data_1ICM
# 
_entry.id   1ICM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ICM         
WWPDB D_1000174103 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ICM 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eads, J.C.'        1 
'Sacchettini, J.C.' 2 
'Kromminga, A.'     3 
'Gordon, J.I.'      4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Escherichia coli-derived rat intestinal fatty acid binding protein with bound myristate at 1.5 A resolution and I-FABPArg106-->Gln with bound oleate at 1.74 A resolution.
;
J.Biol.Chem. 268 26375 26385 1993 JBCHA3 US 0021-9258 0071 ? 8253762 ? 
1       'Refinement of the Structure of Recombinant Rat Intestinal Fatty Acid-Binding Apoprotein at 1.2 Angstroms Resolution' 
J.Biol.Chem. 267 4253  ?     1992 JBCHA3 US 0021-9258 0071 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eads, J.'          1 
primary 'Sacchettini, J.C.' 2 
primary 'Kromminga, A.'     3 
primary 'Gordon, J.I.'      4 
1       'Scapin, G.'        5 
1       'Gordon, J.I.'      6 
1       'Sacchettini, J.C.' 7 
# 
_cell.entry_id           1ICM 
_cell.length_a           36.050 
_cell.length_b           51.800 
_cell.length_c           31.480 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ICM 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INTESTINAL FATTY ACID BINDING PROTEIN' 15015.015 1   ? ? ? ? 
2 non-polymer syn 'MYRISTIC ACID'                         228.371   1   ? ? ? ? 
3 water       nat water                                   18.015    130 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PHE n 
1 3   ASP n 
1 4   GLY n 
1 5   THR n 
1 6   TRP n 
1 7   LYS n 
1 8   VAL n 
1 9   ASP n 
1 10  ARG n 
1 11  ASN n 
1 12  GLU n 
1 13  ASN n 
1 14  TYR n 
1 15  GLU n 
1 16  LYS n 
1 17  PHE n 
1 18  MET n 
1 19  GLU n 
1 20  LYS n 
1 21  MET n 
1 22  GLY n 
1 23  ILE n 
1 24  ASN n 
1 25  VAL n 
1 26  VAL n 
1 27  LYS n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  GLY n 
1 32  ALA n 
1 33  HIS n 
1 34  ASP n 
1 35  ASN n 
1 36  LEU n 
1 37  LYS n 
1 38  LEU n 
1 39  THR n 
1 40  ILE n 
1 41  THR n 
1 42  GLN n 
1 43  GLU n 
1 44  GLY n 
1 45  ASN n 
1 46  LYS n 
1 47  PHE n 
1 48  THR n 
1 49  VAL n 
1 50  LYS n 
1 51  GLU n 
1 52  SER n 
1 53  SER n 
1 54  ASN n 
1 55  PHE n 
1 56  ARG n 
1 57  ASN n 
1 58  ILE n 
1 59  ASP n 
1 60  VAL n 
1 61  VAL n 
1 62  PHE n 
1 63  GLU n 
1 64  LEU n 
1 65  GLY n 
1 66  VAL n 
1 67  ASP n 
1 68  PHE n 
1 69  ALA n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  ALA n 
1 74  ASP n 
1 75  GLY n 
1 76  THR n 
1 77  GLU n 
1 78  LEU n 
1 79  THR n 
1 80  GLY n 
1 81  THR n 
1 82  TRP n 
1 83  THR n 
1 84  MET n 
1 85  GLU n 
1 86  GLY n 
1 87  ASN n 
1 88  LYS n 
1 89  LEU n 
1 90  VAL n 
1 91  GLY n 
1 92  LYS n 
1 93  PHE n 
1 94  LYS n 
1 95  ARG n 
1 96  VAL n 
1 97  ASP n 
1 98  ASN n 
1 99  GLY n 
1 100 LYS n 
1 101 GLU n 
1 102 LEU n 
1 103 ILE n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 GLU n 
1 108 ILE n 
1 109 SER n 
1 110 GLY n 
1 111 ASN n 
1 112 GLU n 
1 113 LEU n 
1 114 ILE n 
1 115 GLN n 
1 116 THR n 
1 117 TYR n 
1 118 THR n 
1 119 TYR n 
1 120 GLU n 
1 121 GLY n 
1 122 VAL n 
1 123 GLU n 
1 124 ALA n 
1 125 LYS n 
1 126 ARG n 
1 127 ILE n 
1 128 PHE n 
1 129 LYS n 
1 130 LYS n 
1 131 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FABPI_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02693 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ICM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02693 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  131 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MYR non-polymer         . 'MYRISTIC ACID' ? 'C14 H28 O2'     228.371 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ICM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.96 
_exptl_crystal.density_percent_sol   37.13 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1ICM 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1590000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1057 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               1203 
_refine_hist.d_res_high                       1.5 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.69 ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ICM 
_struct.title                     
;ESCHERICHIA COLI-DERIVED RAT INTESTINAL FATTY ACID BINDING PROTEIN WITH BOUND MYRISTATE AT 1.5 A RESOLUTION AND I-FABPARG106-->GLN WITH BOUND OLEATE AT 1.74 A RESOLUTION
;
_struct.pdbx_descriptor           'INTESTINAL FATTY ACID BINDING PROTEIN COMPLEXED WITH MYRISTATE (C14:0)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ICM 
_struct_keywords.pdbx_keywords   'BINDING PROTEIN(FATTY ACID)' 
_struct_keywords.text            'BINDING PROTEIN(FATTY ACID)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A1 TYR A 14 ? LYS A 20 ? TYR A 14 LYS A 20 1 ? 7 
HELX_P HELX_P2 A2 VAL A 25 ? HIS A 33 ? VAL A 25 HIS A 33 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 1   ? GLU A 12  ? ALA A 1   GLU A 12  
A 2 ASP A 34  ? GLN A 42  ? ASP A 34  GLN A 42  
A 3 PHE A 47  ? SER A 52  ? PHE A 47  SER A 52  
A 4 ASN A 57  ? PHE A 62  ? ASN A 57  PHE A 62  
A 5 ASP A 67  ? SER A 71  ? ASP A 67  SER A 71  
A 6 THR A 76  ? GLY A 80  ? THR A 76  GLY A 80  
B 1 THR A 81  ? MET A 84  ? THR A 81  MET A 84  
B 2 LEU A 89  ? LYS A 94  ? LEU A 89  LYS A 94  
B 3 LYS A 100 ? ILE A 108 ? LYS A 100 ILE A 108 
B 4 LEU A 113 ? THR A 118 ? LEU A 113 THR A 118 
B 5 GLU A 123 ? GLU A 131 ? GLU A 123 GLU A 131 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 4   ? O GLY A 4   N ILE A 40  ? N ILE A 40  
A 2 3 O THR A 41  ? O THR A 41  N THR A 48  ? N THR A 48  
A 3 4 O VAL A 49  ? O VAL A 49  N VAL A 60  ? N VAL A 60  
A 5 6 O TYR A 70  ? O TYR A 70  N LEU A 78  ? N LEU A 78  
B 1 2 O THR A 83  ? O THR A 83  N VAL A 90  ? N VAL A 90  
B 2 3 O GLY A 91  ? O GLY A 91  N ALA A 104 ? N ALA A 104 
B 3 4 O VAL A 105 ? O VAL A 105 N THR A 116 ? N THR A 116 
B 4 5 O GLN A 115 ? O GLN A 115 N ARG A 126 ? N ARG A 126 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
FA1 Unknown  ? ? ? ? 6 ?                                    
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MYR A 133' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  FA1 6 ARG A 106 ? ARG A 106 . ? 1_555 ? 
2  FA1 6 TRP A 82  ? TRP A 82  . ? 1_555 ? 
3  FA1 6 GLN A 115 ? GLN A 115 . ? 1_555 ? 
4  FA1 6 TYR A 70  ? TYR A 70  . ? 1_555 ? 
5  FA1 6 TYR A 117 ? TYR A 117 . ? 1_555 ? 
6  FA1 6 PHE A 55  ? PHE A 55  . ? 1_555 ? 
7  AC1 5 TYR A 14  ? TYR A 14  . ? 1_555 ? 
8  AC1 5 PHE A 62  ? PHE A 62  . ? 1_555 ? 
9  AC1 5 TRP A 82  ? TRP A 82  . ? 1_555 ? 
10 AC1 5 ARG A 106 ? ARG A 106 . ? 1_555 ? 
11 AC1 5 HOH C .   ? HOH A 170 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ICM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ICM 
_atom_sites.fract_transf_matrix[1][1]   0.027739 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000969 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019305 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.031786 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -8.350 -4.532  10.146 1.00 49.97 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -7.081 -4.869  9.520  1.00 41.62 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -6.039 -3.781  9.725  1.00 30.83 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -5.995 -3.061  10.738 1.00 26.92 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -7.220 -5.211  8.038  1.00 40.83 ? 1   ALA A CB  1 
ATOM   6    N N   . PHE A 1 2   ? -5.203 -3.678  8.699  1.00 26.34 ? 2   PHE A N   1 
ATOM   7    C CA  . PHE A 1 2   ? -4.139 -2.699  8.686  1.00 24.61 ? 2   PHE A CA  1 
ATOM   8    C C   . PHE A 1 2   ? -4.587 -1.321  8.192  1.00 25.03 ? 2   PHE A C   1 
ATOM   9    O O   . PHE A 1 2   ? -3.825 -0.383  8.365  1.00 20.07 ? 2   PHE A O   1 
ATOM   10   C CB  . PHE A 1 2   ? -2.969 -3.196  7.812  1.00 25.14 ? 2   PHE A CB  1 
ATOM   11   C CG  . PHE A 1 2   ? -2.357 -4.408  8.441  1.00 19.32 ? 2   PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 2   ? -1.645 -4.263  9.630  1.00 18.51 ? 2   PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 2   ? -2.507 -5.682  7.884  1.00 21.79 ? 2   PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 2   ? -1.068 -5.377  10.244 1.00 25.03 ? 2   PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 2   ? -1.944 -6.806  8.491  1.00 19.38 ? 2   PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 2   ? -1.221 -6.640  9.671  1.00 18.85 ? 2   PHE A CZ  1 
ATOM   17   N N   . ASP A 1 3   ? -5.792 -1.233  7.598  1.00 21.99 ? 3   ASP A N   1 
ATOM   18   C CA  . ASP A 1 3   ? -6.417 -0.052  7.016  1.00 18.90 ? 3   ASP A CA  1 
ATOM   19   C C   . ASP A 1 3   ? -6.417 1.124   7.950  1.00 20.17 ? 3   ASP A C   1 
ATOM   20   O O   . ASP A 1 3   ? -6.807 1.036   9.108  1.00 23.00 ? 3   ASP A O   1 
ATOM   21   C CB  . ASP A 1 3   ? -7.925 -0.300  6.745  1.00 22.74 ? 3   ASP A CB  1 
ATOM   22   C CG  . ASP A 1 3   ? -8.103 -1.647  6.157  1.00 25.95 ? 3   ASP A CG  1 
ATOM   23   O OD1 . ASP A 1 3   ? -7.967 -1.813  4.943  1.00 31.19 ? 3   ASP A OD1 1 
ATOM   24   O OD2 . ASP A 1 3   ? -8.349 -2.533  7.113  1.00 20.23 ? 3   ASP A OD2 1 
ATOM   25   N N   . GLY A 1 4   ? -6.027 2.274   7.437  1.00 15.46 ? 4   GLY A N   1 
ATOM   26   C CA  . GLY A 1 4   ? -6.076 3.362   8.403  1.00 15.73 ? 4   GLY A CA  1 
ATOM   27   C C   . GLY A 1 4   ? -4.805 4.222   8.476  1.00 15.57 ? 4   GLY A C   1 
ATOM   28   O O   . GLY A 1 4   ? -3.826 3.947   7.777  1.00 14.81 ? 4   GLY A O   1 
ATOM   29   N N   . THR A 1 5   ? -4.896 5.263   9.319  1.00 11.05 ? 5   THR A N   1 
ATOM   30   C CA  . THR A 1 5   ? -3.817 6.190   9.498  1.00 11.31 ? 5   THR A CA  1 
ATOM   31   C C   . THR A 1 5   ? -3.207 5.895   10.816 1.00 12.52 ? 5   THR A C   1 
ATOM   32   O O   . THR A 1 5   ? -4.000 5.802   11.744 1.00 14.24 ? 5   THR A O   1 
ATOM   33   C CB  . THR A 1 5   ? -4.286 7.636   9.287  1.00 12.85 ? 5   THR A CB  1 
ATOM   34   O OG1 . THR A 1 5   ? -4.594 7.734   7.897  1.00 12.52 ? 5   THR A OG1 1 
ATOM   35   C CG2 . THR A 1 5   ? -3.095 8.542   9.558  1.00 16.69 ? 5   THR A CG2 1 
ATOM   36   N N   . TRP A 1 6   ? -1.867 5.719   10.848 1.00 10.89 ? 6   TRP A N   1 
ATOM   37   C CA  . TRP A 1 6   ? -1.175 5.336   12.081 1.00 9.23  ? 6   TRP A CA  1 
ATOM   38   C C   . TRP A 1 6   ? -0.052 6.335   12.355 1.00 8.84  ? 6   TRP A C   1 
ATOM   39   O O   . TRP A 1 6   ? 0.661  6.724   11.433 1.00 14.67 ? 6   TRP A O   1 
ATOM   40   C CB  . TRP A 1 6   ? -0.553 3.953   11.836 1.00 7.85  ? 6   TRP A CB  1 
ATOM   41   C CG  . TRP A 1 6   ? -1.536 2.844   11.486 1.00 10.21 ? 6   TRP A CG  1 
ATOM   42   C CD1 . TRP A 1 6   ? -1.918 2.461   10.228 1.00 13.80 ? 6   TRP A CD1 1 
ATOM   43   C CD2 . TRP A 1 6   ? -2.239 2.005   12.408 1.00 9.62  ? 6   TRP A CD2 1 
ATOM   44   N NE1 . TRP A 1 6   ? -2.854 1.451   10.297 1.00 10.77 ? 6   TRP A NE1 1 
ATOM   45   C CE2 . TRP A 1 6   ? -3.048 1.135   11.634 1.00 9.82  ? 6   TRP A CE2 1 
ATOM   46   C CE3 . TRP A 1 6   ? -2.306 1.922   13.818 1.00 10.61 ? 6   TRP A CE3 1 
ATOM   47   C CZ2 . TRP A 1 6   ? -3.867 0.171   12.254 1.00 10.86 ? 6   TRP A CZ2 1 
ATOM   48   C CZ3 . TRP A 1 6   ? -3.110 0.964   14.428 1.00 12.97 ? 6   TRP A CZ3 1 
ATOM   49   C CH2 . TRP A 1 6   ? -3.890 0.120   13.632 1.00 8.53  ? 6   TRP A CH2 1 
ATOM   50   N N   . LYS A 1 7   ? 0.138  6.719   13.616 1.00 11.96 ? 7   LYS A N   1 
ATOM   51   C CA  . LYS A 1 7   ? 1.152  7.693   14.003 1.00 12.16 ? 7   LYS A CA  1 
ATOM   52   C C   . LYS A 1 7   ? 2.045  7.107   15.067 1.00 11.70 ? 7   LYS A C   1 
ATOM   53   O O   . LYS A 1 7   ? 1.609  6.563   16.092 1.00 11.60 ? 7   LYS A O   1 
ATOM   54   C CB  . LYS A 1 7   ? 0.528  8.977   14.538 1.00 17.12 ? 7   LYS A CB  1 
ATOM   55   C CG  . LYS A 1 7   ? 1.515  10.070  14.969 1.00 35.21 ? 7   LYS A CG  1 
ATOM   56   C CD  . LYS A 1 7   ? 2.011  11.008  13.862 1.00 46.41 ? 7   LYS A CD  1 
ATOM   57   C CE  . LYS A 1 7   ? 2.640  12.324  14.334 1.00 53.12 ? 7   LYS A CE  1 
ATOM   58   N NZ  . LYS A 1 7   ? 2.522  13.448  13.374 1.00 55.26 ? 7   LYS A NZ  1 
ATOM   59   N N   . VAL A 1 8   ? 3.347  7.237   14.846 1.00 11.22 ? 8   VAL A N   1 
ATOM   60   C CA  . VAL A 1 8   ? 4.228  6.641   15.841 1.00 11.09 ? 8   VAL A CA  1 
ATOM   61   C C   . VAL A 1 8   ? 4.045  7.164   17.250 1.00 14.62 ? 8   VAL A C   1 
ATOM   62   O O   . VAL A 1 8   ? 3.863  8.361   17.410 1.00 15.19 ? 8   VAL A O   1 
ATOM   63   C CB  . VAL A 1 8   ? 5.683  6.703   15.362 1.00 12.77 ? 8   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 8   ? 6.182  8.154   15.410 1.00 19.80 ? 8   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 8   ? 6.565  5.771   16.205 1.00 15.02 ? 8   VAL A CG2 1 
ATOM   66   N N   . ASP A 1 9   ? 4.118  6.284   18.260 1.00 15.51 ? 9   ASP A N   1 
ATOM   67   C CA  . ASP A 1 9   ? 3.947  6.657   19.644 1.00 14.41 ? 9   ASP A CA  1 
ATOM   68   C C   . ASP A 1 9   ? 5.201  6.424   20.487 1.00 20.62 ? 9   ASP A C   1 
ATOM   69   O O   . ASP A 1 9   ? 5.584  7.284   21.286 1.00 18.04 ? 9   ASP A O   1 
ATOM   70   C CB  . ASP A 1 9   ? 2.814  5.792   20.185 1.00 12.62 ? 9   ASP A CB  1 
ATOM   71   C CG  . ASP A 1 9   ? 2.533  6.072   21.626 1.00 20.50 ? 9   ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 9   ? 2.199  7.294   21.900 1.00 24.51 ? 9   ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 9   ? 2.590  5.227   22.476 1.00 21.52 ? 9   ASP A OD2 1 
ATOM   74   N N   . ARG A 1 10  ? 5.847  5.253   20.358 1.00 15.14 ? 10  ARG A N   1 
ATOM   75   C CA  . ARG A 1 10  ? 7.050  4.989   21.129 1.00 13.10 ? 10  ARG A CA  1 
ATOM   76   C C   . ARG A 1 10  ? 7.944  4.000   20.402 1.00 11.49 ? 10  ARG A C   1 
ATOM   77   O O   . ARG A 1 10  ? 7.475  3.311   19.484 1.00 11.87 ? 10  ARG A O   1 
ATOM   78   C CB  . ARG A 1 10  ? 6.784  4.528   22.542 1.00 14.00 ? 10  ARG A CB  1 
ATOM   79   C CG  . ARG A 1 10  ? 5.877  3.311   22.507 1.00 16.01 ? 10  ARG A CG  1 
ATOM   80   C CD  . ARG A 1 10  ? 5.249  2.984   23.869 1.00 20.78 ? 10  ARG A CD  1 
ATOM   81   N NE  . ARG A 1 10  ? 4.529  1.710   23.835 1.00 17.43 ? 10  ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 10  ? 3.299  1.487   23.328 1.00 21.44 ? 10  ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 10  ? 2.564  2.461   22.803 1.00 14.60 ? 10  ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 10  ? 2.740  0.275   23.350 1.00 19.85 ? 10  ARG A NH2 1 
ATOM   85   N N   . ASN A 1 11  ? 9.206  3.958   20.815 1.00 12.13 ? 11  ASN A N   1 
ATOM   86   C CA  . ASN A 1 11  ? 10.165 3.046   20.192 1.00 8.60  ? 11  ASN A CA  1 
ATOM   87   C C   . ASN A 1 11  ? 10.838 2.207   21.249 1.00 10.89 ? 11  ASN A C   1 
ATOM   88   O O   . ASN A 1 11  ? 10.858 2.580   22.435 1.00 14.14 ? 11  ASN A O   1 
ATOM   89   C CB  . ASN A 1 11  ? 11.308 3.844   19.562 1.00 12.51 ? 11  ASN A CB  1 
ATOM   90   C CG  . ASN A 1 11  ? 10.821 4.942   18.637 1.00 19.12 ? 11  ASN A CG  1 
ATOM   91   O OD1 . ASN A 1 11  ? 10.073 4.761   17.665 1.00 19.28 ? 11  ASN A OD1 1 
ATOM   92   N ND2 . ASN A 1 11  ? 11.290 6.139   18.943 1.00 27.57 ? 11  ASN A ND2 1 
ATOM   93   N N   . GLU A 1 12  ? 11.412 1.094   20.802 1.00 10.37 ? 12  GLU A N   1 
ATOM   94   C CA  . GLU A 1 12  ? 12.155 0.244   21.714 1.00 13.65 ? 12  GLU A CA  1 
ATOM   95   C C   . GLU A 1 12  ? 13.480 -0.108  21.054 1.00 8.09  ? 12  GLU A C   1 
ATOM   96   O O   . GLU A 1 12  ? 13.462 -0.574  19.918 1.00 8.97  ? 12  GLU A O   1 
ATOM   97   C CB  . GLU A 1 12  ? 11.381 -1.025  22.114 1.00 21.28 ? 12  GLU A CB  1 
ATOM   98   C CG  . GLU A 1 12  ? 10.261 -0.683  23.117 1.00 26.73 ? 12  GLU A CG  1 
ATOM   99   C CD  . GLU A 1 12  ? 9.513  -1.875  23.677 1.00 31.09 ? 12  GLU A CD  1 
ATOM   100  O OE1 . GLU A 1 12  ? 10.181 -2.993  23.552 1.00 22.69 ? 12  GLU A OE1 1 
ATOM   101  O OE2 . GLU A 1 12  ? 8.407  -1.792  24.181 1.00 33.48 ? 12  GLU A OE2 1 
ATOM   102  N N   . ASN A 1 13  ? 14.585 0.229   21.727 1.00 10.12 ? 13  ASN A N   1 
ATOM   103  C CA  . ASN A 1 13  ? 15.929 -0.031  21.220 1.00 7.75  ? 13  ASN A CA  1 
ATOM   104  C C   . ASN A 1 13  ? 16.208 0.487   19.839 1.00 11.59 ? 13  ASN A C   1 
ATOM   105  O O   . ASN A 1 13  ? 17.055 -0.046  19.116 1.00 13.14 ? 13  ASN A O   1 
ATOM   106  C CB  . ASN A 1 13  ? 16.120 -1.548  21.223 1.00 12.55 ? 13  ASN A CB  1 
ATOM   107  C CG  . ASN A 1 13  ? 17.554 -1.973  21.444 1.00 22.30 ? 13  ASN A CG  1 
ATOM   108  O OD1 . ASN A 1 13  ? 18.301 -1.393  22.265 1.00 18.77 ? 13  ASN A OD1 1 
ATOM   109  N ND2 . ASN A 1 13  ? 17.923 -3.009  20.686 1.00 19.59 ? 13  ASN A ND2 1 
ATOM   110  N N   . TYR A 1 14  ? 15.506 1.549   19.396 1.00 8.25  ? 14  TYR A N   1 
ATOM   111  C CA  . TYR A 1 14  ? 15.690 2.057   18.062 1.00 7.31  ? 14  TYR A CA  1 
ATOM   112  C C   . TYR A 1 14  ? 17.061 2.699   17.801 1.00 11.91 ? 14  TYR A C   1 
ATOM   113  O O   . TYR A 1 14  ? 17.658 2.601   16.712 1.00 11.45 ? 14  TYR A O   1 
ATOM   114  C CB  . TYR A 1 14  ? 14.463 2.969   17.782 1.00 8.65  ? 14  TYR A CB  1 
ATOM   115  C CG  . TYR A 1 14  ? 14.326 3.336   16.334 1.00 11.21 ? 14  TYR A CG  1 
ATOM   116  C CD1 . TYR A 1 14  ? 14.476 2.373   15.334 1.00 12.21 ? 14  TYR A CD1 1 
ATOM   117  C CD2 . TYR A 1 14  ? 14.041 4.637   15.925 1.00 11.37 ? 14  TYR A CD2 1 
ATOM   118  C CE1 . TYR A 1 14  ? 14.333 2.663   13.975 1.00 14.46 ? 14  TYR A CE1 1 
ATOM   119  C CE2 . TYR A 1 14  ? 13.879 4.942   14.576 1.00 14.60 ? 14  TYR A CE2 1 
ATOM   120  C CZ  . TYR A 1 14  ? 14.033 3.973   13.582 1.00 14.19 ? 14  TYR A CZ  1 
ATOM   121  O OH  . TYR A 1 14  ? 13.849 4.289   12.248 1.00 11.72 ? 14  TYR A OH  1 
ATOM   122  N N   . GLU A 1 15  ? 17.590 3.404   18.785 1.00 11.67 ? 15  GLU A N   1 
ATOM   123  C CA  . GLU A 1 15  ? 18.883 3.999   18.499 1.00 14.91 ? 15  GLU A CA  1 
ATOM   124  C C   . GLU A 1 15  ? 19.982 2.974   18.317 1.00 15.54 ? 15  GLU A C   1 
ATOM   125  O O   . GLU A 1 15  ? 20.791 3.171   17.439 1.00 14.16 ? 15  GLU A O   1 
ATOM   126  C CB  . GLU A 1 15  ? 19.351 5.046   19.537 1.00 24.63 ? 15  GLU A CB  1 
ATOM   127  C CG  . GLU A 1 15  ? 18.599 6.398   19.411 1.00 28.69 ? 15  GLU A CG  1 
ATOM   128  C CD  . GLU A 1 15  ? 18.965 7.372   20.500 1.00 34.25 ? 15  GLU A CD  1 
ATOM   129  O OE1 . GLU A 1 15  ? 20.112 7.501   20.887 1.00 37.32 ? 15  GLU A OE1 1 
ATOM   130  O OE2 . GLU A 1 15  ? 17.927 8.030   20.994 1.00 29.85 ? 15  GLU A OE2 1 
ATOM   131  N N   . LYS A 1 16  ? 20.014 1.907   19.128 1.00 15.36 ? 16  LYS A N   1 
ATOM   132  C CA  . LYS A 1 16  ? 21.032 0.866   19.002 1.00 12.21 ? 16  LYS A CA  1 
ATOM   133  C C   . LYS A 1 16  ? 20.867 0.203   17.643 1.00 15.16 ? 16  LYS A C   1 
ATOM   134  O O   . LYS A 1 16  ? 21.828 -0.124  16.942 1.00 13.24 ? 16  LYS A O   1 
ATOM   135  C CB  . LYS A 1 16  ? 20.875 -0.176  20.091 1.00 17.51 ? 16  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 16  ? 21.741 0.094   21.312 1.00 35.08 ? 16  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 16  ? 23.243 -0.036  21.038 1.00 49.20 ? 16  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 16  ? 24.164 0.524   22.123 1.00 55.25 ? 16  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 16  ? 25.500 0.954   21.655 1.00 58.04 ? 16  LYS A NZ  1 
ATOM   140  N N   . PHE A 1 17  ? 19.616 0.021   17.231 1.00 10.55 ? 17  PHE A N   1 
ATOM   141  C CA  . PHE A 1 17  ? 19.376 -0.590  15.932 1.00 9.45  ? 17  PHE A CA  1 
ATOM   142  C C   . PHE A 1 17  ? 19.938 0.280   14.818 1.00 14.06 ? 17  PHE A C   1 
ATOM   143  O O   . PHE A 1 17  ? 20.591 -0.186  13.868 1.00 13.04 ? 17  PHE A O   1 
ATOM   144  C CB  . PHE A 1 17  ? 17.858 -0.875  15.749 1.00 8.55  ? 17  PHE A CB  1 
ATOM   145  C CG  . PHE A 1 17  ? 17.538 -1.372  14.362 1.00 7.65  ? 17  PHE A CG  1 
ATOM   146  C CD1 . PHE A 1 17  ? 17.316 -0.507  13.295 1.00 9.34  ? 17  PHE A CD1 1 
ATOM   147  C CD2 . PHE A 1 17  ? 17.493 -2.745  14.120 1.00 12.18 ? 17  PHE A CD2 1 
ATOM   148  C CE1 . PHE A 1 17  ? 17.029 -0.979  12.018 1.00 15.22 ? 17  PHE A CE1 1 
ATOM   149  C CE2 . PHE A 1 17  ? 17.238 -3.248  12.845 1.00 13.30 ? 17  PHE A CE2 1 
ATOM   150  C CZ  . PHE A 1 17  ? 17.022 -2.362  11.795 1.00 14.67 ? 17  PHE A CZ  1 
ATOM   151  N N   . MET A 1 18  ? 19.696 1.611   14.931 1.00 11.42 ? 18  MET A N   1 
ATOM   152  C CA  . MET A 1 18  ? 20.222 2.497   13.893 1.00 10.06 ? 18  MET A CA  1 
ATOM   153  C C   . MET A 1 18  ? 21.755 2.549   13.890 1.00 6.36  ? 18  MET A C   1 
ATOM   154  O O   . MET A 1 18  ? 22.365 2.658   12.836 1.00 10.35 ? 18  MET A O   1 
ATOM   155  C CB  . MET A 1 18  ? 19.704 3.932   14.094 1.00 13.01 ? 18  MET A CB  1 
ATOM   156  C CG  . MET A 1 18  ? 18.240 4.005   13.692 1.00 12.65 ? 18  MET A CG  1 
ATOM   157  S SD  . MET A 1 18  ? 17.593 5.709   13.623 1.00 18.82 ? 18  MET A SD  1 
ATOM   158  C CE  . MET A 1 18  ? 17.190 5.926   15.365 1.00 14.94 ? 18  MET A CE  1 
ATOM   159  N N   . GLU A 1 19  ? 22.359 2.451   15.063 1.00 10.39 ? 19  GLU A N   1 
ATOM   160  C CA  . GLU A 1 19  ? 23.830 2.445   15.167 1.00 13.54 ? 19  GLU A CA  1 
ATOM   161  C C   . GLU A 1 19  ? 24.405 1.264   14.381 1.00 14.65 ? 19  GLU A C   1 
ATOM   162  O O   . GLU A 1 19  ? 25.362 1.389   13.629 1.00 16.27 ? 19  GLU A O   1 
ATOM   163  C CB  . GLU A 1 19  ? 24.240 2.306   16.640 1.00 11.85 ? 19  GLU A CB  1 
ATOM   164  C CG  . GLU A 1 19  ? 25.744 2.207   16.923 1.00 22.92 ? 19  GLU A CG  1 
ATOM   165  C CD  . GLU A 1 19  ? 26.020 2.321   18.414 1.00 40.15 ? 19  GLU A CD  1 
ATOM   166  O OE1 . GLU A 1 19  ? 25.828 1.187   19.059 1.00 50.78 ? 19  GLU A OE1 1 
ATOM   167  O OE2 . GLU A 1 19  ? 26.354 3.347   18.983 1.00 44.17 ? 19  GLU A OE2 1 
ATOM   168  N N   . LYS A 1 20  ? 23.791 0.088   14.522 1.00 14.32 ? 20  LYS A N   1 
ATOM   169  C CA  . LYS A 1 20  ? 24.216 -1.113  13.808 1.00 17.93 ? 20  LYS A CA  1 
ATOM   170  C C   . LYS A 1 20  ? 24.172 -1.010  12.289 1.00 14.75 ? 20  LYS A C   1 
ATOM   171  O O   . LYS A 1 20  ? 25.005 -1.559  11.559 1.00 15.12 ? 20  LYS A O   1 
ATOM   172  C CB  . LYS A 1 20  ? 23.353 -2.284  14.274 1.00 25.04 ? 20  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 20  ? 23.984 -3.662  14.142 1.00 25.20 ? 20  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 20  ? 25.044 -4.004  15.177 1.00 29.15 ? 20  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 20  ? 25.700 -5.351  14.881 1.00 31.67 ? 20  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 20  ? 26.636 -5.729  15.944 1.00 35.27 ? 20  LYS A NZ  1 
ATOM   177  N N   . MET A 1 21  ? 23.161 -0.290  11.801 1.00 11.65 ? 21  MET A N   1 
ATOM   178  C CA  . MET A 1 21  ? 22.904 -0.041  10.392 1.00 10.65 ? 21  MET A CA  1 
ATOM   179  C C   . MET A 1 21  ? 23.916 0.922   9.809  1.00 12.68 ? 21  MET A C   1 
ATOM   180  O O   . MET A 1 21  ? 23.987 1.016   8.589  1.00 15.97 ? 21  MET A O   1 
ATOM   181  C CB  . MET A 1 21  ? 21.482 0.508   10.140 1.00 14.13 ? 21  MET A CB  1 
ATOM   182  C CG  . MET A 1 21  ? 20.435 -0.585  10.388 1.00 16.53 ? 21  MET A CG  1 
ATOM   183  S SD  . MET A 1 21  ? 20.186 -1.668  8.951  1.00 20.29 ? 21  MET A SD  1 
ATOM   184  C CE  . MET A 1 21  ? 19.779 -0.419  7.695  1.00 20.25 ? 21  MET A CE  1 
ATOM   185  N N   . GLY A 1 22  ? 24.649 1.591   10.712 1.00 13.45 ? 22  GLY A N   1 
ATOM   186  C CA  . GLY A 1 22  ? 25.663 2.518   10.272 1.00 14.30 ? 22  GLY A CA  1 
ATOM   187  C C   . GLY A 1 22  ? 25.228 3.984   10.335 1.00 21.06 ? 22  GLY A C   1 
ATOM   188  O O   . GLY A 1 22  ? 25.859 4.833   9.712  1.00 23.14 ? 22  GLY A O   1 
ATOM   189  N N   . ILE A 1 23  ? 24.171 4.320   11.071 1.00 16.54 ? 23  ILE A N   1 
ATOM   190  C CA  . ILE A 1 23  ? 23.722 5.724   11.143 1.00 16.91 ? 23  ILE A CA  1 
ATOM   191  C C   . ILE A 1 23  ? 24.441 6.506   12.229 1.00 13.25 ? 23  ILE A C   1 
ATOM   192  O O   . ILE A 1 23  ? 24.592 6.040   13.358 1.00 17.08 ? 23  ILE A O   1 
ATOM   193  C CB  . ILE A 1 23  ? 22.204 5.854   11.238 1.00 15.04 ? 23  ILE A CB  1 
ATOM   194  C CG1 . ILE A 1 23  ? 21.562 5.450   9.913  1.00 18.82 ? 23  ILE A CG1 1 
ATOM   195  C CG2 . ILE A 1 23  ? 21.792 7.283   11.581 1.00 21.08 ? 23  ILE A CG2 1 
ATOM   196  C CD1 . ILE A 1 23  ? 20.944 4.061   9.945  1.00 26.42 ? 23  ILE A CD1 1 
ATOM   197  N N   . ASN A 1 24  ? 24.893 7.724   11.876 1.00 12.65 ? 24  ASN A N   1 
ATOM   198  C CA  . ASN A 1 24  ? 25.632 8.568   12.798 1.00 13.76 ? 24  ASN A CA  1 
ATOM   199  C C   . ASN A 1 24  ? 24.886 9.055   14.035 1.00 18.46 ? 24  ASN A C   1 
ATOM   200  O O   . ASN A 1 24  ? 23.654 9.148   14.013 1.00 20.54 ? 24  ASN A O   1 
ATOM   201  C CB  . ASN A 1 24  ? 26.423 9.682   12.050 1.00 21.85 ? 24  ASN A CB  1 
ATOM   202  C CG  . ASN A 1 24  ? 25.665 10.966  11.760 1.00 22.04 ? 24  ASN A CG  1 
ATOM   203  O OD1 . ASN A 1 24  ? 24.942 11.453  12.647 1.00 27.35 ? 24  ASN A OD1 1 
ATOM   204  N ND2 . ASN A 1 24  ? 25.837 11.515  10.558 1.00 23.76 ? 24  ASN A ND2 1 
ATOM   205  N N   . VAL A 1 25  ? 25.614 9.397   15.089 1.00 13.89 ? 25  VAL A N   1 
ATOM   206  C CA  . VAL A 1 25  ? 24.965 9.848   16.306 1.00 15.82 ? 25  VAL A CA  1 
ATOM   207  C C   . VAL A 1 25  ? 23.858 10.904  16.127 1.00 21.86 ? 25  VAL A C   1 
ATOM   208  O O   . VAL A 1 25  ? 22.740 10.801  16.655 1.00 18.49 ? 25  VAL A O   1 
ATOM   209  C CB  . VAL A 1 25  ? 25.880 10.169  17.473 1.00 25.48 ? 25  VAL A CB  1 
ATOM   210  C CG1 . VAL A 1 25  ? 26.711 11.396  17.121 1.00 38.08 ? 25  VAL A CG1 1 
ATOM   211  C CG2 . VAL A 1 25  ? 25.072 10.511  18.716 1.00 25.85 ? 25  VAL A CG2 1 
ATOM   212  N N   . VAL A 1 26  ? 24.156 11.935  15.337 1.00 21.28 ? 26  VAL A N   1 
ATOM   213  C CA  . VAL A 1 26  ? 23.183 12.992  15.123 1.00 20.09 ? 26  VAL A CA  1 
ATOM   214  C C   . VAL A 1 26  ? 21.903 12.577  14.390 1.00 17.72 ? 26  VAL A C   1 
ATOM   215  O O   . VAL A 1 26  ? 20.769 12.930  14.761 1.00 14.24 ? 26  VAL A O   1 
ATOM   216  C CB  . VAL A 1 26  ? 23.908 14.163  14.475 1.00 20.11 ? 26  VAL A CB  1 
ATOM   217  C CG1 . VAL A 1 26  ? 22.960 15.188  13.874 1.00 21.64 ? 26  VAL A CG1 1 
ATOM   218  C CG2 . VAL A 1 26  ? 24.778 14.753  15.586 1.00 19.96 ? 26  VAL A CG2 1 
ATOM   219  N N   . LYS A 1 27  ? 22.120 11.800  13.336 1.00 13.34 ? 27  LYS A N   1 
ATOM   220  C CA  . LYS A 1 27  ? 21.013 11.313  12.531 1.00 10.83 ? 27  LYS A CA  1 
ATOM   221  C C   . LYS A 1 27  ? 20.151 10.329  13.355 1.00 14.24 ? 27  LYS A C   1 
ATOM   222  O O   . LYS A 1 27  ? 18.941 10.226  13.129 1.00 14.64 ? 27  LYS A O   1 
ATOM   223  C CB  . LYS A 1 27  ? 21.468 10.821  11.165 1.00 12.60 ? 27  LYS A CB  1 
ATOM   224  C CG  . LYS A 1 27  ? 22.338 11.811  10.407 1.00 24.50 ? 27  LYS A CG  1 
ATOM   225  C CD  . LYS A 1 27  ? 21.589 12.971  9.772  1.00 39.66 ? 27  LYS A CD  1 
ATOM   226  C CE  . LYS A 1 27  ? 22.498 13.955  9.026  1.00 51.00 ? 27  LYS A CE  1 
ATOM   227  N NZ  . LYS A 1 27  ? 21.903 15.292  8.825  1.00 53.80 ? 27  LYS A NZ  1 
ATOM   228  N N   . ARG A 1 28  ? 20.755 9.635   14.349 1.00 14.44 ? 28  ARG A N   1 
ATOM   229  C CA  . ARG A 1 28  ? 19.954 8.734   15.177 1.00 11.71 ? 28  ARG A CA  1 
ATOM   230  C C   . ARG A 1 28  ? 18.980 9.537   16.029 1.00 17.39 ? 28  ARG A C   1 
ATOM   231  O O   . ARG A 1 28  ? 17.805 9.138   16.224 1.00 15.26 ? 28  ARG A O   1 
ATOM   232  C CB  . ARG A 1 28  ? 20.752 7.796   16.083 1.00 10.79 ? 28  ARG A CB  1 
ATOM   233  C CG  . ARG A 1 28  ? 21.714 6.988   15.252 1.00 14.04 ? 28  ARG A CG  1 
ATOM   234  C CD  . ARG A 1 28  ? 22.339 5.854   16.051 1.00 16.42 ? 28  ARG A CD  1 
ATOM   235  N NE  . ARG A 1 28  ? 23.185 6.144   17.212 1.00 22.02 ? 28  ARG A NE  1 
ATOM   236  C CZ  . ARG A 1 28  ? 24.521 6.196   17.149 1.00 22.44 ? 28  ARG A CZ  1 
ATOM   237  N NH1 . ARG A 1 28  ? 25.161 6.061   15.976 1.00 21.46 ? 28  ARG A NH1 1 
ATOM   238  N NH2 . ARG A 1 28  ? 25.226 6.408   18.250 1.00 19.47 ? 28  ARG A NH2 1 
ATOM   239  N N   . LYS A 1 29  ? 19.501 10.640  16.596 1.00 12.93 ? 29  LYS A N   1 
ATOM   240  C CA  . LYS A 1 29  ? 18.625 11.479  17.410 1.00 14.30 ? 29  LYS A CA  1 
ATOM   241  C C   . LYS A 1 29  ? 17.472 12.049  16.567 1.00 13.87 ? 29  LYS A C   1 
ATOM   242  O O   . LYS A 1 29  ? 16.312 12.142  16.964 1.00 18.39 ? 29  LYS A O   1 
ATOM   243  C CB  . LYS A 1 29  ? 19.438 12.500  18.203 1.00 11.49 ? 29  LYS A CB  1 
ATOM   244  C CG  . LYS A 1 29  ? 20.441 11.759  19.112 1.00 15.72 ? 29  LYS A CG  1 
ATOM   245  C CD  . LYS A 1 29  ? 19.761 11.334  20.412 1.00 21.07 ? 29  LYS A CD  1 
ATOM   246  C CE  . LYS A 1 29  ? 20.521 10.511  21.463 1.00 28.80 ? 29  LYS A CE  1 
ATOM   247  N NZ  . LYS A 1 29  ? 19.713 10.371  22.699 1.00 33.21 ? 29  LYS A NZ  1 
ATOM   248  N N   . LEU A 1 30  ? 17.746 12.412  15.331 1.00 9.10  ? 30  LEU A N   1 
ATOM   249  C CA  . LEU A 1 30  ? 16.676 12.914  14.488 1.00 13.70 ? 30  LEU A CA  1 
ATOM   250  C C   . LEU A 1 30  ? 15.706 11.785  14.094 1.00 19.43 ? 30  LEU A C   1 
ATOM   251  O O   . LEU A 1 30  ? 14.505 12.028  14.010 1.00 16.97 ? 30  LEU A O   1 
ATOM   252  C CB  . LEU A 1 30  ? 17.152 13.562  13.160 1.00 10.35 ? 30  LEU A CB  1 
ATOM   253  C CG  . LEU A 1 30  ? 18.162 14.717  13.327 1.00 18.30 ? 30  LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 30  ? 18.685 15.261  11.977 1.00 18.67 ? 30  LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 30  ? 17.616 15.825  14.227 1.00 18.84 ? 30  LEU A CD2 1 
ATOM   256  N N   . GLY A 1 31  ? 16.245 10.588  13.821 1.00 14.47 ? 31  GLY A N   1 
ATOM   257  C CA  . GLY A 1 31  ? 15.474 9.418   13.412 1.00 10.26 ? 31  GLY A CA  1 
ATOM   258  C C   . GLY A 1 31  ? 14.467 8.993   14.459 1.00 12.34 ? 31  GLY A C   1 
ATOM   259  O O   . GLY A 1 31  ? 13.331 8.594   14.157 1.00 18.19 ? 31  GLY A O   1 
ATOM   260  N N   . ALA A 1 32  ? 14.867 9.117   15.708 1.00 8.67  ? 32  ALA A N   1 
ATOM   261  C CA  . ALA A 1 32  ? 14.021 8.739   16.803 1.00 11.02 ? 32  ALA A CA  1 
ATOM   262  C C   . ALA A 1 32  ? 12.868 9.672   17.121 1.00 14.18 ? 32  ALA A C   1 
ATOM   263  O O   . ALA A 1 32  ? 12.041 9.350   17.980 1.00 17.47 ? 32  ALA A O   1 
ATOM   264  C CB  . ALA A 1 32  ? 14.824 8.599   18.090 1.00 18.53 ? 32  ALA A CB  1 
ATOM   265  N N   . HIS A 1 33  ? 12.851 10.837  16.463 1.00 12.66 ? 33  HIS A N   1 
ATOM   266  C CA  . HIS A 1 33  ? 11.818 11.816  16.618 1.00 8.92  ? 33  HIS A CA  1 
ATOM   267  C C   . HIS A 1 33  ? 11.442 12.256  15.205 1.00 12.27 ? 33  HIS A C   1 
ATOM   268  O O   . HIS A 1 33  ? 11.389 13.458  14.872 1.00 16.25 ? 33  HIS A O   1 
ATOM   269  C CB  . HIS A 1 33  ? 12.402 13.028  17.335 1.00 13.61 ? 33  HIS A CB  1 
ATOM   270  C CG  . HIS A 1 33  ? 12.590 12.857  18.779 1.00 26.65 ? 33  HIS A CG  1 
ATOM   271  N ND1 . HIS A 1 33  ? 13.819 12.484  19.308 1.00 32.65 ? 33  HIS A ND1 1 
ATOM   272  C CD2 . HIS A 1 33  ? 11.690 13.049  19.779 1.00 33.66 ? 33  HIS A CD2 1 
ATOM   273  C CE1 . HIS A 1 33  ? 13.647 12.458  20.623 1.00 39.06 ? 33  HIS A CE1 1 
ATOM   274  N NE2 . HIS A 1 33  ? 12.392 12.785  20.937 1.00 42.16 ? 33  HIS A NE2 1 
ATOM   275  N N   . ASP A 1 34  ? 11.173 11.282  14.330 1.00 10.01 ? 34  ASP A N   1 
ATOM   276  C CA  . ASP A 1 34  ? 10.828 11.593  12.959 1.00 9.61  ? 34  ASP A CA  1 
ATOM   277  C C   . ASP A 1 34  ? 9.351  11.899  12.616 1.00 4.63  ? 34  ASP A C   1 
ATOM   278  O O   . ASP A 1 34  ? 9.096  12.225  11.449 1.00 8.98  ? 34  ASP A O   1 
ATOM   279  C CB  . ASP A 1 34  ? 11.360 10.464  12.068 1.00 13.01 ? 34  ASP A CB  1 
ATOM   280  C CG  . ASP A 1 34  ? 10.690 9.122   12.257 1.00 14.88 ? 34  ASP A CG  1 
ATOM   281  O OD1 . ASP A 1 34  ? 9.862  9.039   13.267 1.00 12.20 ? 34  ASP A OD1 1 
ATOM   282  O OD2 . ASP A 1 34  ? 10.908 8.180   11.508 1.00 16.32 ? 34  ASP A OD2 1 
ATOM   283  N N   . ASN A 1 35  ? 8.490  11.811  13.638 1.00 6.83  ? 35  ASN A N   1 
ATOM   284  C CA  . ASN A 1 35  ? 7.040  12.075  13.465 1.00 9.97  ? 35  ASN A CA  1 
ATOM   285  C C   . ASN A 1 35  ? 6.469  11.225  12.345 1.00 12.46 ? 35  ASN A C   1 
ATOM   286  O O   . ASN A 1 35  ? 5.623  11.686  11.600 1.00 15.54 ? 35  ASN A O   1 
ATOM   287  C CB  . ASN A 1 35  ? 6.660  13.556  13.176 1.00 14.59 ? 35  ASN A CB  1 
ATOM   288  C CG  . ASN A 1 35  ? 6.982  14.411  14.384 1.00 38.39 ? 35  ASN A CG  1 
ATOM   289  O OD1 . ASN A 1 35  ? 6.386  14.225  15.460 1.00 46.93 ? 35  ASN A OD1 1 
ATOM   290  N ND2 . ASN A 1 35  ? 7.947  15.318  14.214 1.00 44.97 ? 35  ASN A ND2 1 
ATOM   291  N N   . LEU A 1 36  ? 6.928  9.982   12.219 1.00 9.71  ? 36  LEU A N   1 
ATOM   292  C CA  . LEU A 1 36  ? 6.433  9.153   11.109 1.00 10.21 ? 36  LEU A CA  1 
ATOM   293  C C   . LEU A 1 36  ? 4.935  8.817   11.269 1.00 7.96  ? 36  LEU A C   1 
ATOM   294  O O   . LEU A 1 36  ? 4.458  8.470   12.342 1.00 7.39  ? 36  LEU A O   1 
ATOM   295  C CB  . LEU A 1 36  ? 7.260  7.838   11.172 1.00 12.74 ? 36  LEU A CB  1 
ATOM   296  C CG  . LEU A 1 36  ? 6.889  6.796   10.134 1.00 9.71  ? 36  LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 36  ? 7.073  7.278   8.693  1.00 11.10 ? 36  LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 36  ? 7.667  5.496   10.476 1.00 12.22 ? 36  LEU A CD2 1 
ATOM   299  N N   . LYS A 1 37  ? 4.279  8.905   10.143 1.00 9.96  ? 37  LYS A N   1 
ATOM   300  C CA  . LYS A 1 37  ? 2.864  8.630   9.992  1.00 11.36 ? 37  LYS A CA  1 
ATOM   301  C C   . LYS A 1 37  ? 2.713  7.770   8.740  1.00 9.34  ? 37  LYS A C   1 
ATOM   302  O O   . LYS A 1 37  ? 3.320  7.993   7.667  1.00 9.54  ? 37  LYS A O   1 
ATOM   303  C CB  . LYS A 1 37  ? 2.224  9.987   9.737  1.00 13.81 ? 37  LYS A CB  1 
ATOM   304  C CG  . LYS A 1 37  ? 0.758  9.941   9.369  1.00 27.54 ? 37  LYS A CG  1 
ATOM   305  C CD  . LYS A 1 37  ? 0.155  11.308  9.611  1.00 38.94 ? 37  LYS A CD  1 
ATOM   306  C CE  . LYS A 1 37  ? -0.717 11.780  8.460  1.00 51.61 ? 37  LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 37  ? -1.528 12.971  8.781  1.00 56.04 ? 37  LYS A NZ  1 
ATOM   308  N N   . LEU A 1 38  ? 1.875  6.729   8.881  1.00 7.86  ? 38  LEU A N   1 
ATOM   309  C CA  . LEU A 1 38  ? 1.663  5.848   7.733  1.00 10.25 ? 38  LEU A CA  1 
ATOM   310  C C   . LEU A 1 38  ? 0.166  5.781   7.431  1.00 14.88 ? 38  LEU A C   1 
ATOM   311  O O   . LEU A 1 38  ? -0.673 5.646   8.347  1.00 14.84 ? 38  LEU A O   1 
ATOM   312  C CB  . LEU A 1 38  ? 2.044  4.398   8.158  1.00 12.20 ? 38  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 38  ? 3.504  4.180   8.573  1.00 12.97 ? 38  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 38  ? 3.675  2.751   9.061  1.00 16.55 ? 38  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 38  ? 4.380  4.393   7.337  1.00 15.54 ? 38  LEU A CD2 1 
ATOM   316  N N   . THR A 1 39  ? -0.153 5.848   6.135  1.00 8.32  ? 39  THR A N   1 
ATOM   317  C CA  . THR A 1 39  ? -1.548 5.745   5.738  1.00 12.98 ? 39  THR A CA  1 
ATOM   318  C C   . THR A 1 39  ? -1.566 4.481   4.886  1.00 14.68 ? 39  THR A C   1 
ATOM   319  O O   . THR A 1 39  ? -0.934 4.450   3.829  1.00 13.03 ? 39  THR A O   1 
ATOM   320  C CB  . THR A 1 39  ? -2.063 6.993   4.980  1.00 15.97 ? 39  THR A CB  1 
ATOM   321  O OG1 . THR A 1 39  ? -2.050 8.112   5.858  1.00 14.97 ? 39  THR A OG1 1 
ATOM   322  C CG2 . THR A 1 39  ? -3.472 6.760   4.461  1.00 17.93 ? 39  THR A CG2 1 
ATOM   323  N N   . ILE A 1 40  ? -2.285 3.450   5.361  1.00 11.32 ? 40  ILE A N   1 
ATOM   324  C CA  . ILE A 1 40  ? -2.337 2.150   4.691  1.00 16.89 ? 40  ILE A CA  1 
ATOM   325  C C   . ILE A 1 40  ? -3.659 1.844   4.036  1.00 13.55 ? 40  ILE A C   1 
ATOM   326  O O   . ILE A 1 40  ? -4.709 1.937   4.675  1.00 12.56 ? 40  ILE A O   1 
ATOM   327  C CB  . ILE A 1 40  ? -1.967 1.015   5.657  1.00 15.82 ? 40  ILE A CB  1 
ATOM   328  C CG1 . ILE A 1 40  ? -0.554 1.295   6.160  1.00 13.67 ? 40  ILE A CG1 1 
ATOM   329  C CG2 . ILE A 1 40  ? -1.992 -0.316  4.911  1.00 15.44 ? 40  ILE A CG2 1 
ATOM   330  C CD1 . ILE A 1 40  ? -0.154 0.534   7.412  1.00 16.20 ? 40  ILE A CD1 1 
ATOM   331  N N   . THR A 1 41  ? -3.583 1.471   2.772  1.00 11.22 ? 41  THR A N   1 
ATOM   332  C CA  . THR A 1 41  ? -4.802 1.134   2.073  1.00 14.68 ? 41  THR A CA  1 
ATOM   333  C C   . THR A 1 41  ? -4.528 -0.098  1.233  1.00 19.56 ? 41  THR A C   1 
ATOM   334  O O   . THR A 1 41  ? -3.421 -0.243  0.727  1.00 11.94 ? 41  THR A O   1 
ATOM   335  C CB  . THR A 1 41  ? -5.311 2.243   1.164  1.00 17.85 ? 41  THR A CB  1 
ATOM   336  O OG1 . THR A 1 41  ? -4.330 2.549   0.214  1.00 19.54 ? 41  THR A OG1 1 
ATOM   337  C CG2 . THR A 1 41  ? -5.582 3.471   2.007  1.00 21.44 ? 41  THR A CG2 1 
ATOM   338  N N   . GLN A 1 42  ? -5.547 -0.953  1.101  1.00 14.85 ? 42  GLN A N   1 
ATOM   339  C CA  . GLN A 1 42  ? -5.442 -2.201  0.356  1.00 21.67 ? 42  GLN A CA  1 
ATOM   340  C C   . GLN A 1 42  ? -6.351 -2.238  -0.846 1.00 19.08 ? 42  GLN A C   1 
ATOM   341  O O   . GLN A 1 42  ? -7.428 -1.658  -0.790 1.00 18.57 ? 42  GLN A O   1 
ATOM   342  C CB  . GLN A 1 42  ? -5.814 -3.377  1.302  1.00 20.05 ? 42  GLN A CB  1 
ATOM   343  C CG  . GLN A 1 42  ? -5.649 -4.797  0.717  1.00 23.75 ? 42  GLN A CG  1 
ATOM   344  C CD  . GLN A 1 42  ? -5.736 -5.916  1.759  1.00 26.31 ? 42  GLN A CD  1 
ATOM   345  O OE1 . GLN A 1 42  ? -5.728 -5.724  2.995  1.00 24.84 ? 42  GLN A OE1 1 
ATOM   346  N NE2 . GLN A 1 42  ? -5.757 -7.133  1.218  1.00 32.15 ? 42  GLN A NE2 1 
ATOM   347  N N   . GLU A 1 43  ? -5.947 -2.942  -1.900 1.00 15.06 ? 43  GLU A N   1 
ATOM   348  C CA  . GLU A 1 43  ? -6.763 -3.118  -3.099 1.00 14.56 ? 43  GLU A CA  1 
ATOM   349  C C   . GLU A 1 43  ? -6.357 -4.491  -3.587 1.00 21.23 ? 43  GLU A C   1 
ATOM   350  O O   . GLU A 1 43  ? -5.353 -4.693  -4.263 1.00 16.41 ? 43  GLU A O   1 
ATOM   351  C CB  . GLU A 1 43  ? -6.674 -2.062  -4.191 1.00 19.74 ? 43  GLU A CB  1 
ATOM   352  C CG  . GLU A 1 43  ? -7.663 -2.404  -5.301 1.00 38.29 ? 43  GLU A CG  1 
ATOM   353  C CD  . GLU A 1 43  ? -7.623 -1.326  -6.361 1.00 58.72 ? 43  GLU A CD  1 
ATOM   354  O OE1 . GLU A 1 43  ? -6.849 -0.378  -6.320 1.00 57.79 ? 43  GLU A OE1 1 
ATOM   355  O OE2 . GLU A 1 43  ? -8.497 -1.533  -7.330 1.00 68.06 ? 43  GLU A OE2 1 
ATOM   356  N N   . GLY A 1 44  ? -7.134 -5.444  -3.111 1.00 21.28 ? 44  GLY A N   1 
ATOM   357  C CA  . GLY A 1 44  ? -6.868 -6.838  -3.391 1.00 26.45 ? 44  GLY A CA  1 
ATOM   358  C C   . GLY A 1 44  ? -5.634 -7.288  -2.608 1.00 15.45 ? 44  GLY A C   1 
ATOM   359  O O   . GLY A 1 44  ? -5.518 -7.247  -1.384 1.00 20.45 ? 44  GLY A O   1 
ATOM   360  N N   . ASN A 1 45  ? -4.700 -7.744  -3.429 1.00 18.86 ? 45  ASN A N   1 
ATOM   361  C CA  . ASN A 1 45  ? -3.402 -8.267  -3.045 1.00 21.62 ? 45  ASN A CA  1 
ATOM   362  C C   . ASN A 1 45  ? -2.335 -7.154  -3.023 1.00 15.59 ? 45  ASN A C   1 
ATOM   363  O O   . ASN A 1 45  ? -1.172 -7.397  -2.680 1.00 16.77 ? 45  ASN A O   1 
ATOM   364  C CB  . ASN A 1 45  ? -3.025 -9.329  -4.134 1.00 22.05 ? 45  ASN A CB  1 
ATOM   365  C CG  . ASN A 1 45  ? -2.384 -10.598 -3.587 1.00 37.08 ? 45  ASN A CG  1 
ATOM   366  O OD1 . ASN A 1 45  ? -1.567 -11.261 -4.279 1.00 43.68 ? 45  ASN A OD1 1 
ATOM   367  N ND2 . ASN A 1 45  ? -2.770 -10.930 -2.347 1.00 36.27 ? 45  ASN A ND2 1 
ATOM   368  N N   . LYS A 1 46  ? -2.704 -5.926  -3.414 1.00 11.96 ? 46  LYS A N   1 
ATOM   369  C CA  . LYS A 1 46  ? -1.726 -4.833  -3.432 1.00 14.13 ? 46  LYS A CA  1 
ATOM   370  C C   . LYS A 1 46  ? -1.952 -3.828  -2.325 1.00 15.19 ? 46  LYS A C   1 
ATOM   371  O O   . LYS A 1 46  ? -3.069 -3.414  -2.026 1.00 22.28 ? 46  LYS A O   1 
ATOM   372  C CB  . LYS A 1 46  ? -1.862 -4.015  -4.707 1.00 18.65 ? 46  LYS A CB  1 
ATOM   373  C CG  . LYS A 1 46  ? -1.323 -4.745  -5.905 1.00 26.56 ? 46  LYS A CG  1 
ATOM   374  C CD  . LYS A 1 46  ? -1.636 -4.092  -7.242 1.00 25.40 ? 46  LYS A CD  1 
ATOM   375  C CE  . LYS A 1 46  ? -0.705 -2.958  -7.582 1.00 26.81 ? 46  LYS A CE  1 
ATOM   376  N NZ  . LYS A 1 46  ? -0.640 -2.735  -9.032 1.00 29.53 ? 46  LYS A NZ  1 
ATOM   377  N N   . PHE A 1 47  ? -0.892 -3.388  -1.721 1.00 7.14  ? 47  PHE A N   1 
ATOM   378  C CA  . PHE A 1 47  ? -0.983 -2.424  -0.664 1.00 9.99  ? 47  PHE A CA  1 
ATOM   379  C C   . PHE A 1 47  ? -0.306 -1.109  -1.060 1.00 19.06 ? 47  PHE A C   1 
ATOM   380  O O   . PHE A 1 47  ? 0.694  -1.129  -1.803 1.00 12.96 ? 47  PHE A O   1 
ATOM   381  C CB  . PHE A 1 47  ? -0.233 -2.896  0.582  1.00 12.45 ? 47  PHE A CB  1 
ATOM   382  C CG  . PHE A 1 47  ? -0.954 -3.932  1.413  1.00 15.83 ? 47  PHE A CG  1 
ATOM   383  C CD1 . PHE A 1 47  ? -1.121 -5.227  0.919  1.00 17.06 ? 47  PHE A CD1 1 
ATOM   384  C CD2 . PHE A 1 47  ? -1.481 -3.631  2.671  1.00 19.43 ? 47  PHE A CD2 1 
ATOM   385  C CE1 . PHE A 1 47  ? -1.790 -6.175  1.693  1.00 19.68 ? 47  PHE A CE1 1 
ATOM   386  C CE2 . PHE A 1 47  ? -2.168 -4.569  3.445  1.00 18.46 ? 47  PHE A CE2 1 
ATOM   387  C CZ  . PHE A 1 47  ? -2.341 -5.853  2.935  1.00 14.86 ? 47  PHE A CZ  1 
ATOM   388  N N   . THR A 1 48  ? -0.847 0.000   -0.532 1.00 14.53 ? 48  THR A N   1 
ATOM   389  C CA  . THR A 1 48  ? -0.291 1.311   -0.749 1.00 10.27 ? 48  THR A CA  1 
ATOM   390  C C   . THR A 1 48  ? -0.054 1.886   0.620  1.00 11.26 ? 48  THR A C   1 
ATOM   391  O O   . THR A 1 48  ? -0.980 2.000   1.422  1.00 11.84 ? 48  THR A O   1 
ATOM   392  C CB  . THR A 1 48  ? -1.146 2.290   -1.548 1.00 12.51 ? 48  THR A CB  1 
ATOM   393  O OG1 . THR A 1 48  ? -1.303 1.761   -2.838 1.00 13.23 ? 48  THR A OG1 1 
ATOM   394  C CG2 . THR A 1 48  ? -0.447 3.657   -1.645 1.00 15.83 ? 48  THR A CG2 1 
ATOM   395  N N   . VAL A 1 49  ? 1.213  2.233   0.868  1.00 7.71  ? 49  VAL A N   1 
ATOM   396  C CA  . VAL A 1 49  ? 1.623  2.813   2.139  1.00 8.46  ? 49  VAL A CA  1 
ATOM   397  C C   . VAL A 1 49  ? 2.178  4.201   1.859  1.00 14.24 ? 49  VAL A C   1 
ATOM   398  O O   . VAL A 1 49  ? 3.151  4.398   1.133  1.00 12.60 ? 49  VAL A O   1 
ATOM   399  C CB  . VAL A 1 49  ? 2.681  2.046   2.920  1.00 12.39 ? 49  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 49  ? 2.933  2.683   4.285  1.00 17.52 ? 49  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 49  ? 2.321  0.570   3.111  1.00 14.80 ? 49  VAL A CG2 1 
ATOM   402  N N   . LYS A 1 50  ? 1.513  5.180   2.426  1.00 14.09 ? 50  LYS A N   1 
ATOM   403  C CA  . LYS A 1 50  ? 1.962  6.542   2.243  1.00 13.85 ? 50  LYS A CA  1 
ATOM   404  C C   . LYS A 1 50  ? 2.740  6.817   3.498  1.00 13.17 ? 50  LYS A C   1 
ATOM   405  O O   . LYS A 1 50  ? 2.201  6.796   4.609  1.00 13.54 ? 50  LYS A O   1 
ATOM   406  C CB  . LYS A 1 50  ? 0.786  7.490   2.177  1.00 14.66 ? 50  LYS A CB  1 
ATOM   407  C CG  . LYS A 1 50  ? 0.310  7.547   0.742  1.00 20.48 ? 50  LYS A CG  1 
ATOM   408  C CD  . LYS A 1 50  ? -1.093 8.076   0.642  1.00 26.86 ? 50  LYS A CD  1 
ATOM   409  C CE  . LYS A 1 50  ? -1.464 8.143   -0.821 1.00 32.27 ? 50  LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 50  ? -0.425 8.868   -1.567 1.00 36.39 ? 50  LYS A NZ  1 
ATOM   411  N N   . GLU A 1 51  ? 4.028  7.050   3.285  1.00 11.02 ? 51  GLU A N   1 
ATOM   412  C CA  . GLU A 1 51  ? 4.905  7.294   4.389  1.00 10.54 ? 51  GLU A CA  1 
ATOM   413  C C   . GLU A 1 51  ? 5.166  8.785   4.455  1.00 7.38  ? 51  GLU A C   1 
ATOM   414  O O   . GLU A 1 51  ? 5.530  9.391   3.426  1.00 12.50 ? 51  GLU A O   1 
ATOM   415  C CB  . GLU A 1 51  ? 6.188  6.475   4.084  1.00 19.93 ? 51  GLU A CB  1 
ATOM   416  C CG  . GLU A 1 51  ? 7.335  6.703   5.090  1.00 24.83 ? 51  GLU A CG  1 
ATOM   417  C CD  . GLU A 1 51  ? 8.568  5.942   4.678  1.00 26.10 ? 51  GLU A CD  1 
ATOM   418  O OE1 . GLU A 1 51  ? 8.535  4.818   4.191  1.00 19.98 ? 51  GLU A OE1 1 
ATOM   419  O OE2 . GLU A 1 51  ? 9.675  6.615   4.886  1.00 18.80 ? 51  GLU A OE2 1 
ATOM   420  N N   . SER A 1 52  ? 4.980  9.345   5.647  1.00 7.64  ? 52  SER A N   1 
ATOM   421  C CA  . SER A 1 52  ? 5.205  10.780  5.801  1.00 11.19 ? 52  SER A CA  1 
ATOM   422  C C   . SER A 1 52  ? 6.001  11.003  7.069  1.00 16.33 ? 52  SER A C   1 
ATOM   423  O O   . SER A 1 52  ? 5.653  10.505  8.155  1.00 14.87 ? 52  SER A O   1 
ATOM   424  C CB  . SER A 1 52  ? 3.845  11.474  5.845  1.00 16.95 ? 52  SER A CB  1 
ATOM   425  O OG  . SER A 1 52  ? 3.969  12.847  6.103  1.00 27.05 ? 52  SER A OG  1 
ATOM   426  N N   . SER A 1 53  ? 7.116  11.743  6.934  1.00 11.08 ? 53  SER A N   1 
ATOM   427  C CA  . SER A 1 53  ? 7.925  11.982  8.129  1.00 10.16 ? 53  SER A CA  1 
ATOM   428  C C   . SER A 1 53  ? 8.665  13.308  7.997  1.00 11.54 ? 53  SER A C   1 
ATOM   429  O O   . SER A 1 53  ? 8.547  13.945  6.947  1.00 12.31 ? 53  SER A O   1 
ATOM   430  C CB  . SER A 1 53  ? 8.966  10.883  8.353  1.00 13.86 ? 53  SER A CB  1 
ATOM   431  O OG  . SER A 1 53  ? 9.950  10.956  7.327  1.00 12.83 ? 53  SER A OG  1 
ATOM   432  N N   . ASN A 1 54  ? 9.462  13.634  9.026  1.00 9.25  ? 54  ASN A N   1 
ATOM   433  C CA  . ASN A 1 54  ? 10.240 14.872  8.951  1.00 13.71 ? 54  ASN A CA  1 
ATOM   434  C C   . ASN A 1 54  ? 11.225 14.820  7.799  1.00 18.63 ? 54  ASN A C   1 
ATOM   435  O O   . ASN A 1 54  ? 11.618 15.861  7.274  1.00 17.36 ? 54  ASN A O   1 
ATOM   436  C CB  . ASN A 1 54  ? 10.992 15.255  10.225 1.00 10.61 ? 54  ASN A CB  1 
ATOM   437  C CG  . ASN A 1 54  ? 10.143 15.613  11.414 1.00 13.86 ? 54  ASN A CG  1 
ATOM   438  O OD1 . ASN A 1 54  ? 9.017  16.089  11.257 1.00 15.15 ? 54  ASN A OD1 1 
ATOM   439  N ND2 . ASN A 1 54  ? 10.667 15.359  12.613 1.00 18.89 ? 54  ASN A ND2 1 
ATOM   440  N N   . PHE A 1 55  ? 11.618 13.608  7.384  1.00 13.09 ? 55  PHE A N   1 
ATOM   441  C CA  . PHE A 1 55  ? 12.571 13.411  6.292  1.00 12.58 ? 55  PHE A CA  1 
ATOM   442  C C   . PHE A 1 55  ? 12.011 13.463  4.889  1.00 17.30 ? 55  PHE A C   1 
ATOM   443  O O   . PHE A 1 55  ? 12.631 13.981  3.955  1.00 16.93 ? 55  PHE A O   1 
ATOM   444  C CB  . PHE A 1 55  ? 13.277 12.033  6.409  1.00 12.61 ? 55  PHE A CB  1 
ATOM   445  C CG  . PHE A 1 55  ? 14.029 11.831  7.692  1.00 18.32 ? 55  PHE A CG  1 
ATOM   446  C CD1 . PHE A 1 55  ? 15.274 12.432  7.875  1.00 30.06 ? 55  PHE A CD1 1 
ATOM   447  C CD2 . PHE A 1 55  ? 13.550 11.044  8.734  1.00 21.61 ? 55  PHE A CD2 1 
ATOM   448  C CE1 . PHE A 1 55  ? 16.008 12.272  9.048  1.00 33.67 ? 55  PHE A CE1 1 
ATOM   449  C CE2 . PHE A 1 55  ? 14.265 10.873  9.920  1.00 28.00 ? 55  PHE A CE2 1 
ATOM   450  C CZ  . PHE A 1 55  ? 15.503 11.490  10.086 1.00 32.87 ? 55  PHE A CZ  1 
ATOM   451  N N   . ARG A 1 56  ? 10.814 12.929  4.685  1.00 14.41 ? 56  ARG A N   1 
ATOM   452  C CA  . ARG A 1 56  ? 10.277 12.914  3.335  1.00 13.80 ? 56  ARG A CA  1 
ATOM   453  C C   . ARG A 1 56  ? 8.820  12.458  3.347  1.00 11.71 ? 56  ARG A C   1 
ATOM   454  O O   . ARG A 1 56  ? 8.244  12.121  4.379  1.00 15.86 ? 56  ARG A O   1 
ATOM   455  C CB  . ARG A 1 56  ? 11.039 11.899  2.473  1.00 14.54 ? 56  ARG A CB  1 
ATOM   456  C CG  . ARG A 1 56  ? 11.177 10.536  3.168  1.00 15.04 ? 56  ARG A CG  1 
ATOM   457  C CD  . ARG A 1 56  ? 11.801 9.428   2.334  1.00 15.01 ? 56  ARG A CD  1 
ATOM   458  N NE  . ARG A 1 56  ? 11.681 8.096   2.973  1.00 18.43 ? 56  ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 56  ? 12.239 6.978   2.485  1.00 16.21 ? 56  ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 56  ? 12.973 7.003   1.375  1.00 15.56 ? 56  ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 56  ? 12.073 5.807   3.118  1.00 12.43 ? 56  ARG A NH2 1 
ATOM   462  N N   . ASN A 1 57  ? 8.285  12.401  2.158  1.00 11.52 ? 57  ASN A N   1 
ATOM   463  C CA  . ASN A 1 57  ? 6.907  11.987  1.963  1.00 13.58 ? 57  ASN A CA  1 
ATOM   464  C C   . ASN A 1 57  ? 6.877  11.204  0.676  1.00 19.21 ? 57  ASN A C   1 
ATOM   465  O O   . ASN A 1 57  ? 7.022  11.769  -0.400 1.00 22.04 ? 57  ASN A O   1 
ATOM   466  C CB  . ASN A 1 57  ? 5.972  13.209  1.812  1.00 13.86 ? 57  ASN A CB  1 
ATOM   467  C CG  . ASN A 1 57  ? 5.832  13.914  3.137  1.00 23.64 ? 57  ASN A CG  1 
ATOM   468  O OD1 . ASN A 1 57  ? 6.532  14.898  3.426  1.00 35.60 ? 57  ASN A OD1 1 
ATOM   469  N ND2 . ASN A 1 57  ? 4.924  13.432  3.961  1.00 30.32 ? 57  ASN A ND2 1 
ATOM   470  N N   . ILE A 1 58  ? 6.657  9.894   0.777  1.00 14.74 ? 58  ILE A N   1 
ATOM   471  C CA  . ILE A 1 58  ? 6.634  9.086   -0.422 1.00 12.10 ? 58  ILE A CA  1 
ATOM   472  C C   . ILE A 1 58  ? 5.617  7.967   -0.308 1.00 14.16 ? 58  ILE A C   1 
ATOM   473  O O   . ILE A 1 58  ? 5.210  7.599   0.796  1.00 16.53 ? 58  ILE A O   1 
ATOM   474  C CB  . ILE A 1 58  ? 7.979  8.381   -0.551 1.00 21.67 ? 58  ILE A CB  1 
ATOM   475  C CG1 . ILE A 1 58  ? 8.254  7.521   0.680  1.00 22.19 ? 58  ILE A CG1 1 
ATOM   476  C CG2 . ILE A 1 58  ? 9.070  9.438   -0.613 1.00 24.70 ? 58  ILE A CG2 1 
ATOM   477  C CD1 . ILE A 1 58  ? 9.363  6.480   0.491  1.00 29.67 ? 58  ILE A CD1 1 
ATOM   478  N N   . ASP A 1 59  ? 5.272  7.464   -1.491 1.00 11.77 ? 59  ASP A N   1 
ATOM   479  C CA  . ASP A 1 59  ? 4.356  6.345   -1.573 1.00 13.18 ? 59  ASP A CA  1 
ATOM   480  C C   . ASP A 1 59  ? 5.167  5.056   -1.771 1.00 15.99 ? 59  ASP A C   1 
ATOM   481  O O   . ASP A 1 59  ? 6.187  5.019   -2.498 1.00 14.65 ? 59  ASP A O   1 
ATOM   482  C CB  . ASP A 1 59  ? 3.451  6.496   -2.800 1.00 16.74 ? 59  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 59  ? 2.356  7.521   -2.643 1.00 22.84 ? 59  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 59  ? 2.482  8.283   -1.582 1.00 22.36 ? 59  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 59  ? 1.447  7.604   -3.445 1.00 28.61 ? 59  ASP A OD2 1 
ATOM   486  N N   . VAL A 1 60  ? 4.722  3.999   -1.111 1.00 11.32 ? 60  VAL A N   1 
ATOM   487  C CA  . VAL A 1 60  ? 5.354  2.688   -1.243 1.00 9.90  ? 60  VAL A CA  1 
ATOM   488  C C   . VAL A 1 60  ? 4.220  1.777   -1.708 1.00 11.94 ? 60  VAL A C   1 
ATOM   489  O O   . VAL A 1 60  ? 3.201  1.642   -1.026 1.00 17.31 ? 60  VAL A O   1 
ATOM   490  C CB  . VAL A 1 60  ? 5.914  2.165   0.060  1.00 14.85 ? 60  VAL A CB  1 
ATOM   491  C CG1 . VAL A 1 60  ? 6.781  0.943   -0.217 1.00 18.58 ? 60  VAL A CG1 1 
ATOM   492  C CG2 . VAL A 1 60  ? 6.746  3.212   0.796  1.00 20.16 ? 60  VAL A CG2 1 
ATOM   493  N N   . VAL A 1 61  ? 4.361  1.160   -2.863 1.00 11.02 ? 61  VAL A N   1 
ATOM   494  C CA  . VAL A 1 61  ? 3.362  0.238   -3.360 1.00 8.98  ? 61  VAL A CA  1 
ATOM   495  C C   . VAL A 1 61  ? 3.936  -1.176  -3.495 1.00 13.44 ? 61  VAL A C   1 
ATOM   496  O O   . VAL A 1 61  ? 5.012  -1.373  -4.074 1.00 11.50 ? 61  VAL A O   1 
ATOM   497  C CB  . VAL A 1 61  ? 2.934  0.720   -4.744 1.00 15.08 ? 61  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 61  ? 1.948  -0.254  -5.396 1.00 13.97 ? 61  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 61  ? 2.356  2.129   -4.603 1.00 16.22 ? 61  VAL A CG2 1 
ATOM   500  N N   . PHE A 1 62  ? 3.262  -2.176  -2.986 1.00 10.66 ? 62  PHE A N   1 
ATOM   501  C CA  . PHE A 1 62  ? 3.711  -3.538  -3.137 1.00 13.50 ? 62  PHE A CA  1 
ATOM   502  C C   . PHE A 1 62  ? 2.584  -4.569  -3.300 1.00 15.13 ? 62  PHE A C   1 
ATOM   503  O O   . PHE A 1 62  ? 1.469  -4.367  -2.838 1.00 11.09 ? 62  PHE A O   1 
ATOM   504  C CB  . PHE A 1 62  ? 4.622  -3.963  -1.982 1.00 11.27 ? 62  PHE A CB  1 
ATOM   505  C CG  . PHE A 1 62  ? 4.052  -3.885  -0.617 1.00 6.88  ? 62  PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 62  ? 3.364  -4.988  -0.110 1.00 12.11 ? 62  PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 62  ? 4.208  -2.761  0.186  1.00 9.83  ? 62  PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 62  ? 2.871  -4.957  1.189  1.00 15.20 ? 62  PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 62  ? 3.726  -2.714  1.488  1.00 11.45 ? 62  PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 62  ? 3.045  -3.823  1.985  1.00 9.69  ? 62  PHE A CZ  1 
ATOM   511  N N   . GLU A 1 63  ? 2.871  -5.683  -3.983 1.00 11.33 ? 63  GLU A N   1 
ATOM   512  C CA  . GLU A 1 63  ? 1.933  -6.765  -4.159 1.00 7.45  ? 63  GLU A CA  1 
ATOM   513  C C   . GLU A 1 63  ? 2.446  -7.889  -3.256 1.00 12.21 ? 63  GLU A C   1 
ATOM   514  O O   . GLU A 1 63  ? 3.657  -8.179  -3.266 1.00 12.95 ? 63  GLU A O   1 
ATOM   515  C CB  . GLU A 1 63  ? 1.912  -7.231  -5.628 1.00 12.18 ? 63  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 63  ? 0.900  -8.376  -5.754 1.00 24.60 ? 63  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 63  ? 0.665  -8.842  -7.170 1.00 32.81 ? 63  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 63  ? 1.094  -8.045  -8.120 1.00 29.64 ? 63  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 63  ? 0.099  -9.899  -7.387 1.00 38.53 ? 63  GLU A OE2 1 
ATOM   520  N N   . LEU A 1 64  ? 1.603  -8.521  -2.441 1.00 10.14 ? 64  LEU A N   1 
ATOM   521  C CA  . LEU A 1 64  ? 2.088  -9.583  -1.564 1.00 11.69 ? 64  LEU A CA  1 
ATOM   522  C C   . LEU A 1 64  ? 2.860  -10.671 -2.322 1.00 13.76 ? 64  LEU A C   1 
ATOM   523  O O   . LEU A 1 64  ? 2.437  -11.075 -3.414 1.00 14.38 ? 64  LEU A O   1 
ATOM   524  C CB  . LEU A 1 64  ? 0.890  -10.231 -0.827 1.00 16.38 ? 64  LEU A CB  1 
ATOM   525  C CG  . LEU A 1 64  ? 0.205  -9.329  0.201  1.00 16.13 ? 64  LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 64  ? -0.896 -10.153 0.871  1.00 18.92 ? 64  LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 64  ? 1.206  -8.920  1.277  1.00 18.26 ? 64  LEU A CD2 1 
ATOM   528  N N   . GLY A 1 65  ? 3.995  -11.147 -1.793 1.00 11.37 ? 65  GLY A N   1 
ATOM   529  C CA  . GLY A 1 65  ? 4.723  -12.204 -2.507 1.00 13.81 ? 65  GLY A CA  1 
ATOM   530  C C   . GLY A 1 65  ? 5.531  -11.811 -3.747 1.00 17.62 ? 65  GLY A C   1 
ATOM   531  O O   . GLY A 1 65  ? 6.169  -12.650 -4.379 1.00 17.84 ? 65  GLY A O   1 
ATOM   532  N N   . VAL A 1 66  ? 5.552  -10.536 -4.153 1.00 11.82 ? 66  VAL A N   1 
ATOM   533  C CA  . VAL A 1 66  ? 6.285  -10.086 -5.317 1.00 9.54  ? 66  VAL A CA  1 
ATOM   534  C C   . VAL A 1 66  ? 7.400  -9.169  -4.823 1.00 11.45 ? 66  VAL A C   1 
ATOM   535  O O   . VAL A 1 66  ? 7.122  -8.226  -4.084 1.00 13.14 ? 66  VAL A O   1 
ATOM   536  C CB  . VAL A 1 66  ? 5.337  -9.371  -6.261 1.00 8.76  ? 66  VAL A CB  1 
ATOM   537  C CG1 . VAL A 1 66  ? 6.055  -8.931  -7.513 1.00 11.14 ? 66  VAL A CG1 1 
ATOM   538  C CG2 . VAL A 1 66  ? 4.216  -10.319 -6.676 1.00 13.00 ? 66  VAL A CG2 1 
ATOM   539  N N   . ASP A 1 67  ? 8.674  -9.391  -5.185 1.00 11.99 ? 67  ASP A N   1 
ATOM   540  C CA  . ASP A 1 67  ? 9.650  -8.480  -4.634 1.00 13.59 ? 67  ASP A CA  1 
ATOM   541  C C   . ASP A 1 67  ? 9.638  -7.117  -5.235 1.00 13.84 ? 67  ASP A C   1 
ATOM   542  O O   . ASP A 1 67  ? 9.238  -6.910  -6.368 1.00 10.30 ? 67  ASP A O   1 
ATOM   543  C CB  . ASP A 1 67  ? 11.081 -8.941  -4.433 1.00 31.21 ? 67  ASP A CB  1 
ATOM   544  C CG  . ASP A 1 67  ? 11.302 -9.941  -5.487 1.00 41.63 ? 67  ASP A CG  1 
ATOM   545  O OD1 . ASP A 1 67  ? 11.083 -9.407  -6.667 1.00 39.56 ? 67  ASP A OD1 1 
ATOM   546  O OD2 . ASP A 1 67  ? 11.606 -11.096 -5.219 1.00 46.76 ? 67  ASP A OD2 1 
ATOM   547  N N   . PHE A 1 68  ? 10.114 -6.206  -4.405 1.00 12.17 ? 68  PHE A N   1 
ATOM   548  C CA  . PHE A 1 68  ? 10.129 -4.812  -4.820 1.00 13.17 ? 68  PHE A CA  1 
ATOM   549  C C   . PHE A 1 68  ? 11.332 -4.154  -4.169 1.00 15.25 ? 68  PHE A C   1 
ATOM   550  O O   . PHE A 1 68  ? 11.954 -4.771  -3.291 1.00 15.85 ? 68  PHE A O   1 
ATOM   551  C CB  . PHE A 1 68  ? 8.777  -4.154  -4.408 1.00 8.22  ? 68  PHE A CB  1 
ATOM   552  C CG  . PHE A 1 68  ? 8.592  -4.015  -2.932 1.00 10.34 ? 68  PHE A CG  1 
ATOM   553  C CD1 . PHE A 1 68  ? 8.221  -5.082  -2.117 1.00 10.52 ? 68  PHE A CD1 1 
ATOM   554  C CD2 . PHE A 1 68  ? 8.729  -2.777  -2.303 1.00 12.32 ? 68  PHE A CD2 1 
ATOM   555  C CE1 . PHE A 1 68  ? 8.076  -4.916  -0.742 1.00 12.76 ? 68  PHE A CE1 1 
ATOM   556  C CE2 . PHE A 1 68  ? 8.587  -2.585  -0.928 1.00 8.98  ? 68  PHE A CE2 1 
ATOM   557  C CZ  . PHE A 1 68  ? 8.256  -3.678  -0.129 1.00 13.99 ? 68  PHE A CZ  1 
ATOM   558  N N   . ALA A 1 69  ? 11.660 -2.922  -4.581 1.00 13.28 ? 69  ALA A N   1 
ATOM   559  C CA  . ALA A 1 69  ? 12.807 -2.222  -3.989 1.00 13.15 ? 69  ALA A CA  1 
ATOM   560  C C   . ALA A 1 69  ? 12.359 -1.046  -3.127 1.00 13.98 ? 69  ALA A C   1 
ATOM   561  O O   . ALA A 1 69  ? 11.434 -0.316  -3.495 1.00 14.85 ? 69  ALA A O   1 
ATOM   562  C CB  . ALA A 1 69  ? 13.637 -1.668  -5.134 1.00 16.15 ? 69  ALA A CB  1 
ATOM   563  N N   . TYR A 1 70  ? 12.997 -0.829  -1.991 1.00 11.61 ? 70  TYR A N   1 
ATOM   564  C CA  . TYR A 1 70  ? 12.640 0.280   -1.148 1.00 11.14 ? 70  TYR A CA  1 
ATOM   565  C C   . TYR A 1 70  ? 13.911 0.927   -0.598 1.00 16.32 ? 70  TYR A C   1 
ATOM   566  O O   . TYR A 1 70  ? 14.835 0.243   -0.204 1.00 16.18 ? 70  TYR A O   1 
ATOM   567  C CB  . TYR A 1 70  ? 11.802 -0.254  0.019  1.00 11.94 ? 70  TYR A CB  1 
ATOM   568  C CG  . TYR A 1 70  ? 11.571 0.725   1.158  1.00 13.89 ? 70  TYR A CG  1 
ATOM   569  C CD1 . TYR A 1 70  ? 10.582 1.704   1.092  1.00 13.31 ? 70  TYR A CD1 1 
ATOM   570  C CD2 . TYR A 1 70  ? 12.324 0.632   2.328  1.00 11.12 ? 70  TYR A CD2 1 
ATOM   571  C CE1 . TYR A 1 70  ? 10.365 2.590   2.146  1.00 13.10 ? 70  TYR A CE1 1 
ATOM   572  C CE2 . TYR A 1 70  ? 12.121 1.507   3.388  1.00 12.58 ? 70  TYR A CE2 1 
ATOM   573  C CZ  . TYR A 1 70  ? 11.143 2.497   3.303  1.00 11.10 ? 70  TYR A CZ  1 
ATOM   574  O OH  . TYR A 1 70  ? 10.951 3.341   4.382  1.00 11.89 ? 70  TYR A OH  1 
ATOM   575  N N   . SER A 1 71  ? 14.000 2.248   -0.554 1.00 15.81 ? 71  SER A N   1 
ATOM   576  C CA  . SER A 1 71  ? 15.177 2.911   -0.003 1.00 15.71 ? 71  SER A CA  1 
ATOM   577  C C   . SER A 1 71  ? 14.877 3.642   1.277  1.00 14.10 ? 71  SER A C   1 
ATOM   578  O O   . SER A 1 71  ? 13.818 4.253   1.450  1.00 15.75 ? 71  SER A O   1 
ATOM   579  C CB  . SER A 1 71  ? 15.680 4.046   -0.887 1.00 27.31 ? 71  SER A CB  1 
ATOM   580  O OG  . SER A 1 71  ? 16.038 3.528   -2.149 1.00 34.95 ? 71  SER A OG  1 
ATOM   581  N N   . LEU A 1 72  ? 15.826 3.600   2.180  1.00 12.76 ? 72  LEU A N   1 
ATOM   582  C CA  . LEU A 1 72  ? 15.720 4.305   3.439  1.00 20.39 ? 72  LEU A CA  1 
ATOM   583  C C   . LEU A 1 72  ? 15.968 5.791   3.171  1.00 19.43 ? 72  LEU A C   1 
ATOM   584  O O   . LEU A 1 72  ? 16.452 6.144   2.111  1.00 17.61 ? 72  LEU A O   1 
ATOM   585  C CB  . LEU A 1 72  ? 16.781 3.859   4.445  1.00 24.58 ? 72  LEU A CB  1 
ATOM   586  C CG  . LEU A 1 72  ? 16.755 2.367   4.685  1.00 32.40 ? 72  LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 72  ? 17.587 2.083   5.940  1.00 31.83 ? 72  LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 72  ? 15.287 1.948   4.814  1.00 38.62 ? 72  LEU A CD2 1 
ATOM   589  N N   . ALA A 1 73  ? 15.628 6.636   4.140  1.00 27.46 ? 73  ALA A N   1 
ATOM   590  C CA  . ALA A 1 73  ? 15.745 8.086   4.077  1.00 26.48 ? 73  ALA A CA  1 
ATOM   591  C C   . ALA A 1 73  ? 17.149 8.521   3.725  1.00 28.45 ? 73  ALA A C   1 
ATOM   592  O O   . ALA A 1 73  ? 17.371 9.526   3.033  1.00 28.98 ? 73  ALA A O   1 
ATOM   593  C CB  . ALA A 1 73  ? 15.395 8.651   5.440  1.00 24.83 ? 73  ALA A CB  1 
ATOM   594  N N   . ASP A 1 74  ? 18.087 7.723   4.213  1.00 25.19 ? 74  ASP A N   1 
ATOM   595  C CA  . ASP A 1 74  ? 19.498 7.982   3.964  1.00 28.72 ? 74  ASP A CA  1 
ATOM   596  C C   . ASP A 1 74  ? 20.027 7.444   2.655  1.00 27.08 ? 74  ASP A C   1 
ATOM   597  O O   . ASP A 1 74  ? 21.220 7.511   2.460  1.00 29.17 ? 74  ASP A O   1 
ATOM   598  C CB  . ASP A 1 74  ? 20.455 7.470   5.065  1.00 26.60 ? 74  ASP A CB  1 
ATOM   599  C CG  . ASP A 1 74  ? 20.667 5.988   5.075  1.00 36.67 ? 74  ASP A CG  1 
ATOM   600  O OD1 . ASP A 1 74  ? 19.776 5.336   4.382  1.00 38.54 ? 74  ASP A OD1 1 
ATOM   601  O OD2 . ASP A 1 74  ? 21.562 5.418   5.682  1.00 44.07 ? 74  ASP A OD2 1 
ATOM   602  N N   . GLY A 1 75  ? 19.199 6.869   1.793  1.00 23.33 ? 75  GLY A N   1 
ATOM   603  C CA  . GLY A 1 75  ? 19.671 6.309   0.557  1.00 17.88 ? 75  GLY A CA  1 
ATOM   604  C C   . GLY A 1 75  ? 20.021 4.802   0.563  1.00 12.76 ? 75  GLY A C   1 
ATOM   605  O O   . GLY A 1 75  ? 20.196 4.284   -0.538 1.00 20.32 ? 75  GLY A O   1 
ATOM   606  N N   . THR A 1 76  ? 20.136 4.092   1.705  1.00 15.82 ? 76  THR A N   1 
ATOM   607  C CA  . THR A 1 76  ? 20.462 2.642   1.768  1.00 13.62 ? 76  THR A CA  1 
ATOM   608  C C   . THR A 1 76  ? 19.383 1.854   1.063  1.00 13.47 ? 76  THR A C   1 
ATOM   609  O O   . THR A 1 76  ? 18.189 1.984   1.400  1.00 16.89 ? 76  THR A O   1 
ATOM   610  C CB  . THR A 1 76  ? 20.515 2.196   3.222  1.00 18.26 ? 76  THR A CB  1 
ATOM   611  O OG1 . THR A 1 76  ? 21.587 2.875   3.826  1.00 24.27 ? 76  THR A OG1 1 
ATOM   612  C CG2 . THR A 1 76  ? 20.665 0.694   3.388  1.00 22.20 ? 76  THR A CG2 1 
ATOM   613  N N   . GLU A 1 77  ? 19.758 1.109   0.035  1.00 10.48 ? 77  GLU A N   1 
ATOM   614  C CA  . GLU A 1 77  ? 18.757 0.357   -0.739 1.00 13.48 ? 77  GLU A CA  1 
ATOM   615  C C   . GLU A 1 77  ? 18.489 -1.083  -0.280 1.00 18.19 ? 77  GLU A C   1 
ATOM   616  O O   . GLU A 1 77  ? 19.429 -1.803  0.066  1.00 12.95 ? 77  GLU A O   1 
ATOM   617  C CB  . GLU A 1 77  ? 19.037 0.466   -2.243 1.00 17.63 ? 77  GLU A CB  1 
ATOM   618  C CG  . GLU A 1 77  ? 18.786 1.911   -2.702 1.00 32.72 ? 77  GLU A CG  1 
ATOM   619  C CD  . GLU A 1 77  ? 19.483 2.326   -3.967 1.00 47.25 ? 77  GLU A CD  1 
ATOM   620  O OE1 . GLU A 1 77  ? 20.424 1.714   -4.480 1.00 50.33 ? 77  GLU A OE1 1 
ATOM   621  O OE2 . GLU A 1 77  ? 18.952 3.429   -4.442 1.00 50.89 ? 77  GLU A OE2 1 
ATOM   622  N N   . LEU A 1 78  ? 17.209 -1.497  -0.264 1.00 14.44 ? 78  LEU A N   1 
ATOM   623  C CA  . LEU A 1 78  ? 16.833 -2.844  0.160  1.00 11.92 ? 78  LEU A CA  1 
ATOM   624  C C   . LEU A 1 78  ? 15.967 -3.429  -0.947 1.00 13.27 ? 78  LEU A C   1 
ATOM   625  O O   . LEU A 1 78  ? 15.357 -2.699  -1.752 1.00 12.20 ? 78  LEU A O   1 
ATOM   626  C CB  . LEU A 1 78  ? 15.839 -2.808  1.378  1.00 13.27 ? 78  LEU A CB  1 
ATOM   627  C CG  . LEU A 1 78  ? 16.195 -1.917  2.555  1.00 18.64 ? 78  LEU A CG  1 
ATOM   628  C CD1 . LEU A 1 78  ? 15.151 -2.124  3.627  1.00 23.80 ? 78  LEU A CD1 1 
ATOM   629  C CD2 . LEU A 1 78  ? 17.486 -2.424  3.143  1.00 26.04 ? 78  LEU A CD2 1 
ATOM   630  N N   . THR A 1 79  ? 15.868 -4.755  -0.988 1.00 12.15 ? 79  THR A N   1 
ATOM   631  C CA  . THR A 1 79  ? 14.960 -5.403  -1.938 1.00 11.89 ? 79  THR A CA  1 
ATOM   632  C C   . THR A 1 79  ? 14.330 -6.542  -1.139 1.00 13.59 ? 79  THR A C   1 
ATOM   633  O O   . THR A 1 79  ? 14.981 -7.143  -0.267 1.00 10.70 ? 79  THR A O   1 
ATOM   634  C CB  . THR A 1 79  ? 15.514 -5.936  -3.253 1.00 17.45 ? 79  THR A CB  1 
ATOM   635  O OG1 . THR A 1 79  ? 16.582 -6.781  -2.872 1.00 22.38 ? 79  THR A OG1 1 
ATOM   636  C CG2 . THR A 1 79  ? 16.030 -4.776  -4.084 1.00 19.62 ? 79  THR A CG2 1 
ATOM   637  N N   . GLY A 1 80  ? 13.048 -6.843  -1.387 1.00 15.14 ? 80  GLY A N   1 
ATOM   638  C CA  . GLY A 1 80  ? 12.483 -7.941  -0.604 1.00 13.80 ? 80  GLY A CA  1 
ATOM   639  C C   . GLY A 1 80  ? 11.002 -8.096  -0.922 1.00 13.86 ? 80  GLY A C   1 
ATOM   640  O O   . GLY A 1 80  ? 10.503 -7.578  -1.916 1.00 13.31 ? 80  GLY A O   1 
ATOM   641  N N   . THR A 1 81  ? 10.330 -8.837  -0.044 1.00 12.96 ? 81  THR A N   1 
ATOM   642  C CA  . THR A 1 81  ? 8.904  -9.086  -0.214 1.00 17.04 ? 81  THR A CA  1 
ATOM   643  C C   . THR A 1 81  ? 8.216  -9.143  1.136  1.00 13.19 ? 81  THR A C   1 
ATOM   644  O O   . THR A 1 81  ? 8.760  -9.495  2.180  1.00 15.48 ? 81  THR A O   1 
ATOM   645  C CB  . THR A 1 81  ? 8.606  -10.484 -0.859 1.00 19.20 ? 81  THR A CB  1 
ATOM   646  O OG1 . THR A 1 81  ? 9.056  -11.432 0.079  1.00 28.35 ? 81  THR A OG1 1 
ATOM   647  C CG2 . THR A 1 81  ? 9.404  -10.717 -2.130 1.00 15.19 ? 81  THR A CG2 1 
ATOM   648  N N   . TRP A 1 82  ? 6.941  -8.816  1.082  1.00 11.83 ? 82  TRP A N   1 
ATOM   649  C CA  . TRP A 1 82  ? 6.104  -8.920  2.240  1.00 11.74 ? 82  TRP A CA  1 
ATOM   650  C C   . TRP A 1 82  ? 5.135  -10.080 1.916  1.00 10.30 ? 82  TRP A C   1 
ATOM   651  O O   . TRP A 1 82  ? 4.641  -10.230 0.774  1.00 12.54 ? 82  TRP A O   1 
ATOM   652  C CB  . TRP A 1 82  ? 5.184  -7.666  2.382  1.00 14.58 ? 82  TRP A CB  1 
ATOM   653  C CG  . TRP A 1 82  ? 5.768  -6.418  2.992  1.00 12.51 ? 82  TRP A CG  1 
ATOM   654  C CD1 . TRP A 1 82  ? 6.083  -5.278  2.325  1.00 9.61  ? 82  TRP A CD1 1 
ATOM   655  C CD2 . TRP A 1 82  ? 6.073  -6.190  4.382  1.00 8.11  ? 82  TRP A CD2 1 
ATOM   656  N NE1 . TRP A 1 82  ? 6.596  -4.387  3.244  1.00 8.53  ? 82  TRP A NE1 1 
ATOM   657  C CE2 . TRP A 1 82  ? 6.599  -4.895  4.496  1.00 7.35  ? 82  TRP A CE2 1 
ATOM   658  C CE3 . TRP A 1 82  ? 5.953  -6.957  5.540  1.00 13.87 ? 82  TRP A CE3 1 
ATOM   659  C CZ2 . TRP A 1 82  ? 6.960  -4.356  5.729  1.00 7.04  ? 82  TRP A CZ2 1 
ATOM   660  C CZ3 . TRP A 1 82  ? 6.317  -6.454  6.777  1.00 12.13 ? 82  TRP A CZ3 1 
ATOM   661  C CH2 . TRP A 1 82  ? 6.827  -5.154  6.843  1.00 7.16  ? 82  TRP A CH2 1 
ATOM   662  N N   . THR A 1 83  ? 4.796  -10.842 2.954  1.00 11.02 ? 83  THR A N   1 
ATOM   663  C CA  . THR A 1 83  ? 3.798  -11.888 2.725  1.00 16.56 ? 83  THR A CA  1 
ATOM   664  C C   . THR A 1 83  ? 2.877  -11.924 3.920  1.00 16.88 ? 83  THR A C   1 
ATOM   665  O O   . THR A 1 83  ? 3.289  -11.536 5.009  1.00 14.43 ? 83  THR A O   1 
ATOM   666  C CB  . THR A 1 83  ? 4.409  -13.292 2.573  1.00 21.94 ? 83  THR A CB  1 
ATOM   667  O OG1 . THR A 1 83  ? 5.253  -13.551 3.687  1.00 29.88 ? 83  THR A OG1 1 
ATOM   668  C CG2 . THR A 1 83  ? 5.176  -13.370 1.265  1.00 18.21 ? 83  THR A CG2 1 
ATOM   669  N N   . MET A 1 84  ? 1.635  -12.411 3.753  1.00 17.73 ? 84  MET A N   1 
ATOM   670  C CA  . MET A 1 84  ? 0.733  -12.484 4.911  1.00 15.18 ? 84  MET A CA  1 
ATOM   671  C C   . MET A 1 84  ? 0.868  -13.836 5.594  1.00 20.93 ? 84  MET A C   1 
ATOM   672  O O   . MET A 1 84  ? 0.646  -14.861 4.939  1.00 21.64 ? 84  MET A O   1 
ATOM   673  C CB  . MET A 1 84  ? -0.723 -12.287 4.483  1.00 20.68 ? 84  MET A CB  1 
ATOM   674  C CG  . MET A 1 84  ? -1.645 -12.313 5.691  1.00 31.05 ? 84  MET A CG  1 
ATOM   675  S SD  . MET A 1 84  ? -1.933 -10.681 6.427  1.00 45.74 ? 84  MET A SD  1 
ATOM   676  C CE  . MET A 1 84  ? -2.918 -9.940  5.097  1.00 36.13 ? 84  MET A CE  1 
ATOM   677  N N   . GLU A 1 85  ? 1.245  -13.830 6.871  1.00 20.61 ? 85  GLU A N   1 
ATOM   678  C CA  . GLU A 1 85  ? 1.402  -15.058 7.639  1.00 28.00 ? 85  GLU A CA  1 
ATOM   679  C C   . GLU A 1 85  ? 0.440  -15.017 8.778  1.00 37.90 ? 85  GLU A C   1 
ATOM   680  O O   . GLU A 1 85  ? 0.705  -14.307 9.743  1.00 35.05 ? 85  GLU A O   1 
ATOM   681  C CB  . GLU A 1 85  ? 2.690  -15.208 8.441  1.00 37.40 ? 85  GLU A CB  1 
ATOM   682  C CG  . GLU A 1 85  ? 3.585  -16.317 7.903  1.00 55.76 ? 85  GLU A CG  1 
ATOM   683  C CD  . GLU A 1 85  ? 4.315  -15.809 6.698  1.00 71.55 ? 85  GLU A CD  1 
ATOM   684  O OE1 . GLU A 1 85  ? 3.484  -15.493 5.732  1.00 75.79 ? 85  GLU A OE1 1 
ATOM   685  O OE2 . GLU A 1 85  ? 5.532  -15.706 6.641  1.00 76.00 ? 85  GLU A OE2 1 
ATOM   686  N N   . GLY A 1 86  ? -0.635 -15.788 8.671  1.00 41.03 ? 86  GLY A N   1 
ATOM   687  C CA  . GLY A 1 86  ? -1.612 -15.731 9.715  1.00 37.13 ? 86  GLY A CA  1 
ATOM   688  C C   . GLY A 1 86  ? -2.201 -14.343 9.558  1.00 33.94 ? 86  GLY A C   1 
ATOM   689  O O   . GLY A 1 86  ? -2.665 -13.918 8.491  1.00 32.64 ? 86  GLY A O   1 
ATOM   690  N N   . ASN A 1 87  ? -2.154 -13.633 10.672 1.00 36.07 ? 87  ASN A N   1 
ATOM   691  C CA  . ASN A 1 87  ? -2.657 -12.287 10.734 1.00 41.06 ? 87  ASN A CA  1 
ATOM   692  C C   . ASN A 1 87  ? -1.595 -11.220 10.587 1.00 32.75 ? 87  ASN A C   1 
ATOM   693  O O   . ASN A 1 87  ? -1.895 -10.033 10.593 1.00 34.62 ? 87  ASN A O   1 
ATOM   694  C CB  . ASN A 1 87  ? -3.371 -12.111 12.084 1.00 54.97 ? 87  ASN A CB  1 
ATOM   695  C CG  . ASN A 1 87  ? -4.840 -12.328 11.823 1.00 69.50 ? 87  ASN A CG  1 
ATOM   696  O OD1 . ASN A 1 87  ? -5.486 -11.515 11.128 1.00 73.37 ? 87  ASN A OD1 1 
ATOM   697  N ND2 . ASN A 1 87  ? -5.359 -13.437 12.355 1.00 74.76 ? 87  ASN A ND2 1 
ATOM   698  N N   . LYS A 1 88  ? -0.353 -11.660 10.511 1.00 29.79 ? 88  LYS A N   1 
ATOM   699  C CA  . LYS A 1 88  ? 0.772  -10.759 10.398 1.00 21.15 ? 88  LYS A CA  1 
ATOM   700  C C   . LYS A 1 88  ? 1.308  -10.619 8.995  1.00 15.57 ? 88  LYS A C   1 
ATOM   701  O O   . LYS A 1 88  ? 1.161  -11.499 8.142  1.00 19.01 ? 88  LYS A O   1 
ATOM   702  C CB  . LYS A 1 88  ? 1.981  -11.370 11.096 1.00 24.38 ? 88  LYS A CB  1 
ATOM   703  C CG  . LYS A 1 88  ? 1.815  -11.831 12.534 1.00 29.57 ? 88  LYS A CG  1 
ATOM   704  C CD  . LYS A 1 88  ? 3.033  -12.634 12.984 1.00 34.33 ? 88  LYS A CD  1 
ATOM   705  C CE  . LYS A 1 88  ? 3.254  -12.489 14.491 1.00 43.58 ? 88  LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 88  ? 4.221  -13.437 15.085 1.00 45.75 ? 88  LYS A NZ  1 
ATOM   707  N N   . LEU A 1 89  ? 2.010  -9.490  8.809  1.00 12.29 ? 89  LEU A N   1 
ATOM   708  C CA  . LEU A 1 89  ? 2.725  -9.267  7.557  1.00 9.68  ? 89  LEU A CA  1 
ATOM   709  C C   . LEU A 1 89  ? 4.196  -9.531  7.941  1.00 14.48 ? 89  LEU A C   1 
ATOM   710  O O   . LEU A 1 89  ? 4.673  -8.972  8.957  1.00 13.52 ? 89  LEU A O   1 
ATOM   711  C CB  . LEU A 1 89  ? 2.551  -7.863  6.969  1.00 13.24 ? 89  LEU A CB  1 
ATOM   712  C CG  . LEU A 1 89  ? 1.234  -7.620  6.251  1.00 23.37 ? 89  LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 89  ? 1.124  -6.128  5.905  1.00 24.92 ? 89  LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 89  ? 1.316  -8.391  4.943  1.00 28.84 ? 89  LEU A CD2 1 
ATOM   715  N N   . VAL A 1 90  ? 4.879  -10.401 7.176  1.00 12.36 ? 90  VAL A N   1 
ATOM   716  C CA  . VAL A 1 90  ? 6.268  -10.753 7.450  1.00 12.23 ? 90  VAL A CA  1 
ATOM   717  C C   . VAL A 1 90  ? 7.046  -10.282 6.254  1.00 15.08 ? 90  VAL A C   1 
ATOM   718  O O   . VAL A 1 90  ? 6.626  -10.624 5.147  1.00 13.10 ? 90  VAL A O   1 
ATOM   719  C CB  . VAL A 1 90  ? 6.397  -12.261 7.683  1.00 19.73 ? 90  VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 90  ? 7.872  -12.675 7.787  1.00 18.09 ? 90  VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 90  ? 5.667  -12.644 8.976  1.00 18.45 ? 90  VAL A CG2 1 
ATOM   722  N N   . GLY A 1 91  ? 8.079  -9.453  6.503  1.00 10.67 ? 91  GLY A N   1 
ATOM   723  C CA  . GLY A 1 91  ? 8.859  -8.899  5.433  1.00 8.05  ? 91  GLY A CA  1 
ATOM   724  C C   . GLY A 1 91  ? 10.292 -9.433  5.484  1.00 9.15  ? 91  GLY A C   1 
ATOM   725  O O   . GLY A 1 91  ? 10.970 -9.329  6.506  1.00 17.35 ? 91  GLY A O   1 
ATOM   726  N N   . LYS A 1 92  ? 10.720 -9.997  4.376  1.00 8.17  ? 92  LYS A N   1 
ATOM   727  C CA  . LYS A 1 92  ? 12.069 -10.562 4.231  1.00 11.41 ? 92  LYS A CA  1 
ATOM   728  C C   . LYS A 1 92  ? 12.811 -9.692  3.240  1.00 10.04 ? 92  LYS A C   1 
ATOM   729  O O   . LYS A 1 92  ? 12.481 -9.712  2.051  1.00 9.02  ? 92  LYS A O   1 
ATOM   730  C CB  . LYS A 1 92  ? 12.061 -12.012 3.750  1.00 20.45 ? 92  LYS A CB  1 
ATOM   731  C CG  . LYS A 1 92  ? 11.394 -12.908 4.788  1.00 33.20 ? 92  LYS A CG  1 
ATOM   732  C CD  . LYS A 1 92  ? 10.982 -14.292 4.288  1.00 46.38 ? 92  LYS A CD  1 
ATOM   733  C CE  . LYS A 1 92  ? 10.282 -15.136 5.355  1.00 56.28 ? 92  LYS A CE  1 
ATOM   734  N NZ  . LYS A 1 92  ? 10.362 -16.597 5.128  1.00 60.23 ? 92  LYS A NZ  1 
ATOM   735  N N   . PHE A 1 93  ? 13.801 -8.961  3.788  1.00 11.12 ? 93  PHE A N   1 
ATOM   736  C CA  . PHE A 1 93  ? 14.593 -8.029  2.989  1.00 10.45 ? 93  PHE A CA  1 
ATOM   737  C C   . PHE A 1 93  ? 16.107 -8.272  3.083  1.00 12.23 ? 93  PHE A C   1 
ATOM   738  O O   . PHE A 1 93  ? 16.595 -8.946  3.983  1.00 11.58 ? 93  PHE A O   1 
ATOM   739  C CB  . PHE A 1 93  ? 14.338 -6.589  3.480  1.00 11.39 ? 93  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 93  ? 12.900 -6.185  3.262  1.00 13.93 ? 93  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 93  ? 12.461 -5.796  1.998  1.00 12.92 ? 93  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 93  ? 12.022 -6.257  4.345  1.00 12.96 ? 93  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 93  ? 11.108 -5.475  1.834  1.00 20.53 ? 93  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 93  ? 10.679 -5.905  4.206  1.00 12.87 ? 93  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 93  ? 10.244 -5.532  2.932  1.00 13.44 ? 93  PHE A CZ  1 
ATOM   746  N N   . LYS A 1 94  ? 16.779 -7.666  2.117  1.00 9.91  ? 94  LYS A N   1 
ATOM   747  C CA  . LYS A 1 94  ? 18.233 -7.739  2.001  1.00 18.42 ? 94  LYS A CA  1 
ATOM   748  C C   . LYS A 1 94  ? 18.755 -6.361  1.605  1.00 17.45 ? 94  LYS A C   1 
ATOM   749  O O   . LYS A 1 94  ? 18.162 -5.734  0.727  1.00 12.21 ? 94  LYS A O   1 
ATOM   750  C CB  . LYS A 1 94  ? 18.532 -8.573  0.749  1.00 28.45 ? 94  LYS A CB  1 
ATOM   751  C CG  . LYS A 1 94  ? 19.624 -9.614  0.868  1.00 44.10 ? 94  LYS A CG  1 
ATOM   752  C CD  . LYS A 1 94  ? 19.060 -11.033 0.916  1.00 50.80 ? 94  LYS A CD  1 
ATOM   753  C CE  . LYS A 1 94  ? 19.816 -11.950 1.869  1.00 50.98 ? 94  LYS A CE  1 
ATOM   754  N NZ  . LYS A 1 94  ? 19.548 -13.370 1.605  1.00 52.49 ? 94  LYS A NZ  1 
ATOM   755  N N   . ARG A 1 95  ? 19.869 -5.921  2.209  1.00 14.42 ? 95  ARG A N   1 
ATOM   756  C CA  . ARG A 1 95  ? 20.537 -4.662  1.869  1.00 10.97 ? 95  ARG A CA  1 
ATOM   757  C C   . ARG A 1 95  ? 21.253 -4.926  0.566  1.00 13.79 ? 95  ARG A C   1 
ATOM   758  O O   . ARG A 1 95  ? 21.969 -5.910  0.510  1.00 16.70 ? 95  ARG A O   1 
ATOM   759  C CB  . ARG A 1 95  ? 21.592 -4.320  2.932  1.00 12.45 ? 95  ARG A CB  1 
ATOM   760  C CG  . ARG A 1 95  ? 20.983 -3.683  4.184  1.00 9.61  ? 95  ARG A CG  1 
ATOM   761  C CD  . ARG A 1 95  ? 21.978 -3.149  5.213  1.00 12.23 ? 95  ARG A CD  1 
ATOM   762  N NE  . ARG A 1 95  ? 22.942 -2.191  4.640  1.00 11.16 ? 95  ARG A NE  1 
ATOM   763  C CZ  . ARG A 1 95  ? 23.533 -1.222  5.370  1.00 17.38 ? 95  ARG A CZ  1 
ATOM   764  N NH1 . ARG A 1 95  ? 23.286 -1.020  6.682  1.00 16.37 ? 95  ARG A NH1 1 
ATOM   765  N NH2 . ARG A 1 95  ? 24.414 -0.425  4.735  1.00 16.82 ? 95  ARG A NH2 1 
ATOM   766  N N   . VAL A 1 96  ? 21.106 -4.144  -0.475 1.00 11.38 ? 96  VAL A N   1 
ATOM   767  C CA  . VAL A 1 96  ? 21.786 -4.465  -1.696 1.00 12.16 ? 96  VAL A CA  1 
ATOM   768  C C   . VAL A 1 96  ? 23.287 -4.227  -1.611 1.00 19.18 ? 96  VAL A C   1 
ATOM   769  O O   . VAL A 1 96  ? 24.002 -4.843  -2.382 1.00 23.18 ? 96  VAL A O   1 
ATOM   770  C CB  . VAL A 1 96  ? 21.222 -3.564  -2.778 1.00 18.77 ? 96  VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 96  ? 21.943 -3.709  -4.115 1.00 21.69 ? 96  VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 96  ? 19.730 -3.844  -2.901 1.00 18.67 ? 96  VAL A CG2 1 
ATOM   773  N N   . ASP A 1 97  ? 23.763 -3.357  -0.705 1.00 12.99 ? 97  ASP A N   1 
ATOM   774  C CA  . ASP A 1 97  ? 25.196 -3.113  -0.648 1.00 11.04 ? 97  ASP A CA  1 
ATOM   775  C C   . ASP A 1 97  ? 26.010 -4.289  -0.110 1.00 15.00 ? 97  ASP A C   1 
ATOM   776  O O   . ASP A 1 97  ? 26.913 -4.812  -0.777 1.00 16.71 ? 97  ASP A O   1 
ATOM   777  C CB  . ASP A 1 97  ? 25.503 -1.834  0.157  1.00 11.93 ? 97  ASP A CB  1 
ATOM   778  C CG  . ASP A 1 97  ? 24.900 -1.772  1.535  1.00 18.88 ? 97  ASP A CG  1 
ATOM   779  O OD1 . ASP A 1 97  ? 24.199 -2.652  1.991  1.00 18.56 ? 97  ASP A OD1 1 
ATOM   780  O OD2 . ASP A 1 97  ? 25.208 -0.673  2.205  1.00 22.63 ? 97  ASP A OD2 1 
ATOM   781  N N   . ASN A 1 98  ? 25.682 -4.657  1.126  1.00 11.94 ? 98  ASN A N   1 
ATOM   782  C CA  . ASN A 1 98  ? 26.311 -5.688  1.903  1.00 12.16 ? 98  ASN A CA  1 
ATOM   783  C C   . ASN A 1 98  ? 25.640 -7.060  1.910  1.00 16.85 ? 98  ASN A C   1 
ATOM   784  O O   . ASN A 1 98  ? 26.203 -7.987  2.514  1.00 19.05 ? 98  ASN A O   1 
ATOM   785  C CB  . ASN A 1 98  ? 26.775 -5.149  3.272  1.00 9.12  ? 98  ASN A CB  1 
ATOM   786  C CG  . ASN A 1 98  ? 25.648 -4.926  4.266  1.00 16.52 ? 98  ASN A CG  1 
ATOM   787  O OD1 . ASN A 1 98  ? 25.792 -4.279  5.329  1.00 18.82 ? 98  ASN A OD1 1 
ATOM   788  N ND2 . ASN A 1 98  ? 24.510 -5.517  3.942  1.00 11.65 ? 98  ASN A ND2 1 
ATOM   789  N N   . GLY A 1 99  ? 24.462 -7.205  1.274  1.00 11.37 ? 99  GLY A N   1 
ATOM   790  C CA  . GLY A 1 99  ? 23.779 -8.480  1.227  1.00 12.77 ? 99  GLY A CA  1 
ATOM   791  C C   . GLY A 1 99  ? 23.253 -9.044  2.542  1.00 14.88 ? 99  GLY A C   1 
ATOM   792  O O   . GLY A 1 99  ? 22.824 -10.184 2.658  1.00 14.46 ? 99  GLY A O   1 
ATOM   793  N N   . LYS A 1 100 ? 23.271 -8.252  3.583  1.00 11.02 ? 100 LYS A N   1 
ATOM   794  C CA  . LYS A 1 100 ? 22.818 -8.687  4.883  1.00 16.29 ? 100 LYS A CA  1 
ATOM   795  C C   . LYS A 1 100 ? 21.297 -8.687  4.980  1.00 16.48 ? 100 LYS A C   1 
ATOM   796  O O   . LYS A 1 100 ? 20.643 -7.910  4.323  1.00 12.71 ? 100 LYS A O   1 
ATOM   797  C CB  . LYS A 1 100 ? 23.536 -7.972  6.022  1.00 18.53 ? 100 LYS A CB  1 
ATOM   798  C CG  . LYS A 1 100 ? 24.966 -8.521  6.056  1.00 27.93 ? 100 LYS A CG  1 
ATOM   799  C CD  . LYS A 1 100 ? 26.012 -7.666  6.755  1.00 38.37 ? 100 LYS A CD  1 
ATOM   800  C CE  . LYS A 1 100 ? 27.328 -8.397  6.965  1.00 46.25 ? 100 LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 100 ? 27.190 -9.521  7.906  1.00 49.64 ? 100 LYS A NZ  1 
ATOM   802  N N   . GLU A 1 101 ? 20.776 -9.598  5.770  1.00 12.11 ? 101 GLU A N   1 
ATOM   803  C CA  . GLU A 1 101 ? 19.336 -9.764  5.924  1.00 15.76 ? 101 GLU A CA  1 
ATOM   804  C C   . GLU A 1 101 ? 18.722 -8.889  6.997  1.00 10.42 ? 101 GLU A C   1 
ATOM   805  O O   . GLU A 1 101 ? 19.231 -8.713  8.114  1.00 11.32 ? 101 GLU A O   1 
ATOM   806  C CB  . GLU A 1 101 ? 19.070 -11.266 6.204  1.00 19.68 ? 101 GLU A CB  1 
ATOM   807  C CG  . GLU A 1 101 ? 17.645 -11.629 6.635  1.00 37.03 ? 101 GLU A CG  1 
ATOM   808  C CD  . GLU A 1 101 ? 17.559 -12.996 7.261  1.00 45.35 ? 101 GLU A CD  1 
ATOM   809  O OE1 . GLU A 1 101 ? 18.038 -13.027 8.491  1.00 50.52 ? 101 GLU A OE1 1 
ATOM   810  O OE2 . GLU A 1 101 ? 17.100 -13.955 6.667  1.00 46.05 ? 101 GLU A OE2 1 
ATOM   811  N N   . LEU A 1 102 ? 17.534 -8.391  6.629  1.00 10.69 ? 102 LEU A N   1 
ATOM   812  C CA  . LEU A 1 102 ? 16.763 -7.552  7.547  1.00 10.79 ? 102 LEU A CA  1 
ATOM   813  C C   . LEU A 1 102 ? 15.327 -8.070  7.485  1.00 9.54  ? 102 LEU A C   1 
ATOM   814  O O   . LEU A 1 102 ? 14.726 -8.158  6.402  1.00 9.23  ? 102 LEU A O   1 
ATOM   815  C CB  . LEU A 1 102 ? 16.786 -6.071  7.085  1.00 15.40 ? 102 LEU A CB  1 
ATOM   816  C CG  . LEU A 1 102 ? 16.193 -5.030  8.063  1.00 21.33 ? 102 LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 102 ? 16.648 -3.626  7.642  1.00 20.23 ? 102 LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 102 ? 14.653 -5.112  7.994  1.00 19.99 ? 102 LEU A CD2 1 
ATOM   819  N N   . ILE A 1 103 ? 14.832 -8.422  8.642  1.00 9.36  ? 103 ILE A N   1 
ATOM   820  C CA  . ILE A 1 103 ? 13.456 -8.930  8.712  1.00 12.68 ? 103 ILE A CA  1 
ATOM   821  C C   . ILE A 1 103 ? 12.539 -7.904  9.360  1.00 11.37 ? 103 ILE A C   1 
ATOM   822  O O   . ILE A 1 103 ? 12.908 -7.293  10.376 1.00 13.98 ? 103 ILE A O   1 
ATOM   823  C CB  . ILE A 1 103 ? 13.435 -10.080 9.737  1.00 16.13 ? 103 ILE A CB  1 
ATOM   824  C CG1 . ILE A 1 103 ? 14.313 -11.225 9.259  1.00 17.71 ? 103 ILE A CG1 1 
ATOM   825  C CG2 . ILE A 1 103 ? 11.991 -10.593 9.879  1.00 16.39 ? 103 ILE A CG2 1 
ATOM   826  C CD1 . ILE A 1 103 ? 14.005 -11.701 7.856  1.00 16.94 ? 103 ILE A CD1 1 
ATOM   827  N N   . ALA A 1 104 ? 11.321 -7.775  8.847  1.00 10.75 ? 104 ALA A N   1 
ATOM   828  C CA  . ALA A 1 104 ? 10.400 -6.858  9.507  1.00 11.19 ? 104 ALA A CA  1 
ATOM   829  C C   . ALA A 1 104 ? 9.039  -7.542  9.662  1.00 13.81 ? 104 ALA A C   1 
ATOM   830  O O   . ALA A 1 104 ? 8.616  -8.293  8.778  1.00 11.20 ? 104 ALA A O   1 
ATOM   831  C CB  . ALA A 1 104 ? 10.232 -5.548  8.746  1.00 17.57 ? 104 ALA A CB  1 
ATOM   832  N N   . VAL A 1 105 ? 8.370  -7.221  10.753 1.00 11.27 ? 105 VAL A N   1 
ATOM   833  C CA  . VAL A 1 105 ? 7.042  -7.770  11.002 1.00 9.17  ? 105 VAL A CA  1 
ATOM   834  C C   . VAL A 1 105 ? 6.083  -6.656  11.414 1.00 12.62 ? 105 VAL A C   1 
ATOM   835  O O   . VAL A 1 105 ? 6.438  -5.786  12.204 1.00 12.78 ? 105 VAL A O   1 
ATOM   836  C CB  . VAL A 1 105 ? 7.090  -8.723  12.207 1.00 10.57 ? 105 VAL A CB  1 
ATOM   837  C CG1 . VAL A 1 105 ? 5.721  -9.365  12.503 1.00 14.67 ? 105 VAL A CG1 1 
ATOM   838  C CG2 . VAL A 1 105 ? 8.190  -9.759  12.002 1.00 14.00 ? 105 VAL A CG2 1 
ATOM   839  N N   . ARG A 1 106 ? 4.873  -6.729  10.879 1.00 12.17 ? 106 ARG A N   1 
ATOM   840  C CA  . ARG A 1 106 ? 3.819  -5.786  11.222 1.00 7.69  ? 106 ARG A CA  1 
ATOM   841  C C   . ARG A 1 106 ? 2.685  -6.625  11.807 1.00 9.50  ? 106 ARG A C   1 
ATOM   842  O O   . ARG A 1 106 ? 2.226  -7.583  11.206 1.00 12.51 ? 106 ARG A O   1 
ATOM   843  C CB  . ARG A 1 106 ? 3.223  -5.081  10.023 1.00 10.60 ? 106 ARG A CB  1 
ATOM   844  C CG  . ARG A 1 106 ? 4.082  -3.916  9.570  1.00 14.48 ? 106 ARG A CG  1 
ATOM   845  C CD  . ARG A 1 106 ? 3.468  -3.242  8.356  1.00 18.51 ? 106 ARG A CD  1 
ATOM   846  N NE  . ARG A 1 106 ? 4.193  -2.015  8.054  1.00 16.82 ? 106 ARG A NE  1 
ATOM   847  C CZ  . ARG A 1 106 ? 4.512  -1.564  6.852  1.00 16.62 ? 106 ARG A CZ  1 
ATOM   848  N NH1 . ARG A 1 106 ? 4.233  -2.269  5.751  1.00 14.65 ? 106 ARG A NH1 1 
ATOM   849  N NH2 . ARG A 1 106 ? 5.172  -0.409  6.751  1.00 20.07 ? 106 ARG A NH2 1 
ATOM   850  N N   . GLU A 1 107 ? 2.247  -6.252  12.993 1.00 9.23  ? 107 GLU A N   1 
ATOM   851  C CA  . GLU A 1 107 ? 1.144  -6.977  13.588 1.00 14.74 ? 107 GLU A CA  1 
ATOM   852  C C   . GLU A 1 107 ? 0.300  -6.019  14.441 1.00 17.12 ? 107 GLU A C   1 
ATOM   853  O O   . GLU A 1 107 ? 0.815  -5.040  14.966 1.00 15.80 ? 107 GLU A O   1 
ATOM   854  C CB  . GLU A 1 107 ? 1.736  -8.117  14.412 1.00 13.14 ? 107 GLU A CB  1 
ATOM   855  C CG  . GLU A 1 107 ? 2.241  -7.614  15.749 1.00 26.56 ? 107 GLU A CG  1 
ATOM   856  C CD  . GLU A 1 107 ? 3.023  -8.686  16.460 1.00 41.56 ? 107 GLU A CD  1 
ATOM   857  O OE1 . GLU A 1 107 ? 2.255  -9.686  16.885 1.00 40.83 ? 107 GLU A OE1 1 
ATOM   858  O OE2 . GLU A 1 107 ? 4.248  -8.578  16.592 1.00 34.93 ? 107 GLU A OE2 1 
ATOM   859  N N   . ILE A 1 108 ? -1.006 -6.278  14.566 1.00 11.72 ? 108 ILE A N   1 
ATOM   860  C CA  . ILE A 1 108 ? -1.917 -5.475  15.372 1.00 12.67 ? 108 ILE A CA  1 
ATOM   861  C C   . ILE A 1 108 ? -2.024 -6.045  16.784 1.00 14.17 ? 108 ILE A C   1 
ATOM   862  O O   . ILE A 1 108 ? -2.149 -7.246  17.049 1.00 17.79 ? 108 ILE A O   1 
ATOM   863  C CB  . ILE A 1 108 ? -3.350 -5.511  14.809 1.00 19.40 ? 108 ILE A CB  1 
ATOM   864  C CG1 . ILE A 1 108 ? -3.496 -5.309  13.305 1.00 18.17 ? 108 ILE A CG1 1 
ATOM   865  C CG2 . ILE A 1 108 ? -4.243 -4.542  15.592 1.00 20.67 ? 108 ILE A CG2 1 
ATOM   866  C CD1 . ILE A 1 108 ? -3.159 -3.874  12.943 1.00 23.03 ? 108 ILE A CD1 1 
ATOM   867  N N   . SER A 1 109 ? -2.045 -5.216  17.782 1.00 13.27 ? 109 SER A N   1 
ATOM   868  C CA  . SER A 1 109 ? -2.175 -5.682  19.131 1.00 16.40 ? 109 SER A CA  1 
ATOM   869  C C   . SER A 1 109 ? -3.169 -4.713  19.739 1.00 18.75 ? 109 SER A C   1 
ATOM   870  O O   . SER A 1 109 ? -2.828 -3.584  20.091 1.00 17.46 ? 109 SER A O   1 
ATOM   871  C CB  . SER A 1 109 ? -0.848 -5.558  19.849 1.00 24.69 ? 109 SER A CB  1 
ATOM   872  O OG  . SER A 1 109 ? -1.133 -5.397  21.217 1.00 32.66 ? 109 SER A OG  1 
ATOM   873  N N   . GLY A 1 110 ? -4.437 -5.133  19.814 1.00 26.84 ? 110 GLY A N   1 
ATOM   874  C CA  . GLY A 1 110 ? -5.461 -4.257  20.336 1.00 22.34 ? 110 GLY A CA  1 
ATOM   875  C C   . GLY A 1 110 ? -5.705 -3.206  19.263 1.00 22.86 ? 110 GLY A C   1 
ATOM   876  O O   . GLY A 1 110 ? -6.098 -3.527  18.140 1.00 27.89 ? 110 GLY A O   1 
ATOM   877  N N   . ASN A 1 111 ? -5.482 -1.937  19.600 1.00 18.05 ? 111 ASN A N   1 
ATOM   878  C CA  . ASN A 1 111 ? -5.643 -0.870  18.637 1.00 24.05 ? 111 ASN A CA  1 
ATOM   879  C C   . ASN A 1 111 ? -4.282 -0.300  18.263 1.00 21.13 ? 111 ASN A C   1 
ATOM   880  O O   . ASN A 1 111 ? -4.229 0.840   17.788 1.00 16.58 ? 111 ASN A O   1 
ATOM   881  C CB  . ASN A 1 111 ? -6.510 0.317   19.100 1.00 35.96 ? 111 ASN A CB  1 
ATOM   882  C CG  . ASN A 1 111 ? -6.110 0.907   20.453 1.00 44.27 ? 111 ASN A CG  1 
ATOM   883  O OD1 . ASN A 1 111 ? -6.835 1.777   20.972 1.00 49.49 ? 111 ASN A OD1 1 
ATOM   884  N ND2 . ASN A 1 111 ? -5.006 0.451   21.050 1.00 44.33 ? 111 ASN A ND2 1 
ATOM   885  N N   . GLU A 1 112 ? -3.202 -1.030  18.527 1.00 15.89 ? 112 GLU A N   1 
ATOM   886  C CA  . GLU A 1 112 ? -1.885 -0.502  18.159 1.00 12.22 ? 112 GLU A CA  1 
ATOM   887  C C   . GLU A 1 112 ? -1.307 -1.305  16.998 1.00 13.07 ? 112 GLU A C   1 
ATOM   888  O O   . GLU A 1 112 ? -1.609 -2.501  16.879 1.00 15.64 ? 112 GLU A O   1 
ATOM   889  C CB  . GLU A 1 112 ? -0.888 -0.590  19.348 1.00 10.52 ? 112 GLU A CB  1 
ATOM   890  C CG  . GLU A 1 112 ? -1.188 0.487   20.415 1.00 14.68 ? 112 GLU A CG  1 
ATOM   891  C CD  . GLU A 1 112 ? -0.301 0.477   21.636 1.00 19.84 ? 112 GLU A CD  1 
ATOM   892  O OE1 . GLU A 1 112 ? 0.090  -0.709  22.019 1.00 19.96 ? 112 GLU A OE1 1 
ATOM   893  O OE2 . GLU A 1 112 ? 0.014  1.498   22.227 1.00 20.28 ? 112 GLU A OE2 1 
ATOM   894  N N   . LEU A 1 113 ? -0.442 -0.699  16.171 1.00 11.46 ? 113 LEU A N   1 
ATOM   895  C CA  . LEU A 1 113 ? 0.284  -1.388  15.095 1.00 10.03 ? 113 LEU A CA  1 
ATOM   896  C C   . LEU A 1 113 ? 1.737  -1.569  15.605 1.00 17.74 ? 113 LEU A C   1 
ATOM   897  O O   . LEU A 1 113 ? 2.390  -0.590  16.023 1.00 10.16 ? 113 LEU A O   1 
ATOM   898  C CB  . LEU A 1 113 ? 0.222  -0.621  13.770 1.00 7.76  ? 113 LEU A CB  1 
ATOM   899  C CG  . LEU A 1 113 ? 1.273  -1.041  12.786 1.00 12.02 ? 113 LEU A CG  1 
ATOM   900  C CD1 . LEU A 1 113 ? 0.773  -2.357  12.238 1.00 23.87 ? 113 LEU A CD1 1 
ATOM   901  C CD2 . LEU A 1 113 ? 1.235  -0.083  11.615 1.00 17.68 ? 113 LEU A CD2 1 
ATOM   902  N N   . ILE A 1 114 ? 2.258  -2.807  15.671 1.00 16.47 ? 114 ILE A N   1 
ATOM   903  C CA  . ILE A 1 114 ? 3.607  -2.988  16.168 1.00 11.55 ? 114 ILE A CA  1 
ATOM   904  C C   . ILE A 1 114 ? 4.487  -3.382  15.016 1.00 13.28 ? 114 ILE A C   1 
ATOM   905  O O   . ILE A 1 114 ? 4.111  -4.320  14.315 1.00 13.80 ? 114 ILE A O   1 
ATOM   906  C CB  . ILE A 1 114 ? 3.697  -4.081  17.209 1.00 13.57 ? 114 ILE A CB  1 
ATOM   907  C CG1 . ILE A 1 114 ? 2.720  -3.745  18.348 1.00 15.00 ? 114 ILE A CG1 1 
ATOM   908  C CG2 . ILE A 1 114 ? 5.182  -4.237  17.621 1.00 16.87 ? 114 ILE A CG2 1 
ATOM   909  C CD1 . ILE A 1 114 ? 2.682  -4.817  19.427 1.00 19.01 ? 114 ILE A CD1 1 
ATOM   910  N N   . GLN A 1 115 ? 5.576  -2.626  14.802 1.00 9.56  ? 115 GLN A N   1 
ATOM   911  C CA  . GLN A 1 115 ? 6.486  -2.942  13.711 1.00 10.54 ? 115 GLN A CA  1 
ATOM   912  C C   . GLN A 1 115 ? 7.787  -3.387  14.346 1.00 16.58 ? 115 GLN A C   1 
ATOM   913  O O   . GLN A 1 115 ? 8.419  -2.595  15.054 1.00 12.24 ? 115 GLN A O   1 
ATOM   914  C CB  . GLN A 1 115 ? 6.840  -1.766  12.770 1.00 13.53 ? 115 GLN A CB  1 
ATOM   915  C CG  . GLN A 1 115 ? 5.731  -1.378  11.795 1.00 21.20 ? 115 GLN A CG  1 
ATOM   916  C CD  . GLN A 1 115 ? 6.158  -0.497  10.621 1.00 22.44 ? 115 GLN A CD  1 
ATOM   917  O OE1 . GLN A 1 115 ? 5.276  -0.595  9.646  1.00 20.69 ? 115 GLN A OE1 1 
ATOM   918  N NE2 . GLN A 1 115 ? 7.180  0.244   10.561 1.00 24.77 ? 115 GLN A NE2 1 
ATOM   919  N N   . THR A 1 116 ? 8.199  -4.625  14.123 1.00 10.33 ? 116 THR A N   1 
ATOM   920  C CA  . THR A 1 116 ? 9.450  -5.076  14.733 1.00 8.66  ? 116 THR A CA  1 
ATOM   921  C C   . THR A 1 116 ? 10.466 -5.294  13.613 1.00 10.14 ? 116 THR A C   1 
ATOM   922  O O   . THR A 1 116 ? 10.126 -5.770  12.512 1.00 10.46 ? 116 THR A O   1 
ATOM   923  C CB  . THR A 1 116 ? 9.211  -6.459  15.381 1.00 8.04  ? 116 THR A CB  1 
ATOM   924  O OG1 . THR A 1 116 ? 8.243  -6.288  16.379 1.00 10.25 ? 116 THR A OG1 1 
ATOM   925  C CG2 . THR A 1 116 ? 10.416 -6.956  16.168 1.00 12.05 ? 116 THR A CG2 1 
ATOM   926  N N   . TYR A 1 117 ? 11.724 -4.988  13.921 1.00 7.32  ? 117 TYR A N   1 
ATOM   927  C CA  . TYR A 1 117 ? 12.792 -5.242  12.959 1.00 12.25 ? 117 TYR A CA  1 
ATOM   928  C C   . TYR A 1 117 ? 13.930 -6.040  13.635 1.00 7.75  ? 117 TYR A C   1 
ATOM   929  O O   . TYR A 1 117 ? 14.219 -5.900  14.834 1.00 8.36  ? 117 TYR A O   1 
ATOM   930  C CB  . TYR A 1 117 ? 13.502 -3.942  12.471 1.00 15.85 ? 117 TYR A CB  1 
ATOM   931  C CG  . TYR A 1 117 ? 12.656 -2.724  12.122 1.00 17.47 ? 117 TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 117 ? 11.689 -2.802  11.115 1.00 18.82 ? 117 TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 117 ? 12.850 -1.497  12.761 1.00 19.40 ? 117 TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 117 ? 10.912 -1.694  10.766 1.00 20.64 ? 117 TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 117 ? 12.094 -0.373  12.408 1.00 21.25 ? 117 TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 117 ? 11.109 -0.476  11.420 1.00 27.25 ? 117 TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 117 ? 10.335 0.612   11.071 1.00 35.20 ? 117 TYR A OH  1 
ATOM   938  N N   . THR A 1 118 ? 14.654 -6.796  12.823 1.00 8.21  ? 118 THR A N   1 
ATOM   939  C CA  . THR A 1 118 ? 15.851 -7.464  13.324 1.00 8.98  ? 118 THR A CA  1 
ATOM   940  C C   . THR A 1 118 ? 16.945 -7.303  12.257 1.00 6.34  ? 118 THR A C   1 
ATOM   941  O O   . THR A 1 118 ? 16.716 -7.412  11.049 1.00 8.16  ? 118 THR A O   1 
ATOM   942  C CB  . THR A 1 118 ? 15.725 -8.982  13.641 1.00 16.37 ? 118 THR A CB  1 
ATOM   943  O OG1 . THR A 1 118 ? 15.283 -9.640  12.465 1.00 16.88 ? 118 THR A OG1 1 
ATOM   944  C CG2 . THR A 1 118 ? 14.744 -9.251  14.780 1.00 16.33 ? 118 THR A CG2 1 
ATOM   945  N N   . TYR A 1 119 ? 18.153 -7.076  12.754 1.00 8.03  ? 119 TYR A N   1 
ATOM   946  C CA  . TYR A 1 119 ? 19.294 -6.920  11.873 1.00 7.72  ? 119 TYR A CA  1 
ATOM   947  C C   . TYR A 1 119 ? 20.583 -7.241  12.650 1.00 7.51  ? 119 TYR A C   1 
ATOM   948  O O   . TYR A 1 119 ? 20.812 -6.682  13.739 1.00 10.53 ? 119 TYR A O   1 
ATOM   949  C CB  . TYR A 1 119 ? 19.381 -5.470  11.351 1.00 7.90  ? 119 TYR A CB  1 
ATOM   950  C CG  . TYR A 1 119 ? 20.594 -5.206  10.480 1.00 6.92  ? 119 TYR A CG  1 
ATOM   951  C CD1 . TYR A 1 119 ? 20.640 -5.630  9.149  1.00 5.12  ? 119 TYR A CD1 1 
ATOM   952  C CD2 . TYR A 1 119 ? 21.644 -4.439  10.970 1.00 7.87  ? 119 TYR A CD2 1 
ATOM   953  C CE1 . TYR A 1 119 ? 21.698 -5.397  8.268  1.00 6.76  ? 119 TYR A CE1 1 
ATOM   954  C CE2 . TYR A 1 119 ? 22.705 -4.170  10.099 1.00 11.88 ? 119 TYR A CE2 1 
ATOM   955  C CZ  . TYR A 1 119 ? 22.754 -4.657  8.790  1.00 13.18 ? 119 TYR A CZ  1 
ATOM   956  O OH  . TYR A 1 119 ? 23.818 -4.361  7.966  1.00 17.05 ? 119 TYR A OH  1 
ATOM   957  N N   . GLU A 1 120 ? 21.348 -8.205  12.119 1.00 10.12 ? 120 GLU A N   1 
ATOM   958  C CA  . GLU A 1 120 ? 22.615 -8.630  12.663 1.00 10.47 ? 120 GLU A CA  1 
ATOM   959  C C   . GLU A 1 120 ? 22.572 -8.888  14.123 1.00 11.95 ? 120 GLU A C   1 
ATOM   960  O O   . GLU A 1 120 ? 23.459 -8.474  14.846 1.00 14.05 ? 120 GLU A O   1 
ATOM   961  C CB  . GLU A 1 120 ? 23.678 -7.568  12.396 1.00 10.70 ? 120 GLU A CB  1 
ATOM   962  C CG  . GLU A 1 120 ? 24.050 -7.516  10.914 1.00 13.71 ? 120 GLU A CG  1 
ATOM   963  C CD  . GLU A 1 120 ? 24.748 -8.790  10.527 1.00 33.67 ? 120 GLU A CD  1 
ATOM   964  O OE1 . GLU A 1 120 ? 25.960 -8.852  11.040 1.00 43.02 ? 120 GLU A OE1 1 
ATOM   965  O OE2 . GLU A 1 120 ? 24.243 -9.650  9.822  1.00 36.36 ? 120 GLU A OE2 1 
ATOM   966  N N   . GLY A 1 121 ? 21.510 -9.526  14.588 1.00 11.48 ? 121 GLY A N   1 
ATOM   967  C CA  . GLY A 1 121 ? 21.446 -9.795  16.017 1.00 8.95  ? 121 GLY A CA  1 
ATOM   968  C C   . GLY A 1 121 ? 20.844 -8.733  16.929 1.00 12.06 ? 121 GLY A C   1 
ATOM   969  O O   . GLY A 1 121 ? 20.816 -8.919  18.162 1.00 12.19 ? 121 GLY A O   1 
ATOM   970  N N   . VAL A 1 122 ? 20.328 -7.635  16.341 1.00 10.11 ? 122 VAL A N   1 
ATOM   971  C CA  . VAL A 1 122 ? 19.725 -6.599  17.181 1.00 8.60  ? 122 VAL A CA  1 
ATOM   972  C C   . VAL A 1 122 ? 18.267 -6.459  16.725 1.00 8.11  ? 122 VAL A C   1 
ATOM   973  O O   . VAL A 1 122 ? 17.963 -6.526  15.516 1.00 11.21 ? 122 VAL A O   1 
ATOM   974  C CB  . VAL A 1 122 ? 20.399 -5.247  16.894 1.00 13.74 ? 122 VAL A CB  1 
ATOM   975  C CG1 . VAL A 1 122 ? 19.815 -4.180  17.813 1.00 16.69 ? 122 VAL A CG1 1 
ATOM   976  C CG2 . VAL A 1 122 ? 21.888 -5.402  17.200 1.00 18.81 ? 122 VAL A CG2 1 
ATOM   977  N N   . GLU A 1 123 ? 17.434 -6.278  17.747 1.00 9.60  ? 123 GLU A N   1 
ATOM   978  C CA  . GLU A 1 123 ? 15.990 -6.133  17.517 1.00 10.69 ? 123 GLU A CA  1 
ATOM   979  C C   . GLU A 1 123 ? 15.565 -4.713  17.898 1.00 11.76 ? 123 GLU A C   1 
ATOM   980  O O   . GLU A 1 123 ? 16.109 -4.123  18.839 1.00 15.92 ? 123 GLU A O   1 
ATOM   981  C CB  . GLU A 1 123 ? 15.281 -7.091  18.518 1.00 15.21 ? 123 GLU A CB  1 
ATOM   982  C CG  . GLU A 1 123 ? 13.737 -7.138  18.442 1.00 21.56 ? 123 GLU A CG  1 
ATOM   983  C CD  . GLU A 1 123 ? 13.095 -7.744  19.682 1.00 28.61 ? 123 GLU A CD  1 
ATOM   984  O OE1 . GLU A 1 123 ? 13.673 -8.158  20.670 1.00 27.76 ? 123 GLU A OE1 1 
ATOM   985  O OE2 . GLU A 1 123 ? 11.800 -7.801  19.606 1.00 32.99 ? 123 GLU A OE2 1 
ATOM   986  N N   . ALA A 1 124 ? 14.562 -4.180  17.203 1.00 12.45 ? 124 ALA A N   1 
ATOM   987  C CA  . ALA A 1 124 ? 14.042 -2.859  17.558 1.00 11.76 ? 124 ALA A CA  1 
ATOM   988  C C   . ALA A 1 124 ? 12.545 -2.890  17.269 1.00 14.67 ? 124 ALA A C   1 
ATOM   989  O O   . ALA A 1 124 ? 12.092 -3.651  16.413 1.00 13.04 ? 124 ALA A O   1 
ATOM   990  C CB  . ALA A 1 124 ? 14.592 -1.756  16.668 1.00 13.24 ? 124 ALA A CB  1 
ATOM   991  N N   . LYS A 1 125 ? 11.757 -2.046  17.933 1.00 12.40 ? 125 LYS A N   1 
ATOM   992  C CA  . LYS A 1 125 ? 10.337 -1.947  17.618 1.00 11.84 ? 125 LYS A CA  1 
ATOM   993  C C   . LYS A 1 125 ? 9.943  -0.461  17.561 1.00 16.64 ? 125 LYS A C   1 
ATOM   994  O O   . LYS A 1 125 ? 10.509 0.420   18.272 1.00 14.52 ? 125 LYS A O   1 
ATOM   995  C CB  . LYS A 1 125 ? 9.455  -2.470  18.732 1.00 15.91 ? 125 LYS A CB  1 
ATOM   996  C CG  . LYS A 1 125 ? 9.834  -3.838  19.238 1.00 20.01 ? 125 LYS A CG  1 
ATOM   997  C CD  . LYS A 1 125 ? 8.557  -4.537  19.660 1.00 28.68 ? 125 LYS A CD  1 
ATOM   998  C CE  . LYS A 1 125 ? 8.753  -5.454  20.852 1.00 41.14 ? 125 LYS A CE  1 
ATOM   999  N NZ  . LYS A 1 125 ? 9.794  -6.474  20.670 1.00 48.53 ? 125 LYS A NZ  1 
ATOM   1000 N N   . ARG A 1 126 ? 8.937  -0.222  16.721 1.00 10.40 ? 126 ARG A N   1 
ATOM   1001 C CA  . ARG A 1 126 ? 8.275  1.073   16.580 1.00 9.67  ? 126 ARG A CA  1 
ATOM   1002 C C   . ARG A 1 126 ? 6.790  0.777   16.784 1.00 8.76  ? 126 ARG A C   1 
ATOM   1003 O O   . ARG A 1 126 ? 6.253  -0.046  16.054 1.00 9.32  ? 126 ARG A O   1 
ATOM   1004 C CB  . ARG A 1 126 ? 8.509  1.756   15.246 1.00 12.39 ? 126 ARG A CB  1 
ATOM   1005 C CG  . ARG A 1 126 ? 10.015 1.995   15.085 1.00 13.63 ? 126 ARG A CG  1 
ATOM   1006 C CD  . ARG A 1 126 ? 10.341 3.212   14.220 1.00 15.30 ? 126 ARG A CD  1 
ATOM   1007 N NE  . ARG A 1 126 ? 10.205 4.445   14.997 1.00 14.36 ? 126 ARG A NE  1 
ATOM   1008 C CZ  . ARG A 1 126 ? 10.264 5.600   14.359 1.00 13.29 ? 126 ARG A CZ  1 
ATOM   1009 N NH1 . ARG A 1 126 ? 10.462 5.564   13.025 1.00 12.26 ? 126 ARG A NH1 1 
ATOM   1010 N NH2 . ARG A 1 126 ? 10.171 6.729   15.045 1.00 10.57 ? 126 ARG A NH2 1 
ATOM   1011 N N   . ILE A 1 127 ? 6.157  1.399   17.769 1.00 9.12  ? 127 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 127 ? 4.722  1.156   17.999 1.00 11.61 ? 127 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 127 ? 3.867  2.373   17.612 1.00 13.22 ? 127 ILE A C   1 
ATOM   1014 O O   . ILE A 1 127 ? 4.154  3.497   18.043 1.00 11.75 ? 127 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 127 ? 4.606  0.746   19.462 1.00 11.59 ? 127 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 127 ? 5.427  -0.538  19.682 1.00 16.22 ? 127 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 127 ? 3.128  0.607   19.861 1.00 11.39 ? 127 ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 127 ? 5.751  -0.849  21.139 1.00 17.82 ? 127 ILE A CD1 1 
ATOM   1019 N N   . PHE A 1 128 ? 2.802  2.202   16.816 1.00 14.85 ? 128 PHE A N   1 
ATOM   1020 C CA  . PHE A 1 128 ? 1.960  3.295   16.353 1.00 9.59  ? 128 PHE A CA  1 
ATOM   1021 C C   . PHE A 1 128 ? 0.559  3.259   16.935 1.00 16.30 ? 128 PHE A C   1 
ATOM   1022 O O   . PHE A 1 128 ? 0.087  2.155   17.244 1.00 18.79 ? 128 PHE A O   1 
ATOM   1023 C CB  . PHE A 1 128 ? 1.735  3.103   14.840 1.00 9.53  ? 128 PHE A CB  1 
ATOM   1024 C CG  . PHE A 1 128 ? 3.032  3.072   14.044 1.00 13.61 ? 128 PHE A CG  1 
ATOM   1025 C CD1 . PHE A 1 128 ? 3.934  2.000   14.116 1.00 15.26 ? 128 PHE A CD1 1 
ATOM   1026 C CD2 . PHE A 1 128 ? 3.375  4.139   13.210 1.00 13.29 ? 128 PHE A CD2 1 
ATOM   1027 C CE1 . PHE A 1 128 ? 5.132  1.995   13.383 1.00 14.67 ? 128 PHE A CE1 1 
ATOM   1028 C CE2 . PHE A 1 128 ? 4.568  4.165   12.477 1.00 13.76 ? 128 PHE A CE2 1 
ATOM   1029 C CZ  . PHE A 1 128 ? 5.452  3.082   12.565 1.00 12.49 ? 128 PHE A CZ  1 
ATOM   1030 N N   . LYS A 1 129 ? -0.084 4.429   17.077 1.00 12.95 ? 129 LYS A N   1 
ATOM   1031 C CA  . LYS A 1 129 ? -1.446 4.486   17.577 1.00 10.83 ? 129 LYS A CA  1 
ATOM   1032 C C   . LYS A 1 129 ? -2.317 4.849   16.410 1.00 10.59 ? 129 LYS A C   1 
ATOM   1033 O O   . LYS A 1 129 ? -1.883 5.559   15.523 1.00 11.54 ? 129 LYS A O   1 
ATOM   1034 C CB  . LYS A 1 129 ? -1.647 5.502   18.678 1.00 13.91 ? 129 LYS A CB  1 
ATOM   1035 C CG  . LYS A 1 129 ? -1.377 4.901   20.047 1.00 18.25 ? 129 LYS A CG  1 
ATOM   1036 C CD  . LYS A 1 129 ? -1.483 5.983   21.107 1.00 26.60 ? 129 LYS A CD  1 
ATOM   1037 C CE  . LYS A 1 129 ? -0.756 5.600   22.388 1.00 31.86 ? 129 LYS A CE  1 
ATOM   1038 N NZ  . LYS A 1 129 ? -1.196 4.290   22.907 1.00 31.75 ? 129 LYS A NZ  1 
ATOM   1039 N N   . LYS A 1 130 ? -3.538 4.331   16.379 1.00 14.97 ? 130 LYS A N   1 
ATOM   1040 C CA  . LYS A 1 130 ? -4.404 4.683   15.265 1.00 15.24 ? 130 LYS A CA  1 
ATOM   1041 C C   . LYS A 1 130 ? -4.950 6.087   15.513 1.00 20.92 ? 130 LYS A C   1 
ATOM   1042 O O   . LYS A 1 130 ? -5.267 6.465   16.640 1.00 22.55 ? 130 LYS A O   1 
ATOM   1043 C CB  . LYS A 1 130 ? -5.562 3.694   15.186 1.00 20.76 ? 130 LYS A CB  1 
ATOM   1044 C CG  . LYS A 1 130 ? -5.945 3.321   13.761 1.00 24.91 ? 130 LYS A CG  1 
ATOM   1045 C CD  . LYS A 1 130 ? -7.073 2.300   13.836 1.00 30.41 ? 130 LYS A CD  1 
ATOM   1046 C CE  . LYS A 1 130 ? -7.271 1.456   12.603 1.00 29.31 ? 130 LYS A CE  1 
ATOM   1047 N NZ  . LYS A 1 130 ? -8.013 0.244   12.987 1.00 28.00 ? 130 LYS A NZ  1 
ATOM   1048 N N   . GLU A 1 131 ? -5.039 6.890   14.453 1.00 24.47 ? 131 GLU A N   1 
ATOM   1049 C CA  . GLU A 1 131 ? -5.533 8.262   14.444 1.00 29.51 ? 131 GLU A CA  1 
ATOM   1050 C C   . GLU A 1 131 ? -7.034 8.325   14.705 1.00 42.49 ? 131 GLU A C   1 
ATOM   1051 O O   . GLU A 1 131 ? -7.630 9.397   14.419 1.00 52.61 ? 131 GLU A O   1 
ATOM   1052 C CB  . GLU A 1 131 ? -5.318 8.879   13.044 1.00 33.32 ? 131 GLU A CB  1 
ATOM   1053 C CG  . GLU A 1 131 ? -5.456 10.407  12.981 1.00 51.67 ? 131 GLU A CG  1 
ATOM   1054 C CD  . GLU A 1 131 ? -4.126 11.096  13.091 1.00 67.04 ? 131 GLU A CD  1 
ATOM   1055 O OE1 . GLU A 1 131 ? -3.392 10.562  14.038 1.00 67.61 ? 131 GLU A OE1 1 
ATOM   1056 O OE2 . GLU A 1 131 ? -3.787 12.028  12.367 1.00 73.69 ? 131 GLU A OE2 1 
ATOM   1057 O OXT . GLU A 1 131 ? -7.609 7.315   15.170 1.00 45.67 ? 131 GLU A OXT 1 
HETATM 1058 C C1  . MYR B 2 .   ? 6.748  -0.653  3.744  1.00 27.61 ? 133 MYR A C1  1 
HETATM 1059 O O1  . MYR B 2 .   ? 6.245  0.389   4.316  1.00 24.74 ? 133 MYR A O1  1 
HETATM 1060 O O2  . MYR B 2 .   ? 6.160  -1.704  3.756  1.00 28.44 ? 133 MYR A O2  1 
HETATM 1061 C C2  . MYR B 2 .   ? 8.095  -0.440  3.061  1.00 24.53 ? 133 MYR A C2  1 
HETATM 1062 C C3  . MYR B 2 .   ? 9.236  -1.264  3.627  1.00 27.21 ? 133 MYR A C3  1 
HETATM 1063 C C4  . MYR B 2 .   ? 9.578  -0.958  5.081  1.00 29.37 ? 133 MYR A C4  1 
HETATM 1064 C C5  . MYR B 2 .   ? 10.773 -1.735  5.635  1.00 28.92 ? 133 MYR A C5  1 
HETATM 1065 C C6  . MYR B 2 .   ? 11.280 -1.093  6.928  1.00 31.92 ? 133 MYR A C6  1 
HETATM 1066 C C7  . MYR B 2 .   ? 12.782 -1.170  7.157  1.00 31.57 ? 133 MYR A C7  1 
HETATM 1067 C C8  . MYR B 2 .   ? 13.305 0.171   7.667  1.00 30.64 ? 133 MYR A C8  1 
HETATM 1068 C C9  . MYR B 2 .   ? 14.245 0.011   8.840  1.00 32.29 ? 133 MYR A C9  1 
HETATM 1069 C C10 . MYR B 2 .   ? 14.363 1.259   9.699  1.00 36.89 ? 133 MYR A C10 1 
HETATM 1070 C C11 . MYR B 2 .   ? 15.566 2.088   9.297  1.00 43.89 ? 133 MYR A C11 1 
HETATM 1071 C C12 . MYR B 2 .   ? 15.613 3.507   9.835  1.00 48.14 ? 133 MYR A C12 1 
HETATM 1072 C C13 . MYR B 2 .   ? 16.815 4.232   9.253  1.00 56.15 ? 133 MYR A C13 1 
HETATM 1073 C C14 . MYR B 2 .   ? 17.118 5.584   9.876  1.00 62.28 ? 133 MYR A C14 1 
HETATM 1074 O O   . HOH C 3 .   ? 5.949  -7.863  -1.586 1.00 15.91 ? 134 HOH A O   1 
HETATM 1075 O O   . HOH C 3 .   ? 26.677 4.305   12.918 1.00 74.29 ? 135 HOH A O   1 
HETATM 1076 O O   . HOH C 3 .   ? 16.550 -11.940 3.105  1.00 44.09 ? 136 HOH A O   1 
HETATM 1077 O O   . HOH C 3 .   ? 5.559  -5.817  -5.065 1.00 13.20 ? 137 HOH A O   1 
HETATM 1078 O O   . HOH C 3 .   ? -7.291 -2.854  12.959 1.00 40.22 ? 138 HOH A O   1 
HETATM 1079 O O   . HOH C 3 .   ? 8.002  2.171   8.199  1.00 31.71 ? 139 HOH A O   1 
HETATM 1080 O O   . HOH C 3 .   ? -2.671 -14.602 13.424 1.00 60.70 ? 140 HOH A O   1 
HETATM 1081 O O   . HOH C 3 .   ? 8.422  10.941  16.319 1.00 21.40 ? 141 HOH A O   1 
HETATM 1082 O O   . HOH C 3 .   ? 5.674  -1.735  -6.695 1.00 27.91 ? 142 HOH A O   1 
HETATM 1083 O O   . HOH C 3 .   ? 25.641 -2.315  8.828  1.00 19.39 ? 143 HOH A O   1 
HETATM 1084 O O   . HOH C 3 .   ? 13.451 14.251  12.383 1.00 20.15 ? 144 HOH A O   1 
HETATM 1085 O O   . HOH C 3 .   ? 15.641 15.147  18.008 1.00 18.03 ? 145 HOH A O   1 
HETATM 1086 O O   . HOH C 3 .   ? 17.026 15.328  20.484 1.00 18.91 ? 146 HOH A O   1 
HETATM 1087 O O   . HOH C 3 .   ? 3.407  10.490  1.859  1.00 28.63 ? 147 HOH A O   1 
HETATM 1088 O O   . HOH C 3 .   ? 0.758  9.314   5.654  1.00 20.29 ? 148 HOH A O   1 
HETATM 1089 O O   . HOH C 3 .   ? -2.706 4.688   1.419  1.00 15.36 ? 149 HOH A O   1 
HETATM 1090 O O   . HOH C 3 .   ? -3.188 -0.244  -3.162 1.00 21.33 ? 150 HOH A O   1 
HETATM 1091 O O   . HOH C 3 .   ? -5.538 -8.179  7.459  1.00 47.84 ? 151 HOH A O   1 
HETATM 1092 O O   . HOH C 3 .   ? 9.746  13.841  0.063  1.00 27.52 ? 152 HOH A O   1 
HETATM 1093 O O   . HOH C 3 .   ? 13.305 9.241   -0.576 1.00 40.46 ? 153 HOH A O   1 
HETATM 1094 O O   . HOH C 3 .   ? 0.299  10.894  4.043  1.00 57.10 ? 154 HOH A O   1 
HETATM 1095 O O   . HOH C 3 .   ? 14.546 -9.604  -4.335 1.00 30.50 ? 155 HOH A O   1 
HETATM 1096 O O   . HOH C 3 .   ? 9.448  1.481   -2.353 1.00 21.31 ? 156 HOH A O   1 
HETATM 1097 O O   . HOH C 3 .   ? 8.007  -12.292 2.882  1.00 21.86 ? 157 HOH A O   1 
HETATM 1098 O O   . HOH C 3 .   ? 5.766  -6.749  15.130 1.00 15.98 ? 158 HOH A O   1 
HETATM 1099 O O   . HOH C 3 .   ? 28.077 -0.088  2.539  1.00 21.03 ? 159 HOH A O   1 
HETATM 1100 O O   . HOH C 3 .   ? 9.141  2.321   24.930 1.00 33.87 ? 160 HOH A O   1 
HETATM 1101 O O   . HOH C 3 .   ? 4.251  13.230  9.586  1.00 32.59 ? 161 HOH A O   1 
HETATM 1102 O O   . HOH C 3 .   ? 12.584 -11.054 -2.347 1.00 45.19 ? 162 HOH A O   1 
HETATM 1103 O O   . HOH C 3 .   ? 20.863 -9.748  9.567  1.00 16.79 ? 163 HOH A O   1 
HETATM 1104 O O   . HOH C 3 .   ? -8.059 5.486   17.823 1.00 38.74 ? 164 HOH A O   1 
HETATM 1105 O O   . HOH C 3 .   ? 0.722  -13.722 1.299  1.00 22.12 ? 165 HOH A O   1 
HETATM 1106 O O   . HOH C 3 .   ? 18.634 -6.542  20.575 1.00 27.63 ? 166 HOH A O   1 
HETATM 1107 O O   . HOH C 3 .   ? 11.311 3.326   11.005 1.00 18.40 ? 167 HOH A O   1 
HETATM 1108 O O   . HOH C 3 .   ? 13.261 4.761   5.930  1.00 43.51 ? 168 HOH A O   1 
HETATM 1109 O O   . HOH C 3 .   ? 12.738 4.471   24.020 1.00 48.48 ? 169 HOH A O   1 
HETATM 1110 O O   . HOH C 3 .   ? 7.160  2.720   5.468  1.00 28.66 ? 170 HOH A O   1 
HETATM 1111 O O   . HOH C 3 .   ? 5.008  13.541  17.156 1.00 80.00 ? 172 HOH A O   1 
HETATM 1112 O O   . HOH C 3 .   ? 22.356 -1.461  0.472  1.00 31.67 ? 173 HOH A O   1 
HETATM 1113 O O   . HOH C 3 .   ? 21.573 -7.661  -2.297 1.00 54.97 ? 174 HOH A O   1 
HETATM 1114 O O   . HOH C 3 .   ? 11.939 4.196   -1.617 1.00 35.34 ? 175 HOH A O   1 
HETATM 1115 O O   . HOH C 3 .   ? 9.379  5.009   -4.927 1.00 35.12 ? 176 HOH A O   1 
HETATM 1116 O O   . HOH C 3 .   ? -9.336 -3.864  19.603 1.00 45.28 ? 177 HOH A O   1 
HETATM 1117 O O   . HOH C 3 .   ? 23.210 -12.178 0.368  1.00 29.44 ? 178 HOH A O   1 
HETATM 1118 O O   . HOH C 3 .   ? -5.027 1.259   -2.218 1.00 38.64 ? 179 HOH A O   1 
HETATM 1119 O O   . HOH C 3 .   ? 26.895 12.847  13.393 1.00 41.60 ? 180 HOH A O   1 
HETATM 1120 O O   . HOH C 3 .   ? 8.871  3.797   -2.869 1.00 31.27 ? 181 HOH A O   1 
HETATM 1121 O O   . HOH C 3 .   ? -2.010 -8.878  13.289 1.00 19.39 ? 182 HOH A O   1 
HETATM 1122 O O   . HOH C 3 .   ? 13.682 7.014   11.650 1.00 13.07 ? 183 HOH A O   1 
HETATM 1123 O O   . HOH C 3 .   ? 10.838 8.516   6.374  1.00 31.14 ? 184 HOH A O   1 
HETATM 1124 O O   . HOH C 3 .   ? 23.033 0.233   -3.027 1.00 49.51 ? 185 HOH A O   1 
HETATM 1125 O O   . HOH C 3 .   ? 26.567 6.040   7.296  1.00 79.60 ? 186 HOH A O   1 
HETATM 1126 O O   . HOH C 3 .   ? 23.939 6.558   6.868  1.00 51.42 ? 187 HOH A O   1 
HETATM 1127 O O   . HOH C 3 .   ? -7.800 -4.434  16.917 1.00 44.64 ? 188 HOH A O   1 
HETATM 1128 O O   . HOH C 3 .   ? -5.531 11.293  7.066  1.00 59.94 ? 189 HOH A O   1 
HETATM 1129 O O   . HOH C 3 .   ? 12.627 2.864   -3.983 1.00 73.29 ? 190 HOH A O   1 
HETATM 1130 O O   . HOH C 3 .   ? 3.896  10.045  21.330 1.00 50.54 ? 191 HOH A O   1 
HETATM 1131 O O   . HOH C 3 .   ? 9.787  6.113   22.636 1.00 31.05 ? 192 HOH A O   1 
HETATM 1132 O O   . HOH C 3 .   ? 10.519 3.642   8.494  1.00 27.81 ? 193 HOH A O   1 
HETATM 1133 O O   . HOH C 3 .   ? 7.174  0.187   24.587 1.00 29.33 ? 194 HOH A O   1 
HETATM 1134 O O   . HOH C 3 .   ? 15.062 4.461   21.387 1.00 21.57 ? 195 HOH A O   1 
HETATM 1135 O O   . HOH C 3 .   ? 18.436 2.155   21.787 1.00 26.66 ? 196 HOH A O   1 
HETATM 1136 O O   . HOH C 3 .   ? 22.835 6.450   19.820 1.00 33.65 ? 197 HOH A O   1 
HETATM 1137 O O   . HOH C 3 .   ? 23.615 3.513   19.783 1.00 44.46 ? 198 HOH A O   1 
HETATM 1138 O O   . HOH C 3 .   ? 25.749 -1.943  -4.515 1.00 51.24 ? 199 HOH A O   1 
HETATM 1139 O O   . HOH C 3 .   ? 8.538  16.011  0.274  1.00 52.23 ? 200 HOH A O   1 
HETATM 1140 O O   . HOH C 3 .   ? 7.091  16.157  9.838  1.00 65.57 ? 201 HOH A O   1 
HETATM 1141 O O   . HOH C 3 .   ? 22.442 1.254   -0.840 1.00 41.08 ? 202 HOH A O   1 
HETATM 1142 O O   . HOH C 3 .   ? 26.404 2.766   -0.654 1.00 48.65 ? 203 HOH A O   1 
HETATM 1143 O O   . HOH C 3 .   ? 22.058 -11.893 7.151  1.00 43.00 ? 204 HOH A O   1 
HETATM 1144 O O   . HOH C 3 .   ? -4.607 3.554   18.908 1.00 28.62 ? 205 HOH A O   1 
HETATM 1145 O O   . HOH C 3 .   ? 14.935 -10.764 0.717  1.00 46.08 ? 206 HOH A O   1 
HETATM 1146 O O   . HOH C 3 .   ? 9.810  -8.356  -8.818 1.00 41.63 ? 207 HOH A O   1 
HETATM 1147 O O   . HOH C 3 .   ? 6.410  8.733   -4.121 1.00 27.79 ? 208 HOH A O   1 
HETATM 1148 O O   . HOH C 3 .   ? 24.674 8.620   9.363  1.00 47.59 ? 209 HOH A O   1 
HETATM 1149 O O   . HOH C 3 .   ? 9.386  8.418   17.725 1.00 29.08 ? 210 HOH A O   1 
HETATM 1150 O O   . HOH C 3 .   ? -7.872 -0.787  10.901 1.00 32.24 ? 211 HOH A O   1 
HETATM 1151 O O   . HOH C 3 .   ? -5.698 -4.543  5.518  1.00 44.04 ? 212 HOH A O   1 
HETATM 1152 O O   . HOH C 3 .   ? -4.906 -5.123  -7.035 1.00 51.54 ? 213 HOH A O   1 
HETATM 1153 O O   . HOH C 3 .   ? 13.205 -4.807  -6.811 1.00 46.50 ? 214 HOH A O   1 
HETATM 1154 O O   . HOH C 3 .   ? 19.048 -14.209 4.156  1.00 45.56 ? 215 HOH A O   1 
HETATM 1155 O O   . HOH C 3 .   ? 17.470 -0.404  -5.786 1.00 65.00 ? 216 HOH A O   1 
HETATM 1156 O O   . HOH C 3 .   ? 1.535  -14.017 -1.019 1.00 39.11 ? 217 HOH A O   1 
HETATM 1157 O O   . HOH C 3 .   ? 14.775 1.156   23.926 1.00 34.20 ? 218 HOH A O   1 
HETATM 1158 O O   . HOH C 3 .   ? 25.755 -10.525 14.730 1.00 71.43 ? 219 HOH A O   1 
HETATM 1159 O O   . HOH C 3 .   ? 7.111  9.832   19.286 1.00 54.08 ? 220 HOH A O   1 
HETATM 1160 O O   . HOH C 3 .   ? -1.759 -12.883 -1.362 1.00 51.46 ? 221 HOH A O   1 
HETATM 1161 O O   . HOH C 3 .   ? -5.649 -7.485  4.955  1.00 36.17 ? 222 HOH A O   1 
HETATM 1162 O O   . HOH C 3 .   ? 1.002  5.615   -5.263 1.00 41.57 ? 223 HOH A O   1 
HETATM 1163 O O   . HOH C 3 .   ? 11.307 7.760   9.051  1.00 26.15 ? 224 HOH A O   1 
HETATM 1164 O O   . HOH C 3 .   ? 14.655 11.603  1.227  1.00 45.69 ? 225 HOH A O   1 
HETATM 1165 O O   . HOH C 3 .   ? 5.572  -15.907 14.076 1.00 45.95 ? 226 HOH A O   1 
HETATM 1166 O O   . HOH C 3 .   ? 25.072 -13.136 3.527  1.00 68.75 ? 227 HOH A O   1 
HETATM 1167 O O   . HOH C 3 .   ? 27.757 -9.966  10.162 1.00 62.42 ? 228 HOH A O   1 
HETATM 1168 O O   . HOH C 3 .   ? 7.414  -8.780  18.014 1.00 39.74 ? 229 HOH A O   1 
HETATM 1169 O O   . HOH C 3 .   ? -0.371 -8.495  19.704 1.00 58.84 ? 230 HOH A O   1 
HETATM 1170 O O   . HOH C 3 .   ? 15.416 -3.087  23.737 1.00 60.65 ? 231 HOH A O   1 
HETATM 1171 O O   . HOH C 3 .   ? 13.158 -4.180  21.488 1.00 35.33 ? 232 HOH A O   1 
HETATM 1172 O O   . HOH C 3 .   ? 2.627  -5.283  22.557 1.00 51.62 ? 233 HOH A O   1 
HETATM 1173 O O   . HOH C 3 .   ? 11.386 -7.733  22.671 1.00 46.09 ? 234 HOH A O   1 
HETATM 1174 O O   . HOH C 3 .   ? -5.576 5.212   21.063 1.00 48.58 ? 235 HOH A O   1 
HETATM 1175 O O   . HOH C 3 .   ? 6.960  0.715   -4.405 1.00 25.60 ? 236 HOH A O   1 
HETATM 1176 O O   . HOH C 3 .   ? 13.121 6.859   20.796 1.00 48.40 ? 237 HOH A O   1 
HETATM 1177 O O   . HOH C 3 .   ? 10.087 18.793  6.201  1.00 55.38 ? 238 HOH A O   1 
HETATM 1178 O O   . HOH C 3 .   ? 8.986  -12.401 -7.711 1.00 60.48 ? 239 HOH A O   1 
HETATM 1179 O O   . HOH C 3 .   ? 10.702 -17.467 8.082  1.00 65.21 ? 240 HOH A O   1 
HETATM 1180 O O   . HOH C 3 .   ? 6.902  -17.379 3.033  1.00 58.80 ? 241 HOH A O   1 
HETATM 1181 O O   . HOH C 3 .   ? 24.987 1.969   6.802  1.00 74.17 ? 242 HOH A O   1 
HETATM 1182 O O   . HOH C 3 .   ? -1.460 2.854   -5.468 1.00 60.40 ? 243 HOH A O   1 
HETATM 1183 O O   . HOH C 3 .   ? -3.374 -0.161  -6.308 1.00 78.20 ? 244 HOH A O   1 
HETATM 1184 O O   . HOH C 3 .   ? -7.502 -1.968  15.073 1.00 48.86 ? 245 HOH A O   1 
HETATM 1185 O O   . HOH C 3 .   ? 5.629  -7.324  20.308 1.00 48.07 ? 246 HOH A O   1 
HETATM 1186 O O   . HOH C 3 .   ? 25.042 14.525  9.979  1.00 60.98 ? 247 HOH A O   1 
HETATM 1187 O O   . HOH C 3 .   ? 26.044 -11.209 12.565 1.00 36.14 ? 248 HOH A O   1 
HETATM 1188 O O   . HOH C 3 .   ? 28.724 9.739   10.055 1.00 43.23 ? 249 HOH A O   1 
HETATM 1189 O O   . HOH C 3 .   ? 0.179  -11.111 16.042 1.00 42.71 ? 250 HOH A O   1 
HETATM 1190 O O   . HOH C 3 .   ? -0.418 -12.038 18.370 1.00 47.97 ? 251 HOH A O   1 
HETATM 1191 O O   . HOH C 3 .   ? 21.201 -7.940  20.339 1.00 35.30 ? 252 HOH A O   1 
HETATM 1192 O O   . HOH C 3 .   ? 28.534 5.859   10.829 1.00 30.78 ? 253 HOH A O   1 
HETATM 1193 O O   . HOH C 3 .   ? 5.555  4.487   26.465 1.00 59.01 ? 254 HOH A O   1 
HETATM 1194 O O   . HOH C 3 .   ? 21.977 -3.677  24.143 1.00 50.30 ? 255 HOH A O   1 
HETATM 1195 O O   . HOH C 3 .   ? 22.969 -3.967  20.937 1.00 52.70 ? 256 HOH A O   1 
HETATM 1196 O O   . HOH C 3 .   ? -6.999 12.495  14.003 1.00 59.49 ? 257 HOH A O   1 
HETATM 1197 O O   . HOH C 3 .   ? 2.587  5.730   25.257 1.00 36.33 ? 258 HOH A O   1 
HETATM 1198 O O   . HOH C 3 .   ? 16.373 9.195   23.696 1.00 51.64 ? 259 HOH A O   1 
HETATM 1199 O O   . HOH C 3 .   ? 16.403 7.900   0.113  1.00 60.89 ? 260 HOH A O   1 
HETATM 1200 O O   . HOH C 3 .   ? -5.353 14.717  11.247 1.00 71.32 ? 261 HOH A O   1 
HETATM 1201 O O   . HOH C 3 .   ? -4.710 6.962   0.481  1.00 62.46 ? 262 HOH A O   1 
HETATM 1202 O O   . HOH C 3 .   ? -5.424 -8.340  10.269 1.00 75.32 ? 263 HOH A O   1 
HETATM 1203 O O   . HOH C 3 .   ? 14.019 -9.044  24.294 1.00 64.34 ? 264 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  HIS 33  33  33  HIS HIS A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  MET 84  84  84  MET MET A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MYR 1   133 133 MYR MYR A . 
C 3 HOH 1   134 134 HOH HOH A . 
C 3 HOH 2   135 135 HOH HOH A . 
C 3 HOH 3   136 136 HOH HOH A . 
C 3 HOH 4   137 137 HOH HOH A . 
C 3 HOH 5   138 138 HOH HOH A . 
C 3 HOH 6   139 139 HOH HOH A . 
C 3 HOH 7   140 140 HOH HOH A . 
C 3 HOH 8   141 141 HOH HOH A . 
C 3 HOH 9   142 142 HOH HOH A . 
C 3 HOH 10  143 143 HOH HOH A . 
C 3 HOH 11  144 144 HOH HOH A . 
C 3 HOH 12  145 145 HOH HOH A . 
C 3 HOH 13  146 146 HOH HOH A . 
C 3 HOH 14  147 147 HOH HOH A . 
C 3 HOH 15  148 148 HOH HOH A . 
C 3 HOH 16  149 149 HOH HOH A . 
C 3 HOH 17  150 150 HOH HOH A . 
C 3 HOH 18  151 151 HOH HOH A . 
C 3 HOH 19  152 152 HOH HOH A . 
C 3 HOH 20  153 153 HOH HOH A . 
C 3 HOH 21  154 154 HOH HOH A . 
C 3 HOH 22  155 155 HOH HOH A . 
C 3 HOH 23  156 156 HOH HOH A . 
C 3 HOH 24  157 157 HOH HOH A . 
C 3 HOH 25  158 158 HOH HOH A . 
C 3 HOH 26  159 159 HOH HOH A . 
C 3 HOH 27  160 160 HOH HOH A . 
C 3 HOH 28  161 161 HOH HOH A . 
C 3 HOH 29  162 162 HOH HOH A . 
C 3 HOH 30  163 163 HOH HOH A . 
C 3 HOH 31  164 164 HOH HOH A . 
C 3 HOH 32  165 165 HOH HOH A . 
C 3 HOH 33  166 166 HOH HOH A . 
C 3 HOH 34  167 167 HOH HOH A . 
C 3 HOH 35  168 168 HOH HOH A . 
C 3 HOH 36  169 169 HOH HOH A . 
C 3 HOH 37  170 170 HOH HOH A . 
C 3 HOH 38  172 172 HOH HOH A . 
C 3 HOH 39  173 173 HOH HOH A . 
C 3 HOH 40  174 174 HOH HOH A . 
C 3 HOH 41  175 175 HOH HOH A . 
C 3 HOH 42  176 176 HOH HOH A . 
C 3 HOH 43  177 177 HOH HOH A . 
C 3 HOH 44  178 178 HOH HOH A . 
C 3 HOH 45  179 179 HOH HOH A . 
C 3 HOH 46  180 180 HOH HOH A . 
C 3 HOH 47  181 181 HOH HOH A . 
C 3 HOH 48  182 182 HOH HOH A . 
C 3 HOH 49  183 183 HOH HOH A . 
C 3 HOH 50  184 184 HOH HOH A . 
C 3 HOH 51  185 185 HOH HOH A . 
C 3 HOH 52  186 186 HOH HOH A . 
C 3 HOH 53  187 187 HOH HOH A . 
C 3 HOH 54  188 188 HOH HOH A . 
C 3 HOH 55  189 189 HOH HOH A . 
C 3 HOH 56  190 190 HOH HOH A . 
C 3 HOH 57  191 191 HOH HOH A . 
C 3 HOH 58  192 192 HOH HOH A . 
C 3 HOH 59  193 193 HOH HOH A . 
C 3 HOH 60  194 194 HOH HOH A . 
C 3 HOH 61  195 195 HOH HOH A . 
C 3 HOH 62  196 196 HOH HOH A . 
C 3 HOH 63  197 197 HOH HOH A . 
C 3 HOH 64  198 198 HOH HOH A . 
C 3 HOH 65  199 199 HOH HOH A . 
C 3 HOH 66  200 200 HOH HOH A . 
C 3 HOH 67  201 201 HOH HOH A . 
C 3 HOH 68  202 202 HOH HOH A . 
C 3 HOH 69  203 203 HOH HOH A . 
C 3 HOH 70  204 204 HOH HOH A . 
C 3 HOH 71  205 205 HOH HOH A . 
C 3 HOH 72  206 206 HOH HOH A . 
C 3 HOH 73  207 207 HOH HOH A . 
C 3 HOH 74  208 208 HOH HOH A . 
C 3 HOH 75  209 209 HOH HOH A . 
C 3 HOH 76  210 210 HOH HOH A . 
C 3 HOH 77  211 211 HOH HOH A . 
C 3 HOH 78  212 212 HOH HOH A . 
C 3 HOH 79  213 213 HOH HOH A . 
C 3 HOH 80  214 214 HOH HOH A . 
C 3 HOH 81  215 215 HOH HOH A . 
C 3 HOH 82  216 216 HOH HOH A . 
C 3 HOH 83  217 217 HOH HOH A . 
C 3 HOH 84  218 218 HOH HOH A . 
C 3 HOH 85  219 219 HOH HOH A . 
C 3 HOH 86  220 220 HOH HOH A . 
C 3 HOH 87  221 221 HOH HOH A . 
C 3 HOH 88  222 222 HOH HOH A . 
C 3 HOH 89  223 223 HOH HOH A . 
C 3 HOH 90  224 224 HOH HOH A . 
C 3 HOH 91  225 225 HOH HOH A . 
C 3 HOH 92  226 226 HOH HOH A . 
C 3 HOH 93  227 227 HOH HOH A . 
C 3 HOH 94  228 228 HOH HOH A . 
C 3 HOH 95  229 229 HOH HOH A . 
C 3 HOH 96  230 230 HOH HOH A . 
C 3 HOH 97  231 231 HOH HOH A . 
C 3 HOH 98  232 232 HOH HOH A . 
C 3 HOH 99  233 233 HOH HOH A . 
C 3 HOH 100 234 234 HOH HOH A . 
C 3 HOH 101 235 235 HOH HOH A . 
C 3 HOH 102 236 236 HOH HOH A . 
C 3 HOH 103 237 237 HOH HOH A . 
C 3 HOH 104 238 238 HOH HOH A . 
C 3 HOH 105 239 239 HOH HOH A . 
C 3 HOH 106 240 240 HOH HOH A . 
C 3 HOH 107 241 241 HOH HOH A . 
C 3 HOH 108 242 242 HOH HOH A . 
C 3 HOH 109 243 243 HOH HOH A . 
C 3 HOH 110 244 244 HOH HOH A . 
C 3 HOH 111 245 245 HOH HOH A . 
C 3 HOH 112 246 246 HOH HOH A . 
C 3 HOH 113 247 247 HOH HOH A . 
C 3 HOH 114 248 248 HOH HOH A . 
C 3 HOH 115 249 249 HOH HOH A . 
C 3 HOH 116 250 250 HOH HOH A . 
C 3 HOH 117 251 251 HOH HOH A . 
C 3 HOH 118 252 252 HOH HOH A . 
C 3 HOH 119 253 253 HOH HOH A . 
C 3 HOH 120 254 254 HOH HOH A . 
C 3 HOH 121 255 255 HOH HOH A . 
C 3 HOH 122 256 256 HOH HOH A . 
C 3 HOH 123 257 257 HOH HOH A . 
C 3 HOH 124 258 258 HOH HOH A . 
C 3 HOH 125 259 259 HOH HOH A . 
C 3 HOH 126 260 260 HOH HOH A . 
C 3 HOH 127 261 261 HOH HOH A . 
C 3 HOH 128 262 262 HOH HOH A . 
C 3 HOH 129 263 263 HOH HOH A . 
C 3 HOH 130 264 264 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
TNT    refinement       . ? 2 
X-PLOR refinement       . ? 3 
X-PLOR phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 15  ? ? OE2 A GLU 15  ? ? 1.325 1.252 0.073 0.011 N 
2 1 CD A GLU 19  ? ? OE1 A GLU 19  ? ? 1.319 1.252 0.067 0.011 N 
3 1 CD A GLU 43  ? ? OE2 A GLU 43  ? ? 1.321 1.252 0.069 0.011 N 
4 1 CD A GLU 101 ? ? OE1 A GLU 101 ? ? 1.320 1.252 0.068 0.011 N 
5 1 CD A GLU 107 ? ? OE1 A GLU 107 ? ? 1.331 1.252 0.079 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 3  ? ? CG A ASP 3  ? ? OD2 A ASP 3  ? ? 110.11 118.30 -8.19  0.90 N 
2 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD1 A ASP 67 ? ? 110.03 118.30 -8.27  0.90 N 
3 1 CB A ASP 74 ? ? CG A ASP 74 ? ? OD2 A ASP 74 ? ? 124.65 118.30 6.35   0.90 N 
4 1 CB A GLU 85 ? ? CA A GLU 85 ? ? C   A GLU 85 ? ? 98.39  110.40 -12.01 2.00 N 
5 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH1 A ARG 95 ? ? 123.57 120.30 3.27   0.50 N 
6 1 NE A ARG 95 ? ? CZ A ARG 95 ? ? NH2 A ARG 95 ? ? 117.15 120.30 -3.15  0.50 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     56 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -171.39 
_pdbx_validate_torsion.psi             -178.89 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MYRISTIC ACID' MYR 
3 water           HOH 
#