data_1IBE
# 
_entry.id   1IBE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IBE         
WWPDB D_1000174096 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IBE 
_pdbx_database_status.recvd_initial_deposition_date   1996-09-25 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wilson, J.'   1 
'Phillips, K.' 2 
'Luisi, B.'    3 
# 
_citation.id                        primary 
_citation.title                     'The crystal structure of horse deoxyhaemoglobin trapped in the high-affinity (R) state.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            264 
_citation.page_first                743 
_citation.page_last                 756 
_citation.year                      1996 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8980683 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1996.0674 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wilson, J.'   1 
primary 'Phillips, K.' 2 
primary 'Luisi, B.'    3 
# 
_cell.entry_id           1IBE 
_cell.length_a           108.180 
_cell.length_b           63.180 
_cell.length_c           54.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.10 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IBE 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'HEMOGLOBIN (DEOXY)'              15122.280 1   ? ? ? ? 
2 polymer     nat 'HEMOGLOBIN (DEOXY)'              16032.274 1   ? ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   2   ? ? ? ? 
4 water       nat water                             18.015    187 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGAL
SDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR
;
;VLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGAL
SDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR
;
A ? 
2 'polypeptide(L)' no no 
;VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDN
LKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH
;
;VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDN
LKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   LEU n 
1 3   SER n 
1 4   ALA n 
1 5   ALA n 
1 6   ASP n 
1 7   LYS n 
1 8   THR n 
1 9   ASN n 
1 10  VAL n 
1 11  LYS n 
1 12  ALA n 
1 13  ALA n 
1 14  TRP n 
1 15  SER n 
1 16  LYS n 
1 17  VAL n 
1 18  GLY n 
1 19  GLY n 
1 20  HIS n 
1 21  ALA n 
1 22  GLY n 
1 23  GLU n 
1 24  PHE n 
1 25  GLY n 
1 26  ALA n 
1 27  GLU n 
1 28  ALA n 
1 29  LEU n 
1 30  GLU n 
1 31  ARG n 
1 32  MET n 
1 33  PHE n 
1 34  LEU n 
1 35  GLY n 
1 36  PHE n 
1 37  PRO n 
1 38  THR n 
1 39  THR n 
1 40  LYS n 
1 41  THR n 
1 42  TYR n 
1 43  PHE n 
1 44  PRO n 
1 45  HIS n 
1 46  PHE n 
1 47  ASP n 
1 48  LEU n 
1 49  SER n 
1 50  HIS n 
1 51  GLY n 
1 52  SER n 
1 53  ALA n 
1 54  GLN n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  HIS n 
1 59  GLY n 
1 60  LYS n 
1 61  LYS n 
1 62  VAL n 
1 63  GLY n 
1 64  ASP n 
1 65  ALA n 
1 66  LEU n 
1 67  THR n 
1 68  LEU n 
1 69  ALA n 
1 70  VAL n 
1 71  GLY n 
1 72  HIS n 
1 73  LEU n 
1 74  ASP n 
1 75  ASP n 
1 76  LEU n 
1 77  PRO n 
1 78  GLY n 
1 79  ALA n 
1 80  LEU n 
1 81  SER n 
1 82  ASP n 
1 83  LEU n 
1 84  SER n 
1 85  ASN n 
1 86  LEU n 
1 87  HIS n 
1 88  ALA n 
1 89  HIS n 
1 90  LYS n 
1 91  LEU n 
1 92  ARG n 
1 93  VAL n 
1 94  ASP n 
1 95  PRO n 
1 96  VAL n 
1 97  ASN n 
1 98  PHE n 
1 99  LYS n 
1 100 LEU n 
1 101 LEU n 
1 102 SER n 
1 103 HIS n 
1 104 CYS n 
1 105 LEU n 
1 106 LEU n 
1 107 SER n 
1 108 THR n 
1 109 LEU n 
1 110 ALA n 
1 111 VAL n 
1 112 HIS n 
1 113 LEU n 
1 114 PRO n 
1 115 ASN n 
1 116 ASP n 
1 117 PHE n 
1 118 THR n 
1 119 PRO n 
1 120 ALA n 
1 121 VAL n 
1 122 HIS n 
1 123 ALA n 
1 124 SER n 
1 125 LEU n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 LEU n 
1 130 SER n 
1 131 SER n 
1 132 VAL n 
1 133 SER n 
1 134 THR n 
1 135 VAL n 
1 136 LEU n 
1 137 THR n 
1 138 SER n 
1 139 LYS n 
1 140 TYR n 
1 141 ARG n 
2 1   VAL n 
2 2   GLN n 
2 3   LEU n 
2 4   SER n 
2 5   GLY n 
2 6   GLU n 
2 7   GLU n 
2 8   LYS n 
2 9   ALA n 
2 10  ALA n 
2 11  VAL n 
2 12  LEU n 
2 13  ALA n 
2 14  LEU n 
2 15  TRP n 
2 16  ASP n 
2 17  LYS n 
2 18  VAL n 
2 19  ASN n 
2 20  GLU n 
2 21  GLU n 
2 22  GLU n 
2 23  VAL n 
2 24  GLY n 
2 25  GLY n 
2 26  GLU n 
2 27  ALA n 
2 28  LEU n 
2 29  GLY n 
2 30  ARG n 
2 31  LEU n 
2 32  LEU n 
2 33  VAL n 
2 34  VAL n 
2 35  TYR n 
2 36  PRO n 
2 37  TRP n 
2 38  THR n 
2 39  GLN n 
2 40  ARG n 
2 41  PHE n 
2 42  PHE n 
2 43  ASP n 
2 44  SER n 
2 45  PHE n 
2 46  GLY n 
2 47  ASP n 
2 48  LEU n 
2 49  SER n 
2 50  ASN n 
2 51  PRO n 
2 52  GLY n 
2 53  ALA n 
2 54  VAL n 
2 55  MET n 
2 56  GLY n 
2 57  ASN n 
2 58  PRO n 
2 59  LYS n 
2 60  VAL n 
2 61  LYS n 
2 62  ALA n 
2 63  HIS n 
2 64  GLY n 
2 65  LYS n 
2 66  LYS n 
2 67  VAL n 
2 68  LEU n 
2 69  HIS n 
2 70  SER n 
2 71  PHE n 
2 72  GLY n 
2 73  GLU n 
2 74  GLY n 
2 75  VAL n 
2 76  HIS n 
2 77  HIS n 
2 78  LEU n 
2 79  ASP n 
2 80  ASN n 
2 81  LEU n 
2 82  LYS n 
2 83  GLY n 
2 84  THR n 
2 85  PHE n 
2 86  ALA n 
2 87  ALA n 
2 88  LEU n 
2 89  SER n 
2 90  GLU n 
2 91  LEU n 
2 92  HIS n 
2 93  CYS n 
2 94  ASP n 
2 95  LYS n 
2 96  LEU n 
2 97  HIS n 
2 98  VAL n 
2 99  ASP n 
2 100 PRO n 
2 101 GLU n 
2 102 ASN n 
2 103 PHE n 
2 104 ARG n 
2 105 LEU n 
2 106 LEU n 
2 107 GLY n 
2 108 ASN n 
2 109 VAL n 
2 110 LEU n 
2 111 VAL n 
2 112 VAL n 
2 113 VAL n 
2 114 LEU n 
2 115 ALA n 
2 116 ARG n 
2 117 HIS n 
2 118 PHE n 
2 119 GLY n 
2 120 LYS n 
2 121 ASP n 
2 122 PHE n 
2 123 THR n 
2 124 PRO n 
2 125 GLU n 
2 126 LEU n 
2 127 GLN n 
2 128 ALA n 
2 129 SER n 
2 130 TYR n 
2 131 GLN n 
2 132 LYS n 
2 133 VAL n 
2 134 VAL n 
2 135 ALA n 
2 136 GLY n 
2 137 VAL n 
2 138 ALA n 
2 139 ASN n 
2 140 ALA n 
2 141 LEU n 
2 142 ALA n 
2 143 HIS n 
2 144 LYS n 
2 145 TYR n 
2 146 HIS n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? horse 'Equus caballus' 9796 Equus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? horse 'Equus caballus' 9796 Equus ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP HBA_HORSE 1 P01958 1 
;VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGAL
SNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR
;
? 
2 UNP HBB_HORSE 2 P02062 1 
;VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDN
LKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IBE A 1 ? 141 ? P01958 1 ? 141 ? 1 141 
2 2 1IBE B 1 ? 146 ? P02062 1 ? 146 ? 1 146 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IBE PHE A 24 ? UNP P01958 TYR 24 VARIANT  24 1 
1 1IBE ASP A 82 ? UNP P01958 ASN 82 CONFLICT 82 2 
1 1IBE ASN A 85 ? UNP P01958 ASP 85 CONFLICT 85 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1IBE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   58. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'XUONG-HAMLIN MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IBE 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   32227 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.0590000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1IBE 
_refine.ls_number_reflns_obs                     144335 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1786000 
_refine.ls_R_factor_R_free                       0.2300000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               29.96 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IBE 
_refine_analyze.Luzzati_coordinate_error_obs    0.2 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2297 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             188 
_refine_hist.number_atoms_total               2485 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.024 0.025  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.044 0.035  ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?      ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.051 0.050  ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?      ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         3.337 4.000  ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        4.532 6.000  ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         6.745 8.000  ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        9.006 10.000 ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.018 0.025  ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.130 0.120  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.19  0.30   ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.29  0.30   ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?      ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.19  0.30   ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        3.06  3.00   ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     20.44 20.00  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?      ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    30.64 30.00  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?      ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1IBE 
_struct.title                     'DEOXY-HAEMOGLOBIN TRAPPED IN THE HIGH-AFFINITY (R) STATE' 
_struct.pdbx_descriptor           'HEMOGLOBIN (DEOXY), PROTOPORPHYRIN IX CONTAINING FE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IBE 
_struct_keywords.pdbx_keywords   'OXYGEN TRANSPORT' 
_struct_keywords.text            'HEME, OXYGEN TRANSPORT, RESPIRATORY PROTEIN, ERYTHROCYTE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 4   ? VAL A 17  ? ALA A 4   VAL A 17  1 ? 14 
HELX_P HELX_P2  2  ALA A 21  ? GLY A 35  ? ALA A 21  GLY A 35  1 ? 15 
HELX_P HELX_P3  3  PRO A 37  ? TYR A 42  ? PRO A 37  TYR A 42  5 ? 6  
HELX_P HELX_P4  4  ALA A 53  ? GLY A 71  ? ALA A 53  GLY A 71  1 ? 19 
HELX_P HELX_P5  5  LEU A 80  ? ALA A 88  ? LEU A 80  ALA A 88  1 ? 9  
HELX_P HELX_P6  6  PRO A 95  ? HIS A 112 ? PRO A 95  HIS A 112 5 ? 18 
HELX_P HELX_P7  7  PRO A 119 ? THR A 137 ? PRO A 119 THR A 137 1 ? 19 
HELX_P HELX_P8  8  GLY B 5   ? LYS B 17  ? GLY B 5   LYS B 17  1 ? 13 
HELX_P HELX_P9  9  GLU B 20  ? VAL B 34  ? GLU B 20  VAL B 34  1 ? 15 
HELX_P HELX_P10 10 PRO B 36  ? PHE B 41  ? PRO B 36  PHE B 41  5 ? 6  
HELX_P HELX_P11 11 PRO B 51  ? GLY B 56  ? PRO B 51  GLY B 56  1 ? 6  
HELX_P HELX_P12 12 PRO B 58  ? HIS B 77  ? PRO B 58  HIS B 77  1 ? 20 
HELX_P HELX_P13 13 PHE B 85  ? CYS B 93  ? PHE B 85  CYS B 93  1 ? 9  
HELX_P HELX_P14 14 ASP B 99  ? HIS B 117 ? ASP B 99  HIS B 117 5 ? 19 
HELX_P HELX_P15 15 PRO B 124 ? ALA B 142 ? PRO B 124 ALA B 142 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? C HEM . FE ? ? ? 1_555 A HIS 87 NE2 ? ? A HEM 143 A HIS 87 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc2 metalc ? ? D HEM . FE ? ? ? 1_555 B HIS 92 NE2 ? ? B HEM 147 B HIS 92 1_555 ? ? ? ? ? ? ? 2.284 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE HEM A 143' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE HEM B 147' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 TYR A 42  ? TYR A 42  . ? 1_555 ? 
2  AC1 17 PHE A 43  ? PHE A 43  . ? 1_555 ? 
3  AC1 17 HIS A 45  ? HIS A 45  . ? 1_555 ? 
4  AC1 17 HIS A 58  ? HIS A 58  . ? 1_555 ? 
5  AC1 17 LYS A 61  ? LYS A 61  . ? 1_555 ? 
6  AC1 17 HIS A 87  ? HIS A 87  . ? 1_555 ? 
7  AC1 17 LEU A 91  ? LEU A 91  . ? 1_555 ? 
8  AC1 17 VAL A 93  ? VAL A 93  . ? 1_555 ? 
9  AC1 17 ASN A 97  ? ASN A 97  . ? 1_555 ? 
10 AC1 17 PHE A 98  ? PHE A 98  . ? 1_555 ? 
11 AC1 17 LEU A 101 ? LEU A 101 . ? 1_555 ? 
12 AC1 17 LEU A 136 ? LEU A 136 . ? 1_555 ? 
13 AC1 17 HOH E .   ? HOH A 145 . ? 1_555 ? 
14 AC1 17 HOH E .   ? HOH A 171 . ? 1_555 ? 
15 AC1 17 HOH E .   ? HOH A 181 . ? 1_555 ? 
16 AC1 17 HOH E .   ? HOH A 225 . ? 1_555 ? 
17 AC1 17 HOH E .   ? HOH A 229 . ? 1_555 ? 
18 AC2 14 PHE B 41  ? PHE B 41  . ? 1_555 ? 
19 AC2 14 PHE B 42  ? PHE B 42  . ? 1_555 ? 
20 AC2 14 PHE B 45  ? PHE B 45  . ? 1_555 ? 
21 AC2 14 HIS B 63  ? HIS B 63  . ? 1_555 ? 
22 AC2 14 LYS B 66  ? LYS B 66  . ? 1_555 ? 
23 AC2 14 SER B 70  ? SER B 70  . ? 1_555 ? 
24 AC2 14 LEU B 91  ? LEU B 91  . ? 1_555 ? 
25 AC2 14 HIS B 92  ? HIS B 92  . ? 1_555 ? 
26 AC2 14 LEU B 96  ? LEU B 96  . ? 1_555 ? 
27 AC2 14 VAL B 98  ? VAL B 98  . ? 1_555 ? 
28 AC2 14 ASN B 102 ? ASN B 102 . ? 1_555 ? 
29 AC2 14 PHE B 103 ? PHE B 103 . ? 1_555 ? 
30 AC2 14 LEU B 106 ? LEU B 106 . ? 1_555 ? 
31 AC2 14 LEU B 141 ? LEU B 141 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IBE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IBE 
_atom_sites.fract_transf_matrix[1][1]   0.009244 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003567 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015828 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019638 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 1   ? 36.079 -14.829 31.157 1.00 47.66 ? 1   VAL A N   1 
ATOM   2    C  CA  . VAL A 1 1   ? 36.500 -15.720 29.958 1.00 55.13 ? 1   VAL A CA  1 
ATOM   3    C  C   . VAL A 1 1   ? 35.328 -16.565 29.517 1.00 57.22 ? 1   VAL A C   1 
ATOM   4    O  O   . VAL A 1 1   ? 34.193 -16.533 30.112 1.00 49.22 ? 1   VAL A O   1 
ATOM   5    C  CB  . VAL A 1 1   ? 37.812 -16.452 30.284 1.00 63.90 ? 1   VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 1   ? 37.901 -17.957 30.002 1.00 60.92 ? 1   VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 1   ? 38.994 -15.778 29.502 1.00 59.44 ? 1   VAL A CG2 1 
ATOM   8    N  N   . LEU A 1 2   ? 35.503 -17.370 28.412 1.00 57.67 ? 2   LEU A N   1 
ATOM   9    C  CA  . LEU A 1 2   ? 34.325 -18.194 27.983 1.00 50.84 ? 2   LEU A CA  1 
ATOM   10   C  C   . LEU A 1 2   ? 34.156 -19.465 28.859 1.00 42.02 ? 2   LEU A C   1 
ATOM   11   O  O   . LEU A 1 2   ? 34.629 -20.580 28.810 1.00 42.87 ? 2   LEU A O   1 
ATOM   12   C  CB  . LEU A 1 2   ? 34.212 -18.373 26.490 1.00 43.09 ? 2   LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 2   ? 33.964 -17.168 25.555 1.00 39.17 ? 2   LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 2   ? 32.874 -17.516 24.524 1.00 43.48 ? 2   LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 2   ? 33.564 -15.893 26.273 1.00 38.70 ? 2   LEU A CD2 1 
ATOM   16   N  N   . SER A 1 3   ? 33.266 -19.178 29.829 1.00 41.26 ? 3   SER A N   1 
ATOM   17   C  CA  . SER A 1 3   ? 32.702 -20.030 30.832 1.00 36.99 ? 3   SER A CA  1 
ATOM   18   C  C   . SER A 1 3   ? 31.494 -20.655 30.148 1.00 31.92 ? 3   SER A C   1 
ATOM   19   O  O   . SER A 1 3   ? 31.028 -20.054 29.147 1.00 27.61 ? 3   SER A O   1 
ATOM   20   C  CB  . SER A 1 3   ? 32.200 -19.209 32.043 1.00 35.23 ? 3   SER A CB  1 
ATOM   21   O  OG  . SER A 1 3   ? 31.030 -18.464 31.649 1.00 35.08 ? 3   SER A OG  1 
ATOM   22   N  N   . ALA A 1 4   ? 30.960 -21.725 30.711 1.00 29.57 ? 4   ALA A N   1 
ATOM   23   C  CA  . ALA A 1 4   ? 29.805 -22.362 30.074 1.00 26.87 ? 4   ALA A CA  1 
ATOM   24   C  C   . ALA A 1 4   ? 28.625 -21.423 29.926 1.00 23.73 ? 4   ALA A C   1 
ATOM   25   O  O   . ALA A 1 4   ? 27.856 -21.470 28.969 1.00 29.77 ? 4   ALA A O   1 
ATOM   26   C  CB  . ALA A 1 4   ? 29.343 -23.546 30.919 1.00 38.07 ? 4   ALA A CB  1 
ATOM   27   N  N   . ALA A 1 5   ? 28.430 -20.613 30.957 1.00 27.44 ? 5   ALA A N   1 
ATOM   28   C  CA  . ALA A 1 5   ? 27.303 -19.654 30.950 1.00 24.42 ? 5   ALA A CA  1 
ATOM   29   C  C   . ALA A 1 5   ? 27.532 -18.684 29.815 1.00 21.76 ? 5   ALA A C   1 
ATOM   30   O  O   . ALA A 1 5   ? 26.535 -18.323 29.205 1.00 25.26 ? 5   ALA A O   1 
ATOM   31   C  CB  . ALA A 1 5   ? 27.229 -18.934 32.291 1.00 28.53 ? 5   ALA A CB  1 
ATOM   32   N  N   . ASP A 1 6   ? 28.801 -18.217 29.656 1.00 22.77 ? 6   ASP A N   1 
ATOM   33   C  CA  . ASP A 1 6   ? 29.029 -17.337 28.488 1.00 23.10 ? 6   ASP A CA  1 
ATOM   34   C  C   . ASP A 1 6   ? 28.796 -18.061 27.174 1.00 18.99 ? 6   ASP A C   1 
ATOM   35   O  O   . ASP A 1 6   ? 28.172 -17.491 26.282 1.00 21.60 ? 6   ASP A O   1 
ATOM   36   C  CB  . ASP A 1 6   ? 30.434 -16.775 28.396 1.00 24.45 ? 6   ASP A CB  1 
ATOM   37   C  CG  . ASP A 1 6   ? 30.516 -15.717 29.508 1.00 22.94 ? 6   ASP A CG  1 
ATOM   38   O  OD1 . ASP A 1 6   ? 29.631 -14.857 29.688 1.00 20.78 ? 6   ASP A OD1 1 
ATOM   39   O  OD2 . ASP A 1 6   ? 31.554 -15.820 30.161 1.00 33.11 ? 6   ASP A OD2 1 
ATOM   40   N  N   . LYS A 1 7   ? 29.226 -19.324 27.074 1.00 21.80 ? 7   LYS A N   1 
ATOM   41   C  CA  . LYS A 1 7   ? 28.959 -20.064 25.819 1.00 23.26 ? 7   LYS A CA  1 
ATOM   42   C  C   . LYS A 1 7   ? 27.495 -20.216 25.613 1.00 20.90 ? 7   LYS A C   1 
ATOM   43   O  O   . LYS A 1 7   ? 27.035 -20.061 24.473 1.00 18.86 ? 7   LYS A O   1 
ATOM   44   C  CB  . LYS A 1 7   ? 29.606 -21.448 25.827 1.00 22.21 ? 7   LYS A CB  1 
ATOM   45   C  CG  . LYS A 1 7   ? 31.143 -21.349 25.944 1.00 24.01 ? 7   LYS A CG  1 
ATOM   46   C  CD  . LYS A 1 7   ? 31.620 -22.826 25.923 1.00 36.32 ? 7   LYS A CD  1 
ATOM   47   C  CE  . LYS A 1 7   ? 33.102 -22.877 26.323 1.00 53.69 ? 7   LYS A CE  1 
ATOM   48   N  NZ  . LYS A 1 7   ? 33.304 -23.626 27.627 1.00 59.02 ? 7   LYS A NZ  1 
ATOM   49   N  N   . THR A 1 8   ? 26.710 -20.484 26.656 1.00 19.45 ? 8   THR A N   1 
ATOM   50   C  CA  . THR A 1 8   ? 25.262 -20.596 26.460 1.00 21.86 ? 8   THR A CA  1 
ATOM   51   C  C   . THR A 1 8   ? 24.654 -19.281 26.033 1.00 18.16 ? 8   THR A C   1 
ATOM   52   O  O   . THR A 1 8   ? 23.814 -19.309 25.085 1.00 21.69 ? 8   THR A O   1 
ATOM   53   C  CB  . THR A 1 8   ? 24.617 -21.113 27.784 1.00 31.40 ? 8   THR A CB  1 
ATOM   54   O  OG1 . THR A 1 8   ? 25.221 -22.396 27.994 1.00 32.73 ? 8   THR A OG1 1 
ATOM   55   C  CG2 . THR A 1 8   ? 23.121 -21.268 27.753 1.00 23.19 ? 8   THR A CG2 1 
ATOM   56   N  N   . ASN A 1 9   ? 25.020 -18.153 26.595 1.00 17.02 ? 9   ASN A N   1 
ATOM   57   C  CA  . ASN A 1 9   ? 24.441 -16.871 26.159 1.00 19.34 ? 9   ASN A CA  1 
ATOM   58   C  C   . ASN A 1 9   ? 24.763 -16.532 24.696 1.00 18.17 ? 9   ASN A C   1 
ATOM   59   O  O   . ASN A 1 9   ? 23.894 -16.021 23.948 1.00 18.64 ? 9   ASN A O   1 
ATOM   60   C  CB  . ASN A 1 9   ? 24.967 -15.748 27.060 1.00 18.65 ? 9   ASN A CB  1 
ATOM   61   C  CG  . ASN A 1 9   ? 24.431 -15.746 28.458 1.00 30.16 ? 9   ASN A CG  1 
ATOM   62   O  OD1 . ASN A 1 9   ? 24.963 -15.080 29.327 1.00 32.70 ? 9   ASN A OD1 1 
ATOM   63   N  ND2 . ASN A 1 9   ? 23.383 -16.508 28.753 1.00 20.36 ? 9   ASN A ND2 1 
ATOM   64   N  N   . VAL A 1 10  ? 26.042 -16.784 24.361 1.00 18.57 ? 10  VAL A N   1 
ATOM   65   C  CA  . VAL A 1 10  ? 26.499 -16.455 22.975 1.00 17.27 ? 10  VAL A CA  1 
ATOM   66   C  C   . VAL A 1 10  ? 25.764 -17.286 21.971 1.00 15.84 ? 10  VAL A C   1 
ATOM   67   O  O   . VAL A 1 10  ? 25.233 -16.830 20.947 1.00 16.43 ? 10  VAL A O   1 
ATOM   68   C  CB  . VAL A 1 10  ? 28.026 -16.654 22.923 1.00 22.23 ? 10  VAL A CB  1 
ATOM   69   C  CG1 . VAL A 1 10  ? 28.471 -16.570 21.470 1.00 21.57 ? 10  VAL A CG1 1 
ATOM   70   C  CG2 . VAL A 1 10  ? 28.800 -15.600 23.714 1.00 19.18 ? 10  VAL A CG2 1 
ATOM   71   N  N   . LYS A 1 11  ? 25.581 -18.628 22.176 1.00 18.16 ? 11  LYS A N   1 
ATOM   72   C  CA  . LYS A 1 11  ? 24.818 -19.453 21.217 1.00 18.68 ? 11  LYS A CA  1 
ATOM   73   C  C   . LYS A 1 11  ? 23.371 -19.066 21.056 1.00 17.75 ? 11  LYS A C   1 
ATOM   74   O  O   . LYS A 1 11  ? 22.766 -19.037 19.964 1.00 17.28 ? 11  LYS A O   1 
ATOM   75   C  CB  . LYS A 1 11  ? 24.925 -20.932 21.703 1.00 24.57 ? 11  LYS A CB  1 
ATOM   76   C  CG  . LYS A 1 11  ? 26.246 -21.554 21.329 1.00 25.83 ? 11  LYS A CG  1 
ATOM   77   C  CD  . LYS A 1 11  ? 26.601 -22.739 22.254 1.00 34.88 ? 11  LYS A CD  1 
ATOM   78   C  CE  . LYS A 1 11  ? 26.165 -24.011 21.511 1.00 48.86 ? 11  LYS A CE  1 
ATOM   79   N  NZ  . LYS A 1 11  ? 27.097 -24.267 20.349 1.00 59.19 ? 11  LYS A NZ  1 
ATOM   80   N  N   . ALA A 1 12  ? 22.783 -18.768 22.277 1.00 20.36 ? 12  ALA A N   1 
ATOM   81   C  CA  . ALA A 1 12  ? 21.376 -18.303 22.253 1.00 20.36 ? 12  ALA A CA  1 
ATOM   82   C  C   . ALA A 1 12  ? 21.228 -16.975 21.521 1.00 17.87 ? 12  ALA A C   1 
ATOM   83   O  O   . ALA A 1 12  ? 20.315 -16.793 20.776 1.00 19.07 ? 12  ALA A O   1 
ATOM   84   C  CB  . ALA A 1 12  ? 20.875 -18.135 23.697 1.00 21.89 ? 12  ALA A CB  1 
ATOM   85   N  N   . ALA A 1 13  ? 22.158 -16.007 21.881 1.00 16.83 ? 13  ALA A N   1 
ATOM   86   C  CA  . ALA A 1 13  ? 22.065 -14.698 21.203 1.00 18.50 ? 13  ALA A CA  1 
ATOM   87   C  C   . ALA A 1 13  ? 22.268 -14.825 19.702 1.00 17.74 ? 13  ALA A C   1 
ATOM   88   O  O   . ALA A 1 13  ? 21.477 -14.243 18.965 1.00 16.97 ? 13  ALA A O   1 
ATOM   89   C  CB  . ALA A 1 13  ? 23.087 -13.739 21.826 1.00 17.43 ? 13  ALA A CB  1 
ATOM   90   N  N   . TRP A 1 14  ? 23.254 -15.666 19.274 1.00 21.00 ? 14  TRP A N   1 
ATOM   91   C  CA  . TRP A 1 14  ? 23.475 -15.805 17.798 1.00 21.60 ? 14  TRP A CA  1 
ATOM   92   C  C   . TRP A 1 14  ? 22.365 -16.476 17.065 1.00 18.73 ? 14  TRP A C   1 
ATOM   93   O  O   . TRP A 1 14  ? 22.131 -16.268 15.883 1.00 19.18 ? 14  TRP A O   1 
ATOM   94   C  CB  . TRP A 1 14  ? 24.864 -16.539 17.623 1.00 23.10 ? 14  TRP A CB  1 
ATOM   95   C  CG  . TRP A 1 14  ? 25.479 -16.027 16.340 1.00 24.08 ? 14  TRP A CG  1 
ATOM   96   C  CD1 . TRP A 1 14  ? 25.519 -16.613 15.103 1.00 25.02 ? 14  TRP A CD1 1 
ATOM   97   C  CD2 . TRP A 1 14  ? 26.073 -14.718 16.217 1.00 25.45 ? 14  TRP A CD2 1 
ATOM   98   N  NE1 . TRP A 1 14  ? 26.119 -15.749 14.200 1.00 25.21 ? 14  TRP A NE1 1 
ATOM   99   C  CE2 . TRP A 1 14  ? 26.488 -14.608 14.862 1.00 26.52 ? 14  TRP A CE2 1 
ATOM   100  C  CE3 . TRP A 1 14  ? 26.262 -13.646 17.086 1.00 22.26 ? 14  TRP A CE3 1 
ATOM   101  C  CZ2 . TRP A 1 14  ? 27.077 -13.435 14.351 1.00 24.29 ? 14  TRP A CZ2 1 
ATOM   102  C  CZ3 . TRP A 1 14  ? 26.835 -12.486 16.580 1.00 26.05 ? 14  TRP A CZ3 1 
ATOM   103  C  CH2 . TRP A 1 14  ? 27.240 -12.404 15.224 1.00 29.06 ? 14  TRP A CH2 1 
ATOM   104  N  N   . SER A 1 15  ? 21.521 -17.305 17.720 1.00 21.64 ? 15  SER A N   1 
ATOM   105  C  CA  . SER A 1 15  ? 20.350 -17.963 17.147 1.00 20.35 ? 15  SER A CA  1 
ATOM   106  C  C   . SER A 1 15  ? 19.296 -16.888 16.826 1.00 19.77 ? 15  SER A C   1 
ATOM   107  O  O   . SER A 1 15  ? 18.519 -17.005 15.900 1.00 23.30 ? 15  SER A O   1 
ATOM   108  C  CB  . SER A 1 15  ? 19.758 -19.044 18.096 1.00 21.07 ? 15  SER A CB  1 
ATOM   109  O  OG  . SER A 1 15  ? 18.989 -18.511 19.207 1.00 21.10 ? 15  SER A OG  1 
ATOM   110  N  N   . LYS A 1 16  ? 19.238 -15.798 17.628 1.00 18.62 ? 16  LYS A N   1 
ATOM   111  C  CA  . LYS A 1 16  ? 18.317 -14.689 17.406 1.00 20.63 ? 16  LYS A CA  1 
ATOM   112  C  C   . LYS A 1 16  ? 18.741 -13.762 16.264 1.00 22.87 ? 16  LYS A C   1 
ATOM   113  O  O   . LYS A 1 16  ? 17.951 -13.207 15.535 1.00 25.87 ? 16  LYS A O   1 
ATOM   114  C  CB  . LYS A 1 16  ? 18.072 -13.901 18.700 1.00 24.12 ? 16  LYS A CB  1 
ATOM   115  C  CG  . LYS A 1 16  ? 17.167 -14.721 19.642 1.00 24.85 ? 16  LYS A CG  1 
ATOM   116  C  CD  . LYS A 1 16  ? 17.629 -14.637 21.076 1.00 22.74 ? 16  LYS A CD  1 
ATOM   117  C  CE  . LYS A 1 16  ? 16.980 -15.768 21.934 1.00 25.61 ? 16  LYS A CE  1 
ATOM   118  N  NZ  . LYS A 1 16  ? 17.364 -15.721 23.372 1.00 23.62 ? 16  LYS A NZ  1 
ATOM   119  N  N   . VAL A 1 17  ? 20.044 -13.652 16.028 1.00 24.03 ? 17  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 17  ? 20.691 -12.925 14.935 1.00 23.09 ? 17  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 17  ? 20.266 -13.644 13.650 1.00 27.45 ? 17  VAL A C   1 
ATOM   122  O  O   . VAL A 1 17  ? 19.891 -13.060 12.634 1.00 26.52 ? 17  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 17  ? 22.242 -12.951 15.079 1.00 21.40 ? 17  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 17  ? 22.838 -12.520 13.735 1.00 25.55 ? 17  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 17  ? 22.675 -12.092 16.239 1.00 19.03 ? 17  VAL A CG2 1 
ATOM   126  N  N   . GLY A 1 18  ? 20.293 -14.992 13.749 1.00 32.12 ? 18  GLY A N   1 
ATOM   127  C  CA  . GLY A 1 18  ? 19.887 -15.931 12.712 1.00 35.48 ? 18  GLY A CA  1 
ATOM   128  C  C   . GLY A 1 18  ? 20.481 -15.611 11.349 1.00 35.12 ? 18  GLY A C   1 
ATOM   129  O  O   . GLY A 1 18  ? 21.700 -15.528 11.187 1.00 33.44 ? 18  GLY A O   1 
ATOM   130  N  N   . GLY A 1 19  ? 19.613 -15.321 10.366 1.00 34.16 ? 19  GLY A N   1 
ATOM   131  C  CA  . GLY A 1 19  ? 20.001 -14.964 9.035  1.00 32.76 ? 19  GLY A CA  1 
ATOM   132  C  C   . GLY A 1 19  ? 20.390 -13.504 8.830  1.00 33.17 ? 19  GLY A C   1 
ATOM   133  O  O   . GLY A 1 19  ? 20.635 -13.184 7.663  1.00 33.26 ? 19  GLY A O   1 
ATOM   134  N  N   . HIS A 1 20  ? 20.504 -12.626 9.823  1.00 24.06 ? 20  HIS A N   1 
ATOM   135  C  CA  . HIS A 1 20  ? 20.912 -11.266 9.563  1.00 20.77 ? 20  HIS A CA  1 
ATOM   136  C  C   . HIS A 1 20  ? 22.382 -11.039 9.812  1.00 18.69 ? 20  HIS A C   1 
ATOM   137  O  O   . HIS A 1 20  ? 22.758 -9.857  9.763  1.00 23.35 ? 20  HIS A O   1 
ATOM   138  C  CB  . HIS A 1 20  ? 20.272 -10.353 10.648 1.00 22.53 ? 20  HIS A CB  1 
ATOM   139  C  CG  . HIS A 1 20  ? 18.814 -10.491 10.439 1.00 30.64 ? 20  HIS A CG  1 
ATOM   140  N  ND1 . HIS A 1 20  ? 18.258 -9.874  9.339  1.00 41.99 ? 20  HIS A ND1 1 
ATOM   141  C  CD2 . HIS A 1 20  ? 17.835 -11.166 11.052 1.00 43.96 ? 20  HIS A CD2 1 
ATOM   142  C  CE1 . HIS A 1 20  ? 16.960 -10.165 9.271  1.00 38.36 ? 20  HIS A CE1 1 
ATOM   143  N  NE2 . HIS A 1 20  ? 16.699 -10.969 10.299 1.00 46.33 ? 20  HIS A NE2 1 
ATOM   144  N  N   . ALA A 1 21  ? 23.147 -12.089 10.120 1.00 22.94 ? 21  ALA A N   1 
ATOM   145  C  CA  . ALA A 1 21  ? 24.563 -11.962 10.458 1.00 23.23 ? 21  ALA A CA  1 
ATOM   146  C  C   . ALA A 1 21  ? 25.383 -11.179 9.428  1.00 23.25 ? 21  ALA A C   1 
ATOM   147  O  O   . ALA A 1 21  ? 26.137 -10.263 9.773  1.00 23.61 ? 21  ALA A O   1 
ATOM   148  C  CB  . ALA A 1 21  ? 25.215 -13.308 10.804 1.00 23.47 ? 21  ALA A CB  1 
ATOM   149  N  N   . GLY A 1 22  ? 25.184 -11.442 8.137  1.00 25.86 ? 22  GLY A N   1 
ATOM   150  C  CA  . GLY A 1 22  ? 25.886 -10.731 7.093  1.00 22.92 ? 22  GLY A CA  1 
ATOM   151  C  C   . GLY A 1 22  ? 25.381 -9.294  6.997  1.00 22.93 ? 22  GLY A C   1 
ATOM   152  O  O   . GLY A 1 22  ? 26.213 -8.386  6.895  1.00 23.51 ? 22  GLY A O   1 
ATOM   153  N  N   . GLU A 1 23  ? 24.068 -9.112  7.084  1.00 20.73 ? 23  GLU A N   1 
ATOM   154  C  CA  . GLU A 1 23  ? 23.565 -7.714  7.037  1.00 21.95 ? 23  GLU A CA  1 
ATOM   155  C  C   . GLU A 1 23  ? 24.026 -7.000  8.285  1.00 19.12 ? 23  GLU A C   1 
ATOM   156  O  O   . GLU A 1 23  ? 24.431 -5.821  8.238  1.00 20.20 ? 23  GLU A O   1 
ATOM   157  C  CB  . GLU A 1 23  ? 22.080 -7.801  6.753  1.00 27.21 ? 23  GLU A CB  1 
ATOM   158  C  CG  . GLU A 1 23  ? 21.244 -7.385  7.934  1.00 39.46 ? 23  GLU A CG  1 
ATOM   159  C  CD  . GLU A 1 23  ? 19.740 -7.502  7.619  1.00 59.51 ? 23  GLU A CD  1 
ATOM   160  O  OE1 . GLU A 1 23  ? 19.447 -8.287  6.681  1.00 55.82 ? 23  GLU A OE1 1 
ATOM   161  O  OE2 . GLU A 1 23  ? 18.992 -6.790  8.359  1.00 62.30 ? 23  GLU A OE2 1 
ATOM   162  N  N   . PHE A 1 24  ? 24.092 -7.647  9.493  1.00 15.92 ? 24  PHE A N   1 
ATOM   163  C  CA  . PHE A 1 24  ? 24.612 -6.926  10.633 1.00 18.30 ? 24  PHE A CA  1 
ATOM   164  C  C   . PHE A 1 24  ? 26.101 -6.693  10.455 1.00 25.65 ? 24  PHE A C   1 
ATOM   165  O  O   . PHE A 1 24  ? 26.656 -5.644  10.923 1.00 22.60 ? 24  PHE A O   1 
ATOM   166  C  CB  . PHE A 1 24  ? 24.309 -7.721  11.936 1.00 19.44 ? 24  PHE A CB  1 
ATOM   167  C  CG  . PHE A 1 24  ? 22.832 -7.768  12.288 1.00 22.70 ? 24  PHE A CG  1 
ATOM   168  C  CD1 . PHE A 1 24  ? 21.902 -6.961  11.630 1.00 21.20 ? 24  PHE A CD1 1 
ATOM   169  C  CD2 . PHE A 1 24  ? 22.376 -8.652  13.282 1.00 25.92 ? 24  PHE A CD2 1 
ATOM   170  C  CE1 . PHE A 1 24  ? 20.529 -7.032  11.816 1.00 22.25 ? 24  PHE A CE1 1 
ATOM   171  C  CE2 . PHE A 1 24  ? 21.003 -8.699  13.536 1.00 20.53 ? 24  PHE A CE2 1 
ATOM   172  C  CZ  . PHE A 1 24  ? 20.120 -7.877  12.852 1.00 20.08 ? 24  PHE A CZ  1 
ATOM   173  N  N   . GLY A 1 25  ? 26.817 -7.645  9.809  1.00 19.25 ? 25  GLY A N   1 
ATOM   174  C  CA  . GLY A 1 25  ? 28.289 -7.456  9.643  1.00 17.87 ? 25  GLY A CA  1 
ATOM   175  C  C   . GLY A 1 25  ? 28.513 -6.262  8.710  1.00 16.57 ? 25  GLY A C   1 
ATOM   176  O  O   . GLY A 1 25  ? 29.397 -5.424  8.983  1.00 17.46 ? 25  GLY A O   1 
ATOM   177  N  N   . ALA A 1 26  ? 27.720 -6.063  7.688  1.00 18.95 ? 26  ALA A N   1 
ATOM   178  C  CA  . ALA A 1 26  ? 27.857 -4.913  6.794  1.00 20.53 ? 26  ALA A CA  1 
ATOM   179  C  C   . ALA A 1 26  ? 27.563 -3.597  7.508  1.00 22.59 ? 26  ALA A C   1 
ATOM   180  O  O   . ALA A 1 26  ? 28.204 -2.585  7.305  1.00 16.59 ? 26  ALA A O   1 
ATOM   181  C  CB  . ALA A 1 26  ? 26.908 -5.037  5.604  1.00 18.32 ? 26  ALA A CB  1 
ATOM   182  N  N   . GLU A 1 27  ? 26.523 -3.588  8.347  1.00 19.25 ? 27  GLU A N   1 
ATOM   183  C  CA  . GLU A 1 27  ? 26.173 -2.347  9.071  1.00 18.00 ? 27  GLU A CA  1 
ATOM   184  C  C   . GLU A 1 27  ? 27.241 -1.983  10.059 1.00 16.04 ? 27  GLU A C   1 
ATOM   185  O  O   . GLU A 1 27  ? 27.593 -0.802  10.214 1.00 16.89 ? 27  GLU A O   1 
ATOM   186  C  CB  . GLU A 1 27  ? 24.763 -2.480  9.685  1.00 19.42 ? 27  GLU A CB  1 
ATOM   187  C  CG  . GLU A 1 27  ? 24.492 -1.296  10.635 1.00 22.21 ? 27  GLU A CG  1 
ATOM   188  C  CD  . GLU A 1 27  ? 23.047 -1.199  11.121 1.00 22.73 ? 27  GLU A CD  1 
ATOM   189  O  OE1 . GLU A 1 27  ? 22.216 -1.990  10.594 1.00 22.85 ? 27  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A 1 27  ? 22.877 -0.384  12.093 1.00 24.97 ? 27  GLU A OE2 1 
ATOM   191  N  N   . ALA A 1 28  ? 27.821 -2.983  10.747 1.00 18.00 ? 28  ALA A N   1 
ATOM   192  C  CA  . ALA A 1 28  ? 28.869 -2.742  11.710 1.00 16.83 ? 28  ALA A CA  1 
ATOM   193  C  C   . ALA A 1 28  ? 30.070 -2.125  10.974 1.00 19.03 ? 28  ALA A C   1 
ATOM   194  O  O   . ALA A 1 28  ? 30.719 -1.220  11.529 1.00 17.17 ? 28  ALA A O   1 
ATOM   195  C  CB  . ALA A 1 28  ? 29.233 -4.017  12.470 1.00 14.97 ? 28  ALA A CB  1 
ATOM   196  N  N   . LEU A 1 29  ? 30.438 -2.652  9.780  1.00 18.21 ? 29  LEU A N   1 
ATOM   197  C  CA  . LEU A 1 29  ? 31.616 -2.031  9.072  1.00 20.30 ? 29  LEU A CA  1 
ATOM   198  C  C   . LEU A 1 29  ? 31.381 -0.581  8.779  1.00 16.22 ? 29  LEU A C   1 
ATOM   199  O  O   . LEU A 1 29  ? 32.196 0.341   8.855  1.00 19.78 ? 29  LEU A O   1 
ATOM   200  C  CB  . LEU A 1 29  ? 31.819 -2.787  7.702  1.00 17.87 ? 29  LEU A CB  1 
ATOM   201  C  CG  . LEU A 1 29  ? 32.454 -4.199  7.899  1.00 21.45 ? 29  LEU A CG  1 
ATOM   202  C  CD1 . LEU A 1 29  ? 32.202 -5.005  6.643  1.00 20.29 ? 29  LEU A CD1 1 
ATOM   203  C  CD2 . LEU A 1 29  ? 33.919 -4.149  8.260  1.00 23.78 ? 29  LEU A CD2 1 
ATOM   204  N  N   . GLU A 1 30  ? 30.123 -0.292  8.264  1.00 16.69 ? 30  GLU A N   1 
ATOM   205  C  CA  . GLU A 1 30  ? 29.719 1.064   7.976  1.00 19.61 ? 30  GLU A CA  1 
ATOM   206  C  C   . GLU A 1 30  ? 29.818 2.021   9.148  1.00 21.99 ? 30  GLU A C   1 
ATOM   207  O  O   . GLU A 1 30  ? 30.356 3.146   9.075  1.00 19.65 ? 30  GLU A O   1 
ATOM   208  C  CB  . GLU A 1 30  ? 28.307 1.059   7.434  1.00 20.41 ? 30  GLU A CB  1 
ATOM   209  C  CG  . GLU A 1 30  ? 28.013 2.473   6.884  1.00 29.59 ? 30  GLU A CG  1 
ATOM   210  C  CD  . GLU A 1 30  ? 26.749 2.331   6.004  1.00 42.20 ? 30  GLU A CD  1 
ATOM   211  O  OE1 . GLU A 1 30  ? 26.295 1.191   5.673  1.00 54.47 ? 30  GLU A OE1 1 
ATOM   212  O  OE2 . GLU A 1 30  ? 26.373 3.482   5.772  1.00 43.37 ? 30  GLU A OE2 1 
ATOM   213  N  N   . ARG A 1 31  ? 29.287 1.548   10.325 1.00 17.06 ? 31  ARG A N   1 
ATOM   214  C  CA  . ARG A 1 31  ? 29.414 2.423   11.509 1.00 16.05 ? 31  ARG A CA  1 
ATOM   215  C  C   . ARG A 1 31  ? 30.864 2.570   11.841 1.00 17.75 ? 31  ARG A C   1 
ATOM   216  O  O   . ARG A 1 31  ? 31.304 3.602   12.335 1.00 19.96 ? 31  ARG A O   1 
ATOM   217  C  CB  . ARG A 1 31  ? 28.645 1.755   12.698 1.00 20.21 ? 31  ARG A CB  1 
ATOM   218  C  CG  . ARG A 1 31  ? 27.152 1.574   12.377 1.00 15.74 ? 31  ARG A CG  1 
ATOM   219  C  CD  . ARG A 1 31  ? 26.484 0.911   13.672 1.00 13.32 ? 31  ARG A CD  1 
ATOM   220  N  NE  . ARG A 1 31  ? 25.046 1.056   13.357 1.00 18.24 ? 31  ARG A NE  1 
ATOM   221  C  CZ  . ARG A 1 31  ? 24.198 2.047   13.702 1.00 17.51 ? 31  ARG A CZ  1 
ATOM   222  N  NH1 . ARG A 1 31  ? 24.639 3.055   14.475 1.00 14.02 ? 31  ARG A NH1 1 
ATOM   223  N  NH2 . ARG A 1 31  ? 22.949 1.998   13.188 1.00 18.44 ? 31  ARG A NH2 1 
ATOM   224  N  N   . MET A 1 32  ? 31.762 1.553   11.678 1.00 14.84 ? 32  MET A N   1 
ATOM   225  C  CA  . MET A 1 32  ? 33.151 1.634   11.956 1.00 13.95 ? 32  MET A CA  1 
ATOM   226  C  C   . MET A 1 32  ? 33.898 2.616   10.964 1.00 18.25 ? 32  MET A C   1 
ATOM   227  O  O   . MET A 1 32  ? 34.653 3.428   11.448 1.00 16.57 ? 32  MET A O   1 
ATOM   228  C  CB  . MET A 1 32  ? 33.855 0.284   11.783 1.00 16.99 ? 32  MET A CB  1 
ATOM   229  C  CG  . MET A 1 32  ? 35.294 0.395   12.154 1.00 16.65 ? 32  MET A CG  1 
ATOM   230  S  SD  . MET A 1 32  ? 36.200 -1.177  11.959 1.00 21.68 ? 32  MET A SD  1 
ATOM   231  C  CE  . MET A 1 32  ? 36.214 -1.327  10.160 1.00 21.79 ? 32  MET A CE  1 
ATOM   232  N  N   . PHE A 1 33  ? 33.553 2.531   9.674  1.00 15.75 ? 33  PHE A N   1 
ATOM   233  C  CA  . PHE A 1 33  ? 34.216 3.436   8.735  1.00 21.26 ? 33  PHE A CA  1 
ATOM   234  C  C   . PHE A 1 33  ? 33.831 4.900   8.957  1.00 26.05 ? 33  PHE A C   1 
ATOM   235  O  O   . PHE A 1 33  ? 34.689 5.783   8.731  1.00 23.10 ? 33  PHE A O   1 
ATOM   236  C  CB  . PHE A 1 33  ? 33.831 3.064   7.286  1.00 19.23 ? 33  PHE A CB  1 
ATOM   237  C  CG  . PHE A 1 33  ? 34.431 1.731   6.865  1.00 19.94 ? 33  PHE A CG  1 
ATOM   238  C  CD1 . PHE A 1 33  ? 35.719 1.386   7.268  1.00 21.87 ? 33  PHE A CD1 1 
ATOM   239  C  CD2 . PHE A 1 33  ? 33.682 0.900   6.000  1.00 18.50 ? 33  PHE A CD2 1 
ATOM   240  C  CE1 . PHE A 1 33  ? 36.297 0.196   6.903  1.00 22.63 ? 33  PHE A CE1 1 
ATOM   241  C  CE2 . PHE A 1 33  ? 34.270 -0.326  5.646  1.00 18.57 ? 33  PHE A CE2 1 
ATOM   242  C  CZ  . PHE A 1 33  ? 35.548 -0.638  6.116  1.00 18.23 ? 33  PHE A CZ  1 
ATOM   243  N  N   . LEU A 1 34  ? 32.609 5.175   9.390  1.00 23.17 ? 34  LEU A N   1 
ATOM   244  C  CA  . LEU A 1 34  ? 32.155 6.545   9.665  1.00 22.78 ? 34  LEU A CA  1 
ATOM   245  C  C   . LEU A 1 34  ? 32.583 7.056   11.027 1.00 23.48 ? 34  LEU A C   1 
ATOM   246  O  O   . LEU A 1 34  ? 32.997 8.217   11.196 1.00 23.09 ? 34  LEU A O   1 
ATOM   247  C  CB  . LEU A 1 34  ? 30.636 6.709   9.586  1.00 20.69 ? 34  LEU A CB  1 
ATOM   248  C  CG  . LEU A 1 34  ? 29.965 6.480   8.239  1.00 26.33 ? 34  LEU A CG  1 
ATOM   249  C  CD1 . LEU A 1 34  ? 28.450 6.562   8.335  1.00 28.74 ? 34  LEU A CD1 1 
ATOM   250  C  CD2 . LEU A 1 34  ? 30.433 7.501   7.213  1.00 30.81 ? 34  LEU A CD2 1 
ATOM   251  N  N   . GLY A 1 35  ? 32.541 6.172   12.063 1.00 20.27 ? 35  GLY A N   1 
ATOM   252  C  CA  . GLY A 1 35  ? 32.927 6.628   13.395 1.00 18.97 ? 35  GLY A CA  1 
ATOM   253  C  C   . GLY A 1 35  ? 34.383 6.645   13.576 1.00 22.43 ? 35  GLY A C   1 
ATOM   254  O  O   . GLY A 1 35  ? 34.841 7.379   14.494 1.00 23.26 ? 35  GLY A O   1 
ATOM   255  N  N   . PHE A 1 36  ? 35.222 5.795   12.939 1.00 18.27 ? 36  PHE A N   1 
ATOM   256  C  CA  . PHE A 1 36  ? 36.658 5.677   13.174 1.00 19.35 ? 36  PHE A CA  1 
ATOM   257  C  C   . PHE A 1 36  ? 37.366 5.532   11.813 1.00 22.00 ? 36  PHE A C   1 
ATOM   258  O  O   . PHE A 1 36  ? 37.819 4.517   11.346 1.00 21.04 ? 36  PHE A O   1 
ATOM   259  C  CB  . PHE A 1 36  ? 37.050 4.460   14.022 1.00 18.10 ? 36  PHE A CB  1 
ATOM   260  C  CG  . PHE A 1 36  ? 36.118 4.259   15.213 1.00 36.92 ? 36  PHE A CG  1 
ATOM   261  C  CD1 . PHE A 1 36  ? 34.924 3.530   14.987 1.00 26.55 ? 36  PHE A CD1 1 
ATOM   262  C  CD2 . PHE A 1 36  ? 36.342 4.915   16.428 1.00 26.93 ? 36  PHE A CD2 1 
ATOM   263  C  CE1 . PHE A 1 36  ? 33.978 3.394   15.956 1.00 27.99 ? 36  PHE A CE1 1 
ATOM   264  C  CE2 . PHE A 1 36  ? 35.359 4.722   17.429 1.00 28.08 ? 36  PHE A CE2 1 
ATOM   265  C  CZ  . PHE A 1 36  ? 34.229 3.994   17.188 1.00 24.36 ? 36  PHE A CZ  1 
ATOM   266  N  N   . PRO A 1 37  ? 37.387 6.639   11.105 1.00 29.58 ? 37  PRO A N   1 
ATOM   267  C  CA  . PRO A 1 37  ? 37.939 6.801   9.765  1.00 29.61 ? 37  PRO A CA  1 
ATOM   268  C  C   . PRO A 1 37  ? 39.367 6.357   9.589  1.00 21.59 ? 37  PRO A C   1 
ATOM   269  O  O   . PRO A 1 37  ? 39.656 5.988   8.436  1.00 22.12 ? 37  PRO A O   1 
ATOM   270  C  CB  . PRO A 1 37  ? 37.729 8.263   9.340  1.00 36.71 ? 37  PRO A CB  1 
ATOM   271  C  CG  . PRO A 1 37  ? 37.091 8.916   10.536 1.00 37.57 ? 37  PRO A CG  1 
ATOM   272  C  CD  . PRO A 1 37  ? 36.924 7.934   11.653 1.00 34.79 ? 37  PRO A CD  1 
ATOM   273  N  N   . THR A 1 38  ? 40.213 6.275   10.617 1.00 22.46 ? 38  THR A N   1 
ATOM   274  C  CA  . THR A 1 38  ? 41.530 5.697   10.359 1.00 27.76 ? 38  THR A CA  1 
ATOM   275  C  C   . THR A 1 38  ? 41.385 4.245   9.838  1.00 30.56 ? 38  THR A C   1 
ATOM   276  O  O   . THR A 1 38  ? 42.228 3.739   9.112  1.00 26.85 ? 38  THR A O   1 
ATOM   277  C  CB  . THR A 1 38  ? 42.420 5.637   11.606 1.00 34.32 ? 38  THR A CB  1 
ATOM   278  O  OG1 . THR A 1 38  ? 41.543 5.162   12.669 1.00 39.58 ? 38  THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 38  ? 43.083 6.924   12.077 1.00 40.64 ? 38  THR A CG2 1 
ATOM   280  N  N   . THR A 1 39  ? 40.312 3.496   10.158 1.00 24.39 ? 39  THR A N   1 
ATOM   281  C  CA  . THR A 1 39  ? 40.081 2.142   9.765  1.00 20.63 ? 39  THR A CA  1 
ATOM   282  C  C   . THR A 1 39  ? 39.926 1.971   8.286  1.00 18.78 ? 39  THR A C   1 
ATOM   283  O  O   . THR A 1 39  ? 40.183 0.907   7.756  1.00 20.43 ? 39  THR A O   1 
ATOM   284  C  CB  . THR A 1 39  ? 38.725 1.601   10.381 1.00 15.21 ? 39  THR A CB  1 
ATOM   285  O  OG1 . THR A 1 39  ? 37.557 2.281   10.039 1.00 18.09 ? 39  THR A OG1 1 
ATOM   286  C  CG2 . THR A 1 39  ? 38.953 1.701   11.908 1.00 18.44 ? 39  THR A CG2 1 
ATOM   287  N  N   . LYS A 1 40  ? 39.491 3.034   7.570  1.00 21.70 ? 40  LYS A N   1 
ATOM   288  C  CA  . LYS A 1 40  ? 39.237 3.034   6.126  1.00 24.48 ? 40  LYS A CA  1 
ATOM   289  C  C   . LYS A 1 40  ? 40.460 2.753   5.249  1.00 24.63 ? 40  LYS A C   1 
ATOM   290  O  O   . LYS A 1 40  ? 40.406 2.323   4.107  1.00 23.72 ? 40  LYS A O   1 
ATOM   291  C  CB  . LYS A 1 40  ? 38.681 4.378   5.719  1.00 29.64 ? 40  LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 40  ? 37.229 4.707   6.089  1.00 40.62 ? 40  LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 40  ? 36.729 5.969   5.350  1.00 31.69 ? 40  LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 40  ? 37.386 7.261   5.769  1.00 30.37 ? 40  LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 40  ? 36.694 8.455   5.105  1.00 40.56 ? 40  LYS A NZ  1 
ATOM   296  N  N   . THR A 1 41  ? 41.587 2.954   5.903  1.00 27.84 ? 41  THR A N   1 
ATOM   297  C  CA  . THR A 1 41  ? 42.988 2.761   5.529  1.00 31.38 ? 41  THR A CA  1 
ATOM   298  C  C   . THR A 1 41  ? 43.366 1.379   5.080  1.00 27.29 ? 41  THR A C   1 
ATOM   299  O  O   . THR A 1 41  ? 44.256 1.176   4.216  1.00 22.34 ? 41  THR A O   1 
ATOM   300  C  CB  . THR A 1 41  ? 43.855 3.310   6.708  1.00 29.83 ? 41  THR A CB  1 
ATOM   301  O  OG1 . THR A 1 41  ? 44.273 4.641   6.193  1.00 42.09 ? 41  THR A OG1 1 
ATOM   302  C  CG2 . THR A 1 41  ? 44.957 2.529   7.251  1.00 27.72 ? 41  THR A CG2 1 
ATOM   303  N  N   . TYR A 1 42  ? 42.728 0.335   5.534  1.00 20.14 ? 42  TYR A N   1 
ATOM   304  C  CA  . TYR A 1 42  ? 42.944 -1.058  5.181  1.00 19.49 ? 42  TYR A CA  1 
ATOM   305  C  C   . TYR A 1 42  ? 42.115 -1.472  4.001  1.00 17.64 ? 42  TYR A C   1 
ATOM   306  O  O   . TYR A 1 42  ? 42.163 -2.601  3.478  1.00 21.71 ? 42  TYR A O   1 
ATOM   307  C  CB  . TYR A 1 42  ? 42.521 -1.933  6.420  1.00 19.87 ? 42  TYR A CB  1 
ATOM   308  C  CG  . TYR A 1 42  ? 43.424 -1.748  7.597  1.00 19.91 ? 42  TYR A CG  1 
ATOM   309  C  CD1 . TYR A 1 42  ? 44.570 -2.527  7.731  1.00 20.70 ? 42  TYR A CD1 1 
ATOM   310  C  CD2 . TYR A 1 42  ? 43.100 -0.793  8.579  1.00 17.66 ? 42  TYR A CD2 1 
ATOM   311  C  CE1 . TYR A 1 42  ? 45.443 -2.333  8.812  1.00 19.54 ? 42  TYR A CE1 1 
ATOM   312  C  CE2 . TYR A 1 42  ? 43.979 -0.600  9.642  1.00 19.49 ? 42  TYR A CE2 1 
ATOM   313  C  CZ  . TYR A 1 42  ? 45.122 -1.374  9.729  1.00 19.51 ? 42  TYR A CZ  1 
ATOM   314  O  OH  . TYR A 1 42  ? 45.963 -1.222  10.782 1.00 28.65 ? 42  TYR A OH  1 
ATOM   315  N  N   . PHE A 1 43  ? 41.239 -0.570  3.476  1.00 15.53 ? 43  PHE A N   1 
ATOM   316  C  CA  . PHE A 1 43  ? 40.361 -0.861  2.385  1.00 19.78 ? 43  PHE A CA  1 
ATOM   317  C  C   . PHE A 1 43  ? 40.375 0.092   1.212  1.00 21.59 ? 43  PHE A C   1 
ATOM   318  O  O   . PHE A 1 43  ? 39.367 0.581   0.665  1.00 21.34 ? 43  PHE A O   1 
ATOM   319  C  CB  . PHE A 1 43  ? 38.834 -0.904  2.863  1.00 19.36 ? 43  PHE A CB  1 
ATOM   320  C  CG  . PHE A 1 43  ? 38.650 -1.962  3.931  1.00 21.39 ? 43  PHE A CG  1 
ATOM   321  C  CD1 . PHE A 1 43  ? 38.861 -1.651  5.286  1.00 22.67 ? 43  PHE A CD1 1 
ATOM   322  C  CD2 . PHE A 1 43  ? 38.259 -3.238  3.566  1.00 23.96 ? 43  PHE A CD2 1 
ATOM   323  C  CE1 . PHE A 1 43  ? 38.713 -2.661  6.260  1.00 23.21 ? 43  PHE A CE1 1 
ATOM   324  C  CE2 . PHE A 1 43  ? 38.052 -4.251  4.537  1.00 23.70 ? 43  PHE A CE2 1 
ATOM   325  C  CZ  . PHE A 1 43  ? 38.249 -3.925  5.863  1.00 24.58 ? 43  PHE A CZ  1 
ATOM   326  N  N   . PRO A 1 44  ? 41.567 0.386   0.672  1.00 28.35 ? 44  PRO A N   1 
ATOM   327  C  CA  . PRO A 1 44  ? 41.745 1.345   -0.462 1.00 25.38 ? 44  PRO A CA  1 
ATOM   328  C  C   . PRO A 1 44  ? 41.065 0.945   -1.731 1.00 23.36 ? 44  PRO A C   1 
ATOM   329  O  O   . PRO A 1 44  ? 40.585 1.684   -2.579 1.00 28.17 ? 44  PRO A O   1 
ATOM   330  C  CB  . PRO A 1 44  ? 43.276 1.445   -0.675 1.00 27.31 ? 44  PRO A CB  1 
ATOM   331  C  CG  . PRO A 1 44  ? 43.833 0.211   0.042  1.00 24.67 ? 44  PRO A CG  1 
ATOM   332  C  CD  . PRO A 1 44  ? 42.848 -0.186  1.121  1.00 24.28 ? 44  PRO A CD  1 
ATOM   333  N  N   . HIS A 1 45  ? 41.009 -0.395  -1.864 1.00 22.44 ? 45  HIS A N   1 
ATOM   334  C  CA  . HIS A 1 45  ? 40.441 -1.026  -3.031 1.00 23.00 ? 45  HIS A CA  1 
ATOM   335  C  C   . HIS A 1 45  ? 38.965 -1.173  -2.863 1.00 28.87 ? 45  HIS A C   1 
ATOM   336  O  O   . HIS A 1 45  ? 38.343 -1.739  -3.809 1.00 27.49 ? 45  HIS A O   1 
ATOM   337  C  CB  . HIS A 1 45  ? 41.169 -2.341  -3.234 1.00 24.17 ? 45  HIS A CB  1 
ATOM   338  C  CG  . HIS A 1 45  ? 41.113 -3.209  -2.032 1.00 29.89 ? 45  HIS A CG  1 
ATOM   339  N  ND1 . HIS A 1 45  ? 41.600 -2.829  -0.823 1.00 29.68 ? 45  HIS A ND1 1 
ATOM   340  C  CD2 . HIS A 1 45  ? 40.592 -4.478  -1.886 1.00 24.71 ? 45  HIS A CD2 1 
ATOM   341  C  CE1 . HIS A 1 45  ? 41.486 -3.815  0.058  1.00 26.49 ? 45  HIS A CE1 1 
ATOM   342  N  NE2 . HIS A 1 45  ? 40.898 -4.832  -0.581 1.00 29.27 ? 45  HIS A NE2 1 
ATOM   343  N  N   . PHE A 1 46  ? 38.346 -0.688  -1.773 1.00 27.44 ? 46  PHE A N   1 
ATOM   344  C  CA  . PHE A 1 46  ? 36.897 -0.777  -1.758 1.00 24.37 ? 46  PHE A CA  1 
ATOM   345  C  C   . PHE A 1 46  ? 36.259 0.592   -2.027 1.00 22.17 ? 46  PHE A C   1 
ATOM   346  O  O   . PHE A 1 46  ? 36.659 1.724   -1.789 1.00 21.68 ? 46  PHE A O   1 
ATOM   347  C  CB  . PHE A 1 46  ? 36.386 -1.103  -0.350 1.00 22.09 ? 46  PHE A CB  1 
ATOM   348  C  CG  . PHE A 1 46  ? 36.388 -2.509  0.078  1.00 33.05 ? 46  PHE A CG  1 
ATOM   349  C  CD1 . PHE A 1 46  ? 37.249 -3.439  -0.436 1.00 30.91 ? 46  PHE A CD1 1 
ATOM   350  C  CD2 . PHE A 1 46  ? 35.423 -2.939  1.019  1.00 32.14 ? 46  PHE A CD2 1 
ATOM   351  C  CE1 . PHE A 1 46  ? 37.207 -4.788  -0.061 1.00 37.58 ? 46  PHE A CE1 1 
ATOM   352  C  CE2 . PHE A 1 46  ? 35.397 -4.270  1.413  1.00 32.48 ? 46  PHE A CE2 1 
ATOM   353  C  CZ  . PHE A 1 46  ? 36.265 -5.196  0.868  1.00 29.92 ? 46  PHE A CZ  1 
ATOM   354  N  N   . ASP A 1 47  ? 35.039 0.389   -2.488 1.00 26.06 ? 47  ASP A N   1 
ATOM   355  C  CA  . ASP A 1 47  ? 34.090 1.493   -2.655 1.00 28.53 ? 47  ASP A CA  1 
ATOM   356  C  C   . ASP A 1 47  ? 33.377 1.379   -1.252 1.00 31.17 ? 47  ASP A C   1 
ATOM   357  O  O   . ASP A 1 47  ? 32.783 0.366   -0.891 1.00 29.85 ? 47  ASP A O   1 
ATOM   358  C  CB  . ASP A 1 47  ? 33.108 1.259   -3.723 1.00 32.53 ? 47  ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 47  ? 31.930 2.225   -3.718 1.00 44.68 ? 47  ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 47  ? 32.018 3.232   -3.005 1.00 47.36 ? 47  ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 47  ? 30.933 1.952   -4.450 1.00 58.97 ? 47  ASP A OD2 1 
ATOM   362  N  N   . LEU A 1 48  ? 33.610 2.403   -0.502 1.00 32.58 ? 48  LEU A N   1 
ATOM   363  C  CA  . LEU A 1 48  ? 33.121 2.438   0.888  1.00 35.64 ? 48  LEU A CA  1 
ATOM   364  C  C   . LEU A 1 48  ? 31.867 3.258   0.985  1.00 38.12 ? 48  LEU A C   1 
ATOM   365  O  O   . LEU A 1 48  ? 31.388 3.582   2.098  1.00 49.09 ? 48  LEU A O   1 
ATOM   366  C  CB  . LEU A 1 48  ? 34.311 3.004   1.714  1.00 34.96 ? 48  LEU A CB  1 
ATOM   367  C  CG  . LEU A 1 48  ? 35.284 2.155   2.535  1.00 40.48 ? 48  LEU A CG  1 
ATOM   368  C  CD1 . LEU A 1 48  ? 35.290 0.690   2.131  1.00 31.78 ? 48  LEU A CD1 1 
ATOM   369  C  CD2 . LEU A 1 48  ? 36.719 2.688   2.598  1.00 34.74 ? 48  LEU A CD2 1 
ATOM   370  N  N   . SER A 1 49  ? 31.223 3.643   -0.100 1.00 34.42 ? 49  SER A N   1 
ATOM   371  C  CA  . SER A 1 49  ? 30.024 4.496   -0.037 1.00 34.71 ? 49  SER A CA  1 
ATOM   372  C  C   . SER A 1 49  ? 28.893 3.761   0.659  1.00 35.04 ? 49  SER A C   1 
ATOM   373  O  O   . SER A 1 49  ? 28.961 2.516   0.684  1.00 35.73 ? 49  SER A O   1 
ATOM   374  C  CB  . SER A 1 49  ? 29.592 4.970   -1.429 1.00 40.95 ? 49  SER A CB  1 
ATOM   375  O  OG  . SER A 1 49  ? 28.860 4.035   -2.204 1.00 53.73 ? 49  SER A OG  1 
ATOM   376  N  N   . HIS A 1 50  ? 27.905 4.524   1.178  1.00 37.89 ? 50  HIS A N   1 
ATOM   377  C  CA  . HIS A 1 50  ? 26.808 3.740   1.809  1.00 36.96 ? 50  HIS A CA  1 
ATOM   378  C  C   . HIS A 1 50  ? 26.258 2.727   0.812  1.00 38.98 ? 50  HIS A C   1 
ATOM   379  O  O   . HIS A 1 50  ? 26.004 3.132   -0.361 1.00 40.39 ? 50  HIS A O   1 
ATOM   380  C  CB  . HIS A 1 50  ? 25.722 4.725   2.288  1.00 41.98 ? 50  HIS A CB  1 
ATOM   381  C  CG  . HIS A 1 50  ? 24.468 3.954   2.648  1.00 51.66 ? 50  HIS A CG  1 
ATOM   382  N  ND1 . HIS A 1 50  ? 24.282 3.227   3.808  1.00 50.15 ? 50  HIS A ND1 1 
ATOM   383  C  CD2 . HIS A 1 50  ? 23.347 3.752   1.881  1.00 58.09 ? 50  HIS A CD2 1 
ATOM   384  C  CE1 . HIS A 1 50  ? 23.083 2.634   3.785  1.00 48.45 ? 50  HIS A CE1 1 
ATOM   385  N  NE2 . HIS A 1 50  ? 22.506 2.915   2.615  1.00 57.58 ? 50  HIS A NE2 1 
ATOM   386  N  N   . GLY A 1 51  ? 26.086 1.415   1.121  1.00 37.04 ? 51  GLY A N   1 
ATOM   387  C  CA  . GLY A 1 51  ? 25.515 0.573   0.056  1.00 37.12 ? 51  GLY A CA  1 
ATOM   388  C  C   . GLY A 1 51  ? 26.468 -0.002  -0.948 1.00 43.52 ? 51  GLY A C   1 
ATOM   389  O  O   . GLY A 1 51  ? 26.020 -0.737  -1.887 1.00 48.05 ? 51  GLY A O   1 
ATOM   390  N  N   . SER A 1 52  ? 27.785 0.267   -0.825 1.00 40.58 ? 52  SER A N   1 
ATOM   391  C  CA  . SER A 1 52  ? 28.707 -0.377  -1.788 1.00 37.88 ? 52  SER A CA  1 
ATOM   392  C  C   . SER A 1 52  ? 28.462 -1.888  -1.675 1.00 37.63 ? 52  SER A C   1 
ATOM   393  O  O   . SER A 1 52  ? 28.292 -2.518  -0.609 1.00 35.42 ? 52  SER A O   1 
ATOM   394  C  CB  . SER A 1 52  ? 30.135 -0.027  -1.519 1.00 39.21 ? 52  SER A CB  1 
ATOM   395  O  OG  . SER A 1 52  ? 30.999 -0.972  -0.947 1.00 40.54 ? 52  SER A OG  1 
ATOM   396  N  N   . ALA A 1 53  ? 28.493 -2.558  -2.812 1.00 35.48 ? 53  ALA A N   1 
ATOM   397  C  CA  . ALA A 1 53  ? 28.335 -3.992  -2.863 1.00 33.25 ? 53  ALA A CA  1 
ATOM   398  C  C   . ALA A 1 53  ? 29.495 -4.734  -2.215 1.00 31.44 ? 53  ALA A C   1 
ATOM   399  O  O   . ALA A 1 53  ? 29.422 -5.880  -1.781 1.00 31.95 ? 53  ALA A O   1 
ATOM   400  C  CB  . ALA A 1 53  ? 28.278 -4.318  -4.361 1.00 42.92 ? 53  ALA A CB  1 
ATOM   401  N  N   . GLN A 1 54  ? 30.674 -4.126  -2.266 1.00 29.75 ? 54  GLN A N   1 
ATOM   402  C  CA  . GLN A 1 54  ? 31.862 -4.721  -1.673 1.00 29.16 ? 54  GLN A CA  1 
ATOM   403  C  C   . GLN A 1 54  ? 31.751 -4.799  -0.148 1.00 25.86 ? 54  GLN A C   1 
ATOM   404  O  O   . GLN A 1 54  ? 32.123 -5.759  0.483  1.00 26.85 ? 54  GLN A O   1 
ATOM   405  C  CB  . GLN A 1 54  ? 33.028 -3.765  -2.011 1.00 25.04 ? 54  GLN A CB  1 
ATOM   406  C  CG  . GLN A 1 54  ? 33.531 -4.023  -3.422 1.00 33.31 ? 54  GLN A CG  1 
ATOM   407  C  CD  . GLN A 1 54  ? 34.679 -3.015  -3.711 1.00 33.64 ? 54  GLN A CD  1 
ATOM   408  O  OE1 . GLN A 1 54  ? 34.337 -1.861  -3.884 1.00 36.45 ? 54  GLN A OE1 1 
ATOM   409  N  NE2 . GLN A 1 54  ? 35.893 -3.546  -3.724 1.00 35.12 ? 54  GLN A NE2 1 
ATOM   410  N  N   . VAL A 1 55  ? 31.275 -3.643  0.409  1.00 25.81 ? 55  VAL A N   1 
ATOM   411  C  CA  . VAL A 1 55  ? 31.147 -3.619  1.894  1.00 27.16 ? 55  VAL A CA  1 
ATOM   412  C  C   . VAL A 1 55  ? 30.137 -4.661  2.366  1.00 22.16 ? 55  VAL A C   1 
ATOM   413  O  O   . VAL A 1 55  ? 30.246 -5.434  3.283  1.00 21.01 ? 55  VAL A O   1 
ATOM   414  C  CB  . VAL A 1 55  ? 30.786 -2.213  2.351  1.00 29.18 ? 55  VAL A CB  1 
ATOM   415  C  CG1 . VAL A 1 55  ? 30.415 -2.328  3.846  1.00 32.59 ? 55  VAL A CG1 1 
ATOM   416  C  CG2 . VAL A 1 55  ? 31.924 -1.226  2.113  1.00 26.48 ? 55  VAL A CG2 1 
ATOM   417  N  N   . LYS A 1 56  ? 29.070 -4.748  1.590  1.00 23.25 ? 56  LYS A N   1 
ATOM   418  C  CA  . LYS A 1 56  ? 27.974 -5.700  1.787  1.00 28.73 ? 56  LYS A CA  1 
ATOM   419  C  C   . LYS A 1 56  ? 28.517 -7.095  1.637  1.00 28.40 ? 56  LYS A C   1 
ATOM   420  O  O   . LYS A 1 56  ? 28.279 -7.975  2.488  1.00 30.87 ? 56  LYS A O   1 
ATOM   421  C  CB  . LYS A 1 56  ? 26.807 -5.381  0.828  1.00 33.80 ? 56  LYS A CB  1 
ATOM   422  C  CG  . LYS A 1 56  ? 25.961 -6.617  0.485  1.00 46.77 ? 56  LYS A CG  1 
ATOM   423  C  CD  . LYS A 1 56  ? 25.009 -6.354  -0.702 1.00 65.54 ? 56  LYS A CD  1 
ATOM   424  C  CE  . LYS A 1 56  ? 25.005 -7.429  -1.804 1.00 68.09 ? 56  LYS A CE  1 
ATOM   425  N  NZ  . LYS A 1 56  ? 24.889 -6.849  -3.231 1.00 72.43 ? 56  LYS A NZ  1 
ATOM   426  N  N   . ALA A 1 57  ? 29.418 -7.341  0.678  1.00 27.23 ? 57  ALA A N   1 
ATOM   427  C  CA  . ALA A 1 57  ? 30.001 -8.649  0.471  1.00 22.11 ? 57  ALA A CA  1 
ATOM   428  C  C   . ALA A 1 57  ? 30.971 -9.000  1.581  1.00 22.27 ? 57  ALA A C   1 
ATOM   429  O  O   . ALA A 1 57  ? 31.087 -10.131 2.011  1.00 23.87 ? 57  ALA A O   1 
ATOM   430  C  CB  . ALA A 1 57  ? 30.763 -8.674  -0.874 1.00 30.98 ? 57  ALA A CB  1 
ATOM   431  N  N   . HIS A 1 58  ? 31.720 -7.939  1.993  1.00 22.08 ? 58  HIS A N   1 
ATOM   432  C  CA  . HIS A 1 58  ? 32.662 -8.205  3.084  1.00 22.74 ? 58  HIS A CA  1 
ATOM   433  C  C   . HIS A 1 58  ? 31.906 -8.421  4.444  1.00 19.69 ? 58  HIS A C   1 
ATOM   434  O  O   . HIS A 1 58  ? 32.443 -9.176  5.311  1.00 18.91 ? 58  HIS A O   1 
ATOM   435  C  CB  . HIS A 1 58  ? 33.669 -7.026  3.068  1.00 24.04 ? 58  HIS A CB  1 
ATOM   436  C  CG  . HIS A 1 58  ? 34.806 -7.362  4.003  1.00 21.86 ? 58  HIS A CG  1 
ATOM   437  N  ND1 . HIS A 1 58  ? 35.661 -8.432  3.790  1.00 23.98 ? 58  HIS A ND1 1 
ATOM   438  C  CD2 . HIS A 1 58  ? 35.119 -6.797  5.203  1.00 27.19 ? 58  HIS A CD2 1 
ATOM   439  C  CE1 . HIS A 1 58  ? 36.482 -8.480  4.842  1.00 26.13 ? 58  HIS A CE1 1 
ATOM   440  N  NE2 . HIS A 1 58  ? 36.199 -7.497  5.727  1.00 25.76 ? 58  HIS A NE2 1 
ATOM   441  N  N   . GLY A 1 59  ? 30.783 -7.703  4.619  1.00 18.81 ? 59  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 59  ? 29.880 -7.800  5.816  1.00 18.45 ? 59  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 59  ? 29.379 -9.245  5.919  1.00 20.25 ? 59  GLY A C   1 
ATOM   444  O  O   . GLY A 1 59  ? 29.462 -9.878  6.966  1.00 18.20 ? 59  GLY A O   1 
ATOM   445  N  N   . LYS A 1 60  ? 29.017 -9.864  4.768  1.00 21.84 ? 60  LYS A N   1 
ATOM   446  C  CA  . LYS A 1 60  ? 28.655 -11.288 4.737  1.00 22.72 ? 60  LYS A CA  1 
ATOM   447  C  C   . LYS A 1 60  ? 29.772 -12.208 5.156  1.00 26.21 ? 60  LYS A C   1 
ATOM   448  O  O   . LYS A 1 60  ? 29.612 -13.147 5.987  1.00 24.77 ? 60  LYS A O   1 
ATOM   449  C  CB  . LYS A 1 60  ? 28.202 -11.641 3.281  1.00 25.94 ? 60  LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 60  ? 27.693 -13.092 3.238  1.00 32.45 ? 60  LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 60  ? 26.155 -12.919 3.278  1.00 40.12 ? 60  LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 60  ? 25.621 -13.079 4.654  1.00 38.80 ? 60  LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 60  ? 26.365 -14.094 5.472  1.00 43.93 ? 60  LYS A NZ  1 
ATOM   454  N  N   . LYS A 1 61  ? 31.071 -12.027 4.736  1.00 25.43 ? 61  LYS A N   1 
ATOM   455  C  CA  . LYS A 1 61  ? 32.201 -12.845 5.129  1.00 23.15 ? 61  LYS A CA  1 
ATOM   456  C  C   . LYS A 1 61  ? 32.502 -12.765 6.619  1.00 22.60 ? 61  LYS A C   1 
ATOM   457  O  O   . LYS A 1 61  ? 32.787 -13.751 7.272  1.00 22.60 ? 61  LYS A O   1 
ATOM   458  C  CB  . LYS A 1 61  ? 33.498 -12.422 4.411  1.00 26.99 ? 61  LYS A CB  1 
ATOM   459  C  CG  . LYS A 1 61  ? 33.280 -12.635 2.862  1.00 23.17 ? 61  LYS A CG  1 
ATOM   460  C  CD  . LYS A 1 61  ? 34.763 -12.657 2.390  1.00 47.12 ? 61  LYS A CD  1 
ATOM   461  C  CE  . LYS A 1 61  ? 34.860 -12.024 1.012  1.00 53.98 ? 61  LYS A CE  1 
ATOM   462  N  NZ  . LYS A 1 61  ? 33.795 -12.612 0.082  1.00 66.00 ? 61  LYS A NZ  1 
ATOM   463  N  N   . VAL A 1 62  ? 32.505 -11.497 7.102  1.00 20.29 ? 62  VAL A N   1 
ATOM   464  C  CA  . VAL A 1 62  ? 32.705 -11.291 8.540  1.00 20.90 ? 62  VAL A CA  1 
ATOM   465  C  C   . VAL A 1 62  ? 31.560 -12.008 9.310  1.00 17.29 ? 62  VAL A C   1 
ATOM   466  O  O   . VAL A 1 62  ? 31.872 -12.747 10.241 1.00 19.12 ? 62  VAL A O   1 
ATOM   467  C  CB  . VAL A 1 62  ? 32.766 -9.786  8.818  1.00 22.04 ? 62  VAL A CB  1 
ATOM   468  C  CG1 . VAL A 1 62  ? 32.755 -9.594  10.335 1.00 19.58 ? 62  VAL A CG1 1 
ATOM   469  C  CG2 . VAL A 1 62  ? 34.037 -9.191  8.196  1.00 19.22 ? 62  VAL A CG2 1 
ATOM   470  N  N   . GLY A 1 63  ? 30.345 -11.853 8.942  1.00 20.01 ? 63  GLY A N   1 
ATOM   471  C  CA  . GLY A 1 63  ? 29.155 -12.454 9.542  1.00 21.19 ? 63  GLY A CA  1 
ATOM   472  C  C   . GLY A 1 63  ? 29.300 -13.949 9.498  1.00 23.05 ? 63  GLY A C   1 
ATOM   473  O  O   . GLY A 1 63  ? 29.138 -14.615 10.537 1.00 21.97 ? 63  GLY A O   1 
ATOM   474  N  N   . ASP A 1 64  ? 29.680 -14.550 8.366  1.00 24.78 ? 64  ASP A N   1 
ATOM   475  C  CA  . ASP A 1 64  ? 29.912 -16.006 8.349  1.00 21.95 ? 64  ASP A CA  1 
ATOM   476  C  C   . ASP A 1 64  ? 31.022 -16.513 9.218  1.00 19.94 ? 64  ASP A C   1 
ATOM   477  O  O   . ASP A 1 64  ? 30.947 -17.641 9.738  1.00 24.01 ? 64  ASP A O   1 
ATOM   478  C  CB  . ASP A 1 64  ? 30.296 -16.443 6.916  1.00 25.10 ? 64  ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 64  ? 29.114 -16.368 5.979  1.00 34.13 ? 64  ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 64  ? 27.916 -16.240 6.339  1.00 34.05 ? 64  ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 64  ? 29.370 -16.380 4.751  1.00 43.17 ? 64  ASP A OD2 1 
ATOM   482  N  N   . ALA A 1 65  ? 32.153 -15.768 9.370  1.00 16.53 ? 65  ALA A N   1 
ATOM   483  C  CA  . ALA A 1 65  ? 33.243 -16.187 10.204 1.00 18.53 ? 65  ALA A CA  1 
ATOM   484  C  C   . ALA A 1 65  ? 32.820 -16.171 11.705 1.00 20.60 ? 65  ALA A C   1 
ATOM   485  O  O   . ALA A 1 65  ? 33.272 -16.971 12.505 1.00 21.60 ? 65  ALA A O   1 
ATOM   486  C  CB  . ALA A 1 65  ? 34.454 -15.240 10.094 1.00 19.17 ? 65  ALA A CB  1 
ATOM   487  N  N   . LEU A 1 66  ? 31.959 -15.175 12.060 1.00 23.23 ? 66  LEU A N   1 
ATOM   488  C  CA  . LEU A 1 66  ? 31.427 -15.096 13.453 1.00 20.30 ? 66  LEU A CA  1 
ATOM   489  C  C   . LEU A 1 66  ? 30.498 -16.295 13.753 1.00 16.11 ? 66  LEU A C   1 
ATOM   490  O  O   . LEU A 1 66  ? 30.561 -16.877 14.798 1.00 19.90 ? 66  LEU A O   1 
ATOM   491  C  CB  . LEU A 1 66  ? 30.665 -13.762 13.535 1.00 16.29 ? 66  LEU A CB  1 
ATOM   492  C  CG  . LEU A 1 66  ? 31.685 -12.568 13.670 1.00 20.78 ? 66  LEU A CG  1 
ATOM   493  C  CD1 . LEU A 1 66  ? 30.853 -11.311 13.833 1.00 23.53 ? 66  LEU A CD1 1 
ATOM   494  C  CD2 . LEU A 1 66  ? 32.686 -12.745 14.786 1.00 20.00 ? 66  LEU A CD2 1 
ATOM   495  N  N   . THR A 1 67  ? 29.706 -16.658 12.789 1.00 19.21 ? 67  THR A N   1 
ATOM   496  C  CA  . THR A 1 67  ? 28.795 -17.815 12.819 1.00 22.01 ? 67  THR A CA  1 
ATOM   497  C  C   . THR A 1 67  ? 29.662 -19.046 12.877 1.00 27.95 ? 67  THR A C   1 
ATOM   498  O  O   . THR A 1 67  ? 29.357 -19.797 13.804 1.00 27.05 ? 67  THR A O   1 
ATOM   499  C  CB  . THR A 1 67  ? 27.894 -17.881 11.644 1.00 20.81 ? 67  THR A CB  1 
ATOM   500  O  OG1 . THR A 1 67  ? 27.041 -16.693 11.709 1.00 21.65 ? 67  THR A OG1 1 
ATOM   501  C  CG2 . THR A 1 67  ? 27.042 -19.147 11.677 1.00 22.39 ? 67  THR A CG2 1 
ATOM   502  N  N   . LEU A 1 68  ? 30.732 -19.189 12.082 1.00 27.31 ? 68  LEU A N   1 
ATOM   503  C  CA  . LEU A 1 68  ? 31.666 -20.303 12.357 1.00 27.43 ? 68  LEU A CA  1 
ATOM   504  C  C   . LEU A 1 68  ? 32.243 -20.323 13.782 1.00 26.57 ? 68  LEU A C   1 
ATOM   505  O  O   . LEU A 1 68  ? 32.353 -21.386 14.431 1.00 28.85 ? 68  LEU A O   1 
ATOM   506  C  CB  . LEU A 1 68  ? 32.948 -20.204 11.421 1.00 27.13 ? 68  LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 68  ? 34.112 -21.167 11.871 1.00 31.09 ? 68  LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 68  ? 34.144 -22.298 10.869 1.00 35.16 ? 68  LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 68  ? 35.422 -20.480 12.004 1.00 35.13 ? 68  LEU A CD2 1 
ATOM   510  N  N   . ALA A 1 69  ? 32.759 -19.222 14.358 1.00 21.32 ? 69  ALA A N   1 
ATOM   511  C  CA  . ALA A 1 69  ? 33.346 -19.146 15.666 1.00 22.13 ? 69  ALA A CA  1 
ATOM   512  C  C   . ALA A 1 69  ? 32.299 -19.585 16.720 1.00 24.16 ? 69  ALA A C   1 
ATOM   513  O  O   . ALA A 1 69  ? 32.651 -20.331 17.617 1.00 25.02 ? 69  ALA A O   1 
ATOM   514  C  CB  . ALA A 1 69  ? 33.777 -17.711 15.930 1.00 18.54 ? 69  ALA A CB  1 
ATOM   515  N  N   . VAL A 1 70  ? 31.059 -19.092 16.559 1.00 23.84 ? 70  VAL A N   1 
ATOM   516  C  CA  . VAL A 1 70  ? 29.988 -19.446 17.501 1.00 25.49 ? 70  VAL A CA  1 
ATOM   517  C  C   . VAL A 1 70  ? 29.858 -20.968 17.489 1.00 34.98 ? 70  VAL A C   1 
ATOM   518  O  O   . VAL A 1 70  ? 29.652 -21.612 18.532 1.00 28.67 ? 70  VAL A O   1 
ATOM   519  C  CB  . VAL A 1 70  ? 28.673 -18.702 17.145 1.00 29.68 ? 70  VAL A CB  1 
ATOM   520  C  CG1 . VAL A 1 70  ? 27.440 -19.208 17.900 1.00 24.65 ? 70  VAL A CG1 1 
ATOM   521  C  CG2 . VAL A 1 70  ? 28.839 -17.208 17.387 1.00 23.12 ? 70  VAL A CG2 1 
ATOM   522  N  N   . GLY A 1 71  ? 30.026 -21.670 16.339 1.00 31.19 ? 71  GLY A N   1 
ATOM   523  C  CA  . GLY A 1 71  ? 29.966 -23.125 16.283 1.00 30.36 ? 71  GLY A CA  1 
ATOM   524  C  C   . GLY A 1 71  ? 31.168 -23.815 16.880 1.00 29.10 ? 71  GLY A C   1 
ATOM   525  O  O   . GLY A 1 71  ? 31.070 -25.031 17.110 1.00 31.95 ? 71  GLY A O   1 
ATOM   526  N  N   . HIS A 1 72  ? 32.314 -23.170 17.154 1.00 31.90 ? 72  HIS A N   1 
ATOM   527  C  CA  . HIS A 1 72  ? 33.505 -23.757 17.703 1.00 28.51 ? 72  HIS A CA  1 
ATOM   528  C  C   . HIS A 1 72  ? 34.117 -23.036 18.869 1.00 28.74 ? 72  HIS A C   1 
ATOM   529  O  O   . HIS A 1 72  ? 35.348 -22.908 18.871 1.00 27.07 ? 72  HIS A O   1 
ATOM   530  C  CB  . HIS A 1 72  ? 34.725 -23.699 16.720 1.00 34.52 ? 72  HIS A CB  1 
ATOM   531  C  CG  . HIS A 1 72  ? 34.388 -24.510 15.517 1.00 41.48 ? 72  HIS A CG  1 
ATOM   532  N  ND1 . HIS A 1 72  ? 33.408 -24.134 14.575 1.00 38.56 ? 72  HIS A ND1 1 
ATOM   533  C  CD2 . HIS A 1 72  ? 34.870 -25.730 15.172 1.00 44.43 ? 72  HIS A CD2 1 
ATOM   534  C  CE1 . HIS A 1 72  ? 33.322 -25.061 13.645 1.00 39.72 ? 72  HIS A CE1 1 
ATOM   535  N  NE2 . HIS A 1 72  ? 34.190 -26.047 13.982 1.00 48.62 ? 72  HIS A NE2 1 
ATOM   536  N  N   . LEU A 1 73  ? 33.260 -22.672 19.825 1.00 29.33 ? 73  LEU A N   1 
ATOM   537  C  CA  . LEU A 1 73  ? 33.789 -21.924 20.988 1.00 27.65 ? 73  LEU A CA  1 
ATOM   538  C  C   . LEU A 1 73  ? 34.835 -22.637 21.750 1.00 31.92 ? 73  LEU A C   1 
ATOM   539  O  O   . LEU A 1 73  ? 35.772 -22.072 22.375 1.00 37.69 ? 73  LEU A O   1 
ATOM   540  C  CB  . LEU A 1 73  ? 32.590 -21.515 21.875 1.00 26.94 ? 73  LEU A CB  1 
ATOM   541  C  CG  . LEU A 1 73  ? 31.636 -20.575 21.094 1.00 31.93 ? 73  LEU A CG  1 
ATOM   542  C  CD1 . LEU A 1 73  ? 30.285 -20.417 21.764 1.00 26.05 ? 73  LEU A CD1 1 
ATOM   543  C  CD2 . LEU A 1 73  ? 32.368 -19.231 21.001 1.00 28.67 ? 73  LEU A CD2 1 
ATOM   544  N  N   . ASP A 1 74  ? 34.803 -23.966 21.724 1.00 32.29 ? 74  ASP A N   1 
ATOM   545  C  CA  . ASP A 1 74  ? 35.763 -24.786 22.469 1.00 37.09 ? 74  ASP A CA  1 
ATOM   546  C  C   . ASP A 1 74  ? 37.113 -24.734 21.770 1.00 40.82 ? 74  ASP A C   1 
ATOM   547  O  O   . ASP A 1 74  ? 38.107 -25.044 22.422 1.00 44.20 ? 74  ASP A O   1 
ATOM   548  C  CB  . ASP A 1 74  ? 35.238 -26.225 22.517 1.00 46.08 ? 74  ASP A CB  1 
ATOM   549  C  CG  . ASP A 1 74  ? 33.900 -26.411 23.266 1.00 65.47 ? 74  ASP A CG  1 
ATOM   550  O  OD1 . ASP A 1 74  ? 33.900 -26.077 24.503 1.00 55.94 ? 74  ASP A OD1 1 
ATOM   551  O  OD2 . ASP A 1 74  ? 32.913 -26.892 22.580 1.00 67.52 ? 74  ASP A OD2 1 
ATOM   552  N  N   . ASP A 1 75  ? 37.119 -24.338 20.493 1.00 36.19 ? 75  ASP A N   1 
ATOM   553  C  CA  . ASP A 1 75  ? 38.398 -24.320 19.814 1.00 34.37 ? 75  ASP A CA  1 
ATOM   554  C  C   . ASP A 1 75  ? 38.455 -23.237 18.800 1.00 31.57 ? 75  ASP A C   1 
ATOM   555  O  O   . ASP A 1 75  ? 38.389 -23.398 17.567 1.00 36.97 ? 75  ASP A O   1 
ATOM   556  C  CB  . ASP A 1 75  ? 38.533 -25.737 19.186 1.00 40.53 ? 75  ASP A CB  1 
ATOM   557  C  CG  . ASP A 1 75  ? 39.920 -25.833 18.500 1.00 60.34 ? 75  ASP A CG  1 
ATOM   558  O  OD1 . ASP A 1 75  ? 40.969 -25.359 19.019 1.00 51.80 ? 75  ASP A OD1 1 
ATOM   559  O  OD2 . ASP A 1 75  ? 39.802 -26.369 17.348 1.00 58.70 ? 75  ASP A OD2 1 
ATOM   560  N  N   . LEU A 1 76  ? 38.505 -21.990 19.277 1.00 32.47 ? 76  LEU A N   1 
ATOM   561  C  CA  . LEU A 1 76  ? 38.549 -20.899 18.241 1.00 32.14 ? 76  LEU A CA  1 
ATOM   562  C  C   . LEU A 1 76  ? 39.865 -20.870 17.494 1.00 32.92 ? 76  LEU A C   1 
ATOM   563  O  O   . LEU A 1 76  ? 39.885 -20.621 16.265 1.00 31.81 ? 76  LEU A O   1 
ATOM   564  C  CB  . LEU A 1 76  ? 38.272 -19.573 18.955 1.00 30.40 ? 76  LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 76  ? 36.853 -19.301 19.411 1.00 26.21 ? 76  LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 76  ? 36.849 -17.987 20.161 1.00 30.61 ? 76  LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 76  ? 35.932 -19.327 18.186 1.00 25.07 ? 76  LEU A CD2 1 
ATOM   568  N  N   . PRO A 1 77  ? 40.993 -21.097 18.167 1.00 34.77 ? 77  PRO A N   1 
ATOM   569  C  CA  . PRO A 1 77  ? 42.347 -21.094 17.561 1.00 35.86 ? 77  PRO A CA  1 
ATOM   570  C  C   . PRO A 1 77  ? 42.452 -21.979 16.337 1.00 38.21 ? 77  PRO A C   1 
ATOM   571  O  O   . PRO A 1 77  ? 43.032 -21.521 15.333 1.00 42.65 ? 77  PRO A O   1 
ATOM   572  C  CB  . PRO A 1 77  ? 43.347 -21.429 18.651 1.00 36.42 ? 77  PRO A CB  1 
ATOM   573  C  CG  . PRO A 1 77  ? 42.571 -21.056 19.914 1.00 34.03 ? 77  PRO A CG  1 
ATOM   574  C  CD  . PRO A 1 77  ? 41.103 -21.344 19.606 1.00 31.46 ? 77  PRO A CD  1 
ATOM   575  N  N   . GLY A 1 78  ? 41.873 -23.199 16.349 1.00 37.85 ? 78  GLY A N   1 
ATOM   576  C  CA  . GLY A 1 78  ? 41.883 -24.005 15.121 1.00 37.01 ? 78  GLY A CA  1 
ATOM   577  C  C   . GLY A 1 78  ? 40.854 -23.582 14.080 1.00 36.52 ? 78  GLY A C   1 
ATOM   578  O  O   . GLY A 1 78  ? 41.155 -23.588 12.847 1.00 38.59 ? 78  GLY A O   1 
ATOM   579  N  N   . ALA A 1 79  ? 39.619 -23.178 14.444 1.00 32.22 ? 79  ALA A N   1 
ATOM   580  C  CA  . ALA A 1 79  ? 38.611 -22.735 13.511 1.00 31.85 ? 79  ALA A CA  1 
ATOM   581  C  C   . ALA A 1 79  ? 38.989 -21.427 12.770 1.00 33.12 ? 79  ALA A C   1 
ATOM   582  O  O   . ALA A 1 79  ? 38.492 -21.198 11.646 1.00 35.65 ? 79  ALA A O   1 
ATOM   583  C  CB  . ALA A 1 79  ? 37.246 -22.387 14.162 1.00 26.66 ? 79  ALA A CB  1 
ATOM   584  N  N   . LEU A 1 80  ? 39.703 -20.539 13.476 1.00 35.08 ? 80  LEU A N   1 
ATOM   585  C  CA  . LEU A 1 80  ? 40.096 -19.229 12.918 1.00 35.80 ? 80  LEU A CA  1 
ATOM   586  C  C   . LEU A 1 80  ? 41.574 -19.154 12.583 1.00 35.52 ? 80  LEU A C   1 
ATOM   587  O  O   . LEU A 1 80  ? 42.055 -18.093 12.250 1.00 31.77 ? 80  LEU A O   1 
ATOM   588  C  CB  . LEU A 1 80  ? 39.696 -18.121 13.924 1.00 29.66 ? 80  LEU A CB  1 
ATOM   589  C  CG  . LEU A 1 80  ? 38.213 -17.969 14.325 1.00 36.90 ? 80  LEU A CG  1 
ATOM   590  C  CD1 . LEU A 1 80  ? 37.945 -16.688 15.160 1.00 28.06 ? 80  LEU A CD1 1 
ATOM   591  C  CD2 . LEU A 1 80  ? 37.218 -17.952 13.188 1.00 33.61 ? 80  LEU A CD2 1 
ATOM   592  N  N   . SER A 1 81  ? 42.335 -20.259 12.620 1.00 37.23 ? 81  SER A N   1 
ATOM   593  C  CA  . SER A 1 81  ? 43.767 -20.319 12.397 1.00 33.94 ? 81  SER A CA  1 
ATOM   594  C  C   . SER A 1 81  ? 44.163 -19.603 11.127 1.00 32.35 ? 81  SER A C   1 
ATOM   595  O  O   . SER A 1 81  ? 45.079 -18.794 11.071 1.00 35.89 ? 81  SER A O   1 
ATOM   596  C  CB  . SER A 1 81  ? 44.259 -21.789 12.241 1.00 39.38 ? 81  SER A CB  1 
ATOM   597  O  OG  . SER A 1 81  ? 45.340 -22.007 13.176 1.00 46.58 ? 81  SER A OG  1 
ATOM   598  N  N   . ASP A 1 82  ? 43.385 -19.890 10.070 1.00 31.04 ? 82  ASP A N   1 
ATOM   599  C  CA  . ASP A 1 82  ? 43.672 -19.281 8.746  1.00 34.62 ? 82  ASP A CA  1 
ATOM   600  C  C   . ASP A 1 82  ? 43.439 -17.790 8.692  1.00 34.66 ? 82  ASP A C   1 
ATOM   601  O  O   . ASP A 1 82  ? 44.148 -17.024 8.016  1.00 30.91 ? 82  ASP A O   1 
ATOM   602  C  CB  . ASP A 1 82  ? 42.958 -20.055 7.613  1.00 43.16 ? 82  ASP A CB  1 
ATOM   603  C  CG  . ASP A 1 82  ? 43.650 -21.455 7.475  1.00 75.37 ? 82  ASP A CG  1 
ATOM   604  O  OD1 . ASP A 1 82  ? 44.434 -21.993 8.349  1.00 68.85 ? 82  ASP A OD1 1 
ATOM   605  O  OD2 . ASP A 1 82  ? 43.422 -22.081 6.385  1.00 73.94 ? 82  ASP A OD2 1 
ATOM   606  N  N   . LEU A 1 83  ? 42.491 -17.314 9.469  1.00 29.05 ? 83  LEU A N   1 
ATOM   607  C  CA  . LEU A 1 83  ? 42.238 -15.865 9.569  1.00 28.78 ? 83  LEU A CA  1 
ATOM   608  C  C   . LEU A 1 83  ? 43.330 -15.244 10.414 1.00 19.28 ? 83  LEU A C   1 
ATOM   609  O  O   . LEU A 1 83  ? 43.661 -14.043 10.161 1.00 27.28 ? 83  LEU A O   1 
ATOM   610  C  CB  . LEU A 1 83  ? 40.800 -15.794 10.088 1.00 30.35 ? 83  LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 83  ? 39.587 -15.380 9.351  1.00 32.89 ? 83  LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 83  ? 39.766 -15.415 7.846  1.00 34.43 ? 83  LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 83  ? 38.361 -16.182 9.705  1.00 31.60 ? 83  LEU A CD2 1 
ATOM   614  N  N   . SER A 1 84  ? 44.012 -15.873 11.336 1.00 21.55 ? 84  SER A N   1 
ATOM   615  C  CA  . SER A 1 84  ? 45.074 -15.261 12.137 1.00 30.95 ? 84  SER A CA  1 
ATOM   616  C  C   . SER A 1 84  ? 46.274 -14.874 11.272 1.00 29.00 ? 84  SER A C   1 
ATOM   617  O  O   . SER A 1 84  ? 46.925 -13.860 11.458 1.00 27.70 ? 84  SER A O   1 
ATOM   618  C  CB  . SER A 1 84  ? 45.660 -16.164 13.229 1.00 35.78 ? 84  SER A CB  1 
ATOM   619  O  OG  . SER A 1 84  ? 44.782 -17.063 13.816 1.00 46.88 ? 84  SER A OG  1 
ATOM   620  N  N   . ASN A 1 85  ? 46.536 -15.781 10.303 1.00 33.63 ? 85  ASN A N   1 
ATOM   621  C  CA  . ASN A 1 85  ? 47.678 -15.566 9.388  1.00 31.38 ? 85  ASN A CA  1 
ATOM   622  C  C   . ASN A 1 85  ? 47.444 -14.361 8.543  1.00 25.19 ? 85  ASN A C   1 
ATOM   623  O  O   . ASN A 1 85  ? 48.244 -13.432 8.471  1.00 30.75 ? 85  ASN A O   1 
ATOM   624  C  CB  . ASN A 1 85  ? 47.997 -16.773 8.483  1.00 41.48 ? 85  ASN A CB  1 
ATOM   625  C  CG  . ASN A 1 85  ? 48.463 -17.965 9.306  1.00 48.96 ? 85  ASN A CG  1 
ATOM   626  O  OD1 . ASN A 1 85  ? 49.210 -17.843 10.298 1.00 49.19 ? 85  ASN A OD1 1 
ATOM   627  N  ND2 . ASN A 1 85  ? 48.008 -19.171 8.920  1.00 57.02 ? 85  ASN A ND2 1 
ATOM   628  N  N   . LEU A 1 86  ? 46.287 -14.295 7.927  1.00 26.17 ? 86  LEU A N   1 
ATOM   629  C  CA  . LEU A 1 86  ? 45.931 -13.170 7.098  1.00 22.81 ? 86  LEU A CA  1 
ATOM   630  C  C   . LEU A 1 86  ? 45.987 -11.840 7.805  1.00 31.15 ? 86  LEU A C   1 
ATOM   631  O  O   . LEU A 1 86  ? 46.608 -10.840 7.371  1.00 28.11 ? 86  LEU A O   1 
ATOM   632  C  CB  . LEU A 1 86  ? 44.492 -13.487 6.601  1.00 25.09 ? 86  LEU A CB  1 
ATOM   633  C  CG  . LEU A 1 86  ? 43.838 -12.353 5.802  1.00 36.29 ? 86  LEU A CG  1 
ATOM   634  C  CD1 . LEU A 1 86  ? 44.600 -12.048 4.503  1.00 39.48 ? 86  LEU A CD1 1 
ATOM   635  C  CD2 . LEU A 1 86  ? 42.362 -12.605 5.441  1.00 28.94 ? 86  LEU A CD2 1 
ATOM   636  N  N   . HIS A 1 87  ? 45.338 -11.758 9.000  1.00 27.73 ? 87  HIS A N   1 
ATOM   637  C  CA  . HIS A 1 87  ? 45.317 -10.437 9.672  1.00 26.77 ? 87  HIS A CA  1 
ATOM   638  C  C   . HIS A 1 87  ? 46.665 -10.038 10.234 1.00 24.45 ? 87  HIS A C   1 
ATOM   639  O  O   . HIS A 1 87  ? 47.044 -8.878  10.156 1.00 26.30 ? 87  HIS A O   1 
ATOM   640  C  CB  . HIS A 1 87  ? 44.218 -10.464 10.774 1.00 19.52 ? 87  HIS A CB  1 
ATOM   641  C  CG  . HIS A 1 87  ? 42.846 -10.525 10.104 1.00 16.59 ? 87  HIS A CG  1 
ATOM   642  N  ND1 . HIS A 1 87  ? 42.254 -11.689 9.677  1.00 15.78 ? 87  HIS A ND1 1 
ATOM   643  C  CD2 . HIS A 1 87  ? 42.009 -9.508  9.858  1.00 15.23 ? 87  HIS A CD2 1 
ATOM   644  C  CE1 . HIS A 1 87  ? 41.113 -11.385 9.136  1.00 14.76 ? 87  HIS A CE1 1 
ATOM   645  N  NE2 . HIS A 1 87  ? 40.890 -10.061 9.233  1.00 16.69 ? 87  HIS A NE2 1 
ATOM   646  N  N   . ALA A 1 88  ? 47.426 -10.952 10.806 1.00 25.40 ? 88  ALA A N   1 
ATOM   647  C  CA  . ALA A 1 88  ? 48.732 -10.685 11.372 1.00 30.26 ? 88  ALA A CA  1 
ATOM   648  C  C   . ALA A 1 88  ? 49.846 -10.506 10.329 1.00 34.20 ? 88  ALA A C   1 
ATOM   649  O  O   . ALA A 1 88  ? 50.558 -9.481  10.337 1.00 31.89 ? 88  ALA A O   1 
ATOM   650  C  CB  . ALA A 1 88  ? 49.190 -11.828 12.283 1.00 34.78 ? 88  ALA A CB  1 
ATOM   651  N  N   . HIS A 1 89  ? 50.021 -11.531 9.479  1.00 32.13 ? 89  HIS A N   1 
ATOM   652  C  CA  . HIS A 1 89  ? 51.139 -11.468 8.524  1.00 36.22 ? 89  HIS A CA  1 
ATOM   653  C  C   . HIS A 1 89  ? 50.813 -10.639 7.291  1.00 35.76 ? 89  HIS A C   1 
ATOM   654  O  O   . HIS A 1 89  ? 51.536 -9.648  7.107  1.00 46.49 ? 89  HIS A O   1 
ATOM   655  C  CB  . HIS A 1 89  ? 51.669 -12.842 8.085  1.00 44.50 ? 89  HIS A CB  1 
ATOM   656  C  CG  . HIS A 1 89  ? 51.928 -13.746 9.262  1.00 44.06 ? 89  HIS A CG  1 
ATOM   657  N  ND1 . HIS A 1 89  ? 52.573 -13.327 10.415 1.00 44.79 ? 89  HIS A ND1 1 
ATOM   658  C  CD2 . HIS A 1 89  ? 51.579 -15.050 9.447  1.00 45.20 ? 89  HIS A CD2 1 
ATOM   659  C  CE1 . HIS A 1 89  ? 52.610 -14.342 11.284 1.00 47.38 ? 89  HIS A CE1 1 
ATOM   660  N  NE2 . HIS A 1 89  ? 52.023 -15.399 10.715 1.00 53.99 ? 89  HIS A NE2 1 
ATOM   661  N  N   . LYS A 1 90  ? 49.763 -10.989 6.580  1.00 28.23 ? 90  LYS A N   1 
ATOM   662  C  CA  . LYS A 1 90  ? 49.361 -10.293 5.397  1.00 26.55 ? 90  LYS A CA  1 
ATOM   663  C  C   . LYS A 1 90  ? 48.785 -8.927  5.636  1.00 36.43 ? 90  LYS A C   1 
ATOM   664  O  O   . LYS A 1 90  ? 49.373 -7.923  5.116  1.00 42.71 ? 90  LYS A O   1 
ATOM   665  C  CB  . LYS A 1 90  ? 48.406 -11.213 4.592  1.00 34.62 ? 90  LYS A CB  1 
ATOM   666  C  CG  . LYS A 1 90  ? 47.830 -10.426 3.423  1.00 48.83 ? 90  LYS A CG  1 
ATOM   667  C  CD  . LYS A 1 90  ? 47.007 -11.199 2.394  1.00 64.24 ? 90  LYS A CD  1 
ATOM   668  C  CE  . LYS A 1 90  ? 46.610 -10.302 1.184  1.00 63.05 ? 90  LYS A CE  1 
ATOM   669  N  NZ  . LYS A 1 90  ? 45.290 -10.622 0.547  1.00 62.67 ? 90  LYS A NZ  1 
ATOM   670  N  N   . LEU A 1 91  ? 47.695 -8.720  6.366  1.00 33.69 ? 91  LEU A N   1 
ATOM   671  C  CA  . LEU A 1 91  ? 47.167 -7.328  6.534  1.00 25.52 ? 91  LEU A CA  1 
ATOM   672  C  C   . LEU A 1 91  ? 47.874 -6.501  7.616  1.00 23.27 ? 91  LEU A C   1 
ATOM   673  O  O   . LEU A 1 91  ? 47.786 -5.235  7.480  1.00 23.73 ? 91  LEU A O   1 
ATOM   674  C  CB  . LEU A 1 91  ? 45.675 -7.571  6.773  1.00 22.04 ? 91  LEU A CB  1 
ATOM   675  C  CG  . LEU A 1 91  ? 44.960 -8.258  5.619  1.00 29.77 ? 91  LEU A CG  1 
ATOM   676  C  CD1 . LEU A 1 91  ? 43.543 -8.559  6.040  1.00 35.75 ? 91  LEU A CD1 1 
ATOM   677  C  CD2 . LEU A 1 91  ? 45.075 -7.284  4.469  1.00 29.88 ? 91  LEU A CD2 1 
ATOM   678  N  N   . ARG A 1 92  ? 48.574 -7.003  8.669  1.00 21.19 ? 92  ARG A N   1 
ATOM   679  C  CA  . ARG A 1 92  ? 49.200 -6.150  9.692  1.00 24.83 ? 92  ARG A CA  1 
ATOM   680  C  C   . ARG A 1 92  ? 48.186 -5.176  10.273 1.00 20.08 ? 92  ARG A C   1 
ATOM   681  O  O   . ARG A 1 92  ? 48.347 -3.958  10.420 1.00 21.56 ? 92  ARG A O   1 
ATOM   682  C  CB  . ARG A 1 92  ? 50.379 -5.331  9.078  1.00 28.22 ? 92  ARG A CB  1 
ATOM   683  C  CG  . ARG A 1 92  ? 51.629 -6.234  9.107  1.00 36.94 ? 92  ARG A CG  1 
ATOM   684  C  CD  . ARG A 1 92  ? 52.616 -5.835  7.995  1.00 51.24 ? 92  ARG A CD  1 
ATOM   685  N  NE  . ARG A 1 92  ? 53.470 -6.952  7.702  1.00 60.96 ? 92  ARG A NE  1 
ATOM   686  C  CZ  . ARG A 1 92  ? 54.153 -7.807  8.477  1.00 70.59 ? 92  ARG A CZ  1 
ATOM   687  N  NH1 . ARG A 1 92  ? 54.243 -7.828  9.838  1.00 44.38 ? 92  ARG A NH1 1 
ATOM   688  N  NH2 . ARG A 1 92  ? 54.813 -8.785  7.745  1.00 62.52 ? 92  ARG A NH2 1 
ATOM   689  N  N   . VAL A 1 93  ? 47.049 -5.812  10.657 1.00 17.98 ? 93  VAL A N   1 
ATOM   690  C  CA  . VAL A 1 93  ? 46.003 -4.983  11.279 1.00 18.22 ? 93  VAL A CA  1 
ATOM   691  C  C   . VAL A 1 93  ? 46.360 -4.636  12.741 1.00 16.44 ? 93  VAL A C   1 
ATOM   692  O  O   . VAL A 1 93  ? 46.616 -5.460  13.675 1.00 22.43 ? 93  VAL A O   1 
ATOM   693  C  CB  . VAL A 1 93  ? 44.612 -5.625  11.156 1.00 24.83 ? 93  VAL A CB  1 
ATOM   694  C  CG1 . VAL A 1 93  ? 43.545 -4.635  11.775 1.00 21.81 ? 93  VAL A CG1 1 
ATOM   695  C  CG2 . VAL A 1 93  ? 44.198 -5.999  9.763  1.00 17.23 ? 93  VAL A CG2 1 
ATOM   696  N  N   . ASP A 1 94  ? 46.449 -3.330  13.013 1.00 19.14 ? 94  ASP A N   1 
ATOM   697  C  CA  . ASP A 1 94  ? 46.655 -2.808  14.353 1.00 20.84 ? 94  ASP A CA  1 
ATOM   698  C  C   . ASP A 1 94  ? 45.520 -3.372  15.268 1.00 19.92 ? 94  ASP A C   1 
ATOM   699  O  O   . ASP A 1 94  ? 44.317 -3.248  14.992 1.00 20.04 ? 94  ASP A O   1 
ATOM   700  C  CB  . ASP A 1 94  ? 46.593 -1.276  14.234 1.00 20.21 ? 94  ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 94  ? 46.957 -0.566  15.532 1.00 23.47 ? 94  ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 94  ? 46.676 -1.108  16.630 1.00 24.66 ? 94  ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 94  ? 47.508 0.536   15.429 1.00 24.23 ? 94  ASP A OD2 1 
ATOM   704  N  N   . PRO A 1 95  ? 45.885 -4.068  16.285 1.00 19.95 ? 95  PRO A N   1 
ATOM   705  C  CA  . PRO A 1 95  ? 45.019 -4.674  17.275 1.00 25.02 ? 95  PRO A CA  1 
ATOM   706  C  C   . PRO A 1 95  ? 43.971 -3.714  17.852 1.00 24.41 ? 95  PRO A C   1 
ATOM   707  O  O   . PRO A 1 95  ? 42.828 -4.176  18.086 1.00 20.28 ? 95  PRO A O   1 
ATOM   708  C  CB  . PRO A 1 95  ? 45.897 -5.134  18.443 1.00 24.86 ? 95  PRO A CB  1 
ATOM   709  C  CG  . PRO A 1 95  ? 47.238 -5.281  17.790 1.00 29.06 ? 95  PRO A CG  1 
ATOM   710  C  CD  . PRO A 1 95  ? 47.280 -4.359  16.598 1.00 28.05 ? 95  PRO A CD  1 
ATOM   711  N  N   . VAL A 1 96  ? 44.227 -2.400  17.912 1.00 18.41 ? 96  VAL A N   1 
ATOM   712  C  CA  . VAL A 1 96  ? 43.237 -1.511  18.485 1.00 19.93 ? 96  VAL A CA  1 
ATOM   713  C  C   . VAL A 1 96  ? 41.982 -1.600  17.666 1.00 21.79 ? 96  VAL A C   1 
ATOM   714  O  O   . VAL A 1 96  ? 40.892 -1.372  18.126 1.00 20.23 ? 96  VAL A O   1 
ATOM   715  C  CB  A VAL A 1 96  ? 43.646 -0.033  18.488 0.50 23.20 ? 96  VAL A CB  1 
ATOM   716  C  CB  B VAL A 1 96  ? 43.608 -0.015  18.451 0.50 23.00 ? 96  VAL A CB  1 
ATOM   717  C  CG1 A VAL A 1 96  ? 42.642 0.722   19.343 0.50 29.00 ? 96  VAL A CG1 1 
ATOM   718  C  CG1 B VAL A 1 96  ? 44.631 0.330   19.489 0.50 27.78 ? 96  VAL A CG1 1 
ATOM   719  C  CG2 A VAL A 1 96  ? 45.025 0.182   19.035 0.50 28.89 ? 96  VAL A CG2 1 
ATOM   720  C  CG2 B VAL A 1 96  ? 44.100 0.368   17.063 0.50 25.60 ? 96  VAL A CG2 1 
ATOM   721  N  N   . ASN A 1 97  ? 42.185 -1.901  16.358 1.00 15.86 ? 97  ASN A N   1 
ATOM   722  C  CA  . ASN A 1 97  ? 41.098 -1.939  15.401 1.00 17.09 ? 97  ASN A CA  1 
ATOM   723  C  C   . ASN A 1 97  ? 40.086 -3.089  15.639 1.00 12.38 ? 97  ASN A C   1 
ATOM   724  O  O   . ASN A 1 97  ? 38.903 -2.843  15.208 1.00 17.53 ? 97  ASN A O   1 
ATOM   725  C  CB  . ASN A 1 97  ? 41.522 -1.941  13.927 1.00 21.25 ? 97  ASN A CB  1 
ATOM   726  C  CG  . ASN A 1 97  ? 42.264 -0.635  13.551 1.00 27.00 ? 97  ASN A CG  1 
ATOM   727  O  OD1 . ASN A 1 97  ? 41.844 0.433   13.958 1.00 26.41 ? 97  ASN A OD1 1 
ATOM   728  N  ND2 . ASN A 1 97  ? 43.355 -0.887  12.863 1.00 24.78 ? 97  ASN A ND2 1 
ATOM   729  N  N   . PHE A 1 98  ? 40.432 -4.156  16.181 1.00 15.89 ? 98  PHE A N   1 
ATOM   730  C  CA  . PHE A 1 98  ? 39.454 -5.259  16.505 1.00 18.45 ? 98  PHE A CA  1 
ATOM   731  C  C   . PHE A 1 98  ? 38.449 -4.740  17.571 1.00 18.17 ? 98  PHE A C   1 
ATOM   732  O  O   . PHE A 1 98  ? 37.265 -5.044  17.490 1.00 17.31 ? 98  PHE A O   1 
ATOM   733  C  CB  . PHE A 1 98  ? 40.204 -6.511  17.003 1.00 17.62 ? 98  PHE A CB  1 
ATOM   734  C  CG  . PHE A 1 98  ? 40.981 -7.112  15.832 1.00 20.89 ? 98  PHE A CG  1 
ATOM   735  C  CD1 . PHE A 1 98  ? 42.248 -6.645  15.527 1.00 23.10 ? 98  PHE A CD1 1 
ATOM   736  C  CD2 . PHE A 1 98  ? 40.378 -8.088  15.076 1.00 22.96 ? 98  PHE A CD2 1 
ATOM   737  C  CE1 . PHE A 1 98  ? 42.897 -7.204  14.438 1.00 20.53 ? 98  PHE A CE1 1 
ATOM   738  C  CE2 . PHE A 1 98  ? 41.012 -8.619  13.937 1.00 22.63 ? 98  PHE A CE2 1 
ATOM   739  C  CZ  . PHE A 1 98  ? 42.266 -8.160  13.649 1.00 21.72 ? 98  PHE A CZ  1 
ATOM   740  N  N   . LYS A 1 99  ? 38.924 -3.938  18.508 1.00 18.09 ? 99  LYS A N   1 
ATOM   741  C  CA  . LYS A 1 99  ? 38.104 -3.278  19.542 1.00 21.44 ? 99  LYS A CA  1 
ATOM   742  C  C   . LYS A 1 99  ? 37.066 -2.353  18.962 1.00 20.66 ? 99  LYS A C   1 
ATOM   743  O  O   . LYS A 1 99  ? 35.913 -2.364  19.376 1.00 20.02 ? 99  LYS A O   1 
ATOM   744  C  CB  . LYS A 1 99  ? 38.957 -2.404  20.482 1.00 21.90 ? 99  LYS A CB  1 
ATOM   745  C  CG  . LYS A 1 99  ? 39.842 -3.287  21.363 1.00 33.49 ? 99  LYS A CG  1 
ATOM   746  C  CD  . LYS A 1 99  ? 41.045 -2.541  21.928 1.00 49.06 ? 99  LYS A CD  1 
ATOM   747  C  CE  . LYS A 1 99  ? 40.847 -2.007  23.336 1.00 66.00 ? 99  LYS A CE  1 
ATOM   748  N  NZ  . LYS A 1 99  ? 41.823 -0.885  23.683 1.00 77.95 ? 99  LYS A NZ  1 
ATOM   749  N  N   . LEU A 1 100 ? 37.427 -1.580  17.945 1.00 15.09 ? 100 LEU A N   1 
ATOM   750  C  CA  . LEU A 1 100 ? 36.515 -0.639  17.317 1.00 12.69 ? 100 LEU A CA  1 
ATOM   751  C  C   . LEU A 1 100 ? 35.487 -1.426  16.593 1.00 17.19 ? 100 LEU A C   1 
ATOM   752  O  O   . LEU A 1 100 ? 34.336 -1.030  16.654 1.00 16.85 ? 100 LEU A O   1 
ATOM   753  C  CB  . LEU A 1 100 ? 37.305 0.222   16.305 1.00 18.14 ? 100 LEU A CB  1 
ATOM   754  C  CG  . LEU A 1 100 ? 38.410 1.066   16.918 1.00 20.86 ? 100 LEU A CG  1 
ATOM   755  C  CD1 . LEU A 1 100 ? 39.031 1.982   15.873 1.00 18.90 ? 100 LEU A CD1 1 
ATOM   756  C  CD2 . LEU A 1 100 ? 37.837 1.920   18.043 1.00 22.86 ? 100 LEU A CD2 1 
ATOM   757  N  N   . LEU A 1 101 ? 35.904 -2.486  15.828 1.00 12.62 ? 101 LEU A N   1 
ATOM   758  C  CA  . LEU A 1 101 ? 34.904 -3.249  15.125 1.00 12.70 ? 101 LEU A CA  1 
ATOM   759  C  C   . LEU A 1 101 ? 33.963 -3.992  16.140 1.00 13.71 ? 101 LEU A C   1 
ATOM   760  O  O   . LEU A 1 101 ? 32.725 -4.059  15.879 1.00 14.68 ? 101 LEU A O   1 
ATOM   761  C  CB  . LEU A 1 101 ? 35.571 -4.320  14.208 1.00 13.59 ? 101 LEU A CB  1 
ATOM   762  C  CG  . LEU A 1 101 ? 34.574 -5.122  13.325 1.00 18.47 ? 101 LEU A CG  1 
ATOM   763  C  CD1 . LEU A 1 101 ? 33.509 -4.271  12.649 1.00 17.77 ? 101 LEU A CD1 1 
ATOM   764  C  CD2 . LEU A 1 101 ? 35.241 -5.905  12.203 1.00 22.90 ? 101 LEU A CD2 1 
ATOM   765  N  N   . SER A 1 102 ? 34.487 -4.522  17.219 1.00 13.34 ? 102 SER A N   1 
ATOM   766  C  CA  . SER A 1 102 ? 33.679 -5.232  18.228 1.00 13.08 ? 102 SER A CA  1 
ATOM   767  C  C   . SER A 1 102 ? 32.611 -4.266  18.765 1.00 18.43 ? 102 SER A C   1 
ATOM   768  O  O   . SER A 1 102 ? 31.455 -4.606  18.875 1.00 15.33 ? 102 SER A O   1 
ATOM   769  C  CB  . SER A 1 102 ? 34.559 -5.704  19.366 1.00 13.99 ? 102 SER A CB  1 
ATOM   770  O  OG  . SER A 1 102 ? 35.291 -6.832  18.838 1.00 18.28 ? 102 SER A OG  1 
ATOM   771  N  N   . HIS A 1 103 ? 33.014 -3.032  19.085 1.00 15.58 ? 103 HIS A N   1 
ATOM   772  C  CA  . HIS A 1 103 ? 32.127 -1.974  19.582 1.00 15.11 ? 103 HIS A CA  1 
ATOM   773  C  C   . HIS A 1 103 ? 31.066 -1.687  18.609 1.00 16.44 ? 103 HIS A C   1 
ATOM   774  O  O   . HIS A 1 103 ? 29.844 -1.568  18.907 1.00 14.41 ? 103 HIS A O   1 
ATOM   775  C  CB  . HIS A 1 103 ? 32.978 -0.706  19.903 1.00 12.02 ? 103 HIS A CB  1 
ATOM   776  C  CG  . HIS A 1 103 ? 32.071 0.417   20.299 1.00 19.56 ? 103 HIS A CG  1 
ATOM   777  N  ND1 . HIS A 1 103 ? 31.849 1.490   19.500 1.00 20.64 ? 103 HIS A ND1 1 
ATOM   778  C  CD2 . HIS A 1 103 ? 31.224 0.542   21.383 1.00 10.32 ? 103 HIS A CD2 1 
ATOM   779  C  CE1 . HIS A 1 103 ? 30.947 2.299   20.060 1.00 13.06 ? 103 HIS A CE1 1 
ATOM   780  N  NE2 . HIS A 1 103 ? 30.553 1.704   21.177 1.00 19.67 ? 103 HIS A NE2 1 
ATOM   781  N  N   . CYS A 1 104 ? 31.361 -1.607  17.262 1.00 11.07 ? 104 CYS A N   1 
ATOM   782  C  CA  . CYS A 1 104 ? 30.432 -1.327  16.229 1.00 11.34 ? 104 CYS A CA  1 
ATOM   783  C  C   . CYS A 1 104 ? 29.437 -2.453  15.960 1.00 10.72 ? 104 CYS A C   1 
ATOM   784  O  O   . CYS A 1 104 ? 28.285 -2.208  15.524 1.00 15.53 ? 104 CYS A O   1 
ATOM   785  C  CB  . CYS A 1 104 ? 31.103 -0.946  14.863 1.00 14.26 ? 104 CYS A CB  1 
ATOM   786  S  SG  . CYS A 1 104 ? 31.864 0.727   15.077 1.00 18.12 ? 104 CYS A SG  1 
ATOM   787  N  N   . LEU A 1 105 ? 29.969 -3.659  16.212 1.00 13.07 ? 105 LEU A N   1 
ATOM   788  C  CA  . LEU A 1 105 ? 29.066 -4.861  16.040 1.00 12.96 ? 105 LEU A CA  1 
ATOM   789  C  C   . LEU A 1 105 ? 28.050 -4.890  17.278 1.00 15.22 ? 105 LEU A C   1 
ATOM   790  O  O   . LEU A 1 105 ? 26.830 -5.136  17.067 1.00 14.15 ? 105 LEU A O   1 
ATOM   791  C  CB  . LEU A 1 105 ? 29.950 -6.040  16.080 1.00 18.16 ? 105 LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 105 ? 29.760 -7.247  15.175 1.00 40.62 ? 105 LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 105 ? 28.967 -6.974  13.939 1.00 35.88 ? 105 LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 105 ? 31.249 -7.709  14.950 1.00 34.85 ? 105 LEU A CD2 1 
ATOM   795  N  N   . LEU A 1 106 ? 28.594 -4.566  18.470 1.00 11.83 ? 106 LEU A N   1 
ATOM   796  C  CA  . LEU A 1 106 ? 27.608 -4.529  19.643 1.00 14.29 ? 106 LEU A CA  1 
ATOM   797  C  C   . LEU A 1 106 ? 26.560 -3.452  19.433 1.00 16.76 ? 106 LEU A C   1 
ATOM   798  O  O   . LEU A 1 106 ? 25.353 -3.658  19.656 1.00 14.93 ? 106 LEU A O   1 
ATOM   799  C  CB  . LEU A 1 106 ? 28.328 -4.288  20.964 1.00 14.69 ? 106 LEU A CB  1 
ATOM   800  C  CG  . LEU A 1 106 ? 29.250 -5.411  21.505 1.00 15.42 ? 106 LEU A CG  1 
ATOM   801  C  CD1 . LEU A 1 106 ? 30.011 -4.909  22.715 1.00 17.27 ? 106 LEU A CD1 1 
ATOM   802  C  CD2 . LEU A 1 106 ? 28.491 -6.711  21.712 1.00 20.51 ? 106 LEU A CD2 1 
ATOM   803  N  N   . SER A 1 107 ? 26.970 -2.287  18.851 1.00 14.09 ? 107 SER A N   1 
ATOM   804  C  CA  . SER A 1 107 ? 26.061 -1.193  18.623 1.00 13.13 ? 107 SER A CA  1 
ATOM   805  C  C   . SER A 1 107 ? 24.973 -1.615  17.696 1.00 16.93 ? 107 SER A C   1 
ATOM   806  O  O   . SER A 1 107 ? 23.788 -1.202  17.781 1.00 15.75 ? 107 SER A O   1 
ATOM   807  C  CB  . SER A 1 107 ? 26.781 0.081   18.042 1.00 12.08 ? 107 SER A CB  1 
ATOM   808  O  OG  . SER A 1 107 ? 27.765 0.502   18.982 1.00 17.66 ? 107 SER A OG  1 
ATOM   809  N  N   . THR A 1 108 ? 25.396 -2.381  16.631 1.00 13.16 ? 108 THR A N   1 
ATOM   810  C  CA  . THR A 1 108 ? 24.452 -2.826  15.582 1.00 13.82 ? 108 THR A CA  1 
ATOM   811  C  C   . THR A 1 108 ? 23.431 -3.823  16.134 1.00 13.84 ? 108 THR A C   1 
ATOM   812  O  O   . THR A 1 108 ? 22.269 -3.786  15.792 1.00 13.66 ? 108 THR A O   1 
ATOM   813  C  CB  . THR A 1 108 ? 25.282 -3.513  14.399 1.00 18.69 ? 108 THR A CB  1 
ATOM   814  O  OG1 . THR A 1 108 ? 26.224 -2.498  13.920 1.00 16.69 ? 108 THR A OG1 1 
ATOM   815  C  CG2 . THR A 1 108 ? 24.354 -4.089  13.358 1.00 12.59 ? 108 THR A CG2 1 
ATOM   816  N  N   . LEU A 1 109 ? 23.868 -4.750  16.990 1.00 15.30 ? 109 LEU A N   1 
ATOM   817  C  CA  . LEU A 1 109 ? 23.039 -5.748  17.649 1.00 15.21 ? 109 LEU A CA  1 
ATOM   818  C  C   . LEU A 1 109 ? 22.093 -4.971  18.635 1.00 14.90 ? 109 LEU A C   1 
ATOM   819  O  O   . LEU A 1 109 ? 20.929 -5.346  18.602 1.00 17.14 ? 109 LEU A O   1 
ATOM   820  C  CB  . LEU A 1 109 ? 23.836 -6.743  18.441 1.00 12.82 ? 109 LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 109 ? 24.647 -7.699  17.513 1.00 19.97 ? 109 LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 109 ? 25.570 -8.524  18.353 1.00 20.96 ? 109 LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 109 ? 23.685 -8.526  16.707 1.00 23.55 ? 109 LEU A CD2 1 
ATOM   824  N  N   . ALA A 1 110 ? 22.552 -3.969  19.331 1.00 14.66 ? 110 ALA A N   1 
ATOM   825  C  CA  . ALA A 1 110 ? 21.642 -3.155  20.203 1.00 15.09 ? 110 ALA A CA  1 
ATOM   826  C  C   . ALA A 1 110 ? 20.570 -2.500  19.387 1.00 20.98 ? 110 ALA A C   1 
ATOM   827  O  O   . ALA A 1 110 ? 19.384 -2.419  19.791 1.00 18.01 ? 110 ALA A O   1 
ATOM   828  C  CB  . ALA A 1 110 ? 22.425 -2.112  20.984 1.00 12.54 ? 110 ALA A CB  1 
ATOM   829  N  N   . VAL A 1 111 ? 20.859 -1.978  18.153 1.00 18.85 ? 111 VAL A N   1 
ATOM   830  C  CA  . VAL A 1 111 ? 19.870 -1.374  17.311 1.00 17.60 ? 111 VAL A CA  1 
ATOM   831  C  C   . VAL A 1 111 ? 18.744 -2.340  16.927 1.00 19.59 ? 111 VAL A C   1 
ATOM   832  O  O   . VAL A 1 111 ? 17.560 -2.066  16.899 1.00 17.78 ? 111 VAL A O   1 
ATOM   833  C  CB  . VAL A 1 111 ? 20.504 -0.861  15.952 1.00 13.03 ? 111 VAL A CB  1 
ATOM   834  C  CG1 . VAL A 1 111 ? 19.493 -0.512  14.888 1.00 15.09 ? 111 VAL A CG1 1 
ATOM   835  C  CG2 . VAL A 1 111 ? 21.325 0.390   16.243 1.00 16.67 ? 111 VAL A CG2 1 
ATOM   836  N  N   . HIS A 1 112 ? 19.143 -3.559  16.488 1.00 17.94 ? 112 HIS A N   1 
ATOM   837  C  CA  . HIS A 1 112 ? 18.223 -4.509  15.894 1.00 17.17 ? 112 HIS A CA  1 
ATOM   838  C  C   . HIS A 1 112 ? 17.587 -5.457  16.854 1.00 19.47 ? 112 HIS A C   1 
ATOM   839  O  O   . HIS A 1 112 ? 16.483 -5.928  16.541 1.00 22.86 ? 112 HIS A O   1 
ATOM   840  C  CB  . HIS A 1 112 ? 18.980 -5.337  14.774 1.00 20.52 ? 112 HIS A CB  1 
ATOM   841  C  CG  . HIS A 1 112 ? 19.342 -4.447  13.594 1.00 24.14 ? 112 HIS A CG  1 
ATOM   842  N  ND1 . HIS A 1 112 ? 18.452 -4.062  12.632 1.00 23.48 ? 112 HIS A ND1 1 
ATOM   843  C  CD2 . HIS A 1 112 ? 20.530 -3.836  13.265 1.00 18.22 ? 112 HIS A CD2 1 
ATOM   844  C  CE1 . HIS A 1 112 ? 19.062 -3.193  11.800 1.00 27.31 ? 112 HIS A CE1 1 
ATOM   845  N  NE2 . HIS A 1 112 ? 20.322 -3.091  12.154 1.00 22.73 ? 112 HIS A NE2 1 
ATOM   846  N  N   . LEU A 1 113 ? 18.132 -5.792  18.020 1.00 17.75 ? 113 LEU A N   1 
ATOM   847  C  CA  . LEU A 1 113 ? 17.549 -6.758  18.957 1.00 17.93 ? 113 LEU A CA  1 
ATOM   848  C  C   . LEU A 1 113 ? 17.554 -6.170  20.341 1.00 13.96 ? 113 LEU A C   1 
ATOM   849  O  O   . LEU A 1 113 ? 18.201 -6.654  21.227 1.00 16.63 ? 113 LEU A O   1 
ATOM   850  C  CB  . LEU A 1 113 ? 18.533 -7.953  19.031 1.00 17.20 ? 113 LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 113 ? 18.650 -8.726  17.702 1.00 28.05 ? 113 LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 113 ? 19.752 -9.727  17.698 1.00 29.71 ? 113 LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 113 ? 17.312 -9.447  17.388 1.00 36.24 ? 113 LEU A CD2 1 
ATOM   854  N  N   . PRO A 1 114 ? 16.915 -5.044  20.541 1.00 19.47 ? 114 PRO A N   1 
ATOM   855  C  CA  . PRO A 1 114 ? 16.947 -4.298  21.806 1.00 16.72 ? 114 PRO A CA  1 
ATOM   856  C  C   . PRO A 1 114 ? 16.489 -5.061  23.029 1.00 15.89 ? 114 PRO A C   1 
ATOM   857  O  O   . PRO A 1 114 ? 16.902 -4.875  24.166 1.00 18.90 ? 114 PRO A O   1 
ATOM   858  C  CB  . PRO A 1 114 ? 16.063 -3.079  21.525 1.00 16.62 ? 114 PRO A CB  1 
ATOM   859  C  CG  . PRO A 1 114 ? 15.235 -3.459  20.338 1.00 14.74 ? 114 PRO A CG  1 
ATOM   860  C  CD  . PRO A 1 114 ? 16.059 -4.393  19.499 1.00 16.28 ? 114 PRO A CD  1 
ATOM   861  N  N   . ASN A 1 115 ? 15.477 -5.944  22.713 1.00 18.71 ? 115 ASN A N   1 
ATOM   862  C  CA  . ASN A 1 115 ? 14.848 -6.733  23.803 1.00 19.57 ? 115 ASN A CA  1 
ATOM   863  C  C   . ASN A 1 115 ? 15.698 -7.938  24.167 1.00 21.27 ? 115 ASN A C   1 
ATOM   864  O  O   . ASN A 1 115 ? 15.714 -8.440  25.294 1.00 21.11 ? 115 ASN A O   1 
ATOM   865  C  CB  . ASN A 1 115 ? 13.419 -7.155  23.355 1.00 20.96 ? 115 ASN A CB  1 
ATOM   866  C  CG  . ASN A 1 115 ? 12.467 -5.980  23.147 1.00 26.53 ? 115 ASN A CG  1 
ATOM   867  O  OD1 . ASN A 1 115 ? 12.395 -5.164  24.085 1.00 33.94 ? 115 ASN A OD1 1 
ATOM   868  N  ND2 . ASN A 1 115 ? 11.806 -5.871  22.014 1.00 37.39 ? 115 ASN A ND2 1 
ATOM   869  N  N   . ASP A 1 116 ? 16.439 -8.444  23.146 1.00 18.38 ? 116 ASP A N   1 
ATOM   870  C  CA  . ASP A 1 116 ? 17.339 -9.608  23.402 1.00 18.97 ? 116 ASP A CA  1 
ATOM   871  C  C   . ASP A 1 116 ? 18.689 -9.167  23.901 1.00 18.47 ? 116 ASP A C   1 
ATOM   872  O  O   . ASP A 1 116 ? 19.472 -9.914  24.524 1.00 16.86 ? 116 ASP A O   1 
ATOM   873  C  CB  . ASP A 1 116 ? 17.469 -10.364 22.029 1.00 22.37 ? 116 ASP A CB  1 
ATOM   874  C  CG  . ASP A 1 116 ? 16.097 -10.838 21.493 1.00 19.72 ? 116 ASP A CG  1 
ATOM   875  O  OD1 . ASP A 1 116 ? 15.531 -11.680 22.206 1.00 28.27 ? 116 ASP A OD1 1 
ATOM   876  O  OD2 . ASP A 1 116 ? 15.602 -10.324 20.530 1.00 33.03 ? 116 ASP A OD2 1 
ATOM   877  N  N   . PHE A 1 117 ? 19.063 -7.853  23.694 1.00 16.31 ? 117 PHE A N   1 
ATOM   878  C  CA  . PHE A 1 117 ? 20.374 -7.353  24.078 1.00 16.51 ? 117 PHE A CA  1 
ATOM   879  C  C   . PHE A 1 117 ? 20.353 -6.920  25.501 1.00 16.89 ? 117 PHE A C   1 
ATOM   880  O  O   . PHE A 1 117 ? 20.488 -5.725  25.853 1.00 16.04 ? 117 PHE A O   1 
ATOM   881  C  CB  . PHE A 1 117 ? 20.740 -6.244  23.024 1.00 17.37 ? 117 PHE A CB  1 
ATOM   882  C  CG  . PHE A 1 117 ? 22.208 -5.947  23.109 1.00 16.05 ? 117 PHE A CG  1 
ATOM   883  C  CD1 . PHE A 1 117 ? 23.171 -6.705  22.452 1.00 19.74 ? 117 PHE A CD1 1 
ATOM   884  C  CD2 . PHE A 1 117 ? 22.614 -4.822  23.827 1.00 18.74 ? 117 PHE A CD2 1 
ATOM   885  C  CE1 . PHE A 1 117 ? 24.539 -6.366  22.625 1.00 21.88 ? 117 PHE A CE1 1 
ATOM   886  C  CE2 . PHE A 1 117 ? 23.958 -4.470  23.997 1.00 18.86 ? 117 PHE A CE2 1 
ATOM   887  C  CZ  . PHE A 1 117 ? 24.933 -5.267  23.396 1.00 15.44 ? 117 PHE A CZ  1 
ATOM   888  N  N   . THR A 1 118 ? 20.249 -7.886  26.428 1.00 16.73 ? 118 THR A N   1 
ATOM   889  C  CA  . THR A 1 118 ? 20.187 -7.641  27.881 1.00 18.18 ? 118 THR A CA  1 
ATOM   890  C  C   . THR A 1 118 ? 21.559 -7.420  28.431 1.00 14.49 ? 118 THR A C   1 
ATOM   891  O  O   . THR A 1 118 ? 22.528 -7.800  27.716 1.00 15.74 ? 118 THR A O   1 
ATOM   892  C  CB  . THR A 1 118 ? 19.460 -8.878  28.545 1.00 19.69 ? 118 THR A CB  1 
ATOM   893  O  OG1 . THR A 1 118 ? 20.221 -10.060 28.321 1.00 17.97 ? 118 THR A OG1 1 
ATOM   894  C  CG2 . THR A 1 118 ? 18.038 -9.084  28.011 1.00 17.08 ? 118 THR A CG2 1 
ATOM   895  N  N   . PRO A 1 119 ? 21.807 -6.921  29.614 1.00 16.56 ? 119 PRO A N   1 
ATOM   896  C  CA  . PRO A 1 119 ? 23.090 -6.712  30.227 1.00 15.48 ? 119 PRO A CA  1 
ATOM   897  C  C   . PRO A 1 119 ? 23.924 -7.979  30.306 1.00 19.26 ? 119 PRO A C   1 
ATOM   898  O  O   . PRO A 1 119 ? 25.105 -7.929  29.984 1.00 16.72 ? 119 PRO A O   1 
ATOM   899  C  CB  . PRO A 1 119 ? 22.861 -6.072  31.624 1.00 14.82 ? 119 PRO A CB  1 
ATOM   900  C  CG  . PRO A 1 119 ? 21.534 -5.346  31.326 1.00 16.42 ? 119 PRO A CG  1 
ATOM   901  C  CD  . PRO A 1 119 ? 20.714 -6.341  30.457 1.00 17.91 ? 119 PRO A CD  1 
ATOM   902  N  N   . ALA A 1 120 ? 23.319 -9.133  30.673 1.00 20.50 ? 120 ALA A N   1 
ATOM   903  C  CA  . ALA A 1 120 ? 24.048 -10.410 30.786 1.00 21.14 ? 120 ALA A CA  1 
ATOM   904  C  C   . ALA A 1 120 ? 24.423 -10.858 29.346 1.00 19.19 ? 120 ALA A C   1 
ATOM   905  O  O   . ALA A 1 120 ? 25.540 -11.341 29.277 1.00 21.64 ? 120 ALA A O   1 
ATOM   906  C  CB  . ALA A 1 120 ? 23.267 -11.540 31.420 1.00 22.21 ? 120 ALA A CB  1 
ATOM   907  N  N   . VAL A 1 121 ? 23.563 -10.714 28.364 1.00 13.53 ? 121 VAL A N   1 
ATOM   908  C  CA  . VAL A 1 121 ? 23.874 -11.072 26.968 1.00 16.49 ? 121 VAL A CA  1 
ATOM   909  C  C   . VAL A 1 121 ? 24.960 -10.114 26.426 1.00 20.53 ? 121 VAL A C   1 
ATOM   910  O  O   . VAL A 1 121 ? 25.961 -10.560 25.832 1.00 15.81 ? 121 VAL A O   1 
ATOM   911  C  CB  . VAL A 1 121 ? 22.601 -11.116 26.124 1.00 22.75 ? 121 VAL A CB  1 
ATOM   912  C  CG1 . VAL A 1 121 ? 22.885 -11.052 24.625 1.00 21.97 ? 121 VAL A CG1 1 
ATOM   913  C  CG2 . VAL A 1 121 ? 21.779 -12.391 26.466 1.00 22.26 ? 121 VAL A CG2 1 
ATOM   914  N  N   . HIS A 1 122 ? 24.856 -8.826  26.606 1.00 16.31 ? 122 HIS A N   1 
ATOM   915  C  CA  . HIS A 1 122 ? 25.902 -7.845  26.257 1.00 14.58 ? 122 HIS A CA  1 
ATOM   916  C  C   . HIS A 1 122 ? 27.195 -8.290  26.910 1.00 15.82 ? 122 HIS A C   1 
ATOM   917  O  O   . HIS A 1 122 ? 28.259 -8.354  26.198 1.00 15.11 ? 122 HIS A O   1 
ATOM   918  C  CB  . HIS A 1 122 ? 25.447 -6.455  26.773 1.00 13.94 ? 122 HIS A CB  1 
ATOM   919  C  CG  . HIS A 1 122 ? 26.422 -5.318  26.591 1.00 21.01 ? 122 HIS A CG  1 
ATOM   920  N  ND1 . HIS A 1 122 ? 26.114 -4.030  26.959 1.00 18.70 ? 122 HIS A ND1 1 
ATOM   921  C  CD2 . HIS A 1 122 ? 27.706 -5.243  26.085 1.00 17.67 ? 122 HIS A CD2 1 
ATOM   922  C  CE1 . HIS A 1 122 ? 27.154 -3.207  26.696 1.00 19.19 ? 122 HIS A CE1 1 
ATOM   923  N  NE2 . HIS A 1 122 ? 28.137 -3.944  26.186 1.00 16.06 ? 122 HIS A NE2 1 
ATOM   924  N  N   . ALA A 1 123 ? 27.325 -8.643  28.183 1.00 12.86 ? 123 ALA A N   1 
ATOM   925  C  CA  . ALA A 1 123 ? 28.547 -9.069  28.779 1.00 15.36 ? 123 ALA A CA  1 
ATOM   926  C  C   . ALA A 1 123 ? 29.162 -10.338 28.101 1.00 18.06 ? 123 ALA A C   1 
ATOM   927  O  O   . ALA A 1 123 ? 30.415 -10.414 27.907 1.00 19.70 ? 123 ALA A O   1 
ATOM   928  C  CB  . ALA A 1 123 ? 28.358 -9.252  30.288 1.00 15.49 ? 123 ALA A CB  1 
ATOM   929  N  N   . SER A 1 124 ? 28.403 -11.349 27.780 1.00 13.54 ? 124 SER A N   1 
ATOM   930  C  CA  . SER A 1 124 ? 28.871 -12.582 27.154 1.00 15.78 ? 124 SER A CA  1 
ATOM   931  C  C   . SER A 1 124 ? 29.358 -12.301 25.726 1.00 18.39 ? 124 SER A C   1 
ATOM   932  O  O   . SER A 1 124 ? 30.431 -12.776 25.392 1.00 16.58 ? 124 SER A O   1 
ATOM   933  C  CB  . SER A 1 124 ? 27.735 -13.642 27.102 1.00 19.77 ? 124 SER A CB  1 
ATOM   934  O  OG  . SER A 1 124 ? 27.592 -14.055 28.519 1.00 18.40 ? 124 SER A OG  1 
ATOM   935  N  N   . LEU A 1 125 ? 28.618 -11.491 24.959 1.00 14.35 ? 125 LEU A N   1 
ATOM   936  C  CA  . LEU A 1 125 ? 28.984 -11.126 23.602 1.00 16.48 ? 125 LEU A CA  1 
ATOM   937  C  C   . LEU A 1 125 ? 30.266 -10.315 23.651 1.00 17.47 ? 125 LEU A C   1 
ATOM   938  O  O   . LEU A 1 125 ? 31.131 -10.536 22.802 1.00 17.18 ? 125 LEU A O   1 
ATOM   939  C  CB  . LEU A 1 125 ? 27.924 -10.339 22.858 1.00 14.67 ? 125 LEU A CB  1 
ATOM   940  C  CG  . LEU A 1 125 ? 26.727 -11.191 22.502 1.00 20.52 ? 125 LEU A CG  1 
ATOM   941  C  CD1 . LEU A 1 125 ? 25.618 -10.285 22.003 1.00 23.87 ? 125 LEU A CD1 1 
ATOM   942  C  CD2 . LEU A 1 125 ? 27.131 -12.214 21.448 1.00 24.19 ? 125 LEU A CD2 1 
ATOM   943  N  N   . ASP A 1 126 ? 30.501 -9.475  24.623 1.00 14.70 ? 126 ASP A N   1 
ATOM   944  C  CA  . ASP A 1 126 ? 31.746 -8.724  24.656 1.00 17.23 ? 126 ASP A CA  1 
ATOM   945  C  C   . ASP A 1 126 ? 32.920 -9.690  24.855 1.00 20.01 ? 126 ASP A C   1 
ATOM   946  O  O   . ASP A 1 126 ? 34.004 -9.530  24.211 1.00 18.46 ? 126 ASP A O   1 
ATOM   947  C  CB  . ASP A 1 126 ? 31.642 -7.644  25.744 1.00 20.88 ? 126 ASP A CB  1 
ATOM   948  C  CG  . ASP A 1 126 ? 32.925 -6.735  25.819 1.00 27.52 ? 126 ASP A CG  1 
ATOM   949  O  OD1 . ASP A 1 126 ? 32.939 -5.850  24.949 1.00 31.21 ? 126 ASP A OD1 1 
ATOM   950  O  OD2 . ASP A 1 126 ? 33.744 -7.007  26.698 1.00 29.32 ? 126 ASP A OD2 1 
ATOM   951  N  N   . LYS A 1 127 ? 32.755 -10.672 25.760 1.00 18.41 ? 127 LYS A N   1 
ATOM   952  C  CA  . LYS A 1 127 ? 33.801 -11.646 26.027 1.00 17.54 ? 127 LYS A CA  1 
ATOM   953  C  C   . LYS A 1 127 ? 34.096 -12.445 24.745 1.00 17.03 ? 127 LYS A C   1 
ATOM   954  O  O   . LYS A 1 127 ? 35.233 -12.738 24.438 1.00 18.36 ? 127 LYS A O   1 
ATOM   955  C  CB  . LYS A 1 127 ? 33.450 -12.620 27.167 1.00 21.57 ? 127 LYS A CB  1 
ATOM   956  C  CG  . LYS A 1 127 ? 33.778 -12.009 28.511 1.00 27.68 ? 127 LYS A CG  1 
ATOM   957  C  CD  . LYS A 1 127 ? 33.029 -12.668 29.652 1.00 26.82 ? 127 LYS A CD  1 
ATOM   958  C  CE  . LYS A 1 127 ? 32.752 -11.648 30.773 1.00 46.94 ? 127 LYS A CE  1 
ATOM   959  N  NZ  . LYS A 1 127 ? 32.161 -10.327 30.251 1.00 54.35 ? 127 LYS A NZ  1 
ATOM   960  N  N   . PHE A 1 128 ? 33.071 -12.840 24.038 1.00 16.89 ? 128 PHE A N   1 
ATOM   961  C  CA  . PHE A 1 128 ? 33.177 -13.569 22.792 1.00 18.68 ? 128 PHE A CA  1 
ATOM   962  C  C   . PHE A 1 128 ? 33.971 -12.758 21.752 1.00 24.36 ? 128 PHE A C   1 
ATOM   963  O  O   . PHE A 1 128 ? 34.931 -13.288 21.149 1.00 20.72 ? 128 PHE A O   1 
ATOM   964  C  CB  . PHE A 1 128 ? 31.788 -13.866 22.186 1.00 18.27 ? 128 PHE A CB  1 
ATOM   965  C  CG  . PHE A 1 128 ? 31.667 -14.334 20.772 1.00 15.54 ? 128 PHE A CG  1 
ATOM   966  C  CD1 . PHE A 1 128 ? 32.316 -15.524 20.400 1.00 20.67 ? 128 PHE A CD1 1 
ATOM   967  C  CD2 . PHE A 1 128 ? 30.904 -13.650 19.832 1.00 19.40 ? 128 PHE A CD2 1 
ATOM   968  C  CE1 . PHE A 1 128 ? 32.214 -15.969 19.070 1.00 17.90 ? 128 PHE A CE1 1 
ATOM   969  C  CE2 . PHE A 1 128 ? 30.791 -14.100 18.526 1.00 21.29 ? 128 PHE A CE2 1 
ATOM   970  C  CZ  . PHE A 1 128 ? 31.455 -15.298 18.136 1.00 23.10 ? 128 PHE A CZ  1 
ATOM   971  N  N   . LEU A 1 129 ? 33.563 -11.483 21.472 1.00 17.80 ? 129 LEU A N   1 
ATOM   972  C  CA  . LEU A 1 129 ? 34.282 -10.644 20.505 1.00 18.66 ? 129 LEU A CA  1 
ATOM   973  C  C   . LEU A 1 129 ? 35.705 -10.413 20.953 1.00 17.03 ? 129 LEU A C   1 
ATOM   974  O  O   . LEU A 1 129 ? 36.600 -10.362 20.084 1.00 21.57 ? 129 LEU A O   1 
ATOM   975  C  CB  . LEU A 1 129 ? 33.500 -9.368  20.234 1.00 16.28 ? 129 LEU A CB  1 
ATOM   976  C  CG  . LEU A 1 129 ? 32.204 -9.623  19.465 1.00 19.37 ? 129 LEU A CG  1 
ATOM   977  C  CD1 . LEU A 1 129 ? 31.390 -8.318  19.481 1.00 21.70 ? 129 LEU A CD1 1 
ATOM   978  C  CD2 . LEU A 1 129 ? 32.473 -10.024 18.043 1.00 16.66 ? 129 LEU A CD2 1 
ATOM   979  N  N   . SER A 1 130 ? 36.001 -10.313 22.244 1.00 16.79 ? 130 SER A N   1 
ATOM   980  C  CA  . SER A 1 130 ? 37.319 -10.235 22.766 1.00 23.67 ? 130 SER A CA  1 
ATOM   981  C  C   . SER A 1 130 ? 38.089 -11.554 22.455 1.00 26.36 ? 130 SER A C   1 
ATOM   982  O  O   . SER A 1 130 ? 39.283 -11.417 22.142 1.00 22.70 ? 130 SER A O   1 
ATOM   983  C  CB  . SER A 1 130 ? 37.445 -10.095 24.319 1.00 25.50 ? 130 SER A CB  1 
ATOM   984  O  OG  . SER A 1 130 ? 37.443 -8.731  24.490 1.00 41.56 ? 130 SER A OG  1 
ATOM   985  N  N   . SER A 1 131 ? 37.474 -12.719 22.606 1.00 19.55 ? 131 SER A N   1 
ATOM   986  C  CA  . SER A 1 131 ? 38.186 -13.972 22.317 1.00 20.06 ? 131 SER A CA  1 
ATOM   987  C  C   . SER A 1 131 ? 38.523 -14.141 20.852 1.00 19.20 ? 131 SER A C   1 
ATOM   988  O  O   . SER A 1 131 ? 39.570 -14.592 20.436 1.00 22.67 ? 131 SER A O   1 
ATOM   989  C  CB  . SER A 1 131 ? 37.254 -15.177 22.652 1.00 22.98 ? 131 SER A CB  1 
ATOM   990  O  OG  . SER A 1 131 ? 37.276 -15.099 24.109 1.00 30.61 ? 131 SER A OG  1 
ATOM   991  N  N   . VAL A 1 132 ? 37.553 -13.772 20.021 1.00 15.77 ? 132 VAL A N   1 
ATOM   992  C  CA  . VAL A 1 132 ? 37.725 -13.794 18.597 1.00 19.48 ? 132 VAL A CA  1 
ATOM   993  C  C   . VAL A 1 132 ? 38.832 -12.788 18.292 1.00 24.87 ? 132 VAL A C   1 
ATOM   994  O  O   . VAL A 1 132 ? 39.745 -13.223 17.578 1.00 24.89 ? 132 VAL A O   1 
ATOM   995  C  CB  . VAL A 1 132 ? 36.461 -13.405 17.836 1.00 21.26 ? 132 VAL A CB  1 
ATOM   996  C  CG1 . VAL A 1 132 ? 36.733 -13.135 16.396 1.00 20.48 ? 132 VAL A CG1 1 
ATOM   997  C  CG2 . VAL A 1 132 ? 35.370 -14.531 17.907 1.00 15.87 ? 132 VAL A CG2 1 
ATOM   998  N  N   . SER A 1 133 ? 38.857 -11.549 18.763 1.00 23.02 ? 133 SER A N   1 
ATOM   999  C  CA  . SER A 1 133 ? 39.922 -10.582 18.509 1.00 21.65 ? 133 SER A CA  1 
ATOM   1000 C  C   . SER A 1 133 ? 41.301 -11.089 18.920 1.00 27.97 ? 133 SER A C   1 
ATOM   1001 O  O   . SER A 1 133 ? 42.277 -10.847 18.188 1.00 25.18 ? 133 SER A O   1 
ATOM   1002 C  CB  . SER A 1 133 ? 39.612 -9.282  19.276 1.00 14.80 ? 133 SER A CB  1 
ATOM   1003 O  OG  . SER A 1 133 ? 38.375 -8.808  18.579 1.00 22.75 ? 133 SER A OG  1 
ATOM   1004 N  N   . THR A 1 134 ? 41.468 -11.761 20.037 1.00 23.19 ? 134 THR A N   1 
ATOM   1005 C  CA  . THR A 1 134 ? 42.695 -12.347 20.521 1.00 26.32 ? 134 THR A CA  1 
ATOM   1006 C  C   . THR A 1 134 ? 43.230 -13.410 19.553 1.00 25.72 ? 134 THR A C   1 
ATOM   1007 O  O   . THR A 1 134 ? 44.451 -13.436 19.322 1.00 26.90 ? 134 THR A O   1 
ATOM   1008 C  CB  . THR A 1 134 ? 42.435 -13.051 21.880 1.00 30.97 ? 134 THR A CB  1 
ATOM   1009 O  OG1 . THR A 1 134 ? 42.147 -12.023 22.823 1.00 33.14 ? 134 THR A OG1 1 
ATOM   1010 C  CG2 . THR A 1 134 ? 43.572 -13.866 22.525 1.00 23.06 ? 134 THR A CG2 1 
ATOM   1011 N  N   . VAL A 1 135 ? 42.345 -14.282 19.038 1.00 20.44 ? 135 VAL A N   1 
ATOM   1012 C  CA  . VAL A 1 135 ? 42.796 -15.329 18.124 1.00 20.93 ? 135 VAL A CA  1 
ATOM   1013 C  C   . VAL A 1 135 ? 43.316 -14.680 16.851 1.00 26.90 ? 135 VAL A C   1 
ATOM   1014 O  O   . VAL A 1 135 ? 44.324 -15.035 16.222 1.00 25.79 ? 135 VAL A O   1 
ATOM   1015 C  CB  . VAL A 1 135 ? 41.658 -16.323 17.780 1.00 21.22 ? 135 VAL A CB  1 
ATOM   1016 C  CG1 . VAL A 1 135 ? 41.987 -17.276 16.684 1.00 20.80 ? 135 VAL A CG1 1 
ATOM   1017 C  CG2 . VAL A 1 135 ? 41.281 -17.098 19.028 1.00 26.30 ? 135 VAL A CG2 1 
ATOM   1018 N  N   . LEU A 1 136 ? 42.609 -13.660 16.334 1.00 22.84 ? 136 LEU A N   1 
ATOM   1019 C  CA  . LEU A 1 136 ? 43.002 -12.990 15.110 1.00 25.32 ? 136 LEU A CA  1 
ATOM   1020 C  C   . LEU A 1 136 ? 44.293 -12.170 15.239 1.00 24.88 ? 136 LEU A C   1 
ATOM   1021 O  O   . LEU A 1 136 ? 44.806 -11.823 14.187 1.00 28.34 ? 136 LEU A O   1 
ATOM   1022 C  CB  . LEU A 1 136 ? 41.883 -12.093 14.543 1.00 23.62 ? 136 LEU A CB  1 
ATOM   1023 C  CG  . LEU A 1 136 ? 40.651 -12.829 13.978 1.00 28.62 ? 136 LEU A CG  1 
ATOM   1024 C  CD1 . LEU A 1 136 ? 39.813 -11.944 13.051 1.00 27.10 ? 136 LEU A CD1 1 
ATOM   1025 C  CD2 . LEU A 1 136 ? 41.026 -14.112 13.271 1.00 31.69 ? 136 LEU A CD2 1 
ATOM   1026 N  N   . THR A 1 137 ? 44.764 -11.838 16.403 1.00 22.47 ? 137 THR A N   1 
ATOM   1027 C  CA  . THR A 1 137 ? 45.975 -11.070 16.554 1.00 25.46 ? 137 THR A CA  1 
ATOM   1028 C  C   . THR A 1 137 ? 47.013 -11.957 17.225 1.00 25.39 ? 137 THR A C   1 
ATOM   1029 O  O   . THR A 1 137 ? 48.024 -11.474 17.725 1.00 29.48 ? 137 THR A O   1 
ATOM   1030 C  CB  . THR A 1 137 ? 45.738 -9.847  17.472 1.00 26.12 ? 137 THR A CB  1 
ATOM   1031 O  OG1 . THR A 1 137 ? 45.369 -10.354 18.761 1.00 24.97 ? 137 THR A OG1 1 
ATOM   1032 C  CG2 . THR A 1 137 ? 44.680 -8.903  16.902 1.00 24.68 ? 137 THR A CG2 1 
ATOM   1033 N  N   . SER A 1 138 ? 46.748 -13.260 17.254 1.00 23.44 ? 138 SER A N   1 
ATOM   1034 C  CA  . SER A 1 138 ? 47.665 -14.153 17.976 1.00 29.86 ? 138 SER A CA  1 
ATOM   1035 C  C   . SER A 1 138 ? 49.020 -14.431 17.328 1.00 34.40 ? 138 SER A C   1 
ATOM   1036 O  O   . SER A 1 138 ? 50.030 -14.713 17.973 1.00 34.02 ? 138 SER A O   1 
ATOM   1037 C  CB  . SER A 1 138 ? 46.903 -15.475 18.188 1.00 34.48 ? 138 SER A CB  1 
ATOM   1038 O  OG  . SER A 1 138 ? 46.508 -16.056 16.911 1.00 41.67 ? 138 SER A OG  1 
ATOM   1039 N  N   . LYS A 1 139 ? 49.013 -14.423 15.994 1.00 36.06 ? 139 LYS A N   1 
ATOM   1040 C  CA  . LYS A 1 139 ? 50.097 -14.735 15.083 1.00 38.60 ? 139 LYS A CA  1 
ATOM   1041 C  C   . LYS A 1 139 ? 51.109 -13.609 15.064 1.00 44.74 ? 139 LYS A C   1 
ATOM   1042 O  O   . LYS A 1 139 ? 52.180 -13.781 14.474 1.00 53.78 ? 139 LYS A O   1 
ATOM   1043 C  CB  . LYS A 1 139 ? 49.628 -15.010 13.632 1.00 36.64 ? 139 LYS A CB  1 
ATOM   1044 C  CG  . LYS A 1 139 ? 49.387 -16.486 13.349 1.00 41.40 ? 139 LYS A CG  1 
ATOM   1045 C  CD  . LYS A 1 139 ? 48.718 -17.240 14.495 1.00 48.29 ? 139 LYS A CD  1 
ATOM   1046 C  CE  . LYS A 1 139 ? 48.056 -18.543 14.090 1.00 55.85 ? 139 LYS A CE  1 
ATOM   1047 N  NZ  . LYS A 1 139 ? 47.593 -18.661 12.655 1.00 67.70 ? 139 LYS A NZ  1 
ATOM   1048 N  N   . TYR A 1 140 ? 50.743 -12.499 15.682 1.00 44.50 ? 140 TYR A N   1 
ATOM   1049 C  CA  . TYR A 1 140 ? 51.602 -11.332 15.856 1.00 49.36 ? 140 TYR A CA  1 
ATOM   1050 C  C   . TYR A 1 140 ? 52.503 -11.759 17.050 1.00 58.39 ? 140 TYR A C   1 
ATOM   1051 O  O   . TYR A 1 140 ? 53.443 -12.526 16.973 1.00 64.86 ? 140 TYR A O   1 
ATOM   1052 C  CB  . TYR A 1 140 ? 50.863 -10.133 16.462 1.00 49.49 ? 140 TYR A CB  1 
ATOM   1053 C  CG  . TYR A 1 140 ? 50.191 -9.176  15.563 1.00 38.41 ? 140 TYR A CG  1 
ATOM   1054 C  CD1 . TYR A 1 140 ? 50.817 -8.880  14.348 1.00 35.22 ? 140 TYR A CD1 1 
ATOM   1055 C  CD2 . TYR A 1 140 ? 48.954 -8.624  15.899 1.00 36.81 ? 140 TYR A CD2 1 
ATOM   1056 C  CE1 . TYR A 1 140 ? 50.218 -8.012  13.454 1.00 34.01 ? 140 TYR A CE1 1 
ATOM   1057 C  CE2 . TYR A 1 140 ? 48.327 -7.769  14.993 1.00 31.68 ? 140 TYR A CE2 1 
ATOM   1058 C  CZ  . TYR A 1 140 ? 48.976 -7.508  13.807 1.00 36.58 ? 140 TYR A CZ  1 
ATOM   1059 O  OH  . TYR A 1 140 ? 48.422 -6.723  12.864 1.00 46.22 ? 140 TYR A OH  1 
ATOM   1060 N  N   . ARG A 1 141 ? 52.083 -11.225 18.201 1.00 56.88 ? 141 ARG A N   1 
ATOM   1061 C  CA  . ARG A 1 141 ? 52.547 -11.355 19.553 1.00 58.36 ? 141 ARG A CA  1 
ATOM   1062 C  C   . ARG A 1 141 ? 51.384 -11.955 20.400 1.00 61.00 ? 141 ARG A C   1 
ATOM   1063 O  O   . ARG A 1 141 ? 50.223 -11.755 19.944 1.00 63.33 ? 141 ARG A O   1 
ATOM   1064 C  CB  . ARG A 1 141 ? 53.004 -10.055 20.208 1.00 60.22 ? 141 ARG A CB  1 
ATOM   1065 C  CG  . ARG A 1 141 ? 52.637 -8.723  19.629 1.00 58.16 ? 141 ARG A CG  1 
ATOM   1066 C  CD  . ARG A 1 141 ? 51.569 -7.973  20.421 1.00 67.04 ? 141 ARG A CD  1 
ATOM   1067 N  NE  . ARG A 1 141 ? 51.743 -7.986  21.878 1.00 74.84 ? 141 ARG A NE  1 
ATOM   1068 C  CZ  . ARG A 1 141 ? 51.598 -7.009  22.783 1.00 72.45 ? 141 ARG A CZ  1 
ATOM   1069 N  NH1 . ARG A 1 141 ? 51.243 -5.755  22.424 1.00 59.03 ? 141 ARG A NH1 1 
ATOM   1070 N  NH2 . ARG A 1 141 ? 51.808 -7.278  24.096 1.00 62.46 ? 141 ARG A NH2 1 
ATOM   1071 O  OXT . ARG A 1 141 ? 51.660 -12.647 21.413 1.00 65.61 ? 141 ARG A OXT 1 
ATOM   1072 N  N   . VAL B 2 1   ? 33.100 17.404  19.114 1.00 57.95 ? 1   VAL B N   1 
ATOM   1073 C  CA  . VAL B 2 1   ? 34.129 18.359  19.712 1.00 57.96 ? 1   VAL B CA  1 
ATOM   1074 C  C   . VAL B 2 1   ? 35.047 18.875  18.610 1.00 61.33 ? 1   VAL B C   1 
ATOM   1075 O  O   . VAL B 2 1   ? 36.280 19.010  18.821 1.00 63.34 ? 1   VAL B O   1 
ATOM   1076 C  CB  . VAL B 2 1   ? 34.930 17.553  20.749 1.00 55.55 ? 1   VAL B CB  1 
ATOM   1077 C  CG1 . VAL B 2 1   ? 35.769 18.394  21.741 1.00 58.83 ? 1   VAL B CG1 1 
ATOM   1078 C  CG2 . VAL B 2 1   ? 33.935 16.630  21.466 1.00 59.34 ? 1   VAL B CG2 1 
ATOM   1079 N  N   . GLN B 2 2   ? 34.492 19.124  17.455 1.00 58.47 ? 2   GLN B N   1 
ATOM   1080 C  CA  . GLN B 2 2   ? 34.923 19.537  16.165 1.00 52.53 ? 2   GLN B CA  1 
ATOM   1081 C  C   . GLN B 2 2   ? 33.934 18.875  15.153 1.00 51.40 ? 2   GLN B C   1 
ATOM   1082 O  O   . GLN B 2 2   ? 34.240 17.858  14.526 1.00 52.52 ? 2   GLN B O   1 
ATOM   1083 C  CB  . GLN B 2 2   ? 36.328 19.092  15.784 1.00 54.71 ? 2   GLN B CB  1 
ATOM   1084 C  CG  . GLN B 2 2   ? 37.326 20.209  16.250 1.00 64.47 ? 2   GLN B CG  1 
ATOM   1085 C  CD  . GLN B 2 2   ? 38.543 20.229  15.319 1.00 83.46 ? 2   GLN B CD  1 
ATOM   1086 O  OE1 . GLN B 2 2   ? 38.227 20.287  14.087 1.00 86.08 ? 2   GLN B OE1 1 
ATOM   1087 N  NE2 . GLN B 2 2   ? 39.753 20.165  15.920 1.00 82.52 ? 2   GLN B NE2 1 
ATOM   1088 N  N   . LEU B 2 3   ? 32.749 19.510  15.140 1.00 45.66 ? 3   LEU B N   1 
ATOM   1089 C  CA  . LEU B 2 3   ? 31.604 19.086  14.404 1.00 44.32 ? 3   LEU B CA  1 
ATOM   1090 C  C   . LEU B 2 3   ? 31.018 20.115  13.448 1.00 43.71 ? 3   LEU B C   1 
ATOM   1091 O  O   . LEU B 2 3   ? 31.090 21.314  13.732 1.00 52.01 ? 3   LEU B O   1 
ATOM   1092 C  CB  . LEU B 2 3   ? 30.355 18.812  15.356 1.00 41.39 ? 3   LEU B CB  1 
ATOM   1093 C  CG  . LEU B 2 3   ? 30.336 17.464  16.088 1.00 51.41 ? 3   LEU B CG  1 
ATOM   1094 C  CD1 . LEU B 2 3   ? 30.394 17.579  17.606 1.00 47.20 ? 3   LEU B CD1 1 
ATOM   1095 C  CD2 . LEU B 2 3   ? 29.103 16.665  15.654 1.00 52.60 ? 3   LEU B CD2 1 
ATOM   1096 N  N   . SER B 2 4   ? 30.360 19.596  12.429 1.00 40.40 ? 4   SER B N   1 
ATOM   1097 C  CA  . SER B 2 4   ? 29.705 20.532  11.473 1.00 47.20 ? 4   SER B CA  1 
ATOM   1098 C  C   . SER B 2 4   ? 28.530 21.151  12.235 1.00 48.71 ? 4   SER B C   1 
ATOM   1099 O  O   . SER B 2 4   ? 28.062 20.497  13.198 1.00 51.02 ? 4   SER B O   1 
ATOM   1100 C  CB  . SER B 2 4   ? 29.359 19.895  10.146 1.00 49.80 ? 4   SER B CB  1 
ATOM   1101 O  OG  . SER B 2 4   ? 28.343 18.964  9.923  1.00 60.78 ? 4   SER B OG  1 
ATOM   1102 N  N   . GLY B 2 5   ? 28.007 22.317  11.805 1.00 45.81 ? 5   GLY B N   1 
ATOM   1103 C  CA  . GLY B 2 5   ? 26.869 22.875  12.531 1.00 40.98 ? 5   GLY B CA  1 
ATOM   1104 C  C   . GLY B 2 5   ? 25.652 21.973  12.316 1.00 43.75 ? 5   GLY B C   1 
ATOM   1105 O  O   . GLY B 2 5   ? 24.602 22.176  12.971 1.00 48.04 ? 5   GLY B O   1 
ATOM   1106 N  N   . GLU B 2 6   ? 25.653 21.044  11.359 1.00 38.80 ? 6   GLU B N   1 
ATOM   1107 C  CA  . GLU B 2 6   ? 24.500 20.194  11.142 1.00 41.26 ? 6   GLU B CA  1 
ATOM   1108 C  C   . GLU B 2 6   ? 24.597 18.864  11.954 1.00 41.10 ? 6   GLU B C   1 
ATOM   1109 O  O   . GLU B 2 6   ? 23.561 18.213  12.159 1.00 36.04 ? 6   GLU B O   1 
ATOM   1110 C  CB  . GLU B 2 6   ? 24.303 19.801  9.676  1.00 53.00 ? 6   GLU B CB  1 
ATOM   1111 C  CG  . GLU B 2 6   ? 25.033 20.662  8.662  1.00 76.45 ? 6   GLU B CG  1 
ATOM   1112 C  CD  . GLU B 2 6   ? 24.350 21.969  8.242  1.00 81.19 ? 6   GLU B CD  1 
ATOM   1113 O  OE1 . GLU B 2 6   ? 23.366 21.930  7.408  1.00 70.04 ? 6   GLU B OE1 1 
ATOM   1114 O  OE2 . GLU B 2 6   ? 24.849 23.058  8.734  1.00 68.61 ? 6   GLU B OE2 1 
ATOM   1115 N  N   . GLU B 2 7   ? 25.842 18.506  12.229 1.00 34.62 ? 7   GLU B N   1 
ATOM   1116 C  CA  . GLU B 2 7   ? 26.120 17.316  12.976 1.00 34.43 ? 7   GLU B CA  1 
ATOM   1117 C  C   . GLU B 2 7   ? 25.725 17.677  14.432 1.00 37.06 ? 7   GLU B C   1 
ATOM   1118 O  O   . GLU B 2 7   ? 25.073 16.896  15.104 1.00 33.52 ? 7   GLU B O   1 
ATOM   1119 C  CB  . GLU B 2 7   ? 27.570 17.048  12.884 1.00 28.49 ? 7   GLU B CB  1 
ATOM   1120 C  CG  . GLU B 2 7   ? 27.889 16.151  11.620 1.00 40.60 ? 7   GLU B CG  1 
ATOM   1121 C  CD  . GLU B 2 7   ? 29.315 15.683  12.074 1.00 53.72 ? 7   GLU B CD  1 
ATOM   1122 O  OE1 . GLU B 2 7   ? 30.208 16.539  11.915 1.00 45.29 ? 7   GLU B OE1 1 
ATOM   1123 O  OE2 . GLU B 2 7   ? 29.519 14.608  12.699 1.00 47.92 ? 7   GLU B OE2 1 
ATOM   1124 N  N   . LYS B 2 8   ? 26.179 18.863  14.827 1.00 34.25 ? 8   LYS B N   1 
ATOM   1125 C  CA  . LYS B 2 8   ? 25.883 19.423  16.153 1.00 27.79 ? 8   LYS B CA  1 
ATOM   1126 C  C   . LYS B 2 8   ? 24.393 19.517  16.357 1.00 26.38 ? 8   LYS B C   1 
ATOM   1127 O  O   . LYS B 2 8   ? 23.878 19.172  17.380 1.00 26.79 ? 8   LYS B O   1 
ATOM   1128 C  CB  . LYS B 2 8   ? 26.420 20.817  16.110 1.00 33.67 ? 8   LYS B CB  1 
ATOM   1129 C  CG  . LYS B 2 8   ? 27.113 21.254  17.380 1.00 40.65 ? 8   LYS B CG  1 
ATOM   1130 C  CD  . LYS B 2 8   ? 27.698 22.642  17.122 1.00 53.08 ? 8   LYS B CD  1 
ATOM   1131 C  CE  . LYS B 2 8   ? 29.030 22.565  16.347 1.00 58.15 ? 8   LYS B CE  1 
ATOM   1132 N  NZ  . LYS B 2 8   ? 30.134 22.818  17.401 1.00 66.28 ? 8   LYS B NZ  1 
ATOM   1133 N  N   . ALA B 2 9   ? 23.642 19.987  15.338 1.00 28.28 ? 9   ALA B N   1 
ATOM   1134 C  CA  . ALA B 2 9   ? 22.208 20.083  15.387 1.00 29.07 ? 9   ALA B CA  1 
ATOM   1135 C  C   . ALA B 2 9   ? 21.607 18.676  15.554 1.00 34.17 ? 9   ALA B C   1 
ATOM   1136 O  O   . ALA B 2 9   ? 20.655 18.487  16.323 1.00 30.25 ? 9   ALA B O   1 
ATOM   1137 C  CB  . ALA B 2 9   ? 21.554 20.737  14.168 1.00 21.37 ? 9   ALA B CB  1 
ATOM   1138 N  N   . ALA B 2 10  ? 22.083 17.652  14.825 1.00 31.47 ? 10  ALA B N   1 
ATOM   1139 C  CA  . ALA B 2 10  ? 21.606 16.277  14.950 1.00 28.73 ? 10  ALA B CA  1 
ATOM   1140 C  C   . ALA B 2 10  ? 21.866 15.729  16.401 1.00 23.64 ? 10  ALA B C   1 
ATOM   1141 O  O   . ALA B 2 10  ? 21.023 15.028  16.943 1.00 23.68 ? 10  ALA B O   1 
ATOM   1142 C  CB  . ALA B 2 10  ? 22.260 15.357  13.891 1.00 20.60 ? 10  ALA B CB  1 
ATOM   1143 N  N   . VAL B 2 11  ? 23.023 16.052  16.966 1.00 24.14 ? 11  VAL B N   1 
ATOM   1144 C  CA  . VAL B 2 11  ? 23.447 15.642  18.299 1.00 27.22 ? 11  VAL B CA  1 
ATOM   1145 C  C   . VAL B 2 11  ? 22.455 16.187  19.331 1.00 28.63 ? 11  VAL B C   1 
ATOM   1146 O  O   . VAL B 2 11  ? 21.807 15.494  20.133 1.00 26.73 ? 11  VAL B O   1 
ATOM   1147 C  CB  . VAL B 2 11  ? 24.906 16.080  18.552 1.00 27.48 ? 11  VAL B CB  1 
ATOM   1148 C  CG1 . VAL B 2 11  ? 25.297 15.981  20.042 1.00 21.72 ? 11  VAL B CG1 1 
ATOM   1149 C  CG2 . VAL B 2 11  ? 25.860 15.224  17.701 1.00 22.55 ? 11  VAL B CG2 1 
ATOM   1150 N  N   . LEU B 2 12  ? 22.203 17.503  19.222 1.00 25.84 ? 12  LEU B N   1 
ATOM   1151 C  CA  . LEU B 2 12  ? 21.294 18.190  20.158 1.00 26.63 ? 12  LEU B CA  1 
ATOM   1152 C  C   . LEU B 2 12  ? 19.869 17.721  20.009 1.00 20.68 ? 12  LEU B C   1 
ATOM   1153 O  O   . LEU B 2 12  ? 19.232 17.576  21.072 1.00 23.00 ? 12  LEU B O   1 
ATOM   1154 C  CB  . LEU B 2 12  ? 21.411 19.726  20.046 1.00 26.24 ? 12  LEU B CB  1 
ATOM   1155 C  CG  . LEU B 2 12  ? 22.765 20.295  20.526 1.00 33.60 ? 12  LEU B CG  1 
ATOM   1156 C  CD1 . LEU B 2 12  ? 22.678 21.819  20.317 1.00 42.91 ? 12  LEU B CD1 1 
ATOM   1157 C  CD2 . LEU B 2 12  ? 23.180 20.015  21.933 1.00 30.29 ? 12  LEU B CD2 1 
ATOM   1158 N  N   . ALA B 2 13  ? 19.412 17.447  18.795 1.00 19.86 ? 13  ALA B N   1 
ATOM   1159 C  CA  . ALA B 2 13  ? 18.072 16.970  18.583 1.00 20.69 ? 13  ALA B CA  1 
ATOM   1160 C  C   . ALA B 2 13  ? 17.859 15.606  19.252 1.00 26.04 ? 13  ALA B C   1 
ATOM   1161 O  O   . ALA B 2 13  ? 16.748 15.332  19.719 1.00 24.77 ? 13  ALA B O   1 
ATOM   1162 C  CB  . ALA B 2 13  ? 17.730 16.792  17.132 1.00 21.03 ? 13  ALA B CB  1 
ATOM   1163 N  N   . LEU B 2 14  ? 18.913 14.752  19.263 1.00 24.29 ? 14  LEU B N   1 
ATOM   1164 C  CA  . LEU B 2 14  ? 18.720 13.451  19.888 1.00 22.00 ? 14  LEU B CA  1 
ATOM   1165 C  C   . LEU B 2 14  ? 18.663 13.653  21.419 1.00 19.04 ? 14  LEU B C   1 
ATOM   1166 O  O   . LEU B 2 14  ? 17.876 13.008  22.117 1.00 19.50 ? 14  LEU B O   1 
ATOM   1167 C  CB  . LEU B 2 14  ? 19.858 12.461  19.567 1.00 25.44 ? 14  LEU B CB  1 
ATOM   1168 C  CG  . LEU B 2 14  ? 19.571 11.008  20.103 1.00 24.90 ? 14  LEU B CG  1 
ATOM   1169 C  CD1 . LEU B 2 14  ? 18.568 10.333  19.162 1.00 24.79 ? 14  LEU B CD1 1 
ATOM   1170 C  CD2 . LEU B 2 14  ? 20.866 10.298  20.222 1.00 28.48 ? 14  LEU B CD2 1 
ATOM   1171 N  N   . TRP B 2 15  ? 19.541 14.540  21.926 1.00 15.00 ? 15  TRP B N   1 
ATOM   1172 C  CA  . TRP B 2 15  ? 19.568 14.772  23.352 1.00 21.54 ? 15  TRP B CA  1 
ATOM   1173 C  C   . TRP B 2 15  ? 18.219 15.304  23.875 1.00 24.00 ? 15  TRP B C   1 
ATOM   1174 O  O   . TRP B 2 15  ? 17.985 15.097  25.087 1.00 20.16 ? 15  TRP B O   1 
ATOM   1175 C  CB  . TRP B 2 15  ? 20.708 15.707  23.747 1.00 21.21 ? 15  TRP B CB  1 
ATOM   1176 C  CG  . TRP B 2 15  ? 21.106 15.431  25.158 1.00 22.34 ? 15  TRP B CG  1 
ATOM   1177 C  CD1 . TRP B 2 15  ? 20.660 16.151  26.228 1.00 23.17 ? 15  TRP B CD1 1 
ATOM   1178 C  CD2 . TRP B 2 15  ? 21.918 14.363  25.679 1.00 21.84 ? 15  TRP B CD2 1 
ATOM   1179 N  NE1 . TRP B 2 15  ? 21.202 15.610  27.395 1.00 24.10 ? 15  TRP B NE1 1 
ATOM   1180 C  CE2 . TRP B 2 15  ? 21.931 14.487  27.089 1.00 27.38 ? 15  TRP B CE2 1 
ATOM   1181 C  CE3 . TRP B 2 15  ? 22.641 13.324  25.113 1.00 26.03 ? 15  TRP B CE3 1 
ATOM   1182 C  CZ2 . TRP B 2 15  ? 22.646 13.649  27.948 1.00 19.79 ? 15  TRP B CZ2 1 
ATOM   1183 C  CZ3 . TRP B 2 15  ? 23.320 12.449  25.972 1.00 32.38 ? 15  TRP B CZ3 1 
ATOM   1184 C  CH2 . TRP B 2 15  ? 23.326 12.626  27.383 1.00 28.05 ? 15  TRP B CH2 1 
ATOM   1185 N  N   . ASP B 2 16  ? 17.339 15.925  23.086 1.00 20.85 ? 16  ASP B N   1 
ATOM   1186 C  CA  . ASP B 2 16  ? 16.038 16.376  23.486 1.00 21.69 ? 16  ASP B CA  1 
ATOM   1187 C  C   . ASP B 2 16  ? 15.117 15.196  23.917 1.00 24.88 ? 16  ASP B C   1 
ATOM   1188 O  O   . ASP B 2 16  ? 14.202 15.386  24.688 1.00 19.79 ? 16  ASP B O   1 
ATOM   1189 C  CB  . ASP B 2 16  ? 15.262 17.058  22.368 1.00 20.02 ? 16  ASP B CB  1 
ATOM   1190 C  CG  . ASP B 2 16  ? 15.573 18.534  22.190 1.00 27.25 ? 16  ASP B CG  1 
ATOM   1191 O  OD1 . ASP B 2 16  ? 16.252 19.129  23.013 1.00 27.01 ? 16  ASP B OD1 1 
ATOM   1192 O  OD2 . ASP B 2 16  ? 15.052 19.018  21.155 1.00 34.32 ? 16  ASP B OD2 1 
ATOM   1193 N  N   . LYS B 2 17  ? 15.467 14.020  23.339 1.00 19.74 ? 17  LYS B N   1 
ATOM   1194 C  CA  . LYS B 2 17  ? 14.764 12.790  23.581 1.00 18.44 ? 17  LYS B CA  1 
ATOM   1195 C  C   . LYS B 2 17  ? 15.430 11.857  24.588 1.00 18.67 ? 17  LYS B C   1 
ATOM   1196 O  O   . LYS B 2 17  ? 14.790 10.824  24.908 1.00 21.46 ? 17  LYS B O   1 
ATOM   1197 C  CB  . LYS B 2 17  ? 14.534 12.034  22.270 1.00 20.89 ? 17  LYS B CB  1 
ATOM   1198 C  CG  . LYS B 2 17  ? 14.023 13.015  21.215 1.00 25.87 ? 17  LYS B CG  1 
ATOM   1199 C  CD  . LYS B 2 17  ? 13.626 12.180  19.995 1.00 35.53 ? 17  LYS B CD  1 
ATOM   1200 C  CE  . LYS B 2 17  ? 13.459 12.969  18.701 1.00 48.94 ? 17  LYS B CE  1 
ATOM   1201 N  NZ  . LYS B 2 17  ? 14.424 14.127  18.598 1.00 52.04 ? 17  LYS B NZ  1 
ATOM   1202 N  N   . VAL B 2 18  ? 16.559 12.235  25.177 1.00 16.87 ? 18  VAL B N   1 
ATOM   1203 C  CA  . VAL B 2 18  ? 17.195 11.398  26.153 1.00 16.92 ? 18  VAL B CA  1 
ATOM   1204 C  C   . VAL B 2 18  ? 16.626 11.562  27.570 1.00 20.30 ? 18  VAL B C   1 
ATOM   1205 O  O   . VAL B 2 18  ? 16.663 12.654  28.141 1.00 18.94 ? 18  VAL B O   1 
ATOM   1206 C  CB  . VAL B 2 18  ? 18.755 11.636  26.207 1.00 17.57 ? 18  VAL B CB  1 
ATOM   1207 C  CG1 . VAL B 2 18  ? 19.463 10.959  27.366 1.00 18.62 ? 18  VAL B CG1 1 
ATOM   1208 C  CG2 . VAL B 2 18  ? 19.259 11.218  24.813 1.00 17.83 ? 18  VAL B CG2 1 
ATOM   1209 N  N   . ASN B 2 19  ? 16.098 10.430  28.082 1.00 17.26 ? 19  ASN B N   1 
ATOM   1210 C  CA  . ASN B 2 19  ? 15.625 10.403  29.483 1.00 13.14 ? 19  ASN B CA  1 
ATOM   1211 C  C   . ASN B 2 19  ? 16.879 10.156  30.262 1.00 17.68 ? 19  ASN B C   1 
ATOM   1212 O  O   . ASN B 2 19  ? 17.424 8.976   30.267 1.00 17.62 ? 19  ASN B O   1 
ATOM   1213 C  CB  . ASN B 2 19  ? 14.568 9.304   29.524 1.00 15.83 ? 19  ASN B CB  1 
ATOM   1214 C  CG  . ASN B 2 19  ? 14.059 9.139   30.940 1.00 20.27 ? 19  ASN B CG  1 
ATOM   1215 O  OD1 . ASN B 2 19  ? 14.745 9.426   31.906 1.00 18.23 ? 19  ASN B OD1 1 
ATOM   1216 N  ND2 . ASN B 2 19  ? 12.844 8.702   31.139 1.00 19.58 ? 19  ASN B ND2 1 
ATOM   1217 N  N   . GLU B 2 20  ? 17.431 11.126  31.022 1.00 12.19 ? 20  GLU B N   1 
ATOM   1218 C  CA  . GLU B 2 20  ? 18.681 10.953  31.659 1.00 18.82 ? 20  GLU B CA  1 
ATOM   1219 C  C   . GLU B 2 20  ? 18.739 9.906   32.741 1.00 23.28 ? 20  GLU B C   1 
ATOM   1220 O  O   . GLU B 2 20  ? 19.800 9.329   33.089 1.00 18.54 ? 20  GLU B O   1 
ATOM   1221 C  CB  . GLU B 2 20  ? 19.219 12.300  32.250 1.00 23.45 ? 20  GLU B CB  1 
ATOM   1222 C  CG  . GLU B 2 20  ? 19.492 13.267  31.059 1.00 26.34 ? 20  GLU B CG  1 
ATOM   1223 C  CD  . GLU B 2 20  ? 19.942 14.639  31.603 1.00 34.88 ? 20  GLU B CD  1 
ATOM   1224 O  OE1 . GLU B 2 20  ? 19.740 14.949  32.823 1.00 29.53 ? 20  GLU B OE1 1 
ATOM   1225 O  OE2 . GLU B 2 20  ? 20.489 15.420  30.759 1.00 34.31 ? 20  GLU B OE2 1 
ATOM   1226 N  N   . GLU B 2 21  ? 17.571 9.632   33.341 1.00 22.23 ? 21  GLU B N   1 
ATOM   1227 C  CA  . GLU B 2 21  ? 17.590 8.579   34.424 1.00 28.12 ? 21  GLU B CA  1 
ATOM   1228 C  C   . GLU B 2 21  ? 17.579 7.136   33.875 1.00 17.35 ? 21  GLU B C   1 
ATOM   1229 O  O   . GLU B 2 21  ? 18.315 6.307   34.383 1.00 22.29 ? 21  GLU B O   1 
ATOM   1230 C  CB  . GLU B 2 21  ? 16.378 8.877   35.295 1.00 39.56 ? 21  GLU B CB  1 
ATOM   1231 C  CG  . GLU B 2 21  ? 16.241 7.869   36.498 1.00 53.83 ? 21  GLU B CG  1 
ATOM   1232 C  CD  . GLU B 2 21  ? 14.934 8.360   37.201 1.00 61.86 ? 21  GLU B CD  1 
ATOM   1233 O  OE1 . GLU B 2 21  ? 13.924 8.488   36.447 1.00 60.63 ? 21  GLU B OE1 1 
ATOM   1234 O  OE2 . GLU B 2 21  ? 15.045 8.664   38.406 1.00 62.69 ? 21  GLU B OE2 1 
ATOM   1235 N  N   . GLU B 2 22  ? 16.751 6.891   32.890 1.00 17.04 ? 22  GLU B N   1 
ATOM   1236 C  CA  . GLU B 2 22  ? 16.602 5.609   32.219 1.00 21.65 ? 22  GLU B CA  1 
ATOM   1237 C  C   . GLU B 2 22  ? 17.916 5.308   31.473 1.00 19.65 ? 22  GLU B C   1 
ATOM   1238 O  O   . GLU B 2 22  ? 18.494 4.275   31.767 1.00 17.00 ? 22  GLU B O   1 
ATOM   1239 C  CB  . GLU B 2 22  ? 15.499 5.706   31.259 1.00 23.61 ? 22  GLU B CB  1 
ATOM   1240 C  CG  . GLU B 2 22  ? 14.574 4.744   30.673 1.00 48.10 ? 22  GLU B CG  1 
ATOM   1241 C  CD  . GLU B 2 22  ? 13.640 5.148   29.523 1.00 61.43 ? 22  GLU B CD  1 
ATOM   1242 O  OE1 . GLU B 2 22  ? 14.033 5.389   28.313 1.00 59.90 ? 22  GLU B OE1 1 
ATOM   1243 O  OE2 . GLU B 2 22  ? 12.376 5.283   29.750 1.00 64.30 ? 22  GLU B OE2 1 
ATOM   1244 N  N   . VAL B 2 23  ? 18.360 6.236   30.636 1.00 17.15 ? 23  VAL B N   1 
ATOM   1245 C  CA  . VAL B 2 23  ? 19.658 5.994   29.944 1.00 15.06 ? 23  VAL B CA  1 
ATOM   1246 C  C   . VAL B 2 23  ? 20.860 5.978   30.867 1.00 16.52 ? 23  VAL B C   1 
ATOM   1247 O  O   . VAL B 2 23  ? 21.763 5.105   30.753 1.00 17.74 ? 23  VAL B O   1 
ATOM   1248 C  CB  . VAL B 2 23  ? 19.842 7.066   28.855 1.00 17.39 ? 23  VAL B CB  1 
ATOM   1249 C  CG1 . VAL B 2 23  ? 21.275 7.021   28.281 1.00 17.52 ? 23  VAL B CG1 1 
ATOM   1250 C  CG2 . VAL B 2 23  ? 18.728 6.878   27.787 1.00 16.07 ? 23  VAL B CG2 1 
ATOM   1251 N  N   . GLY B 2 24  ? 20.955 6.916   31.820 1.00 14.81 ? 24  GLY B N   1 
ATOM   1252 C  CA  . GLY B 2 24  ? 22.046 6.966   32.765 1.00 15.67 ? 24  GLY B CA  1 
ATOM   1253 C  C   . GLY B 2 24  ? 22.131 5.728   33.652 1.00 20.65 ? 24  GLY B C   1 
ATOM   1254 O  O   . GLY B 2 24  ? 23.239 5.213   33.878 1.00 17.25 ? 24  GLY B O   1 
ATOM   1255 N  N   . GLY B 2 25  ? 20.959 5.337   34.241 1.00 16.00 ? 25  GLY B N   1 
ATOM   1256 C  CA  . GLY B 2 25  ? 20.974 4.146   35.105 1.00 17.51 ? 25  GLY B CA  1 
ATOM   1257 C  C   . GLY B 2 25  ? 21.423 2.862   34.292 1.00 17.36 ? 25  GLY B C   1 
ATOM   1258 O  O   . GLY B 2 25  ? 22.207 2.032   34.832 1.00 15.22 ? 25  GLY B O   1 
ATOM   1259 N  N   . GLU B 2 26  ? 20.855 2.770   33.066 1.00 17.28 ? 26  GLU B N   1 
ATOM   1260 C  CA  . GLU B 2 26  ? 21.262 1.628   32.211 1.00 17.93 ? 26  GLU B CA  1 
ATOM   1261 C  C   . GLU B 2 26  ? 22.740 1.676   31.785 1.00 16.70 ? 26  GLU B C   1 
ATOM   1262 O  O   . GLU B 2 26  ? 23.409 0.607   31.876 1.00 16.13 ? 26  GLU B O   1 
ATOM   1263 C  CB  . GLU B 2 26  ? 20.338 1.566   31.005 1.00 13.09 ? 26  GLU B CB  1 
ATOM   1264 C  CG  . GLU B 2 26  ? 20.689 0.306   30.173 1.00 13.92 ? 26  GLU B CG  1 
ATOM   1265 C  CD  . GLU B 2 26  ? 19.843 0.130   28.998 1.00 16.18 ? 26  GLU B CD  1 
ATOM   1266 O  OE1 . GLU B 2 26  ? 18.716 0.657   28.850 1.00 17.68 ? 26  GLU B OE1 1 
ATOM   1267 O  OE2 . GLU B 2 26  ? 20.309 -0.636  28.105 1.00 17.86 ? 26  GLU B OE2 1 
ATOM   1268 N  N   . ALA B 2 27  ? 23.239 2.858   31.346 1.00 14.60 ? 27  ALA B N   1 
ATOM   1269 C  CA  . ALA B 2 27  ? 24.654 2.956   30.953 1.00 15.73 ? 27  ALA B CA  1 
ATOM   1270 C  C   . ALA B 2 27  ? 25.528 2.561   32.125 1.00 17.12 ? 27  ALA B C   1 
ATOM   1271 O  O   . ALA B 2 27  ? 26.463 1.731   32.054 1.00 14.28 ? 27  ALA B O   1 
ATOM   1272 C  CB  . ALA B 2 27  ? 25.001 4.352   30.503 1.00 13.72 ? 27  ALA B CB  1 
ATOM   1273 N  N   . LEU B 2 28  ? 25.305 3.178   33.346 1.00 13.64 ? 28  LEU B N   1 
ATOM   1274 C  CA  . LEU B 2 28  ? 26.153 2.790   34.471 1.00 15.61 ? 28  LEU B CA  1 
ATOM   1275 C  C   . LEU B 2 28  ? 26.031 1.302   34.885 1.00 15.97 ? 28  LEU B C   1 
ATOM   1276 O  O   . LEU B 2 28  ? 27.057 0.664   35.243 1.00 16.05 ? 28  LEU B O   1 
ATOM   1277 C  CB  . LEU B 2 28  ? 25.994 3.704   35.702 1.00 14.11 ? 28  LEU B CB  1 
ATOM   1278 C  CG  . LEU B 2 28  ? 27.018 3.636   36.837 1.00 19.34 ? 28  LEU B CG  1 
ATOM   1279 C  CD1 . LEU B 2 28  ? 28.375 4.137   36.357 1.00 19.53 ? 28  LEU B CD1 1 
ATOM   1280 C  CD2 . LEU B 2 28  ? 26.554 4.513   38.039 1.00 25.90 ? 28  LEU B CD2 1 
ATOM   1281 N  N   . GLY B 2 29  ? 24.830 0.741   34.939 1.00 16.10 ? 29  GLY B N   1 
ATOM   1282 C  CA  . GLY B 2 29  ? 24.630 -0.619  35.287 1.00 17.08 ? 29  GLY B CA  1 
ATOM   1283 C  C   . GLY B 2 29  ? 25.390 -1.492  34.272 1.00 16.60 ? 29  GLY B C   1 
ATOM   1284 O  O   . GLY B 2 29  ? 26.051 -2.437  34.712 1.00 16.77 ? 29  GLY B O   1 
ATOM   1285 N  N   . ARG B 2 30  ? 25.198 -1.252  32.999 1.00 12.44 ? 30  ARG B N   1 
ATOM   1286 C  CA  . ARG B 2 30  ? 25.921 -2.107  31.993 1.00 12.83 ? 30  ARG B CA  1 
ATOM   1287 C  C   . ARG B 2 30  ? 27.404 -1.975  32.179 1.00 15.57 ? 30  ARG B C   1 
ATOM   1288 O  O   . ARG B 2 30  ? 28.176 -2.971  32.048 1.00 17.28 ? 30  ARG B O   1 
ATOM   1289 C  CB  . ARG B 2 30  ? 25.498 -1.712  30.629 1.00 12.12 ? 30  ARG B CB  1 
ATOM   1290 C  CG  . ARG B 2 30  ? 24.135 -2.237  30.193 1.00 10.97 ? 30  ARG B CG  1 
ATOM   1291 C  CD  . ARG B 2 30  ? 23.808 -1.801  28.804 1.00 10.94 ? 30  ARG B CD  1 
ATOM   1292 N  NE  . ARG B 2 30  ? 22.454 -2.226  28.491 1.00 10.61 ? 30  ARG B NE  1 
ATOM   1293 C  CZ  . ARG B 2 30  ? 22.092 -3.372  27.907 1.00 18.42 ? 30  ARG B CZ  1 
ATOM   1294 N  NH1 . ARG B 2 30  ? 23.025 -4.282  27.512 1.00 15.60 ? 30  ARG B NH1 1 
ATOM   1295 N  NH2 . ARG B 2 30  ? 20.827 -3.694  27.667 1.00 14.64 ? 30  ARG B NH2 1 
ATOM   1296 N  N   . LEU B 2 31  ? 27.967 -0.815  32.489 1.00 14.81 ? 31  LEU B N   1 
ATOM   1297 C  CA  . LEU B 2 31  ? 29.400 -0.682  32.748 1.00 13.31 ? 31  LEU B CA  1 
ATOM   1298 C  C   . LEU B 2 31  ? 29.867 -1.662  33.866 1.00 19.42 ? 31  LEU B C   1 
ATOM   1299 O  O   . LEU B 2 31  ? 30.839 -2.412  33.772 1.00 16.44 ? 31  LEU B O   1 
ATOM   1300 C  CB  . LEU B 2 31  ? 29.767 0.731   33.155 1.00 10.50 ? 31  LEU B CB  1 
ATOM   1301 C  CG  . LEU B 2 31  ? 31.260 0.929   33.483 1.00 17.11 ? 31  LEU B CG  1 
ATOM   1302 C  CD1 . LEU B 2 31  ? 32.012 1.101   32.135 1.00 19.71 ? 31  LEU B CD1 1 
ATOM   1303 C  CD2 . LEU B 2 31  ? 31.522 2.095   34.411 1.00 14.59 ? 31  LEU B CD2 1 
ATOM   1304 N  N   . LEU B 2 32  ? 29.098 -1.625  34.995 1.00 16.06 ? 32  LEU B N   1 
ATOM   1305 C  CA  . LEU B 2 32  ? 29.371 -2.420  36.170 1.00 16.31 ? 32  LEU B CA  1 
ATOM   1306 C  C   . LEU B 2 32  ? 29.183 -3.872  35.845 1.00 14.97 ? 32  LEU B C   1 
ATOM   1307 O  O   . LEU B 2 32  ? 29.878 -4.686  36.499 1.00 19.76 ? 32  LEU B O   1 
ATOM   1308 C  CB  . LEU B 2 32  ? 28.456 -2.015  37.352 1.00 18.66 ? 32  LEU B CB  1 
ATOM   1309 C  CG  . LEU B 2 32  ? 28.804 -0.660  37.950 1.00 22.07 ? 32  LEU B CG  1 
ATOM   1310 C  CD1 . LEU B 2 32  ? 27.769 -0.220  39.041 1.00 25.43 ? 32  LEU B CD1 1 
ATOM   1311 C  CD2 . LEU B 2 32  ? 30.153 -0.638  38.606 1.00 21.98 ? 32  LEU B CD2 1 
ATOM   1312 N  N   . VAL B 2 33  ? 28.282 -4.217  34.975 1.00 16.03 ? 33  VAL B N   1 
ATOM   1313 C  CA  . VAL B 2 33  ? 28.081 -5.636  34.627 1.00 19.56 ? 33  VAL B CA  1 
ATOM   1314 C  C   . VAL B 2 33  ? 29.186 -6.114  33.653 1.00 21.66 ? 33  VAL B C   1 
ATOM   1315 O  O   . VAL B 2 33  ? 29.826 -7.156  33.852 1.00 17.99 ? 33  VAL B O   1 
ATOM   1316 C  CB  . VAL B 2 33  ? 26.658 -5.875  34.031 1.00 17.08 ? 33  VAL B CB  1 
ATOM   1317 C  CG1 . VAL B 2 33  ? 26.475 -7.259  33.440 1.00 16.80 ? 33  VAL B CG1 1 
ATOM   1318 C  CG2 . VAL B 2 33  ? 25.684 -5.669  35.223 1.00 17.90 ? 33  VAL B CG2 1 
ATOM   1319 N  N   . VAL B 2 34  ? 29.388 -5.381  32.586 1.00 14.88 ? 34  VAL B N   1 
ATOM   1320 C  CA  . VAL B 2 34  ? 30.314 -5.743  31.481 1.00 17.33 ? 34  VAL B CA  1 
ATOM   1321 C  C   . VAL B 2 34  ? 31.754 -5.595  31.872 1.00 19.45 ? 34  VAL B C   1 
ATOM   1322 O  O   . VAL B 2 34  ? 32.623 -6.455  31.445 1.00 20.63 ? 34  VAL B O   1 
ATOM   1323 C  CB  . VAL B 2 34  ? 29.873 -4.959  30.218 1.00 16.12 ? 34  VAL B CB  1 
ATOM   1324 C  CG1 . VAL B 2 34  ? 30.831 -5.247  29.041 1.00 17.41 ? 34  VAL B CG1 1 
ATOM   1325 C  CG2 . VAL B 2 34  ? 28.424 -5.300  29.777 1.00 15.85 ? 34  VAL B CG2 1 
ATOM   1326 N  N   . TYR B 2 35  ? 32.229 -4.632  32.687 1.00 11.46 ? 35  TYR B N   1 
ATOM   1327 C  CA  . TYR B 2 35  ? 33.589 -4.451  33.015 1.00 15.34 ? 35  TYR B CA  1 
ATOM   1328 C  C   . TYR B 2 35  ? 33.676 -4.476  34.517 1.00 15.81 ? 35  TYR B C   1 
ATOM   1329 O  O   . TYR B 2 35  ? 33.778 -3.441  35.195 1.00 16.02 ? 35  TYR B O   1 
ATOM   1330 C  CB  . TYR B 2 35  ? 34.080 -3.055  32.493 1.00 16.71 ? 35  TYR B CB  1 
ATOM   1331 C  CG  . TYR B 2 35  ? 33.829 -2.987  31.026 1.00 15.63 ? 35  TYR B CG  1 
ATOM   1332 C  CD1 . TYR B 2 35  ? 34.571 -3.794  30.131 1.00 17.55 ? 35  TYR B CD1 1 
ATOM   1333 C  CD2 . TYR B 2 35  ? 32.855 -2.185  30.521 1.00 17.93 ? 35  TYR B CD2 1 
ATOM   1334 C  CE1 . TYR B 2 35  ? 34.334 -3.798  28.781 1.00 14.87 ? 35  TYR B CE1 1 
ATOM   1335 C  CE2 . TYR B 2 35  ? 32.568 -2.098  29.129 1.00 19.93 ? 35  TYR B CE2 1 
ATOM   1336 C  CZ  . TYR B 2 35  ? 33.390 -2.916  28.315 1.00 23.08 ? 35  TYR B CZ  1 
ATOM   1337 O  OH  . TYR B 2 35  ? 33.064 -2.828  26.974 1.00 28.14 ? 35  TYR B OH  1 
ATOM   1338 N  N   . PRO B 2 36  ? 33.673 -5.692  35.064 1.00 22.45 ? 36  PRO B N   1 
ATOM   1339 C  CA  . PRO B 2 36  ? 33.554 -5.930  36.484 1.00 23.19 ? 36  PRO B CA  1 
ATOM   1340 C  C   . PRO B 2 36  ? 34.480 -5.264  37.438 1.00 23.55 ? 36  PRO B C   1 
ATOM   1341 O  O   . PRO B 2 36  ? 34.014 -4.917  38.611 1.00 19.41 ? 36  PRO B O   1 
ATOM   1342 C  CB  . PRO B 2 36  ? 33.497 -7.501  36.640 1.00 25.21 ? 36  PRO B CB  1 
ATOM   1343 C  CG  . PRO B 2 36  ? 33.123 -7.975  35.260 1.00 24.62 ? 36  PRO B CG  1 
ATOM   1344 C  CD  . PRO B 2 36  ? 33.694 -6.965  34.321 1.00 21.61 ? 36  PRO B CD  1 
ATOM   1345 N  N   . TRP B 2 37  ? 35.757 -4.952  37.104 1.00 17.88 ? 37  TRP B N   1 
ATOM   1346 C  CA  . TRP B 2 37  ? 36.693 -4.261  37.983 1.00 16.15 ? 37  TRP B CA  1 
ATOM   1347 C  C   . TRP B 2 37  ? 36.219 -2.837  38.301 1.00 17.06 ? 37  TRP B C   1 
ATOM   1348 O  O   . TRP B 2 37  ? 36.702 -2.273  39.274 1.00 19.97 ? 37  TRP B O   1 
ATOM   1349 C  CB  . TRP B 2 37  ? 38.112 -4.213  37.373 1.00 15.96 ? 37  TRP B CB  1 
ATOM   1350 C  CG  . TRP B 2 37  ? 38.100 -3.509  36.060 1.00 15.47 ? 37  TRP B CG  1 
ATOM   1351 C  CD1 . TRP B 2 37  ? 38.254 -2.155  35.845 1.00 21.87 ? 37  TRP B CD1 1 
ATOM   1352 C  CD2 . TRP B 2 37  ? 37.886 -4.091  34.755 1.00 16.50 ? 37  TRP B CD2 1 
ATOM   1353 N  NE1 . TRP B 2 37  ? 38.102 -1.864  34.485 1.00 22.17 ? 37  TRP B NE1 1 
ATOM   1354 C  CE2 . TRP B 2 37  ? 37.872 -3.064  33.817 1.00 15.47 ? 37  TRP B CE2 1 
ATOM   1355 C  CE3 . TRP B 2 37  ? 37.713 -5.420  34.345 1.00 20.67 ? 37  TRP B CE3 1 
ATOM   1356 C  CZ2 . TRP B 2 37  ? 37.765 -3.297  32.442 1.00 17.46 ? 37  TRP B CZ2 1 
ATOM   1357 C  CZ3 . TRP B 2 37  ? 37.531 -5.664  33.007 1.00 20.71 ? 37  TRP B CZ3 1 
ATOM   1358 C  CH2 . TRP B 2 37  ? 37.551 -4.606  32.067 1.00 23.05 ? 37  TRP B CH2 1 
ATOM   1359 N  N   . THR B 2 38  ? 35.241 -2.317  37.487 1.00 18.14 ? 38  THR B N   1 
ATOM   1360 C  CA  . THR B 2 38  ? 34.709 -0.960  37.714 1.00 17.64 ? 38  THR B CA  1 
ATOM   1361 C  C   . THR B 2 38  ? 33.856 -0.910  39.021 1.00 20.57 ? 38  THR B C   1 
ATOM   1362 O  O   . THR B 2 38  ? 33.685 0.169   39.605 1.00 20.38 ? 38  THR B O   1 
ATOM   1363 C  CB  . THR B 2 38  ? 33.864 -0.325  36.603 1.00 16.77 ? 38  THR B CB  1 
ATOM   1364 O  OG1 . THR B 2 38  ? 32.759 -1.127  36.352 1.00 12.75 ? 38  THR B OG1 1 
ATOM   1365 C  CG2 . THR B 2 38  ? 34.738 -0.185  35.314 1.00 16.39 ? 38  THR B CG2 1 
ATOM   1366 N  N   . GLN B 2 39  ? 33.415 -2.099  39.459 1.00 21.85 ? 39  GLN B N   1 
ATOM   1367 C  CA  . GLN B 2 39  ? 32.655 -2.199  40.725 1.00 21.58 ? 39  GLN B CA  1 
ATOM   1368 C  C   . GLN B 2 39  ? 33.460 -1.809  41.955 1.00 24.49 ? 39  GLN B C   1 
ATOM   1369 O  O   . GLN B 2 39  ? 32.870 -1.338  42.921 1.00 22.70 ? 39  GLN B O   1 
ATOM   1370 C  CB  . GLN B 2 39  ? 32.190 -3.634  40.957 1.00 12.94 ? 39  GLN B CB  1 
ATOM   1371 C  CG  . GLN B 2 39  ? 31.215 -4.081  39.881 1.00 17.42 ? 39  GLN B CG  1 
ATOM   1372 C  CD  . GLN B 2 39  ? 30.815 -5.528  39.943 1.00 25.66 ? 39  GLN B CD  1 
ATOM   1373 O  OE1 . GLN B 2 39  ? 31.011 -6.190  40.958 1.00 30.66 ? 39  GLN B OE1 1 
ATOM   1374 N  NE2 . GLN B 2 39  ? 30.155 -6.108  38.893 1.00 22.86 ? 39  GLN B NE2 1 
ATOM   1375 N  N   . ARG B 2 40  ? 34.804 -1.903  41.954 1.00 21.25 ? 40  ARG B N   1 
ATOM   1376 C  CA  . ARG B 2 40  ? 35.552 -1.483  43.108 1.00 23.36 ? 40  ARG B CA  1 
ATOM   1377 C  C   . ARG B 2 40  ? 35.371 -0.013  43.456 1.00 27.67 ? 40  ARG B C   1 
ATOM   1378 O  O   . ARG B 2 40  ? 35.612 0.369   44.643 1.00 28.52 ? 40  ARG B O   1 
ATOM   1379 C  CB  . ARG B 2 40  ? 37.045 -1.891  42.952 1.00 36.24 ? 40  ARG B CB  1 
ATOM   1380 C  CG  . ARG B 2 40  ? 37.723 -1.111  41.834 1.00 32.70 ? 40  ARG B CG  1 
ATOM   1381 C  CD  . ARG B 2 40  ? 39.238 -1.397  41.863 1.00 49.10 ? 40  ARG B CD  1 
ATOM   1382 N  NE  . ARG B 2 40  ? 39.810 -1.454  43.183 1.00 33.90 ? 40  ARG B NE  1 
ATOM   1383 C  CZ  . ARG B 2 40  ? 40.624 -0.526  43.696 1.00 54.58 ? 40  ARG B CZ  1 
ATOM   1384 N  NH1 . ARG B 2 40  ? 40.969 0.556   42.979 1.00 50.15 ? 40  ARG B NH1 1 
ATOM   1385 N  NH2 . ARG B 2 40  ? 41.099 -0.686  44.963 1.00 51.42 ? 40  ARG B NH2 1 
ATOM   1386 N  N   . PHE B 2 41  ? 35.002 0.942   42.600 1.00 20.91 ? 41  PHE B N   1 
ATOM   1387 C  CA  . PHE B 2 41  ? 34.784 2.300   42.913 1.00 23.28 ? 41  PHE B CA  1 
ATOM   1388 C  C   . PHE B 2 41  ? 33.464 2.561   43.628 1.00 21.75 ? 41  PHE B C   1 
ATOM   1389 O  O   . PHE B 2 41  ? 33.147 3.668   44.123 1.00 23.12 ? 41  PHE B O   1 
ATOM   1390 C  CB  . PHE B 2 41  ? 34.628 3.105   41.534 1.00 22.84 ? 41  PHE B CB  1 
ATOM   1391 C  CG  . PHE B 2 41  ? 35.967 3.060   40.861 1.00 28.87 ? 41  PHE B CG  1 
ATOM   1392 C  CD1 . PHE B 2 41  ? 36.962 3.887   41.416 1.00 34.38 ? 41  PHE B CD1 1 
ATOM   1393 C  CD2 . PHE B 2 41  ? 36.284 2.299   39.783 1.00 30.19 ? 41  PHE B CD2 1 
ATOM   1394 C  CE1 . PHE B 2 41  ? 38.249 3.925   40.869 1.00 35.71 ? 41  PHE B CE1 1 
ATOM   1395 C  CE2 . PHE B 2 41  ? 37.583 2.320   39.227 1.00 31.83 ? 41  PHE B CE2 1 
ATOM   1396 C  CZ  . PHE B 2 41  ? 38.569 3.132   39.775 1.00 26.92 ? 41  PHE B CZ  1 
ATOM   1397 N  N   . PHE B 2 42  ? 32.623 1.573   43.622 1.00 22.47 ? 42  PHE B N   1 
ATOM   1398 C  CA  . PHE B 2 42  ? 31.255 1.718   44.125 1.00 27.21 ? 42  PHE B CA  1 
ATOM   1399 C  C   . PHE B 2 42  ? 30.892 0.741   45.202 1.00 29.15 ? 42  PHE B C   1 
ATOM   1400 O  O   . PHE B 2 42  ? 29.799 0.167   45.304 1.00 28.03 ? 42  PHE B O   1 
ATOM   1401 C  CB  . PHE B 2 42  ? 30.348 1.493   42.889 1.00 25.24 ? 42  PHE B CB  1 
ATOM   1402 C  CG  . PHE B 2 42  ? 30.567 2.542   41.815 1.00 27.55 ? 42  PHE B CG  1 
ATOM   1403 C  CD1 . PHE B 2 42  ? 30.083 3.829   41.908 1.00 25.94 ? 42  PHE B CD1 1 
ATOM   1404 C  CD2 . PHE B 2 42  ? 31.297 2.197   40.678 1.00 25.68 ? 42  PHE B CD2 1 
ATOM   1405 C  CE1 . PHE B 2 42  ? 30.279 4.793   40.910 1.00 25.21 ? 42  PHE B CE1 1 
ATOM   1406 C  CE2 . PHE B 2 42  ? 31.485 3.136   39.683 1.00 26.70 ? 42  PHE B CE2 1 
ATOM   1407 C  CZ  . PHE B 2 42  ? 31.006 4.443   39.811 1.00 29.17 ? 42  PHE B CZ  1 
ATOM   1408 N  N   . ASP B 2 43  ? 31.873 0.568   46.060 1.00 32.19 ? 43  ASP B N   1 
ATOM   1409 C  CA  . ASP B 2 43  ? 31.702 -0.352  47.186 1.00 39.33 ? 43  ASP B CA  1 
ATOM   1410 C  C   . ASP B 2 43  ? 30.515 0.063   48.052 1.00 39.75 ? 43  ASP B C   1 
ATOM   1411 O  O   . ASP B 2 43  ? 29.642 -0.784  48.421 1.00 42.02 ? 43  ASP B O   1 
ATOM   1412 C  CB  . ASP B 2 43  ? 33.074 -0.474  47.902 1.00 47.78 ? 43  ASP B CB  1 
ATOM   1413 C  CG  . ASP B 2 43  ? 33.871 -1.671  47.314 1.00 61.66 ? 43  ASP B CG  1 
ATOM   1414 O  OD1 . ASP B 2 43  ? 33.350 -2.495  46.484 1.00 53.49 ? 43  ASP B OD1 1 
ATOM   1415 O  OD2 . ASP B 2 43  ? 35.087 -1.754  47.698 1.00 63.17 ? 43  ASP B OD2 1 
ATOM   1416 N  N   . SER B 2 44  ? 30.372 1.340   48.363 1.00 33.97 ? 44  SER B N   1 
ATOM   1417 C  CA  . SER B 2 44  ? 29.306 1.907   49.139 1.00 36.85 ? 44  SER B CA  1 
ATOM   1418 C  C   . SER B 2 44  ? 27.887 1.753   48.606 1.00 37.63 ? 44  SER B C   1 
ATOM   1419 O  O   . SER B 2 44  ? 26.988 2.214   49.360 1.00 35.44 ? 44  SER B O   1 
ATOM   1420 C  CB  . SER B 2 44  ? 29.581 3.443   49.213 1.00 30.18 ? 44  SER B CB  1 
ATOM   1421 O  OG  . SER B 2 44  ? 29.514 3.981   47.919 1.00 43.92 ? 44  SER B OG  1 
ATOM   1422 N  N   . PHE B 2 45  ? 27.628 1.233   47.400 1.00 26.75 ? 45  PHE B N   1 
ATOM   1423 C  CA  . PHE B 2 45  ? 26.329 1.087   46.788 1.00 28.42 ? 45  PHE B CA  1 
ATOM   1424 C  C   . PHE B 2 45  ? 25.589 -0.199  47.201 1.00 23.24 ? 45  PHE B C   1 
ATOM   1425 O  O   . PHE B 2 45  ? 24.439 -0.430  46.893 1.00 24.85 ? 45  PHE B O   1 
ATOM   1426 C  CB  . PHE B 2 45  ? 26.499 1.168   45.244 1.00 23.99 ? 45  PHE B CB  1 
ATOM   1427 C  CG  . PHE B 2 45  ? 26.707 2.581   44.761 1.00 19.32 ? 45  PHE B CG  1 
ATOM   1428 C  CD1 . PHE B 2 45  ? 27.225 3.605   45.476 1.00 27.24 ? 45  PHE B CD1 1 
ATOM   1429 C  CD2 . PHE B 2 45  ? 26.372 2.863   43.427 1.00 31.31 ? 45  PHE B CD2 1 
ATOM   1430 C  CE1 . PHE B 2 45  ? 27.442 4.886   44.970 1.00 26.53 ? 45  PHE B CE1 1 
ATOM   1431 C  CE2 . PHE B 2 45  ? 26.554 4.148   42.914 1.00 29.86 ? 45  PHE B CE2 1 
ATOM   1432 C  CZ  . PHE B 2 45  ? 27.068 5.174   43.676 1.00 24.41 ? 45  PHE B CZ  1 
ATOM   1433 N  N   . GLY B 2 46  ? 26.316 -1.081  47.904 1.00 24.71 ? 46  GLY B N   1 
ATOM   1434 C  CA  . GLY B 2 46  ? 25.776 -2.312  48.377 1.00 29.60 ? 46  GLY B CA  1 
ATOM   1435 C  C   . GLY B 2 46  ? 25.799 -3.537  47.507 1.00 34.04 ? 46  GLY B C   1 
ATOM   1436 O  O   . GLY B 2 46  ? 26.913 -3.893  47.091 1.00 36.92 ? 46  GLY B O   1 
ATOM   1437 N  N   . ASP B 2 47  ? 24.651 -4.218  47.296 1.00 35.81 ? 47  ASP B N   1 
ATOM   1438 C  CA  . ASP B 2 47  ? 24.650 -5.432  46.444 1.00 41.01 ? 47  ASP B CA  1 
ATOM   1439 C  C   . ASP B 2 47  ? 24.833 -5.137  44.912 1.00 36.78 ? 47  ASP B C   1 
ATOM   1440 O  O   . ASP B 2 47  ? 23.950 -4.583  44.158 1.00 41.52 ? 47  ASP B O   1 
ATOM   1441 C  CB  . ASP B 2 47  ? 23.399 -6.319  46.631 1.00 46.21 ? 47  ASP B CB  1 
ATOM   1442 C  CG  . ASP B 2 47  ? 23.503 -7.788  46.186 1.00 48.31 ? 47  ASP B CG  1 
ATOM   1443 O  OD1 . ASP B 2 47  ? 24.620 -8.367  46.392 1.00 57.83 ? 47  ASP B OD1 1 
ATOM   1444 O  OD2 . ASP B 2 47  ? 22.517 -8.426  45.681 1.00 53.80 ? 47  ASP B OD2 1 
ATOM   1445 N  N   . LEU B 2 48  ? 26.039 -5.571  44.469 1.00 28.76 ? 48  LEU B N   1 
ATOM   1446 C  CA  . LEU B 2 48  ? 26.372 -5.385  42.999 1.00 34.88 ? 48  LEU B CA  1 
ATOM   1447 C  C   . LEU B 2 48  ? 26.826 -6.731  42.406 1.00 38.84 ? 48  LEU B C   1 
ATOM   1448 O  O   . LEU B 2 48  ? 27.541 -6.870  41.418 1.00 37.24 ? 48  LEU B O   1 
ATOM   1449 C  CB  . LEU B 2 48  ? 27.470 -4.360  42.815 1.00 31.15 ? 48  LEU B CB  1 
ATOM   1450 C  CG  . LEU B 2 48  ? 27.304 -2.919  43.259 1.00 23.91 ? 48  LEU B CG  1 
ATOM   1451 C  CD1 . LEU B 2 48  ? 28.456 -2.116  42.745 1.00 30.42 ? 48  LEU B CD1 1 
ATOM   1452 C  CD2 . LEU B 2 48  ? 26.016 -2.320  42.727 1.00 26.12 ? 48  LEU B CD2 1 
ATOM   1453 N  N   . SER B 2 49  ? 26.323 -7.768  43.097 1.00 40.00 ? 49  SER B N   1 
ATOM   1454 C  CA  . SER B 2 49  ? 26.724 -9.154  42.873 1.00 46.08 ? 49  SER B CA  1 
ATOM   1455 C  C   . SER B 2 49  ? 26.184 -9.814  41.645 1.00 41.98 ? 49  SER B C   1 
ATOM   1456 O  O   . SER B 2 49  ? 26.753 -10.825 41.195 1.00 47.87 ? 49  SER B O   1 
ATOM   1457 C  CB  . SER B 2 49  ? 26.552 -9.988  44.175 1.00 42.37 ? 49  SER B CB  1 
ATOM   1458 O  OG  . SER B 2 49  ? 25.325 -10.517 44.555 1.00 38.58 ? 49  SER B OG  1 
ATOM   1459 N  N   . ASN B 2 50  ? 25.137 -9.334  41.016 1.00 37.37 ? 50  ASN B N   1 
ATOM   1460 C  CA  . ASN B 2 50  ? 24.770 -10.109 39.774 1.00 30.03 ? 50  ASN B CA  1 
ATOM   1461 C  C   . ASN B 2 50  ? 24.046 -9.055  38.986 1.00 30.04 ? 50  ASN B C   1 
ATOM   1462 O  O   . ASN B 2 50  ? 23.703 -8.012  39.581 1.00 28.94 ? 50  ASN B O   1 
ATOM   1463 C  CB  . ASN B 2 50  ? 24.075 -11.352 40.280 1.00 35.95 ? 50  ASN B CB  1 
ATOM   1464 C  CG  . ASN B 2 50  ? 22.813 -11.006 41.079 1.00 39.46 ? 50  ASN B CG  1 
ATOM   1465 O  OD1 . ASN B 2 50  ? 21.809 -10.535 40.480 1.00 42.64 ? 50  ASN B OD1 1 
ATOM   1466 N  ND2 . ASN B 2 50  ? 22.997 -11.236 42.374 1.00 44.49 ? 50  ASN B ND2 1 
ATOM   1467 N  N   . PRO B 2 51  ? 23.842 -9.273  37.733 1.00 31.97 ? 51  PRO B N   1 
ATOM   1468 C  CA  . PRO B 2 51  ? 23.168 -8.377  36.848 1.00 31.79 ? 51  PRO B CA  1 
ATOM   1469 C  C   . PRO B 2 51  ? 21.897 -7.864  37.462 1.00 34.55 ? 51  PRO B C   1 
ATOM   1470 O  O   . PRO B 2 51  ? 21.732 -6.659  37.355 1.00 31.66 ? 51  PRO B O   1 
ATOM   1471 C  CB  . PRO B 2 51  ? 22.910 -9.133  35.488 1.00 32.22 ? 51  PRO B CB  1 
ATOM   1472 C  CG  . PRO B 2 51  ? 24.128 -10.036 35.539 1.00 35.58 ? 51  PRO B CG  1 
ATOM   1473 C  CD  . PRO B 2 51  ? 24.259 -10.498 37.008 1.00 34.99 ? 51  PRO B CD  1 
ATOM   1474 N  N   . GLY B 2 52  ? 21.021 -8.680  38.082 1.00 34.15 ? 52  GLY B N   1 
ATOM   1475 C  CA  . GLY B 2 52  ? 19.803 -8.122  38.636 1.00 30.73 ? 52  GLY B CA  1 
ATOM   1476 C  C   . GLY B 2 52  ? 20.082 -7.267  39.838 1.00 27.89 ? 52  GLY B C   1 
ATOM   1477 O  O   . GLY B 2 52  ? 19.518 -6.189  40.076 1.00 31.75 ? 52  GLY B O   1 
ATOM   1478 N  N   . ALA B 2 53  ? 21.058 -7.660  40.667 1.00 27.00 ? 53  ALA B N   1 
ATOM   1479 C  CA  . ALA B 2 53  ? 21.288 -6.770  41.809 1.00 25.21 ? 53  ALA B CA  1 
ATOM   1480 C  C   . ALA B 2 53  ? 21.727 -5.372  41.326 1.00 28.22 ? 53  ALA B C   1 
ATOM   1481 O  O   . ALA B 2 53  ? 21.409 -4.348  41.882 1.00 25.21 ? 53  ALA B O   1 
ATOM   1482 C  CB  . ALA B 2 53  ? 22.381 -7.356  42.664 1.00 22.83 ? 53  ALA B CB  1 
ATOM   1483 N  N   . VAL B 2 54  ? 22.579 -5.409  40.303 1.00 26.92 ? 54  VAL B N   1 
ATOM   1484 C  CA  . VAL B 2 54  ? 23.159 -4.239  39.683 1.00 29.70 ? 54  VAL B CA  1 
ATOM   1485 C  C   . VAL B 2 54  ? 22.126 -3.378  38.986 1.00 23.54 ? 54  VAL B C   1 
ATOM   1486 O  O   . VAL B 2 54  ? 21.962 -2.170  39.358 1.00 23.26 ? 54  VAL B O   1 
ATOM   1487 C  CB  . VAL B 2 54  ? 24.292 -4.611  38.650 1.00 25.82 ? 54  VAL B CB  1 
ATOM   1488 C  CG1 . VAL B 2 54  ? 24.600 -3.339  37.852 1.00 24.58 ? 54  VAL B CG1 1 
ATOM   1489 C  CG2 . VAL B 2 54  ? 25.502 -5.137  39.372 1.00 22.86 ? 54  VAL B CG2 1 
ATOM   1490 N  N   . MET B 2 55  ? 21.351 -3.893  38.062 1.00 24.22 ? 55  MET B N   1 
ATOM   1491 C  CA  . MET B 2 55  ? 20.398 -3.056  37.315 1.00 32.50 ? 55  MET B CA  1 
ATOM   1492 C  C   . MET B 2 55  ? 19.275 -2.468  38.140 1.00 33.39 ? 55  MET B C   1 
ATOM   1493 O  O   . MET B 2 55  ? 18.757 -1.379  37.792 1.00 35.38 ? 55  MET B O   1 
ATOM   1494 C  CB  . MET B 2 55  ? 19.879 -3.757  36.049 1.00 25.67 ? 55  MET B CB  1 
ATOM   1495 C  CG  . MET B 2 55  ? 20.986 -4.366  35.194 1.00 34.73 ? 55  MET B CG  1 
ATOM   1496 S  SD  . MET B 2 55  ? 22.189 -3.158  34.513 1.00 26.07 ? 55  MET B SD  1 
ATOM   1497 C  CE  . MET B 2 55  ? 21.092 -2.288  33.443 1.00 22.01 ? 55  MET B CE  1 
ATOM   1498 N  N   . GLY B 2 56  ? 18.916 -3.127  39.261 1.00 33.57 ? 56  GLY B N   1 
ATOM   1499 C  CA  . GLY B 2 56  ? 17.902 -2.654  40.171 1.00 32.51 ? 56  GLY B CA  1 
ATOM   1500 C  C   . GLY B 2 56  ? 18.357 -1.844  41.375 1.00 31.49 ? 56  GLY B C   1 
ATOM   1501 O  O   . GLY B 2 56  ? 17.473 -1.308  42.096 1.00 30.33 ? 56  GLY B O   1 
ATOM   1502 N  N   . ASN B 2 57  ? 19.647 -1.691  41.645 1.00 26.47 ? 57  ASN B N   1 
ATOM   1503 C  CA  . ASN B 2 57  ? 20.130 -0.904  42.847 1.00 23.49 ? 57  ASN B CA  1 
ATOM   1504 C  C   . ASN B 2 57  ? 19.833 0.533   42.595 1.00 25.13 ? 57  ASN B C   1 
ATOM   1505 O  O   . ASN B 2 57  ? 20.154 1.169   41.556 1.00 23.08 ? 57  ASN B O   1 
ATOM   1506 C  CB  . ASN B 2 57  ? 21.561 -1.283  43.022 1.00 20.37 ? 57  ASN B CB  1 
ATOM   1507 C  CG  . ASN B 2 57  ? 22.331 -0.632  44.046 1.00 18.04 ? 57  ASN B CG  1 
ATOM   1508 O  OD1 . ASN B 2 57  ? 22.213 0.598   44.138 1.00 23.37 ? 57  ASN B OD1 1 
ATOM   1509 N  ND2 . ASN B 2 57  ? 23.143 -1.394  44.791 1.00 19.72 ? 57  ASN B ND2 1 
ATOM   1510 N  N   . PRO B 2 58  ? 19.087 1.176   43.471 1.00 24.05 ? 58  PRO B N   1 
ATOM   1511 C  CA  . PRO B 2 58  ? 18.661 2.537   43.359 1.00 22.84 ? 58  PRO B CA  1 
ATOM   1512 C  C   . PRO B 2 58  ? 19.832 3.485   43.375 1.00 21.07 ? 58  PRO B C   1 
ATOM   1513 O  O   . PRO B 2 58  ? 19.747 4.571   42.818 1.00 22.70 ? 58  PRO B O   1 
ATOM   1514 C  CB  . PRO B 2 58  ? 17.779 2.835   44.632 1.00 24.14 ? 58  PRO B CB  1 
ATOM   1515 C  CG  . PRO B 2 58  ? 18.259 1.778   45.548 1.00 25.15 ? 58  PRO B CG  1 
ATOM   1516 C  CD  . PRO B 2 58  ? 18.612 0.565   44.712 1.00 23.20 ? 58  PRO B CD  1 
ATOM   1517 N  N   . LYS B 2 59  ? 20.931 3.093   44.010 1.00 17.90 ? 59  LYS B N   1 
ATOM   1518 C  CA  . LYS B 2 59  ? 22.164 3.863   44.108 1.00 20.77 ? 59  LYS B CA  1 
ATOM   1519 C  C   . LYS B 2 59  ? 22.853 3.963   42.705 1.00 26.24 ? 59  LYS B C   1 
ATOM   1520 O  O   . LYS B 2 59  ? 23.383 5.002   42.327 1.00 23.37 ? 59  LYS B O   1 
ATOM   1521 C  CB  . LYS B 2 59  ? 23.138 3.190   45.066 1.00 30.03 ? 59  LYS B CB  1 
ATOM   1522 C  CG  . LYS B 2 59  ? 23.937 4.176   45.858 1.00 47.77 ? 59  LYS B CG  1 
ATOM   1523 C  CD  . LYS B 2 59  ? 23.032 4.550   47.054 1.00 35.81 ? 59  LYS B CD  1 
ATOM   1524 C  CE  . LYS B 2 59  ? 24.081 4.765   48.216 1.00 50.55 ? 59  LYS B CE  1 
ATOM   1525 N  NZ  . LYS B 2 59  ? 23.369 5.479   49.323 1.00 53.02 ? 59  LYS B NZ  1 
ATOM   1526 N  N   . VAL B 2 60  ? 22.814 2.860   41.958 1.00 22.65 ? 60  VAL B N   1 
ATOM   1527 C  CA  . VAL B 2 60  ? 23.322 2.831   40.571 1.00 22.88 ? 60  VAL B CA  1 
ATOM   1528 C  C   . VAL B 2 60  ? 22.547 3.764   39.634 1.00 23.48 ? 60  VAL B C   1 
ATOM   1529 O  O   . VAL B 2 60  ? 23.097 4.563   38.844 1.00 18.19 ? 60  VAL B O   1 
ATOM   1530 C  CB  . VAL B 2 60  ? 23.323 1.358   40.095 1.00 15.61 ? 60  VAL B CB  1 
ATOM   1531 C  CG1 . VAL B 2 60  ? 23.453 1.241   38.547 1.00 16.86 ? 60  VAL B CG1 1 
ATOM   1532 C  CG2 . VAL B 2 60  ? 24.399 0.631   40.943 1.00 16.19 ? 60  VAL B CG2 1 
ATOM   1533 N  N   . LYS B 2 61  ? 21.202 3.685   39.672 1.00 21.68 ? 61  LYS B N   1 
ATOM   1534 C  CA  . LYS B 2 61  ? 20.351 4.548   38.872 1.00 23.63 ? 61  LYS B CA  1 
ATOM   1535 C  C   . LYS B 2 61  ? 20.535 6.037   39.219 1.00 20.91 ? 61  LYS B C   1 
ATOM   1536 O  O   . LYS B 2 61  ? 20.583 6.866   38.334 1.00 22.18 ? 61  LYS B O   1 
ATOM   1537 C  CB  . LYS B 2 61  ? 18.870 4.187   39.074 1.00 25.16 ? 61  LYS B CB  1 
ATOM   1538 C  CG  . LYS B 2 61  ? 18.143 4.093   37.705 1.00 56.02 ? 61  LYS B CG  1 
ATOM   1539 C  CD  . LYS B 2 61  ? 17.012 3.076   37.757 1.00 61.91 ? 61  LYS B CD  1 
ATOM   1540 C  CE  . LYS B 2 61  ? 17.409 1.876   38.682 1.00 53.78 ? 61  LYS B CE  1 
ATOM   1541 N  NZ  . LYS B 2 61  ? 16.182 1.020   38.927 1.00 60.84 ? 61  LYS B NZ  1 
ATOM   1542 N  N   . ALA B 2 62  ? 20.622 6.353   40.533 1.00 19.88 ? 62  ALA B N   1 
ATOM   1543 C  CA  . ALA B 2 62  ? 20.769 7.747   40.871 1.00 24.99 ? 62  ALA B CA  1 
ATOM   1544 C  C   . ALA B 2 62  ? 22.138 8.266   40.431 1.00 25.38 ? 62  ALA B C   1 
ATOM   1545 O  O   . ALA B 2 62  ? 22.289 9.404   40.016 1.00 20.83 ? 62  ALA B O   1 
ATOM   1546 C  CB  . ALA B 2 62  ? 20.668 8.003   42.368 1.00 22.80 ? 62  ALA B CB  1 
ATOM   1547 N  N   . HIS B 2 63  ? 23.206 7.483   40.589 1.00 21.98 ? 63  HIS B N   1 
ATOM   1548 C  CA  . HIS B 2 63  ? 24.555 7.910   40.181 1.00 18.01 ? 63  HIS B CA  1 
ATOM   1549 C  C   . HIS B 2 63  ? 24.590 7.979   38.636 1.00 17.79 ? 63  HIS B C   1 
ATOM   1550 O  O   . HIS B 2 63  ? 25.083 8.964   38.084 1.00 18.62 ? 63  HIS B O   1 
ATOM   1551 C  CB  . HIS B 2 63  ? 25.649 6.966   40.764 1.00 21.54 ? 63  HIS B CB  1 
ATOM   1552 C  CG  . HIS B 2 63  ? 26.973 7.601   40.482 1.00 26.69 ? 63  HIS B CG  1 
ATOM   1553 N  ND1 . HIS B 2 63  ? 27.338 8.766   41.172 1.00 23.60 ? 63  HIS B ND1 1 
ATOM   1554 C  CD2 . HIS B 2 63  ? 27.932 7.332   39.586 1.00 27.25 ? 63  HIS B CD2 1 
ATOM   1555 C  CE1 . HIS B 2 63  ? 28.502 9.139   40.719 1.00 26.26 ? 63  HIS B CE1 1 
ATOM   1556 N  NE2 . HIS B 2 63  ? 28.914 8.301   39.762 1.00 24.85 ? 63  HIS B NE2 1 
ATOM   1557 N  N   . GLY B 2 64  ? 23.970 7.030   37.927 1.00 16.48 ? 64  GLY B N   1 
ATOM   1558 C  CA  . GLY B 2 64  ? 23.901 7.035   36.481 1.00 16.04 ? 64  GLY B CA  1 
ATOM   1559 C  C   . GLY B 2 64  ? 23.236 8.301   36.056 1.00 17.48 ? 64  GLY B C   1 
ATOM   1560 O  O   . GLY B 2 64  ? 23.642 8.882   35.045 1.00 16.85 ? 64  GLY B O   1 
ATOM   1561 N  N   . LYS B 2 65  ? 22.175 8.745   36.752 1.00 21.42 ? 65  LYS B N   1 
ATOM   1562 C  CA  . LYS B 2 65  ? 21.492 10.002  36.332 1.00 19.69 ? 65  LYS B CA  1 
ATOM   1563 C  C   . LYS B 2 65  ? 22.419 11.192  36.528 1.00 14.41 ? 65  LYS B C   1 
ATOM   1564 O  O   . LYS B 2 65  ? 22.454 12.025  35.639 1.00 18.55 ? 65  LYS B O   1 
ATOM   1565 C  CB  . LYS B 2 65  ? 20.165 10.223  37.146 1.00 21.11 ? 65  LYS B CB  1 
ATOM   1566 C  CG  . LYS B 2 65  ? 19.511 11.566  36.781 1.00 27.42 ? 65  LYS B CG  1 
ATOM   1567 C  CD  . LYS B 2 65  ? 18.271 11.838  37.580 1.00 51.89 ? 65  LYS B CD  1 
ATOM   1568 C  CE  . LYS B 2 65  ? 17.633 13.205  37.078 1.00 52.31 ? 65  LYS B CE  1 
ATOM   1569 N  NZ  . LYS B 2 65  ? 16.129 12.882  36.838 1.00 49.29 ? 65  LYS B NZ  1 
ATOM   1570 N  N   . LYS B 2 66  ? 23.150 11.256  37.590 1.00 14.38 ? 66  LYS B N   1 
ATOM   1571 C  CA  . LYS B 2 66  ? 24.090 12.371  37.872 1.00 20.10 ? 66  LYS B CA  1 
ATOM   1572 C  C   . LYS B 2 66  ? 25.182 12.433  36.797 1.00 22.38 ? 66  LYS B C   1 
ATOM   1573 O  O   . LYS B 2 66  ? 25.515 13.506  36.294 1.00 20.11 ? 66  LYS B O   1 
ATOM   1574 C  CB  . LYS B 2 66  ? 24.586 12.232  39.254 1.00 25.18 ? 66  LYS B CB  1 
ATOM   1575 C  CG  . LYS B 2 66  ? 25.824 12.662  39.834 1.00 36.42 ? 66  LYS B CG  1 
ATOM   1576 C  CD  . LYS B 2 66  ? 25.807 12.834  41.374 1.00 52.54 ? 66  LYS B CD  1 
ATOM   1577 C  CE  . LYS B 2 66  ? 25.060 11.823  42.217 1.00 58.33 ? 66  LYS B CE  1 
ATOM   1578 N  NZ  . LYS B 2 66  ? 25.745 11.395  43.513 1.00 53.35 ? 66  LYS B NZ  1 
ATOM   1579 N  N   . VAL B 2 67  ? 25.811 11.303  36.515 1.00 17.51 ? 67  VAL B N   1 
ATOM   1580 C  CA  . VAL B 2 67  ? 26.800 11.169  35.457 1.00 20.35 ? 67  VAL B CA  1 
ATOM   1581 C  C   . VAL B 2 67  ? 26.199 11.633  34.125 1.00 18.80 ? 67  VAL B C   1 
ATOM   1582 O  O   . VAL B 2 67  ? 26.772 12.390  33.291 1.00 22.45 ? 67  VAL B O   1 
ATOM   1583 C  CB  . VAL B 2 67  ? 27.271 9.662   35.417 1.00 17.25 ? 67  VAL B CB  1 
ATOM   1584 C  CG1 . VAL B 2 67  ? 28.003 9.411   34.089 1.00 19.38 ? 67  VAL B CG1 1 
ATOM   1585 C  CG2 . VAL B 2 67  ? 28.073 9.339   36.623 1.00 16.86 ? 67  VAL B CG2 1 
ATOM   1586 N  N   . LEU B 2 68  ? 24.971 11.234  33.731 1.00 15.22 ? 68  LEU B N   1 
ATOM   1587 C  CA  . LEU B 2 68  ? 24.361 11.590  32.522 1.00 15.83 ? 68  LEU B CA  1 
ATOM   1588 C  C   . LEU B 2 68  ? 23.926 13.050  32.437 1.00 22.38 ? 68  LEU B C   1 
ATOM   1589 O  O   . LEU B 2 68  ? 24.016 13.630  31.343 1.00 23.97 ? 68  LEU B O   1 
ATOM   1590 C  CB  . LEU B 2 68  ? 23.126 10.789  32.044 1.00 18.77 ? 68  LEU B CB  1 
ATOM   1591 C  CG  . LEU B 2 68  ? 23.397 10.225  30.586 1.00 30.35 ? 68  LEU B CG  1 
ATOM   1592 C  CD1 . LEU B 2 68  ? 24.439 9.125   30.736 1.00 30.24 ? 68  LEU B CD1 1 
ATOM   1593 C  CD2 . LEU B 2 68  ? 22.061 9.877   30.062 1.00 36.60 ? 68  LEU B CD2 1 
ATOM   1594 N  N   . HIS B 2 69  ? 23.517 13.574  33.574 1.00 20.52 ? 69  HIS B N   1 
ATOM   1595 C  CA  . HIS B 2 69  ? 23.142 15.003  33.561 1.00 20.52 ? 69  HIS B CA  1 
ATOM   1596 C  C   . HIS B 2 69  ? 24.386 15.841  33.236 1.00 21.59 ? 69  HIS B C   1 
ATOM   1597 O  O   . HIS B 2 69  ? 24.350 16.786  32.483 1.00 21.22 ? 69  HIS B O   1 
ATOM   1598 C  CB  . HIS B 2 69  ? 22.686 15.358  34.988 1.00 24.71 ? 69  HIS B CB  1 
ATOM   1599 C  CG  . HIS B 2 69  ? 21.984 16.696  34.968 1.00 26.80 ? 69  HIS B CG  1 
ATOM   1600 N  ND1 . HIS B 2 69  ? 20.792 16.847  34.265 1.00 36.74 ? 69  HIS B ND1 1 
ATOM   1601 C  CD2 . HIS B 2 69  ? 22.328 17.911  35.465 1.00 27.15 ? 69  HIS B CD2 1 
ATOM   1602 C  CE1 . HIS B 2 69  ? 20.386 18.091  34.336 1.00 34.59 ? 69  HIS B CE1 1 
ATOM   1603 N  NE2 . HIS B 2 69  ? 21.312 18.747  35.017 1.00 31.23 ? 69  HIS B NE2 1 
ATOM   1604 N  N   . SER B 2 70  ? 25.502 15.453  33.800 1.00 17.47 ? 70  SER B N   1 
ATOM   1605 C  CA  . SER B 2 70  ? 26.772 16.125  33.586 1.00 22.24 ? 70  SER B CA  1 
ATOM   1606 C  C   . SER B 2 70  ? 27.237 15.991  32.156 1.00 28.32 ? 70  SER B C   1 
ATOM   1607 O  O   . SER B 2 70  ? 27.773 16.920  31.495 1.00 28.51 ? 70  SER B O   1 
ATOM   1608 C  CB  . SER B 2 70  ? 27.706 15.565  34.648 1.00 24.95 ? 70  SER B CB  1 
ATOM   1609 O  OG  . SER B 2 70  ? 28.979 15.976  34.434 1.00 29.45 ? 70  SER B OG  1 
ATOM   1610 N  N   . PHE B 2 71  ? 26.989 14.831  31.559 1.00 24.77 ? 71  PHE B N   1 
ATOM   1611 C  CA  . PHE B 2 71  ? 27.299 14.579  30.160 1.00 23.63 ? 71  PHE B CA  1 
ATOM   1612 C  C   . PHE B 2 71  ? 26.476 15.509  29.283 1.00 22.36 ? 71  PHE B C   1 
ATOM   1613 O  O   . PHE B 2 71  ? 27.050 16.187  28.420 1.00 19.97 ? 71  PHE B O   1 
ATOM   1614 C  CB  . PHE B 2 71  ? 26.924 13.119  29.916 1.00 31.12 ? 71  PHE B CB  1 
ATOM   1615 C  CG  . PHE B 2 71  ? 27.588 12.645  28.664 1.00 29.86 ? 71  PHE B CG  1 
ATOM   1616 C  CD1 . PHE B 2 71  ? 26.963 12.819  27.441 1.00 33.88 ? 71  PHE B CD1 1 
ATOM   1617 C  CD2 . PHE B 2 71  ? 28.817 12.048  28.761 1.00 33.13 ? 71  PHE B CD2 1 
ATOM   1618 C  CE1 . PHE B 2 71  ? 27.637 12.390  26.301 1.00 39.41 ? 71  PHE B CE1 1 
ATOM   1619 C  CE2 . PHE B 2 71  ? 29.497 11.603  27.655 1.00 29.66 ? 71  PHE B CE2 1 
ATOM   1620 C  CZ  . PHE B 2 71  ? 28.884 11.792  26.446 1.00 34.68 ? 71  PHE B CZ  1 
ATOM   1621 N  N   . GLY B 2 72  ? 25.183 15.617  29.575 1.00 18.84 ? 72  GLY B N   1 
ATOM   1622 C  CA  . GLY B 2 72  ? 24.250 16.522  28.924 1.00 19.05 ? 72  GLY B CA  1 
ATOM   1623 C  C   . GLY B 2 72  ? 24.761 17.977  28.964 1.00 22.78 ? 72  GLY B C   1 
ATOM   1624 O  O   . GLY B 2 72  ? 24.642 18.826  28.050 1.00 23.97 ? 72  GLY B O   1 
ATOM   1625 N  N   . GLU B 2 73  ? 25.438 18.376  30.012 1.00 23.83 ? 73  GLU B N   1 
ATOM   1626 C  CA  . GLU B 2 73  ? 26.074 19.670  30.093 1.00 28.20 ? 73  GLU B CA  1 
ATOM   1627 C  C   . GLU B 2 73  ? 27.243 19.765  29.081 1.00 31.14 ? 73  GLU B C   1 
ATOM   1628 O  O   . GLU B 2 73  ? 27.399 20.807  28.435 1.00 28.87 ? 73  GLU B O   1 
ATOM   1629 C  CB  . GLU B 2 73  ? 26.687 19.881  31.476 1.00 29.09 ? 73  GLU B CB  1 
ATOM   1630 C  CG  . GLU B 2 73  ? 27.302 21.308  31.447 1.00 54.89 ? 73  GLU B CG  1 
ATOM   1631 C  CD  . GLU B 2 73  ? 27.065 22.014  32.782 1.00 72.03 ? 73  GLU B CD  1 
ATOM   1632 O  OE1 . GLU B 2 73  ? 26.258 21.360  33.511 1.00 68.44 ? 73  GLU B OE1 1 
ATOM   1633 O  OE2 . GLU B 2 73  ? 27.674 23.110  33.047 1.00 60.64 ? 73  GLU B OE2 1 
ATOM   1634 N  N   . GLY B 2 74  ? 28.094 18.753  28.937 1.00 24.73 ? 74  GLY B N   1 
ATOM   1635 C  CA  . GLY B 2 74  ? 29.140 18.859  27.915 1.00 23.35 ? 74  GLY B CA  1 
ATOM   1636 C  C   . GLY B 2 74  ? 28.447 18.898  26.554 1.00 25.96 ? 74  GLY B C   1 
ATOM   1637 O  O   . GLY B 2 74  ? 28.939 19.610  25.669 1.00 24.65 ? 74  GLY B O   1 
ATOM   1638 N  N   . VAL B 2 75  ? 27.326 18.232  26.279 1.00 20.29 ? 75  VAL B N   1 
ATOM   1639 C  CA  . VAL B 2 75  ? 26.652 18.261  25.015 1.00 20.33 ? 75  VAL B CA  1 
ATOM   1640 C  C   . VAL B 2 75  ? 26.162 19.685  24.698 1.00 25.94 ? 75  VAL B C   1 
ATOM   1641 O  O   . VAL B 2 75  ? 26.099 20.074  23.499 1.00 26.12 ? 75  VAL B O   1 
ATOM   1642 C  CB  . VAL B 2 75  ? 25.474 17.293  24.907 1.00 26.92 ? 75  VAL B CB  1 
ATOM   1643 C  CG1 . VAL B 2 75  ? 24.574 17.477  23.701 1.00 26.98 ? 75  VAL B CG1 1 
ATOM   1644 C  CG2 . VAL B 2 75  ? 26.009 15.814  24.881 1.00 33.62 ? 75  VAL B CG2 1 
ATOM   1645 N  N   . HIS B 2 76  ? 25.771 20.420  25.734 1.00 25.86 ? 76  HIS B N   1 
ATOM   1646 C  CA  . HIS B 2 76  ? 25.259 21.775  25.525 1.00 27.24 ? 76  HIS B CA  1 
ATOM   1647 C  C   . HIS B 2 76  ? 26.363 22.799  25.491 1.00 28.84 ? 76  HIS B C   1 
ATOM   1648 O  O   . HIS B 2 76  ? 26.130 24.009  25.355 1.00 31.77 ? 76  HIS B O   1 
ATOM   1649 C  CB  . HIS B 2 76  ? 24.161 21.995  26.604 1.00 22.95 ? 76  HIS B CB  1 
ATOM   1650 C  CG  . HIS B 2 76  ? 22.882 21.349  26.102 1.00 25.55 ? 76  HIS B CG  1 
ATOM   1651 N  ND1 . HIS B 2 76  ? 22.112 20.440  26.782 1.00 31.62 ? 76  HIS B ND1 1 
ATOM   1652 C  CD2 . HIS B 2 76  ? 22.225 21.614  24.921 1.00 28.37 ? 76  HIS B CD2 1 
ATOM   1653 C  CE1 . HIS B 2 76  ? 21.060 20.137  25.972 1.00 32.09 ? 76  HIS B CE1 1 
ATOM   1654 N  NE2 . HIS B 2 76  ? 21.068 20.841  24.835 1.00 29.20 ? 76  HIS B NE2 1 
ATOM   1655 N  N   . HIS B 2 77  ? 27.642 22.416  25.660 1.00 27.01 ? 77  HIS B N   1 
ATOM   1656 C  CA  . HIS B 2 77  ? 28.836 23.250  25.671 1.00 23.06 ? 77  HIS B CA  1 
ATOM   1657 C  C   . HIS B 2 77  ? 30.043 22.607  24.934 1.00 22.41 ? 77  HIS B C   1 
ATOM   1658 O  O   . HIS B 2 77  ? 31.161 22.548  25.480 1.00 26.00 ? 77  HIS B O   1 
ATOM   1659 C  CB  . HIS B 2 77  ? 29.355 23.463  27.113 1.00 26.35 ? 77  HIS B CB  1 
ATOM   1660 C  CG  . HIS B 2 77  ? 28.350 24.172  27.966 1.00 41.90 ? 77  HIS B CG  1 
ATOM   1661 N  ND1 . HIS B 2 77  ? 27.250 23.500  28.486 1.00 40.44 ? 77  HIS B ND1 1 
ATOM   1662 C  CD2 . HIS B 2 77  ? 28.219 25.474  28.340 1.00 41.71 ? 77  HIS B CD2 1 
ATOM   1663 C  CE1 . HIS B 2 77  ? 26.480 24.328  29.128 1.00 43.99 ? 77  HIS B CE1 1 
ATOM   1664 N  NE2 . HIS B 2 77  ? 27.075 25.529  29.100 1.00 49.43 ? 77  HIS B NE2 1 
ATOM   1665 N  N   . LEU B 2 78  ? 29.777 22.136  23.719 1.00 22.60 ? 78  LEU B N   1 
ATOM   1666 C  CA  . LEU B 2 78  ? 30.744 21.385  22.904 1.00 29.61 ? 78  LEU B CA  1 
ATOM   1667 C  C   . LEU B 2 78  ? 31.964 22.188  22.492 1.00 36.65 ? 78  LEU B C   1 
ATOM   1668 O  O   . LEU B 2 78  ? 33.105 21.701  22.304 1.00 38.79 ? 78  LEU B O   1 
ATOM   1669 C  CB  . LEU B 2 78  ? 30.074 20.761  21.671 1.00 31.04 ? 78  LEU B CB  1 
ATOM   1670 C  CG  . LEU B 2 78  ? 29.042 19.613  21.808 1.00 34.51 ? 78  LEU B CG  1 
ATOM   1671 C  CD1 . LEU B 2 78  ? 28.143 19.438  20.590 1.00 32.52 ? 78  LEU B CD1 1 
ATOM   1672 C  CD2 . LEU B 2 78  ? 29.798 18.339  22.236 1.00 35.54 ? 78  LEU B CD2 1 
ATOM   1673 N  N   . ASP B 2 79  ? 31.771 23.521  22.471 1.00 35.79 ? 79  ASP B N   1 
ATOM   1674 C  CA  . ASP B 2 79  ? 32.855 24.465  22.200 1.00 43.54 ? 79  ASP B CA  1 
ATOM   1675 C  C   . ASP B 2 79  ? 33.641 24.727  23.494 1.00 41.89 ? 79  ASP B C   1 
ATOM   1676 O  O   . ASP B 2 79  ? 34.535 25.586  23.551 1.00 44.71 ? 79  ASP B O   1 
ATOM   1677 C  CB  . ASP B 2 79  ? 32.358 25.758  21.561 1.00 49.34 ? 79  ASP B CB  1 
ATOM   1678 C  CG  . ASP B 2 79  ? 31.167 26.439  22.206 1.00 64.28 ? 79  ASP B CG  1 
ATOM   1679 O  OD1 . ASP B 2 79  ? 30.885 26.255  23.429 1.00 62.06 ? 79  ASP B OD1 1 
ATOM   1680 O  OD2 . ASP B 2 79  ? 30.502 27.193  21.382 1.00 69.95 ? 79  ASP B OD2 1 
ATOM   1681 N  N   . ASN B 2 80  ? 33.369 23.939  24.552 1.00 35.35 ? 80  ASN B N   1 
ATOM   1682 C  CA  . ASN B 2 80  ? 34.141 24.235  25.770 1.00 35.20 ? 80  ASN B CA  1 
ATOM   1683 C  C   . ASN B 2 80  ? 34.080 23.119  26.764 1.00 33.52 ? 80  ASN B C   1 
ATOM   1684 O  O   . ASN B 2 80  ? 33.729 23.272  27.941 1.00 37.52 ? 80  ASN B O   1 
ATOM   1685 C  CB  . ASN B 2 80  ? 33.504 25.568  26.158 1.00 41.15 ? 80  ASN B CB  1 
ATOM   1686 C  CG  . ASN B 2 80  ? 33.956 26.141  27.470 1.00 63.61 ? 80  ASN B CG  1 
ATOM   1687 O  OD1 . ASN B 2 80  ? 35.141 26.084  27.907 1.00 55.11 ? 80  ASN B OD1 1 
ATOM   1688 N  ND2 . ASN B 2 80  ? 32.869 26.655  28.101 1.00 66.02 ? 80  ASN B ND2 1 
ATOM   1689 N  N   . LEU B 2 81  ? 34.486 21.939  26.316 1.00 32.85 ? 81  LEU B N   1 
ATOM   1690 C  CA  . LEU B 2 81  ? 34.437 20.766  27.200 1.00 31.84 ? 81  LEU B CA  1 
ATOM   1691 C  C   . LEU B 2 81  ? 35.383 20.818  28.357 1.00 34.23 ? 81  LEU B C   1 
ATOM   1692 O  O   . LEU B 2 81  ? 35.169 20.549  29.544 1.00 31.64 ? 81  LEU B O   1 
ATOM   1693 C  CB  . LEU B 2 81  ? 34.726 19.535  26.295 1.00 27.44 ? 81  LEU B CB  1 
ATOM   1694 C  CG  . LEU B 2 81  ? 33.485 19.231  25.471 1.00 34.52 ? 81  LEU B CG  1 
ATOM   1695 C  CD1 . LEU B 2 81  ? 33.728 18.004  24.614 1.00 38.58 ? 81  LEU B CD1 1 
ATOM   1696 C  CD2 . LEU B 2 81  ? 32.236 19.114  26.355 1.00 31.58 ? 81  LEU B CD2 1 
ATOM   1697 N  N   . LYS B 2 82  ? 36.582 21.220  27.988 1.00 36.20 ? 82  LYS B N   1 
ATOM   1698 C  CA  . LYS B 2 82  ? 37.786 21.396  28.802 1.00 35.59 ? 82  LYS B CA  1 
ATOM   1699 C  C   . LYS B 2 82  ? 37.462 22.221  30.001 1.00 34.02 ? 82  LYS B C   1 
ATOM   1700 O  O   . LYS B 2 82  ? 37.739 21.818  31.140 1.00 37.47 ? 82  LYS B O   1 
ATOM   1701 C  CB  . LYS B 2 82  ? 38.829 21.999  27.842 1.00 52.05 ? 82  LYS B CB  1 
ATOM   1702 C  CG  . LYS B 2 82  ? 38.578 21.516  26.366 1.00 59.92 ? 82  LYS B CG  1 
ATOM   1703 C  CD  . LYS B 2 82  ? 37.569 22.285  25.465 1.00 50.70 ? 82  LYS B CD  1 
ATOM   1704 C  CE  . LYS B 2 82  ? 36.966 21.361  24.393 1.00 59.51 ? 82  LYS B CE  1 
ATOM   1705 N  NZ  . LYS B 2 82  ? 35.734 21.771  23.628 1.00 39.20 ? 82  LYS B NZ  1 
ATOM   1706 N  N   . GLY B 2 83  ? 36.769 23.342  29.806 1.00 34.96 ? 83  GLY B N   1 
ATOM   1707 C  CA  . GLY B 2 83  ? 36.394 24.142  30.977 1.00 33.35 ? 83  GLY B CA  1 
ATOM   1708 C  C   . GLY B 2 83  ? 35.129 23.605  31.651 1.00 38.86 ? 83  GLY B C   1 
ATOM   1709 O  O   . GLY B 2 83  ? 34.995 23.776  32.877 1.00 35.53 ? 83  GLY B O   1 
ATOM   1710 N  N   . THR B 2 84  ? 34.202 23.025  30.864 1.00 37.75 ? 84  THR B N   1 
ATOM   1711 C  CA  . THR B 2 84  ? 32.975 22.445  31.476 1.00 35.55 ? 84  THR B CA  1 
ATOM   1712 C  C   . THR B 2 84  ? 33.358 21.379  32.490 1.00 33.75 ? 84  THR B C   1 
ATOM   1713 O  O   . THR B 2 84  ? 32.746 21.332  33.585 1.00 32.56 ? 84  THR B O   1 
ATOM   1714 C  CB  . THR B 2 84  ? 32.075 21.909  30.339 1.00 35.83 ? 84  THR B CB  1 
ATOM   1715 O  OG1 . THR B 2 84  ? 31.606 23.017  29.545 1.00 34.79 ? 84  THR B OG1 1 
ATOM   1716 C  CG2 . THR B 2 84  ? 30.885 21.052  30.765 1.00 34.09 ? 84  THR B CG2 1 
ATOM   1717 N  N   . PHE B 2 85  ? 34.382 20.524  32.270 1.00 32.82 ? 85  PHE B N   1 
ATOM   1718 C  CA  . PHE B 2 85  ? 34.803 19.449  33.137 1.00 28.58 ? 85  PHE B CA  1 
ATOM   1719 C  C   . PHE B 2 85  ? 36.049 19.561  33.934 1.00 30.93 ? 85  PHE B C   1 
ATOM   1720 O  O   . PHE B 2 85  ? 36.460 18.535  34.504 1.00 32.53 ? 85  PHE B O   1 
ATOM   1721 C  CB  . PHE B 2 85  ? 35.070 18.166  32.270 1.00 24.43 ? 85  PHE B CB  1 
ATOM   1722 C  CG  . PHE B 2 85  ? 33.755 17.825  31.635 1.00 28.56 ? 85  PHE B CG  1 
ATOM   1723 C  CD1 . PHE B 2 85  ? 32.773 17.165  32.378 1.00 36.51 ? 85  PHE B CD1 1 
ATOM   1724 C  CD2 . PHE B 2 85  ? 33.431 18.197  30.382 1.00 21.83 ? 85  PHE B CD2 1 
ATOM   1725 C  CE1 . PHE B 2 85  ? 31.545 16.838  31.798 1.00 31.86 ? 85  PHE B CE1 1 
ATOM   1726 C  CE2 . PHE B 2 85  ? 32.246 17.823  29.772 1.00 23.59 ? 85  PHE B CE2 1 
ATOM   1727 C  CZ  . PHE B 2 85  ? 31.280 17.120  30.482 1.00 30.07 ? 85  PHE B CZ  1 
ATOM   1728 N  N   . ALA B 2 86  ? 36.720 20.679  33.977 1.00 35.65 ? 86  ALA B N   1 
ATOM   1729 C  CA  . ALA B 2 86  ? 37.965 20.819  34.759 1.00 35.27 ? 86  ALA B CA  1 
ATOM   1730 C  C   . ALA B 2 86  ? 37.885 20.366  36.205 1.00 33.30 ? 86  ALA B C   1 
ATOM   1731 O  O   . ALA B 2 86  ? 38.681 19.544  36.709 1.00 36.85 ? 86  ALA B O   1 
ATOM   1732 C  CB  . ALA B 2 86  ? 38.361 22.300  34.652 1.00 40.13 ? 86  ALA B CB  1 
ATOM   1733 N  N   . ALA B 2 87  ? 36.888 20.877  36.926 1.00 30.11 ? 87  ALA B N   1 
ATOM   1734 C  CA  . ALA B 2 87  ? 36.666 20.551  38.321 1.00 32.24 ? 87  ALA B CA  1 
ATOM   1735 C  C   . ALA B 2 87  ? 36.338 19.065  38.434 1.00 36.25 ? 87  ALA B C   1 
ATOM   1736 O  O   . ALA B 2 87  ? 36.792 18.427  39.375 1.00 36.33 ? 87  ALA B O   1 
ATOM   1737 C  CB  . ALA B 2 87  ? 35.466 21.323  38.842 1.00 38.32 ? 87  ALA B CB  1 
ATOM   1738 N  N   . LEU B 2 88  ? 35.557 18.539  37.464 1.00 34.28 ? 88  LEU B N   1 
ATOM   1739 C  CA  . LEU B 2 88  ? 35.223 17.092  37.496 1.00 26.68 ? 88  LEU B CA  1 
ATOM   1740 C  C   . LEU B 2 88  ? 36.490 16.293  37.223 1.00 30.54 ? 88  LEU B C   1 
ATOM   1741 O  O   . LEU B 2 88  ? 36.682 15.243  37.880 1.00 26.55 ? 88  LEU B O   1 
ATOM   1742 C  CB  . LEU B 2 88  ? 34.136 16.837  36.504 1.00 27.13 ? 88  LEU B CB  1 
ATOM   1743 C  CG  . LEU B 2 88  ? 32.881 16.154  37.031 1.00 33.35 ? 88  LEU B CG  1 
ATOM   1744 C  CD1 . LEU B 2 88  ? 32.789 16.147  38.538 1.00 32.09 ? 88  LEU B CD1 1 
ATOM   1745 C  CD2 . LEU B 2 88  ? 31.695 16.831  36.422 1.00 28.13 ? 88  LEU B CD2 1 
ATOM   1746 N  N   . SER B 2 89  ? 37.419 16.850  36.416 1.00 28.68 ? 89  SER B N   1 
ATOM   1747 C  CA  . SER B 2 89  ? 38.682 16.237  36.048 1.00 26.68 ? 89  SER B CA  1 
ATOM   1748 C  C   . SER B 2 89  ? 39.595 16.045  37.232 1.00 30.88 ? 89  SER B C   1 
ATOM   1749 O  O   . SER B 2 89  ? 40.199 14.945  37.365 1.00 35.99 ? 89  SER B O   1 
ATOM   1750 C  CB  . SER B 2 89  ? 39.427 17.012  34.937 1.00 30.44 ? 89  SER B CB  1 
ATOM   1751 O  OG  . SER B 2 89  ? 40.489 16.135  34.526 1.00 27.39 ? 89  SER B OG  1 
ATOM   1752 N  N   . GLU B 2 90  ? 39.600 17.057  38.097 1.00 30.32 ? 90  GLU B N   1 
ATOM   1753 C  CA  . GLU B 2 90  ? 40.371 16.940  39.350 1.00 34.67 ? 90  GLU B CA  1 
ATOM   1754 C  C   . GLU B 2 90  ? 39.781 16.020  40.396 1.00 33.60 ? 90  GLU B C   1 
ATOM   1755 O  O   . GLU B 2 90  ? 40.524 15.292  41.091 1.00 35.31 ? 90  GLU B O   1 
ATOM   1756 C  CB  . GLU B 2 90  ? 40.571 18.373  39.869 1.00 42.49 ? 90  GLU B CB  1 
ATOM   1757 C  CG  . GLU B 2 90  ? 41.980 18.788  39.295 1.00 60.72 ? 90  GLU B CG  1 
ATOM   1758 C  CD  . GLU B 2 90  ? 42.361 20.115  39.948 1.00 70.46 ? 90  GLU B CD  1 
ATOM   1759 O  OE1 . GLU B 2 90  ? 41.569 20.562  40.836 1.00 72.52 ? 90  GLU B OE1 1 
ATOM   1760 O  OE2 . GLU B 2 90  ? 43.421 20.679  39.556 1.00 69.56 ? 90  GLU B OE2 1 
ATOM   1761 N  N   . LEU B 2 91  ? 38.443 15.947  40.543 1.00 33.57 ? 91  LEU B N   1 
ATOM   1762 C  CA  . LEU B 2 91  ? 37.787 15.016  41.450 1.00 35.15 ? 91  LEU B CA  1 
ATOM   1763 C  C   . LEU B 2 91  ? 38.175 13.572  41.074 1.00 33.42 ? 91  LEU B C   1 
ATOM   1764 O  O   . LEU B 2 91  ? 38.621 12.750  41.897 1.00 35.14 ? 91  LEU B O   1 
ATOM   1765 C  CB  . LEU B 2 91  ? 36.251 15.192  41.370 1.00 37.89 ? 91  LEU B CB  1 
ATOM   1766 C  CG  . LEU B 2 91  ? 35.326 14.590  42.400 1.00 36.32 ? 91  LEU B CG  1 
ATOM   1767 C  CD1 . LEU B 2 91  ? 33.930 14.289  41.879 1.00 33.46 ? 91  LEU B CD1 1 
ATOM   1768 C  CD2 . LEU B 2 91  ? 35.771 13.236  42.891 1.00 42.65 ? 91  LEU B CD2 1 
ATOM   1769 N  N   . HIS B 2 92  ? 37.967 13.230  39.770 1.00 28.34 ? 92  HIS B N   1 
ATOM   1770 C  CA  . HIS B 2 92  ? 38.282 11.843  39.367 1.00 26.72 ? 92  HIS B CA  1 
ATOM   1771 C  C   . HIS B 2 92  ? 39.750 11.482  39.505 1.00 28.81 ? 92  HIS B C   1 
ATOM   1772 O  O   . HIS B 2 92  ? 40.074 10.405  39.952 1.00 29.91 ? 92  HIS B O   1 
ATOM   1773 C  CB  . HIS B 2 92  ? 37.786 11.594  37.947 1.00 23.96 ? 92  HIS B CB  1 
ATOM   1774 C  CG  . HIS B 2 92  ? 36.259 11.695  37.898 1.00 25.98 ? 92  HIS B CG  1 
ATOM   1775 N  ND1 . HIS B 2 92  ? 35.572 12.862  37.974 1.00 29.13 ? 92  HIS B ND1 1 
ATOM   1776 C  CD2 . HIS B 2 92  ? 35.328 10.685  37.869 1.00 23.97 ? 92  HIS B CD2 1 
ATOM   1777 C  CE1 . HIS B 2 92  ? 34.247 12.645  37.948 1.00 26.33 ? 92  HIS B CE1 1 
ATOM   1778 N  NE2 . HIS B 2 92  ? 34.101 11.355  37.921 1.00 20.10 ? 92  HIS B NE2 1 
ATOM   1779 N  N   . CYS B 2 93  ? 40.676 12.387  39.156 1.00 32.11 ? 93  CYS B N   1 
ATOM   1780 C  CA  . CYS B 2 93  ? 42.106 12.056  39.265 1.00 32.41 ? 93  CYS B CA  1 
ATOM   1781 C  C   . CYS B 2 93  ? 42.587 11.992  40.686 1.00 33.41 ? 93  CYS B C   1 
ATOM   1782 O  O   . CYS B 2 93  ? 43.049 11.037  41.281 1.00 34.88 ? 93  CYS B O   1 
ATOM   1783 C  CB  . CYS B 2 93  ? 42.865 13.163  38.450 1.00 33.71 ? 93  CYS B CB  1 
ATOM   1784 S  SG  . CYS B 2 93  ? 44.662 12.869  38.590 1.00 48.65 ? 93  CYS B SG  1 
ATOM   1785 N  N   . ASP B 2 94  ? 42.309 13.127  41.338 1.00 36.46 ? 94  ASP B N   1 
ATOM   1786 C  CA  . ASP B 2 94  ? 42.759 13.340  42.705 1.00 42.12 ? 94  ASP B CA  1 
ATOM   1787 C  C   . ASP B 2 94  ? 42.088 12.542  43.796 1.00 38.30 ? 94  ASP B C   1 
ATOM   1788 O  O   . ASP B 2 94  ? 42.737 11.953  44.714 1.00 35.94 ? 94  ASP B O   1 
ATOM   1789 C  CB  . ASP B 2 94  ? 42.711 14.872  43.044 1.00 44.65 ? 94  ASP B CB  1 
ATOM   1790 C  CG  . ASP B 2 94  ? 43.340 15.836  42.059 1.00 66.84 ? 94  ASP B CG  1 
ATOM   1791 O  OD1 . ASP B 2 94  ? 44.332 15.568  41.301 1.00 70.80 ? 94  ASP B OD1 1 
ATOM   1792 O  OD2 . ASP B 2 94  ? 42.859 17.028  41.953 1.00 67.10 ? 94  ASP B OD2 1 
ATOM   1793 N  N   . LYS B 2 95  ? 40.769 12.563  43.807 1.00 33.84 ? 95  LYS B N   1 
ATOM   1794 C  CA  . LYS B 2 95  ? 40.057 11.918  44.906 1.00 33.36 ? 95  LYS B CA  1 
ATOM   1795 C  C   . LYS B 2 95  ? 39.641 10.506  44.579 1.00 33.52 ? 95  LYS B C   1 
ATOM   1796 O  O   . LYS B 2 95  ? 39.793 9.646   45.439 1.00 33.34 ? 95  LYS B O   1 
ATOM   1797 C  CB  . LYS B 2 95  ? 38.851 12.806  45.241 1.00 30.60 ? 95  LYS B CB  1 
ATOM   1798 C  CG  . LYS B 2 95  ? 38.515 12.886  46.722 1.00 56.47 ? 95  LYS B CG  1 
ATOM   1799 C  CD  . LYS B 2 95  ? 37.012 13.106  46.960 1.00 69.94 ? 95  LYS B CD  1 
ATOM   1800 C  CE  . LYS B 2 95  ? 36.168 11.829  46.904 1.00 72.16 ? 95  LYS B CE  1 
ATOM   1801 N  NZ  . LYS B 2 95  ? 35.025 11.876  45.882 1.00 79.95 ? 95  LYS B NZ  1 
ATOM   1802 N  N   . LEU B 2 96  ? 39.152 10.329  43.328 1.00 30.54 ? 96  LEU B N   1 
ATOM   1803 C  CA  . LEU B 2 96  ? 38.663 8.980   42.980 1.00 24.14 ? 96  LEU B CA  1 
ATOM   1804 C  C   . LEU B 2 96  ? 39.739 8.134   42.410 1.00 26.54 ? 96  LEU B C   1 
ATOM   1805 O  O   . LEU B 2 96  ? 39.668 6.907   42.622 1.00 30.70 ? 96  LEU B O   1 
ATOM   1806 C  CB  . LEU B 2 96  ? 37.444 9.116   42.077 1.00 24.30 ? 96  LEU B CB  1 
ATOM   1807 C  CG  . LEU B 2 96  ? 36.448 10.142  42.614 1.00 29.72 ? 96  LEU B CG  1 
ATOM   1808 C  CD1 . LEU B 2 96  ? 35.368 10.433  41.559 1.00 27.14 ? 96  LEU B CD1 1 
ATOM   1809 C  CD2 . LEU B 2 96  ? 35.788 9.690   43.907 1.00 29.86 ? 96  LEU B CD2 1 
ATOM   1810 N  N   . HIS B 2 97  ? 40.787 8.728   41.786 1.00 28.25 ? 97  HIS B N   1 
ATOM   1811 C  CA  . HIS B 2 97  ? 41.791 7.853   41.176 1.00 28.28 ? 97  HIS B CA  1 
ATOM   1812 C  C   . HIS B 2 97  ? 41.270 6.884   40.112 1.00 31.38 ? 97  HIS B C   1 
ATOM   1813 O  O   . HIS B 2 97  ? 41.740 5.686   40.033 1.00 30.97 ? 97  HIS B O   1 
ATOM   1814 C  CB  . HIS B 2 97  ? 42.418 6.947   42.277 1.00 36.28 ? 97  HIS B CB  1 
ATOM   1815 C  CG  . HIS B 2 97  ? 43.117 7.859   43.243 1.00 41.82 ? 97  HIS B CG  1 
ATOM   1816 N  ND1 . HIS B 2 97  ? 44.136 8.704   42.837 1.00 47.65 ? 97  HIS B ND1 1 
ATOM   1817 C  CD2 . HIS B 2 97  ? 42.850 8.084   44.539 1.00 42.21 ? 97  HIS B CD2 1 
ATOM   1818 C  CE1 . HIS B 2 97  ? 44.522 9.405   43.900 1.00 45.27 ? 97  HIS B CE1 1 
ATOM   1819 N  NE2 . HIS B 2 97  ? 43.749 9.065   44.925 1.00 39.77 ? 97  HIS B NE2 1 
ATOM   1820 N  N   . VAL B 2 98  ? 40.320 7.311   39.260 1.00 32.06 ? 98  VAL B N   1 
ATOM   1821 C  CA  . VAL B 2 98  ? 39.750 6.487   38.183 1.00 29.08 ? 98  VAL B CA  1 
ATOM   1822 C  C   . VAL B 2 98  ? 40.698 6.417   36.988 1.00 33.40 ? 98  VAL B C   1 
ATOM   1823 O  O   . VAL B 2 98  ? 41.156 7.482   36.499 1.00 32.02 ? 98  VAL B O   1 
ATOM   1824 C  CB  . VAL B 2 98  ? 38.375 7.112   37.798 1.00 25.96 ? 98  VAL B CB  1 
ATOM   1825 C  CG1 . VAL B 2 98  ? 37.714 6.275   36.697 1.00 21.81 ? 98  VAL B CG1 1 
ATOM   1826 C  CG2 . VAL B 2 98  ? 37.518 7.269   39.065 1.00 24.55 ? 98  VAL B CG2 1 
ATOM   1827 N  N   . ASP B 2 99  ? 41.142 5.251   36.460 1.00 31.12 ? 99  ASP B N   1 
ATOM   1828 C  CA  . ASP B 2 99  ? 42.016 5.391   35.248 1.00 26.39 ? 99  ASP B CA  1 
ATOM   1829 C  C   . ASP B 2 99  ? 41.188 5.955   34.118 1.00 25.71 ? 99  ASP B C   1 
ATOM   1830 O  O   . ASP B 2 99  ? 40.086 5.472   33.865 1.00 24.57 ? 99  ASP B O   1 
ATOM   1831 C  CB  . ASP B 2 99  ? 42.608 4.041   34.877 1.00 28.88 ? 99  ASP B CB  1 
ATOM   1832 C  CG  . ASP B 2 99  ? 43.658 4.137   33.758 1.00 29.63 ? 99  ASP B CG  1 
ATOM   1833 O  OD1 . ASP B 2 99  ? 43.264 4.175   32.584 1.00 29.30 ? 99  ASP B OD1 1 
ATOM   1834 O  OD2 . ASP B 2 99  ? 44.863 4.160   34.076 1.00 31.75 ? 99  ASP B OD2 1 
ATOM   1835 N  N   . PRO B 2 100 ? 41.713 6.886   33.329 1.00 29.49 ? 100 PRO B N   1 
ATOM   1836 C  CA  . PRO B 2 100 ? 41.085 7.530   32.196 1.00 23.37 ? 100 PRO B CA  1 
ATOM   1837 C  C   . PRO B 2 100 ? 40.552 6.586   31.174 1.00 18.50 ? 100 PRO B C   1 
ATOM   1838 O  O   . PRO B 2 100 ? 39.627 6.832   30.360 1.00 19.18 ? 100 PRO B O   1 
ATOM   1839 C  CB  . PRO B 2 100 ? 42.172 8.464   31.586 1.00 30.27 ? 100 PRO B CB  1 
ATOM   1840 C  CG  . PRO B 2 100 ? 43.157 8.636   32.739 1.00 30.14 ? 100 PRO B CG  1 
ATOM   1841 C  CD  . PRO B 2 100 ? 43.066 7.474   33.681 1.00 27.43 ? 100 PRO B CD  1 
ATOM   1842 N  N   . GLU B 2 101 ? 41.132 5.352   31.112 1.00 17.98 ? 101 GLU B N   1 
ATOM   1843 C  CA  . GLU B 2 101 ? 40.614 4.346   30.169 1.00 25.57 ? 101 GLU B CA  1 
ATOM   1844 C  C   . GLU B 2 101 ? 39.112 4.016   30.401 1.00 21.39 ? 101 GLU B C   1 
ATOM   1845 O  O   . GLU B 2 101 ? 38.354 3.757   29.486 1.00 20.73 ? 101 GLU B O   1 
ATOM   1846 C  CB  . GLU B 2 101 ? 41.443 3.044   30.224 1.00 27.20 ? 101 GLU B CB  1 
ATOM   1847 C  CG  . GLU B 2 101 ? 40.780 1.929   29.376 1.00 47.35 ? 101 GLU B CG  1 
ATOM   1848 C  CD  . GLU B 2 101 ? 40.691 2.224   27.869 1.00 62.81 ? 101 GLU B CD  1 
ATOM   1849 O  OE1 . GLU B 2 101 ? 41.432 3.177   27.428 1.00 54.02 ? 101 GLU B OE1 1 
ATOM   1850 O  OE2 . GLU B 2 101 ? 39.915 1.482   27.152 1.00 58.87 ? 101 GLU B OE2 1 
ATOM   1851 N  N   . ASN B 2 102 ? 38.711 4.082   31.697 1.00 21.59 ? 102 ASN B N   1 
ATOM   1852 C  CA  . ASN B 2 102 ? 37.333 3.824   32.114 1.00 19.98 ? 102 ASN B CA  1 
ATOM   1853 C  C   . ASN B 2 102 ? 36.416 4.905   31.585 1.00 19.08 ? 102 ASN B C   1 
ATOM   1854 O  O   . ASN B 2 102 ? 35.293 4.500   31.322 1.00 18.40 ? 102 ASN B O   1 
ATOM   1855 C  CB  . ASN B 2 102 ? 37.184 3.681   33.620 1.00 19.05 ? 102 ASN B CB  1 
ATOM   1856 C  CG  . ASN B 2 102 ? 38.084 2.515   34.107 1.00 26.75 ? 102 ASN B CG  1 
ATOM   1857 O  OD1 . ASN B 2 102 ? 39.011 2.677   34.907 1.00 33.13 ? 102 ASN B OD1 1 
ATOM   1858 N  ND2 . ASN B 2 102 ? 37.869 1.339   33.522 1.00 25.05 ? 102 ASN B ND2 1 
ATOM   1859 N  N   . PHE B 2 103 ? 36.887 6.133   31.383 1.00 20.73 ? 103 PHE B N   1 
ATOM   1860 C  CA  . PHE B 2 103 ? 36.024 7.160   30.772 1.00 19.05 ? 103 PHE B CA  1 
ATOM   1861 C  C   . PHE B 2 103 ? 35.649 6.785   29.364 1.00 20.70 ? 103 PHE B C   1 
ATOM   1862 O  O   . PHE B 2 103 ? 34.555 7.071   28.986 1.00 20.51 ? 103 PHE B O   1 
ATOM   1863 C  CB  . PHE B 2 103 ? 36.638 8.555   30.700 1.00 19.18 ? 103 PHE B CB  1 
ATOM   1864 C  CG  . PHE B 2 103 ? 37.009 9.012   32.091 1.00 23.94 ? 103 PHE B CG  1 
ATOM   1865 C  CD1 . PHE B 2 103 ? 36.095 8.860   33.119 1.00 33.26 ? 103 PHE B CD1 1 
ATOM   1866 C  CD2 . PHE B 2 103 ? 38.228 9.626   32.353 1.00 27.61 ? 103 PHE B CD2 1 
ATOM   1867 C  CE1 . PHE B 2 103 ? 36.391 9.220   34.400 1.00 34.38 ? 103 PHE B CE1 1 
ATOM   1868 C  CE2 . PHE B 2 103 ? 38.575 10.020  33.660 1.00 27.57 ? 103 PHE B CE2 1 
ATOM   1869 C  CZ  . PHE B 2 103 ? 37.619 9.793   34.660 1.00 33.94 ? 103 PHE B CZ  1 
ATOM   1870 N  N   . ARG B 2 104 ? 36.580 6.180   28.594 1.00 20.10 ? 104 ARG B N   1 
ATOM   1871 C  CA  . ARG B 2 104 ? 36.320 5.719   27.277 1.00 19.38 ? 104 ARG B CA  1 
ATOM   1872 C  C   . ARG B 2 104 ? 35.379 4.502   27.261 1.00 16.92 ? 104 ARG B C   1 
ATOM   1873 O  O   . ARG B 2 104 ? 34.528 4.453   26.403 1.00 17.28 ? 104 ARG B O   1 
ATOM   1874 C  CB  . ARG B 2 104 ? 37.683 5.194   26.644 1.00 24.84 ? 104 ARG B CB  1 
ATOM   1875 C  CG  . ARG B 2 104 ? 38.441 6.450   26.162 1.00 44.32 ? 104 ARG B CG  1 
ATOM   1876 C  CD  . ARG B 2 104 ? 39.027 7.224   27.342 1.00 59.03 ? 104 ARG B CD  1 
ATOM   1877 N  NE  . ARG B 2 104 ? 40.066 8.224   27.050 1.00 63.69 ? 104 ARG B NE  1 
ATOM   1878 C  CZ  . ARG B 2 104 ? 40.410 9.279   27.785 1.00 61.85 ? 104 ARG B CZ  1 
ATOM   1879 N  NH1 . ARG B 2 104 ? 39.839 9.624   28.947 1.00 58.07 ? 104 ARG B NH1 1 
ATOM   1880 N  NH2 . ARG B 2 104 ? 41.387 10.081  27.363 1.00 67.81 ? 104 ARG B NH2 1 
ATOM   1881 N  N   . LEU B 2 105 ? 35.582 3.596   28.278 1.00 17.92 ? 105 LEU B N   1 
ATOM   1882 C  CA  . LEU B 2 105 ? 34.628 2.433   28.285 1.00 15.56 ? 105 LEU B CA  1 
ATOM   1883 C  C   . LEU B 2 105 ? 33.201 2.908   28.519 1.00 13.87 ? 105 LEU B C   1 
ATOM   1884 O  O   . LEU B 2 105 ? 32.246 2.511   27.852 1.00 18.22 ? 105 LEU B O   1 
ATOM   1885 C  CB  . LEU B 2 105 ? 35.025 1.470   29.386 1.00 16.08 ? 105 LEU B CB  1 
ATOM   1886 C  CG  . LEU B 2 105 ? 36.371 0.732   29.217 1.00 21.07 ? 105 LEU B CG  1 
ATOM   1887 C  CD1 . LEU B 2 105 ? 36.698 -0.172  30.349 1.00 22.32 ? 105 LEU B CD1 1 
ATOM   1888 C  CD2 . LEU B 2 105 ? 36.252 0.008   27.868 1.00 28.08 ? 105 LEU B CD2 1 
ATOM   1889 N  N   . LEU B 2 106 ? 33.077 3.821   29.533 1.00 14.04 ? 106 LEU B N   1 
ATOM   1890 C  CA  . LEU B 2 106 ? 31.697 4.355   29.805 1.00 13.86 ? 106 LEU B CA  1 
ATOM   1891 C  C   . LEU B 2 106 ? 31.099 5.065   28.632 1.00 16.12 ? 106 LEU B C   1 
ATOM   1892 O  O   . LEU B 2 106 ? 29.923 4.894   28.238 1.00 14.07 ? 106 LEU B O   1 
ATOM   1893 C  CB  . LEU B 2 106 ? 31.755 5.229   31.066 1.00 11.91 ? 106 LEU B CB  1 
ATOM   1894 C  CG  . LEU B 2 106 ? 30.409 5.904   31.458 1.00 18.20 ? 106 LEU B CG  1 
ATOM   1895 C  CD1 . LEU B 2 106 ? 29.288 4.911   31.526 1.00 20.59 ? 106 LEU B CD1 1 
ATOM   1896 C  CD2 . LEU B 2 106 ? 30.577 6.600   32.809 1.00 25.74 ? 106 LEU B CD2 1 
ATOM   1897 N  N   . GLY B 2 107 ? 31.915 5.910   27.914 1.00 19.39 ? 107 GLY B N   1 
ATOM   1898 C  CA  . GLY B 2 107 ? 31.408 6.618   26.716 1.00 15.67 ? 107 GLY B CA  1 
ATOM   1899 C  C   . GLY B 2 107 ? 30.878 5.676   25.669 1.00 14.67 ? 107 GLY B C   1 
ATOM   1900 O  O   . GLY B 2 107 ? 29.855 5.815   25.083 1.00 15.26 ? 107 GLY B O   1 
ATOM   1901 N  N   . ASN B 2 108 ? 31.604 4.529   25.463 1.00 13.88 ? 108 ASN B N   1 
ATOM   1902 C  CA  . ASN B 2 108 ? 31.158 3.568   24.473 1.00 12.44 ? 108 ASN B CA  1 
ATOM   1903 C  C   . ASN B 2 108 ? 29.927 2.776   24.946 1.00 10.15 ? 108 ASN B C   1 
ATOM   1904 O  O   . ASN B 2 108 ? 29.027 2.493   24.144 1.00 13.18 ? 108 ASN B O   1 
ATOM   1905 C  CB  . ASN B 2 108 ? 32.370 2.610   24.222 1.00 16.80 ? 108 ASN B CB  1 
ATOM   1906 C  CG  . ASN B 2 108 ? 33.370 3.237   23.207 1.00 22.95 ? 108 ASN B CG  1 
ATOM   1907 O  OD1 . ASN B 2 108 ? 34.486 2.751   23.129 1.00 34.59 ? 108 ASN B OD1 1 
ATOM   1908 N  ND2 . ASN B 2 108 ? 32.975 4.196   22.413 1.00 19.01 ? 108 ASN B ND2 1 
ATOM   1909 N  N   . VAL B 2 109 ? 29.971 2.455   26.282 1.00 12.37 ? 109 VAL B N   1 
ATOM   1910 C  CA  . VAL B 2 109 ? 28.727 1.765   26.773 1.00 15.34 ? 109 VAL B CA  1 
ATOM   1911 C  C   . VAL B 2 109 ? 27.533 2.714   26.575 1.00 15.95 ? 109 VAL B C   1 
ATOM   1912 O  O   . VAL B 2 109 ? 26.467 2.286   26.159 1.00 14.74 ? 109 VAL B O   1 
ATOM   1913 C  CB  . VAL B 2 109 ? 28.902 1.355   28.244 1.00 17.40 ? 109 VAL B CB  1 
ATOM   1914 C  CG1 . VAL B 2 109 ? 27.493 0.916   28.802 1.00 21.03 ? 109 VAL B CG1 1 
ATOM   1915 C  CG2 . VAL B 2 109 ? 29.912 0.230   28.327 1.00 18.66 ? 109 VAL B CG2 1 
ATOM   1916 N  N   . LEU B 2 110 ? 27.711 4.035   26.797 1.00 13.41 ? 110 LEU B N   1 
ATOM   1917 C  CA  . LEU B 2 110 ? 26.626 4.998   26.577 1.00 12.99 ? 110 LEU B CA  1 
ATOM   1918 C  C   . LEU B 2 110 ? 26.100 4.992   25.183 1.00 14.15 ? 110 LEU B C   1 
ATOM   1919 O  O   . LEU B 2 110 ? 24.920 4.946   24.831 1.00 14.33 ? 110 LEU B O   1 
ATOM   1920 C  CB  . LEU B 2 110 ? 27.080 6.420   26.940 1.00 12.16 ? 110 LEU B CB  1 
ATOM   1921 C  CG  . LEU B 2 110 ? 26.035 7.480   26.540 1.00 16.54 ? 110 LEU B CG  1 
ATOM   1922 C  CD1 . LEU B 2 110 ? 24.721 7.288   27.235 1.00 20.01 ? 110 LEU B CD1 1 
ATOM   1923 C  CD2 . LEU B 2 110 ? 26.627 8.825   26.956 1.00 18.30 ? 110 LEU B CD2 1 
ATOM   1924 N  N   . VAL B 2 111 ? 27.102 4.905   24.238 1.00 15.21 ? 111 VAL B N   1 
ATOM   1925 C  CA  . VAL B 2 111 ? 26.692 4.837   22.822 1.00 16.37 ? 111 VAL B CA  1 
ATOM   1926 C  C   . VAL B 2 111 ? 25.870 3.583   22.540 1.00 13.32 ? 111 VAL B C   1 
ATOM   1927 O  O   . VAL B 2 111 ? 24.912 3.639   21.796 1.00 12.59 ? 111 VAL B O   1 
ATOM   1928 C  CB  . VAL B 2 111 ? 27.976 4.920   21.914 1.00 19.69 ? 111 VAL B CB  1 
ATOM   1929 C  CG1 . VAL B 2 111 ? 27.620 4.524   20.431 1.00 15.52 ? 111 VAL B CG1 1 
ATOM   1930 C  CG2 . VAL B 2 111 ? 28.536 6.311   21.970 1.00 12.58 ? 111 VAL B CG2 1 
ATOM   1931 N  N   . VAL B 2 112 ? 26.314 2.432   23.111 1.00 13.72 ? 112 VAL B N   1 
ATOM   1932 C  CA  . VAL B 2 112 ? 25.531 1.169   22.878 1.00 15.06 ? 112 VAL B CA  1 
ATOM   1933 C  C   . VAL B 2 112 ? 24.090 1.313   23.462 1.00 13.04 ? 112 VAL B C   1 
ATOM   1934 O  O   . VAL B 2 112 ? 23.132 0.814   22.857 1.00 13.19 ? 112 VAL B O   1 
ATOM   1935 C  CB  . VAL B 2 112 ? 26.236 -0.023  23.513 1.00 15.99 ? 112 VAL B CB  1 
ATOM   1936 C  CG1 . VAL B 2 112 ? 25.372 -1.274  23.337 1.00 18.05 ? 112 VAL B CG1 1 
ATOM   1937 C  CG2 . VAL B 2 112 ? 27.643 -0.333  22.852 1.00 19.79 ? 112 VAL B CG2 1 
ATOM   1938 N  N   . VAL B 2 113 ? 23.964 2.020   24.578 1.00 12.05 ? 113 VAL B N   1 
ATOM   1939 C  CA  . VAL B 2 113 ? 22.616 2.226   25.222 1.00 12.90 ? 113 VAL B CA  1 
ATOM   1940 C  C   . VAL B 2 113 ? 21.766 3.126   24.373 1.00 15.18 ? 113 VAL B C   1 
ATOM   1941 O  O   . VAL B 2 113 ? 20.564 2.934   24.151 1.00 14.32 ? 113 VAL B O   1 
ATOM   1942 C  CB  . VAL B 2 113 ? 22.814 2.717   26.690 1.00 17.83 ? 113 VAL B CB  1 
ATOM   1943 C  CG1 . VAL B 2 113 ? 21.467 3.140   27.302 1.00 12.77 ? 113 VAL B CG1 1 
ATOM   1944 C  CG2 . VAL B 2 113 ? 23.460 1.681   27.579 1.00 13.76 ? 113 VAL B CG2 1 
ATOM   1945 N  N   . LEU B 2 114 ? 22.346 4.225   23.807 1.00 15.98 ? 114 LEU B N   1 
ATOM   1946 C  CA  . LEU B 2 114 ? 21.555 5.101   22.884 1.00 14.12 ? 114 LEU B CA  1 
ATOM   1947 C  C   . LEU B 2 114 ? 21.087 4.319   21.706 1.00 14.30 ? 114 LEU B C   1 
ATOM   1948 O  O   . LEU B 2 114 ? 20.014 4.442   21.206 1.00 16.24 ? 114 LEU B O   1 
ATOM   1949 C  CB  . LEU B 2 114 ? 22.427 6.300   22.421 1.00 10.38 ? 114 LEU B CB  1 
ATOM   1950 C  CG  . LEU B 2 114 ? 22.835 7.258   23.526 1.00 18.11 ? 114 LEU B CG  1 
ATOM   1951 C  CD1 . LEU B 2 114 ? 23.717 8.356   22.915 1.00 18.54 ? 114 LEU B CD1 1 
ATOM   1952 C  CD2 . LEU B 2 114 ? 21.593 7.913   24.123 1.00 18.84 ? 114 LEU B CD2 1 
ATOM   1953 N  N   . ALA B 2 115 ? 21.926 3.424   21.099 1.00 13.49 ? 115 ALA B N   1 
ATOM   1954 C  CA  . ALA B 2 115 ? 21.518 2.595   20.014 1.00 13.54 ? 115 ALA B CA  1 
ATOM   1955 C  C   . ALA B 2 115 ? 20.325 1.729   20.390 1.00 13.31 ? 115 ALA B C   1 
ATOM   1956 O  O   . ALA B 2 115 ? 19.374 1.552   19.607 1.00 14.90 ? 115 ALA B O   1 
ATOM   1957 C  CB  . ALA B 2 115 ? 22.730 1.665   19.719 1.00 11.81 ? 115 ALA B CB  1 
ATOM   1958 N  N   . ARG B 2 116 ? 20.437 1.122   21.570 1.00 13.68 ? 116 ARG B N   1 
ATOM   1959 C  CA  . ARG B 2 116 ? 19.339 0.167   22.036 1.00 18.19 ? 116 ARG B CA  1 
ATOM   1960 C  C   . ARG B 2 116 ? 18.019 0.908   22.169 1.00 17.56 ? 116 ARG B C   1 
ATOM   1961 O  O   . ARG B 2 116 ? 16.992 0.468   21.783 1.00 18.26 ? 116 ARG B O   1 
ATOM   1962 C  CB  . ARG B 2 116 ? 19.707 -0.501  23.380 1.00 12.52 ? 116 ARG B CB  1 
ATOM   1963 C  CG  . ARG B 2 116 ? 18.872 -1.754  23.583 1.00 13.05 ? 116 ARG B CG  1 
ATOM   1964 C  CD  . ARG B 2 116 ? 19.278 -2.452  24.881 1.00 17.36 ? 116 ARG B CD  1 
ATOM   1965 N  NE  . ARG B 2 116 ? 18.730 -1.674  26.022 1.00 17.92 ? 116 ARG B NE  1 
ATOM   1966 C  CZ  . ARG B 2 116 ? 17.447 -1.699  26.338 1.00 20.69 ? 116 ARG B CZ  1 
ATOM   1967 N  NH1 . ARG B 2 116 ? 16.544 -2.434  25.669 1.00 16.59 ? 116 ARG B NH1 1 
ATOM   1968 N  NH2 . ARG B 2 116 ? 16.975 -0.923  27.304 1.00 22.23 ? 116 ARG B NH2 1 
ATOM   1969 N  N   . HIS B 2 117 ? 18.106 2.135   22.784 1.00 16.95 ? 117 HIS B N   1 
ATOM   1970 C  CA  . HIS B 2 117 ? 16.906 2.924   22.929 1.00 16.62 ? 117 HIS B CA  1 
ATOM   1971 C  C   . HIS B 2 117 ? 16.453 3.570   21.643 1.00 20.99 ? 117 HIS B C   1 
ATOM   1972 O  O   . HIS B 2 117 ? 15.207 3.689   21.546 1.00 23.54 ? 117 HIS B O   1 
ATOM   1973 C  CB  . HIS B 2 117 ? 17.046 4.035   23.987 1.00 17.69 ? 117 HIS B CB  1 
ATOM   1974 C  CG  . HIS B 2 117 ? 17.228 3.481   25.375 1.00 22.87 ? 117 HIS B CG  1 
ATOM   1975 N  ND1 . HIS B 2 117 ? 16.184 3.431   26.280 1.00 33.12 ? 117 HIS B ND1 1 
ATOM   1976 C  CD2 . HIS B 2 117 ? 18.246 2.869   25.940 1.00 18.82 ? 117 HIS B CD2 1 
ATOM   1977 C  CE1 . HIS B 2 117 ? 16.650 2.931   27.445 1.00 26.96 ? 117 HIS B CE1 1 
ATOM   1978 N  NE2 . HIS B 2 117 ? 17.872 2.565   27.239 1.00 26.96 ? 117 HIS B NE2 1 
ATOM   1979 N  N   . PHE B 2 118 ? 17.232 4.012   20.679 1.00 18.11 ? 118 PHE B N   1 
ATOM   1980 C  CA  . PHE B 2 118 ? 16.695 4.736   19.523 1.00 19.04 ? 118 PHE B CA  1 
ATOM   1981 C  C   . PHE B 2 118 ? 16.609 3.878   18.295 1.00 21.04 ? 118 PHE B C   1 
ATOM   1982 O  O   . PHE B 2 118 ? 15.992 4.321   17.342 1.00 19.78 ? 118 PHE B O   1 
ATOM   1983 C  CB  . PHE B 2 118 ? 17.508 6.012   19.357 1.00 14.24 ? 118 PHE B CB  1 
ATOM   1984 C  CG  . PHE B 2 118 ? 17.315 6.965   20.539 1.00 21.63 ? 118 PHE B CG  1 
ATOM   1985 C  CD1 . PHE B 2 118 ? 16.101 7.716   20.569 1.00 33.22 ? 118 PHE B CD1 1 
ATOM   1986 C  CD2 . PHE B 2 118 ? 18.224 7.136   21.544 1.00 18.05 ? 118 PHE B CD2 1 
ATOM   1987 C  CE1 . PHE B 2 118 ? 15.876 8.588   21.643 1.00 23.86 ? 118 PHE B CE1 1 
ATOM   1988 C  CE2 . PHE B 2 118 ? 17.994 7.980   22.629 1.00 25.05 ? 118 PHE B CE2 1 
ATOM   1989 C  CZ  . PHE B 2 118 ? 16.814 8.717   22.627 1.00 21.35 ? 118 PHE B CZ  1 
ATOM   1990 N  N   . GLY B 2 119 ? 17.208 2.676   18.374 1.00 18.60 ? 119 GLY B N   1 
ATOM   1991 C  CA  . GLY B 2 119 ? 17.108 1.793   17.232 1.00 19.00 ? 119 GLY B CA  1 
ATOM   1992 C  C   . GLY B 2 119 ? 17.647 2.415   15.967 1.00 22.05 ? 119 GLY B C   1 
ATOM   1993 O  O   . GLY B 2 119 ? 18.684 3.044   15.900 1.00 23.81 ? 119 GLY B O   1 
ATOM   1994 N  N   . LYS B 2 120 ? 16.856 2.279   14.895 1.00 22.12 ? 120 LYS B N   1 
ATOM   1995 C  CA  . LYS B 2 120 ? 17.206 2.762   13.537 1.00 27.99 ? 120 LYS B CA  1 
ATOM   1996 C  C   . LYS B 2 120 ? 17.279 4.234   13.301 1.00 26.67 ? 120 LYS B C   1 
ATOM   1997 O  O   . LYS B 2 120 ? 17.922 4.687   12.369 1.00 27.70 ? 120 LYS B O   1 
ATOM   1998 C  CB  . LYS B 2 120 ? 16.352 2.045   12.469 1.00 31.35 ? 120 LYS B CB  1 
ATOM   1999 C  CG  . LYS B 2 120 ? 16.749 0.490   12.642 1.00 52.98 ? 120 LYS B CG  1 
ATOM   2000 C  CD  . LYS B 2 120 ? 16.125 -0.349  11.545 1.00 64.57 ? 120 LYS B CD  1 
ATOM   2001 C  CE  . LYS B 2 120 ? 15.259 -1.547  11.933 1.00 64.46 ? 120 LYS B CE  1 
ATOM   2002 N  NZ  . LYS B 2 120 ? 14.633 -2.283  10.736 1.00 65.33 ? 120 LYS B NZ  1 
ATOM   2003 N  N   . ASP B 2 121 ? 16.831 5.045   14.233 1.00 22.29 ? 121 ASP B N   1 
ATOM   2004 C  CA  . ASP B 2 121 ? 17.001 6.463   14.278 1.00 22.51 ? 121 ASP B CA  1 
ATOM   2005 C  C   . ASP B 2 121 ? 18.443 6.791   14.649 1.00 24.25 ? 121 ASP B C   1 
ATOM   2006 O  O   . ASP B 2 121 ? 18.896 7.890   14.333 1.00 25.64 ? 121 ASP B O   1 
ATOM   2007 C  CB  . ASP B 2 121 ? 16.121 7.071   15.398 1.00 30.13 ? 121 ASP B CB  1 
ATOM   2008 C  CG  . ASP B 2 121 ? 14.655 6.852   14.909 1.00 47.04 ? 121 ASP B CG  1 
ATOM   2009 O  OD1 . ASP B 2 121 ? 14.438 6.960   13.677 1.00 39.55 ? 121 ASP B OD1 1 
ATOM   2010 O  OD2 . ASP B 2 121 ? 13.830 6.477   15.775 1.00 55.13 ? 121 ASP B OD2 1 
ATOM   2011 N  N   . PHE B 2 122 ? 19.090 5.818   15.378 1.00 20.65 ? 122 PHE B N   1 
ATOM   2012 C  CA  . PHE B 2 122 ? 20.462 5.971   15.774 1.00 19.42 ? 122 PHE B CA  1 
ATOM   2013 C  C   . PHE B 2 122 ? 21.336 5.443   14.582 1.00 22.90 ? 122 PHE B C   1 
ATOM   2014 O  O   . PHE B 2 122 ? 21.863 4.342   14.535 1.00 19.54 ? 122 PHE B O   1 
ATOM   2015 C  CB  . PHE B 2 122 ? 20.714 5.227   17.092 1.00 14.06 ? 122 PHE B CB  1 
ATOM   2016 C  CG  . PHE B 2 122 ? 22.006 5.716   17.696 1.00 16.37 ? 122 PHE B CG  1 
ATOM   2017 C  CD1 . PHE B 2 122 ? 22.131 6.958   18.248 1.00 17.50 ? 122 PHE B CD1 1 
ATOM   2018 C  CD2 . PHE B 2 122 ? 23.150 4.964   17.732 1.00 14.74 ? 122 PHE B CD2 1 
ATOM   2019 C  CE1 . PHE B 2 122 ? 23.304 7.431   18.857 1.00 17.94 ? 122 PHE B CE1 1 
ATOM   2020 C  CE2 . PHE B 2 122 ? 24.313 5.372   18.288 1.00 16.25 ? 122 PHE B CE2 1 
ATOM   2021 C  CZ  . PHE B 2 122 ? 24.440 6.649   18.900 1.00 18.32 ? 122 PHE B CZ  1 
ATOM   2022 N  N   . THR B 2 123 ? 21.292 6.221   13.475 1.00 21.78 ? 123 THR B N   1 
ATOM   2023 C  CA  . THR B 2 123 ? 21.972 5.899   12.215 1.00 21.81 ? 123 THR B CA  1 
ATOM   2024 C  C   . THR B 2 123 ? 23.477 5.848   12.371 1.00 18.98 ? 123 THR B C   1 
ATOM   2025 O  O   . THR B 2 123 ? 24.119 6.432   13.311 1.00 18.97 ? 123 THR B O   1 
ATOM   2026 C  CB  . THR B 2 123 ? 21.653 7.051   11.189 1.00 16.87 ? 123 THR B CB  1 
ATOM   2027 O  OG1 . THR B 2 123 ? 22.274 8.277   11.695 1.00 20.22 ? 123 THR B OG1 1 
ATOM   2028 C  CG2 . THR B 2 123 ? 20.193 7.275   11.007 1.00 26.26 ? 123 THR B CG2 1 
ATOM   2029 N  N   . PRO B 2 124 ? 24.184 5.255   11.386 1.00 22.22 ? 124 PRO B N   1 
ATOM   2030 C  CA  . PRO B 2 124 ? 25.660 5.237   11.422 1.00 19.91 ? 124 PRO B CA  1 
ATOM   2031 C  C   . PRO B 2 124 ? 26.308 6.613   11.504 1.00 19.48 ? 124 PRO B C   1 
ATOM   2032 O  O   . PRO B 2 124 ? 27.308 6.830   12.209 1.00 20.71 ? 124 PRO B O   1 
ATOM   2033 C  CB  . PRO B 2 124 ? 26.049 4.447   10.161 1.00 22.59 ? 124 PRO B CB  1 
ATOM   2034 C  CG  . PRO B 2 124 ? 24.770 3.638   9.895  1.00 23.30 ? 124 PRO B CG  1 
ATOM   2035 C  CD  . PRO B 2 124 ? 23.560 4.499   10.305 1.00 23.05 ? 124 PRO B CD  1 
ATOM   2036 N  N   . GLU B 2 125 ? 25.723 7.633   10.764 1.00 16.78 ? 125 GLU B N   1 
ATOM   2037 C  CA  . GLU B 2 125 ? 26.224 8.990   10.835 1.00 21.05 ? 125 GLU B CA  1 
ATOM   2038 C  C   . GLU B 2 125 ? 26.013 9.661   12.205 1.00 19.47 ? 125 GLU B C   1 
ATOM   2039 O  O   . GLU B 2 125 ? 26.824 10.408  12.726 1.00 22.27 ? 125 GLU B O   1 
ATOM   2040 C  CB  . GLU B 2 125 ? 25.436 9.942   9.888  1.00 31.36 ? 125 GLU B CB  1 
ATOM   2041 C  CG  . GLU B 2 125 ? 25.779 9.608   8.474  1.00 40.44 ? 125 GLU B CG  1 
ATOM   2042 C  CD  . GLU B 2 125 ? 24.811 8.652   7.797  1.00 61.49 ? 125 GLU B CD  1 
ATOM   2043 O  OE1 . GLU B 2 125 ? 24.000 7.848   8.372  1.00 44.54 ? 125 GLU B OE1 1 
ATOM   2044 O  OE2 . GLU B 2 125 ? 24.906 8.757   6.514  1.00 72.60 ? 125 GLU B OE2 1 
ATOM   2045 N  N   . LEU B 2 126 ? 24.782 9.367   12.736 1.00 20.87 ? 126 LEU B N   1 
ATOM   2046 C  CA  . LEU B 2 126 ? 24.549 9.954   14.122 1.00 19.24 ? 126 LEU B CA  1 
ATOM   2047 C  C   . LEU B 2 126 ? 25.450 9.353   15.166 1.00 15.74 ? 126 LEU B C   1 
ATOM   2048 O  O   . LEU B 2 126 ? 26.044 9.995   16.067 1.00 16.02 ? 126 LEU B O   1 
ATOM   2049 C  CB  . LEU B 2 126 ? 23.012 9.870   14.339 1.00 20.68 ? 126 LEU B CB  1 
ATOM   2050 C  CG  . LEU B 2 126 ? 22.618 10.570  15.702 1.00 25.71 ? 126 LEU B CG  1 
ATOM   2051 C  CD1 . LEU B 2 126 ? 23.141 12.004  15.726 1.00 21.13 ? 126 LEU B CD1 1 
ATOM   2052 C  CD2 . LEU B 2 126 ? 21.118 10.403  15.889 1.00 22.65 ? 126 LEU B CD2 1 
ATOM   2053 N  N   . GLN B 2 127 ? 25.684 7.990   15.058 1.00 15.50 ? 127 GLN B N   1 
ATOM   2054 C  CA  . GLN B 2 127 ? 26.624 7.333   15.915 1.00 16.95 ? 127 GLN B CA  1 
ATOM   2055 C  C   . GLN B 2 127 ? 28.019 7.945   15.737 1.00 16.91 ? 127 GLN B C   1 
ATOM   2056 O  O   . GLN B 2 127 ? 28.777 8.138   16.712 1.00 18.86 ? 127 GLN B O   1 
ATOM   2057 C  CB  . GLN B 2 127 ? 26.733 5.802   15.653 1.00 15.23 ? 127 GLN B CB  1 
ATOM   2058 C  CG  . GLN B 2 127 ? 27.931 5.221   16.398 1.00 12.20 ? 127 GLN B CG  1 
ATOM   2059 C  CD  . GLN B 2 127 ? 27.746 3.686   16.580 1.00 19.63 ? 127 GLN B CD  1 
ATOM   2060 O  OE1 . GLN B 2 127 ? 26.779 3.031   16.220 1.00 21.04 ? 127 GLN B OE1 1 
ATOM   2061 N  NE2 . GLN B 2 127 ? 28.700 3.052   17.174 1.00 16.92 ? 127 GLN B NE2 1 
ATOM   2062 N  N   . ALA B 2 128 ? 28.429 8.262   14.487 1.00 19.33 ? 128 ALA B N   1 
ATOM   2063 C  CA  . ALA B 2 128 ? 29.806 8.838   14.315 1.00 20.56 ? 128 ALA B CA  1 
ATOM   2064 C  C   . ALA B 2 128 ? 29.930 10.158  15.041 1.00 18.41 ? 128 ALA B C   1 
ATOM   2065 O  O   . ALA B 2 128 ? 30.980 10.414  15.694 1.00 20.54 ? 128 ALA B O   1 
ATOM   2066 C  CB  . ALA B 2 128 ? 30.007 8.929   12.782 1.00 15.88 ? 128 ALA B CB  1 
ATOM   2067 N  N   . SER B 2 129 ? 28.830 11.011  14.944 1.00 17.11 ? 129 SER B N   1 
ATOM   2068 C  CA  . SER B 2 129 ? 28.899 12.289  15.737 1.00 19.68 ? 129 SER B CA  1 
ATOM   2069 C  C   . SER B 2 129 ? 29.054 12.068  17.251 1.00 19.91 ? 129 SER B C   1 
ATOM   2070 O  O   . SER B 2 129 ? 29.885 12.603  18.028 1.00 16.88 ? 129 SER B O   1 
ATOM   2071 C  CB  . SER B 2 129 ? 27.604 13.075  15.478 1.00 21.41 ? 129 SER B CB  1 
ATOM   2072 O  OG  . SER B 2 129 ? 27.552 13.289  14.064 1.00 26.02 ? 129 SER B OG  1 
ATOM   2073 N  N   . TYR B 2 130 ? 28.160 11.061  17.703 1.00 19.07 ? 130 TYR B N   1 
ATOM   2074 C  CA  . TYR B 2 130 ? 28.278 10.761  19.151 1.00 19.74 ? 130 TYR B CA  1 
ATOM   2075 C  C   . TYR B 2 130 ? 29.626 10.224  19.586 1.00 20.19 ? 130 TYR B C   1 
ATOM   2076 O  O   . TYR B 2 130 ? 30.139 10.461  20.705 1.00 17.85 ? 130 TYR B O   1 
ATOM   2077 C  CB  . TYR B 2 130 ? 27.073 9.815   19.518 1.00 17.96 ? 130 TYR B CB  1 
ATOM   2078 C  CG  . TYR B 2 130 ? 25.942 10.737  19.971 1.00 15.98 ? 130 TYR B CG  1 
ATOM   2079 C  CD1 . TYR B 2 130 ? 26.030 11.242  21.285 1.00 22.14 ? 130 TYR B CD1 1 
ATOM   2080 C  CD2 . TYR B 2 130 ? 24.917 11.051  19.110 1.00 15.85 ? 130 TYR B CD2 1 
ATOM   2081 C  CE1 . TYR B 2 130 ? 25.029 12.153  21.684 1.00 22.63 ? 130 TYR B CE1 1 
ATOM   2082 C  CE2 . TYR B 2 130 ? 23.940 11.989  19.483 1.00 20.55 ? 130 TYR B CE2 1 
ATOM   2083 C  CZ  . TYR B 2 130 ? 24.011 12.476  20.781 1.00 24.06 ? 130 TYR B CZ  1 
ATOM   2084 O  OH  . TYR B 2 130 ? 23.034 13.372  21.275 1.00 24.77 ? 130 TYR B OH  1 
ATOM   2085 N  N   . GLN B 2 131 ? 30.361 9.476   18.653 1.00 19.12 ? 131 GLN B N   1 
ATOM   2086 C  CA  . GLN B 2 131 ? 31.696 8.993   19.055 1.00 15.04 ? 131 GLN B CA  1 
ATOM   2087 C  C   . GLN B 2 131 ? 32.617 10.208  19.239 1.00 15.60 ? 131 GLN B C   1 
ATOM   2088 O  O   . GLN B 2 131 ? 33.470 10.198  20.103 1.00 19.16 ? 131 GLN B O   1 
ATOM   2089 C  CB  . GLN B 2 131 ? 32.287 8.031   18.006 1.00 16.92 ? 131 GLN B CB  1 
ATOM   2090 C  CG  . GLN B 2 131 ? 31.546 6.777   17.723 1.00 17.49 ? 131 GLN B CG  1 
ATOM   2091 C  CD  . GLN B 2 131 ? 31.593 5.788   18.911 1.00 17.50 ? 131 GLN B CD  1 
ATOM   2092 O  OE1 . GLN B 2 131 ? 30.781 4.866   18.874 1.00 16.13 ? 131 GLN B OE1 1 
ATOM   2093 N  NE2 . GLN B 2 131 ? 32.481 5.873   19.868 1.00 14.35 ? 131 GLN B NE2 1 
ATOM   2094 N  N   . LYS B 2 132 ? 32.427 11.240  18.405 1.00 19.78 ? 132 LYS B N   1 
ATOM   2095 C  CA  . LYS B 2 132 ? 33.288 12.447  18.685 1.00 21.65 ? 132 LYS B CA  1 
ATOM   2096 C  C   . LYS B 2 132 ? 32.919 13.095  19.996 1.00 17.05 ? 132 LYS B C   1 
ATOM   2097 O  O   . LYS B 2 132 ? 33.800 13.507  20.743 1.00 20.00 ? 132 LYS B O   1 
ATOM   2098 C  CB  . LYS B 2 132 ? 33.093 13.457  17.575 1.00 25.98 ? 132 LYS B CB  1 
ATOM   2099 C  CG  . LYS B 2 132 ? 33.647 12.910  16.219 1.00 30.30 ? 132 LYS B CG  1 
ATOM   2100 C  CD  . LYS B 2 132 ? 33.080 13.916  15.224 1.00 39.77 ? 132 LYS B CD  1 
ATOM   2101 C  CE  . LYS B 2 132 ? 33.197 13.658  13.775 1.00 43.60 ? 132 LYS B CE  1 
ATOM   2102 N  NZ  . LYS B 2 132 ? 32.075 12.817  13.158 1.00 64.39 ? 132 LYS B NZ  1 
ATOM   2103 N  N   . VAL B 2 133 ? 31.610 13.120  20.292 1.00 18.75 ? 133 VAL B N   1 
ATOM   2104 C  CA  . VAL B 2 133 ? 31.255 13.721  21.617 1.00 17.45 ? 133 VAL B CA  1 
ATOM   2105 C  C   . VAL B 2 133 ? 31.784 12.904  22.768 1.00 18.00 ? 133 VAL B C   1 
ATOM   2106 O  O   . VAL B 2 133 ? 32.414 13.448  23.687 1.00 19.43 ? 133 VAL B O   1 
ATOM   2107 C  CB  . VAL B 2 133 ? 29.740 13.943  21.758 1.00 20.89 ? 133 VAL B CB  1 
ATOM   2108 C  CG1 . VAL B 2 133 ? 29.388 14.623  23.089 1.00 21.47 ? 133 VAL B CG1 1 
ATOM   2109 C  CG2 . VAL B 2 133 ? 29.210 14.792  20.562 1.00 19.84 ? 133 VAL B CG2 1 
ATOM   2110 N  N   . VAL B 2 134 ? 31.614 11.569  22.785 1.00 17.73 ? 134 VAL B N   1 
ATOM   2111 C  CA  . VAL B 2 134 ? 32.102 10.823  23.957 1.00 19.55 ? 134 VAL B CA  1 
ATOM   2112 C  C   . VAL B 2 134 ? 33.595 10.902  24.038 1.00 21.66 ? 134 VAL B C   1 
ATOM   2113 O  O   . VAL B 2 134 ? 34.169 10.967  25.158 1.00 21.92 ? 134 VAL B O   1 
ATOM   2114 C  CB  . VAL B 2 134 ? 31.619 9.356   24.028 1.00 24.66 ? 134 VAL B CB  1 
ATOM   2115 C  CG1 . VAL B 2 134 ? 30.084 9.316   24.083 1.00 18.93 ? 134 VAL B CG1 1 
ATOM   2116 C  CG2 . VAL B 2 134 ? 32.141 8.494   22.942 1.00 21.22 ? 134 VAL B CG2 1 
ATOM   2117 N  N   . ALA B 2 135 ? 34.275 10.944  22.856 1.00 20.62 ? 135 ALA B N   1 
ATOM   2118 C  CA  . ALA B 2 135 ? 35.746 11.076  22.992 1.00 22.74 ? 135 ALA B CA  1 
ATOM   2119 C  C   . ALA B 2 135 ? 36.104 12.467  23.530 1.00 21.25 ? 135 ALA B C   1 
ATOM   2120 O  O   . ALA B 2 135 ? 37.065 12.517  24.284 1.00 24.41 ? 135 ALA B O   1 
ATOM   2121 C  CB  . ALA B 2 135 ? 36.471 10.896  21.663 1.00 28.65 ? 135 ALA B CB  1 
ATOM   2122 N  N   . GLY B 2 136 ? 35.378 13.498  23.080 1.00 25.69 ? 136 GLY B N   1 
ATOM   2123 C  CA  . GLY B 2 136 ? 35.579 14.888  23.571 1.00 26.48 ? 136 GLY B CA  1 
ATOM   2124 C  C   . GLY B 2 136 ? 35.400 14.978  25.067 1.00 23.99 ? 136 GLY B C   1 
ATOM   2125 O  O   . GLY B 2 136 ? 36.172 15.607  25.811 1.00 21.78 ? 136 GLY B O   1 
ATOM   2126 N  N   . VAL B 2 137 ? 34.368 14.296  25.589 1.00 24.13 ? 137 VAL B N   1 
ATOM   2127 C  CA  . VAL B 2 137 ? 34.167 14.289  27.041 1.00 17.52 ? 137 VAL B CA  1 
ATOM   2128 C  C   . VAL B 2 137 ? 35.226 13.482  27.731 1.00 17.97 ? 137 VAL B C   1 
ATOM   2129 O  O   . VAL B 2 137 ? 35.736 13.905  28.774 1.00 21.61 ? 137 VAL B O   1 
ATOM   2130 C  CB  . VAL B 2 137 ? 32.704 13.765  27.273 1.00 24.84 ? 137 VAL B CB  1 
ATOM   2131 C  CG1 . VAL B 2 137 ? 32.554 13.498  28.779 1.00 22.99 ? 137 VAL B CG1 1 
ATOM   2132 C  CG2 . VAL B 2 137 ? 31.585 14.677  26.800 1.00 20.34 ? 137 VAL B CG2 1 
ATOM   2133 N  N   . ALA B 2 138 ? 35.615 12.294  27.279 1.00 18.95 ? 138 ALA B N   1 
ATOM   2134 C  CA  . ALA B 2 138 ? 36.588 11.416  27.875 1.00 19.47 ? 138 ALA B CA  1 
ATOM   2135 C  C   . ALA B 2 138 ? 37.895 12.167  27.945 1.00 25.11 ? 138 ALA B C   1 
ATOM   2136 O  O   . ALA B 2 138 ? 38.554 12.178  28.996 1.00 25.25 ? 138 ALA B O   1 
ATOM   2137 C  CB  . ALA B 2 138 ? 36.709 10.195  27.045 1.00 19.75 ? 138 ALA B CB  1 
ATOM   2138 N  N   . ASN B 2 139 ? 38.276 12.858  26.854 1.00 25.43 ? 139 ASN B N   1 
ATOM   2139 C  CA  . ASN B 2 139 ? 39.555 13.679  26.996 1.00 25.02 ? 139 ASN B CA  1 
ATOM   2140 C  C   . ASN B 2 139 ? 39.480 14.861  27.921 1.00 24.15 ? 139 ASN B C   1 
ATOM   2141 O  O   . ASN B 2 139 ? 40.495 15.133  28.603 1.00 28.68 ? 139 ASN B O   1 
ATOM   2142 C  CB  . ASN B 2 139 ? 39.965 14.140  25.581 1.00 37.98 ? 139 ASN B CB  1 
ATOM   2143 C  CG  . ASN B 2 139 ? 40.384 12.903  24.750 1.00 49.69 ? 139 ASN B CG  1 
ATOM   2144 O  OD1 . ASN B 2 139 ? 41.025 11.932  25.186 1.00 44.88 ? 139 ASN B OD1 1 
ATOM   2145 N  ND2 . ASN B 2 139 ? 39.966 12.880  23.492 1.00 41.05 ? 139 ASN B ND2 1 
ATOM   2146 N  N   . ALA B 2 140 ? 38.386 15.648  27.991 1.00 22.32 ? 140 ALA B N   1 
ATOM   2147 C  CA  . ALA B 2 140 ? 38.329 16.706  29.017 1.00 25.00 ? 140 ALA B CA  1 
ATOM   2148 C  C   . ALA B 2 140 ? 38.303 16.122  30.421 1.00 27.92 ? 140 ALA B C   1 
ATOM   2149 O  O   . ALA B 2 140 ? 38.712 16.794  31.344 1.00 27.91 ? 140 ALA B O   1 
ATOM   2150 C  CB  . ALA B 2 140 ? 37.093 17.560  28.751 1.00 30.57 ? 140 ALA B CB  1 
ATOM   2151 N  N   . LEU B 2 141 ? 37.876 14.885  30.761 1.00 26.51 ? 141 LEU B N   1 
ATOM   2152 C  CA  . LEU B 2 141 ? 37.898 14.443  32.146 1.00 24.36 ? 141 LEU B CA  1 
ATOM   2153 C  C   . LEU B 2 141 ? 39.284 13.948  32.502 1.00 26.15 ? 141 LEU B C   1 
ATOM   2154 O  O   . LEU B 2 141 ? 39.761 13.956  33.616 1.00 27.30 ? 141 LEU B O   1 
ATOM   2155 C  CB  . LEU B 2 141 ? 36.839 13.367  32.358 1.00 23.19 ? 141 LEU B CB  1 
ATOM   2156 C  CG  . LEU B 2 141 ? 35.413 13.877  32.614 1.00 40.44 ? 141 LEU B CG  1 
ATOM   2157 C  CD1 . LEU B 2 141 ? 34.407 12.732  32.514 1.00 41.99 ? 141 LEU B CD1 1 
ATOM   2158 C  CD2 . LEU B 2 141 ? 35.241 14.576  33.949 1.00 32.20 ? 141 LEU B CD2 1 
ATOM   2159 N  N   . ALA B 2 142 ? 39.964 13.457  31.491 1.00 29.92 ? 142 ALA B N   1 
ATOM   2160 C  CA  . ALA B 2 142 ? 41.285 12.976  31.479 1.00 32.37 ? 142 ALA B CA  1 
ATOM   2161 C  C   . ALA B 2 142 ? 42.240 14.189  31.328 1.00 43.51 ? 142 ALA B C   1 
ATOM   2162 O  O   . ALA B 2 142 ? 43.413 13.892  31.323 1.00 42.45 ? 142 ALA B O   1 
ATOM   2163 C  CB  . ALA B 2 142 ? 41.559 12.098  30.231 1.00 28.94 ? 142 ALA B CB  1 
ATOM   2164 N  N   . HIS B 2 143 ? 41.853 15.456  31.178 1.00 44.43 ? 143 HIS B N   1 
ATOM   2165 C  CA  . HIS B 2 143 ? 42.747 16.610  30.990 1.00 47.33 ? 143 HIS B CA  1 
ATOM   2166 C  C   . HIS B 2 143 ? 43.634 16.908  32.206 1.00 50.88 ? 143 HIS B C   1 
ATOM   2167 O  O   . HIS B 2 143 ? 44.738 17.474  32.000 1.00 52.42 ? 143 HIS B O   1 
ATOM   2168 C  CB  . HIS B 2 143 ? 42.045 17.960  30.549 1.00 52.64 ? 143 HIS B CB  1 
ATOM   2169 C  CG  . HIS B 2 143 ? 41.187 18.690  31.545 1.00 72.43 ? 143 HIS B CG  1 
ATOM   2170 N  ND1 . HIS B 2 143 ? 39.799 18.548  31.533 1.00 76.27 ? 143 HIS B ND1 1 
ATOM   2171 C  CD2 . HIS B 2 143 ? 41.415 19.601  32.556 1.00 72.12 ? 143 HIS B CD2 1 
ATOM   2172 C  CE1 . HIS B 2 143 ? 39.229 19.197  32.506 1.00 63.81 ? 143 HIS B CE1 1 
ATOM   2173 N  NE2 . HIS B 2 143 ? 40.194 19.849  33.169 1.00 72.26 ? 143 HIS B NE2 1 
ATOM   2174 N  N   . LYS B 2 144 ? 43.275 16.544  33.439 1.00 51.30 ? 144 LYS B N   1 
ATOM   2175 C  CA  . LYS B 2 144 ? 44.033 16.804  34.663 1.00 48.98 ? 144 LYS B CA  1 
ATOM   2176 C  C   . LYS B 2 144 ? 44.979 15.726  35.215 1.00 52.52 ? 144 LYS B C   1 
ATOM   2177 O  O   . LYS B 2 144 ? 45.584 15.844  36.309 1.00 51.44 ? 144 LYS B O   1 
ATOM   2178 C  CB  . LYS B 2 144 ? 43.032 17.087  35.842 1.00 44.37 ? 144 LYS B CB  1 
ATOM   2179 C  CG  . LYS B 2 144 ? 42.214 18.345  35.627 1.00 42.03 ? 144 LYS B CG  1 
ATOM   2180 C  CD  . LYS B 2 144 ? 43.102 19.575  35.639 1.00 52.32 ? 144 LYS B CD  1 
ATOM   2181 C  CE  . LYS B 2 144 ? 42.643 20.594  36.659 1.00 60.77 ? 144 LYS B CE  1 
ATOM   2182 N  NZ  . LYS B 2 144 ? 41.825 21.706  36.090 1.00 61.89 ? 144 LYS B NZ  1 
ATOM   2183 N  N   . TYR B 2 145 ? 45.105 14.632  34.482 1.00 52.66 ? 145 TYR B N   1 
ATOM   2184 C  CA  . TYR B 2 145 ? 45.960 13.488  34.752 1.00 59.36 ? 145 TYR B CA  1 
ATOM   2185 C  C   . TYR B 2 145 ? 47.321 13.658  34.002 1.00 62.53 ? 145 TYR B C   1 
ATOM   2186 O  O   . TYR B 2 145 ? 48.396 13.129  34.329 1.00 62.80 ? 145 TYR B O   1 
ATOM   2187 C  CB  . TYR B 2 145 ? 45.321 12.160  34.253 1.00 58.19 ? 145 TYR B CB  1 
ATOM   2188 C  CG  . TYR B 2 145 ? 44.090 11.612  34.942 1.00 51.67 ? 145 TYR B CG  1 
ATOM   2189 C  CD1 . TYR B 2 145 ? 42.833 12.195  34.692 1.00 51.70 ? 145 TYR B CD1 1 
ATOM   2190 C  CD2 . TYR B 2 145 ? 44.155 10.479  35.773 1.00 53.86 ? 145 TYR B CD2 1 
ATOM   2191 C  CE1 . TYR B 2 145 ? 41.670 11.704  35.268 1.00 49.42 ? 145 TYR B CE1 1 
ATOM   2192 C  CE2 . TYR B 2 145 ? 43.001 9.977   36.381 1.00 55.14 ? 145 TYR B CE2 1 
ATOM   2193 C  CZ  . TYR B 2 145 ? 41.774 10.598  36.105 1.00 52.46 ? 145 TYR B CZ  1 
ATOM   2194 O  OH  . TYR B 2 145 ? 40.663 10.108  36.742 1.00 51.69 ? 145 TYR B OH  1 
ATOM   2195 N  N   . HIS B 2 146 ? 47.229 14.395  32.899 1.00 63.96 ? 146 HIS B N   1 
ATOM   2196 C  CA  . HIS B 2 146 ? 48.147 14.824  31.895 1.00 65.16 ? 146 HIS B CA  1 
ATOM   2197 C  C   . HIS B 2 146 ? 48.818 16.175  32.254 1.00 67.20 ? 146 HIS B C   1 
ATOM   2198 O  O   . HIS B 2 146 ? 48.105 17.218  32.444 1.00 63.14 ? 146 HIS B O   1 
ATOM   2199 C  CB  A HIS B 2 146 ? 47.393 14.930  30.548 0.50 66.01 ? 146 HIS B CB  1 
ATOM   2200 C  CB  B HIS B 2 146 ? 47.395 15.026  30.545 0.50 65.98 ? 146 HIS B CB  1 
ATOM   2201 C  CG  A HIS B 2 146 ? 46.582 13.788  30.036 0.50 75.78 ? 146 HIS B CG  1 
ATOM   2202 C  CG  B HIS B 2 146 ? 48.301 15.653  29.501 0.50 75.75 ? 146 HIS B CG  1 
ATOM   2203 N  ND1 A HIS B 2 146 ? 45.254 13.551  30.216 0.50 84.11 ? 146 HIS B ND1 1 
ATOM   2204 N  ND1 B HIS B 2 146 ? 48.522 17.027  29.373 0.50 84.08 ? 146 HIS B ND1 1 
ATOM   2205 C  CD2 A HIS B 2 146 ? 46.889 12.717  29.309 0.50 80.47 ? 146 HIS B CD2 1 
ATOM   2206 C  CD2 B HIS B 2 146 ? 49.095 15.117  28.586 0.50 80.44 ? 146 HIS B CD2 1 
ATOM   2207 C  CE1 A HIS B 2 146 ? 44.844 12.421  29.613 0.50 81.69 ? 146 HIS B CE1 1 
ATOM   2208 C  CE1 B HIS B 2 146 ? 49.369 17.232  28.386 0.50 81.66 ? 146 HIS B CE1 1 
ATOM   2209 N  NE2 A HIS B 2 146 ? 45.849 11.918  29.008 0.50 88.98 ? 146 HIS B NE2 1 
ATOM   2210 N  NE2 B HIS B 2 146 ? 49.710 16.063  27.852 0.50 88.95 ? 146 HIS B NE2 1 
ATOM   2211 O  OXT . HIS B 2 146 ? 50.091 16.290  32.273 1.00 64.54 ? 146 HIS B OXT 1 
HETATM 2212 C  CHA . HEM C 3 .   ? 39.381 -9.991  5.312  1.00 22.39 ? 143 HEM A CHA 1 
HETATM 2213 C  CHB . HEM C 3 .   ? 36.964 -11.704 9.230  1.00 19.91 ? 143 HEM A CHB 1 
HETATM 2214 C  CHC . HEM C 3 .   ? 38.251 -7.709  11.663 1.00 19.53 ? 143 HEM A CHC 1 
HETATM 2215 C  CHD . HEM C 3 .   ? 40.431 -5.896  7.736  1.00 21.95 ? 143 HEM A CHD 1 
HETATM 2216 C  C1A . HEM C 3 .   ? 38.614 -10.753 6.184  1.00 24.37 ? 143 HEM A C1A 1 
HETATM 2217 C  C2A . HEM C 3 .   ? 37.892 -11.949 5.812  1.00 26.69 ? 143 HEM A C2A 1 
HETATM 2218 C  C3A . HEM C 3 .   ? 37.210 -12.387 6.859  1.00 25.27 ? 143 HEM A C3A 1 
HETATM 2219 C  C4A . HEM C 3 .   ? 37.498 -11.488 7.963  1.00 23.79 ? 143 HEM A C4A 1 
HETATM 2220 C  CMA . HEM C 3 .   ? 36.301 -13.627 7.023  1.00 22.93 ? 143 HEM A CMA 1 
HETATM 2221 C  CAA . HEM C 3 .   ? 37.866 -12.432 4.357  1.00 28.02 ? 143 HEM A CAA 1 
HETATM 2222 C  CBA . HEM C 3 .   ? 39.000 -13.166 3.813  1.00 59.22 ? 143 HEM A CBA 1 
HETATM 2223 C  CGA . HEM C 3 .   ? 38.698 -13.799 2.451  1.00 67.34 ? 143 HEM A CGA 1 
HETATM 2224 O  O1A . HEM C 3 .   ? 39.566 -14.683 2.269  1.00 72.94 ? 143 HEM A O1A 1 
HETATM 2225 O  O2A . HEM C 3 .   ? 37.731 -13.348 1.790  1.00 68.79 ? 143 HEM A O2A 1 
HETATM 2226 C  C1B . HEM C 3 .   ? 37.161 -10.773 10.190 1.00 22.96 ? 143 HEM A C1B 1 
HETATM 2227 C  C2B . HEM C 3 .   ? 36.614 -10.912 11.571 1.00 24.25 ? 143 HEM A C2B 1 
HETATM 2228 C  C3B . HEM C 3 .   ? 36.985 -9.813  12.262 1.00 21.53 ? 143 HEM A C3B 1 
HETATM 2229 C  C4B . HEM C 3 .   ? 37.739 -8.942  11.355 1.00 22.02 ? 143 HEM A C4B 1 
HETATM 2230 C  CMB . HEM C 3 .   ? 35.845 -12.181 11.994 1.00 18.89 ? 143 HEM A CMB 1 
HETATM 2231 C  CAB . HEM C 3 .   ? 36.713 -9.355  13.701 1.00 25.21 ? 143 HEM A CAB 1 
HETATM 2232 C  CBB . HEM C 3 .   ? 35.576 -9.596  14.348 1.00 31.14 ? 143 HEM A CBB 1 
HETATM 2233 C  C1C . HEM C 3 .   ? 38.962 -6.873  10.826 1.00 22.23 ? 143 HEM A C1C 1 
HETATM 2234 C  C2C . HEM C 3 .   ? 39.447 -5.548  11.162 1.00 23.39 ? 143 HEM A C2C 1 
HETATM 2235 C  C3C . HEM C 3 .   ? 40.010 -5.037  10.050 1.00 20.36 ? 143 HEM A C3C 1 
HETATM 2236 C  C4C . HEM C 3 .   ? 39.918 -6.052  9.011  1.00 19.80 ? 143 HEM A C4C 1 
HETATM 2237 C  CMC . HEM C 3 .   ? 39.254 -4.875  12.541 1.00 18.13 ? 143 HEM A CMC 1 
HETATM 2238 C  CAC . HEM C 3 .   ? 40.718 -3.698  9.854  1.00 17.45 ? 143 HEM A CAC 1 
HETATM 2239 C  CBC . HEM C 3 .   ? 40.324 -2.579  10.370 1.00 16.62 ? 143 HEM A CBC 1 
HETATM 2240 C  C1D . HEM C 3 .   ? 40.362 -6.868  6.780  1.00 22.76 ? 143 HEM A C1D 1 
HETATM 2241 C  C2D . HEM C 3 .   ? 40.897 -6.703  5.412  1.00 28.26 ? 143 HEM A C2D 1 
HETATM 2242 C  C3D . HEM C 3 .   ? 40.632 -7.850  4.779  1.00 28.64 ? 143 HEM A C3D 1 
HETATM 2243 C  C4D . HEM C 3 .   ? 39.870 -8.743  5.668  1.00 27.54 ? 143 HEM A C4D 1 
HETATM 2244 C  CMD . HEM C 3 .   ? 41.641 -5.474  4.887  1.00 19.87 ? 143 HEM A CMD 1 
HETATM 2245 C  CAD . HEM C 3 .   ? 40.854 -8.224  3.281  1.00 25.84 ? 143 HEM A CAD 1 
HETATM 2246 C  CBD . HEM C 3 .   ? 39.572 -7.832  2.489  1.00 28.32 ? 143 HEM A CBD 1 
HETATM 2247 C  CGD . HEM C 3 .   ? 39.621 -7.917  0.979  1.00 35.87 ? 143 HEM A CGD 1 
HETATM 2248 O  O1D . HEM C 3 .   ? 40.622 -7.412  0.401  1.00 34.02 ? 143 HEM A O1D 1 
HETATM 2249 O  O2D . HEM C 3 .   ? 38.643 -8.433  0.427  1.00 34.21 ? 143 HEM A O2D 1 
HETATM 2250 N  NA  . HEM C 3 .   ? 38.313 -10.466 7.510  1.00 23.17 ? 143 HEM A NA  1 
HETATM 2251 N  NB  . HEM C 3 .   ? 37.757 -9.515  10.075 1.00 24.24 ? 143 HEM A NB  1 
HETATM 2252 N  NC  . HEM C 3 .   ? 39.249 -7.154  9.475  1.00 19.76 ? 143 HEM A NC  1 
HETATM 2253 N  ND  . HEM C 3 .   ? 39.688 -8.067  6.864  1.00 24.27 ? 143 HEM A ND  1 
HETATM 2254 FE FE  . HEM C 3 .   ? 39.103 -8.955  8.602  1.00 21.91 ? 143 HEM A FE  1 
HETATM 2255 C  CHA . HEM D 3 .   ? 31.191 11.075  40.783 1.00 25.23 ? 147 HEM B CHA 1 
HETATM 2256 C  CHB . HEM D 3 .   ? 30.601 12.524  36.208 1.00 24.14 ? 147 HEM B CHB 1 
HETATM 2257 C  CHC . HEM D 3 .   ? 32.927 8.527   34.683 1.00 19.31 ? 147 HEM B CHC 1 
HETATM 2258 C  CHD . HEM D 3 .   ? 33.315 6.980   39.265 1.00 27.31 ? 147 HEM B CHD 1 
HETATM 2259 C  C1A . HEM D 3 .   ? 30.750 11.777  39.659 1.00 28.51 ? 147 HEM B C1A 1 
HETATM 2260 C  C2A . HEM D 3 .   ? 29.875 12.927  39.661 1.00 29.93 ? 147 HEM B C2A 1 
HETATM 2261 C  C3A . HEM D 3 .   ? 29.764 13.381  38.421 1.00 28.65 ? 147 HEM B C3A 1 
HETATM 2262 C  C4A . HEM D 3 .   ? 30.509 12.452  37.568 1.00 25.85 ? 147 HEM B C4A 1 
HETATM 2263 C  CMA . HEM D 3 .   ? 28.901 14.564  37.955 1.00 29.92 ? 147 HEM B CMA 1 
HETATM 2264 C  CAA . HEM D 3 .   ? 29.274 13.555  40.960 1.00 34.97 ? 147 HEM B CAA 1 
HETATM 2265 C  CBA . HEM D 3 .   ? 30.403 14.259  41.761 1.00 46.25 ? 147 HEM B CBA 1 
HETATM 2266 C  CGA . HEM D 3 .   ? 29.983 15.100  42.958 1.00 56.82 ? 147 HEM B CGA 1 
HETATM 2267 O  O1A . HEM D 3 .   ? 30.746 15.069  44.015 1.00 58.97 ? 147 HEM B O1A 1 
HETATM 2268 O  O2A . HEM D 3 .   ? 28.887 15.737  42.717 1.00 54.32 ? 147 HEM B O2A 1 
HETATM 2269 C  C1B . HEM D 3 .   ? 31.170 11.558  35.417 1.00 23.39 ? 147 HEM B C1B 1 
HETATM 2270 C  C2B . HEM D 3 .   ? 31.260 11.622  33.954 1.00 22.84 ? 147 HEM B C2B 1 
HETATM 2271 C  C3B . HEM D 3 .   ? 31.898 10.530  33.544 1.00 26.28 ? 147 HEM B C3B 1 
HETATM 2272 C  C4B . HEM D 3 .   ? 32.254 9.738   34.721 1.00 21.71 ? 147 HEM B C4B 1 
HETATM 2273 C  CMB . HEM D 3 .   ? 30.649 12.802  33.151 1.00 25.41 ? 147 HEM B CMB 1 
HETATM 2274 C  CAB . HEM D 3 .   ? 32.295 10.077  32.106 1.00 28.09 ? 147 HEM B CAB 1 
HETATM 2275 C  CBB . HEM D 3 .   ? 31.307 10.002  31.235 1.00 31.37 ? 147 HEM B CBB 1 
HETATM 2276 C  C1C . HEM D 3 .   ? 33.202 7.745   35.789 1.00 22.73 ? 147 HEM B C1C 1 
HETATM 2277 C  C2C . HEM D 3 .   ? 33.814 6.403   35.764 1.00 25.70 ? 147 HEM B C2C 1 
HETATM 2278 C  C3C . HEM D 3 .   ? 33.911 5.986   37.030 1.00 23.38 ? 147 HEM B C3C 1 
HETATM 2279 C  C4C . HEM D 3 .   ? 33.406 7.069   37.874 1.00 23.77 ? 147 HEM B C4C 1 
HETATM 2280 C  CMC . HEM D 3 .   ? 34.196 5.652   34.463 1.00 20.43 ? 147 HEM B CMC 1 
HETATM 2281 C  CAC . HEM D 3 .   ? 34.518 4.702   37.632 1.00 26.89 ? 147 HEM B CAC 1 
HETATM 2282 C  CBC . HEM D 3 .   ? 34.630 3.537   36.930 1.00 33.39 ? 147 HEM B CBC 1 
HETATM 2283 C  C1D . HEM D 3 .   ? 32.733 7.944   40.051 1.00 28.46 ? 147 HEM B C1D 1 
HETATM 2284 C  C2D . HEM D 3 .   ? 32.681 7.876   41.511 1.00 30.87 ? 147 HEM B C2D 1 
HETATM 2285 C  C3D . HEM D 3 .   ? 32.157 9.042   41.934 1.00 32.30 ? 147 HEM B C3D 1 
HETATM 2286 C  C4D . HEM D 3 .   ? 31.825 9.846   40.780 1.00 24.69 ? 147 HEM B C4D 1 
HETATM 2287 C  CMD . HEM D 3 .   ? 33.198 6.651   42.313 1.00 27.72 ? 147 HEM B CMD 1 
HETATM 2288 C  CAD . HEM D 3 .   ? 31.795 9.458   43.423 1.00 29.97 ? 147 HEM B CAD 1 
HETATM 2289 C  CBD . HEM D 3 .   ? 30.559 8.596   43.824 1.00 39.84 ? 147 HEM B CBD 1 
HETATM 2290 C  CGD . HEM D 3 .   ? 29.738 9.033   44.994 1.00 49.36 ? 147 HEM B CGD 1 
HETATM 2291 O  O1D . HEM D 3 .   ? 29.139 8.092   45.603 1.00 52.96 ? 147 HEM B O1D 1 
HETATM 2292 O  O2D . HEM D 3 .   ? 29.620 10.264  45.240 1.00 57.35 ? 147 HEM B O2D 1 
HETATM 2293 N  NA  . HEM D 3 .   ? 31.104 11.482  38.346 1.00 22.98 ? 147 HEM B NA  1 
HETATM 2294 N  NB  . HEM D 3 .   ? 31.788 10.402  35.854 1.00 22.50 ? 147 HEM B NB  1 
HETATM 2295 N  NC  . HEM D 3 .   ? 32.935 8.112   37.096 1.00 20.05 ? 147 HEM B NC  1 
HETATM 2296 N  ND  . HEM D 3 .   ? 32.195 9.152   39.643 1.00 26.38 ? 147 HEM B ND  1 
HETATM 2297 FE FE  . HEM D 3 .   ? 32.302 9.955   37.771 1.00 25.24 ? 147 HEM B FE  1 
HETATM 2298 O  O   . HOH E 4 .   ? 48.341 -0.244  18.687 1.00 28.75 ? 144 HOH A O   1 
HETATM 2299 O  O   . HOH E 4 .   ? 36.639 -6.908  8.462  1.00 27.61 ? 145 HOH A O   1 
HETATM 2300 O  O   . HOH E 4 .   ? 20.263 0.675   11.092 1.00 34.26 ? 146 HOH A O   1 
HETATM 2301 O  O   . HOH E 4 .   ? 33.855 -16.044 6.246  1.00 30.11 ? 147 HOH A O   1 
HETATM 2302 O  O   . HOH E 4 .   ? 38.236 -21.665 22.013 1.00 38.51 ? 148 HOH A O   1 
HETATM 2303 O  O   . HOH E 4 .   ? 30.385 -2.560  25.704 1.00 22.04 ? 149 HOH A O   1 
HETATM 2304 O  O   . HOH E 4 .   ? 31.524 -1.306  23.358 1.00 21.21 ? 150 HOH A O   1 
HETATM 2305 O  O   . HOH E 4 .   ? 33.161 -3.528  22.704 1.00 30.38 ? 151 HOH A O   1 
HETATM 2306 O  O   . HOH E 4 .   ? 22.013 -21.582 24.146 1.00 31.34 ? 152 HOH A O   1 
HETATM 2307 O  O   . HOH E 4 .   ? 33.539 -7.380  -0.846 1.00 53.29 ? 153 HOH A O   1 
HETATM 2308 O  O   . HOH E 4 .   ? 37.029 -20.027 26.932 1.00 45.09 ? 154 HOH A O   1 
HETATM 2309 O  O   . HOH E 4 .   ? 44.678 2.059   12.300 1.00 36.65 ? 155 HOH A O   1 
HETATM 2310 O  O   . HOH E 4 .   ? 15.996 -13.080 24.351 1.00 34.25 ? 156 HOH A O   1 
HETATM 2311 O  O   . HOH E 4 .   ? 30.460 -12.388 0.469  1.00 37.57 ? 157 HOH A O   1 
HETATM 2312 O  O   . HOH E 4 .   ? 47.115 -13.397 14.098 1.00 35.25 ? 158 HOH A O   1 
HETATM 2313 O  O   . HOH E 4 .   ? 30.724 -24.290 20.005 1.00 46.11 ? 159 HOH A O   1 
HETATM 2314 O  O   . HOH E 4 .   ? 28.762 -28.972 21.866 1.00 63.03 ? 160 HOH A O   1 
HETATM 2315 O  O   . HOH E 4 .   ? 24.100 -18.149 30.959 1.00 44.60 ? 161 HOH A O   1 
HETATM 2316 O  O   . HOH E 4 .   ? 45.419 3.285   9.934  1.00 39.74 ? 162 HOH A O   1 
HETATM 2317 O  O   . HOH E 4 .   ? 21.843 -10.922 6.257  1.00 40.66 ? 163 HOH A O   1 
HETATM 2318 O  O   . HOH E 4 .   ? 25.971 -8.293  3.761  1.00 33.48 ? 164 HOH A O   1 
HETATM 2319 O  O   . HOH E 4 .   ? 35.643 -2.931  22.155 1.00 32.57 ? 165 HOH A O   1 
HETATM 2320 O  O   . HOH E 4 .   ? 29.635 -12.484 31.164 1.00 42.04 ? 166 HOH A O   1 
HETATM 2321 O  O   . HOH E 4 .   ? 26.646 -12.615 31.402 1.00 31.09 ? 167 HOH A O   1 
HETATM 2322 O  O   . HOH E 4 .   ? 44.859 -2.337  21.655 1.00 43.58 ? 168 HOH A O   1 
HETATM 2323 O  O   . HOH E 4 .   ? 34.569 -0.693  -6.580 1.00 47.07 ? 169 HOH A O   1 
HETATM 2324 O  O   . HOH E 4 .   ? 37.077 -6.650  -6.078 1.00 57.70 ? 170 HOH A O   1 
HETATM 2325 O  O   . HOH E 4 .   ? 39.663 -8.102  -2.432 1.00 48.11 ? 171 HOH A O   1 
HETATM 2326 O  O   . HOH E 4 .   ? 20.677 -9.272  32.255 1.00 25.86 ? 172 HOH A O   1 
HETATM 2327 O  O   . HOH E 4 .   ? 24.140 -15.200 32.720 1.00 39.47 ? 173 HOH A O   1 
HETATM 2328 O  O   . HOH E 4 .   ? 36.440 6.329   0.862  1.00 57.47 ? 174 HOH A O   1 
HETATM 2329 O  O   . HOH E 4 .   ? 48.441 3.195   5.829  1.00 74.11 ? 175 HOH A O   1 
HETATM 2330 O  O   . HOH E 4 .   ? 47.402 2.322   13.560 1.00 33.17 ? 176 HOH A O   1 
HETATM 2331 O  O   . HOH E 4 .   ? 35.838 -18.036 7.394  1.00 61.97 ? 177 HOH A O   1 
HETATM 2332 O  O   . HOH E 4 .   ? 29.576 -19.913 8.402  1.00 38.16 ? 178 HOH A O   1 
HETATM 2333 O  O   . HOH E 4 .   ? 23.560 -20.420 17.913 1.00 26.95 ? 179 HOH A O   1 
HETATM 2334 O  O   . HOH E 4 .   ? 40.809 7.733   6.445  1.00 43.94 ? 180 HOH A O   1 
HETATM 2335 O  O   . HOH E 4 .   ? 35.952 -9.271  1.270  1.00 35.24 ? 181 HOH A O   1 
HETATM 2336 O  O   . HOH E 4 .   ? 39.790 6.852   13.802 1.00 41.70 ? 182 HOH A O   1 
HETATM 2337 O  O   . HOH E 4 .   ? 40.507 -12.830 25.509 1.00 59.13 ? 183 HOH A O   1 
HETATM 2338 O  O   . HOH E 4 .   ? 42.634 2.838   14.163 1.00 34.11 ? 184 HOH A O   1 
HETATM 2339 O  O   . HOH E 4 .   ? 15.118 -2.544  15.875 1.00 43.71 ? 185 HOH A O   1 
HETATM 2340 O  O   . HOH E 4 .   ? 37.280 -7.146  20.756 1.00 40.95 ? 186 HOH A O   1 
HETATM 2341 O  O   . HOH E 4 .   ? 53.530 -4.775  6.160  1.00 42.12 ? 187 HOH A O   1 
HETATM 2342 O  O   . HOH E 4 .   ? 34.815 -4.028  25.356 1.00 38.32 ? 188 HOH A O   1 
HETATM 2343 O  O   . HOH E 4 .   ? 40.379 4.175   1.782  1.00 47.10 ? 189 HOH A O   1 
HETATM 2344 O  O   . HOH E 4 .   ? 31.592 -9.559  32.763 1.00 40.47 ? 190 HOH A O   1 
HETATM 2345 O  O   . HOH E 4 .   ? 44.762 -3.730  2.909  1.00 40.63 ? 191 HOH A O   1 
HETATM 2346 O  O   . HOH E 4 .   ? 34.640 -6.865  22.634 1.00 37.44 ? 192 HOH A O   1 
HETATM 2347 O  O   . HOH E 4 .   ? 23.072 -3.694  6.497  1.00 51.62 ? 193 HOH A O   1 
HETATM 2348 O  O   . HOH E 4 .   ? 14.768 -7.696  20.333 1.00 27.61 ? 194 HOH A O   1 
HETATM 2349 O  O   . HOH E 4 .   ? 29.330 1.453   3.433  1.00 40.48 ? 195 HOH A O   1 
HETATM 2350 O  O   . HOH E 4 .   ? 23.750 -14.119 7.100  1.00 38.80 ? 196 HOH A O   1 
HETATM 2351 O  O   . HOH E 4 .   ? 23.655 -23.616 25.031 1.00 55.38 ? 197 HOH A O   1 
HETATM 2352 O  O   . HOH E 4 .   ? 44.778 -19.482 14.669 1.00 42.37 ? 198 HOH A O   1 
HETATM 2353 O  O   . HOH E 4 .   ? 45.249 -18.923 17.202 1.00 42.00 ? 199 HOH A O   1 
HETATM 2354 O  O   . HOH E 4 .   ? 38.450 3.305   -0.010 1.00 49.07 ? 200 HOH A O   1 
HETATM 2355 O  O   . HOH E 4 .   ? 29.209 -22.554 9.793  1.00 49.64 ? 201 HOH A O   1 
HETATM 2356 O  O   . HOH E 4 .   ? 42.361 -6.101  20.077 1.00 36.91 ? 202 HOH A O   1 
HETATM 2357 O  O   . HOH E 4 .   ? 24.298 -19.900 15.560 1.00 51.47 ? 203 HOH A O   1 
HETATM 2358 O  O   . HOH E 4 .   ? 46.922 -11.384 20.907 1.00 47.36 ? 204 HOH A O   1 
HETATM 2359 O  O   . HOH E 4 .   ? 38.977 4.306   -2.902 1.00 49.98 ? 205 HOH A O   1 
HETATM 2360 O  O   . HOH E 4 .   ? 51.421 -13.455 24.103 1.00 43.95 ? 206 HOH A O   1 
HETATM 2361 O  O   . HOH E 4 .   ? 26.375 -16.371 8.631  1.00 38.91 ? 207 HOH A O   1 
HETATM 2362 O  O   . HOH E 4 .   ? 40.885 -11.291 1.360  1.00 48.01 ? 208 HOH A O   1 
HETATM 2363 O  O   . HOH E 4 .   ? 17.584 -5.508  27.313 1.00 36.44 ? 209 HOH A O   1 
HETATM 2364 O  O   . HOH E 4 .   ? 46.430 2.772   2.447  1.00 61.72 ? 210 HOH A O   1 
HETATM 2365 O  O   . HOH E 4 .   ? 48.063 -9.310  24.185 1.00 56.07 ? 211 HOH A O   1 
HETATM 2366 O  O   . HOH E 4 .   ? 16.870 -11.360 13.906 1.00 48.34 ? 212 HOH A O   1 
HETATM 2367 O  O   . HOH E 4 .   ? 34.695 -27.092 19.115 1.00 57.22 ? 213 HOH A O   1 
HETATM 2368 O  O   . HOH E 4 .   ? 46.990 -3.497  5.226  1.00 45.30 ? 214 HOH A O   1 
HETATM 2369 O  O   . HOH E 4 .   ? 21.367 -3.765  8.583  1.00 47.61 ? 215 HOH A O   1 
HETATM 2370 O  O   . HOH E 4 .   ? 27.668 -10.902 33.827 1.00 53.15 ? 216 HOH A O   1 
HETATM 2371 O  O   . HOH E 4 .   ? 41.703 -11.741 -1.896 1.00 57.29 ? 217 HOH A O   1 
HETATM 2372 O  O   . HOH E 4 .   ? 55.334 -8.097  21.722 1.00 44.75 ? 218 HOH A O   1 
HETATM 2373 O  O   . HOH E 4 .   ? 15.314 -13.588 12.229 1.00 56.13 ? 219 HOH A O   1 
HETATM 2374 O  O   . HOH E 4 .   ? 25.387 -12.710 34.462 1.00 56.28 ? 220 HOH A O   1 
HETATM 2375 O  O   . HOH E 4 .   ? 29.798 -21.056 34.046 1.00 46.51 ? 221 HOH A O   1 
HETATM 2376 O  O   . HOH E 4 .   ? 33.903 9.943   14.813 1.00 55.77 ? 222 HOH A O   1 
HETATM 2377 O  O   . HOH E 4 .   ? 51.122 -10.644 23.372 1.00 48.16 ? 223 HOH A O   1 
HETATM 2378 O  O   . HOH E 4 .   ? 40.071 -4.201  -6.156 1.00 56.49 ? 224 HOH A O   1 
HETATM 2379 O  O   . HOH E 4 .   ? 43.579 -7.760  0.454  1.00 48.08 ? 225 HOH A O   1 
HETATM 2380 O  O   . HOH E 4 .   ? 27.069 -21.536 14.602 1.00 39.29 ? 226 HOH A O   1 
HETATM 2381 O  O   . HOH E 4 .   ? 38.119 -19.536 9.231  1.00 53.66 ? 227 HOH A O   1 
HETATM 2382 O  O   . HOH E 4 .   ? 40.598 -20.073 8.894  1.00 44.94 ? 228 HOH A O   1 
HETATM 2383 O  O   . HOH E 4 .   ? 36.699 -7.367  15.231 1.00 47.14 ? 229 HOH A O   1 
HETATM 2384 O  O   . HOH E 4 .   ? 30.283 -15.573 33.265 1.00 50.40 ? 230 HOH A O   1 
HETATM 2385 O  O   . HOH E 4 .   ? 40.151 -7.011  21.722 1.00 45.43 ? 231 HOH A O   1 
HETATM 2386 O  O   . HOH E 4 .   ? 16.701 -5.795  11.397 1.00 54.85 ? 232 HOH A O   1 
HETATM 2387 O  O   . HOH E 4 .   ? 41.750 -9.172  22.768 1.00 55.98 ? 233 HOH A O   1 
HETATM 2388 O  O   . HOH E 4 .   ? 49.395 -4.635  3.652  1.00 58.77 ? 234 HOH A O   1 
HETATM 2389 O  O   . HOH E 4 .   ? 16.745 -7.289  31.048 1.00 57.32 ? 235 HOH A O   1 
HETATM 2390 O  O   . HOH E 4 .   ? 40.625 -16.728 22.703 1.00 52.33 ? 236 HOH A O   1 
HETATM 2391 O  O   . HOH E 4 .   ? 10.078 -3.451  21.109 1.00 51.51 ? 237 HOH A O   1 
HETATM 2392 O  O   . HOH E 4 .   ? 27.216 -25.524 16.961 1.00 53.05 ? 238 HOH A O   1 
HETATM 2393 O  O   . HOH E 4 .   ? 33.137 -10.062 -2.984 1.00 62.90 ? 239 HOH A O   1 
HETATM 2394 O  O   . HOH E 4 .   ? 23.873 5.359   6.358  1.00 50.81 ? 240 HOH A O   1 
HETATM 2395 O  O   . HOH E 4 .   ? 16.024 -8.828  14.559 1.00 63.75 ? 241 HOH A O   1 
HETATM 2396 O  O   . HOH E 4 .   ? 44.115 -8.273  20.258 1.00 57.22 ? 242 HOH A O   1 
HETATM 2397 O  O   . HOH E 4 .   ? 34.809 4.451   -7.775 1.00 68.23 ? 243 HOH A O   1 
HETATM 2398 O  O   . HOH E 4 .   ? 35.847 -20.401 23.750 1.00 53.80 ? 244 HOH A O   1 
HETATM 2399 O  O   . HOH E 4 .   ? 14.357 -11.368 18.449 1.00 41.89 ? 245 HOH A O   1 
HETATM 2400 O  O   . HOH E 4 .   ? 28.039 -11.969 0.094  1.00 56.27 ? 246 HOH A O   1 
HETATM 2401 O  O   . HOH E 4 .   ? 7.459  -2.176  25.065 1.00 55.46 ? 247 HOH A O   1 
HETATM 2402 O  O   . HOH E 4 .   ? 18.589 -12.392 25.242 1.00 28.01 ? 248 HOH A O   1 
HETATM 2403 O  O   . HOH E 4 .   ? 13.631 -7.549  17.974 1.00 51.74 ? 249 HOH A O   1 
HETATM 2404 O  O   . HOH E 4 .   ? 18.749 -0.377  8.897  1.00 55.12 ? 250 HOH A O   1 
HETATM 2405 O  O   . HOH F 4 .   ? 16.576 -0.550  19.272 1.00 26.73 ? 148 HOH B O   1 
HETATM 2406 O  O   . HOH F 4 .   ? 29.222 5.264   13.495 1.00 21.06 ? 149 HOH B O   1 
HETATM 2407 O  O   . HOH F 4 .   ? 14.541 17.028  26.749 1.00 22.76 ? 150 HOH B O   1 
HETATM 2408 O  O   . HOH F 4 .   ? 39.173 -1.701  39.459 1.00 25.19 ? 151 HOH B O   1 
HETATM 2409 O  O   . HOH F 4 .   ? 19.025 19.820  23.166 1.00 35.04 ? 152 HOH B O   1 
HETATM 2410 O  O   . HOH F 4 .   ? 37.728 17.767  24.834 1.00 58.84 ? 153 HOH B O   1 
HETATM 2411 O  O   . HOH F 4 .   ? 18.664 20.887  16.950 1.00 38.29 ? 154 HOH B O   1 
HETATM 2412 O  O   . HOH F 4 .   ? 15.620 8.014   26.502 1.00 28.41 ? 155 HOH B O   1 
HETATM 2413 O  O   . HOH F 4 .   ? 19.077 13.836  15.606 1.00 29.25 ? 156 HOH B O   1 
HETATM 2414 O  O   . HOH F 4 .   ? 14.147 0.166   22.420 1.00 36.11 ? 157 HOH B O   1 
HETATM 2415 O  O   . HOH F 4 .   ? 18.616 -2.911  30.079 1.00 27.43 ? 158 HOH B O   1 
HETATM 2416 O  O   . HOH F 4 .   ? 20.033 0.782   36.247 1.00 38.99 ? 159 HOH B O   1 
HETATM 2417 O  O   . HOH F 4 .   ? 34.692 7.645   20.226 1.00 26.69 ? 160 HOH B O   1 
HETATM 2418 O  O   . HOH F 4 .   ? 24.026 7.355   44.038 1.00 28.70 ? 161 HOH B O   1 
HETATM 2419 O  O   . HOH F 4 .   ? 39.650 8.798   23.546 1.00 56.04 ? 162 HOH B O   1 
HETATM 2420 O  O   . HOH F 4 .   ? 33.060 9.443   27.460 1.00 43.82 ? 163 HOH B O   1 
HETATM 2421 O  O   . HOH F 4 .   ? 34.294 -0.082  24.605 1.00 52.02 ? 164 HOH B O   1 
HETATM 2422 O  O   . HOH F 4 .   ? 13.874 -2.828  25.637 1.00 56.23 ? 165 HOH B O   1 
HETATM 2423 O  O   . HOH F 4 .   ? 17.151 5.851   42.175 1.00 36.05 ? 166 HOH B O   1 
HETATM 2424 O  O   . HOH F 4 .   ? 21.377 6.801   7.038  1.00 54.99 ? 167 HOH B O   1 
HETATM 2425 O  O   . HOH F 4 .   ? 36.860 8.648   18.462 1.00 44.61 ? 168 HOH B O   1 
HETATM 2426 O  O   . HOH F 4 .   ? 26.749 22.366  22.072 1.00 40.45 ? 169 HOH B O   1 
HETATM 2427 O  O   . HOH F 4 .   ? 12.233 7.718   20.242 1.00 51.53 ? 170 HOH B O   1 
HETATM 2428 O  O   . HOH F 4 .   ? 18.825 -7.402  34.795 1.00 63.67 ? 171 HOH B O   1 
HETATM 2429 O  O   . HOH F 4 .   ? 39.228 3.894   24.508 1.00 54.18 ? 172 HOH B O   1 
HETATM 2430 O  O   . HOH F 4 .   ? 14.153 0.645   19.227 1.00 43.19 ? 173 HOH B O   1 
HETATM 2431 O  O   . HOH F 4 .   ? 28.245 -6.567  51.496 1.00 67.72 ? 174 HOH B O   1 
HETATM 2432 O  O   . HOH F 4 .   ? 17.469 20.928  19.700 1.00 41.26 ? 175 HOH B O   1 
HETATM 2433 O  O   . HOH F 4 .   ? 16.694 -5.869  41.221 1.00 56.91 ? 176 HOH B O   1 
HETATM 2434 O  O   . HOH F 4 .   ? 38.774 1.040   24.706 1.00 56.78 ? 177 HOH B O   1 
HETATM 2435 O  O   . HOH F 4 .   ? 27.270 6.954   47.891 1.00 57.80 ? 178 HOH B O   1 
HETATM 2436 O  O   . HOH F 4 .   ? 28.662 12.170  11.252 1.00 35.18 ? 179 HOH B O   1 
HETATM 2437 O  O   . HOH F 4 .   ? 17.849 9.793   12.915 1.00 36.49 ? 180 HOH B O   1 
HETATM 2438 O  O   . HOH F 4 .   ? 47.101 5.321   33.243 1.00 51.34 ? 181 HOH B O   1 
HETATM 2439 O  O   . HOH F 4 .   ? 12.891 16.810  20.107 1.00 54.67 ? 182 HOH B O   1 
HETATM 2440 O  O   . HOH F 4 .   ? 44.870 4.704   30.279 1.00 43.39 ? 183 HOH B O   1 
HETATM 2441 O  O   . HOH F 4 .   ? 20.577 11.562  40.935 1.00 45.83 ? 184 HOH B O   1 
HETATM 2442 O  O   . HOH F 4 .   ? 25.501 16.076  37.580 1.00 39.87 ? 185 HOH B O   1 
HETATM 2443 O  O   . HOH F 4 .   ? 36.788 13.911  19.636 1.00 43.09 ? 186 HOH B O   1 
HETATM 2444 O  O   . HOH F 4 .   ? 13.886 1.108   15.301 1.00 46.13 ? 187 HOH B O   1 
HETATM 2445 O  O   . HOH F 4 .   ? 15.259 -2.320  30.234 1.00 59.48 ? 188 HOH B O   1 
HETATM 2446 O  O   . HOH F 4 .   ? 25.933 4.737   51.244 1.00 54.07 ? 189 HOH B O   1 
HETATM 2447 O  O   . HOH F 4 .   ? 19.884 -9.136  44.656 1.00 66.57 ? 190 HOH B O   1 
HETATM 2448 O  O   . HOH F 4 .   ? 17.744 9.817   40.896 1.00 49.44 ? 191 HOH B O   1 
HETATM 2449 O  O   . HOH F 4 .   ? 16.865 13.288  16.660 1.00 49.63 ? 192 HOH B O   1 
HETATM 2450 O  O   . HOH F 4 .   ? 30.318 10.742  9.322  1.00 46.87 ? 193 HOH B O   1 
HETATM 2451 O  O   . HOH F 4 .   ? 17.679 2.247   33.906 1.00 50.94 ? 194 HOH B O   1 
HETATM 2452 O  O   . HOH F 4 .   ? 25.565 13.401  12.473 1.00 39.20 ? 195 HOH B O   1 
HETATM 2453 O  O   . HOH F 4 .   ? 36.989 5.495   44.513 1.00 57.14 ? 196 HOH B O   1 
HETATM 2454 O  O   . HOH F 4 .   ? 36.340 6.910   22.868 1.00 54.03 ? 197 HOH B O   1 
HETATM 2455 O  O   . HOH F 4 .   ? 28.014 6.861   52.833 1.00 62.72 ? 198 HOH B O   1 
HETATM 2456 O  O   . HOH F 4 .   ? 48.072 9.772   36.722 1.00 54.22 ? 199 HOH B O   1 
HETATM 2457 O  O   . HOH F 4 .   ? 21.922 17.952  31.421 1.00 39.68 ? 200 HOH B O   1 
HETATM 2458 O  O   . HOH F 4 .   ? 23.256 12.843  11.261 1.00 53.82 ? 201 HOH B O   1 
HETATM 2459 O  O   . HOH F 4 .   ? 16.800 0.705   30.932 1.00 49.96 ? 202 HOH B O   1 
HETATM 2460 O  O   . HOH F 4 .   ? 29.407 -9.187  35.920 1.00 45.60 ? 203 HOH B O   1 
HETATM 2461 O  O   . HOH F 4 .   ? 29.248 19.660  34.147 1.00 50.69 ? 204 HOH B O   1 
HETATM 2462 O  O   . HOH F 4 .   ? 21.828 10.335  9.680  1.00 45.77 ? 205 HOH B O   1 
HETATM 2463 O  O   . HOH F 4 .   ? 11.706 8.098   28.955 1.00 49.40 ? 206 HOH B O   1 
HETATM 2464 O  O   . HOH F 4 .   ? 33.554 20.167  36.014 1.00 46.22 ? 207 HOH B O   1 
HETATM 2465 O  O   . HOH F 4 .   ? 36.525 0.256   21.913 1.00 53.93 ? 208 HOH B O   1 
HETATM 2466 O  O   . HOH F 4 .   ? 19.480 12.229  13.066 1.00 46.39 ? 209 HOH B O   1 
HETATM 2467 O  O   . HOH F 4 .   ? 23.116 22.006  30.715 1.00 59.64 ? 210 HOH B O   1 
HETATM 2468 O  O   . HOH F 4 .   ? 40.636 -1.592  29.951 1.00 43.93 ? 211 HOH B O   1 
HETATM 2469 O  O   . HOH F 4 .   ? 50.876 12.325  33.136 1.00 45.27 ? 212 HOH B O   1 
HETATM 2470 O  O   . HOH F 4 .   ? 18.948 14.451  35.325 1.00 57.86 ? 213 HOH B O   1 
HETATM 2471 O  O   . HOH F 4 .   ? 42.357 6.781   28.292 1.00 55.42 ? 214 HOH B O   1 
HETATM 2472 O  O   . HOH F 4 .   ? 34.809 23.078  36.326 1.00 59.57 ? 215 HOH B O   1 
HETATM 2473 O  O   . HOH F 4 .   ? 21.393 -11.998 38.094 1.00 48.72 ? 216 HOH B O   1 
HETATM 2474 O  O   . HOH F 4 .   ? 27.291 -8.033  38.260 1.00 50.31 ? 217 HOH B O   1 
HETATM 2475 O  O   . HOH F 4 .   ? 46.185 9.413   41.207 1.00 61.49 ? 218 HOH B O   1 
HETATM 2476 O  O   . HOH F 4 .   ? 43.989 9.515   48.154 1.00 58.64 ? 219 HOH B O   1 
HETATM 2477 O  O   . HOH F 4 .   ? 40.660 0.677   39.969 1.00 47.32 ? 220 HOH B O   1 
HETATM 2478 O  O   . HOH F 4 .   ? 9.908  -7.586  36.326 1.00 52.41 ? 221 HOH B O   1 
HETATM 2479 O  O   . HOH F 4 .   ? 13.742 -0.581  27.591 1.00 52.68 ? 222 HOH B O   1 
HETATM 2480 O  O   . HOH F 4 .   ? 14.147 18.812  17.015 1.00 46.15 ? 223 HOH B O   1 
HETATM 2481 O  O   . HOH F 4 .   ? 26.469 14.138  8.817  1.00 50.37 ? 224 HOH B O   1 
HETATM 2482 O  O   . HOH F 4 .   ? 33.149 14.043  50.829 1.00 68.82 ? 225 HOH B O   1 
HETATM 2483 O  O   . HOH F 4 .   ? 20.180 3.180   11.130 1.00 25.12 ? 226 HOH B O   1 
HETATM 2484 O  O   . HOH F 4 .   ? 14.360 9.630   17.510 1.00 28.82 ? 227 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  SER 15  15  15  SER SER A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  HIS 50  50  50  HIS HIS A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  HIS 72  72  72  HIS HIS A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  LYS 99  99  99  LYS LYS A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 HIS 103 103 103 HIS HIS A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LYS 139 139 139 LYS LYS A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
B 2 1   VAL 1   1   1   VAL VAL B . n 
B 2 2   GLN 2   2   2   GLN GLN B . n 
B 2 3   LEU 3   3   3   LEU LEU B . n 
B 2 4   SER 4   4   4   SER SER B . n 
B 2 5   GLY 5   5   5   GLY GLY B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   GLU 7   7   7   GLU GLU B . n 
B 2 8   LYS 8   8   8   LYS LYS B . n 
B 2 9   ALA 9   9   9   ALA ALA B . n 
B 2 10  ALA 10  10  10  ALA ALA B . n 
B 2 11  VAL 11  11  11  VAL VAL B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  ALA 13  13  13  ALA ALA B . n 
B 2 14  LEU 14  14  14  LEU LEU B . n 
B 2 15  TRP 15  15  15  TRP TRP B . n 
B 2 16  ASP 16  16  16  ASP ASP B . n 
B 2 17  LYS 17  17  17  LYS LYS B . n 
B 2 18  VAL 18  18  18  VAL VAL B . n 
B 2 19  ASN 19  19  19  ASN ASN B . n 
B 2 20  GLU 20  20  20  GLU GLU B . n 
B 2 21  GLU 21  21  21  GLU GLU B . n 
B 2 22  GLU 22  22  22  GLU GLU B . n 
B 2 23  VAL 23  23  23  VAL VAL B . n 
B 2 24  GLY 24  24  24  GLY GLY B . n 
B 2 25  GLY 25  25  25  GLY GLY B . n 
B 2 26  GLU 26  26  26  GLU GLU B . n 
B 2 27  ALA 27  27  27  ALA ALA B . n 
B 2 28  LEU 28  28  28  LEU LEU B . n 
B 2 29  GLY 29  29  29  GLY GLY B . n 
B 2 30  ARG 30  30  30  ARG ARG B . n 
B 2 31  LEU 31  31  31  LEU LEU B . n 
B 2 32  LEU 32  32  32  LEU LEU B . n 
B 2 33  VAL 33  33  33  VAL VAL B . n 
B 2 34  VAL 34  34  34  VAL VAL B . n 
B 2 35  TYR 35  35  35  TYR TYR B . n 
B 2 36  PRO 36  36  36  PRO PRO B . n 
B 2 37  TRP 37  37  37  TRP TRP B . n 
B 2 38  THR 38  38  38  THR THR B . n 
B 2 39  GLN 39  39  39  GLN GLN B . n 
B 2 40  ARG 40  40  40  ARG ARG B . n 
B 2 41  PHE 41  41  41  PHE PHE B . n 
B 2 42  PHE 42  42  42  PHE PHE B . n 
B 2 43  ASP 43  43  43  ASP ASP B . n 
B 2 44  SER 44  44  44  SER SER B . n 
B 2 45  PHE 45  45  45  PHE PHE B . n 
B 2 46  GLY 46  46  46  GLY GLY B . n 
B 2 47  ASP 47  47  47  ASP ASP B . n 
B 2 48  LEU 48  48  48  LEU LEU B . n 
B 2 49  SER 49  49  49  SER SER B . n 
B 2 50  ASN 50  50  50  ASN ASN B . n 
B 2 51  PRO 51  51  51  PRO PRO B . n 
B 2 52  GLY 52  52  52  GLY GLY B . n 
B 2 53  ALA 53  53  53  ALA ALA B . n 
B 2 54  VAL 54  54  54  VAL VAL B . n 
B 2 55  MET 55  55  55  MET MET B . n 
B 2 56  GLY 56  56  56  GLY GLY B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  PRO 58  58  58  PRO PRO B . n 
B 2 59  LYS 59  59  59  LYS LYS B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  LYS 61  61  61  LYS LYS B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  HIS 63  63  63  HIS HIS B . n 
B 2 64  GLY 64  64  64  GLY GLY B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  LEU 68  68  68  LEU LEU B . n 
B 2 69  HIS 69  69  69  HIS HIS B . n 
B 2 70  SER 70  70  70  SER SER B . n 
B 2 71  PHE 71  71  71  PHE PHE B . n 
B 2 72  GLY 72  72  72  GLY GLY B . n 
B 2 73  GLU 73  73  73  GLU GLU B . n 
B 2 74  GLY 74  74  74  GLY GLY B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  HIS 76  76  76  HIS HIS B . n 
B 2 77  HIS 77  77  77  HIS HIS B . n 
B 2 78  LEU 78  78  78  LEU LEU B . n 
B 2 79  ASP 79  79  79  ASP ASP B . n 
B 2 80  ASN 80  80  80  ASN ASN B . n 
B 2 81  LEU 81  81  81  LEU LEU B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  GLY 83  83  83  GLY GLY B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  PHE 85  85  85  PHE PHE B . n 
B 2 86  ALA 86  86  86  ALA ALA B . n 
B 2 87  ALA 87  87  87  ALA ALA B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  SER 89  89  89  SER SER B . n 
B 2 90  GLU 90  90  90  GLU GLU B . n 
B 2 91  LEU 91  91  91  LEU LEU B . n 
B 2 92  HIS 92  92  92  HIS HIS B . n 
B 2 93  CYS 93  93  93  CYS CYS B . n 
B 2 94  ASP 94  94  94  ASP ASP B . n 
B 2 95  LYS 95  95  95  LYS LYS B . n 
B 2 96  LEU 96  96  96  LEU LEU B . n 
B 2 97  HIS 97  97  97  HIS HIS B . n 
B 2 98  VAL 98  98  98  VAL VAL B . n 
B 2 99  ASP 99  99  99  ASP ASP B . n 
B 2 100 PRO 100 100 100 PRO PRO B . n 
B 2 101 GLU 101 101 101 GLU GLU B . n 
B 2 102 ASN 102 102 102 ASN ASN B . n 
B 2 103 PHE 103 103 103 PHE PHE B . n 
B 2 104 ARG 104 104 104 ARG ARG B . n 
B 2 105 LEU 105 105 105 LEU LEU B . n 
B 2 106 LEU 106 106 106 LEU LEU B . n 
B 2 107 GLY 107 107 107 GLY GLY B . n 
B 2 108 ASN 108 108 108 ASN ASN B . n 
B 2 109 VAL 109 109 109 VAL VAL B . n 
B 2 110 LEU 110 110 110 LEU LEU B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 VAL 112 112 112 VAL VAL B . n 
B 2 113 VAL 113 113 113 VAL VAL B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 ALA 115 115 115 ALA ALA B . n 
B 2 116 ARG 116 116 116 ARG ARG B . n 
B 2 117 HIS 117 117 117 HIS HIS B . n 
B 2 118 PHE 118 118 118 PHE PHE B . n 
B 2 119 GLY 119 119 119 GLY GLY B . n 
B 2 120 LYS 120 120 120 LYS LYS B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 PHE 122 122 122 PHE PHE B . n 
B 2 123 THR 123 123 123 THR THR B . n 
B 2 124 PRO 124 124 124 PRO PRO B . n 
B 2 125 GLU 125 125 125 GLU GLU B . n 
B 2 126 LEU 126 126 126 LEU LEU B . n 
B 2 127 GLN 127 127 127 GLN GLN B . n 
B 2 128 ALA 128 128 128 ALA ALA B . n 
B 2 129 SER 129 129 129 SER SER B . n 
B 2 130 TYR 130 130 130 TYR TYR B . n 
B 2 131 GLN 131 131 131 GLN GLN B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 VAL 133 133 133 VAL VAL B . n 
B 2 134 VAL 134 134 134 VAL VAL B . n 
B 2 135 ALA 135 135 135 ALA ALA B . n 
B 2 136 GLY 136 136 136 GLY GLY B . n 
B 2 137 VAL 137 137 137 VAL VAL B . n 
B 2 138 ALA 138 138 138 ALA ALA B . n 
B 2 139 ASN 139 139 139 ASN ASN B . n 
B 2 140 ALA 140 140 140 ALA ALA B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 ALA 142 142 142 ALA ALA B . n 
B 2 143 HIS 143 143 143 HIS HIS B . n 
B 2 144 LYS 144 144 144 LYS LYS B . n 
B 2 145 TYR 145 145 145 TYR TYR B . n 
B 2 146 HIS 146 146 146 HIS HIS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HEM 1   143 143 HEM HEM A . 
D 3 HEM 1   147 147 HEM HEM B . 
E 4 HOH 1   144 1   HOH HOH A . 
E 4 HOH 2   145 4   HOH HOH A . 
E 4 HOH 3   146 6   HOH HOH A . 
E 4 HOH 4   147 7   HOH HOH A . 
E 4 HOH 5   148 9   HOH HOH A . 
E 4 HOH 6   149 11  HOH HOH A . 
E 4 HOH 7   150 15  HOH HOH A . 
E 4 HOH 8   151 16  HOH HOH A . 
E 4 HOH 9   152 19  HOH HOH A . 
E 4 HOH 10  153 20  HOH HOH A . 
E 4 HOH 11  154 21  HOH HOH A . 
E 4 HOH 12  155 22  HOH HOH A . 
E 4 HOH 13  156 25  HOH HOH A . 
E 4 HOH 14  157 26  HOH HOH A . 
E 4 HOH 15  158 29  HOH HOH A . 
E 4 HOH 16  159 30  HOH HOH A . 
E 4 HOH 17  160 34  HOH HOH A . 
E 4 HOH 18  161 35  HOH HOH A . 
E 4 HOH 19  162 36  HOH HOH A . 
E 4 HOH 20  163 37  HOH HOH A . 
E 4 HOH 21  164 39  HOH HOH A . 
E 4 HOH 22  165 40  HOH HOH A . 
E 4 HOH 23  166 42  HOH HOH A . 
E 4 HOH 24  167 43  HOH HOH A . 
E 4 HOH 25  168 45  HOH HOH A . 
E 4 HOH 26  169 46  HOH HOH A . 
E 4 HOH 27  170 49  HOH HOH A . 
E 4 HOH 28  171 51  HOH HOH A . 
E 4 HOH 29  172 52  HOH HOH A . 
E 4 HOH 30  173 54  HOH HOH A . 
E 4 HOH 31  174 56  HOH HOH A . 
E 4 HOH 32  175 60  HOH HOH A . 
E 4 HOH 33  176 62  HOH HOH A . 
E 4 HOH 34  177 66  HOH HOH A . 
E 4 HOH 35  178 70  HOH HOH A . 
E 4 HOH 36  179 71  HOH HOH A . 
E 4 HOH 37  180 72  HOH HOH A . 
E 4 HOH 38  181 73  HOH HOH A . 
E 4 HOH 39  182 74  HOH HOH A . 
E 4 HOH 40  183 75  HOH HOH A . 
E 4 HOH 41  184 76  HOH HOH A . 
E 4 HOH 42  185 77  HOH HOH A . 
E 4 HOH 43  186 79  HOH HOH A . 
E 4 HOH 44  187 80  HOH HOH A . 
E 4 HOH 45  188 81  HOH HOH A . 
E 4 HOH 46  189 82  HOH HOH A . 
E 4 HOH 47  190 84  HOH HOH A . 
E 4 HOH 48  191 85  HOH HOH A . 
E 4 HOH 49  192 86  HOH HOH A . 
E 4 HOH 50  193 88  HOH HOH A . 
E 4 HOH 51  194 91  HOH HOH A . 
E 4 HOH 52  195 92  HOH HOH A . 
E 4 HOH 53  196 93  HOH HOH A . 
E 4 HOH 54  197 94  HOH HOH A . 
E 4 HOH 55  198 95  HOH HOH A . 
E 4 HOH 56  199 96  HOH HOH A . 
E 4 HOH 57  200 97  HOH HOH A . 
E 4 HOH 58  201 100 HOH HOH A . 
E 4 HOH 59  202 101 HOH HOH A . 
E 4 HOH 60  203 102 HOH HOH A . 
E 4 HOH 61  204 104 HOH HOH A . 
E 4 HOH 62  205 107 HOH HOH A . 
E 4 HOH 63  206 108 HOH HOH A . 
E 4 HOH 64  207 109 HOH HOH A . 
E 4 HOH 65  208 110 HOH HOH A . 
E 4 HOH 66  209 111 HOH HOH A . 
E 4 HOH 67  210 112 HOH HOH A . 
E 4 HOH 68  211 114 HOH HOH A . 
E 4 HOH 69  212 117 HOH HOH A . 
E 4 HOH 70  213 119 HOH HOH A . 
E 4 HOH 71  214 120 HOH HOH A . 
E 4 HOH 72  215 121 HOH HOH A . 
E 4 HOH 73  216 123 HOH HOH A . 
E 4 HOH 74  217 124 HOH HOH A . 
E 4 HOH 75  218 125 HOH HOH A . 
E 4 HOH 76  219 127 HOH HOH A . 
E 4 HOH 77  220 128 HOH HOH A . 
E 4 HOH 78  221 132 HOH HOH A . 
E 4 HOH 79  222 133 HOH HOH A . 
E 4 HOH 80  223 134 HOH HOH A . 
E 4 HOH 81  224 136 HOH HOH A . 
E 4 HOH 82  225 141 HOH HOH A . 
E 4 HOH 83  226 142 HOH HOH A . 
E 4 HOH 84  227 143 HOH HOH A . 
E 4 HOH 85  228 145 HOH HOH A . 
E 4 HOH 86  229 147 HOH HOH A . 
E 4 HOH 87  230 148 HOH HOH A . 
E 4 HOH 88  231 153 HOH HOH A . 
E 4 HOH 89  232 154 HOH HOH A . 
E 4 HOH 90  233 155 HOH HOH A . 
E 4 HOH 91  234 156 HOH HOH A . 
E 4 HOH 92  235 157 HOH HOH A . 
E 4 HOH 93  236 158 HOH HOH A . 
E 4 HOH 94  237 159 HOH HOH A . 
E 4 HOH 95  238 160 HOH HOH A . 
E 4 HOH 96  239 162 HOH HOH A . 
E 4 HOH 97  240 163 HOH HOH A . 
E 4 HOH 98  241 166 HOH HOH A . 
E 4 HOH 99  242 169 HOH HOH A . 
E 4 HOH 100 243 171 HOH HOH A . 
E 4 HOH 101 244 175 HOH HOH A . 
E 4 HOH 102 245 176 HOH HOH A . 
E 4 HOH 103 246 177 HOH HOH A . 
E 4 HOH 104 247 179 HOH HOH A . 
E 4 HOH 105 248 183 HOH HOH A . 
E 4 HOH 106 249 184 HOH HOH A . 
E 4 HOH 107 250 185 HOH HOH A . 
F 4 HOH 1   148 2   HOH HOH B . 
F 4 HOH 2   149 3   HOH HOH B . 
F 4 HOH 3   150 5   HOH HOH B . 
F 4 HOH 4   151 8   HOH HOH B . 
F 4 HOH 5   152 10  HOH HOH B . 
F 4 HOH 6   153 12  HOH HOH B . 
F 4 HOH 7   154 13  HOH HOH B . 
F 4 HOH 8   155 14  HOH HOH B . 
F 4 HOH 9   156 17  HOH HOH B . 
F 4 HOH 10  157 18  HOH HOH B . 
F 4 HOH 11  158 23  HOH HOH B . 
F 4 HOH 12  159 24  HOH HOH B . 
F 4 HOH 13  160 27  HOH HOH B . 
F 4 HOH 14  161 28  HOH HOH B . 
F 4 HOH 15  162 31  HOH HOH B . 
F 4 HOH 16  163 32  HOH HOH B . 
F 4 HOH 17  164 33  HOH HOH B . 
F 4 HOH 18  165 38  HOH HOH B . 
F 4 HOH 19  166 41  HOH HOH B . 
F 4 HOH 20  167 44  HOH HOH B . 
F 4 HOH 21  168 47  HOH HOH B . 
F 4 HOH 22  169 50  HOH HOH B . 
F 4 HOH 23  170 53  HOH HOH B . 
F 4 HOH 24  171 55  HOH HOH B . 
F 4 HOH 25  172 57  HOH HOH B . 
F 4 HOH 26  173 58  HOH HOH B . 
F 4 HOH 27  174 59  HOH HOH B . 
F 4 HOH 28  175 61  HOH HOH B . 
F 4 HOH 29  176 63  HOH HOH B . 
F 4 HOH 30  177 64  HOH HOH B . 
F 4 HOH 31  178 65  HOH HOH B . 
F 4 HOH 32  179 67  HOH HOH B . 
F 4 HOH 33  180 68  HOH HOH B . 
F 4 HOH 34  181 69  HOH HOH B . 
F 4 HOH 35  182 78  HOH HOH B . 
F 4 HOH 36  183 83  HOH HOH B . 
F 4 HOH 37  184 87  HOH HOH B . 
F 4 HOH 38  185 89  HOH HOH B . 
F 4 HOH 39  186 90  HOH HOH B . 
F 4 HOH 40  187 98  HOH HOH B . 
F 4 HOH 41  188 99  HOH HOH B . 
F 4 HOH 42  189 103 HOH HOH B . 
F 4 HOH 43  190 105 HOH HOH B . 
F 4 HOH 44  191 106 HOH HOH B . 
F 4 HOH 45  192 113 HOH HOH B . 
F 4 HOH 46  193 115 HOH HOH B . 
F 4 HOH 47  194 116 HOH HOH B . 
F 4 HOH 48  195 118 HOH HOH B . 
F 4 HOH 49  196 122 HOH HOH B . 
F 4 HOH 50  197 126 HOH HOH B . 
F 4 HOH 51  198 129 HOH HOH B . 
F 4 HOH 52  199 130 HOH HOH B . 
F 4 HOH 53  200 131 HOH HOH B . 
F 4 HOH 54  201 135 HOH HOH B . 
F 4 HOH 55  202 137 HOH HOH B . 
F 4 HOH 56  203 138 HOH HOH B . 
F 4 HOH 57  204 139 HOH HOH B . 
F 4 HOH 58  205 140 HOH HOH B . 
F 4 HOH 59  206 144 HOH HOH B . 
F 4 HOH 60  207 146 HOH HOH B . 
F 4 HOH 61  208 149 HOH HOH B . 
F 4 HOH 62  209 150 HOH HOH B . 
F 4 HOH 63  210 151 HOH HOH B . 
F 4 HOH 64  211 152 HOH HOH B . 
F 4 HOH 65  212 161 HOH HOH B . 
F 4 HOH 66  213 164 HOH HOH B . 
F 4 HOH 67  214 165 HOH HOH B . 
F 4 HOH 68  215 167 HOH HOH B . 
F 4 HOH 69  216 168 HOH HOH B . 
F 4 HOH 70  217 170 HOH HOH B . 
F 4 HOH 71  218 172 HOH HOH B . 
F 4 HOH 72  219 173 HOH HOH B . 
F 4 HOH 73  220 174 HOH HOH B . 
F 4 HOH 74  221 178 HOH HOH B . 
F 4 HOH 75  222 180 HOH HOH B . 
F 4 HOH 76  223 181 HOH HOH B . 
F 4 HOH 77  224 182 HOH HOH B . 
F 4 HOH 78  225 186 HOH HOH B . 
F 4 HOH 79  226 187 HOH HOH B . 
F 4 HOH 80  227 188 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 88.5313742128 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 50.9206039308 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NA ? C HEM . ? A HEM 143 ? 1_555 95.5  ? 
2  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NB ? C HEM . ? A HEM 143 ? 1_555 100.9 ? 
3  NA  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NB ? C HEM . ? A HEM 143 ? 1_555 85.9  ? 
4  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NC ? C HEM . ? A HEM 143 ? 1_555 105.5 ? 
5  NA  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NC ? C HEM . ? A HEM 143 ? 1_555 158.9 ? 
6  NB  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 NC ? C HEM . ? A HEM 143 ? 1_555 88.9  ? 
7  NE2 ? A HIS 87 ? A HIS 87  ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 ND ? C HEM . ? A HEM 143 ? 1_555 103.4 ? 
8  NA  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 ND ? C HEM . ? A HEM 143 ? 1_555 88.7  ? 
9  NB  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 ND ? C HEM . ? A HEM 143 ? 1_555 155.6 ? 
10 NC  ? C HEM .  ? A HEM 143 ? 1_555 FE ? C HEM . ? A HEM 143 ? 1_555 ND ? C HEM . ? A HEM 143 ? 1_555 87.7  ? 
11 NE2 ? B HIS 92 ? B HIS 92  ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NA ? D HEM . ? B HEM 147 ? 1_555 89.1  ? 
12 NE2 ? B HIS 92 ? B HIS 92  ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NB ? D HEM . ? B HEM 147 ? 1_555 97.2  ? 
13 NA  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NB ? D HEM . ? B HEM 147 ? 1_555 87.3  ? 
14 NE2 ? B HIS 92 ? B HIS 92  ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NC ? D HEM . ? B HEM 147 ? 1_555 109.1 ? 
15 NA  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NC ? D HEM . ? B HEM 147 ? 1_555 161.6 ? 
16 NB  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 NC ? D HEM . ? B HEM 147 ? 1_555 88.0  ? 
17 NE2 ? B HIS 92 ? B HIS 92  ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 ND ? D HEM . ? B HEM 147 ? 1_555 102.8 ? 
18 NA  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 ND ? D HEM . ? B HEM 147 ? 1_555 90.3  ? 
19 NB  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 ND ? D HEM . ? B HEM 147 ? 1_555 159.7 ? 
20 NC  ? D HEM .  ? B HEM 147 ? 1_555 FE ? D HEM . ? B HEM 147 ? 1_555 ND ? D HEM . ? B HEM 147 ? 1_555 88.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-12-23 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_detector      
2 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_detector.pdbx_collection_date' 
2 4 'Structure model' '_pdbx_database_status.process_site'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PROLSQ refinement       . ? 1 
UCSD   'data reduction' . ? 2 
UCSD   'data scaling'   . ? 3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B ALA 140 ? ? ND1 B HIS 143 ? ? 2.07 
2 1 O A LEU 73  ? ? O   A HOH 244 ? ? 2.17 
3 1 O B ALA 142 ? ? ND1 B HIS 146 ? A 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_1             133 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            SER 
_pdbx_validate_rmsd_bond.auth_seq_id_2             133 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.497 
_pdbx_validate_rmsd_bond.bond_target_value         1.418 
_pdbx_validate_rmsd_bond.bond_deviation            0.079 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.013 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  A LEU 2   ? ? C   A LEU 2   ? ? O   A LEU 2   ? ? 133.44 120.10 13.34  2.10 N 
2  1 CB  A ASP 6   ? ? CG  A ASP 6   ? ? OD2 A ASP 6   ? ? 111.79 118.30 -6.51  0.90 N 
3  1 OE1 A GLU 30  ? ? CD  A GLU 30  ? ? OE2 A GLU 30  ? ? 132.80 123.30 9.50   1.20 N 
4  1 CG  A GLU 30  ? ? CD  A GLU 30  ? ? OE2 A GLU 30  ? ? 105.70 118.30 -12.60 2.00 N 
5  1 NE  A ARG 31  ? ? CZ  A ARG 31  ? ? NH2 A ARG 31  ? ? 117.19 120.30 -3.11  0.50 N 
6  1 CA  A THR 39  ? ? CB  A THR 39  ? ? CG2 A THR 39  ? ? 103.62 112.40 -8.78  1.40 N 
7  1 CA  A THR 41  ? ? CB  A THR 41  ? ? CG2 A THR 41  ? ? 120.85 112.40 8.45   1.40 N 
8  1 CB  A ASP 64  ? ? CG  A ASP 64  ? ? OD1 A ASP 64  ? ? 124.97 118.30 6.67   0.90 N 
9  1 CB  A ASP 75  ? ? CG  A ASP 75  ? ? OD2 A ASP 75  ? ? 110.04 118.30 -8.26  0.90 N 
10 1 CB  A ASP 82  ? ? CG  A ASP 82  ? ? OD1 A ASP 82  ? ? 125.48 118.30 7.18   0.90 N 
11 1 CD  A ARG 92  ? ? NE  A ARG 92  ? ? CZ  A ARG 92  ? ? 132.91 123.60 9.31   1.40 N 
12 1 NE  A ARG 92  ? ? CZ  A ARG 92  ? ? NH1 A ARG 92  ? ? 128.32 120.30 8.02   0.50 N 
13 1 NE  A ARG 92  ? ? CZ  A ARG 92  ? ? NH2 A ARG 92  ? ? 112.74 120.30 -7.56  0.50 N 
14 1 CB  A ASP 126 ? ? CG  A ASP 126 ? ? OD1 A ASP 126 ? ? 112.80 118.30 -5.50  0.90 N 
15 1 C   B VAL 1   ? ? N   B GLN 2   ? ? CA  B GLN 2   ? ? 136.84 121.70 15.14  2.50 Y 
16 1 CB  B GLU 7   ? ? CG  B GLU 7   ? ? CD  B GLU 7   ? ? 96.96  114.20 -17.24 2.70 N 
17 1 CB  B ASP 16  ? ? CG  B ASP 16  ? ? OD2 B ASP 16  ? ? 112.72 118.30 -5.58  0.90 N 
18 1 CA  B GLU 22  ? ? CB  B GLU 22  ? ? CG  B GLU 22  ? ? 134.21 113.40 20.81  2.20 N 
19 1 CZ  B TYR 35  ? ? CE2 B TYR 35  ? ? CD2 B TYR 35  ? ? 114.17 119.80 -5.63  0.90 N 
20 1 CB  B PHE 41  ? ? CG  B PHE 41  ? ? CD2 B PHE 41  ? ? 125.59 120.80 4.79   0.70 N 
21 1 CB  B PHE 41  ? ? CG  B PHE 41  ? ? CD1 B PHE 41  ? ? 115.89 120.80 -4.91  0.70 N 
22 1 CB  B PHE 45  ? ? CG  B PHE 45  ? ? CD1 B PHE 45  ? ? 126.39 120.80 5.59   0.70 N 
23 1 CA  B LYS 66  ? ? CB  B LYS 66  ? ? CG  B LYS 66  ? ? 129.90 113.40 16.50  2.20 N 
24 1 N   B ASN 80  ? ? CA  B ASN 80  ? ? CB  B ASN 80  ? ? 99.61  110.60 -10.99 1.80 N 
25 1 CB  B ASP 94  ? ? CG  B ASP 94  ? ? OD1 B ASP 94  ? ? 125.10 118.30 6.80   0.90 N 
26 1 NE  B ARG 104 ? ? CZ  B ARG 104 ? ? NH1 B ARG 104 ? ? 124.95 120.30 4.65   0.50 N 
27 1 CB  B TYR 130 ? ? CG  B TYR 130 ? ? CD1 B TYR 130 ? ? 116.49 121.00 -4.51  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 140 ? ? -79.13  -100.06 
2 1 GLN B 2   ? ? 148.73  75.75   
3 1 ASN B 80  ? ? -164.13 56.70   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 
4 water                             HOH 
#