 24.989  1.00 22.68 ? 234  ASP A N   1 
ATOM   1859 C CA  . ASP A 1 234 ? 40.812 23.399 25.413  1.00 23.38 ? 234  ASP A CA  1 
ATOM   1860 C C   . ASP A 1 234 ? 42.207 23.873 25.063  1.00 23.46 ? 234  ASP A C   1 
ATOM   1861 O O   . ASP A 1 234 ? 42.561 23.956 23.896  1.00 22.94 ? 234  ASP A O   1 
ATOM   1862 C CB  . ASP A 1 234 ? 40.507 22.114 24.650  1.00 24.04 ? 234  ASP A CB  1 
ATOM   1863 C CG  . ASP A 1 234 ? 41.514 21.014 24.933  1.00 26.08 ? 234  ASP A CG  1 
ATOM   1864 O OD1 . ASP A 1 234 ? 42.374 21.172 25.860  1.00 25.16 ? 234  ASP A OD1 1 
ATOM   1865 O OD2 . ASP A 1 234 ? 41.507 19.952 24.264  1.00 27.11 ? 234  ASP A OD2 1 
ATOM   1866 N N   . PRO A 1 235 ? 43.009 24.187 26.065  1.00 24.13 ? 235  PRO A N   1 
ATOM   1867 C CA  . PRO A 1 235 ? 44.379 24.614 25.796  1.00 23.66 ? 235  PRO A CA  1 
ATOM   1868 C C   . PRO A 1 235 ? 45.164 23.642 24.910  1.00 23.26 ? 235  PRO A C   1 
ATOM   1869 O O   . PRO A 1 235 ? 46.098 24.070 24.214  1.00 22.95 ? 235  PRO A O   1 
ATOM   1870 C CB  . PRO A 1 235 ? 44.983 24.712 27.199  1.00 24.39 ? 235  PRO A CB  1 
ATOM   1871 C CG  . PRO A 1 235 ? 43.818 25.067 28.037  1.00 25.19 ? 235  PRO A CG  1 
ATOM   1872 C CD  . PRO A 1 235 ? 42.678 24.199 27.504  1.00 24.67 ? 235  PRO A CD  1 
ATOM   1873 N N   . SER A 1 236 ? 44.815 22.351 24.905  1.00 22.20 ? 236  SER A N   1 
ATOM   1874 C CA  . SER A 1 236 ? 45.541 21.426 24.049  1.00 21.82 ? 236  SER A CA  1 
ATOM   1875 C C   . SER A 1 236 ? 45.281 21.676 22.578  1.00 20.61 ? 236  SER A C   1 
ATOM   1876 O O   . SER A 1 236 ? 46.063 21.251 21.729  1.00 21.24 ? 236  SER A O   1 
ATOM   1877 C CB  . SER A 1 236 ? 45.225 19.962 24.393  1.00 23.41 ? 236  SER A CB  1 
ATOM   1878 O OG  . SER A 1 236 ? 45.521 19.745 25.774  1.00 27.11 ? 236  SER A OG  1 
ATOM   1879 N N   . ALA A 1 237 ? 44.168 22.314 22.261  1.00 18.94 ? 237  ALA A N   1 
ATOM   1880 C CA  . ALA A 1 237 ? 43.848 22.583 20.860  1.00 17.56 ? 237  ALA A CA  1 
ATOM   1881 C C   . ALA A 1 237 ? 44.798 23.618 20.265  1.00 17.43 ? 237  ALA A C   1 
ATOM   1882 O O   . ALA A 1 237 ? 44.933 23.714 19.053  1.00 16.45 ? 237  ALA A O   1 
ATOM   1883 C CB  . ALA A 1 237 ? 42.410 23.063 20.705  1.00 17.74 ? 237  ALA A CB  1 
ATOM   1884 N N   . VAL A 1 238 ? 45.470 24.372 21.122  1.00 16.42 ? 238  VAL A N   1 
ATOM   1885 C CA  . VAL A 1 238 ? 46.355 25.441 20.590  1.00 16.80 ? 238  VAL A CA  1 
ATOM   1886 C C   . VAL A 1 238 ? 47.444 24.849 19.716  1.00 17.00 ? 238  VAL A C   1 
ATOM   1887 O O   . VAL A 1 238 ? 47.840 25.442 18.685  1.00 16.29 ? 238  VAL A O   1 
ATOM   1888 C CB  . VAL A 1 238 ? 46.918 26.261 21.750  1.00 16.03 ? 238  VAL A CB  1 
ATOM   1889 C CG1 . VAL A 1 238 ? 48.081 27.188 21.299  1.00 16.56 ? 238  VAL A CG1 1 
ATOM   1890 C CG2 . VAL A 1 238 ? 45.805 27.078 22.400  1.00 16.77 ? 238  VAL A CG2 1 
ATOM   1891 N N   . ALA A 1 239 ? 47.924 23.662 20.086  1.00 17.28 ? 239  ALA A N   1 
ATOM   1892 C CA  . ALA A 1 239 ? 48.993 22.995 19.345  1.00 18.06 ? 239  ALA A CA  1 
ATOM   1893 C C   . ALA A 1 239 ? 48.639 22.608 17.909  1.00 17.49 ? 239  ALA A C   1 
ATOM   1894 O O   . ALA A 1 239 ? 49.522 22.313 17.101  1.00 18.27 ? 239  ALA A O   1 
ATOM   1895 C CB  . ALA A 1 239 ? 49.481 21.757 20.144  1.00 19.02 ? 239  ALA A CB  1 
ATOM   1896 N N   . LYS A 1 240 ? 47.353 22.584 17.584  1.00 16.11 ? 240  LYS A N   1 
ATOM   1897 C CA  . LYS A 1 240 ? 46.930 22.300 16.226  1.00 15.32 ? 240  LYS A CA  1 
ATOM   1898 C C   . LYS A 1 240 ? 46.740 23.593 15.416  1.00 14.42 ? 240  LYS A C   1 
ATOM   1899 O O   . LYS A 1 240 ? 46.575 23.534 14.205  1.00 14.69 ? 240  LYS A O   1 
ATOM   1900 C CB  . LYS A 1 240 ? 45.600 21.502 16.193  1.00 15.41 ? 240  LYS A CB  1 
ATOM   1901 C CG  . LYS A 1 240 ? 45.699 20.162 16.938  1.00 15.02 ? 240  LYS A CG  1 
ATOM   1902 C CD  . LYS A 1 240 ? 44.350 19.436 16.868  1.00 17.61 ? 240  LYS A CD  1 
ATOM   1903 C CE  . LYS A 1 240 ? 44.425 18.048 17.505  1.00 20.26 ? 240  LYS A CE  1 
ATOM   1904 N NZ  . LYS A 1 240 ? 45.537 17.240 16.984  1.00 23.69 ? 240  LYS A NZ  1 
ATOM   1905 N N   . HIS A 1 241 ? 46.782 24.747 16.072  1.00 13.28 ? 241  HIS A N   1 
ATOM   1906 C CA  . HIS A 1 241 ? 46.462 25.993 15.374  1.00 12.70 ? 241  HIS A CA  1 
ATOM   1907 C C   . HIS A 1 241 ? 47.435 27.153 15.516  1.00 12.67 ? 241  HIS A C   1 
ATOM   1908 O O   . HIS A 1 241 ? 47.168 28.226 14.944  1.00 12.55 ? 241  HIS A O   1 
ATOM   1909 C CB  . HIS A 1 241 ? 45.083 26.445 15.850  1.00 13.29 ? 241  HIS A CB  1 
ATOM   1910 C CG  . HIS A 1 241 ? 43.988 25.537 15.377  1.00 12.19 ? 241  HIS A CG  1 
ATOM   1911 N ND1 . HIS A 1 241 ? 43.268 25.793 14.233  1.00 12.63 ? 241  HIS A ND1 1 
ATOM   1912 C CD2 . HIS A 1 241 ? 43.491 24.378 15.889  1.00 13.37 ? 241  HIS A CD2 1 
ATOM   1913 C CE1 . HIS A 1 241 ? 42.383 24.823 14.044  1.00 14.45 ? 241  HIS A CE1 1 
ATOM   1914 N NE2 . HIS A 1 241 ? 42.502 23.953 15.037  1.00 13.87 ? 241  HIS A NE2 1 
ATOM   1915 N N   . PHE A 1 242 ? 48.504 26.971 16.295  1.00 13.12 ? 242  PHE A N   1 
ATOM   1916 C CA  . PHE A 1 242 ? 49.473 28.040 16.521  1.00 13.12 ? 242  PHE A CA  1 
ATOM   1917 C C   . PHE A 1 242 ? 50.865 27.491 16.396  1.00 13.47 ? 242  PHE A C   1 
ATOM   1918 O O   . PHE A 1 242 ? 51.195 26.508 17.059  1.00 14.03 ? 242  PHE A O   1 
ATOM   1919 C CB  . PHE A 1 242 ? 49.352 28.664 17.926  1.00 13.40 ? 242  PHE A CB  1 
ATOM   1920 C CG  . PHE A 1 242 ? 48.168 29.565 18.084  1.00 13.88 ? 242  PHE A CG  1 
ATOM   1921 C CD1 . PHE A 1 242 ? 48.338 30.946 18.114  1.00 14.07 ? 242  PHE A CD1 1 
ATOM   1922 C CD2 . PHE A 1 242 ? 46.879 29.042 18.164  1.00 13.27 ? 242  PHE A CD2 1 
ATOM   1923 C CE1 . PHE A 1 242 ? 47.278 31.796 18.234  1.00 14.32 ? 242  PHE A CE1 1 
ATOM   1924 C CE2 . PHE A 1 242 ? 45.784 29.898 18.277  1.00 13.83 ? 242  PHE A CE2 1 
ATOM   1925 C CZ  . PHE A 1 242 ? 45.983 31.297 18.310  1.00 14.00 ? 242  PHE A CZ  1 
ATOM   1926 N N   . VAL A 1 243 ? 51.681 28.118 15.557  1.00 12.36 ? 243  VAL A N   1 
ATOM   1927 C CA  . VAL A 1 243 ? 53.098 27.775 15.484  1.00 12.58 ? 243  VAL A CA  1 
ATOM   1928 C C   . VAL A 1 243 ? 53.895 29.070 15.676  1.00 13.21 ? 243  VAL A C   1 
ATOM   1929 O O   . VAL A 1 243 ? 53.336 30.170 15.559  1.00 13.21 ? 243  VAL A O   1 
ATOM   1930 C CB  . VAL A 1 243 ? 53.529 27.057 14.170  1.00 13.13 ? 243  VAL A CB  1 
ATOM   1931 C CG1 . VAL A 1 243 ? 52.760 25.767 14.011  1.00 14.20 ? 243  VAL A CG1 1 
ATOM   1932 C CG2 . VAL A 1 243 ? 53.349 27.948 12.903  1.00 13.79 ? 243  VAL A CG2 1 
ATOM   1933 N N   . ALA A 1 244 ? 55.190 28.928 15.947  1.00 12.94 ? 244  ALA A N   1 
ATOM   1934 C CA  . ALA A 1 244 ? 56.055 30.088 16.205  1.00 12.46 ? 244  ALA A CA  1 
ATOM   1935 C C   . ALA A 1 244 ? 57.271 30.080 15.288  1.00 12.54 ? 244  ALA A C   1 
ATOM   1936 O O   . ALA A 1 244 ? 57.831 29.015 15.023  1.00 12.63 ? 244  ALA A O   1 
ATOM   1937 C CB  . ALA A 1 244 ? 56.546 30.082 17.674  1.00 13.60 ? 244  ALA A CB  1 
ATOM   1938 N N   . LEU A 1 245 ? 57.683 31.268 14.850  1.00 12.40 ? 245  LEU A N   1 
ATOM   1939 C CA  . LEU A 1 245 ? 58.929 31.450 14.085  1.00 12.60 ? 245  LEU A CA  1 
ATOM   1940 C C   . LEU A 1 245 ? 59.761 32.375 14.938  1.00 13.79 ? 245  LEU A C   1 
ATOM   1941 O O   . LEU A 1 245 ? 59.427 33.544 15.077  1.00 13.68 ? 245  LEU A O   1 
ATOM   1942 C CB  . LEU A 1 245 ? 58.650 32.159 12.743  1.00 12.73 ? 245  LEU A CB  1 
ATOM   1943 C CG  . LEU A 1 245 ? 57.429 31.657 11.990  1.00 11.14 ? 245  LEU A CG  1 
ATOM   1944 C CD1 . LEU A 1 245 ? 57.295 32.473 10.656  1.00 12.12 ? 245  LEU A CD1 1 
ATOM   1945 C CD2 . LEU A 1 245 ? 57.522 30.124 11.725  1.00 12.65 ? 245  LEU A CD2 1 
ATOM   1946 N N   . SER A 1 246 ? 60.848 31.886 15.513  1.00 15.06 ? 246  SER A N   1 
ATOM   1947 C CA  . SER A 1 246 ? 61.561 32.751 16.439  1.00 15.79 ? 246  SER A CA  1 
ATOM   1948 C C   . SER A 1 246 ? 62.962 32.257 16.695  1.00 16.24 ? 246  SER A C   1 
ATOM   1949 O O   . SER A 1 246 ? 63.329 31.169 16.240  1.00 16.07 ? 246  SER A O   1 
ATOM   1950 C CB  . SER A 1 246 ? 60.801 32.739 17.773  1.00 14.24 ? 246  SER A CB  1 
ATOM   1951 O OG  . SER A 1 246 ? 61.294 33.734 18.674  1.00 15.87 ? 246  SER A OG  1 
ATOM   1952 N N   . THR A 1 247 ? 63.733 33.063 17.426  1.00 18.03 ? 247  THR A N   1 
ATOM   1953 C CA  . THR A 1 247 ? 65.049 32.602 17.884  1.00 19.01 ? 247  THR A CA  1 
ATOM   1954 C C   . THR A 1 247 ? 64.948 32.263 19.367  1.00 20.39 ? 247  THR A C   1 
ATOM   1955 O O   . THR A 1 247 ? 65.856 31.668 19.908  1.00 20.75 ? 247  THR A O   1 
ATOM   1956 C CB  . THR A 1 247 ? 66.150 33.662 17.744  1.00 19.66 ? 247  THR A CB  1 
ATOM   1957 O OG1 . THR A 1 247 ? 65.918 34.731 18.681  1.00 21.24 ? 247  THR A OG1 1 
ATOM   1958 C CG2 . THR A 1 247 ? 66.167 34.298 16.366  1.00 21.32 ? 247  THR A CG2 1 
ATOM   1959 N N   . ASN A 1 248 ? 63.853 32.628 20.026  1.00 21.25 ? 248  ASN A N   1 
ATOM   1960 C CA  . ASN A 1 248 ? 63.811 32.477 21.484  1.00 23.61 ? 248  ASN A CA  1 
ATOM   1961 C C   . ASN A 1 248 ? 62.963 31.313 21.945  1.00 24.01 ? 248  ASN A C   1 
ATOM   1962 O O   . ASN A 1 248 ? 61.779 31.449 22.210  1.00 23.55 ? 248  ASN A O   1 
ATOM   1963 C CB  . ASN A 1 248 ? 63.381 33.795 22.134  1.00 24.90 ? 248  ASN A CB  1 
ATOM   1964 C CG  . ASN A 1 248 ? 63.744 33.888 23.621  1.00 27.63 ? 248  ASN A CG  1 
ATOM   1965 O OD1 . ASN A 1 248 ? 63.593 32.937 24.363  1.00 28.28 ? 248  ASN A OD1 1 
ATOM   1966 N ND2 . ASN A 1 248 ? 64.178 35.081 24.056  1.00 32.58 ? 248  ASN A ND2 1 
ATOM   1967 N N   . THR A 1 249 ? 63.606 30.164 22.069  1.00 25.34 ? 249  THR A N   1 
ATOM   1968 C CA  . THR A 1 249 ? 62.912 28.976 22.547  1.00 26.70 ? 249  THR A CA  1 
ATOM   1969 C C   . THR A 1 249 ? 62.151 29.168 23.848  1.00 26.81 ? 249  THR A C   1 
ATOM   1970 O O   . THR A 1 249 ? 61.012 28.749 23.978  1.00 27.47 ? 249  THR A O   1 
ATOM   1971 C CB  . THR A 1 249 ? 63.939 27.858 22.700  1.00 27.09 ? 249  THR A CB  1 
ATOM   1972 O OG1 . THR A 1 249 ? 64.597 27.687 21.437  1.00 28.77 ? 249  THR A OG1 1 
ATOM   1973 C CG2 . THR A 1 249 ? 63.257 26.506 23.002  1.00 26.62 ? 249  THR A CG2 1 
ATOM   1974 N N   . THR A 1 250 ? 62.807 29.781 24.825  1.00 27.38 ? 250  THR A N   1 
ATOM   1975 C CA  . THR A 1 250 ? 62.213 30.010 26.146  1.00 27.39 ? 250  THR A CA  1 
ATOM   1976 C C   . THR A 1 250 ? 60.922 30.808 26.079  1.00 26.56 ? 250  THR A C   1 
ATOM   1977 O O   . THR A 1 250 ? 59.894 30.409 26.643  1.00 26.21 ? 250  THR A O   1 
ATOM   1978 C CB  . THR A 1 250 ? 63.226 30.728 27.072  1.00 27.81 ? 250  THR A CB  1 
ATOM   1979 O OG1 . THR A 1 250 ? 64.358 29.879 27.304  1.00 29.88 ? 250  THR A OG1 1 
ATOM   1980 C CG2 . THR A 1 250 ? 62.636 30.913 28.439  1.00 28.61 ? 250  THR A CG2 1 
ATOM   1981 N N   . LYS A 1 251 ? 60.942 31.926 25.368  1.00 25.33 ? 251  LYS A N   1 
ATOM   1982 C CA  . LYS A 1 251 ? 59.725 32.742 25.331  1.00 25.59 ? 251  LYS A CA  1 
ATOM   1983 C C   . LYS A 1 251 ? 58.591 32.088 24.555  1.00 24.35 ? 251  LYS A C   1 
ATOM   1984 O O   . LYS A 1 251 ? 57.412 32.318 24.832  1.00 23.97 ? 251  LYS A O   1 
ATOM   1985 C CB  . LYS A 1 251 ? 59.988 34.147 24.808  1.00 25.92 ? 251  LYS A CB  1 
ATOM   1986 C CG  . LYS A 1 251 ? 60.349 35.153 25.902  1.00 30.43 ? 251  LYS A CG  1 
ATOM   1987 C CD  . LYS A 1 251 ? 61.823 35.234 26.074  1.00 34.63 ? 251  LYS A CD  1 
ATOM   1988 C CE  . LYS A 1 251 ? 62.179 36.493 26.860  1.00 36.96 ? 251  LYS A CE  1 
ATOM   1989 N NZ  . LYS A 1 251 ? 61.270 36.579 28.043  1.00 37.56 ? 251  LYS A NZ  1 
ATOM   1990 N N   . VAL A 1 252 ? 58.956 31.274 23.579  1.00 23.60 ? 252  VAL A N   1 
ATOM   1991 C CA  . VAL A 1 252 ? 57.943 30.577 22.796  1.00 22.89 ? 252  VAL A CA  1 
ATOM   1992 C C   . VAL A 1 252 ? 57.223 29.603 23.709  1.00 23.72 ? 252  VAL A C   1 
ATOM   1993 O O   . VAL A 1 252 ? 56.007 29.515 23.681  1.00 22.98 ? 252  VAL A O   1 
ATOM   1994 C CB  . VAL A 1 252 ? 58.533 29.879 21.565  1.00 22.52 ? 252  VAL A CB  1 
ATOM   1995 C CG1 . VAL A 1 252 ? 57.575 28.865 21.014  1.00 23.40 ? 252  VAL A CG1 1 
ATOM   1996 C CG2 . VAL A 1 252 ? 58.930 30.937 20.490  1.00 21.00 ? 252  VAL A CG2 1 
ATOM   1997 N N   . LYS A 1 253 ? 57.988 28.930 24.564  1.00 25.30 ? 253  LYS A N   1 
ATOM   1998 C CA  . LYS A 1 253 ? 57.405 27.943 25.478  1.00 27.70 ? 253  LYS A CA  1 
ATOM   1999 C C   . LYS A 1 253 ? 56.491 28.618 26.484  1.00 28.09 ? 253  LYS A C   1 
ATOM   2000 O O   . LYS A 1 253 ? 55.357 28.163 26.740  1.00 27.53 ? 253  LYS A O   1 
ATOM   2001 C CB  . LYS A 1 253 ? 58.514 27.131 26.169  1.00 28.71 ? 253  LYS A CB  1 
ATOM   2002 C CG  . LYS A 1 253 ? 59.414 26.428 25.156  1.00 32.76 ? 253  LYS A CG  1 
ATOM   2003 C CD  . LYS A 1 253 ? 60.540 25.558 25.779  1.00 38.09 ? 253  LYS A CD  1 
ATOM   2004 C CE  . LYS A 1 253 ? 61.620 26.394 26.503  1.00 41.66 ? 253  LYS A CE  1 
ATOM   2005 N NZ  . LYS A 1 253 ? 61.521 26.415 28.018  1.00 43.87 ? 253  LYS A NZ  1 
ATOM   2006 N N   . GLU A 1 254 ? 56.981 29.718 27.045  1.00 29.48 ? 254  GLU A N   1 
ATOM   2007 C CA  . GLU A 1 254 ? 56.193 30.480 28.011  1.00 30.08 ? 254  GLU A CA  1 
ATOM   2008 C C   . GLU A 1 254 ? 54.875 30.975 27.421  1.00 29.90 ? 254  GLU A C   1 
ATOM   2009 O O   . GLU A 1 254 ? 53.887 31.152 28.152  1.00 29.71 ? 254  GLU A O   1 
ATOM   2010 C CB  . GLU A 1 254 ? 57.023 31.628 28.618  1.00 31.27 ? 254  GLU A CB  1 
ATOM   2011 C CG  . GLU A 1 254 ? 58.231 31.144 29.423  1.00 34.28 ? 254  GLU A CG  1 
ATOM   2012 C CD  . GLU A 1 254 ? 59.188 32.259 29.850  1.00 38.88 ? 254  GLU A CD  1 
ATOM   2013 O OE1 . GLU A 1 254 ? 60.153 31.944 30.585  1.00 40.94 ? 254  GLU A OE1 1 
ATOM   2014 O OE2 . GLU A 1 254 ? 58.978 33.446 29.480  1.00 41.32 ? 254  GLU A OE2 1 
ATOM   2015 N N   . PHE A 1 255 ? 54.835 31.178 26.096  1.00 29.53 ? 255  PHE A N   1 
ATOM   2016 C CA  . PHE A 1 255 ? 53.616 31.675 25.466  1.00 29.08 ? 255  PHE A CA  1 
ATOM   2017 C C   . PHE A 1 255 ? 52.588 30.566 25.360  1.00 28.98 ? 255  PHE A C   1 
ATOM   2018 O O   . PHE A 1 255 ? 51.395 30.835 25.206  1.00 29.03 ? 255  PHE A O   1 
ATOM   2019 C CB  . PHE A 1 255 ? 53.893 32.297 24.074  1.00 28.84 ? 255  PHE A CB  1 
ATOM   2020 C CG  . PHE A 1 255 ? 52.643 32.770 23.353  1.00 29.39 ? 255  PHE A CG  1 
ATOM   2021 C CD1 . PHE A 1 255 ? 52.061 31.995 22.366  1.00 29.78 ? 255  PHE A CD1 1 
ATOM   2022 C CD2 . PHE A 1 255 ? 52.043 33.979 23.677  1.00 29.78 ? 255  PHE A CD2 1 
ATOM   2023 C CE1 . PHE A 1 255 ? 50.918 32.414 21.713  1.00 30.15 ? 255  PHE A CE1 1 
ATOM   2024 C CE2 . PHE A 1 255 ? 50.902 34.396 23.021  1.00 28.22 ? 255  PHE A CE2 1 
ATOM   2025 C CZ  . PHE A 1 255 ? 50.335 33.616 22.060  1.00 28.29 ? 255  PHE A CZ  1 
ATOM   2026 N N   . GLY A 1 256 ? 53.041 29.320 25.461  1.00 28.16 ? 256  GLY A N   1 
ATOM   2027 C CA  . GLY A 1 256 ? 52.122 28.199 25.363  1.00 29.06 ? 256  GLY A CA  1 
ATOM   2028 C C   . GLY A 1 256 ? 52.195 27.464 24.050  1.00 28.63 ? 256  GLY A C   1 
ATOM   2029 O O   . GLY A 1 256 ? 51.314 26.663 23.715  1.00 29.19 ? 256  GLY A O   1 
ATOM   2030 N N   . ILE A 1 257 ? 53.250 27.722 23.286  1.00 28.52 ? 257  ILE A N   1 
ATOM   2031 C CA  . ILE A 1 257 ? 53.374 27.006 22.016  1.00 29.01 ? 257  ILE A CA  1 
ATOM   2032 C C   . ILE A 1 257 ? 54.225 25.755 22.152  1.00 29.90 ? 257  ILE A C   1 
ATOM   2033 O O   . ILE A 1 257 ? 55.323 25.809 22.705  1.00 30.80 ? 257  ILE A O   1 
ATOM   2034 C CB  . ILE A 1 257 ? 53.862 27.945 20.854  1.00 28.62 ? 257  ILE A CB  1 
ATOM   2035 C CG1 . ILE A 1 257 ? 52.641 28.677 20.261  1.00 28.86 ? 257  ILE A CG1 1 
ATOM   2036 C CG2 . ILE A 1 257 ? 54.592 27.133 19.754  1.00 27.43 ? 257  ILE A CG2 1 
ATOM   2037 C CD1 . ILE A 1 257 ? 52.947 29.882 19.441  1.00 28.36 ? 257  ILE A CD1 1 
ATOM   2038 N N   . ASP A 1 258 ? 53.675 24.635 21.676  1.00 30.49 ? 258  ASP A N   1 
ATOM   2039 C CA  . ASP A 1 258 ? 54.351 23.345 21.609  1.00 32.13 ? 258  ASP A CA  1 
ATOM   2040 C C   . ASP A 1 258 ? 55.752 23.504 21.009  1.00 32.20 ? 258  ASP A C   1 
ATOM   2041 O O   . ASP A 1 258 ? 55.920 24.024 19.917  1.00 32.14 ? 258  ASP A O   1 
ATOM   2042 C CB  . ASP A 1 258 ? 53.514 22.427 20.715  1.00 33.06 ? 258  ASP A CB  1 
ATOM   2043 C CG  . ASP A 1 258 ? 53.974 20.976 20.729  1.00 37.15 ? 258  ASP A CG  1 
ATOM   2044 O OD1 . ASP A 1 258 ? 55.122 20.682 21.146  1.00 39.96 ? 258  ASP A OD1 1 
ATOM   2045 O OD2 . ASP A 1 258 ? 53.232 20.049 20.323  1.00 40.57 ? 258  ASP A OD2 1 
ATOM   2046 N N   . PRO A 1 259 ? 56.759 23.006 21.708  1.00 32.05 ? 259  PRO A N   1 
ATOM   2047 C CA  . PRO A 1 259 ? 58.154 23.127 21.256  1.00 31.06 ? 259  PRO A CA  1 
ATOM   2048 C C   . PRO A 1 259 ? 58.390 22.530 19.857  1.00 29.90 ? 259  PRO A C   1 
ATOM   2049 O O   . PRO A 1 259 ? 59.254 23.009 19.108  1.00 30.48 ? 259  PRO A O   1 
ATOM   2050 C CB  . PRO A 1 259 ? 58.917 22.324 22.311  1.00 31.58 ? 259  PRO A CB  1 
ATOM   2051 C CG  . PRO A 1 259 ? 57.825 21.363 22.842  1.00 32.22 ? 259  PRO A CG  1 
ATOM   2052 C CD  . PRO A 1 259 ? 56.631 22.267 22.978  1.00 32.36 ? 259  PRO A CD  1 
ATOM   2053 N N   . GLN A 1 260 ? 57.642 21.503 19.484  1.00 28.46 ? 260  GLN A N   1 
ATOM   2054 C CA  . GLN A 1 260 ? 57.788 20.935 18.156  1.00 27.41 ? 260  GLN A CA  1 
ATOM   2055 C C   . GLN A 1 260 ? 57.153 21.845 17.092  1.00 25.23 ? 260  GLN A C   1 
ATOM   2056 O O   . GLN A 1 260 ? 57.274 21.585 15.912  1.00 25.39 ? 260  GLN A O   1 
ATOM   2057 C CB  . GLN A 1 260 ? 57.129 19.556 18.074  1.00 29.27 ? 260  GLN A CB  1 
ATOM   2058 C CG  . GLN A 1 260 ? 57.814 18.498 18.918  1.00 34.11 ? 260  GLN A CG  1 
ATOM   2059 C CD  . GLN A 1 260 ? 56.971 17.226 19.053  1.00 40.46 ? 260  GLN A CD  1 
ATOM   2060 O OE1 . GLN A 1 260 ? 57.401 16.138 18.643  1.00 43.25 ? 260  GLN A OE1 1 
ATOM   2061 N NE2 . GLN A 1 260 ? 55.771 17.360 19.640  1.00 42.81 ? 260  GLN A NE2 1 
ATOM   2062 N N   . ASN A 1 261 ? 56.471 22.892 17.537  1.00 22.65 ? 261  ASN A N   1 
ATOM   2063 C CA  . ASN A 1 261 ? 55.790 23.806 16.610  1.00 20.77 ? 261  ASN A CA  1 
ATOM   2064 C C   . ASN A 1 261 ? 56.610 25.082 16.455  1.00 18.91 ? 261  ASN A C   1 
ATOM   2065 O O   . ASN A 1 261 ? 56.071 26.078 16.009  1.00 17.14 ? 261  ASN A O   1 
ATOM   2066 C CB  . ASN A 1 261 ? 54.399 24.200 17.159  1.00 20.97 ? 261  ASN A CB  1 
ATOM   2067 C CG  . ASN A 1 261 ? 53.329 23.155 16.886  1.00 22.61 ? 261  ASN A CG  1 
ATOM   2068 O OD1 . ASN A 1 261 ? 53.603 22.087 16.310  1.00 25.35 ? 261  ASN A OD1 1 
ATOM   2069 N ND2 . ASN A 1 261 ? 52.079 23.470 17.275  1.00 22.37 ? 261  ASN A ND2 1 
ATOM   2070 N N   . MET A 1 262 ? 57.880 25.054 16.877  1.00 17.71 ? 262  MET A N   1 
ATOM   2071 C CA  . MET A 1 262 ? 58.769 26.203 16.749  1.00 17.13 ? 262  MET A CA  1 
ATOM   2072 C C   . MET A 1 262 ? 59.696 25.997 15.572  1.00 16.39 ? 262  MET A C   1 
ATOM   2073 O O   . MET A 1 262 ? 60.335 24.962 15.483  1.00 16.91 ? 262  MET A O   1 
ATOM   2074 C CB  . MET A 1 262 ? 59.598 26.424 18.022  1.00 18.42 ? 262  MET A CB  1 
ATOM   2075 C CG  . MET A 1 262 ? 60.477 27.656 17.926  1.00 21.61 ? 262  MET A CG  1 
ATOM   2076 S SD  . MET A 1 262 ? 61.467 27.862 19.422  1.00 27.58 ? 262  MET A SD  1 
ATOM   2077 C CE  . MET A 1 262 ? 60.258 27.666 20.562  1.00 29.58 ? 262  MET A CE  1 
ATOM   2078 N N   . PHE A 1 263 ? 59.748 26.975 14.663  1.00 14.01 ? 263  PHE A N   1 
ATOM   2079 C CA  . PHE A 1 263 ? 60.639 26.941 13.493  1.00 13.43 ? 263  PHE A CA  1 
ATOM   2080 C C   . PHE A 1 263 ? 61.681 27.983 13.774  1.00 13.58 ? 263  PHE A C   1 
ATOM   2081 O O   . PHE A 1 263 ? 61.366 29.181 13.812  1.00 13.48 ? 263  PHE A O   1 
ATOM   2082 C CB  . PHE A 1 263 ? 59.812 27.277 12.242  1.00 13.74 ? 263  PHE A CB  1 
ATOM   2083 C CG  . PHE A 1 263 ? 58.746 26.255 11.967  1.00 12.84 ? 263  PHE A CG  1 
ATOM   2084 C CD1 . PHE A 1 263 ? 57.530 26.343 12.595  1.00 13.55 ? 263  PHE A CD1 1 
ATOM   2085 C CD2 . PHE A 1 263 ? 58.990 25.191 11.100  1.00 14.92 ? 263  PHE A CD2 1 
ATOM   2086 C CE1 . PHE A 1 263 ? 56.522 25.345 12.377  1.00 13.82 ? 263  PHE A CE1 1 
ATOM   2087 C CE2 . PHE A 1 263 ? 58.006 24.217 10.853  1.00 15.48 ? 263  PHE A CE2 1 
ATOM   2088 C CZ  . PHE A 1 263 ? 56.775 24.296 11.487  1.00 13.52 ? 263  PHE A CZ  1 
ATOM   2089 N N   . GLU A 1 264 ? 62.902 27.526 14.024  1.00 13.20 ? 264  GLU A N   1 
ATOM   2090 C CA  . GLU A 1 264 ? 63.957 28.374 14.534  1.00 13.86 ? 264  GLU A CA  1 
ATOM   2091 C C   . GLU A 1 264 ? 64.683 29.176 13.502  1.00 13.17 ? 264  GLU A C   1 
ATOM   2092 O O   . GLU A 1 264 ? 64.859 28.728 12.377  1.00 13.26 ? 264  GLU A O   1 
ATOM   2093 C CB  . GLU A 1 264 ? 64.984 27.469 15.257  1.00 14.77 ? 264  GLU A CB  1 
ATOM   2094 C CG  . GLU A 1 264 ? 65.961 28.190 16.149  1.00 22.19 ? 264  GLU A CG  1 
ATOM   2095 C CD  . GLU A 1 264 ? 66.766 27.221 17.017  1.00 27.43 ? 264  GLU A CD  1 
ATOM   2096 O OE1 . GLU A 1 264 ? 66.596 25.989 16.876  1.00 28.65 ? 264  GLU A OE1 1 
ATOM   2097 O OE2 . GLU A 1 264 ? 67.565 27.688 17.855  1.00 32.29 ? 264  GLU A OE2 1 
ATOM   2098 N N   . PHE A 1 265 ? 65.099 30.373 13.900  1.00 12.84 ? 265  PHE A N   1 
ATOM   2099 C CA  . PHE A 1 265 ? 66.164 31.056 13.173  1.00 12.95 ? 265  PHE A CA  1 
ATOM   2100 C C   . PHE A 1 265 ? 67.191 31.602 14.181  1.00 13.66 ? 265  PHE A C   1 
ATOM   2101 O O   . PHE A 1 265 ? 67.165 31.215 15.368  1.00 14.50 ? 265  PHE A O   1 
ATOM   2102 C CB  . PHE A 1 265 ? 65.679 32.037 12.086  1.00 12.27 ? 265  PHE A CB  1 
ATOM   2103 C CG  . PHE A 1 265 ? 64.805 33.200 12.574  1.00 12.89 ? 265  PHE A CG  1 
ATOM   2104 C CD1 . PHE A 1 265 ? 65.300 34.510 12.511  1.00 14.97 ? 265  PHE A CD1 1 
ATOM   2105 C CD2 . PHE A 1 265 ? 63.508 33.006 12.994  1.00 13.97 ? 265  PHE A CD2 1 
ATOM   2106 C CE1 . PHE A 1 265 ? 64.522 35.614 12.871  1.00 13.97 ? 265  PHE A CE1 1 
ATOM   2107 C CE2 . PHE A 1 265 ? 62.695 34.099 13.384  1.00 13.24 ? 265  PHE A CE2 1 
ATOM   2108 C CZ  . PHE A 1 265 ? 63.198 35.420 13.311  1.00 14.27 ? 265  PHE A CZ  1 
ATOM   2109 N N   . TRP A 1 266 ? 68.116 32.436 13.724  1.00 13.15 ? 266  TRP A N   1 
ATOM   2110 C CA  . TRP A 1 266 ? 69.332 32.745 14.501  1.00 13.04 ? 266  TRP A CA  1 
ATOM   2111 C C   . TRP A 1 266 ? 69.638 34.206 14.575  1.00 12.67 ? 266  TRP A C   1 
ATOM   2112 O O   . TRP A 1 266 ? 69.096 35.000 13.795  1.00 12.49 ? 266  TRP A O   1 
ATOM   2113 C CB  . TRP A 1 266 ? 70.551 31.952 13.931  1.00 13.35 ? 266  TRP A CB  1 
ATOM   2114 C CG  . TRP A 1 266 ? 70.163 30.471 13.888  1.00 13.48 ? 266  TRP A CG  1 
ATOM   2115 C CD1 . TRP A 1 266 ? 70.210 29.559 14.923  1.00 15.99 ? 266  TRP A CD1 1 
ATOM   2116 C CD2 . TRP A 1 266 ? 69.522 29.792 12.803  1.00 12.78 ? 266  TRP A CD2 1 
ATOM   2117 N NE1 . TRP A 1 266 ? 69.684 28.347 14.521  1.00 16.04 ? 266  TRP A NE1 1 
ATOM   2118 C CE2 . TRP A 1 266 ? 69.247 28.465 13.225  1.00 13.78 ? 266  TRP A CE2 1 
ATOM   2119 C CE3 . TRP A 1 266 ? 69.167 30.166 11.508  1.00 13.13 ? 266  TRP A CE3 1 
ATOM   2120 C CZ2 . TRP A 1 266 ? 68.632 27.508 12.383  1.00 14.40 ? 266  TRP A CZ2 1 
ATOM   2121 C CZ3 . TRP A 1 266 ? 68.543 29.224 10.671  1.00 13.38 ? 266  TRP A CZ3 1 
ATOM   2122 C CH2 . TRP A 1 266 ? 68.289 27.909 11.119  1.00 14.62 ? 266  TRP A CH2 1 
ATOM   2123 N N   . ASP A 1 267 ? 70.506 34.562 15.527  1.00 12.04 ? 267  ASP A N   1 
ATOM   2124 C CA  . ASP A 1 267 ? 70.800 35.970 15.757  1.00 12.35 ? 267  ASP A CA  1 
ATOM   2125 C C   . ASP A 1 267 ? 71.418 36.686 14.568  1.00 12.01 ? 267  ASP A C   1 
ATOM   2126 O O   . ASP A 1 267 ? 71.224 37.921 14.416  1.00 11.75 ? 267  ASP A O   1 
ATOM   2127 C CB  . ASP A 1 267 ? 71.540 36.201 17.101  1.00 13.50 ? 267  ASP A CB  1 
ATOM   2128 C CG  . ASP A 1 267 ? 72.959 35.751 17.105  1.00 18.41 ? 267  ASP A CG  1 
ATOM   2129 O OD1 . ASP A 1 267 ? 73.443 35.201 16.088  1.00 20.55 ? 267  ASP A OD1 1 
ATOM   2130 O OD2 . ASP A 1 267 ? 73.672 35.941 18.144  1.00 21.42 ? 267  ASP A OD2 1 
ATOM   2131 N N   . TRP A 1 268 ? 72.063 35.918 13.685  1.00 10.98 ? 268  TRP A N   1 
ATOM   2132 C CA  . TRP A 1 268 ? 72.709 36.475 12.504  1.00 11.18 ? 268  TRP A CA  1 
ATOM   2133 C C   . TRP A 1 268 ? 71.755 36.639 11.302  1.00 10.72 ? 268  TRP A C   1 
ATOM   2134 O O   . TRP A 1 268 ? 72.180 36.987 10.203  1.00 11.05 ? 268  TRP A O   1 
ATOM   2135 C CB  . TRP A 1 268 ? 73.955 35.651 12.136  1.00 11.09 ? 268  TRP A CB  1 
ATOM   2136 C CG  . TRP A 1 268 ? 73.789 34.143 12.265  1.00 10.95 ? 268  TRP A CG  1 
ATOM   2137 C CD1 . TRP A 1 268 ? 74.299 33.342 13.258  1.00 11.88 ? 268  TRP A CD1 1 
ATOM   2138 C CD2 . TRP A 1 268 ? 73.156 33.255 11.325  1.00 11.14 ? 268  TRP A CD2 1 
ATOM   2139 N NE1 . TRP A 1 268 ? 73.988 32.024 13.002  1.00 12.17 ? 268  TRP A NE1 1 
ATOM   2140 C CE2 . TRP A 1 268 ? 73.278 31.946 11.835  1.00 11.95 ? 268  TRP A CE2 1 
ATOM   2141 C CE3 . TRP A 1 268 ? 72.456 33.445 10.127  1.00 12.17 ? 268  TRP A CE3 1 
ATOM   2142 C CZ2 . TRP A 1 268 ? 72.753 30.820 11.173  1.00 13.38 ? 268  TRP A CZ2 1 
ATOM   2143 C CZ3 . TRP A 1 268 ? 71.943 32.321 9.448   1.00 12.89 ? 268  TRP A CZ3 1 
ATOM   2144 C CH2 . TRP A 1 268 ? 72.090 31.030 9.991   1.00 12.73 ? 268  TRP A CH2 1 
ATOM   2145 N N   . VAL A 1 269 ? 70.466 36.418 11.537  1.00 10.68 ? 269  VAL A N   1 
ATOM   2146 C CA  . VAL A 1 269 ? 69.448 36.737 10.537  1.00 11.32 ? 269  VAL A CA  1 
ATOM   2147 C C   . VAL A 1 269 ? 68.784 38.040 10.970  1.00 11.19 ? 269  VAL A C   1 
ATOM   2148 O O   . VAL A 1 269 ? 67.986 38.038 11.920  1.00 11.60 ? 269  VAL A O   1 
ATOM   2149 C CB  . VAL A 1 269 ? 68.376 35.662 10.530  1.00 11.76 ? 269  VAL A CB  1 
ATOM   2150 C CG1 . VAL A 1 269 ? 67.234 36.002 9.542   1.00 12.05 ? 269  VAL A CG1 1 
ATOM   2151 C CG2 . VAL A 1 269 ? 68.998 34.271 10.181  1.00 11.38 ? 269  VAL A CG2 1 
ATOM   2152 N N   . GLY A 1 270 ? 69.082 39.147 10.292  1.00 11.16 ? 270  GLY A N   1 
ATOM   2153 C CA  . GLY A 1 270 ? 68.418 40.391 10.624  1.00 11.05 ? 270  GLY A CA  1 
ATOM   2154 C C   . GLY A 1 270 ? 66.959 40.329 10.192  1.00 11.05 ? 270  GLY A C   1 
ATOM   2155 O O   . GLY A 1 270 ? 66.632 39.702 9.173   1.00 10.64 ? 270  GLY A O   1 
ATOM   2156 N N   . GLY A 1 271 ? 66.058 40.960 10.955  1.00 10.18 ? 271  GLY A N   1 
ATOM   2157 C CA  . GLY A 1 271 ? 64.664 40.854 10.546  1.00 11.04 ? 271  GLY A CA  1 
ATOM   2158 C C   . GLY A 1 271 ? 64.377 41.320 9.126   1.00 10.85 ? 271  GLY A C   1 
ATOM   2159 O O   . GLY A 1 271 ? 63.591 40.704 8.392   1.00 10.69 ? 271  GLY A O   1 
ATOM   2160 N N   . ARG A 1 272 ? 64.984 42.432 8.726   1.00 11.04 ? 272  ARG A N   1 
ATOM   2161 C CA  . ARG A 1 272 ? 64.765 42.942 7.375   1.00 10.62 ? 272  ARG A CA  1 
ATOM   2162 C C   . ARG A 1 272 ? 65.493 42.130 6.293   1.00 10.78 ? 272  ARG A C   1 
ATOM   2163 O O   . ARG A 1 272 ? 65.458 42.500 5.108   1.00 10.32 ? 272  ARG A O   1 
ATOM   2164 C CB  . ARG A 1 272 ? 65.140 44.450 7.315   1.00 10.58 ? 272  ARG A CB  1 
ATOM   2165 C CG  . ARG A 1 272 ? 66.603 44.750 7.678   1.00 11.28 ? 272  ARG A CG  1 
ATOM   2166 C CD  . ARG A 1 272 ? 66.832 46.283 7.847   1.00 9.92  ? 272  ARG A CD  1 
ATOM   2167 N NE  . ARG A 1 272 ? 68.195 46.555 8.313   1.00 10.07 ? 272  ARG A NE  1 
ATOM   2168 C CZ  . ARG A 1 272 ? 68.522 46.639 9.600   1.00 10.11 ? 272  ARG A CZ  1 
ATOM   2169 N NH1 . ARG A 1 272 ? 69.794 46.805 9.943   1.00 10.55 ? 272  ARG A NH1 1 
ATOM   2170 N NH2 . ARG A 1 272 ? 67.578 46.535 10.555  1.00 10.06 ? 272  ARG A NH2 1 
ATOM   2171 N N   . TYR A 1 273 ? 66.147 41.036 6.703   1.00 10.27 ? 273  TYR A N   1 
ATOM   2172 C CA  . TYR A 1 273 ? 66.806 40.107 5.766   1.00 10.72 ? 273  TYR A CA  1 
ATOM   2173 C C   . TYR A 1 273 ? 66.324 38.713 6.108   1.00 9.92  ? 273  TYR A C   1 
ATOM   2174 O O   . TYR A 1 273 ? 67.037 37.727 5.858   1.00 9.25  ? 273  TYR A O   1 
ATOM   2175 C CB  . TYR A 1 273 ? 68.349 40.152 5.927   1.00 10.59 ? 273  TYR A CB  1 
ATOM   2176 C CG  . TYR A 1 273 ? 68.957 41.493 5.615   1.00 10.54 ? 273  TYR A CG  1 
ATOM   2177 C CD1 . TYR A 1 273 ? 69.281 42.400 6.638   1.00 9.47  ? 273  TYR A CD1 1 
ATOM   2178 C CD2 . TYR A 1 273 ? 69.210 41.853 4.307   1.00 9.80  ? 273  TYR A CD2 1 
ATOM   2179 C CE1 . TYR A 1 273 ? 69.832 43.645 6.313   1.00 10.18 ? 273  TYR A CE1 1 
ATOM   2180 C CE2 . TYR A 1 273 ? 69.752 43.089 4.003   1.00 10.79 ? 273  TYR A CE2 1 
ATOM   2181 C CZ  . TYR A 1 273 ? 70.054 43.963 5.000   1.00 9.33  ? 273  TYR A CZ  1 
ATOM   2182 O OH  . TYR A 1 273 ? 70.620 45.173 4.643   1.00 10.01 ? 273  TYR A OH  1 
ATOM   2183 N N   . SER A 1 274 ? 65.125 38.608 6.687   1.00 9.79  ? 274  SER A N   1 
ATOM   2184 C CA  . SER A 1 274 ? 64.698 37.304 7.251   1.00 9.57  ? 274  SER A CA  1 
ATOM   2185 C C   . SER A 1 274 ? 63.738 36.434 6.444   1.00 9.87  ? 274  SER A C   1 
ATOM   2186 O O   . SER A 1 274 ? 63.477 35.295 6.853   1.00 9.60  ? 274  SER A O   1 
ATOM   2187 C CB  . SER A 1 274 ? 64.123 37.490 8.671   1.00 10.22 ? 274  SER A CB  1 
ATOM   2188 O OG  . SER A 1 274 ? 62.807 38.094 8.668   1.00 10.26 ? 274  SER A OG  1 
ATOM   2189 N N   . LEU A 1 275 ? 63.177 36.943 5.345   1.00 9.50  ? 275  LEU A N   1 
ATOM   2190 C CA  . LEU A 1 275 ? 62.158 36.155 4.638   1.00 9.96  ? 275  LEU A CA  1 
ATOM   2191 C C   . LEU A 1 275 ? 62.690 34.810 4.112   1.00 10.30 ? 275  LEU A C   1 
ATOM   2192 O O   . LEU A 1 275 ? 61.905 33.884 3.857   1.00 11.23 ? 275  LEU A O   1 
ATOM   2193 C CB  . LEU A 1 275 ? 61.505 36.970 3.503   1.00 10.47 ? 275  LEU A CB  1 
ATOM   2194 C CG  . LEU A 1 275 ? 62.415 37.259 2.299   1.00 9.95  ? 275  LEU A CG  1 
ATOM   2195 C CD1 . LEU A 1 275 ? 62.374 36.108 1.265   1.00 12.10 ? 275  LEU A CD1 1 
ATOM   2196 C CD2 . LEU A 1 275 ? 61.893 38.562 1.616   1.00 11.91 ? 275  LEU A CD2 1 
ATOM   2197 N N   . TRP A 1 276 ? 64.013 34.694 4.013   1.00 9.99  ? 276  TRP A N   1 
ATOM   2198 C CA  . TRP A 1 276 ? 64.676 33.489 3.487   1.00 10.01 ? 276  TRP A CA  1 
ATOM   2199 C C   . TRP A 1 276 ? 64.765 32.402 4.550   1.00 10.46 ? 276  TRP A C   1 
ATOM   2200 O O   . TRP A 1 276 ? 65.074 31.258 4.212   1.00 11.55 ? 276  TRP A O   1 
ATOM   2201 C CB  . TRP A 1 276 ? 66.132 33.833 3.097   1.00 9.69  ? 276  TRP A CB  1 
ATOM   2202 C CG  . TRP A 1 276 ? 66.244 35.173 2.398   1.00 9.33  ? 276  TRP A CG  1 
ATOM   2203 C CD1 . TRP A 1 276 ? 66.631 36.376 2.948   1.00 8.74  ? 276  TRP A CD1 1 
ATOM   2204 C CD2 . TRP A 1 276 ? 65.946 35.428 1.040   1.00 8.64  ? 276  TRP A CD2 1 
ATOM   2205 N NE1 . TRP A 1 276 ? 66.570 37.370 2.000   1.00 9.57  ? 276  TRP A NE1 1 
ATOM   2206 C CE2 . TRP A 1 276 ? 66.149 36.816 0.814   1.00 8.91  ? 276  TRP A CE2 1 
ATOM   2207 C CE3 . TRP A 1 276 ? 65.521 34.621 -0.033  1.00 9.30  ? 276  TRP A CE3 1 
ATOM   2208 C CZ2 . TRP A 1 276 ? 65.975 37.400 -0.443  1.00 10.44 ? 276  TRP A CZ2 1 
ATOM   2209 C CZ3 . TRP A 1 276 ? 65.314 35.214 -1.287  1.00 9.24  ? 276  TRP A CZ3 1 
ATOM   2210 C CH2 . TRP A 1 276 ? 65.555 36.591 -1.480  1.00 10.44 ? 276  TRP A CH2 1 
ATOM   2211 N N   . SER A 1 277 ? 64.484 32.761 5.804   1.00 10.01 ? 277  SER A N   1 
ATOM   2212 C CA  . SER A 1 277 ? 64.557 31.826 6.941   1.00 10.53 ? 277  SER A CA  1 
ATOM   2213 C C   . SER A 1 277 ? 63.202 31.205 7.263   1.00 10.44 ? 277  SER A C   1 
ATOM   2214 O O   . SER A 1 277 ? 62.260 31.264 6.459   1.00 10.06 ? 277  SER A O   1 
ATOM   2215 C CB  . SER A 1 277 ? 65.029 32.625 8.169   1.00 10.87 ? 277  SER A CB  1 
ATOM   2216 O OG  . SER A 1 277 ? 64.001 33.472 8.711   1.00 10.53 ? 277  SER A OG  1 
ATOM   2217 N N   . ALA A 1 278 ? 63.091 30.668 8.473   1.00 10.22 ? 278  ALA A N   1 
ATOM   2218 C CA  . ALA A 1 278 ? 61.797 30.255 9.008   1.00 10.87 ? 278  ALA A CA  1 
ATOM   2219 C C   . ALA A 1 278 ? 60.694 31.323 8.838   1.00 11.53 ? 278  ALA A C   1 
ATOM   2220 O O   . ALA A 1 278 ? 59.525 30.967 8.705   1.00 10.96 ? 278  ALA A O   1 
ATOM   2221 C CB  . ALA A 1 278 ? 61.923 29.890 10.473  1.00 11.11 ? 278  ALA A CB  1 
ATOM   2222 N N   . ILE A 1 279 ? 61.056 32.614 8.876   1.00 10.94 ? 279  ILE A N   1 
ATOM   2223 C CA  . ILE A 1 279 ? 60.091 33.685 8.677   1.00 10.68 ? 279  ILE A CA  1 
ATOM   2224 C C   . ILE A 1 279 ? 59.326 33.533 7.358   1.00 11.46 ? 279  ILE A C   1 
ATOM   2225 O O   . ILE A 1 279 ? 58.184 34.003 7.231   1.00 12.22 ? 279  ILE A O   1 
ATOM   2226 C CB  . ILE A 1 279 ? 60.844 35.032 8.751   1.00 10.34 ? 279  ILE A CB  1 
ATOM   2227 C CG1 . ILE A 1 279 ? 61.282 35.298 10.192  1.00 11.28 ? 279  ILE A CG1 1 
ATOM   2228 C CG2 . ILE A 1 279 ? 59.943 36.182 8.233   1.00 10.75 ? 279  ILE A CG2 1 
ATOM   2229 C CD1 . ILE A 1 279 ? 60.097 35.551 11.163  1.00 12.17 ? 279  ILE A CD1 1 
ATOM   2230 N N   . GLY A 1 280 ? 59.946 32.875 6.370   1.00 10.07 ? 280  GLY A N   1 
ATOM   2231 C CA  . GLY A 1 280 ? 59.277 32.597 5.097   1.00 11.30 ? 280  GLY A CA  1 
ATOM   2232 C C   . GLY A 1 280 ? 58.249 31.469 5.135   1.00 11.62 ? 280  GLY A C   1 
ATOM   2233 O O   . GLY A 1 280 ? 57.721 31.103 4.097   1.00 11.44 ? 280  GLY A O   1 
ATOM   2234 N N   . LEU A 1 281 ? 57.931 30.923 6.314   1.00 11.01 ? 281  LEU A N   1 
ATOM   2235 C CA  . LEU A 1 281 ? 56.988 29.798 6.343   1.00 11.56 ? 281  LEU A CA  1 
ATOM   2236 C C   . LEU A 1 281 ? 55.660 30.112 5.660   1.00 11.96 ? 281  LEU A C   1 
ATOM   2237 O O   . LEU A 1 281 ? 55.134 29.269 4.916   1.00 11.52 ? 281  LEU A O   1 
ATOM   2238 C CB  . LEU A 1 281 ? 56.767 29.292 7.782   1.00 10.91 ? 281  LEU A CB  1 
ATOM   2239 C CG  . LEU A 1 281 ? 55.848 28.078 7.886   1.00 12.48 ? 281  LEU A CG  1 
ATOM   2240 C CD1 . LEU A 1 281 ? 56.508 26.857 7.262   1.00 14.35 ? 281  LEU A CD1 1 
ATOM   2241 C CD2 . LEU A 1 281 ? 55.516 27.802 9.379   1.00 13.28 ? 281  LEU A CD2 1 
ATOM   2242 N N   . SER A 1 282 ? 55.107 31.308 5.870   1.00 11.21 ? 282  SER A N   1 
ATOM   2243 C CA  . SER A 1 282 ? 53.832 31.615 5.190   1.00 11.60 ? 282  SER A CA  1 
ATOM   2244 C C   . SER A 1 282 ? 53.979 31.654 3.669   1.00 11.96 ? 282  SER A C   1 
ATOM   2245 O O   . SER A 1 282 ? 53.001 31.389 2.953   1.00 11.49 ? 282  SER A O   1 
ATOM   2246 C CB  . SER A 1 282 ? 53.212 32.916 5.701   1.00 11.50 ? 282  SER A CB  1 
ATOM   2247 O OG  . SER A 1 282 ? 54.089 33.998 5.437   1.00 11.93 ? 282  SER A OG  1 
ATOM   2248 N N   . ILE A 1 283 ? 55.171 31.992 3.171   1.00 11.27 ? 283  ILE A N   1 
ATOM   2249 C CA  . ILE A 1 283 ? 55.414 31.968 1.734   1.00 10.99 ? 283  ILE A CA  1 
ATOM   2250 C C   . ILE A 1 283 ? 55.317 30.525 1.254   1.00 11.56 ? 283  ILE A C   1 
ATOM   2251 O O   . ILE A 1 283 ? 54.566 30.227 0.318   1.00 11.30 ? 283  ILE A O   1 
ATOM   2252 C CB  . ILE A 1 283 ? 56.817 32.523 1.381   1.00 10.60 ? 283  ILE A CB  1 
ATOM   2253 C CG1 . ILE A 1 283 ? 56.941 34.004 1.830   1.00 11.10 ? 283  ILE A CG1 1 
ATOM   2254 C CG2 . ILE A 1 283 ? 57.032 32.389 -0.140  1.00 10.32 ? 283  ILE A CG2 1 
ATOM   2255 C CD1 . ILE A 1 283 ? 58.409 34.544 1.778   1.00 11.90 ? 283  ILE A CD1 1 
ATOM   2256 N N   . ALA A 1 284 ? 56.019 29.623 1.936   1.00 11.39 ? 284  ALA A N   1 
ATOM   2257 C CA  . ALA A 1 284 ? 56.039 28.234 1.515   1.00 11.61 ? 284  ALA A CA  1 
ATOM   2258 C C   . ALA A 1 284 ? 54.651 27.610 1.623   1.00 11.74 ? 284  ALA A C   1 
ATOM   2259 O O   . ALA A 1 284 ? 54.239 26.824 0.748   1.00 12.10 ? 284  ALA A O   1 
ATOM   2260 C CB  . ALA A 1 284 ? 57.052 27.445 2.356   1.00 13.11 ? 284  ALA A CB  1 
ATOM   2261 N N   . LEU A 1 285 ? 53.891 27.977 2.646   1.00 11.77 ? 285  LEU A N   1 
ATOM   2262 C CA  . LEU A 1 285 ? 52.540 27.440 2.729   1.00 11.95 ? 285  LEU A CA  1 
ATOM   2263 C C   . LEU A 1 285 ? 51.655 27.914 1.581   1.00 12.95 ? 285  LEU A C   1 
ATOM   2264 O O   . LEU A 1 285 ? 50.785 27.166 1.073   1.00 13.65 ? 285  LEU A O   1 
ATOM   2265 C CB  . LEU A 1 285 ? 51.886 27.865 4.069   1.00 12.67 ? 285  LEU A CB  1 
ATOM   2266 C CG  . LEU A 1 285 ? 52.384 27.122 5.312   1.00 12.27 ? 285  LEU A CG  1 
ATOM   2267 C CD1 . LEU A 1 285 ? 52.083 27.892 6.587   1.00 14.95 ? 285  LEU A CD1 1 
ATOM   2268 C CD2 . LEU A 1 285 ? 51.723 25.687 5.440   1.00 13.08 ? 285  LEU A CD2 1 
ATOM   2269 N N   . HIS A 1 286 ? 51.842 29.156 1.163   1.00 12.06 ? 286  HIS A N   1 
ATOM   2270 C CA  . HIS A 1 286 ? 50.995 29.702 0.128   1.00 13.17 ? 286  HIS A CA  1 
ATOM   2271 C C   . HIS A 1 286 ? 51.375 29.215 -1.273  1.00 14.33 ? 286  HIS A C   1 
ATOM   2272 O O   . HIS A 1 286 ? 50.481 28.905 -2.081  1.00 15.23 ? 286  HIS A O   1 
ATOM   2273 C CB  . HIS A 1 286 ? 51.069 31.235 0.194   1.00 13.09 ? 286  HIS A CB  1 
ATOM   2274 C CG  . HIS A 1 286 ? 49.927 31.918 -0.481  1.00 14.33 ? 286  HIS A CG  1 
ATOM   2275 N ND1 . HIS A 1 286 ? 50.081 33.023 -1.294  1.00 17.00 ? 286  HIS A ND1 1 
ATOM   2276 C CD2 . HIS A 1 286 ? 48.599 31.685 -0.403  1.00 12.89 ? 286  HIS A CD2 1 
ATOM   2277 C CE1 . HIS A 1 286 ? 48.893 33.408 -1.732  1.00 13.09 ? 286  HIS A CE1 1 
ATOM   2278 N NE2 . HIS A 1 286 ? 47.978 32.619 -1.195  1.00 17.64 ? 286  HIS A NE2 1 
ATOM   2279 N N   . VAL A 1 287 ? 52.672 29.158 -1.582  1.00 14.33 ? 287  VAL A N   1 
ATOM   2280 C CA  . VAL A 1 287 ? 53.089 28.806 -2.949  1.00 14.96 ? 287  VAL A CA  1 
ATOM   2281 C C   . VAL A 1 287 ? 53.748 27.443 -3.106  1.00 14.07 ? 287  VAL A C   1 
ATOM   2282 O O   . VAL A 1 287 ? 54.092 27.027 -4.230  1.00 14.01 ? 287  VAL A O   1 
ATOM   2283 C CB  . VAL A 1 287 ? 53.987 29.916 -3.578  1.00 15.08 ? 287  VAL A CB  1 
ATOM   2284 C CG1 . VAL A 1 287 ? 53.226 31.259 -3.558  1.00 16.24 ? 287  VAL A CG1 1 
ATOM   2285 C CG2 . VAL A 1 287 ? 55.350 30.026 -2.861  1.00 15.59 ? 287  VAL A CG2 1 
ATOM   2286 N N   . GLY A 1 288 ? 53.933 26.747 -1.990  1.00 13.58 ? 288  GLY A N   1 
ATOM   2287 C CA  . GLY A 1 288 ? 54.547 25.430 -2.026  1.00 14.58 ? 288  GLY A CA  1 
ATOM   2288 C C   . GLY A 1 288 ? 56.047 25.462 -1.835  1.00 14.76 ? 288  GLY A C   1 
ATOM   2289 O O   . GLY A 1 288 ? 56.691 26.483 -2.101  1.00 14.41 ? 288  GLY A O   1 
ATOM   2290 N N   . PHE A 1 289 ? 56.615 24.357 -1.371  1.00 15.68 ? 289  PHE A N   1 
ATOM   2291 C CA  . PHE A 1 289 ? 58.065 24.360 -1.088  1.00 15.77 ? 289  PHE A CA  1 
ATOM   2292 C C   . PHE A 1 289 ? 58.980 24.436 -2.287  1.00 15.55 ? 289  PHE A C   1 
ATOM   2293 O O   . PHE A 1 289 ? 60.082 24.985 -2.181  1.00 16.02 ? 289  PHE A O   1 
ATOM   2294 C CB  . PHE A 1 289 ? 58.475 23.174 -0.166  1.00 14.74 ? 289  PHE A CB  1 
ATOM   2295 C CG  . PHE A 1 289 ? 59.539 23.552 0.810   1.00 13.34 ? 289  PHE A CG  1 
ATOM   2296 C CD1 . PHE A 1 289 ? 59.210 24.289 1.928   1.00 14.30 ? 289  PHE A CD1 1 
ATOM   2297 C CD2 . PHE A 1 289 ? 60.875 23.238 0.571   1.00 15.33 ? 289  PHE A CD2 1 
ATOM   2298 C CE1 . PHE A 1 289 ? 60.176 24.703 2.801   1.00 17.57 ? 289  PHE A CE1 1 
ATOM   2299 C CE2 . PHE A 1 289 ? 61.868 23.670 1.462   1.00 16.02 ? 289  PHE A CE2 1 
ATOM   2300 C CZ  . PHE A 1 289 ? 61.491 24.394 2.572   1.00 16.03 ? 289  PHE A CZ  1 
ATOM   2301 N N   . ASP A 1 290 ? 58.571 23.866 -3.416  1.00 15.53 ? 290  ASP A N   1 
ATOM   2302 C CA  . ASP A 1 290 ? 59.402 23.906 -4.610  1.00 15.71 ? 290  ASP A CA  1 
ATOM   2303 C C   . ASP A 1 290 ? 59.577 25.369 -4.985  1.00 14.93 ? 290  ASP A C   1 
ATOM   2304 O O   . ASP A 1 290 ? 60.696 25.833 -5.264  1.00 13.98 ? 290  ASP A O   1 
ATOM   2305 C CB  . ASP A 1 290 ? 58.729 23.189 -5.779  1.00 17.20 ? 290  ASP A CB  1 
ATOM   2306 C CG  . ASP A 1 290 ? 58.825 21.667 -5.693  1.00 20.49 ? 290  ASP A CG  1 
ATOM   2307 O OD1 . ASP A 1 290 ? 58.269 20.998 -6.630  1.00 23.05 ? 290  ASP A OD1 1 
ATOM   2308 O OD2 . ASP A 1 290 ? 59.410 21.063 -4.757  1.00 22.38 ? 290  ASP A OD2 1 
ATOM   2309 N N   . ASN A 1 291 ? 58.461 26.100 -4.981  1.00 13.32 ? 291  ASN A N   1 
ATOM   2310 C CA  . ASN A 1 291 ? 58.548 27.533 -5.311  1.00 12.44 ? 291  ASN A CA  1 
ATOM   2311 C C   . ASN A 1 291 ? 59.394 28.294 -4.279  1.00 12.09 ? 291  ASN A C   1 
ATOM   2312 O O   . ASN A 1 291 ? 60.144 29.195 -4.650  1.00 12.10 ? 291  ASN A O   1 
ATOM   2313 C CB  . ASN A 1 291 ? 57.153 28.172 -5.462  1.00 12.91 ? 291  ASN A CB  1 
ATOM   2314 C CG  . ASN A 1 291 ? 56.449 27.766 -6.750  1.00 13.11 ? 291  ASN A CG  1 
ATOM   2315 O OD1 . ASN A 1 291 ? 55.171 27.624 -6.798  1.00 16.26 ? 291  ASN A OD1 1 
ATOM   2316 N ND2 . ASN A 1 291 ? 57.230 27.588 -7.808  1.00 11.81 ? 291  ASN A ND2 1 
ATOM   2317 N N   . PHE A 1 292 ? 59.304 27.930 -3.010  1.00 11.87 ? 292  PHE A N   1 
ATOM   2318 C CA  . PHE A 1 292 ? 60.110 28.618 -1.987  1.00 11.38 ? 292  PHE A CA  1 
ATOM   2319 C C   . PHE A 1 292 ? 61.594 28.302 -2.221  1.00 12.32 ? 292  PHE A C   1 
ATOM   2320 O O   . PHE A 1 292 ? 62.452 29.191 -2.114  1.00 12.05 ? 292  PHE A O   1 
ATOM   2321 C CB  . PHE A 1 292 ? 59.660 28.192 -0.570  1.00 11.49 ? 292  PHE A CB  1 
ATOM   2322 C CG  . PHE A 1 292 ? 60.378 28.903 0.548   1.00 11.29 ? 292  PHE A CG  1 
ATOM   2323 C CD1 . PHE A 1 292 ? 60.173 30.260 0.772   1.00 11.32 ? 292  PHE A CD1 1 
ATOM   2324 C CD2 . PHE A 1 292 ? 61.278 28.217 1.381   1.00 12.78 ? 292  PHE A CD2 1 
ATOM   2325 C CE1 . PHE A 1 292 ? 60.848 30.943 1.804   1.00 12.49 ? 292  PHE A CE1 1 
ATOM   2326 C CE2 . PHE A 1 292 ? 61.942 28.879 2.434   1.00 13.30 ? 292  PHE A CE2 1 
ATOM   2327 C CZ  . PHE A 1 292 ? 61.740 30.243 2.655   1.00 13.37 ? 292  PHE A CZ  1 
ATOM   2328 N N   . GLU A 1 293 ? 61.903 27.049 -2.552  1.00 12.82 ? 293  GLU A N   1 
ATOM   2329 C CA  . GLU A 1 293 ? 63.299 26.711 -2.868  1.00 12.87 ? 293  GLU A CA  1 
ATOM   2330 C C   . GLU A 1 293 ? 63.773 27.446 -4.123  1.00 12.80 ? 293  GLU A C   1 
ATOM   2331 O O   . GLU A 1 293 ? 64.942 27.812 -4.208  1.00 12.47 ? 293  GLU A O   1 
ATOM   2332 C CB  . GLU A 1 293 ? 63.480 25.208 -3.034  1.00 14.99 ? 293  GLU A CB  1 
ATOM   2333 C CG  . GLU A 1 293 ? 63.384 24.480 -1.708  1.00 16.63 ? 293  GLU A CG  1 
ATOM   2334 C CD  . GLU A 1 293 ? 63.616 22.979 -1.871  1.00 19.31 ? 293  GLU A CD  1 
ATOM   2335 O OE1 . GLU A 1 293 ? 64.194 22.379 -0.951  1.00 21.51 ? 293  GLU A OE1 1 
ATOM   2336 O OE2 . GLU A 1 293 ? 63.214 22.399 -2.905  1.00 19.80 ? 293  GLU A OE2 1 
ATOM   2337 N N   . GLN A 1 294 ? 62.888 27.649 -5.105  1.00 11.11 ? 294  GLN A N   1 
ATOM   2338 C CA  . GLN A 1 294 ? 63.303 28.428 -6.297  1.00 11.55 ? 294  GLN A CA  1 
ATOM   2339 C C   . GLN A 1 294 ? 63.621 29.875 -5.919  1.00 10.76 ? 294  GLN A C   1 
ATOM   2340 O O   . GLN A 1 294 ? 64.600 30.451 -6.429  1.00 11.03 ? 294  GLN A O   1 
ATOM   2341 C CB  . GLN A 1 294 ? 62.247 28.392 -7.408  1.00 12.37 ? 294  GLN A CB  1 
ATOM   2342 C CG  . GLN A 1 294 ? 62.206 26.968 -8.048  1.00 13.21 ? 294  GLN A CG  1 
ATOM   2343 C CD  . GLN A 1 294 ? 60.874 26.672 -8.718  1.00 17.83 ? 294  GLN A CD  1 
ATOM   2344 O OE1 . GLN A 1 294 ? 60.378 25.506 -8.679  1.00 22.10 ? 294  GLN A OE1 1 
ATOM   2345 N NE2 . GLN A 1 294 ? 60.286 27.687 -9.324  1.00 14.19 ? 294  GLN A NE2 1 
ATOM   2346 N N   . LEU A 1 295 ? 62.827 30.431 -4.999  1.00 10.45 ? 295  LEU A N   1 
ATOM   2347 C CA  . LEU A 1 295 ? 63.068 31.793 -4.488  1.00 10.17 ? 295  LEU A CA  1 
ATOM   2348 C C   . LEU A 1 295 ? 64.454 31.858 -3.815  1.00 10.43 ? 295  LEU A C   1 
ATOM   2349 O O   . LEU A 1 295 ? 65.275 32.737 -4.118  1.00 9.84  ? 295  LEU A O   1 
ATOM   2350 C CB  . LEU A 1 295 ? 61.931 32.185 -3.513  1.00 10.41 ? 295  LEU A CB  1 
ATOM   2351 C CG  . LEU A 1 295 ? 62.121 33.487 -2.740  1.00 11.24 ? 295  LEU A CG  1 
ATOM   2352 C CD1 . LEU A 1 295 ? 61.811 34.717 -3.611  1.00 12.80 ? 295  LEU A CD1 1 
ATOM   2353 C CD2 . LEU A 1 295 ? 61.203 33.425 -1.505  1.00 12.63 ? 295  LEU A CD2 1 
ATOM   2354 N N   . LEU A 1 296 ? 64.751 30.889 -2.950  1.00 11.01 ? 296  LEU A N   1 
ATOM   2355 C CA  . LEU A 1 296 ? 66.078 30.854 -2.316  1.00 10.79 ? 296  LEU A CA  1 
ATOM   2356 C C   . LEU A 1 296 ? 67.175 30.682 -3.370  1.00 11.29 ? 296  LEU A C   1 
ATOM   2357 O O   . LEU A 1 296 ? 68.271 31.268 -3.268  1.00 11.12 ? 296  LEU A O   1 
ATOM   2358 C CB  . LEU A 1 296 ? 66.173 29.676 -1.313  1.00 11.92 ? 296  LEU A CB  1 
ATOM   2359 C CG  . LEU A 1 296 ? 65.233 29.671 -0.121  1.00 15.25 ? 296  LEU A CG  1 
ATOM   2360 C CD1 . LEU A 1 296 ? 65.319 28.382 0.676   1.00 16.70 ? 296  LEU A CD1 1 
ATOM   2361 C CD2 . LEU A 1 296 ? 65.499 30.796 0.745   1.00 18.83 ? 296  LEU A CD2 1 
ATOM   2362 N N   . SER A 1 297 ? 66.913 29.859 -4.378  1.00 10.80 ? 297  SER A N   1 
ATOM   2363 C CA  . SER A 1 297 ? 67.948 29.602 -5.388  1.00 11.49 ? 297  SER A CA  1 
ATOM   2364 C C   . SER A 1 297 ? 68.271 30.840 -6.214  1.00 11.54 ? 297  SER A C   1 
ATOM   2365 O O   . SER A 1 297 ? 69.428 31.025 -6.635  1.00 11.38 ? 297  SER A O   1 
ATOM   2366 C CB  . SER A 1 297 ? 67.522 28.436 -6.291  1.00 13.21 ? 297  SER A CB  1 
ATOM   2367 O OG  . SER A 1 297 ? 67.365 27.245 -5.510  1.00 18.01 ? 297  SER A OG  1 
ATOM   2368 N N   . GLY A 1 298 ? 67.241 31.646 -6.526  1.00 10.87 ? 298  GLY A N   1 
ATOM   2369 C CA  . GLY A 1 298 ? 67.484 32.894 -7.254  1.00 11.04 ? 298  GLY A CA  1 
ATOM   2370 C C   . GLY A 1 298 ? 68.385 33.825 -6.448  1.00 10.62 ? 298  GLY A C   1 
ATOM   2371 O O   . GLY A 1 298 ? 69.306 34.462 -6.968  1.00 9.92  ? 298  GLY A O   1 
ATOM   2372 N N   . ALA A 1 299 ? 68.087 33.915 -5.164  1.00 10.09 ? 299  ALA A N   1 
ATOM   2373 C CA  . ALA A 1 299 ? 68.952 34.692 -4.266  1.00 9.77  ? 299  ALA A CA  1 
ATOM   2374 C C   . ALA A 1 299 ? 70.390 34.116 -4.269  1.00 10.24 ? 299  ALA A C   1 
ATOM   2375 O O   . ALA A 1 299 ? 71.359 34.854 -4.327  1.00 10.18 ? 299  ALA A O   1 
ATOM   2376 C CB  . ALA A 1 299 ? 68.399 34.692 -2.850  1.00 10.33 ? 299  ALA A CB  1 
ATOM   2377 N N   . HIS A 1 300 ? 70.510 32.787 -4.209  1.00 10.68 ? 300  HIS A N   1 
ATOM   2378 C CA  . HIS A 1 300 ? 71.831 32.178 -4.238  1.00 10.53 ? 300  HIS A CA  1 
ATOM   2379 C C   . HIS A 1 300 ? 72.608 32.497 -5.517  1.00 10.33 ? 300  HIS A C   1 
ATOM   2380 O O   . HIS A 1 300 ? 73.819 32.689 -5.463  1.00 10.46 ? 300  HIS A O   1 
ATOM   2381 C CB  . HIS A 1 300 ? 71.723 30.647 -4.016  1.00 11.16 ? 300  HIS A CB  1 
ATOM   2382 C CG  . HIS A 1 300 ? 73.045 29.995 -3.739  1.00 11.65 ? 300  HIS A CG  1 
ATOM   2383 N ND1 . HIS A 1 300 ? 73.516 28.880 -4.422  1.00 14.53 ? 300  HIS A ND1 1 
ATOM   2384 C CD2 . HIS A 1 300 ? 74.000 30.317 -2.834  1.00 8.75  ? 300  HIS A CD2 1 
ATOM   2385 C CE1 . HIS A 1 300 ? 74.705 28.541 -3.931  1.00 8.64  ? 300  HIS A CE1 1 
ATOM   2386 N NE2 . HIS A 1 300 ? 75.029 29.410 -2.993  1.00 14.26 ? 300  HIS A NE2 1 
ATOM   2387 N N   . TRP A 1 301 ? 71.920 32.515 -6.658  1.00 9.33  ? 301  TRP A N   1 
ATOM   2388 C CA  . TRP A 1 301 ? 72.543 32.885 -7.911  1.00 10.19 ? 301  TRP A CA  1 
ATOM   2389 C C   . TRP A 1 301 ? 73.127 34.292 -7.792  1.00 10.69 ? 301  TRP A C   1 
ATOM   2390 O O   . TRP A 1 301 ? 74.314 34.536 -8.125  1.00 10.84 ? 301  TRP A O   1 
ATOM   2391 C CB  . TRP A 1 301 ? 71.514 32.840 -9.069  1.00 10.59 ? 301  TRP A CB  1 
ATOM   2392 C CG  . TRP A 1 301 ? 72.244 33.048 -10.390 1.00 11.86 ? 301  TRP A CG  1 
ATOM   2393 C CD1 . TRP A 1 301 ? 72.734 32.069 -11.248 1.00 13.95 ? 301  TRP A CD1 1 
ATOM   2394 C CD2 . TRP A 1 301 ? 72.616 34.311 -10.968 1.00 12.34 ? 301  TRP A CD2 1 
ATOM   2395 N NE1 . TRP A 1 301 ? 73.390 32.660 -12.306 1.00 14.57 ? 301  TRP A NE1 1 
ATOM   2396 C CE2 . TRP A 1 301 ? 73.341 34.031 -12.157 1.00 13.81 ? 301  TRP A CE2 1 
ATOM   2397 C CE3 . TRP A 1 301 ? 72.427 35.652 -10.593 1.00 12.71 ? 301  TRP A CE3 1 
ATOM   2398 C CZ2 . TRP A 1 301 ? 73.860 35.032 -12.967 1.00 14.96 ? 301  TRP A CZ2 1 
ATOM   2399 C CZ3 . TRP A 1 301 ? 72.975 36.672 -11.415 1.00 13.87 ? 301  TRP A CZ3 1 
ATOM   2400 C CH2 . TRP A 1 301 ? 73.671 36.348 -12.582 1.00 14.35 ? 301  TRP A CH2 1 
ATOM   2401 N N   . MET A 1 302 ? 72.321 35.211 -7.276  1.00 10.11 ? 302  MET A N   1 
ATOM   2402 C CA  . MET A 1 302 ? 72.778 36.599 -7.175  1.00 10.57 ? 302  MET A CA  1 
ATOM   2403 C C   . MET A 1 302 ? 73.919 36.744 -6.155  1.00 11.00 ? 302  MET A C   1 
ATOM   2404 O O   . MET A 1 302 ? 74.810 37.571 -6.320  1.00 11.35 ? 302  MET A O   1 
ATOM   2405 C CB  . MET A 1 302 ? 71.575 37.502 -6.799  1.00 10.06 ? 302  MET A CB  1 
ATOM   2406 C CG  . MET A 1 302 ? 71.887 39.015 -6.758  1.00 11.12 ? 302  MET A CG  1 
ATOM   2407 S SD  . MET A 1 302 ? 72.474 39.712 -8.337  1.00 11.44 ? 302  MET A SD  1 
ATOM   2408 C CE  . MET A 1 302 ? 71.015 39.523 -9.347  1.00 11.85 ? 302  MET A CE  1 
ATOM   2409 N N   . ASP A 1 303 ? 73.876 35.927 -5.102  1.00 10.04 ? 303  ASP A N   1 
ATOM   2410 C CA  . ASP A 1 303 ? 74.951 35.964 -4.120  1.00 10.30 ? 303  ASP A CA  1 
ATOM   2411 C C   . ASP A 1 303 ? 76.250 35.577 -4.808  1.00 10.96 ? 303  ASP A C   1 
ATOM   2412 O O   . ASP A 1 303 ? 77.293 36.161 -4.535  1.00 11.84 ? 303  ASP A O   1 
ATOM   2413 C CB  . ASP A 1 303 ? 74.703 34.935 -3.033  1.00 10.99 ? 303  ASP A CB  1 
ATOM   2414 C CG  . ASP A 1 303 ? 73.525 35.309 -2.120  1.00 11.45 ? 303  ASP A CG  1 
ATOM   2415 O OD1 . ASP A 1 303 ? 73.120 36.492 -2.095  1.00 10.36 ? 303  ASP A OD1 1 
ATOM   2416 O OD2 . ASP A 1 303 ? 72.951 34.459 -1.387  1.00 11.36 ? 303  ASP A OD2 1 
ATOM   2417 N N   . GLN A 1 304 ? 76.188 34.568 -5.682  1.00 11.04 ? 304  GLN A N   1 
ATOM   2418 C CA  . GLN A 1 304 ? 77.423 34.144 -6.366  1.00 10.78 ? 304  GLN A CA  1 
ATOM   2419 C C   . GLN A 1 304 ? 77.872 35.210 -7.359  1.00 11.35 ? 304  GLN A C   1 
ATOM   2420 O O   . GLN A 1 304 ? 79.076 35.432 -7.514  1.00 12.28 ? 304  GLN A O   1 
ATOM   2421 C CB  . GLN A 1 304 ? 77.201 32.796 -7.063  1.00 11.01 ? 304  GLN A CB  1 
ATOM   2422 C CG  . GLN A 1 304 ? 77.082 31.646 -6.034  1.00 12.03 ? 304  GLN A CG  1 
ATOM   2423 C CD  . GLN A 1 304 ? 76.447 30.418 -6.647  1.00 13.76 ? 304  GLN A CD  1 
ATOM   2424 O OE1 . GLN A 1 304 ? 75.214 30.357 -6.806  1.00 17.13 ? 304  GLN A OE1 1 
ATOM   2425 N NE2 . GLN A 1 304 ? 77.257 29.440 -6.973  1.00 10.56 ? 304  GLN A NE2 1 
ATOM   2426 N N   . HIS A 1 305 ? 76.924 35.863 -8.027  1.00 10.81 ? 305  HIS A N   1 
ATOM   2427 C CA  . HIS A 1 305 ? 77.281 36.959 -8.918  1.00 10.67 ? 305  HIS A CA  1 
ATOM   2428 C C   . HIS A 1 305 ? 78.002 38.051 -8.131  1.00 11.06 ? 305  HIS A C   1 
ATOM   2429 O O   . HIS A 1 305 ? 79.070 38.556 -8.530  1.00 11.69 ? 305  HIS A O   1 
ATOM   2430 C CB  . HIS A 1 305 ? 76.026 37.552 -9.610  1.00 10.61 ? 305  HIS A CB  1 
ATOM   2431 C CG  . HIS A 1 305 ? 76.305 38.842 -10.327 1.00 10.45 ? 305  HIS A CG  1 
ATOM   2432 N ND1 . HIS A 1 305 ? 76.836 38.884 -11.602 1.00 13.14 ? 305  HIS A ND1 1 
ATOM   2433 C CD2 . HIS A 1 305 ? 76.135 40.138 -9.939  1.00 11.55 ? 305  HIS A CD2 1 
ATOM   2434 C CE1 . HIS A 1 305 ? 76.976 40.151 -11.972 1.00 13.01 ? 305  HIS A CE1 1 
ATOM   2435 N NE2 . HIS A 1 305 ? 76.561 40.932 -10.980 1.00 11.68 ? 305  HIS A NE2 1 
ATOM   2436 N N   . PHE A 1 306 ? 77.408 38.436 -7.006  1.00 10.46 ? 306  PHE A N   1 
ATOM   2437 C CA  . PHE A 1 306 ? 77.982 39.530 -6.214  1.00 11.31 ? 306  PHE A CA  1 
ATOM   2438 C C   . PHE A 1 306 ? 79.345 39.173 -5.661  1.00 11.82 ? 306  PHE A C   1 
ATOM   2439 O O   . PHE A 1 306 ? 80.243 40.009 -5.612  1.00 12.19 ? 306  PHE A O   1 
ATOM   2440 C CB  . PHE A 1 306 ? 77.024 39.844 -5.058  1.00 10.59 ? 306  PHE A CB  1 
ATOM   2441 C CG  . PHE A 1 306 ? 77.551 40.843 -4.042  1.00 10.73 ? 306  PHE A CG  1 
ATOM   2442 C CD1 . PHE A 1 306 ? 78.085 42.074 -4.427  1.00 11.74 ? 306  PHE A CD1 1 
ATOM   2443 C CD2 . PHE A 1 306 ? 77.446 40.552 -2.677  1.00 11.01 ? 306  PHE A CD2 1 
ATOM   2444 C CE1 . PHE A 1 306 ? 78.517 42.998 -3.476  1.00 12.26 ? 306  PHE A CE1 1 
ATOM   2445 C CE2 . PHE A 1 306 ? 77.861 41.475 -1.719  1.00 10.45 ? 306  PHE A CE2 1 
ATOM   2446 C CZ  . PHE A 1 306 ? 78.423 42.706 -2.134  1.00 12.23 ? 306  PHE A CZ  1 
ATOM   2447 N N   . ARG A 1 307 ? 79.487 37.918 -5.237  1.00 11.92 ? 307  ARG A N   1 
ATOM   2448 C CA  . ARG A 1 307 ? 80.728 37.503 -4.607  1.00 13.50 ? 307  ARG A CA  1 
ATOM   2449 C C   . ARG A 1 307 ? 81.891 37.333 -5.581  1.00 13.64 ? 307  ARG A C   1 
ATOM   2450 O O   . ARG A 1 307 ? 83.042 37.513 -5.189  1.00 15.54 ? 307  ARG A O   1 
ATOM   2451 C CB  . ARG A 1 307 ? 80.521 36.181 -3.877  1.00 12.93 ? 307  ARG A CB  1 
ATOM   2452 C CG  . ARG A 1 307 ? 81.686 35.867 -2.941  1.00 14.75 ? 307  ARG A CG  1 
ATOM   2453 C CD  . ARG A 1 307 ? 81.350 34.818 -1.999  1.00 15.09 ? 307  ARG A CD  1 
ATOM   2454 N NE  . ARG A 1 307 ? 82.353 34.710 -0.956  1.00 13.57 ? 307  ARG A NE  1 
ATOM   2455 C CZ  . ARG A 1 307 ? 82.269 33.798 -0.003  1.00 14.76 ? 307  ARG A CZ  1 
ATOM   2456 N NH1 . ARG A 1 307 ? 81.257 32.914 -0.019  1.00 14.16 ? 307  ARG A NH1 1 
ATOM   2457 N NH2 . ARG A 1 307 ? 83.208 33.738 0.942   1.00 15.71 ? 307  ARG A NH2 1 
ATOM   2458 N N   . THR A 1 308 ? 81.619 36.971 -6.817  1.00 13.83 ? 308  THR A N   1 
ATOM   2459 C CA  . THR A 1 308 ? 82.727 36.605 -7.687  1.00 15.14 ? 308  THR A CA  1 
ATOM   2460 C C   . THR A 1 308 ? 82.960 37.494 -8.930  1.00 15.24 ? 308  THR A C   1 
ATOM   2461 O O   . THR A 1 308 ? 83.971 37.361 -9.620  1.00 16.79 ? 308  THR A O   1 
ATOM   2462 C CB  . THR A 1 308 ? 82.597 35.114 -8.005  1.00 17.02 ? 308  THR A CB  1 
ATOM   2463 O OG1 . THR A 1 308 ? 81.369 34.898 -8.685  1.00 16.29 ? 308  THR A OG1 1 
ATOM   2464 C CG2 . THR A 1 308 ? 82.429 34.289 -6.695  1.00 19.72 ? 308  THR A CG2 1 
ATOM   2465 N N   . THR A 1 309 ? 82.077 38.467 -9.176  1.00 14.66 ? 309  THR A N   1 
ATOM   2466 C CA  . THR A 1 309 ? 82.216 39.318 -10.354 1.00 13.14 ? 309  THR A CA  1 
ATOM   2467 C C   . THR A 1 309 ? 83.106 40.550 -10.101 1.00 13.56 ? 309  THR A C   1 
ATOM   2468 O O   . THR A 1 309 ? 82.927 41.223 -9.086  1.00 13.84 ? 309  THR A O   1 
ATOM   2469 C CB  . THR A 1 309 ? 80.810 39.744 -10.789 1.00 12.91 ? 309  THR A CB  1 
ATOM   2470 O OG1 . THR A 1 309 ? 80.045 38.549 -11.093 1.00 14.22 ? 309  THR A OG1 1 
ATOM   2471 C CG2 . THR A 1 309 ? 80.851 40.505 -12.109 1.00 13.91 ? 309  THR A CG2 1 
ATOM   2472 N N   . PRO A 1 310 ? 84.058 40.855 -10.990 1.00 12.85 ? 310  PRO A N   1 
ATOM   2473 C CA  . PRO A 1 310 ? 84.854 42.080 -10.829 1.00 13.23 ? 310  PRO A CA  1 
ATOM   2474 C C   . PRO A 1 310 ? 83.927 43.278 -10.645 1.00 13.19 ? 310  PRO A C   1 
ATOM   2475 O O   . PRO A 1 310 ? 82.875 43.376 -11.284 1.00 12.47 ? 310  PRO A O   1 
ATOM   2476 C CB  . PRO A 1 310 ? 85.652 42.186 -12.131 1.00 14.14 ? 310  PRO A CB  1 
ATOM   2477 C CG  . PRO A 1 310 ? 85.831 40.750 -12.566 1.00 14.29 ? 310  PRO A CG  1 
ATOM   2478 C CD  . PRO A 1 310 ? 84.510 40.047 -12.142 1.00 14.14 ? 310  PRO A CD  1 
ATOM   2479 N N   . LEU A 1 311 ? 84.346 44.201 -9.801  1.00 14.48 ? 311  LEU A N   1 
ATOM   2480 C CA  . LEU A 1 311 ? 83.492 45.316 -9.404  1.00 14.57 ? 311  LEU A CA  1 
ATOM   2481 C C   . LEU A 1 311 ? 82.901 46.082 -10.570 1.00 14.11 ? 311  LEU A C   1 
ATOM   2482 O O   . LEU A 1 311 ? 81.713 46.459 -10.517 1.00 13.88 ? 311  LEU A O   1 
ATOM   2483 C CB  . LEU A 1 311 ? 84.261 46.285 -8.507  1.00 15.33 ? 311  LEU A CB  1 
ATOM   2484 C CG  . LEU A 1 311 ? 84.793 45.694 -7.208  1.00 17.42 ? 311  LEU A CG  1 
ATOM   2485 C CD1 . LEU A 1 311 ? 85.672 46.709 -6.490  1.00 21.41 ? 311  LEU A CD1 1 
ATOM   2486 C CD2 . LEU A 1 311 ? 83.623 45.274 -6.309  1.00 19.03 ? 311  LEU A CD2 1 
ATOM   2487 N N   . GLU A 1 312 ? 83.692 46.293 -11.623 1.00 14.84 ? 312  GLU A N   1 
ATOM   2488 C CA  . GLU A 1 312 ? 83.228 47.150 -12.717 1.00 15.06 ? 312  GLU A CA  1 
ATOM   2489 C C   . GLU A 1 312 ? 82.065 46.572 -13.509 1.00 14.99 ? 312  GLU A C   1 
ATOM   2490 O O   . GLU A 1 312 ? 81.482 47.267 -14.342 1.00 14.11 ? 312  GLU A O   1 
ATOM   2491 C CB  . GLU A 1 312 ? 84.376 47.494 -13.669 1.00 17.32 ? 312  GLU A CB  1 
ATOM   2492 C CG  . GLU A 1 312 ? 84.865 46.290 -14.431 1.00 20.47 ? 312  GLU A CG  1 
ATOM   2493 C CD  . GLU A 1 312 ? 85.968 45.528 -13.736 1.00 26.75 ? 312  GLU A CD  1 
ATOM   2494 O OE1 . GLU A 1 312 ? 86.251 45.775 -12.517 1.00 25.55 ? 312  GLU A OE1 1 
ATOM   2495 O OE2 . GLU A 1 312 ? 86.581 44.670 -14.450 1.00 31.63 ? 312  GLU A OE2 1 
ATOM   2496 N N   . LYS A 1 313 ? 81.769 45.289 -13.292 1.00 14.05 ? 313  LYS A N   1 
ATOM   2497 C CA  . LYS A 1 313 ? 80.672 44.621 -13.976 1.00 15.65 ? 313  LYS A CA  1 
ATOM   2498 C C   . LYS A 1 313 ? 79.751 43.871 -13.005 1.00 14.00 ? 313  LYS A C   1 
ATOM   2499 O O   . LYS A 1 313 ? 78.996 42.986 -13.378 1.00 14.92 ? 313  LYS A O   1 
ATOM   2500 C CB  . LYS A 1 313 ? 81.215 43.703 -15.064 1.00 17.69 ? 313  LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 313 ? 81.842 44.526 -16.184 1.00 25.42 ? 313  LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 313 ? 82.334 43.682 -17.333 1.00 35.11 ? 313  LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 313 ? 82.866 44.585 -18.490 1.00 39.44 ? 313  LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 313 ? 83.480 43.732 -19.569 1.00 43.98 ? 313  LYS A NZ  1 
ATOM   2505 N N   . ASN A 1 314 ? 79.761 44.318 -11.764 1.00 12.43 ? 314  ASN A N   1 
ATOM   2506 C CA  . ASN A 1 314 ? 79.035 43.671 -10.660 1.00 11.20 ? 314  ASN A CA  1 
ATOM   2507 C C   . ASN A 1 314 ? 77.761 44.473 -10.387 1.00 10.93 ? 314  ASN A C   1 
ATOM   2508 O O   . ASN A 1 314 ? 77.830 45.612 -9.957  1.00 11.40 ? 314  ASN A O   1 
ATOM   2509 C CB  . ASN A 1 314 ? 80.007 43.647 -9.464  1.00 10.76 ? 314  ASN A CB  1 
ATOM   2510 C CG  . ASN A 1 314 ? 79.491 42.854 -8.282  1.00 12.42 ? 314  ASN A CG  1 
ATOM   2511 O OD1 . ASN A 1 314 ? 78.348 43.035 -7.860  1.00 13.32 ? 314  ASN A OD1 1 
ATOM   2512 N ND2 . ASN A 1 314 ? 80.357 41.991 -7.706  1.00 11.31 ? 314  ASN A ND2 1 
ATOM   2513 N N   . ALA A 1 315 ? 76.601 43.897 -10.672 1.00 10.39 ? 315  ALA A N   1 
ATOM   2514 C CA  . ALA A 1 315 ? 75.359 44.693 -10.662 1.00 10.69 ? 315  ALA A CA  1 
ATOM   2515 C C   . ALA A 1 315 ? 75.056 45.391 -9.333  1.00 11.08 ? 315  ALA A C   1 
ATOM   2516 O O   . ALA A 1 315 ? 74.813 46.610 -9.333  1.00 11.41 ? 315  ALA A O   1 
ATOM   2517 C CB  . ALA A 1 315 ? 74.146 43.860 -11.157 1.00 12.57 ? 315  ALA A CB  1 
ATOM   2518 N N   . PRO A 1 316 ? 75.030 44.676 -8.204  1.00 10.31 ? 316  PRO A N   1 
ATOM   2519 C CA  . PRO A 1 316 ? 74.761 45.397 -6.946  1.00 11.38 ? 316  PRO A CA  1 
ATOM   2520 C C   . PRO A 1 316 ? 75.785 46.502 -6.677  1.00 11.26 ? 316  PRO A C   1 
ATOM   2521 O O   . PRO A 1 316 ? 75.451 47.534 -6.092  1.00 10.36 ? 316  PRO A O   1 
ATOM   2522 C CB  . PRO A 1 316 ? 74.841 44.314 -5.847  1.00 11.96 ? 316  PRO A CB  1 
ATOM   2523 C CG  . PRO A 1 316 ? 74.943 43.002 -6.536  1.00 13.03 ? 316  PRO A CG  1 
ATOM   2524 C CD  . PRO A 1 316 ? 75.161 43.210 -8.024  1.00 10.84 ? 316  PRO A CD  1 
ATOM   2525 N N   . VAL A 1 317 ? 77.060 46.255 -7.036  1.00 10.50 ? 317  VAL A N   1 
ATOM   2526 C CA  . VAL A 1 317 ? 78.075 47.259 -6.801  1.00 11.15 ? 317  VAL A CA  1 
ATOM   2527 C C   . VAL A 1 317 ? 77.788 48.514 -7.628  1.00 10.57 ? 317  VAL A C   1 
ATOM   2528 O O   . VAL A 1 317 ? 77.893 49.647 -7.124  1.00 10.58 ? 317  VAL A O   1 
ATOM   2529 C CB  . VAL A 1 317 ? 79.507 46.696 -7.112  1.00 10.56 ? 317  VAL A CB  1 
ATOM   2530 C CG1 . VAL A 1 317 ? 80.531 47.805 -7.116  1.00 11.81 ? 317  VAL A CG1 1 
ATOM   2531 C CG2 . VAL A 1 317 ? 79.865 45.597 -6.065  1.00 11.99 ? 317  VAL A CG2 1 
ATOM   2532 N N   . LEU A 1 318 ? 77.437 48.333 -8.899  1.00 10.53 ? 318  LEU A N   1 
ATOM   2533 C CA  . LEU A 1 318 ? 77.233 49.504 -9.738  1.00 10.93 ? 318  LEU A CA  1 
ATOM   2534 C C   . LEU A 1 318 ? 75.967 50.256 -9.286  1.00 10.77 ? 318  LEU A C   1 
ATOM   2535 O O   . LEU A 1 318 ? 75.979 51.485 -9.256  1.00 10.72 ? 318  LEU A O   1 
ATOM   2536 C CB  . LEU A 1 318 ? 77.137 49.125 -11.196 1.00 11.70 ? 318  LEU A CB  1 
ATOM   2537 C CG  . LEU A 1 318 ? 78.436 48.537 -11.778 1.00 12.86 ? 318  LEU A CG  1 
ATOM   2538 C CD1 . LEU A 1 318 ? 78.219 48.276 -13.259 1.00 19.12 ? 318  LEU A CD1 1 
ATOM   2539 C CD2 . LEU A 1 318 ? 79.694 49.407 -11.560 1.00 15.90 ? 318  LEU A CD2 1 
ATOM   2540 N N   . LEU A 1 319 ? 74.896 49.532 -8.920  1.00 10.08 ? 319  LEU A N   1 
ATOM   2541 C CA  . LEU A 1 319 ? 73.718 50.243 -8.409  1.00 9.97  ? 319  LEU A CA  1 
ATOM   2542 C C   . LEU A 1 319 ? 74.094 51.014 -7.153  1.00 10.02 ? 319  LEU A C   1 
ATOM   2543 O O   . LEU A 1 319 ? 73.654 52.162 -6.949  1.00 10.05 ? 319  LEU A O   1 
ATOM   2544 C CB  . LEU A 1 319 ? 72.579 49.285 -8.096  1.00 10.83 ? 319  LEU A CB  1 
ATOM   2545 C CG  . LEU A 1 319 ? 71.987 48.609 -9.333  1.00 11.48 ? 319  LEU A CG  1 
ATOM   2546 C CD1 . LEU A 1 319 ? 70.989 47.566 -8.847  1.00 13.24 ? 319  LEU A CD1 1 
ATOM   2547 C CD2 . LEU A 1 319 ? 71.288 49.585 -10.295 1.00 12.56 ? 319  LEU A CD2 1 
ATOM   2548 N N   . ALA A 1 320 ? 74.889 50.395 -6.283  1.00 8.90  ? 320  ALA A N   1 
ATOM   2549 C CA  . ALA A 1 320 ? 75.306 51.107 -5.092  1.00 9.90  ? 320  ALA A CA  1 
ATOM   2550 C C   . ALA A 1 320 ? 76.080 52.368 -5.410  1.00 10.04 ? 320  ALA A C   1 
ATOM   2551 O O   . ALA A 1 320 ? 75.851 53.416 -4.784  1.00 9.12  ? 320  ALA A O   1 
ATOM   2552 C CB  . ALA A 1 320 ? 76.144 50.190 -4.200  1.00 10.19 ? 320  ALA A CB  1 
ATOM   2553 N N   . LEU A 1 321 ? 77.054 52.233 -6.310  1.00 9.73  ? 321  LEU A N   1 
ATOM   2554 C CA  . LEU A 1 321 ? 77.927 53.356 -6.636  1.00 10.24 ? 321  LEU A CA  1 
ATOM   2555 C C   . LEU A 1 321 ? 77.177 54.533 -7.300  1.00 10.11 ? 321  LEU A C   1 
ATOM   2556 O O   . LEU A 1 321 ? 77.469 55.706 -7.011  1.00 9.53  ? 321  LEU A O   1 
ATOM   2557 C CB  . LEU A 1 321 ? 79.075 52.878 -7.548  1.00 10.59 ? 321  LEU A CB  1 
ATOM   2558 C CG  . LEU A 1 321 ? 80.103 52.046 -6.783  1.00 10.87 ? 321  LEU A CG  1 
ATOM   2559 C CD1 . LEU A 1 321 ? 81.107 51.436 -7.794  1.00 12.08 ? 321  LEU A CD1 1 
ATOM   2560 C CD2 . LEU A 1 321 ? 80.864 52.873 -5.705  1.00 12.04 ? 321  LEU A CD2 1 
ATOM   2561 N N   . LEU A 1 322 ? 76.203 54.213 -8.146  1.00 9.63  ? 322  LEU A N   1 
ATOM   2562 C CA  . LEU A 1 322 ? 75.410 55.283 -8.759  1.00 9.64  ? 322  LEU A CA  1 
ATOM   2563 C C   . LEU A 1 322 ? 74.672 56.013 -7.634  1.00 10.30 ? 322  LEU A C   1 
ATOM   2564 O O   . LEU A 1 322 ? 74.509 57.225 -7.664  1.00 10.11 ? 322  LEU A O   1 
ATOM   2565 C CB  . LEU A 1 322 ? 74.425 54.699 -9.783  1.00 9.98  ? 322  LEU A CB  1 
ATOM   2566 C CG  . LEU A 1 322 ? 75.136 54.175 -11.043 1.00 11.32 ? 322  LEU A CG  1 
ATOM   2567 C CD1 . LEU A 1 322 ? 74.199 53.211 -11.796 1.00 11.75 ? 322  LEU A CD1 1 
ATOM   2568 C CD2 . LEU A 1 322 ? 75.533 55.334 -11.956 1.00 11.28 ? 322  LEU A CD2 1 
ATOM   2569 N N   . GLY A 1 323 ? 74.189 55.257 -6.658  1.00 9.87  ? 323  GLY A N   1 
ATOM   2570 C CA  . GLY A 1 323 ? 73.538 55.876 -5.503  1.00 9.62  ? 323  GLY A CA  1 
ATOM   2571 C C   . GLY A 1 323 ? 74.484 56.775 -4.715  1.00 10.48 ? 323  GLY A C   1 
ATOM   2572 O O   . GLY A 1 323 ? 74.089 57.847 -4.272  1.00 10.38 ? 323  GLY A O   1 
ATOM   2573 N N   . ILE A 1 324 ? 75.725 56.337 -4.508  1.00 9.83  ? 324  ILE A N   1 
ATOM   2574 C CA  . ILE A 1 324 ? 76.705 57.180 -3.806  1.00 10.60 ? 324  ILE A CA  1 
ATOM   2575 C C   . ILE A 1 324 ? 76.891 58.498 -4.579  1.00 10.56 ? 324  ILE A C   1 
ATOM   2576 O O   . ILE A 1 324 ? 76.934 59.584 -3.980  1.00 10.67 ? 324  ILE A O   1 
ATOM   2577 C CB  . ILE A 1 324 ? 78.057 56.444 -3.677  1.00 10.71 ? 324  ILE A CB  1 
ATOM   2578 C CG1 . ILE A 1 324 ? 77.929 55.220 -2.787  1.00 11.59 ? 324  ILE A CG1 1 
ATOM   2579 C CG2 . ILE A 1 324 ? 79.142 57.383 -3.140  1.00 11.93 ? 324  ILE A CG2 1 
ATOM   2580 C CD1 . ILE A 1 324 ? 77.474 55.521 -1.350  1.00 12.05 ? 324  ILE A CD1 1 
ATOM   2581 N N   . TRP A 1 325 ? 76.975 58.404 -5.899  1.00 10.04 ? 325  TRP A N   1 
ATOM   2582 C CA  . TRP A 1 325 ? 77.154 59.593 -6.733  1.00 10.58 ? 325  TRP A CA  1 
ATOM   2583 C C   . TRP A 1 325 ? 75.975 60.562 -6.515  1.00 10.99 ? 325  TRP A C   1 
ATOM   2584 O O   . TRP A 1 325 ? 76.181 61.759 -6.326  1.00 10.09 ? 325  TRP A O   1 
ATOM   2585 C CB  . TRP A 1 325 ? 77.240 59.117 -8.197  1.00 11.08 ? 325  TRP A CB  1 
ATOM   2586 C CG  . TRP A 1 325 ? 77.389 60.093 -9.318  1.00 11.35 ? 325  TRP A CG  1 
ATOM   2587 C CD1 . TRP A 1 325 ? 76.561 60.226 -10.384 1.00 12.36 ? 325  TRP A CD1 1 
ATOM   2588 C CD2 . TRP A 1 325 ? 78.482 61.003 -9.537  1.00 11.65 ? 325  TRP A CD2 1 
ATOM   2589 N NE1 . TRP A 1 325 ? 77.040 61.187 -11.248 1.00 12.00 ? 325  TRP A NE1 1 
ATOM   2590 C CE2 . TRP A 1 325 ? 78.246 61.645 -10.768 1.00 13.21 ? 325  TRP A CE2 1 
ATOM   2591 C CE3 . TRP A 1 325 ? 79.643 61.323 -8.821  1.00 13.18 ? 325  TRP A CE3 1 
ATOM   2592 C CZ2 . TRP A 1 325 ? 79.111 62.612 -11.285 1.00 14.67 ? 325  TRP A CZ2 1 
ATOM   2593 C CZ3 . TRP A 1 325 ? 80.507 62.300 -9.351  1.00 15.06 ? 325  TRP A CZ3 1 
ATOM   2594 C CH2 . TRP A 1 325 ? 80.230 62.913 -10.558 1.00 14.84 ? 325  TRP A CH2 1 
ATOM   2595 N N   . TYR A 1 326 ? 74.740 60.053 -6.552  1.00 9.95  ? 326  TYR A N   1 
ATOM   2596 C CA  . TYR A 1 326 ? 73.608 60.953 -6.385  1.00 10.17 ? 326  TYR A CA  1 
ATOM   2597 C C   . TYR A 1 326 ? 73.418 61.464 -4.975  1.00 10.50 ? 326  TYR A C   1 
ATOM   2598 O O   . TYR A 1 326 ? 72.989 62.601 -4.797  1.00 10.34 ? 326  TYR A O   1 
ATOM   2599 C CB  . TYR A 1 326 ? 72.314 60.338 -6.917  1.00 10.43 ? 326  TYR A CB  1 
ATOM   2600 C CG  . TYR A 1 326 ? 72.389 60.099 -8.405  1.00 9.70  ? 326  TYR A CG  1 
ATOM   2601 C CD1 . TYR A 1 326 ? 72.707 61.146 -9.296  1.00 10.52 ? 326  TYR A CD1 1 
ATOM   2602 C CD2 . TYR A 1 326 ? 72.126 58.850 -8.927  1.00 9.63  ? 326  TYR A CD2 1 
ATOM   2603 C CE1 . TYR A 1 326 ? 72.772 60.932 -10.673 1.00 11.61 ? 326  TYR A CE1 1 
ATOM   2604 C CE2 . TYR A 1 326 ? 72.199 58.624 -10.294 1.00 10.11 ? 326  TYR A CE2 1 
ATOM   2605 C CZ  . TYR A 1 326 ? 72.497 59.680 -11.162 1.00 10.51 ? 326  TYR A CZ  1 
ATOM   2606 O OH  . TYR A 1 326 ? 72.579 59.463 -12.512 1.00 11.45 ? 326  TYR A OH  1 
ATOM   2607 N N   . ILE A 1 327 ? 73.777 60.650 -3.986  1.00 9.94  ? 327  ILE A N   1 
ATOM   2608 C CA  . ILE A 1 327 ? 73.629 61.037 -2.588  1.00 10.38 ? 327  ILE A CA  1 
ATOM   2609 C C   . ILE A 1 327 ? 74.729 61.951 -2.115  1.00 11.40 ? 327  ILE A C   1 
ATOM   2610 O O   . ILE A 1 327 ? 74.461 63.043 -1.626  1.00 11.78 ? 327  ILE A O   1 
ATOM   2611 C CB  . ILE A 1 327 ? 73.565 59.762 -1.697  1.00 10.19 ? 327  ILE A CB  1 
ATOM   2612 C CG1 . ILE A 1 327 ? 72.200 59.110 -1.937  1.00 10.00 ? 327  ILE A CG1 1 
ATOM   2613 C CG2 . ILE A 1 327 ? 73.693 60.113 -0.219  1.00 11.65 ? 327  ILE A CG2 1 
ATOM   2614 C CD1 . ILE A 1 327 ? 72.140 57.587 -1.472  1.00 10.57 ? 327  ILE A CD1 1 
ATOM   2615 N N   . ASN A 1 328 ? 75.972 61.528 -2.308  1.00 11.79 ? 328  ASN A N   1 
ATOM   2616 C CA  . ASN A 1 328 ? 77.081 62.272 -1.754  1.00 11.92 ? 328  ASN A CA  1 
ATOM   2617 C C   . ASN A 1 328 ? 77.659 63.356 -2.642  1.00 12.37 ? 328  ASN A C   1 
ATOM   2618 O O   . ASN A 1 328 ? 78.395 64.213 -2.133  1.00 13.91 ? 328  ASN A O   1 
ATOM   2619 C CB  . ASN A 1 328 ? 78.176 61.325 -1.306  1.00 11.22 ? 328  ASN A CB  1 
ATOM   2620 C CG  . ASN A 1 328 ? 77.719 60.425 -0.171  1.00 10.99 ? 328  ASN A CG  1 
ATOM   2621 O OD1 . ASN A 1 328 ? 77.439 60.894 0.962   1.00 15.08 ? 328  ASN A OD1 1 
ATOM   2622 N ND2 . ASN A 1 328 ? 77.634 59.145 -0.453  1.00 8.56  ? 328  ASN A ND2 1 
ATOM   2623 N N   . CYS A 1 329 ? 77.346 63.347 -3.927  1.00 11.90 ? 329  CYS A N   1 
ATOM   2624 C CA  . CYS A 1 329 ? 77.805 64.431 -4.801  1.00 12.50 ? 329  CYS A CA  1 
ATOM   2625 C C   . CYS A 1 329 ? 76.618 65.320 -5.152  1.00 12.41 ? 329  CYS A C   1 
ATOM   2626 O O   . CYS A 1 329 ? 76.629 66.509 -4.835  1.00 12.98 ? 329  CYS A O   1 
ATOM   2627 C CB  . CYS A 1 329 ? 78.503 63.871 -6.042  1.00 12.20 ? 329  CYS A CB  1 
ATOM   2628 S SG  . CYS A 1 329 ? 80.129 63.141 -5.610  1.00 15.22 ? 329  CYS A SG  1 
ATOM   2629 N N   . PHE A 1 330 ? 75.545 64.770 -5.734  1.00 12.04 ? 330  PHE A N   1 
ATOM   2630 C CA  . PHE A 1 330 ? 74.387 65.617 -6.083  1.00 13.09 ? 330  PHE A CA  1 
ATOM   2631 C C   . PHE A 1 330 ? 73.480 65.992 -4.896  1.00 13.20 ? 330  PHE A C   1 
ATOM   2632 O O   . PHE A 1 330 ? 72.711 66.917 -4.997  1.00 15.91 ? 330  PHE A O   1 
ATOM   2633 C CB  . PHE A 1 330 ? 73.508 64.991 -7.152  1.00 12.89 ? 330  PHE A CB  1 
ATOM   2634 C CG  . PHE A 1 330 ? 74.078 65.072 -8.545  1.00 12.36 ? 330  PHE A CG  1 
ATOM   2635 C CD1 . PHE A 1 330 ? 73.716 66.127 -9.387  1.00 13.41 ? 330  PHE A CD1 1 
ATOM   2636 C CD2 . PHE A 1 330 ? 74.915 64.086 -9.034  1.00 14.14 ? 330  PHE A CD2 1 
ATOM   2637 C CE1 . PHE A 1 330 ? 74.204 66.223 -10.667 1.00 14.54 ? 330  PHE A CE1 1 
ATOM   2638 C CE2 . PHE A 1 330 ? 75.414 64.160 -10.341 1.00 13.93 ? 330  PHE A CE2 1 
ATOM   2639 C CZ  . PHE A 1 330 ? 75.048 65.250 -11.160 1.00 14.35 ? 330  PHE A CZ  1 
ATOM   2640 N N   . GLY A 1 331 ? 73.568 65.276 -3.788  1.00 12.13 ? 331  GLY A N   1 
ATOM   2641 C CA  . GLY A 1 331 ? 72.774 65.611 -2.596  1.00 11.75 ? 331  GLY A CA  1 
ATOM   2642 C C   . GLY A 1 331 ? 71.297 65.230 -2.657  1.00 11.95 ? 331  GLY A C   1 
ATOM   2643 O O   . GLY A 1 331 ? 70.503 65.789 -1.924  1.00 12.77 ? 331  GLY A O   1 
ATOM   2644 N N   . CYS A 1 332 ? 70.940 64.252 -3.485  1.00 10.80 ? 332  CYS A N   1 
ATOM   2645 C CA  . CYS A 1 332 ? 69.529 63.851 -3.604  1.00 10.70 ? 332  CYS A CA  1 
ATOM   2646 C C   . CYS A 1 332 ? 69.102 63.103 -2.334  1.00 10.88 ? 332  CYS A C   1 
ATOM   2647 O O   . CYS A 1 332 ? 69.729 62.079 -1.993  1.00 11.78 ? 332  CYS A O   1 
ATOM   2648 C CB  . CYS A 1 332 ? 69.382 62.882 -4.807  1.00 10.72 ? 332  CYS A CB  1 
ATOM   2649 S SG  . CYS A 1 332 ? 69.838 63.652 -6.363  1.00 11.44 ? 332  CYS A SG  1 
ATOM   2650 N N   . GLU A 1 333 ? 68.039 63.556 -1.654  1.00 9.79  ? 333  GLU A N   1 
ATOM   2651 C CA  . GLU A 1 333 ? 67.640 62.873 -0.408  1.00 9.73  ? 333  GLU A CA  1 
ATOM   2652 C C   . GLU A 1 333 ? 66.952 61.546 -0.655  1.00 9.97  ? 333  GLU A C   1 
ATOM   2653 O O   . GLU A 1 333 ? 66.934 60.685 0.249   1.00 9.80  ? 333  GLU A O   1 
ATOM   2654 C CB  . GLU A 1 333 ? 66.597 63.698 0.346   1.00 9.45  ? 333  GLU A CB  1 
ATOM   2655 C CG  . GLU A 1 333 ? 67.112 64.970 1.011   1.00 10.55 ? 333  GLU A CG  1 
ATOM   2656 C CD  . GLU A 1 333 ? 66.085 65.554 1.981   1.00 10.52 ? 333  GLU A CD  1 
ATOM   2657 O OE1 . GLU A 1 333 ? 65.263 64.776 2.503   1.00 12.22 ? 333  GLU A OE1 1 
ATOM   2658 O OE2 . GLU A 1 333 ? 66.145 66.792 2.261   1.00 12.32 ? 333  GLU A OE2 1 
ATOM   2659 N N   . THR A 1 334 ? 66.345 61.376 -1.832  1.00 9.03  ? 334  THR A N   1 
ATOM   2660 C CA  . THR A 1 334 ? 65.482 60.197 -1.999  1.00 9.80  ? 334  THR A CA  1 
ATOM   2661 C C   . THR A 1 334 ? 65.869 59.294 -3.151  1.00 9.74  ? 334  THR A C   1 
ATOM   2662 O O   . THR A 1 334 ? 66.641 59.649 -4.004  1.00 10.18 ? 334  THR A O   1 
ATOM   2663 C CB  . THR A 1 334 ? 63.962 60.577 -2.167  1.00 9.62  ? 334  THR A CB  1 
ATOM   2664 O OG1 . THR A 1 334 ? 63.680 61.011 -3.526  1.00 9.59  ? 334  THR A OG1 1 
ATOM   2665 C CG2 . THR A 1 334 ? 63.575 61.716 -1.220  1.00 10.89 ? 334  THR A CG2 1 
ATOM   2666 N N   . HIS A 1 335 ? 65.284 58.110 -3.146  1.00 8.93  ? 335  HIS A N   1 
ATOM   2667 C CA  . HIS A 1 335 ? 65.499 57.110 -4.185  1.00 9.16  ? 335  HIS A CA  1 
ATOM   2668 C C   . HIS A 1 335 ? 64.160 56.449 -4.432  1.00 9.32  ? 335  HIS A C   1 
ATOM   2669 O O   . HIS A 1 335 ? 63.582 55.823 -3.523  1.00 10.05 ? 335  HIS A O   1 
ATOM   2670 C CB  . HIS A 1 335 ? 66.494 56.032 -3.688  1.00 10.23 ? 335  HIS A CB  1 
ATOM   2671 C CG  . HIS A 1 335 ? 66.890 55.101 -4.781  1.00 10.54 ? 335  HIS A CG  1 
ATOM   2672 N ND1 . HIS A 1 335 ? 66.388 53.821 -4.934  1.00 13.23 ? 335  HIS A ND1 1 
ATOM   2673 C CD2 . HIS A 1 335 ? 67.711 55.315 -5.829  1.00 9.32  ? 335  HIS A CD2 1 
ATOM   2674 C CE1 . HIS A 1 335 ? 66.885 53.290 -6.051  1.00 7.56  ? 335  HIS A CE1 1 
ATOM   2675 N NE2 . HIS A 1 335 ? 67.695 54.182 -6.598  1.00 13.64 ? 335  HIS A NE2 1 
ATOM   2676 N N   . ALA A 1 336 ? 63.640 56.583 -5.642  1.00 9.01  ? 336  ALA A N   1 
ATOM   2677 C CA  . ALA A 1 336 ? 62.300 56.037 -5.948  1.00 9.22  ? 336  ALA A CA  1 
ATOM   2678 C C   . ALA A 1 336 ? 62.445 54.665 -6.617  1.00 9.50  ? 336  ALA A C   1 
ATOM   2679 O O   . ALA A 1 336 ? 63.298 54.468 -7.489  1.00 10.53 ? 336  ALA A O   1 
ATOM   2680 C CB  . ALA A 1 336 ? 61.540 57.009 -6.896  1.00 9.84  ? 336  ALA A CB  1 
ATOM   2681 N N   . MET A 1 337 ? 61.625 53.710 -6.174  1.00 8.55  ? 337  MET A N   1 
ATOM   2682 C CA  . MET A 1 337 ? 61.594 52.359 -6.766  1.00 9.04  ? 337  MET A CA  1 
ATOM   2683 C C   . MET A 1 337 ? 60.212 52.150 -7.357  1.00 8.78  ? 337  MET A C   1 
ATOM   2684 O O   . MET A 1 337 ? 59.207 52.189 -6.647  1.00 8.49  ? 337  MET A O   1 
ATOM   2685 C CB  . MET A 1 337 ? 61.941 51.322 -5.684  1.00 9.12  ? 337  MET A CB  1 
ATOM   2686 C CG  . MET A 1 337 ? 63.443 51.485 -5.294  1.00 11.00 ? 337  MET A CG  1 
ATOM   2687 S SD  . MET A 1 337 ? 63.972 50.451 -3.919  1.00 11.90 ? 337  MET A SD  1 
ATOM   2688 C CE  . MET A 1 337 ? 63.906 48.808 -4.707  1.00 12.08 ? 337  MET A CE  1 
ATOM   2689 N N   . LEU A 1 338 ? 60.182 51.984 -8.686  1.00 8.31  ? 338  LEU A N   1 
ATOM   2690 C CA  . LEU A 1 338 ? 58.951 52.058 -9.459  1.00 8.67  ? 338  LEU A CA  1 
ATOM   2691 C C   . LEU A 1 338 ? 58.764 50.812 -10.327 1.00 9.10  ? 338  LEU A C   1 
ATOM   2692 O O   . LEU A 1 338 ? 59.096 50.795 -11.511 1.00 9.69  ? 338  LEU A O   1 
ATOM   2693 C CB  . LEU A 1 338 ? 58.967 53.341 -10.320 1.00 8.84  ? 338  LEU A CB  1 
ATOM   2694 C CG  . LEU A 1 338 ? 59.224 54.646 -9.541  1.00 6.92  ? 338  LEU A CG  1 
ATOM   2695 C CD1 . LEU A 1 338 ? 59.425 55.810 -10.542 1.00 8.98  ? 338  LEU A CD1 1 
ATOM   2696 C CD2 . LEU A 1 338 ? 58.041 54.907 -8.605  1.00 9.19  ? 338  LEU A CD2 1 
ATOM   2697 N N   . PRO A 1 339 ? 58.253 49.732 -9.746  1.00 9.09  ? 339  PRO A N   1 
ATOM   2698 C CA  . PRO A 1 339 ? 58.059 48.502 -10.515 1.00 9.25  ? 339  PRO A CA  1 
ATOM   2699 C C   . PRO A 1 339 ? 56.787 48.581 -11.357 1.00 9.40  ? 339  PRO A C   1 
ATOM   2700 O O   . PRO A 1 339 ? 55.713 48.916 -10.847 1.00 9.20  ? 339  PRO A O   1 
ATOM   2701 C CB  . PRO A 1 339 ? 57.907 47.428 -9.435  1.00 10.24 ? 339  PRO A CB  1 
ATOM   2702 C CG  . PRO A 1 339 ? 57.361 48.188 -8.221  1.00 10.45 ? 339  PRO A CG  1 
ATOM   2703 C CD  . PRO A 1 339 ? 57.920 49.597 -8.313  1.00 9.64  ? 339  PRO A CD  1 
ATOM   2704 N N   . TYR A 1 340 ? 56.898 48.287 -12.641 1.00 9.35  ? 340  TYR A N   1 
ATOM   2705 C CA  . TYR A 1 340 ? 55.749 48.338 -13.533 1.00 9.87  ? 340  TYR A CA  1 
ATOM   2706 C C   . TYR A 1 340 ? 55.110 46.944 -13.484 1.00 10.41 ? 340  TYR A C   1 
ATOM   2707 O O   . TYR A 1 340 ? 55.127 46.176 -14.444 1.00 10.04 ? 340  TYR A O   1 
ATOM   2708 C CB  . TYR A 1 340 ? 56.183 48.788 -14.953 1.00 9.90  ? 340  TYR A CB  1 
ATOM   2709 C CG  . TYR A 1 340 ? 56.181 50.305 -15.059 1.00 9.57  ? 340  TYR A CG  1 
ATOM   2710 C CD1 . TYR A 1 340 ? 56.942 51.073 -14.191 1.00 9.41  ? 340  TYR A CD1 1 
ATOM   2711 C CD2 . TYR A 1 340 ? 55.359 50.959 -15.992 1.00 10.13 ? 340  TYR A CD2 1 
ATOM   2712 C CE1 . TYR A 1 340 ? 56.898 52.469 -14.255 1.00 9.94  ? 340  TYR A CE1 1 
ATOM   2713 C CE2 . TYR A 1 340 ? 55.312 52.329 -16.069 1.00 9.78  ? 340  TYR A CE2 1 
ATOM   2714 C CZ  . TYR A 1 340 ? 56.080 53.088 -15.186 1.00 9.90  ? 340  TYR A CZ  1 
ATOM   2715 O OH  . TYR A 1 340 ? 55.993 54.460 -15.229 1.00 10.21 ? 340  TYR A OH  1 
ATOM   2716 N N   . ASP A 1 341 ? 54.527 46.641 -12.329 1.00 9.96  ? 341  ASP A N   1 
ATOM   2717 C CA  . ASP A 1 341 ? 53.994 45.315 -12.055 1.00 9.67  ? 341  ASP A CA  1 
ATOM   2718 C C   . ASP A 1 341 ? 53.143 45.418 -10.802 1.00 9.70  ? 341  ASP A C   1 
ATOM   2719 O O   . ASP A 1 341 ? 53.638 45.716 -9.699  1.00 9.37  ? 341  ASP A O   1 
ATOM   2720 C CB  . ASP A 1 341 ? 55.173 44.361 -11.836 1.00 10.33 ? 341  ASP A CB  1 
ATOM   2721 C CG  . ASP A 1 341 ? 54.728 42.966 -11.632 1.00 11.63 ? 341  ASP A CG  1 
ATOM   2722 O OD1 . ASP A 1 341 ? 54.632 42.207 -12.644 1.00 13.08 ? 341  ASP A OD1 1 
ATOM   2723 O OD2 . ASP A 1 341 ? 54.414 42.553 -10.492 1.00 12.47 ? 341  ASP A OD2 1 
ATOM   2724 N N   . GLN A 1 342 ? 51.853 45.141 -10.967 1.00 9.01  ? 342  GLN A N   1 
ATOM   2725 C CA  . GLN A 1 342 ? 50.920 45.247 -9.875  1.00 9.85  ? 342  GLN A CA  1 
ATOM   2726 C C   . GLN A 1 342 ? 51.185 44.183 -8.812  1.00 10.41 ? 342  GLN A C   1 
ATOM   2727 O O   . GLN A 1 342 ? 50.963 44.432 -7.622  1.00 10.47 ? 342  GLN A O   1 
ATOM   2728 C CB  . GLN A 1 342 ? 49.506 45.175 -10.426 1.00 10.88 ? 342  GLN A CB  1 
ATOM   2729 C CG  . GLN A 1 342 ? 48.404 45.453 -9.402  1.00 11.11 ? 342  GLN A CG  1 
ATOM   2730 C CD  . GLN A 1 342 ? 48.425 46.852 -8.833  1.00 13.67 ? 342  GLN A CD  1 
ATOM   2731 O OE1 . GLN A 1 342 ? 47.987 47.063 -7.684  1.00 19.31 ? 342  GLN A OE1 1 
ATOM   2732 N NE2 . GLN A 1 342 ? 48.890 47.814 -9.600  1.00 9.59  ? 342  GLN A NE2 1 
ATOM   2733 N N   . TYR A 1 343 ? 51.683 43.021 -9.225  1.00 10.45 ? 343  TYR A N   1 
ATOM   2734 C CA  . TYR A 1 343 ? 52.025 42.016 -8.209  1.00 10.42 ? 343  TYR A CA  1 
ATOM   2735 C C   . TYR A 1 343 ? 53.114 42.530 -7.262  1.00 10.88 ? 343  TYR A C   1 
ATOM   2736 O O   . TYR A 1 343 ? 53.099 42.153 -6.079  1.00 10.76 ? 343  TYR A O   1 
ATOM   2737 C CB  . TYR A 1 343 ? 52.434 40.685 -8.843  1.00 10.66 ? 343  TYR A CB  1 
ATOM   2738 C CG  . TYR A 1 343 ? 51.250 39.854 -9.292  1.00 10.86 ? 343  TYR A CG  1 
ATOM   2739 C CD1 . TYR A 1 343 ? 51.268 39.212 -10.535 1.00 10.07 ? 343  TYR A CD1 1 
ATOM   2740 C CD2 . TYR A 1 343 ? 50.142 39.671 -8.461  1.00 12.31 ? 343  TYR A CD2 1 
ATOM   2741 C CE1 . TYR A 1 343 ? 50.197 38.411 -10.923 1.00 11.62 ? 343  TYR A CE1 1 
ATOM   2742 C CE2 . TYR A 1 343 ? 49.074 38.856 -8.844  1.00 12.34 ? 343  TYR A CE2 1 
ATOM   2743 C CZ  . TYR A 1 343 ? 49.115 38.234 -10.068 1.00 12.18 ? 343  TYR A CZ  1 
ATOM   2744 O OH  . TYR A 1 343 ? 48.038 37.453 -10.463 1.00 13.72 ? 343  TYR A OH  1 
ATOM   2745 N N   . LEU A 1 344 ? 54.013 43.398 -7.767  1.00 10.27 ? 344  LEU A N   1 
ATOM   2746 C CA  . LEU A 1 344 ? 55.094 44.016 -6.958  1.00 9.95  ? 344  LEU A CA  1 
ATOM   2747 C C   . LEU A 1 344 ? 54.620 45.291 -6.254  1.00 10.83 ? 344  LEU A C   1 
ATOM   2748 O O   . LEU A 1 344 ? 55.432 46.135 -5.871  1.00 10.01 ? 344  LEU A O   1 
ATOM   2749 C CB  . LEU A 1 344 ? 56.302 44.333 -7.856  1.00 10.04 ? 344  LEU A CB  1 
ATOM   2750 C CG  . LEU A 1 344 ? 57.123 43.104 -8.260  1.00 10.31 ? 344  LEU A CG  1 
ATOM   2751 C CD1 . LEU A 1 344 ? 58.194 43.457 -9.329  1.00 11.97 ? 344  LEU A CD1 1 
ATOM   2752 C CD2 . LEU A 1 344 ? 57.758 42.474 -6.994  1.00 10.90 ? 344  LEU A CD2 1 
ATOM   2753 N N   . HIS A 1 345 ? 53.309 45.403 -5.988  1.00 10.32 ? 345  HIS A N   1 
ATOM   2754 C CA  . HIS A 1 345 ? 52.840 46.644 -5.355  1.00 10.27 ? 345  HIS A CA  1 
ATOM   2755 C C   . HIS A 1 345 ? 53.394 46.911 -3.980  1.00 10.06 ? 345  HIS A C   1 
ATOM   2756 O O   . HIS A 1 345 ? 53.300 48.066 -3.526  1.00 11.13 ? 345  HIS A O   1 
ATOM   2757 C CB  . HIS A 1 345 ? 51.299 46.737 -5.321  1.00 10.89 ? 345  HIS A CB  1 
ATOM   2758 C CG  . HIS A 1 345 ? 50.643 45.762 -4.379  1.00 10.72 ? 345  HIS A CG  1 
ATOM   2759 N ND1 . HIS A 1 345 ? 49.810 46.172 -3.355  1.00 12.72 ? 345  HIS A ND1 1 
ATOM   2760 C CD2 . HIS A 1 345 ? 50.639 44.405 -4.346  1.00 11.35 ? 345  HIS A CD2 1 
ATOM   2761 C CE1 . HIS A 1 345 ? 49.354 45.110 -2.709  1.00 12.92 ? 345  HIS A CE1 1 
ATOM   2762 N NE2 . HIS A 1 345 ? 49.838 44.024 -3.291  1.00 10.69 ? 345  HIS A NE2 1 
ATOM   2763 N N   . ARG A 1 346 ? 53.967 45.902 -3.298  1.00 10.75 ? 346  ARG A N   1 
ATOM   2764 C CA  . ARG A 1 346 ? 54.546 46.174 -1.981  1.00 10.34 ? 346  ARG A CA  1 
ATOM   2765 C C   . ARG A 1 346 ? 56.076 46.069 -1.984  1.00 11.07 ? 346  ARG A C   1 
ATOM   2766 O O   . ARG A 1 346 ? 56.699 46.010 -0.908  1.00 11.60 ? 346  ARG A O   1 
ATOM   2767 C CB  . ARG A 1 346 ? 53.946 45.262 -0.886  1.00 11.35 ? 346  ARG A CB  1 
ATOM   2768 C CG  . ARG A 1 346 ? 52.409 45.394 -0.748  1.00 11.76 ? 346  ARG A CG  1 
ATOM   2769 C CD  . ARG A 1 346 ? 51.928 46.805 -0.531  1.00 12.68 ? 346  ARG A CD  1 
ATOM   2770 N NE  . ARG A 1 346 ? 52.394 47.317 0.768   1.00 12.61 ? 346  ARG A NE  1 
ATOM   2771 C CZ  . ARG A 1 346 ? 52.431 48.616 1.091   1.00 12.88 ? 346  ARG A CZ  1 
ATOM   2772 N NH1 . ARG A 1 346 ? 52.115 49.581 0.201   1.00 13.49 ? 346  ARG A NH1 1 
ATOM   2773 N NH2 . ARG A 1 346 ? 52.832 48.941 2.310   1.00 13.22 ? 346  ARG A NH2 1 
ATOM   2774 N N   . PHE A 1 347 ? 56.675 46.044 -3.188  1.00 9.39  ? 347  PHE A N   1 
ATOM   2775 C CA  . PHE A 1 347 ? 58.138 45.966 -3.318  1.00 9.53  ? 347  PHE A CA  1 
ATOM   2776 C C   . PHE A 1 347 ? 58.848 47.219 -2.793  1.00 9.95  ? 347  PHE A C   1 
ATOM   2777 O O   . PHE A 1 347 ? 59.789 47.113 -2.030  1.00 9.67  ? 347  PHE A O   1 
ATOM   2778 C CB  . PHE A 1 347 ? 58.448 45.710 -4.781  1.00 10.49 ? 347  PHE A CB  1 
ATOM   2779 C CG  . PHE A 1 347 ? 59.879 45.406 -5.089  1.00 10.60 ? 347  PHE A CG  1 
ATOM   2780 C CD1 . PHE A 1 347 ? 60.422 44.133 -4.827  1.00 11.73 ? 347  PHE A CD1 1 
ATOM   2781 C CD2 . PHE A 1 347 ? 60.660 46.369 -5.728  1.00 11.96 ? 347  PHE A CD2 1 
ATOM   2782 C CE1 . PHE A 1 347 ? 61.767 43.856 -5.193  1.00 12.10 ? 347  PHE A CE1 1 
ATOM   2783 C CE2 . PHE A 1 347 ? 61.987 46.102 -6.095  1.00 12.54 ? 347  PHE A CE2 1 
ATOM   2784 C CZ  . PHE A 1 347 ? 62.541 44.862 -5.817  1.00 14.26 ? 347  PHE A CZ  1 
ATOM   2785 N N   . ALA A 1 348 ? 58.409 48.405 -3.201  1.00 10.03 ? 348  ALA A N   1 
ATOM   2786 C CA  . ALA A 1 348 ? 59.025 49.627 -2.690  1.00 10.49 ? 348  ALA A CA  1 
ATOM   2787 C C   . ALA A 1 348 ? 58.868 49.718 -1.162  1.00 9.56  ? 348  ALA A C   1 
ATOM   2788 O O   . ALA A 1 348 ? 59.807 50.109 -0.458  1.00 10.23 ? 348  ALA A O   1 
ATOM   2789 C CB  . ALA A 1 348 ? 58.427 50.827 -3.375  1.00 11.27 ? 348  ALA A CB  1 
ATOM   2790 N N   . ALA A 1 349 ? 57.693 49.340 -0.631  1.00 9.44  ? 349  ALA A N   1 
ATOM   2791 C CA  . ALA A 1 349 ? 57.514 49.395 0.801   1.00 9.63  ? 349  ALA A CA  1 
ATOM   2792 C C   . ALA A 1 349 ? 58.467 48.431 1.528   1.00 9.94  ? 349  ALA A C   1 
ATOM   2793 O O   . ALA A 1 349 ? 58.989 48.744 2.589   1.00 9.60  ? 349  ALA A O   1 
ATOM   2794 C CB  . ALA A 1 349 ? 56.040 49.097 1.179   1.00 10.88 ? 349  ALA A CB  1 
ATOM   2795 N N   . TYR A 1 350 ? 58.727 47.269 0.926   1.00 9.25  ? 350  TYR A N   1 
ATOM   2796 C CA  . TYR A 1 350 ? 59.678 46.335 1.505   1.00 9.67  ? 350  TYR A CA  1 
ATOM   2797 C C   . TYR A 1 350 ? 61.074 46.940 1.589   1.00 10.05 ? 350  TYR A C   1 
ATOM   2798 O O   . TYR A 1 350 ? 61.753 46.805 2.639   1.00 10.06 ? 350  TYR A O   1 
ATOM   2799 C CB  . TYR A 1 350 ? 59.700 45.017 0.695   1.00 9.08  ? 350  TYR A CB  1 
ATOM   2800 C CG  . TYR A 1 350 ? 60.753 44.047 1.191   1.00 10.24 ? 350  TYR A CG  1 
ATOM   2801 C CD1 . TYR A 1 350 ? 62.012 43.978 0.574   1.00 10.32 ? 350  TYR A CD1 1 
ATOM   2802 C CD2 . TYR A 1 350 ? 60.487 43.198 2.264   1.00 10.29 ? 350  TYR A CD2 1 
ATOM   2803 C CE1 . TYR A 1 350 ? 62.999 43.087 1.024   1.00 10.91 ? 350  TYR A CE1 1 
ATOM   2804 C CE2 . TYR A 1 350 ? 61.442 42.327 2.723   1.00 10.93 ? 350  TYR A CE2 1 
ATOM   2805 C CZ  . TYR A 1 350 ? 62.697 42.256 2.099   1.00 10.84 ? 350  TYR A CZ  1 
ATOM   2806 O OH  . TYR A 1 350 ? 63.641 41.359 2.590   1.00 12.33 ? 350  TYR A OH  1 
ATOM   2807 N N   . PHE A 1 351 ? 61.505 47.595 0.501   1.00 10.30 ? 351  PHE A N   1 
ATOM   2808 C CA  . PHE A 1 351 ? 62.848 48.184 0.499   1.00 10.98 ? 351  PHE A CA  1 
ATOM   2809 C C   . PHE A 1 351 ? 62.929 49.466 1.278   1.00 11.67 ? 351  PHE A C   1 
ATOM   2810 O O   . PHE A 1 351 ? 64.011 49.914 1.636   1.00 11.00 ? 351  PHE A O   1 
ATOM   2811 C CB  . PHE A 1 351 ? 63.480 48.211 -0.912  1.00 11.69 ? 351  PHE A CB  1 
ATOM   2812 C CG  . PHE A 1 351 ? 64.095 46.885 -1.230  1.00 12.09 ? 351  PHE A CG  1 
ATOM   2813 C CD1 . PHE A 1 351 ? 63.545 46.030 -2.167  1.00 11.25 ? 351  PHE A CD1 1 
ATOM   2814 C CD2 . PHE A 1 351 ? 65.212 46.456 -0.500  1.00 11.36 ? 351  PHE A CD2 1 
ATOM   2815 C CE1 . PHE A 1 351 ? 64.081 44.763 -2.366  1.00 11.58 ? 351  PHE A CE1 1 
ATOM   2816 C CE2 . PHE A 1 351 ? 65.778 45.204 -0.714  1.00 12.22 ? 351  PHE A CE2 1 
ATOM   2817 C CZ  . PHE A 1 351 ? 65.203 44.348 -1.655  1.00 12.03 ? 351  PHE A CZ  1 
ATOM   2818 N N   . GLN A 1 352 ? 61.768 50.034 1.598   1.00 12.21 ? 352  GLN A N   1 
ATOM   2819 C CA  . GLN A 1 352 ? 61.804 51.151 2.528   1.00 13.43 ? 352  GLN A CA  1 
ATOM   2820 C C   . GLN A 1 352 ? 62.421 50.645 3.857   1.00 13.75 ? 352  GLN A C   1 
ATOM   2821 O O   . GLN A 1 352 ? 63.348 51.283 4.393   1.00 14.58 ? 352  GLN A O   1 
ATOM   2822 C CB  . GLN A 1 352 ? 60.386 51.656 2.709   1.00 15.79 ? 352  GLN A CB  1 
ATOM   2823 C CG  . GLN A 1 352 ? 60.249 53.022 2.968   1.00 17.38 ? 352  GLN A CG  1 
ATOM   2824 C CD  . GLN A 1 352 ? 58.806 53.442 2.760   1.00 15.75 ? 352  GLN A CD  1 
ATOM   2825 O OE1 . GLN A 1 352 ? 57.882 52.742 3.206   1.00 16.21 ? 352  GLN A OE1 1 
ATOM   2826 N NE2 . GLN A 1 352 ? 58.600 54.559 2.057   1.00 11.49 ? 352  GLN A NE2 1 
ATOM   2827 N N   . GLN A 1 353 ? 61.991 49.476 4.380   1.00 11.51 ? 353  GLN A N   1 
ATOM   2828 C CA  . GLN A 1 353 ? 62.694 48.902 5.515   1.00 11.64 ? 353  GLN A CA  1 
ATOM   2829 C C   . GLN A 1 353 ? 64.089 48.413 5.180   1.00 10.77 ? 353  GLN A C   1 
ATOM   2830 O O   . GLN A 1 353 ? 65.053 48.746 5.868   1.00 10.46 ? 353  GLN A O   1 
ATOM   2831 C CB  . GLN A 1 353 ? 61.918 47.735 6.203   1.00 12.61 ? 353  GLN A CB  1 
ATOM   2832 C CG  . GLN A 1 353 ? 62.699 47.290 7.460   1.00 12.31 ? 353  GLN A CG  1 
ATOM   2833 C CD  . GLN A 1 353 ? 62.047 46.185 8.306   1.00 14.21 ? 353  GLN A CD  1 
ATOM   2834 O OE1 . GLN A 1 353 ? 62.513 45.868 9.437   1.00 15.92 ? 353  GLN A OE1 1 
ATOM   2835 N NE2 . GLN A 1 353 ? 60.993 45.605 7.782   1.00 14.12 ? 353  GLN A NE2 1 
ATOM   2836 N N   . GLY A 1 354 ? 64.217 47.596 4.138   1.00 9.92  ? 354  GLY A N   1 
ATOM   2837 C CA  . GLY A 1 354 ? 65.527 47.034 3.835   1.00 10.83 ? 354  GLY A CA  1 
ATOM   2838 C C   . GLY A 1 354 ? 66.629 48.059 3.693   1.00 10.67 ? 354  GLY A C   1 
ATOM   2839 O O   . GLY A 1 354 ? 67.767 47.886 4.236   1.00 11.37 ? 354  GLY A O   1 
ATOM   2840 N N   . ASP A 1 355 ? 66.312 49.143 3.003   1.00 9.60  ? 355  ASP A N   1 
ATOM   2841 C CA  . ASP A 1 355 ? 67.312 50.178 2.757   1.00 9.44  ? 355  ASP A CA  1 
ATOM   2842 C C   . ASP A 1 355 ? 67.375 51.152 3.926   1.00 9.36  ? 355  ASP A C   1 
ATOM   2843 O O   . ASP A 1 355 ? 68.428 51.288 4.561   1.00 8.82  ? 355  ASP A O   1 
ATOM   2844 C CB  . ASP A 1 355 ? 66.931 50.865 1.424   1.00 9.55  ? 355  ASP A CB  1 
ATOM   2845 C CG  . ASP A 1 355 ? 68.022 51.742 0.849   1.00 11.25 ? 355  ASP A CG  1 
ATOM   2846 O OD1 . ASP A 1 355 ? 68.796 52.357 1.624   1.00 10.95 ? 355  ASP A OD1 1 
ATOM   2847 O OD2 . ASP A 1 355 ? 68.166 51.831 -0.378  1.00 10.77 ? 355  ASP A OD2 1 
ATOM   2848 N N   . MET A 1 356 ? 66.229 51.735 4.311   1.00 8.43  ? 356  MET A N   1 
ATOM   2849 C CA  . MET A 1 356 ? 66.284 52.824 5.341   1.00 8.73  ? 356  MET A CA  1 
ATOM   2850 C C   . MET A 1 356 ? 66.631 52.350 6.742   1.00 8.95  ? 356  MET A C   1 
ATOM   2851 O O   . MET A 1 356 ? 67.332 53.064 7.468   1.00 9.36  ? 356  MET A O   1 
ATOM   2852 C CB  . MET A 1 356 ? 64.979 53.636 5.367   1.00 9.32  ? 356  MET A CB  1 
ATOM   2853 C CG  . MET A 1 356 ? 64.683 54.295 3.992   1.00 10.13 ? 356  MET A CG  1 
ATOM   2854 S SD  . MET A 1 356 ? 63.036 55.042 3.987   1.00 9.95  ? 356  MET A SD  1 
ATOM   2855 C CE  . MET A 1 356 ? 63.285 56.440 5.080   1.00 12.03 ? 356  MET A CE  1 
ATOM   2856 N N   . GLU A 1 357 ? 66.181 51.163 7.143   1.00 9.17  ? 357  GLU A N   1 
ATOM   2857 C CA  . GLU A 1 357 ? 66.548 50.706 8.472   1.00 9.08  ? 357  GLU A CA  1 
ATOM   2858 C C   . GLU A 1 357 ? 68.006 50.218 8.495   1.00 9.15  ? 357  GLU A C   1 
ATOM   2859 O O   . GLU A 1 357 ? 68.652 50.212 9.552   1.00 8.95  ? 357  GLU A O   1 
ATOM   2860 C CB  . GLU A 1 357 ? 65.588 49.617 8.969   1.00 10.44 ? 357  GLU A CB  1 
ATOM   2861 C CG  . GLU A 1 357 ? 65.688 49.391 10.486  1.00 11.42 ? 357  GLU A CG  1 
ATOM   2862 C CD  . GLU A 1 357 ? 64.666 48.384 10.972  1.00 13.36 ? 357  GLU A CD  1 
ATOM   2863 O OE1 . GLU A 1 357 ? 64.747 47.200 10.566  1.00 13.07 ? 357  GLU A OE1 1 
ATOM   2864 O OE2 . GLU A 1 357 ? 63.737 48.795 11.724  1.00 15.99 ? 357  GLU A OE2 1 
ATOM   2865 N N   . SER A 1 358 ? 68.521 49.826 7.334   1.00 8.36  ? 358  SER A N   1 
ATOM   2866 C CA  . SER A 1 358 ? 69.933 49.425 7.283   1.00 8.69  ? 358  SER A CA  1 
ATOM   2867 C C   . SER A 1 358 ? 70.872 50.620 7.295   1.00 9.03  ? 358  SER A C   1 
ATOM   2868 O O   . SER A 1 358 ? 71.804 50.681 8.108   1.00 9.27  ? 358  SER A O   1 
ATOM   2869 C CB  . SER A 1 358 ? 70.236 48.662 5.988   1.00 8.91  ? 358  SER A CB  1 
ATOM   2870 O OG  . SER A 1 358 ? 69.579 47.371 5.986   1.00 9.21  ? 358  SER A OG  1 
ATOM   2871 N N   . ASN A 1 359 ? 70.600 51.592 6.413   1.00 9.17  ? 359  ASN A N   1 
ATOM   2872 C CA  . ASN A 1 359 ? 71.581 52.651 6.164   1.00 9.23  ? 359  ASN A CA  1 
ATOM   2873 C C   . ASN A 1 359 ? 71.183 54.045 6.651   1.00 9.64  ? 359  ASN A C   1 
ATOM   2874 O O   . ASN A 1 359 ? 71.913 55.011 6.422   1.00 9.64  ? 359  ASN A O   1 
ATOM   2875 C CB  . ASN A 1 359 ? 71.959 52.689 4.669   1.00 10.96 ? 359  ASN A CB  1 
ATOM   2876 C CG  . ASN A 1 359 ? 72.751 51.456 4.230   1.00 9.81  ? 359  ASN A CG  1 
ATOM   2877 O OD1 . ASN A 1 359 ? 72.925 51.185 3.010   1.00 12.04 ? 359  ASN A OD1 1 
ATOM   2878 N ND2 . ASN A 1 359 ? 73.221 50.705 5.197   1.00 8.30  ? 359  ASN A ND2 1 
ATOM   2879 N N   . GLY A 1 360 ? 70.053 54.138 7.350   1.00 8.95  ? 360  GLY A N   1 
ATOM   2880 C CA  . GLY A 1 360 ? 69.674 55.414 7.985   1.00 8.38  ? 360  GLY A CA  1 
ATOM   2881 C C   . GLY A 1 360 ? 70.422 55.498 9.315   1.00 9.06  ? 360  GLY A C   1 
ATOM   2882 O O   . GLY A 1 360 ? 69.852 55.255 10.411  1.00 9.14  ? 360  GLY A O   1 
ATOM   2883 N N   . LYS A 1 361 ? 71.715 55.782 9.184   1.00 8.55  ? 361  LYS A N   1 
ATOM   2884 C CA  . LYS A 1 361 ? 72.663 55.694 10.307  1.00 9.91  ? 361  LYS A CA  1 
ATOM   2885 C C   . LYS A 1 361 ? 73.571 56.909 10.312  1.00 10.50 ? 361  LYS A C   1 
ATOM   2886 O O   . LYS A 1 361 ? 73.710 57.584 9.277   1.00 10.64 ? 361  LYS A O   1 
ATOM   2887 C CB  . LYS A 1 361 ? 73.562 54.451 10.098  1.00 10.74 ? 361  LYS A CB  1 
ATOM   2888 C CG  . LYS A 1 361 ? 72.778 53.119 10.076  1.00 9.48  ? 361  LYS A CG  1 
ATOM   2889 C CD  . LYS A 1 361 ? 72.307 52.740 11.496  1.00 9.02  ? 361  LYS A CD  1 
ATOM   2890 C CE  . LYS A 1 361 ? 71.224 51.629 11.504  1.00 9.92  ? 361  LYS A CE  1 
ATOM   2891 N NZ  . LYS A 1 361 ? 71.730 50.338 10.894  1.00 10.26 ? 361  LYS A NZ  1 
ATOM   2892 N N   . TYR A 1 362 ? 74.223 57.179 11.458  1.00 9.65  ? 362  TYR A N   1 
ATOM   2893 C CA  . TYR A 1 362 ? 75.125 58.335 11.453  1.00 10.33 ? 362  TYR A CA  1 
ATOM   2894 C C   . TYR A 1 362 ? 76.384 58.105 12.279  1.00 11.03 ? 362  TYR A C   1 
ATOM   2895 O O   . TYR A 1 362 ? 77.210 59.006 12.328  1.00 11.99 ? 362  TYR A O   1 
ATOM   2896 C CB  . TYR A 1 362 ? 74.401 59.623 11.906  1.00 11.00 ? 362  TYR A CB  1 
ATOM   2897 C CG  . TYR A 1 362 ? 74.186 59.775 13.420  1.00 11.54 ? 362  TYR A CG  1 
ATOM   2898 C CD1 . TYR A 1 362 ? 73.430 58.853 14.162  1.00 11.24 ? 362  TYR A CD1 1 
ATOM   2899 C CD2 . TYR A 1 362 ? 74.739 60.858 14.099  1.00 11.53 ? 362  TYR A CD2 1 
ATOM   2900 C CE1 . TYR A 1 362 ? 73.237 59.009 15.572  1.00 11.79 ? 362  TYR A CE1 1 
ATOM   2901 C CE2 . TYR A 1 362 ? 74.516 61.060 15.484  1.00 12.36 ? 362  TYR A CE2 1 
ATOM   2902 C CZ  . TYR A 1 362 ? 73.794 60.130 16.218  1.00 11.73 ? 362  TYR A CZ  1 
ATOM   2903 O OH  . TYR A 1 362 ? 73.590 60.297 17.588  1.00 11.83 ? 362  TYR A OH  1 
ATOM   2904 N N   . ILE A 1 363 ? 76.509 56.937 12.927  1.00 10.36 ? 363  ILE A N   1 
ATOM   2905 C CA  . ILE A 1 363 ? 77.747 56.608 13.656  1.00 11.85 ? 363  ILE A CA  1 
ATOM   2906 C C   . ILE A 1 363 ? 78.593 55.630 12.854  1.00 12.23 ? 363  ILE A C   1 
ATOM   2907 O O   . ILE A 1 363 ? 78.080 54.589 12.371  1.00 12.54 ? 363  ILE A O   1 
ATOM   2908 C CB  . ILE A 1 363 ? 77.424 56.024 15.032  1.00 12.47 ? 363  ILE A CB  1 
ATOM   2909 C CG1 . ILE A 1 363 ? 76.509 56.969 15.812  1.00 12.37 ? 363  ILE A CG1 1 
ATOM   2910 C CG2 . ILE A 1 363 ? 78.740 55.822 15.824  1.00 12.30 ? 363  ILE A CG2 1 
ATOM   2911 C CD1 . ILE A 1 363 ? 76.998 58.422 16.006  1.00 14.05 ? 363  ILE A CD1 1 
ATOM   2912 N N   . THR A 1 364 ? 79.892 55.936 12.671  1.00 12.15 ? 364  THR A N   1 
ATOM   2913 C CA  . THR A 1 364 ? 80.738 55.039 11.878  1.00 13.40 ? 364  THR A CA  1 
ATOM   2914 C C   . THR A 1 364 ? 81.350 53.931 12.724  1.00 14.30 ? 364  THR A C   1 
ATOM   2915 O O   . THR A 1 364 ? 81.176 53.868 13.941  1.00 14.47 ? 364  THR A O   1 
ATOM   2916 C CB  . THR A 1 364 ? 81.888 55.785 11.223  1.00 13.94 ? 364  THR A CB  1 
ATOM   2917 O OG1 . THR A 1 364 ? 82.763 56.301 12.253  1.00 15.95 ? 364  THR A OG1 1 
ATOM   2918 C CG2 . THR A 1 364 ? 81.389 56.961 10.447  1.00 15.17 ? 364  THR A CG2 1 
ATOM   2919 N N   . LYS A 1 365 ? 82.067 53.051 12.061  1.00 15.35 ? 365  LYS A N   1 
ATOM   2920 C CA  . LYS A 1 365 ? 82.733 51.931 12.741  1.00 16.99 ? 365  LYS A CA  1 
ATOM   2921 C C   . LYS A 1 365 ? 83.709 52.428 13.804  1.00 18.03 ? 365  LYS A C   1 
ATOM   2922 O O   . LYS A 1 365 ? 83.938 51.724 14.777  1.00 19.24 ? 365  LYS A O   1 
ATOM   2923 C CB  . LYS A 1 365 ? 83.454 51.077 11.694  1.00 17.82 ? 365  LYS A CB  1 
ATOM   2924 C CG  . LYS A 1 365 ? 84.046 49.766 12.205  1.00 20.15 ? 365  LYS A CG  1 
ATOM   2925 C CD  . LYS A 1 365 ? 84.297 48.784 10.965  1.00 25.33 ? 365  LYS A CD  1 
ATOM   2926 C CE  . LYS A 1 365 ? 85.574 49.045 10.108  1.00 30.64 ? 365  LYS A CE  1 
ATOM   2927 N NZ  . LYS A 1 365 ? 85.680 50.284 9.223   1.00 32.95 ? 365  LYS A NZ  1 
ATOM   2928 N N   . SER A 1 366 ? 84.250 53.637 13.626  1.00 17.27 ? 366  SER A N   1 
ATOM   2929 C CA  . SER A 1 366 ? 85.245 54.194 14.574  1.00 18.28 ? 366  SER A CA  1 
ATOM   2930 C C   . SER A 1 366 ? 84.566 54.908 15.742  1.00 17.56 ? 366  SER A C   1 
ATOM   2931 O O   . SER A 1 366 ? 85.234 55.431 16.649  1.00 17.58 ? 366  SER A O   1 
ATOM   2932 C CB  . SER A 1 366 ? 86.233 55.102 13.847  1.00 19.60 ? 366  SER A CB  1 
ATOM   2933 O OG  . SER A 1 366 ? 85.657 56.352 13.508  1.00 23.46 ? 366  SER A OG  1 
ATOM   2934 N N   . GLY A 1 367 ? 83.234 54.893 15.723  1.00 17.04 ? 367  GLY A N   1 
ATOM   2935 C CA  . GLY A 1 367 ? 82.422 55.512 16.760  1.00 17.07 ? 367  GLY A CA  1 
ATOM   2936 C C   . GLY A 1 367 ? 82.272 57.007 16.590  1.00 18.38 ? 367  GLY A C   1 
ATOM   2937 O O   . GLY A 1 367 ? 81.857 57.677 17.542  1.00 20.17 ? 367  GLY A O   1 
ATOM   2938 N N   . THR A 1 368 ? 82.633 57.544 15.427  1.00 18.43 ? 368  THR A N   1 
ATOM   2939 C CA  . THR A 1 368 ? 82.581 58.984 15.162  1.00 19.44 ? 368  THR A CA  1 
ATOM   2940 C C   . THR A 1 368 ? 81.369 59.283 14.291  1.00 17.98 ? 368  THR A C   1 
ATOM   2941 O O   . THR A 1 368 ? 80.825 58.397 13.654  1.00 19.57 ? 368  THR A O   1 
ATOM   2942 C CB  . THR A 1 368 ? 83.808 59.427 14.445  1.00 20.61 ? 368  THR A CB  1 
ATOM   2943 O OG1 . THR A 1 368 ? 83.987 58.595 13.304  1.00 22.44 ? 368  THR A OG1 1 
ATOM   2944 C CG2 . THR A 1 368 ? 85.051 59.103 15.279  1.00 22.35 ? 368  THR A CG2 1 
ATOM   2945 N N   . ARG A 1 369 ? 80.913 60.523 14.286  1.00 16.02 ? 369  ARG A N   1 
ATOM   2946 C CA  . ARG A 1 369 ? 79.735 60.847 13.505  1.00 16.09 ? 369  ARG A CA  1 
ATOM   2947 C C   . ARG A 1 369 ? 80.079 61.088 12.055  1.00 15.10 ? 369  ARG A C   1 
ATOM   2948 O O   . ARG A 1 369 ? 81.120 61.709 11.731  1.00 15.98 ? 369  ARG A O   1 
ATOM   2949 C CB  . ARG A 1 369 ? 79.053 62.099 14.074  1.00 17.26 ? 369  ARG A CB  1 
ATOM   2950 C CG  . ARG A 1 369 ? 78.247 61.788 15.327  1.00 20.02 ? 369  ARG A CG  1 
ATOM   2951 C CD  . ARG A 1 369 ? 77.615 62.985 15.939  1.00 23.88 ? 369  ARG A CD  1 
ATOM   2952 N NE  . ARG A 1 369 ? 78.653 63.955 16.261  1.00 24.61 ? 369  ARG A NE  1 
ATOM   2953 C CZ  . ARG A 1 369 ? 78.430 65.246 16.478  1.00 26.38 ? 369  ARG A CZ  1 
ATOM   2954 N NH1 . ARG A 1 369 ? 77.196 65.748 16.406  1.00 27.24 ? 369  ARG A NH1 1 
ATOM   2955 N NH2 . ARG A 1 369 ? 79.449 66.036 16.759  1.00 27.54 ? 369  ARG A NH2 1 
ATOM   2956 N N   . VAL A 1 370 ? 79.195 60.647 11.153  1.00 13.53 ? 370  VAL A N   1 
ATOM   2957 C CA  . VAL A 1 370 ? 79.440 60.972 9.768   1.00 13.36 ? 370  VAL A CA  1 
ATOM   2958 C C   . VAL A 1 370 ? 79.320 62.484 9.568   1.00 13.19 ? 370  VAL A C   1 
ATOM   2959 O O   . VAL A 1 370 ? 78.533 63.148 10.261  1.00 14.12 ? 370  VAL A O   1 
ATOM   2960 C CB  . VAL A 1 370 ? 78.463 60.273 8.838   1.00 11.93 ? 370  VAL A CB  1 
ATOM   2961 C CG1 . VAL A 1 370 ? 78.635 58.750 8.960   1.00 12.40 ? 370  VAL A CG1 1 
ATOM   2962 C CG2 . VAL A 1 370 ? 76.985 60.665 9.136   1.00 13.00 ? 370  VAL A CG2 1 
ATOM   2963 N N   . ASP A 1 371 ? 80.091 63.015 8.622   1.00 13.35 ? 371  ASP A N   1 
ATOM   2964 C CA  . ASP A 1 371 ? 79.987 64.427 8.217   1.00 13.59 ? 371  ASP A CA  1 
ATOM   2965 C C   . ASP A 1 371 ? 79.609 64.482 6.733   1.00 13.53 ? 371  ASP A C   1 
ATOM   2966 O O   . ASP A 1 371 ? 80.014 65.389 5.963   1.00 15.77 ? 371  ASP A O   1 
ATOM   2967 C CB  . ASP A 1 371 ? 81.304 65.184 8.491   1.00 14.30 ? 371  ASP A CB  1 
ATOM   2968 C CG  . ASP A 1 371 ? 82.503 64.550 7.831   1.00 15.90 ? 371  ASP A CG  1 
ATOM   2969 O OD1 . ASP A 1 371 ? 83.661 65.087 7.982   1.00 17.74 ? 371  ASP A OD1 1 
ATOM   2970 O OD2 . ASP A 1 371 ? 82.423 63.516 7.141   1.00 14.83 ? 371  ASP A OD2 1 
ATOM   2971 N N   . HIS A 1 372 ? 78.785 63.517 6.341   1.00 12.12 ? 372  HIS A N   1 
ATOM   2972 C CA  . HIS A 1 372 ? 78.304 63.402 4.966   1.00 11.80 ? 372  HIS A CA  1 
ATOM   2973 C C   . HIS A 1 372 ? 76.954 62.663 5.045   1.00 11.86 ? 372  HIS A C   1 
ATOM   2974 O O   . HIS A 1 372 ? 76.600 62.100 6.097   1.00 12.17 ? 372  HIS A O   1 
ATOM   2975 C CB  . HIS A 1 372 ? 79.270 62.525 4.122   1.00 12.33 ? 372  HIS A CB  1 
ATOM   2976 C CG  . HIS A 1 372 ? 79.618 61.215 4.770   1.00 11.65 ? 372  HIS A CG  1 
ATOM   2977 N ND1 . HIS A 1 372 ? 78.814 60.090 4.680   1.00 10.87 ? 372  HIS A ND1 1 
ATOM   2978 C CD2 . HIS A 1 372 ? 80.684 60.854 5.532   1.00 11.34 ? 372  HIS A CD2 1 
ATOM   2979 C CE1 . HIS A 1 372 ? 79.379 59.091 5.348   1.00 11.19 ? 372  HIS A CE1 1 
ATOM   2980 N NE2 . HIS A 1 372 ? 80.520 59.524 5.867   1.00 11.45 ? 372  HIS A NE2 1 
ATOM   2981 N N   . GLN A 1 373 ? 76.216 62.660 3.944   1.00 11.66 ? 373  GLN A N   1 
ATOM   2982 C CA  . GLN A 1 373 ? 74.934 61.941 3.919   1.00 10.89 ? 373  GLN A CA  1 
ATOM   2983 C C   . GLN A 1 373 ? 75.117 60.429 3.942   1.00 10.73 ? 373  GLN A C   1 
ATOM   2984 O O   . GLN A 1 373 ? 76.125 59.888 3.447   1.00 9.94  ? 373  GLN A O   1 
ATOM   2985 C CB  . GLN A 1 373 ? 74.161 62.257 2.631   1.00 11.34 ? 373  GLN A CB  1 
ATOM   2986 C CG  . GLN A 1 373 ? 73.618 63.679 2.531   1.00 12.80 ? 373  GLN A CG  1 
ATOM   2987 C CD  . GLN A 1 373 ? 72.609 63.905 3.636   1.00 13.10 ? 373  GLN A CD  1 
ATOM   2988 O OE1 . GLN A 1 373 ? 71.745 63.048 3.843   1.00 11.52 ? 373  GLN A OE1 1 
ATOM   2989 N NE2 . GLN A 1 373 ? 72.749 65.019 4.393   1.00 18.28 ? 373  GLN A NE2 1 
ATOM   2990 N N   . THR A 1 374 ? 74.126 59.757 4.502   1.00 9.61  ? 374  THR A N   1 
ATOM   2991 C CA  . THR A 1 374 ? 74.058 58.296 4.394   1.00 10.10 ? 374  THR A CA  1 
ATOM   2992 C C   . THR A 1 374 ? 72.770 57.929 3.657   1.00 10.15 ? 374  THR A C   1 
ATOM   2993 O O   . THR A 1 374 ? 72.419 58.596 2.682   1.00 9.97  ? 374  THR A O   1 
ATOM   2994 C CB  . THR A 1 374 ? 74.196 57.578 5.761   1.00 10.34 ? 374  THR A CB  1 
ATOM   2995 O OG1 . THR A 1 374 ? 73.204 58.076 6.676   1.00 10.03 ? 374  THR A OG1 1 
ATOM   2996 C CG2 . THR A 1 374 ? 75.565 57.909 6.383   1.00 12.28 ? 374  THR A CG2 1 
ATOM   2997 N N   . GLY A 1 375 ? 72.058 56.898 4.111   1.00 9.55  ? 375  GLY A N   1 
ATOM   2998 C CA  . GLY A 1 375 ? 70.959 56.311 3.334   1.00 9.71  ? 375  GLY A CA  1 
ATOM   2999 C C   . GLY A 1 375 ? 69.891 57.270 2.887   1.00 9.74  ? 375  GLY A C   1 
ATOM   3000 O O   . GLY A 1 375 ? 69.563 58.202 3.607   1.00 10.25 ? 375  GLY A O   1 
ATOM   3001 N N   . PRO A 1 376 ? 69.314 57.035 1.722   1.00 8.99  ? 376  PRO A N   1 
ATOM   3002 C CA  . PRO A 1 376 ? 68.246 57.921 1.226   1.00 10.03 ? 376  PRO A CA  1 
ATOM   3003 C C   . PRO A 1 376 ? 66.882 57.493 1.743   1.00 10.03 ? 376  PRO A C   1 
ATOM   3004 O O   . PRO A 1 376 ? 66.691 56.392 2.272   1.00 10.63 ? 376  PRO A O   1 
ATOM   3005 C CB  . PRO A 1 376 ? 68.249 57.662 -0.292  1.00 10.10 ? 376  PRO A CB  1 
ATOM   3006 C CG  . PRO A 1 376 ? 68.654 56.143 -0.407  1.00 10.15 ? 376  PRO A CG  1 
ATOM   3007 C CD  . PRO A 1 376 ? 69.627 55.923 0.787   1.00 9.49  ? 376  PRO A CD  1 
ATOM   3008 N N   . ILE A 1 377 ? 65.919 58.376 1.560   1.00 9.54  ? 377  ILE A N   1 
ATOM   3009 C CA  . ILE A 1 377 ? 64.506 58.027 1.803   1.00 9.42  ? 377  ILE A CA  1 
ATOM   3010 C C   . ILE A 1 377 ? 64.030 57.277 0.567   1.00 9.28  ? 377  ILE A C   1 
ATOM   3011 O O   . ILE A 1 377 ? 64.092 57.804 -0.539  1.00 9.52  ? 377  ILE A O   1 
ATOM   3012 C CB  . ILE A 1 377 ? 63.699 59.299 2.021   1.00 8.89  ? 377  ILE A CB  1 
ATOM   3013 C CG1 . ILE A 1 377 ? 64.135 59.938 3.348   1.00 10.04 ? 377  ILE A CG1 1 
ATOM   3014 C CG2 . ILE A 1 377 ? 62.193 58.993 2.072   1.00 9.73  ? 377  ILE A CG2 1 
ATOM   3015 C CD1 . ILE A 1 377 ? 63.736 61.454 3.498   1.00 10.58 ? 377  ILE A CD1 1 
ATOM   3016 N N   . VAL A 1 378 ? 63.601 56.030 0.741   1.00 8.72  ? 378  VAL A N   1 
ATOM   3017 C CA  . VAL A 1 378 ? 63.124 55.213 -0.371  1.00 9.21  ? 378  VAL A CA  1 
ATOM   3018 C C   . VAL A 1 378 ? 61.606 55.261 -0.418  1.00 9.83  ? 378  VAL A C   1 
ATOM   3019 O O   . VAL A 1 378 ? 60.953 55.225 0.627   1.00 10.54 ? 378  VAL A O   1 
ATOM   3020 C CB  . VAL A 1 378 ? 63.584 53.757 -0.124  1.00 10.51 ? 378  VAL A CB  1 
ATOM   3021 C CG1 . VAL A 1 378 ? 62.903 52.772 -1.105  1.00 11.70 ? 378  VAL A CG1 1 
ATOM   3022 C CG2 . VAL A 1 378 ? 65.081 53.706 -0.275  1.00 11.43 ? 378  VAL A CG2 1 
ATOM   3023 N N   . TRP A 1 379 ? 61.042 55.342 -1.617  1.00 9.27  ? 379  TRP A N   1 
ATOM   3024 C CA  . TRP A 1 379 ? 59.600 55.433 -1.750  1.00 9.61  ? 379  TRP A CA  1 
ATOM   3025 C C   . TRP A 1 379 ? 59.205 55.000 -3.155  1.00 9.84  ? 379  TRP A C   1 
ATOM   3026 O O   . TRP A 1 379 ? 60.061 54.804 -4.015  1.00 9.60  ? 379  TRP A O   1 
ATOM   3027 C CB  . TRP A 1 379 ? 59.132 56.882 -1.504  1.00 10.18 ? 379  TRP A CB  1 
ATOM   3028 C CG  . TRP A 1 379 ? 59.729 57.900 -2.475  1.00 10.60 ? 379  TRP A CG  1 
ATOM   3029 C CD1 . TRP A 1 379 ? 61.046 58.386 -2.526  1.00 9.64  ? 379  TRP A CD1 1 
ATOM   3030 C CD2 . TRP A 1 379 ? 59.028 58.547 -3.542  1.00 10.26 ? 379  TRP A CD2 1 
ATOM   3031 N NE1 . TRP A 1 379 ? 61.167 59.289 -3.569  1.00 10.17 ? 379  TRP A NE1 1 
ATOM   3032 C CE2 . TRP A 1 379 ? 59.951 59.409 -4.205  1.00 10.19 ? 379  TRP A CE2 1 
ATOM   3033 C CE3 . TRP A 1 379 ? 57.697 58.483 -4.013  1.00 10.49 ? 379  TRP A CE3 1 
ATOM   3034 C CZ2 . TRP A 1 379 ? 59.588 60.191 -5.293  1.00 10.72 ? 379  TRP A CZ2 1 
ATOM   3035 C CZ3 . TRP A 1 379 ? 57.341 59.261 -5.103  1.00 10.12 ? 379  TRP A CZ3 1 
ATOM   3036 C CH2 . TRP A 1 379 ? 58.271 60.101 -5.734  1.00 9.51  ? 379  TRP A CH2 1 
ATOM   3037 N N   . GLY A 1 380 ? 57.905 54.847 -3.389  1.00 9.50  ? 380  GLY A N   1 
ATOM   3038 C CA  . GLY A 1 380 ? 57.445 54.510 -4.730  1.00 10.01 ? 380  GLY A CA  1 
ATOM   3039 C C   . GLY A 1 380 ? 56.108 53.797 -4.694  1.00 9.71  ? 380  GLY A C   1 
ATOM   3040 O O   . GLY A 1 380 ? 55.627 53.413 -3.616  1.00 9.87  ? 380  GLY A O   1 
ATOM   3041 N N   . GLU A 1 381 ? 55.516 53.669 -5.886  1.00 9.28  ? 381  GLU A N   1 
ATOM   3042 C CA  . GLU A 1 381 ? 54.280 52.915 -6.128  1.00 9.23  ? 381  GLU A CA  1 
ATOM   3043 C C   . GLU A 1 381 ? 54.458 52.286 -7.486  1.00 9.80  ? 381  GLU A C   1 
ATOM   3044 O O   . GLU A 1 381 ? 55.236 52.757 -8.311  1.00 10.08 ? 381  GLU A O   1 
ATOM   3045 C CB  . GLU A 1 381 ? 53.043 53.830 -6.190  1.00 9.49  ? 381  GLU A CB  1 
ATOM   3046 C CG  . GLU A 1 381 ? 52.599 54.368 -4.839  1.00 10.90 ? 381  GLU A CG  1 
ATOM   3047 C CD  . GLU A 1 381 ? 51.952 53.310 -3.943  1.00 11.23 ? 381  GLU A CD  1 
ATOM   3048 O OE1 . GLU A 1 381 ? 51.775 53.574 -2.752  1.00 13.10 ? 381  GLU A OE1 1 
ATOM   3049 O OE2 . GLU A 1 381 ? 51.582 52.201 -4.377  1.00 12.85 ? 381  GLU A OE2 1 
ATOM   3050 N N   . PRO A 1 382 ? 53.763 51.203 -7.747  1.00 10.46 ? 382  PRO A N   1 
ATOM   3051 C CA  . PRO A 1 382 ? 53.901 50.570 -9.066  1.00 10.42 ? 382  PRO A CA  1 
ATOM   3052 C C   . PRO A 1 382 ? 53.419 51.422 -10.238 1.00 11.11 ? 382  PRO A C   1 
ATOM   3053 O O   . PRO A 1 382 ? 52.507 52.231 -10.061 1.00 11.69 ? 382  PRO A O   1 
ATOM   3054 C CB  . PRO A 1 382 ? 53.059 49.305 -8.948  1.00 11.87 ? 382  PRO A CB  1 
ATOM   3055 C CG  . PRO A 1 382 ? 52.120 49.571 -7.834  1.00 11.67 ? 382  PRO A CG  1 
ATOM   3056 C CD  . PRO A 1 382 ? 52.889 50.446 -6.840  1.00 10.85 ? 382  PRO A CD  1 
ATOM   3057 N N   . GLY A 1 383 ? 54.085 51.276 -11.399 1.00 9.75  ? 383  GLY A N   1 
ATOM   3058 C CA  . GLY A 1 383 ? 53.620 51.891 -12.644 1.00 9.73  ? 383  GLY A CA  1 
ATOM   3059 C C   . GLY A 1 383 ? 52.519 50.992 -13.215 1.00 9.51  ? 383  GLY A C   1 
ATOM   3060 O O   . GLY A 1 383 ? 52.567 49.774 -12.996 1.00 10.18 ? 383  GLY A O   1 
ATOM   3061 N N   . THR A 1 384 ? 51.533 51.539 -13.949 1.00 10.15 ? 384  THR A N   1 
ATOM   3062 C CA  . THR A 1 384 ? 51.538 52.969 -14.278 1.00 11.89 ? 384  THR A CA  1 
ATOM   3063 C C   . THR A 1 384 ? 50.878 53.869 -13.267 1.00 12.49 ? 384  THR A C   1 
ATOM   3064 O O   . THR A 1 384 ? 50.794 55.073 -13.505 1.00 13.26 ? 384  THR A O   1 
ATOM   3065 C CB  . THR A 1 384 ? 50.810 53.262 -15.608 1.00 11.59 ? 384  THR A CB  1 
ATOM   3066 O OG1 . THR A 1 384 ? 49.463 52.792 -15.499 1.00 12.97 ? 384  THR A OG1 1 
ATOM   3067 C CG2 . THR A 1 384 ? 51.408 52.514 -16.778 1.00 11.87 ? 384  THR A CG2 1 
ATOM   3068 N N   . ASN A 1 385 ? 50.389 53.309 -12.176 1.00 12.60 ? 385  ASN A N   1 
ATOM   3069 C CA  . ASN A 1 385 ? 49.668 54.136 -11.195 1.00 14.58 ? 385  ASN A CA  1 
ATOM   3070 C C   . ASN A 1 385 ? 50.389 55.388 -10.793 1.00 14.77 ? 385  ASN A C   1 
ATOM   3071 O O   . ASN A 1 385 ? 49.792 56.453 -10.761 1.00 15.18 ? 385  ASN A O   1 
ATOM   3072 C CB  . ASN A 1 385 ? 49.298 53.297 -9.980  1.00 14.92 ? 385  ASN A CB  1 
ATOM   3073 C CG  . ASN A 1 385 ? 48.333 52.217 -10.370 1.00 17.66 ? 385  ASN A CG  1 
ATOM   3074 O OD1 . ASN A 1 385 ? 48.719 51.277 -11.019 1.00 20.38 ? 385  ASN A OD1 1 
ATOM   3075 N ND2 . ASN A 1 385 ? 47.056 52.431 -10.115 1.00 18.93 ? 385  ASN A ND2 1 
ATOM   3076 N N   . GLY A 1 386 ? 51.672 55.268 -10.483 1.00 15.21 ? 386  GLY A N   1 
ATOM   3077 C CA  . GLY A 1 386 ? 52.428 56.441 -10.062 1.00 14.57 ? 386  GLY A CA  1 
ATOM   3078 C C   . GLY A 1 386 ? 52.426 57.567 -11.070 1.00 14.79 ? 386  GLY A C   1 
ATOM   3079 O O   . GLY A 1 386 ? 52.564 58.713 -10.664 1.00 14.98 ? 386  GLY A O   1 
ATOM   3080 N N   . GLN A 1 387 ? 52.360 57.275 -12.383 1.00 13.33 ? 387  GLN A N   1 
ATOM   3081 C CA  . GLN A 1 387 ? 52.287 58.339 -13.408 1.00 14.51 ? 387  GLN A CA  1 
ATOM   3082 C C   . GLN A 1 387 ? 51.165 59.289 -13.214 1.00 15.02 ? 387  GLN A C   1 
ATOM   3083 O O   . GLN A 1 387 ? 51.248 60.435 -13.646 1.00 16.19 ? 387  GLN A O   1 
ATOM   3084 C CB  . GLN A 1 387 ? 52.098 57.749 -14.844 1.00 14.03 ? 387  GLN A CB  1 
ATOM   3085 C CG  . GLN A 1 387 ? 53.260 56.919 -15.248 1.00 13.71 ? 387  GLN A CG  1 
ATOM   3086 C CD  . GLN A 1 387 ? 53.069 56.132 -16.543 1.00 11.05 ? 387  GLN A CD  1 
ATOM   3087 O OE1 . GLN A 1 387 ? 52.193 56.438 -17.416 1.00 14.62 ? 387  GLN A OE1 1 
ATOM   3088 N NE2 . GLN A 1 387 ? 53.891 55.150 -16.702 1.00 8.17  ? 387  GLN A NE2 1 
ATOM   3089 N N   . HIS A 1 388 ? 50.066 58.763 -12.669 1.00 14.65 ? 388  HIS A N   1 
ATOM   3090 C CA  . HIS A 1 388 ? 48.845 59.518 -12.418 1.00 16.31 ? 388  HIS A CA  1 
ATOM   3091 C C   . HIS A 1 388 ? 48.753 59.999 -10.997 1.00 15.60 ? 388  HIS A C   1 
ATOM   3092 O O   . HIS A 1 388 ? 47.680 60.464 -10.566 1.00 16.86 ? 388  HIS A O   1 
ATOM   3093 C CB  . HIS A 1 388 ? 47.622 58.635 -12.741 1.00 15.96 ? 388  HIS A CB  1 
ATOM   3094 C CG  . HIS A 1 388 ? 47.622 58.117 -14.145 1.00 16.71 ? 388  HIS A CG  1 
ATOM   3095 N ND1 . HIS A 1 388 ? 46.911 58.734 -15.156 1.00 17.48 ? 388  HIS A ND1 1 
ATOM   3096 C CD2 . HIS A 1 388 ? 48.256 57.059 -14.714 1.00 15.57 ? 388  HIS A CD2 1 
ATOM   3097 C CE1 . HIS A 1 388 ? 47.112 58.069 -16.289 1.00 17.19 ? 388  HIS A CE1 1 
ATOM   3098 N NE2 . HIS A 1 388 ? 47.937 57.058 -16.049 1.00 17.18 ? 388  HIS A NE2 1 
ATOM   3099 N N   . ALA A 1 389 ? 49.850 59.878 -10.247 1.00 14.16 ? 389  ALA A N   1 
ATOM   3100 C CA  . ALA A 1 389 ? 49.846 60.374 -8.869  1.00 12.04 ? 389  ALA A CA  1 
ATOM   3101 C C   . ALA A 1 389 ? 50.932 61.402 -8.634  1.00 11.92 ? 389  ALA A C   1 
ATOM   3102 O O   . ALA A 1 389 ? 50.646 62.543 -8.290  1.00 13.32 ? 389  ALA A O   1 
ATOM   3103 C CB  . ALA A 1 389 ? 50.012 59.203 -7.847  1.00 12.17 ? 389  ALA A CB  1 
ATOM   3104 N N   . PHE A 1 390 ? 52.195 61.016 -8.838  1.00 11.13 ? 390  PHE A N   1 
ATOM   3105 C CA  . PHE A 1 390 ? 53.278 61.901 -8.429  1.00 10.86 ? 390  PHE A CA  1 
ATOM   3106 C C   . PHE A 1 390 ? 54.320 62.178 -9.488  1.00 10.60 ? 390  PHE A C   1 
ATOM   3107 O O   . PHE A 1 390 ? 55.274 62.930 -9.241  1.00 10.69 ? 390  PHE A O   1 
ATOM   3108 C CB  . PHE A 1 390 ? 53.930 61.370 -7.153  1.00 11.03 ? 390  PHE A CB  1 
ATOM   3109 C CG  . PHE A 1 390 ? 54.369 59.949 -7.251  1.00 9.83  ? 390  PHE A CG  1 
ATOM   3110 C CD1 . PHE A 1 390 ? 55.489 59.620 -8.009  1.00 9.86  ? 390  PHE A CD1 1 
ATOM   3111 C CD2 . PHE A 1 390 ? 53.623 58.947 -6.652  1.00 11.55 ? 390  PHE A CD2 1 
ATOM   3112 C CE1 . PHE A 1 390 ? 55.881 58.303 -8.155  1.00 10.40 ? 390  PHE A CE1 1 
ATOM   3113 C CE2 . PHE A 1 390 ? 53.998 57.585 -6.794  1.00 11.96 ? 390  PHE A CE2 1 
ATOM   3114 C CZ  . PHE A 1 390 ? 55.138 57.270 -7.532  1.00 11.58 ? 390  PHE A CZ  1 
ATOM   3115 N N   . TYR A 1 391 ? 54.152 61.600 -10.680 1.00 9.57  ? 391  TYR A N   1 
ATOM   3116 C CA  . TYR A 1 391 ? 55.202 61.843 -11.663 1.00 9.05  ? 391  TYR A CA  1 
ATOM   3117 C C   . TYR A 1 391 ? 55.225 63.311 -12.138 1.00 9.56  ? 391  TYR A C   1 
ATOM   3118 O O   . TYR A 1 391 ? 56.247 63.778 -12.663 1.00 9.50  ? 391  TYR A O   1 
ATOM   3119 C CB  . TYR A 1 391 ? 55.077 60.978 -12.906 1.00 10.01 ? 391  TYR A CB  1 
ATOM   3120 C CG  . TYR A 1 391 ? 55.556 59.536 -12.803 1.00 10.04 ? 391  TYR A CG  1 
ATOM   3121 C CD1 . TYR A 1 391 ? 55.487 58.824 -11.601 1.00 9.99  ? 391  TYR A CD1 1 
ATOM   3122 C CD2 . TYR A 1 391 ? 56.037 58.875 -13.947 1.00 9.33  ? 391  TYR A CD2 1 
ATOM   3123 C CE1 . TYR A 1 391 ? 55.834 57.466 -11.552 1.00 9.68  ? 391  TYR A CE1 1 
ATOM   3124 C CE2 . TYR A 1 391 ? 56.410 57.525 -13.899 1.00 10.42 ? 391  TYR A CE2 1 
ATOM   3125 C CZ  . TYR A 1 391 ? 56.281 56.832 -12.700 1.00 9.40  ? 391  TYR A CZ  1 
ATOM   3126 O OH  . TYR A 1 391 ? 56.599 55.478 -12.688 1.00 10.87 ? 391  TYR A OH  1 
ATOM   3127 N N   . GLN A 1 392 ? 54.115 64.020 -11.982 1.00 9.10  ? 392  GLN A N   1 
ATOM   3128 C CA  . GLN A 1 392 ? 54.141 65.459 -12.271 1.00 8.97  ? 392  GLN A CA  1 
ATOM   3129 C C   . GLN A 1 392 ? 55.357 66.116 -11.595 1.00 9.66  ? 392  GLN A C   1 
ATOM   3130 O O   . GLN A 1 392 ? 56.066 66.921 -12.204 1.00 9.08  ? 392  GLN A O   1 
ATOM   3131 C CB  . GLN A 1 392 ? 52.835 66.121 -11.779 1.00 9.82  ? 392  GLN A CB  1 
ATOM   3132 C CG  . GLN A 1 392 ? 52.899 67.648 -11.609 1.00 9.94  ? 392  GLN A CG  1 
ATOM   3133 C CD  . GLN A 1 392 ? 53.022 68.363 -12.944 1.00 11.61 ? 392  GLN A CD  1 
ATOM   3134 O OE1 . GLN A 1 392 ? 52.310 68.039 -13.873 1.00 10.93 ? 392  GLN A OE1 1 
ATOM   3135 N NE2 . GLN A 1 392 ? 53.921 69.328 -13.030 1.00 8.84  ? 392  GLN A NE2 1 
ATOM   3136 N N   . LEU A 1 393 ? 55.582 65.778 -10.324 1.00 9.51  ? 393  LEU A N   1 
ATOM   3137 C CA  . LEU A 1 393 ? 56.690 66.388 -9.583  1.00 8.61  ? 393  LEU A CA  1 
ATOM   3138 C C   . LEU A 1 393 ? 58.044 65.840 -10.077 1.00 9.79  ? 393  LEU A C   1 
ATOM   3139 O O   . LEU A 1 393 ? 59.024 66.580 -10.147 1.00 10.79 ? 393  LEU A O   1 
ATOM   3140 C CB  . LEU A 1 393 ? 56.473 66.166 -8.057  1.00 9.14  ? 393  LEU A CB  1 
ATOM   3141 C CG  . LEU A 1 393 ? 57.470 66.861 -7.125  1.00 8.50  ? 393  LEU A CG  1 
ATOM   3142 C CD1 . LEU A 1 393 ? 56.778 67.157 -5.768  1.00 7.49  ? 393  LEU A CD1 1 
ATOM   3143 C CD2 . LEU A 1 393 ? 58.769 65.988 -6.894  1.00 11.09 ? 393  LEU A CD2 1 
ATOM   3144 N N   . ILE A 1 394 ? 58.105 64.548 -10.406 1.00 9.02  ? 394  ILE A N   1 
ATOM   3145 C CA  . ILE A 1 394 ? 59.358 64.028 -10.928 1.00 9.30  ? 394  ILE A CA  1 
ATOM   3146 C C   . ILE A 1 394 ? 59.752 64.764 -12.220 1.00 9.56  ? 394  ILE A C   1 
ATOM   3147 O O   . ILE A 1 394 ? 60.918 65.089 -12.421 1.00 9.22  ? 394  ILE A O   1 
ATOM   3148 C CB  . ILE A 1 394 ? 59.284 62.511 -11.147 1.00 8.98  ? 394  ILE A CB  1 
ATOM   3149 C CG1 . ILE A 1 394 ? 58.886 61.828 -9.819  1.00 10.52 ? 394  ILE A CG1 1 
ATOM   3150 C CG2 . ILE A 1 394 ? 60.639 61.969 -11.630 1.00 10.99 ? 394  ILE A CG2 1 
ATOM   3151 C CD1 . ILE A 1 394 ? 58.766 60.300 -9.945  1.00 11.83 ? 394  ILE A CD1 1 
ATOM   3152 N N   . HIS A 1 395 ? 58.774 65.039 -13.091 1.00 9.69  ? 395  HIS A N   1 
ATOM   3153 C CA  . HIS A 1 395 ? 59.088 65.718 -14.375 1.00 9.08  ? 395  HIS A CA  1 
ATOM   3154 C C   . HIS A 1 395 ? 59.268 67.238 -14.286 1.00 9.84  ? 395  HIS A C   1 
ATOM   3155 O O   . HIS A 1 395 ? 60.073 67.796 -15.022 1.00 10.00 ? 395  HIS A O   1 
ATOM   3156 C CB  . HIS A 1 395 ? 57.944 65.457 -15.388 1.00 9.66  ? 395  HIS A CB  1 
ATOM   3157 C CG  . HIS A 1 395 ? 57.952 64.072 -15.960 1.00 10.68 ? 395  HIS A CG  1 
ATOM   3158 N ND1 . HIS A 1 395 ? 58.794 63.700 -16.985 1.00 10.79 ? 395  HIS A ND1 1 
ATOM   3159 C CD2 . HIS A 1 395 ? 57.202 62.980 -15.670 1.00 12.07 ? 395  HIS A CD2 1 
ATOM   3160 C CE1 . HIS A 1 395 ? 58.577 62.431 -17.288 1.00 11.92 ? 395  HIS A CE1 1 
ATOM   3161 N NE2 . HIS A 1 395 ? 57.606 61.976 -16.513 1.00 12.14 ? 395  HIS A NE2 1 
ATOM   3162 N N   . GLN A 1 396 ? 58.483 67.896 -13.428 1.00 9.56  ? 396  GLN A N   1 
ATOM   3163 C CA  . GLN A 1 396 ? 58.416 69.373 -13.443 1.00 10.20 ? 396  GLN A CA  1 
ATOM   3164 C C   . GLN A 1 396 ? 58.454 70.033 -12.073 1.00 10.45 ? 396  GLN A C   1 
ATOM   3165 O O   . GLN A 1 396 ? 58.087 71.210 -11.939 1.00 10.72 ? 396  GLN A O   1 
ATOM   3166 C CB  . GLN A 1 396 ? 57.132 69.821 -14.195 1.00 10.03 ? 396  GLN A CB  1 
ATOM   3167 C CG  . GLN A 1 396 ? 57.230 69.701 -15.757 1.00 10.66 ? 396  GLN A CG  1 
ATOM   3168 C CD  . GLN A 1 396 ? 56.044 70.369 -16.421 1.00 11.77 ? 396  GLN A CD  1 
ATOM   3169 O OE1 . GLN A 1 396 ? 54.968 70.388 -15.835 1.00 11.25 ? 396  GLN A OE1 1 
ATOM   3170 N NE2 . GLN A 1 396 ? 56.243 70.982 -17.598 1.00 11.61 ? 396  GLN A NE2 1 
ATOM   3171 N N   . GLY A 1 397 ? 58.876 69.292 -11.054 1.00 9.26  ? 397  GLY A N   1 
ATOM   3172 C CA  . GLY A 1 397 ? 59.104 69.903 -9.748  1.00 10.57 ? 397  GLY A CA  1 
ATOM   3173 C C   . GLY A 1 397 ? 60.517 70.458 -9.604  1.00 10.85 ? 397  GLY A C   1 
ATOM   3174 O O   . GLY A 1 397 ? 61.174 70.770 -10.627 1.00 12.02 ? 397  GLY A O   1 
ATOM   3175 N N   . THR A 1 398 ? 60.964 70.613 -8.359  1.00 10.15 ? 398  THR A N   1 
ATOM   3176 C CA  . THR A 1 398 ? 62.278 71.196 -8.099  1.00 10.41 ? 398  THR A CA  1 
ATOM   3177 C C   . THR A 1 398 ? 63.214 70.235 -7.389  1.00 11.23 ? 398  THR A C   1 
ATOM   3178 O O   . THR A 1 398 ? 64.228 70.645 -6.827  1.00 13.22 ? 398  THR A O   1 
ATOM   3179 C CB  . THR A 1 398 ? 62.177 72.516 -7.263  1.00 10.67 ? 398  THR A CB  1 
ATOM   3180 O OG1 . THR A 1 398 ? 61.470 72.219 -6.057  1.00 10.93 ? 398  THR A OG1 1 
ATOM   3181 C CG2 . THR A 1 398 ? 61.314 73.559 -7.981  1.00 10.56 ? 398  THR A CG2 1 
ATOM   3182 N N   . LYS A 1 399 ? 62.872 68.949 -7.419  1.00 11.64 ? 399  LYS A N   1 
ATOM   3183 C CA  . LYS A 1 399 ? 63.692 67.910 -6.787  1.00 11.95 ? 399  LYS A CA  1 
ATOM   3184 C C   . LYS A 1 399 ? 64.342 67.029 -7.833  1.00 11.37 ? 399  LYS A C   1 
ATOM   3185 O O   . LYS A 1 399 ? 63.702 66.690 -8.822  1.00 11.65 ? 399  LYS A O   1 
ATOM   3186 C CB  . LYS A 1 399 ? 62.813 66.983 -5.897  1.00 12.07 ? 399  LYS A CB  1 
ATOM   3187 C CG  . LYS A 1 399 ? 62.618 67.470 -4.458  1.00 13.82 ? 399  LYS A CG  1 
ATOM   3188 C CD  . LYS A 1 399 ? 61.640 68.659 -4.392  1.00 13.75 ? 399  LYS A CD  1 
ATOM   3189 C CE  . LYS A 1 399 ? 61.520 69.049 -2.931  1.00 12.15 ? 399  LYS A CE  1 
ATOM   3190 N NZ  . LYS A 1 399 ? 60.845 70.393 -2.793  1.00 12.14 ? 399  LYS A NZ  1 
ATOM   3191 N N   . MET A 1 400 ? 65.589 66.615 -7.578  1.00 10.32 ? 400  MET A N   1 
ATOM   3192 C CA  . MET A 1 400 ? 66.262 65.617 -8.407  1.00 9.22  ? 400  MET A CA  1 
ATOM   3193 C C   . MET A 1 400 ? 66.040 64.286 -7.677  1.00 9.96  ? 400  MET A C   1 
ATOM   3194 O O   . MET A 1 400 ? 66.323 64.160 -6.488  1.00 10.53 ? 400  MET A O   1 
ATOM   3195 C CB  . MET A 1 400 ? 67.763 65.939 -8.500  1.00 10.80 ? 400  MET A CB  1 
ATOM   3196 C CG  . MET A 1 400 ? 68.503 64.931 -9.327  1.00 9.97  ? 400  MET A CG  1 
ATOM   3197 S SD  . MET A 1 400 ? 70.245 65.385 -9.413  1.00 13.01 ? 400  MET A SD  1 
ATOM   3198 C CE  . MET A 1 400 ? 70.784 64.108 -10.455 1.00 13.54 ? 400  MET A CE  1 
ATOM   3199 N N   . ILE A 1 401 ? 65.505 63.318 -8.396  1.00 9.72  ? 401  ILE A N   1 
ATOM   3200 C CA  . ILE A 1 401 ? 65.077 62.061 -7.810  1.00 9.50  ? 401  ILE A CA  1 
ATOM   3201 C C   . ILE A 1 401 ? 65.537 60.875 -8.672  1.00 9.83  ? 401  ILE A C   1 
ATOM   3202 O O   . ILE A 1 401 ? 64.903 60.537 -9.667  1.00 9.65  ? 401  ILE A O   1 
ATOM   3203 C CB  . ILE A 1 401 ? 63.507 62.033 -7.769  1.00 9.81  ? 401  ILE A CB  1 
ATOM   3204 C CG1 . ILE A 1 401 ? 62.980 63.238 -6.989  1.00 9.16  ? 401  ILE A CG1 1 
ATOM   3205 C CG2 . ILE A 1 401 ? 62.973 60.715 -7.119  1.00 10.61 ? 401  ILE A CG2 1 
ATOM   3206 C CD1 . ILE A 1 401 ? 61.429 63.424 -7.167  1.00 11.18 ? 401  ILE A CD1 1 
ATOM   3207 N N   . PRO A 1 402 ? 66.617 60.225 -8.289  1.00 9.66  ? 402  PRO A N   1 
ATOM   3208 C CA  . PRO A 1 402 ? 67.035 59.001 -9.010  1.00 9.39  ? 402  PRO A CA  1 
ATOM   3209 C C   . PRO A 1 402 ? 65.909 57.986 -8.906  1.00 9.70  ? 402  PRO A C   1 
ATOM   3210 O O   . PRO A 1 402 ? 65.334 57.796 -7.838  1.00 10.44 ? 402  PRO A O   1 
ATOM   3211 C CB  . PRO A 1 402 ? 68.288 58.546 -8.241  1.00 9.53  ? 402  PRO A CB  1 
ATOM   3212 C CG  . PRO A 1 402 ? 68.777 59.845 -7.515  1.00 10.28 ? 402  PRO A CG  1 
ATOM   3213 C CD  . PRO A 1 402 ? 67.485 60.541 -7.129  1.00 9.94  ? 402  PRO A CD  1 
ATOM   3214 N N   . CYS A 1 403 ? 65.562 57.366 -10.024 1.00 9.08  ? 403  CYS A N   1 
ATOM   3215 C CA  . CYS A 1 403 ? 64.495 56.376 -10.027 1.00 9.31  ? 403  CYS A CA  1 
ATOM   3216 C C   . CYS A 1 403 ? 64.961 55.102 -10.645 1.00 10.11 ? 403  CYS A C   1 
ATOM   3217 O O   . CYS A 1 403 ? 65.620 55.131 -11.698 1.00 9.76  ? 403  CYS A O   1 
ATOM   3218 C CB  . CYS A 1 403 ? 63.325 56.840 -10.926 1.00 10.51 ? 403  CYS A CB  1 
ATOM   3219 S SG  . CYS A 1 403 ? 62.434 58.321 -10.396 1.00 10.51 ? 403  CYS A SG  1 
ATOM   3220 N N   . ASP A 1 404 ? 64.583 53.984 -10.019 1.00 8.90  ? 404  ASP A N   1 
ATOM   3221 C CA  . ASP A 1 404 ? 64.773 52.695 -10.654 1.00 9.73  ? 404  ASP A CA  1 
ATOM   3222 C C   . ASP A 1 404 ? 63.430 52.243 -11.194 1.00 9.57  ? 404  ASP A C   1 
ATOM   3223 O O   . ASP A 1 404 ? 62.471 52.059 -10.412 1.00 9.73  ? 404  ASP A O   1 
ATOM   3224 C CB  . ASP A 1 404 ? 65.189 51.638 -9.618  1.00 10.31 ? 404  ASP A CB  1 
ATOM   3225 C CG  . ASP A 1 404 ? 66.578 51.851 -9.098  1.00 9.93  ? 404  ASP A CG  1 
ATOM   3226 O OD1 . ASP A 1 404 ? 66.935 51.197 -8.068  1.00 11.11 ? 404  ASP A OD1 1 
ATOM   3227 O OD2 . ASP A 1 404 ? 67.360 52.645 -9.640  1.00 11.12 ? 404  ASP A OD2 1 
ATOM   3228 N N   . PHE A 1 405 ? 63.362 52.018 -12.508 1.00 8.94  ? 405  PHE A N   1 
ATOM   3229 C CA  . PHE A 1 405 ? 62.160 51.498 -13.173 1.00 9.57  ? 405  PHE A CA  1 
ATOM   3230 C C   . PHE A 1 405 ? 62.400 50.012 -13.385 1.00 10.19 ? 405  PHE A C   1 
ATOM   3231 O O   . PHE A 1 405 ? 63.444 49.635 -13.907 1.00 10.62 ? 405  PHE A O   1 
ATOM   3232 C CB  . PHE A 1 405 ? 61.993 52.190 -14.535 1.00 9.72  ? 405  PHE A CB  1 
ATOM   3233 C CG  . PHE A 1 405 ? 61.354 53.565 -14.447 1.00 8.69  ? 405  PHE A CG  1 
ATOM   3234 C CD1 . PHE A 1 405 ? 60.065 53.756 -14.962 1.00 10.51 ? 405  PHE A CD1 1 
ATOM   3235 C CD2 . PHE A 1 405 ? 62.034 54.643 -13.876 1.00 8.82  ? 405  PHE A CD2 1 
ATOM   3236 C CE1 . PHE A 1 405 ? 59.459 55.014 -14.910 1.00 10.11 ? 405  PHE A CE1 1 
ATOM   3237 C CE2 . PHE A 1 405 ? 61.443 55.920 -13.832 1.00 8.28  ? 405  PHE A CE2 1 
ATOM   3238 C CZ  . PHE A 1 405 ? 60.140 56.092 -14.353 1.00 9.75  ? 405  PHE A CZ  1 
ATOM   3239 N N   . LEU A 1 406 ? 61.467 49.163 -12.959 1.00 9.76  ? 406  LEU A N   1 
ATOM   3240 C CA  . LEU A 1 406 ? 61.630 47.696 -13.127 1.00 10.23 ? 406  LEU A CA  1 
ATOM   3241 C C   . LEU A 1 406 ? 60.451 47.096 -13.864 1.00 10.22 ? 406  LEU A C   1 
ATOM   3242 O O   . LEU A 1 406 ? 59.319 47.525 -13.665 1.00 10.91 ? 406  LEU A O   1 
ATOM   3243 C CB  . LEU A 1 406 ? 61.759 47.029 -11.737 1.00 10.56 ? 406  LEU A CB  1 
ATOM   3244 C CG  . LEU A 1 406 ? 62.893 47.582 -10.847 1.00 11.03 ? 406  LEU A CG  1 
ATOM   3245 C CD1 . LEU A 1 406 ? 62.249 48.554 -9.829  1.00 12.12 ? 406  LEU A CD1 1 
ATOM   3246 C CD2 . LEU A 1 406 ? 63.522 46.400 -10.140 1.00 12.90 ? 406  LEU A CD2 1 
ATOM   3247 N N   . ILE A 1 407 ? 60.675 46.083 -14.719 1.00 8.91  ? 407  ILE A N   1 
ATOM   3248 C CA  . ILE A 1 407 ? 59.535 45.408 -15.336 1.00 9.26  ? 407  ILE A CA  1 
ATOM   3249 C C   . ILE A 1 407 ? 59.901 44.026 -15.842 1.00 10.31 ? 407  ILE A C   1 
ATOM   3250 O O   . ILE A 1 407 ? 61.008 43.831 -16.331 1.00 9.72  ? 407  ILE A O   1 
ATOM   3251 C CB  . ILE A 1 407 ? 59.011 46.259 -16.525 1.00 9.78  ? 407  ILE A CB  1 
ATOM   3252 C CG1 . ILE A 1 407 ? 57.583 45.840 -16.877 1.00 9.55  ? 407  ILE A CG1 1 
ATOM   3253 C CG2 . ILE A 1 407 ? 59.979 46.199 -17.756 1.00 10.55 ? 407  ILE A CG2 1 
ATOM   3254 C CD1 . ILE A 1 407 ? 56.932 46.771 -17.950 1.00 10.42 ? 407  ILE A CD1 1 
ATOM   3255 N N   . PRO A 1 408 ? 58.977 43.069 -15.759 1.00 9.99  ? 408  PRO A N   1 
ATOM   3256 C CA  . PRO A 1 408 ? 59.175 41.795 -16.496 1.00 10.44 ? 408  PRO A CA  1 
ATOM   3257 C C   . PRO A 1 408 ? 58.762 41.919 -17.960 1.00 10.77 ? 408  PRO A C   1 
ATOM   3258 O O   . PRO A 1 408 ? 57.736 42.550 -18.293 1.00 11.10 ? 408  PRO A O   1 
ATOM   3259 C CB  . PRO A 1 408 ? 58.222 40.828 -15.810 1.00 10.80 ? 408  PRO A CB  1 
ATOM   3260 C CG  . PRO A 1 408 ? 57.095 41.722 -15.267 1.00 10.45 ? 408  PRO A CG  1 
ATOM   3261 C CD  . PRO A 1 408 ? 57.750 43.066 -14.925 1.00 9.87  ? 408  PRO A CD  1 
ATOM   3262 N N   . VAL A 1 409 ? 59.539 41.290 -18.840 1.00 9.99  ? 409  VAL A N   1 
ATOM   3263 C CA  . VAL A 1 409 ? 59.163 41.267 -20.259 1.00 10.42 ? 409  VAL A CA  1 
ATOM   3264 C C   . VAL A 1 409 ? 57.875 40.479 -20.450 1.00 10.69 ? 409  VAL A C   1 
ATOM   3265 O O   . VAL A 1 409 ? 56.992 40.876 -21.236 1.00 11.20 ? 409  VAL A O   1 
ATOM   3266 C CB  . VAL A 1 409 ? 60.272 40.593 -21.079 1.00 10.94 ? 409  VAL A CB  1 
ATOM   3267 C CG1 . VAL A 1 409 ? 59.839 40.435 -22.572 1.00 11.66 ? 409  VAL A CG1 1 
ATOM   3268 C CG2 . VAL A 1 409 ? 61.554 41.438 -20.920 1.00 12.17 ? 409  VAL A CG2 1 
ATOM   3269 N N   . GLN A 1 410 ? 57.778 39.330 -19.787 1.00 11.21 ? 410  GLN A N   1 
ATOM   3270 C CA  . GLN A 1 410 ? 56.607 38.488 -19.943 1.00 11.60 ? 410  GLN A CA  1 
ATOM   3271 C C   . GLN A 1 410 ? 55.671 38.669 -18.757 1.00 11.98 ? 410  GLN A C   1 
ATOM   3272 O O   . GLN A 1 410 ? 56.110 38.616 -17.606 1.00 11.69 ? 410  GLN A O   1 
ATOM   3273 C CB  . GLN A 1 410 ? 57.019 37.019 -20.026 1.00 11.66 ? 410  GLN A CB  1 
ATOM   3274 C CG  . GLN A 1 410 ? 57.944 36.764 -21.203 1.00 12.73 ? 410  GLN A CG  1 
ATOM   3275 C CD  . GLN A 1 410 ? 58.464 35.339 -21.263 1.00 14.35 ? 410  GLN A CD  1 
ATOM   3276 O OE1 . GLN A 1 410 ? 57.901 34.443 -20.628 1.00 15.94 ? 410  GLN A OE1 1 
ATOM   3277 N NE2 . GLN A 1 410 ? 59.526 35.112 -22.064 1.00 14.88 ? 410  GLN A NE2 1 
ATOM   3278 N N   . THR A 1 411 ? 54.388 38.852 -19.052 1.00 11.11 ? 411  THR A N   1 
ATOM   3279 C CA  . THR A 1 411 ? 53.388 38.964 -18.003 1.00 11.75 ? 411  THR A CA  1 
ATOM   3280 C C   . THR A 1 411 ? 52.790 37.609 -17.558 1.00 12.53 ? 411  THR A C   1 
ATOM   3281 O O   . THR A 1 411 ? 52.732 36.635 -18.347 1.00 13.05 ? 411  THR A O   1 
ATOM   3282 C CB  . THR A 1 411 ? 52.284 39.927 -18.466 1.00 11.53 ? 411  THR A CB  1 
ATOM   3283 O OG1 . THR A 1 411 ? 51.282 40.001 -17.442 1.00 12.03 ? 411  THR A OG1 1 
ATOM   3284 C CG2 . THR A 1 411 ? 51.523 39.336 -19.713 1.00 11.78 ? 411  THR A CG2 1 
ATOM   3285 N N   . GLN A 1 412 ? 52.332 37.553 -16.307 1.00 11.57 ? 412  GLN A N   1 
ATOM   3286 C CA  . GLN A 1 412 ? 51.635 36.375 -15.802 1.00 11.95 ? 412  GLN A CA  1 
ATOM   3287 C C   . GLN A 1 412 ? 50.223 36.274 -16.390 1.00 12.57 ? 412  GLN A C   1 
ATOM   3288 O O   . GLN A 1 412 ? 49.611 35.185 -16.364 1.00 14.66 ? 412  GLN A O   1 
ATOM   3289 C CB  . GLN A 1 412 ? 51.544 36.407 -14.256 1.00 12.27 ? 412  GLN A CB  1 
ATOM   3290 C CG  . GLN A 1 412 ? 52.920 36.340 -13.572 1.00 12.38 ? 412  GLN A CG  1 
ATOM   3291 C CD  . GLN A 1 412 ? 53.538 34.959 -13.604 1.00 13.60 ? 412  GLN A CD  1 
ATOM   3292 O OE1 . GLN A 1 412 ? 52.865 33.971 -13.900 1.00 15.73 ? 412  GLN A OE1 1 
ATOM   3293 N NE2 . GLN A 1 412 ? 54.825 34.881 -13.286 1.00 13.48 ? 412  GLN A NE2 1 
ATOM   3294 N N   . HIS A 1 413 ? 49.720 37.376 -16.958 1.00 12.83 ? 413  HIS A N   1 
ATOM   3295 C CA  . HIS A 1 413 ? 48.334 37.412 -17.458 1.00 14.23 ? 413  HIS A CA  1 
ATOM   3296 C C   . HIS A 1 413 ? 48.272 38.072 -18.817 1.00 14.03 ? 413  HIS A C   1 
ATOM   3297 O O   . HIS A 1 413 ? 47.908 39.229 -18.911 1.00 14.90 ? 413  HIS A O   1 
ATOM   3298 C CB  . HIS A 1 413 ? 47.443 38.180 -16.467 1.00 15.22 ? 413  HIS A CB  1 
ATOM   3299 C CG  . HIS A 1 413 ? 47.391 37.558 -15.105 1.00 16.36 ? 413  HIS A CG  1 
ATOM   3300 N ND1 . HIS A 1 413 ? 46.599 36.470 -14.807 1.00 18.31 ? 413  HIS A ND1 1 
ATOM   3301 C CD2 . HIS A 1 413 ? 48.075 37.850 -13.970 1.00 15.07 ? 413  HIS A CD2 1 
ATOM   3302 C CE1 . HIS A 1 413 ? 46.781 36.134 -13.538 1.00 19.42 ? 413  HIS A CE1 1 
ATOM   3303 N NE2 . HIS A 1 413 ? 47.685 36.951 -13.014 1.00 16.45 ? 413  HIS A NE2 1 
ATOM   3304 N N   . PRO A 1 414 ? 48.633 37.342 -19.876 1.00 14.00 ? 414  PRO A N   1 
ATOM   3305 C CA  . PRO A 1 414 ? 48.722 37.930 -21.222 1.00 13.72 ? 414  PRO A CA  1 
ATOM   3306 C C   . PRO A 1 414 ? 47.338 38.073 -21.864 1.00 14.36 ? 414  PRO A C   1 
ATOM   3307 O O   . PRO A 1 414 ? 47.099 37.573 -22.991 1.00 15.87 ? 414  PRO A O   1 
ATOM   3308 C CB  . PRO A 1 414 ? 49.632 36.934 -21.981 1.00 14.12 ? 414  PRO A CB  1 
ATOM   3309 C CG  . PRO A 1 414 ? 49.375 35.627 -21.320 1.00 14.43 ? 414  PRO A CG  1 
ATOM   3310 C CD  . PRO A 1 414 ? 49.054 35.928 -19.844 1.00 14.34 ? 414  PRO A CD  1 
ATOM   3311 N N   . ILE A 1 415 ? 46.441 38.754 -21.165 1.00 14.02 ? 415  ILE A N   1 
ATOM   3312 C CA  . ILE A 1 415 ? 45.070 38.919 -21.672 1.00 14.58 ? 415  ILE A CA  1 
ATOM   3313 C C   . ILE A 1 415 ? 45.017 39.800 -22.906 1.00 15.07 ? 415  ILE A C   1 
ATOM   3314 O O   . ILE A 1 415 ? 45.951 40.584 -23.198 1.00 14.79 ? 415  ILE A O   1 
ATOM   3315 C CB  . ILE A 1 415 ? 44.166 39.509 -20.583 1.00 14.32 ? 415  ILE A CB  1 
ATOM   3316 C CG1 . ILE A 1 415 ? 44.707 40.896 -20.139 1.00 14.19 ? 415  ILE A CG1 1 
ATOM   3317 C CG2 . ILE A 1 415 ? 44.124 38.541 -19.386 1.00 16.80 ? 415  ILE A CG2 1 
ATOM   3318 C CD1 . ILE A 1 415 ? 43.789 41.586 -19.118 1.00 15.57 ? 415  ILE A CD1 1 
ATOM   3319 N N   . ARG A 1 416 ? 43.900 39.694 -23.633 1.00 15.10 ? 416  ARG A N   1 
ATOM   3320 C CA  . ARG A 1 416 ? 43.748 40.471 -24.843 1.00 16.01 ? 416  ARG A CA  1 
ATOM   3321 C C   . ARG A 1 416 ? 44.949 40.365 -25.777 1.00 15.90 ? 416  ARG A C   1 
ATOM   3322 O O   . ARG A 1 416 ? 45.366 41.378 -26.356 1.00 15.15 ? 416  ARG A O   1 
ATOM   3323 C CB  . ARG A 1 416 ? 43.477 41.944 -24.544 1.00 17.58 ? 416  ARG A CB  1 
ATOM   3324 C CG  . ARG A 1 416 ? 42.348 42.253 -23.540 1.00 20.56 ? 416  ARG A CG  1 
ATOM   3325 C CD  . ARG A 1 416 ? 40.947 42.423 -24.117 1.00 21.31 ? 416  ARG A CD  1 
ATOM   3326 N NE  . ARG A 1 416 ? 40.895 43.303 -25.294 1.00 20.57 ? 416  ARG A NE  1 
ATOM   3327 C CZ  . ARG A 1 416 ? 40.755 44.633 -25.287 1.00 20.65 ? 416  ARG A CZ  1 
ATOM   3328 N NH1 . ARG A 1 416 ? 40.657 45.330 -24.161 1.00 18.30 ? 416  ARG A NH1 1 
ATOM   3329 N NH2 . ARG A 1 416 ? 40.730 45.291 -26.448 1.00 21.92 ? 416  ARG A NH2 1 
ATOM   3330 N N   . LYS A 1 417 ? 45.462 39.152 -25.950 1.00 16.16 ? 417  LYS A N   1 
ATOM   3331 C CA  . LYS A 1 417 ? 46.592 38.890 -26.851 1.00 17.75 ? 417  LYS A CA  1 
ATOM   3332 C C   . LYS A 1 417 ? 47.780 39.778 -26.549 1.00 17.62 ? 417  LYS A C   1 
ATOM   3333 O O   . LYS A 1 417 ? 48.542 40.181 -27.454 1.00 18.32 ? 417  LYS A O   1 
ATOM   3334 C CB  . LYS A 1 417 ? 46.172 39.028 -28.335 1.00 19.50 ? 417  LYS A CB  1 
ATOM   3335 C CG  . LYS A 1 417 ? 45.128 38.005 -28.780 1.00 25.39 ? 417  LYS A CG  1 
ATOM   3336 C CD  . LYS A 1 417 ? 44.745 38.251 -30.247 1.00 30.55 ? 417  LYS A CD  1 
ATOM   3337 C CE  . LYS A 1 417 ? 45.951 38.713 -31.105 1.00 35.71 ? 417  LYS A CE  1 
ATOM   3338 N NZ  . LYS A 1 417 ? 46.908 37.609 -31.477 1.00 38.49 ? 417  LYS A NZ  1 
ATOM   3339 N N   . GLY A 1 418 ? 47.947 40.071 -25.258 1.00 16.68 ? 418  GLY A N   1 
ATOM   3340 C CA  . GLY A 1 418 ? 49.090 40.845 -24.795 1.00 15.09 ? 418  GLY A CA  1 
ATOM   3341 C C   . GLY A 1 418 ? 48.950 42.363 -24.856 1.00 14.34 ? 418  GLY A C   1 
ATOM   3342 O O   . GLY A 1 418 ? 49.910 43.062 -24.610 1.00 14.05 ? 418  GLY A O   1 
ATOM   3343 N N   . LEU A 1 419 ? 47.762 42.869 -25.157 1.00 13.26 ? 419  LEU A N   1 
ATOM   3344 C CA  . LEU A 1 419 ? 47.575 44.315 -25.322 1.00 12.55 ? 419  LEU A CA  1 
ATOM   3345 C C   . LEU A 1 419 ? 47.897 45.094 -24.061 1.00 11.97 ? 419  LEU A C   1 
ATOM   3346 O O   . LEU A 1 419 ? 48.534 46.167 -24.118 1.00 11.50 ? 419  LEU A O   1 
ATOM   3347 C CB  . LEU A 1 419 ? 46.130 44.613 -25.750 1.00 14.25 ? 419  LEU A CB  1 
ATOM   3348 C CG  . LEU A 1 419 ? 45.780 46.094 -25.868 1.00 14.63 ? 419  LEU A CG  1 
ATOM   3349 C CD1 . LEU A 1 419 ? 46.511 46.751 -27.022 1.00 18.10 ? 419  LEU A CD1 1 
ATOM   3350 C CD2 . LEU A 1 419 ? 44.251 46.163 -26.063 1.00 16.48 ? 419  LEU A CD2 1 
ATOM   3351 N N   . HIS A 1 420 ? 47.424 44.586 -22.921 1.00 11.76 ? 420  HIS A N   1 
ATOM   3352 C CA  . HIS A 1 420 ? 47.673 45.351 -21.691 1.00 11.53 ? 420  HIS A CA  1 
ATOM   3353 C C   . HIS A 1 420 ? 49.160 45.456 -21.435 1.00 11.39 ? 420  HIS A C   1 
ATOM   3354 O O   . HIS A 1 420 ? 49.673 46.515 -21.029 1.00 10.79 ? 420  HIS A O   1 
ATOM   3355 C CB  . HIS A 1 420 ? 46.972 44.720 -20.492 1.00 11.13 ? 420  HIS A CB  1 
ATOM   3356 C CG  . HIS A 1 420 ? 45.485 44.933 -20.449 1.00 12.01 ? 420  HIS A CG  1 
ATOM   3357 N ND1 . HIS A 1 420 ? 44.870 45.616 -19.423 1.00 11.91 ? 420  HIS A ND1 1 
ATOM   3358 C CD2 . HIS A 1 420 ? 44.482 44.487 -21.262 1.00 12.65 ? 420  HIS A CD2 1 
ATOM   3359 C CE1 . HIS A 1 420 ? 43.552 45.603 -19.607 1.00 10.70 ? 420  HIS A CE1 1 
ATOM   3360 N NE2 . HIS A 1 420 ? 43.292 44.912 -20.712 1.00 12.13 ? 420  HIS A NE2 1 
ATOM   3361 N N   . HIS A 1 421 ? 49.858 44.347 -21.626 1.00 11.10 ? 421  HIS A N   1 
ATOM   3362 C CA  . HIS A 1 421 ? 51.281 44.344 -21.341 1.00 11.63 ? 421  HIS A CA  1 
ATOM   3363 C C   . HIS A 1 421 ? 52.073 45.195 -22.313 1.00 12.10 ? 421  HIS A C   1 
ATOM   3364 O O   . HIS A 1 421 ? 53.066 45.819 -21.933 1.00 11.98 ? 421  HIS A O   1 
ATOM   3365 C CB  . HIS A 1 421 ? 51.837 42.916 -21.243 1.00 10.90 ? 421  HIS A CB  1 
ATOM   3366 C CG  . HIS A 1 421 ? 53.079 42.832 -20.404 1.00 10.83 ? 421  HIS A CG  1 
ATOM   3367 N ND1 . HIS A 1 421 ? 53.102 43.249 -19.089 1.00 11.39 ? 421  HIS A ND1 1 
ATOM   3368 C CD2 . HIS A 1 421 ? 54.341 42.442 -20.702 1.00 12.23 ? 421  HIS A CD2 1 
ATOM   3369 C CE1 . HIS A 1 421 ? 54.323 43.070 -18.592 1.00 12.12 ? 421  HIS A CE1 1 
ATOM   3370 N NE2 . HIS A 1 421 ? 55.095 42.584 -19.553 1.00 10.62 ? 421  HIS A NE2 1 
ATOM   3371 N N   . LYS A 1 422 ? 51.631 45.219 -23.576 1.00 12.09 ? 422  LYS A N   1 
ATOM   3372 C CA  . LYS A 1 422 ? 52.288 46.072 -24.562 1.00 12.84 ? 422  LYS A CA  1 
ATOM   3373 C C   . LYS A 1 422 ? 52.168 47.532 -24.118 1.00 12.59 ? 422  LYS A C   1 
ATOM   3374 O O   . LYS A 1 422 ? 53.140 48.288 -24.192 1.00 12.52 ? 422  LYS A O   1 
ATOM   3375 C CB  . LYS A 1 422 ? 51.629 45.886 -25.929 1.00 14.48 ? 422  LYS A CB  1 
ATOM   3376 C CG  . LYS A 1 422 ? 52.162 46.725 -27.049 1.00 19.73 ? 422  LYS A CG  1 
ATOM   3377 C CD  . LYS A 1 422 ? 51.046 46.665 -28.153 1.00 25.59 ? 422  LYS A CD  1 
ATOM   3378 C CE  . LYS A 1 422 ? 51.340 47.427 -29.381 1.00 29.45 ? 422  LYS A CE  1 
ATOM   3379 N NZ  . LYS A 1 422 ? 50.217 47.003 -30.277 1.00 33.70 ? 422  LYS A NZ  1 
ATOM   3380 N N   . ILE A 1 423 ? 50.998 47.921 -23.615 1.00 11.50 ? 423  ILE A N   1 
ATOM   3381 C CA  . ILE A 1 423 ? 50.829 49.330 -23.178 1.00 11.22 ? 423  ILE A CA  1 
ATOM   3382 C C   . ILE A 1 423 ? 51.677 49.591 -21.946 1.00 10.78 ? 423  ILE A C   1 
ATOM   3383 O O   . ILE A 1 423 ? 52.285 50.649 -21.823 1.00 9.94  ? 423  ILE A O   1 
ATOM   3384 C CB  . ILE A 1 423 ? 49.327 49.632 -22.918 1.00 11.68 ? 423  ILE A CB  1 
ATOM   3385 C CG1 . ILE A 1 423 ? 48.572 49.539 -24.241 1.00 11.19 ? 423  ILE A CG1 1 
ATOM   3386 C CG2 . ILE A 1 423 ? 49.143 51.043 -22.358 1.00 11.99 ? 423  ILE A CG2 1 
ATOM   3387 C CD1 . ILE A 1 423 ? 47.023 49.524 -24.042 1.00 12.73 ? 423  ILE A CD1 1 
ATOM   3388 N N   . LEU A 1 424 ? 51.713 48.619 -21.040 1.00 10.48 ? 424  LEU A N   1 
ATOM   3389 C CA  . LEU A 1 424 ? 52.528 48.749 -19.827 1.00 9.94  ? 424  LEU A CA  1 
ATOM   3390 C C   . LEU A 1 424 ? 53.998 48.975 -20.179 1.00 10.51 ? 424  LEU A C   1 
ATOM   3391 O O   . LEU A 1 424 ? 54.637 49.903 -19.656 1.00 9.57  ? 424  LEU A O   1 
ATOM   3392 C CB  . LEU A 1 424 ? 52.331 47.519 -18.931 1.00 10.30 ? 424  LEU A CB  1 
ATOM   3393 C CG  . LEU A 1 424 ? 53.023 47.599 -17.556 1.00 9.82  ? 424  LEU A CG  1 
ATOM   3394 C CD1 . LEU A 1 424 ? 52.376 48.682 -16.684 1.00 11.38 ? 424  LEU A CD1 1 
ATOM   3395 C CD2 . LEU A 1 424 ? 52.853 46.216 -16.879 1.00 9.82  ? 424  LEU A CD2 1 
ATOM   3396 N N   . LEU A 1 425 ? 54.500 48.151 -21.100 1.00 10.00 ? 425  LEU A N   1 
ATOM   3397 C CA  . LEU A 1 425 ? 55.894 48.279 -21.557 1.00 10.01 ? 425  LEU A CA  1 
ATOM   3398 C C   . LEU A 1 425 ? 56.144 49.610 -22.215 1.00 10.14 ? 425  LEU A C   1 
ATOM   3399 O O   . LEU A 1 425 ? 57.179 50.228 -21.985 1.00 10.39 ? 425  LEU A O   1 
ATOM   3400 C CB  . LEU A 1 425 ? 56.204 47.151 -22.563 1.00 10.05 ? 425  LEU A CB  1 
ATOM   3401 C CG  . LEU A 1 425 ? 56.402 45.777 -21.887 1.00 10.72 ? 425  LEU A CG  1 
ATOM   3402 C CD1 . LEU A 1 425 ? 56.174 44.648 -22.921 1.00 11.69 ? 425  LEU A CD1 1 
ATOM   3403 C CD2 . LEU A 1 425 ? 57.816 45.668 -21.286 1.00 12.73 ? 425  LEU A CD2 1 
ATOM   3404 N N   . ALA A 1 426 ? 55.194 50.049 -23.050 1.00 10.12 ? 426  ALA A N   1 
ATOM   3405 C CA  . ALA A 1 426 ? 55.378 51.313 -23.764 1.00 10.58 ? 426  ALA A CA  1 
ATOM   3406 C C   . ALA A 1 426 ? 55.499 52.456 -22.756 1.00 10.88 ? 426  ALA A C   1 
ATOM   3407 O O   . ALA A 1 426 ? 56.305 53.367 -22.933 1.00 10.42 ? 426  ALA A O   1 
ATOM   3408 C CB  . ALA A 1 426 ? 54.204 51.555 -24.711 1.00 11.02 ? 426  ALA A CB  1 
ATOM   3409 N N   . ASN A 1 427 ? 54.679 52.432 -21.704 1.00 9.79  ? 427  ASN A N   1 
ATOM   3410 C CA  . ASN A 1 427 ? 54.809 53.470 -20.665 1.00 9.77  ? 427  ASN A CA  1 
ATOM   3411 C C   . ASN A 1 427 ? 56.112 53.385 -19.888 1.00 9.51  ? 427  ASN A C   1 
ATOM   3412 O O   . ASN A 1 427 ? 56.717 54.399 -19.610 1.00 10.03 ? 427  ASN A O   1 
ATOM   3413 C CB  . ASN A 1 427 ? 53.651 53.383 -19.695 1.00 10.44 ? 427  ASN A CB  1 
ATOM   3414 C CG  . ASN A 1 427 ? 52.378 53.935 -20.291 1.00 11.98 ? 427  ASN A CG  1 
ATOM   3415 O OD1 . ASN A 1 427 ? 51.568 53.199 -20.931 1.00 15.42 ? 427  ASN A OD1 1 
ATOM   3416 N ND2 . ASN A 1 427 ? 52.170 55.209 -20.098 1.00 9.72  ? 427  ASN A ND2 1 
ATOM   3417 N N   . PHE A 1 428 ? 56.539 52.174 -19.544 1.00 9.26  ? 428  PHE A N   1 
ATOM   3418 C CA  . PHE A 1 428 ? 57.801 51.970 -18.849 1.00 8.95  ? 428  PHE A CA  1 
ATOM   3419 C C   . PHE A 1 428 ? 58.960 52.605 -19.627 1.00 9.89  ? 428  PHE A C   1 
ATOM   3420 O O   . PHE A 1 428 ? 59.799 53.310 -19.048 1.00 9.69  ? 428  PHE A O   1 
ATOM   3421 C CB  . PHE A 1 428 ? 57.996 50.439 -18.693 1.00 8.74  ? 428  PHE A CB  1 
ATOM   3422 C CG  . PHE A 1 428 ? 59.380 50.038 -18.233 1.00 9.86  ? 428  PHE A CG  1 
ATOM   3423 C CD1 . PHE A 1 428 ? 59.633 49.822 -16.882 1.00 10.51 ? 428  PHE A CD1 1 
ATOM   3424 C CD2 . PHE A 1 428 ? 60.400 49.816 -19.157 1.00 10.34 ? 428  PHE A CD2 1 
ATOM   3425 C CE1 . PHE A 1 428 ? 60.892 49.413 -16.465 1.00 9.65  ? 428  PHE A CE1 1 
ATOM   3426 C CE2 . PHE A 1 428 ? 61.651 49.454 -18.747 1.00 11.52 ? 428  PHE A CE2 1 
ATOM   3427 C CZ  . PHE A 1 428 ? 61.907 49.250 -17.390 1.00 11.85 ? 428  PHE A CZ  1 
ATOM   3428 N N   . LEU A 1 429 ? 58.965 52.366 -20.954 1.00 9.85  ? 429  LEU A N   1 
ATOM   3429 C CA  . LEU A 1 429 ? 60.031 52.884 -21.802 1.00 9.83  ? 429  LEU A CA  1 
ATOM   3430 C C   . LEU A 1 429 ? 59.925 54.389 -22.004 1.00 10.34 ? 429  LEU A C   1 
ATOM   3431 O O   . LEU A 1 429 ? 60.924 55.105 -21.947 1.00 11.36 ? 429  LEU A O   1 
ATOM   3432 C CB  . LEU A 1 429 ? 59.942 52.226 -23.174 1.00 9.73  ? 429  LEU A CB  1 
ATOM   3433 C CG  . LEU A 1 429 ? 60.174 50.723 -23.072 1.00 9.31  ? 429  LEU A CG  1 
ATOM   3434 C CD1 . LEU A 1 429 ? 59.561 50.037 -24.336 1.00 11.85 ? 429  LEU A CD1 1 
ATOM   3435 C CD2 . LEU A 1 429 ? 61.690 50.433 -22.966 1.00 11.95 ? 429  LEU A CD2 1 
ATOM   3436 N N   . ALA A 1 430 ? 58.695 54.853 -22.234 1.00 10.07 ? 430  ALA A N   1 
ATOM   3437 C CA  . ALA A 1 430 ? 58.470 56.263 -22.542 1.00 10.23 ? 430  ALA A CA  1 
ATOM   3438 C C   . ALA A 1 430 ? 58.803 57.150 -21.366 1.00 10.62 ? 430  ALA A C   1 
ATOM   3439 O O   . ALA A 1 430 ? 59.228 58.287 -21.560 1.00 10.94 ? 430  ALA A O   1 
ATOM   3440 C CB  . ALA A 1 430 ? 56.994 56.473 -22.914 1.00 10.81 ? 430  ALA A CB  1 
ATOM   3441 N N   . GLN A 1 431 ? 58.572 56.660 -20.143 1.00 10.17 ? 431  GLN A N   1 
ATOM   3442 C CA  . GLN A 1 431 ? 58.765 57.551 -18.998 1.00 10.36 ? 431  GLN A CA  1 
ATOM   3443 C C   . GLN A 1 431 ? 60.226 57.873 -18.798 1.00 10.14 ? 431  GLN A C   1 
ATOM   3444 O O   . GLN A 1 431 ? 60.554 59.018 -18.484 1.00 9.54  ? 431  GLN A O   1 
ATOM   3445 C CB  . GLN A 1 431 ? 58.162 56.973 -17.714 1.00 9.84  ? 431  GLN A CB  1 
ATOM   3446 C CG  . GLN A 1 431 ? 56.666 57.026 -17.701 1.00 10.96 ? 431  GLN A CG  1 
ATOM   3447 C CD  . GLN A 1 431 ? 56.109 58.446 -17.597 1.00 12.15 ? 431  GLN A CD  1 
ATOM   3448 O OE1 . GLN A 1 431 ? 56.736 59.319 -17.009 1.00 13.23 ? 431  GLN A OE1 1 
ATOM   3449 N NE2 . GLN A 1 431 ? 54.911 58.654 -18.148 1.00 12.05 ? 431  GLN A NE2 1 
ATOM   3450 N N   . THR A 1 432 ? 61.106 56.878 -18.917 1.00 10.69 ? 432  THR A N   1 
ATOM   3451 C CA  . THR A 1 432 ? 62.522 57.176 -18.733 1.00 10.68 ? 432  THR A CA  1 
ATOM   3452 C C   . THR A 1 432 ? 63.040 57.951 -19.943 1.00 10.97 ? 432  THR A C   1 
ATOM   3453 O O   . THR A 1 432 ? 63.902 58.798 -19.800 1.00 11.00 ? 432  THR A O   1 
ATOM   3454 C CB  . THR A 1 432 ? 63.355 55.915 -18.521 1.00 10.47 ? 432  THR A CB  1 
ATOM   3455 O OG1 . THR A 1 432 ? 63.320 55.108 -19.712 1.00 10.41 ? 432  THR A OG1 1 
ATOM   3456 C CG2 . THR A 1 432 ? 62.773 55.105 -17.355 1.00 9.85  ? 432  THR A CG2 1 
ATOM   3457 N N   . GLU A 1 433 ? 62.508 57.664 -21.130 1.00 11.11 ? 433  GLU A N   1 
ATOM   3458 C CA  . GLU A 1 433 ? 62.903 58.457 -22.311 1.00 11.60 ? 433  GLU A CA  1 
ATOM   3459 C C   . GLU A 1 433 ? 62.512 59.936 -22.074 1.00 11.07 ? 433  GLU A C   1 
ATOM   3460 O O   . GLU A 1 433 ? 63.282 60.862 -22.377 1.00 11.77 ? 433  GLU A O   1 
ATOM   3461 C CB  . GLU A 1 433 ? 62.229 57.898 -23.563 1.00 12.24 ? 433  GLU A CB  1 
ATOM   3462 C CG  . GLU A 1 433 ? 62.632 58.641 -24.835 1.00 12.33 ? 433  GLU A CG  1 
ATOM   3463 C CD  . GLU A 1 433 ? 61.859 58.210 -26.074 1.00 13.47 ? 433  GLU A CD  1 
ATOM   3464 O OE1 . GLU A 1 433 ? 60.728 57.694 -25.950 1.00 13.28 ? 433  GLU A OE1 1 
ATOM   3465 O OE2 . GLU A 1 433 ? 62.401 58.409 -27.202 1.00 15.77 ? 433  GLU A OE2 1 
ATOM   3466 N N   . ALA A 1 434 ? 61.308 60.155 -21.547 1.00 10.40 ? 434  ALA A N   1 
ATOM   3467 C CA  . ALA A 1 434 ? 60.842 61.506 -21.293 1.00 10.51 ? 434  ALA A CA  1 
ATOM   3468 C C   . ALA A 1 434 ? 61.655 62.231 -20.233 1.00 10.91 ? 434  ALA A C   1 
ATOM   3469 O O   . ALA A 1 434 ? 61.955 63.419 -20.371 1.00 11.28 ? 434  ALA A O   1 
ATOM   3470 C CB  . ALA A 1 434 ? 59.378 61.460 -20.865 1.00 11.54 ? 434  ALA A CB  1 
ATOM   3471 N N   . LEU A 1 435 ? 61.944 61.516 -19.139 1.00 10.48 ? 435  LEU A N   1 
ATOM   3472 C CA  . LEU A 1 435 ? 62.742 62.083 -18.061 1.00 10.84 ? 435  LEU A CA  1 
ATOM   3473 C C   . LEU A 1 435 ? 64.104 62.520 -18.572 1.00 11.00 ? 435  LEU A C   1 
ATOM   3474 O O   . LEU A 1 435 ? 64.632 63.554 -18.134 1.00 10.92 ? 435  LEU A O   1 
ATOM   3475 C CB  . LEU A 1 435 ? 62.875 61.072 -16.902 1.00 10.04 ? 435  LEU A CB  1 
ATOM   3476 C CG  . LEU A 1 435 ? 61.592 60.979 -16.064 1.00 9.32  ? 435  LEU A CG  1 
ATOM   3477 C CD1 . LEU A 1 435 ? 61.676 59.744 -15.139 1.00 10.26 ? 435  LEU A CD1 1 
ATOM   3478 C CD2 . LEU A 1 435 ? 61.372 62.266 -15.239 1.00 9.73  ? 435  LEU A CD2 1 
ATOM   3479 N N   . MET A 1 436 ? 64.647 61.757 -19.523 1.00 11.66 ? 436  MET A N   1 
ATOM   3480 C CA  . MET A 1 436 ? 65.962 62.131 -20.073 1.00 12.17 ? 436  MET A CA  1 
ATOM   3481 C C   . MET A 1 436 ? 65.810 63.270 -21.058 1.00 12.87 ? 436  MET A C   1 
ATOM   3482 O O   . MET A 1 436 ? 66.549 64.244 -21.002 1.00 13.51 ? 436  MET A O   1 
ATOM   3483 C CB  . MET A 1 436 ? 66.624 60.928 -20.816 1.00 13.60 ? 436  MET A CB  1 
ATOM   3484 C CG  . MET A 1 436 ? 67.811 61.392 -21.764 1.00 16.66 ? 436  MET A CG  1 
ATOM   3485 S SD  . MET A 1 436 ? 68.883 60.019 -22.164 1.00 22.43 ? 436  MET A SD  1 
ATOM   3486 C CE  . MET A 1 436 ? 67.724 59.085 -23.135 1.00 23.24 ? 436  MET A CE  1 
ATOM   3487 N N   . ARG A 1 437 ? 64.864 63.143 -21.979 1.00 13.09 ? 437  ARG A N   1 
ATOM   3488 C CA  . ARG A 1 437 ? 64.893 64.084 -23.129 1.00 14.68 ? 437  ARG A CA  1 
ATOM   3489 C C   . ARG A 1 437 ? 64.306 65.437 -22.873 1.00 14.46 ? 437  ARG A C   1 
ATOM   3490 O O   . ARG A 1 437 ? 64.812 66.457 -23.375 1.00 14.42 ? 437  ARG A O   1 
ATOM   3491 C CB  . ARG A 1 437 ? 64.250 63.461 -24.373 1.00 17.11 ? 437  ARG A CB  1 
ATOM   3492 C CG  . ARG A 1 437 ? 62.798 63.522 -24.420 1.00 24.58 ? 437  ARG A CG  1 
ATOM   3493 C CD  . ARG A 1 437 ? 62.251 64.087 -25.772 1.00 31.44 ? 437  ARG A CD  1 
ATOM   3494 N NE  . ARG A 1 437 ? 62.888 63.496 -26.957 1.00 33.55 ? 437  ARG A NE  1 
ATOM   3495 C CZ  . ARG A 1 437 ? 63.072 64.136 -28.112 1.00 37.64 ? 437  ARG A CZ  1 
ATOM   3496 N NH1 . ARG A 1 437 ? 62.662 65.399 -28.283 1.00 39.18 ? 437  ARG A NH1 1 
ATOM   3497 N NH2 . ARG A 1 437 ? 63.682 63.507 -29.119 1.00 39.82 ? 437  ARG A NH2 1 
ATOM   3498 N N   . GLY A 1 438 ? 63.234 65.457 -22.100 1.00 13.30 ? 438  GLY A N   1 
ATOM   3499 C CA  . GLY A 1 438 ? 62.493 66.696 -21.924 1.00 12.69 ? 438  GLY A CA  1 
ATOM   3500 C C   . GLY A 1 438 ? 61.913 67.233 -23.228 1.00 12.82 ? 438  GLY A C   1 
ATOM   3501 O O   . GLY A 1 438 ? 61.728 66.505 -24.210 1.00 13.55 ? 438  GLY A O   1 
ATOM   3502 N N   . LYS A 1 439 ? 61.654 68.536 -23.230 1.00 11.94 ? 439  LYS A N   1 
ATOM   3503 C CA  . LYS A 1 439 ? 61.023 69.192 -24.372 1.00 12.48 ? 439  LYS A CA  1 
ATOM   3504 C C   . LYS A 1 439 ? 61.341 70.674 -24.244 1.00 13.16 ? 439  LYS A C   1 
ATOM   3505 O O   . LYS A 1 439 ? 60.927 71.321 -23.286 1.00 13.44 ? 439  LYS A O   1 
ATOM   3506 C CB  . LYS A 1 439 ? 59.495 68.975 -24.313 1.00 12.60 ? 439  LYS A CB  1 
ATOM   3507 C CG  . LYS A 1 439 ? 58.796 69.634 -25.510 1.00 12.00 ? 439  LYS A CG  1 
ATOM   3508 C CD  . LYS A 1 439 ? 57.257 69.586 -25.413 1.00 13.45 ? 439  LYS A CD  1 
ATOM   3509 C CE  . LYS A 1 439 ? 56.709 68.149 -25.351 1.00 13.51 ? 439  LYS A CE  1 
ATOM   3510 N NZ  . LYS A 1 439 ? 55.193 68.215 -25.427 1.00 15.92 ? 439  LYS A NZ  1 
ATOM   3511 N N   . SER A 1 440 ? 62.063 71.226 -25.219 1.00 13.16 ? 440  SER A N   1 
ATOM   3512 C CA  . SER A 1 440 ? 62.499 72.628 -25.109 1.00 12.38 ? 440  SER A CA  1 
ATOM   3513 C C   . SER A 1 440 ? 61.389 73.621 -25.360 1.00 12.41 ? 440  SER A C   1 
ATOM   3514 O O   . SER A 1 440 ? 60.318 73.265 -25.900 1.00 12.20 ? 440  SER A O   1 
ATOM   3515 C CB  . SER A 1 440 ? 63.617 72.899 -26.114 1.00 11.88 ? 440  SER A CB  1 
ATOM   3516 O OG  . SER A 1 440 ? 63.098 72.887 -27.433 1.00 11.79 ? 440  SER A OG  1 
ATOM   3517 N N   . THR A 1 441 ? 61.654 74.885 -25.005 1.00 12.18 ? 441  THR A N   1 
ATOM   3518 C CA  . THR A 1 441 ? 60.742 75.945 -25.350 1.00 12.70 ? 441  THR A CA  1 
ATOM   3519 C C   . THR A 1 441 ? 60.325 75.902 -26.817 1.00 12.13 ? 441  THR A C   1 
ATOM   3520 O O   . THR A 1 441 ? 59.135 75.937 -27.148 1.00 12.07 ? 441  THR A O   1 
ATOM   3521 C CB  . THR A 1 441 ? 61.415 77.277 -25.006 1.00 12.46 ? 441  THR A CB  1 
ATOM   3522 O OG1 . THR A 1 441 ? 61.600 77.346 -23.581 1.00 13.27 ? 441  THR A OG1 1 
ATOM   3523 C CG2 . THR A 1 441 ? 60.505 78.475 -25.367 1.00 14.19 ? 441  THR A CG2 1 
ATOM   3524 N N   . GLU A 1 442 ? 61.294 75.773 -27.716 1.00 12.00 ? 442  GLU A N   1 
ATOM   3525 C CA  . GLU A 1 442 ? 60.956 75.809 -29.145 1.00 11.94 ? 442  GLU A CA  1 
ATOM   3526 C C   . GLU A 1 442 ? 60.151 74.577 -29.561 1.00 12.18 ? 442  GLU A C   1 
ATOM   3527 O O   . GLU A 1 442 ? 59.251 74.672 -30.400 1.00 12.40 ? 442  GLU A O   1 
ATOM   3528 C CB  . GLU A 1 442 ? 62.233 75.952 -30.002 1.00 12.31 ? 442  GLU A CB  1 
ATOM   3529 C CG  . GLU A 1 442 ? 62.055 75.634 -31.495 1.00 14.08 ? 442  GLU A CG  1 
ATOM   3530 C CD  . GLU A 1 442 ? 61.060 76.552 -32.177 1.00 14.84 ? 442  GLU A CD  1 
ATOM   3531 O OE1 . GLU A 1 442 ? 60.684 76.200 -33.316 1.00 16.15 ? 442  GLU A OE1 1 
ATOM   3532 O OE2 . GLU A 1 442 ? 60.667 77.615 -31.619 1.00 12.21 ? 442  GLU A OE2 1 
ATOM   3533 N N   . GLU A 1 443 ? 60.487 73.405 -29.000 1.00 12.36 ? 443  GLU A N   1 
ATOM   3534 C CA  . GLU A 1 443 ? 59.704 72.210 -29.336 1.00 12.67 ? 443  GLU A CA  1 
ATOM   3535 C C   . GLU A 1 443 ? 58.258 72.393 -28.886 1.00 13.02 ? 443  GLU A C   1 
ATOM   3536 O O   . GLU A 1 443 ? 57.326 72.041 -29.622 1.00 13.80 ? 443  GLU A O   1 
ATOM   3537 C CB  . GLU A 1 443 ? 60.282 70.947 -28.659 1.00 12.59 ? 443  GLU A CB  1 
ATOM   3538 C CG  . GLU A 1 443 ? 61.614 70.501 -29.249 1.00 16.30 ? 443  GLU A CG  1 
ATOM   3539 C CD  . GLU A 1 443 ? 62.177 69.259 -28.551 1.00 21.36 ? 443  GLU A CD  1 
ATOM   3540 O OE1 . GLU A 1 443 ? 62.246 68.190 -29.216 1.00 28.13 ? 443  GLU A OE1 1 
ATOM   3541 O OE2 . GLU A 1 443 ? 62.568 69.353 -27.384 1.00 17.73 ? 443  GLU A OE2 1 
ATOM   3542 N N   . ALA A 1 444 ? 58.068 72.931 -27.679 1.00 12.64 ? 444  ALA A N   1 
ATOM   3543 C CA  . ALA A 1 444 ? 56.716 73.087 -27.179 1.00 12.56 ? 444  ALA A CA  1 
ATOM   3544 C C   . ALA A 1 444 ? 55.961 74.164 -27.976 1.00 13.39 ? 444  ALA A C   1 
ATOM   3545 O O   . ALA A 1 444 ? 54.750 74.043 -28.208 1.00 13.52 ? 444  ALA A O   1 
ATOM   3546 C CB  . ALA A 1 444 ? 56.720 73.401 -25.690 1.00 13.69 ? 444  ALA A CB  1 
ATOM   3547 N N   . ARG A 1 445 ? 56.671 75.216 -28.366 1.00 12.82 ? 445  ARG A N   1 
ATOM   3548 C CA  . ARG A 1 445 ? 56.073 76.277 -29.163 1.00 13.11 ? 445  ARG A CA  1 
ATOM   3549 C C   . ARG A 1 445 ? 55.562 75.716 -30.484 1.00 13.65 ? 445  ARG A C   1 
ATOM   3550 O O   . ARG A 1 445 ? 54.416 75.994 -30.868 1.00 14.12 ? 445  ARG A O   1 
ATOM   3551 C CB  . ARG A 1 445 ? 57.104 77.376 -29.452 1.00 13.00 ? 445  ARG A CB  1 
ATOM   3552 C CG  . ARG A 1 445 ? 56.481 78.596 -30.186 1.00 14.96 ? 445  ARG A CG  1 
ATOM   3553 C CD  . ARG A 1 445 ? 57.498 79.296 -31.105 1.00 14.80 ? 445  ARG A CD  1 
ATOM   3554 N NE  . ARG A 1 445 ? 58.062 78.362 -32.095 1.00 14.73 ? 445  ARG A NE  1 
ATOM   3555 C CZ  . ARG A 1 445 ? 57.424 77.927 -33.207 1.00 16.18 ? 445  ARG A CZ  1 
ATOM   3556 N NH1 . ARG A 1 445 ? 56.186 78.344 -33.505 1.00 18.61 ? 445  ARG A NH1 1 
ATOM   3557 N NH2 . ARG A 1 445 ? 58.018 77.086 -34.035 1.00 17.42 ? 445  ARG A NH2 1 
ATOM   3558 N N   . LYS A 1 446 ? 56.398 74.930 -31.173 1.00 13.92 ? 446  LYS A N   1 
ATOM   3559 C CA  . LYS A 1 446 ? 56.014 74.320 -32.433 1.00 16.01 ? 446  LYS A CA  1 
ATOM   3560 C C   . LYS A 1 446 ? 54.741 73.521 -32.271 1.00 16.34 ? 446  LYS A C   1 
ATOM   3561 O O   . LYS A 1 446 ? 53.822 73.625 -33.100 1.00 17.76 ? 446  LYS A O   1 
ATOM   3562 C CB  . LYS A 1 446 ? 57.162 73.431 -32.938 1.00 17.42 ? 446  LYS A CB  1 
ATOM   3563 C CG  . LYS A 1 446 ? 56.849 72.650 -34.201 1.00 22.31 ? 446  LYS A CG  1 
ATOM   3564 C CD  . LYS A 1 446 ? 57.552 73.248 -35.399 1.00 29.02 ? 446  LYS A CD  1 
ATOM   3565 C CE  . LYS A 1 446 ? 56.649 73.913 -36.418 1.00 32.32 ? 446  LYS A CE  1 
ATOM   3566 N NZ  . LYS A 1 446 ? 57.311 73.824 -37.793 1.00 31.23 ? 446  LYS A NZ  1 
ATOM   3567 N N   . GLU A 1 447 ? 54.675 72.723 -31.203 1.00 16.03 ? 447  GLU A N   1 
ATOM   3568 C CA  . GLU A 1 447 ? 53.462 71.922 -30.957 1.00 16.93 ? 447  GLU A CA  1 
ATOM   3569 C C   . GLU A 1 447 ? 52.216 72.754 -30.750 1.00 17.21 ? 447  GLU A C   1 
ATOM   3570 O O   . GLU A 1 447 ? 51.155 72.424 -31.279 1.00 18.70 ? 447  GLU A O   1 
ATOM   3571 C CB  . GLU A 1 447 ? 53.647 71.050 -29.717 1.00 17.37 ? 447  GLU A CB  1 
ATOM   3572 C CG  . GLU A 1 447 ? 54.584 69.876 -29.927 1.00 19.58 ? 447  GLU A CG  1 
ATOM   3573 C CD  . GLU A 1 447 ? 54.736 69.028 -28.658 1.00 22.37 ? 447  GLU A CD  1 
ATOM   3574 O OE1 . GLU A 1 447 ? 54.245 69.413 -27.606 1.00 23.56 ? 447  GLU A OE1 1 
ATOM   3575 O OE2 . GLU A 1 447 ? 55.377 67.985 -28.729 1.00 27.85 ? 447  GLU A OE2 1 
ATOM   3576 N N   . LEU A 1 448 ? 52.327 73.821 -29.975 1.00 17.19 ? 448  LEU A N   1 
ATOM   3577 C CA  . LEU A 1 448 ? 51.188 74.684 -29.696 1.00 18.61 ? 448  LEU A CA  1 
ATOM   3578 C C   . LEU A 1 448 ? 50.737 75.392 -30.962 1.00 20.06 ? 448  LEU A C   1 
ATOM   3579 O O   . LEU A 1 448 ? 49.543 75.552 -31.191 1.00 20.92 ? 448  LEU A O   1 
ATOM   3580 C CB  . LEU A 1 448 ? 51.498 75.691 -28.610 1.00 18.83 ? 448  LEU A CB  1 
ATOM   3581 C CG  . LEU A 1 448 ? 51.607 75.057 -27.229 1.00 18.71 ? 448  LEU A CG  1 
ATOM   3582 C CD1 . LEU A 1 448 ? 52.094 76.055 -26.262 1.00 19.54 ? 448  LEU A CD1 1 
ATOM   3583 C CD2 . LEU A 1 448 ? 50.248 74.461 -26.747 1.00 19.22 ? 448  LEU A CD2 1 
ATOM   3584 N N   . GLN A 1 449 ? 51.684 75.788 -31.793 1.00 20.41 ? 449  GLN A N   1 
ATOM   3585 C CA  . GLN A 1 449 ? 51.321 76.465 -33.025 1.00 23.15 ? 449  GLN A CA  1 
ATOM   3586 C C   . GLN A 1 449 ? 50.586 75.490 -33.934 1.00 23.97 ? 449  GLN A C   1 
ATOM   3587 O O   . GLN A 1 449 ? 49.520 75.808 -34.457 1.00 24.73 ? 449  GLN A O   1 
ATOM   3588 C CB  . GLN A 1 449 ? 52.565 77.006 -33.725 1.00 24.08 ? 449  GLN A CB  1 
ATOM   3589 C CG  . GLN A 1 449 ? 52.194 77.963 -34.855 1.00 28.35 ? 449  GLN A CG  1 
ATOM   3590 C CD  . GLN A 1 449 ? 53.244 78.050 -35.923 1.00 35.35 ? 449  GLN A CD  1 
ATOM   3591 O OE1 . GLN A 1 449 ? 52.926 78.378 -37.074 1.00 41.03 ? 449  GLN A OE1 1 
ATOM   3592 N NE2 . GLN A 1 449 ? 54.494 77.782 -35.572 1.00 35.15 ? 449  GLN A NE2 1 
ATOM   3593 N N   . ALA A 1 450 ? 51.132 74.290 -34.097 1.00 24.79 ? 450  ALA A N   1 
ATOM   3594 C CA  . ALA A 1 450 ? 50.488 73.302 -34.951 1.00 25.98 ? 450  ALA A CA  1 
ATOM   3595 C C   . ALA A 1 450 ? 49.091 72.929 -34.431 1.00 27.30 ? 450  ALA A C   1 
ATOM   3596 O O   . ALA A 1 450 ? 48.234 72.494 -35.204 1.00 27.83 ? 450  ALA A O   1 
ATOM   3597 C CB  . ALA A 1 450 ? 51.366 72.059 -35.079 1.00 26.35 ? 450  ALA A CB  1 
ATOM   3598 N N   . ALA A 1 451 ? 48.843 73.127 -33.144 1.00 28.14 ? 451  ALA A N   1 
ATOM   3599 C CA  . ALA A 1 451 ? 47.532 72.788 -32.566 1.00 29.73 ? 451  ALA A CA  1 
ATOM   3600 C C   . ALA A 1 451 ? 46.527 73.919 -32.746 1.00 30.86 ? 451  ALA A C   1 
ATOM   3601 O O   . ALA A 1 451 ? 45.365 73.829 -32.281 1.00 32.26 ? 451  ALA A O   1 
ATOM   3602 C CB  . ALA A 1 451 ? 47.673 72.426 -31.089 1.00 29.32 ? 451  ALA A CB  1 
ATOM   3603 N N   . GLY A 1 452 ? 46.974 74.993 -33.383 1.00 30.89 ? 452  GLY A N   1 
ATOM   3604 C CA  . GLY A 1 452 ? 46.114 76.125 -33.652 1.00 31.21 ? 452  GLY A CA  1 
ATOM   3605 C C   . GLY A 1 452 ? 45.905 77.138 -32.547 1.00 31.17 ? 452  GLY A C   1 
ATOM   3606 O O   . GLY A 1 452 ? 44.923 77.858 -32.580 1.00 31.69 ? 452  GLY A O   1 
ATOM   3607 N N   . LYS A 1 453 ? 46.813 77.223 -31.576 1.00 30.95 ? 453  LYS A N   1 
ATOM   3608 C CA  . LYS A 1 453 ? 46.691 78.236 -30.526 1.00 31.01 ? 453  LYS A CA  1 
ATOM   3609 C C   . LYS A 1 453 ? 47.044 79.628 -31.066 1.00 30.28 ? 453  LYS A C   1 
ATOM   3610 O O   . LYS A 1 453 ? 47.960 79.743 -31.880 1.00 30.15 ? 453  LYS A O   1 
ATOM   3611 C CB  . LYS A 1 453 ? 47.611 77.884 -29.344 1.00 31.04 ? 453  LYS A CB  1 
ATOM   3612 C CG  . LYS A 1 453 ? 47.221 76.599 -28.627 1.00 33.72 ? 453  LYS A CG  1 
ATOM   3613 C CD  . LYS A 1 453 ? 46.360 76.907 -27.391 1.00 37.77 ? 453  LYS A CD  1 
ATOM   3614 C CE  . LYS A 1 453 ? 45.391 75.772 -26.978 1.00 40.43 ? 453  LYS A CE  1 
ATOM   3615 N NZ  . LYS A 1 453 ? 45.842 74.370 -27.272 1.00 41.96 ? 453  LYS A NZ  1 
ATOM   3616 N N   . SER A 1 454 ? 46.330 80.668 -30.622 1.00 30.21 ? 454  SER A N   1 
ATOM   3617 C CA  . SER A 1 454 ? 46.586 82.060 -31.029 1.00 29.92 ? 454  SER A CA  1 
ATOM   3618 C C   . SER A 1 454 ? 47.859 82.571 -30.359 1.00 29.66 ? 454  SER A C   1 
ATOM   3619 O O   . SER A 1 454 ? 48.322 81.967 -29.403 1.00 29.33 ? 454  SER A O   1 
ATOM   3620 C CB  . SER A 1 454 ? 45.447 82.961 -30.572 1.00 30.74 ? 454  SER A CB  1 
ATOM   3621 O OG  . SER A 1 454 ? 45.419 83.032 -29.147 1.00 31.98 ? 454  SER A OG  1 
ATOM   3622 N N   . PRO A 1 455 ? 48.443 83.657 -30.854 1.00 29.64 ? 455  PRO A N   1 
ATOM   3623 C CA  . PRO A 1 455 ? 49.638 84.210 -30.212 1.00 29.37 ? 455  PRO A CA  1 
ATOM   3624 C C   . PRO A 1 455 ? 49.439 84.494 -28.727 1.00 29.91 ? 455  PRO A C   1 
ATOM   3625 O O   . PRO A 1 455 ? 50.271 84.098 -27.924 1.00 29.27 ? 455  PRO A O   1 
ATOM   3626 C CB  . PRO A 1 455 ? 49.883 85.517 -30.980 1.00 29.39 ? 455  PRO A CB  1 
ATOM   3627 C CG  . PRO A 1 455 ? 49.320 85.249 -32.316 1.00 29.32 ? 455  PRO A CG  1 
ATOM   3628 C CD  . PRO A 1 455 ? 48.074 84.415 -32.073 1.00 29.41 ? 455  PRO A CD  1 
ATOM   3629 N N   . GLU A 1 456 ? 48.368 85.177 -28.351 1.00 30.68 ? 456  GLU A N   1 
ATOM   3630 C CA  . GLU A 1 456 ? 48.199 85.494 -26.937 1.00 31.18 ? 456  GLU A CA  1 
ATOM   3631 C C   . GLU A 1 456 ? 48.097 84.221 -26.118 1.00 29.76 ? 456  GLU A C   1 
ATOM   3632 O O   . GLU A 1 456 ? 48.721 84.117 -25.056 1.00 30.47 ? 456  GLU A O   1 
ATOM   3633 C CB  . GLU A 1 456 ? 46.990 86.402 -26.702 1.00 32.35 ? 456  GLU A CB  1 
ATOM   3634 C CG  . GLU A 1 456 ? 45.952 86.308 -27.811 1.00 36.60 ? 456  GLU A CG  1 
ATOM   3635 C CD  . GLU A 1 456 ? 46.402 87.009 -29.097 1.00 40.16 ? 456  GLU A CD  1 
ATOM   3636 O OE1 . GLU A 1 456 ? 46.398 86.368 -30.182 1.00 37.90 ? 456  GLU A OE1 1 
ATOM   3637 O OE2 . GLU A 1 456 ? 46.774 88.214 -29.009 1.00 44.77 ? 456  GLU A OE2 1 
ATOM   3638 N N   . ASP A 1 457 ? 47.337 83.242 -26.599 1.00 27.84 ? 457  ASP A N   1 
ATOM   3639 C CA  . ASP A 1 457 ? 47.182 82.016 -25.826 1.00 26.97 ? 457  ASP A CA  1 
ATOM   3640 C C   . ASP A 1 457 ? 48.451 81.185 -25.762 1.00 25.03 ? 457  ASP A C   1 
ATOM   3641 O O   . ASP A 1 457 ? 48.739 80.513 -24.755 1.00 24.64 ? 457  ASP A O   1 
ATOM   3642 C CB  . ASP A 1 457 ? 46.101 81.134 -26.424 1.00 27.35 ? 457  ASP A CB  1 
ATOM   3643 C CG  . ASP A 1 457 ? 44.696 81.668 -26.162 1.00 30.56 ? 457  ASP A CG  1 
ATOM   3644 O OD1 . ASP A 1 457 ? 44.541 82.676 -25.410 1.00 32.60 ? 457  ASP A OD1 1 
ATOM   3645 O OD2 . ASP A 1 457 ? 43.686 81.121 -26.670 1.00 31.41 ? 457  ASP A OD2 1 
ATOM   3646 N N   . LEU A 1 458 ? 49.177 81.158 -26.861 1.00 23.06 ? 458  LEU A N   1 
ATOM   3647 C CA  . LEU A 1 458 ? 50.422 80.428 -26.851 1.00 23.20 ? 458  LEU A CA  1 
ATOM   3648 C C   . LEU A 1 458 ? 51.356 81.081 -25.854 1.00 23.75 ? 458  LEU A C   1 
ATOM   3649 O O   . LEU A 1 458 ? 51.981 80.407 -25.036 1.00 23.32 ? 458  LEU A O   1 
ATOM   3650 C CB  . LEU A 1 458 ? 51.020 80.435 -28.277 1.00 23.63 ? 458  LEU A CB  1 
ATOM   3651 C CG  . LEU A 1 458 ? 52.152 79.492 -28.648 1.00 23.86 ? 458  LEU A CG  1 
ATOM   3652 C CD1 . LEU A 1 458 ? 52.194 79.184 -30.164 1.00 24.98 ? 458  LEU A CD1 1 
ATOM   3653 C CD2 . LEU A 1 458 ? 53.453 80.157 -28.193 1.00 25.90 ? 458  LEU A CD2 1 
ATOM   3654 N N   . GLU A 1 459 ? 51.451 82.406 -25.885 1.00 25.26 ? 459  GLU A N   1 
ATOM   3655 C CA  . GLU A 1 459 ? 52.480 83.065 -25.069 1.00 26.31 ? 459  GLU A CA  1 
ATOM   3656 C C   . GLU A 1 459 ? 52.277 82.769 -23.593 1.00 26.57 ? 459  GLU A C   1 
ATOM   3657 O O   . GLU A 1 459 ? 53.238 82.537 -22.823 1.00 26.50 ? 459  GLU A O   1 
ATOM   3658 C CB  . GLU A 1 459 ? 52.538 84.580 -25.329 1.00 26.97 ? 459  GLU A CB  1 
ATOM   3659 C CG  . GLU A 1 459 ? 53.621 85.307 -24.508 1.00 30.37 ? 459  GLU A CG  1 
ATOM   3660 C CD  . GLU A 1 459 ? 53.934 86.713 -25.031 1.00 33.07 ? 459  GLU A CD  1 
ATOM   3661 O OE1 . GLU A 1 459 ? 53.371 87.687 -24.481 1.00 34.43 ? 459  GLU A OE1 1 
ATOM   3662 O OE2 . GLU A 1 459 ? 54.740 86.840 -25.995 1.00 34.89 ? 459  GLU A OE2 1 
ATOM   3663 N N   . ARG A 1 460 ? 51.026 82.712 -23.191 1.00 26.24 ? 460  ARG A N   1 
ATOM   3664 C CA  . ARG A 1 460 ? 50.774 82.473 -21.788 1.00 26.49 ? 460  ARG A CA  1 
ATOM   3665 C C   . ARG A 1 460 ? 50.983 80.986 -21.399 1.00 25.03 ? 460  ARG A C   1 
ATOM   3666 O O   . ARG A 1 460 ? 51.581 80.699 -20.351 1.00 26.26 ? 460  ARG A O   1 
ATOM   3667 C CB  . ARG A 1 460 ? 49.358 82.958 -21.405 1.00 28.16 ? 460  ARG A CB  1 
ATOM   3668 C CG  . ARG A 1 460 ? 49.215 84.505 -21.349 1.00 33.01 ? 460  ARG A CG  1 
ATOM   3669 C CD  . ARG A 1 460 ? 47.758 85.022 -21.217 1.00 40.33 ? 460  ARG A CD  1 
ATOM   3670 N NE  . ARG A 1 460 ? 47.004 84.933 -22.474 1.00 45.81 ? 460  ARG A NE  1 
ATOM   3671 C CZ  . ARG A 1 460 ? 45.962 85.713 -22.795 1.00 49.01 ? 460  ARG A CZ  1 
ATOM   3672 N NH1 . ARG A 1 460 ? 45.539 86.649 -21.951 1.00 49.85 ? 460  ARG A NH1 1 
ATOM   3673 N NH2 . ARG A 1 460 ? 45.337 85.557 -23.967 1.00 50.64 ? 460  ARG A NH2 1 
ATOM   3674 N N   . LEU A 1 461 ? 50.541 80.047 -22.244 1.00 22.66 ? 461  LEU A N   1 
ATOM   3675 C CA  . LEU A 1 461 ? 50.620 78.631 -21.896 1.00 20.42 ? 461  LEU A CA  1 
ATOM   3676 C C   . LEU A 1 461 ? 51.989 77.984 -22.090 1.00 18.09 ? 461  LEU A C   1 
ATOM   3677 O O   . LEU A 1 461 ? 52.420 77.087 -21.332 1.00 17.37 ? 461  LEU A O   1 
ATOM   3678 C CB  . LEU A 1 461 ? 49.656 77.891 -22.761 1.00 21.38 ? 461  LEU A CB  1 
ATOM   3679 C CG  . LEU A 1 461 ? 49.585 76.407 -22.590 1.00 22.41 ? 461  LEU A CG  1 
ATOM   3680 C CD1 . LEU A 1 461 ? 49.304 76.054 -21.100 1.00 23.43 ? 461  LEU A CD1 1 
ATOM   3681 C CD2 . LEU A 1 461 ? 48.381 76.013 -23.447 1.00 24.54 ? 461  LEU A CD2 1 
ATOM   3682 N N   . LEU A 1 462 ? 52.671 78.448 -23.120 1.00 15.82 ? 462  LEU A N   1 
ATOM   3683 C CA  . LEU A 1 462 ? 53.962 77.876 -23.506 1.00 14.86 ? 462  LEU A CA  1 
ATOM   3684 C C   . LEU A 1 462 ? 54.938 77.555 -22.379 1.00 14.29 ? 462  LEU A C   1 
ATOM   3685 O O   . LEU A 1 462 ? 55.435 76.446 -22.332 1.00 12.49 ? 462  LEU A O   1 
ATOM   3686 C CB  . LEU A 1 462 ? 54.635 78.802 -24.539 1.00 15.44 ? 462  LEU A CB  1 
ATOM   3687 C CG  . LEU A 1 462 ? 56.022 78.397 -25.060 1.00 16.34 ? 462  LEU A CG  1 
ATOM   3688 C CD1 . LEU A 1 462 ? 56.054 76.982 -25.555 1.00 16.50 ? 462  LEU A CD1 1 
ATOM   3689 C CD2 . LEU A 1 462 ? 56.412 79.311 -26.236 1.00 18.17 ? 462  LEU A CD2 1 
ATOM   3690 N N   . PRO A 1 463 ? 55.255 78.477 -21.483 1.00 14.60 ? 463  PRO A N   1 
ATOM   3691 C CA  . PRO A 1 463 ? 56.304 78.183 -20.497 1.00 14.21 ? 463  PRO A CA  1 
ATOM   3692 C C   . PRO A 1 463 ? 55.964 76.942 -19.661 1.00 13.06 ? 463  PRO A C   1 
ATOM   3693 O O   . PRO A 1 463 ? 56.861 76.213 -19.248 1.00 13.19 ? 463  PRO A O   1 
ATOM   3694 C CB  . PRO A 1 463 ? 56.309 79.431 -19.590 1.00 15.57 ? 463  PRO A CB  1 
ATOM   3695 C CG  . PRO A 1 463 ? 55.521 80.422 -20.292 1.00 18.84 ? 463  PRO A CG  1 
ATOM   3696 C CD  . PRO A 1 463 ? 54.670 79.826 -21.323 1.00 15.86 ? 463  PRO A CD  1 
ATOM   3697 N N   . HIS A 1 464 ? 54.674 76.721 -19.390 1.00 12.08 ? 464  HIS A N   1 
ATOM   3698 C CA  . HIS A 1 464 ? 54.233 75.577 -18.558 1.00 11.65 ? 464  HIS A CA  1 
ATOM   3699 C C   . HIS A 1 464 ? 54.369 74.229 -19.248 1.00 12.01 ? 464  HIS A C   1 
ATOM   3700 O O   . HIS A 1 464 ? 54.289 73.174 -18.574 1.00 11.42 ? 464  HIS A O   1 
ATOM   3701 C CB  . HIS A 1 464 ? 52.732 75.800 -18.204 1.00 11.56 ? 464  HIS A CB  1 
ATOM   3702 C CG  . HIS A 1 464 ? 52.520 77.063 -17.451 1.00 11.80 ? 464  HIS A CG  1 
ATOM   3703 N ND1 . HIS A 1 464 ? 52.655 77.145 -16.080 1.00 13.08 ? 464  HIS A ND1 1 
ATOM   3704 C CD2 . HIS A 1 464 ? 52.263 78.322 -17.890 1.00 13.18 ? 464  HIS A CD2 1 
ATOM   3705 C CE1 . HIS A 1 464 ? 52.465 78.400 -15.705 1.00 14.13 ? 464  HIS A CE1 1 
ATOM   3706 N NE2 . HIS A 1 464 ? 52.239 79.134 -16.785 1.00 12.87 ? 464  HIS A NE2 1 
ATOM   3707 N N   . LYS A 1 465 ? 54.578 74.254 -20.570 1.00 11.57 ? 465  LYS A N   1 
ATOM   3708 C CA  . LYS A 1 465 ? 54.698 73.038 -21.369 1.00 11.86 ? 465  LYS A CA  1 
ATOM   3709 C C   . LYS A 1 465 ? 56.122 72.581 -21.568 1.00 11.24 ? 465  LYS A C   1 
ATOM   3710 O O   . LYS A 1 465 ? 56.345 71.571 -22.223 1.00 11.11 ? 465  LYS A O   1 
ATOM   3711 C CB  . LYS A 1 465 ? 54.047 73.234 -22.745 1.00 12.08 ? 465  LYS A CB  1 
ATOM   3712 C CG  . LYS A 1 465 ? 52.569 73.589 -22.535 1.00 16.40 ? 465  LYS A CG  1 
ATOM   3713 C CD  . LYS A 1 465 ? 51.609 73.146 -23.586 1.00 23.38 ? 465  LYS A CD  1 
ATOM   3714 C CE  . LYS A 1 465 ? 51.597 71.707 -23.871 1.00 24.68 ? 465  LYS A CE  1 
ATOM   3715 N NZ  . LYS A 1 465 ? 50.130 71.317 -24.153 1.00 23.26 ? 465  LYS A NZ  1 
ATOM   3716 N N   . VAL A 1 466 ? 57.066 73.307 -20.994 1.00 10.30 ? 466  VAL A N   1 
ATOM   3717 C CA  . VAL A 1 466 ? 58.475 72.967 -21.182 1.00 11.06 ? 466  VAL A CA  1 
ATOM   3718 C C   . VAL A 1 466 ? 58.934 71.932 -20.141 1.00 11.31 ? 466  VAL A C   1 
ATOM   3719 O O   . VAL A 1 466 ? 58.579 72.030 -18.957 1.00 12.66 ? 466  VAL A O   1 
ATOM   3720 C CB  . VAL A 1 466 ? 59.330 74.248 -21.103 1.00 10.79 ? 466  VAL A CB  1 
ATOM   3721 C CG1 . VAL A 1 466 ? 60.813 73.916 -21.153 1.00 11.21 ? 466  VAL A CG1 1 
ATOM   3722 C CG2 . VAL A 1 466 ? 58.964 75.165 -22.269 1.00 12.17 ? 466  VAL A CG2 1 
ATOM   3723 N N   . PHE A 1 467 ? 59.728 70.959 -20.586 1.00 11.29 ? 467  PHE A N   1 
ATOM   3724 C CA  . PHE A 1 467 ? 60.295 69.946 -19.691 1.00 10.61 ? 467  PHE A CA  1 
ATOM   3725 C C   . PHE A 1 467 ? 61.796 70.060 -19.746 1.00 10.79 ? 467  PHE A C   1 
ATOM   3726 O O   . PHE A 1 467 ? 62.387 69.927 -20.838 1.00 11.43 ? 467  PHE A O   1 
ATOM   3727 C CB  . PHE A 1 467 ? 59.916 68.538 -20.158 1.00 11.14 ? 467  PHE A CB  1 
ATOM   3728 C CG  . PHE A 1 467 ? 58.455 68.174 -19.918 1.00 10.91 ? 467  PHE A CG  1 
ATOM   3729 C CD1 . PHE A 1 467 ? 58.124 67.256 -18.959 1.00 11.94 ? 467  PHE A CD1 1 
ATOM   3730 C CD2 . PHE A 1 467 ? 57.446 68.733 -20.685 1.00 11.68 ? 467  PHE A CD2 1 
ATOM   3731 C CE1 . PHE A 1 467 ? 56.758 66.903 -18.733 1.00 11.49 ? 467  PHE A CE1 1 
ATOM   3732 C CE2 . PHE A 1 467 ? 56.098 68.392 -20.483 1.00 11.31 ? 467  PHE A CE2 1 
ATOM   3733 C CZ  . PHE A 1 467 ? 55.759 67.459 -19.516 1.00 11.86 ? 467  PHE A CZ  1 
ATOM   3734 N N   . GLU A 1 468 ? 62.426 70.276 -18.600 1.00 11.05 ? 468  GLU A N   1 
ATOM   3735 C CA  . GLU A 1 468 ? 63.895 70.451 -18.594 1.00 11.66 ? 468  GLU A CA  1 
ATOM   3736 C C   . GLU A 1 468 ? 64.632 69.135 -18.828 1.00 11.88 ? 468  GLU A C   1 
ATOM   3737 O O   . GLU A 1 468 ? 65.775 69.122 -19.314 1.00 12.27 ? 468  GLU A O   1 
ATOM   3738 C CB  . GLU A 1 468 ? 64.350 71.173 -17.325 1.00 12.64 ? 468  GLU A CB  1 
ATOM   3739 C CG  . GLU A 1 468 ? 63.867 72.630 -17.387 1.00 14.95 ? 468  GLU A CG  1 
ATOM   3740 C CD  . GLU A 1 468 ? 64.357 73.479 -16.248 1.00 18.86 ? 468  GLU A CD  1 
ATOM   3741 O OE1 . GLU A 1 468 ? 64.715 74.636 -16.516 1.00 21.81 ? 468  GLU A OE1 1 
ATOM   3742 O OE2 . GLU A 1 468 ? 64.374 73.012 -15.099 1.00 19.60 ? 468  GLU A OE2 1 
ATOM   3743 N N   . GLY A 1 469 ? 64.002 68.027 -18.486 1.00 11.78 ? 469  GLY A N   1 
ATOM   3744 C CA  . GLY A 1 469 ? 64.656 66.752 -18.713 1.00 11.69 ? 469  GLY A CA  1 
ATOM   3745 C C   . GLY A 1 469 ? 65.903 66.611 -17.872 1.00 11.77 ? 469  GLY A C   1 
ATOM   3746 O O   . GLY A 1 469 ? 65.995 67.139 -16.768 1.00 11.46 ? 469  GLY A O   1 
ATOM   3747 N N   . ASN A 1 470 ? 66.867 65.863 -18.407 1.00 11.20 ? 470  ASN A N   1 
ATOM   3748 C CA  . ASN A 1 470 ? 68.138 65.579 -17.729 1.00 11.73 ? 470  ASN A CA  1 
ATOM   3749 C C   . ASN A 1 470 ? 67.954 64.861 -16.391 1.00 11.08 ? 470  ASN A C   1 
ATOM   3750 O O   . ASN A 1 470 ? 68.759 65.025 -15.473 1.00 11.98 ? 470  ASN A O   1 
ATOM   3751 C CB  . ASN A 1 470 ? 68.977 66.859 -17.511 1.00 12.93 ? 470  ASN A CB  1 
ATOM   3752 C CG  . ASN A 1 470 ? 70.467 66.575 -17.564 1.00 13.85 ? 470  ASN A CG  1 
ATOM   3753 O OD1 . ASN A 1 470 ? 70.879 65.550 -18.095 1.00 15.32 ? 470  ASN A OD1 1 
ATOM   3754 N ND2 . ASN A 1 470 ? 71.267 67.440 -16.974 1.00 16.25 ? 470  ASN A ND2 1 
ATOM   3755 N N   . ARG A 1 471 ? 66.875 64.082 -16.275 1.00 11.11 ? 471  ARG A N   1 
ATOM   3756 C CA  . ARG A 1 471 ? 66.523 63.422 -15.016 1.00 10.26 ? 471  ARG A CA  1 
ATOM   3757 C C   . ARG A 1 471 ? 66.870 61.944 -15.138 1.00 10.41 ? 471  ARG A C   1 
ATOM   3758 O O   . ARG A 1 471 ? 66.292 61.238 -15.950 1.00 10.15 ? 471  ARG A O   1 
ATOM   3759 C CB  . ARG A 1 471 ? 65.015 63.662 -14.740 1.00 9.59  ? 471  ARG A CB  1 
ATOM   3760 C CG  . ARG A 1 471 ? 64.761 65.097 -14.259 1.00 10.95 ? 471  ARG A CG  1 
ATOM   3761 C CD  . ARG A 1 471 ? 63.336 65.578 -14.583 1.00 12.08 ? 471  ARG A CD  1 
ATOM   3762 N NE  . ARG A 1 471 ? 62.884 66.669 -13.702 1.00 11.48 ? 471  ARG A NE  1 
ATOM   3763 C CZ  . ARG A 1 471 ? 63.217 67.949 -13.833 1.00 10.91 ? 471  ARG A CZ  1 
ATOM   3764 N NH1 . ARG A 1 471 ? 64.070 68.348 -14.778 1.00 12.35 ? 471  ARG A NH1 1 
ATOM   3765 N NH2 . ARG A 1 471 ? 62.732 68.816 -12.943 1.00 11.41 ? 471  ARG A NH2 1 
ATOM   3766 N N   . PRO A 1 472 ? 67.839 61.491 -14.361 1.00 10.43 ? 472  PRO A N   1 
ATOM   3767 C CA  . PRO A 1 472 ? 68.431 60.158 -14.585 1.00 10.78 ? 472  PRO A CA  1 
ATOM   3768 C C   . PRO A 1 472 ? 67.640 58.994 -13.988 1.00 10.79 ? 472  PRO A C   1 
ATOM   3769 O O   . PRO A 1 472 ? 67.020 59.113 -12.939 1.00 11.17 ? 472  PRO A O   1 
ATOM   3770 C CB  . PRO A 1 472 ? 69.782 60.254 -13.884 1.00 10.78 ? 472  PRO A CB  1 
ATOM   3771 C CG  . PRO A 1 472 ? 69.515 61.187 -12.700 1.00 11.99 ? 472  PRO A CG  1 
ATOM   3772 C CD  . PRO A 1 472 ? 68.472 62.231 -13.244 1.00 10.95 ? 472  PRO A CD  1 
ATOM   3773 N N   . THR A 1 473 ? 67.711 57.851 -14.662 1.00 10.39 ? 473  THR A N   1 
ATOM   3774 C CA  . THR A 1 473 ? 66.992 56.647 -14.232 1.00 10.38 ? 473  THR A CA  1 
ATOM   3775 C C   . THR A 1 473 ? 67.842 55.420 -14.506 1.00 10.31 ? 473  THR A C   1 
ATOM   3776 O O   . THR A 1 473 ? 68.774 55.434 -15.328 1.00 10.38 ? 473  THR A O   1 
ATOM   3777 C CB  . THR A 1 473 ? 65.664 56.435 -15.020 1.00 10.97 ? 473  THR A CB  1 
ATOM   3778 O OG1 . THR A 1 473 ? 65.944 56.417 -16.446 1.00 10.96 ? 473  THR A OG1 1 
ATOM   3779 C CG2 . THR A 1 473 ? 64.666 57.596 -14.761 1.00 11.19 ? 473  THR A CG2 1 
ATOM   3780 N N   . ASN A 1 474 ? 67.543 54.362 -13.760 1.00 8.84  ? 474  ASN A N   1 
ATOM   3781 C CA  . ASN A 1 474 ? 67.989 53.015 -14.138 1.00 9.42  ? 474  ASN A CA  1 
ATOM   3782 C C   . ASN A 1 474 ? 66.774 52.278 -14.672 1.00 9.64  ? 474  ASN A C   1 
ATOM   3783 O O   . ASN A 1 474 ? 65.656 52.437 -14.135 1.00 9.98  ? 474  ASN A O   1 
ATOM   3784 C CB  . ASN A 1 474 ? 68.399 52.258 -12.879 1.00 9.91  ? 474  ASN A CB  1 
ATOM   3785 C CG  . ASN A 1 474 ? 69.734 52.754 -12.292 1.00 10.05 ? 474  ASN A CG  1 
ATOM   3786 O OD1 . ASN A 1 474 ? 69.917 52.821 -11.028 1.00 13.03 ? 474  ASN A OD1 1 
ATOM   3787 N ND2 . ASN A 1 474 ? 70.652 53.080 -13.167 1.00 7.61  ? 474  ASN A ND2 1 
ATOM   3788 N N   . SER A 1 475 ? 66.970 51.418 -15.673 1.00 9.44  ? 475  SER A N   1 
ATOM   3789 C CA  . SER A 1 475 ? 65.894 50.534 -16.147 1.00 9.86  ? 475  SER A CA  1 
ATOM   3790 C C   . SER A 1 475 ? 66.361 49.121 -15.935 1.00 10.33 ? 475  SER A C   1 
ATOM   3791 O O   . SER A 1 475 ? 67.408 48.730 -16.450 1.00 10.99 ? 475  SER A O   1 
ATOM   3792 C CB  . SER A 1 475 ? 65.535 50.777 -17.625 1.00 10.99 ? 475  SER A CB  1 
ATOM   3793 O OG  . SER A 1 475 ? 64.827 52.000 -17.762 1.00 10.54 ? 475  SER A OG  1 
ATOM   3794 N N   . ILE A 1 476 ? 65.582 48.348 -15.179 1.00 9.51  ? 476  ILE A N   1 
ATOM   3795 C CA  . ILE A 1 476 ? 65.943 46.961 -14.870 1.00 10.21 ? 476  ILE A CA  1 
ATOM   3796 C C   . ILE A 1 476 ? 64.850 46.106 -15.470 1.00 10.60 ? 476  ILE A C   1 
ATOM   3797 O O   . ILE A 1 476 ? 63.710 46.139 -15.015 1.00 10.52 ? 476  ILE A O   1 
ATOM   3798 C CB  . ILE A 1 476 ? 66.045 46.778 -13.335 1.00 10.95 ? 476  ILE A CB  1 
ATOM   3799 C CG1 . ILE A 1 476 ? 67.142 47.705 -12.773 1.00 11.44 ? 476  ILE A CG1 1 
ATOM   3800 C CG2 . ILE A 1 476 ? 66.349 45.309 -13.021 1.00 12.60 ? 476  ILE A CG2 1 
ATOM   3801 C CD1 . ILE A 1 476 ? 67.104 47.843 -11.296 1.00 13.77 ? 476  ILE A CD1 1 
ATOM   3802 N N   . VAL A 1 477 ? 65.200 45.299 -16.471 1.00 10.15 ? 477  VAL A N   1 
ATOM   3803 C CA  . VAL A 1 477 ? 64.186 44.555 -17.199 1.00 11.16 ? 477  VAL A CA  1 
ATOM   3804 C C   . VAL A 1 477 ? 64.568 43.081 -17.100 1.00 11.28 ? 477  VAL A C   1 
ATOM   3805 O O   . VAL A 1 477 ? 65.720 42.723 -17.347 1.00 12.11 ? 477  VAL A O   1 
ATOM   3806 C CB  . VAL A 1 477 ? 64.203 44.972 -18.672 1.00 12.09 ? 477  VAL A CB  1 
ATOM   3807 C CG1 . VAL A 1 477 ? 63.123 44.233 -19.459 1.00 12.12 ? 477  VAL A CG1 1 
ATOM   3808 C CG2 . VAL A 1 477 ? 64.053 46.516 -18.785 1.00 11.61 ? 477  VAL A CG2 1 
ATOM   3809 N N   . PHE A 1 478 ? 63.615 42.239 -16.745 1.00 9.69  ? 478  PHE A N   1 
ATOM   3810 C CA  . PHE A 1 478 ? 63.932 40.831 -16.568 1.00 10.30 ? 478  PHE A CA  1 
ATOM   3811 C C   . PHE A 1 478 ? 62.910 39.976 -17.282 1.00 10.92 ? 478  PHE A C   1 
ATOM   3812 O O   . PHE A 1 478 ? 61.782 40.426 -17.554 1.00 10.66 ? 478  PHE A O   1 
ATOM   3813 C CB  . PHE A 1 478 ? 64.070 40.533 -15.073 1.00 10.12 ? 478  PHE A CB  1 
ATOM   3814 C CG  . PHE A 1 478 ? 63.012 41.173 -14.248 1.00 11.33 ? 478  PHE A CG  1 
ATOM   3815 C CD1 . PHE A 1 478 ? 61.834 40.498 -13.978 1.00 13.74 ? 478  PHE A CD1 1 
ATOM   3816 C CD2 . PHE A 1 478 ? 63.179 42.471 -13.775 1.00 13.40 ? 478  PHE A CD2 1 
ATOM   3817 C CE1 . PHE A 1 478 ? 60.821 41.132 -13.215 1.00 14.26 ? 478  PHE A CE1 1 
ATOM   3818 C CE2 . PHE A 1 478 ? 62.171 43.092 -13.035 1.00 15.10 ? 478  PHE A CE2 1 
ATOM   3819 C CZ  . PHE A 1 478 ? 61.007 42.421 -12.771 1.00 13.85 ? 478  PHE A CZ  1 
ATOM   3820 N N   . THR A 1 479 ? 63.297 38.745 -17.627 1.00 10.78 ? 479  THR A N   1 
ATOM   3821 C CA  . THR A 1 479 ? 62.435 37.925 -18.467 1.00 11.13 ? 479  THR A CA  1 
ATOM   3822 C C   . THR A 1 479 ? 60.992 37.747 -17.958 1.00 11.01 ? 479  THR A C   1 
ATOM   3823 O O   . THR A 1 479 ? 60.019 37.977 -18.703 1.00 11.16 ? 479  THR A O   1 
ATOM   3824 C CB  . THR A 1 479 ? 63.106 36.569 -18.705 1.00 11.28 ? 479  THR A CB  1 
ATOM   3825 O OG1 . THR A 1 479 ? 64.403 36.811 -19.293 1.00 11.49 ? 479  THR A OG1 1 
ATOM   3826 C CG2 . THR A 1 479 ? 62.295 35.816 -19.746 1.00 12.33 ? 479  THR A CG2 1 
ATOM   3827 N N   . LYS A 1 480 ? 60.853 37.323 -16.704 1.00 10.70 ? 480  LYS A N   1 
ATOM   3828 C CA  . LYS A 1 480 ? 59.548 37.075 -16.126 1.00 11.03 ? 480  LYS A CA  1 
ATOM   3829 C C   . LYS A 1 480 ? 59.696 37.080 -14.607 1.00 11.53 ? 480  LYS A C   1 
ATOM   3830 O O   . LYS A 1 480 ? 60.722 36.649 -14.086 1.00 11.72 ? 480  LYS A O   1 
ATOM   3831 C CB  . LYS A 1 480 ? 59.038 35.709 -16.612 1.00 10.38 ? 480  LYS A CB  1 
ATOM   3832 C CG  . LYS A 1 480 ? 57.551 35.441 -16.313 1.00 12.28 ? 480  LYS A CG  1 
ATOM   3833 C CD  . LYS A 1 480 ? 57.108 34.152 -16.974 1.00 14.49 ? 480  LYS A CD  1 
ATOM   3834 C CE  . LYS A 1 480 ? 55.594 34.035 -16.802 1.00 15.97 ? 480  LYS A CE  1 
ATOM   3835 N NZ  . LYS A 1 480 ? 54.978 32.859 -17.553 1.00 19.41 ? 480  LYS A NZ  1 
ATOM   3836 N N   . LEU A 1 481 ? 58.661 37.533 -13.905 1.00 11.03 ? 481  LEU A N   1 
ATOM   3837 C CA  . LEU A 1 481 ? 58.716 37.531 -12.448 1.00 11.63 ? 481  LEU A CA  1 
ATOM   3838 C C   . LEU A 1 481 ? 58.265 36.173 -11.914 1.00 10.93 ? 481  LEU A C   1 
ATOM   3839 O O   . LEU A 1 481 ? 57.106 35.964 -11.529 1.00 11.81 ? 481  LEU A O   1 
ATOM   3840 C CB  . LEU A 1 481 ? 57.891 38.680 -11.842 1.00 11.51 ? 481  LEU A CB  1 
ATOM   3841 C CG  . LEU A 1 481 ? 58.123 38.863 -10.331 1.00 12.89 ? 481  LEU A CG  1 
ATOM   3842 C CD1 . LEU A 1 481 ? 59.558 39.307 -10.025 1.00 14.56 ? 481  LEU A CD1 1 
ATOM   3843 C CD2 . LEU A 1 481 ? 57.060 39.847 -9.779  1.00 14.90 ? 481  LEU A CD2 1 
ATOM   3844 N N   . THR A 1 482 ? 59.211 35.246 -11.917 1.00 10.79 ? 482  THR A N   1 
ATOM   3845 C CA  . THR A 1 482 ? 59.040 33.912 -11.342 1.00 11.04 ? 482  THR A CA  1 
ATOM   3846 C C   . THR A 1 482 ? 59.607 33.922 -9.918  1.00 10.63 ? 482  THR A C   1 
ATOM   3847 O O   . THR A 1 482 ? 60.231 34.907 -9.478  1.00 10.89 ? 482  THR A O   1 
ATOM   3848 C CB  . THR A 1 482 ? 59.887 32.940 -12.141 1.00 10.68 ? 482  THR A CB  1 
ATOM   3849 O OG1 . THR A 1 482 ? 61.246 33.389 -12.112 1.00 11.27 ? 482  THR A OG1 1 
ATOM   3850 C CG2 . THR A 1 482 ? 59.453 32.935 -13.626 1.00 13.03 ? 482  THR A CG2 1 
ATOM   3851 N N   . PRO A 1 483 ? 59.368 32.860 -9.157  1.00 11.16 ? 483  PRO A N   1 
ATOM   3852 C CA  . PRO A 1 483 ? 59.959 32.810 -7.821  1.00 10.70 ? 483  PRO A CA  1 
ATOM   3853 C C   . PRO A 1 483 ? 61.468 32.985 -7.873  1.00 10.45 ? 483  PRO A C   1 
ATOM   3854 O O   . PRO A 1 483 ? 62.024 33.756 -7.071  1.00 9.67  ? 483  PRO A O   1 
ATOM   3855 C CB  . PRO A 1 483 ? 59.553 31.424 -7.298  1.00 10.79 ? 483  PRO A CB  1 
ATOM   3856 C CG  . PRO A 1 483 ? 58.190 31.201 -7.969  1.00 11.58 ? 483  PRO A CG  1 
ATOM   3857 C CD  . PRO A 1 483 ? 58.414 31.744 -9.416  1.00 11.60 ? 483  PRO A CD  1 
ATOM   3858 N N   . PHE A 1 484 ? 62.121 32.317 -8.813  1.00 10.16 ? 484  PHE A N   1 
ATOM   3859 C CA  . PHE A 1 484 ? 63.586 32.424 -8.889  1.00 11.22 ? 484  PHE A CA  1 
ATOM   3860 C C   . PHE A 1 484 ? 64.014 33.862 -9.195  1.00 10.97 ? 484  PHE A C   1 
ATOM   3861 O O   . PHE A 1 484 ? 64.910 34.396 -8.568  1.00 10.48 ? 484  PHE A O   1 
ATOM   3862 C CB  . PHE A 1 484 ? 64.072 31.473 -9.997  1.00 11.30 ? 484  PHE A CB  1 
ATOM   3863 C CG  . PHE A 1 484 ? 65.570 31.487 -10.232 1.00 11.94 ? 484  PHE A CG  1 
ATOM   3864 C CD1 . PHE A 1 484 ? 66.159 32.473 -11.028 1.00 13.17 ? 484  PHE A CD1 1 
ATOM   3865 C CD2 . PHE A 1 484 ? 66.376 30.527 -9.644  1.00 12.33 ? 484  PHE A CD2 1 
ATOM   3866 C CE1 . PHE A 1 484 ? 67.520 32.481 -11.264 1.00 13.49 ? 484  PHE A CE1 1 
ATOM   3867 C CE2 . PHE A 1 484 ? 67.756 30.529 -9.878  1.00 12.14 ? 484  PHE A CE2 1 
ATOM   3868 C CZ  . PHE A 1 484 ? 68.328 31.504 -10.683 1.00 13.19 ? 484  PHE A CZ  1 
ATOM   3869 N N   . MET A 1 485 ? 63.375 34.482 -10.187 1.00 10.52 ? 485  MET A N   1 
ATOM   3870 C CA  . MET A 1 485 ? 63.780 35.819 -10.558 1.00 10.34 ? 485  MET A CA  1 
ATOM   3871 C C   . MET A 1 485 ? 63.503 36.785 -9.397  1.00 9.92  ? 485  MET A C   1 
ATOM   3872 O O   . MET A 1 485 ? 64.296 37.691 -9.144  1.00 10.12 ? 485  MET A O   1 
ATOM   3873 C CB  . MET A 1 485 ? 63.058 36.269 -11.817 1.00 10.78 ? 485  MET A CB  1 
ATOM   3874 C CG  . MET A 1 485 ? 63.468 37.676 -12.286 1.00 12.97 ? 485  MET A CG  1 
ATOM   3875 S SD  . MET A 1 485 ? 65.247 37.766 -12.659 1.00 16.64 ? 485  MET A SD  1 
ATOM   3876 C CE  . MET A 1 485 ? 65.255 36.670 -14.073 1.00 14.23 ? 485  MET A CE  1 
ATOM   3877 N N   . LEU A 1 486 ? 62.385 36.618 -8.705  1.00 9.27  ? 486  LEU A N   1 
ATOM   3878 C CA  . LEU A 1 486 ? 62.126 37.529 -7.580  1.00 9.22  ? 486  LEU A CA  1 
ATOM   3879 C C   . LEU A 1 486 ? 63.249 37.380 -6.531  1.00 9.51  ? 486  LEU A C   1 
ATOM   3880 O O   . LEU A 1 486 ? 63.753 38.380 -5.997  1.00 9.78  ? 486  LEU A O   1 
ATOM   3881 C CB  . LEU A 1 486 ? 60.768 37.205 -6.948  1.00 9.21  ? 486  LEU A CB  1 
ATOM   3882 C CG  . LEU A 1 486 ? 60.474 38.032 -5.689  1.00 9.37  ? 486  LEU A CG  1 
ATOM   3883 C CD1 . LEU A 1 486 ? 60.429 39.535 -5.975  1.00 10.29 ? 486  LEU A CD1 1 
ATOM   3884 C CD2 . LEU A 1 486 ? 59.146 37.554 -5.096  1.00 12.56 ? 486  LEU A CD2 1 
ATOM   3885 N N   . GLY A 1 487 ? 63.646 36.149 -6.248  1.00 9.55  ? 487  GLY A N   1 
ATOM   3886 C CA  . GLY A 1 487 ? 64.732 35.957 -5.297  1.00 10.17 ? 487  GLY A CA  1 
ATOM   3887 C C   . GLY A 1 487 ? 66.039 36.658 -5.735  1.00 10.33 ? 487  GLY A C   1 
ATOM   3888 O O   . GLY A 1 487 ? 66.728 37.276 -4.887  1.00 10.71 ? 487  GLY A O   1 
ATOM   3889 N N   . ALA A 1 488 ? 66.386 36.549 -7.032  1.00 9.05  ? 488  ALA A N   1 
ATOM   3890 C CA  . ALA A 1 488 ? 67.579 37.218 -7.538  1.00 9.35  ? 488  ALA A CA  1 
ATOM   3891 C C   . ALA A 1 488 ? 67.466 38.747 -7.374  1.00 9.99  ? 488  ALA A C   1 
ATOM   3892 O O   . ALA A 1 488 ? 68.424 39.398 -6.936  1.00 9.36  ? 488  ALA A O   1 
ATOM   3893 C CB  . ALA A 1 488 ? 67.812 36.842 -9.018  1.00 10.01 ? 488  ALA A CB  1 
ATOM   3894 N N   . LEU A 1 489 ? 66.295 39.307 -7.703  1.00 9.69  ? 489  LEU A N   1 
ATOM   3895 C CA  . LEU A 1 489 ? 66.129 40.757 -7.606  1.00 9.22  ? 489  LEU A CA  1 
ATOM   3896 C C   . LEU A 1 489 ? 66.184 41.266 -6.199  1.00 9.22  ? 489  LEU A C   1 
ATOM   3897 O O   . LEU A 1 489 ? 66.777 42.334 -5.932  1.00 9.08  ? 489  LEU A O   1 
ATOM   3898 C CB  . LEU A 1 489 ? 64.783 41.162 -8.191  1.00 9.21  ? 489  LEU A CB  1 
ATOM   3899 C CG  . LEU A 1 489 ? 64.707 40.963 -9.709  1.00 10.79 ? 489  LEU A CG  1 
ATOM   3900 C CD1 . LEU A 1 489 ? 63.249 41.091 -10.186 1.00 10.63 ? 489  LEU A CD1 1 
ATOM   3901 C CD2 . LEU A 1 489 ? 65.638 41.940 -10.478 1.00 11.31 ? 489  LEU A CD2 1 
ATOM   3902 N N   . VAL A 1 490 ? 65.563 40.545 -5.266  1.00 8.80  ? 490  VAL A N   1 
ATOM   3903 C CA  . VAL A 1 490 ? 65.631 41.017 -3.878  1.00 9.17  ? 490  VAL A CA  1 
ATOM   3904 C C   . VAL A 1 490 ? 67.084 40.959 -3.369  1.00 9.55  ? 490  VAL A C   1 
ATOM   3905 O O   . VAL A 1 490 ? 67.556 41.887 -2.713  1.00 9.84  ? 490  VAL A O   1 
ATOM   3906 C CB  . VAL A 1 490 ? 64.710 40.194 -2.942  1.00 9.55  ? 490  VAL A CB  1 
ATOM   3907 C CG1 . VAL A 1 490 ? 64.815 40.655 -1.480  1.00 10.75 ? 490  VAL A CG1 1 
ATOM   3908 C CG2 . VAL A 1 490 ? 63.262 40.347 -3.408  1.00 11.43 ? 490  VAL A CG2 1 
ATOM   3909 N N   . ALA A 1 491 ? 67.788 39.874 -3.658  1.00 9.08  ? 491  ALA A N   1 
ATOM   3910 C CA  . ALA A 1 491 ? 69.183 39.751 -3.196  1.00 9.41  ? 491  ALA A CA  1 
ATOM   3911 C C   . ALA A 1 491 ? 70.036 40.834 -3.822  1.00 9.45  ? 491  ALA A C   1 
ATOM   3912 O O   . ALA A 1 491 ? 70.974 41.333 -3.182  1.00 10.14 ? 491  ALA A O   1 
ATOM   3913 C CB  . ALA A 1 491 ? 69.726 38.367 -3.584  1.00 9.55  ? 491  ALA A CB  1 
ATOM   3914 N N   . MET A 1 492 ? 69.719 41.201 -5.068  1.00 8.80  ? 492  MET A N   1 
ATOM   3915 C CA  . MET A 1 492 ? 70.505 42.259 -5.733  1.00 9.45  ? 492  MET A CA  1 
ATOM   3916 C C   . MET A 1 492 ? 70.467 43.552 -4.917  1.00 9.55  ? 492  MET A C   1 
ATOM   3917 O O   . MET A 1 492 ? 71.486 44.199 -4.684  1.00 9.98  ? 492  MET A O   1 
ATOM   3918 C CB  . MET A 1 492 ? 69.985 42.496 -7.159  1.00 10.50 ? 492  MET A CB  1 
ATOM   3919 C CG  . MET A 1 492 ? 70.804 43.505 -7.938  1.00 10.79 ? 492  MET A CG  1 
ATOM   3920 S SD  . MET A 1 492 ? 70.211 43.653 -9.649  1.00 13.04 ? 492  MET A SD  1 
ATOM   3921 C CE  . MET A 1 492 ? 68.647 44.451 -9.381  1.00 14.86 ? 492  MET A CE  1 
ATOM   3922 N N   . TYR A 1 493 ? 69.279 43.937 -4.497  1.00 9.17  ? 493  TYR A N   1 
ATOM   3923 C CA  . TYR A 1 493 ? 69.142 45.166 -3.689  1.00 8.47  ? 493  TYR A CA  1 
ATOM   3924 C C   . TYR A 1 493 ? 69.735 44.970 -2.269  1.00 8.91  ? 493  TYR A C   1 
ATOM   3925 O O   . TYR A 1 493 ? 70.298 45.904 -1.709  1.00 9.34  ? 493  TYR A O   1 
ATOM   3926 C CB  . TYR A 1 493 ? 67.681 45.576 -3.629  1.00 8.76  ? 493  TYR A CB  1 
ATOM   3927 C CG  . TYR A 1 493 ? 67.267 46.381 -4.837  1.00 8.46  ? 493  TYR A CG  1 
ATOM   3928 C CD1 . TYR A 1 493 ? 66.578 45.790 -5.898  1.00 9.09  ? 493  TYR A CD1 1 
ATOM   3929 C CD2 . TYR A 1 493 ? 67.564 47.744 -4.905  1.00 9.80  ? 493  TYR A CD2 1 
ATOM   3930 C CE1 . TYR A 1 493 ? 66.208 46.546 -7.022  1.00 10.83 ? 493  TYR A CE1 1 
ATOM   3931 C CE2 . TYR A 1 493 ? 67.181 48.512 -6.012  1.00 11.47 ? 493  TYR A CE2 1 
ATOM   3932 C CZ  . TYR A 1 493 ? 66.504 47.898 -7.065  1.00 10.83 ? 493  TYR A CZ  1 
ATOM   3933 O OH  . TYR A 1 493 ? 66.097 48.607 -8.183  1.00 12.54 ? 493  TYR A OH  1 
ATOM   3934 N N   . GLU A 1 494 ? 69.612 43.768 -1.680  1.00 8.83  ? 494  GLU A N   1 
ATOM   3935 C CA  . GLU A 1 494 ? 70.298 43.538 -0.400  1.00 8.18  ? 494  GLU A CA  1 
ATOM   3936 C C   . GLU A 1 494 ? 71.782 43.885 -0.545  1.00 9.05  ? 494  GLU A C   1 
ATOM   3937 O O   . GLU A 1 494 ? 72.386 44.554 0.313   1.00 8.90  ? 494  GLU A O   1 
ATOM   3938 C CB  . GLU A 1 494 ? 70.159 42.053 0.049   1.00 8.11  ? 494  GLU A CB  1 
ATOM   3939 C CG  . GLU A 1 494 ? 68.710 41.738 0.455   1.00 9.13  ? 494  GLU A CG  1 
ATOM   3940 C CD  . GLU A 1 494 ? 68.519 40.315 0.939   1.00 10.21 ? 494  GLU A CD  1 
ATOM   3941 O OE1 . GLU A 1 494 ? 69.299 39.433 0.549   1.00 10.93 ? 494  GLU A OE1 1 
ATOM   3942 O OE2 . GLU A 1 494 ? 67.564 40.071 1.685   1.00 9.98  ? 494  GLU A OE2 1 
ATOM   3943 N N   . HIS A 1 495 ? 72.381 43.391 -1.615  1.00 9.54  ? 495  HIS A N   1 
ATOM   3944 C CA  . HIS A 1 495 ? 73.812 43.634 -1.778  1.00 9.94  ? 495  HIS A CA  1 
ATOM   3945 C C   . HIS A 1 495 ? 74.156 45.074 -2.147  1.00 10.33 ? 495  HIS A C   1 
ATOM   3946 O O   . HIS A 1 495 ? 75.209 45.565 -1.763  1.00 10.08 ? 495  HIS A O   1 
ATOM   3947 C CB  . HIS A 1 495 ? 74.416 42.589 -2.732  1.00 10.57 ? 495  HIS A CB  1 
ATOM   3948 C CG  . HIS A 1 495 ? 74.317 41.207 -2.183  1.00 9.76  ? 495  HIS A CG  1 
ATOM   3949 N ND1 . HIS A 1 495 ? 74.498 40.937 -0.840  1.00 11.23 ? 495  HIS A ND1 1 
ATOM   3950 C CD2 . HIS A 1 495 ? 74.040 40.020 -2.785  1.00 9.31  ? 495  HIS A CD2 1 
ATOM   3951 C CE1 . HIS A 1 495 ? 74.351 39.636 -0.640  1.00 10.63 ? 495  HIS A CE1 1 
ATOM   3952 N NE2 . HIS A 1 495 ? 74.081 39.057 -1.807  1.00 9.54  ? 495  HIS A NE2 1 
ATOM   3953 N N   . LYS A 1 496 ? 73.273 45.749 -2.880  1.00 9.57  ? 496  LYS A N   1 
ATOM   3954 C CA  . LYS A 1 496 ? 73.478 47.179 -3.138  1.00 8.59  ? 496  LYS A CA  1 
ATOM   3955 C C   . LYS A 1 496 ? 73.586 47.908 -1.773  1.00 9.20  ? 496  LYS A C   1 
ATOM   3956 O O   . LYS A 1 496 ? 74.464 48.725 -1.537  1.00 9.19  ? 496  LYS A O   1 
ATOM   3957 C CB  . LYS A 1 496 ? 72.273 47.738 -3.918  1.00 8.59  ? 496  LYS A CB  1 
ATOM   3958 C CG  . LYS A 1 496 ? 72.319 49.270 -4.002  1.00 8.78  ? 496  LYS A CG  1 
ATOM   3959 C CD  . LYS A 1 496 ? 70.968 49.846 -4.419  1.00 9.86  ? 496  LYS A CD  1 
ATOM   3960 C CE  . LYS A 1 496 ? 71.020 51.399 -4.314  1.00 9.33  ? 496  LYS A CE  1 
ATOM   3961 N NZ  . LYS A 1 496 ? 69.642 51.966 -4.697  1.00 9.70  ? 496  LYS A NZ  1 
ATOM   3962 N N   . ILE A 1 497 ? 72.654 47.597 -0.892  1.00 8.65  ? 497  ILE A N   1 
ATOM   3963 C CA  . ILE A 1 497 ? 72.598 48.251 0.417   1.00 9.09  ? 497  ILE A CA  1 
ATOM   3964 C C   . ILE A 1 497 ? 73.861 47.942 1.223   1.00 9.26  ? 497  ILE A C   1 
ATOM   3965 O O   . ILE A 1 497 ? 74.415 48.820 1.902   1.00 8.36  ? 497  ILE A O   1 
ATOM   3966 C CB  . ILE A 1 497 ? 71.329 47.755 1.121   1.00 8.57  ? 497  ILE A CB  1 
ATOM   3967 C CG1 . ILE A 1 497 ? 70.104 48.388 0.426   1.00 11.16 ? 497  ILE A CG1 1 
ATOM   3968 C CG2 . ILE A 1 497 ? 71.309 48.101 2.643   1.00 10.52 ? 497  ILE A CG2 1 
ATOM   3969 C CD1 . ILE A 1 497 ? 68.817 47.610 0.732   1.00 12.28 ? 497  ILE A CD1 1 
ATOM   3970 N N   . PHE A 1 498 ? 74.331 46.706 1.118   1.00 8.98  ? 498  PHE A N   1 
ATOM   3971 C CA  . PHE A 1 498 ? 75.582 46.326 1.784   1.00 9.49  ? 498  PHE A CA  1 
ATOM   3972 C C   . PHE A 1 498 ? 76.734 47.200 1.310   1.00 10.03 ? 498  PHE A C   1 
ATOM   3973 O O   . PHE A 1 498 ? 77.509 47.719 2.127   1.00 9.63  ? 498  PHE A O   1 
ATOM   3974 C CB  . PHE A 1 498 ? 75.916 44.839 1.492   1.00 9.73  ? 498  PHE A CB  1 
ATOM   3975 C CG  . PHE A 1 498 ? 77.290 44.428 2.000   1.00 10.59 ? 498  PHE A CG  1 
ATOM   3976 C CD1 . PHE A 1 498 ? 77.472 44.092 3.341   1.00 11.69 ? 498  PHE A CD1 1 
ATOM   3977 C CD2 . PHE A 1 498 ? 78.396 44.426 1.143   1.00 10.82 ? 498  PHE A CD2 1 
ATOM   3978 C CE1 . PHE A 1 498 ? 78.730 43.750 3.823   1.00 10.78 ? 498  PHE A CE1 1 
ATOM   3979 C CE2 . PHE A 1 498 ? 79.650 44.099 1.629   1.00 13.70 ? 498  PHE A CE2 1 
ATOM   3980 C CZ  . PHE A 1 498 ? 79.804 43.732 2.958   1.00 13.88 ? 498  PHE A CZ  1 
ATOM   3981 N N   . VAL A 1 499 ? 76.876 47.318 -0.014  1.00 9.71  ? 499  VAL A N   1 
ATOM   3982 C CA  . VAL A 1 499 ? 78.012 48.056 -0.560  1.00 9.97  ? 499  VAL A CA  1 
ATOM   3983 C C   . VAL A 1 499 ? 77.965 49.515 -0.108  1.00 9.97  ? 499  VAL A C   1 
ATOM   3984 O O   . VAL A 1 499 ? 78.980 50.082 0.294   1.00 10.54 ? 499  VAL A O   1 
ATOM   3985 C CB  . VAL A 1 499 ? 78.021 47.983 -2.093  1.00 10.21 ? 499  VAL A CB  1 
ATOM   3986 C CG1 . VAL A 1 499 ? 79.107 48.913 -2.645  1.00 10.95 ? 499  VAL A CG1 1 
ATOM   3987 C CG2 . VAL A 1 499 ? 78.278 46.497 -2.559  1.00 10.28 ? 499  VAL A CG2 1 
ATOM   3988 N N   . GLN A 1 500 ? 76.782 50.125 -0.145  1.00 9.72  ? 500  GLN A N   1 
ATOM   3989 C CA  . GLN A 1 500 ? 76.666 51.537 0.292   1.00 9.20  ? 500  GLN A CA  1 
ATOM   3990 C C   . GLN A 1 500 ? 77.064 51.708 1.748   1.00 9.67  ? 500  GLN A C   1 
ATOM   3991 O O   . GLN A 1 500 ? 77.784 52.649 2.093   1.00 9.96  ? 500  GLN A O   1 
ATOM   3992 C CB  . GLN A 1 500 ? 75.252 52.101 0.032   1.00 8.53  ? 500  GLN A CB  1 
ATOM   3993 C CG  . GLN A 1 500 ? 74.974 52.169 -1.492  1.00 9.67  ? 500  GLN A CG  1 
ATOM   3994 C CD  . GLN A 1 500 ? 73.664 52.822 -1.860  1.00 9.49  ? 500  GLN A CD  1 
ATOM   3995 O OE1 . GLN A 1 500 ? 73.586 53.562 -2.876  1.00 13.59 ? 500  GLN A OE1 1 
ATOM   3996 N NE2 . GLN A 1 500 ? 72.648 52.575 -1.076  1.00 7.22  ? 500  GLN A NE2 1 
ATOM   3997 N N   . GLY A 1 501 ? 76.629 50.775 2.604   1.00 8.80  ? 501  GLY A N   1 
ATOM   3998 C CA  . GLY A 1 501 ? 76.974 50.828 4.008   1.00 9.76  ? 501  GLY A CA  1 
ATOM   3999 C C   . GLY A 1 501 ? 78.479 50.738 4.238   1.00 9.79  ? 501  GLY A C   1 
ATOM   4000 O O   . GLY A 1 501 ? 79.006 51.465 5.057   1.00 9.32  ? 501  GLY A O   1 
ATOM   4001 N N   . ILE A 1 502 ? 79.169 49.875 3.498   1.00 9.61  ? 502  ILE A N   1 
ATOM   4002 C CA  . ILE A 1 502 ? 80.616 49.798 3.665   1.00 10.96 ? 502  ILE A CA  1 
ATOM   4003 C C   . ILE A 1 502 ? 81.279 51.096 3.224   1.00 10.59 ? 502  ILE A C   1 
ATOM   4004 O O   . ILE A 1 502 ? 82.178 51.597 3.904   1.00 11.35 ? 502  ILE A O   1 
ATOM   4005 C CB  . ILE A 1 502 ? 81.191 48.610 2.890   1.00 10.75 ? 502  ILE A CB  1 
ATOM   4006 C CG1 . ILE A 1 502 ? 80.632 47.276 3.433   1.00 11.45 ? 502  ILE A CG1 1 
ATOM   4007 C CG2 . ILE A 1 502 ? 82.734 48.605 2.941   1.00 10.96 ? 502  ILE A CG2 1 
ATOM   4008 C CD1 . ILE A 1 502 ? 80.789 47.073 4.946   1.00 12.67 ? 502  ILE A CD1 1 
ATOM   4009 N N   . ILE A 1 503 ? 80.829 51.659 2.103   1.00 10.12 ? 503  ILE A N   1 
ATOM   4010 C CA  . ILE A 1 503 ? 81.415 52.927 1.644   1.00 10.20 ? 503  ILE A CA  1 
ATOM   4011 C C   . ILE A 1 503 ? 81.222 54.032 2.666   1.00 10.95 ? 503  ILE A C   1 
ATOM   4012 O O   . ILE A 1 503 ? 82.146 54.790 2.952   1.00 10.96 ? 503  ILE A O   1 
ATOM   4013 C CB  . ILE A 1 503 ? 80.855 53.263 0.266   1.00 10.24 ? 503  ILE A CB  1 
ATOM   4014 C CG1 . ILE A 1 503 ? 81.432 52.242 -0.737  1.00 10.32 ? 503  ILE A CG1 1 
ATOM   4015 C CG2 . ILE A 1 503 ? 81.221 54.719 -0.150  1.00 11.90 ? 503  ILE A CG2 1 
ATOM   4016 C CD1 . ILE A 1 503 ? 80.810 52.329 -2.151  1.00 13.17 ? 503  ILE A CD1 1 
ATOM   4017 N N   . TRP A 1 504 ? 80.041 54.086 3.271   1.00 10.36 ? 504  TRP A N   1 
ATOM   4018 C CA  . TRP A 1 504 ? 79.770 55.096 4.324   1.00 10.74 ? 504  TRP A CA  1 
ATOM   4019 C C   . TRP A 1 504 ? 80.395 54.802 5.687   1.00 10.67 ? 504  TRP A C   1 
ATOM   4020 O O   . TRP A 1 504 ? 80.380 55.652 6.573   1.00 10.83 ? 504  TRP A O   1 
ATOM   4021 C CB  . TRP A 1 504 ? 78.257 55.284 4.512   1.00 9.99  ? 504  TRP A CB  1 
ATOM   4022 C CG  . TRP A 1 504 ? 77.606 55.950 3.359   1.00 10.59 ? 504  TRP A CG  1 
ATOM   4023 C CD1 . TRP A 1 504 ? 78.107 56.985 2.599   1.00 9.83  ? 504  TRP A CD1 1 
ATOM   4024 C CD2 . TRP A 1 504 ? 76.308 55.642 2.816   1.00 9.98  ? 504  TRP A CD2 1 
ATOM   4025 N NE1 . TRP A 1 504 ? 77.202 57.315 1.613   1.00 9.58  ? 504  TRP A NE1 1 
ATOM   4026 C CE2 . TRP A 1 504 ? 76.088 56.523 1.733   1.00 8.92  ? 504  TRP A CE2 1 
ATOM   4027 C CE3 . TRP A 1 504 ? 75.301 54.704 3.140   1.00 10.37 ? 504  TRP A CE3 1 
ATOM   4028 C CZ2 . TRP A 1 504 ? 74.931 56.475 0.947   1.00 11.73 ? 504  TRP A CZ2 1 
ATOM   4029 C CZ3 . TRP A 1 504 ? 74.106 54.652 2.332   1.00 10.48 ? 504  TRP A CZ3 1 
ATOM   4030 C CH2 . TRP A 1 504 ? 73.950 55.542 1.260   1.00 10.07 ? 504  TRP A CH2 1 
ATOM   4031 N N   . ASP A 1 505 ? 80.945 53.603 5.853   1.00 10.80 ? 505  ASP A N   1 
ATOM   4032 C CA  . ASP A 1 505 ? 81.588 53.179 7.106   1.00 11.71 ? 505  ASP A CA  1 
ATOM   4033 C C   . ASP A 1 505 ? 80.582 53.029 8.230   1.00 11.82 ? 505  ASP A C   1 
ATOM   4034 O O   . ASP A 1 505 ? 80.934 53.185 9.394   1.00 12.48 ? 505  ASP A O   1 
ATOM   4035 C CB  . ASP A 1 505 ? 82.717 54.142 7.523   1.00 12.12 ? 505  ASP A CB  1 
ATOM   4036 C CG  . ASP A 1 505 ? 83.837 53.429 8.242   1.00 15.40 ? 505  ASP A CG  1 
ATOM   4037 O OD1 . ASP A 1 505 ? 84.264 52.371 7.716   1.00 17.93 ? 505  ASP A OD1 1 
ATOM   4038 O OD2 . ASP A 1 505 ? 84.357 53.838 9.320   1.00 14.76 ? 505  ASP A OD2 1 
ATOM   4039 N N   . ILE A 1 506 ? 79.329 52.730 7.891   1.00 11.35 ? 506  ILE A N   1 
ATOM   4040 C CA  . ILE A 1 506 ? 78.321 52.511 8.927   1.00 10.89 ? 506  ILE A CA  1 
ATOM   4041 C C   . ILE A 1 506 ? 77.980 51.023 9.037   1.00 11.09 ? 506  ILE A C   1 
ATOM   4042 O O   . ILE A 1 506 ? 78.454 50.202 8.238   1.00 11.07 ? 506  ILE A O   1 
ATOM   4043 C CB  . ILE A 1 506 ? 77.057 53.331 8.640   1.00 11.42 ? 506  ILE A CB  1 
ATOM   4044 C CG1 . ILE A 1 506 ? 76.550 52.955 7.236   1.00 15.20 ? 506  ILE A CG1 1 
ATOM   4045 C CG2 . ILE A 1 506 ? 77.389 54.859 8.801   1.00 11.83 ? 506  ILE A CG2 1 
ATOM   4046 C CD1 . ILE A 1 506 ? 75.180 53.321 6.959   1.00 20.95 ? 506  ILE A CD1 1 
ATOM   4047 N N   . ASN A 1 507 ? 77.188 50.684 10.050  1.00 10.54 ? 507  ASN A N   1 
ATOM   4048 C CA  . ASN A 1 507 ? 76.763 49.291 10.288  1.00 10.41 ? 507  ASN A CA  1 
ATOM   4049 C C   . ASN A 1 507 ? 75.378 49.121 9.674   1.00 10.14 ? 507  ASN A C   1 
ATOM   4050 O O   . ASN A 1 507 ? 74.383 49.610 10.212  1.00 10.02 ? 507  ASN A O   1 
ATOM   4051 C CB  . ASN A 1 507 ? 76.694 49.030 11.804  1.00 11.04 ? 507  ASN A CB  1 
ATOM   4052 C CG  . ASN A 1 507 ? 76.411 47.559 12.161  1.00 11.07 ? 507  ASN A CG  1 
ATOM   4053 O OD1 . ASN A 1 507 ? 76.373 47.178 13.377  1.00 13.47 ? 507  ASN A OD1 1 
ATOM   4054 N ND2 . ASN A 1 507 ? 76.206 46.736 11.152  1.00 8.56  ? 507  ASN A ND2 1 
ATOM   4055 N N   . SER A 1 508 ? 75.298 48.400 8.560   1.00 9.39  ? 508  SER A N   1 
ATOM   4056 C CA  . SER A 1 508 ? 74.005 48.223 7.886   1.00 9.80  ? 508  SER A CA  1 
ATOM   4057 C C   . SER A 1 508 ? 73.085 47.236 8.606   1.00 9.64  ? 508  SER A C   1 
ATOM   4058 O O   . SER A 1 508 ? 71.944 47.034 8.160   1.00 9.74  ? 508  SER A O   1 
ATOM   4059 C CB  . SER A 1 508 ? 74.239 47.685 6.475   1.00 10.67 ? 508  SER A CB  1 
ATOM   4060 O OG  . SER A 1 508 ? 74.903 48.633 5.651   1.00 9.51  ? 508  SER A OG  1 
ATOM   4061 N N   . PHE A 1 509 ? 73.557 46.624 9.705   1.00 9.67  ? 509  PHE A N   1 
ATOM   4062 C CA  . PHE A 1 509 ? 72.905 45.444 10.262  1.00 10.03 ? 509  PHE A CA  1 
ATOM   4063 C C   . PHE A 1 509 ? 72.353 45.537 11.667  1.00 10.80 ? 509  PHE A C   1 
ATOM   4064 O O   . PHE A 1 509 ? 71.721 44.600 12.141  1.00 10.65 ? 509  PHE A O   1 
ATOM   4065 C CB  . PHE A 1 509 ? 73.851 44.239 10.046  1.00 10.13 ? 509  PHE A CB  1 
ATOM   4066 C CG  . PHE A 1 509 ? 74.183 44.073 8.598   1.00 9.80  ? 509  PHE A CG  1 
ATOM   4067 C CD1 . PHE A 1 509 ? 75.459 44.383 8.084   1.00 9.91  ? 509  PHE A CD1 1 
ATOM   4068 C CD2 . PHE A 1 509 ? 73.167 43.689 7.712   1.00 10.62 ? 509  PHE A CD2 1 
ATOM   4069 C CE1 . PHE A 1 509 ? 75.715 44.296 6.730   1.00 10.30 ? 509  PHE A CE1 1 
ATOM   4070 C CE2 . PHE A 1 509 ? 73.425 43.593 6.330   1.00 10.12 ? 509  PHE A CE2 1 
ATOM   4071 C CZ  . PHE A 1 509 ? 74.708 43.900 5.853   1.00 10.18 ? 509  PHE A CZ  1 
ATOM   4072 N N   . ASP A 1 510 ? 72.554 46.695 12.303  1.00 10.44 ? 510  ASP A N   1 
ATOM   4073 C CA  . ASP A 1 510 ? 71.931 46.940 13.612  1.00 10.31 ? 510  ASP A CA  1 
ATOM   4074 C C   . ASP A 1 510 ? 70.771 47.930 13.436  1.00 10.33 ? 510  ASP A C   1 
ATOM   4075 O O   . ASP A 1 510 ? 70.425 48.328 12.290  1.00 10.40 ? 510  ASP A O   1 
ATOM   4076 C CB  . ASP A 1 510 ? 72.960 47.423 14.652  1.00 9.98  ? 510  ASP A CB  1 
ATOM   4077 C CG  . ASP A 1 510 ? 73.625 48.749 14.260  1.00 11.28 ? 510  ASP A CG  1 
ATOM   4078 O OD1 . ASP A 1 510 ? 73.156 49.402 13.291  1.00 10.56 ? 510  ASP A OD1 1 
ATOM   4079 O OD2 . ASP A 1 510 ? 74.639 49.190 14.880  1.00 11.67 ? 510  ASP A OD2 1 
ATOM   4080 N N   . GLN A 1 511 ? 70.123 48.287 14.542  1.00 10.31 ? 511  GLN A N   1 
ATOM   4081 C CA  . GLN A 1 511 ? 69.022 49.273 14.470  1.00 10.02 ? 511  GLN A CA  1 
ATOM   4082 C C   . GLN A 1 511 ? 68.754 49.861 15.839  1.00 10.95 ? 511  GLN A C   1 
ATOM   4083 O O   . GLN A 1 511 ? 67.652 49.771 16.395  1.00 11.17 ? 511  GLN A O   1 
ATOM   4084 C CB  . GLN A 1 511 ? 67.734 48.700 13.797  1.00 10.91 ? 511  GLN A CB  1 
ATOM   4085 C CG  . GLN A 1 511 ? 67.178 47.455 14.480  1.00 11.19 ? 511  GLN A CG  1 
ATOM   4086 C CD  . GLN A 1 511 ? 68.004 46.183 14.235  1.00 12.06 ? 511  GLN A CD  1 
ATOM   4087 O OE1 . GLN A 1 511 ? 68.430 45.915 13.101  1.00 12.13 ? 511  GLN A OE1 1 
ATOM   4088 N NE2 . GLN A 1 511 ? 68.196 45.379 15.289  1.00 13.02 ? 511  GLN A NE2 1 
ATOM   4089 N N   . TRP A 1 512 ? 69.790 50.494 16.366  1.00 10.17 ? 512  TRP A N   1 
ATOM   4090 C CA  . TRP A 1 512 ? 69.690 51.094 17.700  1.00 10.83 ? 512  TRP A CA  1 
ATOM   4091 C C   . TRP A 1 512 ? 68.709 52.243 17.757  1.00 11.53 ? 512  TRP A C   1 
ATOM   4092 O O   . TRP A 1 512 ? 68.226 52.586 18.831  1.00 10.99 ? 512  TRP A O   1 
ATOM   4093 C CB  . TRP A 1 512 ? 71.074 51.524 18.174  1.00 10.61 ? 512  TRP A CB  1 
ATOM   4094 C CG  . TRP A 1 512 ? 71.945 50.329 18.420  1.00 11.78 ? 512  TRP A CG  1 
ATOM   4095 C CD1 . TRP A 1 512 ? 73.037 49.928 17.695  1.00 11.57 ? 512  TRP A CD1 1 
ATOM   4096 C CD2 . TRP A 1 512 ? 71.777 49.370 19.464  1.00 13.44 ? 512  TRP A CD2 1 
ATOM   4097 N NE1 . TRP A 1 512 ? 73.544 48.766 18.242  1.00 11.86 ? 512  TRP A NE1 1 
ATOM   4098 C CE2 . TRP A 1 512 ? 72.789 48.403 19.317  1.00 13.09 ? 512  TRP A CE2 1 
ATOM   4099 C CE3 . TRP A 1 512 ? 70.837 49.207 20.484  1.00 14.28 ? 512  TRP A CE3 1 
ATOM   4100 C CZ2 . TRP A 1 512 ? 72.935 47.315 20.187  1.00 14.93 ? 512  TRP A CZ2 1 
ATOM   4101 C CZ3 . TRP A 1 512 ? 70.979 48.122 21.357  1.00 16.39 ? 512  TRP A CZ3 1 
ATOM   4102 C CH2 . TRP A 1 512 ? 72.028 47.182 21.186  1.00 15.44 ? 512  TRP A CH2 1 
ATOM   4103 N N   . GLY A 1 513 ? 68.373 52.796 16.596  1.00 11.04 ? 513  GLY A N   1 
ATOM   4104 C CA  . GLY A 1 513 ? 67.489 53.960 16.510  1.00 12.56 ? 513  GLY A CA  1 
ATOM   4105 C C   . GLY A 1 513 ? 66.040 53.685 16.837  1.00 13.63 ? 513  GLY A C   1 
ATOM   4106 O O   . GLY A 1 513 ? 65.258 54.644 16.959  1.00 14.05 ? 513  GLY A O   1 
ATOM   4107 N N   . VAL A 1 514 ? 65.657 52.413 17.016  1.00 13.79 ? 514  VAL A N   1 
ATOM   4108 C CA  . VAL A 1 514 ? 64.272 52.141 17.382  1.00 14.70 ? 514  VAL A CA  1 
ATOM   4109 C C   . VAL A 1 514 ? 64.086 52.059 18.897  1.00 14.15 ? 514  VAL A C   1 
ATOM   4110 O O   . VAL A 1 514 ? 62.956 52.029 19.377  1.00 14.03 ? 514  VAL A O   1 
ATOM   4111 C CB  . VAL A 1 514 ? 63.720 50.876 16.675  1.00 15.30 ? 514  VAL A CB  1 
ATOM   4112 C CG1 . VAL A 1 514 ? 63.954 50.975 15.183  1.00 17.83 ? 514  VAL A CG1 1 
ATOM   4113 C CG2 . VAL A 1 514 ? 64.364 49.610 17.237  1.00 16.41 ? 514  VAL A CG2 1 
ATOM   4114 N N   . GLU A 1 515 ? 65.181 52.083 19.660  1.00 13.91 ? 515  GLU A N   1 
ATOM   4115 C CA  . GLU A 1 515 ? 65.093 51.862 21.106  1.00 14.44 ? 515  GLU A CA  1 
ATOM   4116 C C   . GLU A 1 515 ? 64.402 52.968 21.904  1.00 14.21 ? 515  GLU A C   1 
ATOM   4117 O O   . GLU A 1 515 ? 63.610 52.683 22.814  1.00 14.43 ? 515  GLU A O   1 
ATOM   4118 C CB  . GLU A 1 515 ? 66.512 51.593 21.702  1.00 15.72 ? 515  GLU A CB  1 
ATOM   4119 C CG  . GLU A 1 515 ? 66.468 51.050 23.108  1.00 19.91 ? 515  GLU A CG  1 
ATOM   4120 C CD  . GLU A 1 515 ? 67.791 50.452 23.573  1.00 22.64 ? 515  GLU A CD  1 
ATOM   4121 O OE1 . GLU A 1 515 ? 67.759 49.842 24.671  1.00 26.55 ? 515  GLU A OE1 1 
ATOM   4122 O OE2 . GLU A 1 515 ? 68.824 50.575 22.878  1.00 19.05 ? 515  GLU A OE2 1 
ATOM   4123 N N   . LEU A 1 516 ? 64.738 54.217 21.611  1.00 13.13 ? 516  LEU A N   1 
ATOM   4124 C CA  . LEU A 1 516 ? 64.239 55.332 22.418  1.00 13.07 ? 516  LEU A CA  1 
ATOM   4125 C C   . LEU A 1 516 ? 62.706 55.367 22.394  1.00 12.97 ? 516  LEU A C   1 
ATOM   4126 O O   . LEU A 1 516 ? 62.058 55.528 23.433  1.00 13.03 ? 516  LEU A O   1 
ATOM   4127 C CB  . LEU A 1 516 ? 64.831 56.649 21.938  1.00 12.99 ? 516  LEU A CB  1 
ATOM   4128 C CG  . LEU A 1 516 ? 64.368 57.889 22.745  1.00 13.35 ? 516  LEU A CG  1 
ATOM   4129 C CD1 . LEU A 1 516 ? 64.635 57.745 24.299  1.00 14.06 ? 516  LEU A CD1 1 
ATOM   4130 C CD2 . LEU A 1 516 ? 65.027 59.125 22.139  1.00 14.00 ? 516  LEU A CD2 1 
ATOM   4131 N N   . GLY A 1 517 ? 62.128 55.222 21.203  1.00 12.44 ? 517  GLY A N   1 
ATOM   4132 C CA  . GLY A 1 517 ? 60.668 55.273 21.135  1.00 11.97 ? 517  GLY A CA  1 
ATOM   4133 C C   . GLY A 1 517 ? 60.027 54.125 21.902  1.00 12.64 ? 517  GLY A C   1 
ATOM   4134 O O   . GLY A 1 517 ? 58.928 54.286 22.492  1.00 13.06 ? 517  GLY A O   1 
ATOM   4135 N N   . LYS A 1 518 ? 60.654 52.952 21.877  1.00 12.23 ? 518  LYS A N   1 
ATOM   4136 C CA  . LYS A 1 518 ? 60.110 51.827 22.648  1.00 13.49 ? 518  LYS A CA  1 
ATOM   4137 C C   . LYS A 1 518 ? 60.160 52.144 24.155  1.00 13.75 ? 518  LYS A C   1 
ATOM   4138 O O   . LYS A 1 518 ? 59.188 51.857 24.896  1.00 13.76 ? 518  LYS A O   1 
ATOM   4139 C CB  . LYS A 1 518 ? 60.900 50.528 22.355  1.00 13.54 ? 518  LYS A CB  1 
ATOM   4140 C CG  . LYS A 1 518 ? 60.603 49.926 20.974  1.00 14.58 ? 518  LYS A CG  1 
ATOM   4141 C CD  . LYS A 1 518 ? 61.452 48.667 20.736  1.00 16.72 ? 518  LYS A CD  1 
ATOM   4142 C CE  . LYS A 1 518 ? 61.393 48.254 19.269  1.00 19.88 ? 518  LYS A CE  1 
ATOM   4143 N NZ  . LYS A 1 518 ? 62.235 46.964 19.059  1.00 23.22 ? 518  LYS A NZ  1 
ATOM   4144 N N   . GLN A 1 519 ? 61.277 52.708 24.610  1.00 12.82 ? 519  GLN A N   1 
ATOM   4145 C CA  . GLN A 1 519 ? 61.425 53.077 26.006  1.00 14.00 ? 519  GLN A CA  1 
ATOM   4146 C C   . GLN A 1 519 ? 60.379 54.072 26.429  1.00 13.78 ? 519  GLN A C   1 
ATOM   4147 O O   . GLN A 1 519 ? 59.725 53.916 27.474  1.00 13.98 ? 519  GLN A O   1 
ATOM   4148 C CB  . GLN A 1 519 ? 62.807 53.658 26.253  1.00 14.64 ? 519  GLN A CB  1 
ATOM   4149 C CG  . GLN A 1 519 ? 63.883 52.626 26.095  1.00 16.66 ? 519  GLN A CG  1 
ATOM   4150 C CD  . GLN A 1 519 ? 65.234 53.259 26.279  1.00 22.25 ? 519  GLN A CD  1 
ATOM   4151 O OE1 . GLN A 1 519 ? 65.611 54.146 25.513  1.00 19.21 ? 519  GLN A OE1 1 
ATOM   4152 N NE2 . GLN A 1 519 ? 65.945 52.862 27.343  1.00 27.53 ? 519  GLN A NE2 1 
ATOM   4153 N N   . LEU A 1 520 ? 60.192 55.106 25.620  1.00 12.84 ? 520  LEU A N   1 
ATOM   4154 C CA  . LEU A 1 520 ? 59.271 56.170 26.027  1.00 13.05 ? 520  LEU A CA  1 
ATOM   4155 C C   . LEU A 1 520 ? 57.817 55.690 26.002  1.00 12.61 ? 520  LEU A C   1 
ATOM   4156 O O   . LEU A 1 520 ? 57.007 56.140 26.794  1.00 13.76 ? 520  LEU A O   1 
ATOM   4157 C CB  . LEU A 1 520 ? 59.476 57.442 25.167  1.00 12.36 ? 520  LEU A CB  1 
ATOM   4158 C CG  . LEU A 1 520 ? 60.869 58.067 25.323  1.00 13.74 ? 520  LEU A CG  1 
ATOM   4159 C CD1 . LEU A 1 520 ? 60.892 59.404 24.628  1.00 13.40 ? 520  LEU A CD1 1 
ATOM   4160 C CD2 . LEU A 1 520 ? 61.334 58.231 26.766  1.00 16.70 ? 520  LEU A CD2 1 
ATOM   4161 N N   . ALA A 1 521 ? 57.481 54.779 25.084  1.00 12.18 ? 521  ALA A N   1 
ATOM   4162 C CA  . ALA A 1 521 ? 56.116 54.248 25.049  1.00 13.15 ? 521  ALA A CA  1 
ATOM   4163 C C   . ALA A 1 521 ? 55.797 53.417 26.285  1.00 13.58 ? 521  ALA A C   1 
ATOM   4164 O O   . ALA A 1 521 ? 54.675 53.463 26.800  1.00 14.31 ? 521  ALA A O   1 
ATOM   4165 C CB  . ALA A 1 521 ? 55.859 53.458 23.779  1.00 13.97 ? 521  ALA A CB  1 
ATOM   4166 N N   . LYS A 1 522 ? 56.778 52.671 26.780  1.00 14.50 ? 522  LYS A N   1 
ATOM   4167 C CA  . LYS A 1 522 ? 56.533 51.922 28.009  1.00 15.85 ? 522  LYS A CA  1 
ATOM   4168 C C   . LYS A 1 522 ? 56.230 52.848 29.175  1.00 15.93 ? 522  LYS A C   1 
ATOM   4169 O O   . LYS A 1 522 ? 55.422 52.484 30.029  1.00 16.98 ? 522  LYS A O   1 
ATOM   4170 C CB  . LYS A 1 522 ? 57.717 50.995 28.329  1.00 17.35 ? 522  LYS A CB  1 
ATOM   4171 C CG  . LYS A 1 522 ? 57.851 49.796 27.365  1.00 21.55 ? 522  LYS A CG  1 
ATOM   4172 C CD  . LYS A 1 522 ? 56.520 49.105 27.122  1.00 28.62 ? 522  LYS A CD  1 
ATOM   4173 C CE  . LYS A 1 522 ? 55.991 48.423 28.372  1.00 32.94 ? 522  LYS A CE  1 
ATOM   4174 N NZ  . LYS A 1 522 ? 54.516 48.159 28.257  1.00 34.62 ? 522  LYS A NZ  1 
ATOM   4175 N N   . LYS A 1 523 ? 56.871 54.017 29.241  1.00 15.74 ? 523  LYS A N   1 
ATOM   4176 C CA  . LYS A 1 523 ? 56.591 54.957 30.335  1.00 17.03 ? 523  LYS A CA  1 
ATOM   4177 C C   . LYS A 1 523 ? 55.197 55.567 30.184  1.00 16.98 ? 523  LYS A C   1 
ATOM   4178 O O   . LYS A 1 523 ? 54.513 55.813 31.181  1.00 17.87 ? 523  LYS A O   1 
ATOM   4179 C CB  . LYS A 1 523 ? 57.642 56.083 30.458  1.00 18.63 ? 523  LYS A CB  1 
ATOM   4180 C CG  . LYS A 1 523 ? 59.135 55.633 30.491  1.00 23.00 ? 523  LYS A CG  1 
ATOM   4181 C CD  . LYS A 1 523 ? 59.488 54.466 31.432  1.00 29.97 ? 523  LYS A CD  1 
ATOM   4182 C CE  . LYS A 1 523 ? 59.600 53.068 30.701  1.00 30.98 ? 523  LYS A CE  1 
ATOM   4183 N NZ  . LYS A 1 523 ? 60.790 52.698 29.781  1.00 25.96 ? 523  LYS A NZ  1 
ATOM   4184 N N   . ILE A 1 524 ? 54.776 55.847 28.945  1.00 15.48 ? 524  ILE A N   1 
ATOM   4185 C CA  . ILE A 1 524 ? 53.491 56.514 28.750  1.00 15.11 ? 524  ILE A CA  1 
ATOM   4186 C C   . ILE A 1 524 ? 52.298 55.599 28.913  1.00 15.59 ? 524  ILE A C   1 
ATOM   4187 O O   . ILE A 1 524 ? 51.241 56.030 29.361  1.00 14.92 ? 524  ILE A O   1 
ATOM   4188 C CB  . ILE A 1 524 ? 53.440 57.200 27.368  1.00 14.33 ? 524  ILE A CB  1 
ATOM   4189 C CG1 . ILE A 1 524 ? 54.365 58.422 27.384  1.00 14.54 ? 524  ILE A CG1 1 
ATOM   4190 C CG2 . ILE A 1 524 ? 51.995 57.569 26.979  1.00 13.46 ? 524  ILE A CG2 1 
ATOM   4191 C CD1 . ILE A 1 524 ? 54.653 58.953 25.993  1.00 14.35 ? 524  ILE A CD1 1 
ATOM   4192 N N   . GLU A 1 525 ? 52.456 54.327 28.557  1.00 16.32 ? 525  GLU A N   1 
ATOM   4193 C CA  . GLU A 1 525 ? 51.333 53.390 28.590  1.00 18.29 ? 525  GLU A CA  1 
ATOM   4194 C C   . GLU A 1 525 ? 50.506 53.448 29.900  1.00 18.80 ? 525  GLU A C   1 
ATOM   4195 O O   . GLU A 1 525 ? 49.288 53.675 29.874  1.00 18.69 ? 525  GLU A O   1 
ATOM   4196 C CB  . GLU A 1 525 ? 51.814 51.969 28.208  1.00 18.79 ? 525  GLU A CB  1 
ATOM   4197 C CG  . GLU A 1 525 ? 50.662 51.001 27.976  1.00 21.35 ? 525  GLU A CG  1 
ATOM   4198 C CD  . GLU A 1 525 ? 51.139 49.612 27.606  1.00 24.08 ? 525  GLU A CD  1 
ATOM   4199 O OE1 . GLU A 1 525 ? 52.291 49.518 27.141  1.00 25.05 ? 525  GLU A OE1 1 
ATOM   4200 O OE2 . GLU A 1 525 ? 50.345 48.643 27.798  1.00 26.67 ? 525  GLU A OE2 1 
ATOM   4201 N N   . PRO A 1 526 ? 51.132 53.256 31.052  1.00 19.28 ? 526  PRO A N   1 
ATOM   4202 C CA  . PRO A 1 526 ? 50.358 53.305 32.306  1.00 19.99 ? 526  PRO A CA  1 
ATOM   4203 C C   . PRO A 1 526 ? 49.744 54.677 32.600  1.00 20.22 ? 526  PRO A C   1 
ATOM   4204 O O   . PRO A 1 526 ? 48.725 54.755 33.307  1.00 21.45 ? 526  PRO A O   1 
ATOM   4205 C CB  . PRO A 1 526 ? 51.387 52.992 33.399  1.00 20.29 ? 526  PRO A CB  1 
ATOM   4206 C CG  . PRO A 1 526 ? 52.765 53.029 32.714  1.00 20.44 ? 526  PRO A CG  1 
ATOM   4207 C CD  . PRO A 1 526 ? 52.572 52.996 31.244  1.00 20.18 ? 526  PRO A CD  1 
ATOM   4208 N N   . GLU A 1 527 ? 50.347 55.743 32.091  1.00 18.93 ? 527  GLU A N   1 
ATOM   4209 C CA  . GLU A 1 527 ? 49.843 57.083 32.356  1.00 19.12 ? 527  GLU A CA  1 
ATOM   4210 C C   . GLU A 1 527 ? 48.528 57.345 31.649  1.00 19.02 ? 527  GLU A C   1 
ATOM   4211 O O   . GLU A 1 527 ? 47.827 58.292 31.961  1.00 19.28 ? 527  GLU A O   1 
ATOM   4212 C CB  . GLU A 1 527 ? 50.877 58.121 31.945  1.00 19.16 ? 527  GLU A CB  1 
ATOM   4213 C CG  . GLU A 1 527 ? 52.163 57.981 32.752  1.00 20.40 ? 527  GLU A CG  1 
ATOM   4214 C CD  . GLU A 1 527 ? 53.236 58.955 32.320  1.00 23.66 ? 527  GLU A CD  1 
ATOM   4215 O OE1 . GLU A 1 527 ? 54.004 59.436 33.192  1.00 24.46 ? 527  GLU A OE1 1 
ATOM   4216 O OE2 . GLU A 1 527 ? 53.301 59.264 31.118  1.00 22.70 ? 527  GLU A OE2 1 
ATOM   4217 N N   . LEU A 1 528 ? 48.206 56.513 30.672  1.00 18.48 ? 528  LEU A N   1 
ATOM   4218 C CA  . LEU A 1 528 ? 46.984 56.707 29.930  1.00 19.08 ? 528  LEU A CA  1 
ATOM   4219 C C   . LEU A 1 528 ? 45.793 56.181 30.718  1.00 21.37 ? 528  LEU A C   1 
ATOM   4220 O O   . LEU A 1 528 ? 44.690 56.593 30.464  1.00 22.60 ? 528  LEU A O   1 
ATOM   4221 C CB  . LEU A 1 528 ? 47.076 56.012 28.573  1.00 17.74 ? 528  LEU A CB  1 
ATOM   4222 C CG  . LEU A 1 528 ? 48.081 56.688 27.644  1.00 16.12 ? 528  LEU A CG  1 
ATOM   4223 C CD1 . LEU A 1 528 ? 48.171 55.851 26.354  1.00 15.30 ? 528  LEU A CD1 1 
ATOM   4224 C CD2 . LEU A 1 528 ? 47.629 58.095 27.299  1.00 18.21 ? 528  LEU A CD2 1 
ATOM   4225 N N   . ASP A 1 529 ? 46.035 55.292 31.679  1.00 22.82 ? 529  ASP A N   1 
ATOM   4226 C CA  . ASP A 1 529 ? 44.954 54.767 32.515  1.00 25.21 ? 529  ASP A CA  1 
ATOM   4227 C C   . ASP A 1 529 ? 44.444 55.855 33.468  1.00 26.20 ? 529  ASP A C   1 
ATOM   4228 O O   . ASP A 1 529 ? 45.222 56.689 33.934  1.00 26.96 ? 529  ASP A O   1 
ATOM   4229 C CB  . ASP A 1 529 ? 45.488 53.591 33.331  1.00 26.03 ? 529  ASP A CB  1 
ATOM   4230 C CG  . ASP A 1 529 ? 45.887 52.400 32.468  1.00 29.11 ? 529  ASP A CG  1 
ATOM   4231 O OD1 . ASP A 1 529 ? 45.206 52.136 31.455  1.00 30.41 ? 529  ASP A OD1 1 
ATOM   4232 O OD2 . ASP A 1 529 ? 46.848 51.646 32.759  1.00 33.67 ? 529  ASP A OD2 1 
ATOM   4233 N N   . GLY A 1 530 ? 43.149 55.876 33.755  1.00 26.88 ? 530  GLY A N   1 
ATOM   4234 C CA  . GLY A 1 530 ? 42.644 56.826 34.751  1.00 28.01 ? 530  GLY A CA  1 
ATOM   4235 C C   . GLY A 1 530 ? 42.385 58.236 34.231  1.00 28.85 ? 530  GLY A C   1 
ATOM   4236 O O   . GLY A 1 530 ? 42.821 58.595 33.141  1.00 28.94 ? 530  GLY A O   1 
ATOM   4237 N N   . SER A 1 531 ? 41.720 59.057 35.033  1.00 28.98 ? 531  SER A N   1 
ATOM   4238 C CA  . SER A 1 531 ? 41.265 60.365 34.589  1.00 29.21 ? 531  SER A CA  1 
ATOM   4239 C C   . SER A 1 531 ? 42.246 61.474 34.899  1.00 28.07 ? 531  SER A C   1 
ATOM   4240 O O   . SER A 1 531 ? 42.065 62.596 34.445  1.00 29.39 ? 531  SER A O   1 
ATOM   4241 C CB  . SER A 1 531 ? 39.937 60.694 35.295  1.00 29.81 ? 531  SER A CB  1 
ATOM   4242 O OG  . SER A 1 531 ? 40.143 60.689 36.704  1.00 31.88 ? 531  SER A OG  1 
ATOM   4243 N N   . ALA A 1 532 ? 43.284 61.153 35.651  1.00 26.68 ? 532  ALA A N   1 
ATOM   4244 C CA  . ALA A 1 532 ? 44.205 62.171 36.134  1.00 26.34 ? 532  ALA A CA  1 
ATOM   4245 C C   . ALA A 1 532 ? 44.993 62.860 35.031  1.00 25.88 ? 532  ALA A C   1 
ATOM   4246 O O   . ALA A 1 532 ? 45.471 62.202 34.109  1.00 24.60 ? 532  ALA A O   1 
ATOM   4247 C CB  . ALA A 1 532 ? 45.184 61.566 37.104  1.00 26.93 ? 532  ALA A CB  1 
ATOM   4248 N N   . GLN A 1 533 ? 45.143 64.170 35.179  1.00 25.60 ? 533  GLN A N   1 
ATOM   4249 C CA  . GLN A 1 533 ? 45.974 64.944 34.269  1.00 25.89 ? 533  GLN A CA  1 
ATOM   4250 C C   . GLN A 1 533 ? 47.433 64.531 34.458  1.00 24.04 ? 533  GLN A C   1 
ATOM   4251 O O   . GLN A 1 533 ? 47.887 64.264 35.575  1.00 24.63 ? 533  GLN A O   1 
ATOM   4252 C CB  . GLN A 1 533 ? 45.783 66.449 34.479  1.00 27.59 ? 533  GLN A CB  1 
ATOM   4253 C CG  . GLN A 1 533 ? 44.488 66.985 33.818  1.00 32.90 ? 533  GLN A CG  1 
ATOM   4254 C CD  . GLN A 1 533 ? 44.586 68.447 33.440  1.00 39.24 ? 533  GLN A CD  1 
ATOM   4255 O OE1 . GLN A 1 533 ? 45.643 69.083 33.617  1.00 42.66 ? 533  GLN A OE1 1 
ATOM   4256 N NE2 . GLN A 1 533 ? 43.491 68.992 32.915  1.00 42.57 ? 533  GLN A NE2 1 
ATOM   4257 N N   . VAL A 1 534 ? 48.170 64.475 33.363  1.00 21.00 ? 534  VAL A N   1 
ATOM   4258 C CA  . VAL A 1 534 ? 49.562 64.076 33.386  1.00 20.08 ? 534  VAL A CA  1 
ATOM   4259 C C   . VAL A 1 534 ? 50.424 65.318 33.238  1.00 19.93 ? 534  VAL A C   1 
ATOM   4260 O O   . VAL A 1 534 ? 50.132 66.188 32.415  1.00 18.97 ? 534  VAL A O   1 
ATOM   4261 C CB  . VAL A 1 534 ? 49.824 63.061 32.236  1.00 19.46 ? 534  VAL A CB  1 
ATOM   4262 C CG1 . VAL A 1 534 ? 51.335 62.796 32.012  1.00 18.95 ? 534  VAL A CG1 1 
ATOM   4263 C CG2 . VAL A 1 534 ? 49.048 61.750 32.532  1.00 20.31 ? 534  VAL A CG2 1 
ATOM   4264 N N   . THR A 1 535 ? 51.479 65.413 34.049  1.00 20.31 ? 535  THR A N   1 
ATOM   4265 C CA  . THR A 1 535 ? 52.329 66.592 34.022  1.00 21.38 ? 535  THR A CA  1 
ATOM   4266 C C   . THR A 1 535 ? 53.779 66.193 33.960  1.00 20.77 ? 535  THR A C   1 
ATOM   4267 O O   . THR A 1 535 ? 54.633 67.058 34.097  1.00 22.11 ? 535  THR A O   1 
ATOM   4268 C CB  . THR A 1 535 ? 52.187 67.368 35.360  1.00 22.47 ? 535  THR A CB  1 
ATOM   4269 O OG1 . THR A 1 535 ? 52.562 66.466 36.403  1.00 23.54 ? 535  THR A OG1 1 
ATOM   4270 C CG2 . THR A 1 535 ? 50.722 67.670 35.650  1.00 23.34 ? 535  THR A CG2 1 
ATOM   4271 N N   . SER A 1 536 ? 54.054 64.905 33.761  1.00 19.93 ? 536  SER A N   1 
ATOM   4272 C CA  . SER A 1 536 ? 55.411 64.340 33.877  1.00 20.31 ? 536  SER A CA  1 
ATOM   4273 C C   . SER A 1 536 ? 56.338 64.525 32.681  1.00 19.39 ? 536  SER A C   1 
ATOM   4274 O O   . SER A 1 536 ? 57.517 64.214 32.762  1.00 20.65 ? 536  SER A O   1 
ATOM   4275 C CB  . SER A 1 536 ? 55.324 62.835 34.197  1.00 20.19 ? 536  SER A CB  1 
ATOM   4276 O OG  . SER A 1 536 ? 54.514 62.151 33.217  1.00 22.22 ? 536  SER A OG  1 
ATOM   4277 N N   . HIS A 1 537 ? 55.807 64.984 31.559  1.00 17.02 ? 537  HIS A N   1 
ATOM   4278 C CA  . HIS A 1 537 ? 56.625 65.161 30.366  1.00 16.23 ? 537  HIS A CA  1 
ATOM   4279 C C   . HIS A 1 537 ? 56.697 66.635 29.963  1.00 15.67 ? 537  HIS A C   1 
ATOM   4280 O O   . HIS A 1 537 ? 56.303 67.531 30.717  1.00 16.14 ? 537  HIS A O   1 
ATOM   4281 C CB  . HIS A 1 537 ? 55.970 64.401 29.200  1.00 15.84 ? 537  HIS A CB  1 
ATOM   4282 C CG  . HIS A 1 537 ? 55.686 62.958 29.489  1.00 15.82 ? 537  HIS A CG  1 
ATOM   4283 N ND1 . HIS A 1 537 ? 56.496 61.935 29.045  1.00 14.05 ? 537  HIS A ND1 1 
ATOM   4284 C CD2 . HIS A 1 537 ? 54.660 62.366 30.147  1.00 15.13 ? 537  HIS A CD2 1 
ATOM   4285 C CE1 . HIS A 1 537 ? 56.007 60.776 29.451  1.00 15.05 ? 537  HIS A CE1 1 
ATOM   4286 N NE2 . HIS A 1 537 ? 54.879 61.007 30.107  1.00 15.56 ? 537  HIS A NE2 1 
ATOM   4287 N N   . ASP A 1 538 ? 57.211 66.880 28.755  1.00 15.11 ? 538  ASP A N   1 
ATOM   4288 C CA  . ASP A 1 538 ? 57.199 68.213 28.165  1.00 14.51 ? 538  ASP A CA  1 
ATOM   4289 C C   . ASP A 1 538 ? 55.741 68.633 27.974  1.00 14.60 ? 538  ASP A C   1 
ATOM   4290 O O   . ASP A 1 538 ? 54.833 67.804 28.013  1.00 14.77 ? 538  ASP A O   1 
ATOM   4291 C CB  . ASP A 1 538 ? 57.921 68.172 26.820  1.00 14.47 ? 538  ASP A CB  1 
ATOM   4292 C CG  . ASP A 1 538 ? 57.195 67.320 25.832  1.00 14.27 ? 538  ASP A CG  1 
ATOM   4293 O OD1 . ASP A 1 538 ? 56.299 67.848 25.123  1.00 12.53 ? 538  ASP A OD1 1 
ATOM   4294 O OD2 . ASP A 1 538 ? 57.436 66.110 25.740  1.00 14.86 ? 538  ASP A OD2 1 
ATOM   4295 N N   . ALA A 1 539 ? 55.515 69.927 27.790  1.00 13.95 ? 539  ALA A N   1 
ATOM   4296 C CA  . ALA A 1 539 ? 54.166 70.467 27.721  1.00 13.87 ? 539  ALA A CA  1 
ATOM   4297 C C   . ALA A 1 539 ? 53.341 69.909 26.569  1.00 13.11 ? 539  ALA A C   1 
ATOM   4298 O O   . ALA A 1 539 ? 52.116 69.791 26.694  1.00 13.23 ? 539  ALA A O   1 
ATOM   4299 C CB  . ALA A 1 539 ? 54.229 71.974 27.622  1.00 14.63 ? 539  ALA A CB  1 
ATOM   4300 N N   . SER A 1 540 ? 53.999 69.564 25.457  1.00 12.24 ? 540  SER A N   1 
ATOM   4301 C CA  . SER A 1 540 ? 53.252 68.982 24.322  1.00 12.28 ? 540  SER A CA  1 
ATOM   4302 C C   . SER A 1 540 ? 52.765 67.567 24.620  1.00 12.43 ? 540  SER A C   1 
ATOM   4303 O O   . SER A 1 540 ? 51.580 67.265 24.472  1.00 11.99 ? 540  SER A O   1 
ATOM   4304 C CB  . SER A 1 540 ? 54.107 68.974 23.028  1.00 12.04 ? 540  SER A CB  1 
ATOM   4305 O OG  . SER A 1 540 ? 53.426 68.215 22.029  1.00 11.73 ? 540  SER A OG  1 
ATOM   4306 N N   . THR A 1 541 ? 53.676 66.694 25.048  1.00 11.99 ? 541  THR A N   1 
ATOM   4307 C CA  . THR A 1 541 ? 53.276 65.353 25.401  1.00 12.53 ? 541  THR A CA  1 
ATOM   4308 C C   . THR A 1 541 ? 52.182 65.400 26.473  1.00 12.30 ? 541  THR A C   1 
ATOM   4309 O O   . THR A 1 541 ? 51.192 64.661 26.393  1.00 11.43 ? 541  THR A O   1 
ATOM   4310 C CB  . THR A 1 541 ? 54.498 64.576 25.914  1.00 12.74 ? 541  THR A CB  1 
ATOM   4311 O OG1 . THR A 1 541 ? 55.469 64.505 24.866  1.00 13.16 ? 541  THR A OG1 1 
ATOM   4312 C CG2 . THR A 1 541 ? 54.120 63.150 26.192  1.00 13.05 ? 541  THR A CG2 1 
ATOM   4313 N N   . ASN A 1 542 ? 52.349 66.270 27.480  1.00 11.49 ? 542  ASN A N   1 
ATOM   4314 C CA  . ASN A 1 542 ? 51.309 66.382 28.489  1.00 12.58 ? 542  ASN A CA  1 
ATOM   4315 C C   . ASN A 1 542 ? 49.999 66.831 27.874  1.00 12.26 ? 542  ASN A C   1 
ATOM   4316 O O   . ASN A 1 542 ? 48.959 66.274 28.195  1.00 12.49 ? 542  ASN A O   1 
ATOM   4317 C CB  . ASN A 1 542 ? 51.679 67.408 29.570  1.00 13.15 ? 542  ASN A CB  1 
ATOM   4318 C CG  . ASN A 1 542 ? 52.872 66.988 30.418  1.00 14.29 ? 542  ASN A CG  1 
ATOM   4319 O OD1 . ASN A 1 542 ? 53.226 65.808 30.510  1.00 14.38 ? 542  ASN A OD1 1 
ATOM   4320 N ND2 . ASN A 1 542 ? 53.482 67.981 31.088  1.00 16.16 ? 542  ASN A ND2 1 
ATOM   4321 N N   . GLY A 1 543 ? 50.038 67.873 27.033  1.00 12.70 ? 543  GLY A N   1 
ATOM   4322 C CA  . GLY A 1 543 ? 48.822 68.426 26.435  1.00 12.33 ? 543  GLY A CA  1 
ATOM   4323 C C   . GLY A 1 543 ? 48.081 67.408 25.580  1.00 12.46 ? 543  GLY A C   1 
ATOM   4324 O O   . GLY A 1 543 ? 46.865 67.296 25.608  1.00 12.46 ? 543  GLY A O   1 
ATOM   4325 N N   . LEU A 1 544 ? 48.844 66.638 24.837  1.00 11.27 ? 544  LEU A N   1 
ATOM   4326 C CA  . LEU A 1 544 ? 48.251 65.611 23.989  1.00 10.89 ? 544  LEU A CA  1 
ATOM   4327 C C   . LEU A 1 544 ? 47.585 64.518 24.852  1.00 11.21 ? 544  LEU A C   1 
ATOM   4328 O O   . LEU A 1 544 ? 46.463 64.088 24.583  1.00 11.42 ? 544  LEU A O   1 
ATOM   4329 C CB  . LEU A 1 544 ? 49.345 65.001 23.068  1.00 10.82 ? 544  LEU A CB  1 
ATOM   4330 C CG  . LEU A 1 544 ? 49.848 65.911 21.946  1.00 10.66 ? 544  LEU A CG  1 
ATOM   4331 C CD1 . LEU A 1 544 ? 51.234 65.431 21.451  1.00 11.35 ? 544  LEU A CD1 1 
ATOM   4332 C CD2 . LEU A 1 544 ? 48.815 66.026 20.798  1.00 12.73 ? 544  LEU A CD2 1 
ATOM   4333 N N   . ILE A 1 545 ? 48.268 64.068 25.903  1.00 10.91 ? 545  ILE A N   1 
ATOM   4334 C CA  . ILE A 1 545 ? 47.686 63.068 26.777  1.00 12.59 ? 545  ILE A CA  1 
ATOM   4335 C C   . ILE A 1 545 ? 46.406 63.611 27.402  1.00 12.58 ? 545  ILE A C   1 
ATOM   4336 O O   . ILE A 1 545 ? 45.404 62.905 27.478  1.00 13.43 ? 545  ILE A O   1 
ATOM   4337 C CB  . ILE A 1 545 ? 48.674 62.708 27.908  1.00 12.45 ? 545  ILE A CB  1 
ATOM   4338 C CG1 . ILE A 1 545 ? 49.825 61.860 27.334  1.00 13.68 ? 545  ILE A CG1 1 
ATOM   4339 C CG2 . ILE A 1 545 ? 47.963 61.905 29.030  1.00 14.95 ? 545  ILE A CG2 1 
ATOM   4340 C CD1 . ILE A 1 545 ? 50.980 61.648 28.302  1.00 15.06 ? 545  ILE A CD1 1 
ATOM   4341 N N   . ASN A 1 546 ? 46.437 64.856 27.864  1.00 13.23 ? 546  ASN A N   1 
ATOM   4342 C CA  . ASN A 1 546 ? 45.253 65.388 28.504  1.00 14.07 ? 546  ASN A CA  1 
ATOM   4343 C C   . ASN A 1 546 ? 44.074 65.546 27.554  1.00 13.74 ? 546  ASN A C   1 
ATOM   4344 O O   . ASN A 1 546 ? 42.908 65.328 27.949  1.00 14.22 ? 546  ASN A O   1 
ATOM   4345 C CB  . ASN A 1 546 ? 45.635 66.646 29.275  1.00 14.44 ? 546  ASN A CB  1 
ATOM   4346 C CG  . ASN A 1 546 ? 46.602 66.304 30.427  1.00 16.70 ? 546  ASN A CG  1 
ATOM   4347 O OD1 . ASN A 1 546 ? 46.513 65.216 31.012  1.00 18.68 ? 546  ASN A OD1 1 
ATOM   4348 N ND2 . ASN A 1 546 ? 47.540 67.191 30.718  1.00 19.50 ? 546  ASN A ND2 1 
ATOM   4349 N N   . PHE A 1 547 ? 44.363 65.895 26.296  1.00 13.33 ? 547  PHE A N   1 
ATOM   4350 C CA  . PHE A 1 547 ? 43.309 65.940 25.292  1.00 13.19 ? 547  PHE A CA  1 
ATOM   4351 C C   . PHE A 1 547 ? 42.725 64.547 25.039  1.00 13.40 ? 547  PHE A C   1 
ATOM   4352 O O   . PHE A 1 547 ? 41.486 64.382 24.925  1.00 12.56 ? 547  PHE A O   1 
ATOM   4353 C CB  . PHE A 1 547 ? 43.881 66.510 23.988  1.00 13.55 ? 547  PHE A CB  1 
ATOM   4354 C CG  . PHE A 1 547 ? 42.865 66.584 22.851  1.00 13.07 ? 547  PHE A CG  1 
ATOM   4355 C CD1 . PHE A 1 547 ? 41.960 67.636 22.769  1.00 13.53 ? 547  PHE A CD1 1 
ATOM   4356 C CD2 . PHE A 1 547 ? 42.857 65.612 21.862  1.00 12.88 ? 547  PHE A CD2 1 
ATOM   4357 C CE1 . PHE A 1 547 ? 41.050 67.707 21.732  1.00 14.18 ? 547  PHE A CE1 1 
ATOM   4358 C CE2 . PHE A 1 547 ? 41.944 65.678 20.805  1.00 13.36 ? 547  PHE A CE2 1 
ATOM   4359 C CZ  . PHE A 1 547 ? 41.049 66.739 20.731  1.00 13.44 ? 547  PHE A CZ  1 
ATOM   4360 N N   . ILE A 1 548 ? 43.603 63.549 24.934  1.00 13.01 ? 548  ILE A N   1 
ATOM   4361 C CA  . ILE A 1 548 ? 43.171 62.166 24.775  1.00 13.67 ? 548  ILE A CA  1 
ATOM   4362 C C   . ILE A 1 548 ? 42.256 61.757 25.934  1.00 14.44 ? 548  ILE A C   1 
ATOM   4363 O O   . ILE A 1 548 ? 41.181 61.195 25.717  1.00 14.28 ? 548  ILE A O   1 
ATOM   4364 C CB  . ILE A 1 548 ? 44.392 61.264 24.666  1.00 14.00 ? 548  ILE A CB  1 
ATOM   4365 C CG1 . ILE A 1 548 ? 45.032 61.460 23.286  1.00 14.34 ? 548  ILE A CG1 1 
ATOM   4366 C CG2 . ILE A 1 548 ? 43.991 59.800 24.876  1.00 15.34 ? 548  ILE A CG2 1 
ATOM   4367 C CD1 . ILE A 1 548 ? 46.493 61.013 23.254  1.00 15.01 ? 548  ILE A CD1 1 
ATOM   4368 N N   . LYS A 1 549 ? 42.659 62.073 27.166  1.00 14.89 ? 549  LYS A N   1 
ATOM   4369 C CA  . LYS A 1 549 ? 41.800 61.710 28.285  1.00 16.10 ? 549  LYS A CA  1 
ATOM   4370 C C   . LYS A 1 549 ? 40.454 62.446 28.258  1.00 16.17 ? 549  LYS A C   1 
ATOM   4371 O O   . LYS A 1 549 ? 39.402 61.862 28.581  1.00 17.07 ? 549  LYS A O   1 
ATOM   4372 C CB  . LYS A 1 549 ? 42.514 61.945 29.608  1.00 16.61 ? 549  LYS A CB  1 
ATOM   4373 C CG  . LYS A 1 549 ? 43.667 61.041 29.771  1.00 17.08 ? 549  LYS A CG  1 
ATOM   4374 C CD  . LYS A 1 549 ? 44.147 61.044 31.210  1.00 19.75 ? 549  LYS A CD  1 
ATOM   4375 C CE  . LYS A 1 549 ? 45.356 60.186 31.388  1.00 20.49 ? 549  LYS A CE  1 
ATOM   4376 N NZ  . LYS A 1 549 ? 45.532 59.836 32.864  1.00 20.16 ? 549  LYS A NZ  1 
ATOM   4377 N N   . GLN A 1 550 ? 40.456 63.717 27.872  1.00 16.24 ? 550  GLN A N   1 
ATOM   4378 C CA  . GLN A 1 550 ? 39.211 64.485 27.790  1.00 17.38 ? 550  GLN A CA  1 
ATOM   4379 C C   . GLN A 1 550 ? 38.239 63.925 26.759  1.00 18.17 ? 550  GLN A C   1 
ATOM   4380 O O   . GLN A 1 550 ? 37.009 63.894 26.965  1.00 19.00 ? 550  GLN A O   1 
ATOM   4381 C CB  . GLN A 1 550 ? 39.488 65.952 27.419  1.00 18.65 ? 550  GLN A CB  1 
ATOM   4382 C CG  . GLN A 1 550 ? 38.214 66.757 26.955  1.00 23.39 ? 550  GLN A CG  1 
ATOM   4383 C CD  . GLN A 1 550 ? 38.496 68.184 26.422  1.00 29.01 ? 550  GLN A CD  1 
ATOM   4384 O OE1 . GLN A 1 550 ? 38.291 69.193 27.159  1.00 33.98 ? 550  GLN A OE1 1 
ATOM   4385 N NE2 . GLN A 1 550 ? 38.946 68.287 25.151  1.00 25.32 ? 550  GLN A NE2 1 
ATOM   4386 N N   . GLN A 1 551 ? 38.809 63.461 25.650  1.00 17.53 ? 551  GLN A N   1 
ATOM   4387 C CA  . GLN A 1 551 ? 38.010 63.035 24.515  1.00 17.99 ? 551  GLN A CA  1 
ATOM   4388 C C   . GLN A 1 551 ? 37.592 61.584 24.546  1.00 19.47 ? 551  GLN A C   1 
ATOM   4389 O O   . GLN A 1 551 ? 36.729 61.191 23.766  1.00 19.90 ? 551  GLN A O   1 
ATOM   4390 C CB  . GLN A 1 551 ? 38.740 63.359 23.199  1.00 17.24 ? 551  GLN A CB  1 
ATOM   4391 C CG  . GLN A 1 551 ? 38.889 64.893 22.933  1.00 17.25 ? 551  GLN A CG  1 
ATOM   4392 C CD  . GLN A 1 551 ? 37.554 65.586 22.728  1.00 18.78 ? 551  GLN A CD  1 
ATOM   4393 O OE1 . GLN A 1 551 ? 37.282 66.641 23.327  1.00 24.07 ? 551  GLN A OE1 1 
ATOM   4394 N NE2 . GLN A 1 551 ? 36.714 65.002 21.918  1.00 13.81 ? 551  GLN A NE2 1 
ATOM   4395 N N   . ARG A 1 552 ? 38.173 60.815 25.450  1.00 21.94 ? 552  ARG A N   1 
ATOM   4396 C CA  . ARG A 1 552 ? 37.932 59.382 25.549  1.00 26.57 ? 552  ARG A CA  1 
ATOM   4397 C C   . ARG A 1 552 ? 36.464 59.107 25.772  1.00 28.48 ? 552  ARG A C   1 
ATOM   4398 O O   . ARG A 1 552 ? 35.957 58.077 25.305  1.00 29.69 ? 552  ARG A O   1 
ATOM   4399 C CB  . ARG A 1 552 ? 38.757 58.797 26.712  1.00 27.87 ? 552  ARG A CB  1 
ATOM   4400 C CG  . ARG A 1 552 ? 38.192 57.504 27.310  1.00 32.73 ? 552  ARG A CG  1 
ATOM   4401 C CD  . ARG A 1 552 ? 39.111 56.802 28.332  1.00 40.99 ? 552  ARG A CD  1 
ATOM   4402 N NE  . ARG A 1 552 ? 38.352 55.941 29.251  1.00 46.59 ? 552  ARG A NE  1 
ATOM   4403 C CZ  . ARG A 1 552 ? 38.876 54.962 30.005  1.00 49.44 ? 552  ARG A CZ  1 
ATOM   4404 N NH1 . ARG A 1 552 ? 40.179 54.678 29.955  1.00 50.74 ? 552  ARG A NH1 1 
ATOM   4405 N NH2 . ARG A 1 552 ? 38.084 54.256 30.809  1.00 50.64 ? 552  ARG A NH2 1 
ATOM   4406 N N   . GLU A 1 553 ? 35.843 60.094 26.420  1.00 29.89 ? 553  GLU A N   1 
ATOM   4407 C CA  . GLU A 1 553 ? 34.466 60.170 26.915  1.00 32.83 ? 553  GLU A CA  1 
ATOM   4408 C C   . GLU A 1 553 ? 33.437 60.679 25.905  1.00 32.50 ? 553  GLU A C   1 
ATOM   4409 O O   . GLU A 1 553 ? 32.238 60.335 25.979  1.00 33.29 ? 553  GLU A O   1 
ATOM   4410 C CB  . GLU A 1 553 ? 34.447 61.171 28.102  1.00 34.25 ? 553  GLU A CB  1 
ATOM   4411 C CG  . GLU A 1 553 ? 35.715 61.214 28.957  1.00 37.62 ? 553  GLU A CG  1 
ATOM   4412 C CD  . GLU A 1 553 ? 35.516 61.914 30.310  1.00 43.87 ? 553  GLU A CD  1 
ATOM   4413 O OE1 . GLU A 1 553 ? 35.647 63.167 30.377  1.00 46.94 ? 553  GLU A OE1 1 
ATOM   4414 O OE2 . GLU A 1 553 ? 35.238 61.226 31.324  1.00 45.88 ? 553  GLU A OE2 1 
ATOM   4415 N N   . ALA A 1 554 ? 33.893 61.533 24.993  1.00 31.40 ? 554  ALA A N   1 
ATOM   4416 C CA  . ALA A 1 554 ? 33.016 62.212 24.045  1.00 30.95 ? 554  ALA A CA  1 
ATOM   4417 C C   . ALA A 1 554 ? 32.153 61.243 23.263  1.00 30.83 ? 554  ALA A C   1 
ATOM   4418 O O   . ALA A 1 554 ? 32.586 60.154 22.884  1.00 30.74 ? 554  ALA A O   1 
ATOM   4419 C CB  . ALA A 1 554 ? 33.831 63.090 23.091  1.00 30.37 ? 554  ALA A CB  1 
ATOM   4420 N N   . ARG A 1 555 ? 30.916 61.628 23.013  1.00 31.07 ? 555  ARG A N   1 
ATOM   4421 C CA  . ARG A 1 555 ? 30.045 60.722 22.287  1.00 32.05 ? 555  ARG A CA  1 
ATOM   4422 C C   . ARG A 1 555 ? 29.708 61.326 20.922  1.00 32.55 ? 555  ARG A C   1 
ATOM   4423 O O   . ARG A 1 555 ? 28.888 62.241 20.835  1.00 32.88 ? 555  ARG A O   1 
ATOM   4424 C CB  . ARG A 1 555 ? 28.810 60.416 23.138  1.00 32.78 ? 555  ARG A CB  1 
ATOM   4425 C CG  . ARG A 1 555 ? 29.138 59.411 24.261  1.00 35.77 ? 555  ARG A CG  1 
ATOM   4426 C CD  . ARG A 1 555 ? 29.386 58.019 23.685  1.00 40.75 ? 555  ARG A CD  1 
ATOM   4427 N NE  . ARG A 1 555 ? 29.692 56.964 24.656  1.00 45.68 ? 555  ARG A NE  1 
ATOM   4428 C CZ  . ARG A 1 555 ? 29.423 55.673 24.434  1.00 47.60 ? 555  ARG A CZ  1 
ATOM   4429 N NH1 . ARG A 1 555 ? 29.725 54.740 25.343  1.00 48.43 ? 555  ARG A NH1 1 
ATOM   4430 N NH2 . ARG A 1 555 ? 28.828 55.319 23.294  1.00 48.87 ? 555  ARG A NH2 1 
ATOM   4431 N N   . VAL A 1 556 ? 30.353 60.819 19.863  1.00 32.71 ? 556  VAL A N   1 
ATOM   4432 C CA  . VAL A 1 556 ? 30.225 61.410 18.519  1.00 33.42 ? 556  VAL A CA  1 
ATOM   4433 C C   . VAL A 1 556 ? 29.770 60.424 17.445  1.00 34.84 ? 556  VAL A C   1 
ATOM   4434 O O   . VAL A 1 556 ? 28.748 59.751 17.600  1.00 37.08 ? 556  VAL A O   1 
ATOM   4435 C CB  . VAL A 1 556 ? 31.582 62.024 18.042  1.00 33.02 ? 556  VAL A CB  1 
ATOM   4436 C CG1 . VAL A 1 556 ? 31.952 63.267 18.852  1.00 32.18 ? 556  VAL A CG1 1 
ATOM   4437 C CG2 . VAL A 1 556 ? 32.687 60.975 18.121  1.00 32.91 ? 556  VAL A CG2 1 
HETATM 4438 S S   . SO4 B 2 .   ? 60.698 40.923 15.936  1.00 24.24 ? 602  SO4 A S   1 
HETATM 4439 O O1  . SO4 B 2 .   ? 59.336 40.832 16.507  1.00 23.88 ? 602  SO4 A O1  1 
HETATM 4440 O O2  . SO4 B 2 .   ? 61.011 42.356 15.668  1.00 24.77 ? 602  SO4 A O2  1 
HETATM 4441 O O3  . SO4 B 2 .   ? 60.786 40.109 14.691  1.00 20.77 ? 602  SO4 A O3  1 
HETATM 4442 O O4  . SO4 B 2 .   ? 61.668 40.535 17.005  1.00 23.14 ? 602  SO4 A O4  1 
HETATM 4443 S S   . SO4 C 2 .   ? 70.162 72.722 -21.158 1.00 46.28 ? 603  SO4 A S   1 
HETATM 4444 O O1  . SO4 C 2 .   ? 69.809 73.999 -20.533 1.00 46.24 ? 603  SO4 A O1  1 
HETATM 4445 O O2  . SO4 C 2 .   ? 69.942 72.749 -22.615 1.00 46.51 ? 603  SO4 A O2  1 
HETATM 4446 O O3  . SO4 C 2 .   ? 69.295 71.696 -20.582 1.00 46.47 ? 603  SO4 A O3  1 
HETATM 4447 O O4  . SO4 C 2 .   ? 71.570 72.417 -20.888 1.00 44.16 ? 603  SO4 A O4  1 
HETATM 4448 C C1  . BME D 3 .   ? 62.333 43.532 13.102  1.00 38.03 ? 601  BME A C1  1 
HETATM 4449 C C2  . BME D 3 .   ? 63.812 43.310 12.830  1.00 39.12 ? 601  BME A C2  1 
HETATM 4450 O O1  . BME D 3 .   ? 61.682 44.375 12.173  1.00 33.59 ? 601  BME A O1  1 
HETATM 4451 S S2  . BME D 3 .   ? 64.552 42.085 13.957  1.00 44.39 ? 601  BME A S2  1 
HETATM 4452 O O   . HOH E 4 .   ? 56.019 38.259 -14.796 1.00 10.92 ? 604  HOH A O   1 
HETATM 4453 O O   . HOH E 4 .   ? 77.875 47.565 7.453   1.00 11.93 ? 605  HOH A O   1 
HETATM 4454 O O   . HOH E 4 .   ? 53.999 72.990 -15.784 1.00 11.54 ? 606  HOH A O   1 
HETATM 4455 O O   . HOH E 4 .   ? 61.673 67.221 -17.221 1.00 11.28 ? 607  HOH A O   1 
HETATM 4456 O O   . HOH E 4 .   ? 42.126 51.636 12.216  1.00 12.08 ? 608  HOH A O   1 
HETATM 4457 O O   . HOH E 4 .   ? 72.875 44.352 2.991   1.00 9.92  ? 609  HOH A O   1 
HETATM 4458 O O   . HOH E 4 .   ? 68.395 54.448 3.520   1.00 9.26  ? 610  HOH A O   1 
HETATM 4459 O O   . HOH E 4 .   ? 69.572 51.312 -7.341  1.00 9.90  ? 611  HOH A O   1 
HETATM 4460 O O   . HOH E 4 .   ? 76.079 35.772 15.347  1.00 13.24 ? 612  HOH A O   1 
HETATM 4461 O O   . HOH E 4 .   ? 63.163 65.440 3.965   1.00 10.01 ? 613  HOH A O   1 
HETATM 4462 O O   . HOH E 4 .   ? 74.633 37.641 4.714   1.00 10.94 ? 614  HOH A O   1 
HETATM 4463 O O   . HOH E 4 .   ? 55.542 33.703 7.569   1.00 11.72 ? 615  HOH A O   1 
HETATM 4464 O O   . HOH E 4 .   ? 70.024 53.361 -1.625  1.00 12.24 ? 616  HOH A O   1 
HETATM 4465 O O   . HOH E 4 .   ? 60.768 65.157 -18.509 1.00 12.71 ? 617  HOH A O   1 
HETATM 4466 O O   . HOH E 4 .   ? 66.007 58.888 -17.613 1.00 11.87 ? 618  HOH A O   1 
HETATM 4467 O O   . HOH E 4 .   ? 71.428 53.105 -8.399  1.00 11.32 ? 619  HOH A O   1 
HETATM 4468 O O   . HOH E 4 .   ? 69.412 59.392 -3.926  1.00 12.32 ? 620  HOH A O   1 
HETATM 4469 O O   . HOH E 4 .   ? 74.086 32.170 -0.708  1.00 11.44 ? 621  HOH A O   1 
HETATM 4470 O O   . HOH E 4 .   ? 56.193 48.842 -5.041  1.00 12.98 ? 622  HOH A O   1 
HETATM 4471 O O   . HOH E 4 .   ? 77.108 47.279 4.849   1.00 11.36 ? 623  HOH A O   1 
HETATM 4472 O O   . HOH E 4 .   ? 66.634 29.137 5.192   1.00 11.64 ? 624  HOH A O   1 
HETATM 4473 O O   . HOH E 4 .   ? 41.903 52.123 15.640  1.00 11.56 ? 625  HOH A O   1 
HETATM 4474 O O   . HOH E 4 .   ? 70.164 43.248 10.211  1.00 12.51 ? 626  HOH A O   1 
HETATM 4475 O O   . HOH E 4 .   ? 57.040 40.466 15.025  1.00 13.26 ? 627  HOH A O   1 
HETATM 4476 O O   . HOH E 4 .   ? 54.233 57.026 -20.416 1.00 13.40 ? 628  HOH A O   1 
HETATM 4477 O O   . HOH E 4 .   ? 71.220 38.989 8.360   1.00 10.97 ? 629  HOH A O   1 
HETATM 4478 O O   . HOH E 4 .   ? 62.825 51.450 11.858  1.00 11.79 ? 630  HOH A O   1 
HETATM 4479 O O   . HOH E 4 .   ? 61.602 67.617 -10.398 1.00 11.68 ? 631  HOH A O   1 
HETATM 4480 O O   . HOH E 4 .   ? 48.699 41.838 -19.216 1.00 11.77 ? 632  HOH A O   1 
HETATM 4481 O O   . HOH E 4 .   ? 60.561 52.635 18.179  1.00 14.67 ? 633  HOH A O   1 
HETATM 4482 O O   . HOH E 4 .   ? 54.780 54.420 -10.622 1.00 10.87 ? 634  HOH A O   1 
HETATM 4483 O O   . HOH E 4 .   ? 43.544 50.475 18.068  1.00 10.73 ? 635  HOH A O   1 
HETATM 4484 O O   . HOH E 4 .   ? 69.147 53.944 -17.596 1.00 9.86  ? 636  HOH A O   1 
HETATM 4485 O O   . HOH E 4 .   ? 61.145 30.040 -10.414 1.00 12.35 ? 637  HOH A O   1 
HETATM 4486 O O   . HOH E 4 .   ? 74.232 55.007 13.463  1.00 11.81 ? 638  HOH A O   1 
HETATM 4487 O O   . HOH E 4 .   ? 54.489 69.798 -23.256 1.00 12.56 ? 639  HOH A O   1 
HETATM 4488 O O   . HOH E 4 .   ? 69.237 27.029 1.287   1.00 13.27 ? 640  HOH A O   1 
HETATM 4489 O O   . HOH E 4 .   ? 71.003 62.109 0.426   1.00 14.30 ? 641  HOH A O   1 
HETATM 4490 O O   . HOH E 4 .   ? 54.594 39.497 -12.646 1.00 12.71 ? 642  HOH A O   1 
HETATM 4491 O O   . HOH E 4 .   ? 63.477 44.523 4.325   1.00 10.65 ? 643  HOH A O   1 
HETATM 4492 O O   . HOH E 4 .   ? 52.587 52.585 0.001   0.50 18.20 ? 644  HOH A O   1 
HETATM 4493 O O   . HOH E 4 .   ? 71.393 52.976 1.416   1.00 11.46 ? 645  HOH A O   1 
HETATM 4494 O O   . HOH E 4 .   ? 54.350 43.416 -15.071 1.00 10.68 ? 646  HOH A O   1 
HETATM 4495 O O   . HOH E 4 .   ? 45.564 44.313 15.668  1.00 11.29 ? 647  HOH A O   1 
HETATM 4496 O O   . HOH E 4 .   ? 55.308 49.542 -2.322  1.00 12.48 ? 648  HOH A O   1 
HETATM 4497 O O   . HOH E 4 .   ? 66.037 42.092 2.420   1.00 12.40 ? 649  HOH A O   1 
HETATM 4498 O O   . HOH E 4 .   ? 67.666 50.885 -2.909  1.00 12.16 ? 650  HOH A O   1 
HETATM 4499 O O   . HOH E 4 .   ? 54.413 42.916 -3.726  1.00 10.00 ? 651  HOH A O   1 
HETATM 4500 O O   . HOH E 4 .   ? 55.744 55.780 -1.376  1.00 13.36 ? 652  HOH A O   1 
HETATM 4501 O O   . HOH E 4 .   ? 65.387 29.486 9.671   1.00 12.29 ? 653  HOH A O   1 
HETATM 4502 O O   . HOH E 4 .   ? 60.964 70.338 -16.174 1.00 12.39 ? 654  HOH A O   1 
HETATM 4503 O O   . HOH E 4 .   ? 57.585 50.367 4.609   1.00 12.57 ? 655  HOH A O   1 
HETATM 4504 O O   . HOH E 4 .   ? 68.407 55.408 -9.538  1.00 11.40 ? 656  HOH A O   1 
HETATM 4505 O O   . HOH E 4 .   ? 58.732 57.768 -27.902 1.00 14.28 ? 657  HOH A O   1 
HETATM 4506 O O   . HOH E 4 .   ? 62.004 38.706 11.435  1.00 14.63 ? 658  HOH A O   1 
HETATM 4507 O O   . HOH E 4 .   ? 70.816 54.575 -3.861  1.00 10.31 ? 659  HOH A O   1 
HETATM 4508 O O   . HOH E 4 .   ? 82.425 57.641 6.723   1.00 12.48 ? 660  HOH A O   1 
HETATM 4509 O O   . HOH E 4 .   ? 52.089 42.298 15.210  1.00 12.69 ? 661  HOH A O   1 
HETATM 4510 O O   . HOH E 4 .   ? 70.403 47.206 17.182  1.00 12.40 ? 662  HOH A O   1 
HETATM 4511 O O   . HOH E 4 .   ? 39.016 21.579 12.510  1.00 14.70 ? 663  HOH A O   1 
HETATM 4512 O O   . HOH E 4 .   ? 60.738 40.894 5.965   1.00 11.65 ? 664  HOH A O   1 
HETATM 4513 O O   . HOH E 4 .   ? 52.245 39.817 9.362   1.00 11.82 ? 665  HOH A O   1 
HETATM 4514 O O   . HOH E 4 .   ? 70.353 58.643 6.394   1.00 9.98  ? 666  HOH A O   1 
HETATM 4515 O O   . HOH E 4 .   ? 63.251 55.416 18.599  1.00 15.35 ? 667  HOH A O   1 
HETATM 4516 O O   . HOH E 4 .   ? 63.014 39.815 4.903   1.00 11.00 ? 668  HOH A O   1 
HETATM 4517 O O   . HOH E 4 .   ? 73.625 41.749 1.928   1.00 11.55 ? 669  HOH A O   1 
HETATM 4518 O O   . HOH E 4 .   ? 67.848 43.505 11.894  1.00 14.35 ? 670  HOH A O   1 
HETATM 4519 O O   . HOH E 4 .   ? 54.238 63.624 22.591  1.00 12.28 ? 671  HOH A O   1 
HETATM 4520 O O   . HOH E 4 .   ? 63.047 64.515 -10.570 1.00 13.08 ? 672  HOH A O   1 
HETATM 4521 O O   . HOH E 4 .   ? 62.584 52.541 -19.419 1.00 12.35 ? 673  HOH A O   1 
HETATM 4522 O O   . HOH E 4 .   ? 54.650 37.397 -10.612 1.00 12.40 ? 674  HOH A O   1 
HETATM 4523 O O   . HOH E 4 .   ? 52.422 39.518 -14.401 1.00 14.00 ? 675  HOH A O   1 
HETATM 4524 O O   . HOH E 4 .   ? 78.794 37.330 8.766   1.00 11.54 ? 676  HOH A O   1 
HETATM 4525 O O   . HOH E 4 .   ? 66.412 54.189 -18.088 1.00 10.69 ? 677  HOH A O   1 
HETATM 4526 O O   . HOH E 4 .   ? 75.532 65.193 -0.158  1.00 15.68 ? 678  HOH A O   1 
HETATM 4527 O O   . HOH E 4 .   ? 65.311 61.173 -12.282 1.00 12.06 ? 679  HOH A O   1 
HETATM 4528 O O   . HOH E 4 .   ? 73.268 40.540 12.475  1.00 12.40 ? 680  HOH A O   1 
HETATM 4529 O O   . HOH E 4 .   ? 89.086 44.939 -0.165  1.00 15.83 ? 681  HOH A O   1 
HETATM 4530 O O   . HOH E 4 .   ? 85.780 25.200 12.721  1.00 19.27 ? 682  HOH A O   1 
HETATM 4531 O O   . HOH E 4 .   ? 49.069 40.463 -5.274  1.00 17.29 ? 683  HOH A O   1 
HETATM 4532 O O   . HOH E 4 .   ? 71.912 51.555 14.799  1.00 10.89 ? 684  HOH A O   1 
HETATM 4533 O O   . HOH E 4 .   ? 89.035 54.864 3.025   1.00 16.98 ? 685  HOH A O   1 
HETATM 4534 O O   . HOH E 4 .   ? 83.591 50.224 6.145   1.00 17.96 ? 686  HOH A O   1 
HETATM 4535 O O   . HOH E 4 .   ? 87.922 39.588 4.100   1.00 16.04 ? 687  HOH A O   1 
HETATM 4536 O O   . HOH E 4 .   ? 61.392 43.569 5.983   1.00 12.94 ? 688  HOH A O   1 
HETATM 4537 O O   . HOH E 4 .   ? 53.921 38.082 -22.006 1.00 15.06 ? 689  HOH A O   1 
HETATM 4538 O O   . HOH E 4 .   ? 83.072 30.436 7.329   1.00 15.51 ? 690  HOH A O   1 
HETATM 4539 O O   . HOH E 4 .   ? 76.038 52.808 11.917  1.00 14.65 ? 691  HOH A O   1 
HETATM 4540 O O   . HOH E 4 .   ? 53.293 35.706 -20.874 1.00 19.99 ? 692  HOH A O   1 
HETATM 4541 O O   . HOH E 4 .   ? 70.826 40.770 14.059  1.00 14.89 ? 693  HOH A O   1 
HETATM 4542 O O   . HOH E 4 .   ? 88.696 40.274 -0.585  1.00 17.64 ? 694  HOH A O   1 
HETATM 4543 O O   . HOH E 4 .   ? 52.929 55.692 -1.603  1.00 13.86 ? 695  HOH A O   1 
HETATM 4544 O O   . HOH E 4 .   ? 70.675 55.740 -7.912  1.00 13.30 ? 696  HOH A O   1 
HETATM 4545 O O   . HOH E 4 .   ? 76.068 61.516 18.690  1.00 18.89 ? 697  HOH A O   1 
HETATM 4546 O O   . HOH E 4 .   ? 48.061 41.781 -21.902 1.00 11.85 ? 698  HOH A O   1 
HETATM 4547 O O   . HOH E 4 .   ? 69.068 57.068 -11.690 1.00 12.69 ? 699  HOH A O   1 
HETATM 4548 O O   . HOH E 4 .   ? 65.626 70.798 -14.170 1.00 17.92 ? 700  HOH A O   1 
HETATM 4549 O O   . HOH E 4 .   ? 57.576 71.701 28.788  1.00 17.30 ? 701  HOH A O   1 
HETATM 4550 O O   . HOH E 4 .   ? 49.461 37.879 0.263   1.00 13.95 ? 702  HOH A O   1 
HETATM 4551 O O   . HOH E 4 .   ? 34.761 23.782 22.164  1.00 19.78 ? 703  HOH A O   1 
HETATM 4552 O O   . HOH E 4 .   ? 47.830 56.538 -8.668  1.00 15.13 ? 704  HOH A O   1 
HETATM 4553 O O   . HOH E 4 .   ? 77.325 63.902 1.522   1.00 13.47 ? 705  HOH A O   1 
HETATM 4554 O O   . HOH E 4 .   ? 45.142 21.062 6.466   1.00 15.60 ? 706  HOH A O   1 
HETATM 4555 O O   . HOH E 4 .   ? 75.132 51.897 14.196  1.00 17.01 ? 707  HOH A O   1 
HETATM 4556 O O   . HOH E 4 .   ? 63.036 24.553 14.297  1.00 16.69 ? 708  HOH A O   1 
HETATM 4557 O O   . HOH E 4 .   ? 56.449 40.763 -23.920 1.00 18.09 ? 709  HOH A O   1 
HETATM 4558 O O   . HOH E 4 .   ? 65.289 44.236 10.993  1.00 15.22 ? 710  HOH A O   1 
HETATM 4559 O O   . HOH E 4 .   ? 50.082 56.851 -21.087 1.00 17.88 ? 711  HOH A O   1 
HETATM 4560 O O   . HOH E 4 .   ? 70.015 56.874 -5.260  1.00 12.21 ? 712  HOH A O   1 
HETATM 4561 O O   . HOH E 4 .   ? 70.886 24.886 1.781   1.00 16.69 ? 713  HOH A O   1 
HETATM 4562 O O   . HOH E 4 .   ? 68.160 32.406 -18.851 1.00 20.34 ? 714  HOH A O   1 
HETATM 4563 O O   . HOH E 4 .   ? 74.708 29.856 14.735  1.00 17.28 ? 715  HOH A O   1 
HETATM 4564 O O   . HOH E 4 .   ? 38.590 30.089 8.295   1.00 21.96 ? 716  HOH A O   1 
HETATM 4565 O O   . HOH E 4 .   ? 89.244 36.182 1.618   1.00 28.64 ? 717  HOH A O   1 
HETATM 4566 O O   . HOH E 4 .   ? 50.596 43.592 7.436   1.00 17.25 ? 718  HOH A O   1 
HETATM 4567 O O   . HOH E 4 .   ? 62.740 34.992 -15.527 1.00 15.57 ? 719  HOH A O   1 
HETATM 4568 O O   . HOH E 4 .   ? 54.842 52.023 -1.279  1.00 15.08 ? 720  HOH A O   1 
HETATM 4569 O O   . HOH E 4 .   ? 83.671 32.736 10.946  1.00 18.04 ? 721  HOH A O   1 
HETATM 4570 O O   . HOH E 4 .   ? 70.560 19.141 8.508   1.00 22.96 ? 722  HOH A O   1 
HETATM 4571 O O   . HOH E 4 .   ? 62.076 71.543 -13.845 1.00 19.72 ? 723  HOH A O   1 
HETATM 4572 O O   . HOH E 4 .   ? 69.066 65.490 -21.047 1.00 18.73 ? 724  HOH A O   1 
HETATM 4573 O O   . HOH E 4 .   ? 78.921 58.185 -23.191 1.00 27.81 ? 725  HOH A O   1 
HETATM 4574 O O   . HOH E 4 .   ? 46.210 18.004 14.047  1.00 25.90 ? 726  HOH A O   1 
HETATM 4575 O O   . HOH E 4 .   ? 84.448 62.260 -18.404 1.00 19.34 ? 727  HOH A O   1 
HETATM 4576 O O   . HOH E 4 .   ? 60.081 29.452 -13.087 1.00 31.90 ? 728  HOH A O   1 
HETATM 4577 O O   . HOH E 4 .   ? 54.862 45.735 9.216   1.00 17.62 ? 729  HOH A O   1 
HETATM 4578 O O   . HOH E 4 .   ? 65.555 63.728 -11.210 1.00 12.20 ? 730  HOH A O   1 
HETATM 4579 O O   . HOH E 4 .   ? 54.664 50.433 24.885  1.00 27.43 ? 731  HOH A O   1 
HETATM 4580 O O   . HOH E 4 .   ? 51.453 49.954 -2.827  1.00 17.92 ? 732  HOH A O   1 
HETATM 4581 O O   . HOH E 4 .   ? 80.932 31.604 2.507   1.00 18.53 ? 733  HOH A O   1 
HETATM 4582 O O   . HOH E 4 .   ? 50.334 24.759 22.097  1.00 22.47 ? 734  HOH A O   1 
HETATM 4583 O O   . HOH E 4 .   ? 79.411 45.697 8.578   1.00 17.86 ? 735  HOH A O   1 
HETATM 4584 O O   . HOH E 4 .   ? 50.614 71.043 28.660  1.00 18.95 ? 736  HOH A O   1 
HETATM 4585 O O   . HOH E 4 .   ? 45.103 69.377 26.291  1.00 17.73 ? 737  HOH A O   1 
HETATM 4586 O O   . HOH E 4 .   ? 84.790 56.507 10.081  1.00 19.88 ? 738  HOH A O   1 
HETATM 4587 O O   . HOH E 4 .   ? 80.292 51.299 -16.219 1.00 17.76 ? 739  HOH A O   1 
HETATM 4588 O O   . HOH E 4 .   ? 76.926 32.004 -1.197  1.00 20.81 ? 740  HOH A O   1 
HETATM 4589 O O   . HOH E 4 .   ? 80.104 59.767 18.080  1.00 22.45 ? 741  HOH A O   1 
HETATM 4590 O O   . HOH E 4 .   ? 81.945 33.917 13.790  1.00 19.46 ? 742  HOH A O   1 
HETATM 4591 O O   . HOH E 4 .   ? 74.727 51.623 -27.597 1.00 20.95 ? 743  HOH A O   1 
HETATM 4592 O O   . HOH E 4 .   ? 91.329 52.618 -5.498  1.00 23.88 ? 744  HOH A O   1 
HETATM 4593 O O   . HOH E 4 .   ? 74.459 23.923 12.188  1.00 18.81 ? 745  HOH A O   1 
HETATM 4594 O O   . HOH E 4 .   ? 41.748 37.999 -22.851 1.00 22.12 ? 746  HOH A O   1 
HETATM 4595 O O   . HOH E 4 .   ? 59.963 44.242 14.301  1.00 22.65 ? 747  HOH A O   1 
HETATM 4596 O O   . HOH E 4 .   ? 38.199 23.045 5.944   1.00 20.72 ? 748  HOH A O   1 
HETATM 4597 O O   . HOH E 4 .   ? 86.937 46.550 4.355   1.00 20.56 ? 749  HOH A O   1 
HETATM 4598 O O   . HOH E 4 .   ? 65.615 23.404 1.022   1.00 20.87 ? 750  HOH A O   1 
HETATM 4599 O O   . HOH E 4 .   ? 85.087 59.647 -19.678 1.00 21.93 ? 751  HOH A O   1 
HETATM 4600 O O   . HOH E 4 .   ? 78.805 67.578 -3.492  1.00 23.65 ? 752  HOH A O   1 
HETATM 4601 O O   . HOH E 4 .   ? 87.081 43.448 -8.682  1.00 21.29 ? 753  HOH A O   1 
HETATM 4602 O O   . HOH E 4 .   ? 52.183 70.694 30.862  1.00 19.97 ? 754  HOH A O   1 
HETATM 4603 O O   . HOH E 4 .   ? 64.222 18.653 10.107  1.00 21.35 ? 755  HOH A O   1 
HETATM 4604 O O   . HOH E 4 .   ? 36.616 28.044 2.666   1.00 40.69 ? 756  HOH A O   1 
HETATM 4605 O O   . HOH E 4 .   ? 86.930 50.526 -13.822 1.00 24.72 ? 757  HOH A O   1 
HETATM 4606 O O   . HOH E 4 .   ? 58.318 46.118 21.435  1.00 22.65 ? 758  HOH A O   1 
HETATM 4607 O O   . HOH E 4 .   ? 55.309 33.742 -20.303 1.00 19.27 ? 759  HOH A O   1 
HETATM 4608 O O   . HOH E 4 .   ? 46.832 44.637 -6.073  1.00 20.67 ? 760  HOH A O   1 
HETATM 4609 O O   . HOH E 4 .   ? 66.651 27.867 7.741   1.00 12.20 ? 761  HOH A O   1 
HETATM 4610 O O   . HOH E 4 .   ? 56.937 30.219 -13.894 1.00 25.49 ? 762  HOH A O   1 
HETATM 4611 O O   . HOH E 4 .   ? 62.827 31.798 -13.460 1.00 16.23 ? 763  HOH A O   1 
HETATM 4612 O O   . HOH E 4 .   ? 84.179 31.100 13.175  1.00 17.44 ? 764  HOH A O   1 
HETATM 4613 O O   . HOH E 4 .   ? 70.269 43.367 14.217  1.00 14.26 ? 765  HOH A O   1 
HETATM 4614 O O   . HOH E 4 .   ? 47.647 50.433 -6.851  1.00 44.93 ? 766  HOH A O   1 
HETATM 4615 O O   . HOH E 4 .   ? 45.639 34.811 0.103   1.00 19.87 ? 767  HOH A O   1 
HETATM 4616 O O   . HOH E 4 .   ? 71.250 32.459 17.551  1.00 22.21 ? 768  HOH A O   1 
HETATM 4617 O O   . HOH E 4 .   ? 84.850 35.316 -4.908  1.00 26.96 ? 769  HOH A O   1 
HETATM 4618 O O   . HOH E 4 .   ? 47.599 72.221 -24.964 1.00 26.84 ? 770  HOH A O   1 
HETATM 4619 O O   . HOH E 4 .   ? 55.753 24.970 -5.180  1.00 15.83 ? 771  HOH A O   1 
HETATM 4620 O O   . HOH E 4 .   ? 40.491 19.831 21.742  1.00 22.43 ? 772  HOH A O   1 
HETATM 4621 O O   . HOH E 4 .   ? 70.806 64.927 0.832   1.00 20.40 ? 773  HOH A O   1 
HETATM 4622 O O   . HOH E 4 .   ? 70.147 22.656 0.052   1.00 23.23 ? 774  HOH A O   1 
HETATM 4623 O O   . HOH E 4 .   ? 77.076 28.193 14.613  1.00 19.20 ? 775  HOH A O   1 
HETATM 4624 O O   . HOH E 4 .   ? 87.200 46.232 -2.908  1.00 21.38 ? 776  HOH A O   1 
HETATM 4625 O O   . HOH E 4 .   ? 51.696 81.931 -16.838 1.00 21.68 ? 777  HOH A O   1 
HETATM 4626 O O   . HOH E 4 .   ? 87.120 37.068 5.280   1.00 20.09 ? 778  HOH A O   1 
HETATM 4627 O O   . HOH E 4 .   ? 79.992 27.746 18.356  1.00 21.80 ? 779  HOH A O   1 
HETATM 4628 O O   . HOH E 4 .   ? 46.825 40.250 4.470   1.00 25.04 ? 780  HOH A O   1 
HETATM 4629 O O   . HOH E 4 .   ? 84.488 41.313 -6.824  1.00 26.05 ? 781  HOH A O   1 
HETATM 4630 O O   . HOH E 4 .   ? 86.029 49.326 4.956   1.00 21.63 ? 782  HOH A O   1 
HETATM 4631 O O   . HOH E 4 .   ? 53.560 46.091 3.005   1.00 27.23 ? 783  HOH A O   1 
HETATM 4632 O O   . HOH E 4 .   ? 84.519 37.838 13.717  1.00 21.40 ? 784  HOH A O   1 
HETATM 4633 O O   . HOH E 4 .   ? 68.246 68.291 1.434   1.00 16.35 ? 785  HOH A O   1 
HETATM 4634 O O   . HOH E 4 .   ? 50.346 58.666 -17.718 1.00 16.71 ? 786  HOH A O   1 
HETATM 4635 O O   . HOH E 4 .   ? 61.546 42.993 20.656  1.00 28.78 ? 787  HOH A O   1 
HETATM 4636 O O   . HOH E 4 .   ? 63.608 28.276 -15.913 1.00 26.66 ? 788  HOH A O   1 
HETATM 4637 O O   . HOH E 4 .   ? 76.782 42.297 -19.890 1.00 22.97 ? 789  HOH A O   1 
HETATM 4638 O O   . HOH E 4 .   ? 42.337 17.077 15.010  1.00 21.89 ? 790  HOH A O   1 
HETATM 4639 O O   . HOH E 4 .   ? 53.556 26.507 -9.269  1.00 26.55 ? 791  HOH A O   1 
HETATM 4640 O O   . HOH E 4 .   ? 40.872 17.795 18.642  1.00 23.33 ? 792  HOH A O   1 
HETATM 4641 O O   . HOH E 4 .   ? 68.845 43.228 17.453  1.00 20.23 ? 793  HOH A O   1 
HETATM 4642 O O   . HOH E 4 .   ? 78.040 22.310 5.154   1.00 18.95 ? 794  HOH A O   1 
HETATM 4643 O O   . HOH E 4 .   ? 49.549 69.125 32.503  1.00 34.04 ? 795  HOH A O   1 
HETATM 4644 O O   . HOH E 4 .   ? 48.250 69.757 29.660  1.00 23.44 ? 796  HOH A O   1 
HETATM 4645 O O   . HOH E 4 .   ? 40.255 38.066 21.705  1.00 21.18 ? 797  HOH A O   1 
HETATM 4646 O O   . HOH E 4 .   ? 46.786 35.534 -9.044  1.00 26.42 ? 798  HOH A O   1 
HETATM 4647 O O   . HOH E 4 .   ? 44.416 36.668 -25.170 1.00 27.17 ? 799  HOH A O   1 
HETATM 4648 O O   . HOH E 4 .   ? 59.387 77.615 -19.399 1.00 19.48 ? 800  HOH A O   1 
HETATM 4649 O O   . HOH E 4 .   ? 51.561 25.326 19.584  1.00 25.93 ? 801  HOH A O   1 
HETATM 4650 O O   . HOH E 4 .   ? 52.839 82.564 -19.026 1.00 30.70 ? 802  HOH A O   1 
HETATM 4651 O O   . HOH E 4 .   ? 47.034 61.777 -15.868 1.00 22.94 ? 803  HOH A O   1 
HETATM 4652 O O   . HOH E 4 .   ? 60.782 21.109 -2.455  1.00 24.96 ? 804  HOH A O   1 
HETATM 4653 O O   . HOH E 4 .   ? 58.191 31.667 -20.259 1.00 25.38 ? 805  HOH A O   1 
HETATM 4654 O O   . HOH E 4 .   ? 67.865 41.789 14.821  1.00 25.48 ? 806  HOH A O   1 
HETATM 4655 O O   . HOH E 4 .   ? 89.301 65.161 -9.525  1.00 26.48 ? 807  HOH A O   1 
HETATM 4656 O O   . HOH E 4 .   ? 59.877 78.762 -21.864 1.00 20.15 ? 808  HOH A O   1 
HETATM 4657 O O   . HOH E 4 .   ? 52.819 45.574 5.815   1.00 21.14 ? 809  HOH A O   1 
HETATM 4658 O O   . HOH E 4 .   ? 69.576 52.628 21.320  1.00 13.49 ? 810  HOH A O   1 
HETATM 4659 O O   . HOH E 4 .   ? 84.740 53.182 -16.768 1.00 22.60 ? 811  HOH A O   1 
HETATM 4660 O O   . HOH E 4 .   ? 44.855 35.629 -16.995 1.00 27.70 ? 812  HOH A O   1 
HETATM 4661 O O   . HOH E 4 .   ? 82.328 42.131 16.035  1.00 26.07 ? 813  HOH A O   1 
HETATM 4662 O O   . HOH E 4 .   ? 86.809 34.666 1.226   1.00 22.01 ? 814  HOH A O   1 
HETATM 4663 O O   . HOH E 4 .   ? 51.900 63.120 35.830  1.00 26.61 ? 815  HOH A O   1 
HETATM 4664 O O   . HOH E 4 .   ? 82.234 44.511 -22.699 1.00 41.51 ? 816  HOH A O   1 
HETATM 4665 O O   . HOH E 4 .   ? 61.940 17.449 9.224   1.00 27.23 ? 817  HOH A O   1 
HETATM 4666 O O   . HOH E 4 .   ? 52.298 41.767 -24.761 1.00 25.22 ? 818  HOH A O   1 
HETATM 4667 O O   . HOH E 4 .   ? 89.465 56.983 4.796   1.00 18.66 ? 819  HOH A O   1 
HETATM 4668 O O   . HOH E 4 .   ? 90.113 57.084 -9.616  1.00 28.66 ? 820  HOH A O   1 
HETATM 4669 O O   . HOH E 4 .   ? 48.249 43.271 6.264   1.00 24.23 ? 821  HOH A O   1 
HETATM 4670 O O   . HOH E 4 .   ? 38.968 14.545 9.993   1.00 30.61 ? 822  HOH A O   1 
HETATM 4671 O O   . HOH E 4 .   ? 74.728 43.331 -22.103 1.00 27.82 ? 823  HOH A O   1 
HETATM 4672 O O   . HOH E 4 .   ? 67.551 68.014 -21.150 1.00 23.20 ? 824  HOH A O   1 
HETATM 4673 O O   . HOH E 4 .   ? 77.878 22.260 12.441  1.00 23.13 ? 825  HOH A O   1 
HETATM 4674 O O   . HOH E 4 .   ? 78.489 41.176 -15.383 1.00 22.76 ? 826  HOH A O   1 
HETATM 4675 O O   . HOH E 4 .   ? 35.720 32.902 18.841  1.00 25.98 ? 827  HOH A O   1 
HETATM 4676 O O   . HOH E 4 .   ? 88.044 58.276 -7.309  1.00 29.62 ? 828  HOH A O   1 
HETATM 4677 O O   . HOH E 4 .   ? 76.219 33.278 -10.354 1.00 30.43 ? 829  HOH A O   1 
HETATM 4678 O O   . HOH E 4 .   ? 42.560 19.354 19.962  1.00 21.90 ? 830  HOH A O   1 
HETATM 4679 O O   . HOH E 4 .   ? 57.792 19.343 10.563  1.00 25.67 ? 831  HOH A O   1 
HETATM 4680 O O   . HOH E 4 .   ? 49.469 60.586 -15.990 1.00 17.78 ? 832  HOH A O   1 
HETATM 4681 O O   . HOH E 4 .   ? 61.597 60.585 -28.888 1.00 28.87 ? 833  HOH A O   1 
HETATM 4682 O O   . HOH E 4 .   ? 53.517 71.946 -26.453 1.00 32.55 ? 834  HOH A O   1 
HETATM 4683 O O   . HOH E 4 .   ? 89.364 40.687 6.082   1.00 26.88 ? 835  HOH A O   1 
HETATM 4684 O O   . HOH E 4 .   ? 49.610 28.289 -9.039  1.00 23.55 ? 836  HOH A O   1 
HETATM 4685 O O   . HOH E 4 .   ? 40.488 64.704 31.734  1.00 35.09 ? 837  HOH A O   1 
HETATM 4686 O O   . HOH E 4 .   ? 66.599 35.132 21.447  1.00 34.47 ? 838  HOH A O   1 
HETATM 4687 O O   . HOH E 4 .   ? 74.946 32.900 16.987  1.00 30.08 ? 839  HOH A O   1 
HETATM 4688 O O   . HOH E 4 .   ? 73.538 20.246 5.783   1.00 26.14 ? 840  HOH A O   1 
HETATM 4689 O O   . HOH E 4 .   ? 55.395 55.466 33.792  1.00 27.28 ? 841  HOH A O   1 
HETATM 4690 O O   . HOH E 4 .   ? 38.175 16.483 16.343  1.00 22.92 ? 842  HOH A O   1 
HETATM 4691 O O   . HOH E 4 .   ? 85.822 32.329 9.311   1.00 33.51 ? 843  HOH A O   1 
HETATM 4692 O O   . HOH E 4 .   ? 87.285 67.275 -2.794  1.00 32.82 ? 844  HOH A O   1 
HETATM 4693 O O   . HOH E 4 .   ? 49.672 55.823 -6.668  1.00 16.75 ? 845  HOH A O   1 
HETATM 4694 O O   . HOH E 4 .   ? 72.992 27.742 13.695  1.00 27.13 ? 846  HOH A O   1 
HETATM 4695 O O   . HOH E 4 .   ? 51.335 37.833 -25.476 1.00 27.64 ? 847  HOH A O   1 
HETATM 4696 O O   . HOH E 4 .   ? 36.763 40.307 15.521  1.00 27.98 ? 848  HOH A O   1 
HETATM 4697 O O   . HOH E 4 .   ? 44.931 40.492 7.717   1.00 23.64 ? 849  HOH A O   1 
HETATM 4698 O O   . HOH E 4 .   ? 86.607 53.032 10.553  1.00 27.01 ? 850  HOH A O   1 
HETATM 4699 O O   . HOH E 4 .   ? 56.371 34.585 26.201  1.00 26.48 ? 851  HOH A O   1 
HETATM 4700 O O   . HOH E 4 .   ? 82.873 30.016 4.650   1.00 29.53 ? 852  HOH A O   1 
HETATM 4701 O O   . HOH E 4 .   ? 49.812 19.257 17.043  1.00 36.42 ? 853  HOH A O   1 
HETATM 4702 O O   . HOH E 4 .   ? 48.209 78.394 -34.426 1.00 30.70 ? 854  HOH A O   1 
HETATM 4703 O O   . HOH E 4 .   ? 57.535 48.025 19.456  1.00 18.14 ? 855  HOH A O   1 
HETATM 4704 O O   . HOH E 4 .   ? 50.533 26.545 -4.668  1.00 28.35 ? 856  HOH A O   1 
HETATM 4705 O O   . HOH E 4 .   ? 60.959 66.186 -26.878 1.00 37.26 ? 857  HOH A O   1 
HETATM 4706 O O   . HOH E 4 .   ? 56.087 44.925 2.027   1.00 22.50 ? 858  HOH A O   1 
HETATM 4707 O O   . HOH E 4 .   ? 79.539 34.325 20.616  1.00 44.18 ? 859  HOH A O   1 
HETATM 4708 O O   . HOH E 4 .   ? 77.162 44.686 22.076  1.00 41.81 ? 860  HOH A O   1 
HETATM 4709 O O   . HOH E 4 .   ? 34.972 35.150 13.493  1.00 35.92 ? 861  HOH A O   1 
HETATM 4710 O O   . HOH E 4 .   ? 81.923 50.248 -14.380 1.00 20.42 ? 862  HOH A O   1 
HETATM 4711 O O   . HOH E 4 .   ? 48.434 23.170 23.178  1.00 28.34 ? 863  HOH A O   1 
HETATM 4712 O O   . HOH E 4 .   ? 54.094 48.708 21.297  1.00 21.83 ? 864  HOH A O   1 
HETATM 4713 O O   . HOH E 4 .   ? 64.546 45.775 16.838  1.00 44.22 ? 865  HOH A O   1 
HETATM 4714 O O   . HOH E 4 .   ? 62.406 47.056 13.045  1.00 20.74 ? 866  HOH A O   1 
HETATM 4715 O O   . HOH E 4 .   ? 62.056 25.692 -12.337 1.00 34.15 ? 867  HOH A O   1 
HETATM 4716 O O   . HOH E 4 .   ? 63.559 24.077 -10.041 1.00 27.04 ? 868  HOH A O   1 
HETATM 4717 O O   . HOH E 4 .   ? 73.437 45.508 -23.059 1.00 20.26 ? 869  HOH A O   1 
HETATM 4718 O O   . HOH E 4 .   ? 69.598 67.761 -12.966 1.00 28.90 ? 870  HOH A O   1 
HETATM 4719 O O   . HOH E 4 .   ? 64.458 71.849 -22.186 1.00 32.77 ? 871  HOH A O   1 
HETATM 4720 O O   . HOH E 4 .   ? 80.302 72.543 -12.869 1.00 36.60 ? 872  HOH A O   1 
HETATM 4721 O O   . HOH E 4 .   ? 64.794 47.769 20.110  1.00 34.41 ? 873  HOH A O   1 
HETATM 4722 O O   . HOH E 4 .   ? 53.381 61.225 -15.752 1.00 34.74 ? 874  HOH A O   1 
HETATM 4723 O O   . HOH E 4 .   ? 71.154 29.042 -7.757  1.00 24.21 ? 875  HOH A O   1 
HETATM 4724 O O   . HOH E 4 .   ? 73.555 25.228 -6.350  1.00 41.41 ? 876  HOH A O   1 
HETATM 4725 O O   . HOH E 4 .   ? 75.136 37.636 -19.605 1.00 37.78 ? 877  HOH A O   1 
HETATM 4726 O O   . HOH E 4 .   ? 67.391 69.546 -15.964 1.00 27.81 ? 878  HOH A O   1 
HETATM 4727 O O   . HOH E 4 .   ? 52.756 84.102 -28.774 1.00 33.79 ? 879  HOH A O   1 
HETATM 4728 O O   . HOH E 4 .   ? 67.447 21.863 2.408   1.00 31.54 ? 880  HOH A O   1 
HETATM 4729 O O   . HOH E 4 .   ? 77.342 31.206 18.288  1.00 27.64 ? 881  HOH A O   1 
HETATM 4730 O O   . HOH E 4 .   ? 78.611 33.276 -2.905  1.00 30.08 ? 882  HOH A O   1 
HETATM 4731 O O   . HOH E 4 .   ? 50.647 42.163 -28.212 1.00 39.70 ? 883  HOH A O   1 
HETATM 4732 O O   . HOH E 4 .   ? 42.148 65.884 30.735  1.00 41.09 ? 884  HOH A O   1 
HETATM 4733 O O   . HOH E 4 .   ? 83.943 32.027 19.539  1.00 32.35 ? 885  HOH A O   1 
HETATM 4734 O O   . HOH E 4 .   ? 57.779 70.176 -31.762 1.00 31.19 ? 886  HOH A O   1 
HETATM 4735 O O   . HOH E 4 .   ? 47.423 38.505 2.071   1.00 20.69 ? 887  HOH A O   1 
HETATM 4736 O O   . HOH E 4 .   ? 32.661 56.573 24.644  1.00 52.87 ? 888  HOH A O   1 
HETATM 4737 O O   . HOH E 4 .   ? 75.615 36.710 -15.894 1.00 23.48 ? 889  HOH A O   1 
HETATM 4738 O O   . HOH E 4 .   ? 87.210 63.362 -16.951 1.00 38.95 ? 890  HOH A O   1 
HETATM 4739 O O   . HOH E 4 .   ? 80.655 47.339 -21.170 1.00 49.03 ? 891  HOH A O   1 
HETATM 4740 O O   . HOH E 4 .   ? 32.174 37.494 11.994  1.00 41.23 ? 892  HOH A O   1 
HETATM 4741 O O   . HOH E 4 .   ? 86.979 52.255 6.791   1.00 28.49 ? 893  HOH A O   1 
HETATM 4742 O O   . HOH E 4 .   ? 48.731 48.351 29.895  1.00 32.31 ? 894  HOH A O   1 
HETATM 4743 O O   . HOH E 4 .   ? 57.191 50.099 23.843  1.00 20.04 ? 895  HOH A O   1 
HETATM 4744 O O   . HOH E 4 .   ? 88.721 51.326 -12.022 1.00 31.62 ? 896  HOH A O   1 
HETATM 4745 O O   . HOH E 4 .   ? 77.429 36.651 -13.238 1.00 19.61 ? 897  HOH A O   1 
HETATM 4746 O O   . HOH E 4 .   ? 32.665 25.983 20.051  1.00 28.63 ? 898  HOH A O   1 
HETATM 4747 O O   . HOH E 4 .   ? 63.628 19.742 -0.208  1.00 31.18 ? 899  HOH A O   1 
HETATM 4748 O O   . HOH E 4 .   ? 45.857 23.851 3.487   1.00 29.05 ? 900  HOH A O   1 
HETATM 4749 O O   . HOH E 4 .   ? 41.651 28.121 1.304   1.00 22.13 ? 901  HOH A O   1 
HETATM 4750 O O   . HOH E 4 .   ? 48.503 69.107 -34.107 1.00 36.27 ? 902  HOH A O   1 
HETATM 4751 O O   . HOH E 4 .   ? 73.685 28.057 -8.028  1.00 25.10 ? 903  HOH A O   1 
HETATM 4752 O O   . HOH E 4 .   ? 69.681 67.251 -5.373  1.00 22.03 ? 904  HOH A O   1 
HETATM 4753 O O   . HOH E 4 .   ? 44.399 14.657 18.547  1.00 38.93 ? 905  HOH A O   1 
HETATM 4754 O O   . HOH E 4 .   ? 34.028 24.973 17.953  1.00 33.49 ? 906  HOH A O   1 
HETATM 4755 O O   . HOH E 4 .   ? 90.511 65.027 5.354   1.00 43.14 ? 907  HOH A O   1 
HETATM 4756 O O   . HOH E 4 .   ? 62.679 77.920 -34.727 1.00 22.72 ? 908  HOH A O   1 
HETATM 4757 O O   . HOH E 4 .   ? 53.499 48.274 5.382   1.00 35.97 ? 909  HOH A O   1 
HETATM 4758 O O   . HOH E 4 .   ? 63.973 75.204 -23.192 1.00 27.19 ? 910  HOH A O   1 
HETATM 4759 O O   . HOH E 4 .   ? 80.403 39.153 -15.762 1.00 31.69 ? 911  HOH A O   1 
HETATM 4760 O O   . HOH E 4 .   ? 72.674 69.061 -6.825  1.00 29.48 ? 912  HOH A O   1 
HETATM 4761 O O   . HOH E 4 .   ? 55.988 22.175 -3.975  1.00 26.79 ? 913  HOH A O   1 
HETATM 4762 O O   . HOH E 4 .   ? 52.410 75.108 -37.347 1.00 36.98 ? 914  HOH A O   1 
HETATM 4763 O O   . HOH E 4 .   ? 56.628 45.905 25.993  1.00 35.82 ? 915  HOH A O   1 
HETATM 4764 O O   . HOH E 4 .   ? 44.510 32.940 -1.865  1.00 27.88 ? 916  HOH A O   1 
HETATM 4765 O O   . HOH E 4 .   ? 56.897 53.166 -0.585  1.00 24.30 ? 917  HOH A O   1 
HETATM 4766 O O   . HOH E 4 .   ? 32.523 21.588 14.346  1.00 29.03 ? 918  HOH A O   1 
HETATM 4767 O O   . HOH E 4 .   ? 41.839 44.360 -29.044 1.00 34.60 ? 919  HOH A O   1 
HETATM 4768 O O   . HOH E 4 .   ? 92.417 63.007 -3.638  1.00 31.15 ? 920  HOH A O   1 
HETATM 4769 O O   . HOH E 4 .   ? 46.145 39.943 -2.545  1.00 34.29 ? 921  HOH A O   1 
HETATM 4770 O O   . HOH E 4 .   ? 45.201 43.494 6.210   1.00 31.18 ? 922  HOH A O   1 
HETATM 4771 O O   . HOH E 4 .   ? 77.491 34.476 17.272  1.00 27.26 ? 923  HOH A O   1 
HETATM 4772 O O   . HOH E 4 .   ? 73.541 49.730 -28.922 1.00 27.12 ? 924  HOH A O   1 
HETATM 4773 O O   . HOH E 4 .   ? 60.783 44.997 16.994  1.00 36.48 ? 925  HOH A O   1 
HETATM 4774 O O   . HOH E 4 .   ? 86.089 34.741 -2.431  1.00 20.70 ? 926  HOH A O   1 
HETATM 4775 O O   . HOH E 4 .   ? 76.788 45.852 -22.284 1.00 33.19 ? 927  HOH A O   1 
HETATM 4776 O O   . HOH E 4 .   ? 63.422 19.515 13.185  1.00 38.21 ? 928  HOH A O   1 
HETATM 4777 O O   . HOH E 4 .   ? 53.970 74.179 -35.770 1.00 28.96 ? 929  HOH A O   1 
HETATM 4778 O O   . HOH E 4 .   ? 76.824 39.251 -16.345 1.00 26.27 ? 930  HOH A O   1 
HETATM 4779 O O   . HOH E 4 .   ? 69.581 65.466 4.033   1.00 31.21 ? 931  HOH A O   1 
HETATM 4780 O O   . HOH E 4 .   ? 57.937 27.890 -10.709 1.00 31.09 ? 932  HOH A O   1 
HETATM 4781 O O   . HOH E 4 .   ? 88.147 64.346 9.290   1.00 32.96 ? 933  HOH A O   1 
HETATM 4782 O O   . HOH E 4 .   ? 44.243 42.881 -28.672 1.00 32.47 ? 934  HOH A O   1 
HETATM 4783 O O   . HOH E 4 .   ? 50.825 45.785 27.574  1.00 32.20 ? 935  HOH A O   1 
HETATM 4784 O O   . HOH E 4 .   ? 74.814 45.761 -25.421 1.00 34.18 ? 936  HOH A O   1 
HETATM 4785 O O   . HOH E 4 .   ? 73.984 69.618 -15.693 1.00 36.40 ? 937  HOH A O   1 
HETATM 4786 O O   . HOH E 4 .   ? 70.155 26.067 -6.773  1.00 29.61 ? 938  HOH A O   1 
HETATM 4787 O O   . HOH E 4 .   ? 73.557 66.805 0.906   1.00 28.41 ? 939  HOH A O   1 
HETATM 4788 O O   . HOH E 4 .   ? 65.258 72.434 -11.584 1.00 41.91 ? 940  HOH A O   1 
HETATM 4789 O O   . HOH E 4 .   ? 66.424 67.275 4.897   1.00 22.59 ? 941  HOH A O   1 
HETATM 4790 O O   . HOH E 4 .   ? 75.906 70.207 -5.522  1.00 32.95 ? 942  HOH A O   1 
HETATM 4791 O O   . HOH E 4 .   ? 38.144 55.751 24.149  1.00 20.21 ? 943  HOH A O   1 
HETATM 4792 O O   . HOH E 4 .   ? 44.211 69.962 30.664  1.00 44.45 ? 944  HOH A O   1 
HETATM 4793 O O   . HOH E 4 .   ? 49.009 80.928 -18.068 1.00 26.42 ? 945  HOH A O   1 
HETATM 4794 O O   . HOH E 4 .   ? 44.058 17.705 21.286  1.00 33.47 ? 946  HOH A O   1 
HETATM 4795 O O   . HOH E 4 .   ? 45.091 37.202 -2.038  1.00 37.98 ? 947  HOH A O   1 
HETATM 4796 O O   . HOH E 4 .   ? 48.110 18.027 18.522  1.00 37.82 ? 948  HOH A O   1 
HETATM 4797 O O   . HOH E 4 .   ? 38.628 21.537 27.965  1.00 40.54 ? 949  HOH A O   1 
HETATM 4798 O O   . HOH E 4 .   ? 82.026 46.423 8.415   1.00 38.98 ? 950  HOH A O   1 
HETATM 4799 O O   . HOH E 4 .   ? 56.511 20.595 12.602  1.00 41.11 ? 951  HOH A O   1 
HETATM 4800 O O   . HOH E 4 .   ? 71.203 41.869 -23.441 1.00 29.72 ? 952  HOH A O   1 
HETATM 4801 O O   . HOH E 4 .   ? 60.895 79.327 -29.518 1.00 24.83 ? 953  HOH A O   1 
HETATM 4802 O O   . HOH E 4 .   ? 40.034 42.365 5.413   1.00 41.46 ? 954  HOH A O   1 
HETATM 4803 O O   . HOH E 4 .   ? 73.307 38.095 19.786  1.00 30.82 ? 955  HOH A O   1 
HETATM 4804 O O   . HOH E 4 .   ? 81.229 28.835 2.422   1.00 22.22 ? 956  HOH A O   1 
HETATM 4805 O O   . HOH E 4 .   ? 56.603 70.161 31.325  1.00 36.54 ? 957  HOH A O   1 
HETATM 4806 O O   . HOH E 4 .   ? 39.133 60.335 30.745  1.00 33.21 ? 958  HOH A O   1 
HETATM 4807 O O   . HOH E 4 .   ? 66.060 34.210 -20.761 1.00 25.96 ? 959  HOH A O   1 
HETATM 4808 O O   . HOH E 4 .   ? 39.394 32.775 25.709  1.00 27.91 ? 960  HOH A O   1 
HETATM 4809 O O   . HOH E 4 .   ? 67.183 47.930 18.489  1.00 32.25 ? 961  HOH A O   1 
HETATM 4810 O O   . HOH E 4 .   ? 91.961 57.571 4.144   1.00 34.79 ? 962  HOH A O   1 
HETATM 4811 O O   . HOH E 4 .   ? 71.821 20.291 13.044  1.00 41.45 ? 963  HOH A O   1 
HETATM 4812 O O   . HOH E 4 .   ? 56.713 22.182 -8.498  1.00 37.03 ? 964  HOH A O   1 
HETATM 4813 O O   . HOH E 4 .   ? 69.437 25.765 15.887  1.00 31.95 ? 965  HOH A O   1 
HETATM 4814 O O   . HOH E 4 .   ? 83.883 67.456 9.613   1.00 36.85 ? 966  HOH A O   1 
HETATM 4815 O O   . HOH E 4 .   ? 55.703 17.882 10.138  1.00 33.14 ? 967  HOH A O   1 
HETATM 4816 O O   . HOH E 4 .   ? 57.471 24.812 -9.538  1.00 29.42 ? 968  HOH A O   1 
HETATM 4817 O O   . HOH E 4 .   ? 44.458 29.563 -4.146  1.00 48.16 ? 969  HOH A O   1 
HETATM 4818 O O   . HOH E 4 .   ? 73.796 41.306 20.800  1.00 30.69 ? 970  HOH A O   1 
HETATM 4819 O O   . HOH E 4 .   ? 51.794 40.679 26.691  1.00 40.33 ? 971  HOH A O   1 
HETATM 4820 O O   . HOH E 4 .   ? 53.236 36.883 27.220  1.00 47.53 ? 972  HOH A O   1 
HETATM 4821 O O   . HOH E 4 .   ? 62.621 40.981 13.010  1.00 32.07 ? 973  HOH A O   1 
HETATM 4822 O O   . HOH E 4 .   ? 60.710 18.228 13.694  1.00 44.62 ? 974  HOH A O   1 
HETATM 4823 O O   . HOH E 4 .   ? 66.238 17.116 9.022   1.00 32.69 ? 975  HOH A O   1 
HETATM 4824 O O   . HOH E 4 .   ? 42.656 17.298 23.954  1.00 45.53 ? 976  HOH A O   1 
HETATM 4825 O O   . HOH E 4 .   ? 57.110 37.033 25.292  1.00 28.14 ? 977  HOH A O   1 
HETATM 4826 O O   . HOH E 4 .   ? 83.657 36.746 -14.192 1.00 32.82 ? 978  HOH A O   1 
HETATM 4827 O O   . HOH E 4 .   ? 79.911 47.061 20.667  1.00 33.91 ? 979  HOH A O   1 
HETATM 4828 O O   . HOH E 4 .   ? 49.906 49.990 -31.665 1.00 34.47 ? 980  HOH A O   1 
HETATM 4829 O O   . HOH E 4 .   ? 61.016 18.899 -5.483  1.00 41.87 ? 981  HOH A O   1 
HETATM 4830 O O   . HOH E 4 .   ? 86.718 38.608 12.269  1.00 32.99 ? 982  HOH A O   1 
HETATM 4831 O O   . HOH E 4 .   ? 37.641 37.122 21.303  1.00 36.81 ? 983  HOH A O   1 
HETATM 4832 O O   . HOH E 4 .   ? 47.676 59.286 34.925  1.00 34.65 ? 984  HOH A O   1 
HETATM 4833 O O   . HOH E 4 .   ? 72.197 70.480 -18.998 1.00 28.78 ? 985  HOH A O   1 
HETATM 4834 O O   . HOH E 4 .   ? 83.589 43.722 12.758  1.00 30.85 ? 986  HOH A O   1 
HETATM 4835 O O   . HOH E 4 .   ? 71.997 41.103 10.144  1.00 13.50 ? 987  HOH A O   1 
HETATM 4836 O O   . HOH E 4 .   ? 59.395 59.432 -29.872 1.00 26.54 ? 988  HOH A O   1 
HETATM 4837 O O   . HOH E 4 .   ? 77.258 67.295 -1.141  1.00 38.10 ? 989  HOH A O   1 
HETATM 4838 O O   . HOH E 4 .   ? 89.633 46.695 -2.139  1.00 28.63 ? 990  HOH A O   1 
HETATM 4839 O O   . HOH E 4 .   ? 90.216 42.433 -1.157  1.00 25.67 ? 991  HOH A O   1 
HETATM 4840 O O   . HOH E 4 .   ? 91.484 46.186 -3.800  1.00 34.78 ? 992  HOH A O   1 
HETATM 4841 O O   . HOH E 4 .   ? 48.790 42.925 -6.690  1.00 22.21 ? 993  HOH A O   1 
HETATM 4842 O O   . HOH E 4 .   ? 39.843 46.386 5.438   1.00 28.42 ? 994  HOH A O   1 
HETATM 4843 O O   . HOH E 4 .   ? 46.235 42.253 -2.637  1.00 38.01 ? 995  HOH A O   1 
HETATM 4844 O O   . HOH E 4 .   ? 89.387 38.980 1.764   1.00 20.89 ? 996  HOH A O   1 
HETATM 4845 O O   . HOH E 4 .   ? 89.327 35.602 4.428   1.00 32.32 ? 997  HOH A O   1 
HETATM 4846 O O   . HOH E 4 .   ? 89.027 39.425 8.491   1.00 27.54 ? 998  HOH A O   1 
HETATM 4847 O O   . HOH E 4 .   ? 91.712 39.680 2.274   1.00 32.19 ? 999  HOH A O   1 
HETATM 4848 O O   . HOH E 4 .   ? 51.873 39.287 -23.363 1.00 17.74 ? 1000 HOH A O   1 
HETATM 4849 O O   . HOH E 4 .   ? 85.901 29.963 7.521   1.00 39.24 ? 1001 HOH A O   1 
HETATM 4850 O O   . HOH E 4 .   ? 87.455 39.051 -2.630  1.00 25.46 ? 1002 HOH A O   1 
HETATM 4851 O O   . HOH E 4 .   ? 69.223 69.250 -9.974  1.00 28.69 ? 1003 HOH A O   1 
HETATM 4852 O O   . HOH E 4 .   ? 37.681 54.337 26.417  1.00 29.97 ? 1004 HOH A O   1 
HETATM 4853 O O   . HOH E 4 .   ? 54.296 80.177 -32.962 1.00 28.96 ? 1005 HOH A O   1 
HETATM 4854 O O   . HOH E 4 .   ? 84.765 34.816 12.589  1.00 29.44 ? 1006 HOH A O   1 
HETATM 4855 O O   . HOH E 4 .   ? 72.962 18.268 7.349   1.00 30.63 ? 1007 HOH A O   1 
HETATM 4856 O O   . HOH E 4 .   ? 82.411 58.454 -21.510 1.00 29.97 ? 1008 HOH A O   1 
HETATM 4857 O O   . HOH E 4 .   ? 82.037 54.727 -23.445 1.00 37.97 ? 1009 HOH A O   1 
HETATM 4858 O O   . HOH E 4 .   ? 71.121 44.364 -24.305 1.00 22.25 ? 1010 HOH A O   1 
HETATM 4859 O O   . HOH E 4 .   ? 84.418 51.234 -14.715 1.00 26.48 ? 1011 HOH A O   1 
HETATM 4860 O O   . HOH E 4 .   ? 81.507 51.759 -18.407 1.00 37.89 ? 1012 HOH A O   1 
HETATM 4861 O O   . HOH E 4 .   ? 40.501 39.227 -20.737 1.00 24.00 ? 1013 HOH A O   1 
HETATM 4862 O O   . HOH E 4 .   ? 43.001 35.705 -22.130 1.00 46.74 ? 1014 HOH A O   1 
HETATM 4863 O O   . HOH E 4 .   ? 38.455 40.026 24.919  1.00 34.15 ? 1015 HOH A O   1 
HETATM 4864 O O   . HOH E 4 .   ? 37.958 23.188 3.151   1.00 34.79 ? 1016 HOH A O   1 
HETATM 4865 O O   . HOH E 4 .   ? 36.269 24.894 6.490   1.00 34.62 ? 1017 HOH A O   1 
HETATM 4866 O O   . HOH E 4 .   ? 74.128 50.177 -31.554 1.00 43.19 ? 1018 HOH A O   1 
HETATM 4867 O O   . HOH E 4 .   ? 58.292 47.428 23.868  1.00 24.66 ? 1019 HOH A O   1 
HETATM 4868 O O   . HOH E 4 .   ? 86.578 29.656 12.779  1.00 21.84 ? 1020 HOH A O   1 
HETATM 4869 O O   . HOH E 4 .   ? 49.348 48.592 -2.373  1.00 22.59 ? 1021 HOH A O   1 
HETATM 4870 O O   . HOH E 4 .   ? 73.585 30.678 17.114  1.00 37.99 ? 1022 HOH A O   1 
HETATM 4871 O O   . HOH E 4 .   ? 54.844 83.350 -26.941 1.00 30.67 ? 1023 HOH A O   1 
HETATM 4872 O O   . HOH E 4 .   ? 55.537 24.281 -7.802  1.00 39.76 ? 1024 HOH A O   1 
HETATM 4873 O O   . HOH E 4 .   ? 77.634 28.523 17.389  1.00 25.15 ? 1025 HOH A O   1 
HETATM 4874 O O   . HOH E 4 .   ? 75.560 26.954 18.658  1.00 34.81 ? 1026 HOH A O   1 
HETATM 4875 O O   . HOH E 4 .   ? 64.466 78.212 -23.529 1.00 32.16 ? 1027 HOH A O   1 
HETATM 4876 O O   . HOH E 4 .   ? 77.883 34.422 -11.697 1.00 35.26 ? 1028 HOH A O   1 
HETATM 4877 O O   . HOH E 4 .   ? 44.377 36.156 -7.233  1.00 30.71 ? 1029 HOH A O   1 
HETATM 4878 O O   . HOH E 4 .   ? 36.048 42.228 8.677   1.00 25.18 ? 1030 HOH A O   1 
HETATM 4879 O O   . HOH E 4 .   ? 39.506 41.905 28.051  1.00 37.66 ? 1031 HOH A O   1 
HETATM 4880 O O   . HOH E 4 .   ? 41.500 40.078 27.481  1.00 30.57 ? 1032 HOH A O   1 
HETATM 4881 O O   . HOH E 4 .   ? 90.145 63.622 -11.585 1.00 41.51 ? 1033 HOH A O   1 
HETATM 4882 O O   . HOH E 4 .   ? 52.863 83.403 -31.302 1.00 33.23 ? 1034 HOH A O   1 
HETATM 4883 O O   . HOH E 4 .   ? 34.502 32.408 16.631  1.00 33.41 ? 1035 HOH A O   1 
HETATM 4884 O O   . HOH E 4 .   ? 67.156 67.776 -11.821 1.00 26.00 ? 1036 HOH A O   1 
HETATM 4885 O O   . HOH E 4 .   ? 44.471 41.396 5.212   1.00 37.63 ? 1037 HOH A O   1 
HETATM 4886 O O   . HOH E 4 .   ? 50.472 69.926 -32.021 1.00 28.39 ? 1038 HOH A O   1 
HETATM 4887 O O   . HOH E 4 .   ? 85.880 63.547 8.044   1.00 21.50 ? 1039 HOH A O   1 
HETATM 4888 O O   . HOH E 4 .   ? 69.083 69.403 -7.292  1.00 40.85 ? 1040 HOH A O   1 
HETATM 4889 O O   . HOH E 4 .   ? 39.299 70.210 23.604  1.00 31.81 ? 1041 HOH A O   1 
HETATM 4890 O O   . HOH E 4 .   ? 73.139 43.489 -26.255 1.00 40.54 ? 1042 HOH A O   1 
HETATM 4891 O O   . HOH E 4 .   ? 76.186 38.656 20.476  1.00 33.19 ? 1043 HOH A O   1 
HETATM 4892 O O   . HOH E 4 .   ? 59.431 16.381 3.545   1.00 36.78 ? 1044 HOH A O   1 
HETATM 4893 O O   . HOH E 4 .   ? 69.924 69.926 -16.312 1.00 32.21 ? 1045 HOH A O   1 
HETATM 4894 O O   . HOH E 4 .   ? 64.913 59.199 -27.400 1.00 19.13 ? 1046 HOH A O   1 
HETATM 4895 O O   . HOH E 4 .   ? 65.620 70.487 -23.910 1.00 30.04 ? 1047 HOH A O   1 
HETATM 4896 O O   . HOH E 4 .   ? 81.145 49.688 8.680   1.00 27.24 ? 1048 HOH A O   1 
HETATM 4897 O O   . HOH E 4 .   ? 48.198 40.734 25.554  1.00 22.15 ? 1049 HOH A O   1 
HETATM 4898 O O   . HOH E 4 .   ? 39.247 16.845 7.043   1.00 25.98 ? 1050 HOH A O   1 
HETATM 4899 O O   . HOH E 4 .   ? 42.715 57.204 28.500  1.00 32.38 ? 1051 HOH A O   1 
HETATM 4900 O O   . HOH E 4 .   ? 41.897 57.862 30.632  1.00 26.61 ? 1052 HOH A O   1 
HETATM 4901 O O   . HOH E 4 .   ? 64.371 67.377 -26.228 1.00 34.31 ? 1053 HOH A O   1 
HETATM 4902 O O   . HOH E 4 .   ? 83.218 66.534 -18.564 1.00 37.36 ? 1054 HOH A O   1 
HETATM 4903 O O   . HOH E 4 .   ? 85.837 65.062 1.556   1.00 26.87 ? 1055 HOH A O   1 
HETATM 4904 O O   . HOH E 4 .   ? 67.540 72.972 -24.295 1.00 31.62 ? 1056 HOH A O   1 
HETATM 4905 O O   . HOH E 4 .   ? 79.118 42.363 -17.998 1.00 37.37 ? 1057 HOH A O   1 
HETATM 4906 O O   . HOH E 4 .   ? 87.556 59.433 11.107  1.00 32.37 ? 1058 HOH A O   1 
HETATM 4907 O O   . HOH E 4 .   ? 48.185 48.140 -0.031  0.50 40.69 ? 1059 HOH A O   1 
HETATM 4908 O O   . HOH E 4 .   ? 65.519 26.069 -8.704  1.00 27.42 ? 1060 HOH A O   1 
HETATM 4909 O O   . HOH E 4 .   ? 86.571 44.319 6.214   1.00 32.05 ? 1061 HOH A O   1 
HETATM 4910 O O   . HOH E 4 .   ? 64.156 26.812 -11.338 1.00 29.57 ? 1062 HOH A O   1 
HETATM 4911 O O   . HOH E 4 .   ? 61.170 17.560 4.714   1.00 24.66 ? 1063 HOH A O   1 
HETATM 4912 O O   . HOH E 4 .   ? 50.089 43.071 25.922  1.00 27.42 ? 1064 HOH A O   1 
HETATM 4913 O O   . HOH E 4 .   ? 49.586 51.456 -6.062  1.00 27.38 ? 1065 HOH A O   1 
HETATM 4914 O O   . HOH E 4 .   ? 60.625 45.125 20.210  1.00 34.57 ? 1066 HOH A O   1 
HETATM 4915 O O   . HOH E 4 .   ? 74.497 21.540 13.742  1.00 32.28 ? 1067 HOH A O   1 
HETATM 4916 O O   . HOH E 4 .   ? 71.946 27.509 11.518  1.00 26.54 ? 1068 HOH A O   1 
HETATM 4917 O O   . HOH E 4 .   ? 64.667 75.447 -13.371 1.00 31.96 ? 1069 HOH A O   1 
HETATM 4918 O O   . HOH E 4 .   ? 69.889 76.284 -21.686 1.00 28.62 ? 1070 HOH A O   1 
HETATM 4919 O O   . HOH E 4 .   ? 86.900 34.270 7.922   1.00 29.33 ? 1071 HOH A O   1 
HETATM 4920 O O   . HOH E 4 .   ? 64.544 24.040 -7.018  1.00 32.97 ? 1072 HOH A O   1 
HETATM 4921 O O   . HOH E 4 .   ? 42.166 42.011 3.973   1.00 37.29 ? 1073 HOH A O   1 
HETATM 4922 O O   . HOH E 4 .   ? 46.278 16.225 12.131  1.00 26.46 ? 1074 HOH A O   1 
HETATM 4923 O O   . HOH E 4 .   ? 41.373 58.232 25.948  1.00 32.52 ? 1075 HOH A O   1 
HETATM 4924 O O   . HOH E 4 .   ? 75.408 26.127 14.186  1.00 30.81 ? 1076 HOH A O   1 
HETATM 4925 O O   . HOH E 4 .   ? 61.777 22.858 -7.808  1.00 31.80 ? 1077 HOH A O   1 
HETATM 4926 O O   . HOH E 4 .   ? 65.929 69.258 -10.858 1.00 33.93 ? 1078 HOH A O   1 
HETATM 4927 O O   . HOH E 4 .   ? 84.700 40.516 -16.986 1.00 28.85 ? 1079 HOH A O   1 
HETATM 4928 O O   . HOH E 4 .   ? 27.335 58.847 15.871  1.00 42.01 ? 1080 HOH A O   1 
HETATM 4929 O O   . HOH E 4 .   ? 90.889 53.038 3.643   1.00 44.63 ? 1081 HOH A O   1 
HETATM 4930 O O   . HOH E 4 .   ? 46.080 70.663 28.528  1.00 27.03 ? 1082 HOH A O   1 
HETATM 4931 O O   . HOH E 4 .   ? 72.903 34.907 -23.014 1.00 31.05 ? 1083 HOH A O   1 
HETATM 4932 O O   . HOH E 4 .   ? 70.513 60.230 -28.764 1.00 35.41 ? 1084 HOH A O   1 
HETATM 4933 O O   . HOH E 4 .   ? 89.012 57.478 9.339   1.00 35.25 ? 1085 HOH A O   1 
HETATM 4934 O O   . HOH E 4 .   ? 66.633 45.699 17.919  1.00 33.16 ? 1086 HOH A O   1 
HETATM 4935 O O   . HOH E 4 .   ? 85.042 32.384 15.412  1.00 30.42 ? 1087 HOH A O   1 
HETATM 4936 O O   . HOH E 4 .   ? 41.809 42.226 7.331   1.00 36.91 ? 1088 HOH A O   1 
HETATM 4937 O O   . HOH E 4 .   ? 64.877 56.446 27.788  1.00 38.52 ? 1089 HOH A O   1 
HETATM 4938 O O   . HOH E 4 .   ? 71.837 29.850 -19.959 1.00 37.82 ? 1090 HOH A O   1 
HETATM 4939 O O   . HOH E 4 .   ? 45.410 24.161 0.814   1.00 31.54 ? 1091 HOH A O   1 
HETATM 4940 O O   . HOH E 4 .   ? 89.759 46.676 4.304   1.00 34.95 ? 1092 HOH A O   1 
HETATM 4941 O O   . HOH E 4 .   ? 44.020 34.288 -5.769  1.00 40.95 ? 1093 HOH A O   1 
HETATM 4942 O O   . HOH E 4 .   ? 69.976 69.079 -25.655 1.00 41.95 ? 1094 HOH A O   1 
HETATM 4943 O O   . HOH E 4 .   ? 48.258 18.041 15.075  1.00 40.65 ? 1095 HOH A O   1 
HETATM 4944 O O   . HOH E 4 .   ? 54.845 42.287 -25.721 1.00 38.94 ? 1096 HOH A O   1 
HETATM 4945 O O   . HOH E 4 .   ? 74.607 31.193 -14.322 1.00 37.61 ? 1097 HOH A O   1 
HETATM 4946 O O   . HOH E 4 .   ? 48.548 44.122 -28.624 1.00 33.25 ? 1098 HOH A O   1 
HETATM 4947 O O   . HOH E 4 .   ? 48.837 71.583 -37.791 1.00 31.45 ? 1099 HOH A O   1 
HETATM 4948 O O   . HOH E 4 .   ? 54.455 25.675 25.734  1.00 44.59 ? 1100 HOH A O   1 
HETATM 4949 O O   . HOH E 4 .   ? 68.016 46.000 20.229  1.00 45.70 ? 1101 HOH A O   1 
HETATM 4950 O O   . HOH E 4 .   ? 66.304 30.604 24.427  1.00 38.39 ? 1102 HOH A O   1 
HETATM 4951 O O   . HOH E 4 .   ? 61.285 44.504 22.441  1.00 42.41 ? 1103 HOH A O   1 
HETATM 4952 O O   . HOH E 4 .   ? 43.220 27.187 -6.171  1.00 43.19 ? 1104 HOH A O   1 
HETATM 4953 O O   . HOH E 4 .   ? 45.569 35.104 25.488  1.00 29.93 ? 1105 HOH A O   1 
HETATM 4954 O O   . HOH E 4 .   ? 79.584 47.282 -16.431 1.00 30.80 ? 1106 HOH A O   1 
HETATM 4955 O O   . HOH E 4 .   ? 68.228 30.286 17.786  1.00 33.81 ? 1107 HOH A O   1 
HETATM 4956 O O   . HOH E 4 .   ? 79.937 20.170 4.597   1.00 32.82 ? 1108 HOH A O   1 
HETATM 4957 O O   . HOH E 4 .   ? 44.028 79.950 -29.068 1.00 37.94 ? 1109 HOH A O   1 
HETATM 4958 O O   . HOH E 4 .   ? 73.823 44.134 21.749  1.00 37.96 ? 1110 HOH A O   1 
HETATM 4959 O O   . HOH E 4 .   ? 47.571 42.156 0.992   1.00 44.89 ? 1111 HOH A O   1 
HETATM 4960 O O   . HOH E 4 .   ? 67.394 40.643 18.726  1.00 42.54 ? 1112 HOH A O   1 
HETATM 4961 O O   . HOH E 4 .   ? 70.181 62.182 -27.353 1.00 37.66 ? 1113 HOH A O   1 
HETATM 4962 O O   . HOH E 4 .   ? 93.070 54.013 5.289   1.00 49.75 ? 1114 HOH A O   1 
HETATM 4963 O O   . HOH E 4 .   ? 92.047 66.582 3.471   1.00 46.46 ? 1115 HOH A O   1 
HETATM 4964 O O   . HOH E 4 .   ? 45.511 45.051 -2.300  1.00 48.04 ? 1116 HOH A O   1 
HETATM 4965 O O   . HOH E 4 .   ? 38.379 33.247 5.285   1.00 29.68 ? 1117 HOH A O   1 
HETATM 4966 O O   . HOH E 4 .   ? 74.348 41.612 -24.328 1.00 37.56 ? 1118 HOH A O   1 
HETATM 4967 O O   . HOH E 4 .   ? 34.626 43.726 11.481  1.00 40.09 ? 1119 HOH A O   1 
HETATM 4968 O O   . HOH E 4 .   ? 51.041 70.977 -26.333 1.00 34.05 ? 1120 HOH A O   1 
HETATM 4969 O O   . HOH E 4 .   ? 83.567 62.850 10.996  1.00 36.26 ? 1121 HOH A O   1 
HETATM 4970 O O   . HOH E 4 .   ? 79.545 37.040 -14.678 1.00 38.45 ? 1122 HOH A O   1 
HETATM 4971 O O   . HOH E 4 .   ? 56.745 30.322 -16.369 1.00 43.19 ? 1123 HOH A O   1 
HETATM 4972 O O   . HOH E 4 .   ? 67.569 42.284 21.142  1.00 36.09 ? 1124 HOH A O   1 
HETATM 4973 O O   . HOH E 4 .   ? 41.920 32.852 27.032  1.00 35.80 ? 1125 HOH A O   1 
HETATM 4974 O O   . HOH E 4 .   ? 46.233 33.744 -10.716 1.00 36.96 ? 1126 HOH A O   1 
HETATM 4975 O O   . HOH E 4 .   ? 53.477 42.186 25.290  1.00 37.63 ? 1127 HOH A O   1 
HETATM 4976 O O   . HOH E 4 .   ? 88.405 42.962 -14.224 1.00 36.71 ? 1128 HOH A O   1 
HETATM 4977 O O   . HOH E 4 .   ? 49.259 46.666 3.643   1.00 41.87 ? 1129 HOH A O   1 
HETATM 4978 O O   . HOH E 4 .   ? 87.477 56.940 11.260  1.00 44.10 ? 1130 HOH A O   1 
HETATM 4979 O O   . HOH E 4 .   ? 44.309 32.942 26.128  1.00 32.27 ? 1131 HOH A O   1 
HETATM 4980 O O   . HOH E 4 .   ? 49.266 45.338 1.761   1.00 39.04 ? 1132 HOH A O   1 
HETATM 4981 O O   . HOH E 4 .   ? 37.789 34.824 2.983   1.00 38.04 ? 1133 HOH A O   1 
HETATM 4982 O O   . HOH E 4 .   ? 79.221 65.592 11.638  1.00 32.57 ? 1134 HOH A O   1 
HETATM 4983 O O   . HOH E 4 .   ? 89.487 56.337 12.507  1.00 44.51 ? 1135 HOH A O   1 
HETATM 4984 O O   . HOH E 4 .   ? 67.185 19.632 2.542   1.00 32.98 ? 1136 HOH A O   1 
HETATM 4985 O O   . HOH E 4 .   ? 70.368 72.728 -10.407 1.00 46.32 ? 1137 HOH A O   1 
HETATM 4986 O O   . HOH E 4 .   ? 78.919 67.699 9.614   1.00 47.12 ? 1138 HOH A O   1 
HETATM 4987 O O   . HOH E 4 .   ? 39.780 31.642 -1.441  1.00 36.22 ? 1139 HOH A O   1 
HETATM 4988 O O   . HOH E 4 .   ? 49.101 69.175 -36.684 1.00 34.59 ? 1140 HOH A O   1 
HETATM 4989 O O   . HOH E 4 .   ? 63.609 40.768 24.136  1.00 38.73 ? 1141 HOH A O   1 
HETATM 4990 O O   . HOH E 4 .   ? 33.640 17.944 12.932  1.00 39.37 ? 1142 HOH A O   1 
HETATM 4991 O O   . HOH E 4 .   ? 42.114 29.035 14.666  1.00 30.25 ? 1143 HOH A O   1 
HETATM 4992 O O   . HOH E 4 .   ? 68.117 60.629 -29.795 1.00 36.98 ? 1144 HOH A O   1 
HETATM 4993 O O   . HOH E 4 .   ? 76.729 50.718 -32.363 1.00 45.02 ? 1145 HOH A O   1 
HETATM 4994 O O   . HOH E 4 .   ? 92.787 64.033 3.686   1.00 38.45 ? 1146 HOH A O   1 
HETATM 4995 O O   . HOH E 4 .   ? 55.074 15.581 5.903   1.00 33.98 ? 1147 HOH A O   1 
HETATM 4996 O O   . HOH E 4 .   ? 68.715 22.996 -5.083  1.00 30.01 ? 1148 HOH A O   1 
HETATM 4997 O O   . HOH E 4 .   ? 82.261 62.807 16.546  1.00 29.31 ? 1149 HOH A O   1 
HETATM 4998 O O   . HOH E 4 .   ? 39.066 26.983 0.957   1.00 35.45 ? 1150 HOH A O   1 
HETATM 4999 O O   . HOH E 4 .   ? 42.137 29.395 -1.180  1.00 35.55 ? 1151 HOH A O   1 
HETATM 5000 O O   . HOH E 4 .   ? 37.487 19.648 5.489   1.00 29.90 ? 1152 HOH A O   1 
HETATM 5001 O O   . HOH E 4 .   ? 79.872 64.907 1.428   1.00 33.45 ? 1153 HOH A O   1 
HETATM 5002 O O   . HOH E 4 .   ? 33.433 29.355 16.339  1.00 43.13 ? 1154 HOH A O   1 
HETATM 5003 O O   . HOH E 4 .   ? 47.060 18.834 21.018  1.00 38.55 ? 1155 HOH A O   1 
HETATM 5004 O O   . HOH E 4 .   ? 35.641 26.317 8.566   1.00 40.51 ? 1156 HOH A O   1 
HETATM 5005 O O   . HOH E 4 .   ? 47.500 72.227 -27.554 1.00 39.88 ? 1157 HOH A O   1 
HETATM 5006 O O   . HOH E 4 .   ? 48.968 61.584 36.474  1.00 37.49 ? 1158 HOH A O   1 
HETATM 5007 O O   . HOH E 4 .   ? 71.584 68.260 -12.757 1.00 40.53 ? 1159 HOH A O   1 
HETATM 5008 O O   . HOH E 4 .   ? 80.402 59.269 -21.442 1.00 36.62 ? 1160 HOH A O   1 
HETATM 5009 O O   . HOH E 4 .   ? 68.029 70.739 -19.104 1.00 33.43 ? 1161 HOH A O   1 
HETATM 5010 O O   . HOH E 4 .   ? 41.035 68.843 26.594  1.00 44.21 ? 1162 HOH A O   1 
HETATM 5011 O O   . HOH E 4 .   ? 92.561 50.980 -3.275  1.00 31.89 ? 1163 HOH A O   1 
HETATM 5012 O O   . HOH E 4 .   ? 34.003 30.435 25.687  1.00 41.98 ? 1164 HOH A O   1 
HETATM 5013 O O   . HOH E 4 .   ? 77.405 66.059 -20.674 1.00 40.89 ? 1165 HOH A O   1 
HETATM 5014 O O   . HOH E 4 .   ? 91.438 49.007 0.675   1.00 39.47 ? 1166 HOH A O   1 
HETATM 5015 O O   . HOH E 4 .   ? 54.242 31.010 31.012  1.00 39.12 ? 1167 HOH A O   1 
HETATM 5016 O O   . HOH E 4 .   ? 92.220 52.878 1.207   1.00 39.09 ? 1168 HOH A O   1 
HETATM 5017 O O   . HOH E 4 .   ? 84.342 49.055 -17.611 1.00 42.50 ? 1169 HOH A O   1 
HETATM 5018 O O   . HOH E 4 .   ? 85.067 69.694 -3.720  1.00 39.31 ? 1170 HOH A O   1 
HETATM 5019 O O   . HOH E 4 .   ? 67.879 21.596 0.567   1.00 28.06 ? 1171 HOH A O   1 
HETATM 5020 O O   . HOH E 4 .   ? 25.633 60.169 18.562  1.00 46.28 ? 1172 HOH A O   1 
HETATM 5021 O O   . HOH E 4 .   ? 43.529 53.672 29.402  1.00 36.29 ? 1173 HOH A O   1 
HETATM 5022 O O   . HOH E 4 .   ? 92.342 41.857 0.530   1.00 35.97 ? 1174 HOH A O   1 
HETATM 5023 O O   . HOH E 4 .   ? 86.799 44.829 12.572  1.00 39.55 ? 1175 HOH A O   1 
HETATM 5024 O O   . HOH E 4 .   ? 74.860 67.029 3.751   1.00 40.81 ? 1176 HOH A O   1 
HETATM 5025 O O   . HOH E 4 .   ? 55.010 21.827 -0.519  1.00 31.97 ? 1177 HOH A O   1 
HETATM 5026 O O   . HOH E 4 .   ? 52.615 21.024 -3.059  1.00 34.11 ? 1178 HOH A O   1 
HETATM 5027 O O   . HOH E 4 .   ? 56.081 20.656 0.701   1.00 41.65 ? 1179 HOH A O   1 
HETATM 5028 O O   . HOH E 4 .   ? 75.460 64.879 8.285   1.00 36.34 ? 1180 HOH A O   1 
HETATM 5029 O O   . HOH E 4 .   ? 62.332 50.026 28.604  1.00 41.22 ? 1181 HOH A O   1 
HETATM 5030 O O   . HOH E 4 .   ? 59.549 17.461 10.991  1.00 38.46 ? 1182 HOH A O   1 
HETATM 5031 O O   . HOH E 4 .   ? 66.737 22.826 14.878  1.00 39.14 ? 1183 HOH A O   1 
HETATM 5032 O O   . HOH E 4 .   ? 82.918 39.314 -15.208 0.50 17.20 ? 1184 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 1   ? 0.2052 0.2323 0.2488 -0.0202 0.0063  -0.0226 1    ALA A N   
2    C CA  . ALA A 1   ? 0.2012 0.2108 0.2294 -0.0043 -0.0002 -0.0190 1    ALA A CA  
3    C C   . ALA A 1   ? 0.1922 0.2088 0.2263 -0.0046 0.0021  -0.0073 1    ALA A C   
4    O O   . ALA A 1   ? 0.2022 0.2142 0.2270 -0.0109 0.0006  -0.0051 1    ALA A O   
5    C CB  . ALA A 1   ? 0.2001 0.2244 0.2322 -0.0129 -0.0060 -0.0160 1    ALA A CB  
6    N N   . ALA A 2   ? 0.1782 0.1982 0.2074 -0.0100 0.0013  -0.0118 2    ALA A N   
7    C CA  . ALA A 2   ? 0.1791 0.1909 0.2160 -0.0036 0.0008  -0.0071 2    ALA A CA  
8    C C   . ALA A 2   ? 0.1770 0.1979 0.2141 -0.0080 0.0005  -0.0083 2    ALA A C   
9    O O   . ALA A 2   ? 0.1592 0.2116 0.2179 -0.0215 0.0044  -0.0055 2    ALA A O   
10   C CB  . ALA A 2   ? 0.1901 0.1828 0.2161 -0.0107 -0.0043 -0.0088 2    ALA A CB  
11   N N   . LEU A 3   ? 0.1652 0.1828 0.1990 -0.0065 -0.0005 -0.0103 3    LEU A N   
12   C CA  . LEU A 3   ? 0.1668 0.1868 0.1968 -0.0094 -0.0026 -0.0071 3    LEU A CA  
13   C C   . LEU A 3   ? 0.1750 0.1788 0.1922 -0.0086 0.0036  -0.0077 3    LEU A C   
14   O O   . LEU A 3   ? 0.1683 0.1714 0.1902 -0.0078 -0.0016 -0.0172 3    LEU A O   
15   C CB  . LEU A 3   ? 0.1518 0.1890 0.1878 0.0066  -0.0011 -0.0060 3    LEU A CB  
16   C CG  . LEU A 3   ? 0.1544 0.2016 0.1893 -0.0009 0.0074  -0.0107 3    LEU A CG  
17   C CD1 . LEU A 3   ? 0.2206 0.1978 0.2027 -0.0019 0.0274  -0.0166 3    LEU A CD1 
18   C CD2 . LEU A 3   ? 0.1447 0.2168 0.2219 0.0023  0.0191  -0.0166 3    LEU A CD2 
19   N N   . THR A 4   ? 0.1850 0.1812 0.1960 -0.0080 0.0099  -0.0096 4    THR A N   
20   C CA  . THR A 4   ? 0.1954 0.1932 0.2258 -0.0126 0.0057  -0.0092 4    THR A CA  
21   C C   . THR A 4   ? 0.2020 0.2053 0.2239 -0.0071 -0.0010 -0.0070 4    THR A C   
22   O O   . THR A 4   ? 0.1972 0.2148 0.2458 -0.0270 -0.0042 -0.0090 4    THR A O   
23   C CB  . THR A 4   ? 0.2300 0.2225 0.2363 0.0028  0.0022  -0.0095 4    THR A CB  
24   O OG1 . THR A 4   ? 0.3003 0.2317 0.2608 -0.0126 0.0143  0.0004  4    THR A OG1 
25   C CG2 . THR A 4   ? 0.2136 0.1995 0.2671 -0.0088 0.0123  -0.0162 4    THR A CG2 
26   N N   . ARG A 5   ? 0.1826 0.1953 0.2137 -0.0088 -0.0044 -0.0151 5    ARG A N   
27   C CA  . ARG A 5   ? 0.1909 0.2163 0.2231 -0.0023 -0.0008 -0.0042 5    ARG A CA  
28   C C   . ARG A 5   ? 0.1903 0.2092 0.2235 -0.0034 -0.0006 -0.0047 5    ARG A C   
29   O O   . ARG A 5   ? 0.1939 0.2436 0.2406 -0.0095 0.0018  -0.0072 5    ARG A O   
30   C CB  . ARG A 5   ? 0.1916 0.2366 0.2270 -0.0084 -0.0074 0.0017  5    ARG A CB  
31   C CG  . ARG A 5   ? 0.2368 0.2657 0.2653 -0.0055 0.0095  -0.0070 5    ARG A CG  
32   C CD  . ARG A 5   ? 0.3459 0.3520 0.3221 0.0002  -0.0134 0.0123  5    ARG A CD  
33   N NE  . ARG A 5   ? 0.3883 0.4275 0.4269 -0.0033 -0.0100 0.0090  5    ARG A NE  
34   C CZ  . ARG A 5   ? 0.4315 0.4366 0.4296 -0.0036 -0.0120 -0.0052 5    ARG A CZ  
35   N NH1 . ARG A 5   ? 0.4363 0.4558 0.4435 -0.0055 -0.0058 -0.0004 5    ARG A NH1 
36   N NH2 . ARG A 5   ? 0.4329 0.4659 0.4520 0.0017  -0.0080 -0.0122 5    ARG A NH2 
37   N N   . ASP A 6   ? 0.1868 0.2084 0.2191 0.0035  -0.0013 -0.0068 6    ASP A N   
38   C CA  . ASP A 6   ? 0.1948 0.2159 0.2186 -0.0092 0.0006  -0.0078 6    ASP A CA  
39   C C   . ASP A 6   ? 0.1883 0.2181 0.2190 -0.0058 0.0032  -0.0015 6    ASP A C   
40   O O   . ASP A 6   ? 0.1705 0.1896 0.2092 -0.0215 0.0036  0.0007  6    ASP A O   
41   C CB  . ASP A 6   ? 0.1897 0.2036 0.2174 -0.0014 0.0043  -0.0157 6    ASP A CB  
42   C CG  . ASP A 6   ? 0.2132 0.2126 0.2183 0.0034  0.0037  -0.0064 6    ASP A CG  
43   O OD1 . ASP A 6   ? 0.1943 0.2012 0.2289 -0.0100 0.0016  0.0036  6    ASP A OD1 
44   O OD2 . ASP A 6   ? 0.2191 0.2079 0.2272 -0.0096 0.0195  -0.0027 6    ASP A OD2 
45   N N   . PRO A 7   ? 0.1917 0.2502 0.2310 -0.0023 0.0039  0.0086  7    PRO A N   
46   C CA  . PRO A 7   ? 0.1959 0.2523 0.2341 -0.0032 0.0059  0.0069  7    PRO A CA  
47   C C   . PRO A 7   ? 0.1901 0.2359 0.2285 0.0001  0.0107  0.0031  7    PRO A C   
48   O O   . PRO A 7   ? 0.1724 0.2396 0.2251 -0.0078 0.0187  0.0012  7    PRO A O   
49   C CB  . PRO A 7   ? 0.2060 0.2662 0.2438 0.0095  0.0089  0.0102  7    PRO A CB  
50   C CG  . PRO A 7   ? 0.2332 0.2894 0.2624 0.0070  0.0128  0.0267  7    PRO A CG  
51   C CD  . PRO A 7   ? 0.2102 0.2584 0.2491 0.0010  0.0098  0.0084  7    PRO A CD  
52   N N   . GLN A 8   ? 0.1867 0.2293 0.2232 -0.0018 0.0120  -0.0023 8    GLN A N   
53   C CA  . GLN A 8   ? 0.1895 0.2179 0.2302 -0.0019 0.0041  -0.0026 8    GLN A CA  
54   C C   . GLN A 8   ? 0.1848 0.2045 0.2104 -0.0021 0.0020  0.0006  8    GLN A C   
55   O O   . GLN A 8   ? 0.1748 0.1992 0.2164 -0.0026 0.0072  0.0099  8    GLN A O   
56   C CB  . GLN A 8   ? 0.2098 0.2136 0.2433 0.0033  0.0090  0.0059  8    GLN A CB  
57   C CG  . GLN A 8   ? 0.2480 0.2635 0.2899 0.0182  0.0060  -0.0053 8    GLN A CG  
58   C CD  . GLN A 8   ? 0.3517 0.3609 0.3472 -0.0022 0.0128  0.0062  8    GLN A CD  
59   O OE1 . GLN A 8   ? 0.3970 0.3720 0.3710 -0.0004 0.0063  0.0076  8    GLN A OE1 
60   N NE2 . GLN A 8   ? 0.3835 0.4386 0.4434 0.0063  0.0132  0.0035  8    GLN A NE2 
61   N N   . PHE A 9   ? 0.1518 0.1882 0.2092 -0.0085 0.0040  -0.0002 9    PHE A N   
62   C CA  . PHE A 9   ? 0.1763 0.1787 0.2047 -0.0042 0.0047  -0.0016 9    PHE A CA  
63   C C   . PHE A 9   ? 0.1799 0.1855 0.2114 -0.0079 0.0028  -0.0022 9    PHE A C   
64   O O   . PHE A 9   ? 0.1937 0.1853 0.2037 -0.0181 0.0019  0.0007  9    PHE A O   
65   C CB  . PHE A 9   ? 0.1683 0.1725 0.2068 -0.0013 0.0086  -0.0045 9    PHE A CB  
66   C CG  . PHE A 9   ? 0.1737 0.1943 0.2161 -0.0036 0.0101  -0.0097 9    PHE A CG  
67   C CD1 . PHE A 9   ? 0.1961 0.1972 0.2011 0.0055  0.0161  -0.0071 9    PHE A CD1 
68   C CD2 . PHE A 9   ? 0.2070 0.2244 0.2481 0.0082  -0.0052 -0.0178 9    PHE A CD2 
69   C CE1 . PHE A 9   ? 0.2148 0.2212 0.2518 0.0101  -0.0051 -0.0061 9    PHE A CE1 
70   C CE2 . PHE A 9   ? 0.2052 0.2484 0.2777 -0.0044 -0.0026 -0.0203 9    PHE A CE2 
71   C CZ  . PHE A 9   ? 0.2455 0.2577 0.2963 0.0004  -0.0060 -0.0186 9    PHE A CZ  
72   N N   . GLN A 10  ? 0.1838 0.2086 0.2239 -0.0071 0.0005  -0.0050 10   GLN A N   
73   C CA  . GLN A 10  ? 0.1962 0.2108 0.2280 -0.0119 -0.0048 0.0008  10   GLN A CA  
74   C C   . GLN A 10  ? 0.2000 0.2142 0.2376 -0.0128 -0.0014 -0.0025 10   GLN A C   
75   O O   . GLN A 10  ? 0.2120 0.2250 0.2420 -0.0238 0.0015  0.0072  10   GLN A O   
76   C CB  . GLN A 10  ? 0.2033 0.2198 0.2312 -0.0158 -0.0105 -0.0036 10   GLN A CB  
77   C CG  . GLN A 10  ? 0.2187 0.2440 0.2309 -0.0114 0.0087  0.0036  10   GLN A CG  
78   C CD  . GLN A 10  ? 0.2729 0.3146 0.2780 -0.0189 -0.0109 -0.0027 10   GLN A CD  
79   O OE1 . GLN A 10  ? 0.2886 0.3812 0.3220 -0.0131 0.0056  -0.0040 10   GLN A OE1 
80   N NE2 . GLN A 10  ? 0.2599 0.2865 0.2804 -0.0224 -0.0001 0.0058  10   GLN A NE2 
81   N N   . LYS A 11  ? 0.2063 0.2102 0.2413 -0.0195 0.0025  -0.0075 11   LYS A N   
82   C CA  . LYS A 11  ? 0.2218 0.2237 0.2465 -0.0174 0.0043  0.0013  11   LYS A CA  
83   C C   . LYS A 11  ? 0.2248 0.2158 0.2363 -0.0164 0.0054  0.0024  11   LYS A C   
84   O O   . LYS A 11  ? 0.2228 0.2293 0.2329 -0.0218 0.0126  -0.0024 11   LYS A O   
85   C CB  . LYS A 11  ? 0.2416 0.2314 0.2601 -0.0124 0.0074  0.0023  11   LYS A CB  
86   C CG  . LYS A 11  ? 0.3074 0.3115 0.2914 -0.0105 -0.0016 -0.0027 11   LYS A CG  
87   C CD  . LYS A 11  ? 0.3744 0.3569 0.3894 0.0083  0.0133  -0.0065 11   LYS A CD  
88   C CE  . LYS A 11  ? 0.4219 0.4289 0.4067 -0.0009 0.0012  -0.0060 11   LYS A CE  
89   N NZ  . LYS A 11  ? 0.4502 0.4369 0.4562 0.0043  0.0031  -0.0088 11   LYS A NZ  
90   N N   . LEU A 12  ? 0.2062 0.2102 0.2238 -0.0199 0.0090  0.0000  12   LEU A N   
91   C CA  . LEU A 12  ? 0.2093 0.1986 0.2162 -0.0134 0.0034  0.0094  12   LEU A CA  
92   C C   . LEU A 12  ? 0.2138 0.2134 0.2235 -0.0117 0.0038  0.0080  12   LEU A C   
93   O O   . LEU A 12  ? 0.1951 0.1960 0.2326 -0.0100 0.0007  0.0135  12   LEU A O   
94   C CB  . LEU A 12  ? 0.1984 0.1905 0.2058 -0.0156 0.0087  0.0057  12   LEU A CB  
95   C CG  . LEU A 12  ? 0.2156 0.2084 0.1995 -0.0062 0.0057  0.0176  12   LEU A CG  
96   C CD1 . LEU A 12  ? 0.2230 0.1857 0.2043 -0.0105 0.0072  0.0032  12   LEU A CD1 
97   C CD2 . LEU A 12  ? 0.2026 0.2268 0.2199 -0.0125 0.0130  0.0144  12   LEU A CD2 
98   N N   . GLN A 13  ? 0.2394 0.2153 0.2352 -0.0063 0.0015  0.0001  13   GLN A N   
99   C CA  . GLN A 13  ? 0.2594 0.2420 0.2512 -0.0038 0.0036  0.0002  13   GLN A CA  
100  C C   . GLN A 13  ? 0.2561 0.2377 0.2531 -0.0065 -0.0010 -0.0021 13   GLN A C   
101  O O   . GLN A 13  ? 0.2569 0.2306 0.2584 -0.0212 -0.0043 -0.0003 13   GLN A O   
102  C CB  . GLN A 13  ? 0.2831 0.2727 0.2651 0.0008  -0.0026 -0.0052 13   GLN A CB  
103  C CG  . GLN A 13  ? 0.3157 0.3242 0.3031 -0.0142 0.0005  0.0054  13   GLN A CG  
104  C CD  . GLN A 13  ? 0.3796 0.4005 0.3762 0.0040  0.0072  -0.0232 13   GLN A CD  
105  O OE1 . GLN A 13  ? 0.3936 0.4602 0.4359 -0.0037 -0.0078 -0.0021 13   GLN A OE1 
106  N NE2 . GLN A 13  ? 0.3273 0.3868 0.3756 -0.0115 0.0002  -0.0081 13   GLN A NE2 
107  N N   . GLN A 14  ? 0.2588 0.2469 0.2608 -0.0102 0.0015  0.0040  14   GLN A N   
108  C CA  . GLN A 14  ? 0.2683 0.2700 0.2783 -0.0125 0.0023  0.0103  14   GLN A CA  
109  C C   . GLN A 14  ? 0.2577 0.2602 0.2772 -0.0124 0.0042  0.0059  14   GLN A C   
110  O O   . GLN A 14  ? 0.2725 0.2586 0.2908 -0.0156 0.0013  0.0142  14   GLN A O   
111  C CB  . GLN A 14  ? 0.2763 0.2937 0.2953 -0.0114 -0.0050 0.0066  14   GLN A CB  
112  C CG  . GLN A 14  ? 0.3388 0.3413 0.3513 -0.0199 0.0021  0.0242  14   GLN A CG  
113  C CD  . GLN A 14  ? 0.4337 0.4088 0.4363 0.0032  0.0036  -0.0051 14   GLN A CD  
114  O OE1 . GLN A 14  ? 0.4780 0.4741 0.4531 -0.0045 0.0044  0.0050  14   GLN A OE1 
115  N NE2 . GLN A 14  ? 0.4540 0.4401 0.4520 -0.0025 0.0052  0.0089  14   GLN A NE2 
116  N N   . TRP A 15  ? 0.2457 0.2438 0.2514 -0.0075 0.0104  0.0028  15   TRP A N   
117  C CA  . TRP A 15  ? 0.2304 0.2361 0.2466 -0.0117 0.0077  0.0013  15   TRP A CA  
118  C C   . TRP A 15  ? 0.2308 0.2273 0.2379 -0.0117 0.0078  0.0030  15   TRP A C   
119  O O   . TRP A 15  ? 0.2223 0.2392 0.2391 -0.0236 0.0096  -0.0015 15   TRP A O   
120  C CB  . TRP A 15  ? 0.2365 0.2313 0.2362 -0.0109 0.0096  0.0027  15   TRP A CB  
121  C CG  . TRP A 15  ? 0.2365 0.2329 0.2361 -0.0045 0.0028  0.0053  15   TRP A CG  
122  C CD1 . TRP A 15  ? 0.2416 0.2471 0.2462 -0.0080 0.0066  0.0062  15   TRP A CD1 
123  C CD2 . TRP A 15  ? 0.2253 0.2376 0.2251 -0.0045 0.0088  0.0094  15   TRP A CD2 
124  N NE1 . TRP A 15  ? 0.2479 0.2399 0.2415 -0.0175 0.0099  0.0113  15   TRP A NE1 
125  C CE2 . TRP A 15  ? 0.2365 0.2396 0.2349 -0.0040 -0.0003 -0.0033 15   TRP A CE2 
126  C CE3 . TRP A 15  ? 0.2229 0.2144 0.2208 -0.0113 0.0032  0.0095  15   TRP A CE3 
127  C CZ2 . TRP A 15  ? 0.2489 0.2253 0.2327 -0.0003 0.0012  0.0059  15   TRP A CZ2 
128  C CZ3 . TRP A 15  ? 0.2357 0.2178 0.2275 -0.0155 0.0013  0.0114  15   TRP A CZ3 
129  C CH2 . TRP A 15  ? 0.2418 0.2184 0.2312 -0.0086 -0.0021 0.0046  15   TRP A CH2 
130  N N   . TYR A 16  ? 0.2293 0.2208 0.2303 -0.0124 0.0085  0.0023  16   TYR A N   
131  C CA  . TYR A 16  ? 0.2448 0.2143 0.2393 -0.0054 0.0079  0.0027  16   TYR A CA  
132  C C   . TYR A 16  ? 0.2664 0.2338 0.2600 -0.0017 0.0066  0.0026  16   TYR A C   
133  O O   . TYR A 16  ? 0.2735 0.2149 0.2524 -0.0114 0.0035  0.0052  16   TYR A O   
134  C CB  . TYR A 16  ? 0.2339 0.2259 0.2308 -0.0022 0.0076  0.0019  16   TYR A CB  
135  C CG  . TYR A 16  ? 0.2273 0.2054 0.2099 -0.0074 0.0110  0.0081  16   TYR A CG  
136  C CD1 . TYR A 16  ? 0.2023 0.2020 0.2023 -0.0001 0.0162  0.0093  16   TYR A CD1 
137  C CD2 . TYR A 16  ? 0.2385 0.2052 0.2252 -0.0124 0.0088  0.0010  16   TYR A CD2 
138  C CE1 . TYR A 16  ? 0.1960 0.1876 0.2065 -0.0163 0.0042  0.0131  16   TYR A CE1 
139  C CE2 . TYR A 16  ? 0.2257 0.2372 0.2267 -0.0134 0.0043  0.0113  16   TYR A CE2 
140  C CZ  . TYR A 16  ? 0.2126 0.2008 0.2059 -0.0021 0.0117  0.0182  16   TYR A CZ  
141  O OH  . TYR A 16  ? 0.1849 0.2070 0.2406 -0.0258 0.0168  0.0129  16   TYR A OH  
142  N N   . ARG A 17  ? 0.2746 0.2530 0.2793 -0.0089 0.0079  0.0012  17   ARG A N   
143  C CA  . ARG A 17  ? 0.3246 0.2825 0.3140 -0.0070 0.0001  0.0016  17   ARG A CA  
144  C C   . ARG A 17  ? 0.3358 0.2930 0.3194 -0.0076 -0.0053 0.0008  17   ARG A C   
145  O O   . ARG A 17  ? 0.3415 0.2763 0.3142 -0.0020 -0.0105 0.0000  17   ARG A O   
146  C CB  . ARG A 17  ? 0.3385 0.3117 0.3168 -0.0079 -0.0020 -0.0011 17   ARG A CB  
147  C CG  . ARG A 17  ? 0.4160 0.3586 0.4089 -0.0001 0.0053  0.0016  17   ARG A CG  
148  C CD  . ARG A 17  ? 0.4944 0.4860 0.4643 -0.0061 -0.0169 -0.0088 17   ARG A CD  
149  N NE  . ARG A 17  ? 0.5234 0.5363 0.5380 0.0003  0.0052  0.0021  17   ARG A NE  
150  C CZ  . ARG A 17  ? 0.5625 0.5704 0.5658 -0.0080 -0.0045 -0.0029 17   ARG A CZ  
151  N NH1 . ARG A 17  ? 0.5761 0.5984 0.5984 0.0069  0.0011  -0.0008 17   ARG A NH1 
152  N NH2 . ARG A 17  ? 0.5805 0.5793 0.5730 -0.0019 0.0015  -0.0046 17   ARG A NH2 
153  N N   . GLU A 18  ? 0.3349 0.3066 0.3371 -0.0125 -0.0016 0.0015  18   GLU A N   
154  C CA  . GLU A 18  ? 0.3691 0.3393 0.3493 -0.0110 -0.0043 0.0037  18   GLU A CA  
155  C C   . GLU A 18  ? 0.3647 0.3362 0.3538 -0.0118 -0.0048 0.0061  18   GLU A C   
156  O O   . GLU A 18  ? 0.3845 0.3408 0.3571 -0.0236 -0.0086 0.0093  18   GLU A O   
157  C CB  . GLU A 18  ? 0.3754 0.3519 0.3707 -0.0068 0.0037  0.0021  18   GLU A CB  
158  C CG  . GLU A 18  ? 0.4478 0.4460 0.4260 -0.0123 -0.0138 -0.0004 18   GLU A CG  
159  C CD  . GLU A 18  ? 0.5049 0.5308 0.5365 0.0110  -0.0005 0.0001  18   GLU A CD  
160  O OE1 . GLU A 18  ? 0.5704 0.5631 0.5668 -0.0029 -0.0013 -0.0126 18   GLU A OE1 
161  O OE2 . GLU A 18  ? 0.5378 0.5551 0.5576 -0.0132 -0.0101 0.0004  18   GLU A OE2 
162  N N   . HIS A 19  ? 0.3512 0.3179 0.3446 -0.0118 -0.0033 0.0057  19   HIS A N   
163  C CA  . HIS A 19  ? 0.3518 0.3258 0.3441 -0.0078 0.0005  0.0090  19   HIS A CA  
164  C C   . HIS A 19  ? 0.3536 0.3227 0.3454 -0.0117 -0.0040 0.0112  19   HIS A C   
165  O O   . HIS A 19  ? 0.3636 0.3240 0.3421 -0.0261 0.0004  0.0204  19   HIS A O   
166  C CB  . HIS A 19  ? 0.3564 0.3294 0.3525 -0.0095 0.0017  0.0067  19   HIS A CB  
167  C CG  . HIS A 19  ? 0.3621 0.3534 0.3658 -0.0047 0.0057  0.0039  19   HIS A CG  
168  N ND1 . HIS A 19  ? 0.3815 0.3745 0.3696 -0.0093 0.0079  0.0055  19   HIS A ND1 
169  C CD2 . HIS A 19  ? 0.3674 0.3423 0.3543 -0.0084 0.0048  0.0078  19   HIS A CD2 
170  C CE1 . HIS A 19  ? 0.3809 0.3824 0.3779 -0.0035 0.0051  0.0068  19   HIS A CE1 
171  N NE2 . HIS A 19  ? 0.3734 0.3655 0.3601 -0.0034 0.0099  0.0027  19   HIS A NE2 
172  N N   . ARG A 20  ? 0.3538 0.3334 0.3492 -0.0094 -0.0025 0.0108  20   ARG A N   
173  C CA  . ARG A 20  ? 0.3666 0.3598 0.3670 -0.0074 -0.0073 0.0094  20   ARG A CA  
174  C C   . ARG A 20  ? 0.3804 0.3664 0.3770 -0.0096 -0.0101 0.0111  20   ARG A C   
175  O O   . ARG A 20  ? 0.3813 0.3708 0.3746 -0.0165 -0.0164 0.0257  20   ARG A O   
176  C CB  . ARG A 20  ? 0.3740 0.3724 0.3759 -0.0044 -0.0054 0.0075  20   ARG A CB  
177  C CG  . ARG A 20  ? 0.3928 0.4070 0.4036 -0.0060 0.0017  0.0081  20   ARG A CG  
178  C CD  . ARG A 20  ? 0.4304 0.4254 0.4209 0.0019  -0.0025 -0.0005 20   ARG A CD  
179  N NE  . ARG A 20  ? 0.4464 0.4479 0.4498 -0.0007 0.0019  0.0002  20   ARG A NE  
180  C CZ  . ARG A 20  ? 0.4466 0.4504 0.4586 -0.0015 0.0018  0.0031  20   ARG A CZ  
181  N NH1 . ARG A 20  ? 0.4584 0.4489 0.4551 0.0026  -0.0025 0.0037  20   ARG A NH1 
182  N NH2 . ARG A 20  ? 0.4427 0.4407 0.4472 0.0033  0.0092  0.0025  20   ARG A NH2 
183  N N   . SER A 21  ? 0.3815 0.3695 0.3886 -0.0110 -0.0083 0.0108  21   SER A N   
184  C CA  . SER A 21  ? 0.3893 0.3789 0.3931 -0.0118 -0.0023 0.0113  21   SER A CA  
185  C C   . SER A 21  ? 0.3828 0.3717 0.3928 -0.0150 -0.0036 0.0071  21   SER A C   
186  O O   . SER A 21  ? 0.3999 0.3833 0.4091 -0.0189 -0.0075 0.0165  21   SER A O   
187  C CB  . SER A 21  ? 0.3935 0.3798 0.3969 -0.0093 -0.0034 0.0062  21   SER A CB  
188  O OG  . SER A 21  ? 0.4064 0.3980 0.4105 -0.0091 0.0081  -0.0006 21   SER A OG  
189  N N   . GLU A 22  ? 0.3829 0.3657 0.3913 -0.0180 0.0012  0.0117  22   GLU A N   
190  C CA  . GLU A 22  ? 0.3836 0.3745 0.3746 -0.0179 0.0035  0.0092  22   GLU A CA  
191  C C   . GLU A 22  ? 0.3675 0.3722 0.3572 -0.0125 0.0056  0.0061  22   GLU A C   
192  O O   . GLU A 22  ? 0.3692 0.3865 0.3593 -0.0182 0.0089  0.0062  22   GLU A O   
193  C CB  . GLU A 22  ? 0.3996 0.3963 0.3919 -0.0042 0.0005  0.0044  22   GLU A CB  
194  C CG  . GLU A 22  ? 0.4515 0.4319 0.4381 -0.0205 0.0074  0.0070  22   GLU A CG  
195  C CD  . GLU A 22  ? 0.4883 0.5022 0.5024 -0.0015 -0.0062 0.0071  22   GLU A CD  
196  O OE1 . GLU A 22  ? 0.5293 0.5216 0.5217 0.0029  0.0104  -0.0055 22   GLU A OE1 
197  O OE2 . GLU A 22  ? 0.5310 0.5257 0.5098 -0.0055 -0.0065 -0.0067 22   GLU A OE2 
198  N N   . LEU A 23  ? 0.3194 0.3342 0.3288 -0.0132 0.0065  0.0110  23   LEU A N   
199  C CA  . LEU A 23  ? 0.2968 0.3174 0.3024 -0.0032 0.0034  0.0026  23   LEU A CA  
200  C C   . LEU A 23  ? 0.2870 0.2858 0.2820 -0.0044 0.0021  0.0032  23   LEU A C   
201  O O   . LEU A 23  ? 0.2898 0.3098 0.2872 -0.0098 0.0077  -0.0017 23   LEU A O   
202  C CB  . LEU A 23  ? 0.2844 0.3055 0.3050 -0.0064 0.0009  0.0083  23   LEU A CB  
203  C CG  . LEU A 23  ? 0.3068 0.3296 0.3233 0.0013  -0.0061 0.0025  23   LEU A CG  
204  C CD1 . LEU A 23  ? 0.2960 0.3367 0.3225 0.0025  -0.0075 0.0048  23   LEU A CD1 
205  C CD2 . LEU A 23  ? 0.3099 0.3454 0.3407 0.0087  -0.0032 -0.0034 23   LEU A CD2 
206  N N   . ASN A 24  ? 0.2650 0.2411 0.2589 -0.0083 0.0109  0.0089  24   ASN A N   
207  C CA  . ASN A 24  ? 0.2619 0.2182 0.2381 -0.0050 0.0105  0.0071  24   ASN A CA  
208  C C   . ASN A 24  ? 0.2531 0.2169 0.2412 -0.0112 0.0132  0.0021  24   ASN A C   
209  O O   . ASN A 24  ? 0.2678 0.2171 0.2529 -0.0128 0.0163  0.0098  24   ASN A O   
210  C CB  . ASN A 24  ? 0.2667 0.2123 0.2491 -0.0098 0.0136  0.0107  24   ASN A CB  
211  C CG  . ASN A 24  ? 0.2903 0.2321 0.2470 -0.0096 0.0115  0.0147  24   ASN A CG  
212  O OD1 . ASN A 24  ? 0.3281 0.2196 0.2508 -0.0245 0.0077  0.0322  24   ASN A OD1 
213  N ND2 . ASN A 24  ? 0.2856 0.2168 0.2899 -0.0013 0.0145  0.0167  24   ASN A ND2 
214  N N   . LEU A 25  ? 0.2383 0.2102 0.2173 -0.0037 0.0088  0.0086  25   LEU A N   
215  C CA  . LEU A 25  ? 0.2518 0.2298 0.2394 -0.0022 0.0070  0.0032  25   LEU A CA  
216  C C   . LEU A 25  ? 0.2890 0.2595 0.2570 0.0005  0.0084  0.0001  25   LEU A C   
217  O O   . LEU A 25  ? 0.3004 0.2439 0.2834 0.0006  0.0185  0.0070  25   LEU A O   
218  C CB  . LEU A 25  ? 0.2302 0.2156 0.2252 -0.0006 -0.0002 0.0049  25   LEU A CB  
219  C CG  . LEU A 25  ? 0.2007 0.2316 0.2269 0.0111  0.0044  0.0023  25   LEU A CG  
220  C CD1 . LEU A 25  ? 0.1911 0.2045 0.2102 0.0069  0.0036  0.0062  25   LEU A CD1 
221  C CD2 . LEU A 25  ? 0.2131 0.1799 0.2329 0.0109  -0.0059 0.0103  25   LEU A CD2 
222  N N   . ARG A 26  ? 0.3180 0.2749 0.2859 0.0063  -0.0006 0.0010  26   ARG A N   
223  C CA  . ARG A 26  ? 0.3566 0.3246 0.3176 0.0075  0.0007  -0.0007 26   ARG A CA  
224  C C   . ARG A 26  ? 0.3676 0.3353 0.3305 0.0019  0.0042  0.0041  26   ARG A C   
225  O O   . ARG A 26  ? 0.3819 0.3438 0.3251 0.0013  0.0162  0.0007  26   ARG A O   
226  C CB  . ARG A 26  ? 0.3746 0.3403 0.3368 0.0099  -0.0064 0.0032  26   ARG A CB  
227  C CG  . ARG A 26  ? 0.3857 0.3923 0.3940 -0.0032 0.0134  0.0028  26   ARG A CG  
228  C CD  . ARG A 26  ? 0.4736 0.5011 0.4521 0.0006  -0.0169 -0.0025 26   ARG A CD  
229  N NE  . ARG A 26  ? 0.5268 0.5282 0.5355 -0.0079 0.0061  0.0122  26   ARG A NE  
230  C CZ  . ARG A 26  ? 0.5766 0.5849 0.5694 0.0018  -0.0109 0.0063  26   ARG A CZ  
231  N NH1 . ARG A 26  ? 0.5801 0.5900 0.5881 -0.0088 -0.0015 0.0016  26   ARG A NH1 
232  N NH2 . ARG A 26  ? 0.6057 0.6022 0.6023 -0.0051 0.0000  0.0124  26   ARG A NH2 
233  N N   . ARG A 27  ? 0.3757 0.3371 0.3392 0.0001  0.0027  0.0038  27   ARG A N   
234  C CA  . ARG A 27  ? 0.3819 0.3570 0.3581 0.0000  0.0065  0.0032  27   ARG A CA  
235  C C   . ARG A 27  ? 0.3819 0.3544 0.3519 0.0002  0.0107  0.0048  27   ARG A C   
236  O O   . ARG A 27  ? 0.3876 0.3485 0.3451 -0.0085 0.0203  0.0090  27   ARG A O   
237  C CB  . ARG A 27  ? 0.3958 0.3688 0.3749 -0.0068 0.0057  0.0033  27   ARG A CB  
238  C CG  . ARG A 27  ? 0.4124 0.4060 0.4152 0.0040  0.0026  0.0005  27   ARG A CG  
239  C CD  . ARG A 27  ? 0.4720 0.4319 0.4752 -0.0128 0.0049  0.0032  27   ARG A CD  
240  N NE  . ARG A 27  ? 0.4852 0.4690 0.5121 -0.0055 0.0053  0.0045  27   ARG A NE  
241  C CZ  . ARG A 27  ? 0.5262 0.5061 0.5191 -0.0046 0.0078  -0.0007 27   ARG A CZ  
242  N NH1 . ARG A 27  ? 0.5263 0.5068 0.5258 -0.0047 0.0078  0.0065  27   ARG A NH1 
243  N NH2 . ARG A 27  ? 0.5443 0.5573 0.5621 0.0061  0.0095  0.0013  27   ARG A NH2 
244  N N   . LEU A 28  ? 0.3661 0.3341 0.3395 -0.0035 0.0149  0.0050  28   LEU A N   
245  C CA  . LEU A 28  ? 0.3511 0.3255 0.3248 -0.0060 0.0108  0.0058  28   LEU A CA  
246  C C   . LEU A 28  ? 0.3609 0.3239 0.3288 -0.0051 0.0147  0.0086  28   LEU A C   
247  O O   . LEU A 28  ? 0.3795 0.3220 0.3412 -0.0132 0.0295  0.0092  28   LEU A O   
248  C CB  . LEU A 28  ? 0.3273 0.3186 0.3096 -0.0032 0.0142  -0.0024 28   LEU A CB  
249  C CG  . LEU A 28  ? 0.3196 0.3153 0.3185 0.0003  0.0037  0.0071  28   LEU A CG  
250  C CD1 . LEU A 28  ? 0.2957 0.2914 0.2944 -0.0018 -0.0019 -0.0137 28   LEU A CD1 
251  C CD2 . LEU A 28  ? 0.3198 0.3239 0.3383 -0.0065 0.0103  0.0066  28   LEU A CD2 
252  N N   . PHE A 29  ? 0.3710 0.3234 0.3170 -0.0104 0.0119  0.0086  29   PHE A N   
253  C CA  . PHE A 29  ? 0.3836 0.3311 0.3238 -0.0039 0.0135  0.0054  29   PHE A CA  
254  C C   . PHE A 29  ? 0.4209 0.3690 0.3492 -0.0008 0.0170  0.0058  29   PHE A C   
255  O O   . PHE A 29  ? 0.4314 0.3729 0.3439 0.0002  0.0224  0.0034  29   PHE A O   
256  C CB  . PHE A 29  ? 0.3682 0.3121 0.2989 -0.0060 0.0074  0.0109  29   PHE A CB  
257  C CG  . PHE A 29  ? 0.3153 0.2599 0.2663 -0.0011 0.0050  0.0023  29   PHE A CG  
258  C CD1 . PHE A 29  ? 0.3007 0.2368 0.2541 -0.0111 0.0032  0.0143  29   PHE A CD1 
259  C CD2 . PHE A 29  ? 0.2495 0.2435 0.2183 -0.0028 0.0073  0.0046  29   PHE A CD2 
260  C CE1 . PHE A 29  ? 0.2662 0.2126 0.2212 -0.0027 -0.0072 0.0013  29   PHE A CE1 
261  C CE2 . PHE A 29  ? 0.2610 0.2228 0.2269 -0.0019 -0.0020 -0.0005 29   PHE A CE2 
262  C CZ  . PHE A 29  ? 0.2238 0.2002 0.2145 0.0001  -0.0012 0.0026  29   PHE A CZ  
263  N N   . ASP A 30  ? 0.4486 0.3898 0.3916 0.0010  0.0113  0.0084  30   ASP A N   
264  C CA  . ASP A 30  ? 0.4684 0.4283 0.4172 -0.0003 0.0111  0.0073  30   ASP A CA  
265  C C   . ASP A 30  ? 0.4709 0.4309 0.4369 0.0013  0.0075  0.0070  30   ASP A C   
266  O O   . ASP A 30  ? 0.4835 0.4474 0.4454 0.0031  0.0163  0.0059  30   ASP A O   
267  C CB  . ASP A 30  ? 0.4809 0.4573 0.4528 0.0012  0.0014  0.0098  30   ASP A CB  
268  C CG  . ASP A 30  ? 0.5230 0.4984 0.4764 0.0048  0.0095  0.0017  30   ASP A CG  
269  O OD1 . ASP A 30  ? 0.5329 0.5631 0.5203 0.0043  0.0016  0.0097  30   ASP A OD1 
270  O OD2 . ASP A 30  ? 0.5631 0.5800 0.5542 -0.0145 -0.0050 -0.0005 30   ASP A OD2 
271  N N   . ALA A 31  ? 0.4682 0.4304 0.4451 0.0000  0.0072  0.0020  31   ALA A N   
272  C CA  . ALA A 31  ? 0.4707 0.4466 0.4606 -0.0003 0.0095  0.0032  31   ALA A CA  
273  C C   . ALA A 31  ? 0.4740 0.4519 0.4716 -0.0002 0.0106  0.0005  31   ALA A C   
274  O O   . ALA A 31  ? 0.4764 0.4534 0.4777 -0.0017 0.0153  0.0039  31   ALA A O   
275  C CB  . ALA A 31  ? 0.4675 0.4509 0.4620 -0.0006 0.0066  0.0020  31   ALA A CB  
276  N N   . ASN A 32  ? 0.4790 0.4567 0.4599 -0.0022 0.0121  0.0002  32   ASN A N   
277  C CA  . ASN A 32  ? 0.4720 0.4583 0.4538 0.0004  0.0067  -0.0017 32   ASN A CA  
278  C C   . ASN A 32  ? 0.4735 0.4593 0.4481 -0.0016 0.0083  -0.0028 32   ASN A C   
279  O O   . ASN A 32  ? 0.4794 0.4579 0.4430 0.0007  0.0106  -0.0011 32   ASN A O   
280  C CB  . ASN A 32  ? 0.4710 0.4603 0.4559 0.0023  0.0060  0.0000  32   ASN A CB  
281  C CG  . ASN A 32  ? 0.4788 0.4634 0.4618 -0.0020 0.0023  0.0017  32   ASN A CG  
282  O OD1 . ASN A 32  ? 0.4904 0.4891 0.4768 -0.0007 0.0189  0.0000  32   ASN A OD1 
283  N ND2 . ASN A 32  ? 0.4402 0.4297 0.4423 0.0009  0.0072  -0.0092 32   ASN A ND2 
284  N N   . LYS A 33  ? 0.4680 0.4485 0.4359 -0.0023 0.0087  0.0007  33   LYS A N   
285  C CA  . LYS A 33  ? 0.4607 0.4359 0.4180 0.0015  0.0083  0.0015  33   LYS A CA  
286  C C   . LYS A 33  ? 0.4278 0.4103 0.3863 0.0029  0.0107  -0.0051 33   LYS A C   
287  O O   . LYS A 33  ? 0.4317 0.4021 0.3616 0.0032  0.0187  -0.0093 33   LYS A O   
288  C CB  . LYS A 33  ? 0.4760 0.4549 0.4306 0.0016  0.0062  -0.0007 33   LYS A CB  
289  C CG  . LYS A 33  ? 0.4927 0.5034 0.4925 0.0027  0.0026  -0.0024 33   LYS A CG  
290  C CD  . LYS A 33  ? 0.5522 0.5274 0.5408 -0.0082 0.0031  0.0091  33   LYS A CD  
291  C CE  . LYS A 33  ? 0.5720 0.5497 0.5583 0.0017  0.0007  -0.0044 33   LYS A CE  
292  N NZ  . LYS A 33  ? 0.5994 0.5758 0.5897 -0.0042 0.0021  0.0043  33   LYS A NZ  
293  N N   . ASP A 34  ? 0.4175 0.3813 0.3551 0.0017  0.0178  0.0014  34   ASP A N   
294  C CA  . ASP A 34  ? 0.3941 0.3637 0.3394 0.0023  0.0133  -0.0032 34   ASP A CA  
295  C C   . ASP A 34  ? 0.3449 0.3162 0.3052 0.0080  0.0184  0.0006  34   ASP A C   
296  O O   . ASP A 34  ? 0.3363 0.3022 0.2899 0.0051  0.0320  -0.0038 34   ASP A O   
297  C CB  . ASP A 34  ? 0.4021 0.3953 0.3760 0.0042  0.0137  0.0040  34   ASP A CB  
298  C CG  . ASP A 34  ? 0.4843 0.4506 0.4454 0.0066  0.0053  -0.0151 34   ASP A CG  
299  O OD1 . ASP A 34  ? 0.5215 0.4773 0.4970 0.0029  0.0115  0.0053  34   ASP A OD1 
300  O OD2 . ASP A 34  ? 0.5607 0.5441 0.4903 0.0098  -0.0006 0.0048  34   ASP A OD2 
301  N N   . ARG A 35  ? 0.3035 0.2749 0.2525 -0.0066 0.0219  0.0036  35   ARG A N   
302  C CA  . ARG A 35  ? 0.2595 0.2280 0.2211 -0.0049 0.0145  0.0027  35   ARG A CA  
303  C C   . ARG A 35  ? 0.2329 0.2104 0.2082 -0.0015 0.0048  0.0003  35   ARG A C   
304  O O   . ARG A 35  ? 0.2166 0.2006 0.1957 -0.0027 0.0056  -0.0082 35   ARG A O   
305  C CB  . ARG A 35  ? 0.2640 0.2319 0.2061 0.0031  0.0118  0.0045  35   ARG A CB  
306  C CG  . ARG A 35  ? 0.2612 0.2285 0.2045 -0.0043 0.0250  0.0002  35   ARG A CG  
307  C CD  . ARG A 35  ? 0.2671 0.2339 0.1966 -0.0091 0.0158  0.0008  35   ARG A CD  
308  N NE  . ARG A 35  ? 0.2101 0.2094 0.1613 -0.0105 0.0294  -0.0014 35   ARG A NE  
309  C CZ  . ARG A 35  ? 0.1930 0.2287 0.1891 -0.0154 0.0199  0.0066  35   ARG A CZ  
310  N NH1 . ARG A 35  ? 0.1914 0.2374 0.2322 -0.0169 0.0295  -0.0152 35   ARG A NH1 
311  N NH2 . ARG A 35  ? 0.1696 0.2022 0.1784 -0.0125 0.0272  -0.0099 35   ARG A NH2 
312  N N   . PHE A 36  ? 0.2156 0.1933 0.1847 -0.0032 0.0034  0.0009  36   PHE A N   
313  C CA  . PHE A 36  ? 0.1922 0.1853 0.1701 -0.0030 0.0058  -0.0043 36   PHE A CA  
314  C C   . PHE A 36  ? 0.2029 0.1951 0.1758 0.0013  0.0103  -0.0007 36   PHE A C   
315  O O   . PHE A 36  ? 0.2008 0.1821 0.1743 0.0006  0.0143  0.0004  36   PHE A O   
316  C CB  . PHE A 36  ? 0.1963 0.1842 0.1734 -0.0065 0.0082  -0.0031 36   PHE A CB  
317  C CG  . PHE A 36  ? 0.1932 0.1736 0.1779 -0.0049 0.0012  -0.0024 36   PHE A CG  
318  C CD1 . PHE A 36  ? 0.1831 0.1822 0.1656 -0.0016 0.0098  -0.0054 36   PHE A CD1 
319  C CD2 . PHE A 36  ? 0.1835 0.1840 0.1780 -0.0016 0.0041  -0.0074 36   PHE A CD2 
320  C CE1 . PHE A 36  ? 0.1849 0.1946 0.1785 -0.0064 0.0134  -0.0094 36   PHE A CE1 
321  C CE2 . PHE A 36  ? 0.1941 0.1816 0.1859 0.0030  0.0070  -0.0099 36   PHE A CE2 
322  C CZ  . PHE A 36  ? 0.1724 0.1896 0.1744 -0.0013 0.0076  -0.0136 36   PHE A CZ  
323  N N   . ASN A 37  ? 0.2137 0.2047 0.1804 0.0059  0.0204  -0.0051 37   ASN A N   
324  C CA  . ASN A 37  ? 0.2226 0.2289 0.2054 0.0087  0.0144  -0.0020 37   ASN A CA  
325  C C   . ASN A 37  ? 0.2154 0.2334 0.2122 0.0033  0.0155  -0.0044 37   ASN A C   
326  O O   . ASN A 37  ? 0.2136 0.2490 0.2423 0.0042  0.0017  -0.0014 37   ASN A O   
327  C CB  . ASN A 37  ? 0.2343 0.2380 0.2053 0.0079  0.0208  -0.0016 37   ASN A CB  
328  C CG  . ASN A 37  ? 0.2822 0.2822 0.2602 0.0032  0.0013  -0.0039 37   ASN A CG  
329  O OD1 . ASN A 37  ? 0.3048 0.3283 0.3118 0.0021  0.0171  -0.0161 37   ASN A OD1 
330  N ND2 . ASN A 37  ? 0.3345 0.3209 0.2809 0.0025  0.0130  0.0076  37   ASN A ND2 
331  N N   . HIS A 38  ? 0.2132 0.2412 0.2138 0.0034  0.0245  -0.0100 38   HIS A N   
332  C CA  . HIS A 38  ? 0.2222 0.2549 0.2298 0.0021  0.0177  -0.0085 38   HIS A CA  
333  C C   . HIS A 38  ? 0.1940 0.2326 0.2103 0.0014  0.0132  -0.0028 38   HIS A C   
334  O O   . HIS A 38  ? 0.1718 0.2457 0.2208 -0.0002 0.0238  -0.0068 38   HIS A O   
335  C CB  . HIS A 38  ? 0.2577 0.2810 0.2602 -0.0102 0.0162  0.0004  38   HIS A CB  
336  C CG  . HIS A 38  ? 0.3317 0.3637 0.3274 0.0061  0.0292  -0.0139 38   HIS A CG  
337  N ND1 . HIS A 38  ? 0.4012 0.3893 0.4124 -0.0066 0.0222  -0.0052 38   HIS A ND1 
338  C CD2 . HIS A 38  ? 0.3964 0.3880 0.3967 -0.0130 0.0265  0.0044  38   HIS A CD2 
339  C CE1 . HIS A 38  ? 0.4139 0.4143 0.4126 0.0022  0.0234  -0.0039 38   HIS A CE1 
340  N NE2 . HIS A 38  ? 0.4232 0.4239 0.4198 -0.0030 0.0301  -0.0052 38   HIS A NE2 
341  N N   . PHE A 39  ? 0.1609 0.1905 0.1828 0.0056  0.0173  -0.0033 39   PHE A N   
342  C CA  . PHE A 39  ? 0.1615 0.1471 0.1671 0.0024  0.0053  -0.0111 39   PHE A CA  
343  C C   . PHE A 39  ? 0.1609 0.1588 0.1668 0.0078  0.0101  -0.0066 39   PHE A C   
344  O O   . PHE A 39  ? 0.1561 0.1508 0.1579 0.0147  0.0072  -0.0114 39   PHE A O   
345  C CB  . PHE A 39  ? 0.1557 0.1384 0.1639 0.0112  0.0094  -0.0045 39   PHE A CB  
346  C CG  . PHE A 39  ? 0.1708 0.1690 0.1808 0.0005  0.0091  -0.0079 39   PHE A CG  
347  C CD1 . PHE A 39  ? 0.2289 0.2376 0.2023 -0.0223 0.0060  0.0046  39   PHE A CD1 
348  C CD2 . PHE A 39  ? 0.2056 0.2340 0.2025 -0.0110 -0.0048 -0.0029 39   PHE A CD2 
349  C CE1 . PHE A 39  ? 0.2105 0.2352 0.1985 -0.0233 0.0147  0.0034  39   PHE A CE1 
350  C CE2 . PHE A 39  ? 0.2337 0.2353 0.2369 -0.0177 0.0017  0.0096  39   PHE A CE2 
351  C CZ  . PHE A 39  ? 0.2211 0.2309 0.2135 -0.0108 0.0029  -0.0060 39   PHE A CZ  
352  N N   . SER A 40  ? 0.1611 0.1422 0.1757 -0.0008 0.0092  -0.0067 40   SER A N   
353  C CA  . SER A 40  ? 0.1596 0.1533 0.1657 0.0010  0.0095  0.0010  40   SER A CA  
354  C C   . SER A 40  ? 0.1694 0.1623 0.1863 0.0047  0.0080  0.0007  40   SER A C   
355  O O   . SER A 40  ? 0.1746 0.1605 0.1968 0.0050  0.0226  0.0051  40   SER A O   
356  C CB  . SER A 40  ? 0.1757 0.1724 0.1612 0.0093  0.0092  -0.0028 40   SER A CB  
357  O OG  . SER A 40  ? 0.1883 0.1708 0.1599 0.0180  0.0153  -0.0191 40   SER A OG  
358  N N   . LEU A 41  ? 0.1666 0.1580 0.1894 0.0048  0.0086  0.0065  41   LEU A N   
359  C CA  . LEU A 41  ? 0.2040 0.1780 0.2189 0.0039  0.0066  -0.0023 41   LEU A CA  
360  C C   . LEU A 41  ? 0.1896 0.1718 0.2137 0.0034  0.0078  0.0038  41   LEU A C   
361  O O   . LEU A 41  ? 0.1931 0.1548 0.2015 -0.0016 0.0183  -0.0020 41   LEU A O   
362  C CB  . LEU A 41  ? 0.2104 0.2074 0.2336 0.0064  -0.0016 0.0052  41   LEU A CB  
363  C CG  . LEU A 41  ? 0.2868 0.2597 0.2828 0.0001  -0.0017 -0.0091 41   LEU A CG  
364  C CD1 . LEU A 41  ? 0.3109 0.3153 0.3003 -0.0025 -0.0051 0.0175  41   LEU A CD1 
365  C CD2 . LEU A 41  ? 0.2900 0.3249 0.3243 0.0036  0.0025  0.0049  41   LEU A CD2 
366  N N   . THR A 42  ? 0.1887 0.1700 0.2050 -0.0012 0.0090  -0.0024 42   THR A N   
367  C CA  . THR A 42  ? 0.2033 0.1917 0.2251 0.0010  0.0077  0.0024  42   THR A CA  
368  C C   . THR A 42  ? 0.1955 0.1967 0.2267 0.0020  0.0045  0.0064  42   THR A C   
369  O O   . THR A 42  ? 0.2138 0.1917 0.2565 0.0146  0.0078  0.0092  42   THR A O   
370  C CB  . THR A 42  ? 0.2218 0.2111 0.2304 -0.0028 -0.0025 0.0033  42   THR A CB  
371  O OG1 . THR A 42  ? 0.2434 0.2191 0.2478 0.0050  0.0006  0.0008  42   THR A OG1 
372  C CG2 . THR A 42  ? 0.2609 0.2545 0.2592 -0.0129 -0.0021 -0.0054 42   THR A CG2 
373  N N   . LEU A 43  ? 0.1850 0.1853 0.2183 0.0039  0.0039  0.0063  43   LEU A N   
374  C CA  . LEU A 43  ? 0.1806 0.1861 0.2229 0.0038  -0.0026 0.0012  43   LEU A CA  
375  C C   . LEU A 43  ? 0.1846 0.1864 0.2302 0.0073  0.0012  -0.0029 43   LEU A C   
376  O O   . LEU A 43  ? 0.1839 0.1787 0.2396 -0.0030 -0.0038 -0.0189 43   LEU A O   
377  C CB  . LEU A 43  ? 0.2066 0.2084 0.2256 0.0062  -0.0103 0.0045  43   LEU A CB  
378  C CG  . LEU A 43  ? 0.2716 0.2452 0.2618 -0.0134 -0.0036 -0.0182 43   LEU A CG  
379  C CD1 . LEU A 43  ? 0.3306 0.3176 0.3326 -0.0212 0.0082  -0.0037 43   LEU A CD1 
380  C CD2 . LEU A 43  ? 0.2774 0.2587 0.2801 -0.0102 -0.0059 -0.0135 43   LEU A CD2 
381  N N   . ASN A 44  ? 0.1821 0.1800 0.2163 0.0045  0.0097  -0.0025 44   ASN A N   
382  C CA  . ASN A 44  ? 0.1957 0.1832 0.2042 0.0067  0.0150  -0.0042 44   ASN A CA  
383  C C   . ASN A 44  ? 0.1896 0.1793 0.2015 0.0109  0.0097  -0.0003 44   ASN A C   
384  O O   . ASN A 44  ? 0.1881 0.1866 0.2087 0.0127  0.0090  0.0058  44   ASN A O   
385  C CB  . ASN A 44  ? 0.2200 0.2077 0.2201 0.0131  0.0152  -0.0017 44   ASN A CB  
386  C CG  . ASN A 44  ? 0.2446 0.2276 0.2395 -0.0001 0.0103  -0.0141 44   ASN A CG  
387  O OD1 . ASN A 44  ? 0.2570 0.2199 0.2540 0.0042  0.0106  -0.0118 44   ASN A OD1 
388  N ND2 . ASN A 44  ? 0.2917 0.2861 0.2916 0.0208  0.0281  -0.0308 44   ASN A ND2 
389  N N   . THR A 45  ? 0.1798 0.1763 0.2033 0.0066  0.0056  0.0015  45   THR A N   
390  C CA  . THR A 45  ? 0.1973 0.1778 0.2060 0.0057  0.0053  0.0003  45   THR A CA  
391  C C   . THR A 45  ? 0.1891 0.1821 0.2184 0.0030  0.0011  -0.0016 45   THR A C   
392  O O   . THR A 45  ? 0.1973 0.1940 0.2383 -0.0033 0.0158  -0.0022 45   THR A O   
393  C CB  . THR A 45  ? 0.1890 0.1718 0.1958 0.0001  0.0002  -0.0022 45   THR A CB  
394  O OG1 . THR A 45  ? 0.1926 0.1718 0.1653 0.0084  0.0061  0.0083  45   THR A OG1 
395  C CG2 . THR A 45  ? 0.2224 0.1752 0.2083 -0.0017 0.0038  -0.0028 45   THR A CG2 
396  N N   . ASN A 46  ? 0.1948 0.1806 0.2225 -0.0012 0.0147  -0.0014 46   ASN A N   
397  C CA  . ASN A 46  ? 0.2182 0.2062 0.2311 -0.0004 0.0080  -0.0042 46   ASN A CA  
398  C C   . ASN A 46  ? 0.2099 0.1844 0.2089 -0.0021 0.0044  0.0007  46   ASN A C   
399  O O   . ASN A 46  ? 0.2262 0.1866 0.2134 0.0010  0.0069  -0.0068 46   ASN A O   
400  C CB  . ASN A 46  ? 0.2397 0.2196 0.2485 -0.0018 0.0046  0.0066  46   ASN A CB  
401  C CG  . ASN A 46  ? 0.2874 0.3148 0.3266 0.0100  0.0101  -0.0006 46   ASN A CG  
402  O OD1 . ASN A 46  ? 0.4058 0.4259 0.4014 0.0196  -0.0190 0.0162  46   ASN A OD1 
403  N ND2 . ASN A 46  ? 0.3170 0.3171 0.3493 0.0109  0.0282  0.0028  46   ASN A ND2 
404  N N   . HIS A 47  ? 0.1945 0.1793 0.1836 -0.0024 0.0067  -0.0014 47   HIS A N   
405  C CA  . HIS A 47  ? 0.1990 0.1754 0.1829 0.0064  0.0112  0.0009  47   HIS A CA  
406  C C   . HIS A 47  ? 0.1842 0.1777 0.1828 -0.0019 0.0109  0.0010  47   HIS A C   
407  O O   . HIS A 47  ? 0.1913 0.1875 0.2007 0.0045  0.0055  -0.0098 47   HIS A O   
408  C CB  . HIS A 47  ? 0.2086 0.1964 0.2004 0.0062  0.0110  0.0051  47   HIS A CB  
409  C CG  . HIS A 47  ? 0.2613 0.2149 0.2417 0.0086  0.0120  0.0067  47   HIS A CG  
410  N ND1 . HIS A 47  ? 0.2801 0.2516 0.2472 -0.0040 0.0173  -0.0023 47   HIS A ND1 
411  C CD2 . HIS A 47  ? 0.2758 0.2617 0.2622 0.0084  0.0006  -0.0031 47   HIS A CD2 
412  C CE1 . HIS A 47  ? 0.2915 0.2666 0.2838 0.0073  -0.0027 -0.0076 47   HIS A CE1 
413  N NE2 . HIS A 47  ? 0.2700 0.2654 0.2979 0.0117  -0.0021 0.0065  47   HIS A NE2 
414  N N   . GLY A 48  ? 0.1766 0.1529 0.1676 0.0004  0.0065  0.0072  48   GLY A N   
415  C CA  . GLY A 48  ? 0.1564 0.1412 0.1625 -0.0005 0.0018  0.0002  48   GLY A CA  
416  C C   . GLY A 48  ? 0.1536 0.1345 0.1419 -0.0003 0.0049  -0.0051 48   GLY A C   
417  O O   . GLY A 48  ? 0.1649 0.1406 0.1719 -0.0051 0.0064  -0.0083 48   GLY A O   
418  N N   . HIS A 49  ? 0.1675 0.1266 0.1454 0.0040  0.0005  -0.0097 49   HIS A N   
419  C CA  . HIS A 49  ? 0.1614 0.1536 0.1563 0.0033  0.0050  -0.0080 49   HIS A CA  
420  C C   . HIS A 49  ? 0.1645 0.1457 0.1680 0.0024  -0.0050 -0.0111 49   HIS A C   
421  O O   . HIS A 49  ? 0.1542 0.1381 0.1737 -0.0085 0.0083  -0.0228 49   HIS A O   
422  C CB  . HIS A 49  ? 0.1847 0.1694 0.1597 0.0015  0.0039  -0.0073 49   HIS A CB  
423  C CG  . HIS A 49  ? 0.2192 0.1984 0.2080 0.0200  0.0018  -0.0188 49   HIS A CG  
424  N ND1 . HIS A 49  ? 0.2947 0.2606 0.2853 0.0024  0.0111  -0.0061 49   HIS A ND1 
425  C CD2 . HIS A 49  ? 0.2667 0.2539 0.2671 -0.0014 0.0215  -0.0166 49   HIS A CD2 
426  C CE1 . HIS A 49  ? 0.2876 0.2497 0.2766 0.0045  0.0119  -0.0100 49   HIS A CE1 
427  N NE2 . HIS A 49  ? 0.2876 0.2408 0.2783 0.0125  -0.0002 -0.0211 49   HIS A NE2 
428  N N   . ILE A 50  ? 0.1483 0.1349 0.1691 0.0000  0.0017  -0.0054 50   ILE A N   
429  C CA  . ILE A 50  ? 0.1648 0.1286 0.1532 0.0023  0.0033  -0.0016 50   ILE A CA  
430  C C   . ILE A 50  ? 0.1523 0.1423 0.1563 0.0006  0.0051  0.0009  50   ILE A C   
431  O O   . ILE A 50  ? 0.1615 0.1452 0.1810 -0.0040 0.0047  0.0132  50   ILE A O   
432  C CB  . ILE A 50  ? 0.1557 0.1297 0.1562 0.0025  -0.0012 -0.0042 50   ILE A CB  
433  C CG1 . ILE A 50  ? 0.1930 0.1445 0.1518 0.0062  -0.0028 0.0105  50   ILE A CG1 
434  C CG2 . ILE A 50  ? 0.1923 0.1481 0.1630 0.0105  0.0145  -0.0045 50   ILE A CG2 
435  C CD1 . ILE A 50  ? 0.1905 0.1693 0.1464 -0.0016 -0.0084 0.0041  50   ILE A CD1 
436  N N   . LEU A 51  ? 0.1367 0.1183 0.1366 0.0001  0.0086  0.0036  51   LEU A N   
437  C CA  . LEU A 51  ? 0.1356 0.1232 0.1381 -0.0057 -0.0001 -0.0003 51   LEU A CA  
438  C C   . LEU A 51  ? 0.1448 0.1331 0.1504 0.0003  0.0060  -0.0031 51   LEU A C   
439  O O   . LEU A 51  ? 0.1499 0.1408 0.1574 0.0065  -0.0053 -0.0138 51   LEU A O   
440  C CB  . LEU A 51  ? 0.1469 0.1267 0.1514 -0.0034 0.0002  0.0045  51   LEU A CB  
441  C CG  . LEU A 51  ? 0.1385 0.1266 0.1388 -0.0004 0.0011  0.0086  51   LEU A CG  
442  C CD1 . LEU A 51  ? 0.1458 0.1612 0.1630 -0.0007 0.0156  0.0006  51   LEU A CD1 
443  C CD2 . LEU A 51  ? 0.1378 0.1433 0.1645 0.0012  -0.0080 0.0108  51   LEU A CD2 
444  N N   . VAL A 52  ? 0.1328 0.1139 0.1270 0.0041  -0.0041 -0.0076 52   VAL A N   
445  C CA  . VAL A 52  ? 0.1531 0.1233 0.1254 -0.0013 -0.0011 0.0003  52   VAL A CA  
446  C C   . VAL A 52  ? 0.1422 0.1277 0.1338 -0.0011 -0.0027 0.0030  52   VAL A C   
447  O O   . VAL A 52  ? 0.1533 0.1455 0.1419 0.0055  -0.0038 -0.0038 52   VAL A O   
448  C CB  . VAL A 52  ? 0.1364 0.1152 0.1323 0.0057  0.0014  0.0059  52   VAL A CB  
449  C CG1 . VAL A 52  ? 0.1690 0.1550 0.1185 -0.0093 -0.0011 -0.0061 52   VAL A CG1 
450  C CG2 . VAL A 52  ? 0.1771 0.1438 0.1518 -0.0147 0.0028  0.0140  52   VAL A CG2 
451  N N   . ASP A 53  ? 0.1363 0.1276 0.1313 0.0039  0.0043  0.0102  53   ASP A N   
452  C CA  . ASP A 53  ? 0.1386 0.1376 0.1327 -0.0027 0.0001  0.0076  53   ASP A CA  
453  C C   . ASP A 53  ? 0.1438 0.1417 0.1360 0.0010  0.0015  0.0044  53   ASP A C   
454  O O   . ASP A 53  ? 0.1296 0.1378 0.1345 0.0000  -0.0027 0.0052  53   ASP A O   
455  C CB  . ASP A 53  ? 0.1382 0.1472 0.1451 0.0045  0.0043  0.0229  53   ASP A CB  
456  C CG  . ASP A 53  ? 0.1565 0.1524 0.1539 0.0062  0.0049  0.0081  53   ASP A CG  
457  O OD1 . ASP A 53  ? 0.1728 0.1545 0.1386 -0.0034 0.0118  -0.0176 53   ASP A OD1 
458  O OD2 . ASP A 53  ? 0.1682 0.1708 0.1291 0.0128  0.0043  0.0065  53   ASP A OD2 
459  N N   . TYR A 54  ? 0.1373 0.1307 0.1311 -0.0050 -0.0017 -0.0034 54   TYR A N   
460  C CA  . TYR A 54  ? 0.1511 0.1445 0.1350 -0.0069 -0.0019 -0.0034 54   TYR A CA  
461  C C   . TYR A 54  ? 0.1408 0.1414 0.1352 -0.0015 0.0055  -0.0064 54   TYR A C   
462  O O   . TYR A 54  ? 0.1592 0.1374 0.1485 -0.0147 0.0098  -0.0020 54   TYR A O   
463  C CB  . TYR A 54  ? 0.1453 0.1570 0.1365 0.0063  -0.0012 -0.0005 54   TYR A CB  
464  C CG  . TYR A 54  ? 0.1606 0.1506 0.1582 0.0042  0.0087  0.0014  54   TYR A CG  
465  C CD1 . TYR A 54  ? 0.1374 0.1537 0.1522 0.0124  0.0110  -0.0089 54   TYR A CD1 
466  C CD2 . TYR A 54  ? 0.1472 0.1629 0.1423 0.0052  0.0077  0.0000  54   TYR A CD2 
467  C CE1 . TYR A 54  ? 0.1474 0.1660 0.1637 0.0152  0.0072  -0.0082 54   TYR A CE1 
468  C CE2 . TYR A 54  ? 0.1472 0.1410 0.1679 0.0196  0.0079  0.0011  54   TYR A CE2 
469  C CZ  . TYR A 54  ? 0.1643 0.1639 0.1802 0.0097  0.0052  -0.0042 54   TYR A CZ  
470  O OH  . TYR A 54  ? 0.1565 0.1834 0.2021 0.0033  0.0383  -0.0088 54   TYR A OH  
471  N N   . SER A 55  ? 0.1421 0.1374 0.1328 -0.0059 0.0059  -0.0009 55   SER A N   
472  C CA  . SER A 55  ? 0.1587 0.1413 0.1340 0.0015  0.0109  -0.0047 55   SER A CA  
473  C C   . SER A 55  ? 0.1521 0.1375 0.1474 0.0003  0.0087  0.0060  55   SER A C   
474  O O   . SER A 55  ? 0.1610 0.1354 0.1490 -0.0139 0.0257  0.0046  55   SER A O   
475  C CB  . SER A 55  ? 0.1519 0.1616 0.1280 -0.0095 0.0052  -0.0045 55   SER A CB  
476  O OG  . SER A 55  ? 0.1483 0.1454 0.1363 -0.0004 0.0031  0.0040  55   SER A OG  
477  N N   . LYS A 56  ? 0.1458 0.1287 0.1378 -0.0003 0.0156  0.0037  56   LYS A N   
478  C CA  . LYS A 56  ? 0.1325 0.1291 0.1430 0.0028  0.0004  -0.0090 56   LYS A CA  
479  C C   . LYS A 56  ? 0.1395 0.1259 0.1289 0.0058  0.0037  -0.0006 56   LYS A C   
480  O O   . LYS A 56  ? 0.1335 0.1445 0.1383 0.0080  0.0026  -0.0075 56   LYS A O   
481  C CB  . LYS A 56  ? 0.1346 0.1434 0.1441 0.0005  0.0067  -0.0097 56   LYS A CB  
482  C CG  . LYS A 56  ? 0.1363 0.1343 0.1455 0.0174  0.0025  -0.0073 56   LYS A CG  
483  C CD  . LYS A 56  ? 0.1315 0.1497 0.1463 -0.0017 -0.0100 -0.0036 56   LYS A CD  
484  C CE  . LYS A 56  ? 0.1190 0.1070 0.1287 -0.0028 0.0148  -0.0003 56   LYS A CE  
485  N NZ  . LYS A 56  ? 0.1447 0.1083 0.1024 -0.0122 0.0109  0.0047  56   LYS A NZ  
486  N N   . ASN A 57  ? 0.1442 0.1442 0.1440 -0.0032 0.0041  0.0004  57   ASN A N   
487  C CA  . ASN A 57  ? 0.1599 0.1427 0.1500 -0.0043 0.0015  0.0025  57   ASN A CA  
488  C C   . ASN A 57  ? 0.1618 0.1576 0.1650 -0.0030 0.0100  0.0012  57   ASN A C   
489  O O   . ASN A 57  ? 0.1545 0.1371 0.1611 0.0048  0.0131  0.0064  57   ASN A O   
490  C CB  . ASN A 57  ? 0.1442 0.1504 0.1605 0.0027  0.0040  0.0071  57   ASN A CB  
491  C CG  . ASN A 57  ? 0.1447 0.1469 0.1512 0.0026  -0.0031 -0.0003 57   ASN A CG  
492  O OD1 . ASN A 57  ? 0.1860 0.1611 0.2235 -0.0010 -0.0037 0.0028  57   ASN A OD1 
493  N ND2 . ASN A 57  ? 0.1022 0.1144 0.1116 -0.0047 -0.0030 0.0056  57   ASN A ND2 
494  N N   . LEU A 58  ? 0.1656 0.1534 0.1691 0.0026  0.0071  -0.0012 58   LEU A N   
495  C CA  . LEU A 58  ? 0.1705 0.1577 0.1749 0.0000  0.0119  -0.0006 58   LEU A CA  
496  C C   . LEU A 58  ? 0.1664 0.1546 0.1671 -0.0048 0.0090  0.0058  58   LEU A C   
497  O O   . LEU A 58  ? 0.1596 0.1652 0.1870 -0.0084 0.0197  0.0097  58   LEU A O   
498  C CB  . LEU A 58  ? 0.1792 0.1573 0.1754 0.0039  0.0066  -0.0025 58   LEU A CB  
499  C CG  . LEU A 58  ? 0.1988 0.1868 0.1962 0.0067  0.0097  0.0062  58   LEU A CG  
500  C CD1 . LEU A 58  ? 0.2321 0.2417 0.1971 0.0062  -0.0028 -0.0171 58   LEU A CD1 
501  C CD2 . LEU A 58  ? 0.2343 0.2194 0.2093 0.0107  -0.0119 0.0267  58   LEU A CD2 
502  N N   . VAL A 59  ? 0.1644 0.1614 0.1754 0.0016  0.0210  0.0104  59   VAL A N   
503  C CA  . VAL A 59  ? 0.1614 0.1603 0.1738 -0.0036 0.0177  0.0098  59   VAL A CA  
504  C C   . VAL A 59  ? 0.1708 0.1674 0.1721 -0.0011 0.0124  0.0036  59   VAL A C   
505  O O   . VAL A 59  ? 0.1625 0.1738 0.1721 -0.0031 0.0265  0.0015  59   VAL A O   
506  C CB  . VAL A 59  ? 0.1855 0.1629 0.1617 0.0003  0.0157  0.0047  59   VAL A CB  
507  C CG1 . VAL A 59  ? 0.1913 0.1800 0.1720 -0.0028 0.0269  -0.0063 59   VAL A CG1 
508  C CG2 . VAL A 59  ? 0.1620 0.1901 0.1868 -0.0083 0.0137  0.0111  59   VAL A CG2 
509  N N   . THR A 60  ? 0.1701 0.1832 0.1894 0.0029  0.0162  0.0049  60   THR A N   
510  C CA  . THR A 60  ? 0.1909 0.1977 0.1969 -0.0016 0.0202  0.0040  60   THR A CA  
511  C C   . THR A 60  ? 0.1776 0.2023 0.1935 -0.0032 0.0141  0.0007  60   THR A C   
512  O O   . THR A 60  ? 0.1650 0.1957 0.1858 -0.0032 0.0128  0.0084  60   THR A O   
513  C CB  . THR A 60  ? 0.1889 0.1895 0.2029 -0.0082 0.0198  0.0020  60   THR A CB  
514  O OG1 . THR A 60  ? 0.1971 0.1936 0.1739 -0.0049 0.0450  0.0089  60   THR A OG1 
515  C CG2 . THR A 60  ? 0.2296 0.2271 0.2417 0.0034  0.0214  0.0118  60   THR A CG2 
516  N N   . GLU A 61  ? 0.1724 0.1965 0.1969 -0.0041 0.0228  -0.0036 61   GLU A N   
517  C CA  . GLU A 61  ? 0.1871 0.2182 0.1929 0.0033  0.0202  -0.0029 61   GLU A CA  
518  C C   . GLU A 61  ? 0.1820 0.2084 0.1873 0.0009  0.0203  -0.0052 61   GLU A C   
519  O O   . GLU A 61  ? 0.1724 0.2149 0.2095 -0.0005 0.0325  0.0031  61   GLU A O   
520  C CB  . GLU A 61  ? 0.1944 0.2357 0.1950 -0.0011 0.0279  -0.0055 61   GLU A CB  
521  C CG  . GLU A 61  ? 0.2574 0.2983 0.2466 -0.0090 0.0010  -0.0062 61   GLU A CG  
522  C CD  . GLU A 61  ? 0.3619 0.3391 0.3615 -0.0057 0.0019  0.0019  61   GLU A CD  
523  O OE1 . GLU A 61  ? 0.3890 0.3907 0.3566 0.0025  -0.0015 -0.0024 61   GLU A OE1 
524  O OE2 . GLU A 61  ? 0.3750 0.3909 0.3881 -0.0049 -0.0191 -0.0190 61   GLU A OE2 
525  N N   . ASP A 62  ? 0.1832 0.2017 0.1837 -0.0054 0.0256  0.0013  62   ASP A N   
526  C CA  . ASP A 62  ? 0.2004 0.2088 0.1940 -0.0039 0.0169  -0.0023 62   ASP A CA  
527  C C   . ASP A 62  ? 0.1830 0.1946 0.1869 -0.0080 0.0149  0.0058  62   ASP A C   
528  O O   . ASP A 62  ? 0.1634 0.2009 0.1751 -0.0222 0.0251  0.0005  62   ASP A O   
529  C CB  . ASP A 62  ? 0.2288 0.2275 0.2259 -0.0170 0.0061  -0.0028 62   ASP A CB  
530  C CG  . ASP A 62  ? 0.2968 0.3110 0.2833 -0.0047 0.0199  -0.0001 62   ASP A CG  
531  O OD1 . ASP A 62  ? 0.3293 0.3557 0.3584 0.0096  0.0185  -0.0001 62   ASP A OD1 
532  O OD2 . ASP A 62  ? 0.3920 0.3517 0.3664 -0.0224 0.0200  0.0131  62   ASP A OD2 
533  N N   . VAL A 63  ? 0.1715 0.1613 0.1767 -0.0116 0.0235  0.0031  63   VAL A N   
534  C CA  . VAL A 63  ? 0.1650 0.1645 0.1811 -0.0013 0.0184  0.0034  63   VAL A CA  
535  C C   . VAL A 63  ? 0.1528 0.1727 0.1821 -0.0036 0.0121  -0.0001 63   VAL A C   
536  O O   . VAL A 63  ? 0.1496 0.1713 0.1976 -0.0006 0.0218  0.0107  63   VAL A O   
537  C CB  . VAL A 63  ? 0.1680 0.1544 0.1865 -0.0070 0.0305  0.0064  63   VAL A CB  
538  C CG1 . VAL A 63  ? 0.1861 0.1743 0.1532 -0.0043 0.0208  0.0046  63   VAL A CG1 
539  C CG2 . VAL A 63  ? 0.2094 0.1487 0.1969 0.0015  0.0270  0.0107  63   VAL A CG2 
540  N N   . MET A 64  ? 0.1494 0.1822 0.1956 0.0013  0.0183  0.0010  64   MET A N   
541  C CA  . MET A 64  ? 0.1668 0.1849 0.1892 -0.0006 0.0124  0.0016  64   MET A CA  
542  C C   . MET A 64  ? 0.1716 0.1967 0.1956 -0.0011 0.0127  0.0069  64   MET A C   
543  O O   . MET A 64  ? 0.1704 0.1744 0.1924 -0.0037 0.0211  0.0072  64   MET A O   
544  C CB  . MET A 64  ? 0.1659 0.1848 0.1908 -0.0003 0.0010  -0.0053 64   MET A CB  
545  C CG  . MET A 64  ? 0.1688 0.1998 0.1915 0.0122  0.0144  0.0043  64   MET A CG  
546  S SD  . MET A 64  ? 0.1700 0.1559 0.2009 0.0096  0.0216  0.0156  64   MET A SD  
547  C CE  . MET A 64  ? 0.1692 0.1508 0.1898 0.0061  0.0093  0.0166  64   MET A CE  
548  N N   . ARG A 65  ? 0.1695 0.2048 0.2022 -0.0058 0.0216  0.0022  65   ARG A N   
549  C CA  . ARG A 65  ? 0.1859 0.2162 0.2138 -0.0035 0.0123  0.0055  65   ARG A CA  
550  C C   . ARG A 65  ? 0.1693 0.1995 0.2102 -0.0038 0.0136  0.0076  65   ARG A C   
551  O O   . ARG A 65  ? 0.1604 0.1928 0.2186 0.0004  0.0193  0.0114  65   ARG A O   
552  C CB  . ARG A 65  ? 0.2170 0.2431 0.2452 -0.0146 0.0208  0.0027  65   ARG A CB  
553  C CG  . ARG A 65  ? 0.3345 0.3301 0.3012 -0.0066 0.0029  -0.0131 65   ARG A CG  
554  C CD  . ARG A 65  ? 0.3676 0.4189 0.4067 -0.0114 0.0272  -0.0031 65   ARG A CD  
555  N NE  . ARG A 65  ? 0.4325 0.4813 0.4480 -0.0112 -0.0030 -0.0052 65   ARG A NE  
556  C CZ  . ARG A 65  ? 0.4801 0.4897 0.4929 -0.0033 0.0059  -0.0004 65   ARG A CZ  
557  N NH1 . ARG A 65  ? 0.5003 0.5203 0.5120 -0.0107 -0.0054 0.0055  65   ARG A NH1 
558  N NH2 . ARG A 65  ? 0.4830 0.5159 0.5007 -0.0020 0.0032  0.0086  65   ARG A NH2 
559  N N   . MET A 66  ? 0.1574 0.1885 0.1970 -0.0099 0.0161  0.0112  66   MET A N   
560  C CA  . MET A 66  ? 0.1636 0.1779 0.1960 -0.0095 0.0187  0.0060  66   MET A CA  
561  C C   . MET A 66  ? 0.1555 0.1824 0.1848 -0.0050 0.0108  0.0028  66   MET A C   
562  O O   . MET A 66  ? 0.1427 0.1643 0.1793 -0.0157 0.0096  -0.0010 66   MET A O   
563  C CB  . MET A 66  ? 0.1725 0.1819 0.2025 -0.0107 0.0194  0.0035  66   MET A CB  
564  C CG  . MET A 66  ? 0.1972 0.2127 0.2264 -0.0099 0.0321  0.0048  66   MET A CG  
565  S SD  . MET A 66  ? 0.2448 0.2059 0.2868 -0.0431 0.0052  0.0180  66   MET A SD  
566  C CE  . MET A 66  ? 0.2618 0.2217 0.2518 0.0035  0.0050  0.0067  66   MET A CE  
567  N N   . LEU A 67  ? 0.1499 0.1677 0.1809 -0.0126 0.0162  -0.0070 67   LEU A N   
568  C CA  . LEU A 67  ? 0.1455 0.1633 0.1625 -0.0023 0.0095  -0.0014 67   LEU A CA  
569  C C   . LEU A 67  ? 0.1448 0.1631 0.1663 -0.0032 0.0103  -0.0026 67   LEU A C   
570  O O   . LEU A 67  ? 0.1457 0.1650 0.1687 0.0015  0.0161  -0.0108 67   LEU A O   
571  C CB  . LEU A 67  ? 0.1330 0.1554 0.1693 0.0023  0.0041  0.0000  67   LEU A CB  
572  C CG  . LEU A 67  ? 0.1639 0.1524 0.1546 0.0041  -0.0106 -0.0077 67   LEU A CG  
573  C CD1 . LEU A 67  ? 0.1323 0.1696 0.2035 -0.0013 0.0039  -0.0027 67   LEU A CD1 
574  C CD2 . LEU A 67  ? 0.1570 0.1599 0.1702 -0.0136 0.0080  -0.0153 67   LEU A CD2 
575  N N   . VAL A 68  ? 0.1488 0.1529 0.1598 0.0033  0.0173  -0.0043 68   VAL A N   
576  C CA  . VAL A 68  ? 0.1626 0.1749 0.1689 0.0015  0.0093  -0.0072 68   VAL A CA  
577  C C   . VAL A 68  ? 0.1572 0.1800 0.1741 0.0068  0.0093  -0.0040 68   VAL A C   
578  O O   . VAL A 68  ? 0.1512 0.1986 0.1646 0.0079  0.0196  -0.0074 68   VAL A O   
579  C CB  . VAL A 68  ? 0.1624 0.1693 0.1774 0.0063  -0.0007 -0.0092 68   VAL A CB  
580  C CG1 . VAL A 68  ? 0.1928 0.1645 0.1653 0.0131  0.0028  -0.0072 68   VAL A CG1 
581  C CG2 . VAL A 68  ? 0.1761 0.1917 0.1860 -0.0052 0.0036  -0.0151 68   VAL A CG2 
582  N N   . ASP A 69  ? 0.1751 0.1895 0.1840 0.0023  0.0097  -0.0055 69   ASP A N   
583  C CA  . ASP A 69  ? 0.1694 0.1917 0.1945 -0.0021 0.0066  -0.0020 69   ASP A CA  
584  C C   . ASP A 69  ? 0.1692 0.1964 0.1975 0.0027  0.0067  0.0026  69   ASP A C   
585  O O   . ASP A 69  ? 0.1672 0.1910 0.1972 -0.0027 0.0085  0.0014  69   ASP A O   
586  C CB  . ASP A 69  ? 0.1772 0.2069 0.2127 -0.0024 0.0095  0.0062  69   ASP A CB  
587  C CG  . ASP A 69  ? 0.2295 0.2467 0.2365 -0.0031 0.0076  -0.0012 69   ASP A CG  
588  O OD1 . ASP A 69  ? 0.2510 0.2852 0.2764 0.0012  0.0308  -0.0219 69   ASP A OD1 
589  O OD2 . ASP A 69  ? 0.2549 0.3274 0.2695 -0.0147 0.0291  0.0162  69   ASP A OD2 
590  N N   . LEU A 70  ? 0.1634 0.1828 0.1884 0.0045  0.0115  -0.0066 70   LEU A N   
591  C CA  . LEU A 70  ? 0.1580 0.1755 0.1829 0.0058  0.0047  -0.0001 70   LEU A CA  
592  C C   . LEU A 70  ? 0.1569 0.1770 0.1779 0.0015  -0.0008 -0.0020 70   LEU A C   
593  O O   . LEU A 70  ? 0.1545 0.1706 0.1745 0.0055  -0.0025 -0.0001 70   LEU A O   
594  C CB  . LEU A 70  ? 0.1583 0.1715 0.1767 0.0096  0.0085  0.0030  70   LEU A CB  
595  C CG  . LEU A 70  ? 0.1726 0.1897 0.1683 0.0128  -0.0087 -0.0067 70   LEU A CG  
596  C CD1 . LEU A 70  ? 0.1693 0.1619 0.1938 -0.0109 0.0104  -0.0120 70   LEU A CD1 
597  C CD2 . LEU A 70  ? 0.1721 0.1698 0.2009 0.0085  0.0040  0.0000  70   LEU A CD2 
598  N N   . ALA A 71  ? 0.1512 0.1661 0.1821 -0.0006 0.0018  -0.0058 71   ALA A N   
599  C CA  . ALA A 71  ? 0.1513 0.1632 0.1808 -0.0001 -0.0122 -0.0071 71   ALA A CA  
600  C C   . ALA A 71  ? 0.1643 0.1691 0.1871 0.0049  -0.0012 -0.0025 71   ALA A C   
601  O O   . ALA A 71  ? 0.1616 0.1664 0.1994 0.0164  -0.0060 -0.0082 71   ALA A O   
602  C CB  . ALA A 71  ? 0.1766 0.1610 0.1819 -0.0138 -0.0117 -0.0059 71   ALA A CB  
603  N N   . LYS A 72  ? 0.1527 0.1745 0.1987 0.0066  -0.0026 -0.0019 72   LYS A N   
604  C CA  . LYS A 72  ? 0.1542 0.1912 0.1927 0.0062  0.0031  -0.0014 72   LYS A CA  
605  C C   . LYS A 72  ? 0.1636 0.1893 0.1933 0.0068  0.0071  -0.0013 72   LYS A C   
606  O O   . LYS A 72  ? 0.1622 0.2035 0.1953 0.0098  0.0004  -0.0018 72   LYS A O   
607  C CB  . LYS A 72  ? 0.1671 0.2049 0.1935 0.0044  0.0051  -0.0048 72   LYS A CB  
608  C CG  . LYS A 72  ? 0.2243 0.2461 0.2395 -0.0097 -0.0082 -0.0166 72   LYS A CG  
609  C CD  . LYS A 72  ? 0.3023 0.3458 0.3071 0.0113  0.0177  -0.0097 72   LYS A CD  
610  C CE  . LYS A 72  ? 0.3696 0.3765 0.3581 0.0035  -0.0044 -0.0147 72   LYS A CE  
611  N NZ  . LYS A 72  ? 0.4152 0.4452 0.3928 0.0095  0.0161  -0.0126 72   LYS A NZ  
612  N N   . SER A 73  ? 0.1484 0.1816 0.1927 0.0009  0.0103  0.0062  73   SER A N   
613  C CA  . SER A 73  ? 0.1577 0.1790 0.1904 0.0039  0.0053  0.0033  73   SER A CA  
614  C C   . SER A 73  ? 0.1554 0.1758 0.1905 0.0032  0.0015  -0.0011 73   SER A C   
615  O O   . SER A 73  ? 0.1660 0.1877 0.1894 0.0088  0.0117  0.0050  73   SER A O   
616  C CB  . SER A 73  ? 0.1773 0.1857 0.2030 -0.0076 0.0037  -0.0042 73   SER A CB  
617  O OG  . SER A 73  ? 0.2044 0.2425 0.2497 -0.0074 -0.0100 -0.0018 73   SER A OG  
618  N N   . ARG A 74  ? 0.1360 0.1483 0.1825 0.0041  0.0052  -0.0025 74   ARG A N   
619  C CA  . ARG A 74  ? 0.1431 0.1562 0.1801 0.0046  -0.0001 -0.0013 74   ARG A CA  
620  C C   . ARG A 74  ? 0.1451 0.1660 0.1801 0.0048  -0.0033 0.0013  74   ARG A C   
621  O O   . ARG A 74  ? 0.1463 0.1639 0.2029 0.0008  -0.0003 0.0131  74   ARG A O   
622  C CB  . ARG A 74  ? 0.1387 0.1543 0.1772 0.0041  -0.0037 0.0030  74   ARG A CB  
623  C CG  . ARG A 74  ? 0.1680 0.1490 0.1583 -0.0040 0.0033  -0.0099 74   ARG A CG  
624  C CD  . ARG A 74  ? 0.1619 0.1863 0.1288 -0.0224 -0.0154 0.0003  74   ARG A CD  
625  N NE  . ARG A 74  ? 0.1245 0.1848 0.1551 -0.0043 -0.0027 -0.0073 74   ARG A NE  
626  C CZ  . ARG A 74  ? 0.1659 0.2132 0.1644 0.0015  -0.0029 -0.0062 74   ARG A CZ  
627  N NH1 . ARG A 74  ? 0.1633 0.2193 0.1726 -0.0163 0.0015  -0.0013 74   ARG A NH1 
628  N NH2 . ARG A 74  ? 0.1427 0.2037 0.2047 0.0015  0.0098  -0.0167 74   ARG A NH2 
629  N N   . GLY A 75  ? 0.1441 0.1560 0.1845 -0.0017 -0.0109 -0.0089 75   GLY A N   
630  C CA  . GLY A 75  ? 0.1589 0.1681 0.1934 -0.0034 -0.0055 0.0007  75   GLY A CA  
631  C C   . GLY A 75  ? 0.1726 0.1714 0.1939 -0.0071 -0.0123 -0.0010 75   GLY A C   
632  O O   . GLY A 75  ? 0.1699 0.1729 0.1855 -0.0107 -0.0261 -0.0035 75   GLY A O   
633  N N   . VAL A 76  ? 0.1522 0.1626 0.1860 -0.0030 -0.0102 -0.0037 76   VAL A N   
634  C CA  . VAL A 76  ? 0.1567 0.1563 0.1955 0.0004  -0.0028 -0.0026 76   VAL A CA  
635  C C   . VAL A 76  ? 0.1578 0.1584 0.1799 -0.0052 0.0000  -0.0055 76   VAL A C   
636  O O   . VAL A 76  ? 0.1433 0.1467 0.1833 0.0002  -0.0081 -0.0018 76   VAL A O   
637  C CB  . VAL A 76  ? 0.1516 0.1485 0.1870 -0.0030 -0.0074 -0.0067 76   VAL A CB  
638  C CG1 . VAL A 76  ? 0.1309 0.1622 0.1906 -0.0098 -0.0051 -0.0075 76   VAL A CG1 
639  C CG2 . VAL A 76  ? 0.1721 0.1351 0.1853 -0.0033 0.0079  -0.0129 76   VAL A CG2 
640  N N   . GLU A 77  ? 0.1561 0.1534 0.1905 0.0073  0.0038  -0.0065 77   GLU A N   
641  C CA  . GLU A 77  ? 0.1627 0.1680 0.1842 0.0089  0.0041  0.0022  77   GLU A CA  
642  C C   . GLU A 77  ? 0.1617 0.1671 0.1788 0.0038  -0.0012 0.0003  77   GLU A C   
643  O O   . GLU A 77  ? 0.1444 0.1540 0.1736 0.0228  0.0046  0.0086  77   GLU A O   
644  C CB  . GLU A 77  ? 0.1910 0.1909 0.1800 0.0171  0.0106  0.0015  77   GLU A CB  
645  C CG  . GLU A 77  ? 0.2252 0.2326 0.2059 0.0152  -0.0121 0.0041  77   GLU A CG  
646  C CD  . GLU A 77  ? 0.2812 0.2976 0.2773 0.0022  0.0065  0.0075  77   GLU A CD  
647  O OE1 . GLU A 77  ? 0.3193 0.3244 0.2852 0.0094  0.0022  -0.0056 77   GLU A OE1 
648  O OE2 . GLU A 77  ? 0.2742 0.3170 0.3038 -0.0121 0.0041  0.0096  77   GLU A OE2 
649  N N   . ALA A 78  ? 0.1474 0.1706 0.1776 0.0101  -0.0066 0.0056  78   ALA A N   
650  C CA  . ALA A 78  ? 0.1614 0.1775 0.1813 0.0034  -0.0004 -0.0012 78   ALA A CA  
651  C C   . ALA A 78  ? 0.1508 0.1712 0.1774 0.0014  -0.0056 -0.0007 78   ALA A C   
652  O O   . ALA A 78  ? 0.1475 0.1647 0.1904 0.0000  -0.0032 -0.0026 78   ALA A O   
653  C CB  . ALA A 78  ? 0.1593 0.2030 0.1961 0.0016  -0.0145 0.0013  78   ALA A CB  
654  N N   . ALA A 79  ? 0.1522 0.1538 0.1839 0.0003  0.0007  -0.0016 79   ALA A N   
655  C CA  . ALA A 79  ? 0.1490 0.1490 0.1973 0.0008  -0.0015 -0.0074 79   ALA A CA  
656  C C   . ALA A 79  ? 0.1577 0.1627 0.1877 0.0026  -0.0023 -0.0040 79   ALA A C   
657  O O   . ALA A 79  ? 0.1088 0.1524 0.1932 0.0045  -0.0083 -0.0005 79   ALA A O   
658  C CB  . ALA A 79  ? 0.1546 0.1434 0.2057 0.0092  -0.0042 -0.0023 79   ALA A CB  
659  N N   . ARG A 80  ? 0.1387 0.1603 0.1728 0.0052  -0.0067 -0.0068 80   ARG A N   
660  C CA  . ARG A 80  ? 0.1371 0.1467 0.1655 0.0027  -0.0015 0.0002  80   ARG A CA  
661  C C   . ARG A 80  ? 0.1320 0.1450 0.1799 0.0078  0.0033  -0.0020 80   ARG A C   
662  O O   . ARG A 80  ? 0.1434 0.1321 0.1686 0.0185  -0.0042 0.0001  80   ARG A O   
663  C CB  . ARG A 80  ? 0.1256 0.1539 0.1573 -0.0035 0.0058  -0.0028 80   ARG A CB  
664  C CG  . ARG A 80  ? 0.1528 0.1654 0.1723 0.0027  -0.0033 -0.0160 80   ARG A CG  
665  C CD  . ARG A 80  ? 0.1670 0.2141 0.1861 0.0000  0.0038  0.0010  80   ARG A CD  
666  N NE  . ARG A 80  ? 0.1681 0.2241 0.2182 -0.0048 0.0033  -0.0245 80   ARG A NE  
667  C CZ  . ARG A 80  ? 0.2028 0.2141 0.1998 -0.0010 -0.0002 -0.0179 80   ARG A CZ  
668  N NH1 . ARG A 80  ? 0.2125 0.2221 0.2322 0.0077  0.0009  0.0016  80   ARG A NH1 
669  N NH2 . ARG A 80  ? 0.1822 0.2416 0.2255 -0.0089 -0.0078 -0.0159 80   ARG A NH2 
670  N N   . GLU A 81  ? 0.1222 0.1334 0.1650 0.0166  -0.0122 -0.0019 81   GLU A N   
671  C CA  . GLU A 81  ? 0.1362 0.1396 0.1887 0.0107  -0.0014 0.0001  81   GLU A CA  
672  C C   . GLU A 81  ? 0.1308 0.1424 0.1778 0.0136  -0.0102 -0.0065 81   GLU A C   
673  O O   . GLU A 81  ? 0.1511 0.1458 0.1733 0.0124  -0.0072 0.0048  81   GLU A O   
674  C CB  . GLU A 81  ? 0.1322 0.1638 0.1856 0.0075  0.0116  -0.0059 81   GLU A CB  
675  C CG  . GLU A 81  ? 0.1912 0.1757 0.1906 0.0005  -0.0014 -0.0013 81   GLU A CG  
676  C CD  . GLU A 81  ? 0.2105 0.1879 0.2101 0.0028  -0.0042 -0.0009 81   GLU A CD  
677  O OE1 . GLU A 81  ? 0.2135 0.1457 0.2371 -0.0049 0.0160  -0.0273 81   GLU A OE1 
678  O OE2 . GLU A 81  ? 0.2154 0.2159 0.2501 0.0135  -0.0161 -0.0161 81   GLU A OE2 
679  N N   . ARG A 82  ? 0.1293 0.1406 0.1668 0.0169  -0.0124 -0.0075 82   ARG A N   
680  C CA  . ARG A 82  ? 0.1286 0.1602 0.1722 0.0101  -0.0090 -0.0066 82   ARG A CA  
681  C C   . ARG A 82  ? 0.1436 0.1522 0.1575 0.0007  -0.0055 -0.0043 82   ARG A C   
682  O O   . ARG A 82  ? 0.1573 0.1463 0.1668 -0.0039 -0.0097 -0.0159 82   ARG A O   
683  C CB  . ARG A 82  ? 0.1400 0.1584 0.1619 0.0133  -0.0053 -0.0101 82   ARG A CB  
684  C CG  . ARG A 82  ? 0.1648 0.2146 0.2226 0.0027  -0.0048 -0.0031 82   ARG A CG  
685  C CD  . ARG A 82  ? 0.2566 0.2880 0.2657 -0.0115 -0.0319 -0.0277 82   ARG A CD  
686  N NE  . ARG A 82  ? 0.3427 0.3538 0.3427 -0.0091 0.0053  0.0044  82   ARG A NE  
687  C CZ  . ARG A 82  ? 0.3707 0.3705 0.3642 -0.0022 0.0010  -0.0079 82   ARG A CZ  
688  N NH1 . ARG A 82  ? 0.4061 0.3875 0.4071 0.0003  -0.0003 -0.0056 82   ARG A NH1 
689  N NH2 . ARG A 82  ? 0.3816 0.3742 0.3757 -0.0152 0.0013  -0.0043 82   ARG A NH2 
690  N N   . MET A 83  ? 0.1313 0.1451 0.1519 0.0001  -0.0008 -0.0077 83   MET A N   
691  C CA  . MET A 83  ? 0.1279 0.1322 0.1509 0.0054  -0.0072 -0.0001 83   MET A CA  
692  C C   . MET A 83  ? 0.1325 0.1349 0.1416 -0.0021 -0.0014 -0.0013 83   MET A C   
693  O O   . MET A 83  ? 0.1371 0.1170 0.1514 -0.0033 0.0026  -0.0096 83   MET A O   
694  C CB  . MET A 83  ? 0.1308 0.1440 0.1499 -0.0043 -0.0059 0.0094  83   MET A CB  
695  C CG  . MET A 83  ? 0.1224 0.1425 0.1651 0.0066  -0.0031 0.0121  83   MET A CG  
696  S SD  . MET A 83  ? 0.1308 0.1484 0.1773 0.0035  -0.0096 0.0066  83   MET A SD  
697  C CE  . MET A 83  ? 0.1655 0.1933 0.1832 0.0016  -0.0029 -0.0032 83   MET A CE  
698  N N   . PHE A 84  ? 0.1310 0.1277 0.1474 0.0001  0.0091  -0.0014 84   PHE A N   
699  C CA  . PHE A 84  ? 0.1372 0.1331 0.1360 0.0011  0.0041  0.0008  84   PHE A CA  
700  C C   . PHE A 84  ? 0.1500 0.1457 0.1564 0.0054  0.0038  0.0024  84   PHE A C   
701  O O   . PHE A 84  ? 0.1449 0.1473 0.1715 0.0086  -0.0104 0.0120  84   PHE A O   
702  C CB  . PHE A 84  ? 0.1382 0.1479 0.1281 0.0026  0.0026  0.0004  84   PHE A CB  
703  C CG  . PHE A 84  ? 0.1541 0.1329 0.1394 0.0039  -0.0034 0.0011  84   PHE A CG  
704  C CD1 . PHE A 84  ? 0.1459 0.1682 0.1373 0.0034  -0.0048 0.0023  84   PHE A CD1 
705  C CD2 . PHE A 84  ? 0.1767 0.1499 0.1579 0.0078  -0.0081 0.0077  84   PHE A CD2 
706  C CE1 . PHE A 84  ? 0.1300 0.1337 0.1592 0.0017  -0.0081 0.0019  84   PHE A CE1 
707  C CE2 . PHE A 84  ? 0.1491 0.1541 0.1562 -0.0003 -0.0052 0.0042  84   PHE A CE2 
708  C CZ  . PHE A 84  ? 0.1545 0.1421 0.1643 0.0051  -0.0002 0.0043  84   PHE A CZ  
709  N N   . ASN A 85  ? 0.1590 0.1481 0.1560 0.0143  -0.0072 0.0055  85   ASN A N   
710  C CA  . ASN A 85  ? 0.1735 0.1563 0.1760 0.0147  0.0005  0.0111  85   ASN A CA  
711  C C   . ASN A 85  ? 0.1831 0.1690 0.1630 0.0217  -0.0114 0.0028  85   ASN A C   
712  O O   . ASN A 85  ? 0.2008 0.1655 0.1891 0.0387  -0.0120 0.0191  85   ASN A O   
713  C CB  . ASN A 85  ? 0.1747 0.1709 0.1853 0.0105  0.0018  0.0096  85   ASN A CB  
714  C CG  . ASN A 85  ? 0.2074 0.1962 0.1952 0.0061  0.0023  -0.0039 85   ASN A CG  
715  O OD1 . ASN A 85  ? 0.2277 0.2212 0.2453 0.0037  0.0053  -0.0109 85   ASN A OD1 
716  N ND2 . ASN A 85  ? 0.2168 0.1994 0.2323 0.0064  -0.0013 0.0039  85   ASN A ND2 
717  N N   . GLY A 86  ? 0.1552 0.1545 0.1480 0.0124  -0.0045 0.0043  86   GLY A N   
718  C CA  . GLY A 86  ? 0.1553 0.1525 0.1463 0.0140  -0.0029 -0.0010 86   GLY A CA  
719  C C   . GLY A 86  ? 0.1531 0.1521 0.1510 0.0071  -0.0036 -0.0031 86   GLY A C   
720  O O   . GLY A 86  ? 0.1649 0.1541 0.1621 0.0034  -0.0102 -0.0132 86   GLY A O   
721  N N   . GLU A 87  ? 0.1608 0.1575 0.1466 0.0011  -0.0069 -0.0084 87   GLU A N   
722  C CA  . GLU A 87  ? 0.1685 0.1681 0.1561 0.0042  -0.0041 -0.0118 87   GLU A CA  
723  C C   . GLU A 87  ? 0.1617 0.1855 0.1641 0.0072  -0.0086 -0.0090 87   GLU A C   
724  O O   . GLU A 87  ? 0.1531 0.1731 0.1657 -0.0010 -0.0138 -0.0074 87   GLU A O   
725  C CB  . GLU A 87  ? 0.1672 0.1674 0.1711 0.0067  -0.0053 -0.0100 87   GLU A CB  
726  C CG  . GLU A 87  ? 0.1926 0.2035 0.1927 0.0130  0.0142  -0.0109 87   GLU A CG  
727  C CD  . GLU A 87  ? 0.2401 0.2512 0.2455 -0.0024 0.0034  0.0138  87   GLU A CD  
728  O OE1 . GLU A 87  ? 0.2809 0.3122 0.2809 0.0198  0.0155  0.0079  87   GLU A OE1 
729  O OE2 . GLU A 87  ? 0.2623 0.2829 0.2626 -0.0114 0.0014  0.0100  87   GLU A OE2 
730  N N   . LYS A 88  ? 0.1706 0.1802 0.1579 0.0064  -0.0074 -0.0152 88   LYS A N   
731  C CA  . LYS A 88  ? 0.1807 0.1889 0.1688 0.0084  -0.0096 -0.0086 88   LYS A CA  
732  C C   . LYS A 88  ? 0.1872 0.1890 0.1802 0.0108  -0.0076 -0.0056 88   LYS A C   
733  O O   . LYS A 88  ? 0.2032 0.1982 0.1986 0.0085  -0.0161 -0.0047 88   LYS A O   
734  C CB  . LYS A 88  ? 0.2045 0.1949 0.1732 0.0061  -0.0089 -0.0026 88   LYS A CB  
735  C CG  . LYS A 88  ? 0.2202 0.2075 0.1962 0.0077  -0.0075 0.0148  88   LYS A CG  
736  C CD  . LYS A 88  ? 0.2995 0.2728 0.2264 -0.0002 -0.0088 0.0028  88   LYS A CD  
737  C CE  . LYS A 88  ? 0.3264 0.2777 0.2769 0.0101  0.0035  0.0015  88   LYS A CE  
738  N NZ  . LYS A 88  ? 0.3806 0.3455 0.3207 0.0116  -0.0176 0.0047  88   LYS A NZ  
739  N N   . ILE A 89  ? 0.1732 0.1689 0.1779 0.0150  -0.0067 -0.0020 89   ILE A N   
740  C CA  . ILE A 89  ? 0.1643 0.1659 0.1801 0.0061  0.0053  -0.0058 89   ILE A CA  
741  C C   . ILE A 89  ? 0.1639 0.1579 0.1799 0.0066  -0.0021 -0.0034 89   ILE A C   
742  O O   . ILE A 89  ? 0.1850 0.1541 0.1968 -0.0016 0.0013  -0.0033 89   ILE A O   
743  C CB  . ILE A 89  ? 0.1477 0.1661 0.1785 0.0098  -0.0042 -0.0049 89   ILE A CB  
744  C CG1 . ILE A 89  ? 0.1751 0.1899 0.1731 0.0001  -0.0048 0.0005  89   ILE A CG1 
745  C CG2 . ILE A 89  ? 0.1772 0.1907 0.2030 0.0208  0.0116  -0.0125 89   ILE A CG2 
746  C CD1 . ILE A 89  ? 0.1917 0.1943 0.1689 0.0082  -0.0061 -0.0005 89   ILE A CD1 
747  N N   . ASN A 90  ? 0.1596 0.1533 0.1456 0.0167  0.0048  -0.0116 90   ASN A N   
748  C CA  . ASN A 90  ? 0.1500 0.1512 0.1568 0.0114  -0.0038 -0.0077 90   ASN A CA  
749  C C   . ASN A 90  ? 0.1593 0.1707 0.1629 0.0087  -0.0026 -0.0046 90   ASN A C   
750  O O   . ASN A 90  ? 0.1721 0.1584 0.1368 0.0111  -0.0231 -0.0076 90   ASN A O   
751  C CB  . ASN A 90  ? 0.1364 0.1444 0.1353 0.0130  0.0040  -0.0014 90   ASN A CB  
752  C CG  . ASN A 90  ? 0.1444 0.1461 0.1302 0.0076  -0.0066 -0.0010 90   ASN A CG  
753  O OD1 . ASN A 90  ? 0.1463 0.1486 0.1502 0.0063  0.0081  0.0060  90   ASN A OD1 
754  N ND2 . ASN A 90  ? 0.1612 0.1489 0.1315 0.0066  -0.0087 0.0081  90   ASN A ND2 
755  N N   . TYR A 91  ? 0.1690 0.1745 0.1831 0.0113  -0.0007 -0.0109 91   TYR A N   
756  C CA  . TYR A 91  ? 0.1846 0.1912 0.1933 0.0091  -0.0070 -0.0080 91   TYR A CA  
757  C C   . TYR A 91  ? 0.1988 0.1982 0.2024 0.0174  -0.0108 -0.0128 91   TYR A C   
758  O O   . TYR A 91  ? 0.2149 0.2081 0.2125 0.0334  -0.0183 -0.0151 91   TYR A O   
759  C CB  . TYR A 91  ? 0.1895 0.2128 0.2200 0.0021  -0.0027 -0.0087 91   TYR A CB  
760  C CG  . TYR A 91  ? 0.1878 0.2203 0.2403 -0.0083 -0.0071 -0.0023 91   TYR A CG  
761  C CD1 . TYR A 91  ? 0.2097 0.2512 0.2734 -0.0046 0.0142  -0.0066 91   TYR A CD1 
762  C CD2 . TYR A 91  ? 0.2394 0.2569 0.2526 -0.0068 -0.0012 0.0017  91   TYR A CD2 
763  C CE1 . TYR A 91  ? 0.2309 0.2788 0.2540 -0.0043 -0.0046 0.0005  91   TYR A CE1 
764  C CE2 . TYR A 91  ? 0.2420 0.2539 0.2707 -0.0096 0.0013  0.0001  91   TYR A CE2 
765  C CZ  . TYR A 91  ? 0.2438 0.2608 0.2579 -0.0016 0.0001  -0.0023 91   TYR A CZ  
766  O OH  . TYR A 91  ? 0.2274 0.2398 0.2636 -0.0009 -0.0287 -0.0122 91   TYR A OH  
767  N N   . THR A 92  ? 0.1832 0.1826 0.1984 0.0153  -0.0140 -0.0135 92   THR A N   
768  C CA  . THR A 92  ? 0.1769 0.1815 0.1797 0.0146  -0.0130 -0.0072 92   THR A CA  
769  C C   . THR A 92  ? 0.1854 0.1860 0.1929 0.0113  -0.0092 -0.0116 92   THR A C   
770  O O   . THR A 92  ? 0.2322 0.2050 0.1919 0.0058  -0.0058 -0.0117 92   THR A O   
771  C CB  . THR A 92  ? 0.1659 0.1793 0.1802 0.0042  -0.0175 -0.0024 92   THR A CB  
772  O OG1 . THR A 92  ? 0.1671 0.1686 0.1705 0.0092  -0.0230 -0.0103 92   THR A OG1 
773  C CG2 . THR A 92  ? 0.1630 0.1795 0.1792 0.0044  -0.0114 -0.0055 92   THR A CG2 
774  N N   . GLU A 93  ? 0.1688 0.1812 0.1848 0.0030  -0.0103 -0.0123 93   GLU A N   
775  C CA  . GLU A 93  ? 0.1813 0.1825 0.1847 0.0048  -0.0099 -0.0093 93   GLU A CA  
776  C C   . GLU A 93  ? 0.1929 0.1805 0.1859 -0.0008 -0.0112 -0.0098 93   GLU A C   
777  O O   . GLU A 93  ? 0.2210 0.1968 0.1765 0.0079  -0.0035 -0.0128 93   GLU A O   
778  C CB  . GLU A 93  ? 0.1676 0.1887 0.1861 0.0078  -0.0054 -0.0051 93   GLU A CB  
779  C CG  . GLU A 93  ? 0.2087 0.1737 0.1941 0.0088  -0.0091 -0.0048 93   GLU A CG  
780  C CD  . GLU A 93  ? 0.2332 0.2644 0.2317 -0.0051 -0.0093 -0.0161 93   GLU A CD  
781  O OE1 . GLU A 93  ? 0.2305 0.2498 0.2110 -0.0002 0.0200  -0.0160 93   GLU A OE1 
782  O OE2 . GLU A 93  ? 0.2812 0.3371 0.2798 -0.0040 0.0040  -0.0106 93   GLU A OE2 
783  N N   . GLY A 94  ? 0.1971 0.1861 0.1903 0.0089  -0.0185 -0.0147 94   GLY A N   
784  C CA  . GLY A 94  ? 0.2130 0.1895 0.1988 0.0074  -0.0180 -0.0109 94   GLY A CA  
785  C C   . GLY A 94  ? 0.1994 0.1847 0.1962 -0.0023 -0.0137 0.0025  94   GLY A C   
786  O O   . GLY A 94  ? 0.2312 0.1858 0.1854 0.0113  -0.0244 0.0044  94   GLY A O   
787  N N   . ARG A 95  ? 0.1793 0.1652 0.1685 -0.0014 -0.0158 -0.0047 95   ARG A N   
788  C CA  . ARG A 95  ? 0.1573 0.1606 0.1750 0.0016  -0.0128 -0.0027 95   ARG A CA  
789  C C   . ARG A 95  ? 0.1518 0.1443 0.1576 0.0005  -0.0145 -0.0044 95   ARG A C   
790  O O   . ARG A 95  ? 0.1625 0.1442 0.1672 0.0032  -0.0073 -0.0065 95   ARG A O   
791  C CB  . ARG A 95  ? 0.1557 0.1567 0.1589 0.0061  -0.0068 -0.0002 95   ARG A CB  
792  C CG  . ARG A 95  ? 0.1502 0.1461 0.1787 0.0104  -0.0030 0.0029  95   ARG A CG  
793  C CD  . ARG A 95  ? 0.1514 0.1755 0.1908 0.0053  -0.0026 -0.0059 95   ARG A CD  
794  N NE  . ARG A 95  ? 0.1969 0.1902 0.1925 -0.0018 0.0110  -0.0191 95   ARG A NE  
795  C CZ  . ARG A 95  ? 0.2243 0.2533 0.2383 0.0077  0.0072  -0.0038 95   ARG A CZ  
796  N NH1 . ARG A 95  ? 0.2735 0.2703 0.2428 0.0145  0.0132  0.0033  95   ARG A NH1 
797  N NH2 . ARG A 95  ? 0.2486 0.2457 0.2366 0.0074  0.0096  -0.0012 95   ARG A NH2 
798  N N   . ALA A 96  ? 0.1425 0.1358 0.1532 0.0121  -0.0108 -0.0004 96   ALA A N   
799  C CA  . ALA A 96  ? 0.1363 0.1346 0.1525 0.0071  -0.0107 -0.0039 96   ALA A CA  
800  C C   . ALA A 96  ? 0.1351 0.1399 0.1404 0.0083  -0.0065 -0.0002 96   ALA A C   
801  O O   . ALA A 96  ? 0.1285 0.1486 0.1456 -0.0023 -0.0128 -0.0056 96   ALA A O   
802  C CB  . ALA A 96  ? 0.1318 0.1257 0.1569 0.0057  -0.0073 -0.0032 96   ALA A CB  
803  N N   . VAL A 97  ? 0.1234 0.1193 0.1302 0.0014  -0.0123 0.0058  97   VAL A N   
804  C CA  . VAL A 97  ? 0.1180 0.1104 0.1266 0.0091  -0.0103 -0.0004 97   VAL A CA  
805  C C   . VAL A 97  ? 0.1239 0.1228 0.1343 0.0030  -0.0091 -0.0019 97   VAL A C   
806  O O   . VAL A 97  ? 0.1423 0.1238 0.1344 0.0070  -0.0111 0.0046  97   VAL A O   
807  C CB  . VAL A 97  ? 0.1228 0.1111 0.1169 -0.0036 -0.0219 -0.0017 97   VAL A CB  
808  C CG1 . VAL A 97  ? 0.1268 0.1316 0.1397 0.0205  -0.0264 0.0115  97   VAL A CG1 
809  C CG2 . VAL A 97  ? 0.1321 0.1218 0.1276 0.0071  -0.0045 -0.0120 97   VAL A CG2 
810  N N   . LEU A 98  ? 0.1447 0.1118 0.1526 0.0040  -0.0089 -0.0112 98   LEU A N   
811  C CA  . LEU A 98  ? 0.1286 0.1014 0.1467 0.0102  -0.0116 0.0018  98   LEU A CA  
812  C C   . LEU A 98  ? 0.1314 0.1090 0.1537 0.0064  -0.0070 0.0025  98   LEU A C   
813  O O   . LEU A 98  ? 0.1215 0.1165 0.1391 0.0075  -0.0095 -0.0038 98   LEU A O   
814  C CB  . LEU A 98  ? 0.1358 0.1195 0.1715 0.0036  -0.0070 0.0213  98   LEU A CB  
815  C CG  . LEU A 98  ? 0.1429 0.1290 0.1617 0.0154  -0.0065 0.0156  98   LEU A CG  
816  C CD1 . LEU A 98  ? 0.1548 0.1289 0.1876 0.0055  -0.0225 0.0230  98   LEU A CD1 
817  C CD2 . LEU A 98  ? 0.1502 0.1185 0.1428 0.0065  -0.0130 0.0041  98   LEU A CD2 
818  N N   . HIS A 99  ? 0.1203 0.1265 0.1341 0.0043  -0.0159 0.0060  99   HIS A N   
819  C CA  . HIS A 99  ? 0.1268 0.1158 0.1325 -0.0001 -0.0099 0.0049  99   HIS A CA  
820  C C   . HIS A 99  ? 0.1260 0.1177 0.1441 0.0074  -0.0045 0.0055  99   HIS A C   
821  O O   . HIS A 99  ? 0.1371 0.1118 0.1289 0.0038  -0.0051 0.0044  99   HIS A O   
822  C CB  . HIS A 99  ? 0.1180 0.1097 0.1390 -0.0012 -0.0037 0.0059  99   HIS A CB  
823  C CG  . HIS A 99  ? 0.1082 0.1140 0.1269 -0.0028 -0.0005 -0.0044 99   HIS A CG  
824  N ND1 . HIS A 99  ? 0.0961 0.1190 0.1203 -0.0073 0.0001  -0.0082 99   HIS A ND1 
825  C CD2 . HIS A 99  ? 0.1465 0.1378 0.1422 0.0031  -0.0001 0.0042  99   HIS A CD2 
826  C CE1 . HIS A 99  ? 0.1306 0.1308 0.1270 0.0040  0.0040  0.0108  99   HIS A CE1 
827  N NE2 . HIS A 99  ? 0.1301 0.1417 0.1353 0.0103  -0.0035 -0.0002 99   HIS A NE2 
828  N N   . VAL A 100 ? 0.1274 0.1260 0.1306 0.0069  0.0012  0.0063  100  VAL A N   
829  C CA  . VAL A 100 ? 0.1195 0.1103 0.1342 0.0036  -0.0009 0.0021  100  VAL A CA  
830  C C   . VAL A 100 ? 0.1346 0.1164 0.1303 0.0054  -0.0061 0.0023  100  VAL A C   
831  O O   . VAL A 100 ? 0.1337 0.1247 0.1296 0.0057  -0.0172 0.0013  100  VAL A O   
832  C CB  . VAL A 100 ? 0.1177 0.1098 0.1304 -0.0014 -0.0108 -0.0008 100  VAL A CB  
833  C CG1 . VAL A 100 ? 0.1380 0.1099 0.1534 0.0111  -0.0070 0.0123  100  VAL A CG1 
834  C CG2 . VAL A 100 ? 0.1201 0.1528 0.1350 0.0087  -0.0207 0.0014  100  VAL A CG2 
835  N N   . ALA A 101 ? 0.1221 0.1066 0.1340 0.0055  -0.0046 0.0059  101  ALA A N   
836  C CA  . ALA A 101 ? 0.1411 0.1216 0.1346 0.0085  -0.0061 0.0085  101  ALA A CA  
837  C C   . ALA A 101 ? 0.1375 0.1133 0.1397 0.0076  -0.0050 0.0025  101  ALA A C   
838  O O   . ALA A 101 ? 0.1457 0.1181 0.1536 0.0150  -0.0089 0.0035  101  ALA A O   
839  C CB  . ALA A 101 ? 0.1459 0.1387 0.1166 0.0143  -0.0009 0.0017  101  ALA A CB  
840  N N   . LEU A 102 ? 0.1265 0.1212 0.1403 0.0045  0.0003  0.0061  102  LEU A N   
841  C CA  . LEU A 102 ? 0.1364 0.1258 0.1399 0.0099  -0.0028 -0.0045 102  LEU A CA  
842  C C   . LEU A 102 ? 0.1424 0.1330 0.1370 0.0019  0.0043  -0.0016 102  LEU A C   
843  O O   . LEU A 102 ? 0.1408 0.1369 0.1473 0.0143  -0.0023 0.0049  102  LEU A O   
844  C CB  . LEU A 102 ? 0.1352 0.1265 0.1363 0.0170  -0.0070 -0.0088 102  LEU A CB  
845  C CG  . LEU A 102 ? 0.1684 0.1209 0.1394 0.0106  0.0001  0.0032  102  LEU A CG  
846  C CD1 . LEU A 102 ? 0.1183 0.1116 0.1504 0.0191  0.0001  -0.0013 102  LEU A CD1 
847  C CD2 . LEU A 102 ? 0.1870 0.1442 0.1406 -0.0030 0.0149  0.0045  102  LEU A CD2 
848  N N   . ARG A 103 ? 0.1425 0.1314 0.1270 0.0065  0.0026  0.0017  103  ARG A N   
849  C CA  . ARG A 103 ? 0.1411 0.1308 0.1373 0.0149  0.0041  0.0024  103  ARG A CA  
850  C C   . ARG A 103 ? 0.1302 0.1499 0.1416 0.0100  -0.0004 -0.0009 103  ARG A C   
851  O O   . ARG A 103 ? 0.1239 0.1321 0.1348 0.0069  0.0047  -0.0015 103  ARG A O   
852  C CB  . ARG A 103 ? 0.1350 0.1294 0.1311 0.0039  -0.0073 0.0144  103  ARG A CB  
853  C CG  . ARG A 103 ? 0.1532 0.1137 0.1765 0.0078  -0.0034 -0.0140 103  ARG A CG  
854  C CD  . ARG A 103 ? 0.1513 0.0957 0.1730 0.0043  0.0095  0.0020  103  ARG A CD  
855  N NE  . ARG A 103 ? 0.1344 0.0915 0.1428 -0.0120 -0.0103 -0.0007 103  ARG A NE  
856  C CZ  . ARG A 103 ? 0.1336 0.1051 0.1227 0.0024  0.0041  -0.0026 103  ARG A CZ  
857  N NH1 . ARG A 103 ? 0.0894 0.1235 0.1306 0.0021  0.0002  -0.0028 103  ARG A NH1 
858  N NH2 . ARG A 103 ? 0.1273 0.1049 0.1496 -0.0044 0.0130  -0.0093 103  ARG A NH2 
859  N N   . ASN A 104 ? 0.1269 0.1275 0.1420 0.0167  0.0034  0.0016  104  ASN A N   
860  C CA  . ASN A 104 ? 0.1302 0.1274 0.1546 0.0110  -0.0020 -0.0094 104  ASN A CA  
861  C C   . ASN A 104 ? 0.1438 0.1415 0.1737 0.0012  -0.0073 -0.0046 104  ASN A C   
862  O O   . ASN A 104 ? 0.1643 0.1257 0.1859 0.0009  -0.0134 -0.0077 104  ASN A O   
863  C CB  . ASN A 104 ? 0.1317 0.1408 0.1714 0.0083  -0.0076 -0.0054 104  ASN A CB  
864  C CG  . ASN A 104 ? 0.1706 0.1563 0.1931 0.0145  -0.0006 -0.0121 104  ASN A CG  
865  O OD1 . ASN A 104 ? 0.1756 0.1765 0.2185 0.0223  0.0129  -0.0114 104  ASN A OD1 
866  N ND2 . ASN A 104 ? 0.1942 0.1252 0.2241 0.0241  -0.0239 -0.0136 104  ASN A ND2 
867  N N   . ARG A 105 ? 0.1422 0.1254 0.1574 0.0019  -0.0014 -0.0107 105  ARG A N   
868  C CA  . ARG A 105 ? 0.1421 0.1315 0.1746 0.0057  -0.0046 -0.0133 105  ARG A CA  
869  C C   . ARG A 105 ? 0.1555 0.1400 0.2030 0.0104  -0.0058 -0.0166 105  ARG A C   
870  O O   . ARG A 105 ? 0.1754 0.1469 0.2366 0.0074  -0.0157 -0.0020 105  ARG A O   
871  C CB  . ARG A 105 ? 0.1453 0.1373 0.1791 0.0104  -0.0056 -0.0139 105  ARG A CB  
872  C CG  . ARG A 105 ? 0.1387 0.1603 0.1657 0.0091  0.0026  -0.0011 105  ARG A CG  
873  C CD  . ARG A 105 ? 0.1682 0.1410 0.1709 -0.0140 0.0121  -0.0037 105  ARG A CD  
874  N NE  . ARG A 105 ? 0.1653 0.1591 0.2053 -0.0097 -0.0025 -0.0213 105  ARG A NE  
875  C CZ  . ARG A 105 ? 0.2220 0.1804 0.2147 -0.0024 0.0100  -0.0092 105  ARG A CZ  
876  N NH1 . ARG A 105 ? 0.2008 0.2063 0.2011 0.0013  -0.0013 0.0077  105  ARG A NH1 
877  N NH2 . ARG A 105 ? 0.2113 0.1965 0.2588 -0.0111 0.0007  -0.0074 105  ARG A NH2 
878  N N   . SER A 106 ? 0.1588 0.1468 0.1968 0.0126  0.0050  -0.0111 106  SER A N   
879  C CA  . SER A 106 ? 0.1731 0.1686 0.2027 0.0132  0.0051  -0.0139 106  SER A CA  
880  C C   . SER A 106 ? 0.1826 0.1788 0.2173 0.0149  0.0023  -0.0085 106  SER A C   
881  O O   . SER A 106 ? 0.2103 0.1976 0.2292 0.0346  0.0067  -0.0219 106  SER A O   
882  C CB  . SER A 106 ? 0.1798 0.1834 0.2002 0.0084  0.0065  -0.0064 106  SER A CB  
883  O OG  . SER A 106 ? 0.2006 0.1893 0.2227 0.0186  0.0123  -0.0047 106  SER A OG  
884  N N   . ASN A 107 ? 0.1870 0.1778 0.2078 0.0140  -0.0033 -0.0105 107  ASN A N   
885  C CA  . ASN A 107 ? 0.1945 0.2022 0.2273 0.0076  0.0061  0.0002  107  ASN A CA  
886  C C   . ASN A 107 ? 0.2035 0.2117 0.2297 0.0099  0.0000  -0.0008 107  ASN A C   
887  O O   . ASN A 107 ? 0.2035 0.2180 0.2588 0.0158  0.0063  0.0075  107  ASN A O   
888  C CB  . ASN A 107 ? 0.2066 0.1970 0.2344 0.0158  -0.0018 -0.0032 107  ASN A CB  
889  C CG  . ASN A 107 ? 0.2341 0.2390 0.2746 0.0050  0.0076  -0.0044 107  ASN A CG  
890  O OD1 . ASN A 107 ? 0.3134 0.2815 0.3286 -0.0071 -0.0054 -0.0185 107  ASN A OD1 
891  N ND2 . ASN A 107 ? 0.2152 0.1986 0.2264 0.0041  0.0161  0.0049  107  ASN A ND2 
892  N N   . THR A 108 ? 0.2001 0.1996 0.2250 0.0154  0.0000  -0.0023 108  THR A N   
893  C CA  . THR A 108 ? 0.1999 0.2079 0.2242 0.0112  -0.0006 0.0043  108  THR A CA  
894  C C   . THR A 108 ? 0.1926 0.1900 0.2106 0.0170  -0.0057 0.0029  108  THR A C   
895  O O   . THR A 108 ? 0.1791 0.1820 0.1999 0.0313  -0.0098 0.0167  108  THR A O   
896  C CB  . THR A 108 ? 0.2065 0.2123 0.2370 0.0049  0.0035  0.0002  108  THR A CB  
897  O OG1 . THR A 108 ? 0.2265 0.2392 0.2692 0.0151  0.0004  0.0126  108  THR A OG1 
898  C CG2 . THR A 108 ? 0.2103 0.2534 0.2215 0.0103  -0.0087 0.0137  108  THR A CG2 
899  N N   . PRO A 109 ? 0.1858 0.1759 0.1975 0.0271  -0.0072 0.0044  109  PRO A N   
900  C CA  . PRO A 109 ? 0.1847 0.1584 0.1895 0.0214  -0.0146 -0.0017 109  PRO A CA  
901  C C   . PRO A 109 ? 0.1756 0.1565 0.1871 0.0129  -0.0062 0.0066  109  PRO A C   
902  O O   . PRO A 109 ? 0.1805 0.1698 0.2041 0.0102  -0.0039 -0.0029 109  PRO A O   
903  C CB  . PRO A 109 ? 0.1802 0.1726 0.1842 0.0219  -0.0159 -0.0023 109  PRO A CB  
904  C CG  . PRO A 109 ? 0.2422 0.1998 0.2101 0.0232  -0.0155 -0.0080 109  PRO A CG  
905  C CD  . PRO A 109 ? 0.2049 0.1830 0.2111 0.0277  -0.0043 -0.0004 109  PRO A CD  
906  N N   . ILE A 110 ? 0.1666 0.1463 0.1817 0.0129  -0.0127 0.0039  110  ILE A N   
907  C CA  . ILE A 110 ? 0.1630 0.1533 0.1778 0.0152  -0.0082 0.0019  110  ILE A CA  
908  C C   . ILE A 110 ? 0.1684 0.1586 0.1814 0.0148  -0.0064 0.0038  110  ILE A C   
909  O O   . ILE A 110 ? 0.1638 0.1649 0.1845 0.0211  -0.0058 0.0041  110  ILE A O   
910  C CB  . ILE A 110 ? 0.1782 0.1622 0.1751 0.0174  -0.0094 0.0002  110  ILE A CB  
911  C CG1 . ILE A 110 ? 0.1702 0.1836 0.1626 0.0197  -0.0051 0.0073  110  ILE A CG1 
912  C CG2 . ILE A 110 ? 0.1866 0.1511 0.1828 0.0187  -0.0123 0.0111  110  ILE A CG2 
913  C CD1 . ILE A 110 ? 0.1700 0.1791 0.1907 0.0218  -0.0112 0.0155  110  ILE A CD1 
914  N N   . LEU A 111 ? 0.1621 0.1478 0.1809 0.0197  -0.0021 -0.0002 111  LEU A N   
915  C CA  . LEU A 111 ? 0.1636 0.1644 0.1799 0.0144  -0.0098 -0.0008 111  LEU A CA  
916  C C   . LEU A 111 ? 0.1686 0.1687 0.1773 0.0103  -0.0084 -0.0014 111  LEU A C   
917  O O   . LEU A 111 ? 0.1968 0.1568 0.1772 0.0234  -0.0207 0.0031  111  LEU A O   
918  C CB  . LEU A 111 ? 0.1546 0.1747 0.1856 0.0154  -0.0050 0.0052  111  LEU A CB  
919  C CG  . LEU A 111 ? 0.2006 0.1995 0.2204 0.0033  -0.0028 -0.0027 111  LEU A CG  
920  C CD1 . LEU A 111 ? 0.2027 0.2509 0.2502 0.0087  -0.0068 -0.0044 111  LEU A CD1 
921  C CD2 . LEU A 111 ? 0.2186 0.1975 0.2394 0.0080  0.0099  0.0069  111  LEU A CD2 
922  N N   . VAL A 112 ? 0.1799 0.1685 0.1666 0.0142  -0.0160 0.0039  112  VAL A N   
923  C CA  . VAL A 112 ? 0.1737 0.1832 0.1710 0.0223  -0.0126 0.0008  112  VAL A CA  
924  C C   . VAL A 112 ? 0.1881 0.1832 0.1840 0.0164  -0.0055 0.0052  112  VAL A C   
925  O O   . VAL A 112 ? 0.1711 0.1746 0.1952 0.0143  -0.0212 0.0112  112  VAL A O   
926  C CB  . VAL A 112 ? 0.1888 0.1926 0.1731 0.0142  -0.0050 0.0085  112  VAL A CB  
927  C CG1 . VAL A 112 ? 0.2034 0.2131 0.1771 0.0262  -0.0174 0.0005  112  VAL A CG1 
928  C CG2 . VAL A 112 ? 0.2025 0.1802 0.1715 0.0086  -0.0208 0.0098  112  VAL A CG2 
929  N N   . ASP A 113 ? 0.1910 0.1889 0.1868 0.0244  -0.0134 -0.0020 113  ASP A N   
930  C CA  . ASP A 113 ? 0.2139 0.2007 0.1949 0.0224  -0.0122 0.0012  113  ASP A CA  
931  C C   . ASP A 113 ? 0.1916 0.1943 0.1915 0.0135  -0.0179 -0.0014 113  ASP A C   
932  O O   . ASP A 113 ? 0.1944 0.2020 0.2069 0.0091  -0.0092 -0.0038 113  ASP A O   
933  C CB  . ASP A 113 ? 0.2195 0.2093 0.1984 0.0175  -0.0123 -0.0001 113  ASP A CB  
934  C CG  . ASP A 113 ? 0.2469 0.2201 0.2306 0.0144  -0.0035 0.0077  113  ASP A CG  
935  O OD1 . ASP A 113 ? 0.2760 0.2319 0.2570 0.0075  -0.0135 -0.0102 113  ASP A OD1 
936  O OD2 . ASP A 113 ? 0.2732 0.2610 0.2490 0.0320  -0.0069 -0.0032 113  ASP A OD2 
937  N N   . GLY A 114 ? 0.1895 0.1984 0.2053 0.0153  -0.0180 0.0006  114  GLY A N   
938  C CA  . GLY A 114 ? 0.2077 0.1997 0.2014 0.0119  -0.0192 0.0004  114  GLY A CA  
939  C C   . GLY A 114 ? 0.2120 0.2048 0.2059 0.0070  -0.0075 0.0026  114  GLY A C   
940  O O   . GLY A 114 ? 0.2168 0.2061 0.2185 0.0149  -0.0140 0.0074  114  GLY A O   
941  N N   . LYS A 115 ? 0.2052 0.1968 0.1878 0.0082  -0.0102 0.0071  115  LYS A N   
942  C CA  . LYS A 115 ? 0.1983 0.1990 0.1931 0.0094  -0.0066 0.0065  115  LYS A CA  
943  C C   . LYS A 115 ? 0.1926 0.1837 0.1795 0.0093  -0.0066 0.0043  115  LYS A C   
944  O O   . LYS A 115 ? 0.1876 0.1572 0.1878 0.0050  -0.0083 -0.0011 115  LYS A O   
945  C CB  . LYS A 115 ? 0.2204 0.2151 0.2017 0.0083  0.0014  0.0069  115  LYS A CB  
946  C CG  . LYS A 115 ? 0.2660 0.2604 0.2726 -0.0039 -0.0018 -0.0006 115  LYS A CG  
947  C CD  . LYS A 115 ? 0.3357 0.3408 0.3074 -0.0011 0.0217  0.0052  115  LYS A CD  
948  C CE  . LYS A 115 ? 0.3808 0.3869 0.3886 -0.0159 -0.0003 -0.0019 115  LYS A CE  
949  N NZ  . LYS A 115 ? 0.4169 0.4225 0.4129 -0.0105 -0.0038 0.0064  115  LYS A NZ  
950  N N   . ASP A 116 ? 0.1886 0.1638 0.1723 0.0088  -0.0129 0.0097  116  ASP A N   
951  C CA  . ASP A 116 ? 0.1628 0.1634 0.1736 0.0087  -0.0137 0.0060  116  ASP A CA  
952  C C   . ASP A 116 ? 0.1816 0.1662 0.1828 0.0113  -0.0044 0.0093  116  ASP A C   
953  O O   . ASP A 116 ? 0.1853 0.1742 0.1948 0.0103  -0.0204 0.0094  116  ASP A O   
954  C CB  . ASP A 116 ? 0.1820 0.1775 0.1790 0.0107  -0.0109 0.0001  116  ASP A CB  
955  C CG  . ASP A 116 ? 0.1826 0.1754 0.1795 0.0072  -0.0090 0.0044  116  ASP A CG  
956  O OD1 . ASP A 116 ? 0.1659 0.1498 0.1970 0.0073  -0.0188 0.0016  116  ASP A OD1 
957  O OD2 . ASP A 116 ? 0.2082 0.1929 0.1819 0.0234  -0.0042 0.0037  116  ASP A OD2 
958  N N   . VAL A 117 ? 0.1631 0.1474 0.1693 0.0181  -0.0118 0.0111  117  VAL A N   
959  C CA  . VAL A 117 ? 0.1662 0.1371 0.1712 0.0042  -0.0057 0.0023  117  VAL A CA  
960  C C   . VAL A 117 ? 0.1657 0.1568 0.1746 0.0064  -0.0055 0.0012  117  VAL A C   
961  O O   . VAL A 117 ? 0.1575 0.1534 0.1950 0.0062  -0.0204 -0.0003 117  VAL A O   
962  C CB  . VAL A 117 ? 0.1692 0.1332 0.1478 0.0143  -0.0038 0.0061  117  VAL A CB  
963  C CG1 . VAL A 117 ? 0.1748 0.1409 0.1764 0.0138  -0.0199 0.0000  117  VAL A CG1 
964  C CG2 . VAL A 117 ? 0.1640 0.1629 0.1490 0.0085  -0.0005 0.0095  117  VAL A CG2 
965  N N   . MET A 118 ? 0.1613 0.1529 0.1726 0.0065  -0.0142 -0.0083 118  MET A N   
966  C CA  . MET A 118 ? 0.1653 0.1630 0.1834 0.0001  -0.0069 -0.0048 118  MET A CA  
967  C C   . MET A 118 ? 0.1723 0.1602 0.1975 0.0047  -0.0076 -0.0004 118  MET A C   
968  O O   . MET A 118 ? 0.1622 0.1359 0.2004 0.0108  -0.0052 -0.0088 118  MET A O   
969  C CB  . MET A 118 ? 0.1697 0.1629 0.1869 0.0024  0.0003  -0.0049 118  MET A CB  
970  C CG  . MET A 118 ? 0.1626 0.1659 0.1994 0.0048  -0.0098 0.0134  118  MET A CG  
971  S SD  . MET A 118 ? 0.1674 0.1332 0.2109 -0.0015 -0.0203 -0.0086 118  MET A SD  
972  C CE  . MET A 118 ? 0.1785 0.1692 0.1854 -0.0071 -0.0171 -0.0008 118  MET A CE  
973  N N   . PRO A 119 ? 0.1704 0.1561 0.2039 0.0055  -0.0083 0.0107  119  PRO A N   
974  C CA  . PRO A 119 ? 0.1834 0.1751 0.2083 0.0068  -0.0069 0.0182  119  PRO A CA  
975  C C   . PRO A 119 ? 0.1883 0.1762 0.2018 0.0043  -0.0069 0.0165  119  PRO A C   
976  O O   . PRO A 119 ? 0.1950 0.1764 0.2210 0.0059  -0.0085 0.0308  119  PRO A O   
977  C CB  . PRO A 119 ? 0.1886 0.1837 0.1964 0.0102  -0.0027 0.0250  119  PRO A CB  
978  C CG  . PRO A 119 ? 0.1815 0.1657 0.2220 0.0144  -0.0034 0.0195  119  PRO A CG  
979  C CD  . PRO A 119 ? 0.1806 0.1569 0.2197 -0.0016 -0.0124 0.0057  119  PRO A CD  
980  N N   . GLU A 120 ? 0.1945 0.1869 0.1904 0.0096  -0.0033 0.0178  120  GLU A N   
981  C CA  . GLU A 120 ? 0.2022 0.1970 0.2028 0.0131  -0.0080 0.0104  120  GLU A CA  
982  C C   . GLU A 120 ? 0.1839 0.1621 0.1862 0.0117  -0.0016 0.0120  120  GLU A C   
983  O O   . GLU A 120 ? 0.1677 0.1391 0.1780 0.0057  -0.0053 0.0142  120  GLU A O   
984  C CB  . GLU A 120 ? 0.2264 0.2263 0.2194 0.0096  -0.0122 0.0011  120  GLU A CB  
985  C CG  . GLU A 120 ? 0.3043 0.2721 0.2810 0.0151  -0.0091 0.0172  120  GLU A CG  
986  C CD  . GLU A 120 ? 0.3513 0.3596 0.3626 -0.0096 0.0047  0.0047  120  GLU A CD  
987  O OE1 . GLU A 120 ? 0.3971 0.4078 0.4216 0.0077  0.0080  -0.0026 120  GLU A OE1 
988  O OE2 . GLU A 120 ? 0.4220 0.3981 0.4252 -0.0039 -0.0039 0.0153  120  GLU A OE2 
989  N N   . VAL A 121 ? 0.1661 0.1493 0.1745 0.0106  -0.0019 0.0007  121  VAL A N   
990  C CA  . VAL A 121 ? 0.1684 0.1466 0.1658 0.0015  -0.0077 0.0023  121  VAL A CA  
991  C C   . VAL A 121 ? 0.1696 0.1452 0.1675 0.0047  -0.0037 0.0021  121  VAL A C   
992  O O   . VAL A 121 ? 0.1714 0.1385 0.1699 -0.0036 -0.0002 0.0137  121  VAL A O   
993  C CB  . VAL A 121 ? 0.1679 0.1331 0.1551 0.0030  -0.0035 -0.0025 121  VAL A CB  
994  C CG1 . VAL A 121 ? 0.1601 0.1535 0.1533 -0.0025 -0.0100 -0.0004 121  VAL A CG1 
995  C CG2 . VAL A 121 ? 0.1578 0.1368 0.1740 -0.0096 -0.0072 -0.0077 121  VAL A CG2 
996  N N   . ASN A 122 ? 0.1750 0.1431 0.1721 0.0046  -0.0013 0.0059  122  ASN A N   
997  C CA  . ASN A 122 ? 0.1750 0.1548 0.1775 0.0052  0.0072  0.0000  122  ASN A CA  
998  C C   . ASN A 122 ? 0.1774 0.1542 0.1846 0.0029  0.0022  0.0021  122  ASN A C   
999  O O   . ASN A 122 ? 0.1755 0.1407 0.2019 0.0033  0.0020  0.0057  122  ASN A O   
1000 C CB  . ASN A 122 ? 0.1825 0.1670 0.1835 0.0119  0.0080  -0.0038 122  ASN A CB  
1001 C CG  . ASN A 122 ? 0.1934 0.1653 0.2011 0.0043  0.0056  0.0049  122  ASN A CG  
1002 O OD1 . ASN A 122 ? 0.2150 0.2124 0.2797 0.0125  0.0105  0.0016  122  ASN A OD1 
1003 N ND2 . ASN A 122 ? 0.1481 0.1845 0.2003 0.0265  0.0052  0.0046  122  ASN A ND2 
1004 N N   . LYS A 123 ? 0.1713 0.1448 0.1846 0.0034  0.0058  0.0118  123  LYS A N   
1005 C CA  . LYS A 123 ? 0.1869 0.1602 0.1880 -0.0007 0.0037  0.0118  123  LYS A CA  
1006 C C   . LYS A 123 ? 0.1818 0.1554 0.1767 -0.0028 -0.0004 0.0070  123  LYS A C   
1007 O O   . LYS A 123 ? 0.1692 0.1624 0.1642 0.0142  0.0031  0.0210  123  LYS A O   
1008 C CB  . LYS A 123 ? 0.2164 0.1849 0.2003 0.0012  -0.0031 0.0147  123  LYS A CB  
1009 C CG  . LYS A 123 ? 0.2426 0.2504 0.2689 -0.0137 0.0173  0.0119  123  LYS A CG  
1010 C CD  . LYS A 123 ? 0.3443 0.3690 0.3234 -0.0044 -0.0138 -0.0064 123  LYS A CD  
1011 C CE  . LYS A 123 ? 0.4268 0.4194 0.4173 -0.0081 0.0015  0.0140  123  LYS A CE  
1012 N NZ  . LYS A 123 ? 0.4341 0.4674 0.4360 -0.0093 0.0104  0.0066  123  LYS A NZ  
1013 N N   . VAL A 124 ? 0.1793 0.1449 0.1804 0.0130  -0.0061 0.0079  124  VAL A N   
1014 C CA  . VAL A 124 ? 0.1713 0.1491 0.1767 0.0046  0.0023  -0.0024 124  VAL A CA  
1015 C C   . VAL A 124 ? 0.1681 0.1474 0.1752 0.0078  0.0038  0.0027  124  VAL A C   
1016 O O   . VAL A 124 ? 0.1750 0.1312 0.1744 0.0036  0.0024  0.0068  124  VAL A O   
1017 C CB  . VAL A 124 ? 0.1740 0.1412 0.1774 0.0157  -0.0081 -0.0052 124  VAL A CB  
1018 C CG1 . VAL A 124 ? 0.1655 0.1691 0.1942 0.0144  -0.0055 -0.0017 124  VAL A CG1 
1019 C CG2 . VAL A 124 ? 0.1848 0.1768 0.1750 0.0057  0.0038  -0.0121 124  VAL A CG2 
1020 N N   . LEU A 125 ? 0.1574 0.1413 0.1650 0.0004  0.0108  0.0114  125  LEU A N   
1021 C CA  . LEU A 125 ? 0.1531 0.1397 0.1710 -0.0043 0.0088  0.0019  125  LEU A CA  
1022 C C   . LEU A 125 ? 0.1735 0.1435 0.1878 -0.0033 0.0023  0.0069  125  LEU A C   
1023 O O   . LEU A 125 ? 0.1773 0.1456 0.1901 -0.0075 0.0044  0.0100  125  LEU A O   
1024 C CB  . LEU A 125 ? 0.1627 0.1397 0.1612 -0.0073 0.0091  0.0118  125  LEU A CB  
1025 C CG  . LEU A 125 ? 0.1334 0.1364 0.1738 0.0025  -0.0020 0.0105  125  LEU A CG  
1026 C CD1 . LEU A 125 ? 0.1556 0.1347 0.1597 -0.0053 0.0124  -0.0014 125  LEU A CD1 
1027 C CD2 . LEU A 125 ? 0.1470 0.1415 0.1595 0.0051  -0.0105 0.0032  125  LEU A CD2 
1028 N N   . ASP A 126 ? 0.1824 0.1403 0.1890 -0.0040 0.0011  0.0001  126  ASP A N   
1029 C CA  . ASP A 126 ? 0.1745 0.1530 0.2104 -0.0062 0.0055  0.0088  126  ASP A CA  
1030 C C   . ASP A 126 ? 0.1791 0.1548 0.2048 0.0001  0.0058  0.0020  126  ASP A C   
1031 O O   . ASP A 126 ? 0.1883 0.1571 0.2299 -0.0020 0.0038  0.0054  126  ASP A O   
1032 C CB  . ASP A 126 ? 0.1885 0.1653 0.2270 0.0010  0.0036  0.0059  126  ASP A CB  
1033 C CG  . ASP A 126 ? 0.2208 0.2306 0.2499 -0.0033 0.0074  0.0031  126  ASP A CG  
1034 O OD1 . ASP A 126 ? 0.2834 0.2439 0.2687 0.0056  0.0150  0.0012  126  ASP A OD1 
1035 O OD2 . ASP A 126 ? 0.2540 0.2492 0.3105 0.0245  0.0111  0.0013  126  ASP A OD2 
1036 N N   . LYS A 127 ? 0.1753 0.1506 0.1952 -0.0041 0.0091  0.0040  127  LYS A N   
1037 C CA  . LYS A 127 ? 0.1817 0.1601 0.1905 -0.0108 0.0075  0.0008  127  LYS A CA  
1038 C C   . LYS A 127 ? 0.1849 0.1613 0.1915 -0.0074 0.0088  -0.0026 127  LYS A C   
1039 O O   . LYS A 127 ? 0.1947 0.1661 0.2086 -0.0072 0.0134  -0.0115 127  LYS A O   
1040 C CB  . LYS A 127 ? 0.1944 0.1979 0.1931 -0.0081 0.0073  0.0040  127  LYS A CB  
1041 C CG  . LYS A 127 ? 0.2110 0.2135 0.2215 -0.0123 0.0168  0.0020  127  LYS A CG  
1042 C CD  . LYS A 127 ? 0.2736 0.2624 0.2480 -0.0142 -0.0082 -0.0019 127  LYS A CD  
1043 C CE  . LYS A 127 ? 0.3223 0.2797 0.2920 -0.0090 0.0149  -0.0068 127  LYS A CE  
1044 N NZ  . LYS A 127 ? 0.3744 0.3182 0.3488 -0.0084 0.0044  0.0181  127  LYS A NZ  
1045 N N   . MET A 128 ? 0.1850 0.1547 0.1784 -0.0039 0.0114  0.0011  128  MET A N   
1046 C CA  . MET A 128 ? 0.1812 0.1469 0.1732 -0.0147 0.0022  -0.0007 128  MET A CA  
1047 C C   . MET A 128 ? 0.1824 0.1448 0.1890 -0.0128 0.0026  -0.0012 128  MET A C   
1048 O O   . MET A 128 ? 0.1839 0.1303 0.2238 -0.0160 0.0067  -0.0011 128  MET A O   
1049 C CB  . MET A 128 ? 0.1752 0.1321 0.1555 -0.0180 0.0070  0.0020  128  MET A CB  
1050 C CG  . MET A 128 ? 0.1542 0.1406 0.1148 -0.0084 0.0077  -0.0022 128  MET A CG  
1051 S SD  . MET A 128 ? 0.1599 0.1391 0.1791 -0.0050 0.0070  0.0019  128  MET A SD  
1052 C CE  . MET A 128 ? 0.2011 0.1948 0.1898 0.0027  -0.0078 0.0037  128  MET A CE  
1053 N N   . LYS A 129 ? 0.1851 0.1511 0.1832 -0.0169 0.0052  -0.0067 129  LYS A N   
1054 C CA  . LYS A 129 ? 0.2037 0.1554 0.1922 -0.0196 0.0004  -0.0038 129  LYS A CA  
1055 C C   . LYS A 129 ? 0.1890 0.1624 0.1987 -0.0175 0.0003  -0.0057 129  LYS A C   
1056 O O   . LYS A 129 ? 0.1992 0.1525 0.2261 -0.0247 -0.0009 -0.0135 129  LYS A O   
1057 C CB  . LYS A 129 ? 0.2101 0.1608 0.1832 -0.0136 0.0000  -0.0052 129  LYS A CB  
1058 C CG  . LYS A 129 ? 0.2469 0.1894 0.2133 -0.0233 -0.0129 -0.0098 129  LYS A CG  
1059 C CD  . LYS A 129 ? 0.2826 0.2537 0.2600 -0.0106 0.0163  -0.0056 129  LYS A CD  
1060 C CE  . LYS A 129 ? 0.3238 0.3150 0.2906 -0.0105 0.0019  -0.0065 129  LYS A CE  
1061 N NZ  . LYS A 129 ? 0.3542 0.3406 0.3061 -0.0050 0.0184  -0.0158 129  LYS A NZ  
1062 N N   . SER A 130 ? 0.1863 0.1549 0.2061 -0.0188 0.0030  -0.0065 130  SER A N   
1063 C CA  . SER A 130 ? 0.2035 0.1888 0.2261 -0.0122 0.0106  0.0070  130  SER A CA  
1064 C C   . SER A 130 ? 0.2109 0.1976 0.2200 -0.0122 0.0078  -0.0061 130  SER A C   
1065 O O   . SER A 130 ? 0.2111 0.1914 0.2111 -0.0179 0.0164  -0.0068 130  SER A O   
1066 C CB  . SER A 130 ? 0.2236 0.2024 0.2275 -0.0179 0.0000  0.0138  130  SER A CB  
1067 O OG  . SER A 130 ? 0.2713 0.2528 0.2999 -0.0227 0.0221  0.0178  130  SER A OG  
1068 N N   . PHE A 131 ? 0.2061 0.1831 0.2156 -0.0136 0.0111  -0.0048 131  PHE A N   
1069 C CA  . PHE A 131 ? 0.2052 0.1776 0.2063 -0.0076 0.0040  -0.0071 131  PHE A CA  
1070 C C   . PHE A 131 ? 0.2101 0.1953 0.2253 -0.0082 0.0031  -0.0128 131  PHE A C   
1071 O O   . PHE A 131 ? 0.2051 0.1829 0.2343 -0.0135 0.0065  -0.0129 131  PHE A O   
1072 C CB  . PHE A 131 ? 0.2064 0.1809 0.2146 -0.0080 0.0050  -0.0102 131  PHE A CB  
1073 C CG  . PHE A 131 ? 0.2099 0.1934 0.2106 -0.0008 0.0025  -0.0052 131  PHE A CG  
1074 C CD1 . PHE A 131 ? 0.2052 0.1907 0.2053 0.0031  0.0072  -0.0026 131  PHE A CD1 
1075 C CD2 . PHE A 131 ? 0.2157 0.1904 0.2164 -0.0080 -0.0091 -0.0132 131  PHE A CD2 
1076 C CE1 . PHE A 131 ? 0.1839 0.1925 0.2176 0.0113  -0.0052 0.0070  131  PHE A CE1 
1077 C CE2 . PHE A 131 ? 0.1954 0.2066 0.1913 -0.0122 -0.0080 -0.0136 131  PHE A CE2 
1078 C CZ  . PHE A 131 ? 0.1888 0.1702 0.1941 -0.0014 -0.0058 -0.0045 131  PHE A CZ  
1079 N N   . CYS A 132 ? 0.2219 0.1863 0.2240 -0.0031 0.0015  -0.0058 132  CYS A N   
1080 C CA  . CYS A 132 ? 0.2334 0.2184 0.2384 -0.0042 -0.0044 -0.0084 132  CYS A CA  
1081 C C   . CYS A 132 ? 0.2159 0.2088 0.2186 -0.0035 0.0036  -0.0028 132  CYS A C   
1082 O O   . CYS A 132 ? 0.2093 0.2101 0.2226 -0.0097 0.0097  -0.0012 132  CYS A O   
1083 C CB  . CYS A 132 ? 0.2703 0.2242 0.2644 -0.0115 -0.0051 -0.0119 132  CYS A CB  
1084 S SG  . CYS A 132 ? 0.3754 0.3330 0.3803 -0.0066 -0.0333 0.0065  132  CYS A SG  
1085 N N   . GLN A 133 ? 0.2083 0.1987 0.2286 -0.0084 -0.0014 0.0028  133  GLN A N   
1086 C CA  . GLN A 133 ? 0.2132 0.2198 0.2321 -0.0031 0.0044  -0.0080 133  GLN A CA  
1087 C C   . GLN A 133 ? 0.2124 0.2061 0.2350 -0.0059 0.0029  -0.0046 133  GLN A C   
1088 O O   . GLN A 133 ? 0.2027 0.2096 0.2455 -0.0130 0.0158  -0.0122 133  GLN A O   
1089 C CB  . GLN A 133 ? 0.2174 0.1944 0.2363 -0.0040 -0.0048 -0.0056 133  GLN A CB  
1090 C CG  . GLN A 133 ? 0.2882 0.2903 0.2794 -0.0078 0.0118  -0.0046 133  GLN A CG  
1091 C CD  . GLN A 133 ? 0.3349 0.3382 0.3550 0.0122  0.0042  -0.0045 133  GLN A CD  
1092 O OE1 . GLN A 133 ? 0.4129 0.4173 0.3757 -0.0001 0.0224  -0.0111 133  GLN A OE1 
1093 N NE2 . GLN A 133 ? 0.3575 0.3545 0.3598 0.0023  0.0065  0.0060  133  GLN A NE2 
1094 N N   . ARG A 134 ? 0.2091 0.1949 0.2330 -0.0092 0.0101  -0.0078 134  ARG A N   
1095 C CA  . ARG A 134 ? 0.2128 0.2011 0.2316 -0.0021 0.0085  -0.0064 134  ARG A CA  
1096 C C   . ARG A 134 ? 0.2072 0.1969 0.2297 -0.0062 0.0036  -0.0130 134  ARG A C   
1097 O O   . ARG A 134 ? 0.2001 0.1865 0.2225 -0.0128 0.0123  -0.0080 134  ARG A O   
1098 C CB  . ARG A 134 ? 0.2285 0.2180 0.2396 -0.0052 0.0053  -0.0059 134  ARG A CB  
1099 C CG  . ARG A 134 ? 0.2593 0.2538 0.2838 0.0079  0.0190  0.0022  134  ARG A CG  
1100 C CD  . ARG A 134 ? 0.3533 0.3602 0.3422 0.0034  -0.0109 0.0018  134  ARG A CD  
1101 N NE  . ARG A 134 ? 0.4135 0.4054 0.3861 0.0101  0.0136  0.0056  134  ARG A NE  
1102 C CZ  . ARG A 134 ? 0.4310 0.4224 0.4082 0.0068  0.0023  -0.0035 134  ARG A CZ  
1103 N NH1 . ARG A 134 ? 0.4384 0.4249 0.4236 0.0094  0.0034  -0.0015 134  ARG A NH1 
1104 N NH2 . ARG A 134 ? 0.4321 0.4098 0.4186 -0.0002 0.0092  0.0011  134  ARG A NH2 
1105 N N   . VAL A 135 ? 0.1929 0.1749 0.2142 -0.0040 0.0113  -0.0032 135  VAL A N   
1106 C CA  . VAL A 135 ? 0.1966 0.1829 0.2124 -0.0033 0.0009  -0.0041 135  VAL A CA  
1107 C C   . VAL A 135 ? 0.1999 0.1935 0.2162 -0.0019 0.0042  -0.0061 135  VAL A C   
1108 O O   . VAL A 135 ? 0.2131 0.2028 0.2338 -0.0050 0.0025  -0.0148 135  VAL A O   
1109 C CB  . VAL A 135 ? 0.1934 0.1714 0.2072 -0.0035 0.0000  -0.0003 135  VAL A CB  
1110 C CG1 . VAL A 135 ? 0.1814 0.1917 0.2148 -0.0010 0.0071  -0.0059 135  VAL A CG1 
1111 C CG2 . VAL A 135 ? 0.1721 0.1818 0.2054 -0.0034 0.0065  -0.0028 135  VAL A CG2 
1112 N N   . ARG A 136 ? 0.2092 0.2063 0.2085 -0.0036 0.0060  -0.0003 136  ARG A N   
1113 C CA  . ARG A 136 ? 0.2202 0.2270 0.2222 -0.0142 0.0059  -0.0025 136  ARG A CA  
1114 C C   . ARG A 136 ? 0.2226 0.2434 0.2391 -0.0120 0.0028  -0.0049 136  ARG A C   
1115 O O   . ARG A 136 ? 0.2428 0.2664 0.2532 -0.0076 -0.0042 0.0016  136  ARG A O   
1116 C CB  . ARG A 136 ? 0.2165 0.2327 0.2238 -0.0106 0.0142  -0.0063 136  ARG A CB  
1117 C CG  . ARG A 136 ? 0.2403 0.2317 0.2511 -0.0122 0.0081  0.0026  136  ARG A CG  
1118 C CD  . ARG A 136 ? 0.2600 0.2533 0.2433 -0.0109 0.0150  -0.0026 136  ARG A CD  
1119 N NE  . ARG A 136 ? 0.2980 0.2848 0.2729 -0.0142 -0.0001 -0.0005 136  ARG A NE  
1120 C CZ  . ARG A 136 ? 0.2867 0.2762 0.2746 -0.0024 0.0036  0.0018  136  ARG A CZ  
1121 N NH1 . ARG A 136 ? 0.2411 0.2493 0.2450 -0.0250 0.0091  0.0053  136  ARG A NH1 
1122 N NH2 . ARG A 136 ? 0.3356 0.3127 0.2843 -0.0052 -0.0069 0.0017  136  ARG A NH2 
1123 N N   . SER A 137 ? 0.2201 0.2291 0.2397 -0.0184 0.0024  -0.0084 137  SER A N   
1124 C CA  . SER A 137 ? 0.2324 0.2465 0.2536 -0.0176 0.0052  -0.0111 137  SER A CA  
1125 C C   . SER A 137 ? 0.2426 0.2600 0.2635 -0.0195 0.0060  -0.0118 137  SER A C   
1126 O O   . SER A 137 ? 0.2442 0.2852 0.2940 -0.0306 0.0090  -0.0109 137  SER A O   
1127 C CB  . SER A 137 ? 0.2374 0.2424 0.2524 -0.0107 0.0083  -0.0156 137  SER A CB  
1128 O OG  . SER A 137 ? 0.2363 0.2433 0.2621 -0.0139 0.0218  -0.0147 137  SER A OG  
1129 N N   . GLY A 138 ? 0.2470 0.2505 0.2685 -0.0156 0.0087  -0.0099 138  GLY A N   
1130 C CA  . GLY A 138 ? 0.2539 0.2493 0.2701 -0.0127 0.0038  -0.0116 138  GLY A CA  
1131 C C   . GLY A 138 ? 0.2686 0.2608 0.2765 -0.0109 0.0010  -0.0108 138  GLY A C   
1132 O O   . GLY A 138 ? 0.2738 0.2631 0.2966 -0.0173 0.0044  -0.0091 138  GLY A O   
1133 N N   . ASP A 139 ? 0.2607 0.2499 0.2809 -0.0106 0.0017  -0.0181 139  ASP A N   
1134 C CA  . ASP A 139 ? 0.2667 0.2510 0.2738 -0.0143 0.0045  -0.0109 139  ASP A CA  
1135 C C   . ASP A 139 ? 0.2630 0.2423 0.2774 -0.0119 0.0099  -0.0046 139  ASP A C   
1136 O O   . ASP A 139 ? 0.2711 0.2316 0.2786 -0.0074 0.0193  -0.0002 139  ASP A O   
1137 C CB  . ASP A 139 ? 0.2815 0.2615 0.2989 -0.0115 0.0045  -0.0073 139  ASP A CB  
1138 C CG  . ASP A 139 ? 0.3607 0.3379 0.3517 -0.0050 0.0002  -0.0168 139  ASP A CG  
1139 O OD1 . ASP A 139 ? 0.3915 0.3929 0.4286 0.0132  0.0164  -0.0137 139  ASP A OD1 
1140 O OD2 . ASP A 139 ? 0.3665 0.3856 0.3984 0.0035  -0.0081 -0.0137 139  ASP A OD2 
1141 N N   . TRP A 140 ? 0.2217 0.2068 0.2519 -0.0202 0.0077  -0.0103 140  TRP A N   
1142 C CA  . TRP A 140 ? 0.2198 0.2124 0.2387 -0.0203 0.0139  0.0024  140  TRP A CA  
1143 C C   . TRP A 140 ? 0.2227 0.2078 0.2285 -0.0105 0.0136  0.0001  140  TRP A C   
1144 O O   . TRP A 140 ? 0.2122 0.2217 0.2358 -0.0113 0.0129  0.0018  140  TRP A O   
1145 C CB  . TRP A 140 ? 0.2247 0.1850 0.2206 -0.0272 0.0090  0.0003  140  TRP A CB  
1146 C CG  . TRP A 140 ? 0.2083 0.1863 0.2179 -0.0138 0.0134  0.0080  140  TRP A CG  
1147 C CD1 . TRP A 140 ? 0.2226 0.1775 0.2051 -0.0194 0.0133  0.0026  140  TRP A CD1 
1148 C CD2 . TRP A 140 ? 0.2215 0.1969 0.2018 -0.0144 0.0076  0.0071  140  TRP A CD2 
1149 N NE1 . TRP A 140 ? 0.2041 0.1658 0.1806 -0.0212 0.0099  0.0092  140  TRP A NE1 
1150 C CE2 . TRP A 140 ? 0.2261 0.2023 0.2198 -0.0030 0.0085  0.0021  140  TRP A CE2 
1151 C CE3 . TRP A 140 ? 0.2020 0.2149 0.2169 -0.0126 0.0146  0.0053  140  TRP A CE3 
1152 C CZ2 . TRP A 140 ? 0.2285 0.2230 0.2253 -0.0063 0.0057  0.0071  140  TRP A CZ2 
1153 C CZ3 . TRP A 140 ? 0.2281 0.2245 0.2154 0.0034  0.0060  0.0049  140  TRP A CZ3 
1154 C CH2 . TRP A 140 ? 0.2461 0.2307 0.2381 -0.0084 0.0142  0.0038  140  TRP A CH2 
1155 N N   . LYS A 141 ? 0.2205 0.2061 0.2258 -0.0135 0.0183  -0.0059 141  LYS A N   
1156 C CA  . LYS A 141 ? 0.2176 0.2009 0.2234 -0.0139 0.0166  0.0031  141  LYS A CA  
1157 C C   . LYS A 141 ? 0.2058 0.1976 0.2177 -0.0130 0.0169  0.0070  141  LYS A C   
1158 O O   . LYS A 141 ? 0.2113 0.2055 0.2234 -0.0036 0.0237  0.0069  141  LYS A O   
1159 C CB  . LYS A 141 ? 0.2228 0.2159 0.2369 -0.0172 0.0168  -0.0054 141  LYS A CB  
1160 C CG  . LYS A 141 ? 0.2415 0.2223 0.2537 -0.0125 0.0100  -0.0102 141  LYS A CG  
1161 C CD  . LYS A 141 ? 0.2780 0.2563 0.2652 -0.0013 0.0033  -0.0108 141  LYS A CD  
1162 C CE  . LYS A 141 ? 0.2997 0.2650 0.3016 -0.0172 -0.0052 -0.0141 141  LYS A CE  
1163 N NZ  . LYS A 141 ? 0.3351 0.3215 0.3272 -0.0085 -0.0049 -0.0149 141  LYS A NZ  
1164 N N   . GLY A 142 ? 0.1985 0.1856 0.2095 -0.0142 0.0188  0.0146  142  GLY A N   
1165 C CA  . GLY A 142 ? 0.2006 0.1902 0.1852 -0.0199 0.0156  0.0153  142  GLY A CA  
1166 C C   . GLY A 142 ? 0.1957 0.1874 0.1989 -0.0133 0.0112  0.0121  142  GLY A C   
1167 O O   . GLY A 142 ? 0.1984 0.2044 0.2177 -0.0227 0.0105  0.0127  142  GLY A O   
1168 N N   . TYR A 143 ? 0.1801 0.1882 0.1770 -0.0191 0.0124  0.0183  143  TYR A N   
1169 C CA  . TYR A 143 ? 0.1934 0.1816 0.1732 -0.0215 0.0115  0.0097  143  TYR A CA  
1170 C C   . TYR A 143 ? 0.1926 0.1883 0.1906 -0.0136 0.0071  0.0074  143  TYR A C   
1171 O O   . TYR A 143 ? 0.1955 0.1971 0.1948 -0.0244 0.0170  0.0044  143  TYR A O   
1172 C CB  . TYR A 143 ? 0.1875 0.1858 0.1959 -0.0150 0.0186  0.0052  143  TYR A CB  
1173 C CG  . TYR A 143 ? 0.1942 0.1866 0.2039 -0.0105 0.0087  0.0047  143  TYR A CG  
1174 C CD1 . TYR A 143 ? 0.2134 0.1931 0.2055 -0.0075 0.0031  0.0130  143  TYR A CD1 
1175 C CD2 . TYR A 143 ? 0.1909 0.2029 0.2045 -0.0148 0.0102  0.0035  143  TYR A CD2 
1176 C CE1 . TYR A 143 ? 0.2276 0.2202 0.2172 -0.0028 0.0239  -0.0034 143  TYR A CE1 
1177 C CE2 . TYR A 143 ? 0.1923 0.2219 0.2430 -0.0130 0.0031  0.0063  143  TYR A CE2 
1178 C CZ  . TYR A 143 ? 0.2144 0.2227 0.2569 -0.0089 0.0096  0.0078  143  TYR A CZ  
1179 O OH  . TYR A 143 ? 0.2390 0.2320 0.2727 -0.0109 0.0255  0.0053  143  TYR A OH  
1180 N N   . THR A 144 ? 0.1913 0.1866 0.1887 -0.0209 0.0062  0.0082  144  THR A N   
1181 C CA  . THR A 144 ? 0.2030 0.2070 0.2111 -0.0186 0.0053  -0.0001 144  THR A CA  
1182 C C   . THR A 144 ? 0.2058 0.2036 0.2226 -0.0128 0.0065  -0.0025 144  THR A C   
1183 O O   . THR A 144 ? 0.1923 0.2282 0.2471 -0.0168 0.0080  -0.0080 144  THR A O   
1184 C CB  . THR A 144 ? 0.2031 0.2022 0.2029 -0.0155 0.0086  0.0041  144  THR A CB  
1185 O OG1 . THR A 144 ? 0.2081 0.2149 0.2075 -0.0250 0.0098  0.0067  144  THR A OG1 
1186 C CG2 . THR A 144 ? 0.2076 0.2069 0.2172 -0.0079 0.0005  -0.0018 144  THR A CG2 
1187 N N   . GLY A 145 ? 0.1997 0.1938 0.2282 -0.0182 0.0167  -0.0012 145  GLY A N   
1188 C CA  . GLY A 145 ? 0.2075 0.2166 0.2202 -0.0163 0.0103  -0.0027 145  GLY A CA  
1189 C C   . GLY A 145 ? 0.2118 0.2280 0.2289 -0.0106 0.0112  -0.0005 145  GLY A C   
1190 O O   . GLY A 145 ? 0.2238 0.2419 0.2392 -0.0141 0.0152  -0.0039 145  GLY A O   
1191 N N   . LYS A 146 ? 0.2036 0.2315 0.2322 -0.0116 0.0096  0.0014  146  LYS A N   
1192 C CA  . LYS A 146 ? 0.2033 0.2221 0.2256 -0.0158 0.0149  0.0019  146  LYS A CA  
1193 C C   . LYS A 146 ? 0.2003 0.2130 0.2205 -0.0079 0.0102  -0.0037 146  LYS A C   
1194 O O   . LYS A 146 ? 0.2127 0.2115 0.2134 -0.0108 0.0151  -0.0112 146  LYS A O   
1195 C CB  . LYS A 146 ? 0.2106 0.2383 0.2347 -0.0123 0.0099  0.0000  146  LYS A CB  
1196 C CG  . LYS A 146 ? 0.2432 0.3051 0.2768 -0.0161 0.0241  0.0012  146  LYS A CG  
1197 C CD  . LYS A 146 ? 0.3405 0.3476 0.3598 0.0082  0.0033  0.0022  146  LYS A CD  
1198 C CE  . LYS A 146 ? 0.3720 0.4196 0.4080 -0.0089 0.0048  0.0010  146  LYS A CE  
1199 N NZ  . LYS A 146 ? 0.4272 0.4272 0.4577 0.0054  0.0022  0.0036  146  LYS A NZ  
1200 N N   . THR A 147 ? 0.1894 0.1928 0.1996 -0.0213 0.0057  -0.0055 147  THR A N   
1201 C CA  . THR A 147 ? 0.1970 0.1927 0.2055 -0.0180 0.0079  -0.0081 147  THR A CA  
1202 C C   . THR A 147 ? 0.1846 0.1829 0.2046 -0.0103 0.0050  -0.0050 147  THR A C   
1203 O O   . THR A 147 ? 0.1905 0.1855 0.2107 -0.0181 0.0076  -0.0087 147  THR A O   
1204 C CB  . THR A 147 ? 0.2088 0.1922 0.2183 -0.0074 0.0096  -0.0077 147  THR A CB  
1205 O OG1 . THR A 147 ? 0.2561 0.2507 0.2267 -0.0067 -0.0094 -0.0072 147  THR A OG1 
1206 C CG2 . THR A 147 ? 0.1955 0.1837 0.1904 -0.0298 0.0152  -0.0133 147  THR A CG2 
1207 N N   . ILE A 148 ? 0.1733 0.1727 0.1980 -0.0145 -0.0018 -0.0094 148  ILE A N   
1208 C CA  . ILE A 148 ? 0.1751 0.1554 0.1927 -0.0023 -0.0011 -0.0042 148  ILE A CA  
1209 C C   . ILE A 148 ? 0.1736 0.1688 0.1857 -0.0042 -0.0014 -0.0074 148  ILE A C   
1210 O O   . ILE A 148 ? 0.1951 0.1819 0.1781 0.0006  0.0018  -0.0080 148  ILE A O   
1211 C CB  . ILE A 148 ? 0.1768 0.1538 0.1904 -0.0063 -0.0084 -0.0016 148  ILE A CB  
1212 C CG1 . ILE A 148 ? 0.1916 0.1736 0.1945 0.0035  0.0049  -0.0003 148  ILE A CG1 
1213 C CG2 . ILE A 148 ? 0.1982 0.1607 0.2150 -0.0124 -0.0012 -0.0012 148  ILE A CG2 
1214 C CD1 . ILE A 148 ? 0.2186 0.2057 0.1997 0.0092  0.0015  -0.0075 148  ILE A CD1 
1215 N N   . THR A 149 ? 0.1679 0.1594 0.1823 -0.0045 -0.0010 -0.0050 149  THR A N   
1216 C CA  . THR A 149 ? 0.1855 0.1715 0.1973 -0.0104 -0.0050 0.0015  149  THR A CA  
1217 C C   . THR A 149 ? 0.1931 0.1688 0.1896 -0.0110 -0.0037 0.0000  149  THR A C   
1218 O O   . THR A 149 ? 0.1946 0.1732 0.1915 -0.0134 -0.0092 0.0099  149  THR A O   
1219 C CB  . THR A 149 ? 0.1901 0.1812 0.2083 -0.0031 -0.0053 -0.0044 149  THR A CB  
1220 O OG1 . THR A 149 ? 0.1889 0.1960 0.2113 -0.0122 0.0067  0.0178  149  THR A OG1 
1221 C CG2 . THR A 149 ? 0.2247 0.1984 0.2270 -0.0193 -0.0080 0.0075  149  THR A CG2 
1222 N N   . ASP A 150 ? 0.1786 0.1589 0.1755 -0.0153 -0.0080 0.0075  150  ASP A N   
1223 C CA  . ASP A 150 ? 0.1572 0.1525 0.1693 -0.0053 -0.0088 -0.0041 150  ASP A CA  
1224 C C   . ASP A 150 ? 0.1668 0.1591 0.1665 -0.0109 -0.0088 -0.0072 150  ASP A C   
1225 O O   . ASP A 150 ? 0.1676 0.1663 0.1761 -0.0140 -0.0098 -0.0091 150  ASP A O   
1226 C CB  . ASP A 150 ? 0.1614 0.1594 0.1652 -0.0059 -0.0075 0.0019  150  ASP A CB  
1227 C CG  . ASP A 150 ? 0.1818 0.1885 0.1760 -0.0030 -0.0086 0.0005  150  ASP A CG  
1228 O OD1 . ASP A 150 ? 0.2173 0.1795 0.1964 -0.0133 -0.0263 0.0145  150  ASP A OD1 
1229 O OD2 . ASP A 150 ? 0.1837 0.1887 0.1967 -0.0113 0.0015  -0.0107 150  ASP A OD2 
1230 N N   . VAL A 151 ? 0.1449 0.1483 0.1434 -0.0105 -0.0001 -0.0051 151  VAL A N   
1231 C CA  . VAL A 151 ? 0.1458 0.1463 0.1507 -0.0045 -0.0064 -0.0001 151  VAL A CA  
1232 C C   . VAL A 151 ? 0.1517 0.1570 0.1476 -0.0065 -0.0025 -0.0047 151  VAL A C   
1233 O O   . VAL A 151 ? 0.1661 0.1499 0.1442 -0.0196 0.0001  -0.0016 151  VAL A O   
1234 C CB  . VAL A 151 ? 0.1545 0.1472 0.1691 0.0010  -0.0101 -0.0063 151  VAL A CB  
1235 C CG1 . VAL A 151 ? 0.1734 0.1869 0.1904 -0.0078 -0.0114 0.0009  151  VAL A CG1 
1236 C CG2 . VAL A 151 ? 0.1981 0.1618 0.2190 -0.0018 -0.0097 0.0044  151  VAL A CG2 
1237 N N   . ILE A 152 ? 0.1413 0.1329 0.1401 -0.0128 -0.0065 -0.0130 152  ILE A N   
1238 C CA  . ILE A 152 ? 0.1385 0.1365 0.1463 -0.0047 0.0014  -0.0078 152  ILE A CA  
1239 C C   . ILE A 152 ? 0.1435 0.1474 0.1338 -0.0074 -0.0002 -0.0080 152  ILE A C   
1240 O O   . ILE A 152 ? 0.1612 0.1546 0.1333 -0.0111 0.0141  0.0013  152  ILE A O   
1241 C CB  . ILE A 152 ? 0.1384 0.1324 0.1463 -0.0051 0.0029  -0.0127 152  ILE A CB  
1242 C CG1 . ILE A 152 ? 0.1378 0.1093 0.1522 -0.0046 0.0021  0.0060  152  ILE A CG1 
1243 C CG2 . ILE A 152 ? 0.1449 0.1229 0.1521 -0.0040 0.0000  -0.0043 152  ILE A CG2 
1244 C CD1 . ILE A 152 ? 0.1731 0.1225 0.1675 -0.0142 0.0042  0.0016  152  ILE A CD1 
1245 N N   . ASN A 153 ? 0.1334 0.1422 0.1153 -0.0135 0.0066  -0.0041 153  ASN A N   
1246 C CA  . ASN A 153 ? 0.1326 0.1418 0.1149 -0.0045 0.0076  -0.0046 153  ASN A CA  
1247 C C   . ASN A 153 ? 0.1549 0.1459 0.1341 -0.0029 0.0086  -0.0021 153  ASN A C   
1248 O O   . ASN A 153 ? 0.1886 0.1499 0.1449 -0.0047 0.0084  -0.0059 153  ASN A O   
1249 C CB  . ASN A 153 ? 0.1389 0.1509 0.1045 -0.0088 0.0097  0.0111  153  ASN A CB  
1250 C CG  . ASN A 153 ? 0.1433 0.1396 0.1305 -0.0068 0.0095  0.0087  153  ASN A CG  
1251 O OD1 . ASN A 153 ? 0.1712 0.1665 0.1847 0.0159  0.0147  -0.0083 153  ASN A OD1 
1252 N ND2 . ASN A 153 ? 0.1531 0.1414 0.1506 -0.0143 0.0005  -0.0024 153  ASN A ND2 
1253 N N   . ILE A 154 ? 0.1402 0.1241 0.1281 -0.0099 0.0043  -0.0065 154  ILE A N   
1254 C CA  . ILE A 154 ? 0.1488 0.1430 0.1294 -0.0104 0.0079  0.0001  154  ILE A CA  
1255 C C   . ILE A 154 ? 0.1558 0.1428 0.1415 -0.0103 -0.0026 0.0029  154  ILE A C   
1256 O O   . ILE A 154 ? 0.1498 0.1291 0.1443 -0.0070 0.0051  0.0066  154  ILE A O   
1257 C CB  . ILE A 154 ? 0.1501 0.1388 0.1339 -0.0089 0.0063  0.0014  154  ILE A CB  
1258 C CG1 . ILE A 154 ? 0.1580 0.1687 0.1361 0.0001  0.0034  0.0104  154  ILE A CG1 
1259 C CG2 . ILE A 154 ? 0.1512 0.1479 0.1402 -0.0063 0.0085  -0.0034 154  ILE A CG2 
1260 C CD1 . ILE A 154 ? 0.1459 0.1524 0.1609 -0.0065 0.0153  0.0234  154  ILE A CD1 
1261 N N   . GLY A 155 ? 0.1539 0.1340 0.1478 -0.0162 0.0008  0.0096  155  GLY A N   
1262 C CA  . GLY A 155 ? 0.1448 0.1334 0.1650 -0.0055 0.0047  0.0069  155  GLY A CA  
1263 C C   . GLY A 155 ? 0.1616 0.1444 0.1764 -0.0009 0.0079  0.0102  155  GLY A C   
1264 O O   . GLY A 155 ? 0.1626 0.1507 0.1847 -0.0019 0.0177  0.0081  155  GLY A O   
1265 N N   . ILE A 156 ? 0.1694 0.1412 0.1947 0.0004  0.0069  0.0089  156  ILE A N   
1266 C CA  . ILE A 156 ? 0.1752 0.1516 0.1911 -0.0111 0.0094  0.0044  156  ILE A CA  
1267 C C   . ILE A 156 ? 0.1707 0.1584 0.1836 0.0018  0.0093  -0.0003 156  ILE A C   
1268 O O   . ILE A 156 ? 0.1730 0.1493 0.1583 -0.0068 -0.0039 0.0043  156  ILE A O   
1269 C CB  . ILE A 156 ? 0.1954 0.1725 0.2027 -0.0056 -0.0024 0.0018  156  ILE A CB  
1270 C CG1 . ILE A 156 ? 0.1973 0.1684 0.2227 0.0033  0.0025  -0.0063 156  ILE A CG1 
1271 C CG2 . ILE A 156 ? 0.2114 0.1480 0.1714 -0.0053 -0.0148 0.0047  156  ILE A CG2 
1272 C CD1 . ILE A 156 ? 0.2049 0.2103 0.1896 -0.0116 0.0185  -0.0058 156  ILE A CD1 
1273 N N   . GLY A 157 ? 0.1602 0.1567 0.1814 -0.0061 0.0249  0.0048  157  GLY A N   
1274 C CA  . GLY A 157 ? 0.1501 0.1562 0.1759 -0.0030 0.0171  -0.0114 157  GLY A CA  
1275 C C   . GLY A 157 ? 0.1474 0.1427 0.1655 -0.0027 0.0057  -0.0041 157  GLY A C   
1276 O O   . GLY A 157 ? 0.1601 0.1429 0.1467 -0.0050 0.0018  0.0064  157  GLY A O   
1277 N N   . GLY A 158 ? 0.1300 0.1354 0.1547 0.0045  0.0159  -0.0011 158  GLY A N   
1278 C CA  . GLY A 158 ? 0.1469 0.1262 0.1635 -0.0038 0.0131  -0.0130 158  GLY A CA  
1279 C C   . GLY A 158 ? 0.1677 0.1296 0.1574 -0.0032 0.0114  0.0017  158  GLY A C   
1280 O O   . GLY A 158 ? 0.1708 0.1280 0.1548 -0.0194 0.0096  -0.0029 158  GLY A O   
1281 N N   . SER A 159 ? 0.1666 0.1306 0.1641 -0.0088 0.0060  0.0025  159  SER A N   
1282 C CA  . SER A 159 ? 0.1632 0.1519 0.1539 -0.0123 -0.0063 0.0107  159  SER A CA  
1283 C C   . SER A 159 ? 0.1633 0.1592 0.1659 -0.0109 -0.0072 0.0063  159  SER A C   
1284 O O   . SER A 159 ? 0.1911 0.1739 0.1845 -0.0212 -0.0118 0.0136  159  SER A O   
1285 C CB  . SER A 159 ? 0.1473 0.1484 0.1436 -0.0156 -0.0011 0.0106  159  SER A CB  
1286 O OG  . SER A 159 ? 0.1696 0.1511 0.1482 -0.0077 0.0053  0.0105  159  SER A OG  
1287 N N   . ASP A 160 ? 0.1345 0.1326 0.1465 -0.0002 -0.0067 0.0043  160  ASP A N   
1288 C CA  . ASP A 160 ? 0.1433 0.1431 0.1477 0.0021  -0.0008 -0.0019 160  ASP A CA  
1289 C C   . ASP A 160 ? 0.1418 0.1450 0.1438 -0.0009 -0.0025 -0.0050 160  ASP A C   
1290 O O   . ASP A 160 ? 0.1337 0.1562 0.1485 -0.0033 -0.0032 0.0002  160  ASP A O   
1291 C CB  . ASP A 160 ? 0.1407 0.1457 0.1532 0.0109  -0.0050 -0.0015 160  ASP A CB  
1292 C CG  . ASP A 160 ? 0.1487 0.1584 0.1672 -0.0033 -0.0106 -0.0033 160  ASP A CG  
1293 O OD1 . ASP A 160 ? 0.1350 0.1596 0.1550 -0.0194 0.0064  -0.0013 160  ASP A OD1 
1294 O OD2 . ASP A 160 ? 0.1530 0.1696 0.1956 -0.0198 0.0075  0.0149  160  ASP A OD2 
1295 N N   . LEU A 161 ? 0.1275 0.1452 0.1469 -0.0026 -0.0056 -0.0037 161  LEU A N   
1296 C CA  . LEU A 161 ? 0.1446 0.1445 0.1568 -0.0103 0.0043  -0.0030 161  LEU A CA  
1297 C C   . LEU A 161 ? 0.1444 0.1418 0.1486 -0.0054 -0.0001 0.0005  161  LEU A C   
1298 O O   . LEU A 161 ? 0.1268 0.1409 0.1504 -0.0060 0.0053  0.0022  161  LEU A O   
1299 C CB  . LEU A 161 ? 0.1704 0.1575 0.1877 -0.0227 -0.0036 0.0037  161  LEU A CB  
1300 C CG  . LEU A 161 ? 0.2432 0.2402 0.2886 0.0068  -0.0097 -0.0205 161  LEU A CG  
1301 C CD1 . LEU A 161 ? 0.2509 0.2522 0.2595 -0.0081 0.0176  -0.0124 161  LEU A CD1 
1302 C CD2 . LEU A 161 ? 0.2347 0.1925 0.2509 -0.0043 0.0154  -0.0092 161  LEU A CD2 
1303 N N   . GLY A 162 ? 0.1278 0.1282 0.1266 -0.0026 -0.0046 -0.0032 162  GLY A N   
1304 C CA  . GLY A 162 ? 0.1361 0.1378 0.1338 -0.0067 -0.0056 0.0031  162  GLY A CA  
1305 C C   . GLY A 162 ? 0.1377 0.1315 0.1281 -0.0072 -0.0067 0.0100  162  GLY A C   
1306 O O   . GLY A 162 ? 0.1475 0.1291 0.1262 -0.0096 0.0038  0.0046  162  GLY A O   
1307 N N   . PRO A 163 ? 0.1399 0.1327 0.1330 -0.0115 -0.0081 0.0126  163  PRO A N   
1308 C CA  . PRO A 163 ? 0.1360 0.1356 0.1295 -0.0073 -0.0114 0.0120  163  PRO A CA  
1309 C C   . PRO A 163 ? 0.1391 0.1260 0.1286 -0.0026 -0.0079 0.0071  163  PRO A C   
1310 O O   . PRO A 163 ? 0.1377 0.1321 0.1191 -0.0110 -0.0130 0.0200  163  PRO A O   
1311 C CB  . PRO A 163 ? 0.1538 0.1460 0.1531 -0.0133 -0.0062 0.0223  163  PRO A CB  
1312 C CG  . PRO A 163 ? 0.1638 0.1578 0.1544 -0.0096 -0.0164 0.0126  163  PRO A CG  
1313 C CD  . PRO A 163 ? 0.1329 0.1391 0.1375 -0.0104 -0.0100 0.0040  163  PRO A CD  
1314 N N   . LEU A 164 ? 0.1099 0.1222 0.1171 -0.0009 0.0005  0.0107  164  LEU A N   
1315 C CA  . LEU A 164 ? 0.1308 0.1152 0.1058 0.0048  -0.0093 -0.0038 164  LEU A CA  
1316 C C   . LEU A 164 ? 0.1284 0.1265 0.1183 -0.0091 -0.0015 0.0054  164  LEU A C   
1317 O O   . LEU A 164 ? 0.1369 0.1332 0.1082 -0.0058 0.0004  0.0071  164  LEU A O   
1318 C CB  . LEU A 164 ? 0.1253 0.1284 0.1313 0.0090  0.0065  -0.0071 164  LEU A CB  
1319 C CG  . LEU A 164 ? 0.1684 0.1619 0.1621 0.0176  -0.0090 0.0029  164  LEU A CG  
1320 C CD1 . LEU A 164 ? 0.2289 0.2285 0.2317 0.0304  -0.0056 -0.0315 164  LEU A CD1 
1321 C CD2 . LEU A 164 ? 0.2135 0.2300 0.2171 -0.0099 -0.0071 0.0126  164  LEU A CD2 
1322 N N   . MET A 165 ? 0.1290 0.1178 0.1159 -0.0011 -0.0027 0.0073  165  MET A N   
1323 C CA  . MET A 165 ? 0.1259 0.1219 0.1218 -0.0011 0.0078  -0.0033 165  MET A CA  
1324 C C   . MET A 165 ? 0.1378 0.1166 0.1259 0.0018  -0.0029 -0.0010 165  MET A C   
1325 O O   . MET A 165 ? 0.1237 0.1216 0.1380 0.0165  0.0014  -0.0017 165  MET A O   
1326 C CB  . MET A 165 ? 0.1269 0.1304 0.1166 -0.0118 0.0035  0.0070  165  MET A CB  
1327 C CG  . MET A 165 ? 0.1618 0.1405 0.1108 -0.0012 0.0094  0.0144  165  MET A CG  
1328 S SD  . MET A 165 ? 0.1493 0.1550 0.1345 -0.0180 -0.0002 -0.0056 165  MET A SD  
1329 C CE  . MET A 165 ? 0.1170 0.1732 0.1639 0.0078  0.0038  -0.0112 165  MET A CE  
1330 N N   . VAL A 166 ? 0.1328 0.1109 0.1283 0.0110  -0.0015 -0.0068 166  VAL A N   
1331 C CA  . VAL A 166 ? 0.1226 0.1216 0.1275 0.0061  -0.0043 -0.0095 166  VAL A CA  
1332 C C   . VAL A 166 ? 0.1341 0.1260 0.1255 0.0008  -0.0052 -0.0057 166  VAL A C   
1333 O O   . VAL A 166 ? 0.1443 0.1281 0.1298 -0.0036 -0.0010 -0.0020 166  VAL A O   
1334 C CB  . VAL A 166 ? 0.1326 0.1015 0.1303 0.0102  -0.0077 -0.0057 166  VAL A CB  
1335 C CG1 . VAL A 166 ? 0.1497 0.1195 0.1434 0.0027  -0.0049 -0.0210 166  VAL A CG1 
1336 C CG2 . VAL A 166 ? 0.1212 0.1345 0.1196 -0.0084 0.0096  -0.0080 166  VAL A CG2 
1337 N N   . THR A 167 ? 0.1166 0.1188 0.1178 -0.0101 -0.0032 -0.0055 167  THR A N   
1338 C CA  . THR A 167 ? 0.1238 0.1301 0.1294 -0.0073 -0.0013 0.0013  167  THR A CA  
1339 C C   . THR A 167 ? 0.1207 0.1236 0.1177 -0.0064 -0.0032 -0.0029 167  THR A C   
1340 O O   . THR A 167 ? 0.1321 0.1525 0.1277 -0.0168 -0.0057 0.0021  167  THR A O   
1341 C CB  . THR A 167 ? 0.1526 0.1217 0.1194 0.0053  -0.0059 0.0005  167  THR A CB  
1342 O OG1 . THR A 167 ? 0.1457 0.1264 0.1280 -0.0087 0.0157  -0.0066 167  THR A OG1 
1343 C CG2 . THR A 167 ? 0.1399 0.1417 0.1346 0.0048  -0.0095 0.0219  167  THR A CG2 
1344 N N   . GLU A 168 ? 0.1223 0.1363 0.1264 0.0058  0.0022  0.0046  168  GLU A N   
1345 C CA  . GLU A 168 ? 0.1311 0.1256 0.1197 -0.0014 0.0045  -0.0016 168  GLU A CA  
1346 C C   . GLU A 168 ? 0.1262 0.1328 0.1208 -0.0012 0.0028  -0.0013 168  GLU A C   
1347 O O   . GLU A 168 ? 0.1492 0.1510 0.1302 -0.0048 -0.0012 -0.0034 168  GLU A O   
1348 C CB  . GLU A 168 ? 0.1202 0.1183 0.1242 -0.0007 0.0145  -0.0069 168  GLU A CB  
1349 C CG  . GLU A 168 ? 0.1255 0.1541 0.1326 -0.0076 0.0155  -0.0072 168  GLU A CG  
1350 C CD  . GLU A 168 ? 0.1300 0.1431 0.1446 -0.0049 -0.0059 0.0069  168  GLU A CD  
1351 O OE1 . GLU A 168 ? 0.1498 0.1819 0.1821 0.0017  0.0053  0.0450  168  GLU A OE1 
1352 O OE2 . GLU A 168 ? 0.1369 0.1654 0.1415 -0.0088 -0.0040 0.0210  168  GLU A OE2 
1353 N N   . ALA A 169 ? 0.1219 0.1315 0.1228 -0.0054 0.0010  -0.0004 169  ALA A N   
1354 C CA  . ALA A 169 ? 0.1205 0.1323 0.1282 -0.0055 0.0057  -0.0102 169  ALA A CA  
1355 C C   . ALA A 169 ? 0.1357 0.1348 0.1430 -0.0096 0.0007  0.0003  169  ALA A C   
1356 O O   . ALA A 169 ? 0.1463 0.1309 0.1451 -0.0066 0.0000  0.0000  169  ALA A O   
1357 C CB  . ALA A 169 ? 0.1273 0.1434 0.1419 -0.0114 0.0051  0.0006  169  ALA A CB  
1358 N N   . LEU A 170 ? 0.1504 0.1219 0.1381 -0.0086 0.0019  0.0044  170  LEU A N   
1359 C CA  . LEU A 170 ? 0.1478 0.1359 0.1605 -0.0030 -0.0002 0.0029  170  LEU A CA  
1360 C C   . LEU A 170 ? 0.1580 0.1504 0.1751 -0.0003 -0.0027 0.0098  170  LEU A C   
1361 O O   . LEU A 170 ? 0.1629 0.1448 0.1704 -0.0068 -0.0085 0.0095  170  LEU A O   
1362 C CB  . LEU A 170 ? 0.1476 0.1545 0.1571 -0.0027 -0.0029 0.0069  170  LEU A CB  
1363 C CG  . LEU A 170 ? 0.1501 0.1400 0.1246 0.0041  0.0000  0.0039  170  LEU A CG  
1364 C CD1 . LEU A 170 ? 0.1515 0.1408 0.1163 0.0007  -0.0112 0.0064  170  LEU A CD1 
1365 C CD2 . LEU A 170 ? 0.1587 0.1332 0.1146 -0.0017 0.0184  -0.0014 170  LEU A CD2 
1366 N N   . LYS A 171 ? 0.1619 0.1723 0.1915 0.0052  0.0013  0.0119  171  LYS A N   
1367 C CA  . LYS A 171 ? 0.1813 0.1855 0.2050 0.0019  -0.0038 0.0098  171  LYS A CA  
1368 C C   . LYS A 171 ? 0.1898 0.1939 0.2087 -0.0065 -0.0088 0.0122  171  LYS A C   
1369 O O   . LYS A 171 ? 0.1872 0.2078 0.2249 -0.0114 -0.0182 0.0240  171  LYS A O   
1370 C CB  . LYS A 171 ? 0.1831 0.1900 0.2196 0.0073  -0.0063 0.0223  171  LYS A CB  
1371 C CG  . LYS A 171 ? 0.2327 0.2614 0.2420 -0.0001 0.0101  0.0210  171  LYS A CG  
1372 C CD  . LYS A 171 ? 0.2718 0.2611 0.2265 -0.0048 0.0058  0.0090  171  LYS A CD  
1373 C CE  . LYS A 171 ? 0.2677 0.2677 0.2181 -0.0157 0.0038  0.0135  171  LYS A CE  
1374 N NZ  . LYS A 171 ? 0.2552 0.2362 0.2234 0.0023  0.0046  0.0135  171  LYS A NZ  
1375 N N   . PRO A 172 ? 0.2190 0.2070 0.2086 -0.0126 -0.0150 0.0045  172  PRO A N   
1376 C CA  . PRO A 172 ? 0.2368 0.2145 0.2165 -0.0159 -0.0078 -0.0021 172  PRO A CA  
1377 C C   . PRO A 172 ? 0.2502 0.2242 0.2297 -0.0129 -0.0165 -0.0040 172  PRO A C   
1378 O O   . PRO A 172 ? 0.3076 0.2447 0.2455 -0.0254 -0.0245 -0.0012 172  PRO A O   
1379 C CB  . PRO A 172 ? 0.2569 0.2349 0.2335 -0.0155 -0.0053 0.0016  172  PRO A CB  
1380 C CG  . PRO A 172 ? 0.2415 0.2191 0.2204 -0.0038 0.0021  -0.0036 172  PRO A CG  
1381 C CD  . PRO A 172 ? 0.2033 0.1944 0.1925 -0.0096 -0.0081 0.0132  172  PRO A CD  
1382 N N   . TYR A 173 ? 0.2359 0.1991 0.2007 -0.0126 -0.0195 -0.0021 173  TYR A N   
1383 C CA  . TYR A 173 ? 0.2285 0.2038 0.2051 -0.0067 -0.0113 -0.0065 173  TYR A CA  
1384 C C   . TYR A 173 ? 0.2348 0.2046 0.2040 -0.0101 -0.0141 -0.0058 173  TYR A C   
1385 O O   . TYR A 173 ? 0.2583 0.2075 0.2071 -0.0072 -0.0205 -0.0044 173  TYR A O   
1386 C CB  . TYR A 173 ? 0.2220 0.1962 0.2008 -0.0005 -0.0111 -0.0014 173  TYR A CB  
1387 C CG  . TYR A 173 ? 0.1928 0.1848 0.1909 -0.0011 0.0000  -0.0069 173  TYR A CG  
1388 C CD1 . TYR A 173 ? 0.2165 0.1757 0.1931 0.0020  -0.0095 -0.0110 173  TYR A CD1 
1389 C CD2 . TYR A 173 ? 0.1736 0.1691 0.1798 -0.0018 -0.0092 -0.0027 173  TYR A CD2 
1390 C CE1 . TYR A 173 ? 0.1827 0.1585 0.1830 -0.0016 -0.0174 -0.0190 173  TYR A CE1 
1391 C CE2 . TYR A 173 ? 0.1825 0.1912 0.1590 0.0092  -0.0089 -0.0148 173  TYR A CE2 
1392 C CZ  . TYR A 173 ? 0.1709 0.1727 0.1852 0.0028  -0.0077 -0.0008 173  TYR A CZ  
1393 O OH  . TYR A 173 ? 0.1695 0.1676 0.1672 -0.0127 -0.0217 -0.0290 173  TYR A OH  
1394 N N   . SER A 174 ? 0.2267 0.2195 0.1969 -0.0179 -0.0182 -0.0035 174  SER A N   
1395 C CA  . SER A 174 ? 0.2448 0.2437 0.2267 -0.0204 -0.0092 0.0031  174  SER A CA  
1396 C C   . SER A 174 ? 0.2655 0.2666 0.2470 -0.0255 -0.0037 -0.0011 174  SER A C   
1397 O O   . SER A 174 ? 0.2704 0.2562 0.2326 -0.0345 -0.0058 -0.0043 174  SER A O   
1398 C CB  . SER A 174 ? 0.2305 0.2437 0.2352 -0.0052 -0.0113 0.0075  174  SER A CB  
1399 O OG  . SER A 174 ? 0.2147 0.2487 0.2336 -0.0190 -0.0161 0.0248  174  SER A OG  
1400 N N   . SER A 175 ? 0.2979 0.2844 0.2579 -0.0291 -0.0052 -0.0105 175  SER A N   
1401 C CA  . SER A 175 ? 0.3334 0.3116 0.3003 -0.0259 -0.0014 -0.0097 175  SER A CA  
1402 C C   . SER A 175 ? 0.3306 0.2986 0.2918 -0.0179 -0.0017 -0.0162 175  SER A C   
1403 O O   . SER A 175 ? 0.3460 0.3053 0.3041 -0.0222 0.0077  -0.0136 175  SER A O   
1404 C CB  . SER A 175 ? 0.3424 0.3328 0.3096 -0.0210 -0.0011 -0.0131 175  SER A CB  
1405 O OG  . SER A 175 ? 0.4152 0.3627 0.3841 -0.0213 -0.0021 -0.0067 175  SER A OG  
1406 N N   . GLY A 176 ? 0.3453 0.2966 0.2950 -0.0191 -0.0011 -0.0152 176  GLY A N   
1407 C CA  . GLY A 176 ? 0.3422 0.2928 0.2899 -0.0133 -0.0036 -0.0093 176  GLY A CA  
1408 C C   . GLY A 176 ? 0.3380 0.2826 0.2944 -0.0091 -0.0036 -0.0039 176  GLY A C   
1409 O O   . GLY A 176 ? 0.3513 0.2924 0.2982 -0.0198 0.0055  -0.0005 176  GLY A O   
1410 N N   . GLY A 177 ? 0.3073 0.2624 0.2705 -0.0127 -0.0003 -0.0095 177  GLY A N   
1411 C CA  . GLY A 177 ? 0.2669 0.2492 0.2493 -0.0015 0.0026  -0.0089 177  GLY A CA  
1412 C C   . GLY A 177 ? 0.2522 0.2443 0.2305 -0.0005 0.0028  -0.0001 177  GLY A C   
1413 O O   . GLY A 177 ? 0.2522 0.2549 0.2182 -0.0077 -0.0028 0.0011  177  GLY A O   
1414 N N   . PRO A 178 ? 0.2298 0.2148 0.2155 -0.0043 -0.0028 -0.0093 178  PRO A N   
1415 C CA  . PRO A 178 ? 0.2172 0.2025 0.2041 -0.0037 -0.0011 0.0000  178  PRO A CA  
1416 C C   . PRO A 178 ? 0.2097 0.2048 0.2036 -0.0063 -0.0067 -0.0050 178  PRO A C   
1417 O O   . PRO A 178 ? 0.2110 0.2046 0.2152 -0.0040 0.0106  0.0027  178  PRO A O   
1418 C CB  . PRO A 178 ? 0.2100 0.2002 0.2015 0.0041  -0.0084 -0.0079 178  PRO A CB  
1419 C CG  . PRO A 178 ? 0.2183 0.2121 0.2193 -0.0032 0.0040  -0.0160 178  PRO A CG  
1420 C CD  . PRO A 178 ? 0.2333 0.2204 0.2059 -0.0017 0.0032  -0.0045 178  PRO A CD  
1421 N N   . ARG A 179 ? 0.2040 0.1784 0.1804 -0.0064 -0.0117 -0.0098 179  ARG A N   
1422 C CA  . ARG A 179 ? 0.2042 0.1767 0.1785 -0.0077 -0.0108 -0.0056 179  ARG A CA  
1423 C C   . ARG A 179 ? 0.1834 0.1676 0.1695 -0.0031 -0.0070 -0.0025 179  ARG A C   
1424 O O   . ARG A 179 ? 0.2174 0.1503 0.1691 -0.0213 -0.0150 -0.0050 179  ARG A O   
1425 C CB  . ARG A 179 ? 0.2015 0.1903 0.1910 0.0005  -0.0144 -0.0099 179  ARG A CB  
1426 C CG  . ARG A 179 ? 0.2359 0.2179 0.2156 -0.0040 -0.0207 -0.0092 179  ARG A CG  
1427 C CD  . ARG A 179 ? 0.2547 0.2655 0.2560 0.0022  0.0022  0.0029  179  ARG A CD  
1428 N NE  . ARG A 179 ? 0.2442 0.2448 0.2544 -0.0010 -0.0043 0.0014  179  ARG A NE  
1429 C CZ  . ARG A 179 ? 0.2908 0.2832 0.2693 -0.0183 -0.0067 0.0001  179  ARG A CZ  
1430 N NH1 . ARG A 179 ? 0.3030 0.2998 0.2793 -0.0160 -0.0145 -0.0040 179  ARG A NH1 
1431 N NH2 . ARG A 179 ? 0.2652 0.2609 0.2542 -0.0138 -0.0151 -0.0047 179  ARG A NH2 
1432 N N   . VAL A 180 ? 0.1771 0.1596 0.1594 -0.0104 -0.0063 -0.0037 180  VAL A N   
1433 C CA  . VAL A 180 ? 0.1631 0.1595 0.1568 -0.0051 -0.0047 -0.0005 180  VAL A CA  
1434 C C   . VAL A 180 ? 0.1595 0.1533 0.1489 -0.0056 -0.0026 0.0054  180  VAL A C   
1435 O O   . VAL A 180 ? 0.1802 0.1696 0.1391 0.0076  -0.0150 -0.0021 180  VAL A O   
1436 C CB  . VAL A 180 ? 0.1841 0.1717 0.1659 0.0026  0.0128  0.0097  180  VAL A CB  
1437 C CG1 . VAL A 180 ? 0.2131 0.2079 0.2266 0.0065  0.0168  0.0040  180  VAL A CG1 
1438 C CG2 . VAL A 180 ? 0.1868 0.1970 0.1578 -0.0067 0.0134  0.0152  180  VAL A CG2 
1439 N N   . TRP A 181 ? 0.1556 0.1433 0.1431 0.0000  -0.0018 0.0002  181  TRP A N   
1440 C CA  . TRP A 181 ? 0.1467 0.1426 0.1333 -0.0046 0.0068  -0.0032 181  TRP A CA  
1441 C C   . TRP A 181 ? 0.1434 0.1483 0.1430 -0.0006 0.0064  0.0027  181  TRP A C   
1442 O O   . TRP A 181 ? 0.1704 0.1630 0.1595 -0.0176 -0.0033 0.0032  181  TRP A O   
1443 C CB  . TRP A 181 ? 0.1363 0.1553 0.1432 0.0017  0.0020  -0.0002 181  TRP A CB  
1444 C CG  . TRP A 181 ? 0.1621 0.1738 0.1727 -0.0064 0.0091  -0.0098 181  TRP A CG  
1445 C CD1 . TRP A 181 ? 0.1501 0.1600 0.1602 -0.0153 0.0017  0.0045  181  TRP A CD1 
1446 C CD2 . TRP A 181 ? 0.2020 0.1999 0.2095 -0.0013 -0.0114 0.0009  181  TRP A CD2 
1447 N NE1 . TRP A 181 ? 0.1635 0.1936 0.1816 0.0037  -0.0034 0.0055  181  TRP A NE1 
1448 C CE2 . TRP A 181 ? 0.2054 0.1984 0.2122 0.0007  -0.0168 0.0015  181  TRP A CE2 
1449 C CE3 . TRP A 181 ? 0.2356 0.2259 0.2542 0.0014  -0.0014 0.0101  181  TRP A CE3 
1450 C CZ2 . TRP A 181 ? 0.2112 0.2262 0.2361 0.0008  -0.0114 0.0022  181  TRP A CZ2 
1451 C CZ3 . TRP A 181 ? 0.2431 0.2527 0.2766 -0.0016 -0.0105 -0.0008 181  TRP A CZ3 
1452 C CH2 . TRP A 181 ? 0.2479 0.2408 0.2742 0.0019  -0.0142 -0.0040 181  TRP A CH2 
1453 N N   . TYR A 182 ? 0.1442 0.1416 0.1408 -0.0046 0.0091  -0.0065 182  TYR A N   
1454 C CA  . TYR A 182 ? 0.1542 0.1431 0.1293 0.0006  0.0063  -0.0053 182  TYR A CA  
1455 C C   . TYR A 182 ? 0.1737 0.1482 0.1439 0.0064  0.0037  -0.0050 182  TYR A C   
1456 O O   . TYR A 182 ? 0.2285 0.1808 0.1629 0.0253  0.0018  -0.0053 182  TYR A O   
1457 C CB  . TYR A 182 ? 0.1367 0.1467 0.1427 -0.0084 0.0082  -0.0039 182  TYR A CB  
1458 C CG  . TYR A 182 ? 0.1476 0.1269 0.1439 -0.0007 0.0035  0.0054  182  TYR A CG  
1459 C CD1 . TYR A 182 ? 0.1363 0.1541 0.1500 -0.0007 0.0020  0.0080  182  TYR A CD1 
1460 C CD2 . TYR A 182 ? 0.1658 0.1273 0.1393 -0.0135 0.0122  0.0023  182  TYR A CD2 
1461 C CE1 . TYR A 182 ? 0.1398 0.1548 0.1424 -0.0003 0.0049  0.0028  182  TYR A CE1 
1462 C CE2 . TYR A 182 ? 0.1681 0.1542 0.1464 0.0087  0.0059  0.0083  182  TYR A CE2 
1463 C CZ  . TYR A 182 ? 0.1330 0.1457 0.1376 -0.0014 0.0124  0.0006  182  TYR A CZ  
1464 O OH  . TYR A 182 ? 0.1661 0.1615 0.1174 0.0026  0.0046  -0.0053 182  TYR A OH  
1465 N N   . VAL A 183 ? 0.1724 0.1322 0.1373 0.0018  0.0106  -0.0055 183  VAL A N   
1466 C CA  . VAL A 183 ? 0.1608 0.1350 0.1358 -0.0040 0.0055  -0.0046 183  VAL A CA  
1467 C C   . VAL A 183 ? 0.1479 0.1367 0.1347 0.0027  0.0003  0.0014  183  VAL A C   
1468 O O   . VAL A 183 ? 0.1556 0.1459 0.1692 0.0005  -0.0020 0.0033  183  VAL A O   
1469 C CB  . VAL A 183 ? 0.1542 0.1547 0.1454 -0.0077 0.0079  -0.0062 183  VAL A CB  
1470 C CG1 . VAL A 183 ? 0.1891 0.1620 0.1446 -0.0030 0.0062  -0.0127 183  VAL A CG1 
1471 C CG2 . VAL A 183 ? 0.1718 0.1956 0.1573 -0.0124 -0.0054 -0.0026 183  VAL A CG2 
1472 N N   . SER A 184 ? 0.1413 0.1260 0.1270 -0.0015 -0.0043 0.0010  184  SER A N   
1473 C CA  . SER A 184 ? 0.1385 0.1377 0.1224 -0.0020 0.0046  0.0020  184  SER A CA  
1474 C C   . SER A 184 ? 0.1380 0.1276 0.1271 0.0006  0.0017  0.0030  184  SER A C   
1475 O O   . SER A 184 ? 0.1546 0.1296 0.1134 -0.0022 -0.0072 0.0020  184  SER A O   
1476 C CB  . SER A 184 ? 0.1499 0.1521 0.1340 0.0031  0.0091  0.0138  184  SER A CB  
1477 O OG  . SER A 184 ? 0.1561 0.1609 0.1413 0.0119  -0.0048 0.0080  184  SER A OG  
1478 N N   . ASN A 185 ? 0.1401 0.1224 0.1275 0.0002  0.0008  -0.0050 185  ASN A N   
1479 C CA  . ASN A 185 ? 0.1239 0.1184 0.1149 0.0084  0.0065  -0.0010 185  ASN A CA  
1480 C C   . ASN A 185 ? 0.1316 0.1291 0.1266 -0.0033 0.0017  0.0012  185  ASN A C   
1481 O O   . ASN A 185 ? 0.1453 0.1171 0.1129 -0.0006 0.0132  0.0147  185  ASN A O   
1482 C CB  . ASN A 185 ? 0.1152 0.1071 0.1354 0.0042  0.0000  0.0003  185  ASN A CB  
1483 C CG  . ASN A 185 ? 0.1145 0.1118 0.1279 0.0062  0.0021  0.0042  185  ASN A CG  
1484 O OD1 . ASN A 185 ? 0.1558 0.1249 0.1397 -0.0019 0.0088  0.0040  185  ASN A OD1 
1485 N ND2 . ASN A 185 ? 0.1151 0.1360 0.1173 0.0169  0.0141  0.0150  185  ASN A ND2 
1486 N N   . ILE A 186 ? 0.1284 0.1286 0.1007 0.0033  0.0131  0.0057  186  ILE A N   
1487 C CA  . ILE A 186 ? 0.1290 0.1359 0.1173 0.0025  0.0091  0.0021  186  ILE A CA  
1488 C C   . ILE A 186 ? 0.1364 0.1359 0.1271 0.0001  0.0039  0.0094  186  ILE A C   
1489 O O   . ILE A 186 ? 0.1441 0.1370 0.1308 0.0037  0.0123  0.0169  186  ILE A O   
1490 C CB  . ILE A 186 ? 0.1404 0.1373 0.1137 0.0023  0.0050  -0.0021 186  ILE A CB  
1491 C CG1 . ILE A 186 ? 0.1703 0.1605 0.1442 -0.0114 0.0085  0.0100  186  ILE A CG1 
1492 C CG2 . ILE A 186 ? 0.1620 0.1435 0.1625 0.0013  0.0028  -0.0021 186  ILE A CG2 
1493 C CD1 . ILE A 186 ? 0.1879 0.1530 0.1643 0.0076  -0.0012 0.0081  186  ILE A CD1 
1494 N N   . ASP A 187 ? 0.1191 0.1348 0.1173 0.0085  -0.0004 0.0110  187  ASP A N   
1495 C CA  . ASP A 187 ? 0.1300 0.1378 0.1206 0.0045  0.0008  0.0153  187  ASP A CA  
1496 C C   . ASP A 187 ? 0.1358 0.1376 0.1207 0.0080  0.0028  0.0044  187  ASP A C   
1497 O O   . ASP A 187 ? 0.1360 0.1419 0.1210 0.0035  -0.0157 0.0000  187  ASP A O   
1498 C CB  . ASP A 187 ? 0.1261 0.1341 0.1099 0.0120  0.0047  0.0201  187  ASP A CB  
1499 C CG  . ASP A 187 ? 0.1249 0.1494 0.1317 -0.0048 -0.0031 0.0028  187  ASP A CG  
1500 O OD1 . ASP A 187 ? 0.1470 0.1502 0.1264 -0.0094 0.0002  0.0184  187  ASP A OD1 
1501 O OD2 . ASP A 187 ? 0.1355 0.1618 0.1487 0.0137  -0.0066 0.0144  187  ASP A OD2 
1502 N N   . GLY A 188 ? 0.1262 0.1467 0.1315 -0.0042 0.0090  0.0123  188  GLY A N   
1503 C CA  . GLY A 188 ? 0.1449 0.1451 0.1296 0.0002  -0.0001 0.0084  188  GLY A CA  
1504 C C   . GLY A 188 ? 0.1403 0.1528 0.1327 0.0015  0.0043  0.0054  188  GLY A C   
1505 O O   . GLY A 188 ? 0.1301 0.1625 0.1251 0.0059  0.0084  0.0168  188  GLY A O   
1506 N N   . THR A 189 ? 0.1316 0.1347 0.1340 0.0032  -0.0012 0.0116  189  THR A N   
1507 C CA  . THR A 189 ? 0.1445 0.1315 0.1223 0.0021  0.0033  0.0090  189  THR A CA  
1508 C C   . THR A 189 ? 0.1466 0.1428 0.1360 0.0008  0.0036  0.0135  189  THR A C   
1509 O O   . THR A 189 ? 0.1689 0.1411 0.1231 -0.0014 0.0097  0.0211  189  THR A O   
1510 C CB  . THR A 189 ? 0.1595 0.1389 0.1375 0.0096  -0.0070 0.0063  189  THR A CB  
1511 O OG1 . THR A 189 ? 0.1529 0.1535 0.1494 0.0132  0.0000  0.0073  189  THR A OG1 
1512 C CG2 . THR A 189 ? 0.1634 0.1519 0.1466 -0.0056 -0.0020 0.0055  189  THR A CG2 
1513 N N   . HIS A 190 ? 0.1345 0.1379 0.1230 0.0013  0.0107  0.0108  190  HIS A N   
1514 C CA  . HIS A 190 ? 0.1307 0.1377 0.1441 -0.0008 0.0088  0.0022  190  HIS A CA  
1515 C C   . HIS A 190 ? 0.1357 0.1383 0.1427 0.0012  0.0025  -0.0013 190  HIS A C   
1516 O O   . HIS A 190 ? 0.1445 0.1524 0.1553 -0.0131 0.0003  -0.0041 190  HIS A O   
1517 C CB  . HIS A 190 ? 0.1155 0.1493 0.1330 0.0002  0.0102  -0.0114 190  HIS A CB  
1518 C CG  . HIS A 190 ? 0.1501 0.1626 0.1340 -0.0041 0.0140  0.0110  190  HIS A CG  
1519 N ND1 . HIS A 190 ? 0.1399 0.1679 0.1510 0.0015  0.0016  -0.0057 190  HIS A ND1 
1520 C CD2 . HIS A 190 ? 0.1590 0.1853 0.1473 -0.0011 0.0068  0.0080  190  HIS A CD2 
1521 C CE1 . HIS A 190 ? 0.1643 0.1779 0.1445 -0.0030 0.0082  0.0083  190  HIS A CE1 
1522 N NE2 . HIS A 190 ? 0.1494 0.1701 0.1286 0.0094  0.0106  -0.0045 190  HIS A NE2 
1523 N N   . ILE A 191 ? 0.1335 0.1267 0.1447 -0.0010 0.0069  0.0077  191  ILE A N   
1524 C CA  . ILE A 191 ? 0.1376 0.1289 0.1554 -0.0039 0.0010  0.0041  191  ILE A CA  
1525 C C   . ILE A 191 ? 0.1476 0.1347 0.1522 -0.0053 -0.0001 0.0055  191  ILE A C   
1526 O O   . ILE A 191 ? 0.1701 0.1444 0.1632 -0.0116 -0.0011 0.0025  191  ILE A O   
1527 C CB  . ILE A 191 ? 0.1599 0.1215 0.1348 0.0039  0.0066  0.0107  191  ILE A CB  
1528 C CG1 . ILE A 191 ? 0.2059 0.1568 0.1987 -0.0169 0.0172  -0.0075 191  ILE A CG1 
1529 C CG2 . ILE A 191 ? 0.1722 0.1550 0.1499 -0.0068 0.0086  0.0031  191  ILE A CG2 
1530 C CD1 . ILE A 191 ? 0.2215 0.2084 0.2320 0.0059  0.0156  -0.0178 191  ILE A CD1 
1531 N N   . ALA A 192 ? 0.1354 0.1372 0.1410 -0.0107 0.0125  -0.0035 192  ALA A N   
1532 C CA  . ALA A 192 ? 0.1527 0.1529 0.1648 -0.0059 0.0009  -0.0011 192  ALA A CA  
1533 C C   . ALA A 192 ? 0.1689 0.1755 0.1696 -0.0082 0.0000  -0.0022 192  ALA A C   
1534 O O   . ALA A 192 ? 0.1676 0.1814 0.1912 -0.0058 0.0059  -0.0032 192  ALA A O   
1535 C CB  . ALA A 192 ? 0.1567 0.1630 0.1658 -0.0011 0.0065  -0.0042 192  ALA A CB  
1536 N N   . LYS A 193 ? 0.1746 0.1793 0.1689 -0.0053 -0.0069 0.0060  193  LYS A N   
1537 C CA  . LYS A 193 ? 0.1832 0.1905 0.1788 -0.0072 -0.0085 -0.0042 193  LYS A CA  
1538 C C   . LYS A 193 ? 0.1877 0.1943 0.1885 -0.0044 -0.0080 0.0013  193  LYS A C   
1539 O O   . LYS A 193 ? 0.2030 0.2239 0.2074 -0.0073 -0.0109 -0.0027 193  LYS A O   
1540 C CB  . LYS A 193 ? 0.1942 0.1981 0.1900 -0.0037 -0.0134 0.0048  193  LYS A CB  
1541 C CG  . LYS A 193 ? 0.2193 0.2537 0.2406 -0.0011 0.0038  -0.0030 193  LYS A CG  
1542 C CD  . LYS A 193 ? 0.2966 0.2682 0.3064 -0.0012 0.0051  0.0025  193  LYS A CD  
1543 C CE  . LYS A 193 ? 0.2844 0.2937 0.3103 -0.0015 -0.0043 -0.0073 193  LYS A CE  
1544 N NZ  . LYS A 193 ? 0.3132 0.3457 0.3007 0.0087  -0.0013 -0.0013 193  LYS A NZ  
1545 N N   . THR A 194 ? 0.1609 0.1634 0.1783 -0.0015 0.0084  -0.0015 194  THR A N   
1546 C CA  . THR A 194 ? 0.1697 0.1635 0.1856 -0.0059 0.0007  0.0058  194  THR A CA  
1547 C C   . THR A 194 ? 0.1769 0.1674 0.1959 -0.0114 -0.0015 -0.0010 194  THR A C   
1548 O O   . THR A 194 ? 0.1895 0.1462 0.2047 -0.0239 -0.0093 -0.0095 194  THR A O   
1549 C CB  . THR A 194 ? 0.1587 0.1564 0.1774 -0.0068 0.0096  0.0007  194  THR A CB  
1550 O OG1 . THR A 194 ? 0.1835 0.1569 0.1742 -0.0112 0.0097  0.0155  194  THR A OG1 
1551 C CG2 . THR A 194 ? 0.1794 0.1652 0.1747 -0.0001 -0.0008 0.0064  194  THR A CG2 
1552 N N   . LEU A 195 ? 0.1688 0.1621 0.1910 -0.0166 -0.0026 0.0047  195  LEU A N   
1553 C CA  . LEU A 195 ? 0.1708 0.1701 0.1931 -0.0139 -0.0075 0.0049  195  LEU A CA  
1554 C C   . LEU A 195 ? 0.1678 0.1733 0.2084 -0.0144 -0.0036 0.0053  195  LEU A C   
1555 O O   . LEU A 195 ? 0.1790 0.1579 0.2021 -0.0207 -0.0040 0.0021  195  LEU A O   
1556 C CB  . LEU A 195 ? 0.1723 0.1818 0.1892 -0.0051 -0.0013 0.0095  195  LEU A CB  
1557 C CG  . LEU A 195 ? 0.1813 0.1852 0.2026 0.0010  -0.0025 0.0010  195  LEU A CG  
1558 C CD1 . LEU A 195 ? 0.1764 0.1732 0.1953 -0.0160 -0.0024 -0.0011 195  LEU A CD1 
1559 C CD2 . LEU A 195 ? 0.1933 0.1712 0.2264 -0.0008 0.0015  0.0055  195  LEU A CD2 
1560 N N   . ALA A 196 ? 0.1714 0.1798 0.2081 -0.0153 -0.0086 0.0047  196  ALA A N   
1561 C CA  . ALA A 196 ? 0.1965 0.2010 0.2379 0.0005  -0.0089 0.0086  196  ALA A CA  
1562 C C   . ALA A 196 ? 0.2188 0.2163 0.2464 -0.0033 -0.0153 0.0098  196  ALA A C   
1563 O O   . ALA A 196 ? 0.2337 0.2542 0.2854 -0.0102 -0.0207 0.0093  196  ALA A O   
1564 C CB  . ALA A 196 ? 0.2112 0.1974 0.2425 0.0011  -0.0152 0.0065  196  ALA A CB  
1565 N N   . GLN A 197 ? 0.2444 0.2237 0.2387 -0.0048 -0.0114 0.0033  197  GLN A N   
1566 C CA  . GLN A 197 ? 0.2548 0.2398 0.2467 -0.0020 -0.0158 -0.0015 197  GLN A CA  
1567 C C   . GLN A 197 ? 0.2582 0.2337 0.2330 -0.0070 -0.0117 -0.0006 197  GLN A C   
1568 O O   . GLN A 197 ? 0.3013 0.2418 0.2433 -0.0019 -0.0180 -0.0030 197  GLN A O   
1569 C CB  . GLN A 197 ? 0.2781 0.2652 0.2561 -0.0054 -0.0124 -0.0005 197  GLN A CB  
1570 C CG  . GLN A 197 ? 0.3155 0.2882 0.3319 0.0073  -0.0121 -0.0015 197  GLN A CG  
1571 C CD  . GLN A 197 ? 0.3817 0.3792 0.3699 0.0030  0.0057  0.0075  197  GLN A CD  
1572 O OE1 . GLN A 197 ? 0.4097 0.4143 0.4185 -0.0028 -0.0132 0.0013  197  GLN A OE1 
1573 N NE2 . GLN A 197 ? 0.3801 0.3980 0.3740 0.0006  -0.0108 -0.0066 197  GLN A NE2 
1574 N N   . LEU A 198 ? 0.2117 0.2056 0.2112 -0.0155 -0.0150 0.0026  198  LEU A N   
1575 C CA  . LEU A 198 ? 0.2073 0.2030 0.2083 -0.0091 -0.0045 -0.0017 198  LEU A CA  
1576 C C   . LEU A 198 ? 0.2083 0.2017 0.2120 -0.0073 0.0013  0.0003  198  LEU A C   
1577 O O   . LEU A 198 ? 0.2118 0.1969 0.2235 -0.0118 -0.0016 -0.0082 198  LEU A O   
1578 C CB  . LEU A 198 ? 0.2070 0.2116 0.2160 -0.0014 -0.0028 -0.0043 198  LEU A CB  
1579 C CG  . LEU A 198 ? 0.2353 0.2288 0.2282 -0.0055 0.0039  -0.0015 198  LEU A CG  
1580 C CD1 . LEU A 198 ? 0.2492 0.2753 0.2830 0.0000  -0.0070 -0.0116 198  LEU A CD1 
1581 C CD2 . LEU A 198 ? 0.2499 0.2360 0.2307 -0.0091 0.0091  -0.0033 198  LEU A CD2 
1582 N N   . ASN A 199 ? 0.2059 0.1899 0.2075 -0.0084 0.0024  0.0075  199  ASN A N   
1583 C CA  . ASN A 199 ? 0.2140 0.2126 0.2232 -0.0086 0.0078  0.0068  199  ASN A CA  
1584 C C   . ASN A 199 ? 0.2108 0.2006 0.2214 -0.0083 0.0087  0.0029  199  ASN A C   
1585 O O   . ASN A 199 ? 0.1856 0.1918 0.2149 -0.0192 0.0181  0.0018  199  ASN A O   
1586 C CB  . ASN A 199 ? 0.2389 0.2217 0.2445 -0.0103 0.0031  0.0064  199  ASN A CB  
1587 C CG  . ASN A 199 ? 0.2813 0.2671 0.2977 -0.0226 0.0053  0.0139  199  ASN A CG  
1588 O OD1 . ASN A 199 ? 0.2888 0.3202 0.3263 -0.0123 -0.0088 -0.0114 199  ASN A OD1 
1589 N ND2 . ASN A 199 ? 0.3310 0.3353 0.3598 -0.0197 -0.0171 0.0013  199  ASN A ND2 
1590 N N   . PRO A 200 ? 0.1992 0.2023 0.2151 -0.0037 0.0160  0.0003  200  PRO A N   
1591 C CA  . PRO A 200 ? 0.2091 0.1950 0.2024 -0.0012 0.0118  0.0006  200  PRO A CA  
1592 C C   . PRO A 200 ? 0.1926 0.1870 0.2052 -0.0016 0.0114  -0.0015 200  PRO A C   
1593 O O   . PRO A 200 ? 0.1870 0.1615 0.1928 -0.0053 0.0037  -0.0034 200  PRO A O   
1594 C CB  . PRO A 200 ? 0.2151 0.2180 0.2158 0.0016  0.0181  0.0002  200  PRO A CB  
1595 C CG  . PRO A 200 ? 0.2390 0.2552 0.2428 0.0127  0.0074  0.0009  200  PRO A CG  
1596 C CD  . PRO A 200 ? 0.2145 0.2232 0.2179 -0.0013 0.0165  0.0000  200  PRO A CD  
1597 N N   . GLU A 201 ? 0.1961 0.1928 0.2044 0.0000  0.0160  -0.0011 201  GLU A N   
1598 C CA  . GLU A 201 ? 0.2086 0.2036 0.2208 -0.0081 0.0143  -0.0023 201  GLU A CA  
1599 C C   . GLU A 201 ? 0.1923 0.1957 0.2103 -0.0032 0.0073  0.0020  201  GLU A C   
1600 O O   . GLU A 201 ? 0.1808 0.1755 0.2038 -0.0098 0.0110  0.0066  201  GLU A O   
1601 C CB  . GLU A 201 ? 0.2091 0.2136 0.2403 -0.0072 0.0071  -0.0066 201  GLU A CB  
1602 C CG  . GLU A 201 ? 0.2784 0.2739 0.2770 -0.0042 0.0244  -0.0027 201  GLU A CG  
1603 C CD  . GLU A 201 ? 0.3232 0.3637 0.3765 -0.0129 -0.0005 -0.0037 201  GLU A CD  
1604 O OE1 . GLU A 201 ? 0.3689 0.4176 0.4153 0.0074  0.0155  -0.0018 201  GLU A OE1 
1605 O OE2 . GLU A 201 ? 0.3581 0.3909 0.3648 -0.0041 0.0058  0.0010  201  GLU A OE2 
1606 N N   . SER A 202 ? 0.1841 0.1969 0.2004 -0.0121 -0.0012 -0.0016 202  SER A N   
1607 C CA  . SER A 202 ? 0.1828 0.1877 0.1911 -0.0134 -0.0022 -0.0017 202  SER A CA  
1608 C C   . SER A 202 ? 0.1794 0.1904 0.1897 -0.0167 0.0016  -0.0053 202  SER A C   
1609 O O   . SER A 202 ? 0.1807 0.1815 0.1885 -0.0175 0.0025  -0.0038 202  SER A O   
1610 C CB  . SER A 202 ? 0.1880 0.2082 0.1995 -0.0045 -0.0085 -0.0043 202  SER A CB  
1611 O OG  . SER A 202 ? 0.2319 0.2051 0.2361 -0.0024 -0.0090 0.0027  202  SER A OG  
1612 N N   . SER A 203 ? 0.1626 0.1660 0.1859 -0.0149 -0.0004 -0.0044 203  SER A N   
1613 C CA  . SER A 203 ? 0.1488 0.1674 0.1864 -0.0153 0.0014  -0.0039 203  SER A CA  
1614 C C   . SER A 203 ? 0.1660 0.1743 0.1715 -0.0113 -0.0011 -0.0018 203  SER A C   
1615 O O   . SER A 203 ? 0.1757 0.1687 0.1864 -0.0263 0.0046  0.0117  203  SER A O   
1616 C CB  . SER A 203 ? 0.1445 0.1619 0.1820 -0.0109 -0.0069 -0.0037 203  SER A CB  
1617 O OG  . SER A 203 ? 0.1848 0.1663 0.2003 0.0041  -0.0170 0.0080  203  SER A OG  
1618 N N   . LEU A 204 ? 0.1553 0.1612 0.1824 -0.0148 -0.0006 -0.0060 204  LEU A N   
1619 C CA  . LEU A 204 ? 0.1579 0.1511 0.1640 -0.0049 -0.0012 0.0014  204  LEU A CA  
1620 C C   . LEU A 204 ? 0.1558 0.1532 0.1597 -0.0019 -0.0011 0.0014  204  LEU A C   
1621 O O   . LEU A 204 ? 0.1649 0.1448 0.1489 -0.0116 0.0064  -0.0009 204  LEU A O   
1622 C CB  . LEU A 204 ? 0.1616 0.1494 0.1746 0.0058  -0.0068 -0.0018 204  LEU A CB  
1623 C CG  . LEU A 204 ? 0.1777 0.1915 0.1729 0.0154  -0.0006 0.0091  204  LEU A CG  
1624 C CD1 . LEU A 204 ? 0.2272 0.2128 0.1860 0.0171  0.0037  0.0168  204  LEU A CD1 
1625 C CD2 . LEU A 204 ? 0.2320 0.2355 0.2125 0.0242  -0.0005 0.0003  204  LEU A CD2 
1626 N N   . PHE A 205 ? 0.1391 0.1428 0.1479 -0.0124 0.0032  0.0002  205  PHE A N   
1627 C CA  . PHE A 205 ? 0.1452 0.1534 0.1562 -0.0039 -0.0004 0.0028  205  PHE A CA  
1628 C C   . PHE A 205 ? 0.1463 0.1590 0.1548 -0.0056 0.0039  0.0069  205  PHE A C   
1629 O O   . PHE A 205 ? 0.1418 0.1566 0.1549 -0.0079 0.0133  0.0119  205  PHE A O   
1630 C CB  . PHE A 205 ? 0.1549 0.1575 0.1564 -0.0010 0.0072  0.0017  205  PHE A CB  
1631 C CG  . PHE A 205 ? 0.1372 0.1468 0.1662 -0.0034 0.0017  0.0064  205  PHE A CG  
1632 C CD1 . PHE A 205 ? 0.1440 0.1621 0.1686 0.0011  0.0124  -0.0056 205  PHE A CD1 
1633 C CD2 . PHE A 205 ? 0.1633 0.1571 0.1710 -0.0056 0.0108  -0.0023 205  PHE A CD2 
1634 C CE1 . PHE A 205 ? 0.1616 0.1552 0.1785 0.0066  0.0028  0.0010  205  PHE A CE1 
1635 C CE2 . PHE A 205 ? 0.1791 0.1588 0.1842 0.0015  0.0058  0.0105  205  PHE A CE2 
1636 C CZ  . PHE A 205 ? 0.1570 0.1645 0.1878 0.0100  0.0074  0.0051  205  PHE A CZ  
1637 N N   . ILE A 206 ? 0.1341 0.1388 0.1426 -0.0180 -0.0031 0.0063  206  ILE A N   
1638 C CA  . ILE A 206 ? 0.1466 0.1592 0.1433 -0.0083 0.0022  -0.0040 206  ILE A CA  
1639 C C   . ILE A 206 ? 0.1494 0.1554 0.1498 -0.0059 0.0010  -0.0008 206  ILE A C   
1640 O O   . ILE A 206 ? 0.1925 0.1595 0.1648 -0.0137 -0.0049 -0.0001 206  ILE A O   
1641 C CB  . ILE A 206 ? 0.1503 0.1643 0.1505 -0.0180 0.0038  -0.0014 206  ILE A CB  
1642 C CG1 . ILE A 206 ? 0.2011 0.1713 0.1417 -0.0061 0.0058  -0.0010 206  ILE A CG1 
1643 C CG2 . ILE A 206 ? 0.1516 0.2049 0.1739 -0.0094 0.0034  0.0011  206  ILE A CG2 
1644 C CD1 . ILE A 206 ? 0.2110 0.2209 0.1681 -0.0089 0.0189  -0.0084 206  ILE A CD1 
1645 N N   . ILE A 207 ? 0.1365 0.1575 0.1316 -0.0097 -0.0020 -0.0060 207  ILE A N   
1646 C CA  . ILE A 207 ? 0.1477 0.1480 0.1433 -0.0069 -0.0026 -0.0019 207  ILE A CA  
1647 C C   . ILE A 207 ? 0.1579 0.1604 0.1668 -0.0058 -0.0046 -0.0047 207  ILE A C   
1648 O O   . ILE A 207 ? 0.1596 0.1582 0.1870 -0.0050 -0.0019 -0.0118 207  ILE A O   
1649 C CB  . ILE A 207 ? 0.1458 0.1452 0.1397 -0.0144 -0.0042 -0.0049 207  ILE A CB  
1650 C CG1 . ILE A 207 ? 0.1541 0.1619 0.1434 -0.0050 -0.0070 0.0218  207  ILE A CG1 
1651 C CG2 . ILE A 207 ? 0.1702 0.1484 0.1248 -0.0056 -0.0047 -0.0130 207  ILE A CG2 
1652 C CD1 . ILE A 207 ? 0.1610 0.1721 0.1528 -0.0018 0.0006  0.0103  207  ILE A CD1 
1653 N N   . ALA A 208 ? 0.1497 0.1576 0.1538 -0.0125 0.0098  -0.0099 208  ALA A N   
1654 C CA  . ALA A 208 ? 0.1620 0.1714 0.1725 -0.0071 0.0035  -0.0045 208  ALA A CA  
1655 C C   . ALA A 208 ? 0.1538 0.1771 0.1805 -0.0097 0.0059  0.0011  208  ALA A C   
1656 O O   . ALA A 208 ? 0.1659 0.1747 0.1891 -0.0039 0.0145  -0.0038 208  ALA A O   
1657 C CB  . ALA A 208 ? 0.1693 0.1640 0.1724 -0.0072 -0.0026 -0.0061 208  ALA A CB  
1658 N N   . SER A 209 ? 0.1703 0.1904 0.1806 -0.0060 0.0007  0.0008  209  SER A N   
1659 C CA  . SER A 209 ? 0.1828 0.2027 0.1913 0.0000  -0.0010 -0.0106 209  SER A CA  
1660 C C   . SER A 209 ? 0.1926 0.2005 0.1999 -0.0038 -0.0089 -0.0025 209  SER A C   
1661 O O   . SER A 209 ? 0.2091 0.1932 0.1868 0.0031  -0.0109 -0.0139 209  SER A O   
1662 C CB  . SER A 209 ? 0.2013 0.2151 0.1837 -0.0109 -0.0017 -0.0068 209  SER A CB  
1663 O OG  . SER A 209 ? 0.1949 0.2206 0.2000 -0.0010 -0.0099 -0.0192 209  SER A OG  
1664 N N   . LYS A 210 ? 0.1809 0.2085 0.1914 0.0037  -0.0119 -0.0058 210  LYS A N   
1665 C CA  . LYS A 210 ? 0.1894 0.2063 0.2006 0.0010  -0.0029 -0.0043 210  LYS A CA  
1666 C C   . LYS A 210 ? 0.2050 0.2113 0.2107 0.0018  -0.0080 0.0038  210  LYS A C   
1667 O O   . LYS A 210 ? 0.2077 0.1926 0.2084 -0.0001 -0.0169 0.0012  210  LYS A O   
1668 C CB  . LYS A 210 ? 0.1787 0.1929 0.2081 0.0038  -0.0066 0.0056  210  LYS A CB  
1669 C CG  . LYS A 210 ? 0.1737 0.2177 0.2145 -0.0065 -0.0075 -0.0036 210  LYS A CG  
1670 C CD  . LYS A 210 ? 0.1816 0.2095 0.2136 0.0087  0.0040  0.0075  210  LYS A CD  
1671 C CE  . LYS A 210 ? 0.1675 0.1950 0.1832 -0.0065 0.0012  0.0178  210  LYS A CE  
1672 N NZ  . LYS A 210 ? 0.1533 0.1920 0.1921 -0.0076 0.0095  0.0279  210  LYS A NZ  
1673 N N   . THR A 211 ? 0.1878 0.2232 0.2015 -0.0065 0.0002  0.0002  211  THR A N   
1674 C CA  . THR A 211 ? 0.1954 0.2211 0.2091 0.0036  -0.0035 0.0051  211  THR A CA  
1675 C C   . THR A 211 ? 0.2108 0.2274 0.2114 -0.0024 -0.0062 0.0073  211  THR A C   
1676 O O   . THR A 211 ? 0.2178 0.2274 0.1982 -0.0024 -0.0084 0.0091  211  THR A O   
1677 C CB  . THR A 211 ? 0.1983 0.2332 0.2196 -0.0034 -0.0053 0.0024  211  THR A CB  
1678 O OG1 . THR A 211 ? 0.2056 0.2279 0.2437 0.0047  -0.0072 -0.0056 211  THR A OG1 
1679 C CG2 . THR A 211 ? 0.2077 0.2354 0.2138 -0.0010 0.0018  0.0082  211  THR A CG2 
1680 N N   . PHE A 212 ? 0.2124 0.2269 0.2185 0.0011  -0.0035 0.0014  212  PHE A N   
1681 C CA  . PHE A 212 ? 0.2168 0.2213 0.2172 0.0026  0.0039  -0.0022 212  PHE A CA  
1682 C C   . PHE A 212 ? 0.2279 0.2219 0.2288 0.0077  0.0013  -0.0017 212  PHE A C   
1683 O O   . PHE A 212 ? 0.2419 0.2391 0.2193 0.0176  0.0098  -0.0081 212  PHE A O   
1684 C CB  . PHE A 212 ? 0.2181 0.2161 0.2111 -0.0005 -0.0092 0.0023  212  PHE A CB  
1685 C CG  . PHE A 212 ? 0.2159 0.2373 0.2274 0.0010  0.0031  0.0031  212  PHE A CG  
1686 C CD1 . PHE A 212 ? 0.2364 0.2107 0.1808 0.0002  -0.0054 0.0104  212  PHE A CD1 
1687 C CD2 . PHE A 212 ? 0.2287 0.2182 0.2231 0.0099  -0.0083 -0.0004 212  PHE A CD2 
1688 C CE1 . PHE A 212 ? 0.2328 0.2162 0.1958 0.0017  0.0002  -0.0087 212  PHE A CE1 
1689 C CE2 . PHE A 212 ? 0.2199 0.2120 0.2212 0.0084  0.0050  0.0008  212  PHE A CE2 
1690 C CZ  . PHE A 212 ? 0.2341 0.2189 0.1895 0.0067  -0.0077 0.0084  212  PHE A CZ  
1691 N N   . THR A 213 ? 0.2242 0.2195 0.2252 0.0018  -0.0025 -0.0035 213  THR A N   
1692 C CA  . THR A 213 ? 0.2346 0.2240 0.2293 0.0068  -0.0040 -0.0051 213  THR A CA  
1693 C C   . THR A 213 ? 0.2346 0.2309 0.2394 0.0065  0.0050  -0.0055 213  THR A C   
1694 O O   . THR A 213 ? 0.2474 0.2377 0.2495 0.0122  0.0054  -0.0224 213  THR A O   
1695 C CB  . THR A 213 ? 0.2384 0.2350 0.2399 -0.0018 -0.0033 -0.0008 213  THR A CB  
1696 O OG1 . THR A 213 ? 0.2460 0.2480 0.2554 -0.0037 0.0022  -0.0112 213  THR A OG1 
1697 C CG2 . THR A 213 ? 0.2443 0.2352 0.2167 0.0051  -0.0163 -0.0069 213  THR A CG2 
1698 N N   . THR A 214 ? 0.2163 0.2026 0.2216 0.0083  -0.0010 -0.0081 214  THR A N   
1699 C CA  . THR A 214 ? 0.2079 0.2188 0.2332 0.0061  0.0058  -0.0034 214  THR A CA  
1700 C C   . THR A 214 ? 0.2005 0.2113 0.2297 0.0009  0.0093  -0.0165 214  THR A C   
1701 O O   . THR A 214 ? 0.1992 0.1998 0.2099 -0.0024 0.0032  -0.0351 214  THR A O   
1702 C CB  . THR A 214 ? 0.2034 0.2011 0.2166 0.0108  0.0033  0.0080  214  THR A CB  
1703 O OG1 . THR A 214 ? 0.2345 0.2881 0.2707 0.0082  0.0096  0.0303  214  THR A OG1 
1704 C CG2 . THR A 214 ? 0.2382 0.2162 0.2471 0.0072  -0.0021 0.0114  214  THR A CG2 
1705 N N   . GLN A 215 ? 0.2017 0.2154 0.2234 -0.0026 0.0080  -0.0236 215  GLN A N   
1706 C CA  . GLN A 215 ? 0.1954 0.2123 0.2177 -0.0033 0.0043  -0.0188 215  GLN A CA  
1707 C C   . GLN A 215 ? 0.1987 0.1955 0.2046 -0.0054 0.0042  -0.0074 215  GLN A C   
1708 O O   . GLN A 215 ? 0.1931 0.2095 0.1925 -0.0062 0.0060  -0.0214 215  GLN A O   
1709 C CB  . GLN A 215 ? 0.2173 0.2194 0.2435 -0.0048 0.0059  -0.0227 215  GLN A CB  
1710 C CG  . GLN A 215 ? 0.2027 0.2206 0.2355 -0.0022 0.0018  -0.0228 215  GLN A CG  
1711 C CD  . GLN A 215 ? 0.2255 0.2367 0.2243 -0.0003 -0.0139 -0.0088 215  GLN A CD  
1712 O OE1 . GLN A 215 ? 0.2512 0.2831 0.2493 0.0069  -0.0085 -0.0029 215  GLN A OE1 
1713 N NE2 . GLN A 215 ? 0.2215 0.2209 0.2393 -0.0168 -0.0198 -0.0131 215  GLN A NE2 
1714 N N   . GLU A 216 ? 0.1883 0.1916 0.1983 -0.0040 0.0017  -0.0097 216  GLU A N   
1715 C CA  . GLU A 216 ? 0.1867 0.1730 0.1959 -0.0054 0.0035  -0.0075 216  GLU A CA  
1716 C C   . GLU A 216 ? 0.1714 0.1621 0.1787 -0.0019 0.0053  -0.0049 216  GLU A C   
1717 O O   . GLU A 216 ? 0.1645 0.1620 0.1669 -0.0025 0.0151  -0.0041 216  GLU A O   
1718 C CB  . GLU A 216 ? 0.1973 0.1737 0.2045 0.0046  0.0014  -0.0001 216  GLU A CB  
1719 C CG  . GLU A 216 ? 0.1891 0.1771 0.2327 -0.0024 0.0006  -0.0117 216  GLU A CG  
1720 C CD  . GLU A 216 ? 0.2215 0.2033 0.2477 -0.0127 -0.0066 0.0056  216  GLU A CD  
1721 O OE1 . GLU A 216 ? 0.2246 0.1795 0.2284 -0.0120 -0.0158 0.0181  216  GLU A OE1 
1722 O OE2 . GLU A 216 ? 0.2056 0.2184 0.2442 -0.0053 -0.0105 0.0042  216  GLU A OE2 
1723 N N   . THR A 217 ? 0.1568 0.1466 0.1566 -0.0067 0.0092  0.0013  217  THR A N   
1724 C CA  . THR A 217 ? 0.1594 0.1458 0.1401 -0.0090 0.0112  0.0019  217  THR A CA  
1725 C C   . THR A 217 ? 0.1600 0.1493 0.1423 -0.0059 0.0059  -0.0004 217  THR A C   
1726 O O   . THR A 217 ? 0.1753 0.1525 0.1570 -0.0070 0.0137  0.0023  217  THR A O   
1727 C CB  . THR A 217 ? 0.1686 0.1363 0.1343 0.0008  0.0048  -0.0041 217  THR A CB  
1728 O OG1 . THR A 217 ? 0.1597 0.1562 0.1467 0.0001  0.0199  0.0122  217  THR A OG1 
1729 C CG2 . THR A 217 ? 0.1575 0.1309 0.1235 -0.0112 0.0022  0.0021  217  THR A CG2 
1730 N N   . ILE A 218 ? 0.1697 0.1568 0.1481 -0.0033 0.0039  0.0064  218  ILE A N   
1731 C CA  . ILE A 218 ? 0.1708 0.1667 0.1520 -0.0067 0.0002  0.0060  218  ILE A CA  
1732 C C   . ILE A 218 ? 0.1730 0.1606 0.1586 -0.0010 -0.0049 0.0036  218  ILE A C   
1733 O O   . ILE A 218 ? 0.1771 0.1602 0.1571 0.0010  0.0009  0.0124  218  ILE A O   
1734 C CB  . ILE A 218 ? 0.1747 0.1756 0.1644 -0.0088 -0.0013 0.0099  218  ILE A CB  
1735 C CG1 . ILE A 218 ? 0.2048 0.1972 0.2170 0.0056  -0.0039 0.0061  218  ILE A CG1 
1736 C CG2 . ILE A 218 ? 0.2303 0.2252 0.1782 -0.0189 -0.0097 0.0201  218  ILE A CG2 
1737 C CD1 . ILE A 218 ? 0.2335 0.2071 0.2576 0.0213  -0.0071 -0.0022 218  ILE A CD1 
1738 N N   . THR A 219 ? 0.1547 0.1533 0.1455 -0.0003 -0.0028 0.0010  219  THR A N   
1739 C CA  . THR A 219 ? 0.1561 0.1472 0.1458 -0.0012 0.0035  -0.0017 219  THR A CA  
1740 C C   . THR A 219 ? 0.1489 0.1546 0.1437 -0.0008 0.0093  -0.0003 219  THR A C   
1741 O O   . THR A 219 ? 0.1394 0.1317 0.1309 -0.0068 -0.0004 0.0124  219  THR A O   
1742 C CB  . THR A 219 ? 0.1546 0.1554 0.1564 0.0035  0.0024  -0.0068 219  THR A CB  
1743 O OG1 . THR A 219 ? 0.1745 0.1785 0.1573 -0.0194 -0.0103 -0.0118 219  THR A OG1 
1744 C CG2 . THR A 219 ? 0.1530 0.1472 0.1349 -0.0083 0.0137  -0.0009 219  THR A CG2 
1745 N N   . ASN A 220 ? 0.1509 0.1427 0.1129 0.0004  0.0011  0.0013  220  ASN A N   
1746 C CA  . ASN A 220 ? 0.1458 0.1305 0.1260 -0.0054 0.0086  -0.0013 220  ASN A CA  
1747 C C   . ASN A 220 ? 0.1551 0.1435 0.1362 -0.0016 -0.0010 0.0041  220  ASN A C   
1748 O O   . ASN A 220 ? 0.1548 0.1375 0.1516 -0.0009 0.0099  0.0106  220  ASN A O   
1749 C CB  . ASN A 220 ? 0.1533 0.1406 0.1170 -0.0048 0.0127  0.0030  220  ASN A CB  
1750 C CG  . ASN A 220 ? 0.1309 0.1450 0.1211 0.0024  0.0117  -0.0024 220  ASN A CG  
1751 O OD1 . ASN A 220 ? 0.1418 0.1397 0.1318 0.0066  0.0163  0.0152  220  ASN A OD1 
1752 N ND2 . ASN A 220 ? 0.1428 0.1179 0.1156 -0.0208 0.0058  0.0031  220  ASN A ND2 
1753 N N   . ALA A 221 ? 0.1509 0.1227 0.1446 0.0034  0.0020  -0.0014 221  ALA A N   
1754 C CA  . ALA A 221 ? 0.1514 0.1385 0.1483 -0.0005 0.0100  0.0080  221  ALA A CA  
1755 C C   . ALA A 221 ? 0.1652 0.1535 0.1535 -0.0076 0.0045  0.0050  221  ALA A C   
1756 O O   . ALA A 221 ? 0.1693 0.1534 0.1441 -0.0171 0.0063  0.0160  221  ALA A O   
1757 C CB  . ALA A 221 ? 0.1582 0.1428 0.1551 0.0110  -0.0036 0.0148  221  ALA A CB  
1758 N N   . GLU A 222 ? 0.1731 0.1555 0.1406 -0.0088 0.0141  0.0040  222  GLU A N   
1759 C CA  . GLU A 222 ? 0.1735 0.1784 0.1640 -0.0085 0.0129  0.0028  222  GLU A CA  
1760 C C   . GLU A 222 ? 0.1777 0.1627 0.1583 -0.0047 0.0081  0.0069  222  GLU A C   
1761 O O   . GLU A 222 ? 0.2023 0.1646 0.1704 -0.0171 0.0067  0.0042  222  GLU A O   
1762 C CB  . GLU A 222 ? 0.1941 0.1958 0.1627 -0.0055 0.0108  0.0022  222  GLU A CB  
1763 C CG  . GLU A 222 ? 0.2297 0.2581 0.2527 0.0082  -0.0005 0.0049  222  GLU A CG  
1764 C CD  . GLU A 222 ? 0.3464 0.3444 0.3086 0.0024  -0.0136 -0.0058 222  GLU A CD  
1765 O OE1 . GLU A 222 ? 0.3547 0.3777 0.3202 0.0043  -0.0169 0.0194  222  GLU A OE1 
1766 O OE2 . GLU A 222 ? 0.3909 0.3558 0.3575 0.0022  -0.0022 -0.0146 222  GLU A OE2 
1767 N N   . THR A 223 ? 0.1670 0.1433 0.1551 -0.0015 0.0032  0.0071  223  THR A N   
1768 C CA  . THR A 223 ? 0.1621 0.1372 0.1597 -0.0051 0.0048  0.0127  223  THR A CA  
1769 C C   . THR A 223 ? 0.1649 0.1484 0.1563 -0.0053 0.0069  0.0076  223  THR A C   
1770 O O   . THR A 223 ? 0.1829 0.1554 0.1561 -0.0110 0.0137  0.0120  223  THR A O   
1771 C CB  . THR A 223 ? 0.1610 0.1398 0.1630 -0.0016 0.0017  0.0141  223  THR A CB  
1772 O OG1 . THR A 223 ? 0.1707 0.1491 0.1738 0.0008  -0.0008 0.0050  223  THR A OG1 
1773 C CG2 . THR A 223 ? 0.1673 0.1645 0.1703 0.0000  0.0017  0.0061  223  THR A CG2 
1774 N N   . ALA A 224 ? 0.1575 0.1359 0.1400 -0.0086 0.0113  0.0106  224  ALA A N   
1775 C CA  . ALA A 224 ? 0.1743 0.1450 0.1528 -0.0117 0.0201  0.0062  224  ALA A CA  
1776 C C   . ALA A 224 ? 0.1842 0.1595 0.1610 -0.0130 0.0127  0.0073  224  ALA A C   
1777 O O   . ALA A 224 ? 0.1883 0.1792 0.1727 -0.0159 0.0238  0.0009  224  ALA A O   
1778 C CB  . ALA A 224 ? 0.1732 0.1584 0.1576 -0.0074 0.0223  -0.0015 224  ALA A CB  
1779 N N   . LYS A 225 ? 0.1841 0.1395 0.1571 -0.0059 0.0127  0.0142  225  LYS A N   
1780 C CA  . LYS A 225 ? 0.1877 0.1567 0.1711 -0.0095 0.0102  0.0125  225  LYS A CA  
1781 C C   . LYS A 225 ? 0.1941 0.1635 0.1765 -0.0086 0.0118  0.0033  225  LYS A C   
1782 O O   . LYS A 225 ? 0.2082 0.1735 0.1750 -0.0200 0.0150  0.0019  225  LYS A O   
1783 C CB  . LYS A 225 ? 0.1946 0.1545 0.1823 -0.0054 0.0018  0.0141  225  LYS A CB  
1784 C CG  . LYS A 225 ? 0.2608 0.2001 0.2395 -0.0112 0.0164  0.0240  225  LYS A CG  
1785 C CD  . LYS A 225 ? 0.3158 0.2969 0.3013 0.0140  -0.0109 0.0235  225  LYS A CD  
1786 C CE  . LYS A 225 ? 0.3935 0.3710 0.3715 -0.0012 -0.0107 -0.0169 225  LYS A CE  
1787 N NZ  . LYS A 225 ? 0.4193 0.4462 0.4446 -0.0013 0.0000  0.0005  225  LYS A NZ  
1788 N N   . GLU A 226 ? 0.1851 0.1608 0.1604 -0.0040 0.0131  0.0000  226  GLU A N   
1789 C CA  . GLU A 226 ? 0.1920 0.1746 0.1806 -0.0070 0.0158  -0.0017 226  GLU A CA  
1790 C C   . GLU A 226 ? 0.2017 0.1822 0.1816 -0.0083 0.0141  0.0012  226  GLU A C   
1791 O O   . GLU A 226 ? 0.2099 0.2013 0.1828 -0.0185 0.0294  -0.0063 226  GLU A O   
1792 C CB  . GLU A 226 ? 0.1985 0.1793 0.1909 0.0014  0.0159  -0.0057 226  GLU A CB  
1793 C CG  . GLU A 226 ? 0.2344 0.2374 0.2391 0.0046  0.0222  -0.0073 226  GLU A CG  
1794 C CD  . GLU A 226 ? 0.3515 0.2861 0.3299 0.0079  0.0062  -0.0103 226  GLU A CD  
1795 O OE1 . GLU A 226 ? 0.3526 0.2957 0.3173 0.0048  0.0136  0.0023  226  GLU A OE1 
1796 O OE2 . GLU A 226 ? 0.4211 0.3676 0.3507 0.0032  -0.0091 -0.0133 226  GLU A OE2 
1797 N N   . TRP A 227 ? 0.1945 0.1635 0.1754 -0.0038 0.0117  0.0033  227  TRP A N   
1798 C CA  . TRP A 227 ? 0.1956 0.1639 0.1785 -0.0093 0.0099  0.0069  227  TRP A CA  
1799 C C   . TRP A 227 ? 0.1949 0.1698 0.1952 -0.0042 0.0105  -0.0023 227  TRP A C   
1800 O O   . TRP A 227 ? 0.2002 0.1634 0.1839 -0.0090 0.0128  0.0057  227  TRP A O   
1801 C CB  . TRP A 227 ? 0.2137 0.1754 0.1810 -0.0082 0.0076  0.0091  227  TRP A CB  
1802 C CG  . TRP A 227 ? 0.1991 0.1847 0.1903 -0.0100 0.0104  0.0109  227  TRP A CG  
1803 C CD1 . TRP A 227 ? 0.2078 0.2043 0.2183 -0.0086 0.0136  0.0076  227  TRP A CD1 
1804 C CD2 . TRP A 227 ? 0.1724 0.1623 0.1772 -0.0145 0.0048  0.0017  227  TRP A CD2 
1805 N NE1 . TRP A 227 ? 0.1948 0.2062 0.2206 -0.0067 0.0101  0.0160  227  TRP A NE1 
1806 C CE2 . TRP A 227 ? 0.1981 0.1936 0.2081 -0.0061 0.0058  0.0123  227  TRP A CE2 
1807 C CE3 . TRP A 227 ? 0.1951 0.1681 0.1907 -0.0076 0.0080  0.0042  227  TRP A CE3 
1808 C CZ2 . TRP A 227 ? 0.1839 0.1865 0.2103 -0.0057 -0.0070 0.0130  227  TRP A CZ2 
1809 C CZ3 . TRP A 227 ? 0.1591 0.1845 0.1777 -0.0214 0.0062  0.0076  227  TRP A CZ3 
1810 C CH2 . TRP A 227 ? 0.1878 0.2111 0.2093 -0.0033 0.0013  0.0129  227  TRP A CH2 
1811 N N   . PHE A 228 ? 0.1972 0.1670 0.1852 -0.0092 0.0179  0.0012  228  PHE A N   
1812 C CA  . PHE A 228 ? 0.1824 0.1677 0.1701 -0.0090 0.0184  0.0019  228  PHE A CA  
1813 C C   . PHE A 228 ? 0.1947 0.1763 0.1865 -0.0162 0.0132  0.0047  228  PHE A C   
1814 O O   . PHE A 228 ? 0.1818 0.1908 0.1758 -0.0282 0.0334  0.0026  228  PHE A O   
1815 C CB  . PHE A 228 ? 0.1814 0.1675 0.1798 -0.0037 0.0101  0.0063  228  PHE A CB  
1816 C CG  . PHE A 228 ? 0.1823 0.1726 0.1706 -0.0052 0.0067  0.0059  228  PHE A CG  
1817 C CD1 . PHE A 228 ? 0.1847 0.1730 0.1823 -0.0143 0.0134  -0.0016 228  PHE A CD1 
1818 C CD2 . PHE A 228 ? 0.1831 0.1706 0.1836 0.0000  0.0110  0.0062  228  PHE A CD2 
1819 C CE1 . PHE A 228 ? 0.1909 0.1823 0.1978 0.0109  0.0088  -0.0010 228  PHE A CE1 
1820 C CE2 . PHE A 228 ? 0.1869 0.1603 0.1836 -0.0091 0.0079  0.0055  228  PHE A CE2 
1821 C CZ  . PHE A 228 ? 0.1974 0.1966 0.1816 -0.0043 0.0118  0.0082  228  PHE A CZ  
1822 N N   . LEU A 229 ? 0.2132 0.1865 0.1775 -0.0181 0.0236  0.0123  229  LEU A N   
1823 C CA  . LEU A 229 ? 0.2216 0.1963 0.1987 -0.0098 0.0205  0.0106  229  LEU A CA  
1824 C C   . LEU A 229 ? 0.2316 0.2137 0.2150 -0.0126 0.0170  0.0060  229  LEU A C   
1825 O O   . LEU A 229 ? 0.2389 0.2098 0.2092 -0.0254 0.0301  0.0091  229  LEU A O   
1826 C CB  . LEU A 229 ? 0.2163 0.2054 0.1967 -0.0115 0.0212  0.0122  229  LEU A CB  
1827 C CG  . LEU A 229 ? 0.2336 0.1971 0.2171 -0.0003 0.0123  0.0050  229  LEU A CG  
1828 C CD1 . LEU A 229 ? 0.2412 0.2335 0.2186 -0.0018 0.0099  0.0054  229  LEU A CD1 
1829 C CD2 . LEU A 229 ? 0.2805 0.2044 0.2302 0.0136  0.0080  -0.0017 229  LEU A CD2 
1830 N N   . GLN A 230 ? 0.2249 0.2033 0.2194 -0.0095 0.0169  0.0036  230  GLN A N   
1831 C CA  . GLN A 230 ? 0.2383 0.2341 0.2440 -0.0105 0.0141  -0.0014 230  GLN A CA  
1832 C C   . GLN A 230 ? 0.2361 0.2257 0.2414 -0.0109 0.0181  -0.0019 230  GLN A C   
1833 O O   . GLN A 230 ? 0.2302 0.2191 0.2585 -0.0151 0.0267  -0.0139 230  GLN A O   
1834 C CB  . GLN A 230 ? 0.2510 0.2455 0.2632 -0.0029 0.0190  0.0040  230  GLN A CB  
1835 C CG  . GLN A 230 ? 0.3330 0.3426 0.3155 -0.0078 -0.0039 -0.0158 230  GLN A CG  
1836 C CD  . GLN A 230 ? 0.4223 0.3920 0.4336 -0.0002 -0.0043 0.0056  230  GLN A CD  
1837 O OE1 . GLN A 230 ? 0.4819 0.4712 0.4509 0.0010  -0.0142 0.0017  230  GLN A OE1 
1838 N NE2 . GLN A 230 ? 0.4554 0.4351 0.4310 0.0002  -0.0071 -0.0129 230  GLN A NE2 
1839 N N   . ALA A 231 ? 0.2290 0.2011 0.2206 -0.0172 0.0149  -0.0020 231  ALA A N   
1840 C CA  . ALA A 231 ? 0.2280 0.2088 0.2167 -0.0105 0.0159  0.0017  231  ALA A CA  
1841 C C   . ALA A 231 ? 0.2217 0.2058 0.2245 -0.0133 0.0064  0.0067  231  ALA A C   
1842 O O   . ALA A 231 ? 0.2299 0.2282 0.2496 -0.0255 0.0098  0.0082  231  ALA A O   
1843 C CB  . ALA A 231 ? 0.2323 0.2149 0.2094 -0.0066 0.0069  0.0036  231  ALA A CB  
1844 N N   . ALA A 232 ? 0.2092 0.1895 0.2131 -0.0137 0.0156  0.0041  232  ALA A N   
1845 C CA  . ALA A 232 ? 0.2193 0.2043 0.2253 -0.0073 0.0072  0.0041  232  ALA A CA  
1846 C C   . ALA A 232 ? 0.2462 0.2264 0.2440 -0.0113 0.0091  0.0085  232  ALA A C   
1847 O O   . ALA A 232 ? 0.2563 0.2263 0.2572 -0.0098 0.0105  0.0075  232  ALA A O   
1848 C CB  . ALA A 232 ? 0.2291 0.1994 0.2316 -0.0046 0.0137  0.0006  232  ALA A CB  
1849 N N   . LYS A 233 ? 0.2585 0.2332 0.2434 -0.0121 0.0123  0.0049  233  LYS A N   
1850 C CA  . LYS A 233 ? 0.2783 0.2731 0.2616 -0.0091 0.0095  0.0097  233  LYS A CA  
1851 C C   . LYS A 233 ? 0.2983 0.2929 0.2815 -0.0054 0.0082  0.0145  233  LYS A C   
1852 O O   . LYS A 233 ? 0.3241 0.3123 0.2903 -0.0103 0.0206  0.0258  233  LYS A O   
1853 C CB  . LYS A 233 ? 0.2752 0.2704 0.2595 -0.0146 0.0077  0.0042  233  LYS A CB  
1854 C CG  . LYS A 233 ? 0.2857 0.3095 0.3085 -0.0053 0.0021  0.0104  233  LYS A CG  
1855 C CD  . LYS A 233 ? 0.3008 0.3349 0.3353 -0.0121 0.0048  0.0038  233  LYS A CD  
1856 C CE  . LYS A 233 ? 0.3009 0.3200 0.3496 0.0037  0.0101  0.0183  233  LYS A CE  
1857 N NZ  . LYS A 233 ? 0.2726 0.2607 0.3458 -0.0133 0.0103  0.0154  233  LYS A NZ  
1858 N N   . ASP A 234 ? 0.2925 0.2917 0.2773 -0.0053 0.0053  0.0092  234  ASP A N   
1859 C CA  . ASP A 234 ? 0.3018 0.2981 0.2884 -0.0036 0.0011  0.0057  234  ASP A CA  
1860 C C   . ASP A 234 ? 0.3020 0.3001 0.2893 -0.0087 -0.0042 0.0022  234  ASP A C   
1861 O O   . ASP A 234 ? 0.3018 0.2924 0.2772 -0.0194 -0.0088 0.0085  234  ASP A O   
1862 C CB  . ASP A 234 ? 0.3127 0.3002 0.3003 -0.0037 -0.0032 0.0044  234  ASP A CB  
1863 C CG  . ASP A 234 ? 0.3360 0.3254 0.3294 0.0059  -0.0054 -0.0002 234  ASP A CG  
1864 O OD1 . ASP A 234 ? 0.3177 0.3163 0.3218 -0.0147 0.0020  0.0126  234  ASP A OD1 
1865 O OD2 . ASP A 234 ? 0.3608 0.3147 0.3546 -0.0095 0.0022  0.0052  234  ASP A OD2 
1866 N N   . PRO A 235 ? 0.3134 0.3133 0.2900 -0.0060 -0.0047 0.0037  235  PRO A N   
1867 C CA  . PRO A 235 ? 0.3057 0.3033 0.2898 -0.0077 -0.0090 0.0028  235  PRO A CA  
1868 C C   . PRO A 235 ? 0.3044 0.2975 0.2816 -0.0100 -0.0083 0.0082  235  PRO A C   
1869 O O   . PRO A 235 ? 0.2949 0.2931 0.2838 -0.0126 -0.0141 0.0193  235  PRO A O   
1870 C CB  . PRO A 235 ? 0.3153 0.3208 0.2905 -0.0017 -0.0074 0.0025  235  PRO A CB  
1871 C CG  . PRO A 235 ? 0.3216 0.3343 0.3011 -0.0028 -0.0086 -0.0030 235  PRO A CG  
1872 C CD  . PRO A 235 ? 0.3189 0.3223 0.2962 -0.0071 -0.0043 0.0017  235  PRO A CD  
1873 N N   . SER A 236 ? 0.2964 0.2786 0.2683 -0.0123 -0.0071 0.0154  236  SER A N   
1874 C CA  . SER A 236 ? 0.2904 0.2715 0.2671 -0.0099 -0.0015 0.0124  236  SER A CA  
1875 C C   . SER A 236 ? 0.2713 0.2515 0.2600 -0.0076 0.0021  0.0127  236  SER A C   
1876 O O   . SER A 236 ? 0.2816 0.2596 0.2655 -0.0123 0.0058  0.0121  236  SER A O   
1877 C CB  . SER A 236 ? 0.3153 0.2838 0.2903 -0.0022 -0.0068 0.0104  236  SER A CB  
1878 O OG  . SER A 236 ? 0.3739 0.3420 0.3141 0.0001  0.0036  0.0199  236  SER A OG  
1879 N N   . ALA A 237 ? 0.2545 0.2305 0.2344 -0.0206 0.0003  0.0125  237  ALA A N   
1880 C CA  . ALA A 237 ? 0.2289 0.2209 0.2170 -0.0248 0.0070  0.0121  237  ALA A CA  
1881 C C   . ALA A 237 ? 0.2295 0.2144 0.2183 -0.0271 0.0021  0.0091  237  ALA A C   
1882 O O   . ALA A 237 ? 0.2149 0.2037 0.2062 -0.0317 -0.0002 0.0110  237  ALA A O   
1883 C CB  . ALA A 237 ? 0.2371 0.2149 0.2220 -0.0141 0.0059  0.0123  237  ALA A CB  
1884 N N   . VAL A 238 ? 0.2150 0.1981 0.2105 -0.0323 0.0060  0.0158  238  VAL A N   
1885 C CA  . VAL A 238 ? 0.2152 0.2105 0.2124 -0.0294 0.0040  0.0141  238  VAL A CA  
1886 C C   . VAL A 238 ? 0.2221 0.2091 0.2146 -0.0170 -0.0021 0.0132  238  VAL A C   
1887 O O   . VAL A 238 ? 0.2069 0.2053 0.2065 -0.0299 0.0113  0.0216  238  VAL A O   
1888 C CB  . VAL A 238 ? 0.2029 0.2040 0.2022 -0.0278 0.0011  0.0103  238  VAL A CB  
1889 C CG1 . VAL A 238 ? 0.2063 0.2148 0.2078 -0.0361 0.0063  0.0140  238  VAL A CG1 
1890 C CG2 . VAL A 238 ? 0.2232 0.2108 0.2030 -0.0177 0.0088  0.0147  238  VAL A CG2 
1891 N N   . ALA A 239 ? 0.2240 0.2064 0.2260 -0.0116 -0.0005 0.0176  239  ALA A N   
1892 C CA  . ALA A 239 ? 0.2356 0.2130 0.2374 -0.0068 -0.0009 0.0163  239  ALA A CA  
1893 C C   . ALA A 239 ? 0.2280 0.2009 0.2355 -0.0051 0.0028  0.0161  239  ALA A C   
1894 O O   . ALA A 239 ? 0.2241 0.2283 0.2417 -0.0066 0.0037  0.0246  239  ALA A O   
1895 C CB  . ALA A 239 ? 0.2488 0.2253 0.2485 0.0027  -0.0033 0.0143  239  ALA A CB  
1896 N N   . LYS A 240 ? 0.2111 0.1775 0.2234 -0.0126 0.0044  0.0227  240  LYS A N   
1897 C CA  . LYS A 240 ? 0.1990 0.1709 0.2120 -0.0133 0.0049  0.0163  240  LYS A CA  
1898 C C   . LYS A 240 ? 0.1916 0.1660 0.1901 -0.0119 0.0049  0.0106  240  LYS A C   
1899 O O   . LYS A 240 ? 0.2032 0.1606 0.1942 -0.0193 -0.0021 0.0145  240  LYS A O   
1900 C CB  . LYS A 240 ? 0.2001 0.1743 0.2109 -0.0087 0.0022  0.0153  240  LYS A CB  
1901 C CG  . LYS A 240 ? 0.1849 0.1736 0.2121 -0.0123 0.0044  0.0174  240  LYS A CG  
1902 C CD  . LYS A 240 ? 0.2059 0.2152 0.2479 -0.0214 0.0031  0.0180  240  LYS A CD  
1903 C CE  . LYS A 240 ? 0.2876 0.2287 0.2531 0.0053  -0.0053 0.0113  240  LYS A CE  
1904 N NZ  . LYS A 240 ? 0.2945 0.2932 0.3124 0.0000  0.0111  0.0099  240  LYS A NZ  
1905 N N   . HIS A 241 ? 0.1673 0.1531 0.1839 -0.0114 0.0092  0.0157  241  HIS A N   
1906 C CA  . HIS A 241 ? 0.1606 0.1515 0.1701 -0.0015 0.0083  0.0067  241  HIS A CA  
1907 C C   . HIS A 241 ? 0.1645 0.1543 0.1624 -0.0014 0.0077  0.0051  241  HIS A C   
1908 O O   . HIS A 241 ? 0.1701 0.1512 0.1554 -0.0068 0.0158  0.0082  241  HIS A O   
1909 C CB  . HIS A 241 ? 0.1632 0.1570 0.1846 -0.0034 0.0020  0.0069  241  HIS A CB  
1910 C CG  . HIS A 241 ? 0.1563 0.1494 0.1574 -0.0043 0.0078  0.0013  241  HIS A CG  
1911 N ND1 . HIS A 241 ? 0.1429 0.1774 0.1596 -0.0208 0.0053  0.0026  241  HIS A ND1 
1912 C CD2 . HIS A 241 ? 0.1879 0.1718 0.1482 -0.0099 0.0098  -0.0065 241  HIS A CD2 
1913 C CE1 . HIS A 241 ? 0.1855 0.1717 0.1919 -0.0156 0.0159  0.0102  241  HIS A CE1 
1914 N NE2 . HIS A 241 ? 0.1569 0.1859 0.1840 -0.0237 0.0159  0.0212  241  HIS A NE2 
1915 N N   . PHE A 242 ? 0.1674 0.1599 0.1709 -0.0047 0.0061  0.0021  242  PHE A N   
1916 C CA  . PHE A 242 ? 0.1683 0.1643 0.1657 -0.0045 0.0033  0.0013  242  PHE A CA  
1917 C C   . PHE A 242 ? 0.1733 0.1683 0.1700 0.0001  0.0008  0.0037  242  PHE A C   
1918 O O   . PHE A 242 ? 0.1746 0.1657 0.1924 0.0001  0.0031  0.0185  242  PHE A O   
1919 C CB  . PHE A 242 ? 0.1729 0.1647 0.1713 0.0004  0.0090  -0.0011 242  PHE A CB  
1920 C CG  . PHE A 242 ? 0.1726 0.1734 0.1813 -0.0002 0.0032  -0.0025 242  PHE A CG  
1921 C CD1 . PHE A 242 ? 0.1757 0.1783 0.1807 0.0015  0.0005  -0.0004 242  PHE A CD1 
1922 C CD2 . PHE A 242 ? 0.1657 0.1606 0.1779 0.0042  0.0074  0.0061  242  PHE A CD2 
1923 C CE1 . PHE A 242 ? 0.1853 0.1851 0.1735 0.0051  0.0027  -0.0053 242  PHE A CE1 
1924 C CE2 . PHE A 242 ? 0.1657 0.1705 0.1892 -0.0009 0.0096  0.0051  242  PHE A CE2 
1925 C CZ  . PHE A 242 ? 0.1864 0.1709 0.1744 -0.0072 0.0104  -0.0013 242  PHE A CZ  
1926 N N   . VAL A 243 ? 0.1637 0.1518 0.1539 -0.0094 -0.0014 0.0031  243  VAL A N   
1927 C CA  . VAL A 243 ? 0.1609 0.1531 0.1637 -0.0066 -0.0003 0.0040  243  VAL A CA  
1928 C C   . VAL A 243 ? 0.1695 0.1594 0.1728 -0.0046 0.0020  -0.0010 243  VAL A C   
1929 O O   . VAL A 243 ? 0.1604 0.1590 0.1822 -0.0012 0.0043  0.0075  243  VAL A O   
1930 C CB  . VAL A 243 ? 0.1825 0.1508 0.1655 -0.0098 0.0008  0.0108  243  VAL A CB  
1931 C CG1 . VAL A 243 ? 0.1967 0.1513 0.1913 -0.0184 -0.0050 0.0029  243  VAL A CG1 
1932 C CG2 . VAL A 243 ? 0.1864 0.1781 0.1593 -0.0037 -0.0093 0.0173  243  VAL A CG2 
1933 N N   . ALA A 244 ? 0.1601 0.1693 0.1623 -0.0140 -0.0003 0.0043  244  ALA A N   
1934 C CA  . ALA A 244 ? 0.1627 0.1599 0.1505 -0.0082 0.0027  -0.0025 244  ALA A CA  
1935 C C   . ALA A 244 ? 0.1555 0.1671 0.1538 -0.0059 0.0053  -0.0020 244  ALA A C   
1936 O O   . ALA A 244 ? 0.1578 0.1638 0.1582 -0.0084 0.0126  0.0159  244  ALA A O   
1937 C CB  . ALA A 244 ? 0.1761 0.1823 0.1581 0.0005  -0.0036 -0.0007 244  ALA A CB  
1938 N N   . LEU A 245 ? 0.1502 0.1671 0.1539 -0.0028 0.0052  0.0056  245  LEU A N   
1939 C CA  . LEU A 245 ? 0.1559 0.1713 0.1515 -0.0015 0.0045  0.0023  245  LEU A CA  
1940 C C   . LEU A 245 ? 0.1613 0.1794 0.1832 -0.0028 -0.0003 0.0027  245  LEU A C   
1941 O O   . LEU A 245 ? 0.1589 0.1741 0.1864 -0.0098 0.0010  -0.0140 245  LEU A O   
1942 C CB  . LEU A 245 ? 0.1647 0.1575 0.1613 -0.0002 -0.0114 0.0047  245  LEU A CB  
1943 C CG  . LEU A 245 ? 0.1489 0.1299 0.1443 0.0042  -0.0025 0.0013  245  LEU A CG  
1944 C CD1 . LEU A 245 ? 0.1671 0.1394 0.1540 -0.0039 -0.0020 0.0129  245  LEU A CD1 
1945 C CD2 . LEU A 245 ? 0.1626 0.1418 0.1762 -0.0010 0.0088  -0.0085 245  LEU A CD2 
1946 N N   . SER A 246 ? 0.1848 0.1999 0.1874 -0.0028 -0.0101 -0.0041 246  SER A N   
1947 C CA  . SER A 246 ? 0.1918 0.2078 0.2001 -0.0035 -0.0093 -0.0050 246  SER A CA  
1948 C C   . SER A 246 ? 0.2037 0.2099 0.2034 0.0052  -0.0041 0.0065  246  SER A C   
1949 O O   . SER A 246 ? 0.2074 0.2028 0.2002 0.0037  -0.0064 0.0132  246  SER A O   
1950 C CB  . SER A 246 ? 0.1800 0.1848 0.1762 -0.0106 -0.0162 -0.0003 246  SER A CB  
1951 O OG  . SER A 246 ? 0.2049 0.1985 0.1992 -0.0163 -0.0130 -0.0013 246  SER A OG  
1952 N N   . THR A 247 ? 0.2222 0.2255 0.2370 0.0044  -0.0113 0.0059  247  THR A N   
1953 C CA  . THR A 247 ? 0.2316 0.2456 0.2449 0.0072  -0.0116 0.0049  247  THR A CA  
1954 C C   . THR A 247 ? 0.2586 0.2543 0.2618 0.0031  -0.0089 0.0073  247  THR A C   
1955 O O   . THR A 247 ? 0.2496 0.2731 0.2657 0.0110  -0.0225 0.0174  247  THR A O   
1956 C CB  . THR A 247 ? 0.2526 0.2420 0.2525 0.0129  -0.0018 -0.0009 247  THR A CB  
1957 O OG1 . THR A 247 ? 0.2760 0.2534 0.2777 0.0001  -0.0169 -0.0166 247  THR A OG1 
1958 C CG2 . THR A 247 ? 0.2715 0.2709 0.2676 0.0038  -0.0005 0.0095  247  THR A CG2 
1959 N N   . ASN A 248 ? 0.2762 0.2626 0.2686 0.0019  -0.0051 0.0041  248  ASN A N   
1960 C CA  . ASN A 248 ? 0.3090 0.2956 0.2924 0.0010  -0.0039 0.0090  248  ASN A CA  
1961 C C   . ASN A 248 ? 0.3115 0.3013 0.2994 -0.0007 -0.0050 0.0079  248  ASN A C   
1962 O O   . ASN A 248 ? 0.3054 0.2887 0.3004 -0.0037 -0.0149 0.0221  248  ASN A O   
1963 C CB  . ASN A 248 ? 0.3291 0.3142 0.3026 0.0001  0.0001  -0.0001 248  ASN A CB  
1964 C CG  . ASN A 248 ? 0.3663 0.3558 0.3276 -0.0019 -0.0061 -0.0006 248  ASN A CG  
1965 O OD1 . ASN A 248 ? 0.3829 0.3731 0.3184 -0.0033 -0.0121 -0.0023 248  ASN A OD1 
1966 N ND2 . ASN A 248 ? 0.4391 0.4003 0.3983 -0.0186 -0.0001 -0.0108 248  ASN A ND2 
1967 N N   . THR A 249 ? 0.3312 0.3129 0.3185 -0.0007 -0.0101 0.0066  249  THR A N   
1968 C CA  . THR A 249 ? 0.3466 0.3317 0.3359 0.0023  -0.0073 0.0048  249  THR A CA  
1969 C C   . THR A 249 ? 0.3457 0.3352 0.3374 0.0030  -0.0074 0.0058  249  THR A C   
1970 O O   . THR A 249 ? 0.3512 0.3539 0.3387 0.0056  -0.0169 0.0104  249  THR A O   
1971 C CB  . THR A 249 ? 0.3498 0.3363 0.3431 0.0057  -0.0072 0.0032  249  THR A CB  
1972 O OG1 . THR A 249 ? 0.3768 0.3682 0.3481 0.0073  0.0014  -0.0004 249  THR A OG1 
1973 C CG2 . THR A 249 ? 0.3414 0.3335 0.3366 0.0012  -0.0041 0.0070  249  THR A CG2 
1974 N N   . THR A 250 ? 0.3573 0.3455 0.3373 0.0015  -0.0057 0.0035  250  THR A N   
1975 C CA  . THR A 250 ? 0.3547 0.3494 0.3366 0.0008  -0.0023 0.0025  250  THR A CA  
1976 C C   . THR A 250 ? 0.3514 0.3369 0.3208 -0.0003 -0.0034 0.0012  250  THR A C   
1977 O O   . THR A 250 ? 0.3553 0.3375 0.3028 -0.0013 -0.0049 0.0110  250  THR A O   
1978 C CB  . THR A 250 ? 0.3604 0.3498 0.3463 0.0002  -0.0009 0.0039  250  THR A CB  
1979 O OG1 . THR A 250 ? 0.3688 0.3879 0.3783 0.0117  -0.0014 0.0173  250  THR A OG1 
1980 C CG2 . THR A 250 ? 0.3661 0.3707 0.3500 0.0035  -0.0026 -0.0001 250  THR A CG2 
1981 N N   . LYS A 251 ? 0.3431 0.3167 0.3026 -0.0015 -0.0025 -0.0022 251  LYS A N   
1982 C CA  . LYS A 251 ? 0.3382 0.3236 0.3103 -0.0056 -0.0055 0.0006  251  LYS A CA  
1983 C C   . LYS A 251 ? 0.3246 0.3068 0.2935 -0.0015 -0.0032 0.0082  251  LYS A C   
1984 O O   . LYS A 251 ? 0.3275 0.2992 0.2837 -0.0103 -0.0009 0.0118  251  LYS A O   
1985 C CB  . LYS A 251 ? 0.3461 0.3263 0.3122 -0.0039 -0.0008 0.0080  251  LYS A CB  
1986 C CG  . LYS A 251 ? 0.4030 0.3779 0.3752 -0.0080 -0.0071 -0.0079 251  LYS A CG  
1987 C CD  . LYS A 251 ? 0.4256 0.4522 0.4379 0.0010  -0.0063 -0.0022 251  LYS A CD  
1988 C CE  . LYS A 251 ? 0.4780 0.4610 0.4651 0.0000  -0.0057 -0.0085 251  LYS A CE  
1989 N NZ  . LYS A 251 ? 0.4759 0.4784 0.4728 0.0018  -0.0009 -0.0071 251  LYS A NZ  
1990 N N   . VAL A 252 ? 0.3130 0.2920 0.2918 -0.0022 -0.0042 0.0072  252  VAL A N   
1991 C CA  . VAL A 252 ? 0.3006 0.2825 0.2866 -0.0030 0.0001  0.0103  252  VAL A CA  
1992 C C   . VAL A 252 ? 0.3125 0.2874 0.3011 -0.0025 0.0027  0.0099  252  VAL A C   
1993 O O   . VAL A 252 ? 0.3143 0.2728 0.2860 -0.0044 -0.0077 0.0193  252  VAL A O   
1994 C CB  . VAL A 252 ? 0.2969 0.2729 0.2856 -0.0007 0.0006  0.0118  252  VAL A CB  
1995 C CG1 . VAL A 252 ? 0.3007 0.2911 0.2973 0.0007  -0.0036 0.0066  252  VAL A CG1 
1996 C CG2 . VAL A 252 ? 0.2725 0.2563 0.2688 -0.0045 0.0067  0.0069  252  VAL A CG2 
1997 N N   . LYS A 253 ? 0.3359 0.3130 0.3120 -0.0002 -0.0009 0.0086  253  LYS A N   
1998 C CA  . LYS A 253 ? 0.3634 0.3455 0.3433 -0.0003 0.0029  0.0119  253  LYS A CA  
1999 C C   . LYS A 253 ? 0.3707 0.3501 0.3462 0.0018  0.0001  0.0076  253  LYS A C   
2000 O O   . LYS A 253 ? 0.3644 0.3452 0.3363 0.0080  0.0027  0.0090  253  LYS A O   
2001 C CB  . LYS A 253 ? 0.3714 0.3571 0.3621 0.0037  -0.0047 0.0103  253  LYS A CB  
2002 C CG  . LYS A 253 ? 0.4230 0.4199 0.4017 0.0037  0.0066  -0.0058 253  LYS A CG  
2003 C CD  . LYS A 253 ? 0.4741 0.4884 0.4847 0.0144  -0.0082 0.0114  253  LYS A CD  
2004 C CE  . LYS A 253 ? 0.5214 0.5322 0.5290 -0.0092 -0.0048 -0.0059 253  LYS A CE  
2005 N NZ  . LYS A 253 ? 0.5637 0.5627 0.5402 -0.0002 0.0028  0.0041  253  LYS A NZ  
2006 N N   . GLU A 254 ? 0.3909 0.3688 0.3602 -0.0051 0.0007  0.0061  254  GLU A N   
2007 C CA  . GLU A 254 ? 0.3946 0.3811 0.3670 -0.0014 0.0025  0.0062  254  GLU A CA  
2008 C C   . GLU A 254 ? 0.3894 0.3812 0.3653 -0.0047 0.0053  0.0064  254  GLU A C   
2009 O O   . GLU A 254 ? 0.3960 0.3792 0.3534 -0.0086 0.0077  0.0077  254  GLU A O   
2010 C CB  . GLU A 254 ? 0.4080 0.3917 0.3882 -0.0065 0.0043  0.0010  254  GLU A CB  
2011 C CG  . GLU A 254 ? 0.4402 0.4360 0.4263 0.0082  -0.0019 0.0042  254  GLU A CG  
2012 C CD  . GLU A 254 ? 0.4891 0.4932 0.4947 -0.0093 -0.0058 -0.0081 254  GLU A CD  
2013 O OE1 . GLU A 254 ? 0.5132 0.5292 0.5132 0.0062  -0.0080 -0.0053 254  GLU A OE1 
2014 O OE2 . GLU A 254 ? 0.5388 0.5126 0.5185 -0.0108 -0.0054 0.0021  254  GLU A OE2 
2015 N N   . PHE A 255 ? 0.3861 0.3767 0.3589 -0.0064 0.0000  0.0103  255  PHE A N   
2016 C CA  . PHE A 255 ? 0.3751 0.3751 0.3544 -0.0048 0.0041  0.0108  255  PHE A CA  
2017 C C   . PHE A 255 ? 0.3757 0.3760 0.3491 -0.0033 0.0049  0.0114  255  PHE A C   
2018 O O   . PHE A 255 ? 0.3717 0.3786 0.3527 -0.0050 0.0042  0.0220  255  PHE A O   
2019 C CB  . PHE A 255 ? 0.3722 0.3750 0.3486 -0.0033 0.0037  0.0091  255  PHE A CB  
2020 C CG  . PHE A 255 ? 0.3777 0.3714 0.3675 0.0021  0.0052  0.0048  255  PHE A CG  
2021 C CD1 . PHE A 255 ? 0.3714 0.3858 0.3742 -0.0002 -0.0020 0.0018  255  PHE A CD1 
2022 C CD2 . PHE A 255 ? 0.3738 0.3874 0.3699 0.0032  0.0060  0.0046  255  PHE A CD2 
2023 C CE1 . PHE A 255 ? 0.3800 0.3768 0.3885 0.0095  0.0044  0.0036  255  PHE A CE1 
2024 C CE2 . PHE A 255 ? 0.3648 0.3584 0.3489 0.0078  0.0096  0.0078  255  PHE A CE2 
2025 C CZ  . PHE A 255 ? 0.3550 0.3584 0.3613 0.0004  0.0084  0.0094  255  PHE A CZ  
2026 N N   . GLY A 256 ? 0.3658 0.3658 0.3380 -0.0042 0.0065  0.0083  256  GLY A N   
2027 C CA  . GLY A 256 ? 0.3786 0.3722 0.3534 -0.0050 0.0074  0.0103  256  GLY A CA  
2028 C C   . GLY A 256 ? 0.3728 0.3659 0.3491 -0.0025 0.0015  0.0102  256  GLY A C   
2029 O O   . GLY A 256 ? 0.3793 0.3716 0.3580 -0.0047 0.0030  0.0263  256  GLY A O   
2030 N N   . ILE A 257 ? 0.3760 0.3642 0.3432 0.0000  0.0038  0.0143  257  ILE A N   
2031 C CA  . ILE A 257 ? 0.3747 0.3667 0.3606 0.0006  0.0043  0.0071  257  ILE A CA  
2032 C C   . ILE A 257 ? 0.3818 0.3853 0.3690 0.0035  0.0019  0.0082  257  ILE A C   
2033 O O   . ILE A 257 ? 0.3926 0.3927 0.3848 0.0018  -0.0027 0.0074  257  ILE A O   
2034 C CB  . ILE A 257 ? 0.3673 0.3731 0.3467 0.0041  0.0045  0.0058  257  ILE A CB  
2035 C CG1 . ILE A 257 ? 0.3714 0.3615 0.3634 0.0076  0.0046  0.0073  257  ILE A CG1 
2036 C CG2 . ILE A 257 ? 0.3448 0.3510 0.3463 0.0044  0.0031  0.0112  257  ILE A CG2 
2037 C CD1 . ILE A 257 ? 0.3533 0.3716 0.3525 -0.0003 0.0033  0.0081  257  ILE A CD1 
2038 N N   . ASP A 258 ? 0.3893 0.3864 0.3826 -0.0040 0.0054  0.0092  258  ASP A N   
2039 C CA  . ASP A 258 ? 0.4047 0.4124 0.4037 0.0046  0.0055  0.0110  258  ASP A CA  
2040 C C   . ASP A 258 ? 0.4031 0.4145 0.4057 0.0046  0.0011  0.0133  258  ASP A C   
2041 O O   . ASP A 258 ? 0.4128 0.4070 0.4011 0.0112  0.0060  0.0208  258  ASP A O   
2042 C CB  . ASP A 258 ? 0.4136 0.4265 0.4158 -0.0038 0.0039  0.0058  258  ASP A CB  
2043 C CG  . ASP A 258 ? 0.4748 0.4617 0.4748 0.0028  0.0048  0.0092  258  ASP A CG  
2044 O OD1 . ASP A 258 ? 0.4922 0.5105 0.5156 0.0029  0.0031  0.0270  258  ASP A OD1 
2045 O OD2 . ASP A 258 ? 0.5200 0.5023 0.5189 -0.0132 -0.0068 -0.0010 258  ASP A OD2 
2046 N N   . PRO A 259 ? 0.4004 0.4116 0.4058 0.0087  -0.0006 0.0142  259  PRO A N   
2047 C CA  . PRO A 259 ? 0.3891 0.3961 0.3948 0.0046  0.0002  0.0144  259  PRO A CA  
2048 C C   . PRO A 259 ? 0.3728 0.3742 0.3888 0.0052  -0.0054 0.0148  259  PRO A C   
2049 O O   . PRO A 259 ? 0.3650 0.3883 0.4046 0.0085  -0.0038 0.0166  259  PRO A O   
2050 C CB  . PRO A 259 ? 0.3966 0.4039 0.3991 0.0060  -0.0018 0.0112  259  PRO A CB  
2051 C CG  . PRO A 259 ? 0.4038 0.4093 0.4109 0.0058  0.0008  0.0106  259  PRO A CG  
2052 C CD  . PRO A 259 ? 0.4058 0.4152 0.4084 0.0089  0.0053  0.0127  259  PRO A CD  
2053 N N   . GLN A 260 ? 0.3586 0.3529 0.3698 0.0072  -0.0037 0.0185  260  GLN A N   
2054 C CA  . GLN A 260 ? 0.3506 0.3329 0.3577 0.0051  -0.0045 0.0193  260  GLN A CA  
2055 C C   . GLN A 260 ? 0.3208 0.3040 0.3337 0.0019  -0.0004 0.0119  260  GLN A C   
2056 O O   . GLN A 260 ? 0.3420 0.2858 0.3367 0.0056  -0.0029 0.0218  260  GLN A O   
2057 C CB  . GLN A 260 ? 0.3745 0.3575 0.3798 -0.0035 -0.0005 0.0044  260  GLN A CB  
2058 C CG  . GLN A 260 ? 0.4410 0.4213 0.4337 0.0160  -0.0041 0.0133  260  GLN A CG  
2059 C CD  . GLN A 260 ? 0.5136 0.4903 0.5332 -0.0133 0.0032  0.0031  260  GLN A CD  
2060 O OE1 . GLN A 260 ? 0.5604 0.5229 0.5600 0.0020  0.0011  -0.0133 260  GLN A OE1 
2061 N NE2 . GLN A 260 ? 0.5324 0.5342 0.5597 -0.0018 0.0094  0.0066  260  GLN A NE2 
2062 N N   . ASN A 261 ? 0.2909 0.2650 0.3046 0.0014  -0.0082 0.0251  261  ASN A N   
2063 C CA  . ASN A 261 ? 0.2608 0.2449 0.2835 -0.0025 0.0005  0.0173  261  ASN A CA  
2064 C C   . ASN A 261 ? 0.2401 0.2262 0.2521 -0.0003 -0.0016 0.0145  261  ASN A C   
2065 O O   . ASN A 261 ? 0.2195 0.2059 0.2258 -0.0038 0.0008  0.0142  261  ASN A O   
2066 C CB  . ASN A 261 ? 0.2655 0.2528 0.2783 0.0021  -0.0024 0.0189  261  ASN A CB  
2067 C CG  . ASN A 261 ? 0.2760 0.2745 0.3082 -0.0037 0.0023  0.0030  261  ASN A CG  
2068 O OD1 . ASN A 261 ? 0.3030 0.2890 0.3709 0.0147  0.0039  -0.0044 261  ASN A OD1 
2069 N ND2 . ASN A 261 ? 0.2738 0.2630 0.3132 -0.0153 0.0057  0.0077  261  ASN A ND2 
2070 N N   . MET A 262 ? 0.2317 0.2125 0.2286 -0.0052 0.0017  0.0158  262  MET A N   
2071 C CA  . MET A 262 ? 0.2245 0.2120 0.2144 -0.0029 0.0008  0.0096  262  MET A CA  
2072 C C   . MET A 262 ? 0.2134 0.1951 0.2142 -0.0014 0.0065  0.0132  262  MET A C   
2073 O O   . MET A 262 ? 0.2172 0.2032 0.2220 0.0075  0.0209  0.0329  262  MET A O   
2074 C CB  . MET A 262 ? 0.2355 0.2417 0.2225 -0.0042 0.0018  0.0114  262  MET A CB  
2075 C CG  . MET A 262 ? 0.2797 0.2691 0.2722 -0.0142 -0.0123 -0.0012 262  MET A CG  
2076 S SD  . MET A 262 ? 0.3667 0.3779 0.3031 -0.0293 -0.0319 -0.0091 262  MET A SD  
2077 C CE  . MET A 262 ? 0.3873 0.3750 0.3616 0.0036  0.0007  0.0005  262  MET A CE  
2078 N N   . PHE A 263 ? 0.1865 0.1730 0.1728 -0.0012 0.0045  0.0151  263  PHE A N   
2079 C CA  . PHE A 263 ? 0.1758 0.1594 0.1748 0.0006  -0.0008 0.0044  263  PHE A CA  
2080 C C   . PHE A 263 ? 0.1647 0.1717 0.1794 -0.0014 0.0053  0.0080  263  PHE A C   
2081 O O   . PHE A 263 ? 0.1569 0.1704 0.1848 -0.0066 0.0081  0.0113  263  PHE A O   
2082 C CB  . PHE A 263 ? 0.1837 0.1670 0.1711 -0.0110 -0.0029 0.0075  263  PHE A CB  
2083 C CG  . PHE A 263 ? 0.1767 0.1496 0.1615 -0.0079 0.0006  0.0157  263  PHE A CG  
2084 C CD1 . PHE A 263 ? 0.1762 0.1639 0.1744 -0.0107 -0.0121 0.0165  263  PHE A CD1 
2085 C CD2 . PHE A 263 ? 0.1878 0.1796 0.1993 -0.0142 0.0083  -0.0006 263  PHE A CD2 
2086 C CE1 . PHE A 263 ? 0.1769 0.1574 0.1905 -0.0074 -0.0115 0.0033  263  PHE A CE1 
2087 C CE2 . PHE A 263 ? 0.1912 0.1874 0.2093 -0.0091 0.0090  -0.0112 263  PHE A CE2 
2088 C CZ  . PHE A 263 ? 0.1749 0.1617 0.1768 0.0076  -0.0039 0.0108  263  PHE A CZ  
2089 N N   . GLU A 264 ? 0.1670 0.1594 0.1750 -0.0014 0.0074  0.0061  264  GLU A N   
2090 C CA  . GLU A 264 ? 0.1663 0.1735 0.1865 0.0025  -0.0049 0.0065  264  GLU A CA  
2091 C C   . GLU A 264 ? 0.1576 0.1642 0.1784 0.0055  -0.0107 0.0016  264  GLU A C   
2092 O O   . GLU A 264 ? 0.1611 0.1640 0.1785 -0.0002 -0.0040 0.0071  264  GLU A O   
2093 C CB  . GLU A 264 ? 0.1783 0.1731 0.2098 0.0109  -0.0026 0.0054  264  GLU A CB  
2094 C CG  . GLU A 264 ? 0.2761 0.2778 0.2891 -0.0068 -0.0111 -0.0105 264  GLU A CG  
2095 C CD  . GLU A 264 ? 0.3455 0.3403 0.3563 0.0140  -0.0164 0.0115  264  GLU A CD  
2096 O OE1 . GLU A 264 ? 0.3513 0.3518 0.3853 -0.0004 -0.0214 0.0075  264  GLU A OE1 
2097 O OE2 . GLU A 264 ? 0.4132 0.4062 0.4074 -0.0120 -0.0175 -0.0045 264  GLU A OE2 
2098 N N   . PHE A 265 ? 0.1583 0.1528 0.1767 -0.0032 -0.0104 0.0164  265  PHE A N   
2099 C CA  . PHE A 265 ? 0.1630 0.1616 0.1673 -0.0098 -0.0029 0.0031  265  PHE A CA  
2100 C C   . PHE A 265 ? 0.1707 0.1753 0.1729 -0.0039 -0.0048 0.0072  265  PHE A C   
2101 O O   . PHE A 265 ? 0.1853 0.1873 0.1781 -0.0295 0.0050  0.0138  265  PHE A O   
2102 C CB  . PHE A 265 ? 0.1582 0.1462 0.1616 -0.0061 -0.0111 -0.0035 265  PHE A CB  
2103 C CG  . PHE A 265 ? 0.1507 0.1668 0.1720 -0.0020 -0.0047 0.0011  265  PHE A CG  
2104 C CD1 . PHE A 265 ? 0.2042 0.1730 0.1916 -0.0001 -0.0188 -0.0023 265  PHE A CD1 
2105 C CD2 . PHE A 265 ? 0.1765 0.1917 0.1624 0.0059  -0.0062 0.0070  265  PHE A CD2 
2106 C CE1 . PHE A 265 ? 0.1698 0.2012 0.1597 -0.0078 -0.0168 -0.0158 265  PHE A CE1 
2107 C CE2 . PHE A 265 ? 0.1691 0.1738 0.1599 -0.0041 -0.0165 0.0053  265  PHE A CE2 
2108 C CZ  . PHE A 265 ? 0.1835 0.1748 0.1838 -0.0002 0.0047  -0.0016 265  PHE A CZ  
2109 N N   . TRP A 266 ? 0.1625 0.1545 0.1824 -0.0063 -0.0040 0.0073  266  TRP A N   
2110 C CA  . TRP A 266 ? 0.1676 0.1558 0.1720 0.0027  -0.0084 -0.0043 266  TRP A CA  
2111 C C   . TRP A 266 ? 0.1587 0.1524 0.1701 -0.0036 -0.0062 0.0031  266  TRP A C   
2112 O O   . TRP A 266 ? 0.1478 0.1542 0.1722 0.0001  -0.0089 0.0001  266  TRP A O   
2113 C CB  . TRP A 266 ? 0.1653 0.1585 0.1832 0.0019  0.0014  -0.0024 266  TRP A CB  
2114 C CG  . TRP A 266 ? 0.1797 0.1649 0.1674 -0.0109 -0.0072 0.0002  266  TRP A CG  
2115 C CD1 . TRP A 266 ? 0.2191 0.1863 0.2019 -0.0047 -0.0174 0.0089  266  TRP A CD1 
2116 C CD2 . TRP A 266 ? 0.1670 0.1523 0.1662 0.0019  -0.0056 -0.0106 266  TRP A CD2 
2117 N NE1 . TRP A 266 ? 0.2230 0.1830 0.2033 -0.0035 -0.0126 0.0021  266  TRP A NE1 
2118 C CE2 . TRP A 266 ? 0.1827 0.1613 0.1795 0.0078  -0.0039 -0.0053 266  TRP A CE2 
2119 C CE3 . TRP A 266 ? 0.1812 0.1506 0.1671 0.0188  0.0035  -0.0046 266  TRP A CE3 
2120 C CZ2 . TRP A 266 ? 0.1746 0.1939 0.1785 0.0007  0.0104  -0.0119 266  TRP A CZ2 
2121 C CZ3 . TRP A 266 ? 0.1739 0.1629 0.1716 0.0071  -0.0061 0.0023  266  TRP A CZ3 
2122 C CH2 . TRP A 266 ? 0.1874 0.1728 0.1953 0.0041  0.0035  -0.0038 266  TRP A CH2 
2123 N N   . ASP A 267 ? 0.1579 0.1377 0.1616 -0.0002 -0.0034 0.0004  267  ASP A N   
2124 C CA  . ASP A 267 ? 0.1614 0.1446 0.1631 -0.0079 -0.0025 -0.0022 267  ASP A CA  
2125 C C   . ASP A 267 ? 0.1579 0.1414 0.1569 -0.0011 -0.0008 -0.0044 267  ASP A C   
2126 O O   . ASP A 267 ? 0.1503 0.1357 0.1603 -0.0050 -0.0029 0.0050  267  ASP A O   
2127 C CB  . ASP A 267 ? 0.1721 0.1730 0.1678 -0.0004 -0.0035 -0.0010 267  ASP A CB  
2128 C CG  . ASP A 267 ? 0.2225 0.2401 0.2367 0.0133  -0.0120 -0.0022 267  ASP A CG  
2129 O OD1 . ASP A 267 ? 0.2546 0.2929 0.2332 0.0266  -0.0130 0.0058  267  ASP A OD1 
2130 O OD2 . ASP A 267 ? 0.2767 0.2914 0.2456 0.0152  -0.0210 -0.0160 267  ASP A OD2 
2131 N N   . TRP A 268 ? 0.1346 0.1372 0.1451 -0.0040 -0.0027 -0.0011 268  TRP A N   
2132 C CA  . TRP A 268 ? 0.1373 0.1455 0.1417 0.0106  -0.0063 0.0004  268  TRP A CA  
2133 C C   . TRP A 268 ? 0.1381 0.1383 0.1306 0.0049  -0.0035 -0.0048 268  TRP A C   
2134 O O   . TRP A 268 ? 0.1503 0.1305 0.1390 0.0075  0.0013  0.0097  268  TRP A O   
2135 C CB  . TRP A 268 ? 0.1354 0.1274 0.1586 0.0116  -0.0013 -0.0062 268  TRP A CB  
2136 C CG  . TRP A 268 ? 0.1349 0.1314 0.1495 -0.0050 -0.0128 0.0118  268  TRP A CG  
2137 C CD1 . TRP A 268 ? 0.1524 0.1354 0.1636 0.0067  -0.0008 0.0039  268  TRP A CD1 
2138 C CD2 . TRP A 268 ? 0.1485 0.1260 0.1487 0.0059  -0.0035 0.0022  268  TRP A CD2 
2139 N NE1 . TRP A 268 ? 0.1655 0.1365 0.1601 -0.0051 -0.0104 -0.0035 268  TRP A NE1 
2140 C CE2 . TRP A 268 ? 0.1594 0.1447 0.1497 -0.0035 -0.0023 -0.0007 268  TRP A CE2 
2141 C CE3 . TRP A 268 ? 0.1395 0.1545 0.1681 -0.0049 -0.0091 -0.0085 268  TRP A CE3 
2142 C CZ2 . TRP A 268 ? 0.1736 0.1656 0.1691 -0.0102 0.0000  -0.0057 268  TRP A CZ2 
2143 C CZ3 . TRP A 268 ? 0.1515 0.1559 0.1823 -0.0021 -0.0047 -0.0062 268  TRP A CZ3 
2144 C CH2 . TRP A 268 ? 0.1570 0.1594 0.1671 0.0071  0.0013  -0.0043 268  TRP A CH2 
2145 N N   . VAL A 269 ? 0.1430 0.1361 0.1264 0.0141  -0.0078 -0.0099 269  VAL A N   
2146 C CA  . VAL A 269 ? 0.1435 0.1416 0.1447 0.0077  -0.0072 -0.0041 269  VAL A CA  
2147 C C   . VAL A 269 ? 0.1519 0.1346 0.1384 0.0019  -0.0047 -0.0022 269  VAL A C   
2148 O O   . VAL A 269 ? 0.1611 0.1318 0.1476 0.0024  -0.0063 0.0051  269  VAL A O   
2149 C CB  . VAL A 269 ? 0.1525 0.1449 0.1494 0.0064  -0.0067 -0.0068 269  VAL A CB  
2150 C CG1 . VAL A 269 ? 0.1607 0.1467 0.1503 0.0008  -0.0117 0.0076  269  VAL A CG1 
2151 C CG2 . VAL A 269 ? 0.1460 0.1337 0.1527 0.0139  -0.0145 -0.0029 269  VAL A CG2 
2152 N N   . GLY A 270 ? 0.1542 0.1297 0.1399 0.0039  -0.0133 0.0021  270  GLY A N   
2153 C CA  . GLY A 270 ? 0.1355 0.1417 0.1424 0.0051  -0.0030 -0.0019 270  GLY A CA  
2154 C C   . GLY A 270 ? 0.1378 0.1387 0.1434 0.0069  0.0009  -0.0005 270  GLY A C   
2155 O O   . GLY A 270 ? 0.1211 0.1398 0.1430 0.0037  -0.0121 0.0042  270  GLY A O   
2156 N N   . GLY A 271 ? 0.1172 0.1325 0.1369 0.0013  0.0121  0.0124  271  GLY A N   
2157 C CA  . GLY A 271 ? 0.1325 0.1375 0.1493 0.0069  0.0047  0.0108  271  GLY A CA  
2158 C C   . GLY A 271 ? 0.1346 0.1309 0.1466 0.0023  0.0081  0.0024  271  GLY A C   
2159 O O   . GLY A 271 ? 0.1335 0.1147 0.1579 0.0019  0.0093  0.0038  271  GLY A O   
2160 N N   . ARG A 272 ? 0.1441 0.1200 0.1554 0.0032  0.0088  0.0023  272  ARG A N   
2161 C CA  . ARG A 272 ? 0.1381 0.1163 0.1491 -0.0004 0.0032  -0.0016 272  ARG A CA  
2162 C C   . ARG A 272 ? 0.1363 0.1274 0.1458 -0.0045 0.0018  0.0004  272  ARG A C   
2163 O O   . ARG A 272 ? 0.1370 0.1109 0.1441 -0.0011 0.0008  -0.0011 272  ARG A O   
2164 C CB  . ARG A 272 ? 0.1283 0.1214 0.1520 -0.0105 -0.0106 -0.0101 272  ARG A CB  
2165 C CG  . ARG A 272 ? 0.1259 0.1479 0.1548 0.0050  -0.0095 -0.0018 272  ARG A CG  
2166 C CD  . ARG A 272 ? 0.1211 0.1229 0.1326 -0.0040 -0.0103 -0.0153 272  ARG A CD  
2167 N NE  . ARG A 272 ? 0.1162 0.1377 0.1284 -0.0044 -0.0113 0.0021  272  ARG A NE  
2168 C CZ  . ARG A 272 ? 0.1320 0.1191 0.1329 -0.0254 0.0028  -0.0101 272  ARG A CZ  
2169 N NH1 . ARG A 272 ? 0.1256 0.1143 0.1606 0.0080  -0.0163 -0.0004 272  ARG A NH1 
2170 N NH2 . ARG A 272 ? 0.1521 0.1068 0.1230 -0.0181 0.0135  -0.0135 272  ARG A NH2 
2171 N N   . TYR A 273 ? 0.1311 0.1168 0.1424 -0.0060 0.0078  -0.0036 273  TYR A N   
2172 C CA  . TYR A 273 ? 0.1259 0.1215 0.1597 0.0011  0.0072  -0.0001 273  TYR A CA  
2173 C C   . TYR A 273 ? 0.1234 0.1206 0.1327 0.0061  0.0003  0.0055  273  TYR A C   
2174 O O   . TYR A 273 ? 0.1180 0.1049 0.1285 0.0050  0.0179  -0.0019 273  TYR A O   
2175 C CB  . TYR A 273 ? 0.1287 0.1228 0.1506 -0.0077 -0.0024 0.0103  273  TYR A CB  
2176 C CG  . TYR A 273 ? 0.1442 0.1077 0.1484 0.0054  0.0014  -0.0076 273  TYR A CG  
2177 C CD1 . TYR A 273 ? 0.0982 0.1267 0.1348 0.0003  -0.0027 -0.0134 273  TYR A CD1 
2178 C CD2 . TYR A 273 ? 0.1175 0.1167 0.1380 0.0084  0.0017  0.0028  273  TYR A CD2 
2179 C CE1 . TYR A 273 ? 0.1352 0.1123 0.1389 0.0064  0.0074  0.0017  273  TYR A CE1 
2180 C CE2 . TYR A 273 ? 0.1487 0.1188 0.1423 0.0048  0.0010  0.0012  273  TYR A CE2 
2181 C CZ  . TYR A 273 ? 0.1180 0.1059 0.1303 0.0091  -0.0028 0.0023  273  TYR A CZ  
2182 O OH  . TYR A 273 ? 0.1427 0.1108 0.1267 -0.0047 -0.0022 0.0046  273  TYR A OH  
2183 N N   . SER A 274 ? 0.1230 0.1123 0.1367 -0.0049 0.0046  0.0000  274  SER A N   
2184 C CA  . SER A 274 ? 0.1176 0.1205 0.1253 -0.0038 -0.0006 0.0059  274  SER A CA  
2185 C C   . SER A 274 ? 0.1188 0.1289 0.1273 -0.0035 -0.0003 0.0074  274  SER A C   
2186 O O   . SER A 274 ? 0.1251 0.1179 0.1215 -0.0058 -0.0102 -0.0055 274  SER A O   
2187 C CB  . SER A 274 ? 0.1256 0.1259 0.1366 0.0122  0.0011  0.0046  274  SER A CB  
2188 O OG  . SER A 274 ? 0.1063 0.1306 0.1527 -0.0083 -0.0123 -0.0004 274  SER A OG  
2189 N N   . LEU A 275 ? 0.1057 0.1377 0.1172 -0.0073 0.0016  0.0065  275  LEU A N   
2190 C CA  . LEU A 275 ? 0.1301 0.1257 0.1225 0.0014  -0.0041 0.0068  275  LEU A CA  
2191 C C   . LEU A 275 ? 0.1260 0.1322 0.1330 0.0010  0.0026  -0.0015 275  LEU A C   
2192 O O   . LEU A 275 ? 0.1423 0.1355 0.1487 0.0060  -0.0059 -0.0021 275  LEU A O   
2193 C CB  . LEU A 275 ? 0.1271 0.1455 0.1250 0.0052  0.0000  0.0164  275  LEU A CB  
2194 C CG  . LEU A 275 ? 0.1336 0.1247 0.1198 0.0002  0.0088  0.0059  275  LEU A CG  
2195 C CD1 . LEU A 275 ? 0.1523 0.1526 0.1545 -0.0049 0.0034  -0.0160 275  LEU A CD1 
2196 C CD2 . LEU A 275 ? 0.1587 0.1351 0.1587 0.0028  -0.0087 0.0098  275  LEU A CD2 
2197 N N   . TRP A 276 ? 0.1220 0.1291 0.1285 0.0039  0.0033  -0.0067 276  TRP A N   
2198 C CA  . TRP A 276 ? 0.1203 0.1194 0.1405 0.0074  0.0136  0.0042  276  TRP A CA  
2199 C C   . TRP A 276 ? 0.1307 0.1259 0.1405 0.0068  0.0067  0.0043  276  TRP A C   
2200 O O   . TRP A 276 ? 0.1595 0.1321 0.1472 0.0106  0.0000  0.0096  276  TRP A O   
2201 C CB  . TRP A 276 ? 0.1102 0.1232 0.1347 -0.0039 0.0064  -0.0026 276  TRP A CB  
2202 C CG  . TRP A 276 ? 0.1199 0.1213 0.1132 0.0005  0.0028  -0.0005 276  TRP A CG  
2203 C CD1 . TRP A 276 ? 0.1198 0.0974 0.1148 0.0044  0.0029  0.0143  276  TRP A CD1 
2204 C CD2 . TRP A 276 ? 0.1121 0.1033 0.1125 -0.0089 0.0034  0.0107  276  TRP A CD2 
2205 N NE1 . TRP A 276 ? 0.1269 0.1304 0.1060 0.0080  0.0024  0.0167  276  TRP A NE1 
2206 C CE2 . TRP A 276 ? 0.1256 0.0935 0.1193 0.0053  0.0029  -0.0127 276  TRP A CE2 
2207 C CE3 . TRP A 276 ? 0.1220 0.1257 0.1054 0.0015  -0.0048 0.0019  276  TRP A CE3 
2208 C CZ2 . TRP A 276 ? 0.1307 0.1371 0.1287 -0.0059 -0.0056 -0.0030 276  TRP A CZ2 
2209 C CZ3 . TRP A 276 ? 0.1197 0.1022 0.1289 0.0075  -0.0009 0.0202  276  TRP A CZ3 
2210 C CH2 . TRP A 276 ? 0.1397 0.1049 0.1520 -0.0023 -0.0002 -0.0111 276  TRP A CH2 
2211 N N   . SER A 277 ? 0.1339 0.1177 0.1285 0.0020  -0.0032 0.0129  277  SER A N   
2212 C CA  . SER A 277 ? 0.1313 0.1354 0.1330 -0.0002 -0.0024 0.0087  277  SER A CA  
2213 C C   . SER A 277 ? 0.1377 0.1213 0.1376 0.0062  -0.0002 0.0039  277  SER A C   
2214 O O   . SER A 277 ? 0.1269 0.1156 0.1394 -0.0029 -0.0005 0.0013  277  SER A O   
2215 C CB  . SER A 277 ? 0.1410 0.1385 0.1335 0.0069  0.0032  -0.0006 277  SER A CB  
2216 O OG  . SER A 277 ? 0.1233 0.1150 0.1615 -0.0015 -0.0042 0.0067  277  SER A OG  
2217 N N   . ALA A 278 ? 0.1314 0.1204 0.1364 0.0008  0.0053  0.0055  278  ALA A N   
2218 C CA  . ALA A 278 ? 0.1326 0.1361 0.1440 0.0017  -0.0040 0.0067  278  ALA A CA  
2219 C C   . ALA A 278 ? 0.1470 0.1338 0.1572 -0.0039 -0.0025 0.0022  278  ALA A C   
2220 O O   . ALA A 278 ? 0.1331 0.1411 0.1420 -0.0005 -0.0056 -0.0020 278  ALA A O   
2221 C CB  . ALA A 278 ? 0.1478 0.1276 0.1468 0.0014  0.0064  0.0102  278  ALA A CB  
2222 N N   . ILE A 279 ? 0.1463 0.1189 0.1502 -0.0009 -0.0077 0.0053  279  ILE A N   
2223 C CA  . ILE A 279 ? 0.1468 0.1189 0.1401 -0.0003 -0.0034 0.0063  279  ILE A CA  
2224 C C   . ILE A 279 ? 0.1421 0.1385 0.1546 -0.0055 -0.0027 0.0035  279  ILE A C   
2225 O O   . ILE A 279 ? 0.1595 0.1527 0.1520 0.0065  0.0046  0.0091  279  ILE A O   
2226 C CB  . ILE A 279 ? 0.1347 0.1109 0.1471 0.0013  -0.0196 0.0105  279  ILE A CB  
2227 C CG1 . ILE A 279 ? 0.1576 0.1340 0.1369 0.0034  0.0062  0.0058  279  ILE A CG1 
2228 C CG2 . ILE A 279 ? 0.1349 0.1226 0.1509 0.0152  -0.0036 0.0118  279  ILE A CG2 
2229 C CD1 . ILE A 279 ? 0.1623 0.1572 0.1429 -0.0004 0.0083  -0.0126 279  ILE A CD1 
2230 N N   . GLY A 280 ? 0.1288 0.1263 0.1275 -0.0107 -0.0072 0.0048  280  GLY A N   
2231 C CA  . GLY A 280 ? 0.1526 0.1382 0.1385 -0.0232 -0.0029 0.0096  280  GLY A CA  
2232 C C   . GLY A 280 ? 0.1529 0.1447 0.1438 -0.0129 0.0005  0.0050  280  GLY A C   
2233 O O   . GLY A 280 ? 0.1507 0.1491 0.1345 -0.0199 0.0052  0.0177  280  GLY A O   
2234 N N   . LEU A 281 ? 0.1521 0.1230 0.1431 -0.0165 -0.0025 0.0109  281  LEU A N   
2235 C CA  . LEU A 281 ? 0.1554 0.1411 0.1425 -0.0105 -0.0011 0.0090  281  LEU A CA  
2236 C C   . LEU A 281 ? 0.1592 0.1411 0.1540 -0.0072 -0.0018 0.0006  281  LEU A C   
2237 O O   . LEU A 281 ? 0.1629 0.1357 0.1389 -0.0081 0.0047  -0.0036 281  LEU A O   
2238 C CB  . LEU A 281 ? 0.1539 0.1340 0.1264 -0.0164 0.0011  0.0076  281  LEU A CB  
2239 C CG  . LEU A 281 ? 0.1719 0.1536 0.1486 -0.0160 0.0025  0.0113  281  LEU A CG  
2240 C CD1 . LEU A 281 ? 0.1913 0.1751 0.1786 -0.0057 0.0129  0.0059  281  LEU A CD1 
2241 C CD2 . LEU A 281 ? 0.1899 0.1670 0.1476 -0.0213 0.0112  0.0064  281  LEU A CD2 
2242 N N   . SER A 282 ? 0.1487 0.1358 0.1413 0.0014  0.0003  0.0081  282  SER A N   
2243 C CA  . SER A 282 ? 0.1535 0.1397 0.1474 0.0000  -0.0015 -0.0005 282  SER A CA  
2244 C C   . SER A 282 ? 0.1500 0.1514 0.1529 0.0005  0.0029  0.0000  282  SER A C   
2245 O O   . SER A 282 ? 0.1559 0.1495 0.1312 -0.0061 0.0031  0.0014  282  SER A O   
2246 C CB  . SER A 282 ? 0.1469 0.1339 0.1559 -0.0030 0.0003  -0.0021 282  SER A CB  
2247 O OG  . SER A 282 ? 0.1580 0.1311 0.1640 -0.0189 0.0196  -0.0057 282  SER A OG  
2248 N N   . ILE A 283 ? 0.1477 0.1371 0.1434 -0.0083 0.0028  0.0036  283  ILE A N   
2249 C CA  . ILE A 283 ? 0.1416 0.1345 0.1415 -0.0079 0.0003  -0.0054 283  ILE A CA  
2250 C C   . ILE A 283 ? 0.1498 0.1399 0.1494 -0.0074 -0.0022 0.0022  283  ILE A C   
2251 O O   . ILE A 283 ? 0.1558 0.1366 0.1369 -0.0065 -0.0024 0.0044  283  ILE A O   
2252 C CB  . ILE A 283 ? 0.1422 0.1334 0.1272 -0.0132 0.0111  -0.0062 283  ILE A CB  
2253 C CG1 . ILE A 283 ? 0.1294 0.1352 0.1570 -0.0061 0.0039  0.0009  283  ILE A CG1 
2254 C CG2 . ILE A 283 ? 0.1366 0.1402 0.1150 -0.0127 -0.0106 -0.0049 283  ILE A CG2 
2255 C CD1 . ILE A 283 ? 0.1352 0.1601 0.1566 -0.0160 -0.0072 0.0049  283  ILE A CD1 
2256 N N   . ALA A 284 ? 0.1454 0.1372 0.1501 0.0003  -0.0025 0.0002  284  ALA A N   
2257 C CA  . ALA A 284 ? 0.1463 0.1425 0.1522 -0.0044 -0.0010 0.0021  284  ALA A CA  
2258 C C   . ALA A 284 ? 0.1507 0.1441 0.1511 -0.0038 -0.0009 -0.0010 284  ALA A C   
2259 O O   . ALA A 284 ? 0.1644 0.1430 0.1523 -0.0142 -0.0071 0.0095  284  ALA A O   
2260 C CB  . ALA A 284 ? 0.1645 0.1705 0.1631 0.0054  -0.0094 0.0001  284  ALA A CB  
2261 N N   . LEU A 285 ? 0.1558 0.1319 0.1594 -0.0064 0.0000  0.0089  285  LEU A N   
2262 C CA  . LEU A 285 ? 0.1480 0.1466 0.1592 -0.0017 0.0014  0.0009  285  LEU A CA  
2263 C C   . LEU A 285 ? 0.1730 0.1525 0.1665 -0.0090 -0.0060 -0.0021 285  LEU A C   
2264 O O   . LEU A 285 ? 0.1654 0.1586 0.1943 -0.0134 -0.0076 0.0064  285  LEU A O   
2265 C CB  . LEU A 285 ? 0.1666 0.1620 0.1528 -0.0065 0.0096  -0.0056 285  LEU A CB  
2266 C CG  . LEU A 285 ? 0.1656 0.1403 0.1601 -0.0024 0.0110  -0.0055 285  LEU A CG  
2267 C CD1 . LEU A 285 ? 0.2105 0.1849 0.1724 0.0077  0.0046  -0.0160 285  LEU A CD1 
2268 C CD2 . LEU A 285 ? 0.1872 0.1415 0.1682 -0.0085 0.0149  -0.0092 285  LEU A CD2 
2269 N N   . HIS A 286 ? 0.1560 0.1440 0.1580 -0.0077 -0.0074 0.0034  286  HIS A N   
2270 C CA  . HIS A 286 ? 0.1766 0.1468 0.1769 -0.0042 -0.0075 0.0007  286  HIS A CA  
2271 C C   . HIS A 286 ? 0.1882 0.1733 0.1827 -0.0067 -0.0061 0.0037  286  HIS A C   
2272 O O   . HIS A 286 ? 0.1920 0.2018 0.1846 -0.0242 -0.0036 -0.0041 286  HIS A O   
2273 C CB  . HIS A 286 ? 0.1715 0.1352 0.1904 -0.0027 -0.0213 -0.0066 286  HIS A CB  
2274 C CG  . HIS A 286 ? 0.1905 0.1648 0.1891 0.0047  -0.0087 -0.0073 286  HIS A CG  
2275 N ND1 . HIS A 286 ? 0.2206 0.2141 0.2110 -0.0015 0.0008  0.0010  286  HIS A ND1 
2276 C CD2 . HIS A 286 ? 0.1640 0.1572 0.1684 -0.0030 -0.0090 -0.0088 286  HIS A CD2 
2277 C CE1 . HIS A 286 ? 0.1907 0.1517 0.1546 -0.0002 -0.0034 -0.0039 286  HIS A CE1 
2278 N NE2 . HIS A 286 ? 0.2395 0.2054 0.2252 -0.0025 -0.0087 0.0104  286  HIS A NE2 
2279 N N   . VAL A 287 ? 0.1958 0.1633 0.1851 -0.0015 0.0007  0.0052  287  VAL A N   
2280 C CA  . VAL A 287 ? 0.2017 0.1771 0.1895 -0.0068 0.0019  0.0085  287  VAL A CA  
2281 C C   . VAL A 287 ? 0.1801 0.1711 0.1835 -0.0033 0.0017  0.0040  287  VAL A C   
2282 O O   . VAL A 287 ? 0.1925 0.1570 0.1827 -0.0064 0.0007  0.0135  287  VAL A O   
2283 C CB  . VAL A 287 ? 0.1916 0.1852 0.1959 -0.0034 -0.0017 0.0177  287  VAL A CB  
2284 C CG1 . VAL A 287 ? 0.2264 0.1882 0.2023 0.0004  -0.0059 0.0028  287  VAL A CG1 
2285 C CG2 . VAL A 287 ? 0.2058 0.2064 0.1801 -0.0236 -0.0043 -0.0014 287  VAL A CG2 
2286 N N   . GLY A 288 ? 0.1667 0.1595 0.1896 -0.0139 0.0026  0.0041  288  GLY A N   
2287 C CA  . GLY A 288 ? 0.1739 0.1746 0.2054 -0.0059 -0.0035 0.0084  288  GLY A CA  
2288 C C   . GLY A 288 ? 0.1766 0.1784 0.2056 -0.0020 -0.0082 0.0127  288  GLY A C   
2289 O O   . GLY A 288 ? 0.1705 0.1722 0.2045 -0.0158 -0.0175 0.0110  288  GLY A O   
2290 N N   . PHE A 289 ? 0.1831 0.1891 0.2234 -0.0005 -0.0132 0.0192  289  PHE A N   
2291 C CA  . PHE A 289 ? 0.1951 0.1826 0.2215 -0.0009 -0.0085 0.0208  289  PHE A CA  
2292 C C   . PHE A 289 ? 0.1965 0.1780 0.2162 -0.0004 -0.0083 0.0195  289  PHE A C   
2293 O O   . PHE A 289 ? 0.1968 0.1881 0.2238 -0.0041 -0.0185 0.0153  289  PHE A O   
2294 C CB  . PHE A 289 ? 0.1851 0.1712 0.2038 0.0053  -0.0114 0.0240  289  PHE A CB  
2295 C CG  . PHE A 289 ? 0.1965 0.1314 0.1788 -0.0104 0.0026  0.0283  289  PHE A CG  
2296 C CD1 . PHE A 289 ? 0.1921 0.1605 0.1905 0.0103  -0.0037 0.0233  289  PHE A CD1 
2297 C CD2 . PHE A 289 ? 0.2065 0.1802 0.1956 0.0006  -0.0079 0.0171  289  PHE A CD2 
2298 C CE1 . PHE A 289 ? 0.2414 0.2028 0.2234 -0.0073 -0.0141 0.0159  289  PHE A CE1 
2299 C CE2 . PHE A 289 ? 0.2123 0.1944 0.2019 -0.0105 -0.0058 0.0180  289  PHE A CE2 
2300 C CZ  . PHE A 289 ? 0.2204 0.1824 0.2060 -0.0030 -0.0030 0.0215  289  PHE A CZ  
2301 N N   . ASP A 290 ? 0.1948 0.1796 0.2158 -0.0032 -0.0051 0.0146  290  ASP A N   
2302 C CA  . ASP A 290 ? 0.2035 0.1785 0.2149 0.0015  -0.0034 0.0096  290  ASP A CA  
2303 C C   . ASP A 290 ? 0.1888 0.1643 0.2141 -0.0011 0.0008  0.0005  290  ASP A C   
2304 O O   . ASP A 290 ? 0.1747 0.1575 0.1987 0.0076  -0.0026 -0.0013 290  ASP A O   
2305 C CB  . ASP A 290 ? 0.2183 0.1939 0.2412 -0.0111 -0.0109 -0.0023 290  ASP A CB  
2306 C CG  . ASP A 290 ? 0.2754 0.2256 0.2774 -0.0049 -0.0130 0.0038  290  ASP A CG  
2307 O OD1 . ASP A 290 ? 0.3222 0.2485 0.3051 -0.0202 -0.0137 -0.0198 290  ASP A OD1 
2308 O OD2 . ASP A 290 ? 0.3297 0.2235 0.2972 -0.0153 -0.0306 -0.0045 290  ASP A OD2 
2309 N N   . ASN A 291 ? 0.1703 0.1419 0.1936 -0.0067 -0.0074 0.0055  291  ASN A N   
2310 C CA  . ASN A 291 ? 0.1591 0.1355 0.1778 -0.0049 -0.0079 -0.0039 291  ASN A CA  
2311 C C   . ASN A 291 ? 0.1511 0.1464 0.1615 -0.0060 -0.0058 0.0026  291  ASN A C   
2312 O O   . ASN A 291 ? 0.1602 0.1405 0.1590 -0.0122 -0.0025 -0.0009 291  ASN A O   
2313 C CB  . ASN A 291 ? 0.1614 0.1443 0.1848 -0.0047 -0.0078 0.0029  291  ASN A CB  
2314 C CG  . ASN A 291 ? 0.1667 0.1459 0.1855 -0.0027 0.0001  -0.0036 291  ASN A CG  
2315 O OD1 . ASN A 291 ? 0.1852 0.2050 0.2276 -0.0140 -0.0075 0.0050  291  ASN A OD1 
2316 N ND2 . ASN A 291 ? 0.1468 0.1394 0.1623 -0.0208 -0.0132 0.0028  291  ASN A ND2 
2317 N N   . PHE A 292 ? 0.1533 0.1456 0.1520 -0.0117 -0.0026 -0.0034 292  PHE A N   
2318 C CA  . PHE A 292 ? 0.1408 0.1475 0.1439 -0.0097 0.0013  0.0009  292  PHE A CA  
2319 C C   . PHE A 292 ? 0.1540 0.1488 0.1651 -0.0043 0.0082  -0.0027 292  PHE A C   
2320 O O   . PHE A 292 ? 0.1427 0.1521 0.1628 -0.0019 0.0116  0.0010  292  PHE A O   
2321 C CB  . PHE A 292 ? 0.1493 0.1489 0.1383 -0.0134 0.0039  0.0055  292  PHE A CB  
2322 C CG  . PHE A 292 ? 0.1305 0.1525 0.1459 -0.0017 0.0027  0.0080  292  PHE A CG  
2323 C CD1 . PHE A 292 ? 0.1429 0.1434 0.1436 -0.0096 0.0145  0.0021  292  PHE A CD1 
2324 C CD2 . PHE A 292 ? 0.1556 0.1690 0.1608 0.0024  -0.0067 0.0207  292  PHE A CD2 
2325 C CE1 . PHE A 292 ? 0.1504 0.1678 0.1560 -0.0023 -0.0041 0.0023  292  PHE A CE1 
2326 C CE2 . PHE A 292 ? 0.1804 0.1627 0.1620 -0.0015 0.0008  0.0128  292  PHE A CE2 
2327 C CZ  . PHE A 292 ? 0.1771 0.1810 0.1498 0.0062  0.0039  0.0071  292  PHE A CZ  
2328 N N   . GLU A 293 ? 0.1602 0.1534 0.1731 0.0016  0.0090  0.0017  293  GLU A N   
2329 C CA  . GLU A 293 ? 0.1640 0.1542 0.1705 -0.0011 -0.0003 0.0036  293  GLU A CA  
2330 C C   . GLU A 293 ? 0.1638 0.1565 0.1657 0.0026  -0.0014 0.0042  293  GLU A C   
2331 O O   . GLU A 293 ? 0.1743 0.1317 0.1676 -0.0018 -0.0102 0.0063  293  GLU A O   
2332 C CB  . GLU A 293 ? 0.2017 0.1714 0.1964 0.0024  -0.0015 0.0063  293  GLU A CB  
2333 C CG  . GLU A 293 ? 0.2290 0.2014 0.2013 0.0048  0.0034  0.0053  293  GLU A CG  
2334 C CD  . GLU A 293 ? 0.2707 0.2118 0.2510 -0.0058 -0.0081 0.0025  293  GLU A CD  
2335 O OE1 . GLU A 293 ? 0.2889 0.2419 0.2865 0.0180  -0.0158 0.0048  293  GLU A OE1 
2336 O OE2 . GLU A 293 ? 0.2905 0.2018 0.2599 -0.0002 -0.0048 -0.0002 293  GLU A OE2 
2337 N N   . GLN A 294 ? 0.1447 0.1358 0.1414 0.0021  -0.0026 0.0022  294  GLN A N   
2338 C CA  . GLN A 294 ? 0.1538 0.1311 0.1539 -0.0020 -0.0069 0.0028  294  GLN A CA  
2339 C C   . GLN A 294 ? 0.1424 0.1210 0.1455 0.0010  -0.0005 0.0014  294  GLN A C   
2340 O O   . GLN A 294 ? 0.1354 0.1232 0.1604 0.0090  -0.0024 0.0081  294  GLN A O   
2341 C CB  . GLN A 294 ? 0.1771 0.1342 0.1583 -0.0163 -0.0127 -0.0029 294  GLN A CB  
2342 C CG  . GLN A 294 ? 0.1872 0.1407 0.1741 0.0021  -0.0075 -0.0212 294  GLN A CG  
2343 C CD  . GLN A 294 ? 0.2242 0.2142 0.2390 -0.0022 -0.0143 -0.0059 294  GLN A CD  
2344 O OE1 . GLN A 294 ? 0.3093 0.2309 0.2993 -0.0224 -0.0210 -0.0035 294  GLN A OE1 
2345 N NE2 . GLN A 294 ? 0.2084 0.1729 0.1579 -0.0224 -0.0015 -0.0107 294  GLN A NE2 
2346 N N   . LEU A 295 ? 0.1421 0.1142 0.1405 0.0065  -0.0032 0.0055  295  LEU A N   
2347 C CA  . LEU A 295 ? 0.1330 0.1217 0.1314 0.0013  0.0074  -0.0049 295  LEU A CA  
2348 C C   . LEU A 295 ? 0.1407 0.1264 0.1290 0.0020  0.0055  0.0000  295  LEU A C   
2349 O O   . LEU A 295 ? 0.1394 0.1198 0.1147 0.0022  0.0072  -0.0086 295  LEU A O   
2350 C CB  . LEU A 295 ? 0.1368 0.1247 0.1339 -0.0040 0.0131  -0.0057 295  LEU A CB  
2351 C CG  . LEU A 295 ? 0.1490 0.1363 0.1418 0.0002  0.0072  -0.0060 295  LEU A CG  
2352 C CD1 . LEU A 295 ? 0.1569 0.1596 0.1697 0.0117  0.0065  0.0092  295  LEU A CD1 
2353 C CD2 . LEU A 295 ? 0.1711 0.1638 0.1446 0.0137  0.0070  0.0056  295  LEU A CD2 
2354 N N   . LEU A 296 ? 0.1524 0.1294 0.1363 0.0069  0.0008  -0.0017 296  LEU A N   
2355 C CA  . LEU A 296 ? 0.1427 0.1287 0.1385 0.0035  0.0001  0.0028  296  LEU A CA  
2356 C C   . LEU A 296 ? 0.1493 0.1337 0.1460 -0.0023 0.0024  -0.0053 296  LEU A C   
2357 O O   . LEU A 296 ? 0.1350 0.1426 0.1448 -0.0013 0.0036  -0.0043 296  LEU A O   
2358 C CB  . LEU A 296 ? 0.1689 0.1311 0.1527 0.0032  -0.0021 0.0028  296  LEU A CB  
2359 C CG  . LEU A 296 ? 0.1960 0.1883 0.1950 0.0063  0.0045  0.0190  296  LEU A CG  
2360 C CD1 . LEU A 296 ? 0.2321 0.1983 0.2040 0.0058  0.0031  0.0311  296  LEU A CD1 
2361 C CD2 . LEU A 296 ? 0.2576 0.2347 0.2231 -0.0059 0.0018  -0.0088 296  LEU A CD2 
2362 N N   . SER A 297 ? 0.1401 0.1316 0.1386 -0.0019 -0.0027 -0.0042 297  SER A N   
2363 C CA  . SER A 297 ? 0.1574 0.1387 0.1402 -0.0010 0.0000  -0.0038 297  SER A CA  
2364 C C   . SER A 297 ? 0.1449 0.1472 0.1463 0.0017  -0.0016 0.0000  297  SER A C   
2365 O O   . SER A 297 ? 0.1405 0.1507 0.1412 -0.0015 -0.0007 0.0023  297  SER A O   
2366 C CB  . SER A 297 ? 0.1870 0.1527 0.1621 -0.0033 -0.0183 -0.0040 297  SER A CB  
2367 O OG  . SER A 297 ? 0.2521 0.2224 0.2097 -0.0041 0.0170  0.0082  297  SER A OG  
2368 N N   . GLY A 298 ? 0.1414 0.1384 0.1329 0.0029  -0.0044 0.0015  298  GLY A N   
2369 C CA  . GLY A 298 ? 0.1408 0.1420 0.1366 -0.0057 -0.0135 0.0002  298  GLY A CA  
2370 C C   . GLY A 298 ? 0.1394 0.1267 0.1373 0.0004  -0.0019 -0.0086 298  GLY A C   
2371 O O   . GLY A 298 ? 0.1227 0.1253 0.1287 0.0044  -0.0047 -0.0056 298  GLY A O   
2372 N N   . ALA A 299 ? 0.1285 0.1313 0.1233 0.0043  -0.0068 -0.0030 299  ALA A N   
2373 C CA  . ALA A 299 ? 0.1275 0.1155 0.1282 0.0004  -0.0057 -0.0085 299  ALA A CA  
2374 C C   . ALA A 299 ? 0.1334 0.1148 0.1406 0.0047  0.0003  -0.0088 299  ALA A C   
2375 O O   . ALA A 299 ? 0.1338 0.1209 0.1319 0.0129  -0.0021 -0.0106 299  ALA A O   
2376 C CB  . ALA A 299 ? 0.1266 0.1324 0.1333 0.0003  0.0081  -0.0101 299  ALA A CB  
2377 N N   . HIS A 300 ? 0.1327 0.1148 0.1583 0.0147  -0.0126 0.0040  300  HIS A N   
2378 C CA  . HIS A 300 ? 0.1325 0.1149 0.1526 0.0022  0.0015  -0.0013 300  HIS A CA  
2379 C C   . HIS A 300 ? 0.1349 0.1103 0.1473 0.0014  -0.0023 -0.0011 300  HIS A C   
2380 O O   . HIS A 300 ? 0.1457 0.1030 0.1485 -0.0007 0.0054  -0.0084 300  HIS A O   
2381 C CB  . HIS A 300 ? 0.1388 0.1153 0.1699 0.0027  -0.0137 0.0071  300  HIS A CB  
2382 C CG  . HIS A 300 ? 0.1317 0.1470 0.1638 0.0135  0.0082  0.0000  300  HIS A CG  
2383 N ND1 . HIS A 300 ? 0.1661 0.1759 0.2099 0.0093  -0.0029 0.0037  300  HIS A ND1 
2384 C CD2 . HIS A 300 ? 0.1091 0.1005 0.1229 -0.0029 0.0034  0.0012  300  HIS A CD2 
2385 C CE1 . HIS A 300 ? 0.1041 0.1057 0.1183 0.0162  0.0128  -0.0077 300  HIS A CE1 
2386 N NE2 . HIS A 300 ? 0.1687 0.1804 0.1926 0.0095  -0.0077 -0.0131 300  HIS A NE2 
2387 N N   . TRP A 301 ? 0.1348 0.1010 0.1187 -0.0040 0.0077  -0.0014 301  TRP A N   
2388 C CA  . TRP A 301 ? 0.1320 0.1249 0.1299 -0.0056 0.0027  0.0037  301  TRP A CA  
2389 C C   . TRP A 301 ? 0.1417 0.1238 0.1404 0.0031  0.0059  0.0072  301  TRP A C   
2390 O O   . TRP A 301 ? 0.1281 0.1378 0.1460 -0.0012 -0.0114 0.0135  301  TRP A O   
2391 C CB  . TRP A 301 ? 0.1442 0.1297 0.1283 0.0009  -0.0026 0.0093  301  TRP A CB  
2392 C CG  . TRP A 301 ? 0.1447 0.1540 0.1519 0.0066  0.0109  0.0040  301  TRP A CG  
2393 C CD1 . TRP A 301 ? 0.1856 0.1844 0.1598 -0.0029 -0.0011 -0.0028 301  TRP A CD1 
2394 C CD2 . TRP A 301 ? 0.1585 0.1569 0.1532 0.0001  0.0048  0.0068  301  TRP A CD2 
2395 N NE1 . TRP A 301 ? 0.1912 0.1846 0.1778 0.0065  0.0075  0.0121  301  TRP A NE1 
2396 C CE2 . TRP A 301 ? 0.1804 0.1743 0.1698 0.0001  0.0069  -0.0047 301  TRP A CE2 
2397 C CE3 . TRP A 301 ? 0.1640 0.1614 0.1572 -0.0044 -0.0105 0.0057  301  TRP A CE3 
2398 C CZ2 . TRP A 301 ? 0.2060 0.1815 0.1807 0.0040  0.0002  0.0076  301  TRP A CZ2 
2399 C CZ3 . TRP A 301 ? 0.1765 0.1771 0.1731 -0.0007 0.0019  0.0110  301  TRP A CZ3 
2400 C CH2 . TRP A 301 ? 0.1987 0.1727 0.1738 0.0054  -0.0089 0.0000  301  TRP A CH2 
2401 N N   . MET A 302 ? 0.1326 0.1149 0.1366 0.0059  -0.0006 0.0062  302  MET A N   
2402 C CA  . MET A 302 ? 0.1347 0.1188 0.1481 0.0090  -0.0031 -0.0020 302  MET A CA  
2403 C C   . MET A 302 ? 0.1420 0.1314 0.1444 0.0058  -0.0008 0.0030  302  MET A C   
2404 O O   . MET A 302 ? 0.1484 0.1313 0.1515 0.0075  0.0040  -0.0069 302  MET A O   
2405 C CB  . MET A 302 ? 0.1307 0.1016 0.1498 0.0145  0.0121  0.0032  302  MET A CB  
2406 C CG  . MET A 302 ? 0.1638 0.1066 0.1521 -0.0101 0.0111  -0.0018 302  MET A CG  
2407 S SD  . MET A 302 ? 0.1461 0.1294 0.1591 0.0020  0.0102  0.0026  302  MET A SD  
2408 C CE  . MET A 302 ? 0.1496 0.1529 0.1476 0.0056  0.0079  0.0079  302  MET A CE  
2409 N N   . ASP A 303 ? 0.1388 0.1172 0.1252 0.0070  -0.0038 0.0031  303  ASP A N   
2410 C CA  . ASP A 303 ? 0.1225 0.1341 0.1348 0.0003  0.0010  0.0020  303  ASP A CA  
2411 C C   . ASP A 303 ? 0.1353 0.1370 0.1439 0.0040  0.0040  -0.0029 303  ASP A C   
2412 O O   . ASP A 303 ? 0.1342 0.1514 0.1641 0.0000  0.0087  0.0020  303  ASP A O   
2413 C CB  . ASP A 303 ? 0.1372 0.1478 0.1325 -0.0059 0.0029  -0.0014 303  ASP A CB  
2414 C CG  . ASP A 303 ? 0.1410 0.1479 0.1459 -0.0003 0.0036  -0.0007 303  ASP A CG  
2415 O OD1 . ASP A 303 ? 0.1201 0.1260 0.1475 -0.0097 0.0176  -0.0014 303  ASP A OD1 
2416 O OD2 . ASP A 303 ? 0.1478 0.1370 0.1466 -0.0132 0.0139  0.0019  303  ASP A OD2 
2417 N N   . GLN A 304 ? 0.1313 0.1370 0.1511 0.0073  0.0121  -0.0041 304  GLN A N   
2418 C CA  . GLN A 304 ? 0.1334 0.1292 0.1468 0.0029  0.0151  -0.0036 304  GLN A CA  
2419 C C   . GLN A 304 ? 0.1401 0.1395 0.1514 0.0017  0.0071  -0.0034 304  GLN A C   
2420 O O   . GLN A 304 ? 0.1331 0.1518 0.1816 -0.0014 0.0060  -0.0082 304  GLN A O   
2421 C CB  . GLN A 304 ? 0.1511 0.1327 0.1343 -0.0036 0.0087  0.0004  304  GLN A CB  
2422 C CG  . GLN A 304 ? 0.1609 0.1363 0.1597 -0.0011 -0.0049 -0.0009 304  GLN A CG  
2423 C CD  . GLN A 304 ? 0.1706 0.1491 0.2031 -0.0037 -0.0051 -0.0023 304  GLN A CD  
2424 O OE1 . GLN A 304 ? 0.1870 0.2269 0.2368 -0.0044 -0.0096 0.0057  304  GLN A OE1 
2425 N NE2 . GLN A 304 ? 0.1262 0.1400 0.1348 -0.0063 -0.0085 -0.0075 304  GLN A NE2 
2426 N N   . HIS A 305 ? 0.1340 0.1368 0.1397 0.0064  0.0093  -0.0031 305  HIS A N   
2427 C CA  . HIS A 305 ? 0.1333 0.1294 0.1425 0.0081  -0.0018 -0.0022 305  HIS A CA  
2428 C C   . HIS A 305 ? 0.1466 0.1336 0.1398 0.0050  0.0042  -0.0043 305  HIS A C   
2429 O O   . HIS A 305 ? 0.1488 0.1379 0.1572 0.0088  0.0040  -0.0179 305  HIS A O   
2430 C CB  . HIS A 305 ? 0.1360 0.1332 0.1336 0.0088  0.0038  0.0000  305  HIS A CB  
2431 C CG  . HIS A 305 ? 0.1342 0.1304 0.1325 0.0070  -0.0021 0.0039  305  HIS A CG  
2432 N ND1 . HIS A 305 ? 0.1615 0.1664 0.1712 -0.0019 0.0136  0.0049  305  HIS A ND1 
2433 C CD2 . HIS A 305 ? 0.1421 0.1479 0.1486 -0.0047 0.0028  0.0040  305  HIS A CD2 
2434 C CE1 . HIS A 305 ? 0.1615 0.1580 0.1746 0.0078  0.0060  0.0000  305  HIS A CE1 
2435 N NE2 . HIS A 305 ? 0.1519 0.1358 0.1558 0.0055  0.0061  0.0103  305  HIS A NE2 
2436 N N   . PHE A 306 ? 0.1434 0.1203 0.1337 0.0076  0.0033  -0.0044 306  PHE A N   
2437 C CA  . PHE A 306 ? 0.1441 0.1414 0.1439 0.0034  0.0016  -0.0075 306  PHE A CA  
2438 C C   . PHE A 306 ? 0.1475 0.1454 0.1563 0.0042  0.0030  -0.0001 306  PHE A C   
2439 O O   . PHE A 306 ? 0.1468 0.1499 0.1664 0.0089  -0.0007 -0.0004 306  PHE A O   
2440 C CB  . PHE A 306 ? 0.1366 0.1378 0.1280 -0.0004 0.0044  -0.0042 306  PHE A CB  
2441 C CG  . PHE A 306 ? 0.1249 0.1488 0.1336 -0.0008 -0.0022 -0.0055 306  PHE A CG  
2442 C CD1 . PHE A 306 ? 0.1454 0.1562 0.1445 -0.0016 -0.0142 -0.0062 306  PHE A CD1 
2443 C CD2 . PHE A 306 ? 0.1187 0.1554 0.1442 0.0060  -0.0081 -0.0049 306  PHE A CD2 
2444 C CE1 . PHE A 306 ? 0.1618 0.1516 0.1521 0.0052  -0.0058 -0.0117 306  PHE A CE1 
2445 C CE2 . PHE A 306 ? 0.1066 0.1409 0.1494 0.0025  -0.0034 -0.0110 306  PHE A CE2 
2446 C CZ  . PHE A 306 ? 0.1606 0.1372 0.1668 0.0092  0.0105  0.0118  306  PHE A CZ  
2447 N N   . ARG A 307 ? 0.1456 0.1431 0.1639 0.0132  -0.0028 0.0056  307  ARG A N   
2448 C CA  . ARG A 307 ? 0.1551 0.1666 0.1912 0.0071  0.0019  0.0116  307  ARG A CA  
2449 C C   . ARG A 307 ? 0.1571 0.1642 0.1966 0.0056  0.0039  0.0071  307  ARG A C   
2450 O O   . ARG A 307 ? 0.1643 0.1991 0.2268 0.0050  -0.0162 0.0185  307  ARG A O   
2451 C CB  . ARG A 307 ? 0.1446 0.1626 0.1841 0.0118  -0.0035 0.0128  307  ARG A CB  
2452 C CG  . ARG A 307 ? 0.1765 0.1899 0.1938 0.0171  -0.0140 0.0163  307  ARG A CG  
2453 C CD  . ARG A 307 ? 0.1829 0.2203 0.1700 0.0128  -0.0101 0.0066  307  ARG A CD  
2454 N NE  . ARG A 307 ? 0.1570 0.1965 0.1620 0.0220  -0.0149 -0.0215 307  ARG A NE  
2455 C CZ  . ARG A 307 ? 0.1727 0.1923 0.1955 0.0037  -0.0018 -0.0040 307  ARG A CZ  
2456 N NH1 . ARG A 307 ? 0.1744 0.1716 0.1917 0.0206  -0.0044 -0.0204 307  ARG A NH1 
2457 N NH2 . ARG A 307 ? 0.2079 0.2116 0.1771 0.0275  -0.0073 -0.0143 307  ARG A NH2 
2458 N N   . THR A 308 ? 0.1629 0.1635 0.1989 0.0104  0.0064  0.0147  308  THR A N   
2459 C CA  . THR A 308 ? 0.1792 0.1812 0.2146 0.0125  0.0106  -0.0068 308  THR A CA  
2460 C C   . THR A 308 ? 0.1794 0.1889 0.2106 0.0144  0.0064  -0.0041 308  THR A C   
2461 O O   . THR A 308 ? 0.2144 0.2004 0.2229 0.0208  0.0127  -0.0134 308  THR A O   
2462 C CB  . THR A 308 ? 0.2012 0.2128 0.2326 0.0078  0.0135  -0.0133 308  THR A CB  
2463 O OG1 . THR A 308 ? 0.2008 0.1880 0.2298 0.0232  0.0157  -0.0680 308  THR A OG1 
2464 C CG2 . THR A 308 ? 0.2323 0.2397 0.2773 0.0099  0.0211  -0.0116 308  THR A CG2 
2465 N N   . THR A 309 ? 0.1813 0.1657 0.2099 0.0071  0.0060  -0.0061 309  THR A N   
2466 C CA  . THR A 309 ? 0.1596 0.1553 0.1842 0.0076  0.0029  -0.0116 309  THR A CA  
2467 C C   . THR A 309 ? 0.1688 0.1634 0.1830 0.0006  0.0051  -0.0100 309  THR A C   
2468 O O   . THR A 309 ? 0.1764 0.1643 0.1852 0.0068  0.0118  -0.0140 309  THR A O   
2469 C CB  . THR A 309 ? 0.1606 0.1489 0.1808 -0.0035 -0.0015 -0.0063 309  THR A CB  
2470 O OG1 . THR A 309 ? 0.1810 0.1605 0.1985 -0.0076 -0.0141 -0.0226 309  THR A OG1 
2471 C CG2 . THR A 309 ? 0.1761 0.1754 0.1770 0.0180  0.0127  -0.0020 309  THR A CG2 
2472 N N   . PRO A 310 ? 0.1581 0.1537 0.1763 0.0010  0.0172  -0.0183 310  PRO A N   
2473 C CA  . PRO A 310 ? 0.1603 0.1617 0.1805 -0.0053 0.0114  -0.0087 310  PRO A CA  
2474 C C   . PRO A 310 ? 0.1611 0.1661 0.1736 0.0020  0.0051  -0.0081 310  PRO A C   
2475 O O   . PRO A 310 ? 0.1329 0.1632 0.1776 0.0010  0.0156  0.0018  310  PRO A O   
2476 C CB  . PRO A 310 ? 0.1833 0.1683 0.1855 -0.0008 0.0120  -0.0143 310  PRO A CB  
2477 C CG  . PRO A 310 ? 0.1691 0.1793 0.1945 -0.0099 0.0185  -0.0147 310  PRO A CG  
2478 C CD  . PRO A 310 ? 0.1776 0.1700 0.1894 -0.0083 0.0216  -0.0190 310  PRO A CD  
2479 N N   . LEU A 311 ? 0.1779 0.1790 0.1931 0.0019  0.0002  -0.0061 311  LEU A N   
2480 C CA  . LEU A 311 ? 0.1761 0.1844 0.1929 0.0040  -0.0017 -0.0046 311  LEU A CA  
2481 C C   . LEU A 311 ? 0.1754 0.1659 0.1945 0.0003  0.0016  0.0000  311  LEU A C   
2482 O O   . LEU A 311 ? 0.1631 0.1717 0.1924 0.0037  0.0063  -0.0032 311  LEU A O   
2483 C CB  . LEU A 311 ? 0.1941 0.1852 0.2032 -0.0011 -0.0030 -0.0095 311  LEU A CB  
2484 C CG  . LEU A 311 ? 0.2233 0.2192 0.2192 -0.0072 0.0038  0.0095  311  LEU A CG  
2485 C CD1 . LEU A 311 ? 0.2888 0.2642 0.2603 -0.0046 -0.0147 -0.0141 311  LEU A CD1 
2486 C CD2 . LEU A 311 ? 0.2227 0.2634 0.2369 -0.0021 0.0002  0.0127  311  LEU A CD2 
2487 N N   . GLU A 312 ? 0.1868 0.1769 0.2000 0.0035  0.0067  -0.0020 312  GLU A N   
2488 C CA  . GLU A 312 ? 0.1833 0.2012 0.1877 0.0019  0.0119  0.0036  312  GLU A CA  
2489 C C   . GLU A 312 ? 0.1856 0.2005 0.1833 0.0067  0.0136  -0.0003 312  GLU A C   
2490 O O   . GLU A 312 ? 0.1611 0.1994 0.1756 0.0135  0.0307  0.0042  312  GLU A O   
2491 C CB  . GLU A 312 ? 0.2124 0.2227 0.2229 -0.0040 0.0169  0.0105  312  GLU A CB  
2492 C CG  . GLU A 312 ? 0.2650 0.2575 0.2551 -0.0048 0.0232  -0.0110 312  GLU A CG  
2493 C CD  . GLU A 312 ? 0.3278 0.3431 0.3451 0.0073  -0.0045 0.0057  312  GLU A CD  
2494 O OE1 . GLU A 312 ? 0.2954 0.3337 0.3416 0.0090  0.0238  -0.0031 312  GLU A OE1 
2495 O OE2 . GLU A 312 ? 0.4111 0.3833 0.4072 0.0105  0.0222  -0.0055 312  GLU A OE2 
2496 N N   . LYS A 313 ? 0.1690 0.2009 0.1638 0.0061  0.0148  0.0036  313  LYS A N   
2497 C CA  . LYS A 313 ? 0.2025 0.2061 0.1858 0.0044  0.0088  -0.0042 313  LYS A CA  
2498 C C   . LYS A 313 ? 0.1787 0.1823 0.1710 0.0068  0.0084  -0.0055 313  LYS A C   
2499 O O   . LYS A 313 ? 0.1947 0.2127 0.1595 0.0048  0.0124  -0.0130 313  LYS A O   
2500 C CB  . LYS A 313 ? 0.2328 0.2350 0.2041 -0.0007 0.0041  -0.0142 313  LYS A CB  
2501 C CG  . LYS A 313 ? 0.3301 0.3338 0.3017 -0.0148 0.0080  0.0208  313  LYS A CG  
2502 C CD  . LYS A 313 ? 0.4594 0.4536 0.4209 0.0051  0.0148  -0.0276 313  LYS A CD  
2503 C CE  . LYS A 313 ? 0.5083 0.5011 0.4889 -0.0079 0.0113  0.0134  313  LYS A CE  
2504 N NZ  . LYS A 313 ? 0.5620 0.5703 0.5386 -0.0006 0.0120  -0.0112 313  LYS A NZ  
2505 N N   . ASN A 314 ? 0.1580 0.1616 0.1526 0.0054  0.0057  0.0027  314  ASN A N   
2506 C CA  . ASN A 314 ? 0.1375 0.1408 0.1473 0.0030  0.0049  -0.0029 314  ASN A CA  
2507 C C   . ASN A 314 ? 0.1306 0.1392 0.1452 -0.0012 0.0049  -0.0001 314  ASN A C   
2508 O O   . ASN A 314 ? 0.1294 0.1429 0.1605 -0.0018 0.0073  -0.0067 314  ASN A O   
2509 C CB  . ASN A 314 ? 0.1313 0.1408 0.1368 0.0032  -0.0003 0.0029  314  ASN A CB  
2510 C CG  . ASN A 314 ? 0.1541 0.1499 0.1679 -0.0035 0.0055  0.0026  314  ASN A CG  
2511 O OD1 . ASN A 314 ? 0.1428 0.1668 0.1961 -0.0024 0.0065  -0.0066 314  ASN A OD1 
2512 N ND2 . ASN A 314 ? 0.1505 0.1379 0.1411 -0.0007 0.0014  -0.0134 314  ASN A ND2 
2513 N N   . ALA A 315 ? 0.1285 0.1308 0.1354 0.0129  0.0028  -0.0033 315  ALA A N   
2514 C CA  . ALA A 315 ? 0.1322 0.1316 0.1421 0.0069  0.0007  -0.0069 315  ALA A CA  
2515 C C   . ALA A 315 ? 0.1437 0.1359 0.1413 0.0070  0.0047  -0.0044 315  ALA A C   
2516 O O   . ALA A 315 ? 0.1468 0.1262 0.1604 0.0044  0.0093  -0.0037 315  ALA A O   
2517 C CB  . ALA A 315 ? 0.1538 0.1525 0.1710 0.0020  -0.0039 -0.0083 315  ALA A CB  
2518 N N   . PRO A 316 ? 0.1382 0.1101 0.1431 0.0096  0.0078  0.0011  316  PRO A N   
2519 C CA  . PRO A 316 ? 0.1431 0.1496 0.1394 0.0023  0.0010  0.0026  316  PRO A CA  
2520 C C   . PRO A 316 ? 0.1391 0.1367 0.1518 0.0040  0.0072  -0.0041 316  PRO A C   
2521 O O   . PRO A 316 ? 0.1273 0.1322 0.1339 0.0111  0.0083  0.0075  316  PRO A O   
2522 C CB  . PRO A 316 ? 0.1599 0.1392 0.1551 -0.0046 0.0031  0.0046  316  PRO A CB  
2523 C CG  . PRO A 316 ? 0.1892 0.1544 0.1513 0.0094  0.0018  -0.0054 316  PRO A CG  
2524 C CD  . PRO A 316 ? 0.1462 0.1244 0.1412 -0.0006 0.0166  0.0031  316  PRO A CD  
2525 N N   . VAL A 317 ? 0.1228 0.1415 0.1346 0.0034  0.0109  -0.0038 317  VAL A N   
2526 C CA  . VAL A 317 ? 0.1296 0.1386 0.1554 0.0027  0.0102  0.0031  317  VAL A CA  
2527 C C   . VAL A 317 ? 0.1285 0.1339 0.1390 0.0006  0.0114  0.0007  317  VAL A C   
2528 O O   . VAL A 317 ? 0.1415 0.1204 0.1398 0.0001  0.0266  -0.0035 317  VAL A O   
2529 C CB  . VAL A 317 ? 0.1204 0.1378 0.1431 0.0053  0.0115  0.0082  317  VAL A CB  
2530 C CG1 . VAL A 317 ? 0.1365 0.1432 0.1688 -0.0015 0.0131  -0.0074 317  VAL A CG1 
2531 C CG2 . VAL A 317 ? 0.1344 0.1506 0.1704 0.0113  0.0075  0.0138  317  VAL A CG2 
2532 N N   . LEU A 318 ? 0.1297 0.1341 0.1361 -0.0001 0.0074  0.0087  318  LEU A N   
2533 C CA  . LEU A 318 ? 0.1341 0.1334 0.1476 0.0156  0.0043  -0.0020 318  LEU A CA  
2534 C C   . LEU A 318 ? 0.1313 0.1348 0.1430 0.0096  0.0121  -0.0010 318  LEU A C   
2535 O O   . LEU A 318 ? 0.1386 0.1339 0.1345 0.0143  0.0124  0.0062  318  LEU A O   
2536 C CB  . LEU A 318 ? 0.1462 0.1533 0.1450 0.0189  0.0097  0.0105  318  LEU A CB  
2537 C CG  . LEU A 318 ? 0.1517 0.1677 0.1691 0.0255  0.0019  -0.0220 318  LEU A CG  
2538 C CD1 . LEU A 318 ? 0.2470 0.2753 0.2042 0.0177  0.0039  -0.0150 318  LEU A CD1 
2539 C CD2 . LEU A 318 ? 0.1908 0.1925 0.2207 -0.0050 0.0179  -0.0006 318  LEU A CD2 
2540 N N   . LEU A 319 ? 0.1311 0.1319 0.1197 0.0102  0.0075  0.0005  319  LEU A N   
2541 C CA  . LEU A 319 ? 0.1233 0.1252 0.1301 0.0003  0.0020  0.0001  319  LEU A CA  
2542 C C   . LEU A 319 ? 0.1260 0.1273 0.1272 0.0067  -0.0043 -0.0026 319  LEU A C   
2543 O O   . LEU A 319 ? 0.1332 0.1248 0.1237 0.0046  0.0027  -0.0147 319  LEU A O   
2544 C CB  . LEU A 319 ? 0.1226 0.1431 0.1456 0.0005  0.0021  -0.0075 319  LEU A CB  
2545 C CG  . LEU A 319 ? 0.1537 0.1397 0.1425 0.0002  -0.0048 0.0067  319  LEU A CG  
2546 C CD1 . LEU A 319 ? 0.1566 0.1612 0.1851 -0.0111 -0.0044 0.0056  319  LEU A CD1 
2547 C CD2 . LEU A 319 ? 0.1666 0.1462 0.1643 0.0119  -0.0145 0.0114  319  LEU A CD2 
2548 N N   . ALA A 320 ? 0.1050 0.1228 0.1101 0.0086  0.0016  -0.0055 320  ALA A N   
2549 C CA  . ALA A 320 ? 0.1169 0.1309 0.1280 -0.0002 -0.0004 -0.0024 320  ALA A CA  
2550 C C   . ALA A 320 ? 0.1203 0.1349 0.1260 0.0000  0.0031  0.0016  320  ALA A C   
2551 O O   . ALA A 320 ? 0.0991 0.1175 0.1295 -0.0127 -0.0040 -0.0040 320  ALA A O   
2552 C CB  . ALA A 320 ? 0.1270 0.1381 0.1218 0.0047  -0.0056 0.0067  320  ALA A CB  
2553 N N   . LEU A 321 ? 0.1131 0.1342 0.1221 0.0030  0.0048  0.0000  321  LEU A N   
2554 C CA  . LEU A 321 ? 0.1260 0.1243 0.1386 0.0074  0.0088  0.0060  321  LEU A CA  
2555 C C   . LEU A 321 ? 0.1234 0.1289 0.1318 0.0049  0.0039  0.0074  321  LEU A C   
2556 O O   . LEU A 321 ? 0.1137 0.1163 0.1319 0.0030  0.0121  0.0048  321  LEU A O   
2557 C CB  . LEU A 321 ? 0.1284 0.1398 0.1342 0.0084  0.0118  0.0000  321  LEU A CB  
2558 C CG  . LEU A 321 ? 0.1355 0.1471 0.1301 0.0204  0.0100  -0.0132 321  LEU A CG  
2559 C CD1 . LEU A 321 ? 0.1370 0.1745 0.1476 0.0148  0.0274  -0.0169 321  LEU A CD1 
2560 C CD2 . LEU A 321 ? 0.1345 0.1721 0.1507 -0.0162 0.0026  -0.0086 321  LEU A CD2 
2561 N N   . LEU A 322 ? 0.1218 0.1207 0.1231 0.0072  0.0080  0.0056  322  LEU A N   
2562 C CA  . LEU A 322 ? 0.1177 0.1289 0.1196 0.0082  0.0104  0.0042  322  LEU A CA  
2563 C C   . LEU A 322 ? 0.1231 0.1337 0.1344 0.0044  0.0072  0.0029  322  LEU A C   
2564 O O   . LEU A 322 ? 0.1049 0.1351 0.1438 0.0061  0.0106  0.0112  322  LEU A O   
2565 C CB  . LEU A 322 ? 0.1269 0.1237 0.1285 0.0062  0.0111  -0.0007 322  LEU A CB  
2566 C CG  . LEU A 322 ? 0.1533 0.1405 0.1362 -0.0144 0.0111  -0.0063 322  LEU A CG  
2567 C CD1 . LEU A 322 ? 0.1445 0.1527 0.1493 0.0060  -0.0024 -0.0198 322  LEU A CD1 
2568 C CD2 . LEU A 322 ? 0.1506 0.1384 0.1396 0.0070  0.0219  0.0110  322  LEU A CD2 
2569 N N   . GLY A 323 ? 0.1130 0.1357 0.1263 0.0039  0.0137  0.0025  323  GLY A N   
2570 C CA  . GLY A 323 ? 0.1136 0.1274 0.1242 0.0012  0.0065  -0.0042 323  GLY A CA  
2571 C C   . GLY A 323 ? 0.1336 0.1266 0.1377 -0.0030 0.0114  0.0000  323  GLY A C   
2572 O O   . GLY A 323 ? 0.1327 0.1197 0.1419 0.0076  0.0229  0.0089  323  GLY A O   
2573 N N   . ILE A 324 ? 0.1206 0.1210 0.1316 -0.0019 -0.0009 0.0002  324  ILE A N   
2574 C CA  . ILE A 324 ? 0.1231 0.1259 0.1536 -0.0050 -0.0003 0.0013  324  ILE A CA  
2575 C C   . ILE A 324 ? 0.1270 0.1309 0.1433 0.0004  0.0022  0.0034  324  ILE A C   
2576 O O   . ILE A 324 ? 0.1141 0.1311 0.1601 -0.0111 0.0180  -0.0043 324  ILE A O   
2577 C CB  . ILE A 324 ? 0.1235 0.1333 0.1499 0.0001  -0.0018 0.0058  324  ILE A CB  
2578 C CG1 . ILE A 324 ? 0.1490 0.1427 0.1485 -0.0038 0.0084  0.0009  324  ILE A CG1 
2579 C CG2 . ILE A 324 ? 0.1626 0.1363 0.1543 -0.0069 -0.0092 -0.0135 324  ILE A CG2 
2580 C CD1 . ILE A 324 ? 0.1607 0.1486 0.1485 0.0096  -0.0049 -0.0140 324  ILE A CD1 
2581 N N   . TRP A 325 ? 0.1145 0.1293 0.1374 0.0040  0.0137  0.0028  325  TRP A N   
2582 C CA  . TRP A 325 ? 0.1292 0.1296 0.1429 0.0097  0.0020  -0.0031 325  TRP A CA  
2583 C C   . TRP A 325 ? 0.1309 0.1343 0.1523 0.0019  0.0117  0.0020  325  TRP A C   
2584 O O   . TRP A 325 ? 0.1239 0.1189 0.1406 0.0068  0.0134  -0.0002 325  TRP A O   
2585 C CB  . TRP A 325 ? 0.1373 0.1480 0.1357 0.0022  0.0090  0.0037  325  TRP A CB  
2586 C CG  . TRP A 325 ? 0.1434 0.1318 0.1559 0.0033  0.0063  0.0009  325  TRP A CG  
2587 C CD1 . TRP A 325 ? 0.1697 0.1489 0.1511 0.0004  0.0143  0.0027  325  TRP A CD1 
2588 C CD2 . TRP A 325 ? 0.1423 0.1410 0.1592 0.0037  0.0154  -0.0011 325  TRP A CD2 
2589 N NE1 . TRP A 325 ? 0.1599 0.1277 0.1683 -0.0126 0.0237  0.0024  325  TRP A NE1 
2590 C CE2 . TRP A 325 ? 0.1674 0.1552 0.1793 -0.0073 -0.0058 0.0023  325  TRP A CE2 
2591 C CE3 . TRP A 325 ? 0.1602 0.1554 0.1849 0.0002  0.0160  -0.0130 325  TRP A CE3 
2592 C CZ2 . TRP A 325 ? 0.1897 0.1853 0.1821 -0.0072 0.0068  0.0087  325  TRP A CZ2 
2593 C CZ3 . TRP A 325 ? 0.1610 0.1930 0.2183 -0.0029 0.0185  0.0090  325  TRP A CZ3 
2594 C CH2 . TRP A 325 ? 0.1537 0.1957 0.2144 -0.0040 0.0110  0.0057  325  TRP A CH2 
2595 N N   . TYR A 326 ? 0.1242 0.1102 0.1437 0.0024  0.0012  0.0088  326  TYR A N   
2596 C CA  . TYR A 326 ? 0.1286 0.1272 0.1304 0.0069  -0.0002 -0.0025 326  TYR A CA  
2597 C C   . TYR A 326 ? 0.1448 0.1232 0.1310 0.0057  0.0094  0.0027  326  TYR A C   
2598 O O   . TYR A 326 ? 0.1426 0.1245 0.1256 0.0146  0.0247  -0.0018 326  TYR A O   
2599 C CB  . TYR A 326 ? 0.1377 0.1239 0.1344 0.0007  0.0027  -0.0019 326  TYR A CB  
2600 C CG  . TYR A 326 ? 0.1139 0.1250 0.1294 -0.0021 0.0147  -0.0038 326  TYR A CG  
2601 C CD1 . TYR A 326 ? 0.1424 0.1258 0.1314 0.0146  0.0035  0.0029  326  TYR A CD1 
2602 C CD2 . TYR A 326 ? 0.1111 0.1224 0.1322 0.0104  0.0104  -0.0091 326  TYR A CD2 
2603 C CE1 . TYR A 326 ? 0.1534 0.1419 0.1458 0.0070  -0.0001 -0.0017 326  TYR A CE1 
2604 C CE2 . TYR A 326 ? 0.1318 0.1263 0.1259 0.0048  0.0063  -0.0123 326  TYR A CE2 
2605 C CZ  . TYR A 326 ? 0.1417 0.1421 0.1154 0.0077  0.0078  -0.0050 326  TYR A CZ  
2606 O OH  . TYR A 326 ? 0.1491 0.1622 0.1235 -0.0051 0.0118  -0.0053 326  TYR A OH  
2607 N N   . ILE A 327 ? 0.1251 0.1208 0.1316 -0.0003 -0.0027 0.0000  327  ILE A N   
2608 C CA  . ILE A 327 ? 0.1278 0.1265 0.1397 -0.0015 0.0064  0.0036  327  ILE A CA  
2609 C C   . ILE A 327 ? 0.1457 0.1325 0.1550 -0.0005 0.0016  -0.0044 327  ILE A C   
2610 O O   . ILE A 327 ? 0.1556 0.1377 0.1540 -0.0069 0.0016  -0.0107 327  ILE A O   
2611 C CB  . ILE A 327 ? 0.1256 0.1280 0.1336 -0.0093 -0.0028 0.0000  327  ILE A CB  
2612 C CG1 . ILE A 327 ? 0.1158 0.1120 0.1521 -0.0086 -0.0089 0.0071  327  ILE A CG1 
2613 C CG2 . ILE A 327 ? 0.1548 0.1515 0.1363 0.0019  0.0062  0.0000  327  ILE A CG2 
2614 C CD1 . ILE A 327 ? 0.1401 0.1154 0.1461 -0.0085 -0.0038 0.0054  327  ILE A CD1 
2615 N N   . ASN A 328 ? 0.1429 0.1446 0.1602 -0.0041 0.0106  0.0051  328  ASN A N   
2616 C CA  . ASN A 328 ? 0.1528 0.1451 0.1548 -0.0096 0.0071  0.0045  328  ASN A CA  
2617 C C   . ASN A 328 ? 0.1630 0.1441 0.1628 -0.0057 0.0080  0.0030  328  ASN A C   
2618 O O   . ASN A 328 ? 0.1858 0.1621 0.1805 -0.0277 0.0019  -0.0001 328  ASN A O   
2619 C CB  . ASN A 328 ? 0.1497 0.1436 0.1329 -0.0036 0.0191  0.0064  328  ASN A CB  
2620 C CG  . ASN A 328 ? 0.1388 0.1242 0.1544 -0.0134 0.0008  0.0041  328  ASN A CG  
2621 O OD1 . ASN A 328 ? 0.1740 0.2113 0.1873 0.0114  0.0082  0.0014  328  ASN A OD1 
2622 N ND2 . ASN A 328 ? 0.0957 0.1064 0.1229 0.0033  0.0067  -0.0091 328  ASN A ND2 
2623 N N   . CYS A 329 ? 0.1544 0.1336 0.1638 -0.0073 0.0034  0.0025  329  CYS A N   
2624 C CA  . CYS A 329 ? 0.1626 0.1478 0.1644 -0.0088 0.0060  0.0019  329  CYS A CA  
2625 C C   . CYS A 329 ? 0.1668 0.1451 0.1596 -0.0057 0.0005  0.0007  329  CYS A C   
2626 O O   . CYS A 329 ? 0.1871 0.1354 0.1704 -0.0137 -0.0077 -0.0046 329  CYS A O   
2627 C CB  . CYS A 329 ? 0.1489 0.1467 0.1679 -0.0103 0.0102  -0.0005 329  CYS A CB  
2628 S SG  . CYS A 329 ? 0.1631 0.1970 0.2180 -0.0012 0.0164  -0.0033 329  CYS A SG  
2629 N N   . PHE A 330 ? 0.1569 0.1453 0.1549 -0.0082 0.0075  0.0045  330  PHE A N   
2630 C CA  . PHE A 330 ? 0.1726 0.1614 0.1631 0.0002  0.0080  0.0046  330  PHE A CA  
2631 C C   . PHE A 330 ? 0.1603 0.1659 0.1751 -0.0004 0.0109  0.0063  330  PHE A C   
2632 O O   . PHE A 330 ? 0.1971 0.1928 0.2146 0.0090  0.0199  0.0118  330  PHE A O   
2633 C CB  . PHE A 330 ? 0.1599 0.1575 0.1722 -0.0043 0.0030  0.0055  330  PHE A CB  
2634 C CG  . PHE A 330 ? 0.1509 0.1556 0.1629 0.0039  0.0058  0.0085  330  PHE A CG  
2635 C CD1 . PHE A 330 ? 0.1719 0.1694 0.1682 -0.0004 0.0000  0.0113  330  PHE A CD1 
2636 C CD2 . PHE A 330 ? 0.1866 0.1672 0.1834 -0.0040 0.0060  -0.0035 330  PHE A CD2 
2637 C CE1 . PHE A 330 ? 0.1789 0.1885 0.1850 -0.0020 0.0114  0.0063  330  PHE A CE1 
2638 C CE2 . PHE A 330 ? 0.1721 0.1715 0.1854 -0.0026 0.0079  0.0090  330  PHE A CE2 
2639 C CZ  . PHE A 330 ? 0.1857 0.1713 0.1880 -0.0032 0.0068  0.0043  330  PHE A CZ  
2640 N N   . GLY A 331 ? 0.1478 0.1545 0.1584 -0.0037 0.0099  0.0043  331  GLY A N   
2641 C CA  . GLY A 331 ? 0.1354 0.1452 0.1656 -0.0060 0.0036  -0.0023 331  GLY A CA  
2642 C C   . GLY A 331 ? 0.1445 0.1474 0.1621 -0.0046 0.0046  -0.0072 331  GLY A C   
2643 O O   . GLY A 331 ? 0.1467 0.1648 0.1737 -0.0031 0.0041  -0.0066 331  GLY A O   
2644 N N   . CYS A 332 ? 0.1346 0.1304 0.1454 -0.0090 -0.0029 -0.0044 332  CYS A N   
2645 C CA  . CYS A 332 ? 0.1426 0.1346 0.1293 -0.0130 0.0046  -0.0048 332  CYS A CA  
2646 C C   . CYS A 332 ? 0.1417 0.1352 0.1365 -0.0058 0.0027  -0.0003 332  CYS A C   
2647 O O   . CYS A 332 ? 0.1502 0.1405 0.1565 -0.0021 0.0003  0.0034  332  CYS A O   
2648 C CB  . CYS A 332 ? 0.1544 0.1281 0.1248 -0.0211 0.0062  0.0006  332  CYS A CB  
2649 S SG  . CYS A 332 ? 0.1550 0.1412 0.1384 -0.0058 0.0245  0.0125  332  CYS A SG  
2650 N N   . GLU A 333 ? 0.1370 0.1235 0.1115 -0.0123 0.0015  -0.0019 333  GLU A N   
2651 C CA  . GLU A 333 ? 0.1288 0.1179 0.1230 -0.0104 0.0089  -0.0074 333  GLU A CA  
2652 C C   . GLU A 333 ? 0.1277 0.1219 0.1289 -0.0046 -0.0004 0.0001  333  GLU A C   
2653 O O   . GLU A 333 ? 0.1199 0.1217 0.1307 -0.0017 -0.0035 0.0028  333  GLU A O   
2654 C CB  . GLU A 333 ? 0.1188 0.1266 0.1137 0.0001  0.0028  -0.0101 333  GLU A CB  
2655 C CG  . GLU A 333 ? 0.1360 0.1290 0.1358 -0.0070 -0.0012 -0.0172 333  GLU A CG  
2656 C CD  . GLU A 333 ? 0.1249 0.1363 0.1385 -0.0010 -0.0032 -0.0044 333  GLU A CD  
2657 O OE1 . GLU A 333 ? 0.1626 0.1527 0.1487 0.0161  0.0056  0.0039  333  GLU A OE1 
2658 O OE2 . GLU A 333 ? 0.1548 0.1412 0.1720 0.0133  -0.0074 -0.0062 333  GLU A OE2 
2659 N N   . THR A 334 ? 0.1077 0.1068 0.1285 0.0005  0.0042  -0.0159 334  THR A N   
2660 C CA  . THR A 334 ? 0.1232 0.1101 0.1390 -0.0002 0.0025  -0.0066 334  THR A CA  
2661 C C   . THR A 334 ? 0.1303 0.1199 0.1196 -0.0052 -0.0018 -0.0049 334  THR A C   
2662 O O   . THR A 334 ? 0.1298 0.1249 0.1318 0.0001  -0.0018 -0.0091 334  THR A O   
2663 C CB  . THR A 334 ? 0.1261 0.1267 0.1128 0.0055  -0.0036 -0.0103 334  THR A CB  
2664 O OG1 . THR A 334 ? 0.1237 0.1051 0.1353 0.0041  0.0111  -0.0013 334  THR A OG1 
2665 C CG2 . THR A 334 ? 0.1368 0.1245 0.1524 0.0055  -0.0073 -0.0154 334  THR A CG2 
2666 N N   . HIS A 335 ? 0.1292 0.0903 0.1196 0.0017  -0.0031 -0.0056 335  HIS A N   
2667 C CA  . HIS A 335 ? 0.1182 0.1120 0.1177 0.0035  -0.0028 -0.0039 335  HIS A CA  
2668 C C   . HIS A 335 ? 0.1282 0.1051 0.1207 0.0019  -0.0036 -0.0078 335  HIS A C   
2669 O O   . HIS A 335 ? 0.1420 0.1258 0.1138 -0.0035 -0.0180 -0.0035 335  HIS A O   
2670 C CB  . HIS A 335 ? 0.1361 0.1159 0.1364 0.0133  -0.0017 -0.0124 335  HIS A CB  
2671 C CG  . HIS A 335 ? 0.1324 0.1384 0.1294 -0.0033 0.0078  -0.0154 335  HIS A CG  
2672 N ND1 . HIS A 335 ? 0.1658 0.1788 0.1578 -0.0018 0.0184  -0.0156 335  HIS A ND1 
2673 C CD2 . HIS A 335 ? 0.1218 0.1335 0.0988 -0.0014 0.0173  0.0096  335  HIS A CD2 
2674 C CE1 . HIS A 335 ? 0.0899 0.0931 0.1041 -0.0027 0.0196  -0.0106 335  HIS A CE1 
2675 N NE2 . HIS A 335 ? 0.1925 0.1647 0.1608 -0.0189 0.0146  -0.0054 335  HIS A NE2 
2676 N N   . ALA A 336 ? 0.1096 0.1048 0.1279 0.0002  -0.0064 -0.0022 336  ALA A N   
2677 C CA  . ALA A 336 ? 0.1160 0.1088 0.1251 0.0009  -0.0084 0.0022  336  ALA A CA  
2678 C C   . ALA A 336 ? 0.1243 0.1120 0.1246 -0.0025 0.0023  0.0033  336  ALA A C   
2679 O O   . ALA A 336 ? 0.1356 0.1270 0.1372 -0.0120 0.0078  0.0115  336  ALA A O   
2680 C CB  . ALA A 336 ? 0.1214 0.1323 0.1198 0.0134  -0.0089 0.0016  336  ALA A CB  
2681 N N   . MET A 337 ? 0.1083 0.0891 0.1273 -0.0109 0.0031  -0.0022 337  MET A N   
2682 C CA  . MET A 337 ? 0.1104 0.1150 0.1179 0.0034  -0.0080 0.0000  337  MET A CA  
2683 C C   . MET A 337 ? 0.1105 0.1179 0.1050 0.0013  0.0008  0.0065  337  MET A C   
2684 O O   . MET A 337 ? 0.1172 0.1021 0.1030 0.0057  -0.0005 -0.0004 337  MET A O   
2685 C CB  . MET A 337 ? 0.1060 0.1148 0.1257 -0.0081 0.0024  0.0094  337  MET A CB  
2686 C CG  . MET A 337 ? 0.1301 0.1461 0.1415 -0.0032 -0.0351 0.0181  337  MET A CG  
2687 S SD  . MET A 337 ? 0.1780 0.1413 0.1328 0.0040  -0.0062 0.0013  337  MET A SD  
2688 C CE  . MET A 337 ? 0.1481 0.1229 0.1879 -0.0216 -0.0090 -0.0052 337  MET A CE  
2689 N N   . LEU A 338 ? 0.1057 0.1141 0.0960 0.0056  -0.0089 -0.0003 338  LEU A N   
2690 C CA  . LEU A 338 ? 0.1173 0.1104 0.1016 0.0001  -0.0060 0.0065  338  LEU A CA  
2691 C C   . LEU A 338 ? 0.1299 0.1172 0.0986 -0.0045 -0.0002 0.0045  338  LEU A C   
2692 O O   . LEU A 338 ? 0.1302 0.1384 0.0994 -0.0132 0.0023  0.0093  338  LEU A O   
2693 C CB  . LEU A 338 ? 0.1282 0.0994 0.1081 -0.0022 -0.0034 -0.0018 338  LEU A CB  
2694 C CG  . LEU A 338 ? 0.1024 0.0760 0.0844 0.0035  0.0013  0.0062  338  LEU A CG  
2695 C CD1 . LEU A 338 ? 0.1243 0.1015 0.1154 0.0042  0.0030  0.0233  338  LEU A CD1 
2696 C CD2 . LEU A 338 ? 0.1224 0.1121 0.1145 0.0095  0.0189  0.0010  338  LEU A CD2 
2697 N N   . PRO A 339 ? 0.1376 0.1117 0.0959 -0.0069 -0.0014 0.0009  339  PRO A N   
2698 C CA  . PRO A 339 ? 0.1367 0.1156 0.0988 0.0022  0.0015  0.0003  339  PRO A CA  
2699 C C   . PRO A 339 ? 0.1267 0.1255 0.1048 0.0017  0.0009  -0.0006 339  PRO A C   
2700 O O   . PRO A 339 ? 0.1307 0.1361 0.0825 0.0069  -0.0011 -0.0081 339  PRO A O   
2701 C CB  . PRO A 339 ? 0.1529 0.1307 0.1052 0.0031  0.0072  0.0016  339  PRO A CB  
2702 C CG  . PRO A 339 ? 0.1696 0.1030 0.1243 -0.0098 0.0014  -0.0175 339  PRO A CG  
2703 C CD  . PRO A 339 ? 0.1546 0.1005 0.1109 -0.0217 0.0117  0.0185  339  PRO A CD  
2704 N N   . TYR A 340 ? 0.1258 0.1156 0.1136 0.0111  -0.0016 -0.0004 340  TYR A N   
2705 C CA  . TYR A 340 ? 0.1298 0.1297 0.1153 -0.0043 0.0019  -0.0005 340  TYR A CA  
2706 C C   . TYR A 340 ? 0.1474 0.1257 0.1224 0.0045  0.0032  -0.0014 340  TYR A C   
2707 O O   . TYR A 340 ? 0.1376 0.1330 0.1107 0.0058  -0.0046 0.0002  340  TYR A O   
2708 C CB  . TYR A 340 ? 0.1421 0.1203 0.1136 0.0079  -0.0001 0.0061  340  TYR A CB  
2709 C CG  . TYR A 340 ? 0.1281 0.1119 0.1235 -0.0036 -0.0031 0.0054  340  TYR A CG  
2710 C CD1 . TYR A 340 ? 0.1223 0.1138 0.1213 -0.0023 0.0133  -0.0022 340  TYR A CD1 
2711 C CD2 . TYR A 340 ? 0.1294 0.1170 0.1383 -0.0037 -0.0030 -0.0006 340  TYR A CD2 
2712 C CE1 . TYR A 340 ? 0.1493 0.1137 0.1146 0.0102  -0.0002 -0.0041 340  TYR A CE1 
2713 C CE2 . TYR A 340 ? 0.1323 0.1152 0.1241 -0.0029 -0.0063 -0.0022 340  TYR A CE2 
2714 C CZ  . TYR A 340 ? 0.1307 0.1176 0.1276 -0.0098 -0.0127 0.0002  340  TYR A CZ  
2715 O OH  . TYR A 340 ? 0.1508 0.1085 0.1286 0.0076  0.0086  -0.0109 340  TYR A OH  
2716 N N   . ASP A 341 ? 0.1350 0.1182 0.1252 -0.0083 0.0013  0.0075  341  ASP A N   
2717 C CA  . ASP A 341 ? 0.1267 0.1132 0.1275 0.0042  0.0041  -0.0002 341  ASP A CA  
2718 C C   . ASP A 341 ? 0.1253 0.1203 0.1230 -0.0004 -0.0008 -0.0029 341  ASP A C   
2719 O O   . ASP A 341 ? 0.1153 0.1186 0.1219 0.0030  -0.0012 -0.0155 341  ASP A O   
2720 C CB  . ASP A 341 ? 0.1357 0.1173 0.1394 0.0020  -0.0075 0.0008  341  ASP A CB  
2721 C CG  . ASP A 341 ? 0.1582 0.1355 0.1479 -0.0043 0.0052  0.0011  341  ASP A CG  
2722 O OD1 . ASP A 341 ? 0.1559 0.1638 0.1771 -0.0107 0.0176  -0.0110 341  ASP A OD1 
2723 O OD2 . ASP A 341 ? 0.1777 0.1378 0.1580 -0.0034 0.0014  0.0035  341  ASP A OD2 
2724 N N   . GLN A 342 ? 0.1142 0.1180 0.1099 0.0076  0.0013  -0.0090 342  GLN A N   
2725 C CA  . GLN A 342 ? 0.1146 0.1370 0.1226 0.0078  -0.0031 0.0078  342  GLN A CA  
2726 C C   . GLN A 342 ? 0.1320 0.1329 0.1305 -0.0012 0.0013  0.0038  342  GLN A C   
2727 O O   . GLN A 342 ? 0.1303 0.1348 0.1326 -0.0055 -0.0144 0.0007  342  GLN A O   
2728 C CB  . GLN A 342 ? 0.1211 0.1538 0.1385 0.0012  -0.0004 -0.0092 342  GLN A CB  
2729 C CG  . GLN A 342 ? 0.1261 0.1725 0.1233 0.0014  0.0080  0.0088  342  GLN A CG  
2730 C CD  . GLN A 342 ? 0.1687 0.1814 0.1692 0.0077  0.0073  0.0050  342  GLN A CD  
2731 O OE1 . GLN A 342 ? 0.2449 0.2947 0.1940 0.0226  0.0189  0.0023  342  GLN A OE1 
2732 N NE2 . GLN A 342 ? 0.1129 0.1491 0.1023 0.0336  0.0050  0.0067  342  GLN A NE2 
2733 N N   . TYR A 343 ? 0.1245 0.1321 0.1403 0.0040  -0.0090 0.0102  343  TYR A N   
2734 C CA  . TYR A 343 ? 0.1337 0.1277 0.1344 0.0031  -0.0066 0.0038  343  TYR A CA  
2735 C C   . TYR A 343 ? 0.1313 0.1411 0.1410 0.0005  -0.0083 0.0079  343  TYR A C   
2736 O O   . TYR A 343 ? 0.1273 0.1439 0.1377 -0.0043 -0.0095 0.0029  343  TYR A O   
2737 C CB  . TYR A 343 ? 0.1370 0.1341 0.1339 0.0023  -0.0162 0.0020  343  TYR A CB  
2738 C CG  . TYR A 343 ? 0.1460 0.1358 0.1305 -0.0001 -0.0031 0.0012  343  TYR A CG  
2739 C CD1 . TYR A 343 ? 0.1231 0.1314 0.1280 0.0012  -0.0174 -0.0042 343  TYR A CD1 
2740 C CD2 . TYR A 343 ? 0.1413 0.1568 0.1694 -0.0080 -0.0100 0.0003  343  TYR A CD2 
2741 C CE1 . TYR A 343 ? 0.1370 0.1550 0.1492 -0.0030 -0.0122 0.0006  343  TYR A CE1 
2742 C CE2 . TYR A 343 ? 0.1549 0.1658 0.1479 -0.0030 -0.0128 0.0061  343  TYR A CE2 
2743 C CZ  . TYR A 343 ? 0.1474 0.1598 0.1556 -0.0043 -0.0075 -0.0008 343  TYR A CZ  
2744 O OH  . TYR A 343 ? 0.1613 0.1934 0.1665 -0.0178 -0.0187 -0.0075 343  TYR A OH  
2745 N N   . LEU A 344 ? 0.1242 0.1276 0.1382 -0.0059 -0.0125 0.0039  344  LEU A N   
2746 C CA  . LEU A 344 ? 0.1188 0.1306 0.1284 -0.0003 -0.0036 0.0050  344  LEU A CA  
2747 C C   . LEU A 344 ? 0.1302 0.1325 0.1487 -0.0030 -0.0045 0.0075  344  LEU A C   
2748 O O   . LEU A 344 ? 0.1406 0.1090 0.1306 -0.0047 -0.0050 0.0119  344  LEU A O   
2749 C CB  . LEU A 344 ? 0.1151 0.1290 0.1373 -0.0024 0.0000  -0.0004 344  LEU A CB  
2750 C CG  . LEU A 344 ? 0.1388 0.1307 0.1222 0.0041  -0.0017 0.0146  344  LEU A CG  
2751 C CD1 . LEU A 344 ? 0.1346 0.1721 0.1481 0.0009  0.0066  -0.0002 344  LEU A CD1 
2752 C CD2 . LEU A 344 ? 0.1610 0.1365 0.1165 0.0188  -0.0061 0.0062  344  LEU A CD2 
2753 N N   . HIS A 345 ? 0.1271 0.1231 0.1416 0.0143  -0.0010 0.0067  345  HIS A N   
2754 C CA  . HIS A 345 ? 0.1180 0.1331 0.1390 0.0030  -0.0044 -0.0101 345  HIS A CA  
2755 C C   . HIS A 345 ? 0.1236 0.1258 0.1325 0.0049  -0.0073 0.0031  345  HIS A C   
2756 O O   . HIS A 345 ? 0.1346 0.1392 0.1489 0.0139  -0.0135 -0.0067 345  HIS A O   
2757 C CB  . HIS A 345 ? 0.1153 0.1454 0.1530 0.0020  0.0035  0.0039  345  HIS A CB  
2758 C CG  . HIS A 345 ? 0.1298 0.1443 0.1331 0.0046  0.0035  0.0045  345  HIS A CG  
2759 N ND1 . HIS A 345 ? 0.1684 0.1576 0.1571 -0.0090 0.0304  -0.0102 345  HIS A ND1 
2760 C CD2 . HIS A 345 ? 0.1334 0.1643 0.1333 0.0033  -0.0020 0.0075  345  HIS A CD2 
2761 C CE1 . HIS A 345 ? 0.1856 0.1443 0.1608 0.0077  0.0051  -0.0030 345  HIS A CE1 
2762 N NE2 . HIS A 345 ? 0.1298 0.1430 0.1332 0.0003  0.0031  -0.0053 345  HIS A NE2 
2763 N N   . ARG A 346 ? 0.1291 0.1473 0.1321 0.0061  -0.0063 -0.0015 346  ARG A N   
2764 C CA  . ARG A 346 ? 0.1313 0.1315 0.1299 -0.0052 -0.0014 -0.0011 346  ARG A CA  
2765 C C   . ARG A 346 ? 0.1353 0.1490 0.1363 0.0052  0.0029  -0.0004 346  ARG A C   
2766 O O   . ARG A 346 ? 0.1380 0.1579 0.1445 0.0078  0.0037  -0.0064 346  ARG A O   
2767 C CB  . ARG A 346 ? 0.1329 0.1507 0.1473 -0.0038 0.0014  0.0056  346  ARG A CB  
2768 C CG  . ARG A 346 ? 0.1356 0.1514 0.1597 -0.0055 0.0099  -0.0036 346  ARG A CG  
2769 C CD  . ARG A 346 ? 0.1654 0.1700 0.1464 0.0018  0.0023  -0.0088 346  ARG A CD  
2770 N NE  . ARG A 346 ? 0.1373 0.1883 0.1532 -0.0045 0.0010  -0.0261 346  ARG A NE  
2771 C CZ  . ARG A 346 ? 0.1485 0.1814 0.1592 0.0046  0.0025  -0.0008 346  ARG A CZ  
2772 N NH1 . ARG A 346 ? 0.1534 0.1789 0.1801 0.0123  0.0063  0.0003  346  ARG A NH1 
2773 N NH2 . ARG A 346 ? 0.1358 0.1916 0.1748 -0.0120 -0.0061 -0.0381 346  ARG A NH2 
2774 N N   . PHE A 347 ? 0.1164 0.1215 0.1189 -0.0020 0.0014  -0.0003 347  PHE A N   
2775 C CA  . PHE A 347 ? 0.1210 0.1217 0.1192 -0.0010 -0.0025 -0.0021 347  PHE A CA  
2776 C C   . PHE A 347 ? 0.1230 0.1234 0.1316 0.0034  -0.0060 -0.0007 347  PHE A C   
2777 O O   . PHE A 347 ? 0.1313 0.1278 0.1081 0.0019  -0.0114 -0.0075 347  PHE A O   
2778 C CB  . PHE A 347 ? 0.1293 0.1525 0.1167 -0.0020 -0.0036 -0.0035 347  PHE A CB  
2779 C CG  . PHE A 347 ? 0.1345 0.1463 0.1218 -0.0014 -0.0071 -0.0125 347  PHE A CG  
2780 C CD1 . PHE A 347 ? 0.1291 0.1601 0.1562 0.0038  -0.0100 -0.0013 347  PHE A CD1 
2781 C CD2 . PHE A 347 ? 0.1465 0.1757 0.1321 -0.0129 -0.0071 -0.0015 347  PHE A CD2 
2782 C CE1 . PHE A 347 ? 0.1437 0.1599 0.1560 0.0134  0.0003  0.0045  347  PHE A CE1 
2783 C CE2 . PHE A 347 ? 0.1437 0.1755 0.1569 0.0086  -0.0123 -0.0126 347  PHE A CE2 
2784 C CZ  . PHE A 347 ? 0.1762 0.1677 0.1976 -0.0037 -0.0013 0.0019  347  PHE A CZ  
2785 N N   . ALA A 348 ? 0.1390 0.1040 0.1379 -0.0035 -0.0078 -0.0001 348  ALA A N   
2786 C CA  . ALA A 348 ? 0.1332 0.1164 0.1489 -0.0024 -0.0124 -0.0006 348  ALA A CA  
2787 C C   . ALA A 348 ? 0.1163 0.1048 0.1420 -0.0027 -0.0008 -0.0014 348  ALA A C   
2788 O O   . ALA A 348 ? 0.1350 0.1100 0.1435 0.0016  -0.0068 0.0016  348  ALA A O   
2789 C CB  . ALA A 348 ? 0.1565 0.1166 0.1548 -0.0051 -0.0127 0.0028  348  ALA A CB  
2790 N N   . ALA A 349 ? 0.1168 0.0991 0.1426 0.0012  0.0036  0.0009  349  ALA A N   
2791 C CA  . ALA A 349 ? 0.1129 0.1105 0.1423 -0.0041 0.0018  0.0027  349  ALA A CA  
2792 C C   . ALA A 349 ? 0.1349 0.1102 0.1325 -0.0007 -0.0060 -0.0038 349  ALA A C   
2793 O O   . ALA A 349 ? 0.1338 0.1033 0.1274 -0.0047 -0.0099 -0.0055 349  ALA A O   
2794 C CB  . ALA A 349 ? 0.1150 0.1326 0.1657 -0.0042 0.0012  -0.0063 349  ALA A CB  
2795 N N   . TYR A 350 ? 0.1281 0.0957 0.1274 0.0097  -0.0066 0.0057  350  TYR A N   
2796 C CA  . TYR A 350 ? 0.1230 0.1104 0.1339 0.0059  -0.0118 0.0009  350  TYR A CA  
2797 C C   . TYR A 350 ? 0.1237 0.1252 0.1327 0.0010  -0.0051 0.0081  350  TYR A C   
2798 O O   . TYR A 350 ? 0.1194 0.1205 0.1422 0.0010  -0.0125 0.0102  350  TYR A O   
2799 C CB  . TYR A 350 ? 0.1185 0.0988 0.1276 0.0090  -0.0081 0.0012  350  TYR A CB  
2800 C CG  . TYR A 350 ? 0.1254 0.1294 0.1341 0.0031  -0.0126 0.0085  350  TYR A CG  
2801 C CD1 . TYR A 350 ? 0.1297 0.1399 0.1225 0.0003  -0.0030 -0.0118 350  TYR A CD1 
2802 C CD2 . TYR A 350 ? 0.1413 0.1190 0.1305 -0.0077 -0.0076 -0.0080 350  TYR A CD2 
2803 C CE1 . TYR A 350 ? 0.1566 0.1190 0.1386 -0.0010 -0.0072 0.0069  350  TYR A CE1 
2804 C CE2 . TYR A 350 ? 0.1316 0.1388 0.1447 0.0022  -0.0071 -0.0065 350  TYR A CE2 
2805 C CZ  . TYR A 350 ? 0.1343 0.1423 0.1352 0.0029  0.0030  0.0102  350  TYR A CZ  
2806 O OH  . TYR A 350 ? 0.1450 0.1398 0.1836 0.0068  -0.0054 0.0224  350  TYR A OH  
2807 N N   . PHE A 351 ? 0.1150 0.1183 0.1579 -0.0005 0.0011  0.0179  351  PHE A N   
2808 C CA  . PHE A 351 ? 0.1241 0.1331 0.1600 0.0026  0.0013  0.0011  351  PHE A CA  
2809 C C   . PHE A 351 ? 0.1343 0.1326 0.1762 -0.0022 0.0000  -0.0022 351  PHE A C   
2810 O O   . PHE A 351 ? 0.1248 0.1143 0.1788 0.0049  -0.0178 0.0082  351  PHE A O   
2811 C CB  . PHE A 351 ? 0.1467 0.1425 0.1549 -0.0012 0.0016  0.0113  351  PHE A CB  
2812 C CG  . PHE A 351 ? 0.1557 0.1392 0.1642 -0.0020 -0.0097 -0.0046 351  PHE A CG  
2813 C CD1 . PHE A 351 ? 0.1269 0.1634 0.1369 -0.0079 0.0044  0.0004  351  PHE A CD1 
2814 C CD2 . PHE A 351 ? 0.1219 0.1429 0.1669 -0.0030 -0.0028 0.0110  351  PHE A CD2 
2815 C CE1 . PHE A 351 ? 0.1353 0.1643 0.1404 -0.0107 0.0136  0.0049  351  PHE A CE1 
2816 C CE2 . PHE A 351 ? 0.1670 0.1514 0.1458 -0.0111 0.0003  -0.0026 351  PHE A CE2 
2817 C CZ  . PHE A 351 ? 0.1598 0.1529 0.1444 -0.0141 0.0036  0.0028  351  PHE A CZ  
2818 N N   . GLN A 352 ? 0.1310 0.1384 0.1945 -0.0022 -0.0038 -0.0023 352  GLN A N   
2819 C CA  . GLN A 352 ? 0.1427 0.1504 0.2172 0.0046  0.0095  -0.0107 352  GLN A CA  
2820 C C   . GLN A 352 ? 0.1614 0.1602 0.2007 -0.0116 0.0098  -0.0152 352  GLN A C   
2821 O O   . GLN A 352 ? 0.1801 0.1591 0.2145 -0.0239 0.0113  -0.0218 352  GLN A O   
2822 C CB  . GLN A 352 ? 0.1509 0.1853 0.2637 0.0040  0.0112  -0.0166 352  GLN A CB  
2823 C CG  . GLN A 352 ? 0.1822 0.1909 0.2870 -0.0024 0.0118  0.0096  352  GLN A CG  
2824 C CD  . GLN A 352 ? 0.1749 0.1701 0.2532 0.0132  0.0111  0.0238  352  GLN A CD  
2825 O OE1 . GLN A 352 ? 0.1744 0.1655 0.2758 0.0079  0.0054  0.0355  352  GLN A OE1 
2826 N NE2 . GLN A 352 ? 0.1471 0.1433 0.1459 0.0063  0.0290  0.0215  352  GLN A NE2 
2827 N N   . GLN A 353 ? 0.1474 0.1287 0.1612 -0.0016 0.0164  -0.0124 353  GLN A N   
2828 C CA  . GLN A 353 ? 0.1484 0.1398 0.1541 -0.0144 0.0210  -0.0130 353  GLN A CA  
2829 C C   . GLN A 353 ? 0.1422 0.1273 0.1398 -0.0078 0.0051  -0.0092 353  GLN A C   
2830 O O   . GLN A 353 ? 0.1330 0.1435 0.1209 -0.0159 0.0054  -0.0224 353  GLN A O   
2831 C CB  . GLN A 353 ? 0.1860 0.1281 0.1647 -0.0138 0.0155  -0.0187 353  GLN A CB  
2832 C CG  . GLN A 353 ? 0.1554 0.1484 0.1636 -0.0061 0.0157  -0.0083 353  GLN A CG  
2833 C CD  . GLN A 353 ? 0.1836 0.1740 0.1820 -0.0066 0.0141  -0.0048 353  GLN A CD  
2834 O OE1 . GLN A 353 ? 0.1935 0.1962 0.2150 -0.0030 0.0031  0.0000  353  GLN A OE1 
2835 N NE2 . GLN A 353 ? 0.1793 0.1750 0.1820 -0.0080 0.0188  -0.0200 353  GLN A NE2 
2836 N N   . GLY A 354 ? 0.1281 0.1229 0.1259 -0.0040 0.0121  -0.0035 354  GLY A N   
2837 C CA  . GLY A 354 ? 0.1234 0.1412 0.1466 -0.0104 0.0050  -0.0056 354  GLY A CA  
2838 C C   . GLY A 354 ? 0.1365 0.1261 0.1427 -0.0049 0.0003  0.0018  354  GLY A C   
2839 O O   . GLY A 354 ? 0.1365 0.1390 0.1564 -0.0115 -0.0103 0.0138  354  GLY A O   
2840 N N   . ASP A 355 ? 0.1235 0.1326 0.1087 -0.0056 -0.0005 0.0050  355  ASP A N   
2841 C CA  . ASP A 355 ? 0.1172 0.1259 0.1155 -0.0041 -0.0029 0.0004  355  ASP A CA  
2842 C C   . ASP A 355 ? 0.1146 0.1236 0.1174 -0.0026 -0.0018 -0.0004 355  ASP A C   
2843 O O   . ASP A 355 ? 0.1188 0.1067 0.1094 0.0006  -0.0083 -0.0113 355  ASP A O   
2844 C CB  . ASP A 355 ? 0.1158 0.1320 0.1149 -0.0135 -0.0085 0.0069  355  ASP A CB  
2845 C CG  . ASP A 355 ? 0.1330 0.1509 0.1434 -0.0081 0.0086  0.0035  355  ASP A CG  
2846 O OD1 . ASP A 355 ? 0.1377 0.1479 0.1304 -0.0123 0.0079  0.0007  355  ASP A OD1 
2847 O OD2 . ASP A 355 ? 0.1353 0.1233 0.1502 -0.0100 -0.0045 0.0130  355  ASP A OD2 
2848 N N   . MET A 356 ? 0.1132 0.1042 0.1028 -0.0028 0.0054  -0.0121 356  MET A N   
2849 C CA  . MET A 356 ? 0.1091 0.1182 0.1042 0.0027  -0.0021 -0.0103 356  MET A CA  
2850 C C   . MET A 356 ? 0.1149 0.1113 0.1139 0.0003  -0.0003 -0.0011 356  MET A C   
2851 O O   . MET A 356 ? 0.1335 0.1030 0.1190 0.0036  -0.0060 -0.0056 356  MET A O   
2852 C CB  . MET A 356 ? 0.1188 0.1143 0.1209 0.0071  -0.0035 0.0054  356  MET A CB  
2853 C CG  . MET A 356 ? 0.0984 0.1631 0.1234 0.0042  -0.0053 0.0134  356  MET A CG  
2854 S SD  . MET A 356 ? 0.0991 0.1528 0.1260 0.0011  -0.0066 0.0098  356  MET A SD  
2855 C CE  . MET A 356 ? 0.1463 0.1583 0.1524 -0.0051 0.0097  0.0040  356  MET A CE  
2856 N N   . GLU A 357 ? 0.1265 0.1121 0.1095 0.0045  0.0035  -0.0074 357  GLU A N   
2857 C CA  . GLU A 357 ? 0.1191 0.1139 0.1117 -0.0067 0.0029  0.0001  357  GLU A CA  
2858 C C   . GLU A 357 ? 0.1230 0.1090 0.1154 -0.0041 -0.0034 -0.0058 357  GLU A C   
2859 O O   . GLU A 357 ? 0.1274 0.1011 0.1113 0.0133  -0.0096 -0.0130 357  GLU A O   
2860 C CB  . GLU A 357 ? 0.1500 0.1317 0.1147 -0.0170 0.0004  0.0043  357  GLU A CB  
2861 C CG  . GLU A 357 ? 0.1445 0.1646 0.1246 -0.0107 0.0038  -0.0032 357  GLU A CG  
2862 C CD  . GLU A 357 ? 0.1738 0.1669 0.1668 -0.0092 0.0030  -0.0004 357  GLU A CD  
2863 O OE1 . GLU A 357 ? 0.1513 0.1708 0.1743 0.0069  0.0171  0.0061  357  GLU A OE1 
2864 O OE2 . GLU A 357 ? 0.2089 0.1950 0.2035 -0.0153 0.0244  -0.0129 357  GLU A OE2 
2865 N N   . SER A 358 ? 0.0980 0.1001 0.1195 -0.0042 0.0070  -0.0031 358  SER A N   
2866 C CA  . SER A 358 ? 0.1065 0.1049 0.1187 0.0022  0.0033  -0.0083 358  SER A CA  
2867 C C   . SER A 358 ? 0.1236 0.1025 0.1168 -0.0007 -0.0048 -0.0053 358  SER A C   
2868 O O   . SER A 358 ? 0.1186 0.1059 0.1275 0.0026  -0.0023 -0.0074 358  SER A O   
2869 C CB  . SER A 358 ? 0.1198 0.1087 0.1099 -0.0093 -0.0015 -0.0123 358  SER A CB  
2870 O OG  . SER A 358 ? 0.1302 0.0808 0.1389 0.0010  -0.0024 -0.0040 358  SER A OG  
2871 N N   . ASN A 359 ? 0.1293 0.1075 0.1114 0.0092  0.0014  -0.0061 359  ASN A N   
2872 C CA  . ASN A 359 ? 0.1243 0.1102 0.1161 0.0054  -0.0047 -0.0059 359  ASN A CA  
2873 C C   . ASN A 359 ? 0.1198 0.1222 0.1242 0.0115  -0.0001 -0.0042 359  ASN A C   
2874 O O   . ASN A 359 ? 0.1209 0.1210 0.1242 0.0048  0.0012  -0.0109 359  ASN A O   
2875 C CB  . ASN A 359 ? 0.1409 0.1407 0.1345 0.0100  0.0079  -0.0038 359  ASN A CB  
2876 C CG  . ASN A 359 ? 0.1317 0.1242 0.1168 0.0064  -0.0050 -0.0076 359  ASN A CG  
2877 O OD1 . ASN A 359 ? 0.1541 0.1539 0.1491 -0.0151 -0.0030 -0.0099 359  ASN A OD1 
2878 N ND2 . ASN A 359 ? 0.1278 0.0703 0.1171 0.0225  0.0202  -0.0144 359  ASN A ND2 
2879 N N   . GLY A 360 ? 0.0999 0.1221 0.1178 0.0102  -0.0043 -0.0076 360  GLY A N   
2880 C CA  . GLY A 360 ? 0.1067 0.0973 0.1143 0.0029  -0.0148 -0.0077 360  GLY A CA  
2881 C C   . GLY A 360 ? 0.1125 0.1183 0.1134 0.0030  -0.0057 0.0063  360  GLY A C   
2882 O O   . GLY A 360 ? 0.1103 0.1284 0.1083 -0.0033 -0.0151 -0.0138 360  GLY A O   
2883 N N   . LYS A 361 ? 0.0965 0.1013 0.1269 -0.0039 -0.0172 -0.0030 361  LYS A N   
2884 C CA  . LYS A 361 ? 0.1228 0.1234 0.1301 -0.0029 -0.0097 -0.0054 361  LYS A CA  
2885 C C   . LYS A 361 ? 0.1356 0.1265 0.1368 -0.0078 -0.0098 -0.0090 361  LYS A C   
2886 O O   . LYS A 361 ? 0.1348 0.1301 0.1393 -0.0169 -0.0016 -0.0198 361  LYS A O   
2887 C CB  . LYS A 361 ? 0.1315 0.1210 0.1552 -0.0055 0.0051  -0.0099 361  LYS A CB  
2888 C CG  . LYS A 361 ? 0.1227 0.1200 0.1173 -0.0068 0.0129  -0.0097 361  LYS A CG  
2889 C CD  . LYS A 361 ? 0.1204 0.1067 0.1154 -0.0091 -0.0011 0.0033  361  LYS A CD  
2890 C CE  . LYS A 361 ? 0.1384 0.0917 0.1466 0.0012  -0.0129 -0.0099 361  LYS A CE  
2891 N NZ  . LYS A 361 ? 0.1287 0.1277 0.1333 0.0118  -0.0078 -0.0201 361  LYS A NZ  
2892 N N   . TYR A 362 ? 0.1217 0.1140 0.1307 -0.0038 -0.0058 -0.0168 362  TYR A N   
2893 C CA  . TYR A 362 ? 0.1191 0.1335 0.1398 -0.0043 -0.0093 -0.0134 362  TYR A CA  
2894 C C   . TYR A 362 ? 0.1278 0.1490 0.1420 -0.0014 -0.0096 -0.0021 362  TYR A C   
2895 O O   . TYR A 362 ? 0.1411 0.1566 0.1578 -0.0120 -0.0203 -0.0057 362  TYR A O   
2896 C CB  . TYR A 362 ? 0.1468 0.1344 0.1365 0.0034  -0.0043 -0.0104 362  TYR A CB  
2897 C CG  . TYR A 362 ? 0.1417 0.1595 0.1370 -0.0057 -0.0042 -0.0010 362  TYR A CG  
2898 C CD1 . TYR A 362 ? 0.1370 0.1467 0.1430 0.0054  -0.0081 -0.0054 362  TYR A CD1 
2899 C CD2 . TYR A 362 ? 0.1373 0.1425 0.1581 0.0112  -0.0082 -0.0086 362  TYR A CD2 
2900 C CE1 . TYR A 362 ? 0.1408 0.1514 0.1558 -0.0051 -0.0125 -0.0018 362  TYR A CE1 
2901 C CE2 . TYR A 362 ? 0.1464 0.1734 0.1496 0.0027  -0.0095 0.0045  362  TYR A CE2 
2902 C CZ  . TYR A 362 ? 0.1413 0.1711 0.1332 -0.0045 -0.0055 -0.0177 362  TYR A CZ  
2903 O OH  . TYR A 362 ? 0.1318 0.1808 0.1366 -0.0193 -0.0044 -0.0188 362  TYR A OH  
2904 N N   . ILE A 363 ? 0.1041 0.1474 0.1420 0.0081  -0.0094 -0.0045 363  ILE A N   
2905 C CA  . ILE A 363 ? 0.1290 0.1717 0.1495 -0.0033 -0.0131 0.0001  363  ILE A CA  
2906 C C   . ILE A 363 ? 0.1376 0.1615 0.1654 -0.0020 -0.0109 0.0004  363  ILE A C   
2907 O O   . ILE A 363 ? 0.1445 0.1665 0.1653 -0.0047 -0.0056 -0.0083 363  ILE A O   
2908 C CB  . ILE A 363 ? 0.1393 0.1677 0.1664 0.0060  -0.0158 0.0085  363  ILE A CB  
2909 C CG1 . ILE A 363 ? 0.1536 0.1624 0.1538 -0.0057 -0.0009 -0.0005 363  ILE A CG1 
2910 C CG2 . ILE A 363 ? 0.1202 0.1720 0.1751 0.0073  -0.0260 -0.0132 363  ILE A CG2 
2911 C CD1 . ILE A 363 ? 0.1730 0.1700 0.1907 -0.0046 -0.0148 -0.0104 363  ILE A CD1 
2912 N N   . THR A 364 ? 0.1257 0.1748 0.1611 -0.0002 -0.0095 -0.0033 364  THR A N   
2913 C CA  . THR A 364 ? 0.1661 0.1739 0.1692 0.0047  -0.0079 -0.0072 364  THR A CA  
2914 C C   . THR A 364 ? 0.1739 0.1905 0.1787 0.0086  -0.0081 -0.0013 364  THR A C   
2915 O O   . THR A 364 ? 0.1871 0.1866 0.1758 0.0153  -0.0134 -0.0072 364  THR A O   
2916 C CB  . THR A 364 ? 0.1725 0.1877 0.1691 0.0010  -0.0133 -0.0123 364  THR A CB  
2917 O OG1 . THR A 364 ? 0.1729 0.2103 0.2226 -0.0021 -0.0283 -0.0306 364  THR A OG1 
2918 C CG2 . THR A 364 ? 0.1785 0.1803 0.2176 0.0009  0.0008  -0.0025 364  THR A CG2 
2919 N N   . LYS A 365 ? 0.2048 0.1911 0.1871 0.0137  -0.0072 -0.0054 365  LYS A N   
2920 C CA  . LYS A 365 ? 0.2210 0.2161 0.2083 0.0121  -0.0117 -0.0023 365  LYS A CA  
2921 C C   . LYS A 365 ? 0.2329 0.2343 0.2178 0.0089  -0.0109 -0.0007 365  LYS A C   
2922 O O   . LYS A 365 ? 0.2476 0.2549 0.2282 0.0118  -0.0246 0.0013  365  LYS A O   
2923 C CB  . LYS A 365 ? 0.2326 0.2188 0.2255 0.0181  0.0004  -0.0061 365  LYS A CB  
2924 C CG  . LYS A 365 ? 0.2559 0.2513 0.2581 0.0084  -0.0235 0.0037  365  LYS A CG  
2925 C CD  . LYS A 365 ? 0.3283 0.3187 0.3153 0.0110  -0.0036 -0.0220 365  LYS A CD  
2926 C CE  . LYS A 365 ? 0.3822 0.3965 0.3854 -0.0009 0.0132  0.0023  365  LYS A CE  
2927 N NZ  . LYS A 365 ? 0.4381 0.4066 0.4072 0.0114  -0.0039 0.0009  365  LYS A NZ  
2928 N N   . SER A 366 ? 0.2178 0.2282 0.2100 0.0025  -0.0156 -0.0174 366  SER A N   
2929 C CA  . SER A 366 ? 0.2209 0.2512 0.2224 0.0071  -0.0115 -0.0122 366  SER A CA  
2930 C C   . SER A 366 ? 0.2157 0.2377 0.2136 0.0030  -0.0121 -0.0161 366  SER A C   
2931 O O   . SER A 366 ? 0.2178 0.2384 0.2116 0.0040  -0.0136 -0.0135 366  SER A O   
2932 C CB  . SER A 366 ? 0.2358 0.2586 0.2502 -0.0071 -0.0212 -0.0027 366  SER A CB  
2933 O OG  . SER A 366 ? 0.2973 0.3004 0.2938 0.0013  -0.0066 -0.0015 366  SER A OG  
2934 N N   . GLY A 367 ? 0.2108 0.2301 0.2064 0.0018  -0.0132 -0.0189 367  GLY A N   
2935 C CA  . GLY A 367 ? 0.1992 0.2351 0.2141 0.0006  -0.0118 -0.0152 367  GLY A CA  
2936 C C   . GLY A 367 ? 0.2084 0.2484 0.2412 -0.0012 -0.0081 -0.0170 367  GLY A C   
2937 O O   . GLY A 367 ? 0.2355 0.2544 0.2762 -0.0025 0.0049  -0.0308 367  GLY A O   
2938 N N   . THR A 368 ? 0.2192 0.2397 0.2414 0.0069  -0.0182 -0.0093 368  THR A N   
2939 C CA  . THR A 368 ? 0.2333 0.2501 0.2549 0.0027  -0.0186 -0.0049 368  THR A CA  
2940 C C   . THR A 368 ? 0.2301 0.2220 0.2310 0.0037  -0.0200 -0.0022 368  THR A C   
2941 O O   . THR A 368 ? 0.2636 0.2281 0.2516 0.0093  -0.0251 -0.0151 368  THR A O   
2942 C CB  . THR A 368 ? 0.2513 0.2707 0.2611 0.0063  -0.0141 0.0003  368  THR A CB  
2943 O OG1 . THR A 368 ? 0.2654 0.3086 0.2785 0.0007  -0.0095 -0.0030 368  THR A OG1 
2944 C CG2 . THR A 368 ? 0.2577 0.3060 0.2852 0.0024  -0.0203 -0.0021 368  THR A CG2 
2945 N N   . ARG A 369 ? 0.2047 0.1976 0.2062 -0.0055 -0.0138 -0.0128 369  ARG A N   
2946 C CA  . ARG A 369 ? 0.2044 0.2004 0.2064 -0.0040 -0.0075 -0.0033 369  ARG A CA  
2947 C C   . ARG A 369 ? 0.1814 0.1953 0.1968 -0.0081 -0.0091 -0.0041 369  ARG A C   
2948 O O   . ARG A 369 ? 0.1748 0.2205 0.2116 -0.0178 -0.0171 -0.0013 369  ARG A O   
2949 C CB  . ARG A 369 ? 0.2232 0.2137 0.2188 -0.0014 0.0018  -0.0060 369  ARG A CB  
2950 C CG  . ARG A 369 ? 0.2649 0.2507 0.2449 -0.0118 0.0075  0.0003  369  ARG A CG  
2951 C CD  . ARG A 369 ? 0.3117 0.2946 0.3009 0.0071  0.0021  -0.0132 369  ARG A CD  
2952 N NE  . ARG A 369 ? 0.3046 0.3054 0.3249 -0.0058 0.0046  -0.0094 369  ARG A NE  
2953 C CZ  . ARG A 369 ? 0.3376 0.3216 0.3430 -0.0008 -0.0014 0.0013  369  ARG A CZ  
2954 N NH1 . ARG A 369 ? 0.3433 0.3356 0.3561 0.0015  0.0142  -0.0086 369  ARG A NH1 
2955 N NH2 . ARG A 369 ? 0.3442 0.3491 0.3528 -0.0117 -0.0047 -0.0145 369  ARG A NH2 
2956 N N   . VAL A 370 ? 0.1665 0.1740 0.1734 0.0010  -0.0102 -0.0065 370  VAL A N   
2957 C CA  . VAL A 370 ? 0.1673 0.1693 0.1707 -0.0045 -0.0092 -0.0038 370  VAL A CA  
2958 C C   . VAL A 370 ? 0.1633 0.1689 0.1688 -0.0035 -0.0151 -0.0069 370  VAL A C   
2959 O O   . VAL A 370 ? 0.1744 0.1785 0.1834 -0.0037 0.0010  -0.0015 370  VAL A O   
2960 C CB  . VAL A 370 ? 0.1456 0.1491 0.1585 0.0086  -0.0099 -0.0008 370  VAL A CB  
2961 C CG1 . VAL A 370 ? 0.1632 0.1427 0.1651 -0.0121 -0.0154 -0.0155 370  VAL A CG1 
2962 C CG2 . VAL A 370 ? 0.1562 0.1630 0.1747 0.0031  -0.0064 0.0050  370  VAL A CG2 
2963 N N   . ASP A 371 ? 0.1633 0.1647 0.1791 -0.0097 -0.0124 -0.0036 371  ASP A N   
2964 C CA  . ASP A 371 ? 0.1651 0.1643 0.1868 -0.0146 -0.0089 -0.0010 371  ASP A CA  
2965 C C   . ASP A 371 ? 0.1698 0.1634 0.1807 -0.0148 -0.0003 -0.0013 371  ASP A C   
2966 O O   . ASP A 371 ? 0.1911 0.1962 0.2117 -0.0243 -0.0045 0.0096  371  ASP A O   
2967 C CB  . ASP A 371 ? 0.1686 0.1743 0.2002 -0.0170 -0.0076 -0.0076 371  ASP A CB  
2968 C CG  . ASP A 371 ? 0.1763 0.1948 0.2328 -0.0149 0.0009  -0.0139 371  ASP A CG  
2969 O OD1 . ASP A 371 ? 0.1776 0.2210 0.2754 -0.0271 -0.0073 -0.0315 371  ASP A OD1 
2970 O OD2 . ASP A 371 ? 0.1513 0.1991 0.2128 -0.0315 -0.0070 -0.0100 371  ASP A OD2 
2971 N N   . HIS A 372 ? 0.1391 0.1617 0.1594 -0.0056 -0.0025 -0.0111 372  HIS A N   
2972 C CA  . HIS A 372 ? 0.1410 0.1572 0.1501 -0.0100 0.0067  -0.0087 372  HIS A CA  
2973 C C   . HIS A 372 ? 0.1439 0.1522 0.1544 -0.0065 0.0030  -0.0032 372  HIS A C   
2974 O O   . HIS A 372 ? 0.1445 0.1576 0.1602 -0.0147 0.0054  -0.0049 372  HIS A O   
2975 C CB  . HIS A 372 ? 0.1442 0.1547 0.1693 0.0004  0.0069  -0.0015 372  HIS A CB  
2976 C CG  . HIS A 372 ? 0.1393 0.1480 0.1550 -0.0065 -0.0010 0.0008  372  HIS A CG  
2977 N ND1 . HIS A 372 ? 0.1267 0.1427 0.1436 -0.0008 -0.0006 0.0066  372  HIS A ND1 
2978 C CD2 . HIS A 372 ? 0.1336 0.1404 0.1567 -0.0001 -0.0066 0.0037  372  HIS A CD2 
2979 C CE1 . HIS A 372 ? 0.1413 0.1445 0.1394 -0.0027 0.0000  -0.0161 372  HIS A CE1 
2980 N NE2 . HIS A 372 ? 0.1269 0.1571 0.1510 -0.0124 0.0037  -0.0022 372  HIS A NE2 
2981 N N   . GLN A 373 ? 0.1292 0.1465 0.1672 -0.0091 -0.0035 -0.0119 373  GLN A N   
2982 C CA  . GLN A 373 ? 0.1305 0.1251 0.1581 -0.0034 0.0035  -0.0070 373  GLN A CA  
2983 C C   . GLN A 373 ? 0.1316 0.1313 0.1445 -0.0010 -0.0006 -0.0075 373  GLN A C   
2984 O O   . GLN A 373 ? 0.1196 0.1105 0.1475 -0.0006 0.0053  -0.0185 373  GLN A O   
2985 C CB  . GLN A 373 ? 0.1376 0.1331 0.1599 0.0041  0.0075  -0.0083 373  GLN A CB  
2986 C CG  . GLN A 373 ? 0.1625 0.1416 0.1820 0.0053  0.0131  -0.0066 373  GLN A CG  
2987 C CD  . GLN A 373 ? 0.1575 0.1670 0.1730 -0.0007 0.0039  -0.0069 373  GLN A CD  
2988 O OE1 . GLN A 373 ? 0.1538 0.1392 0.1445 0.0160  0.0028  -0.0039 373  GLN A OE1 
2989 N NE2 . GLN A 373 ? 0.2469 0.1946 0.2529 0.0134  0.0083  -0.0260 373  GLN A NE2 
2990 N N   . THR A 374 ? 0.1203 0.1059 0.1387 -0.0006 0.0005  -0.0085 374  THR A N   
2991 C CA  . THR A 374 ? 0.1319 0.1152 0.1363 0.0002  -0.0009 0.0005  374  THR A CA  
2992 C C   . THR A 374 ? 0.1286 0.1172 0.1395 0.0101  -0.0002 -0.0037 374  THR A C   
2993 O O   . THR A 374 ? 0.1194 0.1326 0.1268 0.0041  0.0124  -0.0068 374  THR A O   
2994 C CB  . THR A 374 ? 0.1178 0.1464 0.1286 0.0061  0.0031  -0.0012 374  THR A CB  
2995 O OG1 . THR A 374 ? 0.1151 0.1236 0.1422 -0.0006 0.0074  -0.0108 374  THR A OG1 
2996 C CG2 . THR A 374 ? 0.1483 0.1562 0.1618 -0.0057 -0.0139 -0.0189 374  THR A CG2 
2997 N N   . GLY A 375 ? 0.1085 0.1324 0.1217 0.0013  -0.0029 -0.0061 375  GLY A N   
2998 C CA  . GLY A 375 ? 0.1118 0.1243 0.1325 0.0058  -0.0044 0.0002  375  GLY A CA  
2999 C C   . GLY A 375 ? 0.1231 0.1218 0.1251 0.0087  0.0019  -0.0011 375  GLY A C   
3000 O O   . GLY A 375 ? 0.1394 0.1159 0.1339 0.0196  0.0053  0.0013  375  GLY A O   
3001 N N   . PRO A 376 ? 0.1083 0.1134 0.1197 0.0122  0.0014  -0.0072 376  PRO A N   
3002 C CA  . PRO A 376 ? 0.1217 0.1359 0.1233 0.0132  0.0006  -0.0012 376  PRO A CA  
3003 C C   . PRO A 376 ? 0.1272 0.1294 0.1243 0.0078  0.0016  -0.0016 376  PRO A C   
3004 O O   . PRO A 376 ? 0.1251 0.1372 0.1414 0.0018  0.0077  -0.0040 376  PRO A O   
3005 C CB  . PRO A 376 ? 0.1367 0.1195 0.1274 0.0064  -0.0029 -0.0133 376  PRO A CB  
3006 C CG  . PRO A 376 ? 0.1217 0.1164 0.1473 0.0181  -0.0176 -0.0043 376  PRO A CG  
3007 C CD  . PRO A 376 ? 0.1238 0.1244 0.1121 0.0175  -0.0086 -0.0116 376  PRO A CD  
3008 N N   . ILE A 377 ? 0.0959 0.1348 0.1318 0.0118  0.0083  -0.0042 377  ILE A N   
3009 C CA  . ILE A 377 ? 0.1139 0.1165 0.1275 -0.0003 0.0050  -0.0035 377  ILE A CA  
3010 C C   . ILE A 377 ? 0.1177 0.1159 0.1190 0.0104  0.0059  -0.0009 377  ILE A C   
3011 O O   . ILE A 377 ? 0.1408 0.1172 0.1036 0.0113  0.0095  -0.0043 377  ILE A O   
3012 C CB  . ILE A 377 ? 0.0930 0.1188 0.1258 0.0072  -0.0012 -0.0066 377  ILE A CB  
3013 C CG1 . ILE A 377 ? 0.1374 0.1139 0.1302 0.0126  -0.0159 -0.0087 377  ILE A CG1 
3014 C CG2 . ILE A 377 ? 0.1028 0.1456 0.1212 0.0017  0.0075  -0.0184 377  ILE A CG2 
3015 C CD1 . ILE A 377 ? 0.1345 0.1153 0.1521 0.0088  0.0057  -0.0143 377  ILE A CD1 
3016 N N   . VAL A 378 ? 0.1090 0.1107 0.1113 -0.0028 0.0086  -0.0072 378  VAL A N   
3017 C CA  . VAL A 378 ? 0.1119 0.1202 0.1177 0.0055  0.0023  -0.0005 378  VAL A CA  
3018 C C   . VAL A 378 ? 0.1239 0.1294 0.1202 -0.0064 -0.0011 0.0004  378  VAL A C   
3019 O O   . VAL A 378 ? 0.1233 0.1565 0.1205 -0.0055 -0.0021 -0.0124 378  VAL A O   
3020 C CB  . VAL A 378 ? 0.1309 0.1262 0.1420 0.0020  -0.0052 -0.0032 378  VAL A CB  
3021 C CG1 . VAL A 378 ? 0.1659 0.1252 0.1531 0.0080  0.0032  -0.0161 378  VAL A CG1 
3022 C CG2 . VAL A 378 ? 0.1328 0.1471 0.1543 0.0203  0.0002  -0.0065 378  VAL A CG2 
3023 N N   . TRP A 379 ? 0.1019 0.1240 0.1261 0.0014  -0.0164 -0.0053 379  TRP A N   
3024 C CA  . TRP A 379 ? 0.1116 0.1283 0.1250 0.0045  -0.0017 -0.0128 379  TRP A CA  
3025 C C   . TRP A 379 ? 0.1154 0.1366 0.1215 0.0047  -0.0023 -0.0018 379  TRP A C   
3026 O O   . TRP A 379 ? 0.1102 0.1309 0.1236 0.0015  0.0073  -0.0160 379  TRP A O   
3027 C CB  . TRP A 379 ? 0.1325 0.1174 0.1368 0.0029  0.0000  -0.0049 379  TRP A CB  
3028 C CG  . TRP A 379 ? 0.1371 0.1306 0.1351 0.0002  -0.0009 -0.0011 379  TRP A CG  
3029 C CD1 . TRP A 379 ? 0.1235 0.1153 0.1272 -0.0004 0.0137  -0.0081 379  TRP A CD1 
3030 C CD2 . TRP A 379 ? 0.1225 0.1369 0.1304 0.0041  -0.0040 -0.0050 379  TRP A CD2 
3031 N NE1 . TRP A 379 ? 0.1246 0.1451 0.1165 0.0095  -0.0011 0.0047  379  TRP A NE1 
3032 C CE2 . TRP A 379 ? 0.1290 0.1380 0.1200 0.0000  -0.0024 -0.0068 379  TRP A CE2 
3033 C CE3 . TRP A 379 ? 0.1421 0.1259 0.1304 0.0131  -0.0132 -0.0130 379  TRP A CE3 
3034 C CZ2 . TRP A 379 ? 0.1302 0.1403 0.1365 0.0070  -0.0118 -0.0118 379  TRP A CZ2 
3035 C CZ3 . TRP A 379 ? 0.1414 0.1222 0.1206 0.0033  0.0000  -0.0073 379  TRP A CZ3 
3036 C CH2 . TRP A 379 ? 0.1138 0.1186 0.1288 0.0004  0.0094  -0.0071 379  TRP A CH2 
3037 N N   . GLY A 380 ? 0.1104 0.1467 0.1037 -0.0133 -0.0091 -0.0099 380  GLY A N   
3038 C CA  . GLY A 380 ? 0.1201 0.1415 0.1186 -0.0154 -0.0122 -0.0118 380  GLY A CA  
3039 C C   . GLY A 380 ? 0.1158 0.1386 0.1145 -0.0074 -0.0005 -0.0024 380  GLY A C   
3040 O O   . GLY A 380 ? 0.1153 0.1309 0.1285 -0.0064 -0.0062 -0.0006 380  GLY A O   
3041 N N   . GLU A 381 ? 0.1106 0.1303 0.1115 -0.0184 -0.0056 -0.0102 381  GLU A N   
3042 C CA  . GLU A 381 ? 0.1134 0.1296 0.1077 -0.0074 0.0003  -0.0121 381  GLU A CA  
3043 C C   . GLU A 381 ? 0.1366 0.1251 0.1103 -0.0134 0.0000  -0.0072 381  GLU A C   
3044 O O   . GLU A 381 ? 0.1336 0.1342 0.1151 -0.0215 0.0021  -0.0245 381  GLU A O   
3045 C CB  . GLU A 381 ? 0.1288 0.1215 0.1100 0.0020  0.0033  0.0009  381  GLU A CB  
3046 C CG  . GLU A 381 ? 0.1563 0.1388 0.1190 -0.0021 0.0062  -0.0142 381  GLU A CG  
3047 C CD  . GLU A 381 ? 0.1493 0.1486 0.1285 -0.0030 0.0067  -0.0129 381  GLU A CD  
3048 O OE1 . GLU A 381 ? 0.2054 0.1631 0.1289 -0.0178 0.0179  -0.0185 381  GLU A OE1 
3049 O OE2 . GLU A 381 ? 0.1654 0.1648 0.1578 -0.0146 0.0282  -0.0060 381  GLU A OE2 
3050 N N   . PRO A 382 ? 0.1514 0.1376 0.1084 -0.0151 -0.0028 -0.0072 382  PRO A N   
3051 C CA  . PRO A 382 ? 0.1552 0.1292 0.1114 -0.0052 0.0029  -0.0074 382  PRO A CA  
3052 C C   . PRO A 382 ? 0.1484 0.1443 0.1293 0.0057  0.0006  -0.0054 382  PRO A C   
3053 O O   . PRO A 382 ? 0.1599 0.1444 0.1397 0.0123  -0.0080 -0.0127 382  PRO A O   
3054 C CB  . PRO A 382 ? 0.1649 0.1491 0.1369 -0.0130 0.0031  -0.0086 382  PRO A CB  
3055 C CG  . PRO A 382 ? 0.1666 0.1419 0.1348 -0.0120 0.0050  -0.0164 382  PRO A CG  
3056 C CD  . PRO A 382 ? 0.1470 0.1478 0.1174 -0.0253 -0.0007 -0.0077 382  PRO A CD  
3057 N N   . GLY A 383 ? 0.1425 0.1147 0.1131 0.0017  0.0016  -0.0128 383  GLY A N   
3058 C CA  . GLY A 383 ? 0.1253 0.1282 0.1161 -0.0012 0.0055  0.0053  383  GLY A CA  
3059 C C   . GLY A 383 ? 0.1214 0.1315 0.1084 0.0045  0.0004  0.0011  383  GLY A C   
3060 O O   . GLY A 383 ? 0.1042 0.1503 0.1319 0.0037  0.0032  -0.0078 383  GLY A O   
3061 N N   . THR A 384 ? 0.1136 0.1416 0.1303 0.0010  0.0032  0.0000  384  THR A N   
3062 C CA  . THR A 384 ? 0.1525 0.1487 0.1505 0.0097  -0.0051 0.0005  384  THR A CA  
3063 C C   . THR A 384 ? 0.1481 0.1573 0.1690 0.0083  -0.0056 -0.0044 384  THR A C   
3064 O O   . THR A 384 ? 0.1579 0.1562 0.1896 0.0110  -0.0205 -0.0151 384  THR A O   
3065 C CB  . THR A 384 ? 0.1443 0.1457 0.1502 0.0016  -0.0104 -0.0037 384  THR A CB  
3066 O OG1 . THR A 384 ? 0.1605 0.1583 0.1740 0.0015  -0.0076 -0.0273 384  THR A OG1 
3067 C CG2 . THR A 384 ? 0.1443 0.1474 0.1592 -0.0042 0.0034  -0.0009 384  THR A CG2 
3068 N N   . ASN A 385 ? 0.1464 0.1605 0.1719 0.0118  0.0011  -0.0099 385  ASN A N   
3069 C CA  . ASN A 385 ? 0.1705 0.1853 0.1980 0.0026  0.0044  -0.0163 385  ASN A CA  
3070 C C   . ASN A 385 ? 0.1696 0.1873 0.2043 0.0024  -0.0039 -0.0177 385  ASN A C   
3071 O O   . ASN A 385 ? 0.1854 0.1811 0.2103 -0.0098 -0.0015 -0.0248 385  ASN A O   
3072 C CB  . ASN A 385 ? 0.1717 0.1847 0.2102 0.0045  0.0061  -0.0076 385  ASN A CB  
3073 C CG  . ASN A 385 ? 0.2047 0.2241 0.2420 -0.0104 0.0057  -0.0047 385  ASN A CG  
3074 O OD1 . ASN A 385 ? 0.2467 0.2335 0.2940 -0.0227 -0.0006 -0.0071 385  ASN A OD1 
3075 N ND2 . ASN A 385 ? 0.2012 0.2697 0.2482 -0.0011 -0.0007 0.0228  385  ASN A ND2 
3076 N N   . GLY A 386 ? 0.1590 0.2021 0.2167 -0.0024 0.0063  -0.0248 386  GLY A N   
3077 C CA  . GLY A 386 ? 0.1580 0.1905 0.2050 -0.0012 0.0024  -0.0267 386  GLY A CA  
3078 C C   . GLY A 386 ? 0.1548 0.2038 0.2032 -0.0057 0.0079  -0.0199 386  GLY A C   
3079 O O   . GLY A 386 ? 0.1517 0.2093 0.2081 -0.0044 0.0254  -0.0391 386  GLY A O   
3080 N N   . GLN A 387 ? 0.1504 0.1778 0.1781 -0.0035 0.0128  -0.0269 387  GLN A N   
3081 C CA  . GLN A 387 ? 0.1764 0.1968 0.1779 -0.0019 0.0095  -0.0185 387  GLN A CA  
3082 C C   . GLN A 387 ? 0.1908 0.1939 0.1857 -0.0027 0.0081  -0.0117 387  GLN A C   
3083 O O   . GLN A 387 ? 0.1961 0.2103 0.2087 -0.0072 0.0154  -0.0092 387  GLN A O   
3084 C CB  . GLN A 387 ? 0.1655 0.1926 0.1747 -0.0060 -0.0019 -0.0077 387  GLN A CB  
3085 C CG  . GLN A 387 ? 0.1693 0.1715 0.1801 -0.0037 0.0004  -0.0252 387  GLN A CG  
3086 C CD  . GLN A 387 ? 0.1434 0.1446 0.1318 0.0032  0.0003  0.0061  387  GLN A CD  
3087 O OE1 . GLN A 387 ? 0.1677 0.1937 0.1940 -0.0100 -0.0217 0.0024  387  GLN A OE1 
3088 N NE2 . GLN A 387 ? 0.1011 0.1360 0.0732 -0.0035 -0.0084 0.0025  387  GLN A NE2 
3089 N N   . HIS A 388 ? 0.1771 0.1949 0.1847 -0.0039 0.0058  -0.0117 388  HIS A N   
3090 C CA  . HIS A 388 ? 0.1946 0.2173 0.2078 -0.0078 -0.0016 -0.0113 388  HIS A CA  
3091 C C   . HIS A 388 ? 0.1845 0.2096 0.1985 -0.0022 0.0002  -0.0062 388  HIS A C   
3092 O O   . HIS A 388 ? 0.1919 0.2241 0.2245 -0.0049 0.0050  -0.0085 388  HIS A O   
3093 C CB  . HIS A 388 ? 0.1890 0.2183 0.1989 -0.0136 0.0016  0.0001  388  HIS A CB  
3094 C CG  . HIS A 388 ? 0.2172 0.2090 0.2084 -0.0089 -0.0081 -0.0071 388  HIS A CG  
3095 N ND1 . HIS A 388 ? 0.2209 0.2230 0.2203 -0.0043 -0.0095 0.0047  388  HIS A ND1 
3096 C CD2 . HIS A 388 ? 0.1536 0.2350 0.2029 0.0075  0.0044  0.0032  388  HIS A CD2 
3097 C CE1 . HIS A 388 ? 0.2099 0.2320 0.2109 0.0000  -0.0127 -0.0085 388  HIS A CE1 
3098 N NE2 . HIS A 388 ? 0.2073 0.2313 0.2139 -0.0049 -0.0051 0.0031  388  HIS A NE2 
3099 N N   . ALA A 389 ? 0.1790 0.1894 0.1693 -0.0081 -0.0043 -0.0067 389  ALA A N   
3100 C CA  . ALA A 389 ? 0.1582 0.1553 0.1439 0.0064  0.0101  -0.0057 389  ALA A CA  
3101 C C   . ALA A 389 ? 0.1579 0.1510 0.1440 0.0039  0.0103  0.0015  389  ALA A C   
3102 O O   . ALA A 389 ? 0.1584 0.1803 0.1672 0.0054  0.0266  -0.0049 389  ALA A O   
3103 C CB  . ALA A 389 ? 0.1692 0.1549 0.1380 -0.0008 0.0113  -0.0050 389  ALA A CB  
3104 N N   . PHE A 390 ? 0.1393 0.1480 0.1353 -0.0026 0.0105  0.0028  390  PHE A N   
3105 C CA  . PHE A 390 ? 0.1546 0.1323 0.1256 -0.0028 0.0046  -0.0047 390  PHE A CA  
3106 C C   . PHE A 390 ? 0.1380 0.1264 0.1380 -0.0021 0.0050  -0.0064 390  PHE A C   
3107 O O   . PHE A 390 ? 0.1497 0.1128 0.1435 0.0007  -0.0067 0.0065  390  PHE A O   
3108 C CB  . PHE A 390 ? 0.1526 0.1222 0.1442 0.0114  -0.0068 -0.0015 390  PHE A CB  
3109 C CG  . PHE A 390 ? 0.1246 0.1159 0.1329 -0.0067 -0.0060 -0.0033 390  PHE A CG  
3110 C CD1 . PHE A 390 ? 0.1333 0.1198 0.1214 0.0173  -0.0111 0.0017  390  PHE A CD1 
3111 C CD2 . PHE A 390 ? 0.1582 0.1320 0.1485 0.0126  0.0117  0.0060  390  PHE A CD2 
3112 C CE1 . PHE A 390 ? 0.1468 0.1245 0.1236 -0.0006 -0.0167 -0.0057 390  PHE A CE1 
3113 C CE2 . PHE A 390 ? 0.1579 0.1253 0.1711 0.0019  0.0037  -0.0029 390  PHE A CE2 
3114 C CZ  . PHE A 390 ? 0.1533 0.1627 0.1240 -0.0061 -0.0030 0.0010  390  PHE A CZ  
3115 N N   . TYR A 391 ? 0.1360 0.1092 0.1180 -0.0021 0.0002  0.0036  391  TYR A N   
3116 C CA  . TYR A 391 ? 0.1280 0.1083 0.1076 0.0001  0.0126  -0.0056 391  TYR A CA  
3117 C C   . TYR A 391 ? 0.1251 0.1191 0.1189 0.0004  0.0042  0.0011  391  TYR A C   
3118 O O   . TYR A 391 ? 0.1328 0.1235 0.1045 -0.0178 0.0085  0.0117  391  TYR A O   
3119 C CB  . TYR A 391 ? 0.1419 0.1091 0.1290 -0.0024 0.0034  -0.0123 391  TYR A CB  
3120 C CG  . TYR A 391 ? 0.1365 0.1257 0.1191 0.0038  0.0044  0.0032  391  TYR A CG  
3121 C CD1 . TYR A 391 ? 0.1386 0.1094 0.1312 0.0043  -0.0116 0.0054  391  TYR A CD1 
3122 C CD2 . TYR A 391 ? 0.1203 0.0953 0.1388 0.0073  0.0005  -0.0070 391  TYR A CD2 
3123 C CE1 . TYR A 391 ? 0.1295 0.1049 0.1333 -0.0010 -0.0044 -0.0089 391  TYR A CE1 
3124 C CE2 . TYR A 391 ? 0.1586 0.1010 0.1362 0.0022  -0.0084 0.0135  391  TYR A CE2 
3125 C CZ  . TYR A 391 ? 0.1301 0.1145 0.1123 0.0045  0.0023  0.0054  391  TYR A CZ  
3126 O OH  . TYR A 391 ? 0.1586 0.1220 0.1323 0.0088  -0.0071 0.0034  391  TYR A OH  
3127 N N   . GLN A 392 ? 0.1197 0.1098 0.1163 0.0020  0.0056  -0.0036 392  GLN A N   
3128 C CA  . GLN A 392 ? 0.1182 0.1070 0.1153 0.0057  0.0034  0.0008  392  GLN A CA  
3129 C C   . GLN A 392 ? 0.1263 0.1228 0.1179 0.0040  0.0012  0.0038  392  GLN A C   
3130 O O   . GLN A 392 ? 0.1159 0.1045 0.1246 0.0110  0.0031  0.0003  392  GLN A O   
3131 C CB  . GLN A 392 ? 0.1286 0.1174 0.1269 0.0090  0.0101  -0.0067 392  GLN A CB  
3132 C CG  . GLN A 392 ? 0.1388 0.1052 0.1333 -0.0076 0.0067  0.0065  392  GLN A CG  
3133 C CD  . GLN A 392 ? 0.1520 0.1487 0.1404 -0.0071 -0.0014 0.0077  392  GLN A CD  
3134 O OE1 . GLN A 392 ? 0.1454 0.1434 0.1262 -0.0046 0.0127  0.0249  392  GLN A OE1 
3135 N NE2 . GLN A 392 ? 0.1303 0.0942 0.1113 0.0113  0.0025  0.0076  392  GLN A NE2 
3136 N N   . LEU A 393 ? 0.1266 0.1219 0.1127 0.0099  -0.0102 0.0023  393  LEU A N   
3137 C CA  . LEU A 393 ? 0.1115 0.1119 0.1035 0.0031  -0.0021 0.0024  393  LEU A CA  
3138 C C   . LEU A 393 ? 0.1299 0.1132 0.1287 0.0011  0.0052  0.0015  393  LEU A C   
3139 O O   . LEU A 393 ? 0.1280 0.1377 0.1440 0.0074  0.0021  -0.0020 393  LEU A O   
3140 C CB  . LEU A 393 ? 0.1268 0.1143 0.1059 -0.0014 -0.0026 -0.0001 393  LEU A CB  
3141 C CG  . LEU A 393 ? 0.1170 0.1144 0.0913 0.0099  0.0003  -0.0105 393  LEU A CG  
3142 C CD1 . LEU A 393 ? 0.1096 0.0870 0.0878 0.0018  0.0293  -0.0028 393  LEU A CD1 
3143 C CD2 . LEU A 393 ? 0.1297 0.1560 0.1356 0.0293  -0.0034 0.0041  393  LEU A CD2 
3144 N N   . ILE A 394 ? 0.1144 0.1086 0.1194 0.0081  0.0051  -0.0048 394  ILE A N   
3145 C CA  . ILE A 394 ? 0.1221 0.1045 0.1267 0.0054  0.0094  -0.0009 394  ILE A CA  
3146 C C   . ILE A 394 ? 0.1275 0.1137 0.1217 0.0032  0.0015  0.0000  394  ILE A C   
3147 O O   . ILE A 394 ? 0.1141 0.1155 0.1207 0.0072  0.0024  -0.0015 394  ILE A O   
3148 C CB  . ILE A 394 ? 0.1200 0.0993 0.1216 0.0165  0.0116  -0.0034 394  ILE A CB  
3149 C CG1 . ILE A 394 ? 0.1508 0.1063 0.1423 0.0001  0.0188  0.0061  394  ILE A CG1 
3150 C CG2 . ILE A 394 ? 0.1117 0.1616 0.1442 0.0042  0.0060  -0.0082 394  ILE A CG2 
3151 C CD1 . ILE A 394 ? 0.1435 0.1270 0.1788 -0.0053 -0.0034 0.0024  394  ILE A CD1 
3152 N N   . HIS A 395 ? 0.1334 0.1196 0.1152 0.0039  0.0037  0.0066  395  HIS A N   
3153 C CA  . HIS A 395 ? 0.1218 0.1123 0.1107 -0.0032 -0.0023 0.0038  395  HIS A CA  
3154 C C   . HIS A 395 ? 0.1247 0.1163 0.1327 0.0034  0.0013  0.0016  395  HIS A C   
3155 O O   . HIS A 395 ? 0.1433 0.1119 0.1248 0.0013  0.0038  -0.0011 395  HIS A O   
3156 C CB  . HIS A 395 ? 0.1312 0.1194 0.1162 0.0032  -0.0025 -0.0027 395  HIS A CB  
3157 C CG  . HIS A 395 ? 0.1514 0.1264 0.1278 -0.0007 -0.0010 0.0056  395  HIS A CG  
3158 N ND1 . HIS A 395 ? 0.1343 0.1339 0.1416 0.0201  -0.0020 0.0052  395  HIS A ND1 
3159 C CD2 . HIS A 395 ? 0.1759 0.1459 0.1365 -0.0011 -0.0040 0.0034  395  HIS A CD2 
3160 C CE1 . HIS A 395 ? 0.1583 0.1504 0.1440 -0.0014 -0.0038 0.0054  395  HIS A CE1 
3161 N NE2 . HIS A 395 ? 0.1748 0.1438 0.1423 0.0086  -0.0074 0.0053  395  HIS A NE2 
3162 N N   . GLN A 396 ? 0.1296 0.1120 0.1215 0.0027  0.0007  -0.0017 396  GLN A N   
3163 C CA  . GLN A 396 ? 0.1330 0.1248 0.1295 0.0085  -0.0047 0.0064  396  GLN A CA  
3164 C C   . GLN A 396 ? 0.1348 0.1266 0.1353 0.0035  -0.0043 0.0011  396  GLN A C   
3165 O O   . GLN A 396 ? 0.1460 0.1268 0.1342 0.0038  -0.0069 0.0147  396  GLN A O   
3166 C CB  . GLN A 396 ? 0.1296 0.1176 0.1336 0.0067  -0.0034 0.0078  396  GLN A CB  
3167 C CG  . GLN A 396 ? 0.1382 0.1282 0.1384 0.0050  0.0026  0.0085  396  GLN A CG  
3168 C CD  . GLN A 396 ? 0.1459 0.1521 0.1491 -0.0043 0.0001  0.0185  396  GLN A CD  
3169 O OE1 . GLN A 396 ? 0.1375 0.1559 0.1341 0.0058  -0.0005 0.0277  396  GLN A OE1 
3170 N NE2 . GLN A 396 ? 0.1702 0.1502 0.1205 0.0060  -0.0010 0.0045  396  GLN A NE2 
3171 N N   . GLY A 397 ? 0.1127 0.1250 0.1137 -0.0118 0.0081  0.0099  397  GLY A N   
3172 C CA  . GLY A 397 ? 0.1291 0.1367 0.1356 -0.0075 0.0007  -0.0020 397  GLY A CA  
3173 C C   . GLY A 397 ? 0.1314 0.1376 0.1432 0.0021  0.0048  0.0007  397  GLY A C   
3174 O O   . GLY A 397 ? 0.1467 0.1517 0.1581 -0.0021 0.0011  0.0202  397  GLY A O   
3175 N N   . THR A 398 ? 0.1298 0.1119 0.1437 0.0070  -0.0041 0.0048  398  THR A N   
3176 C CA  . THR A 398 ? 0.1298 0.1178 0.1479 0.0023  0.0006  -0.0019 398  THR A CA  
3177 C C   . THR A 398 ? 0.1483 0.1262 0.1519 0.0037  -0.0028 -0.0028 398  THR A C   
3178 O O   . THR A 398 ? 0.1731 0.1393 0.1898 0.0055  -0.0084 -0.0168 398  THR A O   
3179 C CB  . THR A 398 ? 0.1462 0.1245 0.1346 0.0078  -0.0044 0.0018  398  THR A CB  
3180 O OG1 . THR A 398 ? 0.1369 0.1219 0.1564 0.0024  0.0159  -0.0191 398  THR A OG1 
3181 C CG2 . THR A 398 ? 0.1249 0.1258 0.1504 0.0108  0.0136  0.0040  398  THR A CG2 
3182 N N   . LYS A 399 ? 0.1579 0.1253 0.1590 0.0080  -0.0014 -0.0040 399  LYS A N   
3183 C CA  . LYS A 399 ? 0.1632 0.1366 0.1541 0.0158  0.0072  0.0000  399  LYS A CA  
3184 C C   . LYS A 399 ? 0.1512 0.1349 0.1458 0.0094  0.0014  -0.0033 399  LYS A C   
3185 O O   . LYS A 399 ? 0.1532 0.1385 0.1507 0.0197  -0.0045 0.0085  399  LYS A O   
3186 C CB  . LYS A 399 ? 0.1639 0.1409 0.1537 0.0097  0.0072  -0.0054 399  LYS A CB  
3187 C CG  . LYS A 399 ? 0.1915 0.1664 0.1671 0.0394  0.0054  -0.0008 399  LYS A CG  
3188 C CD  . LYS A 399 ? 0.1839 0.1554 0.1830 0.0262  0.0044  0.0033  399  LYS A CD  
3189 C CE  . LYS A 399 ? 0.1474 0.1367 0.1773 0.0053  0.0086  -0.0102 399  LYS A CE  
3190 N NZ  . LYS A 399 ? 0.1681 0.1226 0.1703 0.0067  -0.0018 -0.0017 399  LYS A NZ  
3191 N N   . MET A 400 ? 0.1301 0.1186 0.1434 0.0088  0.0082  -0.0104 400  MET A N   
3192 C CA  . MET A 400 ? 0.1154 0.1047 0.1303 0.0025  0.0084  0.0042  400  MET A CA  
3193 C C   . MET A 400 ? 0.1260 0.1139 0.1386 0.0056  0.0016  0.0015  400  MET A C   
3194 O O   . MET A 400 ? 0.1371 0.1199 0.1430 -0.0021 0.0081  0.0005  400  MET A O   
3195 C CB  . MET A 400 ? 0.1268 0.1293 0.1540 -0.0029 0.0176  -0.0027 400  MET A CB  
3196 C CG  . MET A 400 ? 0.1151 0.1266 0.1368 0.0105  0.0050  0.0040  400  MET A CG  
3197 S SD  . MET A 400 ? 0.1376 0.1671 0.1894 0.0073  0.0117  -0.0034 400  MET A SD  
3198 C CE  . MET A 400 ? 0.1669 0.1771 0.1704 -0.0023 0.0160  -0.0110 400  MET A CE  
3199 N N   . ILE A 401 ? 0.1279 0.1040 0.1371 0.0043  0.0072  0.0021  401  ILE A N   
3200 C CA  . ILE A 401 ? 0.1178 0.1082 0.1349 0.0100  0.0111  0.0000  401  ILE A CA  
3201 C C   . ILE A 401 ? 0.1256 0.1189 0.1288 0.0042  0.0019  -0.0107 401  ILE A C   
3202 O O   . ILE A 401 ? 0.1334 0.1163 0.1167 0.0109  0.0088  -0.0066 401  ILE A O   
3203 C CB  . ILE A 401 ? 0.1279 0.1085 0.1360 0.0022  0.0128  0.0055  401  ILE A CB  
3204 C CG1 . ILE A 401 ? 0.1099 0.1029 0.1352 -0.0011 -0.0012 -0.0178 401  ILE A CG1 
3205 C CG2 . ILE A 401 ? 0.1557 0.1252 0.1223 -0.0036 0.0315  0.0121  401  ILE A CG2 
3206 C CD1 . ILE A 401 ? 0.1301 0.1424 0.1520 0.0271  -0.0104 -0.0054 401  ILE A CD1 
3207 N N   . PRO A 402 ? 0.1300 0.1169 0.1199 0.0100  0.0000  -0.0104 402  PRO A N   
3208 C CA  . PRO A 402 ? 0.1162 0.1092 0.1311 0.0028  -0.0021 -0.0075 402  PRO A CA  
3209 C C   . PRO A 402 ? 0.1213 0.1239 0.1233 0.0036  0.0010  -0.0021 402  PRO A C   
3210 O O   . PRO A 402 ? 0.1262 0.1339 0.1363 -0.0006 0.0062  -0.0050 402  PRO A O   
3211 C CB  . PRO A 402 ? 0.1219 0.1095 0.1306 0.0003  -0.0091 0.0013  402  PRO A CB  
3212 C CG  . PRO A 402 ? 0.1302 0.1072 0.1530 0.0132  0.0139  -0.0108 402  PRO A CG  
3213 C CD  . PRO A 402 ? 0.1149 0.1321 0.1306 0.0080  -0.0033 -0.0090 402  PRO A CD  
3214 N N   . CYS A 403 ? 0.1002 0.1189 0.1259 0.0015  0.0039  -0.0067 403  CYS A N   
3215 C CA  . CYS A 403 ? 0.1202 0.1093 0.1242 0.0016  -0.0004 -0.0060 403  CYS A CA  
3216 C C   . CYS A 403 ? 0.1375 0.1227 0.1237 0.0036  0.0026  -0.0002 403  CYS A C   
3217 O O   . CYS A 403 ? 0.1299 0.1174 0.1232 0.0081  0.0138  -0.0036 403  CYS A O   
3218 C CB  . CYS A 403 ? 0.1421 0.1293 0.1279 0.0058  -0.0085 -0.0110 403  CYS A CB  
3219 S SG  . CYS A 403 ? 0.1343 0.1265 0.1383 0.0129  0.0062  0.0033  403  CYS A SG  
3220 N N   . ASP A 404 ? 0.1358 0.0969 0.1053 0.0078  -0.0021 -0.0006 404  ASP A N   
3221 C CA  . ASP A 404 ? 0.1418 0.1123 0.1155 0.0062  -0.0046 0.0032  404  ASP A CA  
3222 C C   . ASP A 404 ? 0.1321 0.1169 0.1145 0.0031  0.0033  0.0024  404  ASP A C   
3223 O O   . ASP A 404 ? 0.1323 0.1227 0.1145 -0.0060 0.0026  -0.0006 404  ASP A O   
3224 C CB  . ASP A 404 ? 0.1456 0.1285 0.1177 0.0042  -0.0060 0.0181  404  ASP A CB  
3225 C CG  . ASP A 404 ? 0.1341 0.1095 0.1337 0.0034  -0.0016 -0.0035 404  ASP A CG  
3226 O OD1 . ASP A 404 ? 0.1422 0.1449 0.1347 -0.0122 -0.0085 0.0170  404  ASP A OD1 
3227 O OD2 . ASP A 404 ? 0.1369 0.1486 0.1369 0.0098  0.0075  -0.0028 404  ASP A OD2 
3228 N N   . PHE A 405 ? 0.1220 0.1083 0.1092 -0.0017 -0.0093 0.0048  405  PHE A N   
3229 C CA  . PHE A 405 ? 0.1241 0.1234 0.1160 0.0019  -0.0005 0.0050  405  PHE A CA  
3230 C C   . PHE A 405 ? 0.1332 0.1307 0.1234 0.0039  -0.0046 0.0070  405  PHE A C   
3231 O O   . PHE A 405 ? 0.1332 0.1461 0.1242 0.0099  0.0095  0.0274  405  PHE A O   
3232 C CB  . PHE A 405 ? 0.1300 0.1189 0.1202 0.0123  -0.0045 0.0038  405  PHE A CB  
3233 C CG  . PHE A 405 ? 0.1020 0.1116 0.1165 0.0042  -0.0011 -0.0062 405  PHE A CG  
3234 C CD1 . PHE A 405 ? 0.1199 0.1227 0.1566 0.0082  0.0056  0.0175  405  PHE A CD1 
3235 C CD2 . PHE A 405 ? 0.1270 0.1000 0.1079 0.0032  0.0139  0.0013  405  PHE A CD2 
3236 C CE1 . PHE A 405 ? 0.1509 0.1162 0.1170 0.0137  0.0032  -0.0058 405  PHE A CE1 
3237 C CE2 . PHE A 405 ? 0.0982 0.1096 0.1066 0.0138  0.0013  0.0057  405  PHE A CE2 
3238 C CZ  . PHE A 405 ? 0.1213 0.1456 0.1033 -0.0101 -0.0070 0.0078  405  PHE A CZ  
3239 N N   . LEU A 406 ? 0.1332 0.1141 0.1234 0.0020  -0.0082 -0.0016 406  LEU A N   
3240 C CA  . LEU A 406 ? 0.1460 0.1181 0.1246 0.0030  -0.0028 0.0039  406  LEU A CA  
3241 C C   . LEU A 406 ? 0.1423 0.1212 0.1245 0.0080  0.0011  -0.0017 406  LEU A C   
3242 O O   . LEU A 406 ? 0.1388 0.1396 0.1359 0.0069  -0.0005 -0.0148 406  LEU A O   
3243 C CB  . LEU A 406 ? 0.1455 0.1306 0.1251 -0.0037 -0.0063 0.0063  406  LEU A CB  
3244 C CG  . LEU A 406 ? 0.1593 0.1367 0.1229 0.0088  -0.0046 -0.0044 406  LEU A CG  
3245 C CD1 . LEU A 406 ? 0.1724 0.1400 0.1479 -0.0020 -0.0058 -0.0260 406  LEU A CD1 
3246 C CD2 . LEU A 406 ? 0.1871 0.1439 0.1589 0.0268  -0.0035 -0.0108 406  LEU A CD2 
3247 N N   . ILE A 407 ? 0.1205 0.1167 0.1011 0.0012  0.0041  -0.0046 407  ILE A N   
3248 C CA  . ILE A 407 ? 0.1270 0.1137 0.1109 0.0055  0.0030  -0.0031 407  ILE A CA  
3249 C C   . ILE A 407 ? 0.1350 0.1345 0.1221 0.0013  0.0035  -0.0075 407  ILE A C   
3250 O O   . ILE A 407 ? 0.1194 0.1335 0.1163 -0.0007 0.0002  -0.0005 407  ILE A O   
3251 C CB  . ILE A 407 ? 0.1143 0.1333 0.1240 0.0044  0.0030  -0.0026 407  ILE A CB  
3252 C CG1 . ILE A 407 ? 0.1113 0.1205 0.1310 0.0066  -0.0141 0.0131  407  ILE A CG1 
3253 C CG2 . ILE A 407 ? 0.1536 0.1314 0.1157 0.0032  0.0121  -0.0036 407  ILE A CG2 
3254 C CD1 . ILE A 407 ? 0.1398 0.1372 0.1187 0.0227  -0.0098 0.0091  407  ILE A CD1 
3255 N N   . PRO A 408 ? 0.1309 0.1233 0.1254 0.0037  0.0126  -0.0139 408  PRO A N   
3256 C CA  . PRO A 408 ? 0.1419 0.1287 0.1260 -0.0020 0.0035  -0.0150 408  PRO A CA  
3257 C C   . PRO A 408 ? 0.1405 0.1379 0.1307 0.0064  0.0014  -0.0053 408  PRO A C   
3258 O O   . PRO A 408 ? 0.1491 0.1373 0.1353 0.0069  -0.0040 -0.0100 408  PRO A O   
3259 C CB  . PRO A 408 ? 0.1340 0.1394 0.1368 0.0030  0.0080  -0.0082 408  PRO A CB  
3260 C CG  . PRO A 408 ? 0.1367 0.1307 0.1294 0.0023  0.0023  -0.0186 408  PRO A CG  
3261 C CD  . PRO A 408 ? 0.1156 0.1285 0.1310 -0.0126 0.0055  -0.0048 408  PRO A CD  
3262 N N   . VAL A 409 ? 0.1440 0.1289 0.1064 0.0018  -0.0050 -0.0134 409  VAL A N   
3263 C CA  . VAL A 409 ? 0.1403 0.1420 0.1136 0.0086  0.0007  -0.0092 409  VAL A CA  
3264 C C   . VAL A 409 ? 0.1446 0.1340 0.1274 0.0111  0.0019  -0.0103 409  VAL A C   
3265 O O   . VAL A 409 ? 0.1496 0.1408 0.1351 -0.0001 -0.0013 -0.0174 409  VAL A O   
3266 C CB  . VAL A 409 ? 0.1395 0.1582 0.1177 0.0068  0.0011  -0.0085 409  VAL A CB  
3267 C CG1 . VAL A 409 ? 0.1483 0.1632 0.1315 0.0189  -0.0050 -0.0118 409  VAL A CG1 
3268 C CG2 . VAL A 409 ? 0.1474 0.1587 0.1561 -0.0019 0.0094  -0.0087 409  VAL A CG2 
3269 N N   . GLN A 410 ? 0.1481 0.1476 0.1301 0.0018  0.0065  -0.0103 410  GLN A N   
3270 C CA  . GLN A 410 ? 0.1518 0.1455 0.1434 0.0000  0.0061  -0.0085 410  GLN A CA  
3271 C C   . GLN A 410 ? 0.1599 0.1510 0.1440 -0.0010 0.0033  -0.0054 410  GLN A C   
3272 O O   . GLN A 410 ? 0.1626 0.1399 0.1413 0.0039  0.0013  -0.0100 410  GLN A O   
3273 C CB  . GLN A 410 ? 0.1606 0.1486 0.1338 -0.0052 0.0003  -0.0110 410  GLN A CB  
3274 C CG  . GLN A 410 ? 0.1579 0.1725 0.1530 0.0009  0.0135  -0.0071 410  GLN A CG  
3275 C CD  . GLN A 410 ? 0.1907 0.1780 0.1763 0.0020  0.0082  -0.0025 410  GLN A CD  
3276 O OE1 . GLN A 410 ? 0.2271 0.1854 0.1928 0.0163  0.0215  -0.0009 410  GLN A OE1 
3277 N NE2 . GLN A 410 ? 0.1925 0.1868 0.1857 0.0131  0.0152  -0.0093 410  GLN A NE2 
3278 N N   . THR A 411 ? 0.1481 0.1397 0.1344 0.0013  0.0050  0.0007  411  THR A N   
3279 C CA  . THR A 411 ? 0.1531 0.1458 0.1474 0.0021  0.0004  -0.0068 411  THR A CA  
3280 C C   . THR A 411 ? 0.1682 0.1574 0.1503 -0.0008 0.0017  -0.0063 411  THR A C   
3281 O O   . THR A 411 ? 0.1801 0.1496 0.1659 -0.0005 -0.0003 -0.0120 411  THR A O   
3282 C CB  . THR A 411 ? 0.1444 0.1652 0.1282 0.0041  -0.0027 -0.0151 411  THR A CB  
3283 O OG1 . THR A 411 ? 0.1519 0.1553 0.1497 0.0121  0.0162  0.0023  411  THR A OG1 
3284 C CG2 . THR A 411 ? 0.1457 0.1659 0.1359 0.0042  -0.0109 -0.0098 411  THR A CG2 
3285 N N   . GLN A 412 ? 0.1475 0.1508 0.1411 -0.0003 -0.0108 0.0059  412  GLN A N   
3286 C CA  . GLN A 412 ? 0.1544 0.1483 0.1512 -0.0023 -0.0079 -0.0001 412  GLN A CA  
3287 C C   . GLN A 412 ? 0.1628 0.1563 0.1583 -0.0059 -0.0092 0.0019  412  GLN A C   
3288 O O   . GLN A 412 ? 0.1814 0.1869 0.1886 -0.0138 -0.0174 0.0010  412  GLN A O   
3289 C CB  . GLN A 412 ? 0.1498 0.1624 0.1539 -0.0069 -0.0129 0.0028  412  GLN A CB  
3290 C CG  . GLN A 412 ? 0.1329 0.1711 0.1661 0.0068  -0.0092 -0.0026 412  GLN A CG  
3291 C CD  . GLN A 412 ? 0.1734 0.1681 0.1749 -0.0005 -0.0094 0.0065  412  GLN A CD  
3292 O OE1 . GLN A 412 ? 0.1881 0.1925 0.2170 -0.0088 -0.0300 0.0104  412  GLN A OE1 
3293 N NE2 . GLN A 412 ? 0.1594 0.1890 0.1637 0.0015  -0.0194 -0.0259 412  GLN A NE2 
3294 N N   . HIS A 413 ? 0.1609 0.1670 0.1595 0.0027  -0.0099 -0.0053 413  HIS A N   
3295 C CA  . HIS A 413 ? 0.1778 0.1866 0.1762 0.0023  -0.0028 -0.0020 413  HIS A CA  
3296 C C   . HIS A 413 ? 0.1760 0.1839 0.1730 0.0046  0.0006  -0.0009 413  HIS A C   
3297 O O   . HIS A 413 ? 0.1956 0.1929 0.1775 -0.0018 -0.0055 -0.0084 413  HIS A O   
3298 C CB  . HIS A 413 ? 0.1892 0.2055 0.1835 -0.0016 -0.0002 -0.0028 413  HIS A CB  
3299 C CG  . HIS A 413 ? 0.2026 0.2295 0.1894 -0.0025 -0.0055 0.0054  413  HIS A CG  
3300 N ND1 . HIS A 413 ? 0.2348 0.2443 0.2166 -0.0213 -0.0148 -0.0165 413  HIS A ND1 
3301 C CD2 . HIS A 413 ? 0.1897 0.1991 0.1834 -0.0136 -0.0086 -0.0089 413  HIS A CD2 
3302 C CE1 . HIS A 413 ? 0.2484 0.2528 0.2364 -0.0257 -0.0109 -0.0034 413  HIS A CE1 
3303 N NE2 . HIS A 413 ? 0.2200 0.2196 0.1850 -0.0131 -0.0067 -0.0096 413  HIS A NE2 
3304 N N   . PRO A 414 ? 0.1859 0.1739 0.1720 -0.0008 -0.0040 -0.0047 414  PRO A N   
3305 C CA  . PRO A 414 ? 0.1738 0.1788 0.1687 0.0001  -0.0028 -0.0076 414  PRO A CA  
3306 C C   . PRO A 414 ? 0.1813 0.1851 0.1790 -0.0072 -0.0070 -0.0091 414  PRO A C   
3307 O O   . PRO A 414 ? 0.1925 0.2140 0.1962 -0.0058 -0.0165 -0.0135 414  PRO A O   
3308 C CB  . PRO A 414 ? 0.1866 0.1735 0.1762 -0.0021 -0.0034 -0.0085 414  PRO A CB  
3309 C CG  . PRO A 414 ? 0.1966 0.1816 0.1699 0.0088  0.0037  0.0002  414  PRO A CG  
3310 C CD  . PRO A 414 ? 0.1949 0.1790 0.1706 0.0028  0.0018  -0.0055 414  PRO A CD  
3311 N N   . ILE A 415 ? 0.1635 0.1867 0.1824 -0.0120 -0.0129 0.0022  415  ILE A N   
3312 C CA  . ILE A 415 ? 0.1724 0.1976 0.1839 -0.0040 -0.0053 -0.0053 415  ILE A CA  
3313 C C   . ILE A 415 ? 0.1789 0.2055 0.1879 -0.0076 -0.0109 0.0002  415  ILE A C   
3314 O O   . ILE A 415 ? 0.1763 0.2100 0.1755 -0.0039 -0.0073 -0.0130 415  ILE A O   
3315 C CB  . ILE A 415 ? 0.1820 0.1894 0.1728 -0.0177 -0.0022 -0.0126 415  ILE A CB  
3316 C CG1 . ILE A 415 ? 0.1885 0.1753 0.1752 -0.0093 0.0086  -0.0122 415  ILE A CG1 
3317 C CG2 . ILE A 415 ? 0.2282 0.2068 0.2032 -0.0024 -0.0035 0.0003  415  ILE A CG2 
3318 C CD1 . ILE A 415 ? 0.1974 0.1939 0.1999 0.0042  -0.0066 -0.0077 415  ILE A CD1 
3319 N N   . ARG A 416 ? 0.1805 0.2043 0.1886 -0.0018 -0.0130 -0.0050 416  ARG A N   
3320 C CA  . ARG A 416 ? 0.1946 0.2227 0.1909 -0.0072 -0.0078 0.0012  416  ARG A CA  
3321 C C   . ARG A 416 ? 0.1979 0.2205 0.1856 -0.0055 -0.0123 -0.0033 416  ARG A C   
3322 O O   . ARG A 416 ? 0.1906 0.2109 0.1741 -0.0111 -0.0220 -0.0087 416  ARG A O   
3323 C CB  . ARG A 416 ? 0.2177 0.2425 0.2075 0.0023  -0.0008 -0.0005 416  ARG A CB  
3324 C CG  . ARG A 416 ? 0.2409 0.2850 0.2553 0.0024  0.0127  0.0000  416  ARG A CG  
3325 C CD  . ARG A 416 ? 0.2582 0.2914 0.2601 -0.0077 -0.0109 0.0055  416  ARG A CD  
3326 N NE  . ARG A 416 ? 0.2525 0.2706 0.2582 0.0046  -0.0050 0.0015  416  ARG A NE  
3327 C CZ  . ARG A 416 ? 0.2570 0.2758 0.2518 0.0003  0.0010  -0.0006 416  ARG A CZ  
3328 N NH1 . ARG A 416 ? 0.1952 0.2616 0.2385 0.0098  0.0023  -0.0002 416  ARG A NH1 
3329 N NH2 . ARG A 416 ? 0.2720 0.3004 0.2604 -0.0006 -0.0050 0.0069  416  ARG A NH2 
3330 N N   . LYS A 417 ? 0.2088 0.2240 0.1811 -0.0067 -0.0158 -0.0130 417  LYS A N   
3331 C CA  . LYS A 417 ? 0.2280 0.2396 0.2066 -0.0038 -0.0028 -0.0110 417  LYS A CA  
3332 C C   . LYS A 417 ? 0.2334 0.2332 0.2029 -0.0057 -0.0006 -0.0096 417  LYS A C   
3333 O O   . LYS A 417 ? 0.2557 0.2438 0.1964 -0.0065 0.0001  -0.0219 417  LYS A O   
3334 C CB  . LYS A 417 ? 0.2584 0.2588 0.2234 0.0000  -0.0095 -0.0076 417  LYS A CB  
3335 C CG  . LYS A 417 ? 0.3103 0.3356 0.3186 -0.0140 0.0007  -0.0114 417  LYS A CG  
3336 C CD  . LYS A 417 ? 0.3916 0.4108 0.3583 -0.0018 -0.0165 -0.0025 417  LYS A CD  
3337 C CE  . LYS A 417 ? 0.4395 0.4709 0.4463 -0.0046 0.0086  0.0012  417  LYS A CE  
3338 N NZ  . LYS A 417 ? 0.4860 0.4810 0.4954 0.0104  0.0030  -0.0071 417  LYS A NZ  
3339 N N   . GLY A 418 ? 0.2226 0.2113 0.1999 -0.0019 -0.0118 -0.0170 418  GLY A N   
3340 C CA  . GLY A 418 ? 0.1925 0.1991 0.1816 0.0005  -0.0020 -0.0058 418  GLY A CA  
3341 C C   . GLY A 418 ? 0.1824 0.1899 0.1724 -0.0003 0.0007  -0.0104 418  GLY A C   
3342 O O   . GLY A 418 ? 0.1849 0.2019 0.1467 0.0038  -0.0052 -0.0103 418  GLY A O   
3343 N N   . LEU A 419 ? 0.1806 0.1739 0.1493 0.0044  -0.0046 -0.0144 419  LEU A N   
3344 C CA  . LEU A 419 ? 0.1576 0.1700 0.1490 0.0009  -0.0090 -0.0072 419  LEU A CA  
3345 C C   . LEU A 419 ? 0.1607 0.1578 0.1361 -0.0044 0.0014  -0.0075 419  LEU A C   
3346 O O   . LEU A 419 ? 0.1555 0.1581 0.1231 -0.0069 0.0043  -0.0099 419  LEU A O   
3347 C CB  . LEU A 419 ? 0.1705 0.1883 0.1825 0.0081  -0.0030 -0.0054 419  LEU A CB  
3348 C CG  . LEU A 419 ? 0.1700 0.1882 0.1973 0.0004  -0.0138 -0.0028 419  LEU A CG  
3349 C CD1 . LEU A 419 ? 0.2223 0.2479 0.2174 -0.0005 -0.0050 0.0046  419  LEU A CD1 
3350 C CD2 . LEU A 419 ? 0.1773 0.2245 0.2242 0.0140  -0.0120 -0.0122 419  LEU A CD2 
3351 N N   . HIS A 420 ? 0.1518 0.1589 0.1361 -0.0014 -0.0038 -0.0132 420  HIS A N   
3352 C CA  . HIS A 420 ? 0.1474 0.1560 0.1347 0.0013  -0.0038 -0.0108 420  HIS A CA  
3353 C C   . HIS A 420 ? 0.1465 0.1467 0.1392 0.0015  -0.0050 -0.0084 420  HIS A C   
3354 O O   . HIS A 420 ? 0.1406 0.1390 0.1303 -0.0026 -0.0015 -0.0042 420  HIS A O   
3355 C CB  . HIS A 420 ? 0.1297 0.1600 0.1329 -0.0030 0.0015  -0.0118 420  HIS A CB  
3356 C CG  . HIS A 420 ? 0.1439 0.1576 0.1548 0.0081  -0.0114 -0.0006 420  HIS A CG  
3357 N ND1 . HIS A 420 ? 0.1277 0.1845 0.1402 -0.0069 -0.0070 -0.0046 420  HIS A ND1 
3358 C CD2 . HIS A 420 ? 0.1426 0.1727 0.1651 0.0048  -0.0046 0.0040  420  HIS A CD2 
3359 C CE1 . HIS A 420 ? 0.1244 0.1619 0.1201 -0.0036 -0.0099 -0.0085 420  HIS A CE1 
3360 N NE2 . HIS A 420 ? 0.1367 0.1698 0.1541 0.0009  -0.0115 -0.0124 420  HIS A NE2 
3361 N N   . HIS A 421 ? 0.1401 0.1457 0.1358 0.0047  -0.0096 -0.0152 421  HIS A N   
3362 C CA  . HIS A 421 ? 0.1456 0.1522 0.1438 0.0036  -0.0024 -0.0075 421  HIS A CA  
3363 C C   . HIS A 421 ? 0.1587 0.1621 0.1389 0.0008  0.0013  -0.0116 421  HIS A C   
3364 O O   . HIS A 421 ? 0.1451 0.1728 0.1373 0.0154  -0.0007 -0.0154 421  HIS A O   
3365 C CB  . HIS A 421 ? 0.1322 0.1535 0.1283 0.0097  -0.0044 -0.0139 421  HIS A CB  
3366 C CG  . HIS A 421 ? 0.1306 0.1545 0.1263 0.0004  -0.0100 -0.0059 421  HIS A CG  
3367 N ND1 . HIS A 421 ? 0.1480 0.1517 0.1328 -0.0045 -0.0027 -0.0200 421  HIS A ND1 
3368 C CD2 . HIS A 421 ? 0.1464 0.1540 0.1642 0.0025  -0.0006 -0.0052 421  HIS A CD2 
3369 C CE1 . HIS A 421 ? 0.1401 0.1500 0.1701 0.0059  0.0027  -0.0137 421  HIS A CE1 
3370 N NE2 . HIS A 421 ? 0.1313 0.1361 0.1360 0.0038  0.0003  0.0001  421  HIS A NE2 
3371 N N   . LYS A 422 ? 0.1625 0.1616 0.1350 0.0047  0.0014  -0.0007 422  LYS A N   
3372 C CA  . LYS A 422 ? 0.1698 0.1691 0.1487 -0.0105 0.0023  -0.0052 422  LYS A CA  
3373 C C   . LYS A 422 ? 0.1650 0.1662 0.1472 -0.0014 0.0037  -0.0020 422  LYS A C   
3374 O O   . LYS A 422 ? 0.1623 0.1737 0.1396 -0.0120 0.0118  -0.0051 422  LYS A O   
3375 C CB  . LYS A 422 ? 0.1961 0.1929 0.1610 -0.0027 -0.0019 -0.0051 422  LYS A CB  
3376 C CG  . LYS A 422 ? 0.2634 0.2553 0.2307 -0.0151 0.0091  0.0062  422  LYS A CG  
3377 C CD  . LYS A 422 ? 0.3286 0.3449 0.2986 -0.0084 -0.0192 -0.0057 422  LYS A CD  
3378 C CE  . LYS A 422 ? 0.3942 0.3682 0.3565 -0.0032 -0.0046 0.0054  422  LYS A CE  
3379 N NZ  . LYS A 422 ? 0.4165 0.4400 0.4240 0.0004  -0.0226 -0.0083 422  LYS A NZ  
3380 N N   . ILE A 423 ? 0.1518 0.1482 0.1370 0.0082  -0.0080 -0.0012 423  ILE A N   
3381 C CA  . ILE A 423 ? 0.1379 0.1525 0.1356 0.0017  -0.0096 -0.0050 423  ILE A CA  
3382 C C   . ILE A 423 ? 0.1327 0.1465 0.1301 0.0000  -0.0066 0.0034  423  ILE A C   
3383 O O   . ILE A 423 ? 0.1291 0.1394 0.1091 -0.0130 -0.0112 0.0088  423  ILE A O   
3384 C CB  . ILE A 423 ? 0.1505 0.1599 0.1331 0.0088  -0.0101 -0.0079 423  ILE A CB  
3385 C CG1 . ILE A 423 ? 0.1348 0.1580 0.1321 0.0048  -0.0097 -0.0082 423  ILE A CG1 
3386 C CG2 . ILE A 423 ? 0.1480 0.1520 0.1553 0.0159  -0.0102 -0.0051 423  ILE A CG2 
3387 C CD1 . ILE A 423 ? 0.1382 0.1832 0.1621 0.0017  -0.0101 -0.0051 423  ILE A CD1 
3388 N N   . LEU A 424 ? 0.1228 0.1502 0.1250 0.0049  -0.0022 0.0016  424  LEU A N   
3389 C CA  . LEU A 424 ? 0.1217 0.1331 0.1226 -0.0013 0.0005  0.0040  424  LEU A CA  
3390 C C   . LEU A 424 ? 0.1311 0.1367 0.1315 0.0014  0.0002  0.0012  424  LEU A C   
3391 O O   . LEU A 424 ? 0.1175 0.1281 0.1179 -0.0099 0.0051  0.0033  424  LEU A O   
3392 C CB  . LEU A 424 ? 0.1361 0.1393 0.1159 -0.0073 -0.0103 0.0068  424  LEU A CB  
3393 C CG  . LEU A 424 ? 0.1470 0.1211 0.1050 -0.0003 -0.0145 -0.0016 424  LEU A CG  
3394 C CD1 . LEU A 424 ? 0.1416 0.1542 0.1364 0.0016  0.0075  -0.0137 424  LEU A CD1 
3395 C CD2 . LEU A 424 ? 0.1400 0.1128 0.1202 0.0117  -0.0007 0.0066  424  LEU A CD2 
3396 N N   . LEU A 425 ? 0.1252 0.1328 0.1218 0.0073  0.0052  0.0011  425  LEU A N   
3397 C CA  . LEU A 425 ? 0.1394 0.1225 0.1185 0.0012  0.0146  0.0012  425  LEU A CA  
3398 C C   . LEU A 425 ? 0.1349 0.1216 0.1285 -0.0013 0.0007  -0.0029 425  LEU A C   
3399 O O   . LEU A 425 ? 0.1401 0.1297 0.1247 -0.0061 0.0094  -0.0090 425  LEU A O   
3400 C CB  . LEU A 425 ? 0.1497 0.1165 0.1153 0.0002  0.0050  -0.0021 425  LEU A CB  
3401 C CG  . LEU A 425 ? 0.1526 0.1211 0.1334 0.0003  0.0012  -0.0015 425  LEU A CG  
3402 C CD1 . LEU A 425 ? 0.1638 0.1375 0.1428 0.0017  0.0090  -0.0073 425  LEU A CD1 
3403 C CD2 . LEU A 425 ? 0.1658 0.1826 0.1353 0.0132  -0.0052 0.0051  425  LEU A CD2 
3404 N N   . ALA A 426 ? 0.1404 0.1226 0.1213 0.0015  0.0062  0.0030  426  ALA A N   
3405 C CA  . ALA A 426 ? 0.1403 0.1332 0.1284 0.0017  0.0005  0.0044  426  ALA A CA  
3406 C C   . ALA A 426 ? 0.1420 0.1423 0.1288 -0.0033 0.0075  -0.0048 426  ALA A C   
3407 O O   . ALA A 426 ? 0.1304 0.1376 0.1276 0.0088  0.0179  -0.0008 426  ALA A O   
3408 C CB  . ALA A 426 ? 0.1390 0.1559 0.1237 0.0016  0.0030  0.0072  426  ALA A CB  
3409 N N   . ASN A 427 ? 0.1253 0.1278 0.1188 0.0000  0.0054  0.0024  427  ASN A N   
3410 C CA  . ASN A 427 ? 0.1268 0.1218 0.1225 -0.0028 -0.0020 -0.0015 427  ASN A CA  
3411 C C   . ASN A 427 ? 0.1331 0.1126 0.1154 -0.0003 -0.0082 -0.0011 427  ASN A C   
3412 O O   . ASN A 427 ? 0.1375 0.1188 0.1244 -0.0097 -0.0037 0.0037  427  ASN A O   
3413 C CB  . ASN A 427 ? 0.1389 0.1206 0.1372 0.0038  0.0051  -0.0025 427  ASN A CB  
3414 C CG  . ASN A 427 ? 0.1444 0.1487 0.1618 -0.0048 -0.0111 -0.0036 427  ASN A CG  
3415 O OD1 . ASN A 427 ? 0.1843 0.1970 0.2043 -0.0053 -0.0287 -0.0257 427  ASN A OD1 
3416 N ND2 . ASN A 427 ? 0.1058 0.1404 0.1230 -0.0041 -0.0065 -0.0242 427  ASN A ND2 
3417 N N   . PHE A 428 ? 0.1270 0.1161 0.1086 0.0005  -0.0127 -0.0019 428  PHE A N   
3418 C CA  . PHE A 428 ? 0.1231 0.1089 0.1080 0.0025  -0.0036 0.0053  428  PHE A CA  
3419 C C   . PHE A 428 ? 0.1359 0.1247 0.1149 -0.0033 -0.0029 0.0009  428  PHE A C   
3420 O O   . PHE A 428 ? 0.1375 0.1200 0.1105 -0.0097 0.0061  0.0177  428  PHE A O   
3421 C CB  . PHE A 428 ? 0.1159 0.0982 0.1177 0.0087  -0.0159 0.0030  428  PHE A CB  
3422 C CG  . PHE A 428 ? 0.1144 0.1292 0.1311 0.0044  -0.0105 0.0091  428  PHE A CG  
3423 C CD1 . PHE A 428 ? 0.1387 0.1396 0.1211 -0.0120 -0.0043 -0.0011 428  PHE A CD1 
3424 C CD2 . PHE A 428 ? 0.1505 0.1162 0.1259 0.0072  -0.0003 0.0170  428  PHE A CD2 
3425 C CE1 . PHE A 428 ? 0.1340 0.1191 0.1136 0.0024  -0.0045 -0.0129 428  PHE A CE1 
3426 C CE2 . PHE A 428 ? 0.1575 0.1389 0.1413 0.0093  -0.0009 0.0065  428  PHE A CE2 
3427 C CZ  . PHE A 428 ? 0.1644 0.1559 0.1299 0.0018  0.0005  -0.0059 428  PHE A CZ  
3428 N N   . LEU A 429 ? 0.1405 0.1260 0.1075 0.0036  0.0087  0.0079  429  LEU A N   
3429 C CA  . LEU A 429 ? 0.1374 0.1202 0.1157 0.0013  0.0109  -0.0010 429  LEU A CA  
3430 C C   . LEU A 429 ? 0.1383 0.1314 0.1229 0.0041  0.0051  0.0067  429  LEU A C   
3431 O O   . LEU A 429 ? 0.1631 0.1372 0.1313 0.0016  0.0103  -0.0012 429  LEU A O   
3432 C CB  . LEU A 429 ? 0.1383 0.1144 0.1168 0.0030  -0.0032 0.0032  429  LEU A CB  
3433 C CG  . LEU A 429 ? 0.1250 0.1173 0.1113 0.0047  -0.0108 -0.0056 429  LEU A CG  
3434 C CD1 . LEU A 429 ? 0.1793 0.1353 0.1355 -0.0011 -0.0147 -0.0148 429  LEU A CD1 
3435 C CD2 . LEU A 429 ? 0.1334 0.1616 0.1589 -0.0016 -0.0063 -0.0071 429  LEU A CD2 
3436 N N   . ALA A 430 ? 0.1355 0.1234 0.1237 0.0170  0.0031  0.0148  430  ALA A N   
3437 C CA  . ALA A 430 ? 0.1341 0.1261 0.1283 0.0038  0.0009  0.0012  430  ALA A CA  
3438 C C   . ALA A 430 ? 0.1446 0.1375 0.1214 -0.0036 0.0000  0.0036  430  ALA A C   
3439 O O   . ALA A 430 ? 0.1663 0.1270 0.1220 0.0005  -0.0035 0.0050  430  ALA A O   
3440 C CB  . ALA A 430 ? 0.1321 0.1455 0.1330 0.0138  -0.0038 0.0113  430  ALA A CB  
3441 N N   . GLN A 431 ? 0.1534 0.1264 0.1065 -0.0005 -0.0103 0.0088  431  GLN A N   
3442 C CA  . GLN A 431 ? 0.1451 0.1290 0.1193 -0.0047 -0.0038 0.0075  431  GLN A CA  
3443 C C   . GLN A 431 ? 0.1348 0.1276 0.1228 0.0012  -0.0038 0.0053  431  GLN A C   
3444 O O   . GLN A 431 ? 0.1313 0.1219 0.1093 -0.0016 -0.0102 0.0136  431  GLN A O   
3445 C CB  . GLN A 431 ? 0.1328 0.1304 0.1106 -0.0014 0.0006  0.0062  431  GLN A CB  
3446 C CG  . GLN A 431 ? 0.1391 0.1249 0.1523 0.0071  -0.0088 0.0087  431  GLN A CG  
3447 C CD  . GLN A 431 ? 0.1602 0.1396 0.1617 0.0025  0.0020  -0.0010 431  GLN A CD  
3448 O OE1 . GLN A 431 ? 0.1804 0.1623 0.1599 -0.0056 0.0139  -0.0083 431  GLN A OE1 
3449 N NE2 . GLN A 431 ? 0.1572 0.1473 0.1534 0.0067  0.0166  0.0197  431  GLN A NE2 
3450 N N   . THR A 432 ? 0.1442 0.1276 0.1341 0.0003  -0.0073 0.0058  432  THR A N   
3451 C CA  . THR A 432 ? 0.1400 0.1282 0.1374 0.0017  0.0003  0.0109  432  THR A CA  
3452 C C   . THR A 432 ? 0.1470 0.1360 0.1337 -0.0032 0.0022  0.0086  432  THR A C   
3453 O O   . THR A 432 ? 0.1354 0.1445 0.1378 -0.0048 0.0086  0.0044  432  THR A O   
3454 C CB  . THR A 432 ? 0.1451 0.1254 0.1271 -0.0013 -0.0008 0.0041  432  THR A CB  
3455 O OG1 . THR A 432 ? 0.1484 0.1177 0.1295 0.0216  0.0058  0.0090  432  THR A OG1 
3456 C CG2 . THR A 432 ? 0.1287 0.1159 0.1294 0.0006  -0.0026 0.0054  432  THR A CG2 
3457 N N   . GLU A 433 ? 0.1483 0.1414 0.1324 -0.0086 0.0039  0.0174  433  GLU A N   
3458 C CA  . GLU A 433 ? 0.1626 0.1442 0.1338 -0.0043 0.0030  0.0069  433  GLU A CA  
3459 C C   . GLU A 433 ? 0.1500 0.1390 0.1315 -0.0048 0.0050  0.0037  433  GLU A C   
3460 O O   . GLU A 433 ? 0.1727 0.1313 0.1429 -0.0036 0.0054  0.0021  433  GLU A O   
3461 C CB  . GLU A 433 ? 0.1706 0.1601 0.1341 -0.0085 -0.0011 0.0185  433  GLU A CB  
3462 C CG  . GLU A 433 ? 0.1820 0.1676 0.1187 -0.0160 0.0108  0.0091  433  GLU A CG  
3463 C CD  . GLU A 433 ? 0.1739 0.1749 0.1627 -0.0088 -0.0003 0.0062  433  GLU A CD  
3464 O OE1 . GLU A 433 ? 0.1809 0.1727 0.1509 0.0001  -0.0029 0.0008  433  GLU A OE1 
3465 O OE2 . GLU A 433 ? 0.2353 0.2072 0.1565 0.0028  0.0148  0.0121  433  GLU A OE2 
3466 N N   . ALA A 434 ? 0.1504 0.1262 0.1186 0.0040  0.0058  0.0018  434  ALA A N   
3467 C CA  . ALA A 434 ? 0.1377 0.1345 0.1269 0.0113  -0.0018 0.0024  434  ALA A CA  
3468 C C   . ALA A 434 ? 0.1499 0.1323 0.1321 0.0052  -0.0001 0.0008  434  ALA A C   
3469 O O   . ALA A 434 ? 0.1576 0.1410 0.1299 0.0033  0.0146  -0.0036 434  ALA A O   
3470 C CB  . ALA A 434 ? 0.1426 0.1512 0.1444 0.0088  0.0122  0.0139  434  ALA A CB  
3471 N N   . LEU A 435 ? 0.1542 0.1244 0.1195 0.0091  0.0003  0.0004  435  LEU A N   
3472 C CA  . LEU A 435 ? 0.1446 0.1368 0.1303 0.0004  0.0007  0.0089  435  LEU A CA  
3473 C C   . LEU A 435 ? 0.1422 0.1389 0.1369 0.0049  0.0008  0.0045  435  LEU A C   
3474 O O   . LEU A 435 ? 0.1401 0.1296 0.1449 -0.0008 0.0022  0.0167  435  LEU A O   
3475 C CB  . LEU A 435 ? 0.1346 0.1234 0.1232 0.0068  0.0025  0.0088  435  LEU A CB  
3476 C CG  . LEU A 435 ? 0.1341 0.1018 0.1182 -0.0014 -0.0007 -0.0017 435  LEU A CG  
3477 C CD1 . LEU A 435 ? 0.1424 0.1038 0.1435 -0.0001 0.0081  0.0022  435  LEU A CD1 
3478 C CD2 . LEU A 435 ? 0.1332 0.1253 0.1111 0.0076  0.0109  -0.0165 435  LEU A CD2 
3479 N N   . MET A 436 ? 0.1388 0.1519 0.1520 0.0139  0.0008  0.0063  436  MET A N   
3480 C CA  . MET A 436 ? 0.1568 0.1489 0.1565 0.0122  0.0142  0.0049  436  MET A CA  
3481 C C   . MET A 436 ? 0.1703 0.1572 0.1613 0.0034  0.0093  0.0011  436  MET A C   
3482 O O   . MET A 436 ? 0.1846 0.1576 0.1711 0.0039  0.0243  0.0070  436  MET A O   
3483 C CB  . MET A 436 ? 0.1879 0.1525 0.1764 0.0087  -0.0004 -0.0011 436  MET A CB  
3484 C CG  . MET A 436 ? 0.1692 0.1857 0.2781 0.0022  0.0060  -0.0033 436  MET A CG  
3485 S SD  . MET A 436 ? 0.2765 0.2658 0.3100 0.0359  0.0108  0.0139  436  MET A SD  
3486 C CE  . MET A 436 ? 0.3101 0.2732 0.2997 0.0054  0.0033  -0.0069 436  MET A CE  
3487 N N   . ARG A 437 ? 0.1588 0.1707 0.1678 0.0108  0.0100  0.0099  437  ARG A N   
3488 C CA  . ARG A 437 ? 0.1878 0.1802 0.1896 0.0114  0.0103  0.0067  437  ARG A CA  
3489 C C   . ARG A 437 ? 0.1851 0.1743 0.1900 0.0076  0.0121  0.0092  437  ARG A C   
3490 O O   . ARG A 437 ? 0.1831 0.1718 0.1929 0.0104  0.0292  0.0105  437  ARG A O   
3491 C CB  . ARG A 437 ? 0.2265 0.2139 0.2097 0.0117  0.0058  -0.0006 437  ARG A CB  
3492 C CG  . ARG A 437 ? 0.2955 0.3112 0.3269 0.0040  -0.0010 -0.0071 437  ARG A CG  
3493 C CD  . ARG A 437 ? 0.4213 0.4080 0.3652 0.0014  -0.0105 0.0138  437  ARG A CD  
3494 N NE  . ARG A 437 ? 0.4333 0.4236 0.4177 0.0086  0.0129  -0.0161 437  ARG A NE  
3495 C CZ  . ARG A 437 ? 0.4946 0.4752 0.4604 -0.0003 0.0002  0.0042  437  ARG A CZ  
3496 N NH1 . ARG A 437 ? 0.4978 0.4841 0.5065 0.0072  -0.0026 -0.0121 437  ARG A NH1 
3497 N NH2 . ARG A 437 ? 0.5249 0.4984 0.4896 0.0015  0.0089  -0.0059 437  ARG A NH2 
3498 N N   . GLY A 438 ? 0.1715 0.1638 0.1699 0.0082  0.0091  0.0066  438  GLY A N   
3499 C CA  . GLY A 438 ? 0.1720 0.1529 0.1571 0.0089  0.0051  0.0128  438  GLY A CA  
3500 C C   . GLY A 438 ? 0.1679 0.1609 0.1581 0.0018  0.0088  0.0079  438  GLY A C   
3501 O O   . GLY A 438 ? 0.1900 0.1553 0.1696 0.0077  -0.0008 0.0178  438  GLY A O   
3502 N N   . LYS A 439 ? 0.1575 0.1466 0.1494 0.0072  0.0046  0.0295  439  LYS A N   
3503 C CA  . LYS A 439 ? 0.1575 0.1596 0.1567 0.0005  -0.0041 0.0167  439  LYS A CA  
3504 C C   . LYS A 439 ? 0.1784 0.1610 0.1605 0.0051  0.0032  0.0167  439  LYS A C   
3505 O O   . LYS A 439 ? 0.1977 0.1512 0.1614 0.0151  0.0078  0.0217  439  LYS A O   
3506 C CB  . LYS A 439 ? 0.1599 0.1670 0.1518 -0.0013 -0.0045 0.0163  439  LYS A CB  
3507 C CG  . LYS A 439 ? 0.1350 0.1627 0.1582 0.0034  -0.0129 0.0071  439  LYS A CG  
3508 C CD  . LYS A 439 ? 0.1518 0.1648 0.1944 -0.0109 -0.0051 0.0019  439  LYS A CD  
3509 C CE  . LYS A 439 ? 0.1510 0.1522 0.2098 -0.0020 -0.0002 0.0076  439  LYS A CE  
3510 N NZ  . LYS A 439 ? 0.1741 0.2110 0.2197 -0.0036 -0.0111 -0.0002 439  LYS A NZ  
3511 N N   . SER A 440 ? 0.1686 0.1634 0.1677 -0.0059 0.0122  0.0086  440  SER A N   
3512 C CA  . SER A 440 ? 0.1628 0.1508 0.1566 -0.0039 0.0136  0.0073  440  SER A CA  
3513 C C   . SER A 440 ? 0.1643 0.1512 0.1560 -0.0083 0.0102  0.0050  440  SER A C   
3514 O O   . SER A 440 ? 0.1653 0.1422 0.1558 -0.0074 0.0081  0.0128  440  SER A O   
3515 C CB  . SER A 440 ? 0.1556 0.1591 0.1367 0.0014  0.0112  0.0111  440  SER A CB  
3516 O OG  . SER A 440 ? 0.1448 0.1353 0.1678 0.0088  -0.0066 -0.0056 440  SER A OG  
3517 N N   . THR A 441 ? 0.1703 0.1479 0.1444 0.0016  0.0189  0.0012  441  THR A N   
3518 C CA  . THR A 441 ? 0.1706 0.1601 0.1518 0.0015  0.0116  0.0050  441  THR A CA  
3519 C C   . THR A 441 ? 0.1573 0.1545 0.1490 -0.0002 0.0081  0.0016  441  THR A C   
3520 O O   . THR A 441 ? 0.1471 0.1634 0.1481 0.0020  0.0231  0.0175  441  THR A O   
3521 C CB  . THR A 441 ? 0.1652 0.1482 0.1599 0.0024  0.0064  -0.0043 441  THR A CB  
3522 O OG1 . THR A 441 ? 0.1742 0.1633 0.1667 -0.0010 0.0177  0.0175  441  THR A OG1 
3523 C CG2 . THR A 441 ? 0.2018 0.1599 0.1774 0.0150  0.0078  0.0167  441  THR A CG2 
3524 N N   . GLU A 442 ? 0.1504 0.1631 0.1421 -0.0048 0.0042  0.0101  442  GLU A N   
3525 C CA  . GLU A 442 ? 0.1549 0.1638 0.1347 -0.0079 0.0096  -0.0011 442  GLU A CA  
3526 C C   . GLU A 442 ? 0.1567 0.1576 0.1483 -0.0064 0.0019  0.0106  442  GLU A C   
3527 O O   . GLU A 442 ? 0.1673 0.1568 0.1468 -0.0099 0.0034  0.0083  442  GLU A O   
3528 C CB  . GLU A 442 ? 0.1472 0.1843 0.1362 -0.0138 0.0049  0.0016  442  GLU A CB  
3529 C CG  . GLU A 442 ? 0.1918 0.1926 0.1504 -0.0046 -0.0027 -0.0045 442  GLU A CG  
3530 C CD  . GLU A 442 ? 0.2023 0.1842 0.1771 -0.0119 -0.0029 -0.0003 442  GLU A CD  
3531 O OE1 . GLU A 442 ? 0.2381 0.2070 0.1685 -0.0059 0.0002  -0.0048 442  GLU A OE1 
3532 O OE2 . GLU A 442 ? 0.1657 0.1677 0.1305 -0.0160 0.0338  0.0220  442  GLU A OE2 
3533 N N   . GLU A 443 ? 0.1699 0.1517 0.1480 -0.0056 0.0033  0.0133  443  GLU A N   
3534 C CA  . GLU A 443 ? 0.1631 0.1535 0.1647 -0.0010 0.0026  0.0137  443  GLU A CA  
3535 C C   . GLU A 443 ? 0.1672 0.1630 0.1644 -0.0040 0.0020  0.0114  443  GLU A C   
3536 O O   . GLU A 443 ? 0.1776 0.1746 0.1720 -0.0136 0.0042  0.0236  443  GLU A O   
3537 C CB  . GLU A 443 ? 0.1625 0.1521 0.1637 -0.0009 0.0057  0.0146  443  GLU A CB  
3538 C CG  . GLU A 443 ? 0.1967 0.2105 0.2119 0.0061  0.0095  0.0028  443  GLU A CG  
3539 C CD  . GLU A 443 ? 0.2884 0.2475 0.2755 0.0213  -0.0119 0.0100  443  GLU A CD  
3540 O OE1 . GLU A 443 ? 0.3919 0.3053 0.3713 0.0152  -0.0036 -0.0171 443  GLU A OE1 
3541 O OE2 . GLU A 443 ? 0.2503 0.1940 0.2294 0.0221  0.0341  0.0121  443  GLU A OE2 
3542 N N   . ALA A 444 ? 0.1685 0.1511 0.1605 -0.0032 0.0067  0.0189  444  ALA A N   
3543 C CA  . ALA A 444 ? 0.1618 0.1576 0.1579 0.0059  0.0000  0.0126  444  ALA A CA  
3544 C C   . ALA A 444 ? 0.1759 0.1639 0.1690 0.0007  0.0008  0.0153  444  ALA A C   
3545 O O   . ALA A 444 ? 0.1880 0.1615 0.1643 0.0076  -0.0004 0.0276  444  ALA A O   
3546 C CB  . ALA A 444 ? 0.1747 0.1753 0.1701 -0.0007 0.0013  0.0114  444  ALA A CB  
3547 N N   . ARG A 445 ? 0.1719 0.1567 0.1585 0.0014  0.0033  0.0238  445  ARG A N   
3548 C CA  . ARG A 445 ? 0.1648 0.1607 0.1723 0.0001  -0.0023 0.0191  445  ARG A CA  
3549 C C   . ARG A 445 ? 0.1758 0.1726 0.1700 -0.0008 0.0027  0.0209  445  ARG A C   
3550 O O   . ARG A 445 ? 0.1703 0.1927 0.1733 -0.0070 0.0066  0.0302  445  ARG A O   
3551 C CB  . ARG A 445 ? 0.1708 0.1447 0.1783 -0.0004 0.0037  0.0173  445  ARG A CB  
3552 C CG  . ARG A 445 ? 0.1951 0.1829 0.1901 0.0099  0.0075  0.0344  445  ARG A CG  
3553 C CD  . ARG A 445 ? 0.1897 0.1639 0.2087 -0.0039 0.0240  0.0155  445  ARG A CD  
3554 N NE  . ARG A 445 ? 0.1779 0.1888 0.1926 -0.0038 0.0094  0.0062  445  ARG A NE  
3555 C CZ  . ARG A 445 ? 0.1987 0.2071 0.2086 -0.0063 0.0046  0.0139  445  ARG A CZ  
3556 N NH1 . ARG A 445 ? 0.2090 0.2675 0.2305 -0.0038 0.0080  0.0453  445  ARG A NH1 
3557 N NH2 . ARG A 445 ? 0.2163 0.2223 0.2233 -0.0140 0.0064  0.0239  445  ARG A NH2 
3558 N N   . LYS A 446 ? 0.1872 0.1814 0.1603 -0.0075 0.0016  0.0201  446  LYS A N   
3559 C CA  . LYS A 446 ? 0.2128 0.2001 0.1953 -0.0092 0.0015  0.0075  446  LYS A CA  
3560 C C   . LYS A 446 ? 0.2158 0.2071 0.1979 -0.0087 -0.0040 0.0067  446  LYS A C   
3561 O O   . LYS A 446 ? 0.2354 0.2229 0.2162 -0.0198 -0.0112 0.0027  446  LYS A O   
3562 C CB  . LYS A 446 ? 0.2240 0.2259 0.2118 -0.0009 0.0030  0.0026  446  LYS A CB  
3563 C CG  . LYS A 446 ? 0.2889 0.2931 0.2655 -0.0082 -0.0024 -0.0217 446  LYS A CG  
3564 C CD  . LYS A 446 ? 0.3725 0.3791 0.3507 -0.0135 0.0113  0.0076  446  LYS A CD  
3565 C CE  . LYS A 446 ? 0.4053 0.4307 0.3920 0.0053  -0.0027 0.0140  446  LYS A CE  
3566 N NZ  . LYS A 446 ? 0.3904 0.3968 0.3994 -0.0073 0.0109  -0.0016 446  LYS A NZ  
3567 N N   . GLU A 447 ? 0.2200 0.1930 0.1960 -0.0122 -0.0050 0.0135  447  GLU A N   
3568 C CA  . GLU A 447 ? 0.2211 0.2148 0.2072 -0.0077 -0.0036 0.0144  447  GLU A CA  
3569 C C   . GLU A 447 ? 0.2191 0.2279 0.2067 -0.0112 -0.0008 0.0175  447  GLU A C   
3570 O O   . GLU A 447 ? 0.2329 0.2497 0.2277 -0.0148 -0.0029 0.0178  447  GLU A O   
3571 C CB  . GLU A 447 ? 0.2379 0.2162 0.2059 -0.0015 0.0022  0.0136  447  GLU A CB  
3572 C CG  . GLU A 447 ? 0.2480 0.2505 0.2453 0.0072  0.0038  0.0083  447  GLU A CG  
3573 C CD  . GLU A 447 ? 0.2838 0.2947 0.2714 -0.0028 -0.0071 0.0130  447  GLU A CD  
3574 O OE1 . GLU A 447 ? 0.3066 0.3140 0.2745 -0.0086 -0.0047 0.0209  447  GLU A OE1 
3575 O OE2 . GLU A 447 ? 0.3866 0.3229 0.3485 0.0097  -0.0107 0.0201  447  GLU A OE2 
3576 N N   . LEU A 448 ? 0.2130 0.2378 0.2023 -0.0060 0.0001  0.0132  448  LEU A N   
3577 C CA  . LEU A 448 ? 0.2321 0.2466 0.2283 -0.0014 -0.0020 0.0087  448  LEU A CA  
3578 C C   . LEU A 448 ? 0.2487 0.2696 0.2438 0.0022  -0.0065 0.0061  448  LEU A C   
3579 O O   . LEU A 448 ? 0.2445 0.2988 0.2513 -0.0066 -0.0023 0.0047  448  LEU A O   
3580 C CB  . LEU A 448 ? 0.2250 0.2549 0.2353 0.0021  -0.0021 0.0065  448  LEU A CB  
3581 C CG  . LEU A 448 ? 0.2322 0.2436 0.2350 -0.0042 0.0055  0.0101  448  LEU A CG  
3582 C CD1 . LEU A 448 ? 0.2429 0.2620 0.2374 -0.0046 -0.0047 -0.0012 448  LEU A CD1 
3583 C CD2 . LEU A 448 ? 0.2245 0.2544 0.2511 0.0020  0.0032  0.0077  448  LEU A CD2 
3584 N N   . GLN A 449 ? 0.2489 0.2710 0.2555 -0.0058 -0.0047 0.0069  449  GLN A N   
3585 C CA  . GLN A 449 ? 0.2930 0.2976 0.2888 -0.0019 -0.0065 0.0075  449  GLN A CA  
3586 C C   . GLN A 449 ? 0.2987 0.3098 0.3023 -0.0043 -0.0066 0.0054  449  GLN A C   
3587 O O   . GLN A 449 ? 0.3051 0.3148 0.3197 -0.0105 -0.0174 0.0023  449  GLN A O   
3588 C CB  . GLN A 449 ? 0.3094 0.3055 0.2998 -0.0048 0.0004  0.0081  449  GLN A CB  
3589 C CG  . GLN A 449 ? 0.3724 0.3562 0.3484 0.0030  -0.0200 0.0216  449  GLN A CG  
3590 C CD  . GLN A 449 ? 0.4404 0.4677 0.4348 0.0021  0.0147  0.0022  449  GLN A CD  
3591 O OE1 . GLN A 449 ? 0.5273 0.5449 0.4867 0.0077  -0.0141 0.0114  449  GLN A OE1 
3592 N NE2 . GLN A 449 ? 0.4520 0.4497 0.4336 0.0015  -0.0110 0.0144  449  GLN A NE2 
3593 N N   . ALA A 450 ? 0.3146 0.3129 0.3141 -0.0093 -0.0038 0.0012  450  ALA A N   
3594 C CA  . ALA A 450 ? 0.3271 0.3348 0.3250 -0.0078 -0.0048 -0.0016 450  ALA A CA  
3595 C C   . ALA A 450 ? 0.3363 0.3515 0.3493 -0.0069 -0.0048 -0.0020 450  ALA A C   
3596 O O   . ALA A 450 ? 0.3394 0.3582 0.3596 -0.0109 -0.0099 0.0015  450  ALA A O   
3597 C CB  . ALA A 450 ? 0.3404 0.3313 0.3294 -0.0079 -0.0023 -0.0036 450  ALA A CB  
3598 N N   . ALA A 451 ? 0.3435 0.3663 0.3594 -0.0087 -0.0002 0.0043  451  ALA A N   
3599 C CA  . ALA A 451 ? 0.3549 0.3890 0.3856 -0.0056 0.0018  0.0019  451  ALA A CA  
3600 C C   . ALA A 451 ? 0.3709 0.4035 0.3978 -0.0020 -0.0010 0.0040  451  ALA A C   
3601 O O   . ALA A 451 ? 0.3750 0.4290 0.4215 -0.0049 -0.0045 0.0036  451  ALA A O   
3602 C CB  . ALA A 451 ? 0.3508 0.3833 0.3800 -0.0075 -0.0016 0.0023  451  ALA A CB  
3603 N N   . GLY A 452 ? 0.3723 0.4013 0.3998 -0.0025 -0.0036 0.0032  452  GLY A N   
3604 C CA  . GLY A 452 ? 0.3798 0.4048 0.4012 -0.0014 -0.0041 0.0049  452  GLY A CA  
3605 C C   . GLY A 452 ? 0.3794 0.4063 0.3984 -0.0014 -0.0023 0.0034  452  GLY A C   
3606 O O   . GLY A 452 ? 0.3785 0.4153 0.4102 0.0025  -0.0070 0.0043  452  GLY A O   
3607 N N   . LYS A 453 ? 0.3757 0.4074 0.3927 0.0005  -0.0048 0.0024  453  LYS A N   
3608 C CA  . LYS A 453 ? 0.3802 0.4082 0.3895 -0.0003 -0.0037 0.0035  453  LYS A CA  
3609 C C   . LYS A 453 ? 0.3724 0.4012 0.3765 0.0015  -0.0065 0.0033  453  LYS A C   
3610 O O   . LYS A 453 ? 0.3738 0.4026 0.3691 -0.0027 -0.0087 0.0100  453  LYS A O   
3611 C CB  . LYS A 453 ? 0.3780 0.4115 0.3898 0.0026  -0.0049 0.0006  453  LYS A CB  
3612 C CG  . LYS A 453 ? 0.4233 0.4301 0.4277 0.0020  -0.0064 0.0105  453  LYS A CG  
3613 C CD  . LYS A 453 ? 0.4760 0.4919 0.4672 0.0040  0.0075  -0.0087 453  LYS A CD  
3614 C CE  . LYS A 453 ? 0.5109 0.5044 0.5208 -0.0060 0.0003  0.0033  453  LYS A CE  
3615 N NZ  . LYS A 453 ? 0.5285 0.5315 0.5344 0.0080  -0.0011 -0.0022 453  LYS A NZ  
3616 N N   . SER A 454 ? 0.3700 0.4007 0.3770 0.0001  -0.0091 0.0031  454  SER A N   
3617 C CA  . SER A 454 ? 0.3695 0.3944 0.3728 0.0014  -0.0059 0.0031  454  SER A CA  
3618 C C   . SER A 454 ? 0.3687 0.3879 0.3701 0.0005  -0.0034 0.0060  454  SER A C   
3619 O O   . SER A 454 ? 0.3561 0.3937 0.3644 0.0081  -0.0051 0.0106  454  SER A O   
3620 C CB  . SER A 454 ? 0.3799 0.4050 0.3832 -0.0002 -0.0069 0.0009  454  SER A CB  
3621 O OG  . SER A 454 ? 0.4008 0.4159 0.3983 0.0091  0.0018  0.0030  454  SER A OG  
3622 N N   . PRO A 455 ? 0.3744 0.3810 0.3706 0.0026  -0.0033 0.0086  455  PRO A N   
3623 C CA  . PRO A 455 ? 0.3734 0.3743 0.3679 0.0036  -0.0041 0.0070  455  PRO A CA  
3624 C C   . PRO A 455 ? 0.3790 0.3815 0.3758 0.0066  -0.0009 0.0051  455  PRO A C   
3625 O O   . PRO A 455 ? 0.3800 0.3655 0.3666 0.0078  -0.0079 0.0085  455  PRO A O   
3626 C CB  . PRO A 455 ? 0.3739 0.3748 0.3678 0.0015  0.0004  0.0072  455  PRO A CB  
3627 C CG  . PRO A 455 ? 0.3748 0.3723 0.3669 0.0001  -0.0027 0.0040  455  PRO A CG  
3628 C CD  . PRO A 455 ? 0.3691 0.3840 0.3640 -0.0003 -0.0027 0.0093  455  PRO A CD  
3629 N N   . GLU A 456 ? 0.3889 0.3927 0.3839 0.0103  -0.0010 0.0051  456  GLU A N   
3630 C CA  . GLU A 456 ? 0.3901 0.4009 0.3934 0.0098  0.0018  0.0029  456  GLU A CA  
3631 C C   . GLU A 456 ? 0.3668 0.3828 0.3812 0.0087  0.0042  0.0000  456  GLU A C   
3632 O O   . GLU A 456 ? 0.3718 0.3961 0.3898 0.0103  0.0017  -0.0026 456  GLU A O   
3633 C CB  . GLU A 456 ? 0.4057 0.4081 0.4153 0.0117  0.0053  0.0021  456  GLU A CB  
3634 C CG  . GLU A 456 ? 0.4581 0.4699 0.4624 0.0018  -0.0107 -0.0046 456  GLU A CG  
3635 C CD  . GLU A 456 ? 0.5191 0.5140 0.4928 0.0013  0.0026  0.0061  456  GLU A CD  
3636 O OE1 . GLU A 456 ? 0.4842 0.4688 0.4870 0.0089  -0.0068 0.0086  456  GLU A OE1 
3637 O OE2 . GLU A 456 ? 0.5742 0.5430 0.5839 -0.0042 -0.0025 0.0010  456  GLU A OE2 
3638 N N   . ASP A 457 ? 0.3293 0.3660 0.3622 0.0146  0.0050  0.0058  457  ASP A N   
3639 C CA  . ASP A 457 ? 0.3177 0.3544 0.3524 0.0113  0.0061  0.0068  457  ASP A CA  
3640 C C   . ASP A 457 ? 0.3013 0.3325 0.3171 0.0094  0.0060  0.0100  457  ASP A C   
3641 O O   . ASP A 457 ? 0.2927 0.3317 0.3118 0.0127  0.0141  0.0186  457  ASP A O   
3642 C CB  . ASP A 457 ? 0.3334 0.3562 0.3493 0.0033  0.0008  0.0011  457  ASP A CB  
3643 C CG  . ASP A 457 ? 0.3655 0.4007 0.3946 0.0019  0.0035  -0.0021 457  ASP A CG  
3644 O OD1 . ASP A 457 ? 0.4071 0.4001 0.4314 0.0062  0.0073  -0.0109 457  ASP A OD1 
3645 O OD2 . ASP A 457 ? 0.3632 0.4312 0.3990 -0.0178 -0.0030 -0.0021 457  ASP A OD2 
3646 N N   . LEU A 458 ? 0.2839 0.2980 0.2941 0.0060  0.0042  0.0127  458  LEU A N   
3647 C CA  . LEU A 458 ? 0.2873 0.3016 0.2925 0.0036  0.0065  0.0115  458  LEU A CA  
3648 C C   . LEU A 458 ? 0.2952 0.3038 0.3033 -0.0013 0.0062  0.0128  458  LEU A C   
3649 O O   . LEU A 458 ? 0.2664 0.3160 0.3034 -0.0036 0.0091  0.0170  458  LEU A O   
3650 C CB  . LEU A 458 ? 0.2905 0.3075 0.2997 0.0043  0.0104  0.0080  458  LEU A CB  
3651 C CG  . LEU A 458 ? 0.3008 0.3063 0.2993 0.0082  0.0013  -0.0001 458  LEU A CG  
3652 C CD1 . LEU A 458 ? 0.3207 0.3173 0.3112 -0.0010 -0.0081 -0.0009 458  LEU A CD1 
3653 C CD2 . LEU A 458 ? 0.3171 0.3264 0.3405 -0.0018 -0.0085 -0.0011 458  LEU A CD2 
3654 N N   . GLU A 459 ? 0.3241 0.3101 0.3255 0.0031  -0.0057 0.0047  459  GLU A N   
3655 C CA  . GLU A 459 ? 0.3352 0.3271 0.3374 -0.0025 -0.0055 0.0035  459  GLU A CA  
3656 C C   . GLU A 459 ? 0.3392 0.3299 0.3401 0.0016  0.0034  0.0008  459  GLU A C   
3657 O O   . GLU A 459 ? 0.3435 0.3319 0.3315 0.0003  0.0047  0.0011  459  GLU A O   
3658 C CB  . GLU A 459 ? 0.3532 0.3288 0.3428 0.0004  -0.0043 0.0059  459  GLU A CB  
3659 C CG  . GLU A 459 ? 0.3769 0.3869 0.3899 -0.0108 -0.0128 0.0020  459  GLU A CG  
3660 C CD  . GLU A 459 ? 0.4223 0.4079 0.4262 -0.0072 -0.0056 0.0047  459  GLU A CD  
3661 O OE1 . GLU A 459 ? 0.4426 0.4318 0.4337 -0.0003 -0.0108 -0.0067 459  GLU A OE1 
3662 O OE2 . GLU A 459 ? 0.4379 0.4496 0.4382 -0.0124 -0.0035 0.0101  459  GLU A OE2 
3663 N N   . ARG A 460 ? 0.3299 0.3208 0.3461 0.0055  0.0016  -0.0021 460  ARG A N   
3664 C CA  . ARG A 460 ? 0.3402 0.3254 0.3407 0.0077  0.0040  0.0069  460  ARG A CA  
3665 C C   . ARG A 460 ? 0.3154 0.3160 0.3196 0.0069  0.0022  0.0008  460  ARG A C   
3666 O O   . ARG A 460 ? 0.3379 0.3348 0.3248 0.0033  0.0055  0.0023  460  ARG A O   
3667 C CB  . ARG A 460 ? 0.3511 0.3586 0.3602 0.0106  0.0041  0.0040  460  ARG A CB  
3668 C CG  . ARG A 460 ? 0.4394 0.3895 0.4250 0.0005  0.0000  0.0034  460  ARG A CG  
3669 C CD  . ARG A 460 ? 0.4882 0.5069 0.5370 0.0141  0.0074  0.0000  460  ARG A CD  
3670 N NE  . ARG A 460 ? 0.5823 0.5878 0.5704 -0.0014 -0.0113 -0.0020 460  ARG A NE  
3671 C CZ  . ARG A 460 ? 0.6129 0.6209 0.6280 0.0099  -0.0042 0.0012  460  ARG A CZ  
3672 N NH1 . ARG A 460 ? 0.6359 0.6310 0.6271 0.0027  0.0023  -0.0062 460  ARG A NH1 
3673 N NH2 . ARG A 460 ? 0.6426 0.6453 0.6359 0.0006  -0.0071 -0.0007 460  ARG A NH2 
3674 N N   . LEU A 461 ? 0.2855 0.2886 0.2867 0.0151  0.0046  0.0087  461  LEU A N   
3675 C CA  . LEU A 461 ? 0.2510 0.2708 0.2540 0.0032  0.0126  0.0044  461  LEU A CA  
3676 C C   . LEU A 461 ? 0.2232 0.2349 0.2290 0.0026  0.0080  0.0139  461  LEU A C   
3677 O O   . LEU A 461 ? 0.2123 0.2317 0.2158 0.0082  0.0190  0.0163  461  LEU A O   
3678 C CB  . LEU A 461 ? 0.2656 0.2855 0.2610 0.0009  0.0051  0.0068  461  LEU A CB  
3679 C CG  . LEU A 461 ? 0.2869 0.2943 0.2701 -0.0003 0.0116  0.0002  461  LEU A CG  
3680 C CD1 . LEU A 461 ? 0.3183 0.3011 0.2708 0.0060  0.0010  0.0182  461  LEU A CD1 
3681 C CD2 . LEU A 461 ? 0.3031 0.3216 0.3074 -0.0030 -0.0082 0.0026  461  LEU A CD2 
3682 N N   . LEU A 462 ? 0.1921 0.2106 0.1984 0.0108  0.0105  0.0065  462  LEU A N   
3683 C CA  . LEU A 462 ? 0.1848 0.1921 0.1874 0.0022  0.0127  0.0184  462  LEU A CA  
3684 C C   . LEU A 462 ? 0.1831 0.1789 0.1810 -0.0013 0.0098  0.0095  462  LEU A C   
3685 O O   . LEU A 462 ? 0.1589 0.1620 0.1536 -0.0012 0.0135  0.0258  462  LEU A O   
3686 C CB  . LEU A 462 ? 0.1967 0.1949 0.1948 -0.0051 0.0211  0.0184  462  LEU A CB  
3687 C CG  . LEU A 462 ? 0.2168 0.1985 0.2055 0.0103  0.0142  0.0093  462  LEU A CG  
3688 C CD1 . LEU A 462 ? 0.2244 0.2014 0.2009 0.0030  0.0136  -0.0028 462  LEU A CD1 
3689 C CD2 . LEU A 462 ? 0.2447 0.2101 0.2356 -0.0091 0.0182  0.0213  462  LEU A CD2 
3690 N N   . PRO A 463 ? 0.1940 0.1735 0.1872 0.0081  0.0187  0.0089  463  PRO A N   
3691 C CA  . PRO A 463 ? 0.1946 0.1708 0.1745 -0.0047 0.0136  0.0016  463  PRO A CA  
3692 C C   . PRO A 463 ? 0.1664 0.1587 0.1710 0.0058  0.0146  0.0062  463  PRO A C   
3693 O O   . PRO A 463 ? 0.1621 0.1799 0.1589 0.0004  0.0161  -0.0008 463  PRO A O   
3694 C CB  . PRO A 463 ? 0.2302 0.1748 0.1864 -0.0075 0.0131  0.0002  463  PRO A CB  
3695 C CG  . PRO A 463 ? 0.2437 0.2267 0.2451 0.0079  -0.0034 -0.0080 463  PRO A CG  
3696 C CD  . PRO A 463 ? 0.2196 0.1845 0.1983 0.0066  0.0159  0.0045  463  PRO A CD  
3697 N N   . HIS A 464 ? 0.1478 0.1447 0.1663 -0.0009 0.0114  0.0170  464  HIS A N   
3698 C CA  . HIS A 464 ? 0.1315 0.1494 0.1615 0.0055  0.0166  0.0091  464  HIS A CA  
3699 C C   . HIS A 464 ? 0.1476 0.1497 0.1587 0.0003  0.0037  0.0148  464  HIS A C   
3700 O O   . HIS A 464 ? 0.1346 0.1469 0.1524 0.0041  0.0066  0.0262  464  HIS A O   
3701 C CB  . HIS A 464 ? 0.1225 0.1534 0.1632 0.0035  0.0151  0.0055  464  HIS A CB  
3702 C CG  . HIS A 464 ? 0.1372 0.1511 0.1598 -0.0066 0.0001  0.0057  464  HIS A CG  
3703 N ND1 . HIS A 464 ? 0.1581 0.1601 0.1784 -0.0172 0.0094  0.0117  464  HIS A ND1 
3704 C CD2 . HIS A 464 ? 0.1655 0.1368 0.1983 -0.0126 0.0156  0.0006  464  HIS A CD2 
3705 C CE1 . HIS A 464 ? 0.1672 0.1769 0.1927 0.0019  0.0094  -0.0079 464  HIS A CE1 
3706 N NE2 . HIS A 464 ? 0.1432 0.1793 0.1663 -0.0081 0.0163  -0.0059 464  HIS A NE2 
3707 N N   . LYS A 465 ? 0.1399 0.1537 0.1459 0.0018  0.0085  -0.0014 465  LYS A N   
3708 C CA  . LYS A 465 ? 0.1407 0.1571 0.1525 0.0012  0.0053  0.0049  465  LYS A CA  
3709 C C   . LYS A 465 ? 0.1415 0.1485 0.1367 0.0023  0.0070  0.0090  465  LYS A C   
3710 O O   . LYS A 465 ? 0.1260 0.1545 0.1415 0.0028  0.0233  0.0048  465  LYS A O   
3711 C CB  . LYS A 465 ? 0.1503 0.1570 0.1517 0.0004  0.0015  -0.0002 465  LYS A CB  
3712 C CG  . LYS A 465 ? 0.1844 0.2307 0.2079 0.0260  -0.0003 0.0039  465  LYS A CG  
3713 C CD  . LYS A 465 ? 0.2948 0.3021 0.2911 -0.0088 -0.0171 -0.0156 465  LYS A CD  
3714 C CE  . LYS A 465 ? 0.3000 0.2974 0.3402 0.0016  -0.0074 0.0125  465  LYS A CE  
3715 N NZ  . LYS A 465 ? 0.2944 0.2868 0.3025 -0.0112 -0.0200 0.0149  465  LYS A NZ  
3716 N N   . VAL A 466 ? 0.1152 0.1333 0.1429 -0.0033 0.0073  0.0203  466  VAL A N   
3717 C CA  . VAL A 466 ? 0.1322 0.1437 0.1442 0.0081  0.0057  0.0203  466  VAL A CA  
3718 C C   . VAL A 466 ? 0.1449 0.1435 0.1413 0.0098  0.0022  0.0131  466  VAL A C   
3719 O O   . VAL A 466 ? 0.1643 0.1630 0.1536 0.0083  0.0102  0.0241  466  VAL A O   
3720 C CB  . VAL A 466 ? 0.1276 0.1447 0.1374 0.0088  -0.0087 0.0050  466  VAL A CB  
3721 C CG1 . VAL A 466 ? 0.1251 0.1484 0.1525 0.0066  0.0081  0.0047  466  VAL A CG1 
3722 C CG2 . VAL A 466 ? 0.1455 0.1684 0.1483 0.0081  0.0200  0.0205  466  VAL A CG2 
3723 N N   . PHE A 467 ? 0.1414 0.1400 0.1475 0.0058  0.0076  0.0162  467  PHE A N   
3724 C CA  . PHE A 467 ? 0.1309 0.1285 0.1434 0.0023  0.0073  0.0116  467  PHE A CA  
3725 C C   . PHE A 467 ? 0.1326 0.1276 0.1498 0.0042  0.0033  0.0105  467  PHE A C   
3726 O O   . PHE A 467 ? 0.1444 0.1352 0.1547 0.0114  -0.0014 0.0045  467  PHE A O   
3727 C CB  . PHE A 467 ? 0.1311 0.1404 0.1514 -0.0024 0.0185  0.0027  467  PHE A CB  
3728 C CG  . PHE A 467 ? 0.1237 0.1390 0.1516 0.0118  0.0162  0.0000  467  PHE A CG  
3729 C CD1 . PHE A 467 ? 0.1467 0.1493 0.1576 -0.0076 0.0139  -0.0059 467  PHE A CD1 
3730 C CD2 . PHE A 467 ? 0.1342 0.1640 0.1454 0.0004  0.0027  -0.0077 467  PHE A CD2 
3731 C CE1 . PHE A 467 ? 0.1265 0.1608 0.1491 0.0074  0.0040  0.0063  467  PHE A CE1 
3732 C CE2 . PHE A 467 ? 0.1375 0.1494 0.1429 0.0047  0.0018  0.0099  467  PHE A CE2 
3733 C CZ  . PHE A 467 ? 0.1494 0.1533 0.1479 0.0087  0.0055  0.0045  467  PHE A CZ  
3734 N N   . GLU A 468 ? 0.1273 0.1323 0.1603 0.0008  0.0054  0.0058  468  GLU A N   
3735 C CA  . GLU A 468 ? 0.1263 0.1460 0.1708 0.0006  0.0054  0.0037  468  GLU A CA  
3736 C C   . GLU A 468 ? 0.1352 0.1476 0.1685 0.0002  0.0035  0.0060  468  GLU A C   
3737 O O   . GLU A 468 ? 0.1406 0.1592 0.1663 0.0158  0.0118  0.0189  468  GLU A O   
3738 C CB  . GLU A 468 ? 0.1446 0.1530 0.1823 -0.0029 0.0015  0.0044  468  GLU A CB  
3739 C CG  . GLU A 468 ? 0.1748 0.1707 0.2223 0.0038  0.0021  0.0013  468  GLU A CG  
3740 C CD  . GLU A 468 ? 0.2503 0.2270 0.2392 -0.0007 0.0052  -0.0119 468  GLU A CD  
3741 O OE1 . GLU A 468 ? 0.3060 0.2399 0.2825 -0.0143 0.0130  0.0034  468  GLU A OE1 
3742 O OE2 . GLU A 468 ? 0.2742 0.2152 0.2549 -0.0016 -0.0091 -0.0048 468  GLU A OE2 
3743 N N   . GLY A 469 ? 0.1438 0.1400 0.1636 0.0066  0.0012  0.0038  469  GLY A N   
3744 C CA  . GLY A 469 ? 0.1435 0.1428 0.1578 0.0040  0.0055  0.0053  469  GLY A CA  
3745 C C   . GLY A 469 ? 0.1497 0.1437 0.1537 -0.0011 0.0032  0.0043  469  GLY A C   
3746 O O   . GLY A 469 ? 0.1545 0.1281 0.1525 0.0108  0.0152  -0.0040 469  GLY A O   
3747 N N   . ASN A 470 ? 0.1367 0.1349 0.1537 0.0015  0.0037  0.0045  470  ASN A N   
3748 C CA  . ASN A 470 ? 0.1379 0.1489 0.1588 0.0001  -0.0027 0.0095  470  ASN A CA  
3749 C C   . ASN A 470 ? 0.1260 0.1453 0.1498 -0.0018 0.0074  0.0046  470  ASN A C   
3750 O O   . ASN A 470 ? 0.1267 0.1630 0.1652 0.0006  0.0087  0.0099  470  ASN A O   
3751 C CB  . ASN A 470 ? 0.1484 0.1599 0.1827 -0.0011 -0.0044 0.0084  470  ASN A CB  
3752 C CG  . ASN A 470 ? 0.1631 0.1768 0.1862 -0.0035 0.0089  0.0024  470  ASN A CG  
3753 O OD1 . ASN A 470 ? 0.1652 0.1830 0.2337 0.0030  0.0169  0.0026  470  ASN A OD1 
3754 N ND2 . ASN A 470 ? 0.1911 0.2345 0.1915 -0.0223 0.0025  -0.0115 470  ASN A ND2 
3755 N N   . ARG A 471 ? 0.1270 0.1442 0.1506 0.0024  0.0027  0.0030  471  ARG A N   
3756 C CA  . ARG A 471 ? 0.1127 0.1255 0.1516 0.0060  0.0125  0.0048  471  ARG A CA  
3757 C C   . ARG A 471 ? 0.1274 0.1253 0.1427 -0.0009 0.0028  0.0028  471  ARG A C   
3758 O O   . ARG A 471 ? 0.1305 0.1358 0.1193 0.0109  -0.0007 0.0105  471  ARG A O   
3759 C CB  . ARG A 471 ? 0.1035 0.1146 0.1461 0.0066  0.0097  0.0029  471  ARG A CB  
3760 C CG  . ARG A 471 ? 0.1263 0.1335 0.1559 0.0045  0.0147  -0.0102 471  ARG A CG  
3761 C CD  . ARG A 471 ? 0.1438 0.1547 0.1604 0.0241  -0.0042 -0.0138 471  ARG A CD  
3762 N NE  . ARG A 471 ? 0.1389 0.1283 0.1689 0.0213  -0.0100 -0.0077 471  ARG A NE  
3763 C CZ  . ARG A 471 ? 0.1348 0.1350 0.1447 0.0051  -0.0017 0.0012  471  ARG A CZ  
3764 N NH1 . ARG A 471 ? 0.1430 0.1672 0.1589 0.0095  0.0041  0.0250  471  ARG A NH1 
3765 N NH2 . ARG A 471 ? 0.1317 0.1555 0.1462 0.0196  0.0009  0.0036  471  ARG A NH2 
3766 N N   . PRO A 472 ? 0.1332 0.1247 0.1380 0.0039  -0.0036 -0.0016 472  PRO A N   
3767 C CA  . PRO A 472 ? 0.1340 0.1272 0.1484 0.0036  -0.0027 0.0021  472  PRO A CA  
3768 C C   . PRO A 472 ? 0.1432 0.1278 0.1388 0.0038  -0.0028 0.0017  472  PRO A C   
3769 O O   . PRO A 472 ? 0.1415 0.1299 0.1529 0.0121  0.0009  0.0167  472  PRO A O   
3770 C CB  . PRO A 472 ? 0.1376 0.1238 0.1480 0.0068  -0.0072 -0.0124 472  PRO A CB  
3771 C CG  . PRO A 472 ? 0.1559 0.1502 0.1491 0.0201  0.0047  -0.0066 472  PRO A CG  
3772 C CD  . PRO A 472 ? 0.1378 0.1386 0.1396 0.0073  -0.0177 0.0023  472  PRO A CD  
3773 N N   . THR A 473 ? 0.1424 0.1186 0.1336 0.0005  -0.0035 0.0027  473  THR A N   
3774 C CA  . THR A 473 ? 0.1334 0.1220 0.1387 0.0045  -0.0010 0.0071  473  THR A CA  
3775 C C   . THR A 473 ? 0.1427 0.1193 0.1298 0.0032  0.0072  -0.0011 473  THR A C   
3776 O O   . THR A 473 ? 0.1371 0.1287 0.1285 0.0006  0.0023  0.0097  473  THR A O   
3777 C CB  . THR A 473 ? 0.1518 0.1375 0.1273 0.0163  -0.0006 0.0000  473  THR A CB  
3778 O OG1 . THR A 473 ? 0.1404 0.1445 0.1315 0.0240  0.0111  0.0009  473  THR A OG1 
3779 C CG2 . THR A 473 ? 0.1328 0.1490 0.1431 0.0155  -0.0187 -0.0016 473  THR A CG2 
3780 N N   . ASN A 474 ? 0.1286 0.0915 0.1155 0.0053  0.0011  0.0000  474  ASN A N   
3781 C CA  . ASN A 474 ? 0.1302 0.1098 0.1179 0.0113  0.0010  0.0019  474  ASN A CA  
3782 C C   . ASN A 474 ? 0.1308 0.1156 0.1196 0.0105  0.0024  0.0010  474  ASN A C   
3783 O O   . ASN A 474 ? 0.1223 0.1177 0.1390 0.0093  0.0078  -0.0081 474  ASN A O   
3784 C CB  . ASN A 474 ? 0.1386 0.1179 0.1200 0.0038  -0.0151 0.0076  474  ASN A CB  
3785 C CG  . ASN A 474 ? 0.1233 0.1184 0.1400 0.0004  0.0023  -0.0012 474  ASN A CG  
3786 O OD1 . ASN A 474 ? 0.1957 0.1460 0.1531 0.0122  -0.0282 0.0022  474  ASN A OD1 
3787 N ND2 . ASN A 474 ? 0.1172 0.0685 0.1034 0.0049  0.0009  0.0006  474  ASN A ND2 
3788 N N   . SER A 475 ? 0.1343 0.1150 0.1091 0.0003  0.0055  0.0001  475  SER A N   
3789 C CA  . SER A 475 ? 0.1367 0.1200 0.1178 0.0089  0.0038  0.0003  475  SER A CA  
3790 C C   . SER A 475 ? 0.1405 0.1219 0.1297 0.0048  0.0077  0.0019  475  SER A C   
3791 O O   . SER A 475 ? 0.1432 0.1250 0.1491 0.0108  0.0191  0.0099  475  SER A O   
3792 C CB  . SER A 475 ? 0.1609 0.1280 0.1285 0.0094  -0.0021 -0.0045 475  SER A CB  
3793 O OG  . SER A 475 ? 0.1428 0.1328 0.1248 0.0205  0.0129  -0.0105 475  SER A OG  
3794 N N   . ILE A 476 ? 0.1259 0.1054 0.1298 0.0081  0.0126  0.0029  476  ILE A N   
3795 C CA  . ILE A 476 ? 0.1369 0.1168 0.1340 -0.0032 -0.0001 0.0038  476  ILE A CA  
3796 C C   . ILE A 476 ? 0.1464 0.1209 0.1352 0.0034  -0.0007 0.0009  476  ILE A C   
3797 O O   . ILE A 476 ? 0.1455 0.1123 0.1419 0.0018  0.0029  -0.0098 476  ILE A O   
3798 C CB  . ILE A 476 ? 0.1405 0.1254 0.1502 -0.0001 -0.0044 0.0079  476  ILE A CB  
3799 C CG1 . ILE A 476 ? 0.1523 0.1375 0.1446 -0.0068 -0.0044 -0.0102 476  ILE A CG1 
3800 C CG2 . ILE A 476 ? 0.1688 0.1320 0.1779 0.0116  -0.0057 0.0055  476  ILE A CG2 
3801 C CD1 . ILE A 476 ? 0.1707 0.2015 0.1507 -0.0164 -0.0125 -0.0040 476  ILE A CD1 
3802 N N   . VAL A 477 ? 0.1318 0.1312 0.1227 0.0000  0.0054  -0.0061 477  VAL A N   
3803 C CA  . VAL A 477 ? 0.1556 0.1262 0.1420 -0.0025 0.0026  -0.0028 477  VAL A CA  
3804 C C   . VAL A 477 ? 0.1502 0.1346 0.1434 0.0070  0.0000  -0.0074 477  VAL A C   
3805 O O   . VAL A 477 ? 0.1632 0.1308 0.1661 0.0160  0.0098  -0.0244 477  VAL A O   
3806 C CB  . VAL A 477 ? 0.1628 0.1463 0.1500 -0.0055 -0.0067 -0.0070 477  VAL A CB  
3807 C CG1 . VAL A 477 ? 0.1448 0.1594 0.1562 -0.0050 0.0036  -0.0075 477  VAL A CG1 
3808 C CG2 . VAL A 477 ? 0.1495 0.1453 0.1460 0.0072  0.0035  0.0033  477  VAL A CG2 
3809 N N   . PHE A 478 ? 0.1438 0.1038 0.1204 0.0123  -0.0057 -0.0049 478  PHE A N   
3810 C CA  . PHE A 478 ? 0.1469 0.1166 0.1278 0.0094  -0.0078 0.0005  478  PHE A CA  
3811 C C   . PHE A 478 ? 0.1538 0.1183 0.1426 0.0073  -0.0007 -0.0043 478  PHE A C   
3812 O O   . PHE A 478 ? 0.1536 0.1200 0.1313 0.0030  0.0059  -0.0074 478  PHE A O   
3813 C CB  . PHE A 478 ? 0.1503 0.1152 0.1188 0.0091  0.0076  0.0030  478  PHE A CB  
3814 C CG  . PHE A 478 ? 0.1486 0.1491 0.1326 0.0116  -0.0020 0.0059  478  PHE A CG  
3815 C CD1 . PHE A 478 ? 0.1696 0.1977 0.1545 0.0047  -0.0058 0.0065  478  PHE A CD1 
3816 C CD2 . PHE A 478 ? 0.1959 0.1746 0.1383 0.0166  -0.0132 0.0049  478  PHE A CD2 
3817 C CE1 . PHE A 478 ? 0.1746 0.2137 0.1535 0.0093  -0.0073 -0.0008 478  PHE A CE1 
3818 C CE2 . PHE A 478 ? 0.2031 0.2020 0.1683 0.0162  -0.0005 0.0126  478  PHE A CE2 
3819 C CZ  . PHE A 478 ? 0.1825 0.1989 0.1446 0.0164  -0.0093 0.0108  478  PHE A CZ  
3820 N N   . THR A 479 ? 0.1500 0.1181 0.1412 0.0066  -0.0044 -0.0139 479  THR A N   
3821 C CA  . THR A 479 ? 0.1430 0.1259 0.1539 0.0066  -0.0015 -0.0137 479  THR A CA  
3822 C C   . THR A 479 ? 0.1469 0.1249 0.1463 0.0022  -0.0049 -0.0156 479  THR A C   
3823 O O   . THR A 479 ? 0.1584 0.1260 0.1396 0.0104  -0.0117 -0.0055 479  THR A O   
3824 C CB  . THR A 479 ? 0.1493 0.1302 0.1488 -0.0006 0.0044  -0.0200 479  THR A CB  
3825 O OG1 . THR A 479 ? 0.1421 0.1373 0.1570 0.0088  0.0011  -0.0207 479  THR A OG1 
3826 C CG2 . THR A 479 ? 0.1640 0.1450 0.1594 -0.0004 -0.0020 -0.0126 479  THR A CG2 
3827 N N   . LYS A 480 ? 0.1428 0.1138 0.1498 -0.0006 0.0044  -0.0102 480  LYS A N   
3828 C CA  . LYS A 480 ? 0.1486 0.1300 0.1404 -0.0054 0.0008  -0.0116 480  LYS A CA  
3829 C C   . LYS A 480 ? 0.1581 0.1372 0.1426 0.0003  0.0005  -0.0110 480  LYS A C   
3830 O O   . LYS A 480 ? 0.1630 0.1449 0.1371 -0.0125 -0.0006 -0.0176 480  LYS A O   
3831 C CB  . LYS A 480 ? 0.1352 0.1132 0.1460 0.0021  0.0140  -0.0151 480  LYS A CB  
3832 C CG  . LYS A 480 ? 0.1526 0.1364 0.1774 -0.0137 -0.0039 -0.0110 480  LYS A CG  
3833 C CD  . LYS A 480 ? 0.1906 0.1760 0.1838 -0.0103 -0.0007 -0.0265 480  LYS A CD  
3834 C CE  . LYS A 480 ? 0.1932 0.2096 0.2040 -0.0200 -0.0031 -0.0195 480  LYS A CE  
3835 N NZ  . LYS A 480 ? 0.2517 0.2464 0.2395 -0.0290 -0.0007 -0.0365 480  LYS A NZ  
3836 N N   . LEU A 481 ? 0.1523 0.1374 0.1294 -0.0050 -0.0001 -0.0145 481  LEU A N   
3837 C CA  . LEU A 481 ? 0.1626 0.1410 0.1382 0.0044  -0.0030 -0.0051 481  LEU A CA  
3838 C C   . LEU A 481 ? 0.1484 0.1340 0.1327 -0.0033 -0.0050 -0.0075 481  LEU A C   
3839 O O   . LEU A 481 ? 0.1678 0.1330 0.1476 0.0098  -0.0135 -0.0068 481  LEU A O   
3840 C CB  . LEU A 481 ? 0.1628 0.1382 0.1363 0.0010  -0.0005 -0.0138 481  LEU A CB  
3841 C CG  . LEU A 481 ? 0.1781 0.1665 0.1451 0.0008  0.0009  -0.0026 481  LEU A CG  
3842 C CD1 . LEU A 481 ? 0.1843 0.1927 0.1758 0.0031  -0.0075 0.0013  481  LEU A CD1 
3843 C CD2 . LEU A 481 ? 0.2022 0.1964 0.1675 0.0081  0.0045  -0.0060 481  LEU A CD2 
3844 N N   . THR A 482 ? 0.1484 0.1255 0.1359 -0.0051 -0.0136 -0.0092 482  THR A N   
3845 C CA  . THR A 482 ? 0.1430 0.1333 0.1428 -0.0008 -0.0043 -0.0062 482  THR A CA  
3846 C C   . THR A 482 ? 0.1309 0.1320 0.1408 -0.0017 -0.0004 -0.0021 482  THR A C   
3847 O O   . THR A 482 ? 0.1306 0.1218 0.1612 0.0052  0.0059  -0.0209 482  THR A O   
3848 C CB  . THR A 482 ? 0.1319 0.1412 0.1326 -0.0024 -0.0054 -0.0065 482  THR A CB  
3849 O OG1 . THR A 482 ? 0.1393 0.1479 0.1409 0.0031  -0.0113 -0.0063 482  THR A OG1 
3850 C CG2 . THR A 482 ? 0.1655 0.1916 0.1380 -0.0017 0.0084  -0.0023 482  THR A CG2 
3851 N N   . PRO A 483 ? 0.1374 0.1348 0.1516 -0.0043 -0.0057 -0.0024 483  PRO A N   
3852 C CA  . PRO A 483 ? 0.1323 0.1335 0.1404 -0.0049 -0.0043 0.0066  483  PRO A CA  
3853 C C   . PRO A 483 ? 0.1291 0.1311 0.1367 0.0017  0.0043  -0.0002 483  PRO A C   
3854 O O   . PRO A 483 ? 0.1106 0.1119 0.1446 0.0029  0.0061  -0.0014 483  PRO A O   
3855 C CB  . PRO A 483 ? 0.1462 0.1163 0.1472 -0.0005 -0.0042 -0.0025 483  PRO A CB  
3856 C CG  . PRO A 483 ? 0.1445 0.1495 0.1457 -0.0027 -0.0011 0.0042  483  PRO A CG  
3857 C CD  . PRO A 483 ? 0.1577 0.1342 0.1488 -0.0093 -0.0038 0.0075  483  PRO A CD  
3858 N N   . PHE A 484 ? 0.1214 0.1240 0.1406 0.0044  0.0010  -0.0078 484  PHE A N   
3859 C CA  . PHE A 484 ? 0.1383 0.1333 0.1544 0.0017  0.0081  -0.0030 484  PHE A CA  
3860 C C   . PHE A 484 ? 0.1384 0.1315 0.1467 0.0019  -0.0018 -0.0048 484  PHE A C   
3861 O O   . PHE A 484 ? 0.1449 0.1147 0.1386 0.0050  -0.0001 -0.0112 484  PHE A O   
3862 C CB  . PHE A 484 ? 0.1478 0.1276 0.1537 0.0034  0.0091  -0.0122 484  PHE A CB  
3863 C CG  . PHE A 484 ? 0.1568 0.1483 0.1485 -0.0032 -0.0052 -0.0034 484  PHE A CG  
3864 C CD1 . PHE A 484 ? 0.1599 0.1823 0.1579 -0.0069 0.0122  0.0097  484  PHE A CD1 
3865 C CD2 . PHE A 484 ? 0.1524 0.1563 0.1596 0.0104  -0.0074 -0.0165 484  PHE A CD2 
3866 C CE1 . PHE A 484 ? 0.1621 0.1714 0.1789 0.0008  0.0077  0.0066  484  PHE A CE1 
3867 C CE2 . PHE A 484 ? 0.1529 0.1694 0.1387 -0.0079 -0.0076 -0.0118 484  PHE A CE2 
3868 C CZ  . PHE A 484 ? 0.1708 0.1669 0.1631 -0.0010 0.0033  -0.0018 484  PHE A CZ  
3869 N N   . MET A 485 ? 0.1356 0.1323 0.1317 -0.0008 -0.0026 0.0020  485  MET A N   
3870 C CA  . MET A 485 ? 0.1502 0.1175 0.1250 0.0010  -0.0096 -0.0066 485  MET A CA  
3871 C C   . MET A 485 ? 0.1373 0.1226 0.1169 0.0038  0.0011  -0.0050 485  MET A C   
3872 O O   . MET A 485 ? 0.1489 0.1119 0.1236 0.0013  -0.0055 0.0017  485  MET A O   
3873 C CB  . MET A 485 ? 0.1490 0.1263 0.1343 0.0043  -0.0037 0.0091  485  MET A CB  
3874 C CG  . MET A 485 ? 0.1792 0.1278 0.1857 -0.0067 0.0041  -0.0017 485  MET A CG  
3875 S SD  . MET A 485 ? 0.2202 0.2150 0.1970 -0.0127 0.0192  -0.0125 485  MET A SD  
3876 C CE  . MET A 485 ? 0.2230 0.1495 0.1680 -0.0055 0.0122  -0.0122 485  MET A CE  
3877 N N   . LEU A 486 ? 0.1307 0.1100 0.1113 -0.0016 -0.0090 -0.0120 486  LEU A N   
3878 C CA  . LEU A 486 ? 0.1088 0.1305 0.1107 0.0062  -0.0004 -0.0104 486  LEU A CA  
3879 C C   . LEU A 486 ? 0.1154 0.1254 0.1203 0.0030  -0.0013 -0.0118 486  LEU A C   
3880 O O   . LEU A 486 ? 0.0904 0.1368 0.1442 -0.0049 -0.0095 -0.0152 486  LEU A O   
3881 C CB  . LEU A 486 ? 0.1099 0.1345 0.1055 -0.0047 0.0014  -0.0133 486  LEU A CB  
3882 C CG  . LEU A 486 ? 0.1294 0.1145 0.1118 -0.0019 0.0064  -0.0046 486  LEU A CG  
3883 C CD1 . LEU A 486 ? 0.1347 0.1213 0.1349 0.0051  -0.0088 0.0168  486  LEU A CD1 
3884 C CD2 . LEU A 486 ? 0.1245 0.1946 0.1579 -0.0005 0.0012  -0.0091 486  LEU A CD2 
3885 N N   . GLY A 487 ? 0.1083 0.1317 0.1227 0.0033  0.0068  -0.0018 487  GLY A N   
3886 C CA  . GLY A 487 ? 0.1178 0.1387 0.1296 0.0009  0.0059  0.0023  487  GLY A CA  
3887 C C   . GLY A 487 ? 0.1262 0.1295 0.1365 -0.0018 0.0063  0.0003  487  GLY A C   
3888 O O   . GLY A 487 ? 0.1393 0.1279 0.1397 -0.0021 0.0143  0.0032  487  GLY A O   
3889 N N   . ALA A 488 ? 0.1091 0.1067 0.1279 0.0058  0.0146  0.0013  488  ALA A N   
3890 C CA  . ALA A 488 ? 0.1269 0.0996 0.1286 0.0020  0.0060  -0.0080 488  ALA A CA  
3891 C C   . ALA A 488 ? 0.1233 0.1039 0.1522 0.0048  -0.0023 0.0031  488  ALA A C   
3892 O O   . ALA A 488 ? 0.1220 0.1008 0.1326 -0.0062 -0.0035 0.0012  488  ALA A O   
3893 C CB  . ALA A 488 ? 0.1289 0.1286 0.1228 0.0110  0.0167  -0.0070 488  ALA A CB  
3894 N N   . LEU A 489 ? 0.1162 0.1081 0.1437 0.0005  0.0046  0.0031  489  LEU A N   
3895 C CA  . LEU A 489 ? 0.1161 0.1072 0.1268 0.0075  -0.0045 -0.0018 489  LEU A CA  
3896 C C   . LEU A 489 ? 0.1132 0.1152 0.1219 0.0006  0.0005  0.0030  489  LEU A C   
3897 O O   . LEU A 489 ? 0.1149 0.0991 0.1311 0.0012  0.0063  0.0063  489  LEU A O   
3898 C CB  . LEU A 489 ? 0.1080 0.1186 0.1230 0.0082  -0.0046 -0.0044 489  LEU A CB  
3899 C CG  . LEU A 489 ? 0.1259 0.1568 0.1273 -0.0004 -0.0008 -0.0023 489  LEU A CG  
3900 C CD1 . LEU A 489 ? 0.1299 0.1474 0.1267 0.0113  -0.0169 0.0118  489  LEU A CD1 
3901 C CD2 . LEU A 489 ? 0.1649 0.1433 0.1215 0.0095  0.0061  0.0056  489  LEU A CD2 
3902 N N   . VAL A 490 ? 0.1049 0.1104 0.1190 0.0025  -0.0051 0.0108  490  VAL A N   
3903 C CA  . VAL A 490 ? 0.1149 0.1102 0.1232 -0.0033 -0.0010 -0.0006 490  VAL A CA  
3904 C C   . VAL A 490 ? 0.1227 0.1097 0.1303 0.0002  -0.0081 0.0033  490  VAL A C   
3905 O O   . VAL A 490 ? 0.1303 0.1177 0.1259 -0.0059 -0.0155 -0.0094 490  VAL A O   
3906 C CB  . VAL A 490 ? 0.1115 0.1301 0.1213 -0.0032 0.0019  -0.0008 490  VAL A CB  
3907 C CG1 . VAL A 490 ? 0.1607 0.1211 0.1263 -0.0056 -0.0033 0.0059  490  VAL A CG1 
3908 C CG2 . VAL A 490 ? 0.1310 0.1503 0.1528 0.0112  -0.0041 -0.0023 490  VAL A CG2 
3909 N N   . ALA A 491 ? 0.1098 0.1121 0.1230 0.0113  -0.0041 0.0017  491  ALA A N   
3910 C CA  . ALA A 491 ? 0.1106 0.1049 0.1419 0.0003  0.0023  -0.0025 491  ALA A CA  
3911 C C   . ALA A 491 ? 0.1259 0.1109 0.1220 0.0045  0.0009  -0.0004 491  ALA A C   
3912 O O   . ALA A 491 ? 0.1198 0.1263 0.1389 0.0043  0.0011  -0.0058 491  ALA A O   
3913 C CB  . ALA A 491 ? 0.1154 0.1185 0.1289 0.0195  0.0045  -0.0085 491  ALA A CB  
3914 N N   . MET A 492 ? 0.1147 0.1081 0.1115 0.0070  0.0031  0.0008  492  MET A N   
3915 C CA  . MET A 492 ? 0.1197 0.1211 0.1181 0.0024  -0.0002 -0.0005 492  MET A CA  
3916 C C   . MET A 492 ? 0.1160 0.1222 0.1246 0.0047  0.0049  -0.0042 492  MET A C   
3917 O O   . MET A 492 ? 0.1274 0.1216 0.1301 0.0072  0.0006  -0.0118 492  MET A O   
3918 C CB  . MET A 492 ? 0.1330 0.1449 0.1211 -0.0012 0.0043  0.0029  492  MET A CB  
3919 C CG  . MET A 492 ? 0.1377 0.1408 0.1313 -0.0073 0.0003  0.0065  492  MET A CG  
3920 S SD  . MET A 492 ? 0.1808 0.1686 0.1461 -0.0085 0.0060  0.0057  492  MET A SD  
3921 C CE  . MET A 492 ? 0.1828 0.1777 0.2040 0.0056  -0.0033 0.0035  492  MET A CE  
3922 N N   . TYR A 493 ? 0.1127 0.1189 0.1167 0.0080  0.0121  -0.0069 493  TYR A N   
3923 C CA  . TYR A 493 ? 0.1005 0.1064 0.1149 0.0043  0.0004  -0.0063 493  TYR A CA  
3924 C C   . TYR A 493 ? 0.1131 0.1130 0.1122 0.0036  0.0028  0.0034  493  TYR A C   
3925 O O   . TYR A 493 ? 0.1255 0.1044 0.1248 0.0133  0.0074  0.0061  493  TYR A O   
3926 C CB  . TYR A 493 ? 0.1090 0.1049 0.1189 0.0033  -0.0052 0.0008  493  TYR A CB  
3927 C CG  . TYR A 493 ? 0.1101 0.1135 0.0978 -0.0033 0.0029  0.0035  493  TYR A CG  
3928 C CD1 . TYR A 493 ? 0.1185 0.1131 0.1135 -0.0001 0.0028  0.0114  493  TYR A CD1 
3929 C CD2 . TYR A 493 ? 0.1200 0.1125 0.1398 -0.0058 -0.0003 0.0034  493  TYR A CD2 
3930 C CE1 . TYR A 493 ? 0.1251 0.1432 0.1431 0.0005  -0.0110 0.0143  493  TYR A CE1 
3931 C CE2 . TYR A 493 ? 0.1331 0.1670 0.1355 -0.0084 -0.0018 0.0063  493  TYR A CE2 
3932 C CZ  . TYR A 493 ? 0.1374 0.1414 0.1326 -0.0046 0.0034  0.0008  493  TYR A CZ  
3933 O OH  . TYR A 493 ? 0.1602 0.1378 0.1783 0.0150  -0.0293 0.0149  493  TYR A OH  
3934 N N   . GLU A 494 ? 0.1079 0.1088 0.1185 0.0110  0.0027  -0.0008 494  GLU A N   
3935 C CA  . GLU A 494 ? 0.1010 0.0987 0.1109 0.0031  0.0071  0.0068  494  GLU A CA  
3936 C C   . GLU A 494 ? 0.1107 0.1159 0.1171 0.0040  0.0043  -0.0020 494  GLU A C   
3937 O O   . GLU A 494 ? 0.1068 0.1176 0.1137 0.0043  -0.0018 -0.0063 494  GLU A O   
3938 C CB  . GLU A 494 ? 0.1012 0.0945 0.1124 -0.0005 0.0149  0.0091  494  GLU A CB  
3939 C CG  . GLU A 494 ? 0.1157 0.1024 0.1287 -0.0062 0.0035  0.0041  494  GLU A CG  
3940 C CD  . GLU A 494 ? 0.1208 0.1283 0.1385 -0.0025 -0.0052 0.0081  494  GLU A CD  
3941 O OE1 . GLU A 494 ? 0.1187 0.1486 0.1477 0.0088  0.0112  -0.0060 494  GLU A OE1 
3942 O OE2 . GLU A 494 ? 0.1226 0.1228 0.1337 -0.0136 -0.0002 0.0045  494  GLU A OE2 
3943 N N   . HIS A 495 ? 0.1195 0.1196 0.1232 0.0093  0.0119  0.0025  495  HIS A N   
3944 C CA  . HIS A 495 ? 0.1241 0.1214 0.1321 0.0043  0.0091  -0.0086 495  HIS A CA  
3945 C C   . HIS A 495 ? 0.1313 0.1239 0.1372 0.0060  0.0024  -0.0025 495  HIS A C   
3946 O O   . HIS A 495 ? 0.1260 0.1269 0.1298 0.0096  -0.0089 0.0025  495  HIS A O   
3947 C CB  . HIS A 495 ? 0.1392 0.1199 0.1423 0.0055  0.0089  -0.0074 495  HIS A CB  
3948 C CG  . HIS A 495 ? 0.1236 0.1245 0.1227 0.0006  0.0029  0.0005  495  HIS A CG  
3949 N ND1 . HIS A 495 ? 0.1564 0.1308 0.1394 -0.0004 -0.0041 -0.0023 495  HIS A ND1 
3950 C CD2 . HIS A 495 ? 0.1212 0.1088 0.1238 -0.0047 0.0098  0.0092  495  HIS A CD2 
3951 C CE1 . HIS A 495 ? 0.1454 0.1201 0.1383 -0.0057 -0.0027 -0.0086 495  HIS A CE1 
3952 N NE2 . HIS A 495 ? 0.1397 0.1270 0.0957 0.0014  -0.0026 0.0074  495  HIS A NE2 
3953 N N   . LYS A 496 ? 0.1273 0.1069 0.1292 0.0095  0.0091  0.0065  496  LYS A N   
3954 C CA  . LYS A 496 ? 0.1092 0.1001 0.1169 0.0067  0.0000  -0.0049 496  LYS A CA  
3955 C C   . LYS A 496 ? 0.1134 0.1131 0.1228 0.0071  -0.0001 -0.0019 496  LYS A C   
3956 O O   . LYS A 496 ? 0.1078 0.0969 0.1444 0.0047  -0.0028 0.0026  496  LYS A O   
3957 C CB  . LYS A 496 ? 0.1174 0.0876 0.1210 0.0057  -0.0037 -0.0034 496  LYS A CB  
3958 C CG  . LYS A 496 ? 0.1097 0.0886 0.1351 0.0047  -0.0101 0.0115  496  LYS A CG  
3959 C CD  . LYS A 496 ? 0.1172 0.1076 0.1496 0.0140  -0.0080 -0.0044 496  LYS A CD  
3960 C CE  . LYS A 496 ? 0.1171 0.0999 0.1373 0.0070  -0.0157 0.0110  496  LYS A CE  
3961 N NZ  . LYS A 496 ? 0.0979 0.1254 0.1450 0.0255  -0.0072 0.0108  496  LYS A NZ  
3962 N N   . ILE A 497 ? 0.1149 0.1058 0.1078 0.0074  0.0000  0.0000  497  ILE A N   
3963 C CA  . ILE A 497 ? 0.1159 0.1191 0.1104 0.0016  -0.0029 -0.0023 497  ILE A CA  
3964 C C   . ILE A 497 ? 0.1169 0.1162 0.1188 0.0049  -0.0040 -0.0047 497  ILE A C   
3965 O O   . ILE A 497 ? 0.1111 0.1047 0.1016 0.0071  0.0022  -0.0190 497  ILE A O   
3966 C CB  . ILE A 497 ? 0.1090 0.1119 0.1044 0.0013  0.0009  -0.0028 497  ILE A CB  
3967 C CG1 . ILE A 497 ? 0.1260 0.1426 0.1552 -0.0008 -0.0105 0.0020  497  ILE A CG1 
3968 C CG2 . ILE A 497 ? 0.1556 0.1287 0.1152 -0.0054 -0.0085 -0.0092 497  ILE A CG2 
3969 C CD1 . ILE A 497 ? 0.1403 0.1615 0.1647 -0.0102 -0.0074 -0.0027 497  ILE A CD1 
3970 N N   . PHE A 498 ? 0.1165 0.1098 0.1147 0.0084  -0.0037 -0.0055 498  PHE A N   
3971 C CA  . PHE A 498 ? 0.1119 0.1107 0.1377 0.0032  -0.0050 -0.0052 498  PHE A CA  
3972 C C   . PHE A 498 ? 0.1244 0.1225 0.1342 0.0046  -0.0023 -0.0078 498  PHE A C   
3973 O O   . PHE A 498 ? 0.1153 0.1127 0.1375 0.0098  -0.0120 -0.0211 498  PHE A O   
3974 C CB  . PHE A 498 ? 0.1130 0.1153 0.1412 0.0109  -0.0049 0.0001  498  PHE A CB  
3975 C CG  . PHE A 498 ? 0.1170 0.1390 0.1462 0.0006  -0.0049 0.0060  498  PHE A CG  
3976 C CD1 . PHE A 498 ? 0.1396 0.1408 0.1634 0.0088  -0.0051 0.0033  498  PHE A CD1 
3977 C CD2 . PHE A 498 ? 0.1408 0.1256 0.1445 0.0067  0.0050  -0.0134 498  PHE A CD2 
3978 C CE1 . PHE A 498 ? 0.1385 0.1237 0.1472 0.0053  -0.0157 0.0136  498  PHE A CE1 
3979 C CE2 . PHE A 498 ? 0.1782 0.1535 0.1888 0.0108  -0.0034 -0.0006 498  PHE A CE2 
3980 C CZ  . PHE A 498 ? 0.1746 0.1696 0.1833 0.0110  0.0021  -0.0031 498  PHE A CZ  
3981 N N   . VAL A 499 ? 0.1195 0.1192 0.1299 0.0018  0.0060  -0.0013 499  VAL A N   
3982 C CA  . VAL A 499 ? 0.1267 0.1186 0.1333 -0.0039 0.0028  -0.0006 499  VAL A CA  
3983 C C   . VAL A 499 ? 0.1225 0.1185 0.1375 -0.0005 -0.0002 -0.0033 499  VAL A C   
3984 O O   . VAL A 499 ? 0.1295 0.1276 0.1432 0.0013  -0.0047 -0.0068 499  VAL A O   
3985 C CB  . VAL A 499 ? 0.1395 0.1170 0.1314 -0.0026 0.0042  0.0006  499  VAL A CB  
3986 C CG1 . VAL A 499 ? 0.1357 0.1425 0.1376 -0.0149 -0.0014 0.0033  499  VAL A CG1 
3987 C CG2 . VAL A 499 ? 0.1276 0.1258 0.1372 -0.0018 -0.0120 0.0023  499  VAL A CG2 
3988 N N   . GLN A 500 ? 0.1108 0.1083 0.1500 -0.0003 0.0064  -0.0062 500  GLN A N   
3989 C CA  . GLN A 500 ? 0.1089 0.1065 0.1339 0.0069  -0.0001 -0.0016 500  GLN A CA  
3990 C C   . GLN A 500 ? 0.1149 0.1158 0.1368 -0.0005 -0.0033 0.0025  500  GLN A C   
3991 O O   . GLN A 500 ? 0.1191 0.1116 0.1475 -0.0019 0.0038  0.0023  500  GLN A O   
3992 C CB  . GLN A 500 ? 0.0975 0.1104 0.1160 0.0092  0.0049  -0.0019 500  GLN A CB  
3993 C CG  . GLN A 500 ? 0.1145 0.1257 0.1270 0.0176  -0.0020 -0.0021 500  GLN A CG  
3994 C CD  . GLN A 500 ? 0.1197 0.1163 0.1245 -0.0016 -0.0048 -0.0085 500  GLN A CD  
3995 O OE1 . GLN A 500 ? 0.1959 0.1530 0.1673 0.0049  -0.0059 0.0050  500  GLN A OE1 
3996 N NE2 . GLN A 500 ? 0.1014 0.1059 0.0667 0.0089  -0.0087 -0.0046 500  GLN A NE2 
3997 N N   . GLY A 501 ? 0.0949 0.1121 0.1270 0.0089  -0.0021 0.0065  501  GLY A N   
3998 C CA  . GLY A 501 ? 0.1050 0.1322 0.1333 -0.0003 -0.0006 0.0011  501  GLY A CA  
3999 C C   . GLY A 501 ? 0.1133 0.1257 0.1327 0.0055  -0.0052 0.0028  501  GLY A C   
4000 O O   . GLY A 501 ? 0.1047 0.1309 0.1185 -0.0006 -0.0084 0.0035  501  GLY A O   
4001 N N   . ILE A 502 ? 0.1021 0.1289 0.1340 0.0067  -0.0018 -0.0038 502  ILE A N   
4002 C CA  . ILE A 502 ? 0.1200 0.1413 0.1549 0.0028  0.0000  -0.0061 502  ILE A CA  
4003 C C   . ILE A 502 ? 0.1315 0.1280 0.1428 0.0037  -0.0020 -0.0109 502  ILE A C   
4004 O O   . ILE A 502 ? 0.1221 0.1461 0.1628 -0.0051 -0.0014 -0.0103 502  ILE A O   
4005 C CB  . ILE A 502 ? 0.1147 0.1338 0.1599 -0.0032 0.0017  -0.0083 502  ILE A CB  
4006 C CG1 . ILE A 502 ? 0.1368 0.1346 0.1636 0.0039  0.0043  0.0074  502  ILE A CG1 
4007 C CG2 . ILE A 502 ? 0.0998 0.1466 0.1698 0.0079  -0.0003 0.0052  502  ILE A CG2 
4008 C CD1 . ILE A 502 ? 0.1408 0.1751 0.1654 0.0103  0.0130  0.0038  502  ILE A CD1 
4009 N N   . ILE A 503 ? 0.1319 0.1154 0.1373 0.0022  0.0057  -0.0028 503  ILE A N   
4010 C CA  . ILE A 503 ? 0.1266 0.1199 0.1410 -0.0001 0.0064  -0.0071 503  ILE A CA  
4011 C C   . ILE A 503 ? 0.1243 0.1376 0.1539 0.0002  0.0043  -0.0110 503  ILE A C   
4012 O O   . ILE A 503 ? 0.1229 0.1273 0.1660 -0.0050 0.0106  -0.0152 503  ILE A O   
4013 C CB  . ILE A 503 ? 0.1315 0.1177 0.1398 -0.0057 0.0048  -0.0063 503  ILE A CB  
4014 C CG1 . ILE A 503 ? 0.1270 0.1294 0.1354 0.0007  -0.0111 -0.0098 503  ILE A CG1 
4015 C CG2 . ILE A 503 ? 0.1719 0.1205 0.1597 -0.0113 0.0082  -0.0029 503  ILE A CG2 
4016 C CD1 . ILE A 503 ? 0.1741 0.1713 0.1549 -0.0003 -0.0181 -0.0027 503  ILE A CD1 
4017 N N   . TRP A 504 ? 0.1115 0.1446 0.1376 0.0035  0.0070  -0.0080 504  TRP A N   
4018 C CA  . TRP A 504 ? 0.1113 0.1468 0.1498 0.0056  -0.0024 -0.0075 504  TRP A CA  
4019 C C   . TRP A 504 ? 0.1218 0.1462 0.1372 0.0009  0.0047  -0.0065 504  TRP A C   
4020 O O   . TRP A 504 ? 0.1198 0.1488 0.1428 0.0017  -0.0044 -0.0101 504  TRP A O   
4021 C CB  . TRP A 504 ? 0.0979 0.1494 0.1321 0.0028  0.0047  0.0021  504  TRP A CB  
4022 C CG  . TRP A 504 ? 0.1275 0.1436 0.1312 -0.0027 -0.0001 -0.0005 504  TRP A CG  
4023 C CD1 . TRP A 504 ? 0.1344 0.1219 0.1168 0.0075  -0.0119 -0.0024 504  TRP A CD1 
4024 C CD2 . TRP A 504 ? 0.1318 0.1236 0.1237 0.0022  -0.0052 0.0008  504  TRP A CD2 
4025 N NE1 . TRP A 504 ? 0.1193 0.1167 0.1277 0.0047  -0.0142 -0.0019 504  TRP A NE1 
4026 C CE2 . TRP A 504 ? 0.1130 0.1136 0.1122 0.0096  0.0053  -0.0022 504  TRP A CE2 
4027 C CE3 . TRP A 504 ? 0.1288 0.1425 0.1225 0.0021  -0.0025 -0.0019 504  TRP A CE3 
4028 C CZ2 . TRP A 504 ? 0.1373 0.1463 0.1621 -0.0056 -0.0100 -0.0017 504  TRP A CZ2 
4029 C CZ3 . TRP A 504 ? 0.1506 0.1163 0.1313 0.0074  -0.0009 0.0000  504  TRP A CZ3 
4030 C CH2 . TRP A 504 ? 0.1412 0.1171 0.1240 0.0033  0.0024  0.0056  504  TRP A CH2 
4031 N N   . ASP A 505 ? 0.1271 0.1395 0.1437 -0.0055 -0.0064 0.0000  505  ASP A N   
4032 C CA  . ASP A 505 ? 0.1416 0.1553 0.1481 -0.0095 -0.0046 -0.0031 505  ASP A CA  
4033 C C   . ASP A 505 ? 0.1448 0.1530 0.1513 -0.0070 -0.0050 -0.0029 505  ASP A C   
4034 O O   . ASP A 505 ? 0.1410 0.1733 0.1597 -0.0042 -0.0066 0.0000  505  ASP A O   
4035 C CB  . ASP A 505 ? 0.1432 0.1593 0.1580 -0.0050 -0.0091 -0.0099 505  ASP A CB  
4036 C CG  . ASP A 505 ? 0.1887 0.2059 0.1904 0.0078  -0.0268 -0.0110 505  ASP A CG  
4037 O OD1 . ASP A 505 ? 0.2082 0.2407 0.2324 0.0256  -0.0367 -0.0154 505  ASP A OD1 
4038 O OD2 . ASP A 505 ? 0.1741 0.2209 0.1655 0.0005  -0.0172 -0.0155 505  ASP A OD2 
4039 N N   . ILE A 506 ? 0.1378 0.1377 0.1555 -0.0086 0.0031  -0.0020 506  ILE A N   
4040 C CA  . ILE A 506 ? 0.1323 0.1312 0.1500 -0.0058 -0.0016 -0.0059 506  ILE A CA  
4041 C C   . ILE A 506 ? 0.1380 0.1387 0.1446 -0.0041 -0.0042 -0.0064 506  ILE A C   
4042 O O   . ILE A 506 ? 0.1343 0.1304 0.1555 -0.0058 0.0002  -0.0131 506  ILE A O   
4043 C CB  . ILE A 506 ? 0.1432 0.1332 0.1572 -0.0033 -0.0082 -0.0151 506  ILE A CB  
4044 C CG1 . ILE A 506 ? 0.1875 0.2208 0.1690 -0.0005 -0.0075 -0.0016 506  ILE A CG1 
4045 C CG2 . ILE A 506 ? 0.1390 0.1269 0.1833 -0.0064 0.0057  0.0101  506  ILE A CG2 
4046 C CD1 . ILE A 506 ? 0.2274 0.3082 0.2603 0.0036  0.0013  0.0021  506  ILE A CD1 
4047 N N   . ASN A 507 ? 0.1301 0.1258 0.1445 -0.0195 -0.0067 0.0074  507  ASN A N   
4048 C CA  . ASN A 507 ? 0.1338 0.1226 0.1390 -0.0046 -0.0132 0.0014  507  ASN A CA  
4049 C C   . ASN A 507 ? 0.1257 0.1223 0.1371 -0.0039 -0.0043 0.0000  507  ASN A C   
4050 O O   . ASN A 507 ? 0.1128 0.1266 0.1411 -0.0031 -0.0075 -0.0124 507  ASN A O   
4051 C CB  . ASN A 507 ? 0.1471 0.1316 0.1408 -0.0007 -0.0146 0.0148  507  ASN A CB  
4052 C CG  . ASN A 507 ? 0.1365 0.1455 0.1385 -0.0106 0.0016  -0.0055 507  ASN A CG  
4053 O OD1 . ASN A 507 ? 0.1709 0.1782 0.1625 0.0094  -0.0173 0.0282  507  ASN A OD1 
4054 N ND2 . ASN A 507 ? 0.1099 0.1277 0.0874 0.0039  -0.0062 0.0020  507  ASN A ND2 
4055 N N   . SER A 508 ? 0.1130 0.1177 0.1260 -0.0009 -0.0049 -0.0011 508  SER A N   
4056 C CA  . SER A 508 ? 0.1238 0.1158 0.1327 -0.0008 -0.0041 -0.0038 508  SER A CA  
4057 C C   . SER A 508 ? 0.1147 0.1136 0.1376 0.0056  -0.0067 0.0014  508  SER A C   
4058 O O   . SER A 508 ? 0.1287 0.1059 0.1355 -0.0006 -0.0084 0.0004  508  SER A O   
4059 C CB  . SER A 508 ? 0.1422 0.1342 0.1286 -0.0046 -0.0038 -0.0019 508  SER A CB  
4060 O OG  . SER A 508 ? 0.1233 0.1179 0.1198 -0.0093 0.0061  -0.0074 508  SER A OG  
4061 N N   . PHE A 509 ? 0.1270 0.1095 0.1309 0.0005  -0.0013 -0.0001 509  PHE A N   
4062 C CA  . PHE A 509 ? 0.1276 0.1165 0.1370 0.0145  0.0052  -0.0071 509  PHE A CA  
4063 C C   . PHE A 509 ? 0.1396 0.1343 0.1362 0.0013  -0.0039 0.0006  509  PHE A C   
4064 O O   . PHE A 509 ? 0.1495 0.1240 0.1309 -0.0025 -0.0048 -0.0037 509  PHE A O   
4065 C CB  . PHE A 509 ? 0.1292 0.1122 0.1434 0.0182  0.0073  -0.0087 509  PHE A CB  
4066 C CG  . PHE A 509 ? 0.1297 0.1203 0.1221 0.0041  -0.0012 0.0050  509  PHE A CG  
4067 C CD1 . PHE A 509 ? 0.1190 0.1300 0.1273 0.0119  0.0067  -0.0030 509  PHE A CD1 
4068 C CD2 . PHE A 509 ? 0.1349 0.1238 0.1448 0.0147  -0.0075 0.0008  509  PHE A CD2 
4069 C CE1 . PHE A 509 ? 0.1386 0.1299 0.1225 0.0099  -0.0167 -0.0070 509  PHE A CE1 
4070 C CE2 . PHE A 509 ? 0.1263 0.1166 0.1416 0.0224  0.0024  0.0003  509  PHE A CE2 
4071 C CZ  . PHE A 509 ? 0.1196 0.1170 0.1499 0.0084  -0.0047 0.0073  509  PHE A CZ  
4072 N N   . ASP A 510 ? 0.1356 0.1312 0.1299 0.0138  -0.0051 -0.0111 510  ASP A N   
4073 C CA  . ASP A 510 ? 0.1326 0.1349 0.1241 0.0063  -0.0097 -0.0090 510  ASP A CA  
4074 C C   . ASP A 510 ? 0.1398 0.1235 0.1290 0.0037  -0.0057 -0.0055 510  ASP A C   
4075 O O   . ASP A 510 ? 0.1463 0.1194 0.1293 0.0100  -0.0051 -0.0011 510  ASP A O   
4076 C CB  . ASP A 510 ? 0.1337 0.1141 0.1314 -0.0040 -0.0104 -0.0126 510  ASP A CB  
4077 C CG  . ASP A 510 ? 0.1517 0.1340 0.1429 -0.0070 -0.0033 0.0041  510  ASP A CG  
4078 O OD1 . ASP A 510 ? 0.1433 0.1153 0.1425 0.0035  0.0003  -0.0183 510  ASP A OD1 
4079 O OD2 . ASP A 510 ? 0.1381 0.1509 0.1542 -0.0128 -0.0012 -0.0119 510  ASP A OD2 
4080 N N   . GLN A 511 ? 0.1366 0.1212 0.1336 0.0117  -0.0079 -0.0031 511  GLN A N   
4081 C CA  . GLN A 511 ? 0.1202 0.1291 0.1312 0.0039  -0.0113 -0.0150 511  GLN A CA  
4082 C C   . GLN A 511 ? 0.1340 0.1473 0.1348 0.0054  -0.0066 -0.0021 511  GLN A C   
4083 O O   . GLN A 511 ? 0.1386 0.1484 0.1372 0.0002  0.0042  -0.0159 511  GLN A O   
4084 C CB  . GLN A 511 ? 0.1319 0.1484 0.1339 -0.0085 -0.0082 -0.0030 511  GLN A CB  
4085 C CG  . GLN A 511 ? 0.1386 0.1381 0.1484 -0.0095 -0.0038 -0.0051 511  GLN A CG  
4086 C CD  . GLN A 511 ? 0.1398 0.1587 0.1597 0.0006  0.0037  0.0034  511  GLN A CD  
4087 O OE1 . GLN A 511 ? 0.1473 0.1705 0.1431 0.0062  -0.0218 -0.0067 511  GLN A OE1 
4088 N NE2 . GLN A 511 ? 0.1815 0.1665 0.1464 -0.0111 -0.0157 -0.0056 511  GLN A NE2 
4089 N N   . TRP A 512 ? 0.1368 0.1212 0.1285 0.0002  -0.0083 -0.0050 512  TRP A N   
4090 C CA  . TRP A 512 ? 0.1423 0.1310 0.1381 0.0033  -0.0106 -0.0142 512  TRP A CA  
4091 C C   . TRP A 512 ? 0.1527 0.1405 0.1447 0.0025  -0.0036 -0.0103 512  TRP A C   
4092 O O   . TRP A 512 ? 0.1522 0.1252 0.1399 0.0085  0.0099  -0.0076 512  TRP A O   
4093 C CB  . TRP A 512 ? 0.1280 0.1287 0.1464 0.0020  -0.0112 -0.0102 512  TRP A CB  
4094 C CG  . TRP A 512 ? 0.1619 0.1382 0.1472 0.0017  -0.0038 -0.0037 512  TRP A CG  
4095 C CD1 . TRP A 512 ? 0.1506 0.1409 0.1479 0.0091  -0.0230 -0.0144 512  TRP A CD1 
4096 C CD2 . TRP A 512 ? 0.1950 0.1472 0.1684 -0.0007 -0.0079 -0.0145 512  TRP A CD2 
4097 N NE1 . TRP A 512 ? 0.1672 0.1293 0.1540 0.0053  -0.0068 -0.0234 512  TRP A NE1 
4098 C CE2 . TRP A 512 ? 0.1671 0.1653 0.1649 0.0060  -0.0178 0.0016  512  TRP A CE2 
4099 C CE3 . TRP A 512 ? 0.2072 0.1811 0.1540 -0.0048 -0.0079 -0.0070 512  TRP A CE3 
4100 C CZ2 . TRP A 512 ? 0.2131 0.1695 0.1844 -0.0110 -0.0095 -0.0005 512  TRP A CZ2 
4101 C CZ3 . TRP A 512 ? 0.2320 0.1837 0.2069 0.0050  0.0007  0.0010  512  TRP A CZ3 
4102 C CH2 . TRP A 512 ? 0.2111 0.2027 0.1728 -0.0005 -0.0108 -0.0084 512  TRP A CH2 
4103 N N   . GLY A 513 ? 0.1502 0.1226 0.1466 0.0027  -0.0128 -0.0041 513  GLY A N   
4104 C CA  . GLY A 513 ? 0.1613 0.1469 0.1688 0.0070  -0.0047 -0.0069 513  GLY A CA  
4105 C C   . GLY A 513 ? 0.1717 0.1657 0.1803 0.0047  -0.0065 -0.0079 513  GLY A C   
4106 O O   . GLY A 513 ? 0.1581 0.1774 0.1981 0.0000  -0.0154 -0.0201 513  GLY A O   
4107 N N   . VAL A 514 ? 0.1671 0.1722 0.1847 -0.0017 -0.0001 -0.0184 514  VAL A N   
4108 C CA  . VAL A 514 ? 0.1860 0.1761 0.1963 -0.0068 0.0000  -0.0087 514  VAL A CA  
4109 C C   . VAL A 514 ? 0.1711 0.1769 0.1895 -0.0020 -0.0007 0.0004  514  VAL A C   
4110 O O   . VAL A 514 ? 0.1649 0.1813 0.1869 0.0024  0.0029  0.0036  514  VAL A O   
4111 C CB  . VAL A 514 ? 0.1903 0.1899 0.2009 -0.0126 -0.0042 -0.0047 514  VAL A CB  
4112 C CG1 . VAL A 514 ? 0.2408 0.2268 0.2095 -0.0161 -0.0003 -0.0106 514  VAL A CG1 
4113 C CG2 . VAL A 514 ? 0.2005 0.1880 0.2347 -0.0054 -0.0041 -0.0065 514  VAL A CG2 
4114 N N   . GLU A 515 ? 0.1774 0.1697 0.1813 -0.0020 -0.0035 0.0000  515  GLU A N   
4115 C CA  . GLU A 515 ? 0.1767 0.1886 0.1833 0.0056  -0.0043 0.0006  515  GLU A CA  
4116 C C   . GLU A 515 ? 0.1741 0.1859 0.1797 0.0027  -0.0064 0.0044  515  GLU A C   
4117 O O   . GLU A 515 ? 0.1748 0.1919 0.1814 0.0135  0.0001  0.0065  515  GLU A O   
4118 C CB  . GLU A 515 ? 0.1921 0.2092 0.1960 0.0015  -0.0104 0.0036  515  GLU A CB  
4119 C CG  . GLU A 515 ? 0.2503 0.2651 0.2411 0.0093  -0.0079 0.0153  515  GLU A CG  
4120 C CD  . GLU A 515 ? 0.2558 0.3220 0.2823 0.0046  -0.0079 0.0163  515  GLU A CD  
4121 O OE1 . GLU A 515 ? 0.3304 0.3605 0.3179 0.0108  -0.0081 0.0428  515  GLU A OE1 
4122 O OE2 . GLU A 515 ? 0.2469 0.2606 0.2160 0.0062  -0.0119 0.0291  515  GLU A OE2 
4123 N N   . LEU A 516 ? 0.1709 0.1674 0.1604 0.0142  -0.0093 0.0034  516  LEU A N   
4124 C CA  . LEU A 516 ? 0.1574 0.1768 0.1623 0.0056  -0.0073 0.0003  516  LEU A CA  
4125 C C   . LEU A 516 ? 0.1519 0.1761 0.1647 -0.0014 -0.0035 -0.0025 516  LEU A C   
4126 O O   . LEU A 516 ? 0.1637 0.1718 0.1592 -0.0037 -0.0097 -0.0053 516  LEU A O   
4127 C CB  . LEU A 516 ? 0.1621 0.1638 0.1677 0.0064  -0.0031 -0.0072 516  LEU A CB  
4128 C CG  . LEU A 516 ? 0.1822 0.1683 0.1565 0.0047  -0.0104 -0.0073 516  LEU A CG  
4129 C CD1 . LEU A 516 ? 0.1839 0.1849 0.1652 0.0004  -0.0179 -0.0137 516  LEU A CD1 
4130 C CD2 . LEU A 516 ? 0.1693 0.1804 0.1822 -0.0074 -0.0102 0.0013  516  LEU A CD2 
4131 N N   . GLY A 517 ? 0.1349 0.1664 0.1711 0.0038  -0.0100 -0.0043 517  GLY A N   
4132 C CA  . GLY A 517 ? 0.1272 0.1679 0.1595 -0.0023 0.0002  0.0044  517  GLY A CA  
4133 C C   . GLY A 517 ? 0.1501 0.1717 0.1585 0.0040  0.0018  0.0016  517  GLY A C   
4134 O O   . GLY A 517 ? 0.1390 0.1867 0.1704 0.0026  0.0003  0.0053  517  GLY A O   
4135 N N   . LYS A 518 ? 0.1499 0.1657 0.1491 0.0022  -0.0013 0.0005  518  LYS A N   
4136 C CA  . LYS A 518 ? 0.1752 0.1780 0.1592 0.0100  0.0032  0.0011  518  LYS A CA  
4137 C C   . LYS A 518 ? 0.1686 0.1916 0.1620 0.0036  0.0057  0.0005  518  LYS A C   
4138 O O   . LYS A 518 ? 0.1683 0.2044 0.1499 0.0051  0.0050  0.0100  518  LYS A O   
4139 C CB  . LYS A 518 ? 0.1807 0.1794 0.1541 0.0124  0.0027  -0.0115 518  LYS A CB  
4140 C CG  . LYS A 518 ? 0.1853 0.1949 0.1739 0.0059  -0.0088 -0.0126 518  LYS A CG  
4141 C CD  . LYS A 518 ? 0.2012 0.2049 0.2290 0.0093  -0.0007 -0.0126 518  LYS A CD  
4142 C CE  . LYS A 518 ? 0.2551 0.2518 0.2484 0.0036  0.0039  -0.0190 518  LYS A CE  
4143 N NZ  . LYS A 518 ? 0.2910 0.2835 0.3077 0.0273  0.0035  -0.0178 518  LYS A NZ  
4144 N N   . GLN A 519 ? 0.1482 0.1750 0.1637 0.0105  0.0055  0.0017  519  GLN A N   
4145 C CA  . GLN A 519 ? 0.1630 0.1849 0.1841 -0.0022 0.0000  0.0081  519  GLN A CA  
4146 C C   . GLN A 519 ? 0.1686 0.1817 0.1733 -0.0050 0.0025  0.0043  519  GLN A C   
4147 O O   . GLN A 519 ? 0.1552 0.2029 0.1729 -0.0098 -0.0024 0.0064  519  GLN A O   
4148 C CB  . GLN A 519 ? 0.1694 0.1909 0.1959 -0.0031 0.0033  0.0043  519  GLN A CB  
4149 C CG  . GLN A 519 ? 0.2104 0.2054 0.2171 0.0130  0.0060  0.0154  519  GLN A CG  
4150 C CD  . GLN A 519 ? 0.2573 0.2951 0.2929 -0.0144 -0.0082 0.0220  519  GLN A CD  
4151 O OE1 . GLN A 519 ? 0.2363 0.2597 0.2337 0.0066  -0.0209 0.0334  519  GLN A OE1 
4152 N NE2 . GLN A 519 ? 0.3328 0.3761 0.3369 0.0032  -0.0326 0.0311  519  GLN A NE2 
4153 N N   . LEU A 520 ? 0.1574 0.1717 0.1588 -0.0015 -0.0055 0.0082  520  LEU A N   
4154 C CA  . LEU A 520 ? 0.1633 0.1660 0.1665 -0.0049 -0.0028 0.0040  520  LEU A CA  
4155 C C   . LEU A 520 ? 0.1590 0.1652 0.1550 0.0009  0.0004  0.0019  520  LEU A C   
4156 O O   . LEU A 520 ? 0.1725 0.1844 0.1657 0.0068  -0.0034 0.0061  520  LEU A O   
4157 C CB  . LEU A 520 ? 0.1569 0.1678 0.1448 -0.0049 -0.0029 0.0079  520  LEU A CB  
4158 C CG  . LEU A 520 ? 0.1728 0.1890 0.1600 -0.0067 0.0054  0.0056  520  LEU A CG  
4159 C CD1 . LEU A 520 ? 0.1759 0.1560 0.1772 -0.0024 -0.0042 0.0031  520  LEU A CD1 
4160 C CD2 . LEU A 520 ? 0.2228 0.2255 0.1860 -0.0122 -0.0019 -0.0002 520  LEU A CD2 
4161 N N   . ALA A 521 ? 0.1496 0.1661 0.1469 0.0000  -0.0053 0.0027  521  ALA A N   
4162 C CA  . ALA A 521 ? 0.1659 0.1719 0.1617 -0.0032 0.0025  0.0071  521  ALA A CA  
4163 C C   . ALA A 521 ? 0.1688 0.1808 0.1660 0.0005  -0.0011 0.0069  521  ALA A C   
4164 O O   . ALA A 521 ? 0.1738 0.1995 0.1704 -0.0013 -0.0026 0.0158  521  ALA A O   
4165 C CB  . ALA A 521 ? 0.1706 0.1943 0.1656 -0.0097 0.0018  0.0046  521  ALA A CB  
4166 N N   . LYS A 522 ? 0.1957 0.1841 0.1711 0.0107  0.0003  0.0136  522  LYS A N   
4167 C CA  . LYS A 522 ? 0.2069 0.2046 0.1907 0.0076  0.0006  0.0099  522  LYS A CA  
4168 C C   . LYS A 522 ? 0.2082 0.2127 0.1843 0.0037  -0.0016 0.0134  522  LYS A C   
4169 O O   . LYS A 522 ? 0.2209 0.2323 0.1918 0.0047  0.0102  -0.0013 522  LYS A O   
4170 C CB  . LYS A 522 ? 0.2224 0.2193 0.2172 0.0174  -0.0044 0.0085  522  LYS A CB  
4171 C CG  . LYS A 522 ? 0.2977 0.2665 0.2546 0.0078  0.0034  -0.0078 522  LYS A CG  
4172 C CD  . LYS A 522 ? 0.3511 0.3657 0.3705 -0.0107 -0.0001 -0.0081 522  LYS A CD  
4173 C CE  . LYS A 522 ? 0.4200 0.4269 0.4044 -0.0113 0.0102  0.0063  522  LYS A CE  
4174 N NZ  . LYS A 522 ? 0.4110 0.4692 0.4351 -0.0053 0.0004  -0.0036 522  LYS A NZ  
4175 N N   . LYS A 523 ? 0.2070 0.2083 0.1825 0.0023  -0.0046 0.0074  523  LYS A N   
4176 C CA  . LYS A 523 ? 0.2192 0.2262 0.2015 0.0002  -0.0027 0.0042  523  LYS A CA  
4177 C C   . LYS A 523 ? 0.2224 0.2243 0.1983 0.0039  0.0028  0.0031  523  LYS A C   
4178 O O   . LYS A 523 ? 0.2361 0.2378 0.2049 0.0011  0.0140  0.0111  523  LYS A O   
4179 C CB  . LYS A 523 ? 0.2441 0.2444 0.2192 -0.0075 0.0023  0.0057  523  LYS A CB  
4180 C CG  . LYS A 523 ? 0.2822 0.3013 0.2903 0.0133  0.0043  -0.0011 523  LYS A CG  
4181 C CD  . LYS A 523 ? 0.3980 0.3593 0.3814 0.0018  -0.0060 0.0165  523  LYS A CD  
4182 C CE  . LYS A 523 ? 0.3902 0.3923 0.3945 0.0092  0.0072  -0.0112 523  LYS A CE  
4183 N NZ  . LYS A 523 ? 0.3428 0.3385 0.3051 0.0100  -0.0204 0.0181  523  LYS A NZ  
4184 N N   . ILE A 524 ? 0.1967 0.2095 0.1818 0.0017  -0.0066 0.0012  524  ILE A N   
4185 C CA  . ILE A 524 ? 0.1944 0.1994 0.1802 0.0045  0.0010  0.0029  524  ILE A CA  
4186 C C   . ILE A 524 ? 0.2022 0.2023 0.1877 0.0055  0.0008  0.0080  524  ILE A C   
4187 O O   . ILE A 524 ? 0.2009 0.1858 0.1801 0.0112  -0.0056 0.0059  524  ILE A O   
4188 C CB  . ILE A 524 ? 0.1751 0.1896 0.1794 0.0053  -0.0009 0.0046  524  ILE A CB  
4189 C CG1 . ILE A 524 ? 0.1977 0.1867 0.1678 -0.0057 0.0156  0.0150  524  ILE A CG1 
4190 C CG2 . ILE A 524 ? 0.1638 0.1662 0.1814 -0.0006 0.0127  -0.0131 524  ILE A CG2 
4191 C CD1 . ILE A 524 ? 0.2040 0.1934 0.1476 0.0040  0.0046  0.0213  524  ILE A CD1 
4192 N N   . GLU A 525 ? 0.2085 0.2079 0.2037 -0.0009 -0.0009 0.0042  525  GLU A N   
4193 C CA  . GLU A 525 ? 0.2263 0.2384 0.2301 -0.0002 0.0038  0.0035  525  GLU A CA  
4194 C C   . GLU A 525 ? 0.2299 0.2556 0.2286 0.0002  -0.0002 0.0119  525  GLU A C   
4195 O O   . GLU A 525 ? 0.2273 0.2615 0.2214 0.0028  0.0130  0.0154  525  GLU A O   
4196 C CB  . GLU A 525 ? 0.2311 0.2330 0.2495 -0.0004 -0.0047 0.0104  525  GLU A CB  
4197 C CG  . GLU A 525 ? 0.2725 0.2660 0.2723 -0.0111 0.0048  -0.0058 525  GLU A CG  
4198 C CD  . GLU A 525 ? 0.3211 0.2915 0.3022 0.0053  -0.0056 -0.0041 525  GLU A CD  
4199 O OE1 . GLU A 525 ? 0.3365 0.3085 0.3065 0.0221  0.0047  -0.0124 525  GLU A OE1 
4200 O OE2 . GLU A 525 ? 0.3634 0.3233 0.3266 -0.0083 0.0025  -0.0072 525  GLU A OE2 
4201 N N   . PRO A 526 ? 0.2337 0.2725 0.2263 -0.0018 0.0027  0.0078  526  PRO A N   
4202 C CA  . PRO A 526 ? 0.2430 0.2809 0.2353 0.0014  0.0048  0.0069  526  PRO A CA  
4203 C C   . PRO A 526 ? 0.2528 0.2797 0.2357 -0.0003 0.0045  0.0025  526  PRO A C   
4204 O O   . PRO A 526 ? 0.2653 0.3043 0.2451 0.0056  0.0180  0.0009  526  PRO A O   
4205 C CB  . PRO A 526 ? 0.2422 0.2918 0.2367 -0.0006 0.0008  0.0132  526  PRO A CB  
4206 C CG  . PRO A 526 ? 0.2420 0.2943 0.2400 0.0048  0.0030  0.0083  526  PRO A CG  
4207 C CD  . PRO A 526 ? 0.2475 0.2792 0.2398 0.0014  -0.0022 0.0093  526  PRO A CD  
4208 N N   . GLU A 527 ? 0.2451 0.2612 0.2127 -0.0019 -0.0046 -0.0052 527  GLU A N   
4209 C CA  . GLU A 527 ? 0.2430 0.2600 0.2233 -0.0001 -0.0008 -0.0040 527  GLU A CA  
4210 C C   . GLU A 527 ? 0.2442 0.2532 0.2249 0.0019  -0.0004 -0.0052 527  GLU A C   
4211 O O   . GLU A 527 ? 0.2470 0.2714 0.2140 0.0054  0.0052  -0.0091 527  GLU A O   
4212 C CB  . GLU A 527 ? 0.2462 0.2513 0.2303 -0.0039 -0.0015 -0.0057 527  GLU A CB  
4213 C CG  . GLU A 527 ? 0.2602 0.2774 0.2374 -0.0030 -0.0080 -0.0054 527  GLU A CG  
4214 C CD  . GLU A 527 ? 0.3009 0.3140 0.2840 -0.0159 -0.0027 0.0021  527  GLU A CD  
4215 O OE1 . GLU A 527 ? 0.3131 0.3359 0.2801 -0.0121 -0.0194 -0.0038 527  GLU A OE1 
4216 O OE2 . GLU A 527 ? 0.2989 0.2992 0.2643 -0.0075 -0.0176 -0.0049 527  GLU A OE2 
4217 N N   . LEU A 528 ? 0.2345 0.2550 0.2123 -0.0032 0.0020  -0.0088 528  LEU A N   
4218 C CA  . LEU A 528 ? 0.2406 0.2609 0.2235 0.0005  0.0083  -0.0019 528  LEU A CA  
4219 C C   . LEU A 528 ? 0.2640 0.2901 0.2577 -0.0026 0.0100  0.0000  528  LEU A C   
4220 O O   . LEU A 528 ? 0.2650 0.3252 0.2684 -0.0025 0.0098  0.0009  528  LEU A O   
4221 C CB  . LEU A 528 ? 0.2295 0.2314 0.2129 -0.0110 0.0027  -0.0049 528  LEU A CB  
4222 C CG  . LEU A 528 ? 0.2203 0.2141 0.1780 0.0007  0.0114  -0.0103 528  LEU A CG  
4223 C CD1 . LEU A 528 ? 0.2101 0.1946 0.1763 -0.0040 0.0198  -0.0124 528  LEU A CD1 
4224 C CD2 . LEU A 528 ? 0.2534 0.2274 0.2110 0.0022  0.0241  -0.0071 528  LEU A CD2 
4225 N N   . ASP A 529 ? 0.2878 0.3034 0.2758 -0.0038 0.0093  0.0010  529  ASP A N   
4226 C CA  . ASP A 529 ? 0.3226 0.3279 0.3073 -0.0080 0.0123  -0.0003 529  ASP A CA  
4227 C C   . ASP A 529 ? 0.3389 0.3436 0.3129 -0.0091 0.0126  -0.0003 529  ASP A C   
4228 O O   . ASP A 529 ? 0.3529 0.3659 0.3055 -0.0198 0.0143  -0.0032 529  ASP A O   
4229 C CB  . ASP A 529 ? 0.3343 0.3339 0.3205 -0.0095 0.0114  0.0039  529  ASP A CB  
4230 C CG  . ASP A 529 ? 0.3737 0.3693 0.3629 -0.0037 0.0091  -0.0042 529  ASP A CG  
4231 O OD1 . ASP A 529 ? 0.4142 0.3918 0.3492 -0.0058 0.0042  0.0025  529  ASP A OD1 
4232 O OD2 . ASP A 529 ? 0.4195 0.4200 0.4397 0.0133  -0.0014 0.0013  529  ASP A OD2 
4233 N N   . GLY A 530 ? 0.3444 0.3486 0.3281 -0.0048 0.0134  0.0034  530  GLY A N   
4234 C CA  . GLY A 530 ? 0.3620 0.3621 0.3401 -0.0042 0.0123  -0.0009 530  GLY A CA  
4235 C C   . GLY A 530 ? 0.3682 0.3704 0.3573 -0.0027 0.0115  0.0001  530  GLY A C   
4236 O O   . GLY A 530 ? 0.3779 0.3760 0.3457 -0.0074 0.0108  0.0047  530  GLY A O   
4237 N N   . SER A 531 ? 0.3632 0.3743 0.3633 -0.0023 0.0124  0.0000  531  SER A N   
4238 C CA  . SER A 531 ? 0.3624 0.3800 0.3671 -0.0029 0.0147  -0.0002 531  SER A CA  
4239 C C   . SER A 531 ? 0.3503 0.3703 0.3456 0.0000  0.0183  -0.0010 531  SER A C   
4240 O O   . SER A 531 ? 0.3625 0.3839 0.3703 -0.0012 0.0214  -0.0012 531  SER A O   
4241 C CB  . SER A 531 ? 0.3664 0.3885 0.3777 -0.0014 0.0144  -0.0019 531  SER A CB  
4242 O OG  . SER A 531 ? 0.3965 0.4171 0.3975 -0.0091 0.0089  0.0021  531  SER A OG  
4243 N N   . ALA A 532 ? 0.3315 0.3617 0.3204 -0.0045 0.0221  -0.0012 532  ALA A N   
4244 C CA  . ALA A 532 ? 0.3345 0.3506 0.3156 -0.0021 0.0168  0.0045  532  ALA A CA  
4245 C C   . ALA A 532 ? 0.3267 0.3433 0.3130 -0.0020 0.0112  0.0069  532  ALA A C   
4246 O O   . ALA A 532 ? 0.3110 0.3324 0.2911 -0.0054 0.0051  0.0099  532  ALA A O   
4247 C CB  . ALA A 532 ? 0.3402 0.3592 0.3236 0.0033  0.0119  -0.0006 532  ALA A CB  
4248 N N   . GLN A 533 ? 0.3196 0.3429 0.3100 -0.0025 0.0109  0.0040  533  GLN A N   
4249 C CA  . GLN A 533 ? 0.3218 0.3460 0.3159 0.0015  0.0064  0.0062  533  GLN A CA  
4250 C C   . GLN A 533 ? 0.3043 0.3281 0.2806 0.0000  0.0056  0.0038  533  GLN A C   
4251 O O   . GLN A 533 ? 0.3178 0.3549 0.2628 0.0068  0.0197  0.0142  533  GLN A O   
4252 C CB  . GLN A 533 ? 0.3475 0.3562 0.3445 0.0007  0.0063  -0.0023 533  GLN A CB  
4253 C CG  . GLN A 533 ? 0.3972 0.4352 0.4176 0.0057  -0.0057 0.0017  533  GLN A CG  
4254 C CD  . GLN A 533 ? 0.5096 0.4737 0.5077 0.0031  0.0012  0.0101  533  GLN A CD  
4255 O OE1 . GLN A 533 ? 0.5293 0.5402 0.5512 -0.0088 -0.0023 -0.0012 533  GLN A OE1 
4256 N NE2 . GLN A 533 ? 0.5272 0.5399 0.5500 0.0063  -0.0103 0.0050  533  GLN A NE2 
4257 N N   . VAL A 534 ? 0.2742 0.2887 0.2347 0.0076  0.0043  -0.0001 534  VAL A N   
4258 C CA  . VAL A 534 ? 0.2659 0.2739 0.2230 -0.0009 0.0027  -0.0060 534  VAL A CA  
4259 C C   . VAL A 534 ? 0.2646 0.2684 0.2242 0.0038  0.0073  -0.0088 534  VAL A C   
4260 O O   . VAL A 534 ? 0.2606 0.2601 0.1997 0.0045  0.0125  -0.0139 534  VAL A O   
4261 C CB  . VAL A 534 ? 0.2529 0.2616 0.2249 0.0007  0.0049  -0.0056 534  VAL A CB  
4262 C CG1 . VAL A 534 ? 0.2524 0.2610 0.2066 0.0047  0.0140  -0.0095 534  VAL A CG1 
4263 C CG2 . VAL A 534 ? 0.2714 0.2698 0.2304 -0.0046 0.0051  0.0058  534  VAL A CG2 
4264 N N   . THR A 535 ? 0.2676 0.2845 0.2195 -0.0004 0.0074  -0.0080 535  THR A N   
4265 C CA  . THR A 535 ? 0.2828 0.2892 0.2404 -0.0027 0.0012  -0.0126 535  THR A CA  
4266 C C   . THR A 535 ? 0.2718 0.2864 0.2307 -0.0041 -0.0040 -0.0025 535  THR A C   
4267 O O   . THR A 535 ? 0.2949 0.3017 0.2433 -0.0124 -0.0085 -0.0086 535  THR A O   
4268 C CB  . THR A 535 ? 0.2945 0.3050 0.2542 0.0005  0.0019  -0.0107 535  THR A CB  
4269 O OG1 . THR A 535 ? 0.3247 0.3254 0.2442 -0.0043 -0.0035 -0.0160 535  THR A OG1 
4270 C CG2 . THR A 535 ? 0.3038 0.3094 0.2733 0.0021  0.0139  -0.0174 535  THR A CG2 
4271 N N   . SER A 536 ? 0.2510 0.2851 0.2208 0.0020  -0.0116 -0.0014 536  SER A N   
4272 C CA  . SER A 536 ? 0.2550 0.2824 0.2341 0.0031  -0.0048 0.0016  536  SER A CA  
4273 C C   . SER A 536 ? 0.2392 0.2763 0.2209 0.0073  -0.0055 0.0073  536  SER A C   
4274 O O   . SER A 536 ? 0.2483 0.3121 0.2241 0.0042  -0.0077 0.0139  536  SER A O   
4275 C CB  . SER A 536 ? 0.2511 0.2729 0.2429 -0.0007 -0.0103 -0.0030 536  SER A CB  
4276 O OG  . SER A 536 ? 0.2872 0.2937 0.2632 -0.0015 -0.0269 0.0013  536  SER A OG  
4277 N N   . HIS A 537 ? 0.2189 0.2396 0.1882 0.0056  -0.0116 0.0002  537  HIS A N   
4278 C CA  . HIS A 537 ? 0.2069 0.2191 0.1903 -0.0056 -0.0100 -0.0058 537  HIS A CA  
4279 C C   . HIS A 537 ? 0.2023 0.2121 0.1807 -0.0003 -0.0117 -0.0033 537  HIS A C   
4280 O O   . HIS A 537 ? 0.2165 0.2178 0.1787 0.0068  -0.0209 -0.0056 537  HIS A O   
4281 C CB  . HIS A 537 ? 0.2152 0.2090 0.1777 0.0000  -0.0117 -0.0073 537  HIS A CB  
4282 C CG  . HIS A 537 ? 0.2002 0.2161 0.1846 -0.0051 0.0044  -0.0039 537  HIS A CG  
4283 N ND1 . HIS A 537 ? 0.1817 0.1848 0.1672 -0.0077 -0.0141 -0.0078 537  HIS A ND1 
4284 C CD2 . HIS A 537 ? 0.1918 0.1866 0.1965 -0.0107 0.0063  -0.0011 537  HIS A CD2 
4285 C CE1 . HIS A 537 ? 0.1861 0.1997 0.1860 0.0000  0.0020  -0.0074 537  HIS A CE1 
4286 N NE2 . HIS A 537 ? 0.1914 0.1982 0.2014 -0.0079 0.0152  -0.0246 537  HIS A NE2 
4287 N N   . ASP A 538 ? 0.1924 0.1999 0.1817 -0.0150 -0.0147 -0.0065 538  ASP A N   
4288 C CA  . ASP A 538 ? 0.1890 0.1843 0.1778 -0.0050 -0.0081 -0.0094 538  ASP A CA  
4289 C C   . ASP A 538 ? 0.1973 0.1798 0.1777 -0.0050 -0.0051 -0.0098 538  ASP A C   
4290 O O   . ASP A 538 ? 0.2021 0.1789 0.1799 -0.0046 -0.0070 -0.0090 538  ASP A O   
4291 C CB  . ASP A 538 ? 0.1860 0.1859 0.1777 -0.0178 -0.0109 -0.0105 538  ASP A CB  
4292 C CG  . ASP A 538 ? 0.1847 0.1802 0.1774 0.0031  -0.0119 -0.0132 538  ASP A CG  
4293 O OD1 . ASP A 538 ? 0.1657 0.1618 0.1486 -0.0050 -0.0034 -0.0137 538  ASP A OD1 
4294 O OD2 . ASP A 538 ? 0.1947 0.1887 0.1811 -0.0030 -0.0350 -0.0074 538  ASP A OD2 
4295 N N   . ALA A 539 ? 0.1907 0.1721 0.1672 0.0068  -0.0051 -0.0105 539  ALA A N   
4296 C CA  . ALA A 539 ? 0.1863 0.1747 0.1658 0.0018  -0.0097 -0.0110 539  ALA A CA  
4297 C C   . ALA A 539 ? 0.1739 0.1707 0.1535 0.0042  -0.0073 -0.0105 539  ALA A C   
4298 O O   . ALA A 539 ? 0.1808 0.1634 0.1585 -0.0002 0.0018  -0.0107 539  ALA A O   
4299 C CB  . ALA A 539 ? 0.2013 0.1674 0.1869 -0.0001 -0.0115 -0.0156 539  ALA A CB  
4300 N N   . SER A 540 ? 0.1537 0.1707 0.1404 0.0043  -0.0078 -0.0093 540  SER A N   
4301 C CA  . SER A 540 ? 0.1634 0.1684 0.1347 -0.0052 -0.0004 -0.0079 540  SER A CA  
4302 C C   . SER A 540 ? 0.1562 0.1689 0.1469 0.0023  -0.0026 -0.0066 540  SER A C   
4303 O O   . SER A 540 ? 0.1611 0.1527 0.1416 -0.0030 0.0063  -0.0074 540  SER A O   
4304 C CB  . SER A 540 ? 0.1526 0.1719 0.1330 -0.0075 0.0019  -0.0121 540  SER A CB  
4305 O OG  . SER A 540 ? 0.1705 0.1610 0.1141 -0.0015 0.0011  -0.0143 540  SER A OG  
4306 N N   . THR A 541 ? 0.1621 0.1499 0.1435 0.0024  -0.0056 -0.0032 541  THR A N   
4307 C CA  . THR A 541 ? 0.1635 0.1698 0.1427 0.0054  -0.0028 -0.0050 541  THR A CA  
4308 C C   . THR A 541 ? 0.1597 0.1611 0.1465 0.0007  0.0035  -0.0135 541  THR A C   
4309 O O   . THR A 541 ? 0.1536 0.1657 0.1147 0.0100  0.0031  -0.0155 541  THR A O   
4310 C CB  . THR A 541 ? 0.1594 0.1677 0.1568 0.0058  0.0014  -0.0049 541  THR A CB  
4311 O OG1 . THR A 541 ? 0.1683 0.1897 0.1417 0.0082  -0.0014 -0.0180 541  THR A OG1 
4312 C CG2 . THR A 541 ? 0.1803 0.1558 0.1596 0.0071  -0.0057 -0.0158 541  THR A CG2 
4313 N N   . ASN A 542 ? 0.1524 0.1587 0.1255 0.0045  0.0013  -0.0070 542  ASN A N   
4314 C CA  . ASN A 542 ? 0.1637 0.1700 0.1441 -0.0006 0.0029  -0.0103 542  ASN A CA  
4315 C C   . ASN A 542 ? 0.1621 0.1636 0.1400 -0.0014 0.0026  -0.0149 542  ASN A C   
4316 O O   . ASN A 542 ? 0.1636 0.1611 0.1497 -0.0108 0.0032  -0.0199 542  ASN A O   
4317 C CB  . ASN A 542 ? 0.1697 0.1850 0.1448 0.0044  0.0020  -0.0142 542  ASN A CB  
4318 C CG  . ASN A 542 ? 0.1838 0.1892 0.1696 -0.0027 -0.0048 -0.0016 542  ASN A CG  
4319 O OD1 . ASN A 542 ? 0.2028 0.2107 0.1327 0.0096  -0.0016 -0.0130 542  ASN A OD1 
4320 N ND2 . ASN A 542 ? 0.2195 0.2078 0.1866 -0.0057 -0.0247 -0.0176 542  ASN A ND2 
4321 N N   . GLY A 543 ? 0.1694 0.1708 0.1423 0.0041  -0.0033 -0.0150 543  GLY A N   
4322 C CA  . GLY A 543 ? 0.1602 0.1634 0.1445 0.0073  0.0000  -0.0256 543  GLY A CA  
4323 C C   . GLY A 543 ? 0.1569 0.1653 0.1510 0.0021  0.0025  -0.0124 543  GLY A C   
4324 O O   . GLY A 543 ? 0.1576 0.1710 0.1446 -0.0072 -0.0039 -0.0177 543  GLY A O   
4325 N N   . LEU A 544 ? 0.1533 0.1474 0.1273 0.0137  0.0030  -0.0160 544  LEU A N   
4326 C CA  . LEU A 544 ? 0.1353 0.1430 0.1353 0.0043  0.0050  -0.0130 544  LEU A CA  
4327 C C   . LEU A 544 ? 0.1454 0.1486 0.1316 0.0083  0.0042  -0.0107 544  LEU A C   
4328 O O   . LEU A 544 ? 0.1559 0.1533 0.1247 0.0025  0.0000  -0.0105 544  LEU A O   
4329 C CB  . LEU A 544 ? 0.1281 0.1472 0.1357 0.0101  0.0103  -0.0068 544  LEU A CB  
4330 C CG  . LEU A 544 ? 0.1033 0.1551 0.1464 0.0063  -0.0012 -0.0010 544  LEU A CG  
4331 C CD1 . LEU A 544 ? 0.1135 0.1654 0.1522 0.0198  0.0138  -0.0082 544  LEU A CD1 
4332 C CD2 . LEU A 544 ? 0.1624 0.1785 0.1428 0.0007  -0.0148 -0.0005 544  LEU A CD2 
4333 N N   . ILE A 545 ? 0.1510 0.1443 0.1190 0.0077  0.0083  -0.0114 545  ILE A N   
4334 C CA  . ILE A 545 ? 0.1581 0.1703 0.1498 0.0066  0.0104  -0.0002 545  ILE A CA  
4335 C C   . ILE A 545 ? 0.1678 0.1679 0.1420 0.0063  0.0090  -0.0073 545  ILE A C   
4336 O O   . ILE A 545 ? 0.1730 0.1942 0.1428 0.0084  0.0076  -0.0142 545  ILE A O   
4337 C CB  . ILE A 545 ? 0.1680 0.1629 0.1421 0.0057  0.0116  0.0069  545  ILE A CB  
4338 C CG1 . ILE A 545 ? 0.1794 0.1786 0.1618 0.0159  0.0038  -0.0031 545  ILE A CG1 
4339 C CG2 . ILE A 545 ? 0.1970 0.2034 0.1674 0.0000  0.0172  0.0142  545  ILE A CG2 
4340 C CD1 . ILE A 545 ? 0.1567 0.2247 0.1909 0.0111  0.0050  -0.0082 545  ILE A CD1 
4341 N N   . ASN A 546 ? 0.1649 0.1814 0.1562 0.0039  0.0030  -0.0073 546  ASN A N   
4342 C CA  . ASN A 546 ? 0.1842 0.1848 0.1653 0.0009  0.0063  -0.0130 546  ASN A CA  
4343 C C   . ASN A 546 ? 0.1837 0.1840 0.1542 0.0013  0.0068  -0.0089 546  ASN A C   
4344 O O   . ASN A 546 ? 0.1933 0.1884 0.1583 -0.0017 0.0034  -0.0085 546  ASN A O   
4345 C CB  . ASN A 546 ? 0.1918 0.1903 0.1663 0.0001  0.0131  -0.0227 546  ASN A CB  
4346 C CG  . ASN A 546 ? 0.2200 0.2273 0.1873 0.0012  0.0033  -0.0127 546  ASN A CG  
4347 O OD1 . ASN A 546 ? 0.2553 0.2542 0.2000 -0.0080 -0.0177 -0.0148 546  ASN A OD1 
4348 N ND2 . ASN A 546 ? 0.2558 0.2734 0.2116 -0.0209 0.0106  -0.0185 546  ASN A ND2 
4349 N N   . PHE A 547 ? 0.1845 0.1719 0.1498 0.0009  0.0041  -0.0032 547  PHE A N   
4350 C CA  . PHE A 547 ? 0.1755 0.1731 0.1525 -0.0035 0.0018  -0.0021 547  PHE A CA  
4351 C C   . PHE A 547 ? 0.1707 0.1823 0.1559 -0.0012 0.0029  -0.0063 547  PHE A C   
4352 O O   . PHE A 547 ? 0.1577 0.1705 0.1487 -0.0031 0.0079  -0.0230 547  PHE A O   
4353 C CB  . PHE A 547 ? 0.1833 0.1870 0.1444 0.0000  -0.0016 -0.0012 547  PHE A CB  
4354 C CG  . PHE A 547 ? 0.1614 0.1715 0.1636 -0.0014 -0.0127 -0.0068 547  PHE A CG  
4355 C CD1 . PHE A 547 ? 0.1617 0.1901 0.1620 0.0025  0.0009  -0.0072 547  PHE A CD1 
4356 C CD2 . PHE A 547 ? 0.1692 0.1752 0.1449 0.0027  0.0019  -0.0031 547  PHE A CD2 
4357 C CE1 . PHE A 547 ? 0.1741 0.1986 0.1660 0.0087  0.0027  -0.0037 547  PHE A CE1 
4358 C CE2 . PHE A 547 ? 0.1720 0.1868 0.1487 0.0052  0.0000  -0.0067 547  PHE A CE2 
4359 C CZ  . PHE A 547 ? 0.1831 0.1635 0.1638 -0.0010 0.0041  0.0073  547  PHE A CZ  
4360 N N   . ILE A 548 ? 0.1742 0.1776 0.1423 -0.0061 0.0037  -0.0098 548  ILE A N   
4361 C CA  . ILE A 548 ? 0.1815 0.1847 0.1532 -0.0011 0.0059  0.0001  548  ILE A CA  
4362 C C   . ILE A 548 ? 0.1900 0.1985 0.1602 -0.0097 0.0040  -0.0032 548  ILE A C   
4363 O O   . ILE A 548 ? 0.1756 0.2153 0.1515 -0.0087 0.0165  -0.0002 548  ILE A O   
4364 C CB  . ILE A 548 ? 0.1873 0.1814 0.1633 -0.0049 0.0071  -0.0074 548  ILE A CB  
4365 C CG1 . ILE A 548 ? 0.1690 0.2018 0.1738 0.0002  0.0119  0.0059  548  ILE A CG1 
4366 C CG2 . ILE A 548 ? 0.2167 0.1817 0.1843 -0.0024 -0.0093 0.0013  548  ILE A CG2 
4367 C CD1 . ILE A 548 ? 0.1650 0.1914 0.2138 0.0156  0.0101  -0.0132 548  ILE A CD1 
4368 N N   . LYS A 549 ? 0.1935 0.2182 0.1540 -0.0005 0.0149  -0.0071 549  LYS A N   
4369 C CA  . LYS A 549 ? 0.2135 0.2265 0.1717 -0.0119 0.0075  -0.0015 549  LYS A CA  
4370 C C   . LYS A 549 ? 0.2132 0.2257 0.1753 -0.0039 0.0110  -0.0057 549  LYS A C   
4371 O O   . LYS A 549 ? 0.2296 0.2371 0.1819 -0.0143 0.0174  -0.0073 549  LYS A O   
4372 C CB  . LYS A 549 ? 0.2145 0.2474 0.1691 -0.0010 0.0021  -0.0013 549  LYS A CB  
4373 C CG  . LYS A 549 ? 0.2267 0.2332 0.1890 0.0037  -0.0030 0.0041  549  LYS A CG  
4374 C CD  . LYS A 549 ? 0.2657 0.2722 0.2124 0.0035  -0.0096 -0.0106 549  LYS A CD  
4375 C CE  . LYS A 549 ? 0.2680 0.2730 0.2373 0.0043  -0.0125 0.0010  549  LYS A CE  
4376 N NZ  . LYS A 549 ? 0.2586 0.2826 0.2247 0.0038  0.0088  0.0190  549  LYS A NZ  
4377 N N   . GLN A 550 ? 0.2190 0.2204 0.1775 -0.0044 0.0188  -0.0102 550  GLN A N   
4378 C CA  . GLN A 550 ? 0.2117 0.2435 0.2052 0.0024  0.0110  -0.0084 550  GLN A CA  
4379 C C   . GLN A 550 ? 0.2181 0.2507 0.2215 0.0024  0.0096  -0.0072 550  GLN A C   
4380 O O   . GLN A 550 ? 0.2234 0.2606 0.2378 0.0102  0.0139  -0.0044 550  GLN A O   
4381 C CB  . GLN A 550 ? 0.2286 0.2435 0.2364 0.0008  0.0135  -0.0028 550  GLN A CB  
4382 C CG  . GLN A 550 ? 0.2719 0.3120 0.3046 0.0118  0.0073  -0.0004 550  GLN A CG  
4383 C CD  . GLN A 550 ? 0.3773 0.3609 0.3641 0.0030  0.0110  0.0103  550  GLN A CD  
4384 O OE1 . GLN A 550 ? 0.4579 0.4202 0.4126 0.0086  0.0049  -0.0177 550  GLN A OE1 
4385 N NE2 . GLN A 550 ? 0.3184 0.3337 0.3098 0.0155  -0.0087 -0.0034 550  GLN A NE2 
4386 N N   . GLN A 551 ? 0.2139 0.2435 0.2086 0.0076  0.0092  -0.0109 551  GLN A N   
4387 C CA  . GLN A 551 ? 0.2157 0.2424 0.2252 -0.0006 0.0063  -0.0071 551  GLN A CA  
4388 C C   . GLN A 551 ? 0.2361 0.2566 0.2470 0.0005  0.0128  -0.0077 551  GLN A C   
4389 O O   . GLN A 551 ? 0.2519 0.2496 0.2542 -0.0103 0.0056  -0.0010 551  GLN A O   
4390 C CB  . GLN A 551 ? 0.2097 0.2280 0.2174 -0.0015 0.0071  -0.0062 551  GLN A CB  
4391 C CG  . GLN A 551 ? 0.2134 0.2242 0.2175 0.0060  0.0098  0.0039  551  GLN A CG  
4392 C CD  . GLN A 551 ? 0.2343 0.2394 0.2399 0.0020  -0.0086 -0.0049 551  GLN A CD  
4393 O OE1 . GLN A 551 ? 0.3356 0.2909 0.2878 0.0239  0.0017  -0.0281 551  GLN A OE1 
4394 N NE2 . GLN A 551 ? 0.1932 0.1697 0.1618 0.0241  0.0163  -0.0191 551  GLN A NE2 
4395 N N   . ARG A 552 ? 0.2705 0.2885 0.2744 0.0069  0.0070  -0.0005 552  ARG A N   
4396 C CA  . ARG A 552 ? 0.3344 0.3348 0.3403 -0.0077 -0.0011 0.0025  552  ARG A CA  
4397 C C   . ARG A 552 ? 0.3563 0.3644 0.3613 -0.0071 -0.0060 0.0089  552  ARG A C   
4398 O O   . ARG A 552 ? 0.3663 0.3767 0.3849 -0.0145 -0.0106 0.0176  552  ARG A O   
4399 C CB  . ARG A 552 ? 0.3577 0.3432 0.3578 0.0041  -0.0060 0.0012  552  ARG A CB  
4400 C CG  . ARG A 552 ? 0.4174 0.4115 0.4146 -0.0193 0.0121  0.0055  552  ARG A CG  
4401 C CD  . ARG A 552 ? 0.5190 0.5170 0.5214 0.0187  -0.0203 0.0103  552  ARG A CD  
4402 N NE  . ARG A 552 ? 0.5883 0.5935 0.5883 -0.0082 0.0107  0.0130  552  ARG A NE  
4403 C CZ  . ARG A 552 ? 0.6313 0.6208 0.6263 0.0032  -0.0031 0.0109  552  ARG A CZ  
4404 N NH1 . ARG A 552 ? 0.6384 0.6429 0.6465 0.0020  0.0000  0.0013  552  ARG A NH1 
4405 N NH2 . ARG A 552 ? 0.6456 0.6432 0.6352 -0.0061 0.0038  0.0102  552  ARG A NH2 
4406 N N   . GLU A 553 ? 0.3683 0.3923 0.3749 0.0019  0.0011  0.0105  553  GLU A N   
4407 C CA  . GLU A 553 ? 0.4032 0.4290 0.4150 -0.0001 0.0005  0.0081  553  GLU A CA  
4408 C C   . GLU A 553 ? 0.4000 0.4222 0.4124 -0.0021 -0.0008 0.0101  553  GLU A C   
4409 O O   . GLU A 553 ? 0.4072 0.4362 0.4214 -0.0057 0.0062  0.0122  553  GLU A O   
4410 C CB  . GLU A 553 ? 0.4350 0.4390 0.4271 0.0026  0.0048  0.0029  553  GLU A CB  
4411 C CG  . GLU A 553 ? 0.4629 0.4790 0.4871 -0.0051 -0.0092 0.0037  553  GLU A CG  
4412 C CD  . GLU A 553 ? 0.5674 0.5600 0.5392 -0.0004 0.0040  -0.0095 553  GLU A CD  
4413 O OE1 . GLU A 553 ? 0.6026 0.5786 0.6022 -0.0023 0.0016  -0.0039 553  GLU A OE1 
4414 O OE2 . GLU A 553 ? 0.5953 0.5768 0.5709 -0.0074 0.0046  0.0092  553  GLU A OE2 
4415 N N   . ALA A 554 ? 0.3871 0.4094 0.3964 -0.0033 0.0009  0.0068  554  ALA A N   
4416 C CA  . ALA A 554 ? 0.3886 0.3984 0.3887 -0.0012 -0.0001 0.0017  554  ALA A CA  
4417 C C   . ALA A 554 ? 0.3860 0.3981 0.3870 0.0000  -0.0023 0.0032  554  ALA A C   
4418 O O   . ALA A 554 ? 0.3778 0.4060 0.3841 0.0060  -0.0034 -0.0043 554  ALA A O   
4419 C CB  . ALA A 554 ? 0.3840 0.3890 0.3806 -0.0019 0.0002  0.0003  554  ALA A CB  
4420 N N   . ARG A 555 ? 0.3899 0.4044 0.3862 0.0048  0.0038  0.0030  555  ARG A N   
4421 C CA  . ARG A 555 ? 0.4026 0.4149 0.4000 0.0013  0.0012  0.0029  555  ARG A CA  
4422 C C   . ARG A 555 ? 0.4110 0.4201 0.4054 0.0049  0.0016  0.0041  555  ARG A C   
4423 O O   . ARG A 555 ? 0.4145 0.4240 0.4106 0.0103  0.0095  0.0046  555  ARG A O   
4424 C CB  . ARG A 555 ? 0.4110 0.4225 0.4117 -0.0020 0.0007  0.0021  555  ARG A CB  
4425 C CG  . ARG A 555 ? 0.4587 0.4568 0.4437 -0.0026 -0.0028 0.0088  555  ARG A CG  
4426 C CD  . ARG A 555 ? 0.5214 0.4962 0.5305 0.0046  0.0012  -0.0122 555  ARG A CD  
4427 N NE  . ARG A 555 ? 0.5973 0.5655 0.5729 -0.0005 -0.0014 0.0126  555  ARG A NE  
4428 C CZ  . ARG A 555 ? 0.6156 0.5865 0.6062 -0.0039 -0.0032 -0.0004 555  ARG A CZ  
4429 N NH1 . ARG A 555 ? 0.6171 0.6089 0.6141 0.0053  -0.0048 0.0065  555  ARG A NH1 
4430 N NH2 . ARG A 555 ? 0.6321 0.6175 0.6070 -0.0018 -0.0067 -0.0057 555  ARG A NH2 
4431 N N   . VAL A 556 ? 0.4084 0.4214 0.4128 0.0041  0.0048  0.0017  556  VAL A N   
4432 C CA  . VAL A 556 ? 0.4191 0.4285 0.4220 0.0000  0.0011  0.0009  556  VAL A CA  
4433 C C   . VAL A 556 ? 0.4383 0.4421 0.4432 -0.0031 0.0026  -0.0049 556  VAL A C   
4434 O O   . VAL A 556 ? 0.4622 0.4681 0.4782 -0.0086 -0.0004 -0.0031 556  VAL A O   
4435 C CB  . VAL A 556 ? 0.4183 0.4194 0.4169 0.0019  0.0026  0.0019  556  VAL A CB  
4436 C CG1 . VAL A 556 ? 0.3979 0.4124 0.4121 -0.0010 -0.0044 0.0060  556  VAL A CG1 
4437 C CG2 . VAL A 556 ? 0.4074 0.4276 0.4152 -0.0001 0.0006  -0.0061 556  VAL A CG2 
4438 S S   . SO4 B .   ? 0.3168 0.2924 0.3118 -0.0026 -0.0020 -0.0124 602  SO4 A S   
4439 O O1  . SO4 B .   ? 0.2975 0.2963 0.3134 -0.0094 0.0071  -0.0115 602  SO4 A O1  
4440 O O2  . SO4 B .   ? 0.3043 0.3027 0.3341 -0.0001 -0.0088 0.0038  602  SO4 A O2  
4441 O O3  . SO4 B .   ? 0.2567 0.2595 0.2727 0.0058  0.0110  0.0126  602  SO4 A O3  
4442 O O4  . SO4 B .   ? 0.2828 0.2919 0.3042 0.0196  0.0023  -0.0085 602  SO4 A O4  
4443 S S   . SO4 C .   ? 0.5824 0.5728 0.6031 0.0061  0.0013  0.0006  603  SO4 A S   
4444 O O1  . SO4 C .   ? 0.5850 0.5768 0.5949 -0.0006 0.0001  -0.0046 603  SO4 A O1  
4445 O O2  . SO4 C .   ? 0.5884 0.5802 0.5982 0.0016  0.0016  0.0012  603  SO4 A O2  
4446 O O3  . SO4 C .   ? 0.5862 0.5837 0.5957 -0.0001 0.0028  0.0055  603  SO4 A O3  
4447 O O4  . SO4 C .   ? 0.5681 0.5428 0.5670 -0.0039 -0.0075 -0.0067 603  SO4 A O4  
4448 C C1  . BME D .   ? 0.4908 0.4767 0.4773 -0.0042 -0.0094 0.0113  601  BME A C1  
4449 C C2  . BME D .   ? 0.4934 0.4929 0.5000 -0.0013 0.0054  -0.0071 601  BME A C2  
4450 O O1  . BME D .   ? 0.4260 0.4404 0.4097 -0.0241 -0.0021 0.0042  601  BME A O1  
4451 S S2  . BME D .   ? 0.5918 0.5590 0.5355 -0.0044 -0.0099 0.0155  601  BME A S2  
4452 O O   . HOH E .   ? 0.1322 0.1449 0.1374 -0.0022 0.0045  0.0004  604  HOH A O   
4453 O O   . HOH E .   ? 0.1288 0.1801 0.1440 0.0266  -0.0016 -0.0106 605  HOH A O   
4454 O O   . HOH E .   ? 0.1558 0.1462 0.1364 -0.0065 0.0063  0.0109  606  HOH A O   
4455 O O   . HOH E .   ? 0.1239 0.1491 0.1554 -0.0073 0.0220  0.0264  607  HOH A O   
4456 O O   . HOH E .   ? 0.1559 0.1864 0.1166 -0.0035 0.0109  0.0112  608  HOH A O   
4457 O O   . HOH E .   ? 0.1226 0.1349 0.1195 0.0046  0.0011  0.0023  609  HOH A O   
4458 O O   . HOH E .   ? 0.1089 0.0860 0.1567 -0.0086 0.0200  0.0157  610  HOH A O   
4459 O O   . HOH E .   ? 0.1166 0.1202 0.1394 0.0108  0.0063  0.0098  611  HOH A O   
4460 O O   . HOH E .   ? 0.1755 0.1425 0.1849 -0.0122 0.0114  -0.0020 612  HOH A O   
4461 O O   . HOH E .   ? 0.1204 0.1386 0.1212 0.0053  -0.0079 0.0115  613  HOH A O   
4462 O O   . HOH E .   ? 0.1143 0.1338 0.1672 -0.0052 0.0016  -0.0152 614  HOH A O   
4463 O O   . HOH E .   ? 0.1561 0.1228 0.1664 -0.0053 -0.0042 -0.0063 615  HOH A O   
4464 O O   . HOH E .   ? 0.1305 0.1680 0.1665 0.0094  0.0013  -0.0075 616  HOH A O   
4465 O O   . HOH E .   ? 0.1638 0.1534 0.1657 0.0205  0.0156  -0.0092 617  HOH A O   
4466 O O   . HOH E .   ? 0.1503 0.1611 0.1394 0.0140  0.0070  -0.0021 618  HOH A O   
4467 O O   . HOH E .   ? 0.1461 0.1404 0.1435 0.0126  0.0078  0.0057  619  HOH A O   
4468 O O   . HOH E .   ? 0.1457 0.1581 0.1640 0.0025  0.0066  0.0079  620  HOH A O   
4469 O O   . HOH E .   ? 0.1687 0.1194 0.1464 0.0134  -0.0198 -0.0054 621  HOH A O   
4470 O O   . HOH E .   ? 0.1886 0.1504 0.1539 -0.0089 -0.0101 -0.0030 622  HOH A O   
4471 O O   . HOH E .   ? 0.1623 0.1362 0.1331 0.0218  -0.0013 -0.0188 623  HOH A O   
4472 O O   . HOH E .   ? 0.1322 0.1509 0.1589 -0.0072 -0.0032 -0.0060 624  HOH A O   
4473 O O   . HOH E .   ? 0.1600 0.1503 0.1288 0.0080  0.0037  0.0144  625  HOH A O   
4474 O O   . HOH E .   ? 0.1799 0.1154 0.1797 -0.0053 -0.0030 -0.0074 626  HOH A O   
4475 O O   . HOH E .   ? 0.1533 0.1880 0.1622 0.0003  0.0130  -0.0040 627  HOH A O   
4476 O O   . HOH E .   ? 0.1782 0.1548 0.1760 0.0132  -0.0066 0.0109  628  HOH A O   
4477 O O   . HOH E .   ? 0.1508 0.1311 0.1346 0.0099  0.0020  0.0062  629  HOH A O   
4478 O O   . HOH E .   ? 0.1439 0.1135 0.1903 -0.0110 -0.0163 0.0125  630  HOH A O   
4479 O O   . HOH E .   ? 0.1275 0.1472 0.1689 -0.0001 0.0163  0.0098  631  HOH A O   
4480 O O   . HOH E .   ? 0.1433 0.1534 0.1503 0.0231  0.0047  -0.0092 632  HOH A O   
4481 O O   . HOH E .   ? 0.1761 0.1839 0.1975 0.0347  0.0070  0.0120  633  HOH A O   
4482 O O   . HOH E .   ? 0.1576 0.1214 0.1337 -0.0036 0.0122  -0.0068 634  HOH A O   
4483 O O   . HOH E .   ? 0.1491 0.1347 0.1237 0.0009  0.0205  0.0076  635  HOH A O   
4484 O O   . HOH E .   ? 0.1040 0.1423 0.1282 0.0089  0.0253  0.0051  636  HOH A O   
4485 O O   . HOH E .   ? 0.1766 0.1357 0.1566 0.0104  -0.0187 -0.0185 637  HOH A O   
4486 O O   . HOH E .   ? 0.1641 0.1304 0.1540 -0.0240 -0.0264 0.0043  638  HOH A O   
4487 O O   . HOH E .   ? 0.1717 0.1506 0.1547 0.0033  0.0090  0.0284  639  HOH A O   
4488 O O   . HOH E .   ? 0.1785 0.1532 0.1723 -0.0098 -0.0106 -0.0195 640  HOH A O   
4489 O O   . HOH E .   ? 0.1687 0.1863 0.1883 0.0137  -0.0005 0.0058  641  HOH A O   
4490 O O   . HOH E .   ? 0.1621 0.1576 0.1631 0.0151  -0.0245 -0.0038 642  HOH A O   
4491 O O   . HOH E .   ? 0.1357 0.1280 0.1409 -0.0069 -0.0103 -0.0175 643  HOH A O   
4492 O O   . HOH E .   ? 0.1936 0.1936 0.3043 0.0017  0.0185  -0.0186 644  HOH A O   
4493 O O   . HOH E .   ? 0.1414 0.1385 0.1553 0.0018  -0.0035 -0.0186 645  HOH A O   
4494 O O   . HOH E .   ? 0.1450 0.1350 0.1256 0.0008  0.0010  -0.0189 646  HOH A O   
4495 O O   . HOH E .   ? 0.1414 0.1456 0.1418 0.0000  0.0001  0.0000  647  HOH A O   
4496 O O   . HOH E .   ? 0.1433 0.1560 0.1748 -0.0066 -0.0117 -0.0085 648  HOH A O   
4497 O O   . HOH E .   ? 0.1692 0.1511 0.1508 0.0199  0.0225  0.0076  649  HOH A O   
4498 O O   . HOH E .   ? 0.1438 0.1356 0.1824 0.0017  0.0000  0.0081  650  HOH A O   
4499 O O   . HOH E .   ? 0.1452 0.1223 0.1123 0.0022  0.0025  -0.0289 651  HOH A O   
4500 O O   . HOH E .   ? 0.1564 0.1479 0.2031 0.0198  -0.0041 -0.0356 652  HOH A O   
4501 O O   . HOH E .   ? 0.1593 0.1231 0.1843 0.0086  -0.0263 -0.0030 653  HOH A O   
4502 O O   . HOH E .   ? 0.1724 0.1529 0.1454 -0.0202 0.0203  0.0206  654  HOH A O   
4503 O O   . HOH E .   ? 0.1810 0.1387 0.1578 0.0016  0.0187  -0.0115 655  HOH A O   
4504 O O   . HOH E .   ? 0.1532 0.1377 0.1420 0.0129  0.0031  0.0199  656  HOH A O   
4505 O O   . HOH E .   ? 0.2133 0.1760 0.1532 0.0119  0.0139  -0.0112 657  HOH A O   
4506 O O   . HOH E .   ? 0.1991 0.1601 0.1966 -0.0158 -0.0048 0.0084  658  HOH A O   
4507 O O   . HOH E .   ? 0.1051 0.1264 0.1601 0.0087  -0.0088 -0.0028 659  HOH A O   
4508 O O   . HOH E .   ? 0.1174 0.1640 0.1925 -0.0133 0.0045  -0.0236 660  HOH A O   
4509 O O   . HOH E .   ? 0.1789 0.1739 0.1292 0.0181  0.0085  0.0380  661  HOH A O   
4510 O O   . HOH E .   ? 0.1718 0.1723 0.1267 0.0062  -0.0030 0.0109  662  HOH A O   
4511 O O   . HOH E .   ? 0.1813 0.1925 0.1846 -0.0127 0.0121  -0.0034 663  HOH A O   
4512 O O   . HOH E .   ? 0.1501 0.1345 0.1579 -0.0063 -0.0062 0.0077  664  HOH A O   
4513 O O   . HOH E .   ? 0.1650 0.1486 0.1354 -0.0011 0.0046  0.0058  665  HOH A O   
4514 O O   . HOH E .   ? 0.1201 0.1407 0.1182 0.0003  0.0114  0.0037  666  HOH A O   
4515 O O   . HOH E .   ? 0.2121 0.1983 0.1726 0.0442  -0.0033 0.0043  667  HOH A O   
4516 O O   . HOH E .   ? 0.1643 0.1128 0.1407 -0.0201 -0.0063 0.0077  668  HOH A O   
4517 O O   . HOH E .   ? 0.1404 0.1530 0.1453 0.0052  -0.0123 -0.0057 669  HOH A O   
4518 O O   . HOH E .   ? 0.1752 0.1746 0.1952 -0.0087 0.0018  -0.0128 670  HOH A O   
4519 O O   . HOH E .   ? 0.1501 0.1702 0.1463 0.0003  -0.0031 -0.0139 671  HOH A O   
4520 O O   . HOH E .   ? 0.1708 0.1702 0.1558 0.0166  0.0073  0.0092  672  HOH A O   
4521 O O   . HOH E .   ? 0.1577 0.1586 0.1529 0.0032  -0.0143 0.0035  673  HOH A O   
4522 O O   . HOH E .   ? 0.1675 0.1676 0.1359 0.0056  -0.0029 -0.0270 674  HOH A O   
4523 O O   . HOH E .   ? 0.1983 0.1622 0.1713 0.0001  -0.0036 -0.0274 675  HOH A O   
4524 O O   . HOH E .   ? 0.1460 0.1509 0.1415 0.0184  -0.0275 -0.0089 676  HOH A O   
4525 O O   . HOH E .   ? 0.1440 0.1266 0.1353 0.0032  0.0169  0.0129  677  HOH A O   
4526 O O   . HOH E .   ? 0.2145 0.1676 0.2135 0.0023  -0.0025 -0.0006 678  HOH A O   
4527 O O   . HOH E .   ? 0.1772 0.1388 0.1420 0.0183  0.0171  0.0019  679  HOH A O   
4528 O O   . HOH E .   ? 0.1542 0.1317 0.1852 0.0080  -0.0037 -0.0129 680  HOH A O   
4529 O O   . HOH E .   ? 0.1323 0.2038 0.2654 -0.0285 -0.0094 -0.0062 681  HOH A O   
4530 O O   . HOH E .   ? 0.2373 0.2187 0.2760 0.0214  -0.0070 0.0168  682  HOH A O   
4531 O O   . HOH E .   ? 0.2173 0.2410 0.1985 0.0159  -0.0142 -0.0209 683  HOH A O   
4532 O O   . HOH E .   ? 0.1302 0.1539 0.1294 0.0068  -0.0278 -0.0269 684  HOH A O   
4533 O O   . HOH E .   ? 0.1480 0.2180 0.2791 -0.0234 -0.0014 0.0009  685  HOH A O   
4534 O O   . HOH E .   ? 0.2412 0.2048 0.2364 0.0010  -0.0141 -0.0050 686  HOH A O   
4535 O O   . HOH E .   ? 0.1659 0.2175 0.2257 0.0122  -0.0076 0.0049  687  HOH A O   
4536 O O   . HOH E .   ? 0.1547 0.1582 0.1786 -0.0126 0.0095  -0.0020 688  HOH A O   
4537 O O   . HOH E .   ? 0.2023 0.2093 0.1607 -0.0032 0.0000  -0.0356 689  HOH A O   
4538 O O   . HOH E .   ? 0.1894 0.1899 0.2100 0.0223  0.0085  0.0159  690  HOH A O   
4539 O O   . HOH E .   ? 0.1985 0.1733 0.1846 -0.0125 -0.0033 -0.0090 691  HOH A O   
4540 O O   . HOH E .   ? 0.2403 0.2698 0.2493 0.0154  -0.0020 -0.0159 692  HOH A O   
4541 O O   . HOH E .   ? 0.1795 0.1829 0.2031 -0.0112 0.0161  0.0077  693  HOH A O   
4542 O O   . HOH E .   ? 0.2049 0.2199 0.2453 0.0191  0.0081  -0.0026 694  HOH A O   
4543 O O   . HOH E .   ? 0.1274 0.1843 0.2147 -0.0006 -0.0092 -0.0347 695  HOH A O   
4544 O O   . HOH E .   ? 0.1484 0.1423 0.2146 -0.0006 0.0161  -0.0021 696  HOH A O   
4545 O O   . HOH E .   ? 0.2355 0.2504 0.2318 -0.0122 -0.0050 -0.0105 697  HOH A O   
4546 O O   . HOH E .   ? 0.1580 0.1449 0.1471 -0.0028 0.0039  -0.0131 698  HOH A O   
4547 O O   . HOH E .   ? 0.1666 0.1804 0.1349 -0.0108 0.0166  -0.0097 699  HOH A O   
4548 O O   . HOH E .   ? 0.2639 0.1857 0.2309 -0.0246 -0.0134 0.0243  700  HOH A O   
4549 O O   . HOH E .   ? 0.2114 0.2370 0.2090 -0.0186 -0.0176 -0.0217 701  HOH A O   
4550 O O   . HOH E .   ? 0.1525 0.1913 0.1860 0.0025  0.0045  0.0294  702  HOH A O   
4551 O O   . HOH E .   ? 0.2488 0.2189 0.2836 -0.0401 0.0241  0.0109  703  HOH A O   
4552 O O   . HOH E .   ? 0.1786 0.1840 0.2119 -0.0142 0.0024  -0.0253 704  HOH A O   
4553 O O   . HOH E .   ? 0.1702 0.1868 0.1547 -0.0091 0.0055  0.0160  705  HOH A O   
4554 O O   . HOH E .   ? 0.2080 0.1622 0.2226 -0.0185 0.0214  -0.0284 706  HOH A O   
4555 O O   . HOH E .   ? 0.2349 0.1981 0.2130 -0.0296 -0.0045 -0.0125 707  HOH A O   
4556 O O   . HOH E .   ? 0.2321 0.1793 0.2226 0.0057  -0.0018 0.0090  708  HOH A O   
4557 O O   . HOH E .   ? 0.2543 0.2446 0.1882 -0.0076 -0.0160 -0.0132 709  HOH A O   
4558 O O   . HOH E .   ? 0.2168 0.1732 0.1880 -0.0198 -0.0157 -0.0107 710  HOH A O   
4559 O O   . HOH E .   ? 0.2393 0.2109 0.2292 0.0346  -0.0245 0.0051  711  HOH A O   
4560 O O   . HOH E .   ? 0.1544 0.1583 0.1512 0.0124  0.0112  0.0044  712  HOH A O   
4561 O O   . HOH E .   ? 0.2137 0.2039 0.2164 -0.0070 0.0012  0.0057  713  HOH A O   
4562 O O   . HOH E .   ? 0.2745 0.2550 0.2433 0.0229  0.0270  0.0046  714  HOH A O   
4563 O O   . HOH E .   ? 0.2434 0.1867 0.2261 0.0503  -0.0177 0.0388  715  HOH A O   
4564 O O   . HOH E .   ? 0.2872 0.2722 0.2748 -0.0201 0.0176  -0.0149 716  HOH A O   
4565 O O   . HOH E .   ? 0.3387 0.3324 0.4168 0.0138  0.0144  -0.0097 717  HOH A O   
4566 O O   . HOH E .   ? 0.2075 0.2408 0.2069 0.0194  0.0045  -0.0189 718  HOH A O   
4567 O O   . HOH E .   ? 0.1895 0.2013 0.2008 -0.0006 0.0018  0.0061  719  HOH A O   
4568 O O   . HOH E .   ? 0.2149 0.1754 0.1826 0.0361  0.0043  0.0160  720  HOH A O   
4569 O O   . HOH E .   ? 0.2318 0.2093 0.2443 0.0043  -0.0378 0.0171  721  HOH A O   
4570 O O   . HOH E .   ? 0.2949 0.2410 0.3363 0.0066  -0.0061 0.0024  722  HOH A O   
4571 O O   . HOH E .   ? 0.3016 0.2091 0.2384 0.0286  -0.0485 0.0019  723  HOH A O   
4572 O O   . HOH E .   ? 0.2443 0.2190 0.2481 -0.0052 0.0163  0.0032  724  HOH A O   
4573 O O   . HOH E .   ? 0.3595 0.3621 0.3349 -0.0162 0.0537  0.0164  725  HOH A O   
4574 O O   . HOH E .   ? 0.3717 0.2799 0.3323 0.0227  -0.0262 0.0050  726  HOH A O   
4575 O O   . HOH E .   ? 0.2260 0.2616 0.2469 -0.0233 0.0113  -0.0071 727  HOH A O   
4576 O O   . HOH E .   ? 0.3533 0.4527 0.4057 0.0108  0.0002  0.0182  728  HOH A O   
4577 O O   . HOH E .   ? 0.2562 0.2083 0.2050 -0.0220 -0.0072 -0.0092 729  HOH A O   
4578 O O   . HOH E .   ? 0.1591 0.1403 0.1642 0.0131  0.0031  0.0042  730  HOH A O   
4579 O O   . HOH E .   ? 0.3480 0.3240 0.3701 -0.0097 0.0015  0.0007  731  HOH A O   
4580 O O   . HOH E .   ? 0.2101 0.2037 0.2669 0.0135  0.0233  0.0163  732  HOH A O   
4581 O O   . HOH E .   ? 0.2673 0.1945 0.2422 -0.0095 0.0198  -0.0042 733  HOH A O   
4582 O O   . HOH E .   ? 0.2873 0.2913 0.2748 -0.0172 0.0087  0.0504  734  HOH A O   
4583 O O   . HOH E .   ? 0.2675 0.2045 0.2066 0.0155  -0.0140 0.0153  735  HOH A O   
4584 O O   . HOH E .   ? 0.2501 0.2337 0.2362 0.0245  0.0029  -0.0405 736  HOH A O   
4585 O O   . HOH E .   ? 0.2412 0.1918 0.2404 0.0159  0.0075  -0.0246 737  HOH A O   
4586 O O   . HOH E .   ? 0.1955 0.2987 0.2612 0.0105  0.0068  0.0005  738  HOH A O   
4587 O O   . HOH E .   ? 0.1807 0.2345 0.2595 0.0217  0.0173  -0.0138 739  HOH A O   
4588 O O   . HOH E .   ? 0.2182 0.2860 0.2865 0.0017  0.0150  -0.0072 740  HOH A O   
4589 O O   . HOH E .   ? 0.3017 0.2743 0.2770 0.0321  0.0291  -0.0066 741  HOH A O   
4590 O O   . HOH E .   ? 0.2755 0.2510 0.2129 -0.0067 -0.0324 0.0084  742  HOH A O   
4591 O O   . HOH E .   ? 0.2754 0.2934 0.2271 0.0214  0.0205  0.0048  743  HOH A O   
4592 O O   . HOH E .   ? 0.2557 0.3262 0.3252 -0.0015 0.0142  -0.0146 744  HOH A O   
4593 O O   . HOH E .   ? 0.2402 0.2105 0.2638 0.0339  0.0100  0.0042  745  HOH A O   
4594 O O   . HOH E .   ? 0.2476 0.3095 0.2832 -0.0310 -0.0080 -0.0096 746  HOH A O   
4595 O O   . HOH E .   ? 0.2939 0.2381 0.3285 0.0219  0.0097  0.0119  747  HOH A O   
4596 O O   . HOH E .   ? 0.2019 0.2648 0.3205 -0.0276 -0.0195 0.0111  748  HOH A O   
4597 O O   . HOH E .   ? 0.2718 0.2671 0.2422 -0.0460 -0.0145 0.0083  749  HOH A O   
4598 O O   . HOH E .   ? 0.2470 0.2591 0.2866 -0.0041 0.0030  -0.0050 750  HOH A O   
4599 O O   . HOH E .   ? 0.2395 0.2857 0.3079 -0.0099 0.0468  0.0184  751  HOH A O   
4600 O O   . HOH E .   ? 0.3216 0.2555 0.3212 -0.0273 -0.0107 0.0069  752  HOH A O   
4601 O O   . HOH E .   ? 0.2032 0.3337 0.2718 0.0164  -0.0119 -0.0325 753  HOH A O   
4602 O O   . HOH E .   ? 0.3056 0.2620 0.1911 0.0253  -0.0212 -0.0568 754  HOH A O   
4603 O O   . HOH E .   ? 0.2979 0.2282 0.2848 -0.0195 0.0061  0.0225  755  HOH A O   
4604 O O   . HOH E .   ? 0.5131 0.5114 0.5213 -0.0069 0.0026  0.0072  756  HOH A O   
4605 O O   . HOH E .   ? 0.3089 0.2936 0.3365 0.0073  -0.0101 0.0032  757  HOH A O   
4606 O O   . HOH E .   ? 0.2852 0.2495 0.3257 0.0037  -0.0196 -0.0013 758  HOH A O   
4607 O O   . HOH E .   ? 0.2159 0.2489 0.2672 -0.0064 0.0001  -0.0055 759  HOH A O   
4608 O O   . HOH E .   ? 0.2423 0.2559 0.2872 -0.0044 0.0004  0.0235  760  HOH A O   
4609 O O   . HOH E .   ? 0.1478 0.1695 0.1463 0.0035  -0.0081 0.0115  761  HOH A O   
4610 O O   . HOH E .   ? 0.3255 0.2901 0.3526 -0.0168 0.0423  -0.0174 762  HOH A O   
4611 O O   . HOH E .   ? 0.1783 0.2080 0.2304 0.0018  0.0124  -0.0186 763  HOH A O   
4612 O O   . HOH E .   ? 0.2349 0.1846 0.2428 -0.0033 -0.0239 0.0257  764  HOH A O   
4613 O O   . HOH E .   ? 0.1878 0.1758 0.1779 0.0172  -0.0023 0.0002  765  HOH A O   
4614 O O   . HOH E .   ? 0.5694 0.5684 0.5691 0.0033  -0.0049 -0.0056 766  HOH A O   
4615 O O   . HOH E .   ? 0.2773 0.2604 0.2171 0.0120  -0.0062 0.0318  767  HOH A O   
4616 O O   . HOH E .   ? 0.3010 0.2363 0.3065 0.0060  -0.0477 -0.0073 768  HOH A O   
4617 O O   . HOH E .   ? 0.3270 0.3398 0.3576 0.0286  0.0159  0.0192  769  HOH A O   
4618 O O   . HOH E .   ? 0.3431 0.3344 0.3421 0.0011  -0.0322 0.0122  770  HOH A O   
4619 O O   . HOH E .   ? 0.1919 0.1850 0.2243 -0.0299 -0.0039 -0.0045 771  HOH A O   
4620 O O   . HOH E .   ? 0.2573 0.2510 0.3439 -0.0123 0.0364  0.0224  772  HOH A O   
4621 O O   . HOH E .   ? 0.2330 0.2681 0.2740 0.0195  0.0036  -0.0142 773  HOH A O   
4622 O O   . HOH E .   ? 0.3028 0.2761 0.3037 0.0036  -0.0126 -0.0115 774  HOH A O   
4623 O O   . HOH E .   ? 0.2040 0.2606 0.2647 0.0414  -0.0194 0.0550  775  HOH A O   
4624 O O   . HOH E .   ? 0.2648 0.2469 0.3005 -0.0074 0.0321  0.0161  776  HOH A O   
4625 O O   . HOH E .   ? 0.3123 0.1973 0.3141 -0.0122 0.0058  -0.0128 777  HOH A O   
4626 O O   . HOH E .   ? 0.2683 0.2370 0.2580 0.0168  -0.0319 0.0029  778  HOH A O   
4627 O O   . HOH E .   ? 0.2844 0.2981 0.2456 0.0124  0.0081  -0.0020 779  HOH A O   
4628 O O   . HOH E .   ? 0.3556 0.2918 0.3037 0.0138  -0.0341 0.0252  780  HOH A O   
4629 O O   . HOH E .   ? 0.3058 0.3745 0.3093 -0.0125 0.0085  0.0057  781  HOH A O   
4630 O O   . HOH E .   ? 0.2722 0.2925 0.2570 0.0063  -0.0038 0.0039  782  HOH A O   
4631 O O   . HOH E .   ? 0.4029 0.2956 0.3358 0.0013  -0.0057 -0.0079 783  HOH A O   
4632 O O   . HOH E .   ? 0.2351 0.3151 0.2627 0.0235  -0.0225 -0.0135 784  HOH A O   
4633 O O   . HOH E .   ? 0.1857 0.2186 0.2167 -0.0218 0.0008  0.0045  785  HOH A O   
4634 O O   . HOH E .   ? 0.2112 0.2102 0.2134 0.0163  -0.0325 0.0071  786  HOH A O   
4635 O O   . HOH E .   ? 0.2740 0.3968 0.4224 -0.0008 -0.0236 -0.0171 787  HOH A O   
4636 O O   . HOH E .   ? 0.3260 0.3091 0.3776 0.0007  -0.0088 -0.0190 788  HOH A O   
4637 O O   . HOH E .   ? 0.2771 0.2814 0.3141 0.0048  0.0197  -0.0192 789  HOH A O   
4638 O O   . HOH E .   ? 0.3216 0.2136 0.2963 -0.0136 -0.0060 0.0099  790  HOH A O   
4639 O O   . HOH E .   ? 0.3575 0.3220 0.3293 -0.0139 0.0001  0.0047  791  HOH A O   
4640 O O   . HOH E .   ? 0.2702 0.2958 0.3201 0.0149  0.0083  0.0319  792  HOH A O   
4641 O O   . HOH E .   ? 0.2538 0.2435 0.2713 0.0187  -0.0066 0.0119  793  HOH A O   
4642 O O   . HOH E .   ? 0.2408 0.2410 0.2380 0.0223  -0.0102 0.0030  794  HOH A O   
4643 O O   . HOH E .   ? 0.4469 0.4350 0.4114 -0.0018 0.0078  -0.0138 795  HOH A O   
4644 O O   . HOH E .   ? 0.3261 0.2745 0.2900 -0.0032 0.0226  -0.0125 796  HOH A O   
4645 O O   . HOH E .   ? 0.2914 0.2271 0.2861 -0.0211 0.0305  0.0059  797  HOH A O   
4646 O O   . HOH E .   ? 0.3371 0.3296 0.3370 -0.0447 -0.0144 0.0234  798  HOH A O   
4647 O O   . HOH E .   ? 0.3729 0.3137 0.3456 -0.0236 0.0063  0.0100  799  HOH A O   
4648 O O   . HOH E .   ? 0.2403 0.2489 0.2509 0.0096  0.0000  -0.0081 800  HOH A O   
4649 O O   . HOH E .   ? 0.3422 0.3012 0.3415 -0.0259 0.0140  0.0219  801  HOH A O   
4650 O O   . HOH E .   ? 0.4130 0.3512 0.4022 -0.0090 0.0143  -0.0011 802  HOH A O   
4651 O O   . HOH E .   ? 0.2984 0.2660 0.3071 -0.0205 0.0281  -0.0074 803  HOH A O   
4652 O O   . HOH E .   ? 0.3426 0.2754 0.3304 -0.0094 -0.0113 -0.0008 804  HOH A O   
4653 O O   . HOH E .   ? 0.3369 0.2922 0.3351 -0.0045 0.0112  0.0135  805  HOH A O   
4654 O O   . HOH E .   ? 0.2993 0.2593 0.4091 -0.0048 0.0228  0.0035  806  HOH A O   
4655 O O   . HOH E .   ? 0.3350 0.3365 0.3344 -0.0172 0.0205  0.0122  807  HOH A O   
4656 O O   . HOH E .   ? 0.2804 0.2435 0.2416 -0.0031 0.0245  0.0046  808  HOH A O   
4657 O O   . HOH E .   ? 0.2382 0.2656 0.2993 0.0033  -0.0200 0.0122  809  HOH A O   
4658 O O   . HOH E .   ? 0.1880 0.1690 0.1555 0.0014  -0.0063 -0.0182 810  HOH A O   
4659 O O   . HOH E .   ? 0.2792 0.3027 0.2766 -0.0007 0.0055  -0.0233 811  HOH A O   
4660 O O   . HOH E .   ? 0.3503 0.3604 0.3415 -0.0196 -0.0380 -0.0189 812  HOH A O   
4661 O O   . HOH E .   ? 0.3801 0.3101 0.3002 0.0131  -0.0416 -0.0199 813  HOH A O   
4662 O O   . HOH E .   ? 0.3008 0.2571 0.2781 -0.0020 0.0120  -0.0020 814  HOH A O   
4663 O O   . HOH E .   ? 0.3551 0.3746 0.2811 -0.0121 -0.0151 0.0106  815  HOH A O   
4664 O O   . HOH E .   ? 0.5263 0.5212 0.5296 0.0023  -0.0052 -0.0014 816  HOH A O   
4665 O O   . HOH E .   ? 0.3394 0.3214 0.3735 0.0026  0.0105  0.0091  817  HOH A O   
4666 O O   . HOH E .   ? 0.3228 0.3363 0.2991 0.0096  0.0204  -0.0052 818  HOH A O   
4667 O O   . HOH E .   ? 0.1882 0.2686 0.2522 0.0149  -0.0006 -0.0003 819  HOH A O   
4668 O O   . HOH E .   ? 0.2875 0.4015 0.3998 -0.0136 -0.0003 0.0277  820  HOH A O   
4669 O O   . HOH E .   ? 0.3237 0.3286 0.2683 0.0028  -0.0088 0.0228  821  HOH A O   
4670 O O   . HOH E .   ? 0.4063 0.3531 0.4036 -0.0155 0.0127  -0.0077 822  HOH A O   
4671 O O   . HOH E .   ? 0.3555 0.3466 0.3548 0.0044  0.0011  0.0089  823  HOH A O   
4672 O O   . HOH E .   ? 0.2814 0.2761 0.3239 0.0242  0.0350  0.0316  824  HOH A O   
4673 O O   . HOH E .   ? 0.2628 0.2522 0.3636 0.0078  -0.0041 0.0359  825  HOH A O   
4674 O O   . HOH E .   ? 0.3061 0.2983 0.2602 0.0006  0.0055  -0.0495 826  HOH A O   
4675 O O   . HOH E .   ? 0.3080 0.3567 0.3224 -0.0211 0.0105  0.0145  827  HOH A O   
4676 O O   . HOH E .   ? 0.3519 0.4168 0.3565 -0.0008 0.0047  -0.0220 828  HOH A O   
4677 O O   . HOH E .   ? 0.3878 0.3762 0.3922 0.0085  -0.0100 0.0051  829  HOH A O   
4678 O O   . HOH E .   ? 0.2651 0.2475 0.3193 -0.0361 0.0249  0.0195  830  HOH A O   
4679 O O   . HOH E .   ? 0.3481 0.2912 0.3359 -0.0083 -0.0015 0.0076  831  HOH A O   
4680 O O   . HOH E .   ? 0.2457 0.1954 0.2344 -0.0192 -0.0196 0.0334  832  HOH A O   
4681 O O   . HOH E .   ? 0.3709 0.3475 0.3784 0.0003  0.0072  0.0286  833  HOH A O   
4682 O O   . HOH E .   ? 0.4018 0.4350 0.3996 -0.0213 0.0013  -0.0117 834  HOH A O   
4683 O O   . HOH E .   ? 0.3292 0.3687 0.3233 0.0003  -0.0025 -0.0066 835  HOH A O   
4684 O O   . HOH E .   ? 0.3435 0.2920 0.2591 -0.0360 -0.0089 -0.0052 836  HOH A O   
4685 O O   . HOH E .   ? 0.4350 0.4702 0.4279 0.0009  0.0194  0.0000  837  HOH A O   
4686 O O   . HOH E .   ? 0.4527 0.4616 0.3953 0.0001  0.0079  -0.0062 838  HOH A O   
4687 O O   . HOH E .   ? 0.3958 0.3644 0.3825 0.0070  0.0074  0.0195  839  HOH A O   
4688 O O   . HOH E .   ? 0.3228 0.3237 0.3466 0.0350  -0.0013 0.0128  840  HOH A O   
4689 O O   . HOH E .   ? 0.3531 0.3854 0.2979 -0.0200 0.0015  0.0114  841  HOH A O   
4690 O O   . HOH E .   ? 0.3051 0.2634 0.3022 -0.0107 0.0280  0.0183  842  HOH A O   
4691 O O   . HOH E .   ? 0.4051 0.4625 0.4054 0.0092  0.0042  0.0123  843  HOH A O   
4692 O O   . HOH E .   ? 0.4297 0.3882 0.4291 -0.0003 -0.0058 -0.0222 844  HOH A O   
4693 O O   . HOH E .   ? 0.1844 0.1943 0.2577 -0.0003 -0.0077 -0.0246 845  HOH A O   
4694 O O   . HOH E .   ? 0.3533 0.3406 0.3369 -0.0119 -0.0002 -0.0102 846  HOH A O   
4695 O O   . HOH E .   ? 0.3562 0.3617 0.3322 0.0073  -0.0067 -0.0231 847  HOH A O   
4696 O O   . HOH E .   ? 0.3268 0.3748 0.3612 -0.0173 0.0254  -0.0021 848  HOH A O   
4697 O O   . HOH E .   ? 0.2877 0.3277 0.2825 -0.0058 -0.0165 -0.0039 849  HOH A O   
4698 O O   . HOH E .   ? 0.2912 0.3768 0.3581 -0.0065 -0.0351 0.0005  850  HOH A O   
4699 O O   . HOH E .   ? 0.3715 0.3212 0.3132 -0.0090 0.0149  0.0008  851  HOH A O   
4700 O O   . HOH E .   ? 0.3929 0.3551 0.3737 0.0048  0.0145  -0.0133 852  HOH A O   
4701 O O   . HOH E .   ? 0.4483 0.4587 0.4765 -0.0004 -0.0003 0.0033  853  HOH A O   
4702 O O   . HOH E .   ? 0.3726 0.3975 0.3964 0.0015  -0.0069 0.0073  854  HOH A O   
4703 O O   . HOH E .   ? 0.2094 0.2571 0.2225 -0.0007 -0.0109 -0.0071 855  HOH A O   
4704 O O   . HOH E .   ? 0.3851 0.3193 0.3727 -0.0043 -0.0144 -0.0045 856  HOH A O   
4705 O O   . HOH E .   ? 0.4946 0.4797 0.4413 -0.0031 -0.0032 0.0081  857  HOH A O   
4706 O O   . HOH E .   ? 0.2909 0.2904 0.2735 0.0189  -0.0103 0.0002  858  HOH A O   
4707 O O   . HOH E .   ? 0.5577 0.5619 0.5589 0.0032  0.0037  -0.0099 859  HOH A O   
4708 O O   . HOH E .   ? 0.5563 0.5188 0.5135 0.0007  0.0046  0.0051  860  HOH A O   
4709 O O   . HOH E .   ? 0.4240 0.4476 0.4931 0.0077  0.0097  0.0089  861  HOH A O   
4710 O O   . HOH E .   ? 0.2416 0.2545 0.2795 -0.0035 -0.0031 0.0055  862  HOH A O   
4711 O O   . HOH E .   ? 0.3508 0.3613 0.3648 -0.0192 0.0138  0.0205  863  HOH A O   
4712 O O   . HOH E .   ? 0.2623 0.2434 0.3238 0.0091  0.0169  -0.0032 864  HOH A O   
4713 O O   . HOH E .   ? 0.5693 0.5455 0.5652 0.0004  0.0117  0.0062  865  HOH A O   
4714 O O   . HOH E .   ? 0.2721 0.2388 0.2771 -0.0159 0.0424  0.0028  866  HOH A O   
4715 O O   . HOH E .   ? 0.4211 0.4434 0.4327 0.0191  -0.0045 -0.0015 867  HOH A O   
4716 O O   . HOH E .   ? 0.3720 0.3088 0.3466 0.0078  -0.0103 -0.0079 868  HOH A O   
4717 O O   . HOH E .   ? 0.2397 0.2662 0.2640 -0.0049 -0.0029 -0.0086 869  HOH A O   
4718 O O   . HOH E .   ? 0.4037 0.4103 0.2837 0.0184  -0.0267 -0.0026 870  HOH A O   
4719 O O   . HOH E .   ? 0.4169 0.4432 0.3850 0.0096  -0.0156 0.0246  871  HOH A O   
4720 O O   . HOH E .   ? 0.4683 0.4430 0.4790 -0.0012 -0.0067 -0.0021 872  HOH A O   
4721 O O   . HOH E .   ? 0.4468 0.4442 0.4163 0.0047  0.0038  0.0134  873  HOH A O   
4722 O O   . HOH E .   ? 0.4523 0.4194 0.4482 0.0066  -0.0205 -0.0014 874  HOH A O   
4723 O O   . HOH E .   ? 0.2848 0.2853 0.3495 0.0178  0.0010  -0.0338 875  HOH A O   
4724 O O   . HOH E .   ? 0.5291 0.5254 0.5188 -0.0040 0.0008  -0.0111 876  HOH A O   
4725 O O   . HOH E .   ? 0.4805 0.4989 0.4560 0.0091  -0.0033 -0.0044 877  HOH A O   
4726 O O   . HOH E .   ? 0.3370 0.3316 0.3878 0.0160  -0.0002 -0.0002 878  HOH A O   
4727 O O   . HOH E .   ? 0.4261 0.4405 0.4173 -0.0021 -0.0275 0.0132  879  HOH A O   
4728 O O   . HOH E .   ? 0.4180 0.3860 0.3941 0.0054  0.0115  -0.0259 880  HOH A O   
4729 O O   . HOH E .   ? 0.3523 0.3602 0.3375 0.0084  0.0052  0.0018  881  HOH A O   
4730 O O   . HOH E .   ? 0.3884 0.3708 0.3837 -0.0327 0.0213  -0.0186 882  HOH A O   
4731 O O   . HOH E .   ? 0.5119 0.5000 0.4964 -0.0013 0.0010  0.0024  883  HOH A O   
4732 O O   . HOH E .   ? 0.5123 0.5229 0.5258 0.0088  0.0076  -0.0010 884  HOH A O   
4733 O O   . HOH E .   ? 0.4141 0.3885 0.4264 -0.0004 -0.0113 -0.0012 885  HOH A O   
4734 O O   . HOH E .   ? 0.4084 0.3781 0.3983 -0.0125 -0.0037 -0.0113 886  HOH A O   
4735 O O   . HOH E .   ? 0.2687 0.2704 0.2468 0.0032  0.0228  0.0095  887  HOH A O   
4736 O O   . HOH E .   ? 0.6714 0.6629 0.6744 -0.0045 -0.0009 0.0026  888  HOH A O   
4737 O O   . HOH E .   ? 0.2429 0.3133 0.3359 0.0320  0.0066  0.0166  889  HOH A O   
4738 O O   . HOH E .   ? 0.4678 0.5158 0.4964 0.0073  0.0201  0.0001  890  HOH A O   
4739 O O   . HOH E .   ? 0.6131 0.6202 0.6295 0.0079  -0.0063 0.0028  891  HOH A O   
4740 O O   . HOH E .   ? 0.5132 0.5246 0.5285 -0.0111 0.0019  -0.0052 892  HOH A O   
4741 O O   . HOH E .   ? 0.3638 0.3646 0.3538 0.0083  -0.0201 0.0074  893  HOH A O   
4742 O O   . HOH E .   ? 0.4162 0.4105 0.4006 -0.0060 0.0070  0.0095  894  HOH A O   
4743 O O   . HOH E .   ? 0.2885 0.2525 0.2204 -0.0126 -0.0047 0.0201  895  HOH A O   
4744 O O   . HOH E .   ? 0.3555 0.4361 0.4097 -0.0075 0.0084  0.0098  896  HOH A O   
4745 O O   . HOH E .   ? 0.2590 0.2243 0.2615 -0.0008 0.0367  -0.0374 897  HOH A O   
4746 O O   . HOH E .   ? 0.3605 0.3473 0.3798 -0.0127 0.0132  0.0073  898  HOH A O   
4747 O O   . HOH E .   ? 0.3947 0.3636 0.4263 0.0143  0.0012  0.0060  899  HOH A O   
4748 O O   . HOH E .   ? 0.3683 0.3773 0.3581 0.0105  0.0131  0.0055  900  HOH A O   
4749 O O   . HOH E .   ? 0.2808 0.3061 0.2540 -0.0225 -0.0072 -0.0256 901  HOH A O   
4750 O O   . HOH E .   ? 0.4593 0.4654 0.4534 -0.0084 -0.0025 -0.0007 902  HOH A O   
4751 O O   . HOH E .   ? 0.3506 0.2751 0.3280 -0.0130 -0.0014 -0.0298 903  HOH A O   
4752 O O   . HOH E .   ? 0.2913 0.2777 0.2679 0.0129  -0.0012 0.0101  904  HOH A O   
4753 O O   . HOH E .   ? 0.4996 0.4758 0.5036 -0.0068 -0.0049 0.0034  905  HOH A O   
4754 O O   . HOH E .   ? 0.3998 0.4122 0.4603 0.0025  -0.0007 -0.0116 906  HOH A O   
4755 O O   . HOH E .   ? 0.5544 0.5453 0.5394 -0.0087 -0.0067 0.0058  907  HOH A O   
4756 O O   . HOH E .   ? 0.2906 0.3257 0.2468 -0.0331 0.0302  -0.0029 908  HOH A O   
4757 O O   . HOH E .   ? 0.4292 0.4451 0.4923 0.0066  -0.0035 0.0088  909  HOH A O   
4758 O O   . HOH E .   ? 0.3290 0.3547 0.3493 -0.0061 -0.0341 -0.0289 910  HOH A O   
4759 O O   . HOH E .   ? 0.3864 0.4085 0.4091 -0.0045 0.0107  -0.0142 911  HOH A O   
4760 O O   . HOH E .   ? 0.3664 0.3707 0.3829 0.0117  0.0182  0.0065  912  HOH A O   
4761 O O   . HOH E .   ? 0.3625 0.3275 0.3280 -0.0142 -0.0069 -0.0264 913  HOH A O   
4762 O O   . HOH E .   ? 0.4923 0.4520 0.4605 -0.0087 -0.0111 -0.0015 914  HOH A O   
4763 O O   . HOH E .   ? 0.4565 0.4443 0.4602 -0.0050 -0.0129 0.0102  915  HOH A O   
4764 O O   . HOH E .   ? 0.3486 0.3748 0.3360 -0.0015 0.0060  -0.0124 916  HOH A O   
4765 O O   . HOH E .   ? 0.3180 0.3127 0.2924 0.0033  0.0283  -0.0051 917  HOH A O   
4766 O O   . HOH E .   ? 0.3549 0.3599 0.3881 -0.0093 -0.0158 0.0207  918  HOH A O   
4767 O O   . HOH E .   ? 0.4438 0.4504 0.4203 0.0027  -0.0017 -0.0060 919  HOH A O   
4768 O O   . HOH E .   ? 0.3832 0.3906 0.4094 -0.0232 0.0033  0.0059  920  HOH A O   
4769 O O   . HOH E .   ? 0.3979 0.4582 0.4465 0.0107  -0.0019 -0.0086 921  HOH A O   
4770 O O   . HOH E .   ? 0.4160 0.4156 0.3528 -0.0023 -0.0027 -0.0090 922  HOH A O   
4771 O O   . HOH E .   ? 0.3484 0.3499 0.3374 0.0218  0.0019  0.0025  923  HOH A O   
4772 O O   . HOH E .   ? 0.3376 0.3467 0.3460 -0.0024 0.0235  -0.0074 924  HOH A O   
4773 O O   . HOH E .   ? 0.4702 0.4576 0.4579 0.0016  -0.0031 0.0017  925  HOH A O   
4774 O O   . HOH E .   ? 0.2429 0.2651 0.2785 0.0175  0.0002  -0.0503 926  HOH A O   
4775 O O   . HOH E .   ? 0.4173 0.4169 0.4267 0.0044  0.0170  -0.0289 927  HOH A O   
4776 O O   . HOH E .   ? 0.4683 0.4961 0.4872 0.0033  0.0048  0.0149  928  HOH A O   
4777 O O   . HOH E .   ? 0.3509 0.3733 0.3760 0.0058  0.0058  -0.0046 929  HOH A O   
4778 O O   . HOH E .   ? 0.3268 0.3138 0.3574 0.0101  -0.0066 0.0071  930  HOH A O   
4779 O O   . HOH E .   ? 0.3423 0.4208 0.4224 0.0077  0.0010  0.0112  931  HOH A O   
4780 O O   . HOH E .   ? 0.4120 0.3877 0.3814 0.0147  -0.0079 -0.0044 932  HOH A O   
4781 O O   . HOH E .   ? 0.4276 0.3987 0.4260 -0.0010 -0.0068 -0.0077 933  HOH A O   
4782 O O   . HOH E .   ? 0.4405 0.3967 0.3961 -0.0075 -0.0093 -0.0153 934  HOH A O   
4783 O O   . HOH E .   ? 0.4062 0.4137 0.4033 0.0002  -0.0177 0.0172  935  HOH A O   
4784 O O   . HOH E .   ? 0.4339 0.4303 0.4342 0.0166  0.0197  -0.0160 936  HOH A O   
4785 O O   . HOH E .   ? 0.4312 0.4690 0.4827 -0.0078 0.0026  -0.0098 937  HOH A O   
4786 O O   . HOH E .   ? 0.3828 0.3768 0.3654 0.0280  0.0135  0.0194  938  HOH A O   
4787 O O   . HOH E .   ? 0.3603 0.3513 0.3679 0.0213  0.0225  0.0002  939  HOH A O   
4788 O O   . HOH E .   ? 0.5364 0.5355 0.5203 0.0079  0.0018  -0.0031 940  HOH A O   
4789 O O   . HOH E .   ? 0.3265 0.2833 0.2483 -0.0536 0.0137  -0.0146 941  HOH A O   
4790 O O   . HOH E .   ? 0.4111 0.4240 0.4165 0.0092  0.0052  -0.0103 942  HOH A O   
4791 O O   . HOH E .   ? 0.2714 0.2419 0.2545 -0.0022 0.0015  -0.0209 943  HOH A O   
4792 O O   . HOH E .   ? 0.5603 0.5717 0.5567 0.0028  0.0025  -0.0054 944  HOH A O   
4793 O O   . HOH E .   ? 0.3427 0.3206 0.3405 -0.0025 0.0012  0.0213  945  HOH A O   
4794 O O   . HOH E .   ? 0.4209 0.4297 0.4212 0.0040  0.0056  0.0119  946  HOH A O   
4795 O O   . HOH E .   ? 0.4760 0.4695 0.4976 0.0091  0.0104  0.0098  947  HOH A O   
4796 O O   . HOH E .   ? 0.4903 0.4597 0.4867 0.0075  0.0024  0.0081  948  HOH A O   
4797 O O   . HOH E .   ? 0.4985 0.5361 0.5054 0.0012  0.0011  0.0081  949  HOH A O   
4798 O O   . HOH E .   ? 0.4792 0.5180 0.4839 0.0020  -0.0067 0.0130  950  HOH A O   
4799 O O   . HOH E .   ? 0.5239 0.5174 0.5205 0.0040  -0.0003 0.0050  951  HOH A O   
4800 O O   . HOH E .   ? 0.3800 0.3724 0.3768 -0.0052 -0.0189 0.0087  952  HOH A O   
4801 O O   . HOH E .   ? 0.3191 0.3190 0.3050 0.0083  0.0102  0.0089  953  HOH A O   
4802 O O   . HOH E .   ? 0.5363 0.4917 0.5472 0.0061  0.0009  -0.0131 954  HOH A O   
4803 O O   . HOH E .   ? 0.4064 0.4037 0.3607 0.0165  0.0054  -0.0012 955  HOH A O   
4804 O O   . HOH E .   ? 0.2925 0.2665 0.2850 0.0287  -0.0147 -0.0073 956  HOH A O   
4805 O O   . HOH E .   ? 0.4677 0.4590 0.4613 0.0008  -0.0084 0.0030  957  HOH A O   
4806 O O   . HOH E .   ? 0.4395 0.4356 0.3866 -0.0074 0.0062  0.0288  958  HOH A O   
4807 O O   . HOH E .   ? 0.3296 0.3481 0.3085 0.0169  0.0143  -0.0210 959  HOH A O   
4808 O O   . HOH E .   ? 0.3787 0.3507 0.3309 -0.0102 0.0291  0.0189  960  HOH A O   
4809 O O   . HOH E .   ? 0.3957 0.4297 0.3999 -0.0044 0.0018  0.0224  961  HOH A O   
4810 O O   . HOH E .   ? 0.4129 0.4657 0.4432 -0.0009 0.0062  0.0057  962  HOH A O   
4811 O O   . HOH E .   ? 0.5242 0.5340 0.5165 -0.0058 -0.0014 0.0056  963  HOH A O   
4812 O O   . HOH E .   ? 0.4675 0.4703 0.4691 0.0043  -0.0085 -0.0034 964  HOH A O   
4813 O O   . HOH E .   ? 0.4286 0.3857 0.3995 0.0020  0.0014  0.0313  965  HOH A O   
4814 O O   . HOH E .   ? 0.4593 0.4706 0.4700 -0.0075 0.0031  -0.0106 966  HOH A O   
4815 O O   . HOH E .   ? 0.4152 0.4279 0.4160 -0.0169 0.0100  0.0106  967  HOH A O   
4816 O O   . HOH E .   ? 0.3631 0.3722 0.3826 -0.0144 -0.0145 0.0110  968  HOH A O   
4817 O O   . HOH E .   ? 0.6100 0.6046 0.6150 0.0006  0.0053  0.0050  969  HOH A O   
4818 O O   . HOH E .   ? 0.4013 0.4080 0.3565 0.0011  0.0045  0.0101  970  HOH A O   
4819 O O   . HOH E .   ? 0.5283 0.5114 0.4923 -0.0001 0.0026  -0.0095 971  HOH A O   
4820 O O   . HOH E .   ? 0.5963 0.6076 0.6020 -0.0005 0.0065  -0.0047 972  HOH A O   
4821 O O   . HOH E .   ? 0.4194 0.4056 0.3932 -0.0336 0.0315  -0.0185 973  HOH A O   
4822 O O   . HOH E .   ? 0.5660 0.5646 0.5646 0.0009  -0.0037 0.0020  974  HOH A O   
4823 O O   . HOH E .   ? 0.4052 0.3841 0.4525 0.0148  0.0020  -0.0012 975  HOH A O   
4824 O O   . HOH E .   ? 0.5777 0.5693 0.5830 -0.0088 -0.0077 -0.0013 976  HOH A O   
4825 O O   . HOH E .   ? 0.3638 0.3654 0.3398 0.0111  0.0165  -0.0032 977  HOH A O   
4826 O O   . HOH E .   ? 0.4171 0.4115 0.4182 -0.0040 0.0031  -0.0253 978  HOH A O   
4827 O O   . HOH E .   ? 0.4476 0.4108 0.4298 -0.0124 -0.0074 -0.0065 979  HOH A O   
4828 O O   . HOH E .   ? 0.4313 0.4425 0.4358 0.0005  0.0018  -0.0043 980  HOH A O   
4829 O O   . HOH E .   ? 0.5422 0.5168 0.5317 0.0011  0.0078  -0.0022 981  HOH A O   
4830 O O   . HOH E .   ? 0.4111 0.4240 0.4182 0.0011  -0.0057 -0.0003 982  HOH A O   
4831 O O   . HOH E .   ? 0.4459 0.4747 0.4779 0.0008  0.0056  -0.0121 983  HOH A O   
4832 O O   . HOH E .   ? 0.4483 0.4400 0.4282 -0.0096 -0.0076 -0.0041 984  HOH A O   
4833 O O   . HOH E .   ? 0.3876 0.3428 0.3629 -0.0026 -0.0065 0.0103  985  HOH A O   
4834 O O   . HOH E .   ? 0.3806 0.3958 0.3954 0.0177  -0.0011 0.0024  986  HOH A O   
4835 O O   . HOH E .   ? 0.1523 0.1616 0.1990 0.0037  0.0011  0.0048  987  HOH A O   
4836 O O   . HOH E .   ? 0.3177 0.3555 0.3352 -0.0061 -0.0301 -0.0162 988  HOH A O   
4837 O O   . HOH E .   ? 0.4914 0.4719 0.4843 -0.0074 0.0241  0.0047  989  HOH A O   
4838 O O   . HOH E .   ? 0.3625 0.3602 0.3648 0.0005  0.0023  -0.0073 990  HOH A O   
4839 O O   . HOH E .   ? 0.3034 0.3163 0.3555 -0.0048 -0.0024 -0.0088 991  HOH A O   
4840 O O   . HOH E .   ? 0.4283 0.4493 0.4439 0.0042  0.0157  0.0061  992  HOH A O   
4841 O O   . HOH E .   ? 0.2911 0.2809 0.2718 -0.0010 -0.0080 0.0053  993  HOH A O   
4842 O O   . HOH E .   ? 0.3647 0.3534 0.3618 0.0026  -0.0132 0.0097  994  HOH A O   
4843 O O   . HOH E .   ? 0.4652 0.5129 0.4659 0.0036  -0.0054 0.0095  995  HOH A O   
4844 O O   . HOH E .   ? 0.2319 0.2923 0.2693 0.0194  -0.0108 0.0036  996  HOH A O   
4845 O O   . HOH E .   ? 0.4060 0.3953 0.4265 0.0116  -0.0054 0.0046  997  HOH A O   
4846 O O   . HOH E .   ? 0.2959 0.3800 0.3704 -0.0078 -0.0158 0.0186  998  HOH A O   
4847 O O   . HOH E .   ? 0.3688 0.4344 0.4198 -0.0038 0.0030  0.0022  999  HOH A O   
4848 O O   . HOH E .   ? 0.2241 0.2603 0.1896 0.0000  -0.0031 0.0201  1000 HOH A O   
4849 O O   . HOH E .   ? 0.4821 0.5104 0.4983 0.0056  0.0027  -0.0039 1001 HOH A O   
4850 O O   . HOH E .   ? 0.3083 0.3353 0.3236 -0.0140 0.0048  0.0012  1002 HOH A O   
4851 O O   . HOH E .   ? 0.3704 0.3619 0.3578 0.0005  -0.0318 -0.0109 1003 HOH A O   
4852 O O   . HOH E .   ? 0.3909 0.3940 0.3539 -0.0045 0.0050  0.0134  1004 HOH A O   
4853 O O   . HOH E .   ? 0.3875 0.3670 0.3455 0.0134  0.0147  -0.0055 1005 HOH A O   
4854 O O   . HOH E .   ? 0.3789 0.3591 0.3803 -0.0078 -0.0147 0.0192  1006 HOH A O   
4855 O O   . HOH E .   ? 0.3867 0.3681 0.4090 -0.0030 0.0093  -0.0008 1007 HOH A O   
4856 O O   . HOH E .   ? 0.4110 0.3590 0.3685 0.0076  -0.0055 -0.0025 1008 HOH A O   
4857 O O   . HOH E .   ? 0.4712 0.4888 0.4824 -0.0077 0.0191  0.0089  1009 HOH A O   
4858 O O   . HOH E .   ? 0.3061 0.2502 0.2890 -0.0165 -0.0061 -0.0002 1010 HOH A O   
4859 O O   . HOH E .   ? 0.3293 0.3205 0.3564 0.0085  -0.0035 0.0149  1011 HOH A O   
4860 O O   . HOH E .   ? 0.4668 0.5039 0.4689 0.0007  0.0022  0.0074  1012 HOH A O   
4861 O O   . HOH E .   ? 0.2752 0.2864 0.3500 -0.0128 -0.0119 -0.0261 1013 HOH A O   
4862 O O   . HOH E .   ? 0.6145 0.5747 0.5864 -0.0041 -0.0046 -0.0084 1014 HOH A O   
4863 O O   . HOH E .   ? 0.4464 0.4317 0.4193 0.0027  0.0051  0.0025  1015 HOH A O   
4864 O O   . HOH E .   ? 0.4399 0.4408 0.4408 -0.0150 -0.0093 -0.0066 1016 HOH A O   
4865 O O   . HOH E .   ? 0.4079 0.4325 0.4746 0.0083  0.0008  0.0069  1017 HOH A O   
4866 O O   . HOH E .   ? 0.5526 0.5490 0.5392 0.0099  -0.0001 -0.0009 1018 HOH A O   
4867 O O   . HOH E .   ? 0.3390 0.2668 0.3311 -0.0039 -0.0276 0.0114  1019 HOH A O   
4868 O O   . HOH E .   ? 0.2564 0.2639 0.3095 0.0024  -0.0015 0.0070  1020 HOH A O   
4869 O O   . HOH E .   ? 0.3039 0.2462 0.3081 -0.0256 0.0375  0.0025  1021 HOH A O   
4870 O O   . HOH E .   ? 0.4884 0.4835 0.4714 0.0009  0.0006  -0.0104 1022 HOH A O   
4871 O O   . HOH E .   ? 0.3678 0.3872 0.4100 -0.0015 -0.0077 0.0036  1023 HOH A O   
4872 O O   . HOH E .   ? 0.5289 0.4887 0.4928 0.0019  -0.0011 -0.0145 1024 HOH A O   
4873 O O   . HOH E .   ? 0.2787 0.3368 0.3398 0.0038  -0.0100 0.0173  1025 HOH A O   
4874 O O   . HOH E .   ? 0.4439 0.4499 0.4288 0.0060  0.0083  -0.0046 1026 HOH A O   
4875 O O   . HOH E .   ? 0.4341 0.3918 0.3959 -0.0199 0.0057  0.0084  1027 HOH A O   
4876 O O   . HOH E .   ? 0.4457 0.4464 0.4474 0.0029  0.0099  -0.0184 1028 HOH A O   
4877 O O   . HOH E .   ? 0.3869 0.4117 0.3681 0.0031  -0.0158 0.0116  1029 HOH A O   
4878 O O   . HOH E .   ? 0.3226 0.3003 0.3337 -0.0059 -0.0307 0.0163  1030 HOH A O   
4879 O O   . HOH E .   ? 0.4550 0.5013 0.4743 0.0128  -0.0058 -0.0050 1031 HOH A O   
4880 O O   . HOH E .   ? 0.4098 0.3855 0.3660 0.0074  0.0133  0.0095  1032 HOH A O   
4881 O O   . HOH E .   ? 0.5241 0.5280 0.5249 -0.0101 0.0053  -0.0040 1033 HOH A O   
4882 O O   . HOH E .   ? 0.3924 0.4361 0.4341 -0.0036 0.0074  0.0201  1034 HOH A O   
4883 O O   . HOH E .   ? 0.3963 0.4331 0.4398 -0.0035 -0.0065 -0.0140 1035 HOH A O   
4884 O O   . HOH E .   ? 0.3812 0.2852 0.3214 -0.0274 -0.0089 0.0701  1036 HOH A O   
4885 O O   . HOH E .   ? 0.4841 0.4836 0.4618 -0.0111 0.0054  0.0096  1037 HOH A O   
4886 O O   . HOH E .   ? 0.3334 0.3607 0.3845 -0.0246 -0.0123 0.0091  1038 HOH A O   
4887 O O   . HOH E .   ? 0.2509 0.2868 0.2790 0.0001  0.0068  0.0032  1039 HOH A O   
4888 O O   . HOH E .   ? 0.5288 0.5116 0.5117 -0.0115 -0.0079 0.0043  1040 HOH A O   
4889 O O   . HOH E .   ? 0.4179 0.3925 0.3982 0.0138  0.0076  -0.0030 1041 HOH A O   
4890 O O   . HOH E .   ? 0.5062 0.5098 0.5241 0.0024  0.0004  0.0031  1042 HOH A O   
4891 O O   . HOH E .   ? 0.4310 0.4194 0.4106 0.0113  0.0047  0.0026  1043 HOH A O   
4892 O O   . HOH E .   ? 0.4739 0.4445 0.4790 0.0033  0.0003  -0.0150 1044 HOH A O   
4893 O O   . HOH E .   ? 0.3797 0.4069 0.4369 -0.0100 0.0105  -0.0275 1045 HOH A O   
4894 O O   . HOH E .   ? 0.2498 0.2378 0.2392 0.0044  0.0181  0.0051  1046 HOH A O   
4895 O O   . HOH E .   ? 0.3743 0.4017 0.3653 -0.0071 -0.0173 0.0162  1047 HOH A O   
4896 O O   . HOH E .   ? 0.2937 0.3447 0.3966 -0.0075 0.0021  0.0166  1048 HOH A O   
4897 O O   . HOH E .   ? 0.2983 0.3097 0.2334 -0.0006 -0.0210 0.0040  1049 HOH A O   
4898 O O   . HOH E .   ? 0.3440 0.3051 0.3378 -0.0241 0.0115  -0.0096 1050 HOH A O   
4899 O O   . HOH E .   ? 0.4099 0.4123 0.4078 0.0049  -0.0181 0.0011  1051 HOH A O   
4900 O O   . HOH E .   ? 0.3265 0.3310 0.3536 0.0128  0.0035  0.0138  1052 HOH A O   
4901 O O   . HOH E .   ? 0.4592 0.4141 0.4300 0.0110  -0.0012 0.0201  1053 HOH A O   
4902 O O   . HOH E .   ? 0.4942 0.4732 0.4520 0.0021  0.0027  0.0055  1054 HOH A O   
4903 O O   . HOH E .   ? 0.3479 0.3309 0.3420 0.0249  -0.0119 0.0118  1055 HOH A O   
4904 O O   . HOH E .   ? 0.3756 0.4094 0.4162 -0.0117 0.0052  0.0019  1056 HOH A O   
4905 O O   . HOH E .   ? 0.4577 0.4874 0.4748 -0.0018 0.0036  -0.0035 1057 HOH A O   
4906 O O   . HOH E .   ? 0.3522 0.4204 0.4573 0.0244  -0.0060 -0.0061 1058 HOH A O   
4907 O O   . HOH E .   ? 0.5206 0.5212 0.5039 -0.0130 0.0100  -0.0092 1059 HOH A O   
4908 O O   . HOH E .   ? 0.3386 0.3515 0.3516 -0.0197 0.0068  -0.0576 1060 HOH A O   
4909 O O   . HOH E .   ? 0.4065 0.4376 0.3737 -0.0310 -0.0225 0.0060  1061 HOH A O   
4910 O O   . HOH E .   ? 0.3785 0.3703 0.3746 0.0134  0.0528  -0.0031 1062 HOH A O   
4911 O O   . HOH E .   ? 0.3150 0.2774 0.3446 0.0058  -0.0006 -0.0143 1063 HOH A O   
4912 O O   . HOH E .   ? 0.3400 0.3953 0.3063 0.0177  -0.0070 0.0038  1064 HOH A O   
4913 O O   . HOH E .   ? 0.3203 0.3576 0.3621 -0.0015 -0.0001 -0.0116 1065 HOH A O   
4914 O O   . HOH E .   ? 0.4247 0.4382 0.4504 -0.0102 -0.0052 -0.0005 1066 HOH A O   
4915 O O   . HOH E .   ? 0.4329 0.4049 0.3886 0.0033  -0.0042 0.0149  1067 HOH A O   
4916 O O   . HOH E .   ? 0.3371 0.3414 0.3299 -0.0075 -0.0197 0.0038  1068 HOH A O   
4917 O O   . HOH E .   ? 0.3949 0.4241 0.3952 -0.0134 0.0059  -0.0264 1069 HOH A O   
4918 O O   . HOH E .   ? 0.4034 0.2974 0.3864 0.0053  -0.0044 -0.0131 1070 HOH A O   
4919 O O   . HOH E .   ? 0.3941 0.3421 0.3782 0.0093  0.0028  0.0104  1071 HOH A O   
4920 O O   . HOH E .   ? 0.4256 0.4281 0.3988 0.0314  0.0104  -0.0049 1072 HOH A O   
4921 O O   . HOH E .   ? 0.4927 0.4480 0.4762 -0.0087 0.0001  -0.0014 1073 HOH A O   
4922 O O   . HOH E .   ? 0.3764 0.2986 0.3301 0.0235  0.0121  0.0185  1074 HOH A O   
4923 O O   . HOH E .   ? 0.4165 0.4061 0.4127 0.0013  -0.0037 -0.0057 1075 HOH A O   
4924 O O   . HOH E .   ? 0.4552 0.3730 0.3421 0.0176  0.0015  -0.0290 1076 HOH A O   
4925 O O   . HOH E .   ? 0.4042 0.4072 0.3965 -0.0185 0.0080  -0.0028 1077 HOH A O   
4926 O O   . HOH E .   ? 0.3987 0.4679 0.4224 -0.0048 -0.0158 0.0128  1078 HOH A O   
4927 O O   . HOH E .   ? 0.3821 0.3703 0.3434 0.0046  0.0226  -0.0144 1079 HOH A O   
4928 O O   . HOH E .   ? 0.5149 0.5403 0.5407 -0.0024 0.0003  -0.0047 1080 HOH A O   
4929 O O   . HOH E .   ? 0.5625 0.5614 0.5716 -0.0006 -0.0078 -0.0075 1081 HOH A O   
4930 O O   . HOH E .   ? 0.3487 0.3437 0.3344 0.0000  0.0088  -0.0236 1082 HOH A O   
4931 O O   . HOH E .   ? 0.4068 0.4057 0.3671 0.0057  0.0089  0.0060  1083 HOH A O   
4932 O O   . HOH E .   ? 0.4610 0.4257 0.4586 -0.0003 -0.0054 0.0117  1084 HOH A O   
4933 O O   . HOH E .   ? 0.4327 0.4742 0.4321 0.0037  -0.0129 -0.0014 1085 HOH A O   
4934 O O   . HOH E .   ? 0.4574 0.4138 0.3885 -0.0094 0.0200  -0.0064 1086 HOH A O   
4935 O O   . HOH E .   ? 0.4040 0.3652 0.3865 -0.0056 -0.0151 -0.0010 1087 HOH A O   
4936 O O   . HOH E .   ? 0.4912 0.4748 0.4364 -0.0025 0.0015  0.0070  1088 HOH A O   
4937 O O   . HOH E .   ? 0.4909 0.5017 0.4707 -0.0027 -0.0038 0.0071  1089 HOH A O   
4938 O O   . HOH E .   ? 0.4862 0.4544 0.4963 0.0023  0.0105  -0.0128 1090 HOH A O   
4939 O O   . HOH E .   ? 0.4216 0.3874 0.3893 -0.0154 -0.0176 0.0007  1091 HOH A O   
4940 O O   . HOH E .   ? 0.4325 0.4545 0.4407 -0.0046 -0.0158 -0.0060 1092 HOH A O   
4941 O O   . HOH E .   ? 0.5285 0.5173 0.5101 0.0054  -0.0072 0.0192  1093 HOH A O   
4942 O O   . HOH E .   ? 0.5232 0.5194 0.5512 0.0011  0.0036  0.0031  1094 HOH A O   
4943 O O   . HOH E .   ? 0.4923 0.4987 0.5533 0.0034  0.0005  -0.0131 1095 HOH A O   
4944 O O   . HOH E .   ? 0.5152 0.5069 0.4572 0.0053  -0.0034 0.0041  1096 HOH A O   
4945 O O   . HOH E .   ? 0.4882 0.4867 0.4540 0.0039  0.0164  -0.0187 1097 HOH A O   
4946 O O   . HOH E .   ? 0.4291 0.4341 0.3999 -0.0008 0.0133  -0.0010 1098 HOH A O   
4947 O O   . HOH E .   ? 0.4024 0.4127 0.3799 -0.0066 -0.0159 -0.0041 1099 HOH A O   
4948 O O   . HOH E .   ? 0.5797 0.5699 0.5443 -0.0053 -0.0026 0.0006  1100 HOH A O   
4949 O O   . HOH E .   ? 0.5822 0.5756 0.5784 -0.0009 -0.0014 -0.0058 1101 HOH A O   
4950 O O   . HOH E .   ? 0.4941 0.4840 0.4803 -0.0022 -0.0145 0.0096  1102 HOH A O   
4951 O O   . HOH E .   ? 0.5231 0.5396 0.5484 0.0046  -0.0102 0.0002  1103 HOH A O   
4952 O O   . HOH E .   ? 0.5420 0.5545 0.5443 0.0000  0.0047  0.0027  1104 HOH A O   
4953 O O   . HOH E .   ? 0.4034 0.3606 0.3732 -0.0001 0.0048  0.0337  1105 HOH A O   
4954 O O   . HOH E .   ? 0.4215 0.3782 0.3703 0.0199  -0.0108 0.0024  1106 HOH A O   
4955 O O   . HOH E .   ? 0.4311 0.4449 0.4087 0.0104  -0.0044 0.0089  1107 HOH A O   
4956 O O   . HOH E .   ? 0.4045 0.4037 0.4389 0.0045  0.0047  -0.0057 1108 HOH A O   
4957 O O   . HOH E .   ? 0.4834 0.4822 0.4756 -0.0039 0.0041  -0.0145 1109 HOH A O   
4958 O O   . HOH E .   ? 0.5023 0.4710 0.4687 0.0162  0.0155  0.0084  1110 HOH A O   
4959 O O   . HOH E .   ? 0.5742 0.5798 0.5517 0.0031  0.0080  -0.0082 1111 HOH A O   
4960 O O   . HOH E .   ? 0.5127 0.5520 0.5516 0.0010  0.0073  0.0034  1112 HOH A O   
4961 O O   . HOH E .   ? 0.5020 0.4647 0.4641 0.0056  -0.0135 0.0075  1113 HOH A O   
4962 O O   . HOH E .   ? 0.6352 0.6327 0.6222 0.0049  -0.0039 0.0033  1114 HOH A O   
4963 O O   . HOH E .   ? 0.6007 0.5860 0.5785 0.0004  -0.0031 -0.0054 1115 HOH A O   
4964 O O   . HOH E .   ? 0.5992 0.6094 0.6164 0.0050  0.0002  -0.0017 1116 HOH A O   
4965 O O   . HOH E .   ? 0.3714 0.3738 0.3823 -0.0038 -0.0112 0.0001  1117 HOH A O   
4966 O O   . HOH E .   ? 0.4646 0.4875 0.4747 0.0014  0.0056  -0.0017 1118 HOH A O   
4967 O O   . HOH E .   ? 0.5136 0.4919 0.5175 0.0000  0.0003  0.0065  1119 HOH A O   
4968 O O   . HOH E .   ? 0.3900 0.4453 0.4582 -0.0045 -0.0056 0.0046  1120 HOH A O   
4969 O O   . HOH E .   ? 0.4378 0.4662 0.4735 -0.0016 0.0110  -0.0122 1121 HOH A O   
4970 O O   . HOH E .   ? 0.4666 0.4983 0.4958 -0.0077 0.0018  0.0019  1122 HOH A O   
4971 O O   . HOH E .   ? 0.5390 0.5350 0.5670 -0.0029 0.0076  0.0106  1123 HOH A O   
4972 O O   . HOH E .   ? 0.4623 0.4420 0.4668 -0.0052 -0.0131 -0.0061 1124 HOH A O   
4973 O O   . HOH E .   ? 0.4705 0.4508 0.4388 -0.0045 -0.0011 -0.0084 1125 HOH A O   
4974 O O   . HOH E .   ? 0.4662 0.4621 0.4756 -0.0040 -0.0015 -0.0031 1126 HOH A O   
4975 O O   . HOH E .   ? 0.4663 0.4841 0.4793 0.0066  -0.0061 0.0030  1127 HOH A O   
4976 O O   . HOH E .   ? 0.4635 0.4618 0.4695 0.0019  0.0155  -0.0004 1128 HOH A O   
4977 O O   . HOH E .   ? 0.5350 0.5338 0.5217 0.0000  0.0012  0.0040  1129 HOH A O   
4978 O O   . HOH E .   ? 0.5537 0.5700 0.5516 -0.0099 -0.0130 0.0080  1130 HOH A O   
4979 O O   . HOH E .   ? 0.4182 0.3986 0.4090 -0.0039 -0.0136 -0.0006 1131 HOH A O   
4980 O O   . HOH E .   ? 0.4801 0.4944 0.5086 0.0182  0.0052  -0.0003 1132 HOH A O   
4981 O O   . HOH E .   ? 0.4883 0.4743 0.4827 0.0065  0.0022  0.0070  1133 HOH A O   
4982 O O   . HOH E .   ? 0.4422 0.3921 0.4032 -0.0089 0.0094  -0.0083 1134 HOH A O   
4983 O O   . HOH E .   ? 0.5558 0.5687 0.5665 -0.0038 0.0003  -0.0037 1135 HOH A O   
4984 O O   . HOH E .   ? 0.4082 0.4262 0.4185 0.0085  0.0067  0.0029  1136 HOH A O   
4985 O O   . HOH E .   ? 0.5794 0.5948 0.5856 0.0025  -0.0010 0.0048  1137 HOH A O   
4986 O O   . HOH E .   ? 0.6001 0.5889 0.6014 0.0093  0.0090  0.0019  1138 HOH A O   
4987 O O   . HOH E .   ? 0.4601 0.4586 0.4573 -0.0034 -0.0073 0.0012  1139 HOH A O   
4988 O O   . HOH E .   ? 0.4585 0.4456 0.4102 -0.0095 0.0044  0.0093  1140 HOH A O   
4989 O O   . HOH E .   ? 0.4582 0.5261 0.4872 -0.0022 0.0034  -0.0003 1141 HOH A O   
4990 O O   . HOH E .   ? 0.5005 0.4997 0.4954 0.0146  0.0007  -0.0064 1142 HOH A O   
4991 O O   . HOH E .   ? 0.4096 0.3578 0.3820 -0.0074 0.0095  0.0040  1143 HOH A O   
4992 O O   . HOH E .   ? 0.4564 0.4764 0.4723 -0.0060 -0.0080 -0.0095 1144 HOH A O   
4993 O O   . HOH E .   ? 0.5754 0.5712 0.5637 0.0030  -0.0005 0.0024  1145 HOH A O   
4994 O O   . HOH E .   ? 0.4731 0.5070 0.4806 -0.0068 -0.0138 -0.0100 1146 HOH A O   
4995 O O   . HOH E .   ? 0.4301 0.4024 0.4585 -0.0065 -0.0011 0.0066  1147 HOH A O   
4996 O O   . HOH E .   ? 0.3963 0.3864 0.3572 0.0151  -0.0005 -0.0095 1148 HOH A O   
4997 O O   . HOH E .   ? 0.3511 0.3802 0.3824 -0.0218 -0.0070 -0.0044 1149 HOH A O   
4998 O O   . HOH E .   ? 0.4675 0.4343 0.4452 -0.0107 -0.0071 -0.0040 1150 HOH A O   
4999 O O   . HOH E .   ? 0.4674 0.4485 0.4346 -0.0002 0.0119  -0.0121 1151 HOH A O   
5000 O O   . HOH E .   ? 0.3935 0.3556 0.3867 -0.0014 0.0261  0.0162  1152 HOH A O   
5001 O O   . HOH E .   ? 0.4239 0.4287 0.4180 -0.0014 0.0004  0.0128  1153 HOH A O   
5002 O O   . HOH E .   ? 0.5274 0.5592 0.5522 -0.0062 -0.0004 0.0040  1154 HOH A O   
5003 O O   . HOH E .   ? 0.4968 0.4793 0.4884 -0.0110 0.0092  0.0091  1155 HOH A O   
5004 O O   . HOH E .   ? 0.5022 0.5092 0.5276 -0.0071 -0.0118 0.0019  1156 HOH A O   
5005 O O   . HOH E .   ? 0.5066 0.5047 0.5038 -0.0026 0.0040  0.0049  1157 HOH A O   
5006 O O   . HOH E .   ? 0.4837 0.4846 0.4559 0.0034  -0.0028 0.0023  1158 HOH A O   
5007 O O   . HOH E .   ? 0.5198 0.5140 0.5061 0.0101  0.0087  0.0031  1159 HOH A O   
5008 O O   . HOH E .   ? 0.4575 0.4790 0.4548 -0.0065 0.0182  0.0144  1160 HOH A O   
5009 O O   . HOH E .   ? 0.4084 0.4305 0.4313 -0.0285 0.0122  0.0041  1161 HOH A O   
5010 O O   . HOH E .   ? 0.5708 0.5573 0.5513 0.0001  -0.0003 -0.0054 1162 HOH A O   
5011 O O   . HOH E .   ? 0.3606 0.4265 0.4244 0.0049  0.0097  -0.0010 1163 HOH A O   
5012 O O   . HOH E .   ? 0.5318 0.5284 0.5345 -0.0092 0.0179  -0.0004 1164 HOH A O   
5013 O O   . HOH E .   ? 0.5196 0.5146 0.5194 -0.0043 0.0186  0.0000  1165 HOH A O   
5014 O O   . HOH E .   ? 0.4922 0.4965 0.5109 0.0079  -0.0083 0.0006  1166 HOH A O   
5015 O O   . HOH E .   ? 0.5002 0.4994 0.4865 0.0024  -0.0032 0.0033  1167 HOH A O   
5016 O O   . HOH E .   ? 0.4763 0.5022 0.5067 0.0039  -0.0099 0.0040  1168 HOH A O   
5017 O O   . HOH E .   ? 0.5528 0.5176 0.5441 -0.0037 0.0033  0.0007  1169 HOH A O   
5018 O O   . HOH E .   ? 0.5250 0.4820 0.4865 -0.0102 -0.0073 -0.0137 1170 HOH A O   
5019 O O   . HOH E .   ? 0.3613 0.3547 0.3501 0.0059  0.0002  0.0018  1171 HOH A O   
5020 O O   . HOH E .   ? 0.5818 0.5827 0.5938 -0.0039 0.0012  0.0036  1172 HOH A O   
5021 O O   . HOH E .   ? 0.4592 0.4604 0.4591 -0.0028 0.0058  -0.0047 1173 HOH A O   
5022 O O   . HOH E .   ? 0.4329 0.4581 0.4756 -0.0027 -0.0181 -0.0027 1174 HOH A O   
5023 O O   . HOH E .   ? 0.5027 0.4950 0.5050 0.0102  -0.0011 0.0032  1175 HOH A O   
5024 O O   . HOH E .   ? 0.5419 0.4791 0.5296 -0.0046 0.0071  -0.0130 1176 HOH A O   
5025 O O   . HOH E .   ? 0.3933 0.3808 0.4406 -0.0204 -0.0240 -0.0108 1177 HOH A O   
5026 O O   . HOH E .   ? 0.4146 0.4331 0.4482 -0.0044 0.0041  0.0006  1178 HOH A O   
5027 O O   . HOH E .   ? 0.5311 0.5188 0.5325 -0.0147 -0.0030 0.0016  1179 HOH A O   
5028 O O   . HOH E .   ? 0.4336 0.4801 0.4669 -0.0033 -0.0052 -0.0052 1180 HOH A O   
5029 O O   . HOH E .   ? 0.5325 0.5172 0.5164 0.0039  0.0039  0.0063  1181 HOH A O   
5030 O O   . HOH E .   ? 0.4863 0.4726 0.5020 -0.0031 -0.0065 0.0064  1182 HOH A O   
5031 O O   . HOH E .   ? 0.4913 0.4998 0.4958 0.0034  0.0094  0.0105  1183 HOH A O   
5032 O O   . HOH E .   ? 0.2197 0.2138 0.2200 -0.0085 -0.0032 -0.0049 1184 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   ARG 5   5   5   ARG ARG A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   PHE 9   9   9   PHE PHE A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  TYR 16  16  16  TYR TYR A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  HIS 19  19  19  HIS HIS A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  HIS 47  47  47  HIS HIS A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  MET 66  66  66  MET MET A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  THR 92  92  92  THR THR A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 MET 118 118 118 MET MET A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 PHE 131 131 131 PHE PHE A . n 
A 1 132 CYS 132 132 132 CYS CYS A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 THR 167 167 167 THR THR A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 TYR 173 173 173 TYR TYR A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 ARG 179 179 179 ARG ARG A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 TRP 181 181 181 TRP TRP A . n 
A 1 182 TYR 182 182 182 TYR TYR A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 SER 202 202 202 SER SER A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 SER 209 209 209 SER SER A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 THR 211 211 211 THR THR A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLN 215 215 215 GLN GLN A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 TRP 227 227 227 TRP TRP A . n 
A 1 228 PHE 228 228 228 PHE PHE A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 LEU 245 245 245 LEU LEU A . n 
A 1 246 SER 246 246 246 SER SER A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 GLN 260 260 260 GLN GLN A . n 
A 1 261 ASN 261 261 261 ASN ASN A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 PHE 263 263 263 PHE PHE A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 TRP 268 268 268 TRP TRP A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 GLY 271 271 271 GLY GLY A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 TYR 273 273 273 TYR TYR A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 TRP 276 276 276 TRP TRP A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 GLU 293 293 293 GLU GLU A . n 
A 1 294 GLN 294 294 294 GLN GLN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 HIS 300 300 300 HIS HIS A . n 
A 1 301 TRP 301 301 301 TRP TRP A . n 
A 1 302 MET 302 302 302 MET MET A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 GLN 304 304 304 GLN GLN A . n 
A 1 305 HIS 305 305 305 HIS HIS A . n 
A 1 306 PHE 306 306 306 PHE PHE A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 THR 308 308 308 THR THR A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 PRO 316 316 316 PRO PRO A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 ALA 320 320 320 ALA ALA A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 GLY 323 323 323 GLY GLY A . n 
A 1 324 ILE 324 324 324 ILE ILE A . n 
A 1 325 TRP 325 325 325 TRP TRP A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 ASN 328 328 328 ASN ASN A . n 
A 1 329 CYS 329 329 329 CYS CYS A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 GLY 331 331 331 GLY GLY A . n 
A 1 332 CYS 332 332 332 CYS CYS A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 THR 334 334 334 THR THR A . n 
A 1 335 HIS 335 335 335 HIS HIS A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 MET 337 337 337 MET MET A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 TYR 340 340 340 TYR TYR A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 GLN 342 342 342 GLN GLN A . n 
A 1 343 TYR 343 343 343 TYR TYR A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 ARG 346 346 346 ARG ARG A . n 
A 1 347 PHE 347 347 347 PHE PHE A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 TYR 350 350 350 TYR TYR A . n 
A 1 351 PHE 351 351 351 PHE PHE A . n 
A 1 352 GLN 352 352 352 GLN GLN A . n 
A 1 353 GLN 353 353 353 GLN GLN A . n 
A 1 354 GLY 354 354 354 GLY GLY A . n 
A 1 355 ASP 355 355 355 ASP ASP A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 SER 358 358 358 SER SER A . n 
A 1 359 ASN 359 359 359 ASN ASN A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 LYS 361 361 361 LYS LYS A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 ILE 363 363 363 ILE ILE A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 LYS 365 365 365 LYS LYS A . n 
A 1 366 SER 366 366 366 SER SER A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 THR 368 368 368 THR THR A . n 
A 1 369 ARG 369 369 369 ARG ARG A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 ASP 371 371 371 ASP ASP A . n 
A 1 372 HIS 372 372 372 HIS HIS A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 GLY 375 375 375 GLY GLY A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 TRP 379 379 379 TRP TRP A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 GLU 381 381 381 GLU GLU A . n 
A 1 382 PRO 382 382 382 PRO PRO A . n 
A 1 383 GLY 383 383 383 GLY GLY A . n 
A 1 384 THR 384 384 384 THR THR A . n 
A 1 385 ASN 385 385 385 ASN ASN A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 GLN 387 387 387 GLN GLN A . n 
A 1 388 HIS 388 388 388 HIS HIS A . n 
A 1 389 ALA 389 389 389 ALA ALA A . n 
A 1 390 PHE 390 390 390 PHE PHE A . n 
A 1 391 TYR 391 391 391 TYR TYR A . n 
A 1 392 GLN 392 392 392 GLN GLN A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 HIS 395 395 395 HIS HIS A . n 
A 1 396 GLN 396 396 396 GLN GLN A . n 
A 1 397 GLY 397 397 397 GLY GLY A . n 
A 1 398 THR 398 398 398 THR THR A . n 
A 1 399 LYS 399 399 399 LYS LYS A . n 
A 1 400 MET 400 400 400 MET MET A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 CYS 403 403 403 CYS CYS A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 PHE 405 405 405 PHE PHE A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 ILE 407 407 407 ILE ILE A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 GLN 410 410 410 GLN GLN A . n 
A 1 411 THR 411 411 411 THR THR A . n 
A 1 412 GLN 412 412 412 GLN GLN A . n 
A 1 413 HIS 413 413 413 HIS HIS A . n 
A 1 414 PRO 414 414 414 PRO PRO A . n 
A 1 415 ILE 415 415 415 ILE ILE A . n 
A 1 416 ARG 416 416 416 ARG ARG A . n 
A 1 417 LYS 417 417 417 LYS LYS A . n 
A 1 418 GLY 418 418 418 GLY GLY A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 HIS 420 420 420 HIS HIS A . n 
A 1 421 HIS 421 421 421 HIS HIS A . n 
A 1 422 LYS 422 422 422 LYS LYS A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 LEU 424 424 424 LEU LEU A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ALA 426 426 426 ALA ALA A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 PHE 428 428 428 PHE PHE A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 ALA 430 430 430 ALA ALA A . n 
A 1 431 GLN 431 431 431 GLN GLN A . n 
A 1 432 THR 432 432 432 THR THR A . n 
A 1 433 GLU 433 433 433 GLU GLU A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 ARG 437 437 437 ARG ARG A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 LYS 439 439 439 LYS LYS A . n 
A 1 440 SER 440 440 440 SER SER A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 GLU 442 442 442 GLU GLU A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ALA 444 444 444 ALA ALA A . n 
A 1 445 ARG 445 445 445 ARG ARG A . n 
A 1 446 LYS 446 446 446 LYS LYS A . n 
A 1 447 GLU 447 447 447 GLU GLU A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 ALA 451 451 451 ALA ALA A . n 
A 1 452 GLY 452 452 452 GLY GLY A . n 
A 1 453 LYS 453 453 453 LYS LYS A . n 
A 1 454 SER 454 454 454 SER SER A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 GLU 456 456 456 GLU GLU A . n 
A 1 457 ASP 457 457 457 ASP ASP A . n 
A 1 458 LEU 458 458 458 LEU LEU A . n 
A 1 459 GLU 459 459 459 GLU GLU A . n 
A 1 460 ARG 460 460 460 ARG ARG A . n 
A 1 461 LEU 461 461 461 LEU LEU A . n 
A 1 462 LEU 462 462 462 LEU LEU A . n 
A 1 463 PRO 463 463 463 PRO PRO A . n 
A 1 464 HIS 464 464 464 HIS HIS A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 PHE 467 467 467 PHE PHE A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLY 469 469 469 GLY GLY A . n 
A 1 470 ASN 470 470 470 ASN ASN A . n 
A 1 471 ARG 471 471 471 ARG ARG A . n 
A 1 472 PRO 472 472 472 PRO PRO A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 SER 475 475 475 SER SER A . n 
A 1 476 ILE 476 476 476 ILE ILE A . n 
A 1 477 VAL 477 477 477 VAL VAL A . n 
A 1 478 PHE 478 478 478 PHE PHE A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 LYS 480 480 480 LYS LYS A . n 
A 1 481 LEU 481 481 481 LEU LEU A . n 
A 1 482 THR 482 482 482 THR THR A . n 
A 1 483 PRO 483 483 483 PRO PRO A . n 
A 1 484 PHE 484 484 484 PHE PHE A . n 
A 1 485 MET 485 485 485 MET MET A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ALA 488 488 488 ALA ALA A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 VAL 490 490 490 VAL VAL A . n 
A 1 491 ALA 491 491 491 ALA ALA A . n 
A 1 492 MET 492 492 492 MET MET A . n 
A 1 493 TYR 493 493 493 TYR TYR A . n 
A 1 494 GLU 494 494 494 GLU GLU A . n 
A 1 495 HIS 495 495 495 HIS HIS A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 ILE 497 497 497 ILE ILE A . n 
A 1 498 PHE 498 498 498 PHE PHE A . n 
A 1 499 VAL 499 499 499 VAL VAL A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 GLY 501 501 501 GLY GLY A . n 
A 1 502 ILE 502 502 502 ILE ILE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 TRP 504 504 504 TRP TRP A . n 
A 1 505 ASP 505 505 505 ASP ASP A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 ASN 507 507 507 ASN ASN A . n 
A 1 508 SER 508 508 508 SER SER A . n 
A 1 509 PHE 509 509 509 PHE PHE A . n 
A 1 510 ASP 510 510 510 ASP ASP A . n 
A 1 511 GLN 511 511 511 GLN GLN A . n 
A 1 512 TRP 512 512 512 TRP TRP A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 VAL 514 514 514 VAL VAL A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 GLY 517 517 517 GLY GLY A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 LEU 520 520 520 LEU LEU A . n 
A 1 521 ALA 521 521 521 ALA ALA A . n 
A 1 522 LYS 522 522 522 LYS LYS A . n 
A 1 523 LYS 523 523 523 LYS LYS A . n 
A 1 524 ILE 524 524 524 ILE ILE A . n 
A 1 525 GLU 525 525 525 GLU GLU A . n 
A 1 526 PRO 526 526 526 PRO PRO A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 ASP 529 529 529 ASP ASP A . n 
A 1 530 GLY 530 530 530 GLY GLY A . n 
A 1 531 SER 531 531 531 SER SER A . n 
A 1 532 ALA 532 532 532 ALA ALA A . n 
A 1 533 GLN 533 533 533 GLN GLN A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 SER 536 536 536 SER SER A . n 
A 1 537 HIS 537 537 537 HIS HIS A . n 
A 1 538 ASP 538 538 538 ASP ASP A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 SER 540 540 540 SER SER A . n 
A 1 541 THR 541 541 541 THR THR A . n 
A 1 542 ASN 542 542 542 ASN ASN A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 LEU 544 544 544 LEU LEU A . n 
A 1 545 ILE 545 545 545 ILE ILE A . n 
A 1 546 ASN 546 546 546 ASN ASN A . n 
A 1 547 PHE 547 547 547 PHE PHE A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 LYS 549 549 549 LYS LYS A . n 
A 1 550 GLN 550 550 550 GLN GLN A . n 
A 1 551 GLN 551 551 551 GLN GLN A . n 
A 1 552 ARG 552 552 552 ARG ARG A . n 
A 1 553 GLU 553 553 553 GLU GLU A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 ARG 555 555 555 ARG ARG A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 GLN 557 557 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14200 ? 
1 MORE         -134  ? 
1 'SSA (A^2)'  37300 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 644  ? E HOH . 
2 1 A HOH 1059 ? E HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-05-30 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
REFMAC    refinement       5.0 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 880  ? ? O A HOH 1171 ? ? 1.91 
2 1 O  A HOH 1177 ? ? O A HOH 1179 ? ? 2.00 
3 1 O  A HOH 870  ? ? O A HOH 1159 ? ? 2.06 
4 1 O  A HOH 1036 ? ? O A HOH 1078 ? ? 2.15 
5 1 O  A GLU 22   ? ? O A HOH 1165 ? ? 2.17 
6 1 O3 A SO4 603  ? ? O A HOH 1161 ? ? 2.17 
7 1 O  A HOH 1008 ? ? O A HOH 1160 ? ? 2.17 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              505 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              505 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              505 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.93 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.63 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 46  ? ? 77.87   -9.03   
2  1 LYS A 56  ? ? -86.74  43.50   
3  1 ASP A 160 ? ? -132.03 -51.46  
4  1 SER A 184 ? ? -138.82 -42.83  
5  1 ASP A 341 ? ? -167.50 117.18  
6  1 TYR A 362 ? ? -142.99 -1.90   
7  1 THR A 374 ? ? -118.48 -138.02 
8  1 ALA A 389 ? ? -122.27 -59.73  
9  1 GLN A 511 ? ? -161.18 60.32   
10 1 HIS A 537 ? ? -116.27 -168.15 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLN 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      557 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLN 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     557 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'        SO4 
3 BETA-MERCAPTOETHANOL BME 
4 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   602  2   SO4 SUL A . 
C 2 SO4 1   603  3   SO4 SUL A . 
D 3 BME 1   601  1   BME BME A . 
E 4 HOH 1   604  1   HOH HOH A . 
E 4 HOH 2   605  2   HOH HOH A . 
E 4 HOH 3   606  3   HOH HOH A . 
E 4 HOH 4   607  4   HOH HOH A . 
E 4 HOH 5   608  5   HOH HOH A . 
E 4 HOH 6   609  6   HOH HOH A . 
E 4 HOH 7   610  7   HOH HOH A . 
E 4 HOH 8   611  8   HOH HOH A . 
E 4 HOH 9   612  9   HOH HOH A . 
E 4 HOH 10  613  10  HOH HOH A . 
E 4 HOH 11  614  11  HOH HOH A . 
E 4 HOH 12  615  12  HOH HOH A . 
E 4 HOH 13  616  13  HOH HOH A . 
E 4 HOH 14  617  14  HOH HOH A . 
E 4 HOH 15  618  15  HOH HOH A . 
E 4 HOH 16  619  16  HOH HOH A . 
E 4 HOH 17  620  17  HOH HOH A . 
E 4 HOH 18  621  18  HOH HOH A . 
E 4 HOH 19  622  19  HOH HOH A . 
E 4 HOH 20  623  20  HOH HOH A . 
E 4 HOH 21  624  21  HOH HOH A . 
E 4 HOH 22  625  22  HOH HOH A . 
E 4 HOH 23  626  23  HOH HOH A . 
E 4 HOH 24  627  24  HOH HOH A . 
E 4 HOH 25  628  25  HOH HOH A . 
E 4 HOH 26  629  26  HOH HOH A . 
E 4 HOH 27  630  27  HOH HOH A . 
E 4 HOH 28  631  28  HOH HOH A . 
E 4 HOH 29  632  29  HOH HOH A . 
E 4 HOH 30  633  30  HOH HOH A . 
E 4 HOH 31  634  31  HOH HOH A . 
E 4 HOH 32  635  32  HOH HOH A . 
E 4 HOH 33  636  33  HOH HOH A . 
E 4 HOH 34  637  34  HOH HOH A . 
E 4 HOH 35  638  35  HOH HOH A . 
E 4 HOH 36  639  36  HOH HOH A . 
E 4 HOH 37  640  37  HOH HOH A . 
E 4 HOH 38  641  38  HOH HOH A . 
E 4 HOH 39  642  39  HOH HOH A . 
E 4 HOH 40  643  40  HOH HOH A . 
E 4 HOH 41  644  41  HOH HOH A . 
E 4 HOH 42  645  42  HOH HOH A . 
E 4 HOH 43  646  43  HOH HOH A . 
E 4 HOH 44  647  44  HOH HOH A . 
E 4 HOH 45  648  45  HOH HOH A . 
E 4 HOH 46  649  46  HOH HOH A . 
E 4 HOH 47  650  47  HOH HOH A . 
E 4 HOH 48  651  48  HOH HOH A . 
E 4 HOH 49  652  49  HOH HOH A . 
E 4 HOH 50  653  50  HOH HOH A . 
E 4 HOH 51  654  51  HOH HOH A . 
E 4 HOH 52  655  52  HOH HOH A . 
E 4 HOH 53  656  53  HOH HOH A . 
E 4 HOH 54  657  54  HOH HOH A . 
E 4 HOH 55  658  55  HOH HOH A . 
E 4 HOH 56  659  56  HOH HOH A . 
E 4 HOH 57  660  57  HOH HOH A . 
E 4 HOH 58  661  58  HOH HOH A . 
E 4 HOH 59  662  59  HOH HOH A . 
E 4 HOH 60  663  60  HOH HOH A . 
E 4 HOH 61  664  61  HOH HOH A . 
E 4 HOH 62  665  62  HOH HOH A . 
E 4 HOH 63  666  63  HOH HOH A . 
E 4 HOH 64  667  64  HOH HOH A . 
E 4 HOH 65  668  65  HOH HOH A . 
E 4 HOH 66  669  66  HOH HOH A . 
E 4 HOH 67  670  67  HOH HOH A . 
E 4 HOH 68  671  68  HOH HOH A . 
E 4 HOH 69  672  69  HOH HOH A . 
E 4 HOH 70  673  70  HOH HOH A . 
E 4 HOH 71  674  71  HOH HOH A . 
E 4 HOH 72  675  72  HOH HOH A . 
E 4 HOH 73  676  73  HOH HOH A . 
E 4 HOH 74  677  74  HOH HOH A . 
E 4 HOH 75  678  75  HOH HOH A . 
E 4 HOH 76  679  76  HOH HOH A . 
E 4 HOH 77  680  77  HOH HOH A . 
E 4 HOH 78  681  78  HOH HOH A . 
E 4 HOH 79  682  79  HOH HOH A . 
E 4 HOH 80  683  80  HOH HOH A . 
E 4 HOH 81  684  81  HOH HOH A . 
E 4 HOH 82  685  82  HOH HOH A . 
E 4 HOH 83  686  83  HOH HOH A . 
E 4 HOH 84  687  84  HOH HOH A . 
E 4 HOH 85  688  85  HOH HOH A . 
E 4 HOH 86  689  86  HOH HOH A . 
E 4 HOH 87  690  87  HOH HOH A . 
E 4 HOH 88  691  88  HOH HOH A . 
E 4 HOH 89  692  89  HOH HOH A . 
E 4 HOH 90  693  90  HOH HOH A . 
E 4 HOH 91  694  91  HOH HOH A . 
E 4 HOH 92  695  92  HOH HOH A . 
E 4 HOH 93  696  93  HOH HOH A . 
E 4 HOH 94  697  94  HOH HOH A . 
E 4 HOH 95  698  95  HOH HOH A . 
E 4 HOH 96  699  96  HOH HOH A . 
E 4 HOH 97  700  97  HOH HOH A . 
E 4 HOH 98  701  98  HOH HOH A . 
E 4 HOH 99  702  99  HOH HOH A . 
E 4 HOH 100 703  100 HOH HOH A . 
E 4 HOH 101 704  101 HOH HOH A . 
E 4 HOH 102 705  102 HOH HOH A . 
E 4 HOH 103 706  103 HOH HOH A . 
E 4 HOH 104 707  104 HOH HOH A . 
E 4 HOH 105 708  105 HOH HOH A . 
E 4 HOH 106 709  106 HOH HOH A . 
E 4 HOH 107 710  107 HOH HOH A . 
E 4 HOH 108 711  108 HOH HOH A . 
E 4 HOH 109 712  109 HOH HOH A . 
E 4 HOH 110 713  110 HOH HOH A . 
E 4 HOH 111 714  111 HOH HOH A . 
E 4 HOH 112 715  112 HOH HOH A . 
E 4 HOH 113 716  113 HOH HOH A . 
E 4 HOH 114 717  114 HOH HOH A . 
E 4 HOH 115 718  115 HOH HOH A . 
E 4 HOH 116 719  116 HOH HOH A . 
E 4 HOH 117 720  117 HOH HOH A . 
E 4 HOH 118 721  118 HOH HOH A . 
E 4 HOH 119 722  119 HOH HOH A . 
E 4 HOH 120 723  120 HOH HOH A . 
E 4 HOH 121 724  121 HOH HOH A . 
E 4 HOH 122 725  122 HOH HOH A . 
E 4 HOH 123 726  123 HOH HOH A . 
E 4 HOH 124 727  124 HOH HOH A . 
E 4 HOH 125 728  125 HOH HOH A . 
E 4 HOH 126 729  126 HOH HOH A . 
E 4 HOH 127 730  127 HOH HOH A . 
E 4 HOH 128 731  128 HOH HOH A . 
E 4 HOH 129 732  129 HOH HOH A . 
E 4 HOH 130 733  130 HOH HOH A . 
E 4 HOH 131 734  131 HOH HOH A . 
E 4 HOH 132 735  132 HOH HOH A . 
E 4 HOH 133 736  133 HOH HOH A . 
E 4 HOH 134 737  134 HOH HOH A . 
E 4 HOH 135 738  135 HOH HOH A . 
E 4 HOH 136 739  136 HOH HOH A . 
E 4 HOH 137 740  137 HOH HOH A . 
E 4 HOH 138 741  138 HOH HOH A . 
E 4 HOH 139 742  139 HOH HOH A . 
E 4 HOH 140 743  140 HOH HOH A . 
E 4 HOH 141 744  141 HOH HOH A . 
E 4 HOH 142 745  142 HOH HOH A . 
E 4 HOH 143 746  143 HOH HOH A . 
E 4 HOH 144 747  144 HOH HOH A . 
E 4 HOH 145 748  145 HOH HOH A . 
E 4 HOH 146 749  146 HOH HOH A . 
E 4 HOH 147 750  147 HOH HOH A . 
E 4 HOH 148 751  148 HOH HOH A . 
E 4 HOH 149 752  149 HOH HOH A . 
E 4 HOH 150 753  150 HOH HOH A . 
E 4 HOH 151 754  151 HOH HOH A . 
E 4 HOH 152 755  152 HOH HOH A . 
E 4 HOH 153 756  153 HOH HOH A . 
E 4 HOH 154 757  154 HOH HOH A . 
E 4 HOH 155 758  155 HOH HOH A . 
E 4 HOH 156 759  156 HOH HOH A . 
E 4 HOH 157 760  157 HOH HOH A . 
E 4 HOH 158 761  158 HOH HOH A . 
E 4 HOH 159 762  159 HOH HOH A . 
E 4 HOH 160 763  160 HOH HOH A . 
E 4 HOH 161 764  161 HOH HOH A . 
E 4 HOH 162 765  162 HOH HOH A . 
E 4 HOH 163 766  163 HOH HOH A . 
E 4 HOH 164 767  164 HOH HOH A . 
E 4 HOH 165 768  165 HOH HOH A . 
E 4 HOH 166 769  166 HOH HOH A . 
E 4 HOH 167 770  167 HOH HOH A . 
E 4 HOH 168 771  168 HOH HOH A . 
E 4 HOH 169 772  169 HOH HOH A . 
E 4 HOH 170 773  170 HOH HOH A . 
E 4 HOH 171 774  171 HOH HOH A . 
E 4 HOH 172 775  172 HOH HOH A . 
E 4 HOH 173 776  173 HOH HOH A . 
E 4 HOH 174 777  174 HOH HOH A . 
E 4 HOH 175 778  175 HOH HOH A . 
E 4 HOH 176 779  176 HOH HOH A . 
E 4 HOH 177 780  177 HOH HOH A . 
E 4 HOH 178 781  178 HOH HOH A . 
E 4 HOH 179 782  179 HOH HOH A . 
E 4 HOH 180 783  180 HOH HOH A . 
E 4 HOH 181 784  181 HOH HOH A . 
E 4 HOH 182 785  182 HOH HOH A . 
E 4 HOH 183 786  183 HOH HOH A . 
E 4 HOH 184 787  184 HOH HOH A . 
E 4 HOH 185 788  185 HOH HOH A . 
E 4 HOH 186 789  186 HOH HOH A . 
E 4 HOH 187 790  187 HOH HOH A . 
E 4 HOH 188 791  188 HOH HOH A . 
E 4 HOH 189 792  189 HOH HOH A . 
E 4 HOH 190 793  190 HOH HOH A . 
E 4 HOH 191 794  191 HOH HOH A . 
E 4 HOH 192 795  192 HOH HOH A . 
E 4 HOH 193 796  193 HOH HOH A . 
E 4 HOH 194 797  194 HOH HOH A . 
E 4 HOH 195 798  195 HOH HOH A . 
E 4 HOH 196 799  196 HOH HOH A . 
E 4 HOH 197 800  197 HOH HOH A . 
E 4 HOH 198 801  198 HOH HOH A . 
E 4 HOH 199 802  199 HOH HOH A . 
E 4 HOH 200 803  200 HOH HOH A . 
E 4 HOH 201 804  201 HOH HOH A . 
E 4 HOH 202 805  202 HOH HOH A . 
E 4 HOH 203 806  203 HOH HOH A . 
E 4 HOH 204 807  204 HOH HOH A . 
E 4 HOH 205 808  205 HOH HOH A . 
E 4 HOH 206 809  206 HOH HOH A . 
E 4 HOH 207 810  207 HOH HOH A . 
E 4 HOH 208 811  208 HOH HOH A . 
E 4 HOH 209 812  209 HOH HOH A . 
E 4 HOH 210 813  210 HOH HOH A . 
E 4 HOH 211 814  211 HOH HOH A . 
E 4 HOH 212 815  212 HOH HOH A . 
E 4 HOH 213 816  213 HOH HOH A . 
E 4 HOH 214 817  214 HOH HOH A . 
E 4 HOH 215 818  215 HOH HOH A . 
E 4 HOH 216 819  216 HOH HOH A . 
E 4 HOH 217 820  217 HOH HOH A . 
E 4 HOH 218 821  218 HOH HOH A . 
E 4 HOH 219 822  219 HOH HOH A . 
E 4 HOH 220 823  220 HOH HOH A . 
E 4 HOH 221 824  221 HOH HOH A . 
E 4 HOH 222 825  222 HOH HOH A . 
E 4 HOH 223 826  223 HOH HOH A . 
E 4 HOH 224 827  224 HOH HOH A . 
E 4 HOH 225 828  225 HOH HOH A . 
E 4 HOH 226 829  227 HOH HOH A . 
E 4 HOH 227 830  228 HOH HOH A . 
E 4 HOH 228 831  229 HOH HOH A . 
E 4 HOH 229 832  230 HOH HOH A . 
E 4 HOH 230 833  231 HOH HOH A . 
E 4 HOH 231 834  232 HOH HOH A . 
E 4 HOH 232 835  233 HOH HOH A . 
E 4 HOH 233 836  234 HOH HOH A . 
E 4 HOH 234 837  235 HOH HOH A . 
E 4 HOH 235 838  236 HOH HOH A . 
E 4 HOH 236 839  237 HOH HOH A . 
E 4 HOH 237 840  238 HOH HOH A . 
E 4 HOH 238 841  239 HOH HOH A . 
E 4 HOH 239 842  240 HOH HOH A . 
E 4 HOH 240 843  241 HOH HOH A . 
E 4 HOH 241 844  242 HOH HOH A . 
E 4 HOH 242 845  243 HOH HOH A . 
E 4 HOH 243 846  244 HOH HOH A . 
E 4 HOH 244 847  245 HOH HOH A . 
E 4 HOH 245 848  246 HOH HOH A . 
E 4 HOH 246 849  247 HOH HOH A . 
E 4 HOH 247 850  248 HOH HOH A . 
E 4 HOH 248 851  249 HOH HOH A . 
E 4 HOH 249 852  250 HOH HOH A . 
E 4 HOH 250 853  251 HOH HOH A . 
E 4 HOH 251 854  252 HOH HOH A . 
E 4 HOH 252 855  253 HOH HOH A . 
E 4 HOH 253 856  254 HOH HOH A . 
E 4 HOH 254 857  255 HOH HOH A . 
E 4 HOH 255 858  256 HOH HOH A . 
E 4 HOH 256 859  257 HOH HOH A . 
E 4 HOH 257 860  258 HOH HOH A . 
E 4 HOH 258 861  259 HOH HOH A . 
E 4 HOH 259 862  260 HOH HOH A . 
E 4 HOH 260 863  261 HOH HOH A . 
E 4 HOH 261 864  262 HOH HOH A . 
E 4 HOH 262 865  263 HOH HOH A . 
E 4 HOH 263 866  264 HOH HOH A . 
E 4 HOH 264 867  265 HOH HOH A . 
E 4 HOH 265 868  266 HOH HOH A . 
E 4 HOH 266 869  267 HOH HOH A . 
E 4 HOH 267 870  268 HOH HOH A . 
E 4 HOH 268 871  269 HOH HOH A . 
E 4 HOH 269 872  270 HOH HOH A . 
E 4 HOH 270 873  271 HOH HOH A . 
E 4 HOH 271 874  272 HOH HOH A . 
E 4 HOH 272 875  273 HOH HOH A . 
E 4 HOH 273 876  274 HOH HOH A . 
E 4 HOH 274 877  275 HOH HOH A . 
E 4 HOH 275 878  276 HOH HOH A . 
E 4 HOH 276 879  277 HOH HOH A . 
E 4 HOH 277 880  278 HOH HOH A . 
E 4 HOH 278 881  279 HOH HOH A . 
E 4 HOH 279 882  280 HOH HOH A . 
E 4 HOH 280 883  281 HOH HOH A . 
E 4 HOH 281 884  282 HOH HOH A . 
E 4 HOH 282 885  283 HOH HOH A . 
E 4 HOH 283 886  284 HOH HOH A . 
E 4 HOH 284 887  285 HOH HOH A . 
E 4 HOH 285 888  286 HOH HOH A . 
E 4 HOH 286 889  287 HOH HOH A . 
E 4 HOH 287 890  288 HOH HOH A . 
E 4 HOH 288 891  289 HOH HOH A . 
E 4 HOH 289 892  290 HOH HOH A . 
E 4 HOH 290 893  291 HOH HOH A . 
E 4 HOH 291 894  292 HOH HOH A . 
E 4 HOH 292 895  293 HOH HOH A . 
E 4 HOH 293 896  294 HOH HOH A . 
E 4 HOH 294 897  295 HOH HOH A . 
E 4 HOH 295 898  296 HOH HOH A . 
E 4 HOH 296 899  297 HOH HOH A . 
E 4 HOH 297 900  298 HOH HOH A . 
E 4 HOH 298 901  299 HOH HOH A . 
E 4 HOH 299 902  300 HOH HOH A . 
E 4 HOH 300 903  301 HOH HOH A . 
E 4 HOH 301 904  302 HOH HOH A . 
E 4 HOH 302 905  303 HOH HOH A . 
E 4 HOH 303 906  304 HOH HOH A . 
E 4 HOH 304 907  305 HOH HOH A . 
E 4 HOH 305 908  306 HOH HOH A . 
E 4 HOH 306 909  307 HOH HOH A . 
E 4 HOH 307 910  308 HOH HOH A . 
E 4 HOH 308 911  309 HOH HOH A . 
E 4 HOH 309 912  310 HOH HOH A . 
E 4 HOH 310 913  311 HOH HOH A . 
E 4 HOH 311 914  312 HOH HOH A . 
E 4 HOH 312 915  313 HOH HOH A . 
E 4 HOH 313 916  314 HOH HOH A . 
E 4 HOH 314 917  315 HOH HOH A . 
E 4 HOH 315 918  316 HOH HOH A . 
E 4 HOH 316 919  317 HOH HOH A . 
E 4 HOH 317 920  318 HOH HOH A . 
E 4 HOH 318 921  319 HOH HOH A . 
E 4 HOH 319 922  320 HOH HOH A . 
E 4 HOH 320 923  321 HOH HOH A . 
E 4 HOH 321 924  322 HOH HOH A . 
E 4 HOH 322 925  323 HOH HOH A . 
E 4 HOH 323 926  324 HOH HOH A . 
E 4 HOH 324 927  325 HOH HOH A . 
E 4 HOH 325 928  326 HOH HOH A . 
E 4 HOH 326 929  327 HOH HOH A . 
E 4 HOH 327 930  328 HOH HOH A . 
E 4 HOH 328 931  329 HOH HOH A . 
E 4 HOH 329 932  330 HOH HOH A . 
E 4 HOH 330 933  331 HOH HOH A . 
E 4 HOH 331 934  332 HOH HOH A . 
E 4 HOH 332 935  333 HOH HOH A . 
E 4 HOH 333 936  334 HOH HOH A . 
E 4 HOH 334 937  335 HOH HOH A . 
E 4 HOH 335 938  336 HOH HOH A . 
E 4 HOH 336 939  337 HOH HOH A . 
E 4 HOH 337 940  338 HOH HOH A . 
E 4 HOH 338 941  339 HOH HOH A . 
E 4 HOH 339 942  340 HOH HOH A . 
E 4 HOH 340 943  341 HOH HOH A . 
E 4 HOH 341 944  342 HOH HOH A . 
E 4 HOH 342 945  343 HOH HOH A . 
E 4 HOH 343 946  344 HOH HOH A . 
E 4 HOH 344 947  345 HOH HOH A . 
E 4 HOH 345 948  346 HOH HOH A . 
E 4 HOH 346 949  347 HOH HOH A . 
E 4 HOH 347 950  348 HOH HOH A . 
E 4 HOH 348 951  349 HOH HOH A . 
E 4 HOH 349 952  351 HOH HOH A . 
E 4 HOH 350 953  352 HOH HOH A . 
E 4 HOH 351 954  353 HOH HOH A . 
E 4 HOH 352 955  354 HOH HOH A . 
E 4 HOH 353 956  355 HOH HOH A . 
E 4 HOH 354 957  356 HOH HOH A . 
E 4 HOH 355 958  357 HOH HOH A . 
E 4 HOH 356 959  358 HOH HOH A . 
E 4 HOH 357 960  359 HOH HOH A . 
E 4 HOH 358 961  360 HOH HOH A . 
E 4 HOH 359 962  361 HOH HOH A . 
E 4 HOH 360 963  362 HOH HOH A . 
E 4 HOH 361 964  363 HOH HOH A . 
E 4 HOH 362 965  364 HOH HOH A . 
E 4 HOH 363 966  365 HOH HOH A . 
E 4 HOH 364 967  366 HOH HOH A . 
E 4 HOH 365 968  367 HOH HOH A . 
E 4 HOH 366 969  368 HOH HOH A . 
E 4 HOH 367 970  369 HOH HOH A . 
E 4 HOH 368 971  370 HOH HOH A . 
E 4 HOH 369 972  371 HOH HOH A . 
E 4 HOH 370 973  372 HOH HOH A . 
E 4 HOH 371 974  373 HOH HOH A . 
E 4 HOH 372 975  374 HOH HOH A . 
E 4 HOH 373 976  375 HOH HOH A . 
E 4 HOH 374 977  376 HOH HOH A . 
E 4 HOH 375 978  377 HOH HOH A . 
E 4 HOH 376 979  378 HOH HOH A . 
E 4 HOH 377 980  379 HOH HOH A . 
E 4 HOH 378 981  380 HOH HOH A . 
E 4 HOH 379 982  381 HOH HOH A . 
E 4 HOH 380 983  382 HOH HOH A . 
E 4 HOH 381 984  383 HOH HOH A . 
E 4 HOH 382 985  384 HOH HOH A . 
E 4 HOH 383 986  385 HOH HOH A . 
E 4 HOH 384 987  386 HOH HOH A . 
E 4 HOH 385 988  387 HOH HOH A . 
E 4 HOH 386 989  388 HOH HOH A . 
E 4 HOH 387 990  389 HOH HOH A . 
E 4 HOH 388 991  390 HOH HOH A . 
E 4 HOH 389 992  391 HOH HOH A . 
E 4 HOH 390 993  392 HOH HOH A . 
E 4 HOH 391 994  393 HOH HOH A . 
E 4 HOH 392 995  394 HOH HOH A . 
E 4 HOH 393 996  395 HOH HOH A . 
E 4 HOH 394 997  396 HOH HOH A . 
E 4 HOH 395 998  397 HOH HOH A . 
E 4 HOH 396 999  398 HOH HOH A . 
E 4 HOH 397 1000 399 HOH HOH A . 
E 4 HOH 398 1001 400 HOH HOH A . 
E 4 HOH 399 1002 401 HOH HOH A . 
E 4 HOH 400 1003 402 HOH HOH A . 
E 4 HOH 401 1004 403 HOH HOH A . 
E 4 HOH 402 1005 404 HOH HOH A . 
E 4 HOH 403 1006 405 HOH HOH A . 
E 4 HOH 404 1007 406 HOH HOH A . 
E 4 HOH 405 1008 407 HOH HOH A . 
E 4 HOH 406 1009 408 HOH HOH A . 
E 4 HOH 407 1010 409 HOH HOH A . 
E 4 HOH 408 1011 410 HOH HOH A . 
E 4 HOH 409 1012 411 HOH HOH A . 
E 4 HOH 410 1013 412 HOH HOH A . 
E 4 HOH 411 1014 413 HOH HOH A . 
E 4 HOH 412 1015 414 HOH HOH A . 
E 4 HOH 413 1016 415 HOH HOH A . 
E 4 HOH 414 1017 416 HOH HOH A . 
E 4 HOH 415 1018 417 HOH HOH A . 
E 4 HOH 416 1019 418 HOH HOH A . 
E 4 HOH 417 1020 419 HOH HOH A . 
E 4 HOH 418 1021 420 HOH HOH A . 
E 4 HOH 419 1022 421 HOH HOH A . 
E 4 HOH 420 1023 422 HOH HOH A . 
E 4 HOH 421 1024 423 HOH HOH A . 
E 4 HOH 422 1025 424 HOH HOH A . 
E 4 HOH 423 1026 425 HOH HOH A . 
E 4 HOH 424 1027 426 HOH HOH A . 
E 4 HOH 425 1028 427 HOH HOH A . 
E 4 HOH 426 1029 428 HOH HOH A . 
E 4 HOH 427 1030 429 HOH HOH A . 
E 4 HOH 428 1031 430 HOH HOH A . 
E 4 HOH 429 1032 431 HOH HOH A . 
E 4 HOH 430 1033 432 HOH HOH A . 
E 4 HOH 431 1034 433 HOH HOH A . 
E 4 HOH 432 1035 434 HOH HOH A . 
E 4 HOH 433 1036 435 HOH HOH A . 
E 4 HOH 434 1037 436 HOH HOH A . 
E 4 HOH 435 1038 437 HOH HOH A . 
E 4 HOH 436 1039 438 HOH HOH A . 
E 4 HOH 437 1040 439 HOH HOH A . 
E 4 HOH 438 1041 440 HOH HOH A . 
E 4 HOH 439 1042 441 HOH HOH A . 
E 4 HOH 440 1043 442 HOH HOH A . 
E 4 HOH 441 1044 443 HOH HOH A . 
E 4 HOH 442 1045 444 HOH HOH A . 
E 4 HOH 443 1046 445 HOH HOH A . 
E 4 HOH 444 1047 446 HOH HOH A . 
E 4 HOH 445 1048 447 HOH HOH A . 
E 4 HOH 446 1049 448 HOH HOH A . 
E 4 HOH 447 1050 449 HOH HOH A . 
E 4 HOH 448 1051 450 HOH HOH A . 
E 4 HOH 449 1052 451 HOH HOH A . 
E 4 HOH 450 1053 452 HOH HOH A . 
E 4 HOH 451 1054 453 HOH HOH A . 
E 4 HOH 452 1055 454 HOH HOH A . 
E 4 HOH 453 1056 455 HOH HOH A . 
E 4 HOH 454 1057 456 HOH HOH A . 
E 4 HOH 455 1058 457 HOH HOH A . 
E 4 HOH 456 1059 458 HOH HOH A . 
E 4 HOH 457 1060 459 HOH HOH A . 
E 4 HOH 458 1061 460 HOH HOH A . 
E 4 HOH 459 1062 461 HOH HOH A . 
E 4 HOH 460 1063 462 HOH HOH A . 
E 4 HOH 461 1064 463 HOH HOH A . 
E 4 HOH 462 1065 464 HOH HOH A . 
E 4 HOH 463 1066 465 HOH HOH A . 
E 4 HOH 464 1067 466 HOH HOH A . 
E 4 HOH 465 1068 467 HOH HOH A . 
E 4 HOH 466 1069 468 HOH HOH A . 
E 4 HOH 467 1070 469 HOH HOH A . 
E 4 HOH 468 1071 470 HOH HOH A . 
E 4 HOH 469 1072 471 HOH HOH A . 
E 4 HOH 470 1073 472 HOH HOH A . 
E 4 HOH 471 1074 473 HOH HOH A . 
E 4 HOH 472 1075 474 HOH HOH A . 
E 4 HOH 473 1076 475 HOH HOH A . 
E 4 HOH 474 1077 476 HOH HOH A . 
E 4 HOH 475 1078 477 HOH HOH A . 
E 4 HOH 476 1079 478 HOH HOH A . 
E 4 HOH 477 1080 479 HOH HOH A . 
E 4 HOH 478 1081 480 HOH HOH A . 
E 4 HOH 479 1082 481 HOH HOH A . 
E 4 HOH 480 1083 482 HOH HOH A . 
E 4 HOH 481 1084 483 HOH HOH A . 
E 4 HOH 482 1085 484 HOH HOH A . 
E 4 HOH 483 1086 485 HOH HOH A . 
E 4 HOH 484 1087 486 HOH HOH A . 
E 4 HOH 485 1088 487 HOH HOH A . 
E 4 HOH 486 1089 488 HOH HOH A . 
E 4 HOH 487 1090 490 HOH HOH A . 
E 4 HOH 488 1091 491 HOH HOH A . 
E 4 HOH 489 1092 492 HOH HOH A . 
E 4 HOH 490 1093 493 HOH HOH A . 
E 4 HOH 491 1094 494 HOH HOH A . 
E 4 HOH 492 1095 495 HOH HOH A . 
E 4 HOH 493 1096 496 HOH HOH A . 
E 4 HOH 494 1097 497 HOH HOH A . 
E 4 HOH 495 1098 498 HOH HOH A . 
E 4 HOH 496 1099 499 HOH HOH A . 
E 4 HOH 497 1100 500 HOH HOH A . 
E 4 HOH 498 1101 501 HOH HOH A . 
E 4 HOH 499 1102 502 HOH HOH A . 
E 4 HOH 500 1103 503 HOH HOH A . 
E 4 HOH 501 1104 504 HOH HOH A . 
E 4 HOH 502 1105 505 HOH HOH A . 
E 4 HOH 503 1106 506 HOH HOH A . 
E 4 HOH 504 1107 507 HOH HOH A . 
E 4 HOH 505 1108 508 HOH HOH A . 
E 4 HOH 506 1109 509 HOH HOH A . 
E 4 HOH 507 1110 510 HOH HOH A . 
E 4 HOH 508 1111 511 HOH HOH A . 
E 4 HOH 509 1112 512 HOH HOH A . 
E 4 HOH 510 1113 513 HOH HOH A . 
E 4 HOH 511 1114 514 HOH HOH A . 
E 4 HOH 512 1115 515 HOH HOH A . 
E 4 HOH 513 1116 516 HOH HOH A . 
E 4 HOH 514 1117 517 HOH HOH A . 
E 4 HOH 515 1118 518 HOH HOH A . 
E 4 HOH 516 1119 519 HOH HOH A . 
E 4 HOH 517 1120 520 HOH HOH A . 
E 4 HOH 518 1121 521 HOH HOH A . 
E 4 HOH 519 1122 522 HOH HOH A . 
E 4 HOH 520 1123 523 HOH HOH A . 
E 4 HOH 521 1124 524 HOH HOH A . 
E 4 HOH 522 1125 525 HOH HOH A . 
E 4 HOH 523 1126 526 HOH HOH A . 
E 4 HOH 524 1127 527 HOH HOH A . 
E 4 HOH 525 1128 528 HOH HOH A . 
E 4 HOH 526 1129 529 HOH HOH A . 
E 4 HOH 527 1130 530 HOH HOH A . 
E 4 HOH 528 1131 531 HOH HOH A . 
E 4 HOH 529 1132 532 HOH HOH A . 
E 4 HOH 530 1133 533 HOH HOH A . 
E 4 HOH 531 1134 534 HOH HOH A . 
E 4 HOH 532 1135 535 HOH HOH A . 
E 4 HOH 533 1136 536 HOH HOH A . 
E 4 HOH 534 1137 537 HOH HOH A . 
E 4 HOH 535 1138 538 HOH HOH A . 
E 4 HOH 536 1139 539 HOH HOH A . 
E 4 HOH 537 1140 540 HOH HOH A . 
E 4 HOH 538 1141 541 HOH HOH A . 
E 4 HOH 539 1142 542 HOH HOH A . 
E 4 HOH 540 1143 543 HOH HOH A . 
E 4 HOH 541 1144 544 HOH HOH A . 
E 4 HOH 542 1145 545 HOH HOH A . 
E 4 HOH 543 1146 546 HOH HOH A . 
E 4 HOH 544 1147 547 HOH HOH A . 
E 4 HOH 545 1148 548 HOH HOH A . 
E 4 HOH 546 1149 549 HOH HOH A . 
E 4 HOH 547 1150 550 HOH HOH A . 
E 4 HOH 548 1151 551 HOH HOH A . 
E 4 HOH 549 1152 552 HOH HOH A . 
E 4 HOH 550 1153 553 HOH HOH A . 
E 4 HOH 551 1154 554 HOH HOH A . 
E 4 HOH 552 1155 555 HOH HOH A . 
E 4 HOH 553 1156 556 HOH HOH A . 
E 4 HOH 554 1157 557 HOH HOH A . 
E 4 HOH 555 1158 558 HOH HOH A . 
E 4 HOH 556 1159 559 HOH HOH A . 
E 4 HOH 557 1160 560 HOH HOH A . 
E 4 HOH 558 1161 561 HOH HOH A . 
E 4 HOH 559 1162 562 HOH HOH A . 
E 4 HOH 560 1163 563 HOH HOH A . 
E 4 HOH 561 1164 564 HOH HOH A . 
E 4 HOH 562 1165 565 HOH HOH A . 
E 4 HOH 563 1166 566 HOH HOH A . 
E 4 HOH 564 1167 567 HOH HOH A . 
E 4 HOH 565 1168 568 HOH HOH A . 
E 4 HOH 566 1169 569 HOH HOH A . 
E 4 HOH 567 1170 571 HOH HOH A . 
E 4 HOH 568 1171 572 HOH HOH A . 
E 4 HOH 569 1172 573 HOH HOH A . 
E 4 HOH 570 1173 574 HOH HOH A . 
E 4 HOH 571 1174 575 HOH HOH A . 
E 4 HOH 572 1175 576 HOH HOH A . 
E 4 HOH 573 1176 577 HOH HOH A . 
E 4 HOH 574 1177 578 HOH HOH A . 
E 4 HOH 575 1178 579 HOH HOH A . 
E 4 HOH 576 1179 580 HOH HOH A . 
E 4 HOH 577 1180 581 HOH HOH A . 
E 4 HOH 578 1181 582 HOH HOH A . 
E 4 HOH 579 1182 583 HOH HOH A . 
E 4 HOH 580 1183 584 HOH HOH A . 
E 4 HOH 581 1184 585 HOH HOH A . 
#