data_1ICN
# 
_entry.id   1ICN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ICN         
WWPDB D_1000174104 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ICN 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-20 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Eads, J.C.'        1 
'Sacchettini, J.C.' 2 
'Kromminga, A.'     3 
'Gordon, J.I.'      4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Escherichia coli-derived rat intestinal fatty acid binding protein with bound myristate at 1.5 A resolution and I-FABPArg106-->Gln with bound oleate at 1.74 A resolution.
;
J.Biol.Chem. 268 26375 26385 1993 JBCHA3 US 0021-9258 0071 ? 8253762 ? 
1       'Refinement of the Structure of Recombinant Rat Intestinal Fatty Acid-Binding Apoprotein at 1.2 Angstroms Resolution' 
J.Biol.Chem. 267 4253  ?     1992 JBCHA3 US 0021-9258 0071 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eads, J.'          1 
primary 'Sacchettini, J.C.' 2 
primary 'Kromminga, A.'     3 
primary 'Gordon, J.I.'      4 
1       'Scapin, G.'        5 
1       'Gordon, J.I.'      6 
1       'Sacchettini, J.C.' 7 
# 
_cell.entry_id           1ICN 
_cell.length_a           35.820 
_cell.length_b           51.550 
_cell.length_c           31.240 
_cell.angle_alpha        90.00 
_cell.angle_beta         92.28 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ICN 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INTESTINAL FATTY ACID BINDING PROTEIN' 14985.950 1   ? ? ? ? 
2 non-polymer syn 'OLEIC ACID'                            282.461   1   ? ? ? ? 
3 water       nat water                                   18.015    133 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVQEISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVQEISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PHE n 
1 3   ASP n 
1 4   GLY n 
1 5   THR n 
1 6   TRP n 
1 7   LYS n 
1 8   VAL n 
1 9   ASP n 
1 10  ARG n 
1 11  ASN n 
1 12  GLU n 
1 13  ASN n 
1 14  TYR n 
1 15  GLU n 
1 16  LYS n 
1 17  PHE n 
1 18  MET n 
1 19  GLU n 
1 20  LYS n 
1 21  MET n 
1 22  GLY n 
1 23  ILE n 
1 24  ASN n 
1 25  VAL n 
1 26  VAL n 
1 27  LYS n 
1 28  ARG n 
1 29  LYS n 
1 30  LEU n 
1 31  GLY n 
1 32  ALA n 
1 33  HIS n 
1 34  ASP n 
1 35  ASN n 
1 36  LEU n 
1 37  LYS n 
1 38  LEU n 
1 39  THR n 
1 40  ILE n 
1 41  THR n 
1 42  GLN n 
1 43  GLU n 
1 44  GLY n 
1 45  ASN n 
1 46  LYS n 
1 47  PHE n 
1 48  THR n 
1 49  VAL n 
1 50  LYS n 
1 51  GLU n 
1 52  SER n 
1 53  SER n 
1 54  ASN n 
1 55  PHE n 
1 56  ARG n 
1 57  ASN n 
1 58  ILE n 
1 59  ASP n 
1 60  VAL n 
1 61  VAL n 
1 62  PHE n 
1 63  GLU n 
1 64  LEU n 
1 65  GLY n 
1 66  VAL n 
1 67  ASP n 
1 68  PHE n 
1 69  ALA n 
1 70  TYR n 
1 71  SER n 
1 72  LEU n 
1 73  ALA n 
1 74  ASP n 
1 75  GLY n 
1 76  THR n 
1 77  GLU n 
1 78  LEU n 
1 79  THR n 
1 80  GLY n 
1 81  THR n 
1 82  TRP n 
1 83  THR n 
1 84  MET n 
1 85  GLU n 
1 86  GLY n 
1 87  ASN n 
1 88  LYS n 
1 89  LEU n 
1 90  VAL n 
1 91  GLY n 
1 92  LYS n 
1 93  PHE n 
1 94  LYS n 
1 95  ARG n 
1 96  VAL n 
1 97  ASP n 
1 98  ASN n 
1 99  GLY n 
1 100 LYS n 
1 101 GLU n 
1 102 LEU n 
1 103 ILE n 
1 104 ALA n 
1 105 VAL n 
1 106 GLN n 
1 107 GLU n 
1 108 ILE n 
1 109 SER n 
1 110 GLY n 
1 111 ASN n 
1 112 GLU n 
1 113 LEU n 
1 114 ILE n 
1 115 GLN n 
1 116 THR n 
1 117 TYR n 
1 118 THR n 
1 119 TYR n 
1 120 GLU n 
1 121 GLY n 
1 122 VAL n 
1 123 GLU n 
1 124 ALA n 
1 125 LYS n 
1 126 ARG n 
1 127 ILE n 
1 128 PHE n 
1 129 LYS n 
1 130 LYS n 
1 131 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FABPI_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02693 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ICN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02693 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  131 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1ICN 
_struct_ref_seq_dif.mon_id                       GLN 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      106 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P02693 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          106 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            106 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
OLA non-polymer         . 'OLEIC ACID'    ? 'C18 H34 O2'     282.461 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ICN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.92 
_exptl_crystal.density_percent_sol   36.04 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1ICN 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.74 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1610000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1055 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               1218 
_refine_hist.d_res_high                       1.74 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.70 ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?    ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ICN 
_struct.title                     
;ESCHERICHIA COLI-DERIVED RAT INTESTINAL FATTY ACID BINDING PROTEIN WITH BOUND MYRISTATE AT 1.5 A RESOLUTION AND I-FABPARG106-->GLN WITH BOUND OLEATE AT 1.74 A RESOLUTION
;
_struct.pdbx_descriptor           
'INTESTINAL FATTY ACID BINDING PROTEIN MUTANT WITH ARG 106 REPLACED BY GLN (R106Q) COMPLEXED WITH OLEATE (C18:1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ICN 
_struct_keywords.pdbx_keywords   'BINDING PROTEIN(FATTY ACID)' 
_struct_keywords.text            'BINDING PROTEIN(FATTY ACID)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A1 TYR A 14 ? LYS A 20 ? TYR A 14 LYS A 20 1 ? 7 
HELX_P HELX_P2 A2 VAL A 25 ? HIS A 33 ? VAL A 25 HIS A 33 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 1   ? GLU A 12  ? ALA A 1   GLU A 12  
A 2 ASP A 34  ? GLN A 42  ? ASP A 34  GLN A 42  
A 3 PHE A 47  ? SER A 52  ? PHE A 47  SER A 52  
A 4 ASN A 57  ? PHE A 62  ? ASN A 57  PHE A 62  
B 1 ASP A 67  ? SER A 71  ? ASP A 67  SER A 71  
B 2 THR A 76  ? GLY A 80  ? THR A 76  GLY A 80  
C 1 THR A 81  ? MET A 84  ? THR A 81  MET A 84  
C 2 LEU A 89  ? LYS A 94  ? LEU A 89  LYS A 94  
C 3 LYS A 100 ? ILE A 108 ? LYS A 100 ILE A 108 
C 4 LEU A 113 ? THR A 118 ? LEU A 113 THR A 118 
C 5 GLU A 123 ? GLU A 131 ? GLU A 123 GLU A 131 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 4   ? O GLY A 4   N ILE A 40  ? N ILE A 40  
A 2 3 O THR A 41  ? O THR A 41  N THR A 48  ? N THR A 48  
A 3 4 O VAL A 49  ? O VAL A 49  N VAL A 60  ? N VAL A 60  
B 1 2 O TYR A 70  ? O TYR A 70  N LEU A 78  ? N LEU A 78  
C 1 2 O THR A 83  ? O THR A 83  N VAL A 90  ? N VAL A 90  
C 2 3 O GLY A 91  ? O GLY A 91  N ALA A 104 ? N ALA A 104 
C 3 4 O VAL A 105 ? O VAL A 105 N THR A 116 ? N THR A 116 
C 4 5 O GLN A 115 ? O GLN A 115 N ARG A 126 ? N ARG A 126 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
FA1 Unknown  ? ? ? ? 6 ?                                    
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE OLA A 133' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  FA1 6 GLN A 106 ? GLN A 106 . ? 1_555 ? 
2  FA1 6 TRP A 82  ? TRP A 82  . ? 1_555 ? 
3  FA1 6 GLN A 115 ? GLN A 115 . ? 1_555 ? 
4  FA1 6 TYR A 70  ? TYR A 70  . ? 1_555 ? 
5  FA1 6 TYR A 117 ? TYR A 117 . ? 1_555 ? 
6  FA1 6 PHE A 55  ? PHE A 55  . ? 1_555 ? 
7  AC1 8 TYR A 14  ? TYR A 14  . ? 1_555 ? 
8  AC1 8 PHE A 17  ? PHE A 17  . ? 1_555 ? 
9  AC1 8 ILE A 23  ? ILE A 23  . ? 1_555 ? 
10 AC1 8 VAL A 60  ? VAL A 60  . ? 1_555 ? 
11 AC1 8 PHE A 62  ? PHE A 62  . ? 1_555 ? 
12 AC1 8 TYR A 70  ? TYR A 70  . ? 1_555 ? 
13 AC1 8 TRP A 82  ? TRP A 82  . ? 1_555 ? 
14 AC1 8 GLN A 106 ? GLN A 106 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ICN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ICN 
_atom_sites.fract_transf_matrix[1][1]   0.027917 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001111 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019399 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.032036 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -8.242  -4.876  9.814  1.00 58.58 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -6.876  -5.031  9.333  1.00 53.64 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -6.020  -3.809  9.608  1.00 43.37 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -6.195  -3.057  10.566 1.00 46.82 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -6.782  -5.376  7.851  1.00 55.69 ? 1   ALA A CB  1 
ATOM   6    N N   . PHE A 1 2   ? -5.082  -3.624  8.706  1.00 32.44 ? 2   PHE A N   1 
ATOM   7    C CA  . PHE A 1 2   ? -4.160  -2.521  8.843  1.00 21.78 ? 2   PHE A CA  1 
ATOM   8    C C   . PHE A 1 2   ? -4.706  -1.237  8.269  1.00 16.81 ? 2   PHE A C   1 
ATOM   9    O O   . PHE A 1 2   ? -4.037  -0.232  8.278  1.00 21.75 ? 2   PHE A O   1 
ATOM   10   C CB  . PHE A 1 2   ? -2.953  -2.974  8.050  1.00 18.23 ? 2   PHE A CB  1 
ATOM   11   C CG  . PHE A 1 2   ? -2.361  -4.222  8.647  1.00 20.60 ? 2   PHE A CG  1 
ATOM   12   C CD1 . PHE A 1 2   ? -1.542  -4.144  9.767  1.00 24.15 ? 2   PHE A CD1 1 
ATOM   13   C CD2 . PHE A 1 2   ? -2.582  -5.480  8.091  1.00 24.28 ? 2   PHE A CD2 1 
ATOM   14   C CE1 . PHE A 1 2   ? -0.955  -5.273  10.326 1.00 26.26 ? 2   PHE A CE1 1 
ATOM   15   C CE2 . PHE A 1 2   ? -2.013  -6.629  8.644  1.00 23.68 ? 2   PHE A CE2 1 
ATOM   16   C CZ  . PHE A 1 2   ? -1.202  -6.526  9.774  1.00 22.52 ? 2   PHE A CZ  1 
ATOM   17   N N   . ASP A 1 3   ? -5.871  -1.247  7.663  1.00 14.88 ? 3   ASP A N   1 
ATOM   18   C CA  . ASP A 1 3   ? -6.391  -0.057  7.039  1.00 16.38 ? 3   ASP A CA  1 
ATOM   19   C C   . ASP A 1 3   ? -6.436  1.176   7.894  1.00 18.17 ? 3   ASP A C   1 
ATOM   20   O O   . ASP A 1 3   ? -6.938  1.140   8.987  1.00 23.68 ? 3   ASP A O   1 
ATOM   21   C CB  . ASP A 1 3   ? -7.872  -0.252  6.643  1.00 22.53 ? 3   ASP A CB  1 
ATOM   22   C CG  . ASP A 1 3   ? -8.070  -1.598  6.018  1.00 29.84 ? 3   ASP A CG  1 
ATOM   23   O OD1 . ASP A 1 3   ? -7.787  -1.835  4.848  1.00 34.00 ? 3   ASP A OD1 1 
ATOM   24   O OD2 . ASP A 1 3   ? -8.513  -2.469  6.886  1.00 26.25 ? 3   ASP A OD2 1 
ATOM   25   N N   . GLY A 1 4   ? -6.050  2.330   7.386  1.00 14.49 ? 4   GLY A N   1 
ATOM   26   C CA  . GLY A 1 4   ? -6.194  3.511   8.219  1.00 17.15 ? 4   GLY A CA  1 
ATOM   27   C C   . GLY A 1 4   ? -4.919  4.336   8.297  1.00 15.64 ? 4   GLY A C   1 
ATOM   28   O O   . GLY A 1 4   ? -3.935  3.990   7.626  1.00 13.52 ? 4   GLY A O   1 
ATOM   29   N N   . THR A 1 5   ? -4.983  5.382   9.115  1.00 9.78  ? 5   THR A N   1 
ATOM   30   C CA  . THR A 1 5   ? -3.856  6.264   9.333  1.00 10.40 ? 5   THR A CA  1 
ATOM   31   C C   . THR A 1 5   ? -3.270  6.011   10.697 1.00 11.58 ? 5   THR A C   1 
ATOM   32   O O   . THR A 1 5   ? -4.045  5.882   11.643 1.00 14.01 ? 5   THR A O   1 
ATOM   33   C CB  . THR A 1 5   ? -4.240  7.733   9.081  1.00 14.45 ? 5   THR A CB  1 
ATOM   34   O OG1 . THR A 1 5   ? -4.677  7.784   7.720  1.00 16.81 ? 5   THR A OG1 1 
ATOM   35   C CG2 . THR A 1 5   ? -3.000  8.594   9.333  1.00 12.84 ? 5   THR A CG2 1 
ATOM   36   N N   . TRP A 1 6   ? -1.979  5.800   10.754 1.00 12.05 ? 6   TRP A N   1 
ATOM   37   C CA  . TRP A 1 6   ? -1.282  5.387   11.959 1.00 12.42 ? 6   TRP A CA  1 
ATOM   38   C C   . TRP A 1 6   ? -0.153  6.351   12.221 1.00 16.10 ? 6   TRP A C   1 
ATOM   39   O O   . TRP A 1 6   ? 0.607   6.681   11.306 1.00 19.23 ? 6   TRP A O   1 
ATOM   40   C CB  . TRP A 1 6   ? -0.655  3.995   11.684 1.00 7.60  ? 6   TRP A CB  1 
ATOM   41   C CG  . TRP A 1 6   ? -1.668  2.903   11.400 1.00 14.67 ? 6   TRP A CG  1 
ATOM   42   C CD1 . TRP A 1 6   ? -2.156  2.542   10.176 1.00 16.08 ? 6   TRP A CD1 1 
ATOM   43   C CD2 . TRP A 1 6   ? -2.398  2.083   12.364 1.00 14.38 ? 6   TRP A CD2 1 
ATOM   44   N NE1 . TRP A 1 6   ? -3.107  1.542   10.295 1.00 14.46 ? 6   TRP A NE1 1 
ATOM   45   C CE2 . TRP A 1 6   ? -3.235  1.207   11.625 1.00 15.93 ? 6   TRP A CE2 1 
ATOM   46   C CE3 . TRP A 1 6   ? -2.393  2.016   13.782 1.00 11.85 ? 6   TRP A CE3 1 
ATOM   47   C CZ2 . TRP A 1 6   ? -4.070  0.274   12.274 1.00 17.98 ? 6   TRP A CZ2 1 
ATOM   48   C CZ3 . TRP A 1 6   ? -3.199  1.073   14.425 1.00 13.67 ? 6   TRP A CZ3 1 
ATOM   49   C CH2 . TRP A 1 6   ? -4.036  0.222   13.669 1.00 16.09 ? 6   TRP A CH2 1 
ATOM   50   N N   . LYS A 1 7   ? 0.045   6.738   13.469 1.00 13.37 ? 7   LYS A N   1 
ATOM   51   C CA  . LYS A 1 7   ? 1.074   7.697   13.788 1.00 11.44 ? 7   LYS A CA  1 
ATOM   52   C C   . LYS A 1 7   ? 1.977   7.135   14.855 1.00 13.01 ? 7   LYS A C   1 
ATOM   53   O O   . LYS A 1 7   ? 1.547   6.542   15.864 1.00 14.96 ? 7   LYS A O   1 
ATOM   54   C CB  . LYS A 1 7   ? 0.322   8.877   14.328 1.00 17.04 ? 7   LYS A CB  1 
ATOM   55   C CG  . LYS A 1 7   ? 1.256   10.047  14.524 1.00 33.52 ? 7   LYS A CG  1 
ATOM   56   C CD  . LYS A 1 7   ? 1.935   10.419  13.220 1.00 42.58 ? 7   LYS A CD  1 
ATOM   57   C CE  . LYS A 1 7   ? 2.995   11.486  13.401 1.00 44.89 ? 7   LYS A CE  1 
ATOM   58   N NZ  . LYS A 1 7   ? 2.423   12.836  13.572 1.00 48.45 ? 7   LYS A NZ  1 
ATOM   59   N N   . VAL A 1 8   ? 3.261   7.243   14.640 1.00 11.92 ? 8   VAL A N   1 
ATOM   60   C CA  . VAL A 1 8   ? 4.154   6.614   15.605 1.00 11.34 ? 8   VAL A CA  1 
ATOM   61   C C   . VAL A 1 8   ? 3.985   7.217   16.975 1.00 20.75 ? 8   VAL A C   1 
ATOM   62   O O   . VAL A 1 8   ? 3.887   8.439   17.097 1.00 15.76 ? 8   VAL A O   1 
ATOM   63   C CB  . VAL A 1 8   ? 5.601   6.594   15.155 1.00 13.05 ? 8   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 8   ? 6.163   8.006   15.168 1.00 14.82 ? 8   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 8   ? 6.407   5.671   16.057 1.00 16.44 ? 8   VAL A CG2 1 
ATOM   66   N N   . ASP A 1 9   ? 3.913   6.326   17.983 1.00 23.17 ? 9   ASP A N   1 
ATOM   67   C CA  . ASP A 1 9   ? 3.770   6.661   19.397 1.00 18.67 ? 9   ASP A CA  1 
ATOM   68   C C   . ASP A 1 9   ? 5.053   6.480   20.209 1.00 19.04 ? 9   ASP A C   1 
ATOM   69   O O   . ASP A 1 9   ? 5.561   7.393   20.855 1.00 18.67 ? 9   ASP A O   1 
ATOM   70   C CB  . ASP A 1 9   ? 2.633   5.831   19.987 1.00 19.80 ? 9   ASP A CB  1 
ATOM   71   C CG  . ASP A 1 9   ? 2.500   6.181   21.445 1.00 25.12 ? 9   ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 9   ? 2.391   7.465   21.654 1.00 28.42 ? 9   ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 9   ? 2.509   5.341   22.300 1.00 21.48 ? 9   ASP A OD2 1 
ATOM   74   N N   . ARG A 1 10  ? 5.687   5.326   20.109 1.00 12.25 ? 10  ARG A N   1 
ATOM   75   C CA  . ARG A 1 10  ? 6.908   5.130   20.852 1.00 10.37 ? 10  ARG A CA  1 
ATOM   76   C C   . ARG A 1 10  ? 7.777   4.073   20.168 1.00 12.55 ? 10  ARG A C   1 
ATOM   77   O O   . ARG A 1 10  ? 7.293   3.269   19.366 1.00 12.93 ? 10  ARG A O   1 
ATOM   78   C CB  . ARG A 1 10  ? 6.572   4.671   22.253 1.00 17.03 ? 10  ARG A CB  1 
ATOM   79   C CG  . ARG A 1 10  ? 5.656   3.454   22.319 1.00 14.04 ? 10  ARG A CG  1 
ATOM   80   C CD  . ARG A 1 10  ? 5.043   3.114   23.680 1.00 15.02 ? 10  ARG A CD  1 
ATOM   81   N NE  . ARG A 1 10  ? 4.456   1.789   23.689 1.00 13.30 ? 10  ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 10  ? 3.208   1.563   23.268 1.00 13.56 ? 10  ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 10  ? 2.388   2.537   22.909 1.00 16.58 ? 10  ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 10  ? 2.700   0.346   23.255 1.00 16.93 ? 10  ARG A NH2 1 
ATOM   85   N N   . ASN A 1 11  ? 9.017   4.042   20.599 1.00 10.35 ? 11  ASN A N   1 
ATOM   86   C CA  . ASN A 1 11  ? 10.003  3.119   20.037 1.00 11.06 ? 11  ASN A CA  1 
ATOM   87   C C   . ASN A 1 11  ? 10.652  2.238   21.083 1.00 15.85 ? 11  ASN A C   1 
ATOM   88   O O   . ASN A 1 11  ? 10.772  2.661   22.219 1.00 17.73 ? 11  ASN A O   1 
ATOM   89   C CB  . ASN A 1 11  ? 11.204  3.898   19.450 1.00 14.67 ? 11  ASN A CB  1 
ATOM   90   C CG  . ASN A 1 11  ? 10.780  5.016   18.508 1.00 20.42 ? 11  ASN A CG  1 
ATOM   91   O OD1 . ASN A 1 11  ? 9.930   4.856   17.630 1.00 21.05 ? 11  ASN A OD1 1 
ATOM   92   N ND2 . ASN A 1 11  ? 11.390  6.171   18.654 1.00 24.00 ? 11  ASN A ND2 1 
ATOM   93   N N   . GLU A 1 12  ? 11.233  1.114   20.699 1.00 11.54 ? 12  GLU A N   1 
ATOM   94   C CA  . GLU A 1 12  ? 11.966  0.320   21.645 1.00 13.34 ? 12  GLU A CA  1 
ATOM   95   C C   . GLU A 1 12  ? 13.274  -0.087  21.008 1.00 12.24 ? 12  GLU A C   1 
ATOM   96   O O   . GLU A 1 12  ? 13.239  -0.726  19.978 1.00 13.50 ? 12  GLU A O   1 
ATOM   97   C CB  . GLU A 1 12  ? 11.197  -0.932  22.144 1.00 18.03 ? 12  GLU A CB  1 
ATOM   98   C CG  . GLU A 1 12  ? 9.906   -0.587  22.909 1.00 19.55 ? 12  GLU A CG  1 
ATOM   99   C CD  . GLU A 1 12  ? 9.126   -1.773  23.418 1.00 27.79 ? 12  GLU A CD  1 
ATOM   100  O OE1 . GLU A 1 12  ? 9.816   -2.896  23.368 1.00 26.83 ? 12  GLU A OE1 1 
ATOM   101  O OE2 . GLU A 1 12  ? 7.978   -1.664  23.836 1.00 31.35 ? 12  GLU A OE2 1 
ATOM   102  N N   . ASN A 1 13  ? 14.407  0.274   21.595 1.00 7.81  ? 13  ASN A N   1 
ATOM   103  C CA  . ASN A 1 13  ? 15.720  -0.097  21.095 1.00 10.86 ? 13  ASN A CA  1 
ATOM   104  C C   . ASN A 1 13  ? 16.055  0.423   19.706 1.00 12.51 ? 13  ASN A C   1 
ATOM   105  O O   . ASN A 1 13  ? 16.915  -0.097  18.988 1.00 10.86 ? 13  ASN A O   1 
ATOM   106  C CB  . ASN A 1 13  ? 15.872  -1.654  21.158 1.00 15.34 ? 13  ASN A CB  1 
ATOM   107  C CG  . ASN A 1 13  ? 17.329  -2.030  21.342 1.00 22.92 ? 13  ASN A CG  1 
ATOM   108  O OD1 . ASN A 1 13  ? 18.080  -1.278  22.004 1.00 22.15 ? 13  ASN A OD1 1 
ATOM   109  N ND2 . ASN A 1 13  ? 17.762  -3.154  20.724 1.00 24.43 ? 13  ASN A ND2 1 
ATOM   110  N N   . TYR A 1 14  ? 15.323  1.449   19.275 1.00 12.70 ? 14  TYR A N   1 
ATOM   111  C CA  . TYR A 1 14  ? 15.499  1.939   17.930 1.00 12.62 ? 14  TYR A CA  1 
ATOM   112  C C   . TYR A 1 14  ? 16.838  2.604   17.662 1.00 15.92 ? 14  TYR A C   1 
ATOM   113  O O   . TYR A 1 14  ? 17.426  2.428   16.569 1.00 12.14 ? 14  TYR A O   1 
ATOM   114  C CB  . TYR A 1 14  ? 14.294  2.815   17.596 1.00 12.00 ? 14  TYR A CB  1 
ATOM   115  C CG  . TYR A 1 14  ? 14.202  3.197   16.141 1.00 12.77 ? 14  TYR A CG  1 
ATOM   116  C CD1 . TYR A 1 14  ? 14.317  2.243   15.124 1.00 14.95 ? 14  TYR A CD1 1 
ATOM   117  C CD2 . TYR A 1 14  ? 13.853  4.506   15.807 1.00 11.63 ? 14  TYR A CD2 1 
ATOM   118  C CE1 . TYR A 1 14  ? 14.098  2.604   13.788 1.00 18.24 ? 14  TYR A CE1 1 
ATOM   119  C CE2 . TYR A 1 14  ? 13.627  4.887   14.481 1.00 14.65 ? 14  TYR A CE2 1 
ATOM   120  C CZ  . TYR A 1 14  ? 13.785  3.934   13.466 1.00 18.78 ? 14  TYR A CZ  1 
ATOM   121  O OH  . TYR A 1 14  ? 13.583  4.289   12.155 1.00 16.04 ? 14  TYR A OH  1 
ATOM   122  N N   . GLU A 1 15  ? 17.359  3.387   18.626 1.00 11.35 ? 15  GLU A N   1 
ATOM   123  C CA  . GLU A 1 15  ? 18.628  3.990   18.317 1.00 13.56 ? 15  GLU A CA  1 
ATOM   124  C C   . GLU A 1 15  ? 19.712  2.949   18.186 1.00 16.24 ? 15  GLU A C   1 
ATOM   125  O O   . GLU A 1 15  ? 20.635  3.109   17.396 1.00 15.01 ? 15  GLU A O   1 
ATOM   126  C CB  . GLU A 1 15  ? 19.160  5.078   19.272 1.00 17.12 ? 15  GLU A CB  1 
ATOM   127  C CG  . GLU A 1 15  ? 18.247  6.295   19.250 1.00 22.38 ? 15  GLU A CG  1 
ATOM   128  C CD  . GLU A 1 15  ? 18.775  7.310   20.218 1.00 26.37 ? 15  GLU A CD  1 
ATOM   129  O OE1 . GLU A 1 15  ? 19.970  7.377   20.421 1.00 29.97 ? 15  GLU A OE1 1 
ATOM   130  O OE2 . GLU A 1 15  ? 17.818  8.022   20.783 1.00 25.55 ? 15  GLU A OE2 1 
ATOM   131  N N   . LYS A 1 16  ? 19.676  1.882   18.991 1.00 15.86 ? 16  LYS A N   1 
ATOM   132  C CA  . LYS A 1 16  ? 20.724  0.856   18.863 1.00 14.38 ? 16  LYS A CA  1 
ATOM   133  C C   . LYS A 1 16  ? 20.613  0.150   17.506 1.00 17.68 ? 16  LYS A C   1 
ATOM   134  O O   . LYS A 1 16  ? 21.634  -0.273  16.950 1.00 15.34 ? 16  LYS A O   1 
ATOM   135  C CB  . LYS A 1 16  ? 20.527  -0.226  19.925 1.00 24.50 ? 16  LYS A CB  1 
ATOM   136  C CG  . LYS A 1 16  ? 21.308  0.016   21.198 1.00 35.89 ? 16  LYS A CG  1 
ATOM   137  C CD  . LYS A 1 16  ? 22.775  -0.293  20.967 1.00 48.49 ? 16  LYS A CD  1 
ATOM   138  C CE  . LYS A 1 16  ? 23.663  0.073   22.144 1.00 57.18 ? 16  LYS A CE  1 
ATOM   139  N NZ  . LYS A 1 16  ? 25.068  0.320   21.751 1.00 62.39 ? 16  LYS A NZ  1 
ATOM   140  N N   . PHE A 1 17  ? 19.380  0.006   16.987 1.00 12.90 ? 17  PHE A N   1 
ATOM   141  C CA  . PHE A 1 17  ? 19.151  -0.654  15.708 1.00 10.45 ? 17  PHE A CA  1 
ATOM   142  C C   . PHE A 1 17  ? 19.718  0.248   14.609 1.00 15.54 ? 17  PHE A C   1 
ATOM   143  O O   . PHE A 1 17  ? 20.448  -0.226  13.728 1.00 14.43 ? 17  PHE A O   1 
ATOM   144  C CB  . PHE A 1 17  ? 17.665  -0.933  15.526 1.00 10.44 ? 17  PHE A CB  1 
ATOM   145  C CG  . PHE A 1 17  ? 17.324  -1.525  14.184 1.00 15.33 ? 17  PHE A CG  1 
ATOM   146  C CD1 . PHE A 1 17  ? 17.042  -0.706  13.082 1.00 14.36 ? 17  PHE A CD1 1 
ATOM   147  C CD2 . PHE A 1 17  ? 17.297  -2.917  14.056 1.00 19.76 ? 17  PHE A CD2 1 
ATOM   148  C CE1 . PHE A 1 17  ? 16.682  -1.278  11.859 1.00 17.41 ? 17  PHE A CE1 1 
ATOM   149  C CE2 . PHE A 1 17  ? 16.944  -3.500  12.836 1.00 20.90 ? 17  PHE A CE2 1 
ATOM   150  C CZ  . PHE A 1 17  ? 16.658  -2.670  11.746 1.00 17.93 ? 17  PHE A CZ  1 
ATOM   151  N N   . MET A 1 18  ? 19.474  1.562   14.721 1.00 14.36 ? 18  MET A N   1 
ATOM   152  C CA  . MET A 1 18  ? 20.035  2.506   13.763 1.00 9.96  ? 18  MET A CA  1 
ATOM   153  C C   . MET A 1 18  ? 21.539  2.552   13.760 1.00 14.52 ? 18  MET A C   1 
ATOM   154  O O   . MET A 1 18  ? 22.175  2.629   12.720 1.00 15.36 ? 18  MET A O   1 
ATOM   155  C CB  . MET A 1 18  ? 19.449  3.882   13.981 1.00 10.72 ? 18  MET A CB  1 
ATOM   156  C CG  . MET A 1 18  ? 18.021  3.887   13.516 1.00 12.36 ? 18  MET A CG  1 
ATOM   157  S SD  . MET A 1 18  ? 17.381  5.583   13.479 1.00 16.86 ? 18  MET A SD  1 
ATOM   158  C CE  . MET A 1 18  ? 16.936  5.893   15.211 1.00 17.28 ? 18  MET A CE  1 
ATOM   159  N N   . GLU A 1 19  ? 22.144  2.449   14.937 1.00 11.05 ? 19  GLU A N   1 
ATOM   160  C CA  . GLU A 1 19  ? 23.598  2.423   15.043 1.00 11.80 ? 19  GLU A CA  1 
ATOM   161  C C   . GLU A 1 19  ? 24.178  1.202   14.322 1.00 17.80 ? 19  GLU A C   1 
ATOM   162  O O   . GLU A 1 19  ? 25.173  1.320   13.625 1.00 16.05 ? 19  GLU A O   1 
ATOM   163  C CB  . GLU A 1 19  ? 23.932  2.305   16.544 1.00 13.98 ? 19  GLU A CB  1 
ATOM   164  C CG  . GLU A 1 19  ? 25.428  2.078   16.853 1.00 24.92 ? 19  GLU A CG  1 
ATOM   165  C CD  . GLU A 1 19  ? 25.608  1.898   18.348 1.00 35.90 ? 19  GLU A CD  1 
ATOM   166  O OE1 . GLU A 1 19  ? 25.375  2.764   19.172 1.00 33.91 ? 19  GLU A OE1 1 
ATOM   167  O OE2 . GLU A 1 19  ? 25.956  0.676   18.695 1.00 45.81 ? 19  GLU A OE2 1 
ATOM   168  N N   . LYS A 1 20  ? 23.566  0.031   14.490 1.00 15.10 ? 20  LYS A N   1 
ATOM   169  C CA  . LYS A 1 20  ? 24.023  -1.180  13.807 1.00 16.22 ? 20  LYS A CA  1 
ATOM   170  C C   . LYS A 1 20  ? 23.944  -1.036  12.283 1.00 19.99 ? 20  LYS A C   1 
ATOM   171  O O   . LYS A 1 20  ? 24.808  -1.526  11.556 1.00 17.74 ? 20  LYS A O   1 
ATOM   172  C CB  . LYS A 1 20  ? 23.047  -2.283  14.222 1.00 18.37 ? 20  LYS A CB  1 
ATOM   173  C CG  . LYS A 1 20  ? 23.561  -3.691  13.984 1.00 20.91 ? 20  LYS A CG  1 
ATOM   174  C CD  . LYS A 1 20  ? 24.676  -4.026  14.952 1.00 28.78 ? 20  LYS A CD  1 
ATOM   175  C CE  . LYS A 1 20  ? 25.388  -5.325  14.612 1.00 36.95 ? 20  LYS A CE  1 
ATOM   176  N NZ  . LYS A 1 20  ? 26.350  -5.711  15.651 1.00 39.17 ? 20  LYS A NZ  1 
ATOM   177  N N   . MET A 1 21  ? 22.888  -0.355  11.806 1.00 14.17 ? 21  MET A N   1 
ATOM   178  C CA  . MET A 1 21  ? 22.657  -0.067  10.417 1.00 13.75 ? 21  MET A CA  1 
ATOM   179  C C   . MET A 1 21  ? 23.718  0.877   9.877  1.00 21.21 ? 21  MET A C   1 
ATOM   180  O O   . MET A 1 21  ? 23.937  0.897   8.672  1.00 23.80 ? 21  MET A O   1 
ATOM   181  C CB  . MET A 1 21  ? 21.246  0.464   10.232 1.00 15.92 ? 21  MET A CB  1 
ATOM   182  C CG  . MET A 1 21  ? 20.287  -0.706  10.392 1.00 15.66 ? 21  MET A CG  1 
ATOM   183  S SD  . MET A 1 21  ? 20.043  -1.732  8.878  1.00 22.50 ? 21  MET A SD  1 
ATOM   184  C CE  . MET A 1 21  ? 19.097  -0.536  7.882  1.00 21.62 ? 21  MET A CE  1 
ATOM   185  N N   . GLY A 1 22  ? 24.420  1.562   10.779 1.00 19.86 ? 22  GLY A N   1 
ATOM   186  C CA  . GLY A 1 22  ? 25.513  2.470   10.485 1.00 19.54 ? 22  GLY A CA  1 
ATOM   187  C C   . GLY A 1 22  ? 25.138  3.949   10.454 1.00 24.03 ? 22  GLY A C   1 
ATOM   188  O O   . GLY A 1 22  ? 25.883  4.784   9.926  1.00 28.26 ? 22  GLY A O   1 
ATOM   189  N N   . ILE A 1 23  ? 24.001  4.305   11.031 1.00 17.19 ? 23  ILE A N   1 
ATOM   190  C CA  . ILE A 1 23  ? 23.554  5.697   11.019 1.00 18.23 ? 23  ILE A CA  1 
ATOM   191  C C   . ILE A 1 23  ? 24.283  6.475   12.062 1.00 19.00 ? 23  ILE A C   1 
ATOM   192  O O   . ILE A 1 23  ? 24.450  5.980   13.154 1.00 19.98 ? 23  ILE A O   1 
ATOM   193  C CB  . ILE A 1 23  ? 22.062  5.717   11.241 1.00 14.39 ? 23  ILE A CB  1 
ATOM   194  C CG1 . ILE A 1 23  ? 21.506  5.016   10.017 1.00 15.23 ? 23  ILE A CG1 1 
ATOM   195  C CG2 . ILE A 1 23  ? 21.609  7.166   11.284 1.00 15.50 ? 23  ILE A CG2 1 
ATOM   196  C CD1 . ILE A 1 23  ? 20.021  4.763   10.157 1.00 21.92 ? 23  ILE A CD1 1 
ATOM   197  N N   . ASN A 1 24  ? 24.726  7.681   11.734 1.00 17.70 ? 24  ASN A N   1 
ATOM   198  C CA  . ASN A 1 24  ? 25.526  8.455   12.670 1.00 17.24 ? 24  ASN A CA  1 
ATOM   199  C C   . ASN A 1 24  ? 24.727  8.934   13.850 1.00 17.26 ? 24  ASN A C   1 
ATOM   200  O O   . ASN A 1 24  ? 23.495  9.022   13.763 1.00 20.11 ? 24  ASN A O   1 
ATOM   201  C CB  . ASN A 1 24  ? 26.317  9.583   11.971 1.00 23.21 ? 24  ASN A CB  1 
ATOM   202  C CG  . ASN A 1 24  ? 25.518  10.857  11.718 1.00 29.92 ? 24  ASN A CG  1 
ATOM   203  O OD1 . ASN A 1 24  ? 24.625  11.269  12.461 1.00 32.29 ? 24  ASN A OD1 1 
ATOM   204  N ND2 . ASN A 1 24  ? 25.837  11.537  10.629 1.00 35.34 ? 24  ASN A ND2 1 
ATOM   205  N N   . VAL A 1 25  ? 25.408  9.269   14.937 1.00 17.45 ? 25  VAL A N   1 
ATOM   206  C CA  . VAL A 1 25  ? 24.757  9.723   16.154 1.00 17.72 ? 25  VAL A CA  1 
ATOM   207  C C   . VAL A 1 25  ? 23.667  10.790  16.017 1.00 18.75 ? 25  VAL A C   1 
ATOM   208  O O   . VAL A 1 25  ? 22.526  10.702  16.504 1.00 19.61 ? 25  VAL A O   1 
ATOM   209  C CB  . VAL A 1 25  ? 25.857  10.140  17.137 1.00 28.71 ? 25  VAL A CB  1 
ATOM   210  C CG1 . VAL A 1 25  ? 26.389  11.512  16.738 1.00 37.75 ? 25  VAL A CG1 1 
ATOM   211  C CG2 . VAL A 1 25  ? 25.307  10.331  18.539 1.00 26.29 ? 25  VAL A CG2 1 
ATOM   212  N N   . VAL A 1 26  ? 23.995  11.883  15.345 1.00 16.06 ? 26  VAL A N   1 
ATOM   213  C CA  . VAL A 1 26  ? 23.018  12.939  15.221 1.00 14.21 ? 26  VAL A CA  1 
ATOM   214  C C   . VAL A 1 26  ? 21.780  12.501  14.459 1.00 18.32 ? 26  VAL A C   1 
ATOM   215  O O   . VAL A 1 26  ? 20.623  12.816  14.815 1.00 15.46 ? 26  VAL A O   1 
ATOM   216  C CB  . VAL A 1 26  ? 23.725  14.115  14.556 1.00 17.16 ? 26  VAL A CB  1 
ATOM   217  C CG1 . VAL A 1 26  ? 22.711  15.125  14.028 1.00 21.71 ? 26  VAL A CG1 1 
ATOM   218  C CG2 . VAL A 1 26  ? 24.599  14.759  15.630 1.00 18.43 ? 26  VAL A CG2 1 
ATOM   219  N N   . LYS A 1 27  ? 22.027  11.718  13.398 1.00 16.98 ? 27  LYS A N   1 
ATOM   220  C CA  . LYS A 1 27  ? 20.921  11.254  12.549 1.00 14.91 ? 27  LYS A CA  1 
ATOM   221  C C   . LYS A 1 27  ? 19.978  10.300  13.298 1.00 15.04 ? 27  LYS A C   1 
ATOM   222  O O   . LYS A 1 27  ? 18.766  10.248  12.976 1.00 15.89 ? 27  LYS A O   1 
ATOM   223  C CB  . LYS A 1 27  ? 21.366  10.712  11.191 1.00 15.62 ? 27  LYS A CB  1 
ATOM   224  C CG  . LYS A 1 27  ? 22.297  11.702  10.473 1.00 19.58 ? 27  LYS A CG  1 
ATOM   225  C CD  . LYS A 1 27  ? 21.680  13.063  10.132 1.00 24.54 ? 27  LYS A CD  1 
ATOM   226  C CE  . LYS A 1 27  ? 22.655  14.006  9.408  1.00 33.18 ? 27  LYS A CE  1 
ATOM   227  N NZ  . LYS A 1 27  ? 22.049  15.280  8.968  1.00 34.55 ? 27  LYS A NZ  1 
ATOM   228  N N   . ARG A 1 28  ? 20.563  9.563   14.265 1.00 15.72 ? 28  ARG A N   1 
ATOM   229  C CA  . ARG A 1 28  ? 19.736  8.640   15.061 1.00 15.33 ? 28  ARG A CA  1 
ATOM   230  C C   . ARG A 1 28  ? 18.739  9.444   15.901 1.00 15.34 ? 28  ARG A C   1 
ATOM   231  O O   . ARG A 1 28  ? 17.572  9.022   16.060 1.00 16.06 ? 28  ARG A O   1 
ATOM   232  C CB  . ARG A 1 28  ? 20.527  7.707   15.988 1.00 15.52 ? 28  ARG A CB  1 
ATOM   233  C CG  . ARG A 1 28  ? 21.497  6.867   15.186 1.00 17.34 ? 28  ARG A CG  1 
ATOM   234  C CD  . ARG A 1 28  ? 22.204  5.784   15.957 1.00 20.64 ? 28  ARG A CD  1 
ATOM   235  N NE  . ARG A 1 28  ? 23.007  6.166   17.106 1.00 27.91 ? 28  ARG A NE  1 
ATOM   236  C CZ  . ARG A 1 28  ? 24.355  6.109   17.181 1.00 27.96 ? 28  ARG A CZ  1 
ATOM   237  N NH1 . ARG A 1 28  ? 25.141  5.795   16.157 1.00 24.27 ? 28  ARG A NH1 1 
ATOM   238  N NH2 . ARG A 1 28  ? 24.976  6.388   18.305 1.00 26.75 ? 28  ARG A NH2 1 
ATOM   239  N N   . LYS A 1 29  ? 19.234  10.589  16.432 1.00 14.12 ? 29  LYS A N   1 
ATOM   240  C CA  . LYS A 1 29  ? 18.328  11.419  17.218 1.00 14.49 ? 29  LYS A CA  1 
ATOM   241  C C   . LYS A 1 29  ? 17.170  11.898  16.360 1.00 13.99 ? 29  LYS A C   1 
ATOM   242  O O   . LYS A 1 29  ? 15.983  11.929  16.750 1.00 16.16 ? 29  LYS A O   1 
ATOM   243  C CB  . LYS A 1 29  ? 19.087  12.527  17.968 1.00 19.78 ? 29  LYS A CB  1 
ATOM   244  C CG  . LYS A 1 29  ? 20.122  11.981  18.966 1.00 21.74 ? 29  LYS A CG  1 
ATOM   245  C CD  . LYS A 1 29  ? 19.365  11.388  20.159 1.00 26.17 ? 29  LYS A CD  1 
ATOM   246  C CE  . LYS A 1 29  ? 20.157  10.744  21.304 1.00 31.69 ? 29  LYS A CE  1 
ATOM   247  N NZ  . LYS A 1 29  ? 19.198  10.347  22.369 1.00 31.88 ? 29  LYS A NZ  1 
ATOM   248  N N   . LEU A 1 30  ? 17.523  12.300  15.136 1.00 13.43 ? 30  LEU A N   1 
ATOM   249  C CA  . LEU A 1 30  ? 16.473  12.744  14.237 1.00 15.86 ? 30  LEU A CA  1 
ATOM   250  C C   . LEU A 1 30  ? 15.510  11.615  13.866 1.00 16.34 ? 30  LEU A C   1 
ATOM   251  O O   . LEU A 1 30  ? 14.280  11.785  13.728 1.00 18.61 ? 30  LEU A O   1 
ATOM   252  C CB  . LEU A 1 30  ? 16.991  13.362  12.926 1.00 16.06 ? 30  LEU A CB  1 
ATOM   253  C CG  . LEU A 1 30  ? 17.971  14.512  13.163 1.00 16.96 ? 30  LEU A CG  1 
ATOM   254  C CD1 . LEU A 1 30  ? 18.597  14.981  11.827 1.00 19.56 ? 30  LEU A CD1 1 
ATOM   255  C CD2 . LEU A 1 30  ? 17.259  15.672  13.844 1.00 16.04 ? 30  LEU A CD2 1 
ATOM   256  N N   . GLY A 1 31  ? 16.103  10.455  13.641 1.00 12.98 ? 31  GLY A N   1 
ATOM   257  C CA  . GLY A 1 31  ? 15.306  9.305   13.248 1.00 13.83 ? 31  GLY A CA  1 
ATOM   258  C C   . GLY A 1 31  ? 14.291  8.867   14.272 1.00 13.71 ? 31  GLY A C   1 
ATOM   259  O O   . GLY A 1 31  ? 13.168  8.429   13.944 1.00 14.97 ? 31  GLY A O   1 
ATOM   260  N N   . ALA A 1 32  ? 14.721  9.027   15.508 1.00 14.96 ? 32  ALA A N   1 
ATOM   261  C CA  . ALA A 1 32  ? 13.883  8.584   16.594 1.00 11.54 ? 32  ALA A CA  1 
ATOM   262  C C   . ALA A 1 32  ? 12.742  9.517   16.828 1.00 12.05 ? 32  ALA A C   1 
ATOM   263  O O   . ALA A 1 32  ? 11.754  9.120   17.443 1.00 17.12 ? 32  ALA A O   1 
ATOM   264  C CB  . ALA A 1 32  ? 14.710  8.383   17.861 1.00 16.14 ? 32  ALA A CB  1 
ATOM   265  N N   . HIS A 1 33  ? 12.840  10.718  16.260 1.00 9.97  ? 33  HIS A N   1 
ATOM   266  C CA  . HIS A 1 33  ? 11.763  11.682  16.397 1.00 13.11 ? 33  HIS A CA  1 
ATOM   267  C C   . HIS A 1 33  ? 11.360  12.171  14.999 1.00 14.47 ? 33  HIS A C   1 
ATOM   268  O O   . HIS A 1 33  ? 11.365  13.378  14.690 1.00 15.41 ? 33  HIS A O   1 
ATOM   269  C CB  . HIS A 1 33  ? 12.333  12.919  17.109 1.00 19.80 ? 33  HIS A CB  1 
ATOM   270  C CG  . HIS A 1 33  ? 12.507  12.780  18.579 1.00 29.19 ? 33  HIS A CG  1 
ATOM   271  N ND1 . HIS A 1 33  ? 13.745  12.491  19.160 1.00 34.14 ? 33  HIS A ND1 1 
ATOM   272  C CD2 . HIS A 1 33  ? 11.562  12.914  19.556 1.00 31.41 ? 33  HIS A CD2 1 
ATOM   273  C CE1 . HIS A 1 33  ? 13.525  12.455  20.468 1.00 35.51 ? 33  HIS A CE1 1 
ATOM   274  N NE2 . HIS A 1 33  ? 12.239  12.687  20.733 1.00 37.96 ? 33  HIS A NE2 1 
ATOM   275  N N   . ASP A 1 34  ? 11.043  11.192  14.156 1.00 13.53 ? 34  ASP A N   1 
ATOM   276  C CA  . ASP A 1 34  ? 10.697  11.398  12.767 1.00 14.52 ? 34  ASP A CA  1 
ATOM   277  C C   . ASP A 1 34  ? 9.277   11.759  12.433 1.00 12.18 ? 34  ASP A C   1 
ATOM   278  O O   . ASP A 1 34  ? 9.000   12.073  11.291 1.00 12.33 ? 34  ASP A O   1 
ATOM   279  C CB  . ASP A 1 34  ? 11.257  10.248  11.924 1.00 11.66 ? 34  ASP A CB  1 
ATOM   280  C CG  . ASP A 1 34  ? 10.535  8.965   12.140 1.00 13.65 ? 34  ASP A CG  1 
ATOM   281  O OD1 . ASP A 1 34  ? 9.621   8.939   13.070 1.00 12.77 ? 34  ASP A OD1 1 
ATOM   282  O OD2 . ASP A 1 34  ? 10.764  8.021   11.440 1.00 14.99 ? 34  ASP A OD2 1 
ATOM   283  N N   . ASN A 1 35  ? 8.382   11.718  13.419 1.00 12.93 ? 35  ASN A N   1 
ATOM   284  C CA  . ASN A 1 35  ? 6.979   12.084  13.217 1.00 13.35 ? 35  ASN A CA  1 
ATOM   285  C C   . ASN A 1 35  ? 6.325   11.202  12.186 1.00 12.47 ? 35  ASN A C   1 
ATOM   286  O O   . ASN A 1 35  ? 5.364   11.589  11.565 1.00 15.08 ? 35  ASN A O   1 
ATOM   287  C CB  . ASN A 1 35  ? 6.823   13.579  12.817 1.00 21.96 ? 35  ASN A CB  1 
ATOM   288  C CG  . ASN A 1 35  ? 7.071   14.568  13.956 1.00 41.17 ? 35  ASN A CG  1 
ATOM   289  O OD1 . ASN A 1 35  ? 6.788   14.285  15.143 1.00 48.26 ? 35  ASN A OD1 1 
ATOM   290  N ND2 . ASN A 1 35  ? 7.589   15.754  13.632 1.00 44.25 ? 35  ASN A ND2 1 
ATOM   291  N N   . LEU A 1 36  ? 6.809   10.001  11.990 1.00 8.62  ? 36  LEU A N   1 
ATOM   292  C CA  . LEU A 1 36  ? 6.262   9.114   10.975 1.00 8.35  ? 36  LEU A CA  1 
ATOM   293  C C   . LEU A 1 36  ? 4.791   8.810   11.119 1.00 10.71 ? 36  LEU A C   1 
ATOM   294  O O   . LEU A 1 36  ? 4.274   8.403   12.152 1.00 10.75 ? 36  LEU A O   1 
ATOM   295  C CB  . LEU A 1 36  ? 7.077   7.800   11.019 1.00 7.87  ? 36  LEU A CB  1 
ATOM   296  C CG  . LEU A 1 36  ? 6.735   6.738   9.989  1.00 13.44 ? 36  LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 36  ? 7.069   7.305   8.606  1.00 15.31 ? 36  LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 36  ? 7.549   5.485   10.323 1.00 11.15 ? 36  LEU A CD2 1 
ATOM   299  N N   . LYS A 1 37  ? 4.119   8.944   10.005 1.00 8.56  ? 37  LYS A N   1 
ATOM   300  C CA  . LYS A 1 37  ? 2.713   8.681   9.880  1.00 9.23  ? 37  LYS A CA  1 
ATOM   301  C C   . LYS A 1 37  ? 2.551   7.805   8.634  1.00 13.82 ? 37  LYS A C   1 
ATOM   302  O O   . LYS A 1 37  ? 3.207   8.032   7.620  1.00 17.02 ? 37  LYS A O   1 
ATOM   303  C CB  . LYS A 1 37  ? 2.054   10.006  9.596  1.00 12.48 ? 37  LYS A CB  1 
ATOM   304  C CG  . LYS A 1 37  ? 0.633   9.805   9.130  1.00 23.99 ? 37  LYS A CG  1 
ATOM   305  C CD  . LYS A 1 37  ? 0.048   11.197  9.068  1.00 35.88 ? 37  LYS A CD  1 
ATOM   306  C CE  . LYS A 1 37  ? -1.095  11.382  8.088  1.00 47.60 ? 37  LYS A CE  1 
ATOM   307  N NZ  . LYS A 1 37  ? -1.327  12.816  7.791  1.00 54.35 ? 37  LYS A NZ  1 
ATOM   308  N N   . LEU A 1 38  ? 1.756   6.743   8.712  1.00 9.86  ? 38  LEU A N   1 
ATOM   309  C CA  . LEU A 1 38  ? 1.539   5.846   7.595  1.00 8.88  ? 38  LEU A CA  1 
ATOM   310  C C   . LEU A 1 38  ? 0.046   5.836   7.298  1.00 18.36 ? 38  LEU A C   1 
ATOM   311  O O   . LEU A 1 38  ? -0.780  5.733   8.256  1.00 18.96 ? 38  LEU A O   1 
ATOM   312  C CB  . LEU A 1 38  ? 1.908   4.392   8.047  1.00 9.62  ? 38  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 38  ? 3.355   4.171   8.494  1.00 14.29 ? 38  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 38  ? 3.553   2.722   8.918  1.00 14.67 ? 38  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 38  ? 4.342   4.480   7.370  1.00 17.43 ? 38  LEU A CD2 1 
ATOM   316  N N   . THR A 1 39  ? -0.296  5.897   6.003  1.00 10.91 ? 39  THR A N   1 
ATOM   317  C CA  . THR A 1 39  ? -1.677  5.784   5.606  1.00 13.18 ? 39  THR A CA  1 
ATOM   318  C C   . THR A 1 39  ? -1.697  4.521   4.742  1.00 10.09 ? 39  THR A C   1 
ATOM   319  O O   . THR A 1 39  ? -1.019  4.439   3.743  1.00 12.74 ? 39  THR A O   1 
ATOM   320  C CB  . THR A 1 39  ? -2.219  7.052   4.904  1.00 15.06 ? 39  THR A CB  1 
ATOM   321  O OG1 . THR A 1 39  ? -2.060  8.161   5.778  1.00 14.09 ? 39  THR A OG1 1 
ATOM   322  C CG2 . THR A 1 39  ? -3.703  6.877   4.564  1.00 14.81 ? 39  THR A CG2 1 
ATOM   323  N N   . ILE A 1 40  ? -2.399  3.521   5.210  1.00 8.93  ? 40  ILE A N   1 
ATOM   324  C CA  . ILE A 1 40  ? -2.414  2.222   4.598  1.00 11.17 ? 40  ILE A CA  1 
ATOM   325  C C   . ILE A 1 40  ? -3.736  1.923   3.952  1.00 12.29 ? 40  ILE A C   1 
ATOM   326  O O   . ILE A 1 40  ? -4.781  1.974   4.567  1.00 13.92 ? 40  ILE A O   1 
ATOM   327  C CB  . ILE A 1 40  ? -2.162  1.201   5.712  1.00 13.17 ? 40  ILE A CB  1 
ATOM   328  C CG1 . ILE A 1 40  ? -0.717  1.397   6.224  1.00 12.44 ? 40  ILE A CG1 1 
ATOM   329  C CG2 . ILE A 1 40  ? -2.293  -0.222  5.151  1.00 19.31 ? 40  ILE A CG2 1 
ATOM   330  C CD1 . ILE A 1 40  ? -0.348  0.500   7.398  1.00 15.17 ? 40  ILE A CD1 1 
ATOM   331  N N   . THR A 1 41  ? -3.713  1.557   2.675  1.00 11.18 ? 41  THR A N   1 
ATOM   332  C CA  . THR A 1 41  ? -4.950  1.181   1.985  1.00 11.09 ? 41  THR A CA  1 
ATOM   333  C C   . THR A 1 41  ? -4.595  -0.098  1.233  1.00 15.89 ? 41  THR A C   1 
ATOM   334  O O   . THR A 1 41  ? -3.463  -0.278  0.793  1.00 15.22 ? 41  THR A O   1 
ATOM   335  C CB  . THR A 1 41  ? -5.506  2.237   1.011  1.00 18.90 ? 41  THR A CB  1 
ATOM   336  O OG1 . THR A 1 41  ? -4.525  2.392   0.031  1.00 26.86 ? 41  THR A OG1 1 
ATOM   337  C CG2 . THR A 1 41  ? -5.706  3.639   1.626  1.00 17.80 ? 41  THR A CG2 1 
ATOM   338  N N   . GLN A 1 42  ? -5.555  -0.995  1.068  1.00 16.26 ? 42  GLN A N   1 
ATOM   339  C CA  . GLN A 1 42  ? -5.299  -2.248  0.400  1.00 20.70 ? 42  GLN A CA  1 
ATOM   340  C C   . GLN A 1 42  ? -6.267  -2.351  -0.755 1.00 21.79 ? 42  GLN A C   1 
ATOM   341  O O   . GLN A 1 42  ? -7.407  -1.892  -0.649 1.00 21.25 ? 42  GLN A O   1 
ATOM   342  C CB  . GLN A 1 42  ? -5.672  -3.371  1.395  1.00 24.96 ? 42  GLN A CB  1 
ATOM   343  C CG  . GLN A 1 42  ? -5.690  -4.804  0.849  1.00 27.64 ? 42  GLN A CG  1 
ATOM   344  C CD  . GLN A 1 42  ? -5.651  -5.851  1.948  1.00 31.07 ? 42  GLN A CD  1 
ATOM   345  O OE1 . GLN A 1 42  ? -5.670  -5.567  3.143  1.00 31.15 ? 42  GLN A OE1 1 
ATOM   346  N NE2 . GLN A 1 42  ? -5.577  -7.109  1.530  1.00 38.14 ? 42  GLN A NE2 1 
ATOM   347  N N   . GLU A 1 43  ? -5.823  -2.995  -1.829 1.00 16.41 ? 43  GLU A N   1 
ATOM   348  C CA  . GLU A 1 43  ? -6.724  -3.191  -2.953 1.00 21.90 ? 43  GLU A CA  1 
ATOM   349  C C   . GLU A 1 43  ? -6.303  -4.557  -3.446 1.00 21.86 ? 43  GLU A C   1 
ATOM   350  O O   . GLU A 1 43  ? -5.296  -4.712  -4.108 1.00 17.39 ? 43  GLU A O   1 
ATOM   351  C CB  . GLU A 1 43  ? -6.584  -2.114  -4.039 1.00 28.83 ? 43  GLU A CB  1 
ATOM   352  C CG  . GLU A 1 43  ? -7.670  -2.191  -5.107 1.00 43.87 ? 43  GLU A CG  1 
ATOM   353  C CD  . GLU A 1 43  ? -7.602  -0.969  -5.996 1.00 58.10 ? 43  GLU A CD  1 
ATOM   354  O OE1 . GLU A 1 43  ? -6.609  -0.253  -6.115 1.00 58.32 ? 43  GLU A OE1 1 
ATOM   355  O OE2 . GLU A 1 43  ? -8.742  -0.768  -6.621 1.00 65.46 ? 43  GLU A OE2 1 
ATOM   356  N N   . GLY A 1 44  ? -7.047  -5.516  -2.950 1.00 26.39 ? 44  GLY A N   1 
ATOM   357  C CA  . GLY A 1 44  ? -6.813  -6.903  -3.246 1.00 27.38 ? 44  GLY A CA  1 
ATOM   358  C C   . GLY A 1 44  ? -5.530  -7.367  -2.631 1.00 20.07 ? 44  GLY A C   1 
ATOM   359  O O   . GLY A 1 44  ? -5.381  -7.361  -1.423 1.00 23.55 ? 44  GLY A O   1 
ATOM   360  N N   . ASN A 1 45  ? -4.624  -7.774  -3.527 1.00 19.60 ? 45  ASN A N   1 
ATOM   361  C CA  . ASN A 1 45  ? -3.355  -8.294  -3.109 1.00 23.06 ? 45  ASN A CA  1 
ATOM   362  C C   . ASN A 1 45  ? -2.327  -7.191  -3.003 1.00 15.13 ? 45  ASN A C   1 
ATOM   363  O O   . ASN A 1 45  ? -1.169  -7.454  -2.681 1.00 17.56 ? 45  ASN A O   1 
ATOM   364  C CB  . ASN A 1 45  ? -2.862  -9.228  -4.245 1.00 28.07 ? 45  ASN A CB  1 
ATOM   365  C CG  . ASN A 1 45  ? -2.147  -10.424 -3.668 1.00 40.88 ? 45  ASN A CG  1 
ATOM   366  O OD1 . ASN A 1 45  ? -1.244  -11.027 -4.305 1.00 44.33 ? 45  ASN A OD1 1 
ATOM   367  N ND2 . ASN A 1 45  ? -2.572  -10.753 -2.438 1.00 41.90 ? 45  ASN A ND2 1 
ATOM   368  N N   . LYS A 1 46  ? -2.763  -5.970  -3.225 1.00 9.90  ? 46  LYS A N   1 
ATOM   369  C CA  . LYS A 1 46  ? -1.762  -4.913  -3.259 1.00 12.57 ? 46  LYS A CA  1 
ATOM   370  C C   . LYS A 1 46  ? -2.028  -3.830  -2.232 1.00 15.18 ? 46  LYS A C   1 
ATOM   371  O O   . LYS A 1 46  ? -3.168  -3.418  -2.029 1.00 19.41 ? 46  LYS A O   1 
ATOM   372  C CB  . LYS A 1 46  ? -2.041  -4.248  -4.610 1.00 21.07 ? 46  LYS A CB  1 
ATOM   373  C CG  . LYS A 1 46  ? -0.814  -4.119  -5.478 1.00 34.24 ? 46  LYS A CG  1 
ATOM   374  C CD  . LYS A 1 46  ? -1.192  -4.047  -6.952 1.00 36.46 ? 46  LYS A CD  1 
ATOM   375  C CE  . LYS A 1 46  ? -1.237  -2.634  -7.526 1.00 35.59 ? 46  LYS A CE  1 
ATOM   376  N NZ  . LYS A 1 46  ? -0.198  -2.346  -8.522 1.00 28.90 ? 46  LYS A NZ  1 
ATOM   377  N N   . PHE A 1 47  ? -0.944  -3.351  -1.664 1.00 12.43 ? 47  PHE A N   1 
ATOM   378  C CA  . PHE A 1 47  ? -1.042  -2.335  -0.634 1.00 15.42 ? 47  PHE A CA  1 
ATOM   379  C C   . PHE A 1 47  ? -0.443  -1.036  -1.108 1.00 18.21 ? 47  PHE A C   1 
ATOM   380  O O   . PHE A 1 47  ? 0.614   -1.062  -1.748 1.00 14.88 ? 47  PHE A O   1 
ATOM   381  C CB  . PHE A 1 47  ? -0.163  -2.825  0.577  1.00 14.31 ? 47  PHE A CB  1 
ATOM   382  C CG  . PHE A 1 47  ? -0.901  -3.804  1.480  1.00 18.05 ? 47  PHE A CG  1 
ATOM   383  C CD1 . PHE A 1 47  ? -0.926  -5.176  1.208  1.00 22.72 ? 47  PHE A CD1 1 
ATOM   384  C CD2 . PHE A 1 47  ? -1.671  -3.366  2.560  1.00 23.46 ? 47  PHE A CD2 1 
ATOM   385  C CE1 . PHE A 1 47  ? -1.642  -6.057  2.023  1.00 21.02 ? 47  PHE A CE1 1 
ATOM   386  C CE2 . PHE A 1 47  ? -2.451  -4.232  3.343  1.00 23.99 ? 47  PHE A CE2 1 
ATOM   387  C CZ  . PHE A 1 47  ? -2.429  -5.598  3.075  1.00 21.11 ? 47  PHE A CZ  1 
ATOM   388  N N   . THR A 1 48  ? -1.064  0.072   -0.709 1.00 14.06 ? 48  THR A N   1 
ATOM   389  C CA  . THR A 1 48  ? -0.454  1.335   -1.011 1.00 10.60 ? 48  THR A CA  1 
ATOM   390  C C   . THR A 1 48  ? -0.235  1.985   0.337  1.00 13.32 ? 48  THR A C   1 
ATOM   391  O O   . THR A 1 48  ? -1.193  2.175   1.096  1.00 19.07 ? 48  THR A O   1 
ATOM   392  C CB  . THR A 1 48  ? -1.289  2.248   -1.913 1.00 18.73 ? 48  THR A CB  1 
ATOM   393  O OG1 . THR A 1 48  ? -1.530  1.572   -3.150 1.00 19.24 ? 48  THR A OG1 1 
ATOM   394  C CG2 . THR A 1 48  ? -0.514  3.578   -2.120 1.00 17.24 ? 48  THR A CG2 1 
ATOM   395  N N   . VAL A 1 49  ? 0.996   2.351   0.631  1.00 13.40 ? 49  VAL A N   1 
ATOM   396  C CA  . VAL A 1 49  ? 1.272   2.995   1.885  1.00 16.03 ? 49  VAL A CA  1 
ATOM   397  C C   . VAL A 1 49  ? 1.822   4.397   1.654  1.00 18.49 ? 49  VAL A C   1 
ATOM   398  O O   . VAL A 1 49  ? 2.896   4.557   1.052  1.00 19.30 ? 49  VAL A O   1 
ATOM   399  C CB  . VAL A 1 49  ? 2.310   2.170   2.622  1.00 13.43 ? 49  VAL A CB  1 
ATOM   400  C CG1 . VAL A 1 49  ? 2.669   2.799   3.949  1.00 18.22 ? 49  VAL A CG1 1 
ATOM   401  C CG2 . VAL A 1 49  ? 1.745   0.773   2.878  1.00 19.52 ? 49  VAL A CG2 1 
ATOM   402  N N   . LYS A 1 50  ? 1.132   5.413   2.163  1.00 13.97 ? 50  LYS A N   1 
ATOM   403  C CA  . LYS A 1 50  ? 1.655   6.774   2.063  1.00 12.29 ? 50  LYS A CA  1 
ATOM   404  C C   . LYS A 1 50  ? 2.570   6.949   3.290  1.00 15.84 ? 50  LYS A C   1 
ATOM   405  O O   . LYS A 1 50  ? 2.117   6.892   4.420  1.00 15.53 ? 50  LYS A O   1 
ATOM   406  C CB  . LYS A 1 50  ? 0.564   7.830   2.023  1.00 17.02 ? 50  LYS A CB  1 
ATOM   407  C CG  . LYS A 1 50  ? -0.230  7.583   0.749  1.00 26.98 ? 50  LYS A CG  1 
ATOM   408  C CD  . LYS A 1 50  ? -1.315  8.521   0.290  1.00 34.62 ? 50  LYS A CD  1 
ATOM   409  C CE  . LYS A 1 50  ? -1.462  8.454   -1.233 1.00 35.57 ? 50  LYS A CE  1 
ATOM   410  N NZ  . LYS A 1 50  ? -0.553  9.305   -2.029 1.00 34.31 ? 50  LYS A NZ  1 
ATOM   411  N N   . GLU A 1 51  ? 3.863   7.099   3.109  1.00 14.29 ? 51  GLU A N   1 
ATOM   412  C CA  . GLU A 1 51  ? 4.747   7.269   4.220  1.00 10.63 ? 51  GLU A CA  1 
ATOM   413  C C   . GLU A 1 51  ? 5.049   8.753   4.370  1.00 13.82 ? 51  GLU A C   1 
ATOM   414  O O   . GLU A 1 51  ? 5.491   9.403   3.427  1.00 19.39 ? 51  GLU A O   1 
ATOM   415  C CB  . GLU A 1 51  ? 5.966   6.367   4.011  1.00 12.51 ? 51  GLU A CB  1 
ATOM   416  C CG  . GLU A 1 51  ? 7.188   6.815   4.813  1.00 14.22 ? 51  GLU A CG  1 
ATOM   417  C CD  . GLU A 1 51  ? 8.370   5.928   4.532  1.00 17.43 ? 51  GLU A CD  1 
ATOM   418  O OE1 . GLU A 1 51  ? 8.255   4.784   4.095  1.00 20.78 ? 51  GLU A OE1 1 
ATOM   419  O OE2 . GLU A 1 51  ? 9.496   6.588   4.676  1.00 14.53 ? 51  GLU A OE2 1 
ATOM   420  N N   . SER A 1 52  ? 4.757   9.387   5.497  1.00 10.70 ? 52  SER A N   1 
ATOM   421  C CA  . SER A 1 52  ? 5.014   10.815  5.603  1.00 10.05 ? 52  SER A CA  1 
ATOM   422  C C   . SER A 1 52  ? 5.839   11.099  6.846  1.00 15.00 ? 52  SER A C   1 
ATOM   423  O O   . SER A 1 52  ? 5.434   10.681  7.935  1.00 16.79 ? 52  SER A O   1 
ATOM   424  C CB  . SER A 1 52  ? 3.681   11.532  5.619  1.00 17.12 ? 52  SER A CB  1 
ATOM   425  O OG  . SER A 1 52  ? 4.003   12.862  5.984  1.00 26.15 ? 52  SER A OG  1 
ATOM   426  N N   . SER A 1 53  ? 6.997   11.723  6.733  1.00 10.36 ? 53  SER A N   1 
ATOM   427  C CA  . SER A 1 53  ? 7.784   11.924  7.932  1.00 12.55 ? 53  SER A CA  1 
ATOM   428  C C   . SER A 1 53  ? 8.531   13.228  7.791  1.00 14.47 ? 53  SER A C   1 
ATOM   429  O O   . SER A 1 53  ? 8.366   13.939  6.808  1.00 13.49 ? 53  SER A O   1 
ATOM   430  C CB  . SER A 1 53  ? 8.764   10.764  8.054  1.00 13.20 ? 53  SER A CB  1 
ATOM   431  O OG  . SER A 1 53  ? 9.877   10.960  7.173  1.00 12.41 ? 53  SER A OG  1 
ATOM   432  N N   . ASN A 1 54  ? 9.355   13.537  8.759  1.00 12.57 ? 54  ASN A N   1 
ATOM   433  C CA  . ASN A 1 54  ? 10.156  14.764  8.725  1.00 14.00 ? 54  ASN A CA  1 
ATOM   434  C C   . ASN A 1 54  ? 11.146  14.682  7.607  1.00 16.71 ? 54  ASN A C   1 
ATOM   435  O O   . ASN A 1 54  ? 11.612  15.718  7.142  1.00 16.20 ? 54  ASN A O   1 
ATOM   436  C CB  . ASN A 1 54  ? 10.964  15.022  10.014 1.00 15.83 ? 54  ASN A CB  1 
ATOM   437  C CG  . ASN A 1 54  ? 10.143  15.465  11.213 1.00 21.24 ? 54  ASN A CG  1 
ATOM   438  O OD1 . ASN A 1 54  ? 9.043   16.027  11.028 1.00 26.04 ? 54  ASN A OD1 1 
ATOM   439  N ND2 . ASN A 1 54  ? 10.620  15.223  12.442 1.00 18.08 ? 54  ASN A ND2 1 
ATOM   440  N N   . PHE A 1 55  ? 11.478  13.465  7.189  1.00 15.85 ? 55  PHE A N   1 
ATOM   441  C CA  . PHE A 1 55  ? 12.445  13.259  6.112  1.00 17.29 ? 55  PHE A CA  1 
ATOM   442  C C   . PHE A 1 55  ? 11.913  13.336  4.701  1.00 19.11 ? 55  PHE A C   1 
ATOM   443  O O   . PHE A 1 55  ? 12.592  13.908  3.843  1.00 15.19 ? 55  PHE A O   1 
ATOM   444  C CB  . PHE A 1 55  ? 13.166  11.913  6.178  1.00 18.82 ? 55  PHE A CB  1 
ATOM   445  C CG  . PHE A 1 55  ? 13.778  11.733  7.538  1.00 21.94 ? 55  PHE A CG  1 
ATOM   446  C CD1 . PHE A 1 55  ? 14.722  12.645  8.010  1.00 25.94 ? 55  PHE A CD1 1 
ATOM   447  C CD2 . PHE A 1 55  ? 13.426  10.666  8.363  1.00 21.67 ? 55  PHE A CD2 1 
ATOM   448  C CE1 . PHE A 1 55  ? 15.310  12.460  9.268  1.00 27.26 ? 55  PHE A CE1 1 
ATOM   449  C CE2 . PHE A 1 55  ? 14.025  10.470  9.608  1.00 25.12 ? 55  PHE A CE2 1 
ATOM   450  C CZ  . PHE A 1 55  ? 14.973  11.377  10.079 1.00 23.94 ? 55  PHE A CZ  1 
ATOM   451  N N   . ARG A 1 56  ? 10.700  12.836  4.498  1.00 11.77 ? 56  ARG A N   1 
ATOM   452  C CA  . ARG A 1 56  ? 10.169  12.790  3.156  1.00 14.35 ? 56  ARG A CA  1 
ATOM   453  C C   . ARG A 1 56  ? 8.730   12.382  3.131  1.00 15.72 ? 56  ARG A C   1 
ATOM   454  O O   . ARG A 1 56  ? 8.200   11.949  4.133  1.00 16.93 ? 56  ARG A O   1 
ATOM   455  C CB  . ARG A 1 56  ? 10.897  11.661  2.425  1.00 13.03 ? 56  ARG A CB  1 
ATOM   456  C CG  . ARG A 1 56  ? 10.763  10.248  2.990  1.00 10.65 ? 56  ARG A CG  1 
ATOM   457  C CD  . ARG A 1 56  ? 11.774  9.253   2.435  1.00 15.35 ? 56  ARG A CD  1 
ATOM   458  N NE  . ARG A 1 56  ? 11.498  7.913   2.981  1.00 17.42 ? 56  ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 56  ? 12.075  6.784   2.532  1.00 21.66 ? 56  ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 56  ? 12.988  6.830   1.551  1.00 17.86 ? 56  ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 56  ? 11.770  5.583   3.072  1.00 18.97 ? 56  ARG A NH2 1 
ATOM   462  N N   . ASN A 1 57  ? 8.144   12.439  1.948  1.00 11.73 ? 57  ASN A N   1 
ATOM   463  C CA  . ASN A 1 57  ? 6.760   12.011  1.782  1.00 15.09 ? 57  ASN A CA  1 
ATOM   464  C C   . ASN A 1 57  ? 6.714   11.176  0.515  1.00 24.35 ? 57  ASN A C   1 
ATOM   465  O O   . ASN A 1 57  ? 6.704   11.738  -0.584 1.00 31.37 ? 57  ASN A O   1 
ATOM   466  C CB  . ASN A 1 57  ? 5.798   13.207  1.673  1.00 19.18 ? 57  ASN A CB  1 
ATOM   467  C CG  . ASN A 1 57  ? 5.926   14.027  2.937  1.00 27.34 ? 57  ASN A CG  1 
ATOM   468  O OD1 . ASN A 1 57  ? 6.632   15.048  3.031  1.00 32.15 ? 57  ASN A OD1 1 
ATOM   469  N ND2 . ASN A 1 57  ? 5.248   13.547  3.952  1.00 28.01 ? 57  ASN A ND2 1 
ATOM   470  N N   . ILE A 1 58  ? 6.598   9.856   0.637  1.00 16.10 ? 58  ILE A N   1 
ATOM   471  C CA  . ILE A 1 58  ? 6.591   9.011   -0.537 1.00 11.72 ? 58  ILE A CA  1 
ATOM   472  C C   . ILE A 1 58  ? 5.517   7.975   -0.468 1.00 17.82 ? 58  ILE A C   1 
ATOM   473  O O   . ILE A 1 58  ? 4.931   7.769   0.577  1.00 19.48 ? 58  ILE A O   1 
ATOM   474  C CB  . ILE A 1 58  ? 7.906   8.248   -0.643 1.00 17.22 ? 58  ILE A CB  1 
ATOM   475  C CG1 . ILE A 1 58  ? 8.058   7.361   0.581  1.00 21.35 ? 58  ILE A CG1 1 
ATOM   476  C CG2 . ILE A 1 58  ? 9.047   9.269   -0.690 1.00 24.53 ? 58  ILE A CG2 1 
ATOM   477  C CD1 . ILE A 1 58  ? 9.354   6.557   0.612  1.00 26.92 ? 58  ILE A CD1 1 
ATOM   478  N N   . ASP A 1 59  ? 5.269   7.351   -1.623 1.00 14.18 ? 59  ASP A N   1 
ATOM   479  C CA  . ASP A 1 59  ? 4.298   6.294   -1.701 1.00 16.55 ? 59  ASP A CA  1 
ATOM   480  C C   . ASP A 1 59  ? 5.086   4.995   -1.779 1.00 17.04 ? 59  ASP A C   1 
ATOM   481  O O   . ASP A 1 59  ? 6.177   4.928   -2.385 1.00 18.78 ? 59  ASP A O   1 
ATOM   482  C CB  . ASP A 1 59  ? 3.449   6.495   -2.953 1.00 22.60 ? 59  ASP A CB  1 
ATOM   483  C CG  . ASP A 1 59  ? 2.365   7.500   -2.797 1.00 32.19 ? 59  ASP A CG  1 
ATOM   484  O OD1 . ASP A 1 59  ? 2.569   8.320   -1.801 1.00 32.97 ? 59  ASP A OD1 1 
ATOM   485  O OD2 . ASP A 1 59  ? 1.405   7.516   -3.537 1.00 42.26 ? 59  ASP A OD2 1 
ATOM   486  N N   . VAL A 1 60  ? 4.582   3.969   -1.093 1.00 7.74  ? 60  VAL A N   1 
ATOM   487  C CA  . VAL A 1 60  ? 5.238   2.696   -1.111 1.00 9.98  ? 60  VAL A CA  1 
ATOM   488  C C   . VAL A 1 60  ? 4.152   1.758   -1.620 1.00 12.82 ? 60  VAL A C   1 
ATOM   489  O O   . VAL A 1 60  ? 3.102   1.634   -0.993 1.00 13.73 ? 60  VAL A O   1 
ATOM   490  C CB  . VAL A 1 60  ? 5.754   2.294   0.250  1.00 14.16 ? 60  VAL A CB  1 
ATOM   491  C CG1 . VAL A 1 60  ? 6.506   1.005   0.056  1.00 14.91 ? 60  VAL A CG1 1 
ATOM   492  C CG2 . VAL A 1 60  ? 6.762   3.335   0.734  1.00 15.26 ? 60  VAL A CG2 1 
ATOM   493  N N   . VAL A 1 61  ? 4.366   1.108   -2.769 1.00 12.27 ? 61  VAL A N   1 
ATOM   494  C CA  . VAL A 1 61  ? 3.312   0.247   -3.303 1.00 10.95 ? 61  VAL A CA  1 
ATOM   495  C C   . VAL A 1 61  ? 3.868   -1.139  -3.496 1.00 14.80 ? 61  VAL A C   1 
ATOM   496  O O   . VAL A 1 61  ? 4.964   -1.227  -4.030 1.00 14.31 ? 61  VAL A O   1 
ATOM   497  C CB  . VAL A 1 61  ? 2.875   0.835   -4.635 1.00 13.88 ? 61  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 61  ? 1.876   -0.103  -5.297 1.00 14.41 ? 61  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 61  ? 2.243   2.196   -4.429 1.00 17.31 ? 61  VAL A CG2 1 
ATOM   500  N N   . PHE A 1 62  ? 3.212   -2.196  -3.031 1.00 12.73 ? 62  PHE A N   1 
ATOM   501  C CA  . PHE A 1 62  ? 3.742   -3.536  -3.212 1.00 10.74 ? 62  PHE A CA  1 
ATOM   502  C C   . PHE A 1 62  ? 2.576   -4.526  -3.343 1.00 11.94 ? 62  PHE A C   1 
ATOM   503  O O   . PHE A 1 62  ? 1.432   -4.237  -2.959 1.00 12.88 ? 62  PHE A O   1 
ATOM   504  C CB  . PHE A 1 62  ? 4.762   -3.913  -2.113 1.00 13.60 ? 62  PHE A CB  1 
ATOM   505  C CG  . PHE A 1 62  ? 4.137   -3.866  -0.724 1.00 14.72 ? 62  PHE A CG  1 
ATOM   506  C CD1 . PHE A 1 62  ? 3.405   -4.949  -0.234 1.00 15.30 ? 62  PHE A CD1 1 
ATOM   507  C CD2 . PHE A 1 62  ? 4.255   -2.748  0.103  1.00 14.60 ? 62  PHE A CD2 1 
ATOM   508  C CE1 . PHE A 1 62  ? 2.758   -4.908  1.002  1.00 16.17 ? 62  PHE A CE1 1 
ATOM   509  C CE2 . PHE A 1 62  ? 3.643   -2.696  1.358  1.00 16.57 ? 62  PHE A CE2 1 
ATOM   510  C CZ  . PHE A 1 62  ? 2.855   -3.763  1.792  1.00 14.61 ? 62  PHE A CZ  1 
ATOM   511  N N   . GLU A 1 63  ? 2.866   -5.655  -3.971 1.00 10.52 ? 63  GLU A N   1 
ATOM   512  C CA  . GLU A 1 63  ? 1.944   -6.784  -4.127 1.00 13.94 ? 63  GLU A CA  1 
ATOM   513  C C   . GLU A 1 63  ? 2.474   -7.892  -3.215 1.00 12.66 ? 63  GLU A C   1 
ATOM   514  O O   . GLU A 1 63  ? 3.672   -8.176  -3.159 1.00 10.85 ? 63  GLU A O   1 
ATOM   515  C CB  . GLU A 1 63  ? 1.818   -7.361  -5.541 1.00 15.08 ? 63  GLU A CB  1 
ATOM   516  C CG  . GLU A 1 63  ? 0.682   -8.392  -5.634 1.00 25.94 ? 63  GLU A CG  1 
ATOM   517  C CD  . GLU A 1 63  ? 0.487   -8.965  -7.033 1.00 34.89 ? 63  GLU A CD  1 
ATOM   518  O OE1 . GLU A 1 63  ? 1.124   -8.305  -7.988 1.00 30.82 ? 63  GLU A OE1 1 
ATOM   519  O OE2 . GLU A 1 63  ? -0.203  -9.965  -7.242 1.00 37.74 ? 63  GLU A OE2 1 
ATOM   520  N N   . LEU A 1 64  ? 1.587   -8.496  -2.438 1.00 10.03 ? 64  LEU A N   1 
ATOM   521  C CA  . LEU A 1 64  ? 2.045   -9.532  -1.536 1.00 14.82 ? 64  LEU A CA  1 
ATOM   522  C C   . LEU A 1 64  ? 2.764   -10.640 -2.307 1.00 14.67 ? 64  LEU A C   1 
ATOM   523  O O   . LEU A 1 64  ? 2.268   -11.073 -3.343 1.00 14.56 ? 64  LEU A O   1 
ATOM   524  C CB  . LEU A 1 64  ? 0.820   -10.140 -0.805 1.00 16.62 ? 64  LEU A CB  1 
ATOM   525  C CG  . LEU A 1 64  ? 0.105   -9.160  0.137  1.00 14.78 ? 64  LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 64  ? -1.099  -9.898  0.705  1.00 19.40 ? 64  LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 64  ? 1.063   -8.825  1.270  1.00 15.48 ? 64  LEU A CD2 1 
ATOM   528  N N   . GLY A 1 65  ? 3.920   -11.063 -1.845 1.00 13.52 ? 65  GLY A N   1 
ATOM   529  C CA  . GLY A 1 65  ? 4.628   -12.150 -2.522 1.00 13.59 ? 65  GLY A CA  1 
ATOM   530  C C   . GLY A 1 65  ? 5.482   -11.748 -3.730 1.00 17.22 ? 65  GLY A C   1 
ATOM   531  O O   . GLY A 1 65  ? 6.173   -12.594 -4.267 1.00 19.02 ? 65  GLY A O   1 
ATOM   532  N N   . VAL A 1 66  ? 5.499   -10.480 -4.161 1.00 15.26 ? 66  VAL A N   1 
ATOM   533  C CA  . VAL A 1 66  ? 6.310   -10.058 -5.275 1.00 10.00 ? 66  VAL A CA  1 
ATOM   534  C C   . VAL A 1 66  ? 7.448   -9.171  -4.804 1.00 11.42 ? 66  VAL A C   1 
ATOM   535  O O   . VAL A 1 66  ? 7.174   -8.197  -4.130 1.00 13.75 ? 66  VAL A O   1 
ATOM   536  C CB  . VAL A 1 66  ? 5.396   -9.351  -6.262 1.00 12.91 ? 66  VAL A CB  1 
ATOM   537  C CG1 . VAL A 1 66  ? 6.178   -8.810  -7.448 1.00 16.13 ? 66  VAL A CG1 1 
ATOM   538  C CG2 . VAL A 1 66  ? 4.246   -10.269 -6.696 1.00 14.16 ? 66  VAL A CG2 1 
ATOM   539  N N   . ASP A 1 67  ? 8.700   -9.398  -5.207 1.00 11.16 ? 67  ASP A N   1 
ATOM   540  C CA  . ASP A 1 67  ? 9.775   -8.547  -4.760 1.00 13.24 ? 67  ASP A CA  1 
ATOM   541  C C   . ASP A 1 67  ? 9.669   -7.160  -5.266 1.00 16.62 ? 67  ASP A C   1 
ATOM   542  O O   . ASP A 1 67  ? 9.208   -6.970  -6.374 1.00 17.69 ? 67  ASP A O   1 
ATOM   543  C CB  . ASP A 1 67  ? 11.173  -8.826  -5.257 1.00 29.01 ? 67  ASP A CB  1 
ATOM   544  C CG  . ASP A 1 67  ? 11.207  -10.259 -5.566 1.00 46.77 ? 67  ASP A CG  1 
ATOM   545  O OD1 . ASP A 1 67  ? 11.373  -11.104 -4.698 1.00 49.83 ? 67  ASP A OD1 1 
ATOM   546  O OD2 . ASP A 1 67  ? 10.950  -10.403 -6.849 1.00 53.61 ? 67  ASP A OD2 1 
ATOM   547  N N   . PHE A 1 68  ? 10.164  -6.233  -4.473 1.00 14.45 ? 68  PHE A N   1 
ATOM   548  C CA  . PHE A 1 68  ? 10.144  -4.836  -4.848 1.00 10.59 ? 68  PHE A CA  1 
ATOM   549  C C   . PHE A 1 68  ? 11.285  -4.165  -4.177 1.00 13.10 ? 68  PHE A C   1 
ATOM   550  O O   . PHE A 1 68  ? 11.979  -4.779  -3.356 1.00 15.28 ? 68  PHE A O   1 
ATOM   551  C CB  . PHE A 1 68  ? 8.824   -4.186  -4.532 1.00 14.14 ? 68  PHE A CB  1 
ATOM   552  C CG  . PHE A 1 68  ? 8.611   -3.923  -3.068 1.00 17.47 ? 68  PHE A CG  1 
ATOM   553  C CD1 . PHE A 1 68  ? 8.326   -4.969  -2.188 1.00 14.71 ? 68  PHE A CD1 1 
ATOM   554  C CD2 . PHE A 1 68  ? 8.568   -2.603  -2.613 1.00 21.64 ? 68  PHE A CD2 1 
ATOM   555  C CE1 . PHE A 1 68  ? 8.146   -4.691  -0.837 1.00 16.39 ? 68  PHE A CE1 1 
ATOM   556  C CE2 . PHE A 1 68  ? 8.336   -2.294  -1.270 1.00 16.57 ? 68  PHE A CE2 1 
ATOM   557  C CZ  . PHE A 1 68  ? 8.168   -3.366  -0.390 1.00 16.79 ? 68  PHE A CZ  1 
ATOM   558  N N   . ALA A 1 69  ? 11.555  -2.959  -4.582 1.00 12.64 ? 69  ALA A N   1 
ATOM   559  C CA  . ALA A 1 69  ? 12.724  -2.340  -3.971 1.00 16.86 ? 69  ALA A CA  1 
ATOM   560  C C   . ALA A 1 69  ? 12.276  -1.212  -3.081 1.00 17.52 ? 69  ALA A C   1 
ATOM   561  O O   . ALA A 1 69  ? 11.251  -0.557  -3.328 1.00 17.58 ? 69  ALA A O   1 
ATOM   562  C CB  . ALA A 1 69  ? 13.677  -1.851  -5.060 1.00 21.38 ? 69  ALA A CB  1 
ATOM   563  N N   . TYR A 1 70  ? 13.021  -0.980  -2.004 1.00 18.19 ? 70  TYR A N   1 
ATOM   564  C CA  . TYR A 1 70  ? 12.624  0.057   -1.096 1.00 16.43 ? 70  TYR A CA  1 
ATOM   565  C C   . TYR A 1 70  ? 13.882  0.717   -0.581 1.00 14.00 ? 70  TYR A C   1 
ATOM   566  O O   . TYR A 1 70  ? 14.811  0.036   -0.172 1.00 19.08 ? 70  TYR A O   1 
ATOM   567  C CB  . TYR A 1 70  ? 11.816  -0.552  0.112  1.00 19.41 ? 70  TYR A CB  1 
ATOM   568  C CG  . TYR A 1 70  ? 11.432  0.438   1.221  1.00 15.09 ? 70  TYR A CG  1 
ATOM   569  C CD1 . TYR A 1 70  ? 10.382  1.335   1.046  1.00 14.31 ? 70  TYR A CD1 1 
ATOM   570  C CD2 . TYR A 1 70  ? 12.132  0.521   2.425  1.00 16.70 ? 70  TYR A CD2 1 
ATOM   571  C CE1 . TYR A 1 70  ? 9.982   2.273   2.001  1.00 16.41 ? 70  TYR A CE1 1 
ATOM   572  C CE2 . TYR A 1 70  ? 11.735  1.423   3.415  1.00 18.51 ? 70  TYR A CE2 1 
ATOM   573  C CZ  . TYR A 1 70  ? 10.687  2.315   3.206  1.00 19.49 ? 70  TYR A CZ  1 
ATOM   574  O OH  . TYR A 1 70  ? 10.376  3.258   4.167  1.00 17.13 ? 70  TYR A OH  1 
ATOM   575  N N   . SER A 1 71  ? 13.830  2.036   -0.543 1.00 11.54 ? 71  SER A N   1 
ATOM   576  C CA  . SER A 1 71  ? 14.887  2.840   -0.012 1.00 18.26 ? 71  SER A CA  1 
ATOM   577  C C   . SER A 1 71  ? 14.568  3.449   1.352  1.00 16.00 ? 71  SER A C   1 
ATOM   578  O O   . SER A 1 71  ? 13.505  4.062   1.592  1.00 16.94 ? 71  SER A O   1 
ATOM   579  C CB  . SER A 1 71  ? 15.070  4.052   -0.921 1.00 32.92 ? 71  SER A CB  1 
ATOM   580  O OG  . SER A 1 71  ? 15.755  3.701   -2.098 1.00 42.00 ? 71  SER A OG  1 
ATOM   581  N N   . LEU A 1 72  ? 15.550  3.284   2.238  1.00 13.89 ? 72  LEU A N   1 
ATOM   582  C CA  . LEU A 1 72  ? 15.518  3.851   3.587  1.00 20.49 ? 72  LEU A CA  1 
ATOM   583  C C   . LEU A 1 72  ? 15.738  5.366   3.468  1.00 20.65 ? 72  LEU A C   1 
ATOM   584  O O   . LEU A 1 72  ? 16.289  5.882   2.491  1.00 18.11 ? 72  LEU A O   1 
ATOM   585  C CB  . LEU A 1 72  ? 16.565  3.201   4.548  1.00 19.63 ? 72  LEU A CB  1 
ATOM   586  C CG  . LEU A 1 72  ? 16.342  1.701   4.757  1.00 22.09 ? 72  LEU A CG  1 
ATOM   587  C CD1 . LEU A 1 72  ? 17.251  1.114   5.850  1.00 19.29 ? 72  LEU A CD1 1 
ATOM   588  C CD2 . LEU A 1 72  ? 14.865  1.485   5.060  1.00 27.33 ? 72  LEU A CD2 1 
ATOM   589  N N   . ALA A 1 73  ? 15.343  6.135   4.476  1.00 23.67 ? 73  ALA A N   1 
ATOM   590  C CA  . ALA A 1 73  ? 15.461  7.568   4.383  1.00 24.69 ? 73  ALA A CA  1 
ATOM   591  C C   . ALA A 1 73  ? 16.914  7.980   4.245  1.00 26.98 ? 73  ALA A C   1 
ATOM   592  O O   . ALA A 1 73  ? 17.265  9.021   3.693  1.00 26.72 ? 73  ALA A O   1 
ATOM   593  C CB  . ALA A 1 73  ? 14.783  8.197   5.594  1.00 20.54 ? 73  ALA A CB  1 
ATOM   594  N N   . ASP A 1 74  ? 17.794  7.119   4.723  1.00 24.15 ? 74  ASP A N   1 
ATOM   595  C CA  . ASP A 1 74  ? 19.165  7.557   4.567  1.00 24.89 ? 74  ASP A CA  1 
ATOM   596  C C   . ASP A 1 74  ? 19.798  7.222   3.246  1.00 27.10 ? 74  ASP A C   1 
ATOM   597  O O   . ASP A 1 74  ? 20.980  7.454   3.062  1.00 27.67 ? 74  ASP A O   1 
ATOM   598  C CB  . ASP A 1 74  ? 20.021  6.934   5.644  1.00 27.68 ? 74  ASP A CB  1 
ATOM   599  C CG  . ASP A 1 74  ? 20.273  5.485   5.353  1.00 30.76 ? 74  ASP A CG  1 
ATOM   600  O OD1 . ASP A 1 74  ? 19.243  4.830   4.863  1.00 26.72 ? 74  ASP A OD1 1 
ATOM   601  O OD2 . ASP A 1 74  ? 21.347  4.970   5.622  1.00 35.25 ? 74  ASP A OD2 1 
ATOM   602  N N   . GLY A 1 75  ? 19.025  6.665   2.326  1.00 27.29 ? 75  GLY A N   1 
ATOM   603  C CA  . GLY A 1 75  ? 19.560  6.299   1.036  1.00 23.97 ? 75  GLY A CA  1 
ATOM   604  C C   . GLY A 1 75  ? 19.848  4.804   0.905  1.00 21.54 ? 75  GLY A C   1 
ATOM   605  O O   . GLY A 1 75  ? 20.070  4.325   -0.184 1.00 25.00 ? 75  GLY A O   1 
ATOM   606  N N   . THR A 1 76  ? 19.827  4.011   1.973  1.00 15.31 ? 76  THR A N   1 
ATOM   607  C CA  . THR A 1 76  ? 20.082  2.583   1.954  1.00 13.23 ? 76  THR A CA  1 
ATOM   608  C C   . THR A 1 76  ? 18.990  1.851   1.221  1.00 13.09 ? 76  THR A C   1 
ATOM   609  O O   . THR A 1 76  ? 17.794  1.990   1.480  1.00 14.45 ? 76  THR A O   1 
ATOM   610  C CB  . THR A 1 76  ? 20.190  1.980   3.365  1.00 13.71 ? 76  THR A CB  1 
ATOM   611  O OG1 . THR A 1 76  ? 21.316  2.531   3.980  1.00 22.76 ? 76  THR A OG1 1 
ATOM   612  C CG2 . THR A 1 76  ? 20.467  0.495   3.340  1.00 12.07 ? 76  THR A CG2 1 
ATOM   613  N N   . GLU A 1 77  ? 19.465  1.052   0.272  1.00 14.35 ? 77  GLU A N   1 
ATOM   614  C CA  . GLU A 1 77  ? 18.519  0.284   -0.534 1.00 19.75 ? 77  GLU A CA  1 
ATOM   615  C C   . GLU A 1 77  ? 18.305  -1.155  -0.115 1.00 16.13 ? 77  GLU A C   1 
ATOM   616  O O   . GLU A 1 77  ? 19.264  -1.928  0.100  1.00 15.22 ? 77  GLU A O   1 
ATOM   617  C CB  . GLU A 1 77  ? 18.943  0.278   -2.020 1.00 28.56 ? 77  GLU A CB  1 
ATOM   618  C CG  . GLU A 1 77  ? 18.394  1.541   -2.713 1.00 38.33 ? 77  GLU A CG  1 
ATOM   619  C CD  . GLU A 1 77  ? 19.351  2.108   -3.724 1.00 47.45 ? 77  GLU A CD  1 
ATOM   620  O OE1 . GLU A 1 77  ? 20.383  1.521   -4.083 1.00 45.78 ? 77  GLU A OE1 1 
ATOM   621  O OE2 . GLU A 1 77  ? 18.937  3.304   -4.105 1.00 53.13 ? 77  GLU A OE2 1 
ATOM   622  N N   . LEU A 1 78  ? 17.027  -1.521  -0.140 1.00 13.95 ? 78  LEU A N   1 
ATOM   623  C CA  . LEU A 1 78  ? 16.688  -2.897  0.184  1.00 13.11 ? 78  LEU A CA  1 
ATOM   624  C C   . LEU A 1 78  ? 15.827  -3.485  -0.936 1.00 12.83 ? 78  LEU A C   1 
ATOM   625  O O   . LEU A 1 78  ? 15.074  -2.799  -1.648 1.00 16.46 ? 78  LEU A O   1 
ATOM   626  C CB  . LEU A 1 78  ? 15.656  -2.897  1.370  1.00 16.65 ? 78  LEU A CB  1 
ATOM   627  C CG  . LEU A 1 78  ? 16.039  -2.108  2.635  1.00 19.75 ? 78  LEU A CG  1 
ATOM   628  C CD1 . LEU A 1 78  ? 14.972  -2.294  3.721  1.00 17.98 ? 78  LEU A CD1 1 
ATOM   629  C CD2 . LEU A 1 78  ? 17.356  -2.670  3.131  1.00 17.56 ? 78  LEU A CD2 1 
ATOM   630  N N   . THR A 1 79  ? 15.840  -4.815  -1.014 1.00 13.39 ? 79  THR A N   1 
ATOM   631  C CA  . THR A 1 79  ? 14.894  -5.480  -1.901 1.00 13.98 ? 79  THR A CA  1 
ATOM   632  C C   . THR A 1 79  ? 14.279  -6.650  -1.114 1.00 13.80 ? 79  THR A C   1 
ATOM   633  O O   . THR A 1 79  ? 14.933  -7.289  -0.265 1.00 16.41 ? 79  THR A O   1 
ATOM   634  C CB  . THR A 1 79  ? 15.586  -6.026  -3.162 1.00 22.41 ? 79  THR A CB  1 
ATOM   635  O OG1 . THR A 1 79  ? 16.644  -6.867  -2.763 1.00 21.92 ? 79  THR A OG1 1 
ATOM   636  C CG2 . THR A 1 79  ? 16.234  -4.846  -3.880 1.00 26.35 ? 79  THR A CG2 1 
ATOM   637  N N   . GLY A 1 80  ? 13.016  -6.959  -1.324 1.00 14.53 ? 80  GLY A N   1 
ATOM   638  C CA  . GLY A 1 80  ? 12.507  -8.099  -0.596 1.00 11.65 ? 80  GLY A CA  1 
ATOM   639  C C   . GLY A 1 80  ? 11.031  -8.186  -0.865 1.00 10.97 ? 80  GLY A C   1 
ATOM   640  O O   . GLY A 1 80  ? 10.512  -7.537  -1.773 1.00 11.31 ? 80  GLY A O   1 
ATOM   641  N N   . THR A 1 81  ? 10.325  -8.990  -0.059 1.00 12.05 ? 81  THR A N   1 
ATOM   642  C CA  . THR A 1 81  ? 8.866   -9.166  -0.190 1.00 15.65 ? 81  THR A CA  1 
ATOM   643  C C   . THR A 1 81  ? 8.161   -9.114  1.146  1.00 15.65 ? 81  THR A C   1 
ATOM   644  O O   . THR A 1 81  ? 8.712   -9.330  2.232  1.00 20.33 ? 81  THR A O   1 
ATOM   645  C CB  . THR A 1 81  ? 8.490   -10.604 -0.646 1.00 19.46 ? 81  THR A CB  1 
ATOM   646  O OG1 . THR A 1 81  ? 9.052   -11.449 0.343  1.00 23.72 ? 81  THR A OG1 1 
ATOM   647  C CG2 . THR A 1 81  ? 9.309   -10.851 -1.895 1.00 17.17 ? 81  THR A CG2 1 
ATOM   648  N N   . TRP A 1 82  ? 6.898   -8.815  1.011  1.00 12.60 ? 82  TRP A N   1 
ATOM   649  C CA  . TRP A 1 82  ? 6.053   -8.867  2.163  1.00 11.85 ? 82  TRP A CA  1 
ATOM   650  C C   . TRP A 1 82  ? 5.085   -10.016 1.820  1.00 15.37 ? 82  TRP A C   1 
ATOM   651  O O   . TRP A 1 82  ? 4.579   -10.155 0.684  1.00 15.90 ? 82  TRP A O   1 
ATOM   652  C CB  . TRP A 1 82  ? 5.166   -7.604  2.316  1.00 15.10 ? 82  TRP A CB  1 
ATOM   653  C CG  . TRP A 1 82  ? 5.843   -6.372  2.847  1.00 18.49 ? 82  TRP A CG  1 
ATOM   654  C CD1 . TRP A 1 82  ? 6.154   -5.248  2.154  1.00 14.72 ? 82  TRP A CD1 1 
ATOM   655  C CD2 . TRP A 1 82  ? 6.165   -6.083  4.223  1.00 17.88 ? 82  TRP A CD2 1 
ATOM   656  N NE1 . TRP A 1 82  ? 6.722   -4.309  3.003  1.00 13.68 ? 82  TRP A NE1 1 
ATOM   657  C CE2 . TRP A 1 82  ? 6.700   -4.779  4.286  1.00 14.86 ? 82  TRP A CE2 1 
ATOM   658  C CE3 . TRP A 1 82  ? 6.043   -6.830  5.394  1.00 21.25 ? 82  TRP A CE3 1 
ATOM   659  C CZ2 . TRP A 1 82  ? 7.136   -4.186  5.463  1.00 15.95 ? 82  TRP A CZ2 1 
ATOM   660  C CZ3 . TRP A 1 82  ? 6.440   -6.222  6.568  1.00 19.61 ? 82  TRP A CZ3 1 
ATOM   661  C CH2 . TRP A 1 82  ? 7.038   -4.954  6.583  1.00 16.67 ? 82  TRP A CH2 1 
ATOM   662  N N   . THR A 1 83  ? 4.712   -10.810 2.831  1.00 15.49 ? 83  THR A N   1 
ATOM   663  C CA  . THR A 1 83  ? 3.715   -11.867 2.678  1.00 17.93 ? 83  THR A CA  1 
ATOM   664  C C   . THR A 1 83  ? 2.835   -11.887 3.918  1.00 18.11 ? 83  THR A C   1 
ATOM   665  O O   . THR A 1 83  ? 3.220   -11.403 4.960  1.00 20.90 ? 83  THR A O   1 
ATOM   666  C CB  . THR A 1 83  ? 4.318   -13.238 2.379  1.00 25.86 ? 83  THR A CB  1 
ATOM   667  O OG1 . THR A 1 83  ? 5.010   -13.625 3.534  1.00 33.05 ? 83  THR A OG1 1 
ATOM   668  C CG2 . THR A 1 83  ? 5.350   -13.037 1.280  1.00 25.40 ? 83  THR A CG2 1 
ATOM   669  N N   . MET A 1 84  ? 1.600   -12.274 3.799  1.00 18.03 ? 84  MET A N   1 
ATOM   670  C CA  . MET A 1 84  ? 0.695   -12.274 4.941  1.00 22.38 ? 84  MET A CA  1 
ATOM   671  C C   . MET A 1 84  ? 0.778   -13.655 5.556  1.00 30.67 ? 84  MET A C   1 
ATOM   672  O O   . MET A 1 84  ? 0.523   -14.635 4.851  1.00 31.62 ? 84  MET A O   1 
ATOM   673  C CB  . MET A 1 84  ? -0.720  -11.990 4.404  1.00 25.00 ? 84  MET A CB  1 
ATOM   674  C CG  . MET A 1 84  ? -1.832  -11.810 5.428  1.00 33.33 ? 84  MET A CG  1 
ATOM   675  S SD  . MET A 1 84  ? -1.916  -10.098 6.025  1.00 41.06 ? 84  MET A SD  1 
ATOM   676  C CE  . MET A 1 84  ? -3.009  -9.382  4.763  1.00 39.55 ? 84  MET A CE  1 
ATOM   677  N N   . GLU A 1 85  ? 1.168   -13.784 6.821  1.00 30.83 ? 85  GLU A N   1 
ATOM   678  C CA  . GLU A 1 85  ? 1.280   -15.094 7.442  1.00 41.26 ? 85  GLU A CA  1 
ATOM   679  C C   . GLU A 1 85  ? 0.348   -15.006 8.631  1.00 50.25 ? 85  GLU A C   1 
ATOM   680  O O   . GLU A 1 85  ? 0.600   -14.253 9.583  1.00 49.57 ? 85  GLU A O   1 
ATOM   681  C CB  . GLU A 1 85  ? 2.686   -15.331 8.004  1.00 46.28 ? 85  GLU A CB  1 
ATOM   682  C CG  . GLU A 1 85  ? 3.340   -16.661 7.598  1.00 56.58 ? 85  GLU A CG  1 
ATOM   683  C CD  . GLU A 1 85  ? 4.344   -16.393 6.502  1.00 66.62 ? 85  GLU A CD  1 
ATOM   684  O OE1 . GLU A 1 85  ? 3.774   -16.202 5.341  1.00 70.14 ? 85  GLU A OE1 1 
ATOM   685  O OE2 . GLU A 1 85  ? 5.554   -16.357 6.696  1.00 68.34 ? 85  GLU A OE2 1 
ATOM   686  N N   . GLY A 1 86  ? -0.747  -15.759 8.581  1.00 52.18 ? 86  GLY A N   1 
ATOM   687  C CA  . GLY A 1 86  ? -1.678  -15.630 9.674  1.00 48.22 ? 86  GLY A CA  1 
ATOM   688  C C   . GLY A 1 86  ? -2.285  -14.243 9.527  1.00 43.82 ? 86  GLY A C   1 
ATOM   689  O O   . GLY A 1 86  ? -2.853  -13.898 8.487  1.00 42.64 ? 86  GLY A O   1 
ATOM   690  N N   . ASN A 1 87  ? -2.177  -13.459 10.594 1.00 42.22 ? 87  ASN A N   1 
ATOM   691  C CA  . ASN A 1 87  ? -2.716  -12.104 10.635 1.00 42.56 ? 87  ASN A CA  1 
ATOM   692  C C   . ASN A 1 87  ? -1.658  -11.006 10.594 1.00 28.46 ? 87  ASN A C   1 
ATOM   693  O O   . ASN A 1 87  ? -1.940  -9.841  10.841 1.00 26.32 ? 87  ASN A O   1 
ATOM   694  C CB  . ASN A 1 87  ? -3.579  -11.918 11.890 1.00 55.85 ? 87  ASN A CB  1 
ATOM   695  C CG  . ASN A 1 87  ? -5.036  -11.758 11.518 1.00 70.47 ? 87  ASN A CG  1 
ATOM   696  O OD1 . ASN A 1 87  ? -5.392  -10.784 10.819 1.00 74.90 ? 87  ASN A OD1 1 
ATOM   697  N ND2 . ASN A 1 87  ? -5.858  -12.702 11.990 1.00 75.39 ? 87  ASN A ND2 1 
ATOM   698  N N   . LYS A 1 88  ? -0.434  -11.408 10.348 1.00 19.31 ? 88  LYS A N   1 
ATOM   699  C CA  . LYS A 1 88  ? 0.670   -10.495 10.332 1.00 23.49 ? 88  LYS A CA  1 
ATOM   700  C C   . LYS A 1 88  ? 1.273   -10.351 8.949  1.00 23.47 ? 88  LYS A C   1 
ATOM   701  O O   . LYS A 1 88  ? 1.198   -11.263 8.150  1.00 21.69 ? 88  LYS A O   1 
ATOM   702  C CB  . LYS A 1 88  ? 1.808   -11.155 11.091 1.00 27.25 ? 88  LYS A CB  1 
ATOM   703  C CG  . LYS A 1 88  ? 1.491   -11.598 12.495 1.00 34.23 ? 88  LYS A CG  1 
ATOM   704  C CD  . LYS A 1 88  ? 2.766   -12.021 13.207 1.00 40.14 ? 88  LYS A CD  1 
ATOM   705  C CE  . LYS A 1 88  ? 2.530   -12.433 14.649 1.00 46.26 ? 88  LYS A CE  1 
ATOM   706  N NZ  . LYS A 1 88  ? 3.789   -12.593 15.402 1.00 51.16 ? 88  LYS A NZ  1 
ATOM   707  N N   . LEU A 1 89  ? 1.927   -9.217  8.722  1.00 15.18 ? 89  LEU A N   1 
ATOM   708  C CA  . LEU A 1 89  ? 2.674   -9.026  7.498  1.00 14.94 ? 89  LEU A CA  1 
ATOM   709  C C   . LEU A 1 89  ? 4.122   -9.346  7.848  1.00 19.89 ? 89  LEU A C   1 
ATOM   710  O O   . LEU A 1 89  ? 4.621   -8.753  8.818  1.00 21.12 ? 89  LEU A O   1 
ATOM   711  C CB  . LEU A 1 89  ? 2.579   -7.583  7.017  1.00 19.69 ? 89  LEU A CB  1 
ATOM   712  C CG  . LEU A 1 89  ? 1.298   -7.258  6.268  1.00 23.50 ? 89  LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 89  ? 1.203   -5.748  6.050  1.00 21.89 ? 89  LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 89  ? 1.402   -7.949  4.907  1.00 22.28 ? 89  LEU A CD2 1 
ATOM   715  N N   . VAL A 1 90  ? 4.763   -10.284 7.120  1.00 10.83 ? 90  VAL A N   1 
ATOM   716  C CA  . VAL A 1 90  ? 6.106   -10.635 7.401  1.00 11.70 ? 90  VAL A CA  1 
ATOM   717  C C   . VAL A 1 90  ? 6.923   -10.155 6.221  1.00 17.06 ? 90  VAL A C   1 
ATOM   718  O O   . VAL A 1 90  ? 6.582   -10.511 5.072  1.00 14.34 ? 90  VAL A O   1 
ATOM   719  C CB  . VAL A 1 90  ? 6.183   -12.140 7.548  1.00 18.62 ? 90  VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 90  ? 7.640   -12.439 7.838  1.00 20.23 ? 90  VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 90  ? 5.303   -12.655 8.687  1.00 19.32 ? 90  VAL A CG2 1 
ATOM   722  N N   . GLY A 1 91  ? 7.960   -9.336  6.468  1.00 13.93 ? 91  GLY A N   1 
ATOM   723  C CA  . GLY A 1 91  ? 8.730   -8.799  5.382  1.00 13.21 ? 91  GLY A CA  1 
ATOM   724  C C   . GLY A 1 91  ? 10.133  -9.346  5.397  1.00 15.41 ? 91  GLY A C   1 
ATOM   725  O O   . GLY A 1 91  ? 10.816  -9.243  6.433  1.00 16.12 ? 91  GLY A O   1 
ATOM   726  N N   . LYS A 1 92  ? 10.596  -9.959  4.308  1.00 11.42 ? 92  LYS A N   1 
ATOM   727  C CA  . LYS A 1 92  ? 11.968  -10.485 4.289  1.00 14.92 ? 92  LYS A CA  1 
ATOM   728  C C   . LYS A 1 92  ? 12.737  -9.660  3.256  1.00 15.40 ? 92  LYS A C   1 
ATOM   729  O O   . LYS A 1 92  ? 12.394  -9.733  2.070  1.00 12.32 ? 92  LYS A O   1 
ATOM   730  C CB  . LYS A 1 92  ? 12.023  -11.959 3.899  1.00 19.01 ? 92  LYS A CB  1 
ATOM   731  C CG  . LYS A 1 92  ? 11.152  -12.779 4.829  1.00 27.31 ? 92  LYS A CG  1 
ATOM   732  C CD  . LYS A 1 92  ? 11.246  -14.274 4.614  1.00 36.76 ? 92  LYS A CD  1 
ATOM   733  C CE  . LYS A 1 92  ? 10.000  -14.996 5.138  1.00 47.65 ? 92  LYS A CE  1 
ATOM   734  N NZ  . LYS A 1 92  ? 10.261  -16.372 5.613  1.00 52.61 ? 92  LYS A NZ  1 
ATOM   735  N N   . PHE A 1 93  ? 13.688  -8.866  3.736  1.00 11.38 ? 93  PHE A N   1 
ATOM   736  C CA  . PHE A 1 93  ? 14.459  -7.964  2.906  1.00 11.95 ? 93  PHE A CA  1 
ATOM   737  C C   . PHE A 1 93  ? 15.936  -8.238  2.978  1.00 14.75 ? 93  PHE A C   1 
ATOM   738  O O   . PHE A 1 93  ? 16.404  -8.990  3.808  1.00 16.00 ? 93  PHE A O   1 
ATOM   739  C CB  . PHE A 1 93  ? 14.282  -6.531  3.393  1.00 10.98 ? 93  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 93  ? 12.845  -6.160  3.153  1.00 14.57 ? 93  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 93  ? 12.444  -5.737  1.885  1.00 18.76 ? 93  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 93  ? 11.898  -6.299  4.167  1.00 20.78 ? 93  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 93  ? 11.108  -5.444  1.604  1.00 22.40 ? 93  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 93  ? 10.562  -5.985  3.911  1.00 22.81 ? 93  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 93  ? 10.172  -5.588  2.631  1.00 19.20 ? 93  PHE A CZ  1 
ATOM   746  N N   . LYS A 1 94  ? 16.666  -7.624  2.082  1.00 10.40 ? 94  LYS A N   1 
ATOM   747  C CA  . LYS A 1 94  ? 18.101  -7.810  2.138  1.00 14.32 ? 94  LYS A CA  1 
ATOM   748  C C   . LYS A 1 94  ? 18.673  -6.480  1.717  1.00 14.81 ? 94  LYS A C   1 
ATOM   749  O O   . LYS A 1 94  ? 18.094  -5.825  0.855  1.00 13.63 ? 94  LYS A O   1 
ATOM   750  C CB  . LYS A 1 94  ? 18.368  -8.867  1.077  1.00 25.18 ? 94  LYS A CB  1 
ATOM   751  C CG  . LYS A 1 94  ? 19.787  -9.202  0.705  1.00 37.30 ? 94  LYS A CG  1 
ATOM   752  C CD  . LYS A 1 94  ? 19.715  -10.362 -0.268 1.00 41.10 ? 94  LYS A CD  1 
ATOM   753  C CE  . LYS A 1 94  ? 18.794  -11.444 0.293  1.00 45.09 ? 94  LYS A CE  1 
ATOM   754  N NZ  . LYS A 1 94  ? 19.354  -12.217 1.420  1.00 47.76 ? 94  LYS A NZ  1 
ATOM   755  N N   . ARG A 1 95  ? 19.732  -6.026  2.357  1.00 12.78 ? 95  ARG A N   1 
ATOM   756  C CA  . ARG A 1 95  ? 20.326  -4.768  1.929  1.00 12.85 ? 95  ARG A CA  1 
ATOM   757  C C   . ARG A 1 95  ? 21.045  -5.042  0.609  1.00 17.36 ? 95  ARG A C   1 
ATOM   758  O O   . ARG A 1 95  ? 21.811  -5.975  0.528  1.00 18.61 ? 95  ARG A O   1 
ATOM   759  C CB  . ARG A 1 95  ? 21.433  -4.340  2.912  1.00 13.84 ? 95  ARG A CB  1 
ATOM   760  C CG  . ARG A 1 95  ? 20.868  -3.675  4.149  1.00 12.96 ? 95  ARG A CG  1 
ATOM   761  C CD  . ARG A 1 95  ? 21.951  -3.263  5.126  1.00 13.75 ? 95  ARG A CD  1 
ATOM   762  N NE  . ARG A 1 95  ? 22.859  -2.299  4.542  1.00 15.90 ? 95  ARG A NE  1 
ATOM   763  C CZ  . ARG A 1 95  ? 23.383  -1.299  5.232  1.00 23.02 ? 95  ARG A CZ  1 
ATOM   764  N NH1 . ARG A 1 95  ? 23.067  -1.093  6.508  1.00 23.67 ? 95  ARG A NH1 1 
ATOM   765  N NH2 . ARG A 1 95  ? 24.210  -0.454  4.617  1.00 23.78 ? 95  ARG A NH2 1 
ATOM   766  N N   . VAL A 1 96  ? 20.920  -4.186  -0.387 1.00 16.61 ? 96  VAL A N   1 
ATOM   767  C CA  . VAL A 1 96  ? 21.600  -4.413  -1.645 1.00 19.59 ? 96  VAL A CA  1 
ATOM   768  C C   . VAL A 1 96  ? 23.114  -4.274  -1.517 1.00 19.69 ? 96  VAL A C   1 
ATOM   769  O O   . VAL A 1 96  ? 23.847  -5.067  -2.104 1.00 21.82 ? 96  VAL A O   1 
ATOM   770  C CB  . VAL A 1 96  ? 20.975  -3.454  -2.681 1.00 19.51 ? 96  VAL A CB  1 
ATOM   771  C CG1 . VAL A 1 96  ? 21.712  -3.552  -4.005 1.00 22.37 ? 96  VAL A CG1 1 
ATOM   772  C CG2 . VAL A 1 96  ? 19.505  -3.779  -2.919 1.00 17.37 ? 96  VAL A CG2 1 
ATOM   773  N N   . ASP A 1 97  ? 23.627  -3.330  -0.730 1.00 13.02 ? 97  ASP A N   1 
ATOM   774  C CA  . ASP A 1 97  ? 25.070  -3.170  -0.615 1.00 15.03 ? 97  ASP A CA  1 
ATOM   775  C C   . ASP A 1 97  ? 25.883  -4.279  0.003  1.00 17.98 ? 97  ASP A C   1 
ATOM   776  O O   . ASP A 1 97  ? 26.907  -4.696  -0.524 1.00 19.23 ? 97  ASP A O   1 
ATOM   777  C CB  . ASP A 1 97  ? 25.425  -1.918  0.187  1.00 19.76 ? 97  ASP A CB  1 
ATOM   778  C CG  . ASP A 1 97  ? 24.790  -1.804  1.558  1.00 28.11 ? 97  ASP A CG  1 
ATOM   779  O OD1 . ASP A 1 97  ? 24.128  -2.711  2.076  1.00 21.26 ? 97  ASP A OD1 1 
ATOM   780  O OD2 . ASP A 1 97  ? 25.014  -0.608  2.132  1.00 29.94 ? 97  ASP A OD2 1 
ATOM   781  N N   . ASN A 1 98  ? 25.478  -4.717  1.192  1.00 14.88 ? 98  ASN A N   1 
ATOM   782  C CA  . ASN A 1 98  ? 26.180  -5.737  1.917  1.00 15.98 ? 98  ASN A CA  1 
ATOM   783  C C   . ASN A 1 98  ? 25.546  -7.119  1.992  1.00 15.77 ? 98  ASN A C   1 
ATOM   784  O O   . ASN A 1 98  ? 26.136  -7.990  2.650  1.00 17.85 ? 98  ASN A O   1 
ATOM   785  C CB  . ASN A 1 98  ? 26.655  -5.258  3.306  1.00 17.18 ? 98  ASN A CB  1 
ATOM   786  C CG  . ASN A 1 98  ? 25.492  -4.974  4.255  1.00 20.05 ? 98  ASN A CG  1 
ATOM   787  O OD1 . ASN A 1 98  ? 25.673  -4.279  5.294  1.00 22.68 ? 98  ASN A OD1 1 
ATOM   788  N ND2 . ASN A 1 98  ? 24.327  -5.531  3.918  1.00 11.75 ? 98  ASN A ND2 1 
ATOM   789  N N   . GLY A 1 99  ? 24.375  -7.299  1.358  1.00 11.65 ? 99  GLY A N   1 
ATOM   790  C CA  . GLY A 1 99  ? 23.696  -8.562  1.320  1.00 12.89 ? 99  GLY A CA  1 
ATOM   791  C C   . GLY A 1 99  ? 23.121  -9.093  2.622  1.00 16.45 ? 99  GLY A C   1 
ATOM   792  O O   . GLY A 1 99  ? 22.627  -10.233 2.610  1.00 20.39 ? 99  GLY A O   1 
ATOM   793  N N   . LYS A 1 100 ? 23.172  -8.310  3.693  1.00 14.15 ? 100 LYS A N   1 
ATOM   794  C CA  . LYS A 1 100 ? 22.654  -8.769  4.988  1.00 13.84 ? 100 LYS A CA  1 
ATOM   795  C C   . LYS A 1 100 ? 21.142  -8.712  5.107  1.00 12.72 ? 100 LYS A C   1 
ATOM   796  O O   . LYS A 1 100 ? 20.507  -7.825  4.589  1.00 15.95 ? 100 LYS A O   1 
ATOM   797  C CB  . LYS A 1 100 ? 23.354  -8.036  6.137  1.00 15.68 ? 100 LYS A CB  1 
ATOM   798  C CG  . LYS A 1 100 ? 24.771  -8.609  6.271  1.00 21.69 ? 100 LYS A CG  1 
ATOM   799  C CD  . LYS A 1 100 ? 25.809  -7.655  6.827  1.00 34.92 ? 100 LYS A CD  1 
ATOM   800  C CE  . LYS A 1 100 ? 27.212  -8.258  6.767  1.00 41.61 ? 100 LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 100 ? 27.164  -9.707  7.058  1.00 43.14 ? 100 LYS A NZ  1 
ATOM   802  N N   . GLU A 1 101 ? 20.550  -9.681  5.744  1.00 11.45 ? 101 GLU A N   1 
ATOM   803  C CA  . GLU A 1 101 ? 19.117  -9.779  5.859  1.00 12.09 ? 101 GLU A CA  1 
ATOM   804  C C   . GLU A 1 101 ? 18.523  -8.835  6.905  1.00 10.91 ? 101 GLU A C   1 
ATOM   805  O O   . GLU A 1 101 ? 19.098  -8.562  7.951  1.00 12.27 ? 101 GLU A O   1 
ATOM   806  C CB  . GLU A 1 101 ? 18.902  -11.233 6.302  1.00 19.87 ? 101 GLU A CB  1 
ATOM   807  C CG  . GLU A 1 101 ? 17.452  -11.707 6.471  1.00 32.64 ? 101 GLU A CG  1 
ATOM   808  C CD  . GLU A 1 101 ? 17.392  -13.047 7.167  1.00 42.75 ? 101 GLU A CD  1 
ATOM   809  O OE1 . GLU A 1 101 ? 18.041  -13.083 8.310  1.00 46.36 ? 101 GLU A OE1 1 
ATOM   810  O OE2 . GLU A 1 101 ? 16.783  -14.001 6.718  1.00 46.74 ? 101 GLU A OE2 1 
ATOM   811  N N   . LEU A 1 102 ? 17.339  -8.372  6.602  1.00 9.05  ? 102 LEU A N   1 
ATOM   812  C CA  . LEU A 1 102 ? 16.617  -7.464  7.464  1.00 10.37 ? 102 LEU A CA  1 
ATOM   813  C C   . LEU A 1 102 ? 15.184  -7.959  7.460  1.00 14.68 ? 102 LEU A C   1 
ATOM   814  O O   . LEU A 1 102 ? 14.563  -8.026  6.412  1.00 14.41 ? 102 LEU A O   1 
ATOM   815  C CB  . LEU A 1 102 ? 16.729  -5.995  6.989  1.00 15.05 ? 102 LEU A CB  1 
ATOM   816  C CG  . LEU A 1 102 ? 16.194  -4.954  8.007  1.00 22.41 ? 102 LEU A CG  1 
ATOM   817  C CD1 . LEU A 1 102 ? 16.509  -3.516  7.563  1.00 19.06 ? 102 LEU A CD1 1 
ATOM   818  C CD2 . LEU A 1 102 ? 14.677  -5.134  8.163  1.00 25.95 ? 102 LEU A CD2 1 
ATOM   819  N N   . ILE A 1 103 ? 14.683  -8.392  8.628  1.00 14.57 ? 103 ILE A N   1 
ATOM   820  C CA  . ILE A 1 103 ? 13.338  -8.913  8.765  1.00 15.21 ? 103 ILE A CA  1 
ATOM   821  C C   . ILE A 1 103 ? 12.424  -7.897  9.418  1.00 14.55 ? 103 ILE A C   1 
ATOM   822  O O   . ILE A 1 103 ? 12.823  -7.145  10.273 1.00 16.12 ? 103 ILE A O   1 
ATOM   823  C CB  . ILE A 1 103 ? 13.344  -10.140 9.683  1.00 16.34 ? 103 ILE A CB  1 
ATOM   824  C CG1 . ILE A 1 103 ? 14.230  -11.248 9.112  1.00 21.49 ? 103 ILE A CG1 1 
ATOM   825  C CG2 . ILE A 1 103 ? 11.914  -10.619 9.808  1.00 13.45 ? 103 ILE A CG2 1 
ATOM   826  C CD1 . ILE A 1 103 ? 13.819  -11.769 7.738  1.00 21.10 ? 103 ILE A CD1 1 
ATOM   827  N N   . ALA A 1 104 ? 11.179  -7.841  8.999  1.00 10.86 ? 104 ALA A N   1 
ATOM   828  C CA  . ALA A 1 104 ? 10.259  -6.907  9.624  1.00 11.68 ? 104 ALA A CA  1 
ATOM   829  C C   . ALA A 1 104 ? 8.939   -7.639  9.761  1.00 16.84 ? 104 ALA A C   1 
ATOM   830  O O   . ALA A 1 104 ? 8.546   -8.438  8.915  1.00 20.77 ? 104 ALA A O   1 
ATOM   831  C CB  . ALA A 1 104 ? 10.068  -5.670  8.765  1.00 16.25 ? 104 ALA A CB  1 
ATOM   832  N N   . VAL A 1 105 ? 8.250   -7.418  10.869 1.00 11.70 ? 105 VAL A N   1 
ATOM   833  C CA  . VAL A 1 105 ? 6.960   -8.041  11.063 1.00 10.11 ? 105 VAL A CA  1 
ATOM   834  C C   . VAL A 1 105 ? 6.027   -6.902  11.465 1.00 14.08 ? 105 VAL A C   1 
ATOM   835  O O   . VAL A 1 105 ? 6.438   -5.985  12.199 1.00 17.15 ? 105 VAL A O   1 
ATOM   836  C CB  . VAL A 1 105 ? 7.105   -9.057  12.196 1.00 12.25 ? 105 VAL A CB  1 
ATOM   837  C CG1 . VAL A 1 105 ? 5.744   -9.686  12.536 1.00 15.27 ? 105 VAL A CG1 1 
ATOM   838  C CG2 . VAL A 1 105 ? 8.201   -10.062 11.827 1.00 12.32 ? 105 VAL A CG2 1 
ATOM   839  N N   . GLN A 1 106 ? 4.800   -6.949  10.982 1.00 9.47  ? 106 GLN A N   1 
ATOM   840  C CA  . GLN A 1 106 ? 3.865   -5.923  11.334 1.00 11.22 ? 106 GLN A CA  1 
ATOM   841  C C   . GLN A 1 106 ? 2.654   -6.665  11.896 1.00 15.23 ? 106 GLN A C   1 
ATOM   842  O O   . GLN A 1 106 ? 2.170   -7.614  11.272 1.00 14.94 ? 106 GLN A O   1 
ATOM   843  C CB  . GLN A 1 106 ? 3.230   -5.113  10.198 1.00 16.32 ? 106 GLN A CB  1 
ATOM   844  C CG  . GLN A 1 106 ? 4.191   -4.273  9.371  1.00 23.36 ? 106 GLN A CG  1 
ATOM   845  C CD  . GLN A 1 106 ? 3.300   -3.077  9.059  1.00 29.02 ? 106 GLN A CD  1 
ATOM   846  O OE1 . GLN A 1 106 ? 3.800   -1.995  8.834  1.00 31.40 ? 106 GLN A OE1 1 
ATOM   847  N NE2 . GLN A 1 106 ? 1.975   -3.242  9.052  1.00 30.22 ? 106 GLN A NE2 1 
ATOM   848  N N   . GLU A 1 107 ? 2.198   -6.237  13.073 1.00 16.52 ? 107 GLU A N   1 
ATOM   849  C CA  . GLU A 1 107 ? 1.006   -6.912  13.594 1.00 21.58 ? 107 GLU A CA  1 
ATOM   850  C C   . GLU A 1 107 ? 0.152   -5.928  14.365 1.00 16.05 ? 107 GLU A C   1 
ATOM   851  O O   . GLU A 1 107 ? 0.613   -4.876  14.746 1.00 16.25 ? 107 GLU A O   1 
ATOM   852  C CB  . GLU A 1 107 ? 1.384   -8.114  14.462 1.00 27.03 ? 107 GLU A CB  1 
ATOM   853  C CG  . GLU A 1 107 ? 2.065   -7.577  15.714 1.00 33.16 ? 107 GLU A CG  1 
ATOM   854  C CD  . GLU A 1 107 ? 2.863   -8.665  16.354 1.00 38.39 ? 107 GLU A CD  1 
ATOM   855  O OE1 . GLU A 1 107 ? 2.149   -9.763  16.472 1.00 37.80 ? 107 GLU A OE1 1 
ATOM   856  O OE2 . GLU A 1 107 ? 4.033   -8.516  16.669 1.00 37.60 ? 107 GLU A OE2 1 
ATOM   857  N N   . ILE A 1 108 ? -1.115  -6.232  14.528 1.00 13.72 ? 108 ILE A N   1 
ATOM   858  C CA  . ILE A 1 108 ? -2.006  -5.376  15.305 1.00 14.50 ? 108 ILE A CA  1 
ATOM   859  C C   . ILE A 1 108 ? -2.060  -5.928  16.747 1.00 19.42 ? 108 ILE A C   1 
ATOM   860  O O   . ILE A 1 108 ? -2.258  -7.113  16.962 1.00 22.51 ? 108 ILE A O   1 
ATOM   861  C CB  . ILE A 1 108 ? -3.435  -5.469  14.762 1.00 17.82 ? 108 ILE A CB  1 
ATOM   862  C CG1 . ILE A 1 108 ? -3.570  -5.062  13.301 1.00 21.22 ? 108 ILE A CG1 1 
ATOM   863  C CG2 . ILE A 1 108 ? -4.438  -4.624  15.564 1.00 18.84 ? 108 ILE A CG2 1 
ATOM   864  C CD1 . ILE A 1 108 ? -3.215  -3.598  13.104 1.00 24.76 ? 108 ILE A CD1 1 
ATOM   865  N N   . SER A 1 109 ? -1.918  -5.087  17.765 1.00 18.82 ? 109 SER A N   1 
ATOM   866  C CA  . SER A 1 109 ? -1.988  -5.453  19.176 1.00 21.88 ? 109 SER A CA  1 
ATOM   867  C C   . SER A 1 109 ? -3.049  -4.541  19.744 1.00 22.26 ? 109 SER A C   1 
ATOM   868  O O   . SER A 1 109 ? -2.901  -3.330  19.972 1.00 18.54 ? 109 SER A O   1 
ATOM   869  C CB  . SER A 1 109 ? -0.721  -5.144  19.931 1.00 28.11 ? 109 SER A CB  1 
ATOM   870  O OG  . SER A 1 109 ? -1.009  -5.294  21.301 1.00 32.14 ? 109 SER A OG  1 
ATOM   871  N N   . GLY A 1 110 ? -4.222  -5.124  19.859 1.00 28.16 ? 110 GLY A N   1 
ATOM   872  C CA  . GLY A 1 110 ? -5.344  -4.350  20.334 1.00 29.57 ? 110 GLY A CA  1 
ATOM   873  C C   . GLY A 1 110 ? -5.660  -3.319  19.285 1.00 27.82 ? 110 GLY A C   1 
ATOM   874  O O   . GLY A 1 110 ? -6.104  -3.634  18.199 1.00 31.13 ? 110 GLY A O   1 
ATOM   875  N N   . ASN A 1 111 ? -5.422  -2.072  19.606 1.00 28.21 ? 111 ASN A N   1 
ATOM   876  C CA  . ASN A 1 111 ? -5.677  -1.061  18.617 1.00 24.39 ? 111 ASN A CA  1 
ATOM   877  C C   . ASN A 1 111 ? -4.366  -0.340  18.252 1.00 19.96 ? 111 ASN A C   1 
ATOM   878  O O   . ASN A 1 111 ? -4.327  0.820   17.836 1.00 19.49 ? 111 ASN A O   1 
ATOM   879  C CB  . ASN A 1 111 ? -6.765  -0.123  19.151 1.00 37.97 ? 111 ASN A CB  1 
ATOM   880  C CG  . ASN A 1 111 ? -6.356  0.784   20.306 1.00 44.22 ? 111 ASN A CG  1 
ATOM   881  O OD1 . ASN A 1 111 ? -7.115  1.707   20.658 1.00 52.42 ? 111 ASN A OD1 1 
ATOM   882  N ND2 . ASN A 1 111 ? -5.187  0.547   20.896 1.00 39.58 ? 111 ASN A ND2 1 
ATOM   883  N N   . GLU A 1 112 ? -3.246  -1.010  18.473 1.00 12.18 ? 112 GLU A N   1 
ATOM   884  C CA  . GLU A 1 112 ? -1.986  -0.412  18.133 1.00 12.16 ? 112 GLU A CA  1 
ATOM   885  C C   . GLU A 1 112 ? -1.393  -1.242  17.012 1.00 18.05 ? 112 GLU A C   1 
ATOM   886  O O   . GLU A 1 112 ? -1.666  -2.453  16.934 1.00 19.82 ? 112 GLU A O   1 
ATOM   887  C CB  . GLU A 1 112 ? -1.023  -0.484  19.329 1.00 13.28 ? 112 GLU A CB  1 
ATOM   888  C CG  . GLU A 1 112 ? -1.346  0.635   20.327 1.00 14.88 ? 112 GLU A CG  1 
ATOM   889  C CD  . GLU A 1 112 ? -0.404  0.655   21.501 1.00 20.48 ? 112 GLU A CD  1 
ATOM   890  O OE1 . GLU A 1 112 ? 0.061   -0.520  21.863 1.00 20.58 ? 112 GLU A OE1 1 
ATOM   891  O OE2 . GLU A 1 112 ? -0.112  1.676   22.072 1.00 25.49 ? 112 GLU A OE2 1 
ATOM   892  N N   . LEU A 1 113 ? -0.562  -0.592  16.198 1.00 14.19 ? 113 LEU A N   1 
ATOM   893  C CA  . LEU A 1 113 ? 0.141   -1.268  15.093 1.00 13.61 ? 113 LEU A CA  1 
ATOM   894  C C   . LEU A 1 113 ? 1.592   -1.402  15.523 1.00 11.59 ? 113 LEU A C   1 
ATOM   895  O O   . LEU A 1 113 ? 2.271   -0.433  15.923 1.00 9.88  ? 113 LEU A O   1 
ATOM   896  C CB  . LEU A 1 113 ? 0.072   -0.469  13.760 1.00 17.46 ? 113 LEU A CB  1 
ATOM   897  C CG  . LEU A 1 113 ? 0.937   -1.046  12.636 1.00 24.21 ? 113 LEU A CG  1 
ATOM   898  C CD1 . LEU A 1 113 ? 0.118   -2.232  12.161 1.00 26.26 ? 113 LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1 113 ? 0.923   -0.072  11.472 1.00 30.21 ? 113 LEU A CD2 1 
ATOM   900  N N   . ILE A 1 114 ? 2.058   -2.644  15.517 1.00 11.61 ? 114 ILE A N   1 
ATOM   901  C CA  . ILE A 1 114 ? 3.432   -2.788  15.932 1.00 12.38 ? 114 ILE A CA  1 
ATOM   902  C C   . ILE A 1 114 ? 4.314   -3.325  14.815 1.00 15.02 ? 114 ILE A C   1 
ATOM   903  O O   . ILE A 1 114 ? 3.901   -4.283  14.116 1.00 15.15 ? 114 ILE A O   1 
ATOM   904  C CB  . ILE A 1 114 ? 3.514   -3.768  17.109 1.00 18.89 ? 114 ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 114 ? 2.427   -3.361  18.139 1.00 19.69 ? 114 ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 114 ? 4.974   -3.799  17.584 1.00 16.44 ? 114 ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 114 ? 2.533   -4.134  19.438 1.00 27.23 ? 114 ILE A CD1 1 
ATOM   908  N N   . GLN A 1 115 ? 5.470   -2.665  14.665 1.00 9.00  ? 115 GLN A N   1 
ATOM   909  C CA  . GLN A 1 115 ? 6.436   -3.144  13.704 1.00 8.73  ? 115 GLN A CA  1 
ATOM   910  C C   . GLN A 1 115 ? 7.653   -3.577  14.453 1.00 10.11 ? 115 GLN A C   1 
ATOM   911  O O   . GLN A 1 115 ? 8.230   -2.861  15.246 1.00 11.09 ? 115 GLN A O   1 
ATOM   912  C CB  . GLN A 1 115 ? 6.905   -2.041  12.717 1.00 11.61 ? 115 GLN A CB  1 
ATOM   913  C CG  . GLN A 1 115 ? 5.790   -1.618  11.753 1.00 12.03 ? 115 GLN A CG  1 
ATOM   914  C CD  . GLN A 1 115 ? 6.254   -0.520  10.813 1.00 18.55 ? 115 GLN A CD  1 
ATOM   915  O OE1 . GLN A 1 115 ? 7.288   0.160   11.007 1.00 17.97 ? 115 GLN A OE1 1 
ATOM   916  N NE2 . GLN A 1 115 ? 5.424   -0.402  9.789  1.00 22.80 ? 115 GLN A NE2 1 
ATOM   917  N N   . THR A 1 116 ? 8.175   -4.716  14.097 1.00 8.03  ? 116 THR A N   1 
ATOM   918  C CA  . THR A 1 116 ? 9.394   -5.144  14.802 1.00 9.82  ? 116 THR A CA  1 
ATOM   919  C C   . THR A 1 116 ? 10.381  -5.412  13.663 1.00 12.89 ? 116 THR A C   1 
ATOM   920  O O   . THR A 1 116 ? 10.019  -5.959  12.608 1.00 11.57 ? 116 THR A O   1 
ATOM   921  C CB  . THR A 1 116 ? 9.155   -6.515  15.505 1.00 10.96 ? 116 THR A CB  1 
ATOM   922  O OG1 . THR A 1 116 ? 8.038   -6.448  16.376 1.00 10.77 ? 116 THR A OG1 1 
ATOM   923  C CG2 . THR A 1 116 ? 10.391  -7.150  16.132 1.00 12.46 ? 116 THR A CG2 1 
ATOM   924  N N   . TYR A 1 117 ? 11.608  -5.010  13.881 1.00 13.89 ? 117 TYR A N   1 
ATOM   925  C CA  . TYR A 1 117 ? 12.686  -5.206  12.911 1.00 17.01 ? 117 TYR A CA  1 
ATOM   926  C C   . TYR A 1 117 ? 13.809  -5.990  13.569 1.00 14.93 ? 117 TYR A C   1 
ATOM   927  O O   . TYR A 1 117 ? 14.081  -5.820  14.768 1.00 14.16 ? 117 TYR A O   1 
ATOM   928  C CB  . TYR A 1 117 ? 13.326  -3.835  12.480 1.00 17.17 ? 117 TYR A CB  1 
ATOM   929  C CG  . TYR A 1 117 ? 12.319  -2.706  12.236 1.00 14.32 ? 117 TYR A CG  1 
ATOM   930  C CD1 . TYR A 1 117 ? 11.187  -2.876  11.431 1.00 14.43 ? 117 TYR A CD1 1 
ATOM   931  C CD2 . TYR A 1 117 ? 12.560  -1.428  12.758 1.00 14.76 ? 117 TYR A CD2 1 
ATOM   932  C CE1 . TYR A 1 117 ? 10.244  -1.850  11.275 1.00 13.18 ? 117 TYR A CE1 1 
ATOM   933  C CE2 . TYR A 1 117 ? 11.668  -0.376  12.564 1.00 13.27 ? 117 TYR A CE2 1 
ATOM   934  C CZ  . TYR A 1 117 ? 10.505  -0.593  11.824 1.00 15.05 ? 117 TYR A CZ  1 
ATOM   935  O OH  . TYR A 1 117 ? 9.628   0.464   11.634 1.00 18.85 ? 117 TYR A OH  1 
ATOM   936  N N   . THR A 1 118 ? 14.482  -6.815  12.776 1.00 9.81  ? 118 THR A N   1 
ATOM   937  C CA  . THR A 1 118 ? 15.666  -7.480  13.270 1.00 9.95  ? 118 THR A CA  1 
ATOM   938  C C   . THR A 1 118 ? 16.724  -7.309  12.168 1.00 12.74 ? 118 THR A C   1 
ATOM   939  O O   . THR A 1 118 ? 16.482  -7.495  10.950 1.00 10.22 ? 118 THR A O   1 
ATOM   940  C CB  . THR A 1 118 ? 15.493  -8.995  13.572 1.00 17.51 ? 118 THR A CB  1 
ATOM   941  O OG1 . THR A 1 118 ? 15.276  -9.712  12.358 1.00 20.49 ? 118 THR A OG1 1 
ATOM   942  C CG2 . THR A 1 118 ? 14.316  -9.279  14.515 1.00 18.18 ? 118 THR A CG2 1 
ATOM   943  N N   . TYR A 1 119 ? 17.912  -7.021  12.645 1.00 10.75 ? 119 TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 19.080  -6.851  11.824 1.00 9.79  ? 119 TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 20.330  -7.191  12.627 1.00 13.04 ? 119 TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 20.662  -6.629  13.647 1.00 11.51 ? 119 TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 19.176  -5.407  11.297 1.00 8.81  ? 119 TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 20.403  -5.170  10.451 1.00 11.92 ? 119 TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 20.463  -5.577  9.121  1.00 10.46 ? 119 TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 21.473  -4.407  10.916 1.00 15.06 ? 119 TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 21.587  -5.325  8.325  1.00 13.58 ? 119 TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 22.604  -4.129  10.142 1.00 17.89 ? 119 TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 22.663  -4.598  8.825  1.00 16.10 ? 119 TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 23.762  -4.356  8.035  1.00 17.55 ? 119 TYR A OH  1 
ATOM   955  N N   . GLU A 1 120 ? 21.070  -8.165  12.130 1.00 14.56 ? 120 GLU A N   1 
ATOM   956  C CA  . GLU A 1 120 ? 22.325  -8.583  12.645 1.00 15.15 ? 120 GLU A CA  1 
ATOM   957  C C   . GLU A 1 120 ? 22.270  -8.856  14.112 1.00 16.26 ? 120 GLU A C   1 
ATOM   958  O O   . GLU A 1 120 ? 23.210  -8.454  14.787 1.00 12.82 ? 120 GLU A O   1 
ATOM   959  C CB  . GLU A 1 120 ? 23.410  -7.547  12.377 1.00 16.63 ? 120 GLU A CB  1 
ATOM   960  C CG  . GLU A 1 120 ? 23.869  -7.578  10.922 1.00 23.99 ? 120 GLU A CG  1 
ATOM   961  C CD  . GLU A 1 120 ? 24.817  -8.722  10.763 1.00 40.59 ? 120 GLU A CD  1 
ATOM   962  O OE1 . GLU A 1 120 ? 26.017  -8.449  11.225 1.00 48.81 ? 120 GLU A OE1 1 
ATOM   963  O OE2 . GLU A 1 120 ? 24.482  -9.794  10.282 1.00 44.74 ? 120 GLU A OE2 1 
ATOM   964  N N   . GLY A 1 121 ? 21.194  -9.490  14.590 1.00 16.12 ? 121 GLY A N   1 
ATOM   965  C CA  . GLY A 1 121 ? 21.188  -9.804  16.013 1.00 18.13 ? 121 GLY A CA  1 
ATOM   966  C C   . GLY A 1 121 ? 20.606  -8.753  16.959 1.00 17.24 ? 121 GLY A C   1 
ATOM   967  O O   . GLY A 1 121 ? 20.533  -9.000  18.161 1.00 18.35 ? 121 GLY A O   1 
ATOM   968  N N   . VAL A 1 122 ? 20.132  -7.619  16.429 1.00 9.28  ? 122 VAL A N   1 
ATOM   969  C CA  . VAL A 1 122 ? 19.503  -6.567  17.209 1.00 12.31 ? 122 VAL A CA  1 
ATOM   970  C C   . VAL A 1 122 ? 18.052  -6.433  16.763 1.00 14.39 ? 122 VAL A C   1 
ATOM   971  O O   . VAL A 1 122 ? 17.717  -6.510  15.564 1.00 15.23 ? 122 VAL A O   1 
ATOM   972  C CB  . VAL A 1 122 ? 20.219  -5.232  16.969 1.00 20.24 ? 122 VAL A CB  1 
ATOM   973  C CG1 . VAL A 1 122 ? 19.644  -4.103  17.827 1.00 17.59 ? 122 VAL A CG1 1 
ATOM   974  C CG2 . VAL A 1 122 ? 21.712  -5.397  17.246 1.00 22.00 ? 122 VAL A CG2 1 
ATOM   975  N N   . GLU A 1 123 ? 17.190  -6.216  17.727 1.00 10.23 ? 123 GLU A N   1 
ATOM   976  C CA  . GLU A 1 123 ? 15.749  -6.062  17.496 1.00 10.92 ? 123 GLU A CA  1 
ATOM   977  C C   . GLU A 1 123 ? 15.310  -4.634  17.821 1.00 15.87 ? 123 GLU A C   1 
ATOM   978  O O   . GLU A 1 123 ? 15.891  -3.989  18.701 1.00 18.80 ? 123 GLU A O   1 
ATOM   979  C CB  . GLU A 1 123 ? 15.004  -7.021  18.473 1.00 15.83 ? 123 GLU A CB  1 
ATOM   980  C CG  . GLU A 1 123 ? 13.456  -7.119  18.389 1.00 21.17 ? 123 GLU A CG  1 
ATOM   981  C CD  . GLU A 1 123 ? 12.825  -7.835  19.578 1.00 26.10 ? 123 GLU A CD  1 
ATOM   982  O OE1 . GLU A 1 123 ? 13.423  -8.376  20.496 1.00 27.09 ? 123 GLU A OE1 1 
ATOM   983  O OE2 . GLU A 1 123 ? 11.527  -7.814  19.525 1.00 28.43 ? 123 GLU A OE2 1 
ATOM   984  N N   . ALA A 1 124 ? 14.291  -4.129  17.128 1.00 12.48 ? 124 ALA A N   1 
ATOM   985  C CA  . ALA A 1 124 ? 13.780  -2.814  17.468 1.00 9.27  ? 124 ALA A CA  1 
ATOM   986  C C   . ALA A 1 124 ? 12.313  -2.861  17.150 1.00 9.25  ? 124 ALA A C   1 
ATOM   987  O O   . ALA A 1 124 ? 11.873  -3.732  16.407 1.00 11.69 ? 124 ALA A O   1 
ATOM   988  C CB  . ALA A 1 124 ? 14.423  -1.608  16.797 1.00 12.41 ? 124 ALA A CB  1 
ATOM   989  N N   . LYS A 1 125 ? 11.503  -1.989  17.786 1.00 8.91  ? 125 LYS A N   1 
ATOM   990  C CA  . LYS A 1 125 ? 10.093  -1.979  17.496 1.00 9.50  ? 125 LYS A CA  1 
ATOM   991  C C   . LYS A 1 125 ? 9.696   -0.520  17.468 1.00 10.92 ? 125 LYS A C   1 
ATOM   992  O O   . LYS A 1 125 ? 10.333  0.341   18.127 1.00 12.83 ? 125 LYS A O   1 
ATOM   993  C CB  . LYS A 1 125 ? 9.182   -2.510  18.601 1.00 13.03 ? 125 LYS A CB  1 
ATOM   994  C CG  . LYS A 1 125 ? 9.524   -3.886  19.101 1.00 19.51 ? 125 LYS A CG  1 
ATOM   995  C CD  . LYS A 1 125 ? 8.318   -4.515  19.787 1.00 24.43 ? 125 LYS A CD  1 
ATOM   996  C CE  . LYS A 1 125 ? 8.700   -5.778  20.537 1.00 30.51 ? 125 LYS A CE  1 
ATOM   997  N NZ  . LYS A 1 125 ? 9.817   -5.562  21.467 1.00 38.42 ? 125 LYS A NZ  1 
ATOM   998  N N   . ARG A 1 126 ? 8.664   -0.268  16.672 1.00 9.13  ? 126 ARG A N   1 
ATOM   999  C CA  . ARG A 1 126 ? 8.034   1.031   16.575 1.00 9.39  ? 126 ARG A CA  1 
ATOM   1000 C C   . ARG A 1 126 ? 6.567   0.732   16.710 1.00 10.83 ? 126 ARG A C   1 
ATOM   1001 O O   . ARG A 1 126 ? 6.089   -0.195  16.038 1.00 13.24 ? 126 ARG A O   1 
ATOM   1002 C CB  . ARG A 1 126 ? 8.323   1.769   15.267 1.00 13.97 ? 126 ARG A CB  1 
ATOM   1003 C CG  . ARG A 1 126 ? 9.854   1.934   15.133 1.00 13.86 ? 126 ARG A CG  1 
ATOM   1004 C CD  . ARG A 1 126 ? 10.249  3.088   14.215 1.00 14.61 ? 126 ARG A CD  1 
ATOM   1005 N NE  . ARG A 1 126 ? 9.993   4.403   14.777 1.00 14.98 ? 126 ARG A NE  1 
ATOM   1006 C CZ  . ARG A 1 126 ? 10.032  5.537   14.066 1.00 16.83 ? 126 ARG A CZ  1 
ATOM   1007 N NH1 . ARG A 1 126 ? 10.311  5.496   12.748 1.00 11.73 ? 126 ARG A NH1 1 
ATOM   1008 N NH2 . ARG A 1 126 ? 9.808   6.702   14.674 1.00 14.02 ? 126 ARG A NH2 1 
ATOM   1009 N N   . ILE A 1 127 ? 5.921   1.434   17.652 1.00 9.25  ? 127 ILE A N   1 
ATOM   1010 C CA  . ILE A 1 127 ? 4.513   1.258   17.921 1.00 8.74  ? 127 ILE A CA  1 
ATOM   1011 C C   . ILE A 1 127 ? 3.734   2.501   17.531 1.00 8.83  ? 127 ILE A C   1 
ATOM   1012 O O   . ILE A 1 127 ? 4.124   3.599   17.902 1.00 11.99 ? 127 ILE A O   1 
ATOM   1013 C CB  . ILE A 1 127 ? 4.318   0.851   19.394 1.00 10.94 ? 127 ILE A CB  1 
ATOM   1014 C CG1 . ILE A 1 127 ? 5.109   -0.458  19.513 1.00 17.55 ? 127 ILE A CG1 1 
ATOM   1015 C CG2 . ILE A 1 127 ? 2.822   0.583   19.653 1.00 8.95  ? 127 ILE A CG2 1 
ATOM   1016 C CD1 . ILE A 1 127 ? 5.735   -0.654  20.874 1.00 25.27 ? 127 ILE A CD1 1 
ATOM   1017 N N   . PHE A 1 128 ? 2.665   2.294   16.747 1.00 11.31 ? 128 PHE A N   1 
ATOM   1018 C CA  . PHE A 1 128 ? 1.842   3.315   16.179 1.00 10.11 ? 128 PHE A CA  1 
ATOM   1019 C C   . PHE A 1 128 ? 0.441   3.295   16.735 1.00 12.72 ? 128 PHE A C   1 
ATOM   1020 O O   . PHE A 1 128 ? -0.088  2.196   16.984 1.00 15.86 ? 128 PHE A O   1 
ATOM   1021 C CB  . PHE A 1 128 ? 1.706   2.970   14.662 1.00 17.27 ? 128 PHE A CB  1 
ATOM   1022 C CG  . PHE A 1 128 ? 2.995   3.068   13.866 1.00 14.33 ? 128 PHE A CG  1 
ATOM   1023 C CD1 . PHE A 1 128 ? 3.931   2.031   13.910 1.00 15.72 ? 128 PHE A CD1 1 
ATOM   1024 C CD2 . PHE A 1 128 ? 3.308   4.191   13.110 1.00 16.30 ? 128 PHE A CD2 1 
ATOM   1025 C CE1 . PHE A 1 128 ? 5.147   2.057   13.232 1.00 12.69 ? 128 PHE A CE1 1 
ATOM   1026 C CE2 . PHE A 1 128 ? 4.531   4.258   12.442 1.00 15.68 ? 128 PHE A CE2 1 
ATOM   1027 C CZ  . PHE A 1 128 ? 5.435   3.196   12.492 1.00 13.07 ? 128 PHE A CZ  1 
ATOM   1028 N N   . LYS A 1 129 ? -0.137  4.485   16.866 1.00 12.60 ? 129 LYS A N   1 
ATOM   1029 C CA  . LYS A 1 129 ? -1.524  4.588   17.328 1.00 13.35 ? 129 LYS A CA  1 
ATOM   1030 C C   . LYS A 1 129 ? -2.383  5.001   16.151 1.00 11.61 ? 129 LYS A C   1 
ATOM   1031 O O   . LYS A 1 129 ? -1.935  5.789   15.327 1.00 12.41 ? 129 LYS A O   1 
ATOM   1032 C CB  . LYS A 1 129 ? -1.751  5.594   18.442 1.00 18.46 ? 129 LYS A CB  1 
ATOM   1033 C CG  . LYS A 1 129 ? -1.545  5.016   19.837 1.00 28.05 ? 129 LYS A CG  1 
ATOM   1034 C CD  . LYS A 1 129 ? -1.111  6.094   20.811 1.00 33.79 ? 129 LYS A CD  1 
ATOM   1035 C CE  . LYS A 1 129 ? -1.501  5.764   22.238 1.00 37.82 ? 129 LYS A CE  1 
ATOM   1036 N NZ  . LYS A 1 129 ? -1.315  4.331   22.516 1.00 37.52 ? 129 LYS A NZ  1 
ATOM   1037 N N   . LYS A 1 130 ? -3.630  4.532   16.151 1.00 17.94 ? 130 LYS A N   1 
ATOM   1038 C CA  . LYS A 1 130 ? -4.521  4.898   15.061 1.00 22.40 ? 130 LYS A CA  1 
ATOM   1039 C C   . LYS A 1 130 ? -4.977  6.320   15.267 1.00 25.12 ? 130 LYS A C   1 
ATOM   1040 O O   . LYS A 1 130 ? -5.314  6.723   16.344 1.00 28.89 ? 130 LYS A O   1 
ATOM   1041 C CB  . LYS A 1 130 ? -5.724  3.970   15.027 1.00 28.77 ? 130 LYS A CB  1 
ATOM   1042 C CG  . LYS A 1 130 ? -5.880  3.361   13.647 1.00 35.44 ? 130 LYS A CG  1 
ATOM   1043 C CD  . LYS A 1 130 ? -7.163  2.578   13.491 1.00 39.87 ? 130 LYS A CD  1 
ATOM   1044 C CE  . LYS A 1 130 ? -6.964  1.299   12.708 1.00 41.69 ? 130 LYS A CE  1 
ATOM   1045 N NZ  . LYS A 1 130 ? -8.041  0.325   12.954 1.00 44.57 ? 130 LYS A NZ  1 
ATOM   1046 N N   . GLU A 1 131 ? -4.980  7.145   14.250 1.00 31.81 ? 131 GLU A N   1 
ATOM   1047 C CA  . GLU A 1 131 ? -5.373  8.537   14.325 1.00 35.06 ? 131 GLU A CA  1 
ATOM   1048 C C   . GLU A 1 131 ? -6.842  8.712   14.606 1.00 41.68 ? 131 GLU A C   1 
ATOM   1049 O O   . GLU A 1 131 ? -7.189  9.913   14.677 1.00 46.25 ? 131 GLU A O   1 
ATOM   1050 C CB  . GLU A 1 131 ? -5.126  9.212   12.970 1.00 35.20 ? 131 GLU A CB  1 
ATOM   1051 C CG  . GLU A 1 131 ? -4.792  10.702  13.045 1.00 45.23 ? 131 GLU A CG  1 
ATOM   1052 C CD  . GLU A 1 131 ? -3.353  10.836  13.423 1.00 53.95 ? 131 GLU A CD  1 
ATOM   1053 O OE1 . GLU A 1 131 ? -2.948  9.826   14.153 1.00 55.19 ? 131 GLU A OE1 1 
ATOM   1054 O OE2 . GLU A 1 131 ? -2.627  11.759  13.085 1.00 57.61 ? 131 GLU A OE2 1 
ATOM   1055 O OXT . GLU A 1 131 ? -7.504  7.661   14.677 1.00 40.76 ? 131 GLU A OXT 1 
HETATM 1056 C C1  1 OLA B 2 .   ? 6.207   -0.861  5.247  0.40 42.26 ? 133 OLA A C1  1 
HETATM 1057 C C1  2 OLA B 2 .   ? 6.476   0.366   3.796  0.30 42.01 ? 133 OLA A C1  1 
HETATM 1058 C C1  3 OLA B 2 .   ? 6.104   -0.320  3.964  0.30 46.74 ? 133 OLA A C1  1 
HETATM 1059 O O1  1 OLA B 2 .   ? 6.928   -0.010  5.937  0.40 41.96 ? 133 OLA A O1  1 
HETATM 1060 O O1  2 OLA B 2 .   ? 6.388   1.428   4.567  0.30 40.90 ? 133 OLA A O1  1 
HETATM 1061 O O1  3 OLA B 2 .   ? 5.461   -0.299  2.825  0.30 48.07 ? 133 OLA A O1  1 
HETATM 1062 O O2  1 OLA B 2 .   ? 5.052   -1.124  5.550  0.40 42.13 ? 133 OLA A O2  1 
HETATM 1063 O O2  2 OLA B 2 .   ? 5.542   -0.077  3.147  0.30 43.30 ? 133 OLA A O2  1 
HETATM 1064 O O2  3 OLA B 2 .   ? 5.544   -0.304  5.057  0.30 47.70 ? 133 OLA A O2  1 
HETATM 1065 C C2  1 OLA B 2 .   ? 6.900   -1.505  4.030  0.40 42.26 ? 133 OLA A C2  1 
HETATM 1066 C C2  2 OLA B 2 .   ? 7.876   -0.237  3.805  0.30 41.64 ? 133 OLA A C2  1 
HETATM 1067 C C2  3 OLA B 2 .   ? 7.621   -0.325  3.808  0.30 43.94 ? 133 OLA A C2  1 
HETATM 1068 C C3  1 OLA B 2 .   ? 8.150   -0.887  3.399  0.70 43.58 ? 133 OLA A C3  1 
HETATM 1069 C C3  3 OLA B 2 .   ? 8.130   -1.557  3.084  0.30 41.60 ? 133 OLA A C3  1 
HETATM 1070 C C4  1 OLA B 2 .   ? 9.449   -1.701  3.524  0.70 43.83 ? 133 OLA A C4  1 
HETATM 1071 C C4  3 OLA B 2 .   ? 9.545   -2.016  3.443  0.30 40.70 ? 133 OLA A C4  1 
HETATM 1072 C C5  . OLA B 2 .   ? 9.771   -2.113  4.957  1.00 38.54 ? 133 OLA A C5  1 
HETATM 1073 C C6  . OLA B 2 .   ? 11.219  -2.201  5.406  1.00 33.43 ? 133 OLA A C6  1 
HETATM 1074 C C7  . OLA B 2 .   ? 11.345  -1.624  6.817  1.00 33.76 ? 133 OLA A C7  1 
HETATM 1075 C C8  . OLA B 2 .   ? 12.742  -1.113  7.189  1.00 36.08 ? 133 OLA A C8  1 
HETATM 1076 C C9  . OLA B 2 .   ? 12.734  -0.273  8.459  1.00 33.21 ? 133 OLA A C9  1 
HETATM 1077 C C10 . OLA B 2 .   ? 13.608  0.624   9.012  1.00 36.09 ? 133 OLA A C10 1 
HETATM 1078 C C11 . OLA B 2 .   ? 15.130  0.645   9.109  1.00 42.30 ? 133 OLA A C11 1 
HETATM 1079 C C12 . OLA B 2 .   ? 15.845  1.851   9.758  1.00 44.54 ? 133 OLA A C12 1 
HETATM 1080 C C13 . OLA B 2 .   ? 15.605  3.279   9.237  1.00 42.50 ? 133 OLA A C13 1 
HETATM 1081 C C14 . OLA B 2 .   ? 16.817  4.202   9.280  1.00 38.18 ? 133 OLA A C14 1 
HETATM 1082 C C15 . OLA B 2 .   ? 16.390  5.660   9.205  1.00 38.75 ? 133 OLA A C15 1 
HETATM 1083 C C16 . OLA B 2 .   ? 17.579  6.588   9.043  1.00 41.13 ? 133 OLA A C16 1 
HETATM 1084 C C17 . OLA B 2 .   ? 17.311  8.068   9.293  1.00 40.35 ? 133 OLA A C17 1 
HETATM 1085 C C18 . OLA B 2 .   ? 18.503  8.975   8.971  1.00 39.84 ? 133 OLA A C18 1 
HETATM 1086 O O   . HOH C 3 .   ? -3.497  -15.336 13.251 1.00 49.75 ? 134 HOH A O   1 
HETATM 1087 O O   . HOH C 3 .   ? 18.067  2.305   21.710 1.00 25.67 ? 135 HOH A O   1 
HETATM 1088 O O   . HOH C 3 .   ? 5.424   -5.918  -5.072 1.00 16.09 ? 136 HOH A O   1 
HETATM 1089 O O   . HOH C 3 .   ? -7.647  -1.799  14.287 1.00 34.61 ? 137 HOH A O   1 
HETATM 1090 O O   . HOH C 3 .   ? 4.559   13.568  14.244 1.00 36.38 ? 138 HOH A O   1 
HETATM 1091 O O   . HOH C 3 .   ? 8.557   2.047   7.932  1.00 35.09 ? 139 HOH A O   1 
HETATM 1092 O O   . HOH C 3 .   ? 8.260   10.888  16.216 1.00 21.89 ? 140 HOH A O   1 
HETATM 1093 O O   . HOH C 3 .   ? 5.421   -1.768  -6.705 1.00 33.27 ? 141 HOH A O   1 
HETATM 1094 O O   . HOH C 3 .   ? 25.594  -2.428  8.996  1.00 26.82 ? 142 HOH A O   1 
HETATM 1095 O O   . HOH C 3 .   ? 13.353  14.099  12.283 1.00 16.72 ? 143 HOH A O   1 
HETATM 1096 O O   . HOH C 3 .   ? 15.570  14.940  17.855 1.00 16.64 ? 144 HOH A O   1 
HETATM 1097 O O   . HOH C 3 .   ? 16.930  15.337  20.231 1.00 21.93 ? 145 HOH A O   1 
HETATM 1098 O O   . HOH C 3 .   ? 3.258   10.568  1.576  1.00 30.44 ? 146 HOH A O   1 
HETATM 1099 O O   . HOH C 3 .   ? 0.609   9.197   5.762  1.00 21.67 ? 147 HOH A O   1 
HETATM 1100 O O   . HOH C 3 .   ? -2.809  4.789   1.286  1.00 21.59 ? 148 HOH A O   1 
HETATM 1101 O O   . HOH C 3 .   ? -3.197  -0.320  -3.377 1.00 31.95 ? 149 HOH A O   1 
HETATM 1102 O O   . HOH C 3 .   ? 9.795   13.779  -0.034 1.00 29.04 ? 150 HOH A O   1 
HETATM 1103 O O   . HOH C 3 .   ? 14.244  9.181   0.037  1.00 27.64 ? 151 HOH A O   1 
HETATM 1104 O O   . HOH C 3 .   ? 0.343   11.769  3.452  1.00 49.30 ? 152 HOH A O   1 
HETATM 1105 O O   . HOH C 3 .   ? 15.737  -9.898  -1.754 1.00 65.60 ? 153 HOH A O   1 
HETATM 1106 O O   . HOH C 3 .   ? 9.402   1.160   -2.588 1.00 23.55 ? 154 HOH A O   1 
HETATM 1107 O O   . HOH C 3 .   ? 7.875   -12.326 2.825  1.00 24.41 ? 155 HOH A O   1 
HETATM 1108 O O   . HOH C 3 .   ? 5.782   -6.727  15.386 1.00 18.45 ? 156 HOH A O   1 
HETATM 1109 O O   . HOH C 3 .   ? 27.892  -0.155  2.903  1.00 27.97 ? 157 HOH A O   1 
HETATM 1110 O O   . HOH C 3 .   ? -12.674 4.701   1.907  1.00 84.02 ? 158 HOH A O   1 
HETATM 1111 O O   . HOH C 3 .   ? 8.712   2.434   24.554 1.00 30.56 ? 159 HOH A O   1 
HETATM 1112 O O   . HOH C 3 .   ? 3.890   13.166  9.655  1.00 40.24 ? 160 HOH A O   1 
HETATM 1113 O O   . HOH C 3 .   ? 20.844  -9.738  9.527  1.00 18.69 ? 161 HOH A O   1 
HETATM 1114 O O   . HOH C 3 .   ? 0.651   -13.455 1.445  1.00 28.15 ? 162 HOH A O   1 
HETATM 1115 O O   . HOH C 3 .   ? 18.378  -6.531  20.562 1.00 24.30 ? 163 HOH A O   1 
HETATM 1116 O O   . HOH C 3 .   ? 28.810  5.470   12.249 1.00 93.65 ? 164 HOH A O   1 
HETATM 1117 O O   . HOH C 3 .   ? 5.196   5.604   25.693 1.00 42.04 ? 165 HOH A O   1 
HETATM 1118 O O   . HOH C 3 .   ? 24.628  8.424   9.411  1.00 44.62 ? 166 HOH A O   1 
HETATM 1119 O O   . HOH C 3 .   ? 10.879  3.274   10.782 1.00 23.40 ? 167 HOH A O   1 
HETATM 1120 O O   . HOH C 3 .   ? 13.520  5.031   6.446  1.00 46.59 ? 168 HOH A O   1 
HETATM 1121 O O   . HOH C 3 .   ? 11.748  3.835   -2.216 1.00 43.11 ? 169 HOH A O   1 
HETATM 1122 O O   . HOH C 3 .   ? 9.310   5.047   -5.238 1.00 31.53 ? 170 HOH A O   1 
HETATM 1123 O O   . HOH C 3 .   ? 23.297  -12.042 0.640  1.00 38.14 ? 171 HOH A O   1 
HETATM 1124 O O   . HOH C 3 .   ? 26.750  12.733  13.604 1.00 55.88 ? 172 HOH A O   1 
HETATM 1125 O O   . HOH C 3 .   ? 8.887   3.552   -2.881 1.00 35.98 ? 173 HOH A O   1 
HETATM 1126 O O   . HOH C 3 .   ? -1.866  -8.706  13.582 1.00 25.01 ? 174 HOH A O   1 
HETATM 1127 O O   . HOH C 3 .   ? 15.951  -12.594 3.680  1.00 62.36 ? 175 HOH A O   1 
HETATM 1128 O O   . HOH C 3 .   ? 25.073  -0.933  -3.755 1.00 40.59 ? 176 HOH A O   1 
HETATM 1129 O O   . HOH C 3 .   ? 23.425  6.583   6.334  1.00 51.70 ? 177 HOH A O   1 
HETATM 1130 O O   . HOH C 3 .   ? 12.534  2.211   -4.876 1.00 43.28 ? 178 HOH A O   1 
HETATM 1131 O O   . HOH C 3 .   ? 4.201   9.785   21.102 1.00 48.51 ? 179 HOH A O   1 
HETATM 1132 O O   . HOH C 3 .   ? 9.754   6.346   22.141 1.00 35.57 ? 180 HOH A O   1 
HETATM 1133 O O   . HOH C 3 .   ? 9.260   8.434   17.356 1.00 39.47 ? 181 HOH A O   1 
HETATM 1134 O O   . HOH C 3 .   ? 6.507   0.831   24.442 1.00 37.21 ? 182 HOH A O   1 
HETATM 1135 O O   . HOH C 3 .   ? 13.330  6.918   11.493 1.00 14.05 ? 183 HOH A O   1 
HETATM 1136 O O   . HOH C 3 .   ? 10.483  8.284   6.433  1.00 24.11 ? 184 HOH A O   1 
HETATM 1137 O O   . HOH C 3 .   ? 23.360  3.826   19.681 1.00 42.12 ? 185 HOH A O   1 
HETATM 1138 O O   . HOH C 3 .   ? 21.996  6.336   19.753 1.00 53.74 ? 186 HOH A O   1 
HETATM 1139 O O   . HOH C 3 .   ? 8.924   16.037  1.161  1.00 57.88 ? 187 HOH A O   1 
HETATM 1140 O O   . HOH C 3 .   ? 22.424  1.150   -0.375 1.00 40.85 ? 188 HOH A O   1 
HETATM 1141 O O   . HOH C 3 .   ? 22.047  -11.815 7.195  1.00 41.90 ? 189 HOH A O   1 
HETATM 1142 O O   . HOH C 3 .   ? -4.553  3.346   18.467 1.00 41.57 ? 190 HOH A O   1 
HETATM 1143 O O   . HOH C 3 .   ? 14.951  -10.825 0.190  1.00 59.12 ? 191 HOH A O   1 
HETATM 1144 O O   . HOH C 3 .   ? 9.556   -8.599  -9.174 1.00 43.68 ? 192 HOH A O   1 
HETATM 1145 O O   . HOH C 3 .   ? 10.966  3.892   7.520  1.00 49.10 ? 193 HOH A O   1 
HETATM 1146 O O   . HOH C 3 .   ? -8.093  -0.680  10.754 1.00 37.15 ? 194 HOH A O   1 
HETATM 1147 O O   . HOH C 3 .   ? -5.669  -3.964  5.091  1.00 39.37 ? 195 HOH A O   1 
HETATM 1148 O O   . HOH C 3 .   ? -4.850  -5.439  -7.105 1.00 65.12 ? 196 HOH A O   1 
HETATM 1149 O O   . HOH C 3 .   ? 13.574  -5.387  -6.530 1.00 41.13 ? 197 HOH A O   1 
HETATM 1150 O O   . HOH C 3 .   ? 18.514  -14.609 4.623  1.00 54.10 ? 198 HOH A O   1 
HETATM 1151 O O   . HOH C 3 .   ? 1.554   -13.980 -1.174 1.00 36.85 ? 199 HOH A O   1 
HETATM 1152 O O   . HOH C 3 .   ? 14.734  1.284   23.914 1.00 46.43 ? 200 HOH A O   1 
HETATM 1153 O O   . HOH C 3 .   ? 1.230   5.428   -5.803 1.00 40.00 ? 201 HOH A O   1 
HETATM 1154 O O   . HOH C 3 .   ? 6.922   1.160   -4.089 1.00 26.34 ? 202 HOH A O   1 
HETATM 1155 O O   . HOH C 3 .   ? 14.806  13.785  2.132  1.00 59.27 ? 203 HOH A O   1 
HETATM 1156 O O   . HOH C 3 .   ? 14.543  -4.056  23.049 1.00 67.16 ? 204 HOH A O   1 
HETATM 1157 O O   . HOH C 3 .   ? 11.715  -4.092  22.360 1.00 46.72 ? 205 HOH A O   1 
HETATM 1158 O O   . HOH C 3 .   ? 10.725  -7.557  22.497 1.00 44.84 ? 206 HOH A O   1 
HETATM 1159 O O   . HOH C 3 .   ? 24.117  -1.252  18.008 1.00 32.40 ? 207 HOH A O   1 
HETATM 1160 O O   . HOH C 3 .   ? -1.684  -17.578 7.304  1.00 52.17 ? 208 HOH A O   1 
HETATM 1161 O O   . HOH C 3 .   ? 26.433  2.547   5.104  1.00 65.78 ? 209 HOH A O   1 
HETATM 1162 O O   . HOH C 3 .   ? -1.521  1.954   -7.151 1.00 39.46 ? 210 HOH A O   1 
HETATM 1163 O O   . HOH C 3 .   ? 25.362  -11.356 12.555 1.00 47.65 ? 211 HOH A O   1 
HETATM 1164 O O   . HOH C 3 .   ? -0.037  -11.057 16.322 1.00 43.62 ? 212 HOH A O   1 
HETATM 1165 O O   . HOH C 3 .   ? 21.067  -7.768  20.396 1.00 34.80 ? 213 HOH A O   1 
HETATM 1166 O O   . HOH C 3 .   ? 21.949  -1.464  0.137  1.00 28.51 ? 214 HOH A O   1 
HETATM 1167 O O   . HOH C 3 .   ? 22.932  -4.036  20.602 1.00 44.56 ? 215 HOH A O   1 
HETATM 1168 O O   . HOH C 3 .   ? 14.129  3.779   21.205 1.00 13.22 ? 216 HOH A O   1 
HETATM 1169 O O   . HOH C 3 .   ? 6.636   10.125  19.588 1.00 52.53 ? 217 HOH A O   1 
HETATM 1170 O O   . HOH C 3 .   ? 0.812   8.517   17.949 1.00 41.11 ? 218 HOH A O   1 
HETATM 1171 O O   . HOH C 3 .   ? -4.337  -1.041  22.388 1.00 36.51 ? 219 HOH A O   1 
HETATM 1172 O O   . HOH C 3 .   ? -0.197  -8.974  18.548 1.00 43.97 ? 220 HOH A O   1 
HETATM 1173 O O   . HOH C 3 .   ? 7.034   -4.685  23.240 1.00 26.86 ? 221 HOH A O   1 
HETATM 1174 O O   . HOH C 3 .   ? 5.958   -7.815  -1.664 1.00 14.39 ? 222 HOH A O   1 
HETATM 1175 O O   . HOH C 3 .   ? 8.233   -12.032 -7.969 1.00 57.97 ? 223 HOH A O   1 
HETATM 1176 O O   . HOH C 3 .   ? 11.483  7.475   8.859  1.00 23.96 ? 224 HOH A O   1 
HETATM 1177 O O   . HOH C 3 .   ? -2.255  8.764   16.887 1.00 48.45 ? 225 HOH A O   1 
HETATM 1178 O O   . HOH C 3 .   ? 21.183  -7.887  -2.772 1.00 81.07 ? 226 HOH A O   1 
HETATM 1179 O O   . HOH C 3 .   ? 16.730  7.877   0.684  1.00 48.26 ? 227 HOH A O   1 
HETATM 1180 O O   . HOH C 3 .   ? 19.677  -1.082  23.642 1.00 65.33 ? 228 HOH A O   1 
HETATM 1181 O O   . HOH C 3 .   ? 21.434  0.959   24.239 1.00 68.13 ? 229 HOH A O   1 
HETATM 1182 O O   . HOH C 3 .   ? 28.270  0.738   16.173 1.00 51.71 ? 230 HOH A O   1 
HETATM 1183 O O   . HOH C 3 .   ? 30.136  14.563  10.701 1.00 50.17 ? 231 HOH A O   1 
HETATM 1184 O O   . HOH C 3 .   ? -8.546  0.680   -2.185 1.00 52.31 ? 232 HOH A O   1 
HETATM 1185 O O   . HOH C 3 .   ? -4.598  9.887   5.656  1.00 44.31 ? 233 HOH A O   1 
HETATM 1186 O O   . HOH C 3 .   ? -3.669  10.367  1.658  1.00 42.93 ? 234 HOH A O   1 
HETATM 1187 O O   . HOH C 3 .   ? 15.481  10.898  2.541  1.00 44.41 ? 235 HOH A O   1 
HETATM 1188 O O   . HOH C 3 .   ? 12.885  10.088  -1.345 1.00 27.33 ? 236 HOH A O   1 
HETATM 1189 O O   . HOH C 3 .   ? 5.605   15.548  5.981  1.00 81.81 ? 237 HOH A O   1 
HETATM 1190 O O   . HOH C 3 .   ? -3.333  5.474   -4.099 1.00 72.45 ? 238 HOH A O   1 
HETATM 1191 O O   . HOH C 3 .   ? 3.194   17.532  6.799  1.00 95.39 ? 239 HOH A O   1 
HETATM 1192 O O   . HOH C 3 .   ? -6.311  10.213  17.449 1.00 70.02 ? 240 HOH A O   1 
HETATM 1193 O O   . HOH C 3 .   ? 28.069  9.677   20.970 1.00 78.45 ? 241 HOH A O   1 
HETATM 1194 O O   . HOH C 3 .   ? 18.585  -14.398 11.306 1.00 55.52 ? 242 HOH A O   1 
HETATM 1195 O O   . HOH C 3 .   ? 15.942  -8.505  22.266 1.00 54.36 ? 243 HOH A O   1 
HETATM 1196 O O   . HOH C 3 .   ? 16.040  4.243   21.254 1.00 22.41 ? 244 HOH A O   1 
HETATM 1197 O O   . HOH C 3 .   ? 14.477  5.712   20.574 1.00 33.93 ? 245 HOH A O   1 
HETATM 1198 O O   . HOH C 3 .   ? 25.018  -14.913 7.882  1.00 65.63 ? 246 HOH A O   1 
HETATM 1199 O O   . HOH C 3 .   ? -0.685  12.161  14.696 1.00 76.38 ? 247 HOH A O   1 
HETATM 1200 O O   . HOH C 3 .   ? 20.544  1.650   6.995  1.00 76.34 ? 248 HOH A O   1 
HETATM 1201 O O   . HOH C 3 .   ? 27.886  -4.129  16.282 1.00 51.51 ? 249 HOH A O   1 
HETATM 1202 O O   . HOH C 3 .   ? 27.890  -3.459  12.673 1.00 53.68 ? 250 HOH A O   1 
HETATM 1203 O O   . HOH C 3 .   ? 26.618  4.356   12.870 1.00 61.29 ? 251 HOH A O   1 
HETATM 1204 O O   . HOH C 3 .   ? 23.381  8.748   4.289  1.00 90.77 ? 252 HOH A O   1 
HETATM 1205 O O   . HOH C 3 .   ? 16.248  -0.144  -3.234 1.00 62.21 ? 253 HOH A O   1 
HETATM 1206 O O   . HOH C 3 .   ? 24.771  7.847   22.016 1.00 83.67 ? 254 HOH A O   1 
HETATM 1207 O O   . HOH C 3 .   ? 28.240  5.954   10.104 1.00 37.34 ? 255 HOH A O   1 
HETATM 1208 O O   . HOH C 3 .   ? 13.194  7.939   27.507 1.00 52.02 ? 256 HOH A O   1 
HETATM 1209 O O   . HOH C 3 .   ? 12.547  -11.573 -0.075 1.00 48.36 ? 257 HOH A O   1 
HETATM 1210 O O   . HOH C 3 .   ? 22.373  4.449   -2.051 1.00 59.93 ? 258 HOH A O   1 
HETATM 1211 O O   . HOH C 3 .   ? 25.695  -8.944  14.443 1.00 75.23 ? 259 HOH A O   1 
HETATM 1212 O O   . HOH C 3 .   ? -2.020  -10.990 15.192 1.00 54.26 ? 260 HOH A O   1 
HETATM 1213 O O   . HOH C 3 .   ? 7.361   -14.181 4.757  1.00 93.25 ? 261 HOH A O   1 
HETATM 1214 O O   . HOH C 3 .   ? 12.718  4.047   23.280 1.00 47.81 ? 262 HOH A O   1 
HETATM 1215 O O   . HOH C 3 .   ? 12.342  6.249   25.166 1.00 56.98 ? 263 HOH A O   1 
HETATM 1216 O O   . HOH C 3 .   ? 20.536  -4.412  21.233 1.00 44.18 ? 264 HOH A O   1 
HETATM 1217 O O   . HOH C 3 .   ? 6.594   8.490   -4.211 1.00 41.82 ? 265 HOH A O   1 
HETATM 1218 O O   . HOH C 3 .   ? 25.288  -12.217 6.143  1.00 76.92 ? 266 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   TRP 6   6   6   TRP TRP A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ARG 10  10  10  ARG ARG A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  MET 18  18  18  MET MET A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ILE 23  23  23  ILE ILE A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  HIS 33  33  33  HIS HIS A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LYS 37  37  37  LYS LYS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  LYS 50  50  50  LYS LYS A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ARG 56  56  56  ARG ARG A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  MET 84  84  84  MET MET A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 GLN 115 115 115 GLN GLN A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 PHE 128 128 128 PHE PHE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 OLA 1   133 133 OLA OLA A . 
C 3 HOH 1   134 134 HOH HOH A . 
C 3 HOH 2   135 135 HOH HOH A . 
C 3 HOH 3   136 136 HOH HOH A . 
C 3 HOH 4   137 137 HOH HOH A . 
C 3 HOH 5   138 138 HOH HOH A . 
C 3 HOH 6   139 139 HOH HOH A . 
C 3 HOH 7   140 140 HOH HOH A . 
C 3 HOH 8   141 141 HOH HOH A . 
C 3 HOH 9   142 142 HOH HOH A . 
C 3 HOH 10  143 143 HOH HOH A . 
C 3 HOH 11  144 144 HOH HOH A . 
C 3 HOH 12  145 145 HOH HOH A . 
C 3 HOH 13  146 146 HOH HOH A . 
C 3 HOH 14  147 147 HOH HOH A . 
C 3 HOH 15  148 148 HOH HOH A . 
C 3 HOH 16  149 149 HOH HOH A . 
C 3 HOH 17  150 150 HOH HOH A . 
C 3 HOH 18  151 151 HOH HOH A . 
C 3 HOH 19  152 152 HOH HOH A . 
C 3 HOH 20  153 153 HOH HOH A . 
C 3 HOH 21  154 154 HOH HOH A . 
C 3 HOH 22  155 155 HOH HOH A . 
C 3 HOH 23  156 156 HOH HOH A . 
C 3 HOH 24  157 157 HOH HOH A . 
C 3 HOH 25  158 158 HOH HOH A . 
C 3 HOH 26  159 159 HOH HOH A . 
C 3 HOH 27  160 160 HOH HOH A . 
C 3 HOH 28  161 161 HOH HOH A . 
C 3 HOH 29  162 162 HOH HOH A . 
C 3 HOH 30  163 163 HOH HOH A . 
C 3 HOH 31  164 164 HOH HOH A . 
C 3 HOH 32  165 165 HOH HOH A . 
C 3 HOH 33  166 166 HOH HOH A . 
C 3 HOH 34  167 167 HOH HOH A . 
C 3 HOH 35  168 168 HOH HOH A . 
C 3 HOH 36  169 169 HOH HOH A . 
C 3 HOH 37  170 170 HOH HOH A . 
C 3 HOH 38  171 171 HOH HOH A . 
C 3 HOH 39  172 172 HOH HOH A . 
C 3 HOH 40  173 173 HOH HOH A . 
C 3 HOH 41  174 174 HOH HOH A . 
C 3 HOH 42  175 175 HOH HOH A . 
C 3 HOH 43  176 176 HOH HOH A . 
C 3 HOH 44  177 177 HOH HOH A . 
C 3 HOH 45  178 178 HOH HOH A . 
C 3 HOH 46  179 179 HOH HOH A . 
C 3 HOH 47  180 180 HOH HOH A . 
C 3 HOH 48  181 181 HOH HOH A . 
C 3 HOH 49  182 182 HOH HOH A . 
C 3 HOH 50  183 183 HOH HOH A . 
C 3 HOH 51  184 184 HOH HOH A . 
C 3 HOH 52  185 185 HOH HOH A . 
C 3 HOH 53  186 186 HOH HOH A . 
C 3 HOH 54  187 187 HOH HOH A . 
C 3 HOH 55  188 188 HOH HOH A . 
C 3 HOH 56  189 189 HOH HOH A . 
C 3 HOH 57  190 190 HOH HOH A . 
C 3 HOH 58  191 191 HOH HOH A . 
C 3 HOH 59  192 192 HOH HOH A . 
C 3 HOH 60  193 193 HOH HOH A . 
C 3 HOH 61  194 194 HOH HOH A . 
C 3 HOH 62  195 195 HOH HOH A . 
C 3 HOH 63  196 196 HOH HOH A . 
C 3 HOH 64  197 197 HOH HOH A . 
C 3 HOH 65  198 198 HOH HOH A . 
C 3 HOH 66  199 199 HOH HOH A . 
C 3 HOH 67  200 200 HOH HOH A . 
C 3 HOH 68  201 201 HOH HOH A . 
C 3 HOH 69  202 202 HOH HOH A . 
C 3 HOH 70  203 203 HOH HOH A . 
C 3 HOH 71  204 204 HOH HOH A . 
C 3 HOH 72  205 205 HOH HOH A . 
C 3 HOH 73  206 206 HOH HOH A . 
C 3 HOH 74  207 207 HOH HOH A . 
C 3 HOH 75  208 208 HOH HOH A . 
C 3 HOH 76  209 209 HOH HOH A . 
C 3 HOH 77  210 210 HOH HOH A . 
C 3 HOH 78  211 211 HOH HOH A . 
C 3 HOH 79  212 212 HOH HOH A . 
C 3 HOH 80  213 213 HOH HOH A . 
C 3 HOH 81  214 214 HOH HOH A . 
C 3 HOH 82  215 215 HOH HOH A . 
C 3 HOH 83  216 216 HOH HOH A . 
C 3 HOH 84  217 217 HOH HOH A . 
C 3 HOH 85  218 218 HOH HOH A . 
C 3 HOH 86  219 219 HOH HOH A . 
C 3 HOH 87  220 220 HOH HOH A . 
C 3 HOH 88  221 221 HOH HOH A . 
C 3 HOH 89  222 222 HOH HOH A . 
C 3 HOH 90  223 223 HOH HOH A . 
C 3 HOH 91  224 224 HOH HOH A . 
C 3 HOH 92  225 225 HOH HOH A . 
C 3 HOH 93  226 226 HOH HOH A . 
C 3 HOH 94  227 227 HOH HOH A . 
C 3 HOH 95  228 228 HOH HOH A . 
C 3 HOH 96  229 229 HOH HOH A . 
C 3 HOH 97  230 230 HOH HOH A . 
C 3 HOH 98  231 231 HOH HOH A . 
C 3 HOH 99  232 232 HOH HOH A . 
C 3 HOH 100 233 233 HOH HOH A . 
C 3 HOH 101 234 234 HOH HOH A . 
C 3 HOH 102 235 235 HOH HOH A . 
C 3 HOH 103 236 236 HOH HOH A . 
C 3 HOH 104 237 237 HOH HOH A . 
C 3 HOH 105 238 238 HOH HOH A . 
C 3 HOH 106 239 239 HOH HOH A . 
C 3 HOH 107 240 240 HOH HOH A . 
C 3 HOH 108 241 241 HOH HOH A . 
C 3 HOH 109 242 242 HOH HOH A . 
C 3 HOH 110 243 243 HOH HOH A . 
C 3 HOH 111 244 244 HOH HOH A . 
C 3 HOH 112 245 245 HOH HOH A . 
C 3 HOH 113 246 246 HOH HOH A . 
C 3 HOH 114 247 247 HOH HOH A . 
C 3 HOH 115 248 248 HOH HOH A . 
C 3 HOH 116 249 249 HOH HOH A . 
C 3 HOH 117 250 250 HOH HOH A . 
C 3 HOH 118 251 251 HOH HOH A . 
C 3 HOH 119 252 252 HOH HOH A . 
C 3 HOH 120 253 253 HOH HOH A . 
C 3 HOH 121 254 254 HOH HOH A . 
C 3 HOH 122 255 255 HOH HOH A . 
C 3 HOH 123 256 256 HOH HOH A . 
C 3 HOH 124 257 257 HOH HOH A . 
C 3 HOH 125 258 258 HOH HOH A . 
C 3 HOH 126 259 259 HOH HOH A . 
C 3 HOH 127 260 260 HOH HOH A . 
C 3 HOH 128 261 261 HOH HOH A . 
C 3 HOH 129 262 262 HOH HOH A . 
C 3 HOH 130 263 263 HOH HOH A . 
C 3 HOH 131 264 264 HOH HOH A . 
C 3 HOH 132 265 265 HOH HOH A . 
C 3 HOH 133 266 266 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
TNT    refinement       . ? 2 
X-PLOR refinement       . ? 3 
X-PLOR phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1ICN 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;BOUND OLEATE HAS THREE CONFORMATIONS FOR THE CARBOXYLATE
GROUP.
;
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 216 ? ? O A HOH 244 ? ? 1.97 
2 1 O A HOH 216 ? ? O A HOH 245 ? ? 2.06 
3 1 O A HOH 151 ? ? O A HOH 236 ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 12 ? ? OE1 A GLU 12 ? ? 1.319 1.252 0.067 0.011 N 
2 1 CD A GLU 15 ? ? OE2 A GLU 15 ? ? 1.320 1.252 0.068 0.011 N 
3 1 CD A GLU 63 ? ? OE1 A GLU 63 ? ? 1.324 1.252 0.072 0.011 N 
4 1 CD A GLU 77 ? ? OE2 A GLU 77 ? ? 1.322 1.252 0.070 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 3  ? ? CG A ASP 3  ? ? OD2 A ASP 3  ? ? 111.51 118.30 -6.79  0.90 N 
2 1 NE A ARG 28 ? ? CZ A ARG 28 ? ? NH1 A ARG 28 ? ? 123.88 120.30 3.58   0.50 N 
3 1 CB A ASP 67 ? ? CA A ASP 67 ? ? C   A ASP 67 ? ? 97.29  110.40 -13.11 2.00 N 
4 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD2 A ASP 67 ? ? 107.92 118.30 -10.38 0.90 N 
5 1 CB A ASP 97 ? ? CG A ASP 97 ? ? OD2 A ASP 97 ? ? 112.53 118.30 -5.77  0.90 N 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'OLEIC ACID' OLA 
3 water        HOH 
#