data_1IEQ
# 
_entry.id   1IEQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IEQ         
RCSB  RCSB013216   
WWPDB D_1000013216 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EX1 'Three-dimensional structure of a barley beta-D-glucan exohydrolase, a family 3 glycosyl hydrolase.' unspecified 
PDB 1IEV 'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with cyclohexitol.' unspecified 
PDB 1IEW 
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside' 
unspecified 
PDB 1IEX 
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose'   
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IEQ 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hrmova, M.'     1 
'DeGori, R.'     2 
'Fincher, G.B.'  3 
'Varghese, J.N.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Catalytic mechanisms and reaction intermediates along the hydrolytic pathway of a plant beta-D-glucan glucohydrolase.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1005 
_citation.page_last                 1016 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11709165 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00673-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hrmova, M.'     1 ? 
primary 'Varghese, J.N.' 2 ? 
primary 'De Gori, R.'    3 ? 
primary 'Smith, B.J.'    4 ? 
primary 'Driguez, H.'    5 ? 
primary 'Fincher, G.B.'  6 ? 
# 
_cell.entry_id           1IEQ 
_cell.length_a           100.951 
_cell.length_b           100.951 
_cell.length_c           181.196 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1IEQ 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1' 65475.617 1   3.2.1.58 ? ? ? 
2 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1   
?        ? ? ? 
3 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-3)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1098.016  1   ?        ? ? ? 
4 non-polymer man beta-D-glucopyranose 180.156   1   ?        ? ? ? 
5 water       nat water 18.015    220 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETA-D-GLUCAN EXOHYDROLASE ISOENZYME EXOI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   TYR n 
1 3   VAL n 
1 4   LEU n 
1 5   TYR n 
1 6   LYS n 
1 7   ASP n 
1 8   ALA n 
1 9   THR n 
1 10  LYS n 
1 11  PRO n 
1 12  VAL n 
1 13  GLU n 
1 14  ASP n 
1 15  ARG n 
1 16  VAL n 
1 17  ALA n 
1 18  ASP n 
1 19  LEU n 
1 20  LEU n 
1 21  GLY n 
1 22  ARG n 
1 23  MET n 
1 24  THR n 
1 25  LEU n 
1 26  ALA n 
1 27  GLU n 
1 28  LYS n 
1 29  ILE n 
1 30  GLY n 
1 31  GLN n 
1 32  MET n 
1 33  THR n 
1 34  GLN n 
1 35  ILE n 
1 36  GLU n 
1 37  ARG n 
1 38  LEU n 
1 39  VAL n 
1 40  ALA n 
1 41  THR n 
1 42  PRO n 
1 43  ASP n 
1 44  VAL n 
1 45  LEU n 
1 46  ARG n 
1 47  ASP n 
1 48  ASN n 
1 49  PHE n 
1 50  ILE n 
1 51  GLY n 
1 52  SER n 
1 53  LEU n 
1 54  LEU n 
1 55  SER n 
1 56  GLY n 
1 57  GLY n 
1 58  GLY n 
1 59  SER n 
1 60  VAL n 
1 61  PRO n 
1 62  ARG n 
1 63  LYS n 
1 64  GLY n 
1 65  ALA n 
1 66  THR n 
1 67  ALA n 
1 68  LYS n 
1 69  GLU n 
1 70  TRP n 
1 71  GLN n 
1 72  ASP n 
1 73  MET n 
1 74  VAL n 
1 75  ASP n 
1 76  GLY n 
1 77  PHE n 
1 78  GLN n 
1 79  LYS n 
1 80  ALA n 
1 81  CYS n 
1 82  MET n 
1 83  SER n 
1 84  THR n 
1 85  ARG n 
1 86  LEU n 
1 87  GLY n 
1 88  ILE n 
1 89  PRO n 
1 90  MET n 
1 91  ILE n 
1 92  TYR n 
1 93  GLY n 
1 94  ILE n 
1 95  ASP n 
1 96  ALA n 
1 97  VAL n 
1 98  HIS n 
1 99  GLY n 
1 100 GLN n 
1 101 ASN n 
1 102 ASN n 
1 103 VAL n 
1 104 TYR n 
1 105 GLY n 
1 106 ALA n 
1 107 THR n 
1 108 ILE n 
1 109 PHE n 
1 110 PRO n 
1 111 HIS n 
1 112 ASN n 
1 113 VAL n 
1 114 GLY n 
1 115 LEU n 
1 116 GLY n 
1 117 ALA n 
1 118 THR n 
1 119 ARG n 
1 120 ASP n 
1 121 PRO n 
1 122 TYR n 
1 123 LEU n 
1 124 VAL n 
1 125 LYS n 
1 126 ARG n 
1 127 ILE n 
1 128 GLY n 
1 129 GLU n 
1 130 ALA n 
1 131 THR n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 VAL n 
1 136 ARG n 
1 137 ALA n 
1 138 THR n 
1 139 GLY n 
1 140 ILE n 
1 141 GLN n 
1 142 TYR n 
1 143 ALA n 
1 144 PHE n 
1 145 ALA n 
1 146 PRO n 
1 147 CYS n 
1 148 ILE n 
1 149 ALA n 
1 150 VAL n 
1 151 CYS n 
1 152 ARG n 
1 153 ASP n 
1 154 PRO n 
1 155 ARG n 
1 156 TRP n 
1 157 GLY n 
1 158 ARG n 
1 159 CYS n 
1 160 TYR n 
1 161 GLU n 
1 162 SER n 
1 163 TYR n 
1 164 SER n 
1 165 GLU n 
1 166 ASP n 
1 167 ARG n 
1 168 ARG n 
1 169 ILE n 
1 170 VAL n 
1 171 GLN n 
1 172 SER n 
1 173 MET n 
1 174 THR n 
1 175 GLU n 
1 176 LEU n 
1 177 ILE n 
1 178 PRO n 
1 179 GLY n 
1 180 LEU n 
1 181 GLN n 
1 182 GLY n 
1 183 ASP n 
1 184 VAL n 
1 185 PRO n 
1 186 LYS n 
1 187 ASP n 
1 188 PHE n 
1 189 THR n 
1 190 SER n 
1 191 GLY n 
1 192 MET n 
1 193 PRO n 
1 194 PHE n 
1 195 VAL n 
1 196 ALA n 
1 197 GLY n 
1 198 LYS n 
1 199 ASN n 
1 200 LYS n 
1 201 VAL n 
1 202 ALA n 
1 203 ALA n 
1 204 CYS n 
1 205 ALA n 
1 206 LYS n 
1 207 HIS n 
1 208 PHE n 
1 209 VAL n 
1 210 GLY n 
1 211 ASP n 
1 212 GLY n 
1 213 GLY n 
1 214 THR n 
1 215 VAL n 
1 216 ASP n 
1 217 GLY n 
1 218 ILE n 
1 219 ASN n 
1 220 GLU n 
1 221 ASN n 
1 222 ASN n 
1 223 THR n 
1 224 ILE n 
1 225 ILE n 
1 226 ASN n 
1 227 ARG n 
1 228 GLU n 
1 229 GLY n 
1 230 LEU n 
1 231 MET n 
1 232 ASN n 
1 233 ILE n 
1 234 HIS n 
1 235 MET n 
1 236 PRO n 
1 237 ALA n 
1 238 TYR n 
1 239 LYS n 
1 240 ASN n 
1 241 ALA n 
1 242 MET n 
1 243 ASP n 
1 244 LYS n 
1 245 GLY n 
1 246 VAL n 
1 247 SER n 
1 248 THR n 
1 249 VAL n 
1 250 MET n 
1 251 ILE n 
1 252 SER n 
1 253 TYR n 
1 254 SER n 
1 255 SER n 
1 256 TRP n 
1 257 ASN n 
1 258 GLY n 
1 259 VAL n 
1 260 LYS n 
1 261 MET n 
1 262 HIS n 
1 263 ALA n 
1 264 ASN n 
1 265 GLN n 
1 266 ASP n 
1 267 LEU n 
1 268 VAL n 
1 269 THR n 
1 270 GLY n 
1 271 TYR n 
1 272 LEU n 
1 273 LYS n 
1 274 ASP n 
1 275 THR n 
1 276 LEU n 
1 277 LYS n 
1 278 PHE n 
1 279 LYS n 
1 280 GLY n 
1 281 PHE n 
1 282 VAL n 
1 283 ILE n 
1 284 SER n 
1 285 ASP n 
1 286 TRP n 
1 287 GLU n 
1 288 GLY n 
1 289 ILE n 
1 290 ASP n 
1 291 ARG n 
1 292 ILE n 
1 293 THR n 
1 294 THR n 
1 295 PRO n 
1 296 ALA n 
1 297 GLY n 
1 298 SER n 
1 299 ASP n 
1 300 TYR n 
1 301 SER n 
1 302 TYR n 
1 303 SER n 
1 304 VAL n 
1 305 LYS n 
1 306 ALA n 
1 307 SER n 
1 308 ILE n 
1 309 LEU n 
1 310 ALA n 
1 311 GLY n 
1 312 LEU n 
1 313 ASP n 
1 314 MET n 
1 315 ILE n 
1 316 MET n 
1 317 VAL n 
1 318 PRO n 
1 319 ASN n 
1 320 LYS n 
1 321 TYR n 
1 322 GLN n 
1 323 GLN n 
1 324 PHE n 
1 325 ILE n 
1 326 SER n 
1 327 ILE n 
1 328 LEU n 
1 329 THR n 
1 330 GLY n 
1 331 HIS n 
1 332 VAL n 
1 333 ASN n 
1 334 GLY n 
1 335 GLY n 
1 336 VAL n 
1 337 ILE n 
1 338 PRO n 
1 339 MET n 
1 340 SER n 
1 341 ARG n 
1 342 ILE n 
1 343 ASP n 
1 344 ASP n 
1 345 ALA n 
1 346 VAL n 
1 347 THR n 
1 348 ARG n 
1 349 ILE n 
1 350 LEU n 
1 351 ARG n 
1 352 VAL n 
1 353 LYS n 
1 354 PHE n 
1 355 THR n 
1 356 MET n 
1 357 GLY n 
1 358 LEU n 
1 359 PHE n 
1 360 GLU n 
1 361 ASN n 
1 362 PRO n 
1 363 TYR n 
1 364 ALA n 
1 365 ASP n 
1 366 PRO n 
1 367 ALA n 
1 368 MET n 
1 369 ALA n 
1 370 GLU n 
1 371 GLN n 
1 372 LEU n 
1 373 GLY n 
1 374 LYS n 
1 375 GLN n 
1 376 GLU n 
1 377 HIS n 
1 378 ARG n 
1 379 ASP n 
1 380 LEU n 
1 381 ALA n 
1 382 ARG n 
1 383 GLU n 
1 384 ALA n 
1 385 ALA n 
1 386 ARG n 
1 387 LYS n 
1 388 SER n 
1 389 LEU n 
1 390 VAL n 
1 391 LEU n 
1 392 LEU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLY n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 THR n 
1 400 ASP n 
1 401 ALA n 
1 402 PRO n 
1 403 LEU n 
1 404 LEU n 
1 405 PRO n 
1 406 LEU n 
1 407 PRO n 
1 408 LYS n 
1 409 LYS n 
1 410 ALA n 
1 411 PRO n 
1 412 LYS n 
1 413 ILE n 
1 414 LEU n 
1 415 VAL n 
1 416 ALA n 
1 417 GLY n 
1 418 SER n 
1 419 HIS n 
1 420 ALA n 
1 421 ASP n 
1 422 ASN n 
1 423 LEU n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 CYS n 
1 428 GLY n 
1 429 GLY n 
1 430 TRP n 
1 431 THR n 
1 432 ILE n 
1 433 GLU n 
1 434 TRP n 
1 435 GLN n 
1 436 GLY n 
1 437 ASP n 
1 438 THR n 
1 439 GLY n 
1 440 ARG n 
1 441 THR n 
1 442 THR n 
1 443 VAL n 
1 444 GLY n 
1 445 THR n 
1 446 THR n 
1 447 ILE n 
1 448 LEU n 
1 449 GLU n 
1 450 ALA n 
1 451 VAL n 
1 452 LYS n 
1 453 ALA n 
1 454 ALA n 
1 455 VAL n 
1 456 ASP n 
1 457 PRO n 
1 458 SER n 
1 459 THR n 
1 460 VAL n 
1 461 VAL n 
1 462 VAL n 
1 463 PHE n 
1 464 ALA n 
1 465 GLU n 
1 466 ASN n 
1 467 PRO n 
1 468 ASP n 
1 469 ALA n 
1 470 GLU n 
1 471 PHE n 
1 472 VAL n 
1 473 LYS n 
1 474 SER n 
1 475 GLY n 
1 476 GLY n 
1 477 PHE n 
1 478 SER n 
1 479 TYR n 
1 480 ALA n 
1 481 ILE n 
1 482 VAL n 
1 483 ALA n 
1 484 VAL n 
1 485 GLY n 
1 486 GLU n 
1 487 HIS n 
1 488 PRO n 
1 489 TYR n 
1 490 THR n 
1 491 GLU n 
1 492 THR n 
1 493 LYS n 
1 494 GLY n 
1 495 ASP n 
1 496 ASN n 
1 497 LEU n 
1 498 ASN n 
1 499 LEU n 
1 500 THR n 
1 501 ILE n 
1 502 PRO n 
1 503 GLU n 
1 504 PRO n 
1 505 GLY n 
1 506 LEU n 
1 507 SER n 
1 508 THR n 
1 509 VAL n 
1 510 GLN n 
1 511 ALA n 
1 512 VAL n 
1 513 CYS n 
1 514 GLY n 
1 515 GLY n 
1 516 VAL n 
1 517 ARG n 
1 518 CYS n 
1 519 ALA n 
1 520 THR n 
1 521 VAL n 
1 522 LEU n 
1 523 ILE n 
1 524 SER n 
1 525 GLY n 
1 526 ARG n 
1 527 PRO n 
1 528 VAL n 
1 529 VAL n 
1 530 VAL n 
1 531 GLN n 
1 532 PRO n 
1 533 LEU n 
1 534 LEU n 
1 535 ALA n 
1 536 ALA n 
1 537 SER n 
1 538 ASP n 
1 539 ALA n 
1 540 LEU n 
1 541 VAL n 
1 542 ALA n 
1 543 ALA n 
1 544 TRP n 
1 545 LEU n 
1 546 PRO n 
1 547 GLY n 
1 548 SER n 
1 549 GLU n 
1 550 GLY n 
1 551 GLN n 
1 552 GLY n 
1 553 VAL n 
1 554 THR n 
1 555 ASP n 
1 556 ALA n 
1 557 LEU n 
1 558 PHE n 
1 559 GLY n 
1 560 ASP n 
1 561 PHE n 
1 562 GLY n 
1 563 PHE n 
1 564 THR n 
1 565 GLY n 
1 566 ARG n 
1 567 LEU n 
1 568 PRO n 
1 569 ARG n 
1 570 THR n 
1 571 TRP n 
1 572 PHE n 
1 573 LYS n 
1 574 SER n 
1 575 VAL n 
1 576 ASP n 
1 577 GLN n 
1 578 LEU n 
1 579 PRO n 
1 580 MET n 
1 581 ASN n 
1 582 VAL n 
1 583 GLY n 
1 584 ASP n 
1 585 ALA n 
1 586 HIS n 
1 587 TYR n 
1 588 ASP n 
1 589 PRO n 
1 590 LEU n 
1 591 PHE n 
1 592 ARG n 
1 593 LEU n 
1 594 GLY n 
1 595 TYR n 
1 596 GLY n 
1 597 LEU n 
1 598 THR n 
1 599 THR n 
1 600 ASN n 
1 601 ALA n 
1 602 THR n 
1 603 LYS n 
1 604 LYS n 
1 605 TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Hordeum vulgare' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      4513 
_entity_src_nat.genus                      Hordeum 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'CULTIVAR CLIPPER' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAD23382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNN
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_accession          4566505 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IEQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 605 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             4566505 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  630 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       605 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IEQ 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      320 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             GB 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   4566505 
_struct_ref_seq_dif.db_mon_id                    ASN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          345 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            320 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking'  . beta-D-glucopyranose                     ? 'C6 H12 O6'      180.156 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IEQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.52 
_exptl_crystal.density_percent_sol   65.09 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, PEG 400, sodium acetate, Hepes-NaOH, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1999-11-15 
_diffrn_detector.details                Monocapillary 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1IEQ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             100.00 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   26752 
_reflns.number_all                   164280 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.117 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.16 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              6.0 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.421 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IEQ 
_refine.ls_number_reflns_obs                     23701 
_refine.ls_number_reflns_all                     26292 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2591 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB Entry 1EX1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IEQ 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4566 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         125 
_refine_hist.number_atoms_solvent             220 
_refine_hist.number_atoms_total               4911 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_d   0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1IEQ 
_struct.title                     'CRYSTAL STRUCTURE OF BARLEY BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1' 
_struct.pdbx_descriptor           'beta-D-glucan exohydrolase isoenzyme ExoI (E.C.3.2.1.58)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IEQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '2-domain fold, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The biological assembly is a monomer constructed from an (alpha/beta)8 barrel and an (alpha/beta)6 sandwich.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 3   ? ASP A 7   ? VAL A 3   ASP A 7   5 ? 5  
HELX_P HELX_P2  2  PRO A 11  ? GLY A 21  ? PRO A 11  GLY A 21  1 ? 11 
HELX_P HELX_P3  3  THR A 24  ? MET A 32  ? THR A 24  MET A 32  1 ? 9  
HELX_P HELX_P4  4  LEU A 38  ? ALA A 40  ? LEU A 38  ALA A 40  5 ? 3  
HELX_P HELX_P5  5  THR A 41  ? PHE A 49  ? THR A 41  PHE A 49  1 ? 9  
HELX_P HELX_P6  6  THR A 66  ? SER A 83  ? THR A 66  SER A 83  1 ? 18 
HELX_P HELX_P7  7  HIS A 111 ? THR A 118 ? HIS A 111 THR A 118 1 ? 8  
HELX_P HELX_P8  8  ASP A 120 ? ALA A 137 ? ASP A 120 ALA A 137 1 ? 18 
HELX_P HELX_P9  9  ARG A 158 ? SER A 162 ? ARG A 158 SER A 162 5 ? 5  
HELX_P HELX_P10 10 ASP A 166 ? MET A 173 ? ASP A 166 MET A 173 1 ? 8  
HELX_P HELX_P11 11 GLU A 175 ? GLY A 182 ? GLU A 175 GLY A 182 1 ? 8  
HELX_P HELX_P12 12 GLY A 210 ? THR A 214 ? GLY A 210 THR A 214 5 ? 5  
HELX_P HELX_P13 13 THR A 214 ? ILE A 218 ? THR A 214 ILE A 218 5 ? 5  
HELX_P HELX_P14 14 ASN A 226 ? HIS A 234 ? ASN A 226 HIS A 234 1 ? 9  
HELX_P HELX_P15 15 MET A 235 ? LYS A 244 ? MET A 235 LYS A 244 1 ? 10 
HELX_P HELX_P16 16 ASN A 264 ? THR A 269 ? ASN A 264 THR A 269 1 ? 6  
HELX_P HELX_P17 17 ILE A 289 ? THR A 293 ? ILE A 289 THR A 293 5 ? 5  
HELX_P HELX_P18 18 ASP A 299 ? GLY A 311 ? ASP A 299 GLY A 311 1 ? 13 
HELX_P HELX_P19 19 LYS A 320 ? GLY A 334 ? LYS A 320 GLY A 334 1 ? 15 
HELX_P HELX_P20 20 PRO A 338 ? MET A 356 ? PRO A 338 MET A 356 1 ? 19 
HELX_P HELX_P21 21 ASP A 365 ? LEU A 372 ? ASP A 365 LEU A 372 5 ? 8  
HELX_P HELX_P22 22 LYS A 374 ? LEU A 389 ? LYS A 374 LEU A 389 1 ? 16 
HELX_P HELX_P23 23 ASN A 422 ? GLY A 428 ? ASN A 422 GLY A 428 1 ? 7  
HELX_P HELX_P24 24 THR A 446 ? ALA A 453 ? THR A 446 ALA A 453 1 ? 8  
HELX_P HELX_P25 25 ASP A 468 ? SER A 474 ? ASP A 468 SER A 474 1 ? 7  
HELX_P HELX_P26 26 THR A 490 ? ASP A 495 ? THR A 490 ASP A 495 5 ? 6  
HELX_P HELX_P27 27 GLY A 505 ? VAL A 516 ? GLY A 505 VAL A 516 1 ? 12 
HELX_P HELX_P28 28 VAL A 530 ? SER A 537 ? VAL A 530 SER A 537 1 ? 8  
HELX_P HELX_P29 29 GLY A 550 ? PHE A 558 ? GLY A 550 PHE A 558 1 ? 9  
HELX_P HELX_P30 30 SER A 574 ? LEU A 578 ? SER A 574 LEU A 578 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 151 SG  ? ? ? 1_555 A CYS 159 SG ? ? A CYS 151 A CYS 159 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf2 disulf ?    ? A CYS 513 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 513 A CYS 518 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
covale1 covale one  ? A ASN 221 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 221 B NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale2 covale one  ? A ASN 498 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 498 C NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.395 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
covale5 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale6 covale both ? C NAG .   O3  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 6   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
covale7 covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale8 covale both ? C BMA .   O6  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 3   C MAN 4   1_555 ? ? ? ? ? ? ? 1.402 ? ?               
covale9 covale both ? C MAN .   O2  ? ? ? 1_555 C NAG .   C1 ? ? C MAN 4   C NAG 5   1_555 ? ? ? ? ? ? ? 1.390 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 145 A . ? ALA 145 A PRO 146 A ? PRO 146 A 1 0.38  
2 LYS 206 A . ? LYS 206 A HIS 207 A ? HIS 207 A 1 -0.96 
3 PHE 208 A . ? PHE 208 A VAL 209 A ? VAL 209 A 1 -0.83 
4 THR 294 A . ? THR 294 A PRO 295 A ? PRO 295 A 1 0.25  
5 VAL 317 A . ? VAL 317 A PRO 318 A ? PRO 318 A 1 -0.22 
6 LEU 404 A . ? LEU 404 A PRO 405 A ? PRO 405 A 1 0.08  
7 GLU 503 A . ? GLU 503 A PRO 504 A ? PRO 504 A 1 0.00  
8 LEU 578 A . ? LEU 578 A PRO 579 A ? PRO 579 A 1 -0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 3 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 142 ? ALA A 143 ? TYR A 142 ALA A 143 
A 2 ILE A 91  ? ILE A 94  ? ILE A 91  ILE A 94  
A 3 SER A 52  ? SER A 55  ? SER A 52  SER A 55  
A 4 THR A 33  ? GLU A 36  ? THR A 33  GLU A 36  
A 5 ILE A 315 ? MET A 316 ? ILE A 315 MET A 316 
B 1 CYS A 204 ? PHE A 208 ? CYS A 204 PHE A 208 
B 2 THR A 248 ? ILE A 251 ? THR A 248 ILE A 251 
B 3 PHE A 281 ? ILE A 283 ? PHE A 281 ILE A 283 
C 1 ASN A 222 ? THR A 223 ? ASN A 222 THR A 223 
C 2 SER A 255 ? TRP A 256 ? SER A 255 TRP A 256 
C 3 VAL A 259 ? LYS A 260 ? VAL A 259 LYS A 260 
D 1 VAL A 390 ? ASN A 394 ? VAL A 390 ASN A 394 
D 2 ALA A 539 ? TRP A 544 ? ALA A 539 TRP A 544 
D 3 CYS A 518 ? ILE A 523 ? CYS A 518 ILE A 523 
D 4 ALA A 480 ? GLY A 485 ? ALA A 480 GLY A 485 
D 5 LYS A 412 ? ALA A 416 ? LYS A 412 ALA A 416 
D 6 VAL A 460 ? ALA A 464 ? VAL A 460 ALA A 464 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 142 ? N TYR A 142 O TYR A 92  ? O TYR A 92  
A 2 3 N GLY A 93  ? N GLY A 93  O LEU A 53  ? O LEU A 53  
A 3 4 N SER A 52  ? N SER A 52  O THR A 33  ? O THR A 33  
A 4 5 N GLN A 34  ? N GLN A 34  O ILE A 315 ? O ILE A 315 
B 1 2 N ALA A 205 ? N ALA A 205 O THR A 248 ? O THR A 248 
B 2 3 N VAL A 249 ? N VAL A 249 O PHE A 281 ? O PHE A 281 
C 1 2 N THR A 223 ? N THR A 223 O SER A 255 ? O SER A 255 
C 2 3 N TRP A 256 ? N TRP A 256 O VAL A 259 ? O VAL A 259 
D 1 2 N LEU A 392 ? N LEU A 392 O LEU A 540 ? O LEU A 540 
D 2 3 N ALA A 539 ? N ALA A 539 O CYS A 518 ? O CYS A 518 
D 3 4 N ALA A 519 ? N ALA A 519 O ALA A 480 ? O ALA A 480 
D 4 5 N ILE A 481 ? N ILE A 481 O LEU A 414 ? O LEU A 414 
D 5 6 N ILE A 413 ? N ILE A 413 O VAL A 460 ? O VAL A 460 
# 
_database_PDB_matrix.entry_id          1IEQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IEQ 
_atom_sites.fract_transf_matrix[1][1]   0.009906 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009906 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005519 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 30.340  5.167  -2.188 1.00 40.42 ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 29.525  3.969  -1.851 1.00 40.76 ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 28.588  4.253  -0.683 1.00 39.68 ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 28.508  5.379  -0.196 1.00 40.34 ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 30.441  2.780  -1.518 1.00 43.11 ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 31.344  3.044  -0.320 1.00 46.12 ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 31.955  4.130  -0.265 1.00 48.49 ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 31.455  2.162  0.565  1.00 47.39 ? 1   ASP A OD2 1 
ATOM   9    N N   . TYR A 1 2   ? 27.879  3.218  -0.246 1.00 38.05 ? 2   TYR A N   1 
ATOM   10   C CA  . TYR A 1 2   ? 26.930  3.311  0.859  1.00 35.59 ? 2   TYR A CA  1 
ATOM   11   C C   . TYR A 1 2   ? 27.576  3.841  2.144  1.00 35.13 ? 2   TYR A C   1 
ATOM   12   O O   . TYR A 1 2   ? 28.641  3.366  2.553  1.00 33.93 ? 2   TYR A O   1 
ATOM   13   C CB  . TYR A 1 2   ? 26.338  1.923  1.100  1.00 33.55 ? 2   TYR A CB  1 
ATOM   14   C CG  . TYR A 1 2   ? 25.507  1.772  2.353  1.00 32.53 ? 2   TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 2   ? 24.237  2.342  2.450  1.00 31.63 ? 2   TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 2   ? 25.979  1.023  3.431  1.00 31.32 ? 2   TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 2   ? 23.454  2.164  3.589  1.00 30.65 ? 2   TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 2   ? 25.208  0.840  4.572  1.00 31.99 ? 2   TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 2   ? 23.946  1.410  4.645  1.00 31.65 ? 2   TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 2   ? 23.179  1.215  5.774  1.00 33.06 ? 2   TYR A OH  1 
ATOM   21   N N   . VAL A 1 3   ? 26.934  4.828  2.770  1.00 33.48 ? 3   VAL A N   1 
ATOM   22   C CA  . VAL A 1 3   ? 27.438  5.402  4.019  1.00 33.01 ? 3   VAL A CA  1 
ATOM   23   C C   . VAL A 1 3   ? 26.553  4.957  5.194  1.00 32.70 ? 3   VAL A C   1 
ATOM   24   O O   . VAL A 1 3   ? 25.526  5.567  5.492  1.00 33.23 ? 3   VAL A O   1 
ATOM   25   C CB  . VAL A 1 3   ? 27.484  6.951  3.957  1.00 32.73 ? 3   VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 3   ? 28.004  7.511  5.280  1.00 31.14 ? 3   VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 3   ? 28.380  7.402  2.808  1.00 29.91 ? 3   VAL A CG2 1 
ATOM   28   N N   . LEU A 1 4   ? 26.982  3.891  5.859  1.00 31.45 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 26.264  3.295  6.979  1.00 30.04 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 25.673  4.254  8.011  1.00 29.65 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 24.490  4.157  8.337  1.00 29.16 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 27.184  2.292  7.685  1.00 30.59 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 26.631  1.281  8.699  1.00 32.30 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 26.071  1.984  9.932  1.00 32.91 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 25.567  0.447  8.025  1.00 33.77 ? 4   LEU A CD2 1 
ATOM   36   N N   . TYR A 1 5   ? 26.484  5.174  8.527  1.00 28.43 ? 5   TYR A N   1 
ATOM   37   C CA  . TYR A 1 5   ? 26.004  6.086  9.559  1.00 27.13 ? 5   TYR A CA  1 
ATOM   38   C C   . TYR A 1 5   ? 24.860  7.001  9.146  1.00 26.56 ? 5   TYR A C   1 
ATOM   39   O O   . TYR A 1 5   ? 24.095  7.450  9.993  1.00 27.05 ? 5   TYR A O   1 
ATOM   40   C CB  . TYR A 1 5   ? 27.174  6.895  10.154 1.00 26.03 ? 5   TYR A CB  1 
ATOM   41   C CG  . TYR A 1 5   ? 27.595  8.159  9.425  1.00 24.30 ? 5   TYR A CG  1 
ATOM   42   C CD1 . TYR A 1 5   ? 26.884  9.351  9.581  1.00 22.14 ? 5   TYR A CD1 1 
ATOM   43   C CD2 . TYR A 1 5   ? 28.736  8.175  8.618  1.00 22.28 ? 5   TYR A CD2 1 
ATOM   44   C CE1 . TYR A 1 5   ? 27.303  10.525 8.954  1.00 20.83 ? 5   TYR A CE1 1 
ATOM   45   C CE2 . TYR A 1 5   ? 29.161  9.339  7.990  1.00 20.44 ? 5   TYR A CE2 1 
ATOM   46   C CZ  . TYR A 1 5   ? 28.442  10.509 8.161  1.00 20.07 ? 5   TYR A CZ  1 
ATOM   47   O OH  . TYR A 1 5   ? 28.862  11.658 7.540  1.00 19.44 ? 5   TYR A OH  1 
ATOM   48   N N   . LYS A 1 6   ? 24.726  7.261  7.853  1.00 26.36 ? 6   LYS A N   1 
ATOM   49   C CA  . LYS A 1 6   ? 23.646  8.119  7.368  1.00 26.92 ? 6   LYS A CA  1 
ATOM   50   C C   . LYS A 1 6   ? 22.355  7.336  7.123  1.00 25.38 ? 6   LYS A C   1 
ATOM   51   O O   . LYS A 1 6   ? 21.336  7.919  6.774  1.00 24.94 ? 6   LYS A O   1 
ATOM   52   C CB  . LYS A 1 6   ? 24.054  8.827  6.067  1.00 28.07 ? 6   LYS A CB  1 
ATOM   53   C CG  . LYS A 1 6   ? 25.066  9.961  6.219  1.00 28.62 ? 6   LYS A CG  1 
ATOM   54   C CD  . LYS A 1 6   ? 25.342  10.590 4.855  1.00 31.44 ? 6   LYS A CD  1 
ATOM   55   C CE  . LYS A 1 6   ? 26.422  11.662 4.912  1.00 31.95 ? 6   LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 6   ? 26.024  12.797 5.778  1.00 34.92 ? 6   LYS A NZ  1 
ATOM   57   N N   . ASP A 1 7   ? 22.409  6.020  7.305  1.00 24.92 ? 7   ASP A N   1 
ATOM   58   C CA  . ASP A 1 7   ? 21.250  5.149  7.099  1.00 25.50 ? 7   ASP A CA  1 
ATOM   59   C C   . ASP A 1 7   ? 20.405  5.045  8.379  1.00 26.62 ? 7   ASP A C   1 
ATOM   60   O O   . ASP A 1 7   ? 20.781  4.349  9.332  1.00 27.09 ? 7   ASP A O   1 
ATOM   61   C CB  . ASP A 1 7   ? 21.727  3.754  6.684  1.00 24.34 ? 7   ASP A CB  1 
ATOM   62   C CG  . ASP A 1 7   ? 20.586  2.838  6.294  1.00 25.65 ? 7   ASP A CG  1 
ATOM   63   O OD1 . ASP A 1 7   ? 19.479  2.970  6.862  1.00 25.94 ? 7   ASP A OD1 1 
ATOM   64   O OD2 . ASP A 1 7   ? 20.798  1.971  5.426  1.00 26.00 ? 7   ASP A OD2 1 
ATOM   65   N N   . ALA A 1 8   ? 19.259  5.718  8.395  1.00 25.94 ? 8   ALA A N   1 
ATOM   66   C CA  . ALA A 1 8   ? 18.398  5.709  9.574  1.00 27.24 ? 8   ALA A CA  1 
ATOM   67   C C   . ALA A 1 8   ? 17.759  4.363  9.911  1.00 28.64 ? 8   ALA A C   1 
ATOM   68   O O   . ALA A 1 8   ? 17.100  4.237  10.937 1.00 29.36 ? 8   ALA A O   1 
ATOM   69   C CB  . ALA A 1 8   ? 17.323  6.764  9.433  1.00 24.49 ? 8   ALA A CB  1 
ATOM   70   N N   . THR A 1 9   ? 17.958  3.355  9.068  1.00 30.73 ? 9   THR A N   1 
ATOM   71   C CA  . THR A 1 9   ? 17.368  2.038  9.323  1.00 29.66 ? 9   THR A CA  1 
ATOM   72   C C   . THR A 1 9   ? 18.333  1.089  10.025 1.00 30.54 ? 9   THR A C   1 
ATOM   73   O O   . THR A 1 9   ? 17.961  -0.038 10.348 1.00 30.12 ? 9   THR A O   1 
ATOM   74   C CB  . THR A 1 9   ? 16.931  1.345  8.015  1.00 29.07 ? 9   THR A CB  1 
ATOM   75   O OG1 . THR A 1 9   ? 18.071  0.726  7.399  1.00 27.53 ? 9   THR A OG1 1 
ATOM   76   C CG2 . THR A 1 9   ? 16.327  2.352  7.054  1.00 25.86 ? 9   THR A CG2 1 
ATOM   77   N N   . LYS A 1 10  ? 19.565  1.535  10.255 1.00 30.23 ? 10  LYS A N   1 
ATOM   78   C CA  . LYS A 1 10  ? 20.568  0.691  10.905 1.00 31.43 ? 10  LYS A CA  1 
ATOM   79   C C   . LYS A 1 10  ? 20.636  0.905  12.415 1.00 30.50 ? 10  LYS A C   1 
ATOM   80   O O   . LYS A 1 10  ? 20.287  1.968  12.920 1.00 30.74 ? 10  LYS A O   1 
ATOM   81   C CB  . LYS A 1 10  ? 21.955  0.964  10.312 1.00 33.76 ? 10  LYS A CB  1 
ATOM   82   C CG  . LYS A 1 10  ? 21.995  1.100  8.793  1.00 37.29 ? 10  LYS A CG  1 
ATOM   83   C CD  . LYS A 1 10  ? 21.663  -0.201 8.062  1.00 39.58 ? 10  LYS A CD  1 
ATOM   84   C CE  . LYS A 1 10  ? 22.708  -1.276 8.301  1.00 39.35 ? 10  LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 10  ? 22.536  -2.423 7.365  1.00 40.80 ? 10  LYS A NZ  1 
ATOM   86   N N   . PRO A 1 11  ? 21.096  -0.112 13.159 1.00 30.38 ? 11  PRO A N   1 
ATOM   87   C CA  . PRO A 1 11  ? 21.205  -0.004 14.616 1.00 29.46 ? 11  PRO A CA  1 
ATOM   88   C C   . PRO A 1 11  ? 22.137  1.135  15.009 1.00 29.27 ? 11  PRO A C   1 
ATOM   89   O O   . PRO A 1 11  ? 23.127  1.402  14.327 1.00 29.28 ? 11  PRO A O   1 
ATOM   90   C CB  . PRO A 1 11  ? 21.768  -1.363 15.025 1.00 29.60 ? 11  PRO A CB  1 
ATOM   91   C CG  . PRO A 1 11  ? 21.229  -2.285 13.972 1.00 28.08 ? 11  PRO A CG  1 
ATOM   92   C CD  . PRO A 1 11  ? 21.421  -1.477 12.708 1.00 29.88 ? 11  PRO A CD  1 
ATOM   93   N N   . VAL A 1 12  ? 21.813  1.792  16.117 1.00 29.19 ? 12  VAL A N   1 
ATOM   94   C CA  . VAL A 1 12  ? 22.594  2.910  16.633 1.00 27.22 ? 12  VAL A CA  1 
ATOM   95   C C   . VAL A 1 12  ? 24.086  2.594  16.784 1.00 27.30 ? 12  VAL A C   1 
ATOM   96   O O   . VAL A 1 12  ? 24.934  3.341  16.294 1.00 26.28 ? 12  VAL A O   1 
ATOM   97   C CB  . VAL A 1 12  ? 22.016  3.380  17.995 1.00 25.97 ? 12  VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 12  ? 22.961  4.361  18.674 1.00 23.64 ? 12  VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 12  ? 20.665  4.031  17.772 1.00 24.53 ? 12  VAL A CG2 1 
ATOM   100  N N   . GLU A 1 13  ? 24.405  1.493  17.461 1.00 27.31 ? 13  GLU A N   1 
ATOM   101  C CA  . GLU A 1 13  ? 25.798  1.106  17.663 1.00 27.41 ? 13  GLU A CA  1 
ATOM   102  C C   . GLU A 1 13  ? 26.534  0.991  16.328 1.00 28.28 ? 13  GLU A C   1 
ATOM   103  O O   . GLU A 1 13  ? 27.686  1.418  16.207 1.00 29.69 ? 13  GLU A O   1 
ATOM   104  C CB  . GLU A 1 13  ? 25.883  -0.221 18.420 1.00 24.98 ? 13  GLU A CB  1 
ATOM   105  C CG  . GLU A 1 13  ? 25.231  -0.206 19.791 1.00 27.09 ? 13  GLU A CG  1 
ATOM   106  C CD  . GLU A 1 13  ? 25.792  0.872  20.716 1.00 29.80 ? 13  GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 13  ? 27.024  0.908  20.922 1.00 27.97 ? 13  GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 13  ? 24.996  1.679  21.248 1.00 29.58 ? 13  GLU A OE2 1 
ATOM   109  N N   . ASP A 1 14  ? 25.876  0.418  15.325 1.00 28.51 ? 14  ASP A N   1 
ATOM   110  C CA  . ASP A 1 14  ? 26.497  0.284  14.012 1.00 28.84 ? 14  ASP A CA  1 
ATOM   111  C C   . ASP A 1 14  ? 26.791  1.650  13.436 1.00 27.93 ? 14  ASP A C   1 
ATOM   112  O O   . ASP A 1 14  ? 27.875  1.892  12.915 1.00 29.03 ? 14  ASP A O   1 
ATOM   113  C CB  . ASP A 1 14  ? 25.588  -0.473 13.048 1.00 29.86 ? 14  ASP A CB  1 
ATOM   114  C CG  . ASP A 1 14  ? 25.456  -1.921 13.409 1.00 30.31 ? 14  ASP A CG  1 
ATOM   115  O OD1 . ASP A 1 14  ? 26.491  -2.539 13.719 1.00 30.25 ? 14  ASP A OD1 1 
ATOM   116  O OD2 . ASP A 1 14  ? 24.325  -2.443 13.380 1.00 34.34 ? 14  ASP A OD2 1 
ATOM   117  N N   . ARG A 1 15  ? 25.811  2.540  13.529 1.00 28.11 ? 15  ARG A N   1 
ATOM   118  C CA  . ARG A 1 15  ? 25.965  3.889  13.010 1.00 27.47 ? 15  ARG A CA  1 
ATOM   119  C C   . ARG A 1 15  ? 27.080  4.621  13.748 1.00 27.25 ? 15  ARG A C   1 
ATOM   120  O O   . ARG A 1 15  ? 27.899  5.291  13.122 1.00 28.58 ? 15  ARG A O   1 
ATOM   121  C CB  . ARG A 1 15  ? 24.635  4.654  13.112 1.00 26.50 ? 15  ARG A CB  1 
ATOM   122  C CG  . ARG A 1 15  ? 23.507  4.023  12.285 1.00 24.08 ? 15  ARG A CG  1 
ATOM   123  C CD  . ARG A 1 15  ? 22.198  4.786  12.401 1.00 23.14 ? 15  ARG A CD  1 
ATOM   124  N NE  . ARG A 1 15  ? 22.213  6.065  11.694 1.00 23.08 ? 15  ARG A NE  1 
ATOM   125  C CZ  . ARG A 1 15  ? 21.220  6.955  11.737 1.00 23.60 ? 15  ARG A CZ  1 
ATOM   126  N NH1 . ARG A 1 15  ? 20.129  6.711  12.455 1.00 22.12 ? 15  ARG A NH1 1 
ATOM   127  N NH2 . ARG A 1 15  ? 21.312  8.091  11.059 1.00 20.54 ? 15  ARG A NH2 1 
ATOM   128  N N   . VAL A 1 16  ? 27.130  4.485  15.070 1.00 26.43 ? 16  VAL A N   1 
ATOM   129  C CA  . VAL A 1 16  ? 28.181  5.146  15.840 1.00 25.24 ? 16  VAL A CA  1 
ATOM   130  C C   . VAL A 1 16  ? 29.553  4.653  15.391 1.00 25.01 ? 16  VAL A C   1 
ATOM   131  O O   . VAL A 1 16  ? 30.440  5.452  15.093 1.00 25.15 ? 16  VAL A O   1 
ATOM   132  C CB  . VAL A 1 16  ? 28.028  4.894  17.360 1.00 23.88 ? 16  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 16  ? 29.317  5.256  18.090 1.00 21.19 ? 16  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 16  ? 26.883  5.731  17.906 1.00 24.48 ? 16  VAL A CG2 1 
ATOM   135  N N   . ALA A 1 17  ? 29.717  3.337  15.335 1.00 24.57 ? 17  ALA A N   1 
ATOM   136  C CA  . ALA A 1 17  ? 30.989  2.748  14.930 1.00 25.52 ? 17  ALA A CA  1 
ATOM   137  C C   . ALA A 1 17  ? 31.414  3.237  13.550 1.00 25.21 ? 17  ALA A C   1 
ATOM   138  O O   . ALA A 1 17  ? 32.564  3.637  13.336 1.00 24.31 ? 17  ALA A O   1 
ATOM   139  C CB  . ALA A 1 17  ? 30.885  1.234  14.931 1.00 24.22 ? 17  ALA A CB  1 
ATOM   140  N N   . ASP A 1 18  ? 30.475  3.210  12.618 1.00 24.14 ? 18  ASP A N   1 
ATOM   141  C CA  . ASP A 1 18  ? 30.756  3.632  11.264 1.00 24.54 ? 18  ASP A CA  1 
ATOM   142  C C   . ASP A 1 18  ? 31.214  5.084  11.191 1.00 24.50 ? 18  ASP A C   1 
ATOM   143  O O   . ASP A 1 18  ? 32.149  5.410  10.464 1.00 25.03 ? 18  ASP A O   1 
ATOM   144  C CB  . ASP A 1 18  ? 29.520  3.453  10.393 1.00 26.53 ? 18  ASP A CB  1 
ATOM   145  C CG  . ASP A 1 18  ? 29.825  3.636  8.932  1.00 29.21 ? 18  ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 18  ? 30.420  2.708  8.344  1.00 30.92 ? 18  ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 18  ? 29.490  4.705  8.378  1.00 29.88 ? 18  ASP A OD2 1 
ATOM   148  N N   . LEU A 1 19  ? 30.554  5.958  11.942 1.00 24.17 ? 19  LEU A N   1 
ATOM   149  C CA  . LEU A 1 19  ? 30.912  7.367  11.922 1.00 23.95 ? 19  LEU A CA  1 
ATOM   150  C C   . LEU A 1 19  ? 32.258  7.615  12.600 1.00 24.86 ? 19  LEU A C   1 
ATOM   151  O O   . LEU A 1 19  ? 33.150  8.250  12.032 1.00 24.91 ? 19  LEU A O   1 
ATOM   152  C CB  . LEU A 1 19  ? 29.820  8.195  12.598 1.00 21.87 ? 19  LEU A CB  1 
ATOM   153  C CG  . LEU A 1 19  ? 30.089  9.701  12.656 1.00 21.38 ? 19  LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 19  ? 30.349  10.218 11.251 1.00 20.97 ? 19  LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 19  ? 28.905  10.424 13.300 1.00 21.89 ? 19  LEU A CD2 1 
ATOM   156  N N   . LEU A 1 20  ? 32.398  7.103  13.814 1.00 24.81 ? 20  LEU A N   1 
ATOM   157  C CA  . LEU A 1 20  ? 33.627  7.265  14.565 1.00 25.07 ? 20  LEU A CA  1 
ATOM   158  C C   . LEU A 1 20  ? 34.833  6.888  13.707 1.00 26.83 ? 20  LEU A C   1 
ATOM   159  O O   . LEU A 1 20  ? 35.859  7.578  13.707 1.00 28.24 ? 20  LEU A O   1 
ATOM   160  C CB  . LEU A 1 20  ? 33.585  6.382  15.810 1.00 22.72 ? 20  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 20  ? 34.779  6.527  16.750 1.00 23.51 ? 20  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 20  ? 34.904  7.987  17.198 1.00 23.10 ? 20  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 20  ? 34.604  5.599  17.944 1.00 21.47 ? 20  LEU A CD2 1 
ATOM   164  N N   . GLY A 1 21  ? 34.695  5.793  12.967 1.00 26.29 ? 21  GLY A N   1 
ATOM   165  C CA  . GLY A 1 21  ? 35.780  5.321  12.133 1.00 26.00 ? 21  GLY A CA  1 
ATOM   166  C C   . GLY A 1 21  ? 36.218  6.234  11.004 1.00 27.16 ? 21  GLY A C   1 
ATOM   167  O O   . GLY A 1 21  ? 37.285  6.023  10.431 1.00 29.45 ? 21  GLY A O   1 
ATOM   168  N N   . ARG A 1 22  ? 35.421  7.246  10.678 1.00 25.99 ? 22  ARG A N   1 
ATOM   169  C CA  . ARG A 1 22  ? 35.771  8.153  9.587  1.00 24.42 ? 22  ARG A CA  1 
ATOM   170  C C   . ARG A 1 22  ? 36.295  9.481  10.099 1.00 24.42 ? 22  ARG A C   1 
ATOM   171  O O   . ARG A 1 22  ? 36.874  10.255 9.342  1.00 25.24 ? 22  ARG A O   1 
ATOM   172  C CB  . ARG A 1 22  ? 34.544  8.442  8.715  1.00 24.27 ? 22  ARG A CB  1 
ATOM   173  C CG  . ARG A 1 22  ? 33.793  7.226  8.235  1.00 23.76 ? 22  ARG A CG  1 
ATOM   174  C CD  . ARG A 1 22  ? 32.398  7.617  7.781  1.00 24.87 ? 22  ARG A CD  1 
ATOM   175  N NE  . ARG A 1 22  ? 31.607  6.460  7.373  1.00 25.69 ? 22  ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 22  ? 31.592  5.951  6.146  1.00 25.83 ? 22  ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 22  ? 32.326  6.503  5.185  1.00 24.67 ? 22  ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 22  ? 30.849  4.878  5.884  1.00 26.78 ? 22  ARG A NH2 1 
ATOM   179  N N   . MET A 1 23  ? 36.088  9.741  11.385 1.00 24.48 ? 23  MET A N   1 
ATOM   180  C CA  . MET A 1 23  ? 36.486  11.009 11.998 1.00 23.45 ? 23  MET A CA  1 
ATOM   181  C C   . MET A 1 23  ? 37.973  11.272 12.228 1.00 22.07 ? 23  MET A C   1 
ATOM   182  O O   . MET A 1 23  ? 38.715  10.393 12.645 1.00 22.63 ? 23  MET A O   1 
ATOM   183  C CB  . MET A 1 23  ? 35.744  11.175 13.326 1.00 22.80 ? 23  MET A CB  1 
ATOM   184  C CG  . MET A 1 23  ? 34.233  11.130 13.188 1.00 23.40 ? 23  MET A CG  1 
ATOM   185  S SD  . MET A 1 23  ? 33.386  11.036 14.767 1.00 24.21 ? 23  MET A SD  1 
ATOM   186  C CE  . MET A 1 23  ? 33.583  12.725 15.357 1.00 17.83 ? 23  MET A CE  1 
ATOM   187  N N   . THR A 1 24  ? 38.387  12.505 11.957 1.00 21.22 ? 24  THR A N   1 
ATOM   188  C CA  . THR A 1 24  ? 39.760  12.941 12.172 1.00 21.07 ? 24  THR A CA  1 
ATOM   189  C C   . THR A 1 24  ? 39.838  13.377 13.639 1.00 22.54 ? 24  THR A C   1 
ATOM   190  O O   . THR A 1 24  ? 38.814  13.497 14.309 1.00 22.76 ? 24  THR A O   1 
ATOM   191  C CB  . THR A 1 24  ? 40.096  14.156 11.308 1.00 20.22 ? 24  THR A CB  1 
ATOM   192  O OG1 . THR A 1 24  ? 39.291  15.264 11.727 1.00 18.89 ? 24  THR A OG1 1 
ATOM   193  C CG2 . THR A 1 24  ? 39.816  13.868 9.847  1.00 20.61 ? 24  THR A CG2 1 
ATOM   194  N N   . LEU A 1 25  ? 41.040  13.628 14.140 1.00 23.69 ? 25  LEU A N   1 
ATOM   195  C CA  . LEU A 1 25  ? 41.182  14.043 15.533 1.00 25.33 ? 25  LEU A CA  1 
ATOM   196  C C   . LEU A 1 25  ? 40.443  15.352 15.810 1.00 26.64 ? 25  LEU A C   1 
ATOM   197  O O   . LEU A 1 25  ? 39.823  15.518 16.864 1.00 27.62 ? 25  LEU A O   1 
ATOM   198  C CB  . LEU A 1 25  ? 42.660  14.198 15.901 1.00 24.71 ? 25  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 25  ? 42.925  14.715 17.314 1.00 25.62 ? 25  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 25  ? 42.242  13.811 18.336 1.00 26.02 ? 25  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 25  ? 44.418  14.776 17.561 1.00 26.57 ? 25  LEU A CD2 1 
ATOM   202  N N   . ALA A 1 26  ? 40.503  16.277 14.860 1.00 27.04 ? 26  ALA A N   1 
ATOM   203  C CA  . ALA A 1 26  ? 39.843  17.563 15.020 1.00 26.77 ? 26  ALA A CA  1 
ATOM   204  C C   . ALA A 1 26  ? 38.335  17.390 15.141 1.00 27.30 ? 26  ALA A C   1 
ATOM   205  O O   . ALA A 1 26  ? 37.687  18.075 15.932 1.00 27.88 ? 26  ALA A O   1 
ATOM   206  C CB  . ALA A 1 26  ? 40.169  18.466 13.847 1.00 26.36 ? 26  ALA A CB  1 
ATOM   207  N N   . GLU A 1 27  ? 37.778  16.468 14.362 1.00 26.02 ? 27  GLU A N   1 
ATOM   208  C CA  . GLU A 1 27  ? 36.341  16.242 14.395 1.00 25.42 ? 27  GLU A CA  1 
ATOM   209  C C   . GLU A 1 27  ? 35.897  15.540 15.669 1.00 25.96 ? 27  GLU A C   1 
ATOM   210  O O   . GLU A 1 27  ? 34.758  15.723 16.120 1.00 25.93 ? 27  GLU A O   1 
ATOM   211  C CB  . GLU A 1 27  ? 35.901  15.458 13.154 1.00 24.00 ? 27  GLU A CB  1 
ATOM   212  C CG  . GLU A 1 27  ? 36.077  16.264 11.875 1.00 23.98 ? 27  GLU A CG  1 
ATOM   213  C CD  . GLU A 1 27  ? 35.991  15.420 10.625 1.00 25.05 ? 27  GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 27  ? 36.382  14.235 10.687 1.00 26.39 ? 27  GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 27  ? 35.552  15.943 9.576  1.00 24.84 ? 27  GLU A OE2 1 
ATOM   216  N N   . LYS A 1 28  ? 36.792  14.751 16.262 1.00 24.65 ? 28  LYS A N   1 
ATOM   217  C CA  . LYS A 1 28  ? 36.453  14.053 17.494 1.00 22.87 ? 28  LYS A CA  1 
ATOM   218  C C   . LYS A 1 28  ? 36.496  15.025 18.662 1.00 23.11 ? 28  LYS A C   1 
ATOM   219  O O   . LYS A 1 28  ? 35.572  15.073 19.475 1.00 24.25 ? 28  LYS A O   1 
ATOM   220  C CB  . LYS A 1 28  ? 37.409  12.894 17.741 1.00 20.75 ? 28  LYS A CB  1 
ATOM   221  C CG  . LYS A 1 28  ? 37.287  11.795 16.718 1.00 19.52 ? 28  LYS A CG  1 
ATOM   222  C CD  . LYS A 1 28  ? 38.204  10.636 17.039 1.00 16.61 ? 28  LYS A CD  1 
ATOM   223  C CE  . LYS A 1 28  ? 38.078  9.569  15.986 1.00 14.45 ? 28  LYS A CE  1 
ATOM   224  N NZ  . LYS A 1 28  ? 38.904  8.388  16.314 1.00 14.15 ? 28  LYS A NZ  1 
ATOM   225  N N   . ILE A 1 29  ? 37.565  15.805 18.751 1.00 23.31 ? 29  ILE A N   1 
ATOM   226  C CA  . ILE A 1 29  ? 37.673  16.776 19.833 1.00 23.03 ? 29  ILE A CA  1 
ATOM   227  C C   . ILE A 1 29  ? 36.554  17.812 19.682 1.00 22.85 ? 29  ILE A C   1 
ATOM   228  O O   . ILE A 1 29  ? 36.131  18.433 20.659 1.00 23.34 ? 29  ILE A O   1 
ATOM   229  C CB  . ILE A 1 29  ? 39.057  17.470 19.825 1.00 20.81 ? 29  ILE A CB  1 
ATOM   230  C CG1 . ILE A 1 29  ? 40.129  16.473 20.264 1.00 20.56 ? 29  ILE A CG1 1 
ATOM   231  C CG2 . ILE A 1 29  ? 39.046  18.682 20.735 1.00 19.28 ? 29  ILE A CG2 1 
ATOM   232  C CD1 . ILE A 1 29  ? 41.536  17.053 20.298 1.00 21.18 ? 29  ILE A CD1 1 
ATOM   233  N N   . GLY A 1 30  ? 36.068  17.976 18.454 1.00 22.10 ? 30  GLY A N   1 
ATOM   234  C CA  . GLY A 1 30  ? 34.993  18.920 18.194 1.00 22.90 ? 30  GLY A CA  1 
ATOM   235  C C   . GLY A 1 30  ? 33.683  18.488 18.828 1.00 23.11 ? 30  GLY A C   1 
ATOM   236  O O   . GLY A 1 30  ? 32.972  19.300 19.416 1.00 24.37 ? 30  GLY A O   1 
ATOM   237  N N   . GLN A 1 31  ? 33.355  17.206 18.706 1.00 22.43 ? 31  GLN A N   1 
ATOM   238  C CA  . GLN A 1 31  ? 32.136  16.678 19.296 1.00 22.55 ? 31  GLN A CA  1 
ATOM   239  C C   . GLN A 1 31  ? 32.167  16.847 20.810 1.00 23.79 ? 31  GLN A C   1 
ATOM   240  O O   . GLN A 1 31  ? 31.133  17.021 21.452 1.00 25.46 ? 31  GLN A O   1 
ATOM   241  C CB  . GLN A 1 31  ? 31.982  15.193 18.964 1.00 20.63 ? 31  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 31  ? 31.512  14.923 17.548 1.00 20.62 ? 31  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 31  ? 30.165  15.560 17.261 1.00 20.07 ? 31  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 31  ? 29.196  15.327 17.978 1.00 20.10 ? 31  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 31  ? 30.099  16.366 16.208 1.00 20.31 ? 31  GLN A NE2 1 
ATOM   246  N N   . MET A 1 32  ? 33.362  16.799 21.382 1.00 22.60 ? 32  MET A N   1 
ATOM   247  C CA  . MET A 1 32  ? 33.506  16.926 22.820 1.00 21.79 ? 32  MET A CA  1 
ATOM   248  C C   . MET A 1 32  ? 33.419  18.373 23.296 1.00 21.44 ? 32  MET A C   1 
ATOM   249  O O   . MET A 1 32  ? 33.518  18.635 24.494 1.00 22.20 ? 32  MET A O   1 
ATOM   250  C CB  . MET A 1 32  ? 34.845  16.328 23.251 1.00 22.84 ? 32  MET A CB  1 
ATOM   251  C CG  . MET A 1 32  ? 35.060  14.873 22.830 1.00 22.14 ? 32  MET A CG  1 
ATOM   252  S SD  . MET A 1 32  ? 36.754  14.296 23.150 1.00 21.50 ? 32  MET A SD  1 
ATOM   253  C CE  . MET A 1 32  ? 36.793  14.374 24.929 1.00 19.37 ? 32  MET A CE  1 
ATOM   254  N N   . THR A 1 33  ? 33.209  19.307 22.370 1.00 20.15 ? 33  THR A N   1 
ATOM   255  C CA  . THR A 1 33  ? 33.160  20.726 22.724 1.00 18.66 ? 33  THR A CA  1 
ATOM   256  C C   . THR A 1 33  ? 31.791  21.405 22.678 1.00 18.53 ? 33  THR A C   1 
ATOM   257  O O   . THR A 1 33  ? 31.162  21.473 21.621 1.00 18.51 ? 33  THR A O   1 
ATOM   258  C CB  . THR A 1 33  ? 34.109  21.537 21.818 1.00 19.29 ? 33  THR A CB  1 
ATOM   259  O OG1 . THR A 1 33  ? 35.412  20.948 21.849 1.00 21.64 ? 33  THR A OG1 1 
ATOM   260  C CG2 . THR A 1 33  ? 34.207  22.979 22.289 1.00 18.69 ? 33  THR A CG2 1 
ATOM   261  N N   . GLN A 1 34  ? 31.340  21.912 23.826 1.00 17.46 ? 34  GLN A N   1 
ATOM   262  C CA  . GLN A 1 34  ? 30.069  22.629 23.906 1.00 18.71 ? 34  GLN A CA  1 
ATOM   263  C C   . GLN A 1 34  ? 30.351  24.104 24.187 1.00 18.80 ? 34  GLN A C   1 
ATOM   264  O O   . GLN A 1 34  ? 31.014  24.440 25.169 1.00 19.47 ? 34  GLN A O   1 
ATOM   265  C CB  . GLN A 1 34  ? 29.183  22.075 25.016 1.00 19.39 ? 34  GLN A CB  1 
ATOM   266  C CG  . GLN A 1 34  ? 27.822  22.760 25.078 1.00 19.89 ? 34  GLN A CG  1 
ATOM   267  C CD  . GLN A 1 34  ? 27.000  22.322 26.269 1.00 20.50 ? 34  GLN A CD  1 
ATOM   268  O OE1 . GLN A 1 34  ? 27.285  22.690 27.410 1.00 19.79 ? 34  GLN A OE1 1 
ATOM   269  N NE2 . GLN A 1 34  ? 25.976  21.523 26.010 1.00 21.18 ? 34  GLN A NE2 1 
ATOM   270  N N   . ILE A 1 35  ? 29.842  24.983 23.329 1.00 18.55 ? 35  ILE A N   1 
ATOM   271  C CA  . ILE A 1 35  ? 30.076  26.414 23.485 1.00 18.08 ? 35  ILE A CA  1 
ATOM   272  C C   . ILE A 1 35  ? 28.791  27.216 23.666 1.00 19.52 ? 35  ILE A C   1 
ATOM   273  O O   . ILE A 1 35  ? 27.697  26.762 23.324 1.00 19.22 ? 35  ILE A O   1 
ATOM   274  C CB  . ILE A 1 35  ? 30.867  26.982 22.266 1.00 16.76 ? 35  ILE A CB  1 
ATOM   275  C CG1 . ILE A 1 35  ? 30.039  26.858 20.986 1.00 15.70 ? 35  ILE A CG1 1 
ATOM   276  C CG2 . ILE A 1 35  ? 32.161  26.198 22.074 1.00 18.27 ? 35  ILE A CG2 1 
ATOM   277  C CD1 . ILE A 1 35  ? 30.751  27.325 19.738 1.00 12.80 ? 35  ILE A CD1 1 
ATOM   278  N N   . GLU A 1 36  ? 28.943  28.413 24.220 1.00 20.86 ? 36  GLU A N   1 
ATOM   279  C CA  . GLU A 1 36  ? 27.828  29.320 24.463 1.00 21.96 ? 36  GLU A CA  1 
ATOM   280  C C   . GLU A 1 36  ? 27.456  29.948 23.129 1.00 22.30 ? 36  GLU A C   1 
ATOM   281  O O   . GLU A 1 36  ? 28.327  30.257 22.319 1.00 22.80 ? 36  GLU A O   1 
ATOM   282  C CB  . GLU A 1 36  ? 28.265  30.416 25.437 1.00 22.97 ? 36  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 36  ? 27.348  30.651 26.630 1.00 24.95 ? 36  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 36  ? 26.061  31.375 26.274 1.00 26.00 ? 36  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 36  ? 25.990  31.991 25.190 1.00 26.07 ? 36  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 36  ? 25.120  31.336 27.097 1.00 27.07 ? 36  GLU A OE2 1 
ATOM   287  N N   . ARG A 1 37  ? 26.167  30.139 22.894 1.00 22.77 ? 37  ARG A N   1 
ATOM   288  C CA  . ARG A 1 37  ? 25.741  30.738 21.642 1.00 22.87 ? 37  ARG A CA  1 
ATOM   289  C C   . ARG A 1 37  ? 26.384  32.111 21.472 1.00 23.34 ? 37  ARG A C   1 
ATOM   290  O O   . ARG A 1 37  ? 26.675  32.531 20.354 1.00 24.03 ? 37  ARG A O   1 
ATOM   291  C CB  . ARG A 1 37  ? 24.217  30.865 21.603 1.00 22.39 ? 37  ARG A CB  1 
ATOM   292  C CG  . ARG A 1 37  ? 23.608  31.490 22.840 1.00 22.84 ? 37  ARG A CG  1 
ATOM   293  C CD  . ARG A 1 37  ? 22.184  31.922 22.567 1.00 23.23 ? 37  ARG A CD  1 
ATOM   294  N NE  . ARG A 1 37  ? 22.130  33.139 21.761 1.00 24.66 ? 37  ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 37  ? 22.178  34.374 22.256 1.00 24.81 ? 37  ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 37  ? 22.276  34.563 23.567 1.00 22.84 ? 37  ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 37  ? 22.137  35.420 21.438 1.00 24.07 ? 37  ARG A NH2 1 
ATOM   298  N N   . LEU A 1 38  ? 26.617  32.801 22.585 1.00 23.84 ? 38  LEU A N   1 
ATOM   299  C CA  . LEU A 1 38  ? 27.214  34.129 22.540 1.00 23.85 ? 38  LEU A CA  1 
ATOM   300  C C   . LEU A 1 38  ? 28.548  34.183 21.812 1.00 25.03 ? 38  LEU A C   1 
ATOM   301  O O   . LEU A 1 38  ? 28.926  35.241 21.308 1.00 25.72 ? 38  LEU A O   1 
ATOM   302  C CB  . LEU A 1 38  ? 27.370  34.696 23.950 1.00 22.27 ? 38  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 38  ? 26.048  35.116 24.598 1.00 23.46 ? 38  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 38  ? 26.294  35.623 26.005 1.00 21.17 ? 38  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 38  ? 25.385  36.198 23.752 1.00 22.13 ? 38  LEU A CD2 1 
ATOM   306  N N   . VAL A 1 39  ? 29.264  33.062 21.745 1.00 23.80 ? 39  VAL A N   1 
ATOM   307  C CA  . VAL A 1 39  ? 30.549  33.050 21.038 1.00 22.92 ? 39  VAL A CA  1 
ATOM   308  C C   . VAL A 1 39  ? 30.497  32.171 19.792 1.00 22.78 ? 39  VAL A C   1 
ATOM   309  O O   . VAL A 1 39  ? 31.529  31.890 19.187 1.00 22.46 ? 39  VAL A O   1 
ATOM   310  C CB  . VAL A 1 39  ? 31.714  32.533 21.927 1.00 21.97 ? 39  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 39  ? 31.772  33.316 23.220 1.00 19.94 ? 39  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 39  ? 31.559  31.041 22.193 1.00 21.30 ? 39  VAL A CG2 1 
ATOM   313  N N   . ALA A 1 40  ? 29.295  31.745 19.410 1.00 22.35 ? 40  ALA A N   1 
ATOM   314  C CA  . ALA A 1 40  ? 29.125  30.882 18.247 1.00 21.91 ? 40  ALA A CA  1 
ATOM   315  C C   . ALA A 1 40  ? 28.920  31.640 16.948 1.00 22.27 ? 40  ALA A C   1 
ATOM   316  O O   . ALA A 1 40  ? 28.248  32.662 16.909 1.00 22.55 ? 40  ALA A O   1 
ATOM   317  C CB  . ALA A 1 40  ? 27.968  29.930 18.470 1.00 21.03 ? 40  ALA A CB  1 
ATOM   318  N N   . THR A 1 41  ? 29.501  31.105 15.883 1.00 23.84 ? 41  THR A N   1 
ATOM   319  C CA  . THR A 1 41  ? 29.424  31.683 14.548 1.00 24.86 ? 41  THR A CA  1 
ATOM   320  C C   . THR A 1 41  ? 29.316  30.541 13.547 1.00 25.35 ? 41  THR A C   1 
ATOM   321  O O   . THR A 1 41  ? 29.771  29.429 13.827 1.00 26.06 ? 41  THR A O   1 
ATOM   322  C CB  . THR A 1 41  ? 30.701  32.500 14.249 1.00 25.95 ? 41  THR A CB  1 
ATOM   323  O OG1 . THR A 1 41  ? 30.527  33.837 14.736 1.00 25.94 ? 41  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 41  ? 31.013  32.522 12.757 1.00 27.41 ? 41  THR A CG2 1 
ATOM   325  N N   . PRO A 1 42  ? 28.702  30.788 12.375 1.00 24.94 ? 42  PRO A N   1 
ATOM   326  C CA  . PRO A 1 42  ? 28.599  29.699 11.398 1.00 24.24 ? 42  PRO A CA  1 
ATOM   327  C C   . PRO A 1 42  ? 29.998  29.161 11.100 1.00 24.29 ? 42  PRO A C   1 
ATOM   328  O O   . PRO A 1 42  ? 30.199  27.954 10.963 1.00 23.69 ? 42  PRO A O   1 
ATOM   329  C CB  . PRO A 1 42  ? 27.962  30.378 10.190 1.00 22.76 ? 42  PRO A CB  1 
ATOM   330  C CG  . PRO A 1 42  ? 27.076  31.402 10.821 1.00 22.76 ? 42  PRO A CG  1 
ATOM   331  C CD  . PRO A 1 42  ? 27.963  31.977 11.914 1.00 24.72 ? 42  PRO A CD  1 
ATOM   332  N N   . ASP A 1 43  ? 30.963  30.071 11.020 1.00 25.12 ? 43  ASP A N   1 
ATOM   333  C CA  . ASP A 1 43  ? 32.347  29.694 10.755 1.00 26.17 ? 43  ASP A CA  1 
ATOM   334  C C   . ASP A 1 43  ? 32.935  28.920 11.916 1.00 25.41 ? 43  ASP A C   1 
ATOM   335  O O   . ASP A 1 43  ? 33.517  27.854 11.732 1.00 24.76 ? 43  ASP A O   1 
ATOM   336  C CB  . ASP A 1 43  ? 33.214  30.929 10.511 1.00 28.60 ? 43  ASP A CB  1 
ATOM   337  C CG  . ASP A 1 43  ? 32.967  31.553 9.164  1.00 32.12 ? 43  ASP A CG  1 
ATOM   338  O OD1 . ASP A 1 43  ? 33.041  30.819 8.153  1.00 34.30 ? 43  ASP A OD1 1 
ATOM   339  O OD2 . ASP A 1 43  ? 32.706  32.776 9.118  1.00 35.24 ? 43  ASP A OD2 1 
ATOM   340  N N   . VAL A 1 44  ? 32.792  29.471 13.115 1.00 25.09 ? 44  VAL A N   1 
ATOM   341  C CA  . VAL A 1 44  ? 33.327  28.823 14.299 1.00 24.32 ? 44  VAL A CA  1 
ATOM   342  C C   . VAL A 1 44  ? 32.803  27.395 14.421 1.00 25.14 ? 44  VAL A C   1 
ATOM   343  O O   . VAL A 1 44  ? 33.585  26.450 14.576 1.00 24.64 ? 44  VAL A O   1 
ATOM   344  C CB  . VAL A 1 44  ? 32.982  29.631 15.573 1.00 24.23 ? 44  VAL A CB  1 
ATOM   345  C CG1 . VAL A 1 44  ? 33.432  28.876 16.812 1.00 21.19 ? 44  VAL A CG1 1 
ATOM   346  C CG2 . VAL A 1 44  ? 33.663  30.999 15.513 1.00 20.44 ? 44  VAL A CG2 1 
ATOM   347  N N   . LEU A 1 45  ? 31.484  27.239 14.332 1.00 24.79 ? 45  LEU A N   1 
ATOM   348  C CA  . LEU A 1 45  ? 30.874  25.921 14.433 1.00 25.16 ? 45  LEU A CA  1 
ATOM   349  C C   . LEU A 1 45  ? 31.365  25.024 13.311 1.00 25.66 ? 45  LEU A C   1 
ATOM   350  O O   . LEU A 1 45  ? 31.731  23.872 13.537 1.00 26.40 ? 45  LEU A O   1 
ATOM   351  C CB  . LEU A 1 45  ? 29.347  26.029 14.366 1.00 24.70 ? 45  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 45  ? 28.673  26.820 15.491 1.00 25.82 ? 45  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 45  ? 27.195  26.951 15.185 1.00 25.16 ? 45  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 45  ? 28.896  26.133 16.839 1.00 23.57 ? 45  LEU A CD2 1 
ATOM   355  N N   . ARG A 1 46  ? 31.378  25.560 12.099 1.00 26.18 ? 46  ARG A N   1 
ATOM   356  C CA  . ARG A 1 46  ? 31.812  24.794 10.945 1.00 26.67 ? 46  ARG A CA  1 
ATOM   357  C C   . ARG A 1 46  ? 33.300  24.444 11.014 1.00 25.29 ? 46  ARG A C   1 
ATOM   358  O O   . ARG A 1 46  ? 33.673  23.275 10.947 1.00 24.91 ? 46  ARG A O   1 
ATOM   359  C CB  . ARG A 1 46  ? 31.507  25.574 9.659  1.00 29.49 ? 46  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 46  ? 31.709  24.772 8.382  1.00 35.21 ? 46  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 46  ? 31.524  25.619 7.129  1.00 37.88 ? 46  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 46  ? 30.180  26.187 7.042  1.00 43.70 ? 46  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 46  ? 29.882  27.471 7.249  1.00 45.16 ? 46  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 46  ? 30.837  28.342 7.559  1.00 45.92 ? 46  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 46  ? 28.624  27.886 7.146  1.00 44.06 ? 46  ARG A NH2 1 
ATOM   366  N N   . ASP A 1 47  ? 34.151  25.449 11.170 1.00 24.95 ? 47  ASP A N   1 
ATOM   367  C CA  . ASP A 1 47  ? 35.590  25.205 11.212 1.00 25.67 ? 47  ASP A CA  1 
ATOM   368  C C   . ASP A 1 47  ? 36.088  24.413 12.416 1.00 25.34 ? 47  ASP A C   1 
ATOM   369  O O   . ASP A 1 47  ? 37.081  23.697 12.321 1.00 26.95 ? 47  ASP A O   1 
ATOM   370  C CB  . ASP A 1 47  ? 36.359  26.526 11.115 1.00 25.90 ? 47  ASP A CB  1 
ATOM   371  C CG  . ASP A 1 47  ? 35.992  27.323 9.874  1.00 28.56 ? 47  ASP A CG  1 
ATOM   372  O OD1 . ASP A 1 47  ? 35.550  26.707 8.873  1.00 27.39 ? 47  ASP A OD1 1 
ATOM   373  O OD2 . ASP A 1 47  ? 36.154  28.566 9.901  1.00 29.79 ? 47  ASP A OD2 1 
ATOM   374  N N   . ASN A 1 48  ? 35.414  24.527 13.550 1.00 23.64 ? 48  ASN A N   1 
ATOM   375  C CA  . ASN A 1 48  ? 35.850  23.783 14.720 1.00 21.87 ? 48  ASN A CA  1 
ATOM   376  C C   . ASN A 1 48  ? 35.077  22.490 14.957 1.00 20.87 ? 48  ASN A C   1 
ATOM   377  O O   . ASN A 1 48  ? 35.325  21.783 15.934 1.00 19.19 ? 48  ASN A O   1 
ATOM   378  C CB  . ASN A 1 48  ? 35.778  24.679 15.951 1.00 23.10 ? 48  ASN A CB  1 
ATOM   379  C CG  . ASN A 1 48  ? 36.837  25.752 15.934 1.00 22.84 ? 48  ASN A CG  1 
ATOM   380  O OD1 . ASN A 1 48  ? 38.024  25.467 16.076 1.00 24.09 ? 48  ASN A OD1 1 
ATOM   381  N ND2 . ASN A 1 48  ? 36.417  26.993 15.745 1.00 24.29 ? 48  ASN A ND2 1 
ATOM   382  N N   . PHE A 1 49  ? 34.145  22.183 14.059 1.00 20.45 ? 49  PHE A N   1 
ATOM   383  C CA  . PHE A 1 49  ? 33.342  20.971 14.162 1.00 21.22 ? 49  PHE A CA  1 
ATOM   384  C C   . PHE A 1 49  ? 32.635  20.873 15.514 1.00 20.96 ? 49  PHE A C   1 
ATOM   385  O O   . PHE A 1 49  ? 32.499  19.788 16.073 1.00 20.76 ? 49  PHE A O   1 
ATOM   386  C CB  . PHE A 1 49  ? 34.238  19.742 13.959 1.00 22.45 ? 49  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 49  ? 35.041  19.782 12.690 1.00 25.06 ? 49  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 49  ? 34.412  19.716 11.447 1.00 26.88 ? 49  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 49  ? 36.426  19.893 12.732 1.00 24.35 ? 49  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 49  ? 35.155  19.759 10.263 1.00 26.43 ? 49  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 49  ? 37.177  19.937 11.558 1.00 24.95 ? 49  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 49  ? 36.542  19.869 10.320 1.00 26.37 ? 49  PHE A CZ  1 
ATOM   393  N N   . ILE A 1 50  ? 32.181  22.008 16.033 1.00 20.67 ? 50  ILE A N   1 
ATOM   394  C CA  . ILE A 1 50  ? 31.501  22.046 17.326 1.00 20.99 ? 50  ILE A CA  1 
ATOM   395  C C   . ILE A 1 50  ? 30.368  21.021 17.424 1.00 21.58 ? 50  ILE A C   1 
ATOM   396  O O   . ILE A 1 50  ? 29.503  20.941 16.546 1.00 23.02 ? 50  ILE A O   1 
ATOM   397  C CB  . ILE A 1 50  ? 30.956  23.462 17.604 1.00 20.68 ? 50  ILE A CB  1 
ATOM   398  C CG1 . ILE A 1 50  ? 32.112  24.462 17.584 1.00 22.05 ? 50  ILE A CG1 1 
ATOM   399  C CG2 . ILE A 1 50  ? 30.274  23.517 18.957 1.00 20.96 ? 50  ILE A CG2 1 
ATOM   400  C CD1 . ILE A 1 50  ? 33.198  24.157 18.598 1.00 20.14 ? 50  ILE A CD1 1 
ATOM   401  N N   . GLY A 1 51  ? 30.377  20.240 18.501 1.00 20.44 ? 51  GLY A N   1 
ATOM   402  C CA  . GLY A 1 51  ? 29.364  19.217 18.681 1.00 18.56 ? 51  GLY A CA  1 
ATOM   403  C C   . GLY A 1 51  ? 28.166  19.634 19.504 1.00 18.79 ? 51  GLY A C   1 
ATOM   404  O O   . GLY A 1 51  ? 27.167  18.915 19.548 1.00 17.96 ? 51  GLY A O   1 
ATOM   405  N N   . SER A 1 52  ? 28.251  20.789 20.157 1.00 18.89 ? 52  SER A N   1 
ATOM   406  C CA  . SER A 1 52  ? 27.144  21.252 20.978 1.00 19.35 ? 52  SER A CA  1 
ATOM   407  C C   . SER A 1 52  ? 27.178  22.738 21.326 1.00 19.64 ? 52  SER A C   1 
ATOM   408  O O   . SER A 1 52  ? 28.242  23.342 21.432 1.00 18.55 ? 52  SER A O   1 
ATOM   409  C CB  . SER A 1 52  ? 27.092  20.434 22.274 1.00 17.95 ? 52  SER A CB  1 
ATOM   410  O OG  . SER A 1 52  ? 26.089  20.920 23.151 1.00 16.79 ? 52  SER A OG  1 
ATOM   411  N N   . LEU A 1 53  ? 25.991  23.315 21.489 1.00 20.74 ? 53  LEU A N   1 
ATOM   412  C CA  . LEU A 1 53  ? 25.838  24.712 21.879 1.00 21.89 ? 53  LEU A CA  1 
ATOM   413  C C   . LEU A 1 53  ? 24.913  24.738 23.080 1.00 22.20 ? 53  LEU A C   1 
ATOM   414  O O   . LEU A 1 53  ? 24.257  23.742 23.379 1.00 23.61 ? 53  LEU A O   1 
ATOM   415  C CB  . LEU A 1 53  ? 25.208  25.548 20.768 1.00 22.18 ? 53  LEU A CB  1 
ATOM   416  C CG  . LEU A 1 53  ? 26.083  26.018 19.609 1.00 23.95 ? 53  LEU A CG  1 
ATOM   417  C CD1 . LEU A 1 53  ? 26.146  24.951 18.524 1.00 23.40 ? 53  LEU A CD1 1 
ATOM   418  C CD2 . LEU A 1 53  ? 25.488  27.299 19.054 1.00 22.69 ? 53  LEU A CD2 1 
ATOM   419  N N   . LEU A 1 54  ? 24.864  25.870 23.774 1.00 21.50 ? 54  LEU A N   1 
ATOM   420  C CA  . LEU A 1 54  ? 23.981  26.003 24.928 1.00 19.91 ? 54  LEU A CA  1 
ATOM   421  C C   . LEU A 1 54  ? 23.736  27.459 25.283 1.00 19.25 ? 54  LEU A C   1 
ATOM   422  O O   . LEU A 1 54  ? 24.516  28.341 24.930 1.00 19.93 ? 54  LEU A O   1 
ATOM   423  C CB  . LEU A 1 54  ? 24.569  25.313 26.162 1.00 19.39 ? 54  LEU A CB  1 
ATOM   424  C CG  . LEU A 1 54  ? 25.383  26.238 27.076 1.00 20.50 ? 54  LEU A CG  1 
ATOM   425  C CD1 . LEU A 1 54  ? 25.451  25.667 28.471 1.00 21.03 ? 54  LEU A CD1 1 
ATOM   426  C CD2 . LEU A 1 54  ? 26.769  26.446 26.500 1.00 19.34 ? 54  LEU A CD2 1 
ATOM   427  N N   . SER A 1 55  ? 22.635  27.699 25.978 1.00 18.87 ? 55  SER A N   1 
ATOM   428  C CA  . SER A 1 55  ? 22.305  29.029 26.453 1.00 18.21 ? 55  SER A CA  1 
ATOM   429  C C   . SER A 1 55  ? 22.418  28.943 27.962 1.00 17.97 ? 55  SER A C   1 
ATOM   430  O O   . SER A 1 55  ? 21.744  28.126 28.585 1.00 16.62 ? 55  SER A O   1 
ATOM   431  C CB  . SER A 1 55  ? 20.869  29.422 26.099 1.00 17.77 ? 55  SER A CB  1 
ATOM   432  O OG  . SER A 1 55  ? 20.763  29.879 24.771 1.00 19.68 ? 55  SER A OG  1 
ATOM   433  N N   . GLY A 1 56  ? 23.287  29.752 28.552 1.00 17.32 ? 56  GLY A N   1 
ATOM   434  C CA  . GLY A 1 56  ? 23.377  29.739 29.996 1.00 17.43 ? 56  GLY A CA  1 
ATOM   435  C C   . GLY A 1 56  ? 22.167  30.517 30.484 1.00 17.75 ? 56  GLY A C   1 
ATOM   436  O O   . GLY A 1 56  ? 21.358  30.986 29.678 1.00 16.42 ? 56  GLY A O   1 
ATOM   437  N N   . GLY A 1 57  ? 22.021  30.655 31.794 1.00 18.56 ? 57  GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? 20.900  31.420 32.297 1.00 17.69 ? 57  GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? 20.907  32.805 31.665 1.00 18.73 ? 57  GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? 21.937  33.482 31.639 1.00 15.81 ? 57  GLY A O   1 
ATOM   441  N N   . GLY A 1 58  ? 19.760  33.215 31.130 1.00 18.86 ? 58  GLY A N   1 
ATOM   442  C CA  . GLY A 1 58  ? 19.652  34.526 30.523 1.00 17.38 ? 58  GLY A CA  1 
ATOM   443  C C   . GLY A 1 58  ? 20.201  34.705 29.117 1.00 17.75 ? 58  GLY A C   1 
ATOM   444  O O   . GLY A 1 58  ? 20.016  35.770 28.525 1.00 18.02 ? 58  GLY A O   1 
ATOM   445  N N   . SER A 1 59  ? 20.868  33.695 28.566 1.00 18.18 ? 59  SER A N   1 
ATOM   446  C CA  . SER A 1 59  ? 21.431  33.822 27.215 1.00 17.66 ? 59  SER A CA  1 
ATOM   447  C C   . SER A 1 59  ? 20.342  33.631 26.155 1.00 19.18 ? 59  SER A C   1 
ATOM   448  O O   . SER A 1 59  ? 20.050  32.509 25.738 1.00 20.85 ? 59  SER A O   1 
ATOM   449  C CB  . SER A 1 59  ? 22.549  32.804 27.017 1.00 14.10 ? 59  SER A CB  1 
ATOM   450  O OG  . SER A 1 59  ? 23.276  33.087 25.840 1.00 12.94 ? 59  SER A OG  1 
ATOM   451  N N   . VAL A 1 60  ? 19.752  34.735 25.713 1.00 20.79 ? 60  VAL A N   1 
ATOM   452  C CA  . VAL A 1 60  ? 18.665  34.683 24.745 1.00 22.60 ? 60  VAL A CA  1 
ATOM   453  C C   . VAL A 1 60  ? 18.884  35.559 23.505 1.00 24.33 ? 60  VAL A C   1 
ATOM   454  O O   . VAL A 1 60  ? 19.734  36.449 23.499 1.00 24.62 ? 60  VAL A O   1 
ATOM   455  C CB  . VAL A 1 60  ? 17.337  35.104 25.424 1.00 22.62 ? 60  VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 60  ? 17.088  34.245 26.661 1.00 22.12 ? 60  VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 60  ? 17.398  36.575 25.820 1.00 21.03 ? 60  VAL A CG2 1 
ATOM   458  N N   . PRO A 1 61  ? 18.108  35.312 22.436 1.00 26.28 ? 61  PRO A N   1 
ATOM   459  C CA  . PRO A 1 61  ? 18.192  36.062 21.176 1.00 27.24 ? 61  PRO A CA  1 
ATOM   460  C C   . PRO A 1 61  ? 17.837  37.536 21.376 1.00 28.82 ? 61  PRO A C   1 
ATOM   461  O O   . PRO A 1 61  ? 18.541  38.426 20.908 1.00 29.28 ? 61  PRO A O   1 
ATOM   462  C CB  . PRO A 1 61  ? 17.174  35.352 20.286 1.00 26.74 ? 61  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 61  ? 17.144  33.960 20.836 1.00 25.97 ? 61  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 61  ? 17.158  34.191 22.314 1.00 25.90 ? 61  PRO A CD  1 
ATOM   465  N N   . ARG A 1 62  ? 16.724  37.769 22.063 1.00 30.41 ? 62  ARG A N   1 
ATOM   466  C CA  . ARG A 1 62  ? 16.227  39.107 22.376 1.00 32.94 ? 62  ARG A CA  1 
ATOM   467  C C   . ARG A 1 62  ? 15.333  38.960 23.587 1.00 34.16 ? 62  ARG A C   1 
ATOM   468  O O   . ARG A 1 62  ? 14.845  37.870 23.885 1.00 35.60 ? 62  ARG A O   1 
ATOM   469  C CB  . ARG A 1 62  ? 15.301  39.670 21.296 1.00 34.78 ? 62  ARG A CB  1 
ATOM   470  C CG  . ARG A 1 62  ? 15.866  40.060 19.964 1.00 37.88 ? 62  ARG A CG  1 
ATOM   471  C CD  . ARG A 1 62  ? 14.789  40.871 19.228 1.00 38.23 ? 62  ARG A CD  1 
ATOM   472  N NE  . ARG A 1 62  ? 13.459  40.260 19.350 1.00 38.41 ? 62  ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 62  ? 12.305  40.911 19.185 1.00 37.45 ? 62  ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 62  ? 12.297  42.210 18.890 1.00 35.75 ? 62  ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 62  ? 11.154  40.261 19.314 1.00 33.42 ? 62  ARG A NH2 1 
ATOM   476  N N   . LYS A 1 63  ? 15.088  40.062 24.274 1.00 33.81 ? 63  LYS A N   1 
ATOM   477  C CA  . LYS A 1 63  ? 14.176  40.006 25.389 1.00 33.12 ? 63  LYS A CA  1 
ATOM   478  C C   . LYS A 1 63  ? 12.823  39.897 24.703 1.00 31.53 ? 63  LYS A C   1 
ATOM   479  O O   . LYS A 1 63  ? 12.573  40.592 23.719 1.00 30.30 ? 63  LYS A O   1 
ATOM   480  C CB  . LYS A 1 63  ? 14.257  41.288 26.214 1.00 36.34 ? 63  LYS A CB  1 
ATOM   481  C CG  . LYS A 1 63  ? 15.335  41.250 27.288 1.00 40.77 ? 63  LYS A CG  1 
ATOM   482  C CD  . LYS A 1 63  ? 15.044  40.141 28.301 1.00 42.14 ? 63  LYS A CD  1 
ATOM   483  C CE  . LYS A 1 63  ? 16.086  40.113 29.396 1.00 42.69 ? 63  LYS A CE  1 
ATOM   484  N NZ  . LYS A 1 63  ? 16.179  41.433 30.087 1.00 43.63 ? 63  LYS A NZ  1 
ATOM   485  N N   . GLY A 1 64  ? 11.972  39.002 25.196 1.00 29.99 ? 64  GLY A N   1 
ATOM   486  C CA  . GLY A 1 64  ? 10.652  38.832 24.618 1.00 26.85 ? 64  GLY A CA  1 
ATOM   487  C C   . GLY A 1 64  ? 10.607  38.093 23.291 1.00 26.39 ? 64  GLY A C   1 
ATOM   488  O O   . GLY A 1 64  ? 9.555   38.042 22.656 1.00 25.91 ? 64  GLY A O   1 
ATOM   489  N N   . ALA A 1 65  ? 11.729  37.515 22.870 1.00 24.77 ? 65  ALA A N   1 
ATOM   490  C CA  . ALA A 1 65  ? 11.785  36.782 21.606 1.00 23.60 ? 65  ALA A CA  1 
ATOM   491  C C   . ALA A 1 65  ? 10.712  35.695 21.537 1.00 23.56 ? 65  ALA A C   1 
ATOM   492  O O   . ALA A 1 65  ? 10.377  35.079 22.549 1.00 25.88 ? 65  ALA A O   1 
ATOM   493  C CB  . ALA A 1 65  ? 13.163  36.169 21.430 1.00 22.48 ? 65  ALA A CB  1 
ATOM   494  N N   . THR A 1 66  ? 10.178  35.455 20.342 1.00 22.67 ? 66  THR A N   1 
ATOM   495  C CA  . THR A 1 66  ? 9.133   34.443 20.154 1.00 21.62 ? 66  THR A CA  1 
ATOM   496  C C   . THR A 1 66  ? 9.713   33.048 19.964 1.00 22.52 ? 66  THR A C   1 
ATOM   497  O O   . THR A 1 66  ? 10.926  32.878 19.843 1.00 23.93 ? 66  THR A O   1 
ATOM   498  C CB  . THR A 1 66  ? 8.290   34.733 18.913 1.00 21.12 ? 66  THR A CB  1 
ATOM   499  O OG1 . THR A 1 66  ? 9.088   34.501 17.742 1.00 21.12 ? 66  THR A OG1 1 
ATOM   500  C CG2 . THR A 1 66  ? 7.796   36.173 18.927 1.00 16.57 ? 66  THR A CG2 1 
ATOM   501  N N   . ALA A 1 67  ? 8.840   32.048 19.919 1.00 22.08 ? 67  ALA A N   1 
ATOM   502  C CA  . ALA A 1 67  ? 9.286   30.674 19.727 1.00 22.55 ? 67  ALA A CA  1 
ATOM   503  C C   . ALA A 1 67  ? 9.974   30.512 18.368 1.00 23.15 ? 67  ALA A C   1 
ATOM   504  O O   . ALA A 1 67  ? 10.970  29.797 18.265 1.00 24.66 ? 67  ALA A O   1 
ATOM   505  C CB  . ALA A 1 67  ? 8.106   29.704 19.849 1.00 19.70 ? 67  ALA A CB  1 
ATOM   506  N N   . LYS A 1 68  ? 9.456   31.172 17.331 1.00 22.75 ? 68  LYS A N   1 
ATOM   507  C CA  . LYS A 1 68  ? 10.070  31.076 16.004 1.00 24.36 ? 68  LYS A CA  1 
ATOM   508  C C   . LYS A 1 68  ? 11.463  31.690 16.006 1.00 23.05 ? 68  LYS A C   1 
ATOM   509  O O   . LYS A 1 68  ? 12.355  31.211 15.307 1.00 20.53 ? 68  LYS A O   1 
ATOM   510  C CB  . LYS A 1 68  ? 9.219   31.778 14.940 1.00 27.11 ? 68  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 68  ? 7.920   31.073 14.620 1.00 33.22 ? 68  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 68  ? 8.129   29.820 13.773 1.00 36.20 ? 68  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 68  ? 6.899   28.904 13.859 1.00 38.51 ? 68  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 68  ? 5.618   29.660 13.757 1.00 38.87 ? 68  LYS A NZ  1 
ATOM   515  N N   . GLU A 1 69  ? 11.647  32.756 16.784 1.00 22.79 ? 69  GLU A N   1 
ATOM   516  C CA  . GLU A 1 69  ? 12.954  33.398 16.856 1.00 23.40 ? 69  GLU A CA  1 
ATOM   517  C C   . GLU A 1 69  ? 13.957  32.387 17.392 1.00 22.83 ? 69  GLU A C   1 
ATOM   518  O O   . GLU A 1 69  ? 15.055  32.253 16.847 1.00 21.46 ? 69  GLU A O   1 
ATOM   519  C CB  . GLU A 1 69  ? 12.918  34.632 17.757 1.00 23.33 ? 69  GLU A CB  1 
ATOM   520  C CG  . GLU A 1 69  ? 12.101  35.777 17.205 1.00 24.58 ? 69  GLU A CG  1 
ATOM   521  C CD  . GLU A 1 69  ? 12.175  37.018 18.077 1.00 28.31 ? 69  GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 69  ? 13.283  37.582 18.227 1.00 28.14 ? 69  GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 69  ? 11.124  37.429 18.618 1.00 30.54 ? 69  GLU A OE2 1 
ATOM   524  N N   . TRP A 1 70  ? 13.572  31.671 18.451 1.00 20.92 ? 70  TRP A N   1 
ATOM   525  C CA  . TRP A 1 70  ? 14.445  30.656 19.025 1.00 20.01 ? 70  TRP A CA  1 
ATOM   526  C C   . TRP A 1 70  ? 14.704  29.578 17.974 1.00 20.00 ? 70  TRP A C   1 
ATOM   527  O O   . TRP A 1 70  ? 15.844  29.204 17.718 1.00 19.88 ? 70  TRP A O   1 
ATOM   528  C CB  . TRP A 1 70  ? 13.820  30.023 20.278 1.00 18.74 ? 70  TRP A CB  1 
ATOM   529  C CG  . TRP A 1 70  ? 13.937  30.858 21.515 1.00 15.39 ? 70  TRP A CG  1 
ATOM   530  C CD1 . TRP A 1 70  ? 13.091  31.851 21.920 1.00 15.65 ? 70  TRP A CD1 1 
ATOM   531  C CD2 . TRP A 1 70  ? 14.986  30.805 22.488 1.00 15.12 ? 70  TRP A CD2 1 
ATOM   532  N NE1 . TRP A 1 70  ? 13.547  32.421 23.084 1.00 13.99 ? 70  TRP A NE1 1 
ATOM   533  C CE2 . TRP A 1 70  ? 14.711  31.799 23.455 1.00 15.28 ? 70  TRP A CE2 1 
ATOM   534  C CE3 . TRP A 1 70  ? 16.135  30.017 22.636 1.00 14.96 ? 70  TRP A CE3 1 
ATOM   535  C CZ2 . TRP A 1 70  ? 15.547  32.028 24.560 1.00 13.59 ? 70  TRP A CZ2 1 
ATOM   536  C CZ3 . TRP A 1 70  ? 16.968  30.246 23.736 1.00 15.31 ? 70  TRP A CZ3 1 
ATOM   537  C CH2 . TRP A 1 70  ? 16.666  31.246 24.682 1.00 13.40 ? 70  TRP A CH2 1 
ATOM   538  N N   . GLN A 1 71  ? 13.641  29.083 17.357 1.00 21.56 ? 71  GLN A N   1 
ATOM   539  C CA  . GLN A 1 71  ? 13.794  28.059 16.335 1.00 23.00 ? 71  GLN A CA  1 
ATOM   540  C C   . GLN A 1 71  ? 14.747  28.534 15.244 1.00 23.52 ? 71  GLN A C   1 
ATOM   541  O O   . GLN A 1 71  ? 15.606  27.778 14.785 1.00 23.46 ? 71  GLN A O   1 
ATOM   542  C CB  . GLN A 1 71  ? 12.427  27.694 15.739 1.00 22.96 ? 71  GLN A CB  1 
ATOM   543  C CG  . GLN A 1 71  ? 11.665  26.680 16.588 1.00 23.74 ? 71  GLN A CG  1 
ATOM   544  C CD  . GLN A 1 71  ? 10.365  26.210 15.961 1.00 24.33 ? 71  GLN A CD  1 
ATOM   545  O OE1 . GLN A 1 71  ? 10.237  26.118 14.734 1.00 23.98 ? 71  GLN A OE1 1 
ATOM   546  N NE2 . GLN A 1 71  ? 9.396   25.881 16.807 1.00 24.15 ? 71  GLN A NE2 1 
ATOM   547  N N   . ASP A 1 72  ? 14.613  29.796 14.847 1.00 23.48 ? 72  ASP A N   1 
ATOM   548  C CA  . ASP A 1 72  ? 15.471  30.345 13.809 1.00 23.05 ? 72  ASP A CA  1 
ATOM   549  C C   . ASP A 1 72  ? 16.920  30.431 14.273 1.00 23.34 ? 72  ASP A C   1 
ATOM   550  O O   . ASP A 1 72  ? 17.845  30.221 13.488 1.00 22.90 ? 72  ASP A O   1 
ATOM   551  C CB  . ASP A 1 72  ? 14.985  31.733 13.378 1.00 23.44 ? 72  ASP A CB  1 
ATOM   552  C CG  . ASP A 1 72  ? 13.660  31.689 12.623 1.00 26.33 ? 72  ASP A CG  1 
ATOM   553  O OD1 . ASP A 1 72  ? 13.288  30.609 12.102 1.00 22.88 ? 72  ASP A OD1 1 
ATOM   554  O OD2 . ASP A 1 72  ? 12.998  32.752 12.540 1.00 27.81 ? 72  ASP A OD2 1 
ATOM   555  N N   . MET A 1 73  ? 17.124  30.739 15.549 1.00 22.45 ? 73  MET A N   1 
ATOM   556  C CA  . MET A 1 73  ? 18.478  30.840 16.071 1.00 22.17 ? 73  MET A CA  1 
ATOM   557  C C   . MET A 1 73  ? 19.145  29.467 16.087 1.00 22.80 ? 73  MET A C   1 
ATOM   558  O O   . MET A 1 73  ? 20.280  29.313 15.639 1.00 24.88 ? 73  MET A O   1 
ATOM   559  C CB  . MET A 1 73  ? 18.471  31.419 17.483 1.00 21.16 ? 73  MET A CB  1 
ATOM   560  C CG  . MET A 1 73  ? 19.853  31.504 18.099 1.00 21.84 ? 73  MET A CG  1 
ATOM   561  S SD  . MET A 1 73  ? 19.795  31.841 19.856 1.00 23.19 ? 73  MET A SD  1 
ATOM   562  C CE  . MET A 1 73  ? 19.424  30.218 20.497 1.00 20.76 ? 73  MET A CE  1 
ATOM   563  N N   . VAL A 1 74  ? 18.431  28.470 16.598 1.00 20.31 ? 74  VAL A N   1 
ATOM   564  C CA  . VAL A 1 74  ? 18.961  27.125 16.674 1.00 18.12 ? 74  VAL A CA  1 
ATOM   565  C C   . VAL A 1 74  ? 19.205  26.553 15.285 1.00 19.54 ? 74  VAL A C   1 
ATOM   566  O O   . VAL A 1 74  ? 20.281  26.023 15.011 1.00 19.66 ? 74  VAL A O   1 
ATOM   567  C CB  . VAL A 1 74  ? 18.014  26.215 17.465 1.00 15.78 ? 74  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 74  ? 18.562  24.806 17.517 1.00 14.31 ? 74  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 74  ? 17.854  26.763 18.870 1.00 15.29 ? 74  VAL A CG2 1 
ATOM   570  N N   . ASP A 1 75  ? 18.214  26.658 14.406 1.00 20.79 ? 75  ASP A N   1 
ATOM   571  C CA  . ASP A 1 75  ? 18.378  26.153 13.048 1.00 21.54 ? 75  ASP A CA  1 
ATOM   572  C C   . ASP A 1 75  ? 19.577  26.820 12.364 1.00 21.63 ? 75  ASP A C   1 
ATOM   573  O O   . ASP A 1 75  ? 20.283  26.189 11.576 1.00 21.07 ? 75  ASP A O   1 
ATOM   574  C CB  . ASP A 1 75  ? 17.113  26.394 12.218 1.00 22.00 ? 75  ASP A CB  1 
ATOM   575  C CG  . ASP A 1 75  ? 15.970  25.453 12.589 1.00 24.14 ? 75  ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 75  ? 16.235  24.315 13.036 1.00 24.34 ? 75  ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 75  ? 14.797  25.845 12.411 1.00 24.20 ? 75  ASP A OD2 1 
ATOM   578  N N   . GLY A 1 76  ? 19.802  28.095 12.676 1.00 22.21 ? 76  GLY A N   1 
ATOM   579  C CA  . GLY A 1 76  ? 20.913  28.828 12.091 1.00 21.09 ? 76  GLY A CA  1 
ATOM   580  C C   . GLY A 1 76  ? 22.246  28.201 12.446 1.00 22.62 ? 76  GLY A C   1 
ATOM   581  O O   . GLY A 1 76  ? 23.124  28.045 11.592 1.00 23.20 ? 76  GLY A O   1 
ATOM   582  N N   . PHE A 1 77  ? 22.403  27.842 13.715 1.00 22.14 ? 77  PHE A N   1 
ATOM   583  C CA  . PHE A 1 77  ? 23.627  27.211 14.174 1.00 21.52 ? 77  PHE A CA  1 
ATOM   584  C C   . PHE A 1 77  ? 23.718  25.794 13.601 1.00 21.60 ? 77  PHE A C   1 
ATOM   585  O O   . PHE A 1 77  ? 24.790  25.340 13.198 1.00 20.22 ? 77  PHE A O   1 
ATOM   586  C CB  . PHE A 1 77  ? 23.656  27.157 15.709 1.00 20.82 ? 77  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 23.710  28.516 16.375 1.00 21.11 ? 77  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 24.577  29.506 15.914 1.00 19.70 ? 77  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 22.925  28.788 17.500 1.00 20.29 ? 77  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 24.665  30.738 16.560 1.00 18.83 ? 77  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 23.007  30.018 18.154 1.00 18.49 ? 77  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 23.880  30.994 17.681 1.00 18.61 ? 77  PHE A CZ  1 
ATOM   593  N N   . GLN A 1 78  ? 22.581  25.103 13.561 1.00 22.13 ? 78  GLN A N   1 
ATOM   594  C CA  . GLN A 1 78  ? 22.526  23.736 13.045 1.00 22.15 ? 78  GLN A CA  1 
ATOM   595  C C   . GLN A 1 78  ? 22.961  23.660 11.579 1.00 22.93 ? 78  GLN A C   1 
ATOM   596  O O   . GLN A 1 78  ? 23.727  22.771 11.206 1.00 22.42 ? 78  GLN A O   1 
ATOM   597  C CB  . GLN A 1 78  ? 21.113  23.171 13.196 1.00 21.34 ? 78  GLN A CB  1 
ATOM   598  C CG  . GLN A 1 78  ? 20.985  21.685 12.892 1.00 20.79 ? 78  GLN A CG  1 
ATOM   599  C CD  . GLN A 1 78  ? 21.687  20.810 13.920 1.00 23.98 ? 78  GLN A CD  1 
ATOM   600  O OE1 . GLN A 1 78  ? 22.918  20.729 13.952 1.00 24.30 ? 78  GLN A OE1 1 
ATOM   601  N NE2 . GLN A 1 78  ? 20.904  20.155 14.772 1.00 22.77 ? 78  GLN A NE2 1 
ATOM   602  N N   . LYS A 1 79  ? 22.470  24.582 10.751 1.00 24.23 ? 79  LYS A N   1 
ATOM   603  C CA  . LYS A 1 79  ? 22.840  24.604 9.335  1.00 25.62 ? 79  LYS A CA  1 
ATOM   604  C C   . LYS A 1 79  ? 24.356  24.667 9.170  1.00 24.61 ? 79  LYS A C   1 
ATOM   605  O O   . LYS A 1 79  ? 24.915  24.060 8.252  1.00 24.41 ? 79  LYS A O   1 
ATOM   606  C CB  . LYS A 1 79  ? 22.216  25.805 8.620  1.00 27.30 ? 79  LYS A CB  1 
ATOM   607  C CG  . LYS A 1 79  ? 20.807  25.581 8.103  1.00 33.48 ? 79  LYS A CG  1 
ATOM   608  C CD  . LYS A 1 79  ? 20.314  26.825 7.382  1.00 38.40 ? 79  LYS A CD  1 
ATOM   609  C CE  . LYS A 1 79  ? 18.813  26.791 7.129  1.00 41.17 ? 79  LYS A CE  1 
ATOM   610  N NZ  . LYS A 1 79  ? 18.345  28.111 6.596  1.00 44.35 ? 79  LYS A NZ  1 
ATOM   611  N N   . ALA A 1 80  ? 25.012  25.412 10.055 1.00 22.12 ? 80  ALA A N   1 
ATOM   612  C CA  . ALA A 1 80  ? 26.456  25.538 10.010 1.00 22.14 ? 80  ALA A CA  1 
ATOM   613  C C   . ALA A 1 80  ? 27.082  24.166 10.285 1.00 23.18 ? 80  ALA A C   1 
ATOM   614  O O   . ALA A 1 80  ? 27.974  23.723 9.561  1.00 23.85 ? 80  ALA A O   1 
ATOM   615  C CB  . ALA A 1 80  ? 26.924  26.561 11.041 1.00 19.98 ? 80  ALA A CB  1 
ATOM   616  N N   . CYS A 1 81  ? 26.602  23.490 11.324 1.00 21.98 ? 81  CYS A N   1 
ATOM   617  C CA  . CYS A 1 81  ? 27.115  22.172 11.668 1.00 22.84 ? 81  CYS A CA  1 
ATOM   618  C C   . CYS A 1 81  ? 26.780  21.126 10.601 1.00 23.68 ? 81  CYS A C   1 
ATOM   619  O O   . CYS A 1 81  ? 27.573  20.216 10.341 1.00 24.78 ? 81  CYS A O   1 
ATOM   620  C CB  . CYS A 1 81  ? 26.550  21.724 13.016 1.00 21.51 ? 81  CYS A CB  1 
ATOM   621  S SG  . CYS A 1 81  ? 26.980  22.811 14.380 1.00 21.43 ? 81  CYS A SG  1 
ATOM   622  N N   . MET A 1 82  ? 25.610  21.248 9.984  1.00 22.74 ? 82  MET A N   1 
ATOM   623  C CA  . MET A 1 82  ? 25.217  20.293 8.961  1.00 23.40 ? 82  MET A CA  1 
ATOM   624  C C   . MET A 1 82  ? 26.051  20.436 7.700  1.00 24.28 ? 82  MET A C   1 
ATOM   625  O O   . MET A 1 82  ? 26.023  19.561 6.836  1.00 25.09 ? 82  MET A O   1 
ATOM   626  C CB  . MET A 1 82  ? 23.736  20.448 8.608  1.00 23.60 ? 82  MET A CB  1 
ATOM   627  C CG  . MET A 1 82  ? 22.789  19.966 9.691  1.00 26.82 ? 82  MET A CG  1 
ATOM   628  S SD  . MET A 1 82  ? 23.159  18.279 10.222 1.00 31.73 ? 82  MET A SD  1 
ATOM   629  C CE  . MET A 1 82  ? 22.467  17.345 8.860  1.00 29.79 ? 82  MET A CE  1 
ATOM   630  N N   . SER A 1 83  ? 26.800  21.529 7.586  1.00 23.32 ? 83  SER A N   1 
ATOM   631  C CA  . SER A 1 83  ? 27.607  21.728 6.393  1.00 21.81 ? 83  SER A CA  1 
ATOM   632  C C   . SER A 1 83  ? 29.020  21.157 6.513  1.00 22.02 ? 83  SER A C   1 
ATOM   633  O O   . SER A 1 83  ? 29.803  21.229 5.568  1.00 23.65 ? 83  SER A O   1 
ATOM   634  C CB  . SER A 1 83  ? 27.655  23.218 6.023  1.00 20.41 ? 83  SER A CB  1 
ATOM   635  O OG  . SER A 1 83  ? 28.388  23.977 6.964  1.00 23.22 ? 83  SER A OG  1 
ATOM   636  N N   . THR A 1 84  ? 29.357  20.583 7.660  1.00 20.53 ? 84  THR A N   1 
ATOM   637  C CA  . THR A 1 84  ? 30.686  20.002 7.814  1.00 21.21 ? 84  THR A CA  1 
ATOM   638  C C   . THR A 1 84  ? 30.818  18.773 6.920  1.00 21.53 ? 84  THR A C   1 
ATOM   639  O O   . THR A 1 84  ? 29.822  18.239 6.425  1.00 20.96 ? 84  THR A O   1 
ATOM   640  C CB  . THR A 1 84  ? 30.956  19.573 9.260  1.00 21.37 ? 84  THR A CB  1 
ATOM   641  O OG1 . THR A 1 84  ? 29.926  18.671 9.692  1.00 23.14 ? 84  THR A OG1 1 
ATOM   642  C CG2 . THR A 1 84  ? 30.991  20.784 10.168 1.00 21.87 ? 84  THR A CG2 1 
ATOM   643  N N   . ARG A 1 85  ? 32.053  18.328 6.720  1.00 22.19 ? 85  ARG A N   1 
ATOM   644  C CA  . ARG A 1 85  ? 32.330  17.165 5.886  1.00 22.83 ? 85  ARG A CA  1 
ATOM   645  C C   . ARG A 1 85  ? 31.421  15.986 6.234  1.00 23.86 ? 85  ARG A C   1 
ATOM   646  O O   . ARG A 1 85  ? 30.847  15.349 5.346  1.00 25.27 ? 85  ARG A O   1 
ATOM   647  C CB  . ARG A 1 85  ? 33.800  16.751 6.045  1.00 22.84 ? 85  ARG A CB  1 
ATOM   648  C CG  . ARG A 1 85  ? 34.251  15.639 5.110  1.00 22.66 ? 85  ARG A CG  1 
ATOM   649  C CD  . ARG A 1 85  ? 35.707  15.296 5.349  1.00 23.38 ? 85  ARG A CD  1 
ATOM   650  N NE  . ARG A 1 85  ? 35.898  14.681 6.660  1.00 25.64 ? 85  ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 85  ? 36.148  13.390 6.853  1.00 25.69 ? 85  ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 85  ? 36.247  12.567 5.816  1.00 24.97 ? 85  ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 85  ? 36.281  12.918 8.086  1.00 24.35 ? 85  ARG A NH2 1 
ATOM   654  N N   . LEU A 1 86  ? 31.283  15.707 7.528  1.00 22.97 ? 86  LEU A N   1 
ATOM   655  C CA  . LEU A 1 86  ? 30.459  14.595 7.991  1.00 22.36 ? 86  LEU A CA  1 
ATOM   656  C C   . LEU A 1 86  ? 29.009  14.975 8.293  1.00 23.27 ? 86  LEU A C   1 
ATOM   657  O O   . LEU A 1 86  ? 28.146  14.104 8.408  1.00 21.93 ? 86  LEU A O   1 
ATOM   658  C CB  . LEU A 1 86  ? 31.107  13.965 9.224  1.00 21.73 ? 86  LEU A CB  1 
ATOM   659  C CG  . LEU A 1 86  ? 32.527  13.455 8.945  1.00 21.36 ? 86  LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 86  ? 33.176  13.004 10.228 1.00 17.59 ? 86  LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 86  ? 32.474  12.315 7.929  1.00 19.00 ? 86  LEU A CD2 1 
ATOM   662  N N   . GLY A 1 87  ? 28.745  16.275 8.415  1.00 23.57 ? 87  GLY A N   1 
ATOM   663  C CA  . GLY A 1 87  ? 27.397  16.740 8.695  1.00 23.65 ? 87  GLY A CA  1 
ATOM   664  C C   . GLY A 1 87  ? 26.781  16.259 10.000 1.00 23.23 ? 87  GLY A C   1 
ATOM   665  O O   . GLY A 1 87  ? 25.598  15.916 10.046 1.00 24.00 ? 87  GLY A O   1 
ATOM   666  N N   . ILE A 1 88  ? 27.577  16.239 11.063 1.00 22.37 ? 88  ILE A N   1 
ATOM   667  C CA  . ILE A 1 88  ? 27.097  15.807 12.366 1.00 22.06 ? 88  ILE A CA  1 
ATOM   668  C C   . ILE A 1 88  ? 26.287  16.922 13.026 1.00 21.79 ? 88  ILE A C   1 
ATOM   669  O O   . ILE A 1 88  ? 26.798  18.014 13.270 1.00 21.15 ? 88  ILE A O   1 
ATOM   670  C CB  . ILE A 1 88  ? 28.262  15.430 13.302 1.00 21.90 ? 88  ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 88  ? 29.151  14.375 12.638 1.00 22.38 ? 88  ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 88  ? 27.710  14.902 14.611 1.00 21.14 ? 88  ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 88  ? 30.269  13.856 13.532 1.00 21.65 ? 88  ILE A CD1 1 
ATOM   674  N N   . PRO A 1 89  ? 25.009  16.652 13.333 1.00 21.13 ? 89  PRO A N   1 
ATOM   675  C CA  . PRO A 1 89  ? 24.129  17.635 13.965 1.00 19.54 ? 89  PRO A CA  1 
ATOM   676  C C   . PRO A 1 89  ? 24.667  18.001 15.337 1.00 19.70 ? 89  PRO A C   1 
ATOM   677  O O   . PRO A 1 89  ? 25.274  17.170 16.013 1.00 18.97 ? 89  PRO A O   1 
ATOM   678  C CB  . PRO A 1 89  ? 22.799  16.894 14.094 1.00 20.26 ? 89  PRO A CB  1 
ATOM   679  C CG  . PRO A 1 89  ? 22.919  15.732 13.141 1.00 21.89 ? 89  PRO A CG  1 
ATOM   680  C CD  . PRO A 1 89  ? 24.348  15.340 13.247 1.00 20.53 ? 89  PRO A CD  1 
ATOM   681  N N   . MET A 1 90  ? 24.446  19.239 15.752 1.00 19.36 ? 90  MET A N   1 
ATOM   682  C CA  . MET A 1 90  ? 24.881  19.655 17.069 1.00 20.54 ? 90  MET A CA  1 
ATOM   683  C C   . MET A 1 90  ? 23.685  19.472 18.000 1.00 21.72 ? 90  MET A C   1 
ATOM   684  O O   . MET A 1 90  ? 22.549  19.377 17.535 1.00 23.06 ? 90  MET A O   1 
ATOM   685  C CB  . MET A 1 90  ? 25.330  21.121 17.052 1.00 20.41 ? 90  MET A CB  1 
ATOM   686  C CG  . MET A 1 90  ? 24.257  22.157 16.713 1.00 20.21 ? 90  MET A CG  1 
ATOM   687  S SD  . MET A 1 90  ? 23.176  22.663 18.085 1.00 20.81 ? 90  MET A SD  1 
ATOM   688  C CE  . MET A 1 90  ? 21.568  22.712 17.254 1.00 20.00 ? 90  MET A CE  1 
ATOM   689  N N   . ILE A 1 91  ? 23.935  19.391 19.303 1.00 21.12 ? 91  ILE A N   1 
ATOM   690  C CA  . ILE A 1 91  ? 22.850  19.250 20.263 1.00 19.72 ? 91  ILE A CA  1 
ATOM   691  C C   . ILE A 1 91  ? 22.859  20.522 21.104 1.00 20.77 ? 91  ILE A C   1 
ATOM   692  O O   . ILE A 1 91  ? 23.890  20.897 21.668 1.00 21.11 ? 91  ILE A O   1 
ATOM   693  C CB  . ILE A 1 91  ? 23.032  17.988 21.156 1.00 19.26 ? 91  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 91  ? 21.812  17.821 22.067 1.00 16.66 ? 91  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 91  ? 24.327  18.081 21.968 1.00 16.44 ? 91  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 91  ? 21.758  16.484 22.765 1.00 13.17 ? 91  ILE A CD1 1 
ATOM   697  N N   . TYR A 1 92  ? 21.715  21.195 21.162 1.00 20.09 ? 92  TYR A N   1 
ATOM   698  C CA  . TYR A 1 92  ? 21.594  22.450 21.899 1.00 20.50 ? 92  TYR A CA  1 
ATOM   699  C C   . TYR A 1 92  ? 21.006  22.218 23.286 1.00 20.37 ? 92  TYR A C   1 
ATOM   700  O O   . TYR A 1 92  ? 19.930  21.636 23.430 1.00 20.51 ? 92  TYR A O   1 
ATOM   701  C CB  . TYR A 1 92  ? 20.708  23.422 21.107 1.00 21.05 ? 92  TYR A CB  1 
ATOM   702  C CG  . TYR A 1 92  ? 20.878  24.884 21.463 1.00 20.22 ? 92  TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 92  ? 20.391  25.402 22.663 1.00 20.10 ? 92  TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 92  ? 21.533  25.750 20.594 1.00 20.62 ? 92  TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 92  ? 20.557  26.747 22.982 1.00 19.67 ? 92  TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 92  ? 21.704  27.092 20.905 1.00 19.58 ? 92  TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 92  ? 21.217  27.581 22.094 1.00 19.99 ? 92  TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 92  ? 21.408  28.907 22.385 1.00 21.55 ? 92  TYR A OH  1 
ATOM   709  N N   . GLY A 1 93  ? 21.715  22.687 24.307 1.00 18.63 ? 93  GLY A N   1 
ATOM   710  C CA  . GLY A 1 93  ? 21.244  22.505 25.665 1.00 18.42 ? 93  GLY A CA  1 
ATOM   711  C C   . GLY A 1 93  ? 20.818  23.793 26.337 1.00 18.29 ? 93  GLY A C   1 
ATOM   712  O O   . GLY A 1 93  ? 21.235  24.885 25.953 1.00 17.55 ? 93  GLY A O   1 
ATOM   713  N N   . ILE A 1 94  ? 19.976  23.663 27.352 1.00 17.21 ? 94  ILE A N   1 
ATOM   714  C CA  . ILE A 1 94  ? 19.501  24.819 28.083 1.00 17.45 ? 94  ILE A CA  1 
ATOM   715  C C   . ILE A 1 94  ? 18.928  24.373 29.413 1.00 17.73 ? 94  ILE A C   1 
ATOM   716  O O   . ILE A 1 94  ? 18.536  23.223 29.579 1.00 18.34 ? 94  ILE A O   1 
ATOM   717  C CB  . ILE A 1 94  ? 18.413  25.573 27.285 1.00 18.20 ? 94  ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 94  ? 18.064  26.890 27.990 1.00 17.64 ? 94  ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 94  ? 17.182  24.693 27.126 1.00 14.70 ? 94  ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 94  ? 17.275  27.855 27.130 1.00 17.20 ? 94  ILE A CD1 1 
ATOM   721  N N   . ASP A 1 95  ? 18.883  25.294 30.363 1.00 18.45 ? 95  ASP A N   1 
ATOM   722  C CA  . ASP A 1 95  ? 18.350  24.988 31.673 1.00 17.75 ? 95  ASP A CA  1 
ATOM   723  C C   . ASP A 1 95  ? 16.838  25.127 31.742 1.00 18.32 ? 95  ASP A C   1 
ATOM   724  O O   . ASP A 1 95  ? 16.319  26.199 32.043 1.00 18.34 ? 95  ASP A O   1 
ATOM   725  C CB  . ASP A 1 95  ? 18.984  25.894 32.721 1.00 18.57 ? 95  ASP A CB  1 
ATOM   726  C CG  . ASP A 1 95  ? 20.426  25.541 32.994 1.00 21.06 ? 95  ASP A CG  1 
ATOM   727  O OD1 . ASP A 1 95  ? 20.666  24.432 33.519 1.00 21.53 ? 95  ASP A OD1 1 
ATOM   728  O OD2 . ASP A 1 95  ? 21.316  26.366 32.687 1.00 21.49 ? 95  ASP A OD2 1 
ATOM   729  N N   . ALA A 1 96  ? 16.129  24.049 31.429 1.00 17.34 ? 96  ALA A N   1 
ATOM   730  C CA  . ALA A 1 96  ? 14.681  24.050 31.539 1.00 17.47 ? 96  ALA A CA  1 
ATOM   731  C C   . ALA A 1 96  ? 14.492  23.267 32.839 1.00 18.44 ? 96  ALA A C   1 
ATOM   732  O O   . ALA A 1 96  ? 14.173  22.080 32.833 1.00 19.86 ? 96  ALA A O   1 
ATOM   733  C CB  . ALA A 1 96  ? 14.053  23.324 30.364 1.00 15.61 ? 96  ALA A CB  1 
ATOM   734  N N   . VAL A 1 97  ? 14.728  23.940 33.957 1.00 18.41 ? 97  VAL A N   1 
ATOM   735  C CA  . VAL A 1 97  ? 14.633  23.299 35.257 1.00 20.43 ? 97  VAL A CA  1 
ATOM   736  C C   . VAL A 1 97  ? 13.257  23.361 35.910 1.00 20.67 ? 97  VAL A C   1 
ATOM   737  O O   . VAL A 1 97  ? 13.007  22.662 36.885 1.00 22.04 ? 97  VAL A O   1 
ATOM   738  C CB  . VAL A 1 97  ? 15.728  23.848 36.218 1.00 20.55 ? 97  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 97  ? 17.097  23.466 35.680 1.00 16.60 ? 97  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 97  ? 15.625  25.362 36.348 1.00 18.50 ? 97  VAL A CG2 1 
ATOM   741  N N   . HIS A 1 98  ? 12.379  24.212 35.387 1.00 20.49 ? 98  HIS A N   1 
ATOM   742  C CA  . HIS A 1 98  ? 10.998  24.308 35.870 1.00 20.59 ? 98  HIS A CA  1 
ATOM   743  C C   . HIS A 1 98  ? 10.174  24.955 34.762 1.00 20.39 ? 98  HIS A C   1 
ATOM   744  O O   . HIS A 1 98  ? 9.443   25.928 34.968 1.00 19.94 ? 98  HIS A O   1 
ATOM   745  C CB  . HIS A 1 98  ? 10.875  25.076 37.210 1.00 19.82 ? 98  HIS A CB  1 
ATOM   746  C CG  . HIS A 1 98  ? 11.245  26.529 37.151 1.00 20.00 ? 98  HIS A CG  1 
ATOM   747  N ND1 . HIS A 1 98  ? 10.678  27.466 37.993 1.00 18.69 ? 98  HIS A ND1 1 
ATOM   748  C CD2 . HIS A 1 98  ? 12.166  27.196 36.416 1.00 19.32 ? 98  HIS A CD2 1 
ATOM   749  C CE1 . HIS A 1 98  ? 11.236  28.644 37.781 1.00 17.59 ? 98  HIS A CE1 1 
ATOM   750  N NE2 . HIS A 1 98  ? 12.143  28.508 36.830 1.00 19.67 ? 98  HIS A NE2 1 
ATOM   751  N N   . GLY A 1 99  ? 10.309  24.359 33.581 1.00 19.82 ? 99  GLY A N   1 
ATOM   752  C CA  . GLY A 1 99  ? 9.653   24.838 32.380 1.00 19.00 ? 99  GLY A CA  1 
ATOM   753  C C   . GLY A 1 99  ? 10.768  25.399 31.514 1.00 18.04 ? 99  GLY A C   1 
ATOM   754  O O   . GLY A 1 99  ? 11.918  25.426 31.943 1.00 17.99 ? 99  GLY A O   1 
ATOM   755  N N   . GLN A 1 100 ? 10.458  25.816 30.293 1.00 18.16 ? 100 GLN A N   1 
ATOM   756  C CA  . GLN A 1 100 ? 11.473  26.409 29.420 1.00 17.64 ? 100 GLN A CA  1 
ATOM   757  C C   . GLN A 1 100 ? 11.632  27.826 29.989 1.00 17.44 ? 100 GLN A C   1 
ATOM   758  O O   . GLN A 1 100 ? 11.326  28.823 29.333 1.00 17.43 ? 100 GLN A O   1 
ATOM   759  C CB  . GLN A 1 100 ? 10.955  26.435 27.974 1.00 15.80 ? 100 GLN A CB  1 
ATOM   760  C CG  . GLN A 1 100 ? 11.873  27.112 26.968 1.00 15.41 ? 100 GLN A CG  1 
ATOM   761  C CD  . GLN A 1 100 ? 13.213  26.420 26.821 1.00 14.55 ? 100 GLN A CD  1 
ATOM   762  O OE1 . GLN A 1 100 ? 13.879  26.110 27.813 1.00 13.74 ? 100 GLN A OE1 1 
ATOM   763  N NE2 . GLN A 1 100 ? 13.623  26.184 25.578 1.00 11.95 ? 100 GLN A NE2 1 
ATOM   764  N N   . ASN A 1 101 ? 12.117  27.884 31.227 1.00 17.27 ? 101 ASN A N   1 
ATOM   765  C CA  . ASN A 1 101 ? 12.264  29.124 31.985 1.00 18.67 ? 101 ASN A CA  1 
ATOM   766  C C   . ASN A 1 101 ? 13.033  30.323 31.436 1.00 20.34 ? 101 ASN A C   1 
ATOM   767  O O   . ASN A 1 101 ? 12.802  31.444 31.887 1.00 20.69 ? 101 ASN A O   1 
ATOM   768  C CB  . ASN A 1 101 ? 12.768  28.792 33.394 1.00 16.90 ? 101 ASN A CB  1 
ATOM   769  C CG  . ASN A 1 101 ? 13.998  27.912 33.387 1.00 16.61 ? 101 ASN A CG  1 
ATOM   770  O OD1 . ASN A 1 101 ? 15.087  28.346 33.014 1.00 17.78 ? 101 ASN A OD1 1 
ATOM   771  N ND2 . ASN A 1 101 ? 13.829  26.666 33.801 1.00 16.75 ? 101 ASN A ND2 1 
ATOM   772  N N   . ASN A 1 102 ? 13.942  30.115 30.489 1.00 21.08 ? 102 ASN A N   1 
ATOM   773  C CA  . ASN A 1 102 ? 14.686  31.239 29.919 1.00 22.58 ? 102 ASN A CA  1 
ATOM   774  C C   . ASN A 1 102 ? 13.824  31.971 28.886 1.00 24.00 ? 102 ASN A C   1 
ATOM   775  O O   . ASN A 1 102 ? 14.028  33.155 28.615 1.00 24.04 ? 102 ASN A O   1 
ATOM   776  C CB  . ASN A 1 102 ? 15.959  30.745 29.227 1.00 23.00 ? 102 ASN A CB  1 
ATOM   777  C CG  . ASN A 1 102 ? 17.140  30.634 30.167 1.00 25.19 ? 102 ASN A CG  1 
ATOM   778  O OD1 . ASN A 1 102 ? 17.859  29.636 30.153 1.00 26.21 ? 102 ASN A OD1 1 
ATOM   779  N ND2 . ASN A 1 102 ? 17.361  31.667 30.976 1.00 25.41 ? 102 ASN A ND2 1 
ATOM   780  N N   . VAL A 1 103 ? 12.855  31.251 28.325 1.00 23.70 ? 103 VAL A N   1 
ATOM   781  C CA  . VAL A 1 103 ? 11.980  31.772 27.281 1.00 23.59 ? 103 VAL A CA  1 
ATOM   782  C C   . VAL A 1 103 ? 10.762  32.567 27.736 1.00 24.10 ? 103 VAL A C   1 
ATOM   783  O O   . VAL A 1 103 ? 9.990   32.121 28.583 1.00 25.01 ? 103 VAL A O   1 
ATOM   784  C CB  . VAL A 1 103 ? 11.502  30.618 26.368 1.00 23.40 ? 103 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 103 ? 10.551  31.145 25.303 1.00 20.90 ? 103 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 103 ? 12.709  29.936 25.730 1.00 20.41 ? 103 VAL A CG2 1 
ATOM   787  N N   . TYR A 1 104 ? 10.592  33.746 27.143 1.00 23.82 ? 104 TYR A N   1 
ATOM   788  C CA  . TYR A 1 104 ? 9.469   34.614 27.460 1.00 22.82 ? 104 TYR A CA  1 
ATOM   789  C C   . TYR A 1 104 ? 8.181   33.928 27.035 1.00 22.19 ? 104 TYR A C   1 
ATOM   790  O O   . TYR A 1 104 ? 8.091   33.384 25.935 1.00 22.51 ? 104 TYR A O   1 
ATOM   791  C CB  . TYR A 1 104 ? 9.589   35.944 26.713 1.00 24.49 ? 104 TYR A CB  1 
ATOM   792  C CG  . TYR A 1 104 ? 8.423   36.878 26.963 1.00 27.50 ? 104 TYR A CG  1 
ATOM   793  C CD1 . TYR A 1 104 ? 8.363   37.659 28.118 1.00 29.41 ? 104 TYR A CD1 1 
ATOM   794  C CD2 . TYR A 1 104 ? 7.349   36.938 26.075 1.00 27.26 ? 104 TYR A CD2 1 
ATOM   795  C CE1 . TYR A 1 104 ? 7.261   38.474 28.388 1.00 29.51 ? 104 TYR A CE1 1 
ATOM   796  C CE2 . TYR A 1 104 ? 6.244   37.744 26.335 1.00 28.45 ? 104 TYR A CE2 1 
ATOM   797  C CZ  . TYR A 1 104 ? 6.205   38.510 27.494 1.00 30.27 ? 104 TYR A CZ  1 
ATOM   798  O OH  . TYR A 1 104 ? 5.107   39.303 27.763 1.00 31.49 ? 104 TYR A OH  1 
ATOM   799  N N   . GLY A 1 105 ? 7.183   33.961 27.906 1.00 21.01 ? 105 GLY A N   1 
ATOM   800  C CA  . GLY A 1 105 ? 5.913   33.346 27.586 1.00 19.81 ? 105 GLY A CA  1 
ATOM   801  C C   . GLY A 1 105 ? 5.859   31.868 27.906 1.00 20.51 ? 105 GLY A C   1 
ATOM   802  O O   . GLY A 1 105 ? 4.814   31.235 27.736 1.00 21.56 ? 105 GLY A O   1 
ATOM   803  N N   . ALA A 1 106 ? 6.970   31.302 28.367 1.00 19.39 ? 106 ALA A N   1 
ATOM   804  C CA  . ALA A 1 106 ? 6.984   29.881 28.697 1.00 18.19 ? 106 ALA A CA  1 
ATOM   805  C C   . ALA A 1 106 ? 6.295   29.632 30.033 1.00 18.41 ? 106 ALA A C   1 
ATOM   806  O O   . ALA A 1 106 ? 6.307   30.485 30.925 1.00 16.71 ? 106 ALA A O   1 
ATOM   807  C CB  . ALA A 1 106 ? 8.412   29.361 28.743 1.00 17.56 ? 106 ALA A CB  1 
ATOM   808  N N   . THR A 1 107 ? 5.678   28.463 30.159 1.00 18.11 ? 107 THR A N   1 
ATOM   809  C CA  . THR A 1 107 ? 5.003   28.095 31.392 1.00 19.63 ? 107 THR A CA  1 
ATOM   810  C C   . THR A 1 107 ? 6.050   27.909 32.487 1.00 19.98 ? 107 THR A C   1 
ATOM   811  O O   . THR A 1 107 ? 7.006   27.156 32.307 1.00 20.27 ? 107 THR A O   1 
ATOM   812  C CB  . THR A 1 107 ? 4.245   26.772 31.235 1.00 20.44 ? 107 THR A CB  1 
ATOM   813  O OG1 . THR A 1 107 ? 3.261   26.903 30.203 1.00 22.12 ? 107 THR A OG1 1 
ATOM   814  C CG2 . THR A 1 107 ? 3.563   26.396 32.535 1.00 20.46 ? 107 THR A CG2 1 
ATOM   815  N N   . ILE A 1 108 ? 5.879   28.594 33.613 1.00 18.38 ? 108 ILE A N   1 
ATOM   816  C CA  . ILE A 1 108 ? 6.831   28.459 34.707 1.00 17.58 ? 108 ILE A CA  1 
ATOM   817  C C   . ILE A 1 108 ? 6.217   27.592 35.805 1.00 19.13 ? 108 ILE A C   1 
ATOM   818  O O   . ILE A 1 108 ? 5.308   28.021 36.517 1.00 20.80 ? 108 ILE A O   1 
ATOM   819  C CB  . ILE A 1 108 ? 7.226   29.842 35.304 1.00 16.24 ? 108 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 108 ? 7.712   30.785 34.195 1.00 14.87 ? 108 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 108 ? 8.319   29.666 36.349 1.00 12.05 ? 108 ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 108 ? 8.910   30.276 33.406 1.00 12.76 ? 108 ILE A CD1 1 
ATOM   823  N N   . PHE A 1 109 ? 6.713   26.365 35.927 1.00 18.59 ? 109 PHE A N   1 
ATOM   824  C CA  . PHE A 1 109 ? 6.231   25.421 36.933 1.00 18.47 ? 109 PHE A CA  1 
ATOM   825  C C   . PHE A 1 109 ? 6.890   25.696 38.283 1.00 18.19 ? 109 PHE A C   1 
ATOM   826  O O   . PHE A 1 109 ? 7.872   26.431 38.367 1.00 18.70 ? 109 PHE A O   1 
ATOM   827  C CB  . PHE A 1 109 ? 6.556   23.986 36.497 1.00 18.08 ? 109 PHE A CB  1 
ATOM   828  C CG  . PHE A 1 109 ? 5.871   23.568 35.229 1.00 20.43 ? 109 PHE A CG  1 
ATOM   829  C CD1 . PHE A 1 109 ? 4.618   22.960 35.266 1.00 20.04 ? 109 PHE A CD1 1 
ATOM   830  C CD2 . PHE A 1 109 ? 6.464   23.810 33.989 1.00 20.13 ? 109 PHE A CD2 1 
ATOM   831  C CE1 . PHE A 1 109 ? 3.966   22.600 34.089 1.00 20.55 ? 109 PHE A CE1 1 
ATOM   832  C CE2 . PHE A 1 109 ? 5.821   23.456 32.809 1.00 19.65 ? 109 PHE A CE2 1 
ATOM   833  C CZ  . PHE A 1 109 ? 4.570   22.850 32.859 1.00 20.90 ? 109 PHE A CZ  1 
ATOM   834  N N   . PRO A 1 110 ? 6.349   25.111 39.364 1.00 17.43 ? 110 PRO A N   1 
ATOM   835  C CA  . PRO A 1 110 ? 6.939   25.327 40.685 1.00 16.66 ? 110 PRO A CA  1 
ATOM   836  C C   . PRO A 1 110 ? 8.324   24.703 40.719 1.00 16.68 ? 110 PRO A C   1 
ATOM   837  O O   . PRO A 1 110 ? 8.552   23.678 40.076 1.00 14.88 ? 110 PRO A O   1 
ATOM   838  C CB  . PRO A 1 110 ? 5.974   24.597 41.619 1.00 16.24 ? 110 PRO A CB  1 
ATOM   839  C CG  . PRO A 1 110 ? 4.678   24.667 40.899 1.00 16.58 ? 110 PRO A CG  1 
ATOM   840  C CD  . PRO A 1 110 ? 5.077   24.378 39.476 1.00 16.10 ? 110 PRO A CD  1 
ATOM   841  N N   . HIS A 1 111 ? 9.248   25.315 41.456 1.00 17.77 ? 111 HIS A N   1 
ATOM   842  C CA  . HIS A 1 111 ? 10.594  24.762 41.563 1.00 18.17 ? 111 HIS A CA  1 
ATOM   843  C C   . HIS A 1 111 ? 10.560  23.406 42.268 1.00 18.00 ? 111 HIS A C   1 
ATOM   844  O O   . HIS A 1 111 ? 9.585   23.061 42.927 1.00 18.02 ? 111 HIS A O   1 
ATOM   845  C CB  . HIS A 1 111 ? 11.513  25.736 42.294 1.00 17.63 ? 111 HIS A CB  1 
ATOM   846  C CG  . HIS A 1 111 ? 12.244  26.663 41.374 1.00 19.44 ? 111 HIS A CG  1 
ATOM   847  N ND1 . HIS A 1 111 ? 13.083  26.208 40.379 1.00 17.74 ? 111 HIS A ND1 1 
ATOM   848  C CD2 . HIS A 1 111 ? 12.253  28.015 41.286 1.00 19.86 ? 111 HIS A CD2 1 
ATOM   849  C CE1 . HIS A 1 111 ? 13.576  27.240 39.716 1.00 18.98 ? 111 HIS A CE1 1 
ATOM   850  N NE2 . HIS A 1 111 ? 13.088  28.348 40.246 1.00 19.39 ? 111 HIS A NE2 1 
ATOM   851  N N   . ASN A 1 112 ? 11.626  22.635 42.134 1.00 18.60 ? 112 ASN A N   1 
ATOM   852  C CA  . ASN A 1 112 ? 11.664  21.306 42.729 1.00 20.87 ? 112 ASN A CA  1 
ATOM   853  C C   . ASN A 1 112 ? 11.247  21.123 44.190 1.00 21.19 ? 112 ASN A C   1 
ATOM   854  O O   . ASN A 1 112 ? 10.516  20.178 44.493 1.00 21.99 ? 112 ASN A O   1 
ATOM   855  C CB  . ASN A 1 112 ? 13.040  20.675 42.504 1.00 21.28 ? 112 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 112 ? 13.238  20.235 41.073 1.00 22.03 ? 112 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 112 ? 12.315  20.304 40.264 1.00 22.00 ? 112 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 112 ? 14.438  19.771 40.750 1.00 22.59 ? 112 ASN A ND2 1 
ATOM   859  N N   . VAL A 1 113 ? 11.689  21.995 45.096 1.00 19.87 ? 113 VAL A N   1 
ATOM   860  C CA  . VAL A 1 113 ? 11.322  21.826 46.503 1.00 19.99 ? 113 VAL A CA  1 
ATOM   861  C C   . VAL A 1 113 ? 9.804   21.736 46.683 1.00 20.00 ? 113 VAL A C   1 
ATOM   862  O O   . VAL A 1 113 ? 9.304   20.926 47.468 1.00 19.25 ? 113 VAL A O   1 
ATOM   863  C CB  . VAL A 1 113 ? 11.876  22.971 47.392 1.00 20.32 ? 113 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 113 ? 11.241  24.296 47.015 1.00 21.41 ? 113 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 113 ? 11.610  22.658 48.853 1.00 19.26 ? 113 VAL A CG2 1 
ATOM   866  N N   . GLY A 1 114 ? 9.071   22.562 45.947 1.00 18.78 ? 114 GLY A N   1 
ATOM   867  C CA  . GLY A 1 114 ? 7.628   22.533 46.048 1.00 17.44 ? 114 GLY A CA  1 
ATOM   868  C C   . GLY A 1 114 ? 7.062   21.271 45.429 1.00 17.44 ? 114 GLY A C   1 
ATOM   869  O O   . GLY A 1 114 ? 6.045   20.746 45.885 1.00 18.88 ? 114 GLY A O   1 
ATOM   870  N N   . LEU A 1 115 ? 7.713   20.772 44.386 1.00 17.07 ? 115 LEU A N   1 
ATOM   871  C CA  . LEU A 1 115 ? 7.237   19.562 43.725 1.00 18.31 ? 115 LEU A CA  1 
ATOM   872  C C   . LEU A 1 115 ? 7.379   18.326 44.615 1.00 18.94 ? 115 LEU A C   1 
ATOM   873  O O   . LEU A 1 115 ? 6.628   17.361 44.474 1.00 18.78 ? 115 LEU A O   1 
ATOM   874  C CB  . LEU A 1 115 ? 7.975   19.346 42.397 1.00 17.15 ? 115 LEU A CB  1 
ATOM   875  C CG  . LEU A 1 115 ? 7.721   20.383 41.296 1.00 15.58 ? 115 LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 115 ? 8.432   19.948 40.030 1.00 14.71 ? 115 LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 115 ? 6.229   20.530 41.040 1.00 14.18 ? 115 LEU A CD2 1 
ATOM   878  N N   . GLY A 1 116 ? 8.341   18.354 45.530 1.00 19.02 ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? 8.518   17.228 46.421 1.00 20.06 ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? 7.414   17.228 47.460 1.00 21.13 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? 6.984   16.178 47.947 1.00 21.86 ? 116 GLY A O   1 
ATOM   882  N N   . ALA A 1 117 ? 6.945   18.423 47.794 1.00 21.26 ? 117 ALA A N   1 
ATOM   883  C CA  . ALA A 1 117 ? 5.888   18.582 48.780 1.00 22.03 ? 117 ALA A CA  1 
ATOM   884  C C   . ALA A 1 117 ? 4.587   17.948 48.295 1.00 22.05 ? 117 ALA A C   1 
ATOM   885  O O   . ALA A 1 117 ? 3.687   17.665 49.088 1.00 21.71 ? 117 ALA A O   1 
ATOM   886  C CB  . ALA A 1 117 ? 5.674   20.069 49.078 1.00 20.28 ? 117 ALA A CB  1 
ATOM   887  N N   . THR A 1 118 ? 4.497   17.720 46.991 1.00 21.59 ? 118 THR A N   1 
ATOM   888  C CA  . THR A 1 118 ? 3.298   17.140 46.414 1.00 22.39 ? 118 THR A CA  1 
ATOM   889  C C   . THR A 1 118 ? 3.272   15.633 46.580 1.00 23.35 ? 118 THR A C   1 
ATOM   890  O O   . THR A 1 118 ? 2.200   15.026 46.597 1.00 24.55 ? 118 THR A O   1 
ATOM   891  C CB  . THR A 1 118 ? 3.197   17.439 44.913 1.00 22.87 ? 118 THR A CB  1 
ATOM   892  O OG1 . THR A 1 118 ? 4.220   16.712 44.217 1.00 22.31 ? 118 THR A OG1 1 
ATOM   893  C CG2 . THR A 1 118 ? 3.361   18.936 44.648 1.00 22.61 ? 118 THR A CG2 1 
ATOM   894  N N   . ARG A 1 119 ? 4.452   15.031 46.690 1.00 23.87 ? 119 ARG A N   1 
ATOM   895  C CA  . ARG A 1 119 ? 4.561   13.581 46.824 1.00 24.76 ? 119 ARG A CA  1 
ATOM   896  C C   . ARG A 1 119 ? 3.852   12.890 45.656 1.00 25.02 ? 119 ARG A C   1 
ATOM   897  O O   . ARG A 1 119 ? 3.435   11.739 45.765 1.00 25.98 ? 119 ARG A O   1 
ATOM   898  C CB  . ARG A 1 119 ? 3.933   13.117 48.141 1.00 22.95 ? 119 ARG A CB  1 
ATOM   899  C CG  . ARG A 1 119 ? 4.639   13.610 49.387 1.00 24.37 ? 119 ARG A CG  1 
ATOM   900  C CD  . ARG A 1 119 ? 6.089   13.143 49.439 1.00 25.87 ? 119 ARG A CD  1 
ATOM   901  N NE  . ARG A 1 119 ? 6.625   13.218 50.795 1.00 28.85 ? 119 ARG A NE  1 
ATOM   902  C CZ  . ARG A 1 119 ? 6.722   14.342 51.500 1.00 31.05 ? 119 ARG A CZ  1 
ATOM   903  N NH1 . ARG A 1 119 ? 6.328   15.494 50.971 1.00 32.20 ? 119 ARG A NH1 1 
ATOM   904  N NH2 . ARG A 1 119 ? 7.186   14.312 52.745 1.00 31.10 ? 119 ARG A NH2 1 
ATOM   905  N N   . ASP A 1 120 ? 3.730   13.597 44.537 1.00 24.29 ? 120 ASP A N   1 
ATOM   906  C CA  . ASP A 1 120 ? 3.047   13.072 43.360 1.00 23.75 ? 120 ASP A CA  1 
ATOM   907  C C   . ASP A 1 120 ? 4.009   12.892 42.177 1.00 23.60 ? 120 ASP A C   1 
ATOM   908  O O   . ASP A 1 120 ? 4.179   13.791 41.352 1.00 24.58 ? 120 ASP A O   1 
ATOM   909  C CB  . ASP A 1 120 ? 1.924   14.031 42.977 1.00 24.44 ? 120 ASP A CB  1 
ATOM   910  C CG  . ASP A 1 120 ? 0.981   13.445 41.961 1.00 27.20 ? 120 ASP A CG  1 
ATOM   911  O OD1 . ASP A 1 120 ? 1.446   12.675 41.097 1.00 27.87 ? 120 ASP A OD1 1 
ATOM   912  O OD2 . ASP A 1 120 ? -0.226  13.770 42.019 1.00 29.94 ? 120 ASP A OD2 1 
ATOM   913  N N   . PRO A 1 121 ? 4.659   11.726 42.083 1.00 22.15 ? 121 PRO A N   1 
ATOM   914  C CA  . PRO A 1 121 ? 5.588   11.507 40.977 1.00 20.24 ? 121 PRO A CA  1 
ATOM   915  C C   . PRO A 1 121 ? 4.961   11.565 39.590 1.00 21.58 ? 121 PRO A C   1 
ATOM   916  O O   . PRO A 1 121 ? 5.603   11.997 38.635 1.00 24.94 ? 121 PRO A O   1 
ATOM   917  C CB  . PRO A 1 121 ? 6.168   10.141 41.299 1.00 18.78 ? 121 PRO A CB  1 
ATOM   918  C CG  . PRO A 1 121 ? 6.209   10.159 42.786 1.00 18.79 ? 121 PRO A CG  1 
ATOM   919  C CD  . PRO A 1 121 ? 4.838   10.695 43.118 1.00 20.06 ? 121 PRO A CD  1 
ATOM   920  N N   . TYR A 1 122 ? 3.711   11.138 39.464 1.00 20.60 ? 122 TYR A N   1 
ATOM   921  C CA  . TYR A 1 122 ? 3.067   11.161 38.161 1.00 20.57 ? 122 TYR A CA  1 
ATOM   922  C C   . TYR A 1 122 ? 2.862   12.598 37.700 1.00 21.33 ? 122 TYR A C   1 
ATOM   923  O O   . TYR A 1 122 ? 2.929   12.895 36.503 1.00 22.09 ? 122 TYR A O   1 
ATOM   924  C CB  . TYR A 1 122 ? 1.730   10.420 38.209 1.00 20.92 ? 122 TYR A CB  1 
ATOM   925  C CG  . TYR A 1 122 ? 1.023   10.380 36.879 1.00 23.23 ? 122 TYR A CG  1 
ATOM   926  C CD1 . TYR A 1 122 ? 1.662   9.874  35.742 1.00 25.47 ? 122 TYR A CD1 1 
ATOM   927  C CD2 . TYR A 1 122 ? -0.278  10.871 36.744 1.00 23.86 ? 122 TYR A CD2 1 
ATOM   928  C CE1 . TYR A 1 122 ? 1.022   9.862  34.498 1.00 27.41 ? 122 TYR A CE1 1 
ATOM   929  C CE2 . TYR A 1 122 ? -0.930  10.863 35.513 1.00 24.94 ? 122 TYR A CE2 1 
ATOM   930  C CZ  . TYR A 1 122 ? -0.276  10.360 34.392 1.00 28.01 ? 122 TYR A CZ  1 
ATOM   931  O OH  . TYR A 1 122 ? -0.909  10.370 33.167 1.00 30.10 ? 122 TYR A OH  1 
ATOM   932  N N   . LEU A 1 123 ? 2.602   13.487 38.654 1.00 21.48 ? 123 LEU A N   1 
ATOM   933  C CA  . LEU A 1 123 ? 2.424   14.905 38.353 1.00 21.22 ? 123 LEU A CA  1 
ATOM   934  C C   . LEU A 1 123 ? 3.739   15.436 37.772 1.00 20.62 ? 123 LEU A C   1 
ATOM   935  O O   . LEU A 1 123 ? 3.759   16.070 36.717 1.00 19.65 ? 123 LEU A O   1 
ATOM   936  C CB  . LEU A 1 123 ? 2.082   15.687 39.630 1.00 19.31 ? 123 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 123 ? 2.095   17.219 39.521 1.00 18.21 ? 123 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 123 ? 0.974   17.687 38.616 1.00 17.42 ? 123 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 123 ? 1.937   17.830 40.893 1.00 19.40 ? 123 LEU A CD2 1 
ATOM   940  N N   . VAL A 1 124 ? 4.834   15.161 38.475 1.00 19.74 ? 124 VAL A N   1 
ATOM   941  C CA  . VAL A 1 124 ? 6.150   15.600 38.045 1.00 20.37 ? 124 VAL A CA  1 
ATOM   942  C C   . VAL A 1 124 ? 6.465   15.042 36.657 1.00 21.25 ? 124 VAL A C   1 
ATOM   943  O O   . VAL A 1 124 ? 7.009   15.750 35.802 1.00 21.02 ? 124 VAL A O   1 
ATOM   944  C CB  . VAL A 1 124 ? 7.230   15.162 39.061 1.00 19.92 ? 124 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 124 ? 8.615   15.567 38.578 1.00 19.35 ? 124 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 124 ? 6.944   15.801 40.411 1.00 19.86 ? 124 VAL A CG2 1 
ATOM   947  N N   . LYS A 1 125 ? 6.115   13.780 36.426 1.00 20.84 ? 125 LYS A N   1 
ATOM   948  C CA  . LYS A 1 125 ? 6.356   13.176 35.126 1.00 20.22 ? 125 LYS A CA  1 
ATOM   949  C C   . LYS A 1 125 ? 5.606   13.971 34.068 1.00 21.06 ? 125 LYS A C   1 
ATOM   950  O O   . LYS A 1 125 ? 6.124   14.212 32.977 1.00 21.35 ? 125 LYS A O   1 
ATOM   951  C CB  . LYS A 1 125 ? 5.882   11.724 35.095 1.00 20.81 ? 125 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 125 ? 6.059   11.079 33.729 1.00 20.80 ? 125 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 125 ? 5.587   9.647  33.706 1.00 22.16 ? 125 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 125 ? 5.663   9.070  32.296 1.00 24.94 ? 125 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 125 ? 5.280   7.630  32.263 1.00 25.23 ? 125 LYS A NZ  1 
ATOM   956  N N   . ARG A 1 126 ? 4.381   14.376 34.392 1.00 22.27 ? 126 ARG A N   1 
ATOM   957  C CA  . ARG A 1 126 ? 3.570   15.153 33.458 1.00 23.54 ? 126 ARG A CA  1 
ATOM   958  C C   . ARG A 1 126 ? 4.194   16.516 33.176 1.00 22.73 ? 126 ARG A C   1 
ATOM   959  O O   . ARG A 1 126 ? 4.130   17.008 32.054 1.00 21.81 ? 126 ARG A O   1 
ATOM   960  C CB  . ARG A 1 126 ? 2.138   15.307 33.986 1.00 24.09 ? 126 ARG A CB  1 
ATOM   961  C CG  . ARG A 1 126 ? 1.220   14.177 33.531 1.00 27.01 ? 126 ARG A CG  1 
ATOM   962  C CD  . ARG A 1 126 ? 0.142   13.879 34.553 1.00 30.35 ? 126 ARG A CD  1 
ATOM   963  N NE  . ARG A 1 126 ? -0.745  15.015 34.770 1.00 34.04 ? 126 ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 126 ? -1.168  15.419 35.967 1.00 36.35 ? 126 ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 126 ? -0.782  14.783 37.070 1.00 35.79 ? 126 ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 126 ? -1.986  16.462 36.058 1.00 36.61 ? 126 ARG A NH2 1 
ATOM   967  N N   . ILE A 1 127 ? 4.798   17.124 34.192 1.00 23.67 ? 127 ILE A N   1 
ATOM   968  C CA  . ILE A 1 127 ? 5.458   18.415 34.013 1.00 23.66 ? 127 ILE A CA  1 
ATOM   969  C C   . ILE A 1 127 ? 6.627   18.215 33.033 1.00 24.55 ? 127 ILE A C   1 
ATOM   970  O O   . ILE A 1 127 ? 6.888   19.064 32.172 1.00 24.35 ? 127 ILE A O   1 
ATOM   971  C CB  . ILE A 1 127 ? 5.989   18.966 35.365 1.00 21.78 ? 127 ILE A CB  1 
ATOM   972  C CG1 . ILE A 1 127 ? 4.809   19.337 36.265 1.00 20.27 ? 127 ILE A CG1 1 
ATOM   973  C CG2 . ILE A 1 127 ? 6.887   20.181 35.131 1.00 19.96 ? 127 ILE A CG2 1 
ATOM   974  C CD1 . ILE A 1 127 ? 5.218   19.785 37.662 1.00 20.63 ? 127 ILE A CD1 1 
ATOM   975  N N   . GLY A 1 128 ? 7.315   17.082 33.166 1.00 24.03 ? 128 GLY A N   1 
ATOM   976  C CA  . GLY A 1 128 ? 8.428   16.775 32.286 1.00 22.72 ? 128 GLY A CA  1 
ATOM   977  C C   . GLY A 1 128 ? 7.980   16.616 30.842 1.00 23.17 ? 128 GLY A C   1 
ATOM   978  O O   . GLY A 1 128 ? 8.743   16.886 29.909 1.00 22.56 ? 128 GLY A O   1 
ATOM   979  N N   . GLU A 1 129 ? 6.740   16.180 30.640 1.00 22.31 ? 129 GLU A N   1 
ATOM   980  C CA  . GLU A 1 129 ? 6.242   16.009 29.282 1.00 23.37 ? 129 GLU A CA  1 
ATOM   981  C C   . GLU A 1 129 ? 5.911   17.374 28.679 1.00 23.20 ? 129 GLU A C   1 
ATOM   982  O O   . GLU A 1 129 ? 6.197   17.639 27.505 1.00 23.42 ? 129 GLU A O   1 
ATOM   983  C CB  . GLU A 1 129 ? 5.008   15.112 29.284 1.00 21.76 ? 129 GLU A CB  1 
ATOM   984  C CG  . GLU A 1 129 ? 5.164   13.905 30.181 1.00 27.40 ? 129 GLU A CG  1 
ATOM   985  C CD  . GLU A 1 129 ? 4.046   12.883 30.020 1.00 29.53 ? 129 GLU A CD  1 
ATOM   986  O OE1 . GLU A 1 129 ? 2.864   13.284 29.940 1.00 29.86 ? 129 GLU A OE1 1 
ATOM   987  O OE2 . GLU A 1 129 ? 4.355   11.672 29.989 1.00 31.09 ? 129 GLU A OE2 1 
ATOM   988  N N   . ALA A 1 130 ? 5.322   18.242 29.496 1.00 22.48 ? 130 ALA A N   1 
ATOM   989  C CA  . ALA A 1 130 ? 4.951   19.580 29.058 1.00 21.79 ? 130 ALA A CA  1 
ATOM   990  C C   . ALA A 1 130 ? 6.205   20.394 28.825 1.00 21.66 ? 130 ALA A C   1 
ATOM   991  O O   . ALA A 1 130 ? 6.272   21.176 27.882 1.00 23.12 ? 130 ALA A O   1 
ATOM   992  C CB  . ALA A 1 130 ? 4.072   20.258 30.106 1.00 20.60 ? 130 ALA A CB  1 
ATOM   993  N N   . THR A 1 131 ? 7.198   20.209 29.691 1.00 21.72 ? 131 THR A N   1 
ATOM   994  C CA  . THR A 1 131 ? 8.457   20.934 29.567 1.00 21.26 ? 131 THR A CA  1 
ATOM   995  C C   . THR A 1 131 ? 9.143   20.563 28.262 1.00 21.17 ? 131 THR A C   1 
ATOM   996  O O   . THR A 1 131 ? 9.611   21.428 27.528 1.00 21.43 ? 131 THR A O   1 
ATOM   997  C CB  . THR A 1 131 ? 9.409   20.627 30.741 1.00 21.26 ? 131 THR A CB  1 
ATOM   998  O OG1 . THR A 1 131 ? 8.833   21.115 31.959 1.00 18.35 ? 131 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 131 ? 10.767  21.301 30.525 1.00 20.35 ? 131 THR A CG2 1 
ATOM   1000 N N   . ALA A 1 132 ? 9.193   19.270 27.971 1.00 21.40 ? 132 ALA A N   1 
ATOM   1001 C CA  . ALA A 1 132 ? 9.818   18.805 26.740 1.00 20.98 ? 132 ALA A CA  1 
ATOM   1002 C C   . ALA A 1 132 ? 9.135   19.466 25.548 1.00 20.00 ? 132 ALA A C   1 
ATOM   1003 O O   . ALA A 1 132 ? 9.798   19.998 24.659 1.00 19.72 ? 132 ALA A O   1 
ATOM   1004 C CB  . ALA A 1 132 ? 9.714   17.286 26.638 1.00 21.63 ? 132 ALA A CB  1 
ATOM   1005 N N   . LEU A 1 133 ? 7.807   19.431 25.535 1.00 19.48 ? 133 LEU A N   1 
ATOM   1006 C CA  . LEU A 1 133 ? 7.049   20.041 24.452 1.00 19.62 ? 133 LEU A CA  1 
ATOM   1007 C C   . LEU A 1 133 ? 7.398   21.516 24.284 1.00 19.40 ? 133 LEU A C   1 
ATOM   1008 O O   . LEU A 1 133 ? 7.602   21.983 23.159 1.00 20.02 ? 133 LEU A O   1 
ATOM   1009 C CB  . LEU A 1 133 ? 5.543   19.895 24.702 1.00 19.37 ? 133 LEU A CB  1 
ATOM   1010 C CG  . LEU A 1 133 ? 4.961   18.498 24.456 1.00 19.61 ? 133 LEU A CG  1 
ATOM   1011 C CD1 . LEU A 1 133 ? 3.515   18.424 24.894 1.00 16.13 ? 133 LEU A CD1 1 
ATOM   1012 C CD2 . LEU A 1 133 ? 5.086   18.175 22.982 1.00 20.08 ? 133 LEU A CD2 1 
ATOM   1013 N N   . GLU A 1 134 ? 7.480   22.247 25.395 1.00 18.70 ? 134 GLU A N   1 
ATOM   1014 C CA  . GLU A 1 134 ? 7.789   23.671 25.326 1.00 20.42 ? 134 GLU A CA  1 
ATOM   1015 C C   . GLU A 1 134 ? 9.242   23.986 24.997 1.00 20.26 ? 134 GLU A C   1 
ATOM   1016 O O   . GLU A 1 134 ? 9.551   25.072 24.518 1.00 21.82 ? 134 GLU A O   1 
ATOM   1017 C CB  . GLU A 1 134 ? 7.362   24.382 26.617 1.00 21.74 ? 134 GLU A CB  1 
ATOM   1018 C CG  . GLU A 1 134 ? 5.853   24.593 26.709 1.00 22.82 ? 134 GLU A CG  1 
ATOM   1019 C CD  . GLU A 1 134 ? 5.452   25.645 27.723 1.00 22.88 ? 134 GLU A CD  1 
ATOM   1020 O OE1 . GLU A 1 134 ? 6.033   26.746 27.701 1.00 23.70 ? 134 GLU A OE1 1 
ATOM   1021 O OE2 . GLU A 1 134 ? 4.542   25.378 28.533 1.00 24.51 ? 134 GLU A OE2 1 
ATOM   1022 N N   . VAL A 1 135 ? 10.138  23.042 25.252 1.00 20.28 ? 135 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 135 ? 11.539  23.248 24.923 1.00 18.57 ? 135 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 135 ? 11.672  23.030 23.406 1.00 19.55 ? 135 VAL A C   1 
ATOM   1025 O O   . VAL A 1 135 ? 12.355  23.791 22.711 1.00 20.48 ? 135 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 135 ? 12.442  22.256 25.697 1.00 17.59 ? 135 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 135 ? 13.846  22.248 25.110 1.00 18.76 ? 135 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 135 ? 12.500  22.653 27.161 1.00 16.07 ? 135 VAL A CG2 1 
ATOM   1029 N N   . ARG A 1 136 ? 11.008  21.997 22.897 1.00 17.68 ? 136 ARG A N   1 
ATOM   1030 C CA  . ARG A 1 136 ? 11.048  21.705 21.470 1.00 19.09 ? 136 ARG A CA  1 
ATOM   1031 C C   . ARG A 1 136 ? 10.343  22.807 20.694 1.00 19.40 ? 136 ARG A C   1 
ATOM   1032 O O   . ARG A 1 136 ? 10.603  23.006 19.505 1.00 18.46 ? 136 ARG A O   1 
ATOM   1033 C CB  . ARG A 1 136 ? 10.369  20.364 21.165 1.00 20.35 ? 136 ARG A CB  1 
ATOM   1034 C CG  . ARG A 1 136 ? 11.232  19.137 21.399 1.00 19.59 ? 136 ARG A CG  1 
ATOM   1035 C CD  . ARG A 1 136 ? 12.386  19.058 20.415 1.00 20.08 ? 136 ARG A CD  1 
ATOM   1036 N NE  . ARG A 1 136 ? 13.045  17.760 20.510 1.00 23.21 ? 136 ARG A NE  1 
ATOM   1037 C CZ  . ARG A 1 136 ? 13.955  17.306 19.655 1.00 22.36 ? 136 ARG A CZ  1 
ATOM   1038 N NH1 . ARG A 1 136 ? 14.337  18.039 18.623 1.00 21.56 ? 136 ARG A NH1 1 
ATOM   1039 N NH2 . ARG A 1 136 ? 14.469  16.101 19.830 1.00 22.33 ? 136 ARG A NH2 1 
ATOM   1040 N N   . ALA A 1 137 ? 9.438   23.511 21.370 1.00 20.19 ? 137 ALA A N   1 
ATOM   1041 C CA  . ALA A 1 137 ? 8.697   24.601 20.748 1.00 20.31 ? 137 ALA A CA  1 
ATOM   1042 C C   . ALA A 1 137 ? 9.671   25.711 20.358 1.00 20.31 ? 137 ALA A C   1 
ATOM   1043 O O   . ALA A 1 137 ? 9.386   26.523 19.480 1.00 19.94 ? 137 ALA A O   1 
ATOM   1044 C CB  . ALA A 1 137 ? 7.647   25.135 21.713 1.00 19.98 ? 137 ALA A CB  1 
ATOM   1045 N N   . THR A 1 138 ? 10.826  25.735 21.017 1.00 20.21 ? 138 THR A N   1 
ATOM   1046 C CA  . THR A 1 138 ? 11.845  26.735 20.734 1.00 21.18 ? 138 THR A CA  1 
ATOM   1047 C C   . THR A 1 138 ? 12.999  26.125 19.942 1.00 20.42 ? 138 THR A C   1 
ATOM   1048 O O   . THR A 1 138 ? 14.015  26.773 19.701 1.00 20.62 ? 138 THR A O   1 
ATOM   1049 C CB  . THR A 1 138 ? 12.380  27.360 22.028 1.00 21.72 ? 138 THR A CB  1 
ATOM   1050 O OG1 . THR A 1 138 ? 13.018  26.353 22.825 1.00 23.39 ? 138 THR A OG1 1 
ATOM   1051 C CG2 . THR A 1 138 ? 11.236  27.969 22.816 1.00 23.14 ? 138 THR A CG2 1 
ATOM   1052 N N   . GLY A 1 139 ? 12.837  24.869 19.550 1.00 19.75 ? 139 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 139 ? 13.851  24.208 18.755 1.00 20.06 ? 139 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 139 ? 15.017  23.620 19.507 1.00 20.35 ? 139 GLY A C   1 
ATOM   1055 O O   . GLY A 1 139 ? 15.950  23.112 18.897 1.00 22.04 ? 139 GLY A O   1 
ATOM   1056 N N   . ILE A 1 140 ? 14.981  23.687 20.829 1.00 21.19 ? 140 ILE A N   1 
ATOM   1057 C CA  . ILE A 1 140 ? 16.062  23.127 21.623 1.00 20.87 ? 140 ILE A CA  1 
ATOM   1058 C C   . ILE A 1 140 ? 15.748  21.649 21.885 1.00 20.61 ? 140 ILE A C   1 
ATOM   1059 O O   . ILE A 1 140 ? 14.584  21.269 22.008 1.00 20.61 ? 140 ILE A O   1 
ATOM   1060 C CB  . ILE A 1 140 ? 16.243  23.942 22.918 1.00 20.28 ? 140 ILE A CB  1 
ATOM   1061 C CG1 . ILE A 1 140 ? 16.673  25.369 22.541 1.00 19.18 ? 140 ILE A CG1 1 
ATOM   1062 C CG2 . ILE A 1 140 ? 17.291  23.299 23.808 1.00 21.36 ? 140 ILE A CG2 1 
ATOM   1063 C CD1 . ILE A 1 140 ? 16.788  26.334 23.702 1.00 20.64 ? 140 ILE A CD1 1 
ATOM   1064 N N   . GLN A 1 141 ? 16.782  20.815 21.954 1.00 20.31 ? 141 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 141 ? 16.585  19.375 22.129 1.00 21.75 ? 141 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 141 ? 17.185  18.747 23.393 1.00 21.47 ? 141 GLN A C   1 
ATOM   1067 O O   . GLN A 1 141 ? 17.118  17.528 23.570 1.00 21.72 ? 141 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 141 ? 17.161  18.635 20.904 1.00 21.42 ? 141 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 141 ? 17.004  19.372 19.571 1.00 24.47 ? 141 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 141 ? 18.220  20.225 19.191 1.00 24.64 ? 141 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 141 ? 18.866  20.832 20.042 1.00 26.59 ? 141 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 141 ? 18.517  20.282 17.902 1.00 22.88 ? 141 GLN A NE2 1 
ATOM   1073 N N   . TYR A 1 142 ? 17.738  19.560 24.284 1.00 19.75 ? 142 TYR A N   1 
ATOM   1074 C CA  . TYR A 1 142 ? 18.398  19.016 25.467 1.00 19.74 ? 142 TYR A CA  1 
ATOM   1075 C C   . TYR A 1 142 ? 18.191  19.896 26.700 1.00 19.79 ? 142 TYR A C   1 
ATOM   1076 O O   . TYR A 1 142 ? 18.458  21.094 26.666 1.00 22.03 ? 142 TYR A O   1 
ATOM   1077 C CB  . TYR A 1 142 ? 19.881  18.856 25.097 1.00 17.43 ? 142 TYR A CB  1 
ATOM   1078 C CG  . TYR A 1 142 ? 20.858  18.431 26.167 1.00 16.24 ? 142 TYR A CG  1 
ATOM   1079 C CD1 . TYR A 1 142 ? 20.478  17.607 27.229 1.00 15.17 ? 142 TYR A CD1 1 
ATOM   1080 C CD2 . TYR A 1 142 ? 22.202  18.807 26.068 1.00 15.09 ? 142 TYR A CD2 1 
ATOM   1081 C CE1 . TYR A 1 142 ? 21.420  17.173 28.166 1.00 14.85 ? 142 TYR A CE1 1 
ATOM   1082 C CE2 . TYR A 1 142 ? 23.143  18.378 26.987 1.00 13.09 ? 142 TYR A CE2 1 
ATOM   1083 C CZ  . TYR A 1 142 ? 22.753  17.568 28.030 1.00 14.41 ? 142 TYR A CZ  1 
ATOM   1084 O OH  . TYR A 1 142 ? 23.703  17.173 28.934 1.00 13.51 ? 142 TYR A OH  1 
ATOM   1085 N N   . ALA A 1 143 ? 17.704  19.303 27.785 1.00 17.92 ? 143 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 143 ? 17.453  20.061 29.005 1.00 17.28 ? 143 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 143 ? 18.319  19.592 30.164 1.00 18.27 ? 143 ALA A C   1 
ATOM   1088 O O   . ALA A 1 143 ? 18.364  18.401 30.478 1.00 17.97 ? 143 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 143 ? 15.983  19.962 29.383 1.00 16.63 ? 143 ALA A CB  1 
ATOM   1090 N N   . PHE A 1 144 ? 19.003  20.538 30.804 1.00 18.81 ? 144 PHE A N   1 
ATOM   1091 C CA  . PHE A 1 144 ? 19.870  20.222 31.931 1.00 18.35 ? 144 PHE A CA  1 
ATOM   1092 C C   . PHE A 1 144 ? 19.033  19.983 33.170 1.00 18.87 ? 144 PHE A C   1 
ATOM   1093 O O   . PHE A 1 144 ? 19.164  20.690 34.164 1.00 20.24 ? 144 PHE A O   1 
ATOM   1094 C CB  . PHE A 1 144 ? 20.851  21.363 32.189 1.00 18.11 ? 144 PHE A CB  1 
ATOM   1095 C CG  . PHE A 1 144 ? 21.747  21.661 31.025 1.00 20.18 ? 144 PHE A CG  1 
ATOM   1096 C CD1 . PHE A 1 144 ? 22.411  20.633 30.362 1.00 21.61 ? 144 PHE A CD1 1 
ATOM   1097 C CD2 . PHE A 1 144 ? 21.929  22.966 30.588 1.00 20.54 ? 144 PHE A CD2 1 
ATOM   1098 C CE1 . PHE A 1 144 ? 23.243  20.901 29.278 1.00 22.74 ? 144 PHE A CE1 1 
ATOM   1099 C CE2 . PHE A 1 144 ? 22.760  23.247 29.504 1.00 22.68 ? 144 PHE A CE2 1 
ATOM   1100 C CZ  . PHE A 1 144 ? 23.419  22.211 28.846 1.00 23.95 ? 144 PHE A CZ  1 
ATOM   1101 N N   . ALA A 1 145 ? 18.175  18.973 33.100 1.00 18.45 ? 145 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 145 ? 17.295  18.624 34.204 1.00 17.75 ? 145 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 145 ? 17.075  17.122 34.146 1.00 18.51 ? 145 ALA A C   1 
ATOM   1104 O O   . ALA A 1 145 ? 17.172  16.519 33.079 1.00 18.54 ? 145 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 145 ? 15.971  19.358 34.062 1.00 16.98 ? 145 ALA A CB  1 
ATOM   1106 N N   . PRO A 1 146 ? 16.719  16.503 35.282 1.00 18.76 ? 146 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 146 ? 16.515  17.151 36.578 1.00 19.17 ? 146 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 146 ? 17.724  17.175 37.495 1.00 20.33 ? 146 PRO A C   1 
ATOM   1109 O O   . PRO A 1 146 ? 18.628  16.345 37.391 1.00 20.69 ? 146 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 146 ? 15.422  16.308 37.189 1.00 18.65 ? 146 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 146 ? 15.907  14.933 36.829 1.00 18.01 ? 146 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 146 ? 16.318  15.087 35.358 1.00 18.56 ? 146 PRO A CD  1 
ATOM   1113 N N   . CYS A 1 147 ? 17.712  18.134 38.410 1.00 20.96 ? 147 CYS A N   1 
ATOM   1114 C CA  . CYS A 1 147 ? 18.756  18.247 39.406 1.00 21.21 ? 147 CYS A CA  1 
ATOM   1115 C C   . CYS A 1 147 ? 18.299  17.275 40.487 1.00 21.46 ? 147 CYS A C   1 
ATOM   1116 O O   . CYS A 1 147 ? 17.271  17.503 41.115 1.00 21.74 ? 147 CYS A O   1 
ATOM   1117 C CB  . CYS A 1 147 ? 18.795  19.661 39.976 1.00 20.02 ? 147 CYS A CB  1 
ATOM   1118 S SG  . CYS A 1 147 ? 19.740  19.804 41.511 1.00 22.01 ? 147 CYS A SG  1 
ATOM   1119 N N   . ILE A 1 148 ? 19.024  16.179 40.689 1.00 21.12 ? 148 ILE A N   1 
ATOM   1120 C CA  . ILE A 1 148 ? 18.619  15.235 41.717 1.00 20.17 ? 148 ILE A CA  1 
ATOM   1121 C C   . ILE A 1 148 ? 19.481  15.336 42.962 1.00 21.06 ? 148 ILE A C   1 
ATOM   1122 O O   . ILE A 1 148 ? 19.711  14.348 43.658 1.00 21.82 ? 148 ILE A O   1 
ATOM   1123 C CB  . ILE A 1 148 ? 18.618  13.775 41.217 1.00 18.69 ? 148 ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 148 ? 19.964  13.420 40.586 1.00 17.52 ? 148 ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 148 ? 17.465  13.571 40.257 1.00 16.04 ? 148 ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 148 ? 20.075  11.953 40.204 1.00 15.73 ? 148 ILE A CD1 1 
ATOM   1127 N N   . ALA A 1 149 ? 19.958  16.541 43.244 1.00 20.24 ? 149 ALA A N   1 
ATOM   1128 C CA  . ALA A 1 149 ? 20.754  16.750 44.437 1.00 21.28 ? 149 ALA A CA  1 
ATOM   1129 C C   . ALA A 1 149 ? 19.842  16.518 45.637 1.00 21.40 ? 149 ALA A C   1 
ATOM   1130 O O   . ALA A 1 149 ? 18.634  16.746 45.564 1.00 22.44 ? 149 ALA A O   1 
ATOM   1131 C CB  . ALA A 1 149 ? 21.295  18.170 44.469 1.00 19.76 ? 149 ALA A CB  1 
ATOM   1132 N N   . VAL A 1 150 ? 20.419  16.046 46.733 1.00 21.24 ? 150 VAL A N   1 
ATOM   1133 C CA  . VAL A 1 150 ? 19.661  15.823 47.959 1.00 21.66 ? 150 VAL A CA  1 
ATOM   1134 C C   . VAL A 1 150 ? 20.166  16.885 48.936 1.00 21.85 ? 150 VAL A C   1 
ATOM   1135 O O   . VAL A 1 150 ? 21.145  16.666 49.645 1.00 22.71 ? 150 VAL A O   1 
ATOM   1136 C CB  . VAL A 1 150 ? 19.925  14.409 48.537 1.00 21.27 ? 150 VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 150 ? 19.100  14.198 49.798 1.00 19.23 ? 150 VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 150 ? 19.595  13.348 47.489 1.00 19.11 ? 150 VAL A CG2 1 
ATOM   1139 N N   . CYS A 1 151 ? 19.511  18.042 48.957 1.00 21.31 ? 151 CYS A N   1 
ATOM   1140 C CA  . CYS A 1 151 ? 19.942  19.126 49.829 1.00 22.19 ? 151 CYS A CA  1 
ATOM   1141 C C   . CYS A 1 151 ? 19.862  18.740 51.305 1.00 20.91 ? 151 CYS A C   1 
ATOM   1142 O O   . CYS A 1 151 ? 18.806  18.371 51.808 1.00 21.08 ? 151 CYS A O   1 
ATOM   1143 C CB  . CYS A 1 151 ? 19.128  20.397 49.541 1.00 22.82 ? 151 CYS A CB  1 
ATOM   1144 S SG  . CYS A 1 151 ? 19.432  21.745 50.724 1.00 24.46 ? 151 CYS A SG  1 
ATOM   1145 N N   . ARG A 1 152 ? 20.997  18.821 51.990 1.00 19.48 ? 152 ARG A N   1 
ATOM   1146 C CA  . ARG A 1 152 ? 21.061  18.462 53.398 1.00 20.36 ? 152 ARG A CA  1 
ATOM   1147 C C   . ARG A 1 152 ? 21.236  19.657 54.325 1.00 20.32 ? 152 ARG A C   1 
ATOM   1148 O O   . ARG A 1 152 ? 21.325  19.496 55.542 1.00 21.19 ? 152 ARG A O   1 
ATOM   1149 C CB  . ARG A 1 152 ? 22.206  17.482 53.625 1.00 20.43 ? 152 ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 152 ? 22.036  16.155 52.921 1.00 21.97 ? 152 ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 152 ? 21.919  15.038 53.929 1.00 24.06 ? 152 ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 152 ? 20.544  14.607 54.123 1.00 24.90 ? 152 ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 152 ? 20.143  13.839 55.130 1.00 26.10 ? 152 ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 152 ? 21.012  13.425 56.041 1.00 23.44 ? 152 ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 152 ? 18.870  13.470 55.218 1.00 28.27 ? 152 ARG A NH2 1 
ATOM   1156 N N   . ASP A 1 153 ? 21.278  20.852 53.752 1.00 19.62 ? 153 ASP A N   1 
ATOM   1157 C CA  . ASP A 1 153 ? 21.454  22.058 54.534 1.00 21.46 ? 153 ASP A CA  1 
ATOM   1158 C C   . ASP A 1 153 ? 20.787  23.221 53.798 1.00 24.40 ? 153 ASP A C   1 
ATOM   1159 O O   . ASP A 1 153 ? 21.280  23.682 52.765 1.00 26.08 ? 153 ASP A O   1 
ATOM   1160 C CB  . ASP A 1 153 ? 22.945  22.327 54.717 1.00 22.67 ? 153 ASP A CB  1 
ATOM   1161 C CG  . ASP A 1 153 ? 23.231  23.273 55.861 1.00 24.25 ? 153 ASP A CG  1 
ATOM   1162 O OD1 . ASP A 1 153 ? 22.689  24.396 55.852 1.00 26.45 ? 153 ASP A OD1 1 
ATOM   1163 O OD2 . ASP A 1 153 ? 23.999  22.893 56.769 1.00 24.82 ? 153 ASP A OD2 1 
ATOM   1164 N N   . PRO A 1 154 ? 19.664  23.723 54.334 1.00 24.36 ? 154 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 154 ? 18.884  24.829 53.766 1.00 23.93 ? 154 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 154 ? 19.708  26.055 53.371 1.00 23.73 ? 154 PRO A C   1 
ATOM   1167 O O   . PRO A 1 154 ? 19.324  26.803 52.470 1.00 23.13 ? 154 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 154 ? 17.890  25.162 54.878 1.00 24.70 ? 154 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 154 ? 17.766  23.886 55.635 1.00 25.89 ? 154 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 154 ? 19.184  23.398 55.687 1.00 25.84 ? 154 PRO A CD  1 
ATOM   1171 N N   . ARG A 1 155 ? 20.828  26.271 54.053 1.00 22.19 ? 155 ARG A N   1 
ATOM   1172 C CA  . ARG A 1 155 ? 21.668  27.424 53.763 1.00 22.36 ? 155 ARG A CA  1 
ATOM   1173 C C   . ARG A 1 155 ? 22.251  27.416 52.353 1.00 22.39 ? 155 ARG A C   1 
ATOM   1174 O O   . ARG A 1 155 ? 22.811  28.414 51.895 1.00 22.19 ? 155 ARG A O   1 
ATOM   1175 C CB  . ARG A 1 155 ? 22.774  27.524 54.810 1.00 22.38 ? 155 ARG A CB  1 
ATOM   1176 C CG  . ARG A 1 155 ? 22.224  27.902 56.179 1.00 25.03 ? 155 ARG A CG  1 
ATOM   1177 C CD  . ARG A 1 155 ? 23.270  27.828 57.265 1.00 25.64 ? 155 ARG A CD  1 
ATOM   1178 N NE  . ARG A 1 155 ? 23.715  26.456 57.492 1.00 25.42 ? 155 ARG A NE  1 
ATOM   1179 C CZ  . ARG A 1 155 ? 24.602  26.107 58.414 1.00 24.18 ? 155 ARG A CZ  1 
ATOM   1180 N NH1 . ARG A 1 155 ? 25.139  27.033 59.199 1.00 22.45 ? 155 ARG A NH1 1 
ATOM   1181 N NH2 . ARG A 1 155 ? 24.953  24.837 58.546 1.00 25.46 ? 155 ARG A NH2 1 
ATOM   1182 N N   . TRP A 1 156 ? 22.103  26.293 51.661 1.00 21.74 ? 156 TRP A N   1 
ATOM   1183 C CA  . TRP A 1 156 ? 22.609  26.167 50.305 1.00 21.58 ? 156 TRP A CA  1 
ATOM   1184 C C   . TRP A 1 156 ? 21.720  26.950 49.344 1.00 22.44 ? 156 TRP A C   1 
ATOM   1185 O O   . TRP A 1 156 ? 20.504  26.761 49.304 1.00 23.60 ? 156 TRP A O   1 
ATOM   1186 C CB  . TRP A 1 156 ? 22.661  24.691 49.903 1.00 20.91 ? 156 TRP A CB  1 
ATOM   1187 C CG  . TRP A 1 156 ? 23.254  24.446 48.562 1.00 20.95 ? 156 TRP A CG  1 
ATOM   1188 C CD1 . TRP A 1 156 ? 24.320  25.096 48.005 1.00 22.81 ? 156 TRP A CD1 1 
ATOM   1189 C CD2 . TRP A 1 156 ? 22.874  23.428 47.629 1.00 20.30 ? 156 TRP A CD2 1 
ATOM   1190 N NE1 . TRP A 1 156 ? 24.630  24.541 46.783 1.00 23.61 ? 156 TRP A NE1 1 
ATOM   1191 C CE2 . TRP A 1 156 ? 23.757  23.515 46.530 1.00 21.74 ? 156 TRP A CE2 1 
ATOM   1192 C CE3 . TRP A 1 156 ? 21.876  22.448 47.616 1.00 19.62 ? 156 TRP A CE3 1 
ATOM   1193 C CZ2 . TRP A 1 156 ? 23.671  22.657 45.429 1.00 22.06 ? 156 TRP A CZ2 1 
ATOM   1194 C CZ3 . TRP A 1 156 ? 21.791  21.596 46.518 1.00 20.01 ? 156 TRP A CZ3 1 
ATOM   1195 C CH2 . TRP A 1 156 ? 22.683  21.707 45.442 1.00 20.30 ? 156 TRP A CH2 1 
ATOM   1196 N N   . GLY A 1 157 ? 22.339  27.831 48.571 1.00 22.52 ? 157 GLY A N   1 
ATOM   1197 C CA  . GLY A 1 157 ? 21.596  28.638 47.628 1.00 21.83 ? 157 GLY A CA  1 
ATOM   1198 C C   . GLY A 1 157 ? 20.826  27.856 46.584 1.00 22.45 ? 157 GLY A C   1 
ATOM   1199 O O   . GLY A 1 157 ? 19.977  28.425 45.897 1.00 23.62 ? 157 GLY A O   1 
ATOM   1200 N N   . ARG A 1 158 ? 21.105  26.563 46.452 1.00 22.14 ? 158 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 158 ? 20.397  25.753 45.463 1.00 22.03 ? 158 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 158 ? 19.405  24.772 46.086 1.00 21.76 ? 158 ARG A C   1 
ATOM   1203 O O   . ARG A 1 158 ? 18.858  23.921 45.385 1.00 22.53 ? 158 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 158 ? 21.393  24.966 44.600 1.00 20.11 ? 158 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 158 ? 22.558  25.789 44.091 1.00 20.62 ? 158 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 158 ? 23.297  25.086 42.964 1.00 18.63 ? 158 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 158 ? 22.515  25.040 41.730 1.00 16.19 ? 158 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 158 ? 22.997  24.640 40.554 1.00 17.13 ? 158 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 158 ? 24.262  24.246 40.455 1.00 15.17 ? 158 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 158 ? 22.221  24.645 39.470 1.00 12.78 ? 158 ARG A NH2 1 
ATOM   1211 N N   . CYS A 1 159 ? 19.157  24.890 47.387 1.00 20.46 ? 159 CYS A N   1 
ATOM   1212 C CA  . CYS A 1 159 ? 18.250  23.961 48.050 1.00 21.90 ? 159 CYS A CA  1 
ATOM   1213 C C   . CYS A 1 159 ? 16.857  23.875 47.421 1.00 20.57 ? 159 CYS A C   1 
ATOM   1214 O O   . CYS A 1 159 ? 16.195  22.845 47.534 1.00 20.17 ? 159 CYS A O   1 
ATOM   1215 C CB  . CYS A 1 159 ? 18.138  24.303 49.537 1.00 23.84 ? 159 CYS A CB  1 
ATOM   1216 S SG  . CYS A 1 159 ? 17.735  22.901 50.650 1.00 32.23 ? 159 CYS A SG  1 
ATOM   1217 N N   . TYR A 1 160 ? 16.412  24.935 46.751 1.00 19.13 ? 160 TYR A N   1 
ATOM   1218 C CA  . TYR A 1 160 ? 15.096  24.900 46.120 1.00 19.51 ? 160 TYR A CA  1 
ATOM   1219 C C   . TYR A 1 160 ? 15.091  24.038 44.854 1.00 19.78 ? 160 TYR A C   1 
ATOM   1220 O O   . TYR A 1 160 ? 14.029  23.719 44.316 1.00 19.55 ? 160 TYR A O   1 
ATOM   1221 C CB  . TYR A 1 160 ? 14.597  26.320 45.808 1.00 18.84 ? 160 TYR A CB  1 
ATOM   1222 C CG  . TYR A 1 160 ? 15.342  27.074 44.727 1.00 18.23 ? 160 TYR A CG  1 
ATOM   1223 C CD1 . TYR A 1 160 ? 15.168  26.764 43.377 1.00 18.16 ? 160 TYR A CD1 1 
ATOM   1224 C CD2 . TYR A 1 160 ? 16.192  28.132 45.054 1.00 19.26 ? 160 TYR A CD2 1 
ATOM   1225 C CE1 . TYR A 1 160 ? 15.815  27.490 42.381 1.00 17.35 ? 160 TYR A CE1 1 
ATOM   1226 C CE2 . TYR A 1 160 ? 16.849  28.866 44.066 1.00 19.21 ? 160 TYR A CE2 1 
ATOM   1227 C CZ  . TYR A 1 160 ? 16.655  28.541 42.730 1.00 20.06 ? 160 TYR A CZ  1 
ATOM   1228 O OH  . TYR A 1 160 ? 17.304  29.268 41.750 1.00 20.53 ? 160 TYR A OH  1 
ATOM   1229 N N   . GLU A 1 161 ? 16.277  23.655 44.387 1.00 19.49 ? 161 GLU A N   1 
ATOM   1230 C CA  . GLU A 1 161 ? 16.384  22.816 43.200 1.00 20.15 ? 161 GLU A CA  1 
ATOM   1231 C C   . GLU A 1 161 ? 16.420  21.351 43.598 1.00 21.19 ? 161 GLU A C   1 
ATOM   1232 O O   . GLU A 1 161 ? 16.573  20.474 42.748 1.00 20.29 ? 161 GLU A O   1 
ATOM   1233 C CB  . GLU A 1 161 ? 17.641  23.148 42.405 1.00 19.61 ? 161 GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 161 ? 17.662  24.555 41.841 1.00 21.74 ? 161 GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 161 ? 18.740  24.739 40.797 1.00 22.83 ? 161 GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 161 ? 18.626  24.114 39.719 1.00 24.66 ? 161 GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 161 ? 19.700  25.498 41.055 1.00 23.03 ? 161 GLU A OE2 1 
ATOM   1238 N N   . SER A 1 162 ? 16.298  21.097 44.899 1.00 20.53 ? 162 SER A N   1 
ATOM   1239 C CA  . SER A 1 162 ? 16.294  19.738 45.417 1.00 19.38 ? 162 SER A CA  1 
ATOM   1240 C C   . SER A 1 162 ? 14.881  19.396 45.848 1.00 19.91 ? 162 SER A C   1 
ATOM   1241 O O   . SER A 1 162 ? 14.255  20.144 46.594 1.00 20.41 ? 162 SER A O   1 
ATOM   1242 C CB  . SER A 1 162 ? 17.240  19.607 46.613 1.00 18.94 ? 162 SER A CB  1 
ATOM   1243 O OG  . SER A 1 162 ? 17.084  18.350 47.256 1.00 15.01 ? 162 SER A OG  1 
ATOM   1244 N N   . TYR A 1 163 ? 14.382  18.265 45.370 1.00 19.41 ? 163 TYR A N   1 
ATOM   1245 C CA  . TYR A 1 163 ? 13.040  17.829 45.704 1.00 19.89 ? 163 TYR A CA  1 
ATOM   1246 C C   . TYR A 1 163 ? 12.891  17.626 47.198 1.00 21.82 ? 163 TYR A C   1 
ATOM   1247 O O   . TYR A 1 163 ? 11.822  17.866 47.752 1.00 22.53 ? 163 TYR A O   1 
ATOM   1248 C CB  . TYR A 1 163 ? 12.715  16.512 45.006 1.00 18.46 ? 163 TYR A CB  1 
ATOM   1249 C CG  . TYR A 1 163 ? 12.674  16.585 43.494 1.00 19.36 ? 163 TYR A CG  1 
ATOM   1250 C CD1 . TYR A 1 163 ? 11.648  17.265 42.835 1.00 17.55 ? 163 TYR A CD1 1 
ATOM   1251 C CD2 . TYR A 1 163 ? 13.644  15.943 42.721 1.00 16.62 ? 163 TYR A CD2 1 
ATOM   1252 C CE1 . TYR A 1 163 ? 11.587  17.299 41.444 1.00 16.67 ? 163 TYR A CE1 1 
ATOM   1253 C CE2 . TYR A 1 163 ? 13.591  15.976 41.334 1.00 16.51 ? 163 TYR A CE2 1 
ATOM   1254 C CZ  . TYR A 1 163 ? 12.563  16.654 40.702 1.00 16.66 ? 163 TYR A CZ  1 
ATOM   1255 O OH  . TYR A 1 163 ? 12.524  16.706 39.329 1.00 14.72 ? 163 TYR A OH  1 
ATOM   1256 N N   . SER A 1 164 ? 13.960  17.180 47.855 1.00 22.69 ? 164 SER A N   1 
ATOM   1257 C CA  . SER A 1 164 ? 13.892  16.917 49.290 1.00 24.12 ? 164 SER A CA  1 
ATOM   1258 C C   . SER A 1 164 ? 15.235  16.606 49.941 1.00 25.48 ? 164 SER A C   1 
ATOM   1259 O O   . SER A 1 164 ? 16.256  16.501 49.265 1.00 28.31 ? 164 SER A O   1 
ATOM   1260 C CB  . SER A 1 164 ? 12.947  15.742 49.541 1.00 21.76 ? 164 SER A CB  1 
ATOM   1261 O OG  . SER A 1 164 ? 13.012  15.325 50.889 1.00 22.20 ? 164 SER A OG  1 
ATOM   1262 N N   . GLU A 1 165 ? 15.223  16.466 51.263 1.00 26.32 ? 165 GLU A N   1 
ATOM   1263 C CA  . GLU A 1 165 ? 16.428  16.126 52.018 1.00 27.07 ? 165 GLU A CA  1 
ATOM   1264 C C   . GLU A 1 165 ? 16.413  14.611 52.191 1.00 26.35 ? 165 GLU A C   1 
ATOM   1265 O O   . GLU A 1 165 ? 17.362  14.022 52.710 1.00 26.30 ? 165 GLU A O   1 
ATOM   1266 C CB  . GLU A 1 165 ? 16.415  16.796 53.399 1.00 27.25 ? 165 GLU A CB  1 
ATOM   1267 C CG  . GLU A 1 165 ? 15.271  16.340 54.295 1.00 28.21 ? 165 GLU A CG  1 
ATOM   1268 C CD  . GLU A 1 165 ? 15.215  17.083 55.616 1.00 29.23 ? 165 GLU A CD  1 
ATOM   1269 O OE1 . GLU A 1 165 ? 15.143  18.329 55.602 1.00 30.51 ? 165 GLU A OE1 1 
ATOM   1270 O OE2 . GLU A 1 165 ? 15.233  16.419 56.673 1.00 29.52 ? 165 GLU A OE2 1 
ATOM   1271 N N   . ASP A 1 166 ? 15.319  13.999 51.746 1.00 25.56 ? 166 ASP A N   1 
ATOM   1272 C CA  . ASP A 1 166 ? 15.115  12.558 51.834 1.00 26.33 ? 166 ASP A CA  1 
ATOM   1273 C C   . ASP A 1 166 ? 15.275  11.898 50.465 1.00 27.06 ? 166 ASP A C   1 
ATOM   1274 O O   . ASP A 1 166 ? 14.407  12.031 49.598 1.00 26.98 ? 166 ASP A O   1 
ATOM   1275 C CB  . ASP A 1 166 ? 13.709  12.273 52.366 1.00 26.91 ? 166 ASP A CB  1 
ATOM   1276 C CG  . ASP A 1 166 ? 13.432  10.792 52.531 1.00 28.49 ? 166 ASP A CG  1 
ATOM   1277 O OD1 . ASP A 1 166 ? 14.042  9.974  51.813 1.00 29.79 ? 166 ASP A OD1 1 
ATOM   1278 O OD2 . ASP A 1 166 ? 12.584  10.444 53.376 1.00 31.68 ? 166 ASP A OD2 1 
ATOM   1279 N N   . ARG A 1 167 ? 16.374  11.175 50.284 1.00 27.72 ? 167 ARG A N   1 
ATOM   1280 C CA  . ARG A 1 167 ? 16.652  10.488 49.026 1.00 29.13 ? 167 ARG A CA  1 
ATOM   1281 C C   . ARG A 1 167 ? 15.454  9.702  48.481 1.00 28.04 ? 167 ARG A C   1 
ATOM   1282 O O   . ARG A 1 167 ? 15.188  9.717  47.281 1.00 26.00 ? 167 ARG A O   1 
ATOM   1283 C CB  . ARG A 1 167 ? 17.857  9.560  49.211 1.00 31.54 ? 167 ARG A CB  1 
ATOM   1284 C CG  . ARG A 1 167 ? 17.834  8.806  50.529 1.00 36.56 ? 167 ARG A CG  1 
ATOM   1285 C CD  . ARG A 1 167 ? 17.082  7.489  50.446 1.00 39.06 ? 167 ARG A CD  1 
ATOM   1286 N NE  . ARG A 1 167 ? 17.994  6.391  50.156 1.00 43.53 ? 167 ARG A NE  1 
ATOM   1287 C CZ  . ARG A 1 167 ? 17.663  5.104  50.192 1.00 45.60 ? 167 ARG A CZ  1 
ATOM   1288 N NH1 . ARG A 1 167 ? 16.427  4.737  50.507 1.00 45.39 ? 167 ARG A NH1 1 
ATOM   1289 N NH2 . ARG A 1 167 ? 18.579  4.182  49.922 1.00 46.76 ? 167 ARG A NH2 1 
ATOM   1290 N N   . ARG A 1 168 ? 14.731  9.018  49.361 1.00 28.92 ? 168 ARG A N   1 
ATOM   1291 C CA  . ARG A 1 168 ? 13.572  8.247  48.935 1.00 29.71 ? 168 ARG A CA  1 
ATOM   1292 C C   . ARG A 1 168 ? 12.607  9.099  48.103 1.00 28.36 ? 168 ARG A C   1 
ATOM   1293 O O   . ARG A 1 168 ? 12.021  8.608  47.132 1.00 29.13 ? 168 ARG A O   1 
ATOM   1294 C CB  . ARG A 1 168 ? 12.854  7.647  50.151 1.00 31.88 ? 168 ARG A CB  1 
ATOM   1295 C CG  . ARG A 1 168 ? 13.613  6.481  50.801 1.00 38.37 ? 168 ARG A CG  1 
ATOM   1296 C CD  . ARG A 1 168 ? 12.962  5.996  52.105 1.00 43.29 ? 168 ARG A CD  1 
ATOM   1297 N NE  . ARG A 1 168 ? 12.939  7.042  53.134 1.00 49.24 ? 168 ARG A NE  1 
ATOM   1298 C CZ  . ARG A 1 168 ? 12.343  6.930  54.323 1.00 51.87 ? 168 ARG A CZ  1 
ATOM   1299 N NH1 . ARG A 1 168 ? 11.706  5.808  54.658 1.00 53.41 ? 168 ARG A NH1 1 
ATOM   1300 N NH2 . ARG A 1 168 ? 12.376  7.947  55.181 1.00 50.73 ? 168 ARG A NH2 1 
ATOM   1301 N N   . ILE A 1 169 ? 12.452  10.372 48.471 1.00 25.08 ? 169 ILE A N   1 
ATOM   1302 C CA  . ILE A 1 169 ? 11.561  11.268 47.732 1.00 21.87 ? 169 ILE A CA  1 
ATOM   1303 C C   . ILE A 1 169 ? 12.201  11.711 46.412 1.00 20.34 ? 169 ILE A C   1 
ATOM   1304 O O   . ILE A 1 169 ? 11.546  11.737 45.372 1.00 18.91 ? 169 ILE A O   1 
ATOM   1305 C CB  . ILE A 1 169 ? 11.177  12.514 48.579 1.00 20.31 ? 169 ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 169 ? 10.310  12.080 49.765 1.00 19.20 ? 169 ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 169 ? 10.410  13.522 47.726 1.00 17.96 ? 169 ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 169 ? 9.912   13.207 50.698 1.00 14.42 ? 169 ILE A CD1 1 
ATOM   1309 N N   . VAL A 1 170 ? 13.484  12.050 46.456 1.00 19.59 ? 170 VAL A N   1 
ATOM   1310 C CA  . VAL A 1 170 ? 14.193  12.468 45.255 1.00 19.16 ? 170 VAL A CA  1 
ATOM   1311 C C   . VAL A 1 170 ? 14.205  11.323 44.246 1.00 20.65 ? 170 VAL A C   1 
ATOM   1312 O O   . VAL A 1 170 ? 14.096  11.546 43.042 1.00 20.15 ? 170 VAL A O   1 
ATOM   1313 C CB  . VAL A 1 170 ? 15.645  12.883 45.576 1.00 17.48 ? 170 VAL A CB  1 
ATOM   1314 C CG1 . VAL A 1 170 ? 16.382  13.259 44.297 1.00 16.02 ? 170 VAL A CG1 1 
ATOM   1315 C CG2 . VAL A 1 170 ? 15.644  14.053 46.546 1.00 15.44 ? 170 VAL A CG2 1 
ATOM   1316 N N   . GLN A 1 171 ? 14.333  10.094 44.740 1.00 22.71 ? 171 GLN A N   1 
ATOM   1317 C CA  . GLN A 1 171 ? 14.343  8.934  43.858 1.00 24.75 ? 171 GLN A CA  1 
ATOM   1318 C C   . GLN A 1 171 ? 13.022  8.882  43.114 1.00 26.23 ? 171 GLN A C   1 
ATOM   1319 O O   . GLN A 1 171 ? 12.990  8.728  41.890 1.00 26.33 ? 171 GLN A O   1 
ATOM   1320 C CB  . GLN A 1 171 ? 14.498  7.635  44.647 1.00 24.97 ? 171 GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 171 ? 15.756  7.534  45.472 1.00 29.99 ? 171 GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 171 ? 15.909  6.168  46.111 1.00 31.66 ? 171 GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 171 ? 16.159  5.178  45.422 1.00 31.83 ? 171 GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 171 ? 15.752  6.105  47.435 1.00 31.65 ? 171 GLN A NE2 1 
ATOM   1325 N N   . SER A 1 172 ? 11.931  9.016  43.865 1.00 26.55 ? 172 SER A N   1 
ATOM   1326 C CA  . SER A 1 172 ? 10.601  8.957  43.285 1.00 27.03 ? 172 SER A CA  1 
ATOM   1327 C C   . SER A 1 172 ? 10.374  10.053 42.253 1.00 26.93 ? 172 SER A C   1 
ATOM   1328 O O   . SER A 1 172 ? 9.721   9.819  41.237 1.00 26.64 ? 172 SER A O   1 
ATOM   1329 C CB  . SER A 1 172 ? 9.528   9.032  44.383 1.00 28.57 ? 172 SER A CB  1 
ATOM   1330 O OG  . SER A 1 172 ? 9.392   10.340 44.912 1.00 31.68 ? 172 SER A OG  1 
ATOM   1331 N N   . MET A 1 173 ? 10.922  11.241 42.500 1.00 26.32 ? 173 MET A N   1 
ATOM   1332 C CA  . MET A 1 173 ? 10.747  12.357 41.571 1.00 25.39 ? 173 MET A CA  1 
ATOM   1333 C C   . MET A 1 173 ? 11.572  12.262 40.283 1.00 24.25 ? 173 MET A C   1 
ATOM   1334 O O   . MET A 1 173 ? 11.521  13.163 39.452 1.00 23.99 ? 173 MET A O   1 
ATOM   1335 C CB  . MET A 1 173 ? 11.041  13.688 42.271 1.00 24.52 ? 173 MET A CB  1 
ATOM   1336 C CG  . MET A 1 173 ? 10.067  14.044 43.389 1.00 27.25 ? 173 MET A CG  1 
ATOM   1337 S SD  . MET A 1 173 ? 8.333   14.107 42.873 1.00 28.61 ? 173 MET A SD  1 
ATOM   1338 C CE  . MET A 1 173 ? 7.544   13.182 44.175 1.00 30.95 ? 173 MET A CE  1 
ATOM   1339 N N   . THR A 1 174 ? 12.328  11.183 40.109 1.00 23.26 ? 174 THR A N   1 
ATOM   1340 C CA  . THR A 1 174 ? 13.117  11.026 38.889 1.00 23.87 ? 174 THR A CA  1 
ATOM   1341 C C   . THR A 1 174 ? 12.188  10.686 37.724 1.00 23.35 ? 174 THR A C   1 
ATOM   1342 O O   . THR A 1 174 ? 12.638  10.443 36.603 1.00 22.43 ? 174 THR A O   1 
ATOM   1343 C CB  . THR A 1 174 ? 14.175  9.913  39.016 1.00 23.33 ? 174 THR A CB  1 
ATOM   1344 O OG1 . THR A 1 174 ? 13.525  8.664  39.284 1.00 25.51 ? 174 THR A OG1 1 
ATOM   1345 C CG2 . THR A 1 174 ? 15.154  10.233 40.133 1.00 21.89 ? 174 THR A CG2 1 
ATOM   1346 N N   . GLU A 1 175 ? 10.888  10.665 38.001 1.00 22.73 ? 175 GLU A N   1 
ATOM   1347 C CA  . GLU A 1 175 ? 9.897   10.383 36.973 1.00 23.60 ? 175 GLU A CA  1 
ATOM   1348 C C   . GLU A 1 175 ? 9.895   11.508 35.945 1.00 24.12 ? 175 GLU A C   1 
ATOM   1349 O O   . GLU A 1 175 ? 9.295   11.383 34.872 1.00 25.04 ? 175 GLU A O   1 
ATOM   1350 C CB  . GLU A 1 175 ? 8.503   10.245 37.588 1.00 22.13 ? 175 GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 175 ? 8.216   8.865  38.118 1.00 23.56 ? 175 GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 175 ? 8.167   7.829  37.013 1.00 25.59 ? 175 GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 175 ? 7.173   7.823  36.253 1.00 26.28 ? 175 GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 175 ? 9.127   7.030  36.899 1.00 24.99 ? 175 GLU A OE2 1 
ATOM   1355 N N   . LEU A 1 176 ? 10.565  12.609 36.279 1.00 22.68 ? 176 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 176 ? 10.651  13.746 35.369 1.00 22.84 ? 176 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 176 ? 11.364  13.300 34.093 1.00 23.43 ? 176 LEU A C   1 
ATOM   1358 O O   . LEU A 1 176 ? 11.018  13.738 32.994 1.00 25.76 ? 176 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 176 ? 11.438  14.900 36.003 1.00 21.37 ? 176 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 176 ? 11.485  16.182 35.165 1.00 19.92 ? 176 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 176 ? 10.236  16.999 35.445 1.00 18.63 ? 176 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 176 ? 12.723  16.997 35.491 1.00 17.24 ? 176 LEU A CD2 1 
ATOM   1363 N N   . ILE A 1 177 ? 12.355  12.425 34.247 1.00 21.63 ? 177 ILE A N   1 
ATOM   1364 C CA  . ILE A 1 177 ? 13.129  11.925 33.119 1.00 20.24 ? 177 ILE A CA  1 
ATOM   1365 C C   . ILE A 1 177 ? 12.269  11.256 32.037 1.00 20.59 ? 177 ILE A C   1 
ATOM   1366 O O   . ILE A 1 177 ? 12.345  11.622 30.865 1.00 19.45 ? 177 ILE A O   1 
ATOM   1367 C CB  . ILE A 1 177 ? 14.224  10.968 33.616 1.00 18.73 ? 177 ILE A CB  1 
ATOM   1368 C CG1 . ILE A 1 177 ? 15.207  11.756 34.489 1.00 19.39 ? 177 ILE A CG1 1 
ATOM   1369 C CG2 . ILE A 1 177 ? 14.916  10.301 32.442 1.00 15.47 ? 177 ILE A CG2 1 
ATOM   1370 C CD1 . ILE A 1 177 ? 16.284  10.914 35.157 1.00 19.85 ? 177 ILE A CD1 1 
ATOM   1371 N N   . PRO A 1 178 ? 11.444  10.266 32.410 1.00 21.90 ? 178 PRO A N   1 
ATOM   1372 C CA  . PRO A 1 178 ? 10.602  9.611  31.399 1.00 22.24 ? 178 PRO A CA  1 
ATOM   1373 C C   . PRO A 1 178 ? 9.640   10.630 30.788 1.00 23.03 ? 178 PRO A C   1 
ATOM   1374 O O   . PRO A 1 178 ? 9.177   10.469 29.659 1.00 22.28 ? 178 PRO A O   1 
ATOM   1375 C CB  . PRO A 1 178 ? 9.859   8.549  32.201 1.00 21.13 ? 178 PRO A CB  1 
ATOM   1376 C CG  . PRO A 1 178 ? 10.806  8.243  33.313 1.00 23.14 ? 178 PRO A CG  1 
ATOM   1377 C CD  . PRO A 1 178 ? 11.305  9.600  33.715 1.00 23.02 ? 178 PRO A CD  1 
ATOM   1378 N N   . GLY A 1 179 ? 9.335   11.675 31.558 1.00 22.74 ? 179 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 179 ? 8.446   12.713 31.078 1.00 21.79 ? 179 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 179 ? 9.138   13.487 29.977 1.00 22.60 ? 179 GLY A C   1 
ATOM   1381 O O   . GLY A 1 179 ? 8.586   13.669 28.890 1.00 23.09 ? 179 GLY A O   1 
ATOM   1382 N N   . LEU A 1 180 ? 10.361  13.928 30.261 1.00 22.25 ? 180 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 180 ? 11.168  14.684 29.311 1.00 21.40 ? 180 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 180 ? 11.617  13.866 28.102 1.00 22.87 ? 180 LEU A C   1 
ATOM   1385 O O   . LEU A 1 180 ? 11.541  14.331 26.966 1.00 24.50 ? 180 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 180 ? 12.411  15.235 30.009 1.00 19.28 ? 180 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 180 ? 12.234  16.367 31.014 1.00 16.72 ? 180 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 180 ? 13.531  16.585 31.779 1.00 15.54 ? 180 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 180 ? 11.822  17.625 30.280 1.00 13.95 ? 180 LEU A CD2 1 
ATOM   1390 N N   . GLN A 1 181 ? 12.085  12.646 28.345 1.00 24.09 ? 181 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 181 ? 12.586  11.801 27.268 1.00 24.49 ? 181 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 181 ? 11.575  10.824 26.703 1.00 25.11 ? 181 GLN A C   1 
ATOM   1393 O O   . GLN A 1 181 ? 11.714  10.374 25.570 1.00 26.12 ? 181 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 181 ? 13.810  11.010 27.745 1.00 23.89 ? 181 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 181 ? 14.905  11.845 28.392 1.00 24.48 ? 181 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 181 ? 16.175  11.047 28.662 1.00 25.69 ? 181 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 181 ? 16.118  9.898  29.097 1.00 26.11 ? 181 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 181 ? 17.325  11.662 28.416 1.00 23.22 ? 181 GLN A NE2 1 
ATOM   1399 N N   . GLY A 1 182 ? 10.560  10.495 27.491 1.00 26.52 ? 182 GLY A N   1 
ATOM   1400 C CA  . GLY A 1 182 ? 9.574   9.521  27.052 1.00 26.09 ? 182 GLY A CA  1 
ATOM   1401 C C   . GLY A 1 182 ? 9.902   8.200  27.730 1.00 25.54 ? 182 GLY A C   1 
ATOM   1402 O O   . GLY A 1 182 ? 11.054  7.960  28.097 1.00 23.23 ? 182 GLY A O   1 
ATOM   1403 N N   . ASP A 1 183 ? 8.903   7.342  27.911 1.00 26.95 ? 183 ASP A N   1 
ATOM   1404 C CA  . ASP A 1 183 ? 9.130   6.052  28.560 1.00 28.41 ? 183 ASP A CA  1 
ATOM   1405 C C   . ASP A 1 183 ? 10.040  5.145  27.750 1.00 28.50 ? 183 ASP A C   1 
ATOM   1406 O O   . ASP A 1 183 ? 9.984   5.126  26.521 1.00 29.10 ? 183 ASP A O   1 
ATOM   1407 C CB  . ASP A 1 183 ? 7.805   5.333  28.816 1.00 28.56 ? 183 ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 183 ? 6.913   6.085  29.780 1.00 29.58 ? 183 ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 183 ? 7.379   6.397  30.895 1.00 27.78 ? 183 ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 183 ? 5.749   6.363  29.423 1.00 30.63 ? 183 ASP A OD2 1 
ATOM   1411 N N   . VAL A 1 184 ? 10.877  4.394  28.455 1.00 29.31 ? 184 VAL A N   1 
ATOM   1412 C CA  . VAL A 1 184 ? 11.806  3.467  27.825 1.00 31.41 ? 184 VAL A CA  1 
ATOM   1413 C C   . VAL A 1 184 ? 11.104  2.141  27.543 1.00 33.59 ? 184 VAL A C   1 
ATOM   1414 O O   . VAL A 1 184 ? 10.149  1.784  28.229 1.00 33.01 ? 184 VAL A O   1 
ATOM   1415 C CB  . VAL A 1 184 ? 13.009  3.178  28.747 1.00 31.29 ? 184 VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 184 ? 13.692  4.483  29.152 1.00 30.65 ? 184 VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 184 ? 12.538  2.413  29.979 1.00 28.95 ? 184 VAL A CG2 1 
ATOM   1418 N N   . PRO A 1 185 ? 11.567  1.400  26.522 1.00 36.63 ? 185 PRO A N   1 
ATOM   1419 C CA  . PRO A 1 185 ? 10.998  0.103  26.139 1.00 38.70 ? 185 PRO A CA  1 
ATOM   1420 C C   . PRO A 1 185 ? 11.000  -0.876 27.309 1.00 41.42 ? 185 PRO A C   1 
ATOM   1421 O O   . PRO A 1 185 ? 11.753  -0.703 28.271 1.00 41.52 ? 185 PRO A O   1 
ATOM   1422 C CB  . PRO A 1 185 ? 11.921  -0.349 25.014 1.00 37.89 ? 185 PRO A CB  1 
ATOM   1423 C CG  . PRO A 1 185 ? 12.261  0.930  24.347 1.00 37.58 ? 185 PRO A CG  1 
ATOM   1424 C CD  . PRO A 1 185 ? 12.562  1.837  25.527 1.00 38.65 ? 185 PRO A CD  1 
ATOM   1425 N N   . LYS A 1 186 ? 10.166  -1.908 27.232 1.00 44.84 ? 186 LYS A N   1 
ATOM   1426 C CA  . LYS A 1 186 ? 10.110  -2.883 28.316 1.00 47.28 ? 186 LYS A CA  1 
ATOM   1427 C C   . LYS A 1 186 ? 11.393  -3.711 28.403 1.00 47.22 ? 186 LYS A C   1 
ATOM   1428 O O   . LYS A 1 186 ? 11.735  -4.226 29.466 1.00 48.53 ? 186 LYS A O   1 
ATOM   1429 C CB  . LYS A 1 186 ? 8.898   -3.805 28.155 1.00 49.13 ? 186 LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 186 ? 8.760   -4.819 29.288 1.00 52.57 ? 186 LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 186 ? 7.365   -5.432 29.352 1.00 55.28 ? 186 LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 186 ? 6.312   -4.388 29.727 1.00 56.12 ? 186 LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 186 ? 4.947   -4.983 29.846 1.00 56.51 ? 186 LYS A NZ  1 
ATOM   1434 N N   . ASP A 1 187 ? 12.104  -3.835 27.288 1.00 45.86 ? 187 ASP A N   1 
ATOM   1435 C CA  . ASP A 1 187 ? 13.351  -4.598 27.274 1.00 46.13 ? 187 ASP A CA  1 
ATOM   1436 C C   . ASP A 1 187 ? 14.478  -3.798 27.938 1.00 43.93 ? 187 ASP A C   1 
ATOM   1437 O O   . ASP A 1 187 ? 15.222  -4.314 28.767 1.00 43.52 ? 187 ASP A O   1 
ATOM   1438 C CB  . ASP A 1 187 ? 13.732  -4.949 25.826 1.00 48.37 ? 187 ASP A CB  1 
ATOM   1439 C CG  . ASP A 1 187 ? 13.748  -3.730 24.909 1.00 50.05 ? 187 ASP A CG  1 
ATOM   1440 O OD1 . ASP A 1 187 ? 14.650  -2.875 25.062 1.00 51.02 ? 187 ASP A OD1 1 
ATOM   1441 O OD2 . ASP A 1 187 ? 12.855  -3.622 24.038 1.00 50.34 ? 187 ASP A OD2 1 
ATOM   1442 N N   . PHE A 1 188 ? 14.568  -2.530 27.557 1.00 41.44 ? 188 PHE A N   1 
ATOM   1443 C CA  . PHE A 1 188 ? 15.559  -1.574 28.037 1.00 37.60 ? 188 PHE A CA  1 
ATOM   1444 C C   . PHE A 1 188 ? 16.574  -1.996 29.097 1.00 35.90 ? 188 PHE A C   1 
ATOM   1445 O O   . PHE A 1 188 ? 16.214  -2.463 30.177 1.00 35.35 ? 188 PHE A O   1 
ATOM   1446 C CB  . PHE A 1 188 ? 14.855  -0.319 28.535 1.00 36.64 ? 188 PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 188 ? 15.758  0.863  28.629 1.00 36.05 ? 188 PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 188 ? 16.269  1.448  27.472 1.00 34.39 ? 188 PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 188 ? 16.130  1.373  29.867 1.00 34.68 ? 188 PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 188 ? 17.137  2.522  27.544 1.00 35.80 ? 188 PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 188 ? 17.001  2.450  29.956 1.00 35.93 ? 188 PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 188 ? 17.508  3.029  28.791 1.00 37.02 ? 188 PHE A CZ  1 
ATOM   1453 N N   . THR A 1 189 ? 17.849  -1.783 28.784 1.00 32.60 ? 189 THR A N   1 
ATOM   1454 C CA  . THR A 1 189 ? 18.934  -2.113 29.697 1.00 30.63 ? 189 THR A CA  1 
ATOM   1455 C C   . THR A 1 189 ? 19.290  -0.875 30.509 1.00 29.95 ? 189 THR A C   1 
ATOM   1456 O O   . THR A 1 189 ? 19.579  0.179  29.943 1.00 30.34 ? 189 THR A O   1 
ATOM   1457 C CB  . THR A 1 189 ? 20.194  -2.569 28.927 1.00 29.77 ? 189 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 189 ? 19.912  -3.781 28.215 1.00 29.28 ? 189 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 189 ? 21.350  -2.804 29.884 1.00 26.43 ? 189 THR A CG2 1 
ATOM   1460 N N   . SER A 1 190 ? 19.270  -0.997 31.833 1.00 27.64 ? 190 SER A N   1 
ATOM   1461 C CA  . SER A 1 190 ? 19.603  0.135  32.681 1.00 26.06 ? 190 SER A CA  1 
ATOM   1462 C C   . SER A 1 190 ? 20.983  0.671  32.330 1.00 27.34 ? 190 SER A C   1 
ATOM   1463 O O   . SER A 1 190 ? 21.948  -0.092 32.208 1.00 27.27 ? 190 SER A O   1 
ATOM   1464 C CB  . SER A 1 190 ? 19.579  -0.266 34.151 1.00 25.15 ? 190 SER A CB  1 
ATOM   1465 O OG  . SER A 1 190 ? 20.073  0.784  34.968 1.00 23.22 ? 190 SER A OG  1 
ATOM   1466 N N   . GLY A 1 191 ? 21.072  1.989  32.170 1.00 26.49 ? 191 GLY A N   1 
ATOM   1467 C CA  . GLY A 1 191 ? 22.339  2.607  31.839 1.00 25.26 ? 191 GLY A CA  1 
ATOM   1468 C C   . GLY A 1 191 ? 22.389  3.133  30.419 1.00 24.67 ? 191 GLY A C   1 
ATOM   1469 O O   . GLY A 1 191 ? 23.192  4.009  30.115 1.00 25.13 ? 191 GLY A O   1 
ATOM   1470 N N   . MET A 1 192 ? 21.547  2.599  29.542 1.00 24.11 ? 192 MET A N   1 
ATOM   1471 C CA  . MET A 1 192 ? 21.527  3.063  28.158 1.00 25.63 ? 192 MET A CA  1 
ATOM   1472 C C   . MET A 1 192 ? 20.803  4.400  28.062 1.00 24.89 ? 192 MET A C   1 
ATOM   1473 O O   . MET A 1 192 ? 19.946  4.707  28.890 1.00 25.28 ? 192 MET A O   1 
ATOM   1474 C CB  . MET A 1 192 ? 20.836  2.039  27.252 1.00 26.39 ? 192 MET A CB  1 
ATOM   1475 C CG  . MET A 1 192 ? 21.660  0.787  26.971 1.00 27.23 ? 192 MET A CG  1 
ATOM   1476 S SD  . MET A 1 192 ? 23.140  1.140  26.007 1.00 31.95 ? 192 MET A SD  1 
ATOM   1477 C CE  . MET A 1 192 ? 22.506  1.024  24.331 1.00 26.00 ? 192 MET A CE  1 
ATOM   1478 N N   . PRO A 1 193 ? 21.148  5.220  27.054 1.00 24.66 ? 193 PRO A N   1 
ATOM   1479 C CA  . PRO A 1 193 ? 20.510  6.529  26.871 1.00 23.31 ? 193 PRO A CA  1 
ATOM   1480 C C   . PRO A 1 193 ? 19.200  6.323  26.133 1.00 22.56 ? 193 PRO A C   1 
ATOM   1481 O O   . PRO A 1 193 ? 19.052  5.340  25.412 1.00 21.64 ? 193 PRO A O   1 
ATOM   1482 C CB  . PRO A 1 193 ? 21.511  7.298  26.004 1.00 22.57 ? 193 PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 193 ? 22.755  6.450  25.995 1.00 23.62 ? 193 PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 193 ? 22.254  5.054  26.104 1.00 23.73 ? 193 PRO A CD  1 
ATOM   1485 N N   . PHE A 1 194 ? 18.253  7.238  26.304 1.00 22.68 ? 194 PHE A N   1 
ATOM   1486 C CA  . PHE A 1 194 ? 16.982  7.110  25.602 1.00 22.52 ? 194 PHE A CA  1 
ATOM   1487 C C   . PHE A 1 194 ? 16.216  8.412  25.424 1.00 22.28 ? 194 PHE A C   1 
ATOM   1488 O O   . PHE A 1 194 ? 16.187  9.251  26.320 1.00 23.64 ? 194 PHE A O   1 
ATOM   1489 C CB  . PHE A 1 194 ? 16.068  6.119  26.312 1.00 20.71 ? 194 PHE A CB  1 
ATOM   1490 C CG  . PHE A 1 194 ? 14.774  5.890  25.595 1.00 20.88 ? 194 PHE A CG  1 
ATOM   1491 C CD1 . PHE A 1 194 ? 14.715  5.037  24.496 1.00 22.38 ? 194 PHE A CD1 1 
ATOM   1492 C CD2 . PHE A 1 194 ? 13.625  6.571  25.974 1.00 20.11 ? 194 PHE A CD2 1 
ATOM   1493 C CE1 . PHE A 1 194 ? 13.527  4.867  23.782 1.00 22.01 ? 194 PHE A CE1 1 
ATOM   1494 C CE2 . PHE A 1 194 ? 12.435  6.410  25.268 1.00 20.97 ? 194 PHE A CE2 1 
ATOM   1495 C CZ  . PHE A 1 194 ? 12.387  5.557  24.169 1.00 21.21 ? 194 PHE A CZ  1 
ATOM   1496 N N   . VAL A 1 195 ? 15.603  8.562  24.252 1.00 20.84 ? 195 VAL A N   1 
ATOM   1497 C CA  . VAL A 1 195 ? 14.775  9.714  23.906 1.00 20.71 ? 195 VAL A CA  1 
ATOM   1498 C C   . VAL A 1 195 ? 13.834  9.210  22.805 1.00 21.97 ? 195 VAL A C   1 
ATOM   1499 O O   . VAL A 1 195 ? 14.291  8.723  21.773 1.00 22.72 ? 195 VAL A O   1 
ATOM   1500 C CB  . VAL A 1 195 ? 15.600  10.899 23.361 1.00 20.15 ? 195 VAL A CB  1 
ATOM   1501 C CG1 . VAL A 1 195 ? 14.669  12.058 23.051 1.00 19.94 ? 195 VAL A CG1 1 
ATOM   1502 C CG2 . VAL A 1 195 ? 16.639  11.339 24.372 1.00 18.86 ? 195 VAL A CG2 1 
ATOM   1503 N N   . ALA A 1 196 ? 12.527  9.325  23.031 1.00 22.02 ? 196 ALA A N   1 
ATOM   1504 C CA  . ALA A 1 196 ? 11.516  8.841  22.091 1.00 22.16 ? 196 ALA A CA  1 
ATOM   1505 C C   . ALA A 1 196 ? 11.578  9.382  20.671 1.00 23.73 ? 196 ALA A C   1 
ATOM   1506 O O   . ALA A 1 196 ? 11.491  8.620  19.711 1.00 25.01 ? 196 ALA A O   1 
ATOM   1507 C CB  . ALA A 1 196 ? 10.125  9.081  22.659 1.00 19.70 ? 196 ALA A CB  1 
ATOM   1508 N N   . GLY A 1 197 ? 11.707  10.694 20.526 1.00 25.15 ? 197 GLY A N   1 
ATOM   1509 C CA  . GLY A 1 197 ? 11.751  11.260 19.192 1.00 25.07 ? 197 GLY A CA  1 
ATOM   1510 C C   . GLY A 1 197 ? 11.848  12.770 19.171 1.00 26.14 ? 197 GLY A C   1 
ATOM   1511 O O   . GLY A 1 197 ? 12.261  13.392 20.153 1.00 27.00 ? 197 GLY A O   1 
ATOM   1512 N N   . LYS A 1 198 ? 11.446  13.370 18.058 1.00 25.32 ? 198 LYS A N   1 
ATOM   1513 C CA  . LYS A 1 198 ? 11.529  14.813 17.917 1.00 26.00 ? 198 LYS A CA  1 
ATOM   1514 C C   . LYS A 1 198 ? 10.642  15.624 18.862 1.00 26.16 ? 198 LYS A C   1 
ATOM   1515 O O   . LYS A 1 198 ? 10.767  16.846 18.925 1.00 25.79 ? 198 LYS A O   1 
ATOM   1516 C CB  . LYS A 1 198 ? 11.255  15.201 16.462 1.00 25.98 ? 198 LYS A CB  1 
ATOM   1517 C CG  . LYS A 1 198 ? 9.869   14.880 15.951 1.00 24.66 ? 198 LYS A CG  1 
ATOM   1518 C CD  . LYS A 1 198 ? 9.896   14.829 14.435 1.00 28.15 ? 198 LYS A CD  1 
ATOM   1519 C CE  . LYS A 1 198 ? 8.503   14.784 13.830 1.00 30.37 ? 198 LYS A CE  1 
ATOM   1520 N NZ  . LYS A 1 198 ? 7.820   16.108 13.905 1.00 31.56 ? 198 LYS A NZ  1 
ATOM   1521 N N   . ASN A 1 199 ? 9.762   14.958 19.604 1.00 26.69 ? 199 ASN A N   1 
ATOM   1522 C CA  . ASN A 1 199 ? 8.874   15.663 20.528 1.00 28.04 ? 199 ASN A CA  1 
ATOM   1523 C C   . ASN A 1 199 ? 9.292   15.498 21.978 1.00 28.16 ? 199 ASN A C   1 
ATOM   1524 O O   . ASN A 1 199 ? 8.572   15.884 22.901 1.00 28.99 ? 199 ASN A O   1 
ATOM   1525 C CB  . ASN A 1 199 ? 7.438   15.188 20.341 1.00 29.31 ? 199 ASN A CB  1 
ATOM   1526 C CG  . ASN A 1 199 ? 6.915   15.482 18.952 1.00 31.43 ? 199 ASN A CG  1 
ATOM   1527 O OD1 . ASN A 1 199 ? 6.406   14.593 18.279 1.00 33.35 ? 199 ASN A OD1 1 
ATOM   1528 N ND2 . ASN A 1 199 ? 7.043   16.736 18.511 1.00 29.62 ? 199 ASN A ND2 1 
ATOM   1529 N N   . LYS A 1 200 ? 10.466  14.910 22.165 1.00 27.68 ? 200 LYS A N   1 
ATOM   1530 C CA  . LYS A 1 200 ? 11.027  14.700 23.488 1.00 25.81 ? 200 LYS A CA  1 
ATOM   1531 C C   . LYS A 1 200 ? 12.426  15.296 23.473 1.00 25.07 ? 200 LYS A C   1 
ATOM   1532 O O   . LYS A 1 200 ? 12.953  15.641 22.411 1.00 24.35 ? 200 LYS A O   1 
ATOM   1533 C CB  . LYS A 1 200 ? 11.092  13.206 23.809 1.00 26.01 ? 200 LYS A CB  1 
ATOM   1534 C CG  . LYS A 1 200 ? 9.736   12.542 23.957 1.00 22.31 ? 200 LYS A CG  1 
ATOM   1535 C CD  . LYS A 1 200 ? 8.962   13.149 25.112 1.00 21.48 ? 200 LYS A CD  1 
ATOM   1536 C CE  . LYS A 1 200 ? 7.680   12.386 25.368 1.00 20.71 ? 200 LYS A CE  1 
ATOM   1537 N NZ  . LYS A 1 200 ? 6.926   12.941 26.521 1.00 20.95 ? 200 LYS A NZ  1 
ATOM   1538 N N   . VAL A 1 201 ? 13.025  15.423 24.648 1.00 23.79 ? 201 VAL A N   1 
ATOM   1539 C CA  . VAL A 1 201 ? 14.360  15.985 24.742 1.00 22.44 ? 201 VAL A CA  1 
ATOM   1540 C C   . VAL A 1 201 ? 15.252  15.079 25.564 1.00 21.85 ? 201 VAL A C   1 
ATOM   1541 O O   . VAL A 1 201 ? 14.772  14.259 26.344 1.00 22.19 ? 201 VAL A O   1 
ATOM   1542 C CB  . VAL A 1 201 ? 14.347  17.374 25.422 1.00 22.34 ? 201 VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 201 ? 13.421  18.316 24.678 1.00 22.22 ? 201 VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 201 ? 13.922  17.238 26.869 1.00 21.22 ? 201 VAL A CG2 1 
ATOM   1545 N N   . ALA A 1 202 ? 16.556  15.226 25.379 1.00 21.01 ? 202 ALA A N   1 
ATOM   1546 C CA  . ALA A 1 202 ? 17.517  14.449 26.140 1.00 20.09 ? 202 ALA A CA  1 
ATOM   1547 C C   . ALA A 1 202 ? 17.515  15.086 27.525 1.00 17.81 ? 202 ALA A C   1 
ATOM   1548 O O   . ALA A 1 202 ? 17.409  16.309 27.639 1.00 16.86 ? 202 ALA A O   1 
ATOM   1549 C CB  . ALA A 1 202 ? 18.898  14.561 25.503 1.00 20.99 ? 202 ALA A CB  1 
ATOM   1550 N N   . ALA A 1 203 ? 17.609  14.272 28.569 1.00 16.59 ? 203 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 203 ? 17.613  14.802 29.928 1.00 17.42 ? 203 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 203 ? 19.018  14.784 30.505 1.00 18.31 ? 203 ALA A C   1 
ATOM   1553 O O   . ALA A 1 203 ? 19.963  14.362 29.843 1.00 19.99 ? 203 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 203 ? 16.676  14.000 30.811 1.00 17.41 ? 203 ALA A CB  1 
ATOM   1555 N N   . CYS A 1 204 ? 19.150  15.236 31.746 1.00 18.87 ? 204 CYS A N   1 
ATOM   1556 C CA  . CYS A 1 204 ? 20.449  15.288 32.396 1.00 19.41 ? 204 CYS A CA  1 
ATOM   1557 C C   . CYS A 1 204 ? 20.358  15.248 33.915 1.00 19.94 ? 204 CYS A C   1 
ATOM   1558 O O   . CYS A 1 204 ? 19.877  16.189 34.532 1.00 19.33 ? 204 CYS A O   1 
ATOM   1559 C CB  . CYS A 1 204 ? 21.182  16.563 31.973 1.00 20.38 ? 204 CYS A CB  1 
ATOM   1560 S SG  . CYS A 1 204 ? 22.763  16.819 32.790 1.00 20.84 ? 204 CYS A SG  1 
ATOM   1561 N N   . ALA A 1 205 ? 20.826  14.157 34.514 1.00 20.88 ? 205 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 205 ? 20.820  14.029 35.964 1.00 21.29 ? 205 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 205 ? 22.029  14.794 36.489 1.00 22.22 ? 205 ALA A C   1 
ATOM   1564 O O   . ALA A 1 205 ? 23.163  14.497 36.112 1.00 24.02 ? 205 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 205 ? 20.910  12.568 36.362 1.00 20.59 ? 205 ALA A CB  1 
ATOM   1566 N N   . LYS A 1 206 ? 21.788  15.781 37.348 1.00 22.13 ? 206 LYS A N   1 
ATOM   1567 C CA  . LYS A 1 206 ? 22.867  16.591 37.900 1.00 22.27 ? 206 LYS A CA  1 
ATOM   1568 C C   . LYS A 1 206 ? 22.667  16.872 39.393 1.00 22.74 ? 206 LYS A C   1 
ATOM   1569 O O   . LYS A 1 206 ? 21.533  16.782 39.863 1.00 24.64 ? 206 LYS A O   1 
ATOM   1570 C CB  . LYS A 1 206 ? 22.956  17.917 37.134 1.00 21.87 ? 206 LYS A CB  1 
ATOM   1571 C CG  . LYS A 1 206 ? 21.735  18.817 37.293 1.00 21.44 ? 206 LYS A CG  1 
ATOM   1572 C CD  . LYS A 1 206 ? 21.825  20.042 36.404 1.00 22.18 ? 206 LYS A CD  1 
ATOM   1573 C CE  . LYS A 1 206 ? 20.703  21.020 36.705 1.00 21.20 ? 206 LYS A CE  1 
ATOM   1574 N NZ  . LYS A 1 206 ? 20.794  22.246 35.867 1.00 20.20 ? 206 LYS A NZ  1 
ATOM   1575 N N   . HIS A 1 207 ? 23.732  17.178 40.131 1.00 21.43 ? 207 HIS A N   1 
ATOM   1576 C CA  . HIS A 1 207 ? 25.112  17.258 39.660 1.00 21.27 ? 207 HIS A CA  1 
ATOM   1577 C C   . HIS A 1 207 ? 25.902  16.164 40.370 1.00 21.55 ? 207 HIS A C   1 
ATOM   1578 O O   . HIS A 1 207 ? 26.063  16.201 41.588 1.00 20.05 ? 207 HIS A O   1 
ATOM   1579 C CB  . HIS A 1 207 ? 25.721  18.623 39.971 1.00 19.73 ? 207 HIS A CB  1 
ATOM   1580 C CG  . HIS A 1 207 ? 24.871  19.775 39.546 1.00 21.58 ? 207 HIS A CG  1 
ATOM   1581 N ND1 . HIS A 1 207 ? 23.783  20.204 40.274 1.00 22.62 ? 207 HIS A ND1 1 
ATOM   1582 C CD2 . HIS A 1 207 ? 24.948  20.592 38.468 1.00 23.32 ? 207 HIS A CD2 1 
ATOM   1583 C CE1 . HIS A 1 207 ? 23.231  21.239 39.666 1.00 23.83 ? 207 HIS A CE1 1 
ATOM   1584 N NE2 . HIS A 1 207 ? 23.918  21.495 38.568 1.00 22.46 ? 207 HIS A NE2 1 
ATOM   1585 N N   . PHE A 1 208 ? 26.381  15.193 39.594 1.00 22.33 ? 208 PHE A N   1 
ATOM   1586 C CA  . PHE A 1 208 ? 27.133  14.049 40.107 1.00 22.24 ? 208 PHE A CA  1 
ATOM   1587 C C   . PHE A 1 208 ? 28.442  14.467 40.775 1.00 22.37 ? 208 PHE A C   1 
ATOM   1588 O O   . PHE A 1 208 ? 29.297  15.024 40.088 1.00 22.98 ? 208 PHE A O   1 
ATOM   1589 C CB  . PHE A 1 208 ? 27.427  13.089 38.952 1.00 22.08 ? 208 PHE A CB  1 
ATOM   1590 C CG  . PHE A 1 208 ? 27.954  11.756 39.382 1.00 21.76 ? 208 PHE A CG  1 
ATOM   1591 C CD1 . PHE A 1 208 ? 27.094  10.771 39.840 1.00 21.38 ? 208 PHE A CD1 1 
ATOM   1592 C CD2 . PHE A 1 208 ? 29.314  11.479 39.310 1.00 22.91 ? 208 PHE A CD2 1 
ATOM   1593 C CE1 . PHE A 1 208 ? 27.580  9.526  40.216 1.00 23.44 ? 208 PHE A CE1 1 
ATOM   1594 C CE2 . PHE A 1 208 ? 29.808  10.235 39.687 1.00 24.49 ? 208 PHE A CE2 1 
ATOM   1595 C CZ  . PHE A 1 208 ? 28.939  9.257  40.139 1.00 23.29 ? 208 PHE A CZ  1 
ATOM   1596 N N   . VAL A 1 209 ? 28.590  14.252 42.083 1.00 21.24 ? 209 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 209 ? 27.612  13.659 42.991 1.00 20.75 ? 209 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 209 ? 27.801  14.268 44.380 1.00 21.13 ? 209 VAL A C   1 
ATOM   1599 O O   . VAL A 1 209 ? 28.903  14.686 44.730 1.00 19.24 ? 209 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 209 ? 27.778  12.113 43.086 1.00 23.06 ? 209 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 209 ? 29.090  11.762 43.777 1.00 20.94 ? 209 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 209 ? 26.591  11.498 43.832 1.00 21.47 ? 209 VAL A CG2 1 
ATOM   1603 N N   . GLY A 1 210 ? 26.721  14.330 45.159 1.00 21.11 ? 210 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 210 ? 26.795  14.887 46.501 1.00 20.54 ? 210 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 210 ? 26.786  16.406 46.534 1.00 21.53 ? 210 GLY A C   1 
ATOM   1606 O O   . GLY A 1 210 ? 27.161  17.017 47.531 1.00 21.48 ? 210 GLY A O   1 
ATOM   1607 N N   . ASP A 1 211 ? 26.356  17.024 45.442 1.00 20.59 ? 211 ASP A N   1 
ATOM   1608 C CA  . ASP A 1 211 ? 26.315  18.476 45.363 1.00 21.13 ? 211 ASP A CA  1 
ATOM   1609 C C   . ASP A 1 211 ? 25.426  19.090 46.443 1.00 22.25 ? 211 ASP A C   1 
ATOM   1610 O O   . ASP A 1 211 ? 25.595  20.254 46.811 1.00 21.88 ? 211 ASP A O   1 
ATOM   1611 C CB  . ASP A 1 211 ? 25.839  18.905 43.969 1.00 20.32 ? 211 ASP A CB  1 
ATOM   1612 C CG  . ASP A 1 211 ? 24.548  18.220 43.552 1.00 20.25 ? 211 ASP A CG  1 
ATOM   1613 O OD1 . ASP A 1 211 ? 24.349  17.035 43.899 1.00 18.01 ? 211 ASP A OD1 1 
ATOM   1614 O OD2 . ASP A 1 211 ? 23.740  18.865 42.856 1.00 19.98 ? 211 ASP A OD2 1 
ATOM   1615 N N   . GLY A 1 212 ? 24.485  18.305 46.956 1.00 22.62 ? 212 GLY A N   1 
ATOM   1616 C CA  . GLY A 1 212 ? 23.598  18.814 47.984 1.00 23.29 ? 212 GLY A CA  1 
ATOM   1617 C C   . GLY A 1 212 ? 24.069  18.500 49.391 1.00 24.22 ? 212 GLY A C   1 
ATOM   1618 O O   . GLY A 1 212 ? 23.297  18.613 50.352 1.00 24.48 ? 212 GLY A O   1 
ATOM   1619 N N   . GLY A 1 213 ? 25.337  18.120 49.523 1.00 23.31 ? 213 GLY A N   1 
ATOM   1620 C CA  . GLY A 1 213 ? 25.863  17.785 50.834 1.00 23.08 ? 213 GLY A CA  1 
ATOM   1621 C C   . GLY A 1 213 ? 27.107  18.533 51.273 1.00 23.17 ? 213 GLY A C   1 
ATOM   1622 O O   . GLY A 1 213 ? 27.862  18.028 52.097 1.00 23.09 ? 213 GLY A O   1 
ATOM   1623 N N   . THR A 1 214 ? 27.334  19.730 50.741 1.00 23.87 ? 214 THR A N   1 
ATOM   1624 C CA  . THR A 1 214 ? 28.517  20.500 51.121 1.00 25.15 ? 214 THR A CA  1 
ATOM   1625 C C   . THR A 1 214 ? 28.376  21.022 52.545 1.00 26.04 ? 214 THR A C   1 
ATOM   1626 O O   . THR A 1 214 ? 27.264  21.189 53.041 1.00 27.26 ? 214 THR A O   1 
ATOM   1627 C CB  . THR A 1 214 ? 28.754  21.696 50.165 1.00 25.99 ? 214 THR A CB  1 
ATOM   1628 O OG1 . THR A 1 214 ? 27.634  22.592 50.212 1.00 25.52 ? 214 THR A OG1 1 
ATOM   1629 C CG2 . THR A 1 214 ? 28.947  21.199 48.736 1.00 25.46 ? 214 THR A CG2 1 
ATOM   1630 N N   . VAL A 1 215 ? 29.501  21.273 53.206 1.00 25.35 ? 215 VAL A N   1 
ATOM   1631 C CA  . VAL A 1 215 ? 29.461  21.772 54.575 1.00 24.93 ? 215 VAL A CA  1 
ATOM   1632 C C   . VAL A 1 215 ? 28.836  23.167 54.651 1.00 25.50 ? 215 VAL A C   1 
ATOM   1633 O O   . VAL A 1 215 ? 29.144  24.052 53.844 1.00 24.73 ? 215 VAL A O   1 
ATOM   1634 C CB  . VAL A 1 215 ? 30.887  21.785 55.218 1.00 24.33 ? 215 VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 215 ? 31.946  21.880 54.143 1.00 22.85 ? 215 VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 215 ? 31.017  22.958 56.196 1.00 21.63 ? 215 VAL A CG2 1 
ATOM   1637 N N   . ASP A 1 216 ? 27.951  23.347 55.628 1.00 25.61 ? 216 ASP A N   1 
ATOM   1638 C CA  . ASP A 1 216 ? 27.259  24.615 55.835 1.00 27.39 ? 216 ASP A CA  1 
ATOM   1639 C C   . ASP A 1 216 ? 26.463  25.011 54.606 1.00 27.68 ? 216 ASP A C   1 
ATOM   1640 O O   . ASP A 1 216 ? 25.994  26.146 54.493 1.00 26.86 ? 216 ASP A O   1 
ATOM   1641 C CB  . ASP A 1 216 ? 28.254  25.722 56.170 1.00 28.83 ? 216 ASP A CB  1 
ATOM   1642 C CG  . ASP A 1 216 ? 28.946  25.490 57.489 1.00 30.22 ? 216 ASP A CG  1 
ATOM   1643 O OD1 . ASP A 1 216 ? 28.561  24.522 58.180 1.00 30.77 ? 216 ASP A OD1 1 
ATOM   1644 O OD2 . ASP A 1 216 ? 29.864  26.271 57.832 1.00 30.27 ? 216 ASP A OD2 1 
ATOM   1645 N N   . GLY A 1 217 ? 26.318  24.065 53.684 1.00 26.43 ? 217 GLY A N   1 
ATOM   1646 C CA  . GLY A 1 217 ? 25.576  24.334 52.475 1.00 24.60 ? 217 GLY A CA  1 
ATOM   1647 C C   . GLY A 1 217 ? 26.253  25.364 51.603 1.00 24.06 ? 217 GLY A C   1 
ATOM   1648 O O   . GLY A 1 217 ? 25.590  26.060 50.833 1.00 25.76 ? 217 GLY A O   1 
ATOM   1649 N N   . ILE A 1 218 ? 27.569  25.486 51.721 1.00 23.49 ? 218 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 218 ? 28.285  26.445 50.891 1.00 21.97 ? 218 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 218 ? 28.305  25.853 49.488 1.00 22.20 ? 218 ILE A C   1 
ATOM   1652 O O   . ILE A 1 218 ? 28.735  24.714 49.284 1.00 22.46 ? 218 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 218 ? 29.717  26.653 51.382 1.00 20.93 ? 218 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 218 ? 29.697  27.109 52.844 1.00 20.37 ? 218 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 218 ? 30.415  27.680 50.513 1.00 19.91 ? 218 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 218 ? 31.068  27.182 53.473 1.00 18.33 ? 218 ILE A CD1 1 
ATOM   1657 N N   . ASN A 1 219 ? 27.822  26.621 48.524 1.00 21.73 ? 219 ASN A N   1 
ATOM   1658 C CA  . ASN A 1 219 ? 27.760  26.159 47.146 1.00 22.17 ? 219 ASN A CA  1 
ATOM   1659 C C   . ASN A 1 219 ? 29.119  25.795 46.552 1.00 21.98 ? 219 ASN A C   1 
ATOM   1660 O O   . ASN A 1 219 ? 30.129  26.445 46.827 1.00 20.94 ? 219 ASN A O   1 
ATOM   1661 C CB  . ASN A 1 219 ? 27.102  27.225 46.272 1.00 21.95 ? 219 ASN A CB  1 
ATOM   1662 C CG  . ASN A 1 219 ? 26.794  26.717 44.884 1.00 23.45 ? 219 ASN A CG  1 
ATOM   1663 O OD1 . ASN A 1 219 ? 26.804  27.482 43.915 1.00 24.83 ? 219 ASN A OD1 1 
ATOM   1664 N ND2 . ASN A 1 219 ? 26.504  25.420 44.776 1.00 21.03 ? 219 ASN A ND2 1 
ATOM   1665 N N   . GLU A 1 220 ? 29.131  24.741 45.741 1.00 23.00 ? 220 GLU A N   1 
ATOM   1666 C CA  . GLU A 1 220 ? 30.346  24.282 45.072 1.00 24.76 ? 220 GLU A CA  1 
ATOM   1667 C C   . GLU A 1 220 ? 31.463  23.853 46.018 1.00 26.11 ? 220 GLU A C   1 
ATOM   1668 O O   . GLU A 1 220 ? 32.575  23.567 45.570 1.00 27.45 ? 220 GLU A O   1 
ATOM   1669 C CB  . GLU A 1 220 ? 30.882  25.395 44.162 1.00 23.81 ? 220 GLU A CB  1 
ATOM   1670 C CG  . GLU A 1 220 ? 29.913  25.855 43.090 1.00 23.88 ? 220 GLU A CG  1 
ATOM   1671 C CD  . GLU A 1 220 ? 30.522  26.870 42.132 1.00 24.72 ? 220 GLU A CD  1 
ATOM   1672 O OE1 . GLU A 1 220 ? 31.768  26.928 42.011 1.00 23.63 ? 220 GLU A OE1 1 
ATOM   1673 O OE2 . GLU A 1 220 ? 29.748  27.600 41.481 1.00 24.55 ? 220 GLU A OE2 1 
ATOM   1674 N N   . ASN A 1 221 ? 31.177  23.791 47.316 1.00 27.49 ? 221 ASN A N   1 
ATOM   1675 C CA  . ASN A 1 221 ? 32.208  23.454 48.292 1.00 27.28 ? 221 ASN A CA  1 
ATOM   1676 C C   . ASN A 1 221 ? 32.519  21.966 48.486 1.00 27.95 ? 221 ASN A C   1 
ATOM   1677 O O   . ASN A 1 221 ? 32.341  21.153 47.575 1.00 28.21 ? 221 ASN A O   1 
ATOM   1678 C CB  . ASN A 1 221 ? 31.875  24.115 49.636 1.00 27.80 ? 221 ASN A CB  1 
ATOM   1679 C CG  . ASN A 1 221 ? 33.122  24.546 50.403 1.00 29.28 ? 221 ASN A CG  1 
ATOM   1680 O OD1 . ASN A 1 221 ? 33.418  23.996 51.463 1.00 29.64 ? 221 ASN A OD1 1 
ATOM   1681 N ND2 . ASN A 1 221 ? 33.847  25.525 49.859 1.00 30.38 ? 221 ASN A ND2 1 
ATOM   1682 N N   . ASN A 1 222 ? 32.992  21.622 49.680 1.00 28.30 ? 222 ASN A N   1 
ATOM   1683 C CA  . ASN A 1 222 ? 33.388  20.255 49.998 1.00 28.17 ? 222 ASN A CA  1 
ATOM   1684 C C   . ASN A 1 222 ? 32.311  19.447 50.727 1.00 27.89 ? 222 ASN A C   1 
ATOM   1685 O O   . ASN A 1 222 ? 31.679  19.935 51.663 1.00 28.14 ? 222 ASN A O   1 
ATOM   1686 C CB  . ASN A 1 222 ? 34.688  20.317 50.820 1.00 29.76 ? 222 ASN A CB  1 
ATOM   1687 C CG  . ASN A 1 222 ? 35.331  18.951 51.044 1.00 32.09 ? 222 ASN A CG  1 
ATOM   1688 O OD1 . ASN A 1 222 ? 35.162  18.021 50.252 1.00 33.46 ? 222 ASN A OD1 1 
ATOM   1689 N ND2 . ASN A 1 222 ? 36.100  18.839 52.124 1.00 32.69 ? 222 ASN A ND2 1 
ATOM   1690 N N   . THR A 1 223 ? 32.093  18.218 50.268 1.00 26.30 ? 223 THR A N   1 
ATOM   1691 C CA  . THR A 1 223 ? 31.120  17.321 50.883 1.00 27.41 ? 223 THR A CA  1 
ATOM   1692 C C   . THR A 1 223 ? 31.913  16.296 51.688 1.00 29.26 ? 223 THR A C   1 
ATOM   1693 O O   . THR A 1 223 ? 32.566  15.419 51.116 1.00 29.41 ? 223 THR A O   1 
ATOM   1694 C CB  . THR A 1 223 ? 30.290  16.556 49.835 1.00 25.87 ? 223 THR A CB  1 
ATOM   1695 O OG1 . THR A 1 223 ? 29.547  17.484 49.047 1.00 27.69 ? 223 THR A OG1 1 
ATOM   1696 C CG2 . THR A 1 223 ? 29.320  15.603 50.509 1.00 22.68 ? 223 THR A CG2 1 
ATOM   1697 N N   . ILE A 1 224 ? 31.851  16.411 53.011 1.00 29.30 ? 224 ILE A N   1 
ATOM   1698 C CA  . ILE A 1 224 ? 32.579  15.509 53.889 1.00 30.01 ? 224 ILE A CA  1 
ATOM   1699 C C   . ILE A 1 224 ? 31.673  14.413 54.448 1.00 31.50 ? 224 ILE A C   1 
ATOM   1700 O O   . ILE A 1 224 ? 30.868  14.653 55.347 1.00 32.93 ? 224 ILE A O   1 
ATOM   1701 C CB  . ILE A 1 224 ? 33.223  16.303 55.039 1.00 28.80 ? 224 ILE A CB  1 
ATOM   1702 C CG1 . ILE A 1 224 ? 34.158  17.369 54.456 1.00 27.39 ? 224 ILE A CG1 1 
ATOM   1703 C CG2 . ILE A 1 224 ? 33.975  15.370 55.962 1.00 28.10 ? 224 ILE A CG2 1 
ATOM   1704 C CD1 . ILE A 1 224 ? 34.797  18.269 55.487 1.00 24.66 ? 224 ILE A CD1 1 
ATOM   1705 N N   . ILE A 1 225 ? 31.820  13.205 53.916 1.00 30.83 ? 225 ILE A N   1 
ATOM   1706 C CA  . ILE A 1 225 ? 31.003  12.083 54.346 1.00 30.72 ? 225 ILE A CA  1 
ATOM   1707 C C   . ILE A 1 225 ? 31.687  10.793 53.907 1.00 32.80 ? 225 ILE A C   1 
ATOM   1708 O O   . ILE A 1 225 ? 32.309  10.751 52.844 1.00 32.63 ? 225 ILE A O   1 
ATOM   1709 C CB  . ILE A 1 225 ? 29.607  12.172 53.705 1.00 29.34 ? 225 ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 225 ? 28.684  11.103 54.284 1.00 29.31 ? 225 ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 225 ? 29.720  12.001 52.199 1.00 27.66 ? 225 ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 225 ? 27.237  11.252 53.836 1.00 26.80 ? 225 ILE A CD1 1 
ATOM   1713 N N   . ASN A 1 226 ? 31.591  9.744  54.722 1.00 33.90 ? 226 ASN A N   1 
ATOM   1714 C CA  . ASN A 1 226 ? 32.223  8.483  54.357 1.00 34.77 ? 226 ASN A CA  1 
ATOM   1715 C C   . ASN A 1 226 ? 31.536  7.937  53.118 1.00 34.71 ? 226 ASN A C   1 
ATOM   1716 O O   . ASN A 1 226 ? 30.478  8.423  52.731 1.00 34.89 ? 226 ASN A O   1 
ATOM   1717 C CB  . ASN A 1 226 ? 32.143  7.466  55.500 1.00 36.17 ? 226 ASN A CB  1 
ATOM   1718 C CG  . ASN A 1 226 ? 30.719  7.144  55.908 1.00 38.75 ? 226 ASN A CG  1 
ATOM   1719 O OD1 . ASN A 1 226 ? 29.869  6.836  55.070 1.00 40.21 ? 226 ASN A OD1 1 
ATOM   1720 N ND2 . ASN A 1 226 ? 30.456  7.197  57.207 1.00 40.55 ? 226 ASN A ND2 1 
ATOM   1721 N N   . ARG A 1 227 ? 32.134  6.929  52.497 1.00 35.45 ? 227 ARG A N   1 
ATOM   1722 C CA  . ARG A 1 227 ? 31.560  6.349  51.292 1.00 37.64 ? 227 ARG A CA  1 
ATOM   1723 C C   . ARG A 1 227 ? 30.188  5.723  51.523 1.00 39.09 ? 227 ARG A C   1 
ATOM   1724 O O   . ARG A 1 227 ? 29.374  5.641  50.602 1.00 38.86 ? 227 ARG A O   1 
ATOM   1725 C CB  . ARG A 1 227 ? 32.511  5.309  50.709 1.00 37.62 ? 227 ARG A CB  1 
ATOM   1726 C CG  . ARG A 1 227 ? 31.994  4.651  49.451 1.00 38.92 ? 227 ARG A CG  1 
ATOM   1727 C CD  . ARG A 1 227 ? 33.028  3.716  48.867 1.00 40.20 ? 227 ARG A CD  1 
ATOM   1728 N NE  . ARG A 1 227 ? 32.406  2.739  47.982 1.00 42.25 ? 227 ARG A NE  1 
ATOM   1729 C CZ  . ARG A 1 227 ? 32.505  2.753  46.660 1.00 43.88 ? 227 ARG A CZ  1 
ATOM   1730 N NH1 . ARG A 1 227 ? 33.213  3.703  46.053 1.00 44.21 ? 227 ARG A NH1 1 
ATOM   1731 N NH2 . ARG A 1 227 ? 31.892  1.812  45.948 1.00 43.55 ? 227 ARG A NH2 1 
ATOM   1732 N N   . GLU A 1 228 ? 29.933  5.277  52.749 1.00 41.15 ? 228 GLU A N   1 
ATOM   1733 C CA  . GLU A 1 228 ? 28.651  4.665  53.077 1.00 42.82 ? 228 GLU A CA  1 
ATOM   1734 C C   . GLU A 1 228 ? 27.547  5.702  52.907 1.00 41.22 ? 228 GLU A C   1 
ATOM   1735 O O   . GLU A 1 228 ? 26.524  5.439  52.283 1.00 39.89 ? 228 GLU A O   1 
ATOM   1736 C CB  . GLU A 1 228 ? 28.653  4.157  54.523 1.00 47.50 ? 228 GLU A CB  1 
ATOM   1737 C CG  . GLU A 1 228 ? 29.799  3.193  54.872 1.00 56.87 ? 228 GLU A CG  1 
ATOM   1738 C CD  . GLU A 1 228 ? 29.623  1.789  54.280 1.00 60.62 ? 228 GLU A CD  1 
ATOM   1739 O OE1 . GLU A 1 228 ? 28.577  1.151  54.556 1.00 62.92 ? 228 GLU A OE1 1 
ATOM   1740 O OE2 . GLU A 1 228 ? 30.534  1.325  53.550 1.00 61.17 ? 228 GLU A OE2 1 
ATOM   1741 N N   . GLY A 1 229 ? 27.774  6.888  53.460 1.00 39.95 ? 229 GLY A N   1 
ATOM   1742 C CA  . GLY A 1 229 ? 26.792  7.952  53.373 1.00 38.95 ? 229 GLY A CA  1 
ATOM   1743 C C   . GLY A 1 229 ? 26.617  8.529  51.982 1.00 38.14 ? 229 GLY A C   1 
ATOM   1744 O O   . GLY A 1 229 ? 25.502  8.855  51.575 1.00 39.39 ? 229 GLY A O   1 
ATOM   1745 N N   . LEU A 1 230 ? 27.715  8.671  51.253 1.00 36.18 ? 230 LEU A N   1 
ATOM   1746 C CA  . LEU A 1 230 ? 27.657  9.208  49.902 1.00 34.87 ? 230 LEU A CA  1 
ATOM   1747 C C   . LEU A 1 230 ? 26.729  8.316  49.073 1.00 34.88 ? 230 LEU A C   1 
ATOM   1748 O O   . LEU A 1 230 ? 25.915  8.803  48.283 1.00 34.88 ? 230 LEU A O   1 
ATOM   1749 C CB  . LEU A 1 230 ? 29.073  9.233  49.302 1.00 33.51 ? 230 LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 230 ? 29.406  9.898  47.959 1.00 31.86 ? 230 LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 230 ? 28.877  9.060  46.821 1.00 30.98 ? 230 LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 230 ? 28.845  11.311 47.922 1.00 30.94 ? 230 LEU A CD2 1 
ATOM   1753 N N   . MET A 1 231 ? 26.841  7.008  49.293 1.00 33.71 ? 231 MET A N   1 
ATOM   1754 C CA  . MET A 1 231 ? 26.056  6.010  48.570 1.00 32.46 ? 231 MET A CA  1 
ATOM   1755 C C   . MET A 1 231 ? 24.650  5.785  49.114 1.00 31.74 ? 231 MET A C   1 
ATOM   1756 O O   . MET A 1 231 ? 23.752  5.372  48.380 1.00 30.69 ? 231 MET A O   1 
ATOM   1757 C CB  . MET A 1 231 ? 26.810  4.683  48.573 1.00 32.85 ? 231 MET A CB  1 
ATOM   1758 C CG  . MET A 1 231 ? 28.197  4.781  47.994 1.00 34.95 ? 231 MET A CG  1 
ATOM   1759 S SD  . MET A 1 231 ? 28.160  5.060  46.226 1.00 35.95 ? 231 MET A SD  1 
ATOM   1760 C CE  . MET A 1 231 ? 28.473  3.433  45.675 1.00 37.13 ? 231 MET A CE  1 
ATOM   1761 N N   . ASN A 1 232 ? 24.470  6.049  50.402 1.00 32.05 ? 232 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 232 ? 23.185  5.872  51.067 1.00 31.78 ? 232 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 232 ? 22.255  7.070  50.854 1.00 30.03 ? 232 ASN A C   1 
ATOM   1764 O O   . ASN A 1 232 ? 21.032  6.909  50.737 1.00 28.51 ? 232 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 232 ? 23.421  5.649  52.569 1.00 36.02 ? 232 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 232 ? 22.128  5.595  53.374 1.00 40.95 ? 232 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 232 ? 21.246  4.769  53.108 1.00 43.85 ? 232 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 232 ? 22.012  6.476  54.372 1.00 40.74 ? 232 ASN A ND2 1 
ATOM   1769 N N   . ILE A 1 233 ? 22.848  8.260  50.781 1.00 27.47 ? 233 ILE A N   1 
ATOM   1770 C CA  . ILE A 1 233 ? 22.098  9.503  50.621 1.00 25.15 ? 233 ILE A CA  1 
ATOM   1771 C C   . ILE A 1 233 ? 22.128  10.168 49.245 1.00 24.90 ? 233 ILE A C   1 
ATOM   1772 O O   . ILE A 1 233 ? 21.085  10.423 48.654 1.00 25.64 ? 233 ILE A O   1 
ATOM   1773 C CB  . ILE A 1 233 ? 22.582  10.566 51.640 1.00 23.34 ? 233 ILE A CB  1 
ATOM   1774 C CG1 . ILE A 1 233 ? 22.491  10.019 53.068 1.00 21.30 ? 233 ILE A CG1 1 
ATOM   1775 C CG2 . ILE A 1 233 ? 21.748  11.831 51.511 1.00 22.05 ? 233 ILE A CG2 1 
ATOM   1776 C CD1 . ILE A 1 233 ? 23.176  10.903 54.098 1.00 17.05 ? 233 ILE A CD1 1 
ATOM   1777 N N   . HIS A 1 234 ? 23.320  10.449 48.733 1.00 24.01 ? 234 HIS A N   1 
ATOM   1778 C CA  . HIS A 1 234 ? 23.435  11.156 47.463 1.00 24.08 ? 234 HIS A CA  1 
ATOM   1779 C C   . HIS A 1 234 ? 23.461  10.359 46.165 1.00 24.42 ? 234 HIS A C   1 
ATOM   1780 O O   . HIS A 1 234 ? 23.203  10.914 45.099 1.00 24.18 ? 234 HIS A O   1 
ATOM   1781 C CB  . HIS A 1 234 ? 24.665  12.061 47.502 1.00 22.60 ? 234 HIS A CB  1 
ATOM   1782 C CG  . HIS A 1 234 ? 24.713  12.959 48.696 1.00 22.58 ? 234 HIS A CG  1 
ATOM   1783 N ND1 . HIS A 1 234 ? 25.589  12.760 49.742 1.00 22.88 ? 234 HIS A ND1 1 
ATOM   1784 C CD2 . HIS A 1 234 ? 23.978  14.049 49.023 1.00 23.02 ? 234 HIS A CD2 1 
ATOM   1785 C CE1 . HIS A 1 234 ? 25.393  13.689 50.661 1.00 22.79 ? 234 HIS A CE1 1 
ATOM   1786 N NE2 . HIS A 1 234 ? 24.421  14.484 50.249 1.00 23.32 ? 234 HIS A NE2 1 
ATOM   1787 N N   . MET A 1 235 ? 23.756  9.070  46.243 1.00 25.03 ? 235 MET A N   1 
ATOM   1788 C CA  . MET A 1 235 ? 23.855  8.252  45.038 1.00 25.32 ? 235 MET A CA  1 
ATOM   1789 C C   . MET A 1 235 ? 22.580  7.573  44.527 1.00 25.11 ? 235 MET A C   1 
ATOM   1790 O O   . MET A 1 235 ? 22.366  7.498  43.321 1.00 28.06 ? 235 MET A O   1 
ATOM   1791 C CB  . MET A 1 235 ? 24.947  7.191  45.238 1.00 24.13 ? 235 MET A CB  1 
ATOM   1792 C CG  . MET A 1 235 ? 25.366  6.435  43.982 1.00 23.64 ? 235 MET A CG  1 
ATOM   1793 S SD  . MET A 1 235 ? 26.184  7.467  42.741 1.00 24.69 ? 235 MET A SD  1 
ATOM   1794 C CE  . MET A 1 235 ? 27.785  7.711  43.497 1.00 22.52 ? 235 MET A CE  1 
ATOM   1795 N N   . PRO A 1 236 ? 21.711  7.087  45.428 1.00 24.35 ? 236 PRO A N   1 
ATOM   1796 C CA  . PRO A 1 236 ? 20.478  6.412  45.002 1.00 23.43 ? 236 PRO A CA  1 
ATOM   1797 C C   . PRO A 1 236 ? 19.753  6.888  43.738 1.00 24.28 ? 236 PRO A C   1 
ATOM   1798 O O   . PRO A 1 236 ? 19.648  6.136  42.770 1.00 24.83 ? 236 PRO A O   1 
ATOM   1799 C CB  . PRO A 1 236 ? 19.609  6.487  46.249 1.00 21.91 ? 236 PRO A CB  1 
ATOM   1800 C CG  . PRO A 1 236 ? 20.634  6.298  47.341 1.00 21.56 ? 236 PRO A CG  1 
ATOM   1801 C CD  . PRO A 1 236 ? 21.744  7.231  46.898 1.00 22.61 ? 236 PRO A CD  1 
ATOM   1802 N N   . ALA A 1 237 ? 19.250  8.120  43.742 1.00 25.32 ? 237 ALA A N   1 
ATOM   1803 C CA  . ALA A 1 237 ? 18.516  8.659  42.593 1.00 25.32 ? 237 ALA A CA  1 
ATOM   1804 C C   . ALA A 1 237 ? 19.191  8.419  41.236 1.00 24.71 ? 237 ALA A C   1 
ATOM   1805 O O   . ALA A 1 237 ? 18.508  8.222  40.220 1.00 23.58 ? 237 ALA A O   1 
ATOM   1806 C CB  . ALA A 1 237 ? 18.259  10.162 42.794 1.00 27.65 ? 237 ALA A CB  1 
ATOM   1807 N N   . TYR A 1 238 ? 20.522  8.447  41.218 1.00 22.50 ? 238 TYR A N   1 
ATOM   1808 C CA  . TYR A 1 238 ? 21.272  8.223  39.988 1.00 22.43 ? 238 TYR A CA  1 
ATOM   1809 C C   . TYR A 1 238 ? 21.017  6.828  39.433 1.00 24.00 ? 238 TYR A C   1 
ATOM   1810 O O   . TYR A 1 238 ? 20.941  6.629  38.218 1.00 23.62 ? 238 TYR A O   1 
ATOM   1811 C CB  . TYR A 1 238 ? 22.766  8.433  40.240 1.00 20.60 ? 238 TYR A CB  1 
ATOM   1812 C CG  . TYR A 1 238 ? 23.144  9.892  40.218 1.00 18.89 ? 238 TYR A CG  1 
ATOM   1813 C CD1 . TYR A 1 238 ? 23.236  10.583 39.008 1.00 17.45 ? 238 TYR A CD1 1 
ATOM   1814 C CD2 . TYR A 1 238 ? 23.316  10.607 41.406 1.00 16.70 ? 238 TYR A CD2 1 
ATOM   1815 C CE1 . TYR A 1 238 ? 23.480  11.951 38.980 1.00 18.31 ? 238 TYR A CE1 1 
ATOM   1816 C CE2 . TYR A 1 238 ? 23.560  11.974 41.393 1.00 16.50 ? 238 TYR A CE2 1 
ATOM   1817 C CZ  . TYR A 1 238 ? 23.638  12.643 40.178 1.00 18.21 ? 238 TYR A CZ  1 
ATOM   1818 O OH  . TYR A 1 238 ? 23.841  14.002 40.155 1.00 17.53 ? 238 TYR A OH  1 
ATOM   1819 N N   . LYS A 1 239 ? 20.880  5.861  40.330 1.00 25.06 ? 239 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 239 ? 20.614  4.497  39.919 1.00 26.94 ? 239 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 239 ? 19.237  4.459  39.257 1.00 26.52 ? 239 LYS A C   1 
ATOM   1822 O O   . LYS A 1 239 ? 19.022  3.725  38.291 1.00 27.39 ? 239 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 239 ? 20.666  3.568  41.135 1.00 29.64 ? 239 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 239 ? 20.192  2.148  40.861 1.00 33.28 ? 239 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 239 ? 21.040  1.448  39.812 1.00 35.16 ? 239 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 239 ? 20.505  0.049  39.542 1.00 36.03 ? 239 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 239 ? 21.402  -0.693 38.624 1.00 36.65 ? 239 LYS A NZ  1 
ATOM   1828 N N   . ASN A 1 240 ? 18.307  5.259  39.774 1.00 25.98 ? 240 ASN A N   1 
ATOM   1829 C CA  . ASN A 1 240 ? 16.961  5.323  39.207 1.00 25.52 ? 240 ASN A CA  1 
ATOM   1830 C C   . ASN A 1 240 ? 17.025  5.963  37.822 1.00 25.39 ? 240 ASN A C   1 
ATOM   1831 O O   . ASN A 1 240 ? 16.343  5.526  36.890 1.00 23.55 ? 240 ASN A O   1 
ATOM   1832 C CB  . ASN A 1 240 ? 16.031  6.148  40.100 1.00 26.00 ? 240 ASN A CB  1 
ATOM   1833 C CG  . ASN A 1 240 ? 15.942  5.607  41.517 1.00 27.76 ? 240 ASN A CG  1 
ATOM   1834 O OD1 . ASN A 1 240 ? 16.850  5.798  42.329 1.00 30.86 ? 240 ASN A OD1 1 
ATOM   1835 N ND2 . ASN A 1 240 ? 14.846  4.927  41.821 1.00 27.21 ? 240 ASN A ND2 1 
ATOM   1836 N N   . ALA A 1 241 ? 17.845  7.008  37.701 1.00 24.95 ? 241 ALA A N   1 
ATOM   1837 C CA  . ALA A 1 241 ? 18.021  7.708  36.436 1.00 23.69 ? 241 ALA A CA  1 
ATOM   1838 C C   . ALA A 1 241 ? 18.579  6.734  35.405 1.00 24.19 ? 241 ALA A C   1 
ATOM   1839 O O   . ALA A 1 241 ? 18.249  6.809  34.219 1.00 25.04 ? 241 ALA A O   1 
ATOM   1840 C CB  . ALA A 1 241 ? 18.966  8.882  36.616 1.00 24.35 ? 241 ALA A CB  1 
ATOM   1841 N N   . MET A 1 242 ? 19.435  5.824  35.857 1.00 23.32 ? 242 MET A N   1 
ATOM   1842 C CA  . MET A 1 242 ? 20.008  4.825  34.967 1.00 23.18 ? 242 MET A CA  1 
ATOM   1843 C C   . MET A 1 242 ? 18.884  3.912  34.470 1.00 22.95 ? 242 MET A C   1 
ATOM   1844 O O   . MET A 1 242 ? 18.769  3.661  33.272 1.00 23.34 ? 242 MET A O   1 
ATOM   1845 C CB  . MET A 1 242 ? 21.051  3.993  35.704 1.00 25.07 ? 242 MET A CB  1 
ATOM   1846 C CG  . MET A 1 242 ? 22.233  4.779  36.244 1.00 27.16 ? 242 MET A CG  1 
ATOM   1847 S SD  . MET A 1 242 ? 23.307  5.411  34.956 1.00 28.56 ? 242 MET A SD  1 
ATOM   1848 C CE  . MET A 1 242 ? 22.975  7.137  35.045 1.00 29.31 ? 242 MET A CE  1 
ATOM   1849 N N   . ASP A 1 243 ? 18.057  3.422  35.395 1.00 22.38 ? 243 ASP A N   1 
ATOM   1850 C CA  . ASP A 1 243 ? 16.932  2.547  35.048 1.00 21.49 ? 243 ASP A CA  1 
ATOM   1851 C C   . ASP A 1 243 ? 15.941  3.225  34.113 1.00 20.96 ? 243 ASP A C   1 
ATOM   1852 O O   . ASP A 1 243 ? 15.241  2.560  33.349 1.00 20.54 ? 243 ASP A O   1 
ATOM   1853 C CB  . ASP A 1 243 ? 16.140  2.123  36.287 1.00 21.24 ? 243 ASP A CB  1 
ATOM   1854 C CG  . ASP A 1 243 ? 16.952  1.330  37.269 1.00 21.32 ? 243 ASP A CG  1 
ATOM   1855 O OD1 . ASP A 1 243 ? 17.983  0.742  36.876 1.00 22.99 ? 243 ASP A OD1 1 
ATOM   1856 O OD2 . ASP A 1 243 ? 16.536  1.283  38.444 1.00 23.10 ? 243 ASP A OD2 1 
ATOM   1857 N N   . LYS A 1 244 ? 15.853  4.548  34.194 1.00 20.35 ? 244 LYS A N   1 
ATOM   1858 C CA  . LYS A 1 244 ? 14.916  5.265  33.351 1.00 19.32 ? 244 LYS A CA  1 
ATOM   1859 C C   . LYS A 1 244 ? 15.557  5.861  32.105 1.00 19.39 ? 244 LYS A C   1 
ATOM   1860 O O   . LYS A 1 244 ? 14.938  6.642  31.378 1.00 20.85 ? 244 LYS A O   1 
ATOM   1861 C CB  . LYS A 1 244 ? 14.195  6.310  34.190 1.00 17.33 ? 244 LYS A CB  1 
ATOM   1862 C CG  . LYS A 1 244 ? 13.366  5.653  35.266 1.00 17.14 ? 244 LYS A CG  1 
ATOM   1863 C CD  . LYS A 1 244 ? 12.766  6.646  36.225 1.00 21.04 ? 244 LYS A CD  1 
ATOM   1864 C CE  . LYS A 1 244 ? 12.113  5.925  37.389 1.00 22.44 ? 244 LYS A CE  1 
ATOM   1865 N NZ  . LYS A 1 244 ? 11.506  6.864  38.367 1.00 24.26 ? 244 LYS A NZ  1 
ATOM   1866 N N   . GLY A 1 245 ? 16.804  5.468  31.868 1.00 18.10 ? 245 GLY A N   1 
ATOM   1867 C CA  . GLY A 1 245 ? 17.528  5.903  30.691 1.00 17.61 ? 245 GLY A CA  1 
ATOM   1868 C C   . GLY A 1 245 ? 17.894  7.361  30.512 1.00 17.41 ? 245 GLY A C   1 
ATOM   1869 O O   . GLY A 1 245 ? 17.882  7.854  29.386 1.00 17.49 ? 245 GLY A O   1 
ATOM   1870 N N   . VAL A 1 246 ? 18.222  8.059  31.593 1.00 16.79 ? 246 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 246 ? 18.613  9.456  31.463 1.00 18.18 ? 246 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 246 ? 19.757  9.491  30.435 1.00 17.79 ? 246 VAL A C   1 
ATOM   1873 O O   . VAL A 1 246 ? 20.683  8.684  30.501 1.00 17.57 ? 246 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 246 ? 19.073  10.038 32.828 1.00 18.60 ? 246 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 246 ? 20.354  9.353  33.295 1.00 18.33 ? 246 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 246 ? 19.255  11.547 32.714 1.00 16.74 ? 246 VAL A CG2 1 
ATOM   1877 N N   . SER A 1 247 ? 19.683  10.412 29.479 1.00 17.25 ? 247 SER A N   1 
ATOM   1878 C CA  . SER A 1 247 ? 20.689  10.489 28.425 1.00 16.28 ? 247 SER A CA  1 
ATOM   1879 C C   . SER A 1 247 ? 22.048  11.030 28.830 1.00 17.32 ? 247 SER A C   1 
ATOM   1880 O O   . SER A 1 247 ? 23.073  10.584 28.311 1.00 17.79 ? 247 SER A O   1 
ATOM   1881 C CB  . SER A 1 247 ? 20.154  11.302 27.248 1.00 16.87 ? 247 SER A CB  1 
ATOM   1882 O OG  . SER A 1 247 ? 19.045  10.649 26.650 1.00 18.20 ? 247 SER A OG  1 
ATOM   1883 N N   . THR A 1 248 ? 22.074  11.986 29.748 1.00 16.87 ? 248 THR A N   1 
ATOM   1884 C CA  . THR A 1 248 ? 23.349  12.548 30.168 1.00 15.71 ? 248 THR A CA  1 
ATOM   1885 C C   . THR A 1 248 ? 23.426  12.771 31.671 1.00 16.13 ? 248 THR A C   1 
ATOM   1886 O O   . THR A 1 248 ? 22.418  12.719 32.376 1.00 14.57 ? 248 THR A O   1 
ATOM   1887 C CB  . THR A 1 248 ? 23.625  13.907 29.468 1.00 14.96 ? 248 THR A CB  1 
ATOM   1888 O OG1 . THR A 1 248 ? 22.736  14.901 29.991 1.00 14.73 ? 248 THR A OG1 1 
ATOM   1889 C CG2 . THR A 1 248 ? 23.417  13.796 27.963 1.00 10.78 ? 248 THR A CG2 1 
ATOM   1890 N N   . VAL A 1 249 ? 24.642  13.014 32.146 1.00 16.34 ? 249 VAL A N   1 
ATOM   1891 C CA  . VAL A 1 249 ? 24.891  13.288 33.555 1.00 17.02 ? 249 VAL A CA  1 
ATOM   1892 C C   . VAL A 1 249 ? 25.885  14.442 33.629 1.00 18.44 ? 249 VAL A C   1 
ATOM   1893 O O   . VAL A 1 249 ? 26.917  14.421 32.959 1.00 18.60 ? 249 VAL A O   1 
ATOM   1894 C CB  . VAL A 1 249 ? 25.512  12.076 34.284 1.00 15.49 ? 249 VAL A CB  1 
ATOM   1895 C CG1 . VAL A 1 249 ? 25.891  12.465 35.699 1.00 14.25 ? 249 VAL A CG1 1 
ATOM   1896 C CG2 . VAL A 1 249 ? 24.538  10.923 34.311 1.00 17.00 ? 249 VAL A CG2 1 
ATOM   1897 N N   . MET A 1 250 ? 25.570  15.454 34.428 1.00 19.01 ? 250 MET A N   1 
ATOM   1898 C CA  . MET A 1 250 ? 26.470  16.587 34.584 1.00 18.81 ? 250 MET A CA  1 
ATOM   1899 C C   . MET A 1 250 ? 27.252  16.408 35.887 1.00 21.00 ? 250 MET A C   1 
ATOM   1900 O O   . MET A 1 250 ? 26.691  15.997 36.909 1.00 20.96 ? 250 MET A O   1 
ATOM   1901 C CB  . MET A 1 250 ? 25.681  17.893 34.621 1.00 16.60 ? 250 MET A CB  1 
ATOM   1902 C CG  . MET A 1 250 ? 26.551  19.128 34.700 1.00 16.44 ? 250 MET A CG  1 
ATOM   1903 S SD  . MET A 1 250 ? 25.613  20.675 34.700 1.00 18.58 ? 250 MET A SD  1 
ATOM   1904 C CE  . MET A 1 250 ? 24.786  20.557 33.134 1.00 17.74 ? 250 MET A CE  1 
ATOM   1905 N N   . ILE A 1 251 ? 28.548  16.703 35.841 1.00 21.54 ? 251 ILE A N   1 
ATOM   1906 C CA  . ILE A 1 251 ? 29.408  16.583 37.014 1.00 21.70 ? 251 ILE A CA  1 
ATOM   1907 C C   . ILE A 1 251 ? 29.287  17.854 37.864 1.00 22.47 ? 251 ILE A C   1 
ATOM   1908 O O   . ILE A 1 251 ? 29.156  18.957 37.334 1.00 22.25 ? 251 ILE A O   1 
ATOM   1909 C CB  . ILE A 1 251 ? 30.894  16.376 36.595 1.00 21.94 ? 251 ILE A CB  1 
ATOM   1910 C CG1 . ILE A 1 251 ? 31.015  15.155 35.682 1.00 20.36 ? 251 ILE A CG1 1 
ATOM   1911 C CG2 . ILE A 1 251 ? 31.773  16.189 37.821 1.00 20.69 ? 251 ILE A CG2 1 
ATOM   1912 C CD1 . ILE A 1 251 ? 30.554  13.874 36.313 1.00 21.71 ? 251 ILE A CD1 1 
ATOM   1913 N N   . SER A 1 252 ? 29.337  17.690 39.183 1.00 23.09 ? 252 SER A N   1 
ATOM   1914 C CA  . SER A 1 252 ? 29.217  18.810 40.119 1.00 22.93 ? 252 SER A CA  1 
ATOM   1915 C C   . SER A 1 252 ? 30.513  19.590 40.366 1.00 22.66 ? 252 SER A C   1 
ATOM   1916 O O   . SER A 1 252 ? 31.612  19.044 40.248 1.00 23.11 ? 252 SER A O   1 
ATOM   1917 C CB  . SER A 1 252 ? 28.681  18.292 41.459 1.00 22.38 ? 252 SER A CB  1 
ATOM   1918 O OG  . SER A 1 252 ? 28.641  19.318 42.435 1.00 23.33 ? 252 SER A OG  1 
ATOM   1919 N N   . TYR A 1 253 ? 30.371  20.871 40.704 1.00 22.19 ? 253 TYR A N   1 
ATOM   1920 C CA  . TYR A 1 253 ? 31.519  21.727 41.004 1.00 23.19 ? 253 TYR A CA  1 
ATOM   1921 C C   . TYR A 1 253 ? 32.105  21.264 42.327 1.00 23.51 ? 253 TYR A C   1 
ATOM   1922 O O   . TYR A 1 253 ? 33.299  21.413 42.578 1.00 24.75 ? 253 TYR A O   1 
ATOM   1923 C CB  . TYR A 1 253 ? 31.103  23.189 41.205 1.00 22.41 ? 253 TYR A CB  1 
ATOM   1924 C CG  . TYR A 1 253 ? 30.624  23.936 39.984 1.00 23.28 ? 253 TYR A CG  1 
ATOM   1925 C CD1 . TYR A 1 253 ? 31.456  24.122 38.880 1.00 24.93 ? 253 TYR A CD1 1 
ATOM   1926 C CD2 . TYR A 1 253 ? 29.365  24.536 39.965 1.00 22.21 ? 253 TYR A CD2 1 
ATOM   1927 C CE1 . TYR A 1 253 ? 31.049  24.895 37.792 1.00 24.25 ? 253 TYR A CE1 1 
ATOM   1928 C CE2 . TYR A 1 253 ? 28.952  25.306 38.892 1.00 22.39 ? 253 TYR A CE2 1 
ATOM   1929 C CZ  . TYR A 1 253 ? 29.798  25.485 37.810 1.00 23.07 ? 253 TYR A CZ  1 
ATOM   1930 O OH  . TYR A 1 253 ? 29.402  26.276 36.761 1.00 22.21 ? 253 TYR A OH  1 
ATOM   1931 N N   . SER A 1 254 ? 31.240  20.716 43.174 1.00 23.69 ? 254 SER A N   1 
ATOM   1932 C CA  . SER A 1 254 ? 31.624  20.267 44.505 1.00 23.93 ? 254 SER A CA  1 
ATOM   1933 C C   . SER A 1 254 ? 32.729  19.227 44.568 1.00 24.37 ? 254 SER A C   1 
ATOM   1934 O O   . SER A 1 254 ? 33.127  18.640 43.560 1.00 24.48 ? 254 SER A O   1 
ATOM   1935 C CB  . SER A 1 254 ? 30.392  19.744 45.254 1.00 22.65 ? 254 SER A CB  1 
ATOM   1936 O OG  . SER A 1 254 ? 29.750  18.709 44.533 1.00 21.82 ? 254 SER A OG  1 
ATOM   1937 N N   . SER A 1 255 ? 33.222  19.011 45.781 1.00 24.93 ? 255 SER A N   1 
ATOM   1938 C CA  . SER A 1 255 ? 34.275  18.039 46.021 1.00 26.01 ? 255 SER A CA  1 
ATOM   1939 C C   . SER A 1 255 ? 33.780  17.008 47.025 1.00 26.15 ? 255 SER A C   1 
ATOM   1940 O O   . SER A 1 255 ? 32.841  17.268 47.778 1.00 26.95 ? 255 SER A O   1 
ATOM   1941 C CB  . SER A 1 255 ? 35.516  18.735 46.585 1.00 24.73 ? 255 SER A CB  1 
ATOM   1942 O OG  . SER A 1 255 ? 35.996  19.722 45.692 1.00 27.36 ? 255 SER A OG  1 
ATOM   1943 N N   . TRP A 1 256 ? 34.401  15.833 47.016 1.00 27.07 ? 256 TRP A N   1 
ATOM   1944 C CA  . TRP A 1 256 ? 34.057  14.779 47.961 1.00 27.38 ? 256 TRP A CA  1 
ATOM   1945 C C   . TRP A 1 256 ? 35.314  14.438 48.750 1.00 27.60 ? 256 TRP A C   1 
ATOM   1946 O O   . TRP A 1 256 ? 36.248  13.822 48.230 1.00 26.39 ? 256 TRP A O   1 
ATOM   1947 C CB  . TRP A 1 256 ? 33.542  13.534 47.248 1.00 27.00 ? 256 TRP A CB  1 
ATOM   1948 C CG  . TRP A 1 256 ? 33.262  12.414 48.202 1.00 28.06 ? 256 TRP A CG  1 
ATOM   1949 C CD1 . TRP A 1 256 ? 32.622  12.507 49.404 1.00 28.19 ? 256 TRP A CD1 1 
ATOM   1950 C CD2 . TRP A 1 256 ? 33.587  11.028 48.027 1.00 27.15 ? 256 TRP A CD2 1 
ATOM   1951 N NE1 . TRP A 1 256 ? 32.529  11.267 49.989 1.00 28.76 ? 256 TRP A NE1 1 
ATOM   1952 C CE2 . TRP A 1 256 ? 33.111  10.341 49.166 1.00 27.85 ? 256 TRP A CE2 1 
ATOM   1953 C CE3 . TRP A 1 256 ? 34.232  10.301 47.019 1.00 27.13 ? 256 TRP A CE3 1 
ATOM   1954 C CZ2 . TRP A 1 256 ? 33.260  8.956  49.327 1.00 28.89 ? 256 TRP A CZ2 1 
ATOM   1955 C CZ3 . TRP A 1 256 ? 34.380  8.921  47.176 1.00 28.54 ? 256 TRP A CZ3 1 
ATOM   1956 C CH2 . TRP A 1 256 ? 33.895  8.265  48.324 1.00 28.90 ? 256 TRP A CH2 1 
ATOM   1957 N N   . ASN A 1 257 ? 35.330  14.855 50.010 1.00 27.12 ? 257 ASN A N   1 
ATOM   1958 C CA  . ASN A 1 257 ? 36.471  14.620 50.874 1.00 27.46 ? 257 ASN A CA  1 
ATOM   1959 C C   . ASN A 1 257 ? 37.735  15.227 50.276 1.00 28.18 ? 257 ASN A C   1 
ATOM   1960 O O   . ASN A 1 257 ? 38.790  14.595 50.264 1.00 28.08 ? 257 ASN A O   1 
ATOM   1961 C CB  . ASN A 1 257 ? 36.666  13.123 51.111 1.00 26.70 ? 257 ASN A CB  1 
ATOM   1962 C CG  . ASN A 1 257 ? 35.539  12.515 51.921 1.00 28.89 ? 257 ASN A CG  1 
ATOM   1963 O OD1 . ASN A 1 257 ? 35.100  13.093 52.917 1.00 29.15 ? 257 ASN A OD1 1 
ATOM   1964 N ND2 . ASN A 1 257 ? 35.070  11.341 51.506 1.00 27.98 ? 257 ASN A ND2 1 
ATOM   1965 N N   . GLY A 1 258 ? 37.615  16.455 49.771 1.00 27.68 ? 258 GLY A N   1 
ATOM   1966 C CA  . GLY A 1 258 ? 38.760  17.144 49.201 1.00 25.80 ? 258 GLY A CA  1 
ATOM   1967 C C   . GLY A 1 258 ? 39.084  16.902 47.734 1.00 25.72 ? 258 GLY A C   1 
ATOM   1968 O O   . GLY A 1 258 ? 39.935  17.596 47.175 1.00 24.56 ? 258 GLY A O   1 
ATOM   1969 N N   . VAL A 1 259 ? 38.426  15.931 47.105 1.00 24.14 ? 259 VAL A N   1 
ATOM   1970 C CA  . VAL A 1 259 ? 38.683  15.640 45.696 1.00 24.19 ? 259 VAL A CA  1 
ATOM   1971 C C   . VAL A 1 259 ? 37.602  16.254 44.797 1.00 25.15 ? 259 VAL A C   1 
ATOM   1972 O O   . VAL A 1 259 ? 36.411  16.009 44.990 1.00 26.48 ? 259 VAL A O   1 
ATOM   1973 C CB  . VAL A 1 259 ? 38.743  14.101 45.437 1.00 24.33 ? 259 VAL A CB  1 
ATOM   1974 C CG1 . VAL A 1 259 ? 39.005  13.823 43.964 1.00 18.26 ? 259 VAL A CG1 1 
ATOM   1975 C CG2 . VAL A 1 259 ? 39.824  13.465 46.303 1.00 20.21 ? 259 VAL A CG2 1 
ATOM   1976 N N   . LYS A 1 260 ? 38.023  17.056 43.821 1.00 24.35 ? 260 LYS A N   1 
ATOM   1977 C CA  . LYS A 1 260 ? 37.092  17.696 42.895 1.00 22.31 ? 260 LYS A CA  1 
ATOM   1978 C C   . LYS A 1 260 ? 36.378  16.643 42.055 1.00 23.13 ? 260 LYS A C   1 
ATOM   1979 O O   . LYS A 1 260 ? 37.023  15.767 41.479 1.00 23.25 ? 260 LYS A O   1 
ATOM   1980 C CB  . LYS A 1 260 ? 37.842  18.648 41.958 1.00 20.55 ? 260 LYS A CB  1 
ATOM   1981 C CG  . LYS A 1 260 ? 38.425  19.893 42.613 1.00 18.69 ? 260 LYS A CG  1 
ATOM   1982 C CD  . LYS A 1 260 ? 37.340  20.865 43.027 1.00 18.46 ? 260 LYS A CD  1 
ATOM   1983 C CE  . LYS A 1 260 ? 37.922  22.199 43.471 1.00 17.17 ? 260 LYS A CE  1 
ATOM   1984 N NZ  . LYS A 1 260 ? 36.847  23.173 43.815 1.00 14.34 ? 260 LYS A NZ  1 
ATOM   1985 N N   . MET A 1 261 ? 35.052  16.728 41.978 1.00 22.23 ? 261 MET A N   1 
ATOM   1986 C CA  . MET A 1 261 ? 34.291  15.768 41.186 1.00 21.84 ? 261 MET A CA  1 
ATOM   1987 C C   . MET A 1 261 ? 34.750  15.768 39.722 1.00 21.98 ? 261 MET A C   1 
ATOM   1988 O O   . MET A 1 261 ? 34.814  14.720 39.078 1.00 21.98 ? 261 MET A O   1 
ATOM   1989 C CB  . MET A 1 261 ? 32.789  16.079 41.257 1.00 21.88 ? 261 MET A CB  1 
ATOM   1990 C CG  . MET A 1 261 ? 32.089  15.589 42.526 1.00 22.85 ? 261 MET A CG  1 
ATOM   1991 S SD  . MET A 1 261 ? 32.282  13.794 42.846 1.00 24.40 ? 261 MET A SD  1 
ATOM   1992 C CE  . MET A 1 261 ? 31.696  13.097 41.310 1.00 20.87 ? 261 MET A CE  1 
ATOM   1993 N N   . HIS A 1 262 ? 35.078  16.944 39.201 1.00 21.46 ? 262 HIS A N   1 
ATOM   1994 C CA  . HIS A 1 262 ? 35.521  17.060 37.819 1.00 21.65 ? 262 HIS A CA  1 
ATOM   1995 C C   . HIS A 1 262 ? 36.856  16.360 37.581 1.00 22.43 ? 262 HIS A C   1 
ATOM   1996 O O   . HIS A 1 262 ? 37.326  16.271 36.445 1.00 22.04 ? 262 HIS A O   1 
ATOM   1997 C CB  . HIS A 1 262 ? 35.620  18.538 37.426 1.00 20.13 ? 262 HIS A CB  1 
ATOM   1998 C CG  . HIS A 1 262 ? 34.296  19.178 37.157 1.00 20.81 ? 262 HIS A CG  1 
ATOM   1999 N ND1 . HIS A 1 262 ? 33.779  19.311 35.886 1.00 22.22 ? 262 HIS A ND1 1 
ATOM   2000 C CD2 . HIS A 1 262 ? 33.356  19.670 37.998 1.00 20.24 ? 262 HIS A CD2 1 
ATOM   2001 C CE1 . HIS A 1 262 ? 32.576  19.854 35.956 1.00 20.45 ? 262 HIS A CE1 1 
ATOM   2002 N NE2 . HIS A 1 262 ? 32.295  20.080 37.227 1.00 20.06 ? 262 HIS A NE2 1 
ATOM   2003 N N   . ALA A 1 263 ? 37.471  15.861 38.649 1.00 21.62 ? 263 ALA A N   1 
ATOM   2004 C CA  . ALA A 1 263 ? 38.749  15.172 38.509 1.00 23.11 ? 263 ALA A CA  1 
ATOM   2005 C C   . ALA A 1 263 ? 38.738  13.799 39.182 1.00 23.49 ? 263 ALA A C   1 
ATOM   2006 O O   . ALA A 1 263 ? 39.778  13.159 39.319 1.00 24.36 ? 263 ALA A O   1 
ATOM   2007 C CB  . ALA A 1 263 ? 39.873  16.033 39.084 1.00 19.61 ? 263 ALA A CB  1 
ATOM   2008 N N   . ASN A 1 264 ? 37.558  13.341 39.583 1.00 23.71 ? 264 ASN A N   1 
ATOM   2009 C CA  . ASN A 1 264 ? 37.447  12.059 40.257 1.00 23.44 ? 264 ASN A CA  1 
ATOM   2010 C C   . ASN A 1 264 ? 37.175  10.903 39.304 1.00 25.34 ? 264 ASN A C   1 
ATOM   2011 O O   . ASN A 1 264 ? 36.022  10.577 38.998 1.00 25.55 ? 264 ASN A O   1 
ATOM   2012 C CB  . ASN A 1 264 ? 36.351  12.117 41.316 1.00 23.10 ? 264 ASN A CB  1 
ATOM   2013 C CG  . ASN A 1 264 ? 36.349  10.896 42.206 1.00 22.49 ? 264 ASN A CG  1 
ATOM   2014 O OD1 . ASN A 1 264 ? 36.535  9.774  41.732 1.00 23.69 ? 264 ASN A OD1 1 
ATOM   2015 N ND2 . ASN A 1 264 ? 36.128  11.102 43.499 1.00 19.73 ? 264 ASN A ND2 1 
ATOM   2016 N N   . GLN A 1 265 ? 38.254  10.276 38.849 1.00 26.15 ? 265 GLN A N   1 
ATOM   2017 C CA  . GLN A 1 265 ? 38.167  9.149  37.937 1.00 26.24 ? 265 GLN A CA  1 
ATOM   2018 C C   . GLN A 1 265 ? 37.468  7.954  38.583 1.00 27.56 ? 265 GLN A C   1 
ATOM   2019 O O   . GLN A 1 265 ? 36.789  7.183  37.897 1.00 28.24 ? 265 GLN A O   1 
ATOM   2020 C CB  . GLN A 1 265 ? 39.566  8.744  37.491 1.00 25.33 ? 265 GLN A CB  1 
ATOM   2021 C CG  . GLN A 1 265 ? 39.600  7.649  36.445 1.00 26.21 ? 265 GLN A CG  1 
ATOM   2022 C CD  . GLN A 1 265 ? 40.994  7.098  36.264 1.00 26.85 ? 265 GLN A CD  1 
ATOM   2023 O OE1 . GLN A 1 265 ? 41.538  6.461  37.166 1.00 29.06 ? 265 GLN A OE1 1 
ATOM   2024 N NE2 . GLN A 1 265 ? 41.590  7.350  35.106 1.00 25.99 ? 265 GLN A NE2 1 
ATOM   2025 N N   . ASP A 1 266 ? 37.631  7.802  39.898 1.00 28.09 ? 266 ASP A N   1 
ATOM   2026 C CA  . ASP A 1 266 ? 37.008  6.690  40.618 1.00 29.10 ? 266 ASP A CA  1 
ATOM   2027 C C   . ASP A 1 266 ? 35.489  6.730  40.548 1.00 27.53 ? 266 ASP A C   1 
ATOM   2028 O O   . ASP A 1 266 ? 34.841  5.710  40.310 1.00 26.33 ? 266 ASP A O   1 
ATOM   2029 C CB  . ASP A 1 266 ? 37.432  6.684  42.089 1.00 33.20 ? 266 ASP A CB  1 
ATOM   2030 C CG  . ASP A 1 266 ? 38.838  6.149  42.291 1.00 38.47 ? 266 ASP A CG  1 
ATOM   2031 O OD1 . ASP A 1 266 ? 39.135  5.050  41.769 1.00 40.66 ? 266 ASP A OD1 1 
ATOM   2032 O OD2 . ASP A 1 266 ? 39.641  6.820  42.980 1.00 41.25 ? 266 ASP A OD2 1 
ATOM   2033 N N   . LEU A 1 267 ? 34.926  7.914  40.756 1.00 25.44 ? 267 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 267 ? 33.485  8.076  40.726 1.00 24.15 ? 267 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 267 ? 32.915  8.196  39.318 1.00 24.41 ? 267 LEU A C   1 
ATOM   2036 O O   . LEU A 1 267 ? 31.955  7.510  38.976 1.00 24.69 ? 267 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 267 ? 33.089  9.296  41.558 1.00 24.55 ? 267 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 267 ? 33.362  9.145  43.061 1.00 23.12 ? 267 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 267 ? 33.142  10.467 43.779 1.00 20.69 ? 267 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 267 ? 32.457  8.062  43.625 1.00 20.71 ? 267 LEU A CD2 1 
ATOM   2041 N N   . VAL A 1 268 ? 33.506  9.055  38.496 1.00 24.25 ? 268 VAL A N   1 
ATOM   2042 C CA  . VAL A 1 268 ? 33.009  9.248  37.138 1.00 22.52 ? 268 VAL A CA  1 
ATOM   2043 C C   . VAL A 1 268 ? 33.199  8.023  36.247 1.00 22.46 ? 268 VAL A C   1 
ATOM   2044 O O   . VAL A 1 268 ? 32.263  7.595  35.574 1.00 21.98 ? 268 VAL A O   1 
ATOM   2045 C CB  . VAL A 1 268 ? 33.678  10.477 36.475 1.00 22.45 ? 268 VAL A CB  1 
ATOM   2046 C CG1 . VAL A 1 268 ? 33.285  10.571 34.999 1.00 18.86 ? 268 VAL A CG1 1 
ATOM   2047 C CG2 . VAL A 1 268 ? 33.269  11.733 37.211 1.00 18.22 ? 268 VAL A CG2 1 
ATOM   2048 N N   . THR A 1 269 ? 34.402  7.455  36.242 1.00 22.78 ? 269 THR A N   1 
ATOM   2049 C CA  . THR A 1 269 ? 34.671  6.287  35.404 1.00 22.96 ? 269 THR A CA  1 
ATOM   2050 C C   . THR A 1 269 ? 34.505  4.960  36.129 1.00 23.54 ? 269 THR A C   1 
ATOM   2051 O O   . THR A 1 269 ? 33.829  4.055  35.635 1.00 22.67 ? 269 THR A O   1 
ATOM   2052 C CB  . THR A 1 269 ? 36.087  6.327  34.824 1.00 21.88 ? 269 THR A CB  1 
ATOM   2053 O OG1 . THR A 1 269 ? 36.200  7.424  33.911 1.00 23.64 ? 269 THR A OG1 1 
ATOM   2054 C CG2 . THR A 1 269 ? 36.390  5.031  34.098 1.00 19.28 ? 269 THR A CG2 1 
ATOM   2055 N N   . GLY A 1 270 ? 35.133  4.853  37.296 1.00 24.41 ? 270 GLY A N   1 
ATOM   2056 C CA  . GLY A 1 270 ? 35.053  3.632  38.074 1.00 24.56 ? 270 GLY A CA  1 
ATOM   2057 C C   . GLY A 1 270 ? 33.644  3.271  38.498 1.00 26.24 ? 270 GLY A C   1 
ATOM   2058 O O   . GLY A 1 270 ? 33.239  2.105  38.389 1.00 26.58 ? 270 GLY A O   1 
ATOM   2059 N N   . TYR A 1 271 ? 32.886  4.265  38.959 1.00 25.00 ? 271 TYR A N   1 
ATOM   2060 C CA  . TYR A 1 271 ? 31.525  4.016  39.422 1.00 25.54 ? 271 TYR A CA  1 
ATOM   2061 C C   . TYR A 1 271 ? 30.392  4.267  38.423 1.00 26.63 ? 271 TYR A C   1 
ATOM   2062 O O   . TYR A 1 271 ? 29.691  3.325  38.022 1.00 27.52 ? 271 TYR A O   1 
ATOM   2063 C CB  . TYR A 1 271 ? 31.245  4.818  40.692 1.00 25.77 ? 271 TYR A CB  1 
ATOM   2064 C CG  . TYR A 1 271 ? 30.037  4.305  41.419 1.00 27.15 ? 271 TYR A CG  1 
ATOM   2065 C CD1 . TYR A 1 271 ? 30.045  3.036  42.001 1.00 28.80 ? 271 TYR A CD1 1 
ATOM   2066 C CD2 . TYR A 1 271 ? 28.865  5.050  41.476 1.00 29.35 ? 271 TYR A CD2 1 
ATOM   2067 C CE1 . TYR A 1 271 ? 28.913  2.517  42.617 1.00 29.69 ? 271 TYR A CE1 1 
ATOM   2068 C CE2 . TYR A 1 271 ? 27.718  4.539  42.093 1.00 30.88 ? 271 TYR A CE2 1 
ATOM   2069 C CZ  . TYR A 1 271 ? 27.752  3.273  42.659 1.00 30.89 ? 271 TYR A CZ  1 
ATOM   2070 O OH  . TYR A 1 271 ? 26.629  2.761  43.263 1.00 31.84 ? 271 TYR A OH  1 
ATOM   2071 N N   . LEU A 1 272 ? 30.200  5.529  38.036 1.00 24.80 ? 272 LEU A N   1 
ATOM   2072 C CA  . LEU A 1 272 ? 29.130  5.891  37.107 1.00 23.37 ? 272 LEU A CA  1 
ATOM   2073 C C   . LEU A 1 272 ? 29.131  5.112  35.803 1.00 24.37 ? 272 LEU A C   1 
ATOM   2074 O O   . LEU A 1 272 ? 28.084  4.635  35.368 1.00 24.16 ? 272 LEU A O   1 
ATOM   2075 C CB  . LEU A 1 272 ? 29.169  7.388  36.791 1.00 21.52 ? 272 LEU A CB  1 
ATOM   2076 C CG  . LEU A 1 272 ? 28.174  7.865  35.729 1.00 18.00 ? 272 LEU A CG  1 
ATOM   2077 C CD1 . LEU A 1 272 ? 26.741  7.589  36.162 1.00 17.94 ? 272 LEU A CD1 1 
ATOM   2078 C CD2 . LEU A 1 272 ? 28.383  9.341  35.499 1.00 18.49 ? 272 LEU A CD2 1 
ATOM   2079 N N   . LYS A 1 273 ? 30.296  4.986  35.174 1.00 25.36 ? 273 LYS A N   1 
ATOM   2080 C CA  . LYS A 1 273 ? 30.382  4.256  33.917 1.00 26.58 ? 273 LYS A CA  1 
ATOM   2081 C C   . LYS A 1 273 ? 30.557  2.754  34.102 1.00 28.31 ? 273 LYS A C   1 
ATOM   2082 O O   . LYS A 1 273 ? 29.748  1.970  33.609 1.00 28.93 ? 273 LYS A O   1 
ATOM   2083 C CB  . LYS A 1 273 ? 31.527  4.792  33.056 1.00 26.40 ? 273 LYS A CB  1 
ATOM   2084 C CG  . LYS A 1 273 ? 31.279  6.167  32.478 1.00 24.75 ? 273 LYS A CG  1 
ATOM   2085 C CD  . LYS A 1 273 ? 32.404  6.576  31.553 1.00 23.36 ? 273 LYS A CD  1 
ATOM   2086 C CE  . LYS A 1 273 ? 32.120  7.912  30.895 1.00 23.09 ? 273 LYS A CE  1 
ATOM   2087 N NZ  . LYS A 1 273 ? 33.171  8.269  29.914 1.00 22.60 ? 273 LYS A NZ  1 
ATOM   2088 N N   . ASP A 1 274 ? 31.601  2.349  34.819 1.00 29.50 ? 274 ASP A N   1 
ATOM   2089 C CA  . ASP A 1 274 ? 31.862  0.924  35.021 1.00 31.06 ? 274 ASP A CA  1 
ATOM   2090 C C   . ASP A 1 274 ? 30.889  0.154  35.930 1.00 31.70 ? 274 ASP A C   1 
ATOM   2091 O O   . ASP A 1 274 ? 30.523  -0.987 35.621 1.00 31.50 ? 274 ASP A O   1 
ATOM   2092 C CB  . ASP A 1 274 ? 33.294  0.725  35.522 1.00 31.37 ? 274 ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 274 ? 34.329  1.232  34.534 1.00 33.12 ? 274 ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 274 ? 34.008  1.293  33.329 1.00 33.66 ? 274 ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 274 ? 35.464  1.557  34.955 1.00 34.34 ? 274 ASP A OD2 1 
ATOM   2096 N N   . THR A 1 275 ? 30.464  0.769  37.032 1.00 30.69 ? 275 THR A N   1 
ATOM   2097 C CA  . THR A 1 275 ? 29.562  0.100  37.965 1.00 29.76 ? 275 THR A CA  1 
ATOM   2098 C C   . THR A 1 275 ? 28.084  0.249  37.610 1.00 29.15 ? 275 THR A C   1 
ATOM   2099 O O   . THR A 1 275 ? 27.400  -0.752 37.400 1.00 27.99 ? 275 THR A O   1 
ATOM   2100 C CB  . THR A 1 275 ? 29.799  0.591  39.408 1.00 30.94 ? 275 THR A CB  1 
ATOM   2101 O OG1 . THR A 1 275 ? 31.188  0.456  39.734 1.00 30.55 ? 275 THR A OG1 1 
ATOM   2102 C CG2 . THR A 1 275 ? 28.993  -0.236 40.391 1.00 28.96 ? 275 THR A CG2 1 
ATOM   2103 N N   . LEU A 1 276 ? 27.587  1.485  37.553 1.00 29.66 ? 276 LEU A N   1 
ATOM   2104 C CA  . LEU A 1 276 ? 26.183  1.719  37.196 1.00 29.35 ? 276 LEU A CA  1 
ATOM   2105 C C   . LEU A 1 276 ? 25.965  1.467  35.704 1.00 29.03 ? 276 LEU A C   1 
ATOM   2106 O O   . LEU A 1 276 ? 24.835  1.427  35.228 1.00 28.84 ? 276 LEU A O   1 
ATOM   2107 C CB  . LEU A 1 276 ? 25.761  3.150  37.539 1.00 28.07 ? 276 LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 276 ? 25.735  3.496  39.028 1.00 29.24 ? 276 LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 276 ? 25.246  4.924  39.215 1.00 28.06 ? 276 LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 276 ? 24.827  2.516  39.763 1.00 27.84 ? 276 LEU A CD2 1 
ATOM   2111 N N   . LYS A 1 277 ? 27.068  1.304  34.982 1.00 28.99 ? 277 LYS A N   1 
ATOM   2112 C CA  . LYS A 1 277 ? 27.054  1.035  33.552 1.00 30.71 ? 277 LYS A CA  1 
ATOM   2113 C C   . LYS A 1 277 ? 26.345  2.062  32.674 1.00 29.75 ? 277 LYS A C   1 
ATOM   2114 O O   . LYS A 1 277 ? 25.645  1.716  31.720 1.00 28.89 ? 277 LYS A O   1 
ATOM   2115 C CB  . LYS A 1 277 ? 26.516  -0.376 33.305 1.00 33.00 ? 277 LYS A CB  1 
ATOM   2116 C CG  . LYS A 1 277 ? 27.515  -1.422 33.779 1.00 38.61 ? 277 LYS A CG  1 
ATOM   2117 C CD  . LYS A 1 277 ? 27.053  -2.839 33.567 1.00 43.30 ? 277 LYS A CD  1 
ATOM   2118 C CE  . LYS A 1 277 ? 28.155  -3.818 33.979 1.00 46.96 ? 277 LYS A CE  1 
ATOM   2119 N NZ  . LYS A 1 277 ? 27.737  -5.252 33.821 1.00 49.84 ? 277 LYS A NZ  1 
ATOM   2120 N N   . PHE A 1 278 ? 26.562  3.332  33.003 1.00 28.17 ? 278 PHE A N   1 
ATOM   2121 C CA  . PHE A 1 278 ? 25.998  4.446  32.262 1.00 26.05 ? 278 PHE A CA  1 
ATOM   2122 C C   . PHE A 1 278 ? 26.636  4.436  30.877 1.00 25.37 ? 278 PHE A C   1 
ATOM   2123 O O   . PHE A 1 278 ? 27.854  4.397  30.750 1.00 24.12 ? 278 PHE A O   1 
ATOM   2124 C CB  . PHE A 1 278 ? 26.316  5.754  32.992 1.00 25.34 ? 278 PHE A CB  1 
ATOM   2125 C CG  . PHE A 1 278 ? 25.885  6.988  32.252 1.00 25.82 ? 278 PHE A CG  1 
ATOM   2126 C CD1 . PHE A 1 278 ? 24.574  7.133  31.811 1.00 25.14 ? 278 PHE A CD1 1 
ATOM   2127 C CD2 . PHE A 1 278 ? 26.795  8.015  32.001 1.00 25.15 ? 278 PHE A CD2 1 
ATOM   2128 C CE1 . PHE A 1 278 ? 24.174  8.283  31.129 1.00 24.58 ? 278 PHE A CE1 1 
ATOM   2129 C CE2 . PHE A 1 278 ? 26.407  9.166  31.321 1.00 24.33 ? 278 PHE A CE2 1 
ATOM   2130 C CZ  . PHE A 1 278 ? 25.093  9.300  30.884 1.00 25.54 ? 278 PHE A CZ  1 
ATOM   2131 N N   . LYS A 1 279 ? 25.805  4.462  29.844 1.00 26.31 ? 279 LYS A N   1 
ATOM   2132 C CA  . LYS A 1 279 ? 26.285  4.437  28.469 1.00 26.79 ? 279 LYS A CA  1 
ATOM   2133 C C   . LYS A 1 279 ? 26.025  5.751  27.724 1.00 26.85 ? 279 LYS A C   1 
ATOM   2134 O O   . LYS A 1 279 ? 26.398  5.894  26.556 1.00 26.85 ? 279 LYS A O   1 
ATOM   2135 C CB  . LYS A 1 279 ? 25.631  3.271  27.713 1.00 28.65 ? 279 LYS A CB  1 
ATOM   2136 C CG  . LYS A 1 279 ? 26.499  2.019  27.581 1.00 28.43 ? 279 LYS A CG  1 
ATOM   2137 C CD  . LYS A 1 279 ? 26.916  1.467  28.922 1.00 30.58 ? 279 LYS A CD  1 
ATOM   2138 C CE  . LYS A 1 279 ? 27.650  0.132  28.782 1.00 30.75 ? 279 LYS A CE  1 
ATOM   2139 N NZ  . LYS A 1 279 ? 29.038  0.259  28.250 1.00 32.46 ? 279 LYS A NZ  1 
ATOM   2140 N N   . GLY A 1 280 ? 25.379  6.702  28.393 1.00 25.04 ? 280 GLY A N   1 
ATOM   2141 C CA  . GLY A 1 280 ? 25.109  7.983  27.765 1.00 23.99 ? 280 GLY A CA  1 
ATOM   2142 C C   . GLY A 1 280 ? 26.367  8.812  27.888 1.00 23.46 ? 280 GLY A C   1 
ATOM   2143 O O   . GLY A 1 280 ? 27.438  8.239  28.061 1.00 24.31 ? 280 GLY A O   1 
ATOM   2144 N N   . PHE A 1 281 ? 26.273  10.138 27.806 1.00 22.52 ? 281 PHE A N   1 
ATOM   2145 C CA  . PHE A 1 281 ? 27.484  10.930 27.939 1.00 20.83 ? 281 PHE A CA  1 
ATOM   2146 C C   . PHE A 1 281 ? 27.555  11.833 29.166 1.00 20.93 ? 281 PHE A C   1 
ATOM   2147 O O   . PHE A 1 281 ? 26.556  12.397 29.618 1.00 21.23 ? 281 PHE A O   1 
ATOM   2148 C CB  . PHE A 1 281 ? 27.791  11.701 26.632 1.00 21.07 ? 281 PHE A CB  1 
ATOM   2149 C CG  . PHE A 1 281 ? 26.883  12.875 26.326 1.00 20.99 ? 281 PHE A CG  1 
ATOM   2150 C CD1 . PHE A 1 281 ? 27.002  14.080 27.022 1.00 21.93 ? 281 PHE A CD1 1 
ATOM   2151 C CD2 . PHE A 1 281 ? 26.012  12.825 25.234 1.00 21.40 ? 281 PHE A CD2 1 
ATOM   2152 C CE1 . PHE A 1 281 ? 26.277  15.223 26.623 1.00 22.73 ? 281 PHE A CE1 1 
ATOM   2153 C CE2 . PHE A 1 281 ? 25.285  13.959 24.829 1.00 22.01 ? 281 PHE A CE2 1 
ATOM   2154 C CZ  . PHE A 1 281 ? 25.419  15.161 25.524 1.00 19.99 ? 281 PHE A CZ  1 
ATOM   2155 N N   . VAL A 1 282 ? 28.757  11.923 29.723 1.00 19.31 ? 282 VAL A N   1 
ATOM   2156 C CA  . VAL A 1 282 ? 29.014  12.734 30.902 1.00 18.24 ? 282 VAL A CA  1 
ATOM   2157 C C   . VAL A 1 282 ? 29.503  14.114 30.468 1.00 19.36 ? 282 VAL A C   1 
ATOM   2158 O O   . VAL A 1 282 ? 30.480  14.232 29.721 1.00 20.59 ? 282 VAL A O   1 
ATOM   2159 C CB  . VAL A 1 282 ? 30.082  12.075 31.782 1.00 17.33 ? 282 VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 282 ? 30.374  12.932 32.999 1.00 17.41 ? 282 VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 282 ? 29.618  10.699 32.190 1.00 17.34 ? 282 VAL A CG2 1 
ATOM   2162 N N   . ILE A 1 283 ? 28.818  15.152 30.935 1.00 17.03 ? 283 ILE A N   1 
ATOM   2163 C CA  . ILE A 1 283 ? 29.174  16.515 30.590 1.00 16.93 ? 283 ILE A CA  1 
ATOM   2164 C C   . ILE A 1 283 ? 29.601  17.260 31.848 1.00 18.17 ? 283 ILE A C   1 
ATOM   2165 O O   . ILE A 1 283 ? 29.174  16.924 32.955 1.00 17.38 ? 283 ILE A O   1 
ATOM   2166 C CB  . ILE A 1 283 ? 27.968  17.244 29.925 1.00 17.61 ? 283 ILE A CB  1 
ATOM   2167 C CG1 . ILE A 1 283 ? 28.408  18.587 29.339 1.00 14.03 ? 283 ILE A CG1 1 
ATOM   2168 C CG2 . ILE A 1 283 ? 26.839  17.449 30.952 1.00 17.11 ? 283 ILE A CG2 1 
ATOM   2169 C CD1 . ILE A 1 283 ? 27.298  19.316 28.594 1.00 10.76 ? 283 ILE A CD1 1 
ATOM   2170 N N   . SER A 1 284 ? 30.455  18.262 31.677 1.00 19.05 ? 284 SER A N   1 
ATOM   2171 C CA  . SER A 1 284 ? 30.925  19.064 32.801 1.00 20.52 ? 284 SER A CA  1 
ATOM   2172 C C   . SER A 1 284 ? 29.910  20.175 33.087 1.00 21.16 ? 284 SER A C   1 
ATOM   2173 O O   . SER A 1 284 ? 28.851  20.252 32.453 1.00 19.40 ? 284 SER A O   1 
ATOM   2174 C CB  . SER A 1 284 ? 32.273  19.707 32.466 1.00 21.89 ? 284 SER A CB  1 
ATOM   2175 O OG  . SER A 1 284 ? 32.108  20.794 31.561 1.00 22.13 ? 284 SER A OG  1 
ATOM   2176 N N   . ASP A 1 285 ? 30.240  21.030 34.049 1.00 20.68 ? 285 ASP A N   1 
ATOM   2177 C CA  . ASP A 1 285 ? 29.387  22.152 34.387 1.00 20.44 ? 285 ASP A CA  1 
ATOM   2178 C C   . ASP A 1 285 ? 30.096  23.391 33.830 1.00 21.39 ? 285 ASP A C   1 
ATOM   2179 O O   . ASP A 1 285 ? 31.228  23.303 33.354 1.00 21.61 ? 285 ASP A O   1 
ATOM   2180 C CB  . ASP A 1 285 ? 29.229  22.272 35.903 1.00 21.42 ? 285 ASP A CB  1 
ATOM   2181 C CG  . ASP A 1 285 ? 27.934  22.973 36.305 1.00 24.91 ? 285 ASP A CG  1 
ATOM   2182 O OD1 . ASP A 1 285 ? 27.480  23.865 35.552 1.00 23.40 ? 285 ASP A OD1 1 
ATOM   2183 O OD2 . ASP A 1 285 ? 27.377  22.636 37.379 1.00 23.23 ? 285 ASP A OD2 1 
ATOM   2184 N N   . TRP A 1 286 ? 29.423  24.535 33.891 1.00 21.32 ? 286 TRP A N   1 
ATOM   2185 C CA  . TRP A 1 286 ? 29.946  25.808 33.397 1.00 21.24 ? 286 TRP A CA  1 
ATOM   2186 C C   . TRP A 1 286 ? 31.329  26.114 33.964 1.00 21.74 ? 286 TRP A C   1 
ATOM   2187 O O   . TRP A 1 286 ? 31.466  26.533 35.114 1.00 24.37 ? 286 TRP A O   1 
ATOM   2188 C CB  . TRP A 1 286 ? 28.938  26.906 33.760 1.00 20.59 ? 286 TRP A CB  1 
ATOM   2189 C CG  . TRP A 1 286 ? 29.189  28.283 33.217 1.00 19.66 ? 286 TRP A CG  1 
ATOM   2190 C CD1 . TRP A 1 286 ? 30.009  29.237 33.747 1.00 19.19 ? 286 TRP A CD1 1 
ATOM   2191 C CD2 . TRP A 1 286 ? 28.542  28.892 32.090 1.00 19.35 ? 286 TRP A CD2 1 
ATOM   2192 N NE1 . TRP A 1 286 ? 29.906  30.403 33.030 1.00 20.61 ? 286 TRP A NE1 1 
ATOM   2193 C CE2 . TRP A 1 286 ? 29.014  30.219 32.006 1.00 19.57 ? 286 TRP A CE2 1 
ATOM   2194 C CE3 . TRP A 1 286 ? 27.607  28.445 31.145 1.00 18.60 ? 286 TRP A CE3 1 
ATOM   2195 C CZ2 . TRP A 1 286 ? 28.584  31.105 31.012 1.00 17.53 ? 286 TRP A CZ2 1 
ATOM   2196 C CZ3 . TRP A 1 286 ? 27.179  29.326 30.155 1.00 16.68 ? 286 TRP A CZ3 1 
ATOM   2197 C CH2 . TRP A 1 286 ? 27.669  30.639 30.098 1.00 17.27 ? 286 TRP A CH2 1 
ATOM   2198 N N   . GLU A 1 287 ? 32.356  25.904 33.148 1.00 22.43 ? 287 GLU A N   1 
ATOM   2199 C CA  . GLU A 1 287 ? 33.736  26.144 33.571 1.00 23.15 ? 287 GLU A CA  1 
ATOM   2200 C C   . GLU A 1 287 ? 34.098  25.194 34.709 1.00 22.40 ? 287 GLU A C   1 
ATOM   2201 O O   . GLU A 1 287 ? 34.983  25.474 35.517 1.00 21.67 ? 287 GLU A O   1 
ATOM   2202 C CB  . GLU A 1 287 ? 33.919  27.596 34.031 1.00 23.49 ? 287 GLU A CB  1 
ATOM   2203 C CG  . GLU A 1 287 ? 33.461  28.648 33.025 1.00 25.01 ? 287 GLU A CG  1 
ATOM   2204 C CD  . GLU A 1 287 ? 33.656  30.068 33.532 1.00 26.18 ? 287 GLU A CD  1 
ATOM   2205 O OE1 . GLU A 1 287 ? 33.347  30.332 34.713 1.00 28.26 ? 287 GLU A OE1 1 
ATOM   2206 O OE2 . GLU A 1 287 ? 34.106  30.926 32.747 1.00 28.05 ? 287 GLU A OE2 1 
ATOM   2207 N N   . GLY A 1 288 ? 33.401  24.063 34.757 1.00 23.28 ? 288 GLY A N   1 
ATOM   2208 C CA  . GLY A 1 288 ? 33.643  23.072 35.789 1.00 23.86 ? 288 GLY A CA  1 
ATOM   2209 C C   . GLY A 1 288 ? 35.096  22.652 35.925 1.00 24.50 ? 288 GLY A C   1 
ATOM   2210 O O   . GLY A 1 288 ? 35.637  22.633 37.036 1.00 24.46 ? 288 GLY A O   1 
ATOM   2211 N N   . ILE A 1 289 ? 35.736  22.314 34.808 1.00 23.90 ? 289 ILE A N   1 
ATOM   2212 C CA  . ILE A 1 289 ? 37.131  21.898 34.854 1.00 23.96 ? 289 ILE A CA  1 
ATOM   2213 C C   . ILE A 1 289 ? 38.053  23.059 35.248 1.00 23.84 ? 289 ILE A C   1 
ATOM   2214 O O   . ILE A 1 289 ? 39.081  22.847 35.894 1.00 24.63 ? 289 ILE A O   1 
ATOM   2215 C CB  . ILE A 1 289 ? 37.590  21.278 33.503 1.00 23.75 ? 289 ILE A CB  1 
ATOM   2216 C CG1 . ILE A 1 289 ? 37.737  22.354 32.424 1.00 23.78 ? 289 ILE A CG1 1 
ATOM   2217 C CG2 . ILE A 1 289 ? 36.576  20.240 33.050 1.00 24.24 ? 289 ILE A CG2 1 
ATOM   2218 C CD1 . ILE A 1 289 ? 38.264  21.814 31.096 1.00 20.55 ? 289 ILE A CD1 1 
ATOM   2219 N N   . ASP A 1 290 ? 37.677  24.282 34.882 1.00 21.93 ? 290 ASP A N   1 
ATOM   2220 C CA  . ASP A 1 290 ? 38.477  25.455 35.224 1.00 22.44 ? 290 ASP A CA  1 
ATOM   2221 C C   . ASP A 1 290 ? 38.651  25.519 36.740 1.00 23.94 ? 290 ASP A C   1 
ATOM   2222 O O   . ASP A 1 290 ? 39.746  25.770 37.259 1.00 22.92 ? 290 ASP A O   1 
ATOM   2223 C CB  . ASP A 1 290 ? 37.776  26.753 34.796 1.00 22.52 ? 290 ASP A CB  1 
ATOM   2224 C CG  . ASP A 1 290 ? 37.527  26.841 33.301 1.00 23.67 ? 290 ASP A CG  1 
ATOM   2225 O OD1 . ASP A 1 290 ? 36.873  25.940 32.736 1.00 23.44 ? 290 ASP A OD1 1 
ATOM   2226 O OD2 . ASP A 1 290 ? 37.977  27.836 32.693 1.00 24.44 ? 290 ASP A OD2 1 
ATOM   2227 N N   . ARG A 1 291 ? 37.549  25.290 37.443 1.00 23.18 ? 291 ARG A N   1 
ATOM   2228 C CA  . ARG A 1 291 ? 37.539  25.378 38.887 1.00 23.54 ? 291 ARG A CA  1 
ATOM   2229 C C   . ARG A 1 291 ? 38.171  24.220 39.631 1.00 25.11 ? 291 ARG A C   1 
ATOM   2230 O O   . ARG A 1 291 ? 38.128  24.177 40.860 1.00 24.64 ? 291 ARG A O   1 
ATOM   2231 C CB  . ARG A 1 291 ? 36.104  25.610 39.355 1.00 24.33 ? 291 ARG A CB  1 
ATOM   2232 C CG  . ARG A 1 291 ? 35.523  26.868 38.733 1.00 24.19 ? 291 ARG A CG  1 
ATOM   2233 C CD  . ARG A 1 291 ? 34.068  27.091 39.056 1.00 24.40 ? 291 ARG A CD  1 
ATOM   2234 N NE  . ARG A 1 291 ? 33.501  28.069 38.132 1.00 24.28 ? 291 ARG A NE  1 
ATOM   2235 C CZ  . ARG A 1 291 ? 32.242  28.494 38.161 1.00 22.74 ? 291 ARG A CZ  1 
ATOM   2236 N NH1 . ARG A 1 291 ? 31.404  28.038 39.080 1.00 22.55 ? 291 ARG A NH1 1 
ATOM   2237 N NH2 . ARG A 1 291 ? 31.817  29.355 37.248 1.00 20.63 ? 291 ARG A NH2 1 
ATOM   2238 N N   . ILE A 1 292 ? 38.759  23.278 38.901 1.00 26.32 ? 292 ILE A N   1 
ATOM   2239 C CA  . ILE A 1 292 ? 39.416  22.158 39.559 1.00 26.92 ? 292 ILE A CA  1 
ATOM   2240 C C   . ILE A 1 292 ? 40.603  22.742 40.305 1.00 27.21 ? 292 ILE A C   1 
ATOM   2241 O O   . ILE A 1 292 ? 40.895  22.359 41.439 1.00 28.80 ? 292 ILE A O   1 
ATOM   2242 C CB  . ILE A 1 292 ? 39.926  21.116 38.557 1.00 26.22 ? 292 ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 292 ? 38.744  20.344 37.970 1.00 26.19 ? 292 ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 292 ? 40.905  20.174 39.244 1.00 25.09 ? 292 ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 292 ? 39.143  19.305 36.938 1.00 27.22 ? 292 ILE A CD1 1 
ATOM   2246 N N   . THR A 1 293 ? 41.276  23.684 39.654 1.00 26.10 ? 293 THR A N   1 
ATOM   2247 C CA  . THR A 1 293 ? 42.426  24.349 40.242 1.00 25.60 ? 293 THR A CA  1 
ATOM   2248 C C   . THR A 1 293 ? 41.943  25.563 41.015 1.00 26.74 ? 293 THR A C   1 
ATOM   2249 O O   . THR A 1 293 ? 40.777  25.946 40.932 1.00 28.22 ? 293 THR A O   1 
ATOM   2250 C CB  . THR A 1 293 ? 43.426  24.827 39.167 1.00 23.56 ? 293 THR A CB  1 
ATOM   2251 O OG1 . THR A 1 293 ? 42.831  25.866 38.385 1.00 21.39 ? 293 THR A OG1 1 
ATOM   2252 C CG2 . THR A 1 293 ? 43.828  23.675 38.256 1.00 21.72 ? 293 THR A CG2 1 
ATOM   2253 N N   . THR A 1 294 ? 42.842  26.161 41.780 1.00 27.64 ? 294 THR A N   1 
ATOM   2254 C CA  . THR A 1 294 ? 42.501  27.344 42.552 1.00 29.11 ? 294 THR A CA  1 
ATOM   2255 C C   . THR A 1 294 ? 43.746  28.218 42.645 1.00 28.81 ? 294 THR A C   1 
ATOM   2256 O O   . THR A 1 294 ? 44.753  27.813 43.223 1.00 30.21 ? 294 THR A O   1 
ATOM   2257 C CB  . THR A 1 294 ? 41.999  26.971 43.972 1.00 30.45 ? 294 THR A CB  1 
ATOM   2258 O OG1 . THR A 1 294 ? 42.737  27.709 44.951 1.00 31.03 ? 294 THR A OG1 1 
ATOM   2259 C CG2 . THR A 1 294 ? 42.141  25.469 44.227 1.00 29.79 ? 294 THR A CG2 1 
ATOM   2260 N N   . PRO A 1 295 ? 43.698  29.429 42.068 1.00 27.23 ? 295 PRO A N   1 
ATOM   2261 C CA  . PRO A 1 295 ? 42.573  30.035 41.347 1.00 26.92 ? 295 PRO A CA  1 
ATOM   2262 C C   . PRO A 1 295 ? 42.052  29.184 40.190 1.00 28.11 ? 295 PRO A C   1 
ATOM   2263 O O   . PRO A 1 295 ? 42.770  28.348 39.637 1.00 28.40 ? 295 PRO A O   1 
ATOM   2264 C CB  . PRO A 1 295 ? 43.155  31.354 40.840 1.00 25.43 ? 295 PRO A CB  1 
ATOM   2265 C CG  . PRO A 1 295 ? 44.257  31.641 41.795 1.00 26.01 ? 295 PRO A CG  1 
ATOM   2266 C CD  . PRO A 1 295 ? 44.882  30.294 41.983 1.00 25.24 ? 295 PRO A CD  1 
ATOM   2267 N N   . ALA A 1 296 ? 40.794  29.404 39.830 1.00 28.02 ? 296 ALA A N   1 
ATOM   2268 C CA  . ALA A 1 296 ? 40.190  28.680 38.729 1.00 28.21 ? 296 ALA A CA  1 
ATOM   2269 C C   . ALA A 1 296 ? 40.917  29.135 37.475 1.00 28.65 ? 296 ALA A C   1 
ATOM   2270 O O   . ALA A 1 296 ? 41.279  30.304 37.357 1.00 29.63 ? 296 ALA A O   1 
ATOM   2271 C CB  . ALA A 1 296 ? 38.714  29.012 38.637 1.00 26.18 ? 296 ALA A CB  1 
ATOM   2272 N N   . GLY A 1 297 ? 41.150  28.213 36.550 1.00 28.71 ? 297 GLY A N   1 
ATOM   2273 C CA  . GLY A 1 297 ? 41.838  28.570 35.322 1.00 29.65 ? 297 GLY A CA  1 
ATOM   2274 C C   . GLY A 1 297 ? 43.338  28.801 35.447 1.00 30.12 ? 297 GLY A C   1 
ATOM   2275 O O   . GLY A 1 297 ? 44.022  28.952 34.437 1.00 31.17 ? 297 GLY A O   1 
ATOM   2276 N N   . SER A 1 298 ? 43.863  28.822 36.669 1.00 29.74 ? 298 SER A N   1 
ATOM   2277 C CA  . SER A 1 298 ? 45.291  29.045 36.870 1.00 29.83 ? 298 SER A CA  1 
ATOM   2278 C C   . SER A 1 298 ? 46.172  28.013 36.156 1.00 29.34 ? 298 SER A C   1 
ATOM   2279 O O   . SER A 1 298 ? 47.387  28.193 36.067 1.00 29.75 ? 298 SER A O   1 
ATOM   2280 C CB  . SER A 1 298 ? 45.625  29.054 38.364 1.00 31.75 ? 298 SER A CB  1 
ATOM   2281 O OG  . SER A 1 298 ? 45.558  27.750 38.919 1.00 36.13 ? 298 SER A OG  1 
ATOM   2282 N N   . ASP A 1 299 ? 45.564  26.937 35.658 1.00 27.12 ? 299 ASP A N   1 
ATOM   2283 C CA  . ASP A 1 299 ? 46.295  25.892 34.942 1.00 25.66 ? 299 ASP A CA  1 
ATOM   2284 C C   . ASP A 1 299 ? 45.320  25.091 34.075 1.00 26.06 ? 299 ASP A C   1 
ATOM   2285 O O   . ASP A 1 299 ? 45.043  23.918 34.341 1.00 25.88 ? 299 ASP A O   1 
ATOM   2286 C CB  . ASP A 1 299 ? 46.989  24.961 35.932 1.00 25.82 ? 299 ASP A CB  1 
ATOM   2287 C CG  . ASP A 1 299 ? 47.957  24.003 35.255 1.00 26.51 ? 299 ASP A CG  1 
ATOM   2288 O OD1 . ASP A 1 299 ? 47.926  23.884 34.011 1.00 28.47 ? 299 ASP A OD1 1 
ATOM   2289 O OD2 . ASP A 1 299 ? 48.749  23.358 35.968 1.00 26.58 ? 299 ASP A OD2 1 
ATOM   2290 N N   . TYR A 1 300 ? 44.812  25.730 33.027 1.00 26.06 ? 300 TYR A N   1 
ATOM   2291 C CA  . TYR A 1 300 ? 43.845  25.105 32.142 1.00 26.48 ? 300 TYR A CA  1 
ATOM   2292 C C   . TYR A 1 300 ? 44.334  23.801 31.543 1.00 27.64 ? 300 TYR A C   1 
ATOM   2293 O O   . TYR A 1 300 ? 43.545  22.887 31.286 1.00 27.69 ? 300 TYR A O   1 
ATOM   2294 C CB  . TYR A 1 300 ? 43.459  26.066 31.023 1.00 27.36 ? 300 TYR A CB  1 
ATOM   2295 C CG  . TYR A 1 300 ? 42.099  25.773 30.439 1.00 28.61 ? 300 TYR A CG  1 
ATOM   2296 C CD1 . TYR A 1 300 ? 40.956  25.810 31.240 1.00 27.88 ? 300 TYR A CD1 1 
ATOM   2297 C CD2 . TYR A 1 300 ? 41.950  25.448 29.094 1.00 29.01 ? 300 TYR A CD2 1 
ATOM   2298 C CE1 . TYR A 1 300 ? 39.702  25.533 30.718 1.00 29.05 ? 300 TYR A CE1 1 
ATOM   2299 C CE2 . TYR A 1 300 ? 40.695  25.166 28.558 1.00 30.37 ? 300 TYR A CE2 1 
ATOM   2300 C CZ  . TYR A 1 300 ? 39.574  25.212 29.376 1.00 30.12 ? 300 TYR A CZ  1 
ATOM   2301 O OH  . TYR A 1 300 ? 38.329  24.948 28.852 1.00 28.88 ? 300 TYR A OH  1 
ATOM   2302 N N   . SER A 1 301 ? 45.637  23.718 31.309 1.00 28.52 ? 301 SER A N   1 
ATOM   2303 C CA  . SER A 1 301 ? 46.218  22.510 30.748 1.00 27.64 ? 301 SER A CA  1 
ATOM   2304 C C   . SER A 1 301 ? 45.904  21.333 31.669 1.00 27.59 ? 301 SER A C   1 
ATOM   2305 O O   . SER A 1 301 ? 45.427  20.289 31.223 1.00 28.66 ? 301 SER A O   1 
ATOM   2306 C CB  . SER A 1 301 ? 47.728  22.670 30.605 1.00 26.71 ? 301 SER A CB  1 
ATOM   2307 O OG  . SER A 1 301 ? 48.300  21.488 30.076 1.00 28.18 ? 301 SER A OG  1 
ATOM   2308 N N   . TYR A 1 302 ? 46.172  21.511 32.958 1.00 25.99 ? 302 TYR A N   1 
ATOM   2309 C CA  . TYR A 1 302 ? 45.906  20.474 33.945 1.00 25.22 ? 302 TYR A CA  1 
ATOM   2310 C C   . TYR A 1 302 ? 44.401  20.183 33.981 1.00 24.66 ? 302 TYR A C   1 
ATOM   2311 O O   . TYR A 1 302 ? 43.980  19.027 34.040 1.00 23.90 ? 302 TYR A O   1 
ATOM   2312 C CB  . TYR A 1 302 ? 46.397  20.934 35.323 1.00 26.71 ? 302 TYR A CB  1 
ATOM   2313 C CG  . TYR A 1 302 ? 46.021  20.003 36.449 1.00 27.01 ? 302 TYR A CG  1 
ATOM   2314 C CD1 . TYR A 1 302 ? 46.560  18.721 36.531 1.00 25.61 ? 302 TYR A CD1 1 
ATOM   2315 C CD2 . TYR A 1 302 ? 45.081  20.388 37.407 1.00 28.42 ? 302 TYR A CD2 1 
ATOM   2316 C CE1 . TYR A 1 302 ? 46.170  17.843 37.534 1.00 27.40 ? 302 TYR A CE1 1 
ATOM   2317 C CE2 . TYR A 1 302 ? 44.680  19.517 38.415 1.00 28.38 ? 302 TYR A CE2 1 
ATOM   2318 C CZ  . TYR A 1 302 ? 45.226  18.247 38.471 1.00 29.10 ? 302 TYR A CZ  1 
ATOM   2319 O OH  . TYR A 1 302 ? 44.806  17.376 39.447 1.00 30.50 ? 302 TYR A OH  1 
ATOM   2320 N N   . SER A 1 303 ? 43.595  21.238 33.937 1.00 24.19 ? 303 SER A N   1 
ATOM   2321 C CA  . SER A 1 303 ? 42.141  21.089 33.952 1.00 23.77 ? 303 SER A CA  1 
ATOM   2322 C C   . SER A 1 303 ? 41.674  20.086 32.909 1.00 23.85 ? 303 SER A C   1 
ATOM   2323 O O   . SER A 1 303 ? 40.916  19.168 33.213 1.00 22.17 ? 303 SER A O   1 
ATOM   2324 C CB  . SER A 1 303 ? 41.454  22.432 33.680 1.00 22.33 ? 303 SER A CB  1 
ATOM   2325 O OG  . SER A 1 303 ? 41.659  23.349 34.739 1.00 22.02 ? 303 SER A OG  1 
ATOM   2326 N N   . VAL A 1 304 ? 42.130  20.268 31.674 1.00 25.50 ? 304 VAL A N   1 
ATOM   2327 C CA  . VAL A 1 304 ? 41.730  19.384 30.585 1.00 26.03 ? 304 VAL A CA  1 
ATOM   2328 C C   . VAL A 1 304 ? 42.223  17.959 30.787 1.00 27.16 ? 304 VAL A C   1 
ATOM   2329 O O   . VAL A 1 304 ? 41.474  16.999 30.591 1.00 28.30 ? 304 VAL A O   1 
ATOM   2330 C CB  . VAL A 1 304 ? 42.243  19.902 29.229 1.00 24.92 ? 304 VAL A CB  1 
ATOM   2331 C CG1 . VAL A 1 304 ? 41.724  19.019 28.099 1.00 24.41 ? 304 VAL A CG1 1 
ATOM   2332 C CG2 . VAL A 1 304 ? 41.801  21.338 29.030 1.00 24.35 ? 304 VAL A CG2 1 
ATOM   2333 N N   . LYS A 1 305 ? 43.480  17.824 31.189 1.00 27.42 ? 305 LYS A N   1 
ATOM   2334 C CA  . LYS A 1 305 ? 44.065  16.510 31.407 1.00 27.93 ? 305 LYS A CA  1 
ATOM   2335 C C   . LYS A 1 305 ? 43.321  15.729 32.490 1.00 26.77 ? 305 LYS A C   1 
ATOM   2336 O O   . LYS A 1 305 ? 42.931  14.575 32.288 1.00 25.37 ? 305 LYS A O   1 
ATOM   2337 C CB  . LYS A 1 305 ? 45.539  16.661 31.795 1.00 30.42 ? 305 LYS A CB  1 
ATOM   2338 C CG  . LYS A 1 305 ? 46.271  15.349 32.023 1.00 35.45 ? 305 LYS A CG  1 
ATOM   2339 C CD  . LYS A 1 305 ? 47.708  15.603 32.460 1.00 40.10 ? 305 LYS A CD  1 
ATOM   2340 C CE  . LYS A 1 305 ? 48.389  14.326 32.936 1.00 41.82 ? 305 LYS A CE  1 
ATOM   2341 N NZ  . LYS A 1 305 ? 49.736  14.607 33.507 1.00 43.81 ? 305 LYS A NZ  1 
ATOM   2342 N N   . ALA A 1 306 ? 43.115  16.373 33.635 1.00 25.28 ? 306 ALA A N   1 
ATOM   2343 C CA  . ALA A 1 306 ? 42.443  15.740 34.763 1.00 24.15 ? 306 ALA A CA  1 
ATOM   2344 C C   . ALA A 1 306 ? 40.986  15.363 34.492 1.00 24.65 ? 306 ALA A C   1 
ATOM   2345 O O   . ALA A 1 306 ? 40.560  14.247 34.799 1.00 24.87 ? 306 ALA A O   1 
ATOM   2346 C CB  . ALA A 1 306 ? 42.535  16.643 35.980 1.00 23.04 ? 306 ALA A CB  1 
ATOM   2347 N N   . SER A 1 307 ? 40.228  16.291 33.916 1.00 23.90 ? 307 SER A N   1 
ATOM   2348 C CA  . SER A 1 307 ? 38.823  16.057 33.619 1.00 23.25 ? 307 SER A CA  1 
ATOM   2349 C C   . SER A 1 307 ? 38.605  14.982 32.554 1.00 24.11 ? 307 SER A C   1 
ATOM   2350 O O   . SER A 1 307 ? 37.763  14.094 32.719 1.00 24.35 ? 307 SER A O   1 
ATOM   2351 C CB  . SER A 1 307 ? 38.161  17.362 33.175 1.00 21.92 ? 307 SER A CB  1 
ATOM   2352 O OG  . SER A 1 307 ? 38.788  17.877 32.016 1.00 21.79 ? 307 SER A OG  1 
ATOM   2353 N N   . ILE A 1 308 ? 39.355  15.059 31.459 1.00 23.21 ? 308 ILE A N   1 
ATOM   2354 C CA  . ILE A 1 308 ? 39.201  14.078 30.391 1.00 23.25 ? 308 ILE A CA  1 
ATOM   2355 C C   . ILE A 1 308 ? 39.640  12.687 30.852 1.00 23.30 ? 308 ILE A C   1 
ATOM   2356 O O   . ILE A 1 308 ? 38.974  11.700 30.560 1.00 24.18 ? 308 ILE A O   1 
ATOM   2357 C CB  . ILE A 1 308 ? 39.991  14.507 29.116 1.00 23.26 ? 308 ILE A CB  1 
ATOM   2358 C CG1 . ILE A 1 308 ? 39.405  15.805 28.557 1.00 21.99 ? 308 ILE A CG1 1 
ATOM   2359 C CG2 . ILE A 1 308 ? 39.912  13.430 28.045 1.00 21.20 ? 308 ILE A CG2 1 
ATOM   2360 C CD1 . ILE A 1 308 ? 37.960  15.688 28.133 1.00 20.88 ? 308 ILE A CD1 1 
ATOM   2361 N N   . LEU A 1 309 ? 40.751  12.600 31.578 1.00 23.49 ? 309 LEU A N   1 
ATOM   2362 C CA  . LEU A 1 309 ? 41.216  11.301 32.064 1.00 22.69 ? 309 LEU A CA  1 
ATOM   2363 C C   . LEU A 1 309 ? 40.274  10.762 33.143 1.00 22.42 ? 309 LEU A C   1 
ATOM   2364 O O   . LEU A 1 309 ? 40.155  9.551  33.322 1.00 22.91 ? 309 LEU A O   1 
ATOM   2365 C CB  . LEU A 1 309 ? 42.656  11.400 32.595 1.00 20.10 ? 309 LEU A CB  1 
ATOM   2366 C CG  . LEU A 1 309 ? 43.712  11.642 31.505 1.00 20.49 ? 309 LEU A CG  1 
ATOM   2367 C CD1 . LEU A 1 309 ? 45.084  11.820 32.115 1.00 19.87 ? 309 LEU A CD1 1 
ATOM   2368 C CD2 . LEU A 1 309 ? 43.720  10.480 30.539 1.00 17.10 ? 309 LEU A CD2 1 
ATOM   2369 N N   . ALA A 1 310 ? 39.596  11.665 33.848 1.00 21.83 ? 310 ALA A N   1 
ATOM   2370 C CA  . ALA A 1 310 ? 38.651  11.270 34.887 1.00 21.26 ? 310 ALA A CA  1 
ATOM   2371 C C   . ALA A 1 310 ? 37.452  10.565 34.266 1.00 21.83 ? 310 ALA A C   1 
ATOM   2372 O O   . ALA A 1 310 ? 36.755  9.811  34.942 1.00 21.98 ? 310 ALA A O   1 
ATOM   2373 C CB  . ALA A 1 310 ? 38.185  12.485 35.666 1.00 21.00 ? 310 ALA A CB  1 
ATOM   2374 N N   . GLY A 1 311 ? 37.208  10.821 32.980 1.00 21.56 ? 311 GLY A N   1 
ATOM   2375 C CA  . GLY A 1 311 ? 36.096  10.176 32.299 1.00 21.97 ? 311 GLY A CA  1 
ATOM   2376 C C   . GLY A 1 311 ? 35.060  11.067 31.623 1.00 22.56 ? 311 GLY A C   1 
ATOM   2377 O O   . GLY A 1 311 ? 34.187  10.567 30.907 1.00 22.93 ? 311 GLY A O   1 
ATOM   2378 N N   . LEU A 1 312 ? 35.131  12.377 31.842 1.00 21.24 ? 312 LEU A N   1 
ATOM   2379 C CA  . LEU A 1 312 ? 34.167  13.281 31.226 1.00 20.53 ? 312 LEU A CA  1 
ATOM   2380 C C   . LEU A 1 312 ? 34.239  13.151 29.706 1.00 20.34 ? 312 LEU A C   1 
ATOM   2381 O O   . LEU A 1 312 ? 35.317  12.976 29.138 1.00 20.44 ? 312 LEU A O   1 
ATOM   2382 C CB  . LEU A 1 312 ? 34.429  14.729 31.666 1.00 19.66 ? 312 LEU A CB  1 
ATOM   2383 C CG  . LEU A 1 312 ? 34.036  15.054 33.111 1.00 18.59 ? 312 LEU A CG  1 
ATOM   2384 C CD1 . LEU A 1 312 ? 34.922  14.284 34.069 1.00 20.08 ? 312 LEU A CD1 1 
ATOM   2385 C CD2 . LEU A 1 312 ? 34.160  16.541 33.367 1.00 18.56 ? 312 LEU A CD2 1 
ATOM   2386 N N   . ASP A 1 313 ? 33.086  13.238 29.053 1.00 19.27 ? 313 ASP A N   1 
ATOM   2387 C CA  . ASP A 1 313 ? 33.013  13.092 27.604 1.00 18.52 ? 313 ASP A CA  1 
ATOM   2388 C C   . ASP A 1 313 ? 32.837  14.403 26.840 1.00 18.04 ? 313 ASP A C   1 
ATOM   2389 O O   . ASP A 1 313 ? 33.449  14.595 25.793 1.00 17.08 ? 313 ASP A O   1 
ATOM   2390 C CB  . ASP A 1 313 ? 31.881  12.126 27.261 1.00 17.63 ? 313 ASP A CB  1 
ATOM   2391 C CG  . ASP A 1 313 ? 31.935  10.857 28.096 1.00 18.69 ? 313 ASP A CG  1 
ATOM   2392 O OD1 . ASP A 1 313 ? 33.006  10.218 28.133 1.00 17.24 ? 313 ASP A OD1 1 
ATOM   2393 O OD2 . ASP A 1 313 ? 30.911  10.497 28.716 1.00 20.76 ? 313 ASP A OD2 1 
ATOM   2394 N N   . MET A 1 314 ? 31.996  15.296 27.357 1.00 18.59 ? 314 MET A N   1 
ATOM   2395 C CA  . MET A 1 314 ? 31.759  16.589 26.717 1.00 18.16 ? 314 MET A CA  1 
ATOM   2396 C C   . MET A 1 314 ? 32.032  17.709 27.705 1.00 17.91 ? 314 MET A C   1 
ATOM   2397 O O   . MET A 1 314 ? 31.628  17.636 28.864 1.00 18.48 ? 314 MET A O   1 
ATOM   2398 C CB  . MET A 1 314 ? 30.317  16.702 26.222 1.00 17.92 ? 314 MET A CB  1 
ATOM   2399 C CG  . MET A 1 314 ? 30.006  18.035 25.553 1.00 17.07 ? 314 MET A CG  1 
ATOM   2400 S SD  . MET A 1 314 ? 28.263  18.217 25.106 1.00 19.95 ? 314 MET A SD  1 
ATOM   2401 C CE  . MET A 1 314 ? 28.140  17.024 23.769 1.00 13.95 ? 314 MET A CE  1 
ATOM   2402 N N   . ILE A 1 315 ? 32.701  18.757 27.241 1.00 17.55 ? 315 ILE A N   1 
ATOM   2403 C CA  . ILE A 1 315 ? 33.032  19.876 28.111 1.00 17.43 ? 315 ILE A CA  1 
ATOM   2404 C C   . ILE A 1 315 ? 32.263  21.150 27.798 1.00 18.33 ? 315 ILE A C   1 
ATOM   2405 O O   . ILE A 1 315 ? 32.157  21.568 26.647 1.00 18.16 ? 315 ILE A O   1 
ATOM   2406 C CB  . ILE A 1 315 ? 34.545  20.188 28.050 1.00 16.83 ? 315 ILE A CB  1 
ATOM   2407 C CG1 . ILE A 1 315 ? 35.350  18.956 28.488 1.00 13.96 ? 315 ILE A CG1 1 
ATOM   2408 C CG2 . ILE A 1 315 ? 34.864  21.411 28.916 1.00 15.35 ? 315 ILE A CG2 1 
ATOM   2409 C CD1 . ILE A 1 315 ? 35.043  18.473 29.897 1.00 9.57  ? 315 ILE A CD1 1 
ATOM   2410 N N   . MET A 1 316 ? 31.731  21.763 28.845 1.00 19.92 ? 316 MET A N   1 
ATOM   2411 C CA  . MET A 1 316 ? 30.982  23.012 28.732 1.00 19.92 ? 316 MET A CA  1 
ATOM   2412 C C   . MET A 1 316 ? 32.003  24.117 29.033 1.00 19.99 ? 316 MET A C   1 
ATOM   2413 O O   . MET A 1 316 ? 32.069  24.636 30.151 1.00 20.61 ? 316 MET A O   1 
ATOM   2414 C CB  . MET A 1 316 ? 29.863  23.007 29.769 1.00 20.01 ? 316 MET A CB  1 
ATOM   2415 C CG  . MET A 1 316 ? 28.839  24.099 29.613 1.00 20.99 ? 316 MET A CG  1 
ATOM   2416 S SD  . MET A 1 316 ? 27.495  23.821 30.764 1.00 21.65 ? 316 MET A SD  1 
ATOM   2417 C CE  . MET A 1 316 ? 27.442  25.307 31.528 1.00 22.04 ? 316 MET A CE  1 
ATOM   2418 N N   . VAL A 1 317 ? 32.793  24.463 28.023 1.00 20.11 ? 317 VAL A N   1 
ATOM   2419 C CA  . VAL A 1 317 ? 33.865  25.448 28.145 1.00 20.58 ? 317 VAL A CA  1 
ATOM   2420 C C   . VAL A 1 317 ? 33.591  26.719 28.959 1.00 21.30 ? 317 VAL A C   1 
ATOM   2421 O O   . VAL A 1 317 ? 34.239  26.944 29.983 1.00 21.37 ? 317 VAL A O   1 
ATOM   2422 C CB  . VAL A 1 317 ? 34.409  25.820 26.745 1.00 21.12 ? 317 VAL A CB  1 
ATOM   2423 C CG1 . VAL A 1 317 ? 35.689  26.645 26.871 1.00 20.16 ? 317 VAL A CG1 1 
ATOM   2424 C CG2 . VAL A 1 317 ? 34.682  24.546 25.956 1.00 20.14 ? 317 VAL A CG2 1 
ATOM   2425 N N   . PRO A 1 318 ? 32.646  27.572 28.526 1.00 21.37 ? 318 PRO A N   1 
ATOM   2426 C CA  . PRO A 1 318 ? 31.788  27.500 27.348 1.00 21.37 ? 318 PRO A CA  1 
ATOM   2427 C C   . PRO A 1 318 ? 32.161  28.603 26.358 1.00 22.00 ? 318 PRO A C   1 
ATOM   2428 O O   . PRO A 1 318 ? 31.524  28.746 25.318 1.00 22.62 ? 318 PRO A O   1 
ATOM   2429 C CB  . PRO A 1 318 ? 30.419  27.734 27.944 1.00 20.84 ? 318 PRO A CB  1 
ATOM   2430 C CG  . PRO A 1 318 ? 30.717  28.881 28.889 1.00 19.98 ? 318 PRO A CG  1 
ATOM   2431 C CD  . PRO A 1 318 ? 32.074  28.523 29.502 1.00 20.07 ? 318 PRO A CD  1 
ATOM   2432 N N   . ASN A 1 319 ? 33.184  29.386 26.687 1.00 21.71 ? 319 ASN A N   1 
ATOM   2433 C CA  . ASN A 1 319 ? 33.601  30.482 25.820 1.00 22.81 ? 319 ASN A CA  1 
ATOM   2434 C C   . ASN A 1 319 ? 34.937  30.283 25.113 1.00 24.70 ? 319 ASN A C   1 
ATOM   2435 O O   . ASN A 1 319 ? 35.005  30.337 23.886 1.00 25.14 ? 319 ASN A O   1 
ATOM   2436 C CB  . ASN A 1 319 ? 33.653  31.793 26.610 1.00 21.01 ? 319 ASN A CB  1 
ATOM   2437 C CG  . ASN A 1 319 ? 32.310  32.165 27.218 1.00 21.05 ? 319 ASN A CG  1 
ATOM   2438 O OD1 . ASN A 1 319 ? 31.295  32.199 26.530 1.00 23.20 ? 319 ASN A OD1 1 
ATOM   2439 N ND2 . ASN A 1 319 ? 32.304  32.453 28.509 1.00 18.34 ? 319 ASN A ND2 1 
ATOM   2440 N N   . LYS A 1 320 ? 35.995  30.059 25.888 1.00 27.40 ? 320 LYS A N   1 
ATOM   2441 C CA  . LYS A 1 320 ? 37.337  29.884 25.333 1.00 28.14 ? 320 LYS A CA  1 
ATOM   2442 C C   . LYS A 1 320 ? 37.541  28.513 24.695 1.00 27.19 ? 320 LYS A C   1 
ATOM   2443 O O   . LYS A 1 320 ? 38.341  27.704 25.165 1.00 27.80 ? 320 LYS A O   1 
ATOM   2444 C CB  . LYS A 1 320 ? 38.374  30.118 26.434 1.00 31.24 ? 320 LYS A CB  1 
ATOM   2445 C CG  . LYS A 1 320 ? 38.228  31.470 27.128 1.00 34.82 ? 320 LYS A CG  1 
ATOM   2446 C CD  . LYS A 1 320 ? 39.209  31.620 28.288 1.00 40.09 ? 320 LYS A CD  1 
ATOM   2447 C CE  . LYS A 1 320 ? 38.902  30.642 29.420 1.00 41.62 ? 320 LYS A CE  1 
ATOM   2448 N NZ  . LYS A 1 320 ? 39.935  30.650 30.506 1.00 44.08 ? 320 LYS A NZ  1 
ATOM   2449 N N   . TYR A 1 321 ? 36.817  28.268 23.608 1.00 25.94 ? 321 TYR A N   1 
ATOM   2450 C CA  . TYR A 1 321 ? 36.893  27.000 22.897 1.00 24.20 ? 321 TYR A CA  1 
ATOM   2451 C C   . TYR A 1 321 ? 38.221  26.825 22.166 1.00 24.73 ? 321 TYR A C   1 
ATOM   2452 O O   . TYR A 1 321 ? 38.690  25.698 21.974 1.00 23.60 ? 321 TYR A O   1 
ATOM   2453 C CB  . TYR A 1 321 ? 35.726  26.888 21.910 1.00 22.17 ? 321 TYR A CB  1 
ATOM   2454 C CG  . TYR A 1 321 ? 35.670  28.002 20.884 1.00 21.32 ? 321 TYR A CG  1 
ATOM   2455 C CD1 . TYR A 1 321 ? 36.454  27.960 19.726 1.00 18.98 ? 321 TYR A CD1 1 
ATOM   2456 C CD2 . TYR A 1 321 ? 34.849  29.110 21.084 1.00 19.84 ? 321 TYR A CD2 1 
ATOM   2457 C CE1 . TYR A 1 321 ? 36.419  28.996 18.798 1.00 17.71 ? 321 TYR A CE1 1 
ATOM   2458 C CE2 . TYR A 1 321 ? 34.807  30.151 20.165 1.00 20.81 ? 321 TYR A CE2 1 
ATOM   2459 C CZ  . TYR A 1 321 ? 35.595  30.090 19.026 1.00 20.93 ? 321 TYR A CZ  1 
ATOM   2460 O OH  . TYR A 1 321 ? 35.561  31.136 18.133 1.00 20.57 ? 321 TYR A OH  1 
ATOM   2461 N N   . GLN A 1 322 ? 38.828  27.933 21.750 1.00 25.87 ? 322 GLN A N   1 
ATOM   2462 C CA  . GLN A 1 322 ? 40.102  27.834 21.056 1.00 26.42 ? 322 GLN A CA  1 
ATOM   2463 C C   . GLN A 1 322 ? 41.105  27.243 22.033 1.00 25.68 ? 322 GLN A C   1 
ATOM   2464 O O   . GLN A 1 322 ? 41.803  26.277 21.710 1.00 23.39 ? 322 GLN A O   1 
ATOM   2465 C CB  . GLN A 1 322 ? 40.595  29.199 20.575 1.00 27.73 ? 322 GLN A CB  1 
ATOM   2466 C CG  . GLN A 1 322 ? 41.814  29.075 19.665 1.00 34.32 ? 322 GLN A CG  1 
ATOM   2467 C CD  . GLN A 1 322 ? 42.315  30.409 19.139 1.00 39.00 ? 322 GLN A CD  1 
ATOM   2468 O OE1 . GLN A 1 322 ? 41.521  31.282 18.769 1.00 42.16 ? 322 GLN A OE1 1 
ATOM   2469 N NE2 . GLN A 1 322 ? 43.638  30.568 19.084 1.00 38.62 ? 322 GLN A NE2 1 
ATOM   2470 N N   . GLN A 1 323 ? 41.157  27.816 23.235 1.00 24.10 ? 323 GLN A N   1 
ATOM   2471 C CA  . GLN A 1 323 ? 42.071  27.329 24.252 1.00 25.13 ? 323 GLN A CA  1 
ATOM   2472 C C   . GLN A 1 323 ? 41.788  25.860 24.553 1.00 24.72 ? 323 GLN A C   1 
ATOM   2473 O O   . GLN A 1 323 ? 42.706  25.041 24.577 1.00 24.83 ? 323 GLN A O   1 
ATOM   2474 C CB  . GLN A 1 323 ? 41.958  28.159 25.539 1.00 28.24 ? 323 GLN A CB  1 
ATOM   2475 C CG  . GLN A 1 323 ? 42.953  27.726 26.623 1.00 35.02 ? 323 GLN A CG  1 
ATOM   2476 C CD  . GLN A 1 323 ? 42.888  28.564 27.896 1.00 39.52 ? 323 GLN A CD  1 
ATOM   2477 O OE1 . GLN A 1 323 ? 41.839  28.659 28.549 1.00 42.25 ? 323 GLN A OE1 1 
ATOM   2478 N NE2 . GLN A 1 323 ? 44.018  29.167 28.262 1.00 39.48 ? 323 GLN A NE2 1 
ATOM   2479 N N   . PHE A 1 324 ? 40.520  25.520 24.775 1.00 24.10 ? 324 PHE A N   1 
ATOM   2480 C CA  . PHE A 1 324 ? 40.163  24.133 25.069 1.00 23.10 ? 324 PHE A CA  1 
ATOM   2481 C C   . PHE A 1 324 ? 40.612  23.172 23.970 1.00 22.44 ? 324 PHE A C   1 
ATOM   2482 O O   . PHE A 1 324 ? 41.359  22.235 24.229 1.00 22.47 ? 324 PHE A O   1 
ATOM   2483 C CB  . PHE A 1 324 ? 38.648  23.977 25.269 1.00 21.70 ? 324 PHE A CB  1 
ATOM   2484 C CG  . PHE A 1 324 ? 38.210  22.544 25.468 1.00 18.22 ? 324 PHE A CG  1 
ATOM   2485 C CD1 . PHE A 1 324 ? 38.526  21.860 26.642 1.00 18.23 ? 324 PHE A CD1 1 
ATOM   2486 C CD2 . PHE A 1 324 ? 37.543  21.859 24.457 1.00 16.47 ? 324 PHE A CD2 1 
ATOM   2487 C CE1 . PHE A 1 324 ? 38.189  20.509 26.805 1.00 16.47 ? 324 PHE A CE1 1 
ATOM   2488 C CE2 . PHE A 1 324 ? 37.202  20.513 24.606 1.00 16.33 ? 324 PHE A CE2 1 
ATOM   2489 C CZ  . PHE A 1 324 ? 37.529  19.836 25.784 1.00 16.87 ? 324 PHE A CZ  1 
ATOM   2490 N N   . ILE A 1 325 ? 40.148  23.402 22.747 1.00 21.97 ? 325 ILE A N   1 
ATOM   2491 C CA  . ILE A 1 325 ? 40.499  22.528 21.638 1.00 23.47 ? 325 ILE A CA  1 
ATOM   2492 C C   . ILE A 1 325 ? 42.005  22.439 21.412 1.00 23.40 ? 325 ILE A C   1 
ATOM   2493 O O   . ILE A 1 325 ? 42.539  21.358 21.157 1.00 24.95 ? 325 ILE A O   1 
ATOM   2494 C CB  . ILE A 1 325 ? 39.821  22.984 20.313 1.00 24.36 ? 325 ILE A CB  1 
ATOM   2495 C CG1 . ILE A 1 325 ? 38.299  22.935 20.458 1.00 23.78 ? 325 ILE A CG1 1 
ATOM   2496 C CG2 . ILE A 1 325 ? 40.260  22.084 19.163 1.00 21.92 ? 325 ILE A CG2 1 
ATOM   2497 C CD1 . ILE A 1 325 ? 37.552  23.385 19.222 1.00 24.78 ? 325 ILE A CD1 1 
ATOM   2498 N N   . SER A 1 326 ? 42.695  23.568 21.509 1.00 22.33 ? 326 SER A N   1 
ATOM   2499 C CA  . SER A 1 326 ? 44.135  23.569 21.284 1.00 21.49 ? 326 SER A CA  1 
ATOM   2500 C C   . SER A 1 326 ? 44.861  22.681 22.288 1.00 21.18 ? 326 SER A C   1 
ATOM   2501 O O   . SER A 1 326 ? 45.652  21.815 21.907 1.00 22.03 ? 326 SER A O   1 
ATOM   2502 C CB  . SER A 1 326 ? 44.682  24.994 21.363 1.00 21.07 ? 326 SER A CB  1 
ATOM   2503 O OG  . SER A 1 326 ? 46.007  25.043 20.870 1.00 24.10 ? 326 SER A OG  1 
ATOM   2504 N N   . ILE A 1 327 ? 44.574  22.897 23.569 1.00 19.87 ? 327 ILE A N   1 
ATOM   2505 C CA  . ILE A 1 327 ? 45.193  22.146 24.651 1.00 19.01 ? 327 ILE A CA  1 
ATOM   2506 C C   . ILE A 1 327 ? 44.911  20.648 24.612 1.00 20.11 ? 327 ILE A C   1 
ATOM   2507 O O   . ILE A 1 327 ? 45.822  19.836 24.808 1.00 20.57 ? 327 ILE A O   1 
ATOM   2508 C CB  . ILE A 1 327 ? 44.759  22.704 26.015 1.00 17.79 ? 327 ILE A CB  1 
ATOM   2509 C CG1 . ILE A 1 327 ? 45.426  24.060 26.241 1.00 18.04 ? 327 ILE A CG1 1 
ATOM   2510 C CG2 . ILE A 1 327 ? 45.124  21.729 27.128 1.00 17.63 ? 327 ILE A CG2 1 
ATOM   2511 C CD1 . ILE A 1 327 ? 45.005  24.746 27.523 1.00 21.90 ? 327 ILE A CD1 1 
ATOM   2512 N N   . LEU A 1 328 ? 43.660  20.274 24.368 1.00 19.21 ? 328 LEU A N   1 
ATOM   2513 C CA  . LEU A 1 328 ? 43.321  18.860 24.310 1.00 20.26 ? 328 LEU A CA  1 
ATOM   2514 C C   . LEU A 1 328 ? 44.040  18.212 23.121 1.00 22.05 ? 328 LEU A C   1 
ATOM   2515 O O   . LEU A 1 328 ? 44.544  17.086 23.213 1.00 21.05 ? 328 LEU A O   1 
ATOM   2516 C CB  . LEU A 1 328 ? 41.806  18.677 24.183 1.00 19.18 ? 328 LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 328 ? 41.320  17.227 24.142 1.00 18.07 ? 328 LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 328 ? 41.996  16.419 25.239 1.00 17.93 ? 328 LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 328 ? 39.819  17.199 24.309 1.00 18.49 ? 328 LEU A CD2 1 
ATOM   2520 N N   . THR A 1 329 ? 44.092  18.929 22.004 1.00 21.49 ? 329 THR A N   1 
ATOM   2521 C CA  . THR A 1 329 ? 44.768  18.409 20.830 1.00 23.33 ? 329 THR A CA  1 
ATOM   2522 C C   . THR A 1 329 ? 46.223  18.111 21.198 1.00 24.43 ? 329 THR A C   1 
ATOM   2523 O O   . THR A 1 329 ? 46.737  17.022 20.921 1.00 24.92 ? 329 THR A O   1 
ATOM   2524 C CB  . THR A 1 329 ? 44.733  19.422 19.673 1.00 23.36 ? 329 THR A CB  1 
ATOM   2525 O OG1 . THR A 1 329 ? 43.373  19.674 19.301 1.00 24.59 ? 329 THR A OG1 1 
ATOM   2526 C CG2 . THR A 1 329 ? 45.484  18.882 18.476 1.00 20.76 ? 329 THR A CG2 1 
ATOM   2527 N N   . GLY A 1 330 ? 46.880  19.082 21.830 1.00 23.61 ? 330 GLY A N   1 
ATOM   2528 C CA  . GLY A 1 330 ? 48.262  18.892 22.228 1.00 23.98 ? 330 GLY A CA  1 
ATOM   2529 C C   . GLY A 1 330 ? 48.447  17.617 23.034 1.00 24.91 ? 330 GLY A C   1 
ATOM   2530 O O   . GLY A 1 330 ? 49.296  16.785 22.718 1.00 24.91 ? 330 GLY A O   1 
ATOM   2531 N N   . HIS A 1 331 ? 47.641  17.462 24.077 1.00 25.17 ? 331 HIS A N   1 
ATOM   2532 C CA  . HIS A 1 331 ? 47.714  16.290 24.932 1.00 25.60 ? 331 HIS A CA  1 
ATOM   2533 C C   . HIS A 1 331 ? 47.580  14.976 24.171 1.00 25.70 ? 331 HIS A C   1 
ATOM   2534 O O   . HIS A 1 331 ? 48.313  14.025 24.444 1.00 26.01 ? 331 HIS A O   1 
ATOM   2535 C CB  . HIS A 1 331 ? 46.642  16.376 26.019 1.00 26.99 ? 331 HIS A CB  1 
ATOM   2536 C CG  . HIS A 1 331 ? 46.941  17.393 27.075 1.00 28.69 ? 331 HIS A CG  1 
ATOM   2537 N ND1 . HIS A 1 331 ? 46.044  17.724 28.066 1.00 28.33 ? 331 HIS A ND1 1 
ATOM   2538 C CD2 . HIS A 1 331 ? 48.047  18.142 27.303 1.00 30.02 ? 331 HIS A CD2 1 
ATOM   2539 C CE1 . HIS A 1 331 ? 46.583  18.633 28.860 1.00 29.67 ? 331 HIS A CE1 1 
ATOM   2540 N NE2 . HIS A 1 331 ? 47.798  18.904 28.419 1.00 29.86 ? 331 HIS A NE2 1 
ATOM   2541 N N   . VAL A 1 332 ? 46.650  14.910 23.223 1.00 24.89 ? 332 VAL A N   1 
ATOM   2542 C CA  . VAL A 1 332 ? 46.482  13.683 22.461 1.00 23.94 ? 332 VAL A CA  1 
ATOM   2543 C C   . VAL A 1 332 ? 47.706  13.474 21.585 1.00 24.24 ? 332 VAL A C   1 
ATOM   2544 O O   . VAL A 1 332 ? 48.295  12.396 21.594 1.00 24.08 ? 332 VAL A O   1 
ATOM   2545 C CB  . VAL A 1 332 ? 45.216  13.718 21.584 1.00 24.78 ? 332 VAL A CB  1 
ATOM   2546 C CG1 . VAL A 1 332 ? 45.120  12.437 20.752 1.00 22.68 ? 332 VAL A CG1 1 
ATOM   2547 C CG2 . VAL A 1 332 ? 43.987  13.868 22.469 1.00 22.56 ? 332 VAL A CG2 1 
ATOM   2548 N N   . ASN A 1 333 ? 48.100  14.503 20.836 1.00 24.49 ? 333 ASN A N   1 
ATOM   2549 C CA  . ASN A 1 333 ? 49.283  14.393 19.983 1.00 24.68 ? 333 ASN A CA  1 
ATOM   2550 C C   . ASN A 1 333 ? 50.509  13.947 20.787 1.00 25.23 ? 333 ASN A C   1 
ATOM   2551 O O   . ASN A 1 333 ? 51.378  13.246 20.269 1.00 25.18 ? 333 ASN A O   1 
ATOM   2552 C CB  . ASN A 1 333 ? 49.593  15.730 19.294 1.00 23.41 ? 333 ASN A CB  1 
ATOM   2553 C CG  . ASN A 1 333 ? 48.641  16.035 18.142 1.00 25.44 ? 333 ASN A CG  1 
ATOM   2554 O OD1 . ASN A 1 333 ? 47.967  15.141 17.623 1.00 27.49 ? 333 ASN A OD1 1 
ATOM   2555 N ND2 . ASN A 1 333 ? 48.596  17.296 17.725 1.00 23.38 ? 333 ASN A ND2 1 
ATOM   2556 N N   . GLY A 1 334 ? 50.569  14.344 22.054 1.00 24.97 ? 334 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 334 ? 51.703  13.988 22.886 1.00 25.30 ? 334 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 334 ? 51.585  12.690 23.663 1.00 27.08 ? 334 GLY A C   1 
ATOM   2559 O O   . GLY A 1 334 ? 52.522  12.297 24.361 1.00 26.13 ? 334 GLY A O   1 
ATOM   2560 N N   . GLY A 1 335 ? 50.437  12.025 23.559 1.00 28.23 ? 335 GLY A N   1 
ATOM   2561 C CA  . GLY A 1 335 ? 50.245  10.769 24.266 1.00 27.08 ? 335 GLY A CA  1 
ATOM   2562 C C   . GLY A 1 335 ? 49.794  10.894 25.712 1.00 27.29 ? 335 GLY A C   1 
ATOM   2563 O O   . GLY A 1 335 ? 49.675  9.882  26.407 1.00 28.55 ? 335 GLY A O   1 
ATOM   2564 N N   . VAL A 1 336 ? 49.546  12.116 26.176 1.00 25.87 ? 336 VAL A N   1 
ATOM   2565 C CA  . VAL A 1 336 ? 49.093  12.330 27.552 1.00 25.41 ? 336 VAL A CA  1 
ATOM   2566 C C   . VAL A 1 336 ? 47.684  11.763 27.712 1.00 25.32 ? 336 VAL A C   1 
ATOM   2567 O O   . VAL A 1 336 ? 47.318  11.266 28.774 1.00 25.39 ? 336 VAL A O   1 
ATOM   2568 C CB  . VAL A 1 336 ? 49.068  13.833 27.915 1.00 26.72 ? 336 VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 336 ? 48.534  14.018 29.340 1.00 27.26 ? 336 VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 336 ? 50.463  14.425 27.777 1.00 23.49 ? 336 VAL A CG2 1 
ATOM   2571 N N   . ILE A 1 337 ? 46.890  11.857 26.650 1.00 24.36 ? 337 ILE A N   1 
ATOM   2572 C CA  . ILE A 1 337 ? 45.535  11.323 26.656 1.00 23.80 ? 337 ILE A CA  1 
ATOM   2573 C C   . ILE A 1 337 ? 45.437  10.379 25.466 1.00 24.67 ? 337 ILE A C   1 
ATOM   2574 O O   . ILE A 1 337 ? 45.664  10.783 24.324 1.00 24.92 ? 337 ILE A O   1 
ATOM   2575 C CB  . ILE A 1 337 ? 44.483  12.436 26.520 1.00 23.02 ? 337 ILE A CB  1 
ATOM   2576 C CG1 . ILE A 1 337 ? 44.573  13.374 27.722 1.00 21.96 ? 337 ILE A CG1 1 
ATOM   2577 C CG2 . ILE A 1 337 ? 43.092  11.833 26.438 1.00 19.61 ? 337 ILE A CG2 1 
ATOM   2578 C CD1 . ILE A 1 337 ? 43.571  14.501 27.692 1.00 22.98 ? 337 ILE A CD1 1 
ATOM   2579 N N   . PRO A 1 338 ? 45.086  9.107  25.720 1.00 24.93 ? 338 PRO A N   1 
ATOM   2580 C CA  . PRO A 1 338 ? 44.958  8.073  24.690 1.00 24.96 ? 338 PRO A CA  1 
ATOM   2581 C C   . PRO A 1 338 ? 43.769  8.299  23.770 1.00 27.14 ? 338 PRO A C   1 
ATOM   2582 O O   . PRO A 1 338 ? 42.759  8.888  24.170 1.00 27.53 ? 338 PRO A O   1 
ATOM   2583 C CB  . PRO A 1 338 ? 44.781  6.781  25.497 1.00 24.47 ? 338 PRO A CB  1 
ATOM   2584 C CG  . PRO A 1 338 ? 44.947  7.185  26.951 1.00 24.19 ? 338 PRO A CG  1 
ATOM   2585 C CD  . PRO A 1 338 ? 44.541  8.619  26.993 1.00 24.26 ? 338 PRO A CD  1 
ATOM   2586 N N   . MET A 1 339 ? 43.887  7.817  22.540 1.00 27.63 ? 339 MET A N   1 
ATOM   2587 C CA  . MET A 1 339 ? 42.802  7.947  21.586 1.00 28.48 ? 339 MET A CA  1 
ATOM   2588 C C   . MET A 1 339 ? 41.581  7.197  22.101 1.00 27.46 ? 339 MET A C   1 
ATOM   2589 O O   . MET A 1 339 ? 40.447  7.560  21.780 1.00 28.40 ? 339 MET A O   1 
ATOM   2590 C CB  . MET A 1 339 ? 43.202  7.383  20.216 1.00 28.51 ? 339 MET A CB  1 
ATOM   2591 C CG  . MET A 1 339 ? 43.717  8.423  19.233 1.00 31.04 ? 339 MET A CG  1 
ATOM   2592 S SD  . MET A 1 339 ? 42.507  9.731  18.908 1.00 31.67 ? 339 MET A SD  1 
ATOM   2593 C CE  . MET A 1 339 ? 41.109  8.741  18.412 1.00 32.73 ? 339 MET A CE  1 
ATOM   2594 N N   . SER A 1 340 ? 41.806  6.156  22.902 1.00 24.91 ? 340 SER A N   1 
ATOM   2595 C CA  . SER A 1 340 ? 40.687  5.376  23.424 1.00 24.31 ? 340 SER A CA  1 
ATOM   2596 C C   . SER A 1 340 ? 39.803  6.224  24.336 1.00 23.33 ? 340 SER A C   1 
ATOM   2597 O O   . SER A 1 340 ? 38.592  6.014  24.403 1.00 22.92 ? 340 SER A O   1 
ATOM   2598 C CB  . SER A 1 340 ? 41.182  4.128  24.167 1.00 22.30 ? 340 SER A CB  1 
ATOM   2599 O OG  . SER A 1 340 ? 42.028  4.461  25.251 1.00 25.33 ? 340 SER A OG  1 
ATOM   2600 N N   . ARG A 1 341 ? 40.407  7.189  25.024 1.00 21.35 ? 341 ARG A N   1 
ATOM   2601 C CA  . ARG A 1 341 ? 39.652  8.060  25.909 1.00 20.91 ? 341 ARG A CA  1 
ATOM   2602 C C   . ARG A 1 341 ? 38.769  8.960  25.043 1.00 22.08 ? 341 ARG A C   1 
ATOM   2603 O O   . ARG A 1 341 ? 37.601  9.183  25.353 1.00 22.09 ? 341 ARG A O   1 
ATOM   2604 C CB  . ARG A 1 341 ? 40.611  8.897  26.752 1.00 20.30 ? 341 ARG A CB  1 
ATOM   2605 C CG  . ARG A 1 341 ? 39.950  9.730  27.837 1.00 19.97 ? 341 ARG A CG  1 
ATOM   2606 C CD  . ARG A 1 341 ? 39.204  8.876  28.848 1.00 18.81 ? 341 ARG A CD  1 
ATOM   2607 N NE  . ARG A 1 341 ? 37.811  8.618  28.481 1.00 18.64 ? 341 ARG A NE  1 
ATOM   2608 C CZ  . ARG A 1 341 ? 36.853  9.543  28.451 1.00 18.27 ? 341 ARG A CZ  1 
ATOM   2609 N NH1 . ARG A 1 341 ? 37.122  10.800 28.763 1.00 16.55 ? 341 ARG A NH1 1 
ATOM   2610 N NH2 . ARG A 1 341 ? 35.614  9.211  28.120 1.00 18.24 ? 341 ARG A NH2 1 
ATOM   2611 N N   . ILE A 1 342 ? 39.342  9.454  23.947 1.00 22.67 ? 342 ILE A N   1 
ATOM   2612 C CA  . ILE A 1 342 ? 38.643  10.319 22.999 1.00 20.77 ? 342 ILE A CA  1 
ATOM   2613 C C   . ILE A 1 342 ? 37.540  9.543  22.284 1.00 21.60 ? 342 ILE A C   1 
ATOM   2614 O O   . ILE A 1 342 ? 36.402  10.013 22.192 1.00 22.24 ? 342 ILE A O   1 
ATOM   2615 C CB  . ILE A 1 342 ? 39.623  10.890 21.925 1.00 20.06 ? 342 ILE A CB  1 
ATOM   2616 C CG1 . ILE A 1 342 ? 40.721  11.733 22.599 1.00 18.11 ? 342 ILE A CG1 1 
ATOM   2617 C CG2 . ILE A 1 342 ? 38.853  11.700 20.883 1.00 14.98 ? 342 ILE A CG2 1 
ATOM   2618 C CD1 . ILE A 1 342 ? 40.220  12.883 23.461 1.00 15.62 ? 342 ILE A CD1 1 
ATOM   2619 N N   . ASP A 1 343 ? 37.880  8.360  21.774 1.00 21.55 ? 343 ASP A N   1 
ATOM   2620 C CA  . ASP A 1 343 ? 36.911  7.524  21.069 1.00 21.34 ? 343 ASP A CA  1 
ATOM   2621 C C   . ASP A 1 343 ? 35.750  7.133  21.971 1.00 21.01 ? 343 ASP A C   1 
ATOM   2622 O O   . ASP A 1 343 ? 34.603  7.075  21.528 1.00 20.99 ? 343 ASP A O   1 
ATOM   2623 C CB  . ASP A 1 343 ? 37.576  6.261  20.514 1.00 22.60 ? 343 ASP A CB  1 
ATOM   2624 C CG  . ASP A 1 343 ? 38.519  6.558  19.361 1.00 25.84 ? 343 ASP A CG  1 
ATOM   2625 O OD1 . ASP A 1 343 ? 38.369  7.630  18.738 1.00 27.03 ? 343 ASP A OD1 1 
ATOM   2626 O OD2 . ASP A 1 343 ? 39.400  5.720  19.066 1.00 26.56 ? 343 ASP A OD2 1 
ATOM   2627 N N   . ASP A 1 344 ? 36.044  6.860  23.236 1.00 20.40 ? 344 ASP A N   1 
ATOM   2628 C CA  . ASP A 1 344 ? 34.994  6.502  24.178 1.00 20.70 ? 344 ASP A CA  1 
ATOM   2629 C C   . ASP A 1 344 ? 34.046  7.694  24.324 1.00 21.72 ? 344 ASP A C   1 
ATOM   2630 O O   . ASP A 1 344 ? 32.824  7.550  24.228 1.00 22.17 ? 344 ASP A O   1 
ATOM   2631 C CB  . ASP A 1 344 ? 35.597  6.149  25.540 1.00 19.62 ? 344 ASP A CB  1 
ATOM   2632 C CG  . ASP A 1 344 ? 34.544  5.981  26.617 1.00 20.86 ? 344 ASP A CG  1 
ATOM   2633 O OD1 . ASP A 1 344 ? 33.690  5.078  26.489 1.00 21.36 ? 344 ASP A OD1 1 
ATOM   2634 O OD2 . ASP A 1 344 ? 34.567  6.759  27.594 1.00 21.05 ? 344 ASP A OD2 1 
ATOM   2635 N N   . ALA A 1 345 ? 34.623  8.870  24.554 1.00 20.41 ? 345 ALA A N   1 
ATOM   2636 C CA  . ALA A 1 345 ? 33.848  10.089 24.712 1.00 20.76 ? 345 ALA A CA  1 
ATOM   2637 C C   . ALA A 1 345 ? 32.989  10.340 23.480 1.00 21.41 ? 345 ALA A C   1 
ATOM   2638 O O   . ALA A 1 345 ? 31.774  10.531 23.587 1.00 21.10 ? 345 ALA A O   1 
ATOM   2639 C CB  . ALA A 1 345 ? 34.781  11.277 24.951 1.00 19.35 ? 345 ALA A CB  1 
ATOM   2640 N N   . VAL A 1 346 ? 33.621  10.331 22.308 1.00 21.15 ? 346 VAL A N   1 
ATOM   2641 C CA  . VAL A 1 346 ? 32.899  10.571 21.065 1.00 20.18 ? 346 VAL A CA  1 
ATOM   2642 C C   . VAL A 1 346 ? 31.857  9.487  20.805 1.00 20.46 ? 346 VAL A C   1 
ATOM   2643 O O   . VAL A 1 346 ? 30.815  9.753  20.213 1.00 21.53 ? 346 VAL A O   1 
ATOM   2644 C CB  . VAL A 1 346 ? 33.867  10.680 19.869 1.00 18.73 ? 346 VAL A CB  1 
ATOM   2645 C CG1 . VAL A 1 346 ? 33.107  11.074 18.620 1.00 16.39 ? 346 VAL A CG1 1 
ATOM   2646 C CG2 . VAL A 1 346 ? 34.944  11.709 20.170 1.00 14.94 ? 346 VAL A CG2 1 
ATOM   2647 N N   . THR A 1 347 ? 32.131  8.270  21.258 1.00 20.61 ? 347 THR A N   1 
ATOM   2648 C CA  . THR A 1 347 ? 31.186  7.167  21.090 1.00 21.58 ? 347 THR A CA  1 
ATOM   2649 C C   . THR A 1 347 ? 29.898  7.464  21.865 1.00 21.83 ? 347 THR A C   1 
ATOM   2650 O O   . THR A 1 347 ? 28.797  7.345  21.333 1.00 21.79 ? 347 THR A O   1 
ATOM   2651 C CB  . THR A 1 347 ? 31.784  5.830  21.601 1.00 21.44 ? 347 THR A CB  1 
ATOM   2652 O OG1 . THR A 1 347 ? 32.830  5.407  20.715 1.00 21.02 ? 347 THR A OG1 1 
ATOM   2653 C CG2 . THR A 1 347 ? 30.708  4.747  21.684 1.00 18.76 ? 347 THR A CG2 1 
ATOM   2654 N N   . ARG A 1 348 ? 30.049  7.856  23.125 1.00 22.68 ? 348 ARG A N   1 
ATOM   2655 C CA  . ARG A 1 348 ? 28.907  8.175  23.973 1.00 22.82 ? 348 ARG A CA  1 
ATOM   2656 C C   . ARG A 1 348 ? 28.119  9.369  23.446 1.00 23.32 ? 348 ARG A C   1 
ATOM   2657 O O   . ARG A 1 348 ? 26.890  9.330  23.409 1.00 24.71 ? 348 ARG A O   1 
ATOM   2658 C CB  . ARG A 1 348 ? 29.381  8.446  25.399 1.00 22.69 ? 348 ARG A CB  1 
ATOM   2659 C CG  . ARG A 1 348 ? 29.925  7.210  26.091 1.00 22.54 ? 348 ARG A CG  1 
ATOM   2660 C CD  . ARG A 1 348 ? 30.913  7.552  27.185 1.00 20.59 ? 348 ARG A CD  1 
ATOM   2661 N NE  . ARG A 1 348 ? 31.241  6.366  27.966 1.00 20.63 ? 348 ARG A NE  1 
ATOM   2662 C CZ  . ARG A 1 348 ? 30.360  5.699  28.705 1.00 19.91 ? 348 ARG A CZ  1 
ATOM   2663 N NH1 . ARG A 1 348 ? 29.102  6.102  28.761 1.00 20.96 ? 348 ARG A NH1 1 
ATOM   2664 N NH2 . ARG A 1 348 ? 30.733  4.635  29.396 1.00 19.69 ? 348 ARG A NH2 1 
ATOM   2665 N N   . ILE A 1 349 ? 28.817  10.425 23.034 1.00 22.37 ? 349 ILE A N   1 
ATOM   2666 C CA  . ILE A 1 349 ? 28.135  11.604 22.509 1.00 21.57 ? 349 ILE A CA  1 
ATOM   2667 C C   . ILE A 1 349 ? 27.337  11.250 21.263 1.00 22.85 ? 349 ILE A C   1 
ATOM   2668 O O   . ILE A 1 349 ? 26.180  11.650 21.125 1.00 23.21 ? 349 ILE A O   1 
ATOM   2669 C CB  . ILE A 1 349 ? 29.128  12.730 22.159 1.00 20.64 ? 349 ILE A CB  1 
ATOM   2670 C CG1 . ILE A 1 349 ? 29.782  13.249 23.440 1.00 19.17 ? 349 ILE A CG1 1 
ATOM   2671 C CG2 . ILE A 1 349 ? 28.409  13.856 21.417 1.00 15.89 ? 349 ILE A CG2 1 
ATOM   2672 C CD1 . ILE A 1 349 ? 30.841  14.296 23.209 1.00 20.28 ? 349 ILE A CD1 1 
ATOM   2673 N N   . LEU A 1 350 ? 27.954  10.495 20.359 1.00 23.03 ? 350 LEU A N   1 
ATOM   2674 C CA  . LEU A 1 350 ? 27.280  10.094 19.133 1.00 22.38 ? 350 LEU A CA  1 
ATOM   2675 C C   . LEU A 1 350 ? 26.127  9.135  19.423 1.00 23.15 ? 350 LEU A C   1 
ATOM   2676 O O   . LEU A 1 350 ? 25.077  9.208  18.778 1.00 23.28 ? 350 LEU A O   1 
ATOM   2677 C CB  . LEU A 1 350 ? 28.272  9.448  18.158 1.00 22.41 ? 350 LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 350 ? 29.328  10.377 17.535 1.00 25.40 ? 350 LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 350 ? 30.258  9.572  16.630 1.00 24.00 ? 350 LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 350 ? 28.651  11.489 16.741 1.00 23.28 ? 350 LEU A CD2 1 
ATOM   2681 N N   . ARG A 1 351 ? 26.308  8.240  20.392 1.00 22.17 ? 351 ARG A N   1 
ATOM   2682 C CA  . ARG A 1 351 ? 25.243  7.299  20.716 1.00 22.30 ? 351 ARG A CA  1 
ATOM   2683 C C   . ARG A 1 351 ? 23.983  8.074  21.105 1.00 22.49 ? 351 ARG A C   1 
ATOM   2684 O O   . ARG A 1 351 ? 22.875  7.762  20.655 1.00 22.21 ? 351 ARG A O   1 
ATOM   2685 C CB  . ARG A 1 351 ? 25.656  6.373  21.864 1.00 22.53 ? 351 ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 351 ? 24.554  5.408  22.277 1.00 21.43 ? 351 ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 351 ? 24.971  4.497  23.408 1.00 21.51 ? 351 ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 351 ? 26.001  3.556  22.992 1.00 22.00 ? 351 ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 351 ? 27.243  3.559  23.459 1.00 22.97 ? 351 ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 351 ? 27.611  4.456  24.364 1.00 21.26 ? 351 ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 351 ? 28.116  2.668  23.018 1.00 21.90 ? 351 ARG A NH2 1 
ATOM   2692 N N   . VAL A 1 352 ? 24.159  9.095  21.934 1.00 21.36 ? 352 VAL A N   1 
ATOM   2693 C CA  . VAL A 1 352 ? 23.034  9.904  22.373 1.00 20.50 ? 352 VAL A CA  1 
ATOM   2694 C C   . VAL A 1 352 ? 22.365  10.617 21.193 1.00 21.15 ? 352 VAL A C   1 
ATOM   2695 O O   . VAL A 1 352 ? 21.142  10.598 21.069 1.00 21.79 ? 352 VAL A O   1 
ATOM   2696 C CB  . VAL A 1 352 ? 23.478  10.945 23.438 1.00 19.52 ? 352 VAL A CB  1 
ATOM   2697 C CG1 . VAL A 1 352 ? 22.281  11.732 23.936 1.00 15.07 ? 352 VAL A CG1 1 
ATOM   2698 C CG2 . VAL A 1 352 ? 24.155  10.237 24.599 1.00 16.29 ? 352 VAL A CG2 1 
ATOM   2699 N N   . LYS A 1 353 ? 23.158  11.230 20.318 1.00 21.51 ? 353 LYS A N   1 
ATOM   2700 C CA  . LYS A 1 353 ? 22.598  11.939 19.167 1.00 21.14 ? 353 LYS A CA  1 
ATOM   2701 C C   . LYS A 1 353 ? 21.826  11.028 18.203 1.00 21.14 ? 353 LYS A C   1 
ATOM   2702 O O   . LYS A 1 353 ? 20.760  11.402 17.694 1.00 18.67 ? 353 LYS A O   1 
ATOM   2703 C CB  . LYS A 1 353 ? 23.706  12.674 18.413 1.00 20.18 ? 353 LYS A CB  1 
ATOM   2704 C CG  . LYS A 1 353 ? 24.310  13.831 19.183 1.00 18.89 ? 353 LYS A CG  1 
ATOM   2705 C CD  . LYS A 1 353 ? 25.259  14.623 18.301 1.00 17.38 ? 353 LYS A CD  1 
ATOM   2706 C CE  . LYS A 1 353 ? 25.709  15.897 18.981 1.00 16.64 ? 353 LYS A CE  1 
ATOM   2707 N NZ  . LYS A 1 353 ? 26.665  16.650 18.125 1.00 14.28 ? 353 LYS A NZ  1 
ATOM   2708 N N   . PHE A 1 354 ? 22.367  9.837  17.952 1.00 21.38 ? 354 PHE A N   1 
ATOM   2709 C CA  . PHE A 1 354 ? 21.715  8.874  17.067 1.00 21.44 ? 354 PHE A CA  1 
ATOM   2710 C C   . PHE A 1 354 ? 20.443  8.326  17.713 1.00 22.06 ? 354 PHE A C   1 
ATOM   2711 O O   . PHE A 1 354 ? 19.399  8.231  17.068 1.00 22.40 ? 354 PHE A O   1 
ATOM   2712 C CB  . PHE A 1 354 ? 22.653  7.703  16.751 1.00 20.63 ? 354 PHE A CB  1 
ATOM   2713 C CG  . PHE A 1 354 ? 23.629  7.981  15.645 1.00 21.54 ? 354 PHE A CG  1 
ATOM   2714 C CD1 . PHE A 1 354 ? 23.180  8.248  14.355 1.00 21.38 ? 354 PHE A CD1 1 
ATOM   2715 C CD2 . PHE A 1 354 ? 25.000  7.961  15.887 1.00 21.09 ? 354 PHE A CD2 1 
ATOM   2716 C CE1 . PHE A 1 354 ? 24.083  8.488  13.320 1.00 20.99 ? 354 PHE A CE1 1 
ATOM   2717 C CE2 . PHE A 1 354 ? 25.909  8.201  14.859 1.00 21.22 ? 354 PHE A CE2 1 
ATOM   2718 C CZ  . PHE A 1 354 ? 25.448  8.464  13.574 1.00 20.96 ? 354 PHE A CZ  1 
ATOM   2719 N N   . THR A 1 355 ? 20.534  7.976  18.992 1.00 21.43 ? 355 THR A N   1 
ATOM   2720 C CA  . THR A 1 355 ? 19.396  7.420  19.702 1.00 21.71 ? 355 THR A CA  1 
ATOM   2721 C C   . THR A 1 355 ? 18.198  8.358  19.764 1.00 22.19 ? 355 THR A C   1 
ATOM   2722 O O   . THR A 1 355 ? 17.056  7.910  19.648 1.00 24.03 ? 355 THR A O   1 
ATOM   2723 C CB  . THR A 1 355 ? 19.772  7.016  21.139 1.00 21.74 ? 355 THR A CB  1 
ATOM   2724 O OG1 . THR A 1 355 ? 20.843  6.067  21.108 1.00 20.34 ? 355 THR A OG1 1 
ATOM   2725 C CG2 . THR A 1 355 ? 18.574  6.394  21.843 1.00 19.66 ? 355 THR A CG2 1 
ATOM   2726 N N   . MET A 1 356 ? 18.448  9.651  19.946 1.00 21.13 ? 356 MET A N   1 
ATOM   2727 C CA  . MET A 1 356 ? 17.356  10.615 20.032 1.00 21.45 ? 356 MET A CA  1 
ATOM   2728 C C   . MET A 1 356 ? 16.840  11.032 18.658 1.00 21.89 ? 356 MET A C   1 
ATOM   2729 O O   . MET A 1 356 ? 15.894  11.815 18.552 1.00 22.85 ? 356 MET A O   1 
ATOM   2730 C CB  . MET A 1 356 ? 17.793  11.854 20.815 1.00 21.31 ? 356 MET A CB  1 
ATOM   2731 C CG  . MET A 1 356 ? 18.830  12.727 20.121 1.00 22.67 ? 356 MET A CG  1 
ATOM   2732 S SD  . MET A 1 356 ? 19.220  14.215 21.089 1.00 23.92 ? 356 MET A SD  1 
ATOM   2733 C CE  . MET A 1 356 ? 20.540  13.597 22.027 1.00 25.94 ? 356 MET A CE  1 
ATOM   2734 N N   . GLY A 1 357 ? 17.465  10.508 17.609 1.00 21.19 ? 357 GLY A N   1 
ATOM   2735 C CA  . GLY A 1 357 ? 17.048  10.838 16.259 1.00 20.56 ? 357 GLY A CA  1 
ATOM   2736 C C   . GLY A 1 357 ? 17.529  12.174 15.711 1.00 21.82 ? 357 GLY A C   1 
ATOM   2737 O O   . GLY A 1 357 ? 16.925  12.703 14.774 1.00 22.42 ? 357 GLY A O   1 
ATOM   2738 N N   . LEU A 1 358 ? 18.611  12.720 16.268 1.00 20.62 ? 358 LEU A N   1 
ATOM   2739 C CA  . LEU A 1 358 ? 19.136  14.005 15.804 1.00 19.48 ? 358 LEU A CA  1 
ATOM   2740 C C   . LEU A 1 358 ? 19.534  14.015 14.329 1.00 19.37 ? 358 LEU A C   1 
ATOM   2741 O O   . LEU A 1 358 ? 19.406  15.040 13.667 1.00 17.83 ? 358 LEU A O   1 
ATOM   2742 C CB  . LEU A 1 358 ? 20.353  14.433 16.630 1.00 19.26 ? 358 LEU A CB  1 
ATOM   2743 C CG  . LEU A 1 358 ? 20.264  15.660 17.541 1.00 17.57 ? 358 LEU A CG  1 
ATOM   2744 C CD1 . LEU A 1 358 ? 21.674  16.178 17.755 1.00 16.20 ? 358 LEU A CD1 1 
ATOM   2745 C CD2 . LEU A 1 358 ? 19.398  16.752 16.928 1.00 16.36 ? 358 LEU A CD2 1 
ATOM   2746 N N   . PHE A 1 359 ? 20.029  12.890 13.817 1.00 18.94 ? 359 PHE A N   1 
ATOM   2747 C CA  . PHE A 1 359 ? 20.441  12.835 12.417 1.00 20.26 ? 359 PHE A CA  1 
ATOM   2748 C C   . PHE A 1 359 ? 19.240  12.819 11.493 1.00 21.69 ? 359 PHE A C   1 
ATOM   2749 O O   . PHE A 1 359 ? 19.332  13.201 10.328 1.00 21.11 ? 359 PHE A O   1 
ATOM   2750 C CB  . PHE A 1 359 ? 21.315  11.612 12.152 1.00 19.56 ? 359 PHE A CB  1 
ATOM   2751 C CG  . PHE A 1 359 ? 22.666  11.689 12.794 1.00 21.27 ? 359 PHE A CG  1 
ATOM   2752 C CD1 . PHE A 1 359 ? 22.797  11.622 14.183 1.00 20.69 ? 359 PHE A CD1 1 
ATOM   2753 C CD2 . PHE A 1 359 ? 23.811  11.845 12.014 1.00 20.40 ? 359 PHE A CD2 1 
ATOM   2754 C CE1 . PHE A 1 359 ? 24.050  11.710 14.785 1.00 22.52 ? 359 PHE A CE1 1 
ATOM   2755 C CE2 . PHE A 1 359 ? 25.070  11.935 12.602 1.00 22.37 ? 359 PHE A CE2 1 
ATOM   2756 C CZ  . PHE A 1 359 ? 25.194  11.867 13.990 1.00 23.19 ? 359 PHE A CZ  1 
ATOM   2757 N N   . GLU A 1 360 ? 18.107  12.371 12.014 1.00 22.76 ? 360 GLU A N   1 
ATOM   2758 C CA  . GLU A 1 360 ? 16.899  12.341 11.215 1.00 23.87 ? 360 GLU A CA  1 
ATOM   2759 C C   . GLU A 1 360 ? 16.152  13.661 11.339 1.00 25.09 ? 360 GLU A C   1 
ATOM   2760 O O   . GLU A 1 360 ? 15.547  14.127 10.380 1.00 26.61 ? 360 GLU A O   1 
ATOM   2761 C CB  . GLU A 1 360 ? 16.002  11.180 11.640 1.00 23.75 ? 360 GLU A CB  1 
ATOM   2762 C CG  . GLU A 1 360 ? 16.433  9.840  11.068 1.00 25.49 ? 360 GLU A CG  1 
ATOM   2763 C CD  . GLU A 1 360 ? 17.812  9.427  11.525 1.00 28.63 ? 360 GLU A CD  1 
ATOM   2764 O OE1 . GLU A 1 360 ? 17.967  9.071  12.714 1.00 30.61 ? 360 GLU A OE1 1 
ATOM   2765 O OE2 . GLU A 1 360 ? 18.744  9.467  10.696 1.00 29.95 ? 360 GLU A OE2 1 
ATOM   2766 N N   . ASN A 1 361 ? 16.209  14.281 12.512 1.00 25.37 ? 361 ASN A N   1 
ATOM   2767 C CA  . ASN A 1 361 ? 15.508  15.540 12.704 1.00 25.28 ? 361 ASN A CA  1 
ATOM   2768 C C   . ASN A 1 361 ? 16.373  16.602 13.362 1.00 25.42 ? 361 ASN A C   1 
ATOM   2769 O O   . ASN A 1 361 ? 16.152  16.980 14.511 1.00 26.93 ? 361 ASN A O   1 
ATOM   2770 C CB  . ASN A 1 361 ? 14.240  15.286 13.510 1.00 25.21 ? 361 ASN A CB  1 
ATOM   2771 C CG  . ASN A 1 361 ? 13.260  14.404 12.763 1.00 24.72 ? 361 ASN A CG  1 
ATOM   2772 O OD1 . ASN A 1 361 ? 12.620  14.845 11.806 1.00 23.13 ? 361 ASN A OD1 1 
ATOM   2773 N ND2 . ASN A 1 361 ? 13.160  13.141 13.177 1.00 23.43 ? 361 ASN A ND2 1 
ATOM   2774 N N   . PRO A 1 362 ? 17.368  17.110 12.620 1.00 24.73 ? 362 PRO A N   1 
ATOM   2775 C CA  . PRO A 1 362 ? 18.312  18.133 13.067 1.00 23.78 ? 362 PRO A CA  1 
ATOM   2776 C C   . PRO A 1 362 ? 17.668  19.495 13.229 1.00 23.75 ? 362 PRO A C   1 
ATOM   2777 O O   . PRO A 1 362 ? 18.156  20.327 13.991 1.00 23.21 ? 362 PRO A O   1 
ATOM   2778 C CB  . PRO A 1 362 ? 19.359  18.162 11.950 1.00 25.21 ? 362 PRO A CB  1 
ATOM   2779 C CG  . PRO A 1 362 ? 19.163  16.877 11.213 1.00 25.41 ? 362 PRO A CG  1 
ATOM   2780 C CD  . PRO A 1 362 ? 17.686  16.685 11.249 1.00 24.28 ? 362 PRO A CD  1 
ATOM   2781 N N   . TYR A 1 363 ? 16.576  19.727 12.510 1.00 23.41 ? 363 TYR A N   1 
ATOM   2782 C CA  . TYR A 1 363 ? 15.914  21.028 12.566 1.00 24.92 ? 363 TYR A CA  1 
ATOM   2783 C C   . TYR A 1 363 ? 14.630  21.121 13.382 1.00 24.85 ? 363 TYR A C   1 
ATOM   2784 O O   . TYR A 1 363 ? 13.999  20.115 13.704 1.00 24.80 ? 363 TYR A O   1 
ATOM   2785 C CB  . TYR A 1 363 ? 15.662  21.522 11.145 1.00 23.37 ? 363 TYR A CB  1 
ATOM   2786 C CG  . TYR A 1 363 ? 16.936  21.654 10.354 1.00 23.30 ? 363 TYR A CG  1 
ATOM   2787 C CD1 . TYR A 1 363 ? 17.825  22.700 10.598 1.00 22.75 ? 363 TYR A CD1 1 
ATOM   2788 C CD2 . TYR A 1 363 ? 17.269  20.715 9.383  1.00 21.75 ? 363 TYR A CD2 1 
ATOM   2789 C CE1 . TYR A 1 363 ? 19.018  22.807 9.886  1.00 23.94 ? 363 TYR A CE1 1 
ATOM   2790 C CE2 . TYR A 1 363 ? 18.455  20.808 8.670  1.00 21.24 ? 363 TYR A CE2 1 
ATOM   2791 C CZ  . TYR A 1 363 ? 19.326  21.855 8.922  1.00 23.60 ? 363 TYR A CZ  1 
ATOM   2792 O OH  . TYR A 1 363 ? 20.498  21.949 8.206  1.00 21.96 ? 363 TYR A OH  1 
ATOM   2793 N N   . ALA A 1 364 ? 14.255  22.353 13.710 1.00 25.33 ? 364 ALA A N   1 
ATOM   2794 C CA  . ALA A 1 364 ? 13.063  22.619 14.499 1.00 24.57 ? 364 ALA A CA  1 
ATOM   2795 C C   . ALA A 1 364 ? 11.777  22.388 13.714 1.00 25.69 ? 364 ALA A C   1 
ATOM   2796 O O   . ALA A 1 364 ? 11.759  22.479 12.485 1.00 24.67 ? 364 ALA A O   1 
ATOM   2797 C CB  . ALA A 1 364 ? 13.102  24.041 15.014 1.00 22.06 ? 364 ALA A CB  1 
ATOM   2798 N N   . ASP A 1 365 ? 10.707  22.076 14.443 1.00 26.68 ? 365 ASP A N   1 
ATOM   2799 C CA  . ASP A 1 365 ? 9.396   21.849 13.851 1.00 25.94 ? 365 ASP A CA  1 
ATOM   2800 C C   . ASP A 1 365 ? 8.576   23.096 14.138 1.00 25.79 ? 365 ASP A C   1 
ATOM   2801 O O   . ASP A 1 365 ? 8.211   23.352 15.277 1.00 26.76 ? 365 ASP A O   1 
ATOM   2802 C CB  . ASP A 1 365 ? 8.721   20.644 14.498 1.00 27.64 ? 365 ASP A CB  1 
ATOM   2803 C CG  . ASP A 1 365 ? 7.369   20.324 13.875 1.00 29.83 ? 365 ASP A CG  1 
ATOM   2804 O OD1 . ASP A 1 365 ? 6.718   21.242 13.325 1.00 30.13 ? 365 ASP A OD1 1 
ATOM   2805 O OD2 . ASP A 1 365 ? 6.950   19.149 13.952 1.00 31.44 ? 365 ASP A OD2 1 
ATOM   2806 N N   . PRO A 1 366 ? 8.270   23.885 13.103 1.00 26.09 ? 366 PRO A N   1 
ATOM   2807 C CA  . PRO A 1 366 ? 7.489   25.116 13.250 1.00 26.16 ? 366 PRO A CA  1 
ATOM   2808 C C   . PRO A 1 366 ? 6.126   24.884 13.885 1.00 25.96 ? 366 PRO A C   1 
ATOM   2809 O O   . PRO A 1 366 ? 5.588   25.771 14.545 1.00 27.20 ? 366 PRO A O   1 
ATOM   2810 C CB  . PRO A 1 366 ? 7.357   25.618 11.814 1.00 25.27 ? 366 PRO A CB  1 
ATOM   2811 C CG  . PRO A 1 366 ? 8.555   25.058 11.140 1.00 26.52 ? 366 PRO A CG  1 
ATOM   2812 C CD  . PRO A 1 366 ? 8.609   23.659 11.691 1.00 26.07 ? 366 PRO A CD  1 
ATOM   2813 N N   . ALA A 1 367 ? 5.567   23.697 13.672 1.00 24.19 ? 367 ALA A N   1 
ATOM   2814 C CA  . ALA A 1 367 ? 4.257   23.369 14.220 1.00 24.99 ? 367 ALA A CA  1 
ATOM   2815 C C   . ALA A 1 367 ? 4.293   23.299 15.739 1.00 25.92 ? 367 ALA A C   1 
ATOM   2816 O O   . ALA A 1 367 ? 3.259   23.406 16.397 1.00 26.76 ? 367 ALA A O   1 
ATOM   2817 C CB  . ALA A 1 367 ? 3.766   22.045 13.653 1.00 22.41 ? 367 ALA A CB  1 
ATOM   2818 N N   . MET A 1 368 ? 5.488   23.123 16.293 1.00 26.20 ? 368 MET A N   1 
ATOM   2819 C CA  . MET A 1 368 ? 5.660   23.030 17.741 1.00 25.93 ? 368 MET A CA  1 
ATOM   2820 C C   . MET A 1 368 ? 5.646   24.389 18.444 1.00 24.59 ? 368 MET A C   1 
ATOM   2821 O O   . MET A 1 368 ? 5.430   24.465 19.649 1.00 23.69 ? 368 MET A O   1 
ATOM   2822 C CB  . MET A 1 368 ? 6.975   22.316 18.056 1.00 27.75 ? 368 MET A CB  1 
ATOM   2823 C CG  . MET A 1 368 ? 7.011   20.871 17.620 1.00 29.68 ? 368 MET A CG  1 
ATOM   2824 S SD  . MET A 1 368 ? 5.912   19.899 18.634 1.00 33.96 ? 368 MET A SD  1 
ATOM   2825 C CE  . MET A 1 368 ? 7.002   19.564 20.033 1.00 34.11 ? 368 MET A CE  1 
ATOM   2826 N N   . ALA A 1 369 ? 5.870   25.457 17.688 1.00 23.94 ? 369 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 369 ? 5.913   26.796 18.254 1.00 24.33 ? 369 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 369 ? 4.798   27.105 19.253 1.00 25.60 ? 369 ALA A C   1 
ATOM   2829 O O   . ALA A 1 369 ? 5.052   27.693 20.307 1.00 24.70 ? 369 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 369 ? 5.916   27.828 17.135 1.00 22.71 ? 369 ALA A CB  1 
ATOM   2831 N N   . GLU A 1 370 ? 3.571   26.701 18.937 1.00 27.62 ? 370 GLU A N   1 
ATOM   2832 C CA  . GLU A 1 370 ? 2.439   26.974 19.822 1.00 28.87 ? 370 GLU A CA  1 
ATOM   2833 C C   . GLU A 1 370 ? 2.390   26.163 21.113 1.00 27.87 ? 370 GLU A C   1 
ATOM   2834 O O   . GLU A 1 370 ? 1.485   26.346 21.927 1.00 27.61 ? 370 GLU A O   1 
ATOM   2835 C CB  . GLU A 1 370 ? 1.127   26.812 19.063 1.00 32.14 ? 370 GLU A CB  1 
ATOM   2836 C CG  . GLU A 1 370 ? 1.057   27.699 17.833 1.00 40.41 ? 370 GLU A CG  1 
ATOM   2837 C CD  . GLU A 1 370 ? -0.324  28.276 17.607 1.00 43.89 ? 370 GLU A CD  1 
ATOM   2838 O OE1 . GLU A 1 370 ? -1.297  27.490 17.557 1.00 47.65 ? 370 GLU A OE1 1 
ATOM   2839 O OE2 . GLU A 1 370 ? -0.435  29.517 17.477 1.00 45.72 ? 370 GLU A OE2 1 
ATOM   2840 N N   . GLN A 1 371 ? 3.350   25.266 21.304 1.00 26.99 ? 371 GLN A N   1 
ATOM   2841 C CA  . GLN A 1 371 ? 3.399   24.480 22.528 1.00 26.99 ? 371 GLN A CA  1 
ATOM   2842 C C   . GLN A 1 371 ? 3.810   25.401 23.673 1.00 26.84 ? 371 GLN A C   1 
ATOM   2843 O O   . GLN A 1 371 ? 3.407   25.212 24.828 1.00 25.98 ? 371 GLN A O   1 
ATOM   2844 C CB  . GLN A 1 371 ? 4.415   23.348 22.396 1.00 27.85 ? 371 GLN A CB  1 
ATOM   2845 C CG  . GLN A 1 371 ? 3.912   22.178 21.593 1.00 30.31 ? 371 GLN A CG  1 
ATOM   2846 C CD  . GLN A 1 371 ? 2.608   21.632 22.143 1.00 31.60 ? 371 GLN A CD  1 
ATOM   2847 O OE1 . GLN A 1 371 ? 2.530   21.217 23.301 1.00 32.70 ? 371 GLN A OE1 1 
ATOM   2848 N NE2 . GLN A 1 371 ? 1.575   21.634 21.315 1.00 33.05 ? 371 GLN A NE2 1 
ATOM   2849 N N   . LEU A 1 372 ? 4.613   26.406 23.337 1.00 25.33 ? 372 LEU A N   1 
ATOM   2850 C CA  . LEU A 1 372 ? 5.096   27.366 24.315 1.00 24.65 ? 372 LEU A CA  1 
ATOM   2851 C C   . LEU A 1 372 ? 3.944   28.117 24.971 1.00 25.26 ? 372 LEU A C   1 
ATOM   2852 O O   . LEU A 1 372 ? 3.211   28.848 24.309 1.00 26.09 ? 372 LEU A O   1 
ATOM   2853 C CB  . LEU A 1 372 ? 6.027   28.362 23.642 1.00 22.88 ? 372 LEU A CB  1 
ATOM   2854 C CG  . LEU A 1 372 ? 6.797   29.305 24.557 1.00 20.70 ? 372 LEU A CG  1 
ATOM   2855 C CD1 . LEU A 1 372 ? 7.782   28.514 25.394 1.00 20.01 ? 372 LEU A CD1 1 
ATOM   2856 C CD2 . LEU A 1 372 ? 7.531   30.327 23.710 1.00 21.96 ? 372 LEU A CD2 1 
ATOM   2857 N N   . GLY A 1 373 ? 3.790   27.929 26.276 1.00 25.20 ? 373 GLY A N   1 
ATOM   2858 C CA  . GLY A 1 373 ? 2.733   28.603 26.998 1.00 24.00 ? 373 GLY A CA  1 
ATOM   2859 C C   . GLY A 1 373 ? 1.341   28.071 26.724 1.00 25.03 ? 373 GLY A C   1 
ATOM   2860 O O   . GLY A 1 373 ? 0.364   28.749 27.037 1.00 25.43 ? 373 GLY A O   1 
ATOM   2861 N N   . LYS A 1 374 ? 1.228   26.873 26.149 1.00 25.27 ? 374 LYS A N   1 
ATOM   2862 C CA  . LYS A 1 374 ? -0.091  26.307 25.865 1.00 24.71 ? 374 LYS A CA  1 
ATOM   2863 C C   . LYS A 1 374 ? -0.864  26.280 27.185 1.00 23.79 ? 374 LYS A C   1 
ATOM   2864 O O   . LYS A 1 374 ? -0.339  25.850 28.213 1.00 22.60 ? 374 LYS A O   1 
ATOM   2865 C CB  . LYS A 1 374 ? 0.034   24.892 25.269 1.00 26.81 ? 374 LYS A CB  1 
ATOM   2866 C CG  . LYS A 1 374 ? -1.190  24.431 24.458 1.00 31.83 ? 374 LYS A CG  1 
ATOM   2867 C CD  . LYS A 1 374 ? -0.956  23.119 23.685 1.00 33.41 ? 374 LYS A CD  1 
ATOM   2868 C CE  . LYS A 1 374 ? -0.947  21.897 24.601 1.00 37.86 ? 374 LYS A CE  1 
ATOM   2869 N NZ  . LYS A 1 374 ? -0.584  20.615 23.906 1.00 38.41 ? 374 LYS A NZ  1 
ATOM   2870 N N   . GLN A 1 375 ? -2.108  26.752 27.151 1.00 23.88 ? 375 GLN A N   1 
ATOM   2871 C CA  . GLN A 1 375 ? -2.947  26.825 28.346 1.00 23.00 ? 375 GLN A CA  1 
ATOM   2872 C C   . GLN A 1 375 ? -3.017  25.548 29.178 1.00 22.13 ? 375 GLN A C   1 
ATOM   2873 O O   . GLN A 1 375 ? -3.088  25.614 30.408 1.00 22.74 ? 375 GLN A O   1 
ATOM   2874 C CB  . GLN A 1 375 ? -4.364  27.280 27.975 1.00 22.55 ? 375 GLN A CB  1 
ATOM   2875 C CG  . GLN A 1 375 ? -5.204  27.723 29.168 1.00 23.54 ? 375 GLN A CG  1 
ATOM   2876 C CD  . GLN A 1 375 ? -4.503  28.777 30.027 1.00 25.99 ? 375 GLN A CD  1 
ATOM   2877 O OE1 . GLN A 1 375 ? -4.045  29.807 29.522 1.00 27.27 ? 375 GLN A OE1 1 
ATOM   2878 N NE2 . GLN A 1 375 ? -4.423  28.523 31.331 1.00 24.15 ? 375 GLN A NE2 1 
ATOM   2879 N N   . GLU A 1 376 ? -2.993  24.391 28.529 1.00 20.80 ? 376 GLU A N   1 
ATOM   2880 C CA  . GLU A 1 376 ? -3.050  23.146 29.278 1.00 22.44 ? 376 GLU A CA  1 
ATOM   2881 C C   . GLU A 1 376 ? -1.824  22.984 30.177 1.00 22.91 ? 376 GLU A C   1 
ATOM   2882 O O   . GLU A 1 376 ? -1.926  22.435 31.272 1.00 24.47 ? 376 GLU A O   1 
ATOM   2883 C CB  . GLU A 1 376 ? -3.185  21.944 28.337 1.00 22.55 ? 376 GLU A CB  1 
ATOM   2884 C CG  . GLU A 1 376 ? -4.542  21.859 27.638 1.00 24.77 ? 376 GLU A CG  1 
ATOM   2885 C CD  . GLU A 1 376 ? -4.624  22.681 26.353 1.00 27.40 ? 376 GLU A CD  1 
ATOM   2886 O OE1 . GLU A 1 376 ? -3.811  23.617 26.166 1.00 25.94 ? 376 GLU A OE1 1 
ATOM   2887 O OE2 . GLU A 1 376 ? -5.520  22.391 25.530 1.00 29.51 ? 376 GLU A OE2 1 
ATOM   2888 N N   . HIS A 1 377 ? -0.666  23.461 29.729 1.00 21.61 ? 377 HIS A N   1 
ATOM   2889 C CA  . HIS A 1 377 ? 0.537   23.349 30.543 1.00 22.30 ? 377 HIS A CA  1 
ATOM   2890 C C   . HIS A 1 377 ? 0.365   24.243 31.770 1.00 23.11 ? 377 HIS A C   1 
ATOM   2891 O O   . HIS A 1 377 ? 0.720   23.865 32.893 1.00 21.26 ? 377 HIS A O   1 
ATOM   2892 C CB  . HIS A 1 377 ? 1.781   23.785 29.757 1.00 23.48 ? 377 HIS A CB  1 
ATOM   2893 C CG  . HIS A 1 377 ? 1.998   23.021 28.488 1.00 25.09 ? 377 HIS A CG  1 
ATOM   2894 N ND1 . HIS A 1 377 ? 1.265   21.902 28.155 1.00 26.06 ? 377 HIS A ND1 1 
ATOM   2895 C CD2 . HIS A 1 377 ? 2.857   23.225 27.461 1.00 24.85 ? 377 HIS A CD2 1 
ATOM   2896 C CE1 . HIS A 1 377 ? 1.661   21.451 26.978 1.00 24.74 ? 377 HIS A CE1 1 
ATOM   2897 N NE2 . HIS A 1 377 ? 2.626   22.236 26.536 1.00 25.50 ? 377 HIS A NE2 1 
ATOM   2898 N N   . ARG A 1 378 ? -0.178  25.437 31.544 1.00 23.35 ? 378 ARG A N   1 
ATOM   2899 C CA  . ARG A 1 378 ? -0.413  26.382 32.625 1.00 23.78 ? 378 ARG A CA  1 
ATOM   2900 C C   . ARG A 1 378 ? -1.404  25.778 33.614 1.00 24.93 ? 378 ARG A C   1 
ATOM   2901 O O   . ARG A 1 378 ? -1.286  25.982 34.825 1.00 25.67 ? 378 ARG A O   1 
ATOM   2902 C CB  . ARG A 1 378 ? -0.951  27.702 32.070 1.00 23.48 ? 378 ARG A CB  1 
ATOM   2903 C CG  . ARG A 1 378 ? 0.080   28.511 31.290 1.00 21.42 ? 378 ARG A CG  1 
ATOM   2904 C CD  . ARG A 1 378 ? -0.519  29.796 30.732 1.00 20.53 ? 378 ARG A CD  1 
ATOM   2905 N NE  . ARG A 1 378 ? 0.413   30.503 29.856 1.00 19.44 ? 378 ARG A NE  1 
ATOM   2906 C CZ  . ARG A 1 378 ? 1.501   31.137 30.278 1.00 17.69 ? 378 ARG A CZ  1 
ATOM   2907 N NH1 . ARG A 1 378 ? 1.796   31.159 31.570 1.00 17.45 ? 378 ARG A NH1 1 
ATOM   2908 N NH2 . ARG A 1 378 ? 2.295   31.746 29.411 1.00 15.75 ? 378 ARG A NH2 1 
ATOM   2909 N N   . ASP A 1 379 ? -2.379  25.031 33.100 1.00 24.68 ? 379 ASP A N   1 
ATOM   2910 C CA  . ASP A 1 379 ? -3.357  24.386 33.967 1.00 24.85 ? 379 ASP A CA  1 
ATOM   2911 C C   . ASP A 1 379 ? -2.647  23.340 34.808 1.00 23.71 ? 379 ASP A C   1 
ATOM   2912 O O   . ASP A 1 379 ? -2.950  23.167 35.995 1.00 24.43 ? 379 ASP A O   1 
ATOM   2913 C CB  . ASP A 1 379 ? -4.469  23.732 33.152 1.00 25.91 ? 379 ASP A CB  1 
ATOM   2914 C CG  . ASP A 1 379 ? -5.314  24.746 32.418 1.00 30.60 ? 379 ASP A CG  1 
ATOM   2915 O OD1 . ASP A 1 379 ? -5.499  25.861 32.957 1.00 31.36 ? 379 ASP A OD1 1 
ATOM   2916 O OD2 . ASP A 1 379 ? -5.804  24.434 31.309 1.00 34.29 ? 379 ASP A OD2 1 
ATOM   2917 N N   . LEU A 1 380 ? -1.704  22.639 34.187 1.00 21.94 ? 380 LEU A N   1 
ATOM   2918 C CA  . LEU A 1 380 ? -0.926  21.628 34.889 1.00 20.33 ? 380 LEU A CA  1 
ATOM   2919 C C   . LEU A 1 380 ? -0.141  22.326 36.003 1.00 19.64 ? 380 LEU A C   1 
ATOM   2920 O O   . LEU A 1 380 ? -0.176  21.901 37.156 1.00 19.78 ? 380 LEU A O   1 
ATOM   2921 C CB  . LEU A 1 380 ? 0.036   20.932 33.920 1.00 19.05 ? 380 LEU A CB  1 
ATOM   2922 C CG  . LEU A 1 380 ? 1.071   19.957 34.492 1.00 17.34 ? 380 LEU A CG  1 
ATOM   2923 C CD1 . LEU A 1 380 ? 0.380   18.827 35.209 1.00 15.25 ? 380 LEU A CD1 1 
ATOM   2924 C CD2 . LEU A 1 380 ? 1.925   19.420 33.375 1.00 15.73 ? 380 LEU A CD2 1 
ATOM   2925 N N   . ALA A 1 381 ? 0.546   23.410 35.648 1.00 18.49 ? 381 ALA A N   1 
ATOM   2926 C CA  . ALA A 1 381 ? 1.347   24.178 36.600 1.00 17.06 ? 381 ALA A CA  1 
ATOM   2927 C C   . ALA A 1 381 ? 0.475   24.664 37.740 1.00 17.56 ? 381 ALA A C   1 
ATOM   2928 O O   . ALA A 1 381 ? 0.893   24.699 38.896 1.00 15.43 ? 381 ALA A O   1 
ATOM   2929 C CB  . ALA A 1 381 ? 1.986   25.362 35.903 1.00 15.88 ? 381 ALA A CB  1 
ATOM   2930 N N   . ARG A 1 382 ? -0.744  25.052 37.396 1.00 17.95 ? 382 ARG A N   1 
ATOM   2931 C CA  . ARG A 1 382 ? -1.687  25.529 38.381 1.00 18.78 ? 382 ARG A CA  1 
ATOM   2932 C C   . ARG A 1 382 ? -1.982  24.390 39.351 1.00 18.81 ? 382 ARG A C   1 
ATOM   2933 O O   . ARG A 1 382 ? -2.022  24.590 40.559 1.00 19.54 ? 382 ARG A O   1 
ATOM   2934 C CB  . ARG A 1 382 ? -2.958  25.995 37.679 1.00 20.21 ? 382 ARG A CB  1 
ATOM   2935 C CG  . ARG A 1 382 ? -3.996  26.596 38.592 1.00 21.14 ? 382 ARG A CG  1 
ATOM   2936 C CD  . ARG A 1 382 ? -5.030  27.311 37.767 1.00 21.43 ? 382 ARG A CD  1 
ATOM   2937 N NE  . ARG A 1 382 ? -6.199  27.685 38.546 1.00 22.66 ? 382 ARG A NE  1 
ATOM   2938 C CZ  . ARG A 1 382 ? -7.231  28.358 38.051 1.00 24.45 ? 382 ARG A CZ  1 
ATOM   2939 N NH1 . ARG A 1 382 ? -7.225  28.731 36.776 1.00 24.29 ? 382 ARG A NH1 1 
ATOM   2940 N NH2 . ARG A 1 382 ? -8.269  28.650 38.824 1.00 23.18 ? 382 ARG A NH2 1 
ATOM   2941 N N   . GLU A 1 383 ? -2.179  23.192 38.816 1.00 19.62 ? 383 GLU A N   1 
ATOM   2942 C CA  . GLU A 1 383 ? -2.444  22.026 39.650 1.00 20.26 ? 383 GLU A CA  1 
ATOM   2943 C C   . GLU A 1 383 ? -1.242  21.758 40.560 1.00 20.17 ? 383 GLU A C   1 
ATOM   2944 O O   . GLU A 1 383 ? -1.402  21.503 41.755 1.00 20.83 ? 383 GLU A O   1 
ATOM   2945 C CB  . GLU A 1 383 ? -2.692  20.798 38.773 1.00 20.66 ? 383 GLU A CB  1 
ATOM   2946 C CG  . GLU A 1 383 ? -2.993  19.518 39.537 1.00 19.19 ? 383 GLU A CG  1 
ATOM   2947 C CD  . GLU A 1 383 ? -2.969  18.309 38.627 1.00 21.39 ? 383 GLU A CD  1 
ATOM   2948 O OE1 . GLU A 1 383 ? -3.398  18.454 37.464 1.00 24.56 ? 383 GLU A OE1 1 
ATOM   2949 O OE2 . GLU A 1 383 ? -2.534  17.217 39.058 1.00 19.91 ? 383 GLU A OE2 1 
ATOM   2950 N N   . ALA A 1 384 ? -0.040  21.814 39.992 1.00 18.35 ? 384 ALA A N   1 
ATOM   2951 C CA  . ALA A 1 384 ? 1.173   21.570 40.760 1.00 18.41 ? 384 ALA A CA  1 
ATOM   2952 C C   . ALA A 1 384 ? 1.419   22.659 41.808 1.00 19.18 ? 384 ALA A C   1 
ATOM   2953 O O   . ALA A 1 384 ? 1.899   22.378 42.910 1.00 20.60 ? 384 ALA A O   1 
ATOM   2954 C CB  . ALA A 1 384 ? 2.361   21.462 39.831 1.00 16.44 ? 384 ALA A CB  1 
ATOM   2955 N N   . ALA A 1 385 ? 1.094   23.901 41.467 1.00 18.08 ? 385 ALA A N   1 
ATOM   2956 C CA  . ALA A 1 385 ? 1.283   25.000 42.400 1.00 17.62 ? 385 ALA A CA  1 
ATOM   2957 C C   . ALA A 1 385 ? 0.403   24.748 43.614 1.00 19.17 ? 385 ALA A C   1 
ATOM   2958 O O   . ALA A 1 385 ? 0.853   24.848 44.757 1.00 19.31 ? 385 ALA A O   1 
ATOM   2959 C CB  . ALA A 1 385 ? 0.903   26.317 41.745 1.00 15.60 ? 385 ALA A CB  1 
ATOM   2960 N N   . ARG A 1 386 ? -0.859  24.420 43.353 1.00 18.96 ? 386 ARG A N   1 
ATOM   2961 C CA  . ARG A 1 386 ? -1.820  24.141 44.408 1.00 19.30 ? 386 ARG A CA  1 
ATOM   2962 C C   . ARG A 1 386 ? -1.371  22.952 45.266 1.00 19.43 ? 386 ARG A C   1 
ATOM   2963 O O   . ARG A 1 386 ? -1.310  23.044 46.494 1.00 18.73 ? 386 ARG A O   1 
ATOM   2964 C CB  . ARG A 1 386 ? -3.194  23.864 43.785 1.00 19.69 ? 386 ARG A CB  1 
ATOM   2965 C CG  . ARG A 1 386 ? -4.300  23.549 44.786 1.00 22.20 ? 386 ARG A CG  1 
ATOM   2966 C CD  . ARG A 1 386 ? -4.664  22.076 44.749 1.00 21.71 ? 386 ARG A CD  1 
ATOM   2967 N NE  . ARG A 1 386 ? -5.029  21.667 43.396 1.00 22.51 ? 386 ARG A NE  1 
ATOM   2968 C CZ  . ARG A 1 386 ? -5.429  20.446 43.063 1.00 21.26 ? 386 ARG A CZ  1 
ATOM   2969 N NH1 . ARG A 1 386 ? -5.523  19.500 43.990 1.00 20.51 ? 386 ARG A NH1 1 
ATOM   2970 N NH2 . ARG A 1 386 ? -5.733  20.174 41.801 1.00 20.55 ? 386 ARG A NH2 1 
ATOM   2971 N N   . LYS A 1 387 ? -1.044  21.843 44.611 1.00 19.38 ? 387 LYS A N   1 
ATOM   2972 C CA  . LYS A 1 387 ? -0.602  20.640 45.312 1.00 19.42 ? 387 LYS A CA  1 
ATOM   2973 C C   . LYS A 1 387 ? 0.701   20.792 46.085 1.00 19.16 ? 387 LYS A C   1 
ATOM   2974 O O   . LYS A 1 387 ? 0.992   19.984 46.968 1.00 19.85 ? 387 LYS A O   1 
ATOM   2975 C CB  . LYS A 1 387 ? -0.442  19.478 44.331 1.00 18.73 ? 387 LYS A CB  1 
ATOM   2976 C CG  . LYS A 1 387 ? -1.734  19.011 43.712 1.00 19.46 ? 387 LYS A CG  1 
ATOM   2977 C CD  . LYS A 1 387 ? -1.521  17.725 42.962 1.00 20.62 ? 387 LYS A CD  1 
ATOM   2978 C CE  . LYS A 1 387 ? -2.782  17.261 42.278 1.00 17.45 ? 387 LYS A CE  1 
ATOM   2979 N NZ  . LYS A 1 387 ? -2.500  15.968 41.608 1.00 19.37 ? 387 LYS A NZ  1 
ATOM   2980 N N   . SER A 1 388 ? 1.487   21.811 45.761 1.00 18.11 ? 388 SER A N   1 
ATOM   2981 C CA  . SER A 1 388 ? 2.759   22.000 46.442 1.00 19.00 ? 388 SER A CA  1 
ATOM   2982 C C   . SER A 1 388 ? 2.657   22.814 47.723 1.00 19.46 ? 388 SER A C   1 
ATOM   2983 O O   . SER A 1 388 ? 3.550   22.754 48.565 1.00 21.62 ? 388 SER A O   1 
ATOM   2984 C CB  . SER A 1 388 ? 3.774   22.662 45.506 1.00 18.52 ? 388 SER A CB  1 
ATOM   2985 O OG  . SER A 1 388 ? 3.461   24.026 45.287 1.00 19.22 ? 388 SER A OG  1 
ATOM   2986 N N   . LEU A 1 389 ? 1.574   23.571 47.874 1.00 20.10 ? 389 LEU A N   1 
ATOM   2987 C CA  . LEU A 1 389 ? 1.378   24.412 49.058 1.00 19.63 ? 389 LEU A CA  1 
ATOM   2988 C C   . LEU A 1 389 ? 1.311   23.603 50.344 1.00 19.21 ? 389 LEU A C   1 
ATOM   2989 O O   . LEU A 1 389 ? 0.679   22.550 50.392 1.00 19.89 ? 389 LEU A O   1 
ATOM   2990 C CB  . LEU A 1 389 ? 0.085   25.216 48.929 1.00 19.25 ? 389 LEU A CB  1 
ATOM   2991 C CG  . LEU A 1 389 ? -0.113  25.997 47.635 1.00 20.66 ? 389 LEU A CG  1 
ATOM   2992 C CD1 . LEU A 1 389 ? -1.504  26.623 47.624 1.00 19.85 ? 389 LEU A CD1 1 
ATOM   2993 C CD2 . LEU A 1 389 ? 0.977   27.056 47.511 1.00 20.54 ? 389 LEU A CD2 1 
ATOM   2994 N N   . VAL A 1 390 ? 1.961   24.093 51.391 1.00 18.39 ? 390 VAL A N   1 
ATOM   2995 C CA  . VAL A 1 390 ? 1.910   23.395 52.662 1.00 19.27 ? 390 VAL A CA  1 
ATOM   2996 C C   . VAL A 1 390 ? 1.345   24.313 53.732 1.00 20.10 ? 390 VAL A C   1 
ATOM   2997 O O   . VAL A 1 390 ? 1.931   25.342 54.056 1.00 21.54 ? 390 VAL A O   1 
ATOM   2998 C CB  . VAL A 1 390 ? 3.299   22.893 53.099 1.00 19.65 ? 390 VAL A CB  1 
ATOM   2999 C CG1 . VAL A 1 390 ? 3.224   22.309 54.503 1.00 18.91 ? 390 VAL A CG1 1 
ATOM   3000 C CG2 . VAL A 1 390 ? 3.788   21.827 52.133 1.00 19.98 ? 390 VAL A CG2 1 
ATOM   3001 N N   . LEU A 1 391 ? 0.185   23.936 54.257 1.00 20.70 ? 391 LEU A N   1 
ATOM   3002 C CA  . LEU A 1 391 ? -0.486  24.696 55.300 1.00 21.60 ? 391 LEU A CA  1 
ATOM   3003 C C   . LEU A 1 391 ? 0.199   24.367 56.625 1.00 22.25 ? 391 LEU A C   1 
ATOM   3004 O O   . LEU A 1 391 ? 0.196   23.217 57.058 1.00 22.96 ? 391 LEU A O   1 
ATOM   3005 C CB  . LEU A 1 391 ? -1.962  24.291 55.352 1.00 21.41 ? 391 LEU A CB  1 
ATOM   3006 C CG  . LEU A 1 391 ? -2.916  25.021 56.302 1.00 21.86 ? 391 LEU A CG  1 
ATOM   3007 C CD1 . LEU A 1 391 ? -3.023  26.497 55.934 1.00 20.36 ? 391 LEU A CD1 1 
ATOM   3008 C CD2 . LEU A 1 391 ? -4.279  24.356 56.218 1.00 21.95 ? 391 LEU A CD2 1 
ATOM   3009 N N   . LEU A 1 392 ? 0.789   25.374 57.262 1.00 23.03 ? 392 LEU A N   1 
ATOM   3010 C CA  . LEU A 1 392 ? 1.489   25.172 58.526 1.00 24.08 ? 392 LEU A CA  1 
ATOM   3011 C C   . LEU A 1 392 ? 0.663   25.595 59.729 1.00 24.82 ? 392 LEU A C   1 
ATOM   3012 O O   . LEU A 1 392 ? 0.922   25.171 60.854 1.00 24.21 ? 392 LEU A O   1 
ATOM   3013 C CB  . LEU A 1 392 ? 2.804   25.949 58.530 1.00 23.89 ? 392 LEU A CB  1 
ATOM   3014 C CG  . LEU A 1 392 ? 3.862   25.491 57.528 1.00 23.63 ? 392 LEU A CG  1 
ATOM   3015 C CD1 . LEU A 1 392 ? 5.052   26.429 57.590 1.00 23.63 ? 392 LEU A CD1 1 
ATOM   3016 C CD2 . LEU A 1 392 ? 4.272   24.059 57.830 1.00 22.91 ? 392 LEU A CD2 1 
ATOM   3017 N N   . LYS A 1 393 ? -0.331  26.440 59.488 1.00 25.58 ? 393 LYS A N   1 
ATOM   3018 C CA  . LYS A 1 393 ? -1.186  26.924 60.559 1.00 24.62 ? 393 LYS A CA  1 
ATOM   3019 C C   . LYS A 1 393 ? -2.508  27.412 59.985 1.00 25.12 ? 393 LYS A C   1 
ATOM   3020 O O   . LYS A 1 393 ? -2.543  28.055 58.934 1.00 24.84 ? 393 LYS A O   1 
ATOM   3021 C CB  . LYS A 1 393 ? -0.483  28.060 61.297 1.00 23.74 ? 393 LYS A CB  1 
ATOM   3022 C CG  . LYS A 1 393 ? -1.243  28.595 62.482 1.00 23.25 ? 393 LYS A CG  1 
ATOM   3023 C CD  . LYS A 1 393 ? -0.459  29.697 63.156 1.00 23.21 ? 393 LYS A CD  1 
ATOM   3024 C CE  . LYS A 1 393 ? -1.282  30.362 64.236 1.00 23.90 ? 393 LYS A CE  1 
ATOM   3025 N NZ  . LYS A 1 393 ? -0.572  31.533 64.800 1.00 25.32 ? 393 LYS A NZ  1 
ATOM   3026 N N   . ASN A 1 394 ? -3.597  27.097 60.673 1.00 25.44 ? 394 ASN A N   1 
ATOM   3027 C CA  . ASN A 1 394 ? -4.917  27.514 60.219 1.00 26.37 ? 394 ASN A CA  1 
ATOM   3028 C C   . ASN A 1 394 ? -5.808  27.774 61.434 1.00 26.05 ? 394 ASN A C   1 
ATOM   3029 O O   . ASN A 1 394 ? -6.839  27.132 61.619 1.00 27.06 ? 394 ASN A O   1 
ATOM   3030 C CB  . ASN A 1 394 ? -5.522  26.438 59.307 1.00 25.53 ? 394 ASN A CB  1 
ATOM   3031 C CG  . ASN A 1 394 ? -6.727  26.940 58.534 1.00 26.75 ? 394 ASN A CG  1 
ATOM   3032 O OD1 . ASN A 1 394 ? -6.828  28.129 58.237 1.00 26.85 ? 394 ASN A OD1 1 
ATOM   3033 N ND2 . ASN A 1 394 ? -7.638  26.034 58.187 1.00 26.73 ? 394 ASN A ND2 1 
ATOM   3034 N N   . GLY A 1 395 ? -5.380  28.732 62.253 1.00 25.57 ? 395 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 395 ? -6.097  29.095 63.462 1.00 25.94 ? 395 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 395 ? -5.112  29.381 64.587 1.00 27.51 ? 395 GLY A C   1 
ATOM   3037 O O   . GLY A 1 395 ? -4.150  28.636 64.781 1.00 26.94 ? 395 GLY A O   1 
ATOM   3038 N N   . LYS A 1 396 ? -5.341  30.455 65.336 1.00 28.48 ? 396 LYS A N   1 
ATOM   3039 C CA  . LYS A 1 396 ? -4.441  30.805 66.427 1.00 29.43 ? 396 LYS A CA  1 
ATOM   3040 C C   . LYS A 1 396 ? -4.553  29.883 67.635 1.00 29.84 ? 396 LYS A C   1 
ATOM   3041 O O   . LYS A 1 396 ? -3.561  29.646 68.320 1.00 32.02 ? 396 LYS A O   1 
ATOM   3042 C CB  . LYS A 1 396 ? -4.660  32.259 66.855 1.00 29.00 ? 396 LYS A CB  1 
ATOM   3043 C CG  . LYS A 1 396 ? -4.194  33.256 65.811 1.00 29.56 ? 396 LYS A CG  1 
ATOM   3044 C CD  . LYS A 1 396 ? -4.117  34.669 66.357 1.00 30.21 ? 396 LYS A CD  1 
ATOM   3045 C CE  . LYS A 1 396 ? -3.441  35.590 65.346 1.00 32.52 ? 396 LYS A CE  1 
ATOM   3046 N NZ  . LYS A 1 396 ? -3.336  37.002 65.815 1.00 34.63 ? 396 LYS A NZ  1 
ATOM   3047 N N   . THR A 1 397 ? -5.746  29.360 67.901 1.00 28.86 ? 397 THR A N   1 
ATOM   3048 C CA  . THR A 1 397 ? -5.929  28.462 69.044 1.00 28.83 ? 397 THR A CA  1 
ATOM   3049 C C   . THR A 1 397 ? -6.782  27.272 68.647 1.00 28.82 ? 397 THR A C   1 
ATOM   3050 O O   . THR A 1 397 ? -7.496  27.318 67.653 1.00 29.78 ? 397 THR A O   1 
ATOM   3051 C CB  . THR A 1 397 ? -6.641  29.150 70.226 1.00 28.04 ? 397 THR A CB  1 
ATOM   3052 O OG1 . THR A 1 397 ? -8.056  29.001 70.069 1.00 28.03 ? 397 THR A OG1 1 
ATOM   3053 C CG2 . THR A 1 397 ? -6.297  30.639 70.279 1.00 25.53 ? 397 THR A CG2 1 
ATOM   3054 N N   . SER A 1 398 ? -6.715  26.214 69.443 1.00 29.67 ? 398 SER A N   1 
ATOM   3055 C CA  . SER A 1 398 ? -7.475  24.998 69.178 1.00 29.83 ? 398 SER A CA  1 
ATOM   3056 C C   . SER A 1 398 ? -8.969  25.258 69.016 1.00 30.50 ? 398 SER A C   1 
ATOM   3057 O O   . SER A 1 398 ? -9.666  24.503 68.335 1.00 31.22 ? 398 SER A O   1 
ATOM   3058 C CB  . SER A 1 398 ? -7.284  24.008 70.323 1.00 31.20 ? 398 SER A CB  1 
ATOM   3059 O OG  . SER A 1 398 ? -7.864  24.513 71.521 1.00 32.71 ? 398 SER A OG  1 
ATOM   3060 N N   . THR A 1 399 ? -9.465  26.317 69.646 1.00 29.51 ? 399 THR A N   1 
ATOM   3061 C CA  . THR A 1 399 ? -10.884 26.621 69.570 1.00 30.30 ? 399 THR A CA  1 
ATOM   3062 C C   . THR A 1 399 ? -11.279 27.656 68.523 1.00 28.48 ? 399 THR A C   1 
ATOM   3063 O O   . THR A 1 399 ? -12.465 27.859 68.261 1.00 27.72 ? 399 THR A O   1 
ATOM   3064 C CB  . THR A 1 399 ? -11.415 27.058 70.945 1.00 32.92 ? 399 THR A CB  1 
ATOM   3065 O OG1 . THR A 1 399 ? -10.628 28.146 71.437 1.00 34.90 ? 399 THR A OG1 1 
ATOM   3066 C CG2 . THR A 1 399 ? -11.340 25.897 71.929 1.00 34.03 ? 399 THR A CG2 1 
ATOM   3067 N N   . ASP A 1 400 ? -10.290 28.310 67.926 1.00 27.91 ? 400 ASP A N   1 
ATOM   3068 C CA  . ASP A 1 400 ? -10.556 29.302 66.888 1.00 26.32 ? 400 ASP A CA  1 
ATOM   3069 C C   . ASP A 1 400 ? -11.222 28.635 65.691 1.00 24.39 ? 400 ASP A C   1 
ATOM   3070 O O   . ASP A 1 400 ? -11.054 27.443 65.465 1.00 23.83 ? 400 ASP A O   1 
ATOM   3071 C CB  . ASP A 1 400 ? -9.250  29.940 66.414 1.00 26.61 ? 400 ASP A CB  1 
ATOM   3072 C CG  . ASP A 1 400 ? -8.802  31.078 67.295 1.00 29.06 ? 400 ASP A CG  1 
ATOM   3073 O OD1 . ASP A 1 400 ? -9.014  31.001 68.524 1.00 29.31 ? 400 ASP A OD1 1 
ATOM   3074 O OD2 . ASP A 1 400 ? -8.221  32.047 66.754 1.00 29.78 ? 400 ASP A OD2 1 
ATOM   3075 N N   . ALA A 1 401 ? -11.985 29.409 64.934 1.00 23.48 ? 401 ALA A N   1 
ATOM   3076 C CA  . ALA A 1 401 ? -12.621 28.897 63.729 1.00 22.49 ? 401 ALA A CA  1 
ATOM   3077 C C   . ALA A 1 401 ? -11.531 28.890 62.659 1.00 22.09 ? 401 ALA A C   1 
ATOM   3078 O O   . ALA A 1 401 ? -10.723 29.817 62.570 1.00 22.23 ? 401 ALA A O   1 
ATOM   3079 C CB  . ALA A 1 401 ? -13.756 29.809 63.302 1.00 20.29 ? 401 ALA A CB  1 
ATOM   3080 N N   . PRO A 1 402 ? -11.482 27.838 61.839 1.00 22.23 ? 402 PRO A N   1 
ATOM   3081 C CA  . PRO A 1 402 ? -10.454 27.778 60.791 1.00 21.60 ? 402 PRO A CA  1 
ATOM   3082 C C   . PRO A 1 402 ? -10.605 28.939 59.804 1.00 21.56 ? 402 PRO A C   1 
ATOM   3083 O O   . PRO A 1 402 ? -11.660 29.097 59.188 1.00 20.18 ? 402 PRO A O   1 
ATOM   3084 C CB  . PRO A 1 402 ? -10.718 26.433 60.122 1.00 21.79 ? 402 PRO A CB  1 
ATOM   3085 C CG  . PRO A 1 402 ? -11.390 25.626 61.210 1.00 23.47 ? 402 PRO A CG  1 
ATOM   3086 C CD  . PRO A 1 402 ? -12.309 26.622 61.854 1.00 21.22 ? 402 PRO A CD  1 
ATOM   3087 N N   . LEU A 1 403 ? -9.556  29.746 59.659 1.00 20.76 ? 403 LEU A N   1 
ATOM   3088 C CA  . LEU A 1 403 ? -9.585  30.874 58.734 1.00 20.93 ? 403 LEU A CA  1 
ATOM   3089 C C   . LEU A 1 403 ? -9.736  30.408 57.290 1.00 21.04 ? 403 LEU A C   1 
ATOM   3090 O O   . LEU A 1 403 ? -10.502 30.984 56.523 1.00 20.86 ? 403 LEU A O   1 
ATOM   3091 C CB  . LEU A 1 403 ? -8.308  31.708 58.849 1.00 20.73 ? 403 LEU A CB  1 
ATOM   3092 C CG  . LEU A 1 403 ? -8.192  32.790 57.767 1.00 24.08 ? 403 LEU A CG  1 
ATOM   3093 C CD1 . LEU A 1 403 ? -9.350  33.783 57.916 1.00 24.04 ? 403 LEU A CD1 1 
ATOM   3094 C CD2 . LEU A 1 403 ? -6.851  33.504 57.867 1.00 23.15 ? 403 LEU A CD2 1 
ATOM   3095 N N   . LEU A 1 404 ? -8.989  29.371 56.923 1.00 21.64 ? 404 LEU A N   1 
ATOM   3096 C CA  . LEU A 1 404 ? -9.041  28.822 55.574 1.00 22.52 ? 404 LEU A CA  1 
ATOM   3097 C C   . LEU A 1 404 ? -9.975  27.615 55.542 1.00 24.20 ? 404 LEU A C   1 
ATOM   3098 O O   . LEU A 1 404 ? -10.021 26.833 56.493 1.00 24.34 ? 404 LEU A O   1 
ATOM   3099 C CB  . LEU A 1 404 ? -7.641  28.402 55.124 1.00 20.92 ? 404 LEU A CB  1 
ATOM   3100 C CG  . LEU A 1 404 ? -6.539  29.469 55.160 1.00 20.35 ? 404 LEU A CG  1 
ATOM   3101 C CD1 . LEU A 1 404 ? -5.236  28.858 54.659 1.00 20.75 ? 404 LEU A CD1 1 
ATOM   3102 C CD2 . LEU A 1 404 ? -6.925  30.657 54.298 1.00 17.76 ? 404 LEU A CD2 1 
ATOM   3103 N N   . PRO A 1 405 ? -10.729 27.440 54.443 1.00 25.65 ? 405 PRO A N   1 
ATOM   3104 C CA  . PRO A 1 405 ? -10.778 28.273 53.234 1.00 25.65 ? 405 PRO A CA  1 
ATOM   3105 C C   . PRO A 1 405 ? -11.457 29.611 53.480 1.00 25.70 ? 405 PRO A C   1 
ATOM   3106 O O   . PRO A 1 405 ? -12.313 29.730 54.350 1.00 27.60 ? 405 PRO A O   1 
ATOM   3107 C CB  . PRO A 1 405 ? -11.599 27.429 52.252 1.00 26.64 ? 405 PRO A CB  1 
ATOM   3108 C CG  . PRO A 1 405 ? -11.498 26.036 52.784 1.00 27.71 ? 405 PRO A CG  1 
ATOM   3109 C CD  . PRO A 1 405 ? -11.569 26.245 54.272 1.00 26.38 ? 405 PRO A CD  1 
ATOM   3110 N N   . LEU A 1 406 ? -11.080 30.613 52.697 1.00 25.25 ? 406 LEU A N   1 
ATOM   3111 C CA  . LEU A 1 406 ? -11.676 31.934 52.802 1.00 23.41 ? 406 LEU A CA  1 
ATOM   3112 C C   . LEU A 1 406 ? -12.890 31.982 51.871 1.00 23.28 ? 406 LEU A C   1 
ATOM   3113 O O   . LEU A 1 406 ? -12.929 31.295 50.848 1.00 22.42 ? 406 LEU A O   1 
ATOM   3114 C CB  . LEU A 1 406 ? -10.665 33.001 52.379 1.00 22.50 ? 406 LEU A CB  1 
ATOM   3115 C CG  . LEU A 1 406 ? -9.432  33.204 53.262 1.00 22.79 ? 406 LEU A CG  1 
ATOM   3116 C CD1 . LEU A 1 406 ? -8.390  34.002 52.497 1.00 22.20 ? 406 LEU A CD1 1 
ATOM   3117 C CD2 . LEU A 1 406 ? -9.823  33.920 54.557 1.00 22.34 ? 406 LEU A CD2 1 
ATOM   3118 N N   . PRO A 1 407 ? -13.897 32.799 52.215 1.00 22.64 ? 407 PRO A N   1 
ATOM   3119 C CA  . PRO A 1 407 ? -15.123 32.957 51.423 1.00 20.71 ? 407 PRO A CA  1 
ATOM   3120 C C   . PRO A 1 407 ? -14.829 33.774 50.174 1.00 20.17 ? 407 PRO A C   1 
ATOM   3121 O O   . PRO A 1 407 ? -14.099 34.762 50.236 1.00 19.69 ? 407 PRO A O   1 
ATOM   3122 C CB  . PRO A 1 407 ? -16.049 33.733 52.350 1.00 20.74 ? 407 PRO A CB  1 
ATOM   3123 C CG  . PRO A 1 407 ? -15.388 33.661 53.701 1.00 22.87 ? 407 PRO A CG  1 
ATOM   3124 C CD  . PRO A 1 407 ? -13.939 33.658 53.404 1.00 21.77 ? 407 PRO A CD  1 
ATOM   3125 N N   . LYS A 1 408 ? -15.391 33.380 49.041 1.00 20.07 ? 408 LYS A N   1 
ATOM   3126 C CA  . LYS A 1 408 ? -15.159 34.147 47.827 1.00 20.37 ? 408 LYS A CA  1 
ATOM   3127 C C   . LYS A 1 408 ? -16.007 35.420 47.871 1.00 20.85 ? 408 LYS A C   1 
ATOM   3128 O O   . LYS A 1 408 ? -15.704 36.405 47.199 1.00 19.85 ? 408 LYS A O   1 
ATOM   3129 C CB  . LYS A 1 408 ? -15.503 33.316 46.592 1.00 18.20 ? 408 LYS A CB  1 
ATOM   3130 C CG  . LYS A 1 408 ? -14.597 32.111 46.396 1.00 20.44 ? 408 LYS A CG  1 
ATOM   3131 C CD  . LYS A 1 408 ? -14.916 31.375 45.103 1.00 20.87 ? 408 LYS A CD  1 
ATOM   3132 C CE  . LYS A 1 408 ? -14.080 30.120 44.948 1.00 21.32 ? 408 LYS A CE  1 
ATOM   3133 N NZ  . LYS A 1 408 ? -14.451 29.398 43.702 1.00 20.37 ? 408 LYS A NZ  1 
ATOM   3134 N N   . LYS A 1 409 ? -17.065 35.398 48.678 1.00 21.35 ? 409 LYS A N   1 
ATOM   3135 C CA  . LYS A 1 409 ? -17.937 36.556 48.793 1.00 21.55 ? 409 LYS A CA  1 
ATOM   3136 C C   . LYS A 1 409 ? -17.775 37.254 50.139 1.00 21.86 ? 409 LYS A C   1 
ATOM   3137 O O   . LYS A 1 409 ? -18.122 36.708 51.188 1.00 21.49 ? 409 LYS A O   1 
ATOM   3138 C CB  . LYS A 1 409 ? -19.398 36.148 48.594 1.00 20.76 ? 409 LYS A CB  1 
ATOM   3139 C CG  . LYS A 1 409 ? -20.345 37.337 48.522 1.00 21.56 ? 409 LYS A CG  1 
ATOM   3140 C CD  . LYS A 1 409 ? -21.779 36.918 48.235 1.00 24.06 ? 409 LYS A CD  1 
ATOM   3141 C CE  . LYS A 1 409 ? -22.670 38.131 47.980 1.00 26.17 ? 409 LYS A CE  1 
ATOM   3142 N NZ  . LYS A 1 409 ? -24.046 37.732 47.555 1.00 29.62 ? 409 LYS A NZ  1 
ATOM   3143 N N   . ALA A 1 410 ? -17.234 38.466 50.095 1.00 21.31 ? 410 ALA A N   1 
ATOM   3144 C CA  . ALA A 1 410 ? -17.020 39.270 51.290 1.00 22.47 ? 410 ALA A CA  1 
ATOM   3145 C C   . ALA A 1 410 ? -17.147 40.725 50.863 1.00 23.43 ? 410 ALA A C   1 
ATOM   3146 O O   . ALA A 1 410 ? -16.823 41.079 49.732 1.00 25.30 ? 410 ALA A O   1 
ATOM   3147 C CB  . ALA A 1 410 ? -15.632 39.005 51.871 1.00 22.17 ? 410 ALA A CB  1 
ATOM   3148 N N   . PRO A 1 411 ? -17.626 41.590 51.756 1.00 23.32 ? 411 PRO A N   1 
ATOM   3149 C CA  . PRO A 1 411 ? -17.778 43.004 51.405 1.00 23.56 ? 411 PRO A CA  1 
ATOM   3150 C C   . PRO A 1 411 ? -16.518 43.700 50.899 1.00 25.01 ? 411 PRO A C   1 
ATOM   3151 O O   . PRO A 1 411 ? -16.556 44.431 49.909 1.00 26.97 ? 411 PRO A O   1 
ATOM   3152 C CB  . PRO A 1 411 ? -18.289 43.618 52.701 1.00 22.36 ? 411 PRO A CB  1 
ATOM   3153 C CG  . PRO A 1 411 ? -19.111 42.513 53.276 1.00 22.70 ? 411 PRO A CG  1 
ATOM   3154 C CD  . PRO A 1 411 ? -18.221 41.306 53.071 1.00 22.63 ? 411 PRO A CD  1 
ATOM   3155 N N   . LYS A 1 412 ? -15.397 43.462 51.568 1.00 24.40 ? 412 LYS A N   1 
ATOM   3156 C CA  . LYS A 1 412 ? -14.152 44.118 51.198 1.00 23.26 ? 412 LYS A CA  1 
ATOM   3157 C C   . LYS A 1 412 ? -12.987 43.322 51.774 1.00 23.09 ? 412 LYS A C   1 
ATOM   3158 O O   . LYS A 1 412 ? -13.009 42.946 52.946 1.00 25.19 ? 412 LYS A O   1 
ATOM   3159 C CB  . LYS A 1 412 ? -14.179 45.528 51.779 1.00 23.29 ? 412 LYS A CB  1 
ATOM   3160 C CG  . LYS A 1 412 ? -13.069 46.462 51.372 1.00 23.75 ? 412 LYS A CG  1 
ATOM   3161 C CD  . LYS A 1 412 ? -13.353 47.813 52.006 1.00 21.20 ? 412 LYS A CD  1 
ATOM   3162 C CE  . LYS A 1 412 ? -12.382 48.866 51.562 1.00 23.42 ? 412 LYS A CE  1 
ATOM   3163 N NZ  . LYS A 1 412 ? -12.646 50.133 52.288 1.00 26.81 ? 412 LYS A NZ  1 
ATOM   3164 N N   . ILE A 1 413 ? -11.969 43.063 50.962 1.00 21.75 ? 413 ILE A N   1 
ATOM   3165 C CA  . ILE A 1 413 ? -10.826 42.294 51.439 1.00 19.91 ? 413 ILE A CA  1 
ATOM   3166 C C   . ILE A 1 413 ? -9.509  42.974 51.106 1.00 20.43 ? 413 ILE A C   1 
ATOM   3167 O O   . ILE A 1 413 ? -9.430  43.766 50.163 1.00 19.94 ? 413 ILE A O   1 
ATOM   3168 C CB  . ILE A 1 413 ? -10.816 40.867 50.827 1.00 17.86 ? 413 ILE A CB  1 
ATOM   3169 C CG1 . ILE A 1 413 ? -10.525 40.932 49.327 1.00 15.84 ? 413 ILE A CG1 1 
ATOM   3170 C CG2 . ILE A 1 413 ? -12.168 40.200 51.046 1.00 16.18 ? 413 ILE A CG2 1 
ATOM   3171 C CD1 . ILE A 1 413 ? -10.338 39.577 48.686 1.00 11.87 ? 413 ILE A CD1 1 
ATOM   3172 N N   . LEU A 1 414 ? -8.474  42.660 51.881 1.00 20.68 ? 414 LEU A N   1 
ATOM   3173 C CA  . LEU A 1 414 ? -7.149  43.233 51.652 1.00 19.77 ? 414 LEU A CA  1 
ATOM   3174 C C   . LEU A 1 414 ? -6.132  42.207 51.149 1.00 19.67 ? 414 LEU A C   1 
ATOM   3175 O O   . LEU A 1 414 ? -6.061  41.081 51.644 1.00 21.30 ? 414 LEU A O   1 
ATOM   3176 C CB  . LEU A 1 414 ? -6.610  43.875 52.935 1.00 18.12 ? 414 LEU A CB  1 
ATOM   3177 C CG  . LEU A 1 414 ? -5.219  44.510 52.804 1.00 17.72 ? 414 LEU A CG  1 
ATOM   3178 C CD1 . LEU A 1 414 ? -5.275  45.709 51.880 1.00 13.88 ? 414 LEU A CD1 1 
ATOM   3179 C CD2 . LEU A 1 414 ? -4.714  44.928 54.174 1.00 17.17 ? 414 LEU A CD2 1 
ATOM   3180 N N   . VAL A 1 415 ? -5.358  42.602 50.147 1.00 19.98 ? 415 VAL A N   1 
ATOM   3181 C CA  . VAL A 1 415 ? -4.309  41.753 49.586 1.00 19.11 ? 415 VAL A CA  1 
ATOM   3182 C C   . VAL A 1 415 ? -3.080  42.628 49.729 1.00 19.65 ? 415 VAL A C   1 
ATOM   3183 O O   . VAL A 1 415 ? -3.048  43.743 49.206 1.00 22.12 ? 415 VAL A O   1 
ATOM   3184 C CB  . VAL A 1 415 ? -4.552  41.428 48.091 1.00 16.12 ? 415 VAL A CB  1 
ATOM   3185 C CG1 . VAL A 1 415 ? -3.326  40.786 47.496 1.00 14.01 ? 415 VAL A CG1 1 
ATOM   3186 C CG2 . VAL A 1 415 ? -5.732  40.494 47.946 1.00 12.92 ? 415 VAL A CG2 1 
ATOM   3187 N N   . ALA A 1 416 ? -2.075  42.139 50.444 1.00 19.29 ? 416 ALA A N   1 
ATOM   3188 C CA  . ALA A 1 416 ? -0.879  42.940 50.672 1.00 18.99 ? 416 ALA A CA  1 
ATOM   3189 C C   . ALA A 1 416 ? 0.410   42.140 50.683 1.00 18.19 ? 416 ALA A C   1 
ATOM   3190 O O   . ALA A 1 416 ? 0.389   40.908 50.662 1.00 17.17 ? 416 ALA A O   1 
ATOM   3191 C CB  . ALA A 1 416 ? -1.023  43.698 51.995 1.00 18.09 ? 416 ALA A CB  1 
ATOM   3192 N N   . GLY A 1 417 ? 1.530   42.859 50.733 1.00 17.51 ? 417 GLY A N   1 
ATOM   3193 C CA  . GLY A 1 417 ? 2.826   42.213 50.757 1.00 18.56 ? 417 GLY A CA  1 
ATOM   3194 C C   . GLY A 1 417 ? 3.677   42.475 49.528 1.00 20.15 ? 417 GLY A C   1 
ATOM   3195 O O   . GLY A 1 417 ? 3.169   42.772 48.442 1.00 20.40 ? 417 GLY A O   1 
ATOM   3196 N N   . SER A 1 418 ? 4.986   42.359 49.707 1.00 20.05 ? 418 SER A N   1 
ATOM   3197 C CA  . SER A 1 418 ? 5.937   42.576 48.628 1.00 20.84 ? 418 SER A CA  1 
ATOM   3198 C C   . SER A 1 418 ? 5.813   41.508 47.551 1.00 21.65 ? 418 SER A C   1 
ATOM   3199 O O   . SER A 1 418 ? 6.239   41.716 46.416 1.00 22.73 ? 418 SER A O   1 
ATOM   3200 C CB  . SER A 1 418 ? 7.363   42.571 49.184 1.00 19.96 ? 418 SER A CB  1 
ATOM   3201 O OG  . SER A 1 418 ? 7.630   41.367 49.884 1.00 19.65 ? 418 SER A OG  1 
ATOM   3202 N N   . HIS A 1 419 ? 5.220   40.371 47.912 1.00 22.15 ? 419 HIS A N   1 
ATOM   3203 C CA  . HIS A 1 419 ? 5.053   39.247 46.991 1.00 22.06 ? 419 HIS A CA  1 
ATOM   3204 C C   . HIS A 1 419 ? 3.631   39.027 46.480 1.00 22.25 ? 419 HIS A C   1 
ATOM   3205 O O   . HIS A 1 419 ? 3.387   38.100 45.708 1.00 21.49 ? 419 HIS A O   1 
ATOM   3206 C CB  . HIS A 1 419 ? 5.529   37.955 47.661 1.00 23.27 ? 419 HIS A CB  1 
ATOM   3207 C CG  . HIS A 1 419 ? 7.002   37.914 47.921 1.00 22.62 ? 419 HIS A CG  1 
ATOM   3208 N ND1 . HIS A 1 419 ? 7.660   38.896 48.628 1.00 21.30 ? 419 HIS A ND1 1 
ATOM   3209 C CD2 . HIS A 1 419 ? 7.943   37.010 47.565 1.00 22.07 ? 419 HIS A CD2 1 
ATOM   3210 C CE1 . HIS A 1 419 ? 8.945   38.600 48.694 1.00 22.35 ? 419 HIS A CE1 1 
ATOM   3211 N NE2 . HIS A 1 419 ? 9.143   37.460 48.058 1.00 22.52 ? 419 HIS A NE2 1 
ATOM   3212 N N   . ALA A 1 420 ? 2.697   39.868 46.909 1.00 21.98 ? 420 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 420 ? 1.307   39.724 46.491 1.00 21.61 ? 420 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 420 ? 1.094   39.964 45.000 1.00 21.87 ? 420 ALA A C   1 
ATOM   3215 O O   . ALA A 1 420 ? 0.245   39.329 44.379 1.00 21.44 ? 420 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 420 ? 0.437   40.666 47.290 1.00 21.70 ? 420 ALA A CB  1 
ATOM   3217 N N   . ASP A 1 421 ? 1.872   40.875 44.424 1.00 21.92 ? 421 ASP A N   1 
ATOM   3218 C CA  . ASP A 1 421 ? 1.733   41.198 43.012 1.00 21.19 ? 421 ASP A CA  1 
ATOM   3219 C C   . ASP A 1 421 ? 3.084   41.389 42.331 1.00 20.37 ? 421 ASP A C   1 
ATOM   3220 O O   . ASP A 1 421 ? 3.322   42.402 41.676 1.00 20.20 ? 421 ASP A O   1 
ATOM   3221 C CB  . ASP A 1 421 ? 0.890   42.465 42.871 1.00 22.48 ? 421 ASP A CB  1 
ATOM   3222 C CG  . ASP A 1 421 ? 0.539   42.780 41.433 1.00 23.42 ? 421 ASP A CG  1 
ATOM   3223 O OD1 . ASP A 1 421 ? 0.039   41.881 40.721 1.00 21.36 ? 421 ASP A OD1 1 
ATOM   3224 O OD2 . ASP A 1 421 ? 0.753   43.938 41.020 1.00 24.78 ? 421 ASP A OD2 1 
ATOM   3225 N N   . ASN A 1 422 ? 3.959   40.400 42.483 1.00 18.78 ? 422 ASN A N   1 
ATOM   3226 C CA  . ASN A 1 422 ? 5.296   40.438 41.898 1.00 17.50 ? 422 ASN A CA  1 
ATOM   3227 C C   . ASN A 1 422 ? 5.579   39.069 41.260 1.00 17.28 ? 422 ASN A C   1 
ATOM   3228 O O   . ASN A 1 422 ? 6.021   38.134 41.943 1.00 17.71 ? 422 ASN A O   1 
ATOM   3229 C CB  . ASN A 1 422 ? 6.319   40.738 43.000 1.00 16.62 ? 422 ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 422 ? 7.690   41.062 42.454 1.00 16.33 ? 422 ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 422 ? 8.147   40.452 41.487 1.00 15.13 ? 422 ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 422 ? 8.366   42.019 43.084 1.00 14.50 ? 422 ASN A ND2 1 
ATOM   3233 N N   . LEU A 1 423 ? 5.328   38.960 39.954 1.00 16.98 ? 423 LEU A N   1 
ATOM   3234 C CA  . LEU A 1 423 ? 5.510   37.706 39.219 1.00 16.14 ? 423 LEU A CA  1 
ATOM   3235 C C   . LEU A 1 423 ? 6.918   37.158 39.302 1.00 17.30 ? 423 LEU A C   1 
ATOM   3236 O O   . LEU A 1 423 ? 7.113   35.951 39.391 1.00 18.71 ? 423 LEU A O   1 
ATOM   3237 C CB  . LEU A 1 423 ? 5.117   37.880 37.749 1.00 15.09 ? 423 LEU A CB  1 
ATOM   3238 C CG  . LEU A 1 423 ? 5.019   36.606 36.895 1.00 14.90 ? 423 LEU A CG  1 
ATOM   3239 C CD1 . LEU A 1 423 ? 4.073   35.596 37.541 1.00 13.90 ? 423 LEU A CD1 1 
ATOM   3240 C CD2 . LEU A 1 423 ? 4.526   36.964 35.508 1.00 12.81 ? 423 LEU A CD2 1 
ATOM   3241 N N   . GLY A 1 424 ? 7.903   38.043 39.274 1.00 18.70 ? 424 GLY A N   1 
ATOM   3242 C CA  . GLY A 1 424 ? 9.281   37.598 39.362 1.00 19.26 ? 424 GLY A CA  1 
ATOM   3243 C C   . GLY A 1 424 ? 9.591   36.919 40.685 1.00 19.50 ? 424 GLY A C   1 
ATOM   3244 O O   . GLY A 1 424 ? 10.267  35.896 40.715 1.00 20.12 ? 424 GLY A O   1 
ATOM   3245 N N   . TYR A 1 425 ? 9.102   37.496 41.780 1.00 20.22 ? 425 TYR A N   1 
ATOM   3246 C CA  . TYR A 1 425 ? 9.327   36.952 43.120 1.00 20.75 ? 425 TYR A CA  1 
ATOM   3247 C C   . TYR A 1 425 ? 8.656   35.593 43.253 1.00 20.97 ? 425 TYR A C   1 
ATOM   3248 O O   . TYR A 1 425 ? 9.140   34.692 43.932 1.00 20.35 ? 425 TYR A O   1 
ATOM   3249 C CB  . TYR A 1 425 ? 8.736   37.894 44.169 1.00 20.16 ? 425 TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 425 ? 9.541   39.138 44.464 1.00 21.78 ? 425 TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 425 ? 10.624  39.522 43.661 1.00 21.09 ? 425 TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 425 ? 9.222   39.933 45.562 1.00 20.97 ? 425 TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 425 ? 11.367  40.668 43.957 1.00 19.62 ? 425 TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 425 ? 9.949   41.070 45.862 1.00 21.45 ? 425 TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 425 ? 11.020  41.435 45.065 1.00 21.95 ? 425 TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 425 ? 11.741  42.560 45.411 1.00 25.14 ? 425 TYR A OH  1 
ATOM   3257 N N   . GLN A 1 426 ? 7.514   35.481 42.597 1.00 21.01 ? 426 GLN A N   1 
ATOM   3258 C CA  . GLN A 1 426 ? 6.695   34.285 42.597 1.00 20.06 ? 426 GLN A CA  1 
ATOM   3259 C C   . GLN A 1 426 ? 7.383   33.105 41.905 1.00 20.22 ? 426 GLN A C   1 
ATOM   3260 O O   . GLN A 1 426 ? 7.160   31.952 42.266 1.00 20.93 ? 426 GLN A O   1 
ATOM   3261 C CB  . GLN A 1 426 ? 5.402   34.643 41.887 1.00 19.91 ? 426 GLN A CB  1 
ATOM   3262 C CG  . GLN A 1 426 ? 4.323   33.624 41.867 1.00 20.50 ? 426 GLN A CG  1 
ATOM   3263 C CD  . GLN A 1 426 ? 3.102   34.188 41.182 1.00 19.69 ? 426 GLN A CD  1 
ATOM   3264 O OE1 . GLN A 1 426 ? 2.663   35.287 41.505 1.00 19.83 ? 426 GLN A OE1 1 
ATOM   3265 N NE2 . GLN A 1 426 ? 2.552   33.448 40.230 1.00 19.54 ? 426 GLN A NE2 1 
ATOM   3266 N N   . CYS A 1 427 ? 8.220   33.398 40.913 1.00 19.55 ? 427 CYS A N   1 
ATOM   3267 C CA  . CYS A 1 427 ? 8.919   32.359 40.164 1.00 20.75 ? 427 CYS A CA  1 
ATOM   3268 C C   . CYS A 1 427 ? 10.286  31.999 40.732 1.00 21.82 ? 427 CYS A C   1 
ATOM   3269 O O   . CYS A 1 427 ? 10.738  30.864 40.595 1.00 22.41 ? 427 CYS A O   1 
ATOM   3270 C CB  . CYS A 1 427 ? 9.091   32.785 38.709 1.00 20.85 ? 427 CYS A CB  1 
ATOM   3271 S SG  . CYS A 1 427 ? 7.553   33.014 37.816 1.00 22.88 ? 427 CYS A SG  1 
ATOM   3272 N N   . GLY A 1 428 ? 10.950  32.966 41.356 1.00 21.91 ? 428 GLY A N   1 
ATOM   3273 C CA  . GLY A 1 428 ? 12.255  32.705 41.933 1.00 22.05 ? 428 GLY A CA  1 
ATOM   3274 C C   . GLY A 1 428 ? 13.355  32.591 40.892 1.00 23.60 ? 428 GLY A C   1 
ATOM   3275 O O   . GLY A 1 428 ? 13.185  33.015 39.746 1.00 23.92 ? 428 GLY A O   1 
ATOM   3276 N N   . GLY A 1 429 ? 14.484  32.009 41.289 1.00 22.24 ? 429 GLY A N   1 
ATOM   3277 C CA  . GLY A 1 429 ? 15.605  31.861 40.379 1.00 21.72 ? 429 GLY A CA  1 
ATOM   3278 C C   . GLY A 1 429 ? 15.301  31.101 39.099 1.00 22.38 ? 429 GLY A C   1 
ATOM   3279 O O   . GLY A 1 429 ? 14.275  30.422 38.989 1.00 22.75 ? 429 GLY A O   1 
ATOM   3280 N N   . TRP A 1 430 ? 16.214  31.209 38.135 1.00 21.65 ? 430 TRP A N   1 
ATOM   3281 C CA  . TRP A 1 430 ? 16.084  30.552 36.843 1.00 20.31 ? 430 TRP A CA  1 
ATOM   3282 C C   . TRP A 1 430 ? 14.773  30.892 36.142 1.00 20.42 ? 430 TRP A C   1 
ATOM   3283 O O   . TRP A 1 430 ? 14.034  30.001 35.737 1.00 20.55 ? 430 TRP A O   1 
ATOM   3284 C CB  . TRP A 1 430 ? 16.193  29.031 36.984 1.00 21.10 ? 430 TRP A CB  1 
ATOM   3285 C CG  . TRP A 1 430 ? 17.556  28.515 37.375 1.00 22.41 ? 430 TRP A CG  1 
ATOM   3286 C CD1 . TRP A 1 430 ? 17.918  27.988 38.585 1.00 22.27 ? 430 TRP A CD1 1 
ATOM   3287 C CD2 . TRP A 1 430 ? 18.727  28.453 36.547 1.00 23.45 ? 430 TRP A CD2 1 
ATOM   3288 N NE1 . TRP A 1 430 ? 19.236  27.601 38.560 1.00 22.38 ? 430 TRP A NE1 1 
ATOM   3289 C CE2 . TRP A 1 430 ? 19.758  27.876 37.323 1.00 23.16 ? 430 TRP A CE2 1 
ATOM   3290 C CE3 . TRP A 1 430 ? 19.006  28.828 35.225 1.00 23.69 ? 430 TRP A CE3 1 
ATOM   3291 C CZ2 . TRP A 1 430 ? 21.051  27.667 36.819 1.00 24.30 ? 430 TRP A CZ2 1 
ATOM   3292 C CZ3 . TRP A 1 430 ? 20.294  28.620 34.725 1.00 23.18 ? 430 TRP A CZ3 1 
ATOM   3293 C CH2 . TRP A 1 430 ? 21.297  28.045 35.523 1.00 24.07 ? 430 TRP A CH2 1 
ATOM   3294 N N   . THR A 1 431 ? 14.482  32.180 36.008 1.00 19.70 ? 431 THR A N   1 
ATOM   3295 C CA  . THR A 1 431 ? 13.273  32.614 35.323 1.00 19.58 ? 431 THR A CA  1 
ATOM   3296 C C   . THR A 1 431 ? 13.620  33.863 34.515 1.00 19.55 ? 431 THR A C   1 
ATOM   3297 O O   . THR A 1 431 ? 13.854  34.927 35.079 1.00 18.85 ? 431 THR A O   1 
ATOM   3298 C CB  . THR A 1 431 ? 12.131  32.939 36.320 1.00 20.31 ? 431 THR A CB  1 
ATOM   3299 O OG1 . THR A 1 431 ? 12.006  31.876 37.276 1.00 19.71 ? 431 THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 431 ? 10.804  33.092 35.573 1.00 17.24 ? 431 THR A CG2 1 
ATOM   3301 N N   . ILE A 1 432 ? 13.659  33.714 33.194 1.00 19.84 ? 432 ILE A N   1 
ATOM   3302 C CA  . ILE A 1 432 ? 13.996  34.804 32.278 1.00 20.80 ? 432 ILE A CA  1 
ATOM   3303 C C   . ILE A 1 432 ? 15.472  35.173 32.431 1.00 21.61 ? 432 ILE A C   1 
ATOM   3304 O O   . ILE A 1 432 ? 16.249  35.096 31.474 1.00 21.50 ? 432 ILE A O   1 
ATOM   3305 C CB  . ILE A 1 432 ? 13.106  36.047 32.525 1.00 20.02 ? 432 ILE A CB  1 
ATOM   3306 C CG1 . ILE A 1 432 ? 11.630  35.667 32.364 1.00 20.42 ? 432 ILE A CG1 1 
ATOM   3307 C CG2 . ILE A 1 432 ? 13.463  37.145 31.552 1.00 16.42 ? 432 ILE A CG2 1 
ATOM   3308 C CD1 . ILE A 1 432 ? 11.298  34.995 31.033 1.00 21.34 ? 432 ILE A CD1 1 
ATOM   3309 N N   . GLU A 1 433 ? 15.854  35.578 33.636 1.00 21.44 ? 433 GLU A N   1 
ATOM   3310 C CA  . GLU A 1 433 ? 17.239  35.918 33.918 1.00 23.18 ? 433 GLU A CA  1 
ATOM   3311 C C   . GLU A 1 433 ? 17.838  34.742 34.674 1.00 23.71 ? 433 GLU A C   1 
ATOM   3312 O O   . GLU A 1 433 ? 17.111  33.871 35.156 1.00 22.89 ? 433 GLU A O   1 
ATOM   3313 C CB  . GLU A 1 433 ? 17.334  37.166 34.794 1.00 24.27 ? 433 GLU A CB  1 
ATOM   3314 C CG  . GLU A 1 433 ? 16.908  38.458 34.128 1.00 27.55 ? 433 GLU A CG  1 
ATOM   3315 C CD  . GLU A 1 433 ? 17.664  38.730 32.844 1.00 29.49 ? 433 GLU A CD  1 
ATOM   3316 O OE1 . GLU A 1 433 ? 18.845  38.337 32.743 1.00 30.57 ? 433 GLU A OE1 1 
ATOM   3317 O OE2 . GLU A 1 433 ? 17.080  39.352 31.936 1.00 32.29 ? 433 GLU A OE2 1 
ATOM   3318 N N   . TRP A 1 434 ? 19.159  34.712 34.779 1.00 23.27 ? 434 TRP A N   1 
ATOM   3319 C CA  . TRP A 1 434 ? 19.812  33.634 35.503 1.00 22.67 ? 434 TRP A CA  1 
ATOM   3320 C C   . TRP A 1 434 ? 19.406  33.685 36.975 1.00 22.23 ? 434 TRP A C   1 
ATOM   3321 O O   . TRP A 1 434 ? 18.877  32.717 37.518 1.00 21.03 ? 434 TRP A O   1 
ATOM   3322 C CB  . TRP A 1 434 ? 21.330  33.760 35.385 1.00 22.03 ? 434 TRP A CB  1 
ATOM   3323 C CG  . TRP A 1 434 ? 22.090  32.756 36.218 1.00 22.06 ? 434 TRP A CG  1 
ATOM   3324 C CD1 . TRP A 1 434 ? 21.858  31.409 36.302 1.00 21.85 ? 434 TRP A CD1 1 
ATOM   3325 C CD2 . TRP A 1 434 ? 23.258  33.009 37.007 1.00 20.36 ? 434 TRP A CD2 1 
ATOM   3326 N NE1 . TRP A 1 434 ? 22.813  30.812 37.084 1.00 21.12 ? 434 TRP A NE1 1 
ATOM   3327 C CE2 . TRP A 1 434 ? 23.685  31.767 37.530 1.00 19.15 ? 434 TRP A CE2 1 
ATOM   3328 C CE3 . TRP A 1 434 ? 23.991  34.165 37.317 1.00 18.65 ? 434 TRP A CE3 1 
ATOM   3329 C CZ2 . TRP A 1 434 ? 24.815  31.646 38.345 1.00 18.28 ? 434 TRP A CZ2 1 
ATOM   3330 C CZ3 . TRP A 1 434 ? 25.120  34.043 38.129 1.00 15.35 ? 434 TRP A CZ3 1 
ATOM   3331 C CH2 . TRP A 1 434 ? 25.518  32.792 38.631 1.00 16.20 ? 434 TRP A CH2 1 
ATOM   3332 N N   . GLN A 1 435 ? 19.657  34.829 37.604 1.00 22.46 ? 435 GLN A N   1 
ATOM   3333 C CA  . GLN A 1 435 ? 19.339  35.039 39.015 1.00 23.16 ? 435 GLN A CA  1 
ATOM   3334 C C   . GLN A 1 435 ? 17.856  35.352 39.246 1.00 24.27 ? 435 GLN A C   1 
ATOM   3335 O O   . GLN A 1 435 ? 17.456  35.739 40.349 1.00 24.07 ? 435 GLN A O   1 
ATOM   3336 C CB  . GLN A 1 435 ? 20.187  36.190 39.573 1.00 20.55 ? 435 GLN A CB  1 
ATOM   3337 C CG  . GLN A 1 435 ? 21.667  35.890 39.745 1.00 19.92 ? 435 GLN A CG  1 
ATOM   3338 C CD  . GLN A 1 435 ? 21.929  34.795 40.759 1.00 21.74 ? 435 GLN A CD  1 
ATOM   3339 O OE1 . GLN A 1 435 ? 21.433  34.845 41.891 1.00 22.04 ? 435 GLN A OE1 1 
ATOM   3340 N NE2 . GLN A 1 435 ? 22.714  33.798 40.363 1.00 19.59 ? 435 GLN A NE2 1 
ATOM   3341 N N   . GLY A 1 436 ? 17.039  35.179 38.212 1.00 24.83 ? 436 GLY A N   1 
ATOM   3342 C CA  . GLY A 1 436 ? 15.630  35.491 38.356 1.00 24.09 ? 436 GLY A CA  1 
ATOM   3343 C C   . GLY A 1 436 ? 15.502  36.999 38.331 1.00 23.85 ? 436 GLY A C   1 
ATOM   3344 O O   . GLY A 1 436 ? 16.493  37.705 38.149 1.00 24.17 ? 436 GLY A O   1 
ATOM   3345 N N   . ASP A 1 437 ? 14.300  37.514 38.531 1.00 23.41 ? 437 ASP A N   1 
ATOM   3346 C CA  . ASP A 1 437 ? 14.131  38.951 38.486 1.00 24.23 ? 437 ASP A CA  1 
ATOM   3347 C C   . ASP A 1 437 ? 12.893  39.386 39.248 1.00 24.17 ? 437 ASP A C   1 
ATOM   3348 O O   . ASP A 1 437 ? 12.129  38.554 39.729 1.00 25.32 ? 437 ASP A O   1 
ATOM   3349 C CB  . ASP A 1 437 ? 14.009  39.392 37.029 1.00 26.40 ? 437 ASP A CB  1 
ATOM   3350 C CG  . ASP A 1 437 ? 14.505  40.794 36.804 1.00 27.21 ? 437 ASP A CG  1 
ATOM   3351 O OD1 . ASP A 1 437 ? 14.533  41.579 37.775 1.00 27.41 ? 437 ASP A OD1 1 
ATOM   3352 O OD2 . ASP A 1 437 ? 14.861  41.110 35.650 1.00 29.37 ? 437 ASP A OD2 1 
ATOM   3353 N N   . THR A 1 438 ? 12.695  40.697 39.338 1.00 22.77 ? 438 THR A N   1 
ATOM   3354 C CA  . THR A 1 438 ? 11.541  41.260 40.024 1.00 22.03 ? 438 THR A CA  1 
ATOM   3355 C C   . THR A 1 438 ? 10.587  41.887 39.006 1.00 22.36 ? 438 THR A C   1 
ATOM   3356 O O   . THR A 1 438 ? 11.025  42.381 37.967 1.00 22.41 ? 438 THR A O   1 
ATOM   3357 C CB  . THR A 1 438 ? 11.972  42.357 41.015 1.00 22.07 ? 438 THR A CB  1 
ATOM   3358 O OG1 . THR A 1 438 ? 10.822  42.854 41.715 1.00 21.74 ? 438 THR A OG1 1 
ATOM   3359 C CG2 . THR A 1 438 ? 12.644  43.501 40.269 1.00 16.28 ? 438 THR A CG2 1 
ATOM   3360 N N   . GLY A 1 439 ? 9.290   41.857 39.299 1.00 21.11 ? 439 GLY A N   1 
ATOM   3361 C CA  . GLY A 1 439 ? 8.318   42.460 38.401 1.00 21.18 ? 439 GLY A CA  1 
ATOM   3362 C C   . GLY A 1 439 ? 7.664   41.556 37.377 1.00 22.23 ? 439 GLY A C   1 
ATOM   3363 O O   . GLY A 1 439 ? 7.771   40.336 37.446 1.00 23.79 ? 439 GLY A O   1 
ATOM   3364 N N   . ARG A 1 440 ? 6.980   42.166 36.416 1.00 22.60 ? 440 ARG A N   1 
ATOM   3365 C CA  . ARG A 1 440 ? 6.289   41.420 35.371 1.00 23.40 ? 440 ARG A CA  1 
ATOM   3366 C C   . ARG A 1 440 ? 7.254   41.042 34.243 1.00 22.00 ? 440 ARG A C   1 
ATOM   3367 O O   . ARG A 1 440 ? 7.205   41.605 33.148 1.00 21.05 ? 440 ARG A O   1 
ATOM   3368 C CB  . ARG A 1 440 ? 5.120   42.262 34.843 1.00 25.62 ? 440 ARG A CB  1 
ATOM   3369 C CG  . ARG A 1 440 ? 4.308   41.616 33.748 1.00 29.12 ? 440 ARG A CG  1 
ATOM   3370 C CD  . ARG A 1 440 ? 2.888   42.166 33.717 1.00 34.73 ? 440 ARG A CD  1 
ATOM   3371 N NE  . ARG A 1 440 ? 1.936   41.171 34.214 1.00 41.27 ? 440 ARG A NE  1 
ATOM   3372 C CZ  . ARG A 1 440 ? 1.905   40.720 35.467 1.00 42.26 ? 440 ARG A CZ  1 
ATOM   3373 N NH1 . ARG A 1 440 ? 2.770   41.186 36.362 1.00 43.28 ? 440 ARG A NH1 1 
ATOM   3374 N NH2 . ARG A 1 440 ? 1.035   39.778 35.816 1.00 40.44 ? 440 ARG A NH2 1 
ATOM   3375 N N   . THR A 1 441 ? 8.119   40.069 34.519 1.00 20.08 ? 441 THR A N   1 
ATOM   3376 C CA  . THR A 1 441 ? 9.120   39.622 33.554 1.00 18.96 ? 441 THR A CA  1 
ATOM   3377 C C   . THR A 1 441 ? 8.626   38.632 32.499 1.00 18.75 ? 441 THR A C   1 
ATOM   3378 O O   . THR A 1 441 ? 9.346   38.327 31.549 1.00 18.35 ? 441 THR A O   1 
ATOM   3379 C CB  . THR A 1 441 ? 10.308  38.978 34.266 1.00 18.10 ? 441 THR A CB  1 
ATOM   3380 O OG1 . THR A 1 441 ? 9.869   37.791 34.934 1.00 17.62 ? 441 THR A OG1 1 
ATOM   3381 C CG2 . THR A 1 441 ? 10.896  39.931 35.282 1.00 18.55 ? 441 THR A CG2 1 
ATOM   3382 N N   . THR A 1 442 ? 7.416   38.113 32.664 1.00 17.53 ? 442 THR A N   1 
ATOM   3383 C CA  . THR A 1 442 ? 6.888   37.169 31.686 1.00 17.64 ? 442 THR A CA  1 
ATOM   3384 C C   . THR A 1 442 ? 5.371   37.081 31.793 1.00 17.47 ? 442 THR A C   1 
ATOM   3385 O O   . THR A 1 442 ? 4.754   37.891 32.476 1.00 18.84 ? 442 THR A O   1 
ATOM   3386 C CB  . THR A 1 442 ? 7.520   35.761 31.864 1.00 15.92 ? 442 THR A CB  1 
ATOM   3387 O OG1 . THR A 1 442 ? 7.148   34.932 30.765 1.00 12.83 ? 442 THR A OG1 1 
ATOM   3388 C CG2 . THR A 1 442 ? 7.051   35.111 33.144 1.00 15.94 ? 442 THR A CG2 1 
ATOM   3389 N N   . VAL A 1 443 ? 4.772   36.115 31.107 1.00 16.29 ? 443 VAL A N   1 
ATOM   3390 C CA  . VAL A 1 443 ? 3.325   35.946 31.147 1.00 17.07 ? 443 VAL A CA  1 
ATOM   3391 C C   . VAL A 1 443 ? 2.911   35.080 32.337 1.00 17.64 ? 443 VAL A C   1 
ATOM   3392 O O   . VAL A 1 443 ? 3.394   33.956 32.498 1.00 17.03 ? 443 VAL A O   1 
ATOM   3393 C CB  . VAL A 1 443 ? 2.807   35.290 29.844 1.00 17.45 ? 443 VAL A CB  1 
ATOM   3394 C CG1 . VAL A 1 443 ? 1.319   34.968 29.964 1.00 13.64 ? 443 VAL A CG1 1 
ATOM   3395 C CG2 . VAL A 1 443 ? 3.057   36.221 28.673 1.00 18.03 ? 443 VAL A CG2 1 
ATOM   3396 N N   . GLY A 1 444 ? 2.016   35.607 33.165 1.00 16.56 ? 444 GLY A N   1 
ATOM   3397 C CA  . GLY A 1 444 ? 1.557   34.861 34.322 1.00 17.02 ? 444 GLY A CA  1 
ATOM   3398 C C   . GLY A 1 444 ? 0.473   35.573 35.110 1.00 16.99 ? 444 GLY A C   1 
ATOM   3399 O O   . GLY A 1 444 ? -0.070  36.584 34.676 1.00 18.84 ? 444 GLY A O   1 
ATOM   3400 N N   . THR A 1 445 ? 0.153   35.033 36.276 1.00 17.42 ? 445 THR A N   1 
ATOM   3401 C CA  . THR A 1 445 ? -0.863  35.613 37.138 1.00 16.58 ? 445 THR A CA  1 
ATOM   3402 C C   . THR A 1 445 ? -0.274  35.674 38.533 1.00 16.55 ? 445 THR A C   1 
ATOM   3403 O O   . THR A 1 445 ? 0.130   34.652 39.081 1.00 15.02 ? 445 THR A O   1 
ATOM   3404 C CB  . THR A 1 445 ? -2.139  34.742 37.179 1.00 17.22 ? 445 THR A CB  1 
ATOM   3405 O OG1 . THR A 1 445 ? -2.570  34.452 35.846 1.00 17.65 ? 445 THR A OG1 1 
ATOM   3406 C CG2 . THR A 1 445 ? -3.252  35.468 37.895 1.00 17.71 ? 445 THR A CG2 1 
ATOM   3407 N N   . THR A 1 446 ? -0.212  36.876 39.097 1.00 16.52 ? 446 THR A N   1 
ATOM   3408 C CA  . THR A 1 446 ? 0.327   37.062 40.437 1.00 16.54 ? 446 THR A CA  1 
ATOM   3409 C C   . THR A 1 446 ? -0.727  36.646 41.452 1.00 16.24 ? 446 THR A C   1 
ATOM   3410 O O   . THR A 1 446 ? -1.839  36.272 41.071 1.00 16.78 ? 446 THR A O   1 
ATOM   3411 C CB  . THR A 1 446 ? 0.700   38.532 40.683 1.00 17.55 ? 446 THR A CB  1 
ATOM   3412 O OG1 . THR A 1 446 ? -0.485  39.337 40.678 1.00 18.65 ? 446 THR A OG1 1 
ATOM   3413 C CG2 . THR A 1 446 ? 1.651   39.019 39.599 1.00 17.26 ? 446 THR A CG2 1 
ATOM   3414 N N   . ILE A 1 447 ? -0.391  36.704 42.737 1.00 13.99 ? 447 ILE A N   1 
ATOM   3415 C CA  . ILE A 1 447 ? -1.360  36.329 43.751 1.00 14.43 ? 447 ILE A CA  1 
ATOM   3416 C C   . ILE A 1 447 ? -2.538  37.305 43.731 1.00 16.86 ? 447 ILE A C   1 
ATOM   3417 O O   . ILE A 1 447 ? -3.689  36.882 43.782 1.00 18.51 ? 447 ILE A O   1 
ATOM   3418 C CB  . ILE A 1 447 ? -0.702  36.261 45.145 1.00 14.13 ? 447 ILE A CB  1 
ATOM   3419 C CG1 . ILE A 1 447 ? 0.177   35.004 45.213 1.00 14.68 ? 447 ILE A CG1 1 
ATOM   3420 C CG2 . ILE A 1 447 ? -1.760  36.219 46.240 1.00 10.43 ? 447 ILE A CG2 1 
ATOM   3421 C CD1 . ILE A 1 447 ? 1.010   34.888 46.466 1.00 14.52 ? 447 ILE A CD1 1 
ATOM   3422 N N   . LEU A 1 448 ? -2.251  38.601 43.621 1.00 18.93 ? 448 LEU A N   1 
ATOM   3423 C CA  . LEU A 1 448 ? -3.292  39.628 43.566 1.00 18.98 ? 448 LEU A CA  1 
ATOM   3424 C C   . LEU A 1 448 ? -4.257  39.373 42.408 1.00 20.86 ? 448 LEU A C   1 
ATOM   3425 O O   . LEU A 1 448 ? -5.477  39.329 42.599 1.00 21.38 ? 448 LEU A O   1 
ATOM   3426 C CB  . LEU A 1 448 ? -2.663  41.013 43.407 1.00 18.53 ? 448 LEU A CB  1 
ATOM   3427 C CG  . LEU A 1 448 ? -3.602  42.193 43.133 1.00 17.58 ? 448 LEU A CG  1 
ATOM   3428 C CD1 . LEU A 1 448 ? -4.688  42.257 44.197 1.00 17.52 ? 448 LEU A CD1 1 
ATOM   3429 C CD2 . LEU A 1 448 ? -2.796  43.487 43.117 1.00 16.81 ? 448 LEU A CD2 1 
ATOM   3430 N N   . GLU A 1 449 ? -3.710  39.207 41.208 1.00 21.38 ? 449 GLU A N   1 
ATOM   3431 C CA  . GLU A 1 449 ? -4.537  38.942 40.033 1.00 22.78 ? 449 GLU A CA  1 
ATOM   3432 C C   . GLU A 1 449 ? -5.409  37.712 40.260 1.00 22.24 ? 449 GLU A C   1 
ATOM   3433 O O   . GLU A 1 449 ? -6.596  37.715 39.940 1.00 22.76 ? 449 GLU A O   1 
ATOM   3434 C CB  . GLU A 1 449 ? -3.665  38.702 38.801 1.00 24.37 ? 449 GLU A CB  1 
ATOM   3435 C CG  . GLU A 1 449 ? -2.848  39.886 38.346 1.00 25.97 ? 449 GLU A CG  1 
ATOM   3436 C CD  . GLU A 1 449 ? -1.925  39.517 37.202 1.00 30.22 ? 449 GLU A CD  1 
ATOM   3437 O OE1 . GLU A 1 449 ? -0.969  38.734 37.423 1.00 29.96 ? 449 GLU A OE1 1 
ATOM   3438 O OE2 . GLU A 1 449 ? -2.164  39.997 36.073 1.00 33.46 ? 449 GLU A OE2 1 
ATOM   3439 N N   . ALA A 1 450 ? -4.809  36.659 40.805 1.00 22.23 ? 450 ALA A N   1 
ATOM   3440 C CA  . ALA A 1 450 ? -5.527  35.420 41.077 1.00 21.94 ? 450 ALA A CA  1 
ATOM   3441 C C   . ALA A 1 450 ? -6.689  35.661 42.030 1.00 22.02 ? 450 ALA A C   1 
ATOM   3442 O O   . ALA A 1 450 ? -7.768  35.098 41.859 1.00 21.09 ? 450 ALA A O   1 
ATOM   3443 C CB  . ALA A 1 450 ? -4.585  34.391 41.661 1.00 22.41 ? 450 ALA A CB  1 
ATOM   3444 N N   . VAL A 1 451 ? -6.461  36.497 43.038 1.00 22.06 ? 451 VAL A N   1 
ATOM   3445 C CA  . VAL A 1 451 ? -7.502  36.811 44.001 1.00 22.43 ? 451 VAL A CA  1 
ATOM   3446 C C   . VAL A 1 451 ? -8.654  37.523 43.293 1.00 23.13 ? 451 VAL A C   1 
ATOM   3447 O O   . VAL A 1 451 ? -9.822  37.169 43.482 1.00 23.32 ? 451 VAL A O   1 
ATOM   3448 C CB  . VAL A 1 451 ? -6.959  37.707 45.140 1.00 22.01 ? 451 VAL A CB  1 
ATOM   3449 C CG1 . VAL A 1 451 ? -8.092  38.140 46.048 1.00 22.60 ? 451 VAL A CG1 1 
ATOM   3450 C CG2 . VAL A 1 451 ? -5.924  36.945 45.948 1.00 22.10 ? 451 VAL A CG2 1 
ATOM   3451 N N   . LYS A 1 452 ? -8.325  38.520 42.474 1.00 23.28 ? 452 LYS A N   1 
ATOM   3452 C CA  . LYS A 1 452 ? -9.341  39.279 41.737 1.00 23.82 ? 452 LYS A CA  1 
ATOM   3453 C C   . LYS A 1 452 ? -10.130 38.391 40.777 1.00 24.31 ? 452 LYS A C   1 
ATOM   3454 O O   . LYS A 1 452 ? -11.297 38.646 40.494 1.00 24.44 ? 452 LYS A O   1 
ATOM   3455 C CB  . LYS A 1 452 ? -8.697  40.405 40.928 1.00 22.05 ? 452 LYS A CB  1 
ATOM   3456 C CG  . LYS A 1 452 ? -8.105  41.534 41.734 1.00 21.30 ? 452 LYS A CG  1 
ATOM   3457 C CD  . LYS A 1 452 ? -7.600  42.611 40.793 1.00 21.26 ? 452 LYS A CD  1 
ATOM   3458 C CE  . LYS A 1 452 ? -7.141  43.840 41.536 1.00 26.28 ? 452 LYS A CE  1 
ATOM   3459 N NZ  . LYS A 1 452 ? -6.601  44.886 40.609 1.00 30.26 ? 452 LYS A NZ  1 
ATOM   3460 N N   . ALA A 1 453 ? -9.484  37.349 40.274 1.00 24.80 ? 453 ALA A N   1 
ATOM   3461 C CA  . ALA A 1 453 ? -10.128 36.442 39.337 1.00 25.03 ? 453 ALA A CA  1 
ATOM   3462 C C   . ALA A 1 453 ? -10.926 35.339 40.026 1.00 24.47 ? 453 ALA A C   1 
ATOM   3463 O O   . ALA A 1 453 ? -11.588 34.547 39.358 1.00 24.62 ? 453 ALA A O   1 
ATOM   3464 C CB  . ALA A 1 453 ? -9.070  35.817 38.416 1.00 24.58 ? 453 ALA A CB  1 
ATOM   3465 N N   . ALA A 1 454 ? -10.881 35.297 41.354 1.00 23.68 ? 454 ALA A N   1 
ATOM   3466 C CA  . ALA A 1 454 ? -11.564 34.244 42.100 1.00 22.68 ? 454 ALA A CA  1 
ATOM   3467 C C   . ALA A 1 454 ? -12.782 34.678 42.891 1.00 22.91 ? 454 ALA A C   1 
ATOM   3468 O O   . ALA A 1 454 ? -13.776 33.962 42.955 1.00 23.60 ? 454 ALA A O   1 
ATOM   3469 C CB  . ALA A 1 454 ? -10.570 33.568 43.045 1.00 22.65 ? 454 ALA A CB  1 
ATOM   3470 N N   . VAL A 1 455 ? -12.694 35.847 43.507 1.00 22.71 ? 455 VAL A N   1 
ATOM   3471 C CA  . VAL A 1 455 ? -13.772 36.356 44.334 1.00 21.98 ? 455 VAL A CA  1 
ATOM   3472 C C   . VAL A 1 455 ? -15.065 36.688 43.599 1.00 22.80 ? 455 VAL A C   1 
ATOM   3473 O O   . VAL A 1 455 ? -15.083 36.890 42.386 1.00 22.40 ? 455 VAL A O   1 
ATOM   3474 C CB  . VAL A 1 455 ? -13.317 37.609 45.094 1.00 21.65 ? 455 VAL A CB  1 
ATOM   3475 C CG1 . VAL A 1 455 ? -12.202 37.252 46.067 1.00 18.93 ? 455 VAL A CG1 1 
ATOM   3476 C CG2 . VAL A 1 455 ? -12.857 38.667 44.097 1.00 21.42 ? 455 VAL A CG2 1 
ATOM   3477 N N   . ASP A 1 456 ? -16.144 36.741 44.372 1.00 22.79 ? 456 ASP A N   1 
ATOM   3478 C CA  . ASP A 1 456 ? -17.467 37.065 43.874 1.00 24.57 ? 456 ASP A CA  1 
ATOM   3479 C C   . ASP A 1 456 ? -17.443 38.516 43.374 1.00 24.87 ? 456 ASP A C   1 
ATOM   3480 O O   . ASP A 1 456 ? -16.753 39.361 43.941 1.00 25.20 ? 456 ASP A O   1 
ATOM   3481 C CB  . ASP A 1 456 ? -18.478 36.883 45.015 1.00 26.48 ? 456 ASP A CB  1 
ATOM   3482 C CG  . ASP A 1 456 ? -19.885 37.259 44.619 1.00 29.01 ? 456 ASP A CG  1 
ATOM   3483 O OD1 . ASP A 1 456 ? -20.187 38.477 44.533 1.00 28.86 ? 456 ASP A OD1 1 
ATOM   3484 O OD2 . ASP A 1 456 ? -20.687 36.331 44.390 1.00 30.00 ? 456 ASP A OD2 1 
ATOM   3485 N N   . PRO A 1 457 ? -18.201 38.821 42.307 1.00 24.79 ? 457 PRO A N   1 
ATOM   3486 C CA  . PRO A 1 457 ? -18.258 40.171 41.733 1.00 23.88 ? 457 PRO A CA  1 
ATOM   3487 C C   . PRO A 1 457 ? -18.479 41.278 42.762 1.00 23.26 ? 457 PRO A C   1 
ATOM   3488 O O   . PRO A 1 457 ? -17.969 42.388 42.613 1.00 22.30 ? 457 PRO A O   1 
ATOM   3489 C CB  . PRO A 1 457 ? -19.428 40.086 40.751 1.00 23.24 ? 457 PRO A CB  1 
ATOM   3490 C CG  . PRO A 1 457 ? -19.458 38.658 40.364 1.00 25.78 ? 457 PRO A CG  1 
ATOM   3491 C CD  . PRO A 1 457 ? -19.191 37.939 41.663 1.00 25.19 ? 457 PRO A CD  1 
ATOM   3492 N N   . SER A 1 458 ? -19.249 40.977 43.801 1.00 23.05 ? 458 SER A N   1 
ATOM   3493 C CA  . SER A 1 458 ? -19.549 41.977 44.813 1.00 23.63 ? 458 SER A CA  1 
ATOM   3494 C C   . SER A 1 458 ? -18.401 42.210 45.775 1.00 24.04 ? 458 SER A C   1 
ATOM   3495 O O   . SER A 1 458 ? -18.425 43.168 46.536 1.00 25.75 ? 458 SER A O   1 
ATOM   3496 C CB  . SER A 1 458 ? -20.801 41.584 45.602 1.00 23.22 ? 458 SER A CB  1 
ATOM   3497 O OG  . SER A 1 458 ? -20.597 40.390 46.335 1.00 24.00 ? 458 SER A OG  1 
ATOM   3498 N N   . THR A 1 459 ? -17.394 41.346 45.741 1.00 24.00 ? 459 THR A N   1 
ATOM   3499 C CA  . THR A 1 459 ? -16.255 41.485 46.642 1.00 23.24 ? 459 THR A CA  1 
ATOM   3500 C C   . THR A 1 459 ? -15.245 42.537 46.191 1.00 22.88 ? 459 THR A C   1 
ATOM   3501 O O   . THR A 1 459 ? -14.584 42.383 45.162 1.00 23.56 ? 459 THR A O   1 
ATOM   3502 C CB  . THR A 1 459 ? -15.513 40.140 46.815 1.00 23.69 ? 459 THR A CB  1 
ATOM   3503 O OG1 . THR A 1 459 ? -16.408 39.172 47.377 1.00 23.00 ? 459 THR A OG1 1 
ATOM   3504 C CG2 . THR A 1 459 ? -14.300 40.309 47.735 1.00 21.36 ? 459 THR A CG2 1 
ATOM   3505 N N   . VAL A 1 460 ? -15.126 43.607 46.966 1.00 21.10 ? 460 VAL A N   1 
ATOM   3506 C CA  . VAL A 1 460 ? -14.178 44.657 46.646 1.00 21.35 ? 460 VAL A CA  1 
ATOM   3507 C C   . VAL A 1 460 ? -12.805 44.186 47.095 1.00 23.64 ? 460 VAL A C   1 
ATOM   3508 O O   . VAL A 1 460 ? -12.634 43.724 48.227 1.00 24.06 ? 460 VAL A O   1 
ATOM   3509 C CB  . VAL A 1 460 ? -14.511 45.960 47.376 1.00 21.40 ? 460 VAL A CB  1 
ATOM   3510 C CG1 . VAL A 1 460 ? -13.432 46.992 47.097 1.00 19.58 ? 460 VAL A CG1 1 
ATOM   3511 C CG2 . VAL A 1 460 ? -15.876 46.472 46.934 1.00 18.12 ? 460 VAL A CG2 1 
ATOM   3512 N N   . VAL A 1 461 ? -11.825 44.297 46.206 1.00 25.06 ? 461 VAL A N   1 
ATOM   3513 C CA  . VAL A 1 461 ? -10.471 43.864 46.522 1.00 25.85 ? 461 VAL A CA  1 
ATOM   3514 C C   . VAL A 1 461 ? -9.502  45.037 46.519 1.00 26.36 ? 461 VAL A C   1 
ATOM   3515 O O   . VAL A 1 461 ? -9.282  45.677 45.491 1.00 27.25 ? 461 VAL A O   1 
ATOM   3516 C CB  . VAL A 1 461 ? -9.984  42.813 45.516 1.00 25.16 ? 461 VAL A CB  1 
ATOM   3517 C CG1 . VAL A 1 461 ? -8.613  42.310 45.916 1.00 26.40 ? 461 VAL A CG1 1 
ATOM   3518 C CG2 . VAL A 1 461 ? -10.971 41.668 45.453 1.00 25.67 ? 461 VAL A CG2 1 
ATOM   3519 N N   . VAL A 1 462 ? -8.923  45.316 47.679 1.00 26.12 ? 462 VAL A N   1 
ATOM   3520 C CA  . VAL A 1 462 ? -7.980  46.413 47.801 1.00 25.45 ? 462 VAL A CA  1 
ATOM   3521 C C   . VAL A 1 462 ? -6.542  45.915 47.897 1.00 26.49 ? 462 VAL A C   1 
ATOM   3522 O O   . VAL A 1 462 ? -6.242  44.973 48.632 1.00 26.04 ? 462 VAL A O   1 
ATOM   3523 C CB  . VAL A 1 462 ? -8.284  47.268 49.045 1.00 23.71 ? 462 VAL A CB  1 
ATOM   3524 C CG1 . VAL A 1 462 ? -7.252  48.372 49.176 1.00 22.33 ? 462 VAL A CG1 1 
ATOM   3525 C CG2 . VAL A 1 462 ? -9.688  47.849 48.948 1.00 22.68 ? 462 VAL A CG2 1 
ATOM   3526 N N   . PHE A 1 463 ? -5.652  46.545 47.140 1.00 26.24 ? 463 PHE A N   1 
ATOM   3527 C CA  . PHE A 1 463 ? -4.253  46.169 47.187 1.00 25.33 ? 463 PHE A CA  1 
ATOM   3528 C C   . PHE A 1 463 ? -3.430  47.259 47.862 1.00 26.25 ? 463 PHE A C   1 
ATOM   3529 O O   . PHE A 1 463 ? -3.626  48.446 47.613 1.00 26.97 ? 463 PHE A O   1 
ATOM   3530 C CB  . PHE A 1 463 ? -3.703  45.919 45.787 1.00 23.22 ? 463 PHE A CB  1 
ATOM   3531 C CG  . PHE A 1 463 ? -2.227  45.679 45.772 1.00 24.21 ? 463 PHE A CG  1 
ATOM   3532 C CD1 . PHE A 1 463 ? -1.680  44.613 46.478 1.00 24.18 ? 463 PHE A CD1 1 
ATOM   3533 C CD2 . PHE A 1 463 ? -1.374  46.544 45.104 1.00 22.52 ? 463 PHE A CD2 1 
ATOM   3534 C CE1 . PHE A 1 463 ? -0.303  44.418 46.520 1.00 24.12 ? 463 PHE A CE1 1 
ATOM   3535 C CE2 . PHE A 1 463 ? 0.005   46.354 45.141 1.00 22.19 ? 463 PHE A CE2 1 
ATOM   3536 C CZ  . PHE A 1 463 ? 0.541   45.292 45.850 1.00 21.30 ? 463 PHE A CZ  1 
ATOM   3537 N N   . ALA A 1 464 ? -2.514  46.846 48.728 1.00 27.30 ? 464 ALA A N   1 
ATOM   3538 C CA  . ALA A 1 464 ? -1.643  47.778 49.435 1.00 28.41 ? 464 ALA A CA  1 
ATOM   3539 C C   . ALA A 1 464 ? -0.389  47.002 49.797 1.00 29.63 ? 464 ALA A C   1 
ATOM   3540 O O   . ALA A 1 464 ? -0.432  46.132 50.668 1.00 30.28 ? 464 ALA A O   1 
ATOM   3541 C CB  . ALA A 1 464 ? -2.328  48.290 50.688 1.00 26.23 ? 464 ALA A CB  1 
ATOM   3542 N N   . GLU A 1 465 ? 0.722   47.314 49.132 1.00 29.02 ? 465 GLU A N   1 
ATOM   3543 C CA  . GLU A 1 465 ? 1.966   46.597 49.373 1.00 28.92 ? 465 GLU A CA  1 
ATOM   3544 C C   . GLU A 1 465 ? 2.442   46.592 50.818 1.00 29.71 ? 465 GLU A C   1 
ATOM   3545 O O   . GLU A 1 465 ? 2.834   45.541 51.328 1.00 29.58 ? 465 GLU A O   1 
ATOM   3546 C CB  . GLU A 1 465 ? 3.090   47.127 48.478 1.00 27.66 ? 465 GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 465 ? 4.227   46.116 48.355 1.00 31.85 ? 465 GLU A CG  1 
ATOM   3548 C CD  . GLU A 1 465 ? 5.345   46.539 47.418 1.00 31.89 ? 465 GLU A CD  1 
ATOM   3549 O OE1 . GLU A 1 465 ? 5.044   47.095 46.340 1.00 33.35 ? 465 GLU A OE1 1 
ATOM   3550 O OE2 . GLU A 1 465 ? 6.527   46.290 47.756 1.00 32.43 ? 465 GLU A OE2 1 
ATOM   3551 N N   . ASN A 1 466 ? 2.408   47.751 51.476 1.00 30.35 ? 466 ASN A N   1 
ATOM   3552 C CA  . ASN A 1 466 ? 2.863   47.857 52.863 1.00 31.73 ? 466 ASN A CA  1 
ATOM   3553 C C   . ASN A 1 466 ? 2.050   48.814 53.709 1.00 31.59 ? 466 ASN A C   1 
ATOM   3554 O O   . ASN A 1 466 ? 2.534   49.864 54.128 1.00 31.53 ? 466 ASN A O   1 
ATOM   3555 C CB  . ASN A 1 466 ? 4.327   48.275 52.898 1.00 33.81 ? 466 ASN A CB  1 
ATOM   3556 C CG  . ASN A 1 466 ? 5.254   47.101 52.737 1.00 39.75 ? 466 ASN A CG  1 
ATOM   3557 O OD1 . ASN A 1 466 ? 5.473   46.350 53.689 1.00 41.29 ? 466 ASN A OD1 1 
ATOM   3558 N ND2 . ASN A 1 466 ? 5.790   46.912 51.525 1.00 39.88 ? 466 ASN A ND2 1 
ATOM   3559 N N   . PRO A 1 467 ? 0.803   48.444 54.005 1.00 31.49 ? 467 PRO A N   1 
ATOM   3560 C CA  . PRO A 1 467 ? -0.075  49.293 54.810 1.00 30.66 ? 467 PRO A CA  1 
ATOM   3561 C C   . PRO A 1 467 ? 0.350   49.322 56.268 1.00 29.85 ? 467 PRO A C   1 
ATOM   3562 O O   . PRO A 1 467 ? 0.805   48.308 56.803 1.00 29.82 ? 467 PRO A O   1 
ATOM   3563 C CB  . PRO A 1 467 ? -1.449  48.633 54.655 1.00 30.98 ? 467 PRO A CB  1 
ATOM   3564 C CG  . PRO A 1 467 ? -1.259  47.566 53.582 1.00 32.32 ? 467 PRO A CG  1 
ATOM   3565 C CD  . PRO A 1 467 ? 0.162   47.156 53.711 1.00 30.64 ? 467 PRO A CD  1 
ATOM   3566 N N   . ASP A 1 468 ? 0.213   50.476 56.912 1.00 28.59 ? 468 ASP A N   1 
ATOM   3567 C CA  . ASP A 1 468 ? 0.543   50.549 58.325 1.00 27.96 ? 468 ASP A CA  1 
ATOM   3568 C C   . ASP A 1 468 ? -0.669  49.991 59.059 1.00 27.71 ? 468 ASP A C   1 
ATOM   3569 O O   . ASP A 1 468 ? -1.734  49.799 58.462 1.00 27.50 ? 468 ASP A O   1 
ATOM   3570 C CB  . ASP A 1 468 ? 0.833   51.987 58.775 1.00 29.82 ? 468 ASP A CB  1 
ATOM   3571 C CG  . ASP A 1 468 ? -0.233  52.972 58.342 1.00 32.15 ? 468 ASP A CG  1 
ATOM   3572 O OD1 . ASP A 1 468 ? -1.437  52.701 58.548 1.00 33.37 ? 468 ASP A OD1 1 
ATOM   3573 O OD2 . ASP A 1 468 ? 0.145   54.034 57.803 1.00 33.36 ? 468 ASP A OD2 1 
ATOM   3574 N N   . ALA A 1 469 ? -0.513  49.724 60.348 1.00 26.52 ? 469 ALA A N   1 
ATOM   3575 C CA  . ALA A 1 469 ? -1.603  49.158 61.125 1.00 26.61 ? 469 ALA A CA  1 
ATOM   3576 C C   . ALA A 1 469 ? -2.906  49.954 61.015 1.00 26.30 ? 469 ALA A C   1 
ATOM   3577 O O   . ALA A 1 469 ? -3.994  49.379 60.918 1.00 25.74 ? 469 ALA A O   1 
ATOM   3578 C CB  . ALA A 1 469 ? -1.181  49.035 62.582 1.00 24.78 ? 469 ALA A CB  1 
ATOM   3579 N N   . GLU A 1 470 ? -2.792  51.276 61.020 1.00 25.79 ? 470 GLU A N   1 
ATOM   3580 C CA  . GLU A 1 470 ? -3.964  52.133 60.955 1.00 27.43 ? 470 GLU A CA  1 
ATOM   3581 C C   . GLU A 1 470 ? -4.805  51.899 59.702 1.00 26.77 ? 470 GLU A C   1 
ATOM   3582 O O   . GLU A 1 470 ? -6.024  51.738 59.782 1.00 25.73 ? 470 GLU A O   1 
ATOM   3583 C CB  . GLU A 1 470 ? -3.530  53.594 61.021 1.00 30.78 ? 470 GLU A CB  1 
ATOM   3584 C CG  . GLU A 1 470 ? -4.542  54.514 61.665 1.00 36.36 ? 470 GLU A CG  1 
ATOM   3585 C CD  . GLU A 1 470 ? -3.989  55.915 61.873 1.00 41.63 ? 470 GLU A CD  1 
ATOM   3586 O OE1 . GLU A 1 470 ? -3.926  56.679 60.882 1.00 42.27 ? 470 GLU A OE1 1 
ATOM   3587 O OE2 . GLU A 1 470 ? -3.603  56.246 63.026 1.00 43.37 ? 470 GLU A OE2 1 
ATOM   3588 N N   . PHE A 1 471 ? -4.146  51.880 58.548 1.00 25.37 ? 471 PHE A N   1 
ATOM   3589 C CA  . PHE A 1 471 ? -4.821  51.679 57.279 1.00 24.09 ? 471 PHE A CA  1 
ATOM   3590 C C   . PHE A 1 471 ? -5.673  50.421 57.288 1.00 24.42 ? 471 PHE A C   1 
ATOM   3591 O O   . PHE A 1 471 ? -6.742  50.378 56.674 1.00 25.57 ? 471 PHE A O   1 
ATOM   3592 C CB  . PHE A 1 471 ? -3.788  51.608 56.152 1.00 23.84 ? 471 PHE A CB  1 
ATOM   3593 C CG  . PHE A 1 471 ? -4.356  51.191 54.818 1.00 25.36 ? 471 PHE A CG  1 
ATOM   3594 C CD1 . PHE A 1 471 ? -4.574  49.842 54.524 1.00 24.51 ? 471 PHE A CD1 1 
ATOM   3595 C CD2 . PHE A 1 471 ? -4.662  52.145 53.846 1.00 26.52 ? 471 PHE A CD2 1 
ATOM   3596 C CE1 . PHE A 1 471 ? -5.085  49.450 53.284 1.00 24.70 ? 471 PHE A CE1 1 
ATOM   3597 C CE2 . PHE A 1 471 ? -5.175  51.763 52.597 1.00 25.26 ? 471 PHE A CE2 1 
ATOM   3598 C CZ  . PHE A 1 471 ? -5.386  50.413 52.317 1.00 25.09 ? 471 PHE A CZ  1 
ATOM   3599 N N   . VAL A 1 472 ? -5.202  49.397 57.989 1.00 23.01 ? 472 VAL A N   1 
ATOM   3600 C CA  . VAL A 1 472 ? -5.927  48.145 58.050 1.00 22.28 ? 472 VAL A CA  1 
ATOM   3601 C C   . VAL A 1 472 ? -7.091  48.208 59.026 1.00 23.04 ? 472 VAL A C   1 
ATOM   3602 O O   . VAL A 1 472 ? -8.220  47.861 58.669 1.00 22.74 ? 472 VAL A O   1 
ATOM   3603 C CB  . VAL A 1 472 ? -4.992  46.991 58.441 1.00 22.11 ? 472 VAL A CB  1 
ATOM   3604 C CG1 . VAL A 1 472 ? -5.744  45.672 58.399 1.00 19.65 ? 472 VAL A CG1 1 
ATOM   3605 C CG2 . VAL A 1 472 ? -3.803  46.957 57.494 1.00 19.55 ? 472 VAL A CG2 1 
ATOM   3606 N N   . LYS A 1 473 ? -6.827  48.659 60.249 1.00 23.58 ? 473 LYS A N   1 
ATOM   3607 C CA  . LYS A 1 473 ? -7.882  48.746 61.258 1.00 25.36 ? 473 LYS A CA  1 
ATOM   3608 C C   . LYS A 1 473 ? -9.114  49.529 60.800 1.00 25.60 ? 473 LYS A C   1 
ATOM   3609 O O   . LYS A 1 473 ? -10.231 49.214 61.200 1.00 26.44 ? 473 LYS A O   1 
ATOM   3610 C CB  . LYS A 1 473 ? -7.361  49.371 62.554 1.00 26.81 ? 473 LYS A CB  1 
ATOM   3611 C CG  . LYS A 1 473 ? -6.393  48.521 63.350 1.00 28.62 ? 473 LYS A CG  1 
ATOM   3612 C CD  . LYS A 1 473 ? -6.553  48.812 64.840 1.00 32.65 ? 473 LYS A CD  1 
ATOM   3613 C CE  . LYS A 1 473 ? -5.389  48.275 65.669 1.00 36.04 ? 473 LYS A CE  1 
ATOM   3614 N NZ  . LYS A 1 473 ? -4.137  49.058 65.429 1.00 37.49 ? 473 LYS A NZ  1 
ATOM   3615 N N   . SER A 1 474 ? -8.919  50.549 59.970 1.00 25.43 ? 474 SER A N   1 
ATOM   3616 C CA  . SER A 1 474 ? -10.047 51.343 59.495 1.00 26.37 ? 474 SER A CA  1 
ATOM   3617 C C   . SER A 1 474 ? -10.444 51.056 58.055 1.00 25.96 ? 474 SER A C   1 
ATOM   3618 O O   . SER A 1 474 ? -11.284 51.753 57.490 1.00 25.53 ? 474 SER A O   1 
ATOM   3619 C CB  . SER A 1 474 ? -9.749  52.833 59.658 1.00 26.36 ? 474 SER A CB  1 
ATOM   3620 O OG  . SER A 1 474 ? -8.406  53.115 59.335 1.00 29.75 ? 474 SER A OG  1 
ATOM   3621 N N   . GLY A 1 475 ? -9.859  50.014 57.471 1.00 25.78 ? 475 GLY A N   1 
ATOM   3622 C CA  . GLY A 1 475 ? -10.169 49.672 56.095 1.00 23.81 ? 475 GLY A CA  1 
ATOM   3623 C C   . GLY A 1 475 ? -11.477 48.932 55.889 1.00 23.17 ? 475 GLY A C   1 
ATOM   3624 O O   . GLY A 1 475 ? -11.959 48.828 54.758 1.00 23.19 ? 475 GLY A O   1 
ATOM   3625 N N   . GLY A 1 476 ? -12.052 48.417 56.971 1.00 21.66 ? 476 GLY A N   1 
ATOM   3626 C CA  . GLY A 1 476 ? -13.300 47.687 56.862 1.00 21.41 ? 476 GLY A CA  1 
ATOM   3627 C C   . GLY A 1 476 ? -13.125 46.376 56.115 1.00 22.08 ? 476 GLY A C   1 
ATOM   3628 O O   . GLY A 1 476 ? -13.949 46.008 55.276 1.00 22.19 ? 476 GLY A O   1 
ATOM   3629 N N   . PHE A 1 477 ? -12.050 45.661 56.426 1.00 22.05 ? 477 PHE A N   1 
ATOM   3630 C CA  . PHE A 1 477 ? -11.758 44.393 55.767 1.00 20.87 ? 477 PHE A CA  1 
ATOM   3631 C C   . PHE A 1 477 ? -12.330 43.191 56.515 1.00 21.08 ? 477 PHE A C   1 
ATOM   3632 O O   . PHE A 1 477 ? -12.413 43.195 57.741 1.00 20.87 ? 477 PHE A O   1 
ATOM   3633 C CB  . PHE A 1 477 ? -10.244 44.236 55.611 1.00 20.14 ? 477 PHE A CB  1 
ATOM   3634 C CG  . PHE A 1 477 ? -9.614  45.280 54.731 1.00 19.93 ? 477 PHE A CG  1 
ATOM   3635 C CD1 . PHE A 1 477 ? -9.953  45.369 53.384 1.00 19.97 ? 477 PHE A CD1 1 
ATOM   3636 C CD2 . PHE A 1 477 ? -8.680  46.177 55.250 1.00 19.98 ? 477 PHE A CD2 1 
ATOM   3637 C CE1 . PHE A 1 477 ? -9.374  46.336 52.568 1.00 20.40 ? 477 PHE A CE1 1 
ATOM   3638 C CE2 . PHE A 1 477 ? -8.094  47.149 54.444 1.00 19.11 ? 477 PHE A CE2 1 
ATOM   3639 C CZ  . PHE A 1 477 ? -8.440  47.230 53.101 1.00 21.15 ? 477 PHE A CZ  1 
ATOM   3640 N N   . SER A 1 478 ? -12.733 42.167 55.768 1.00 21.45 ? 478 SER A N   1 
ATOM   3641 C CA  . SER A 1 478 ? -13.287 40.955 56.366 1.00 22.21 ? 478 SER A CA  1 
ATOM   3642 C C   . SER A 1 478 ? -12.143 40.009 56.709 1.00 21.96 ? 478 SER A C   1 
ATOM   3643 O O   . SER A 1 478 ? -12.234 39.202 57.639 1.00 22.56 ? 478 SER A O   1 
ATOM   3644 C CB  . SER A 1 478 ? -14.242 40.264 55.387 1.00 23.10 ? 478 SER A CB  1 
ATOM   3645 O OG  . SER A 1 478 ? -15.275 41.141 54.974 1.00 28.52 ? 478 SER A OG  1 
ATOM   3646 N N   . TYR A 1 479 ? -11.068 40.118 55.936 1.00 20.44 ? 479 TYR A N   1 
ATOM   3647 C CA  . TYR A 1 479 ? -9.879  39.303 56.128 1.00 20.16 ? 479 TYR A CA  1 
ATOM   3648 C C   . TYR A 1 479 ? -8.805  39.809 55.185 1.00 19.29 ? 479 TYR A C   1 
ATOM   3649 O O   . TYR A 1 479 ? -9.068  40.667 54.345 1.00 18.62 ? 479 TYR A O   1 
ATOM   3650 C CB  . TYR A 1 479 ? -10.189 37.829 55.846 1.00 20.95 ? 479 TYR A CB  1 
ATOM   3651 C CG  . TYR A 1 479 ? -10.642 37.528 54.430 1.00 21.44 ? 479 TYR A CG  1 
ATOM   3652 C CD1 . TYR A 1 479 ? -9.738  37.556 53.364 1.00 21.70 ? 479 TYR A CD1 1 
ATOM   3653 C CD2 . TYR A 1 479 ? -11.971 37.197 54.158 1.00 18.58 ? 479 TYR A CD2 1 
ATOM   3654 C CE1 . TYR A 1 479 ? -10.147 37.263 52.066 1.00 22.33 ? 479 TYR A CE1 1 
ATOM   3655 C CE2 . TYR A 1 479 ? -12.390 36.898 52.866 1.00 20.24 ? 479 TYR A CE2 1 
ATOM   3656 C CZ  . TYR A 1 479 ? -11.474 36.933 51.825 1.00 22.34 ? 479 TYR A CZ  1 
ATOM   3657 O OH  . TYR A 1 479 ? -11.873 36.640 50.545 1.00 21.74 ? 479 TYR A OH  1 
ATOM   3658 N N   . ALA A 1 480 ? -7.592  39.290 55.321 1.00 19.68 ? 480 ALA A N   1 
ATOM   3659 C CA  . ALA A 1 480 ? -6.513  39.730 54.452 1.00 20.25 ? 480 ALA A CA  1 
ATOM   3660 C C   . ALA A 1 480 ? -5.580  38.599 54.053 1.00 21.45 ? 480 ALA A C   1 
ATOM   3661 O O   . ALA A 1 480 ? -5.399  37.625 54.789 1.00 21.81 ? 480 ALA A O   1 
ATOM   3662 C CB  . ALA A 1 480 ? -5.717  40.841 55.126 1.00 17.85 ? 480 ALA A CB  1 
ATOM   3663 N N   . ILE A 1 481 ? -5.005  38.735 52.863 1.00 21.59 ? 481 ILE A N   1 
ATOM   3664 C CA  . ILE A 1 481 ? -4.052  37.768 52.347 1.00 19.82 ? 481 ILE A CA  1 
ATOM   3665 C C   . ILE A 1 481 ? -2.783  38.582 52.152 1.00 20.88 ? 481 ILE A C   1 
ATOM   3666 O O   . ILE A 1 481 ? -2.775  39.544 51.377 1.00 20.57 ? 481 ILE A O   1 
ATOM   3667 C CB  . ILE A 1 481 ? -4.508  37.185 50.991 1.00 18.29 ? 481 ILE A CB  1 
ATOM   3668 C CG1 . ILE A 1 481 ? -5.828  36.427 51.162 1.00 16.22 ? 481 ILE A CG1 1 
ATOM   3669 C CG2 . ILE A 1 481 ? -3.442  36.266 50.442 1.00 13.19 ? 481 ILE A CG2 1 
ATOM   3670 C CD1 . ILE A 1 481 ? -6.474  36.009 49.857 1.00 12.64 ? 481 ILE A CD1 1 
ATOM   3671 N N   . VAL A 1 482 ? -1.732  38.218 52.884 1.00 21.20 ? 482 VAL A N   1 
ATOM   3672 C CA  . VAL A 1 482 ? -0.449  38.908 52.802 1.00 20.47 ? 482 VAL A CA  1 
ATOM   3673 C C   . VAL A 1 482 ? 0.609   37.958 52.271 1.00 20.62 ? 482 VAL A C   1 
ATOM   3674 O O   . VAL A 1 482 ? 0.756   36.845 52.769 1.00 21.69 ? 482 VAL A O   1 
ATOM   3675 C CB  . VAL A 1 482 ? 0.030   39.390 54.174 1.00 21.88 ? 482 VAL A CB  1 
ATOM   3676 C CG1 . VAL A 1 482 ? 1.199   40.344 53.999 1.00 23.02 ? 482 VAL A CG1 1 
ATOM   3677 C CG2 . VAL A 1 482 ? -1.097  40.050 54.924 1.00 23.34 ? 482 VAL A CG2 1 
ATOM   3678 N N   . ALA A 1 483 ? 1.356   38.403 51.270 1.00 20.88 ? 483 ALA A N   1 
ATOM   3679 C CA  . ALA A 1 483 ? 2.393   37.571 50.679 1.00 19.70 ? 483 ALA A CA  1 
ATOM   3680 C C   . ALA A 1 483 ? 3.759   38.218 50.845 1.00 19.74 ? 483 ALA A C   1 
ATOM   3681 O O   . ALA A 1 483 ? 3.976   39.355 50.421 1.00 19.72 ? 483 ALA A O   1 
ATOM   3682 C CB  . ALA A 1 483 ? 2.097   37.340 49.200 1.00 19.09 ? 483 ALA A CB  1 
ATOM   3683 N N   . VAL A 1 484 ? 4.675   37.484 51.468 1.00 19.25 ? 484 VAL A N   1 
ATOM   3684 C CA  . VAL A 1 484 ? 6.032   37.962 51.697 1.00 17.54 ? 484 VAL A CA  1 
ATOM   3685 C C   . VAL A 1 484 ? 7.013   36.805 51.520 1.00 17.57 ? 484 VAL A C   1 
ATOM   3686 O O   . VAL A 1 484 ? 6.608   35.642 51.434 1.00 18.66 ? 484 VAL A O   1 
ATOM   3687 C CB  . VAL A 1 484 ? 6.177   38.546 53.122 1.00 16.65 ? 484 VAL A CB  1 
ATOM   3688 C CG1 . VAL A 1 484 ? 5.311   39.794 53.269 1.00 14.40 ? 484 VAL A CG1 1 
ATOM   3689 C CG2 . VAL A 1 484 ? 5.773   37.511 54.147 1.00 13.22 ? 484 VAL A CG2 1 
ATOM   3690 N N   . GLY A 1 485 ? 8.301   37.116 51.457 1.00 17.40 ? 485 GLY A N   1 
ATOM   3691 C CA  . GLY A 1 485 ? 9.284   36.059 51.297 1.00 17.72 ? 485 GLY A CA  1 
ATOM   3692 C C   . GLY A 1 485 ? 10.654  36.468 50.782 1.00 18.25 ? 485 GLY A C   1 
ATOM   3693 O O   . GLY A 1 485 ? 11.037  37.643 50.803 1.00 16.02 ? 485 GLY A O   1 
ATOM   3694 N N   . GLU A 1 486 ? 11.395  35.466 50.319 1.00 18.76 ? 486 GLU A N   1 
ATOM   3695 C CA  . GLU A 1 486 ? 12.737  35.658 49.786 1.00 18.54 ? 486 GLU A CA  1 
ATOM   3696 C C   . GLU A 1 486 ? 12.704  36.293 48.407 1.00 19.01 ? 486 GLU A C   1 
ATOM   3697 O O   . GLU A 1 486 ? 11.666  36.306 47.741 1.00 18.82 ? 486 GLU A O   1 
ATOM   3698 C CB  . GLU A 1 486 ? 13.457  34.315 49.673 1.00 18.50 ? 486 GLU A CB  1 
ATOM   3699 C CG  . GLU A 1 486 ? 13.743  33.605 50.983 1.00 20.44 ? 486 GLU A CG  1 
ATOM   3700 C CD  . GLU A 1 486 ? 14.618  32.379 50.779 1.00 23.07 ? 486 GLU A CD  1 
ATOM   3701 O OE1 . GLU A 1 486 ? 14.163  31.430 50.101 1.00 24.13 ? 486 GLU A OE1 1 
ATOM   3702 O OE2 . GLU A 1 486 ? 15.764  32.365 51.285 1.00 21.84 ? 486 GLU A OE2 1 
ATOM   3703 N N   . HIS A 1 487 ? 13.846  36.823 47.983 1.00 19.75 ? 487 HIS A N   1 
ATOM   3704 C CA  . HIS A 1 487 ? 13.959  37.416 46.654 1.00 20.39 ? 487 HIS A CA  1 
ATOM   3705 C C   . HIS A 1 487 ? 14.592  36.356 45.748 1.00 18.95 ? 487 HIS A C   1 
ATOM   3706 O O   . HIS A 1 487 ? 15.283  35.458 46.224 1.00 18.16 ? 487 HIS A O   1 
ATOM   3707 C CB  . HIS A 1 487 ? 14.830  38.676 46.697 1.00 21.62 ? 487 HIS A CB  1 
ATOM   3708 C CG  . HIS A 1 487 ? 14.203  39.818 47.435 1.00 22.95 ? 487 HIS A CG  1 
ATOM   3709 N ND1 . HIS A 1 487 ? 14.821  41.041 47.576 1.00 24.76 ? 487 HIS A ND1 1 
ATOM   3710 C CD2 . HIS A 1 487 ? 13.015  39.922 48.075 1.00 24.69 ? 487 HIS A CD2 1 
ATOM   3711 C CE1 . HIS A 1 487 ? 14.041  41.850 48.272 1.00 24.77 ? 487 HIS A CE1 1 
ATOM   3712 N NE2 . HIS A 1 487 ? 12.938  41.195 48.587 1.00 24.83 ? 487 HIS A NE2 1 
ATOM   3713 N N   . PRO A 1 488 ? 14.355  36.437 44.432 1.00 17.88 ? 488 PRO A N   1 
ATOM   3714 C CA  . PRO A 1 488 ? 14.935  35.445 43.522 1.00 17.91 ? 488 PRO A CA  1 
ATOM   3715 C C   . PRO A 1 488 ? 16.446  35.317 43.691 1.00 18.54 ? 488 PRO A C   1 
ATOM   3716 O O   . PRO A 1 488 ? 17.137  36.305 43.957 1.00 19.39 ? 488 PRO A O   1 
ATOM   3717 C CB  . PRO A 1 488 ? 14.557  35.978 42.144 1.00 17.05 ? 488 PRO A CB  1 
ATOM   3718 C CG  . PRO A 1 488 ? 13.264  36.691 42.402 1.00 18.03 ? 488 PRO A CG  1 
ATOM   3719 C CD  . PRO A 1 488 ? 13.551  37.423 43.691 1.00 18.02 ? 488 PRO A CD  1 
ATOM   3720 N N   . TYR A 1 489 ? 16.954  34.098 43.546 1.00 16.80 ? 489 TYR A N   1 
ATOM   3721 C CA  . TYR A 1 489 ? 18.381  33.865 43.665 1.00 17.65 ? 489 TYR A CA  1 
ATOM   3722 C C   . TYR A 1 489 ? 18.811  32.533 43.066 1.00 19.57 ? 489 TYR A C   1 
ATOM   3723 O O   . TYR A 1 489 ? 18.052  31.561 43.040 1.00 20.94 ? 489 TYR A O   1 
ATOM   3724 C CB  . TYR A 1 489 ? 18.811  33.955 45.130 1.00 17.47 ? 489 TYR A CB  1 
ATOM   3725 C CG  . TYR A 1 489 ? 18.132  32.975 46.048 1.00 16.27 ? 489 TYR A CG  1 
ATOM   3726 C CD1 . TYR A 1 489 ? 18.463  31.621 46.028 1.00 17.78 ? 489 TYR A CD1 1 
ATOM   3727 C CD2 . TYR A 1 489 ? 17.168  33.402 46.947 1.00 15.96 ? 489 TYR A CD2 1 
ATOM   3728 C CE1 . TYR A 1 489 ? 17.848  30.719 46.886 1.00 18.85 ? 489 TYR A CE1 1 
ATOM   3729 C CE2 . TYR A 1 489 ? 16.546  32.513 47.809 1.00 17.94 ? 489 TYR A CE2 1 
ATOM   3730 C CZ  . TYR A 1 489 ? 16.887  31.176 47.776 1.00 18.95 ? 489 TYR A CZ  1 
ATOM   3731 O OH  . TYR A 1 489 ? 16.254  30.299 48.624 1.00 21.31 ? 489 TYR A OH  1 
ATOM   3732 N N   . THR A 1 490 ? 20.042  32.491 42.580 1.00 20.06 ? 490 THR A N   1 
ATOM   3733 C CA  . THR A 1 490 ? 20.555  31.276 41.984 1.00 20.51 ? 490 THR A CA  1 
ATOM   3734 C C   . THR A 1 490 ? 21.979  30.975 42.429 1.00 21.13 ? 490 THR A C   1 
ATOM   3735 O O   . THR A 1 490 ? 22.769  31.876 42.716 1.00 20.31 ? 490 THR A O   1 
ATOM   3736 C CB  . THR A 1 490 ? 20.524  31.376 40.466 1.00 21.70 ? 490 THR A CB  1 
ATOM   3737 O OG1 . THR A 1 490 ? 19.231  31.833 40.055 1.00 21.92 ? 490 THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 490 ? 20.813  30.022 39.838 1.00 20.92 ? 490 THR A CG2 1 
ATOM   3739 N N   . GLU A 1 491 ? 22.292  29.691 42.484 1.00 21.36 ? 491 GLU A N   1 
ATOM   3740 C CA  . GLU A 1 491 ? 23.607  29.234 42.885 1.00 22.34 ? 491 GLU A CA  1 
ATOM   3741 C C   . GLU A 1 491 ? 24.177  29.975 44.104 1.00 23.07 ? 491 GLU A C   1 
ATOM   3742 O O   . GLU A 1 491 ? 23.468  30.192 45.090 1.00 23.28 ? 491 GLU A O   1 
ATOM   3743 C CB  . GLU A 1 491 ? 24.543  29.296 41.672 1.00 22.66 ? 491 GLU A CB  1 
ATOM   3744 C CG  . GLU A 1 491 ? 24.041  28.385 40.549 1.00 22.71 ? 491 GLU A CG  1 
ATOM   3745 C CD  . GLU A 1 491 ? 24.930  28.358 39.322 1.00 24.80 ? 491 GLU A CD  1 
ATOM   3746 O OE1 . GLU A 1 491 ? 26.121  27.984 39.453 1.00 24.73 ? 491 GLU A OE1 1 
ATOM   3747 O OE2 . GLU A 1 491 ? 24.428  28.699 38.223 1.00 22.83 ? 491 GLU A OE2 1 
ATOM   3748 N N   . THR A 1 492 ? 25.446  30.364 44.050 1.00 22.84 ? 492 THR A N   1 
ATOM   3749 C CA  . THR A 1 492 ? 26.066  31.027 45.189 1.00 21.68 ? 492 THR A CA  1 
ATOM   3750 C C   . THR A 1 492 ? 25.349  32.264 45.725 1.00 21.44 ? 492 THR A C   1 
ATOM   3751 O O   . THR A 1 492 ? 25.353  32.511 46.927 1.00 21.74 ? 492 THR A O   1 
ATOM   3752 C CB  . THR A 1 492 ? 27.530  31.365 44.884 1.00 20.57 ? 492 THR A CB  1 
ATOM   3753 O OG1 . THR A 1 492 ? 28.241  30.150 44.613 1.00 20.91 ? 492 THR A OG1 1 
ATOM   3754 C CG2 . THR A 1 492 ? 28.177  32.058 46.069 1.00 18.45 ? 492 THR A CG2 1 
ATOM   3755 N N   . LYS A 1 493 ? 24.728  33.043 44.853 1.00 22.55 ? 493 LYS A N   1 
ATOM   3756 C CA  . LYS A 1 493 ? 24.021  34.227 45.327 1.00 24.71 ? 493 LYS A CA  1 
ATOM   3757 C C   . LYS A 1 493 ? 22.989  33.818 46.372 1.00 23.88 ? 493 LYS A C   1 
ATOM   3758 O O   . LYS A 1 493 ? 22.599  34.614 47.221 1.00 23.99 ? 493 LYS A O   1 
ATOM   3759 C CB  . LYS A 1 493 ? 23.325  34.935 44.165 1.00 27.54 ? 493 LYS A CB  1 
ATOM   3760 C CG  . LYS A 1 493 ? 24.139  36.030 43.507 1.00 31.11 ? 493 LYS A CG  1 
ATOM   3761 C CD  . LYS A 1 493 ? 24.109  37.304 44.342 1.00 37.39 ? 493 LYS A CD  1 
ATOM   3762 C CE  . LYS A 1 493 ? 24.767  38.480 43.612 1.00 40.61 ? 493 LYS A CE  1 
ATOM   3763 N NZ  . LYS A 1 493 ? 24.569  39.778 44.341 1.00 43.90 ? 493 LYS A NZ  1 
ATOM   3764 N N   . GLY A 1 494 ? 22.567  32.562 46.305 1.00 23.77 ? 494 GLY A N   1 
ATOM   3765 C CA  . GLY A 1 494 ? 21.571  32.058 47.231 1.00 23.03 ? 494 GLY A CA  1 
ATOM   3766 C C   . GLY A 1 494 ? 22.089  31.617 48.584 1.00 22.52 ? 494 GLY A C   1 
ATOM   3767 O O   . GLY A 1 494 ? 21.314  31.532 49.533 1.00 22.76 ? 494 GLY A O   1 
ATOM   3768 N N   . ASP A 1 495 ? 23.379  31.314 48.683 1.00 22.35 ? 495 ASP A N   1 
ATOM   3769 C CA  . ASP A 1 495 ? 23.942  30.896 49.961 1.00 23.43 ? 495 ASP A CA  1 
ATOM   3770 C C   . ASP A 1 495 ? 23.540  31.910 51.030 1.00 23.96 ? 495 ASP A C   1 
ATOM   3771 O O   . ASP A 1 495 ? 23.756  33.113 50.870 1.00 23.38 ? 495 ASP A O   1 
ATOM   3772 C CB  . ASP A 1 495 ? 25.467  30.800 49.873 1.00 23.91 ? 495 ASP A CB  1 
ATOM   3773 C CG  . ASP A 1 495 ? 25.928  29.586 49.095 1.00 25.14 ? 495 ASP A CG  1 
ATOM   3774 O OD1 . ASP A 1 495 ? 25.073  28.753 48.720 1.00 26.29 ? 495 ASP A OD1 1 
ATOM   3775 O OD2 . ASP A 1 495 ? 27.147  29.457 48.867 1.00 25.21 ? 495 ASP A OD2 1 
ATOM   3776 N N   . ASN A 1 496 ? 22.950  31.420 52.114 1.00 23.35 ? 496 ASN A N   1 
ATOM   3777 C CA  . ASN A 1 496 ? 22.485  32.290 53.189 1.00 23.87 ? 496 ASN A CA  1 
ATOM   3778 C C   . ASN A 1 496 ? 22.695  31.629 54.553 1.00 24.72 ? 496 ASN A C   1 
ATOM   3779 O O   . ASN A 1 496 ? 22.264  30.500 54.780 1.00 24.02 ? 496 ASN A O   1 
ATOM   3780 C CB  . ASN A 1 496 ? 20.995  32.591 52.985 1.00 22.15 ? 496 ASN A CB  1 
ATOM   3781 C CG  . ASN A 1 496 ? 20.523  33.777 53.794 1.00 22.77 ? 496 ASN A CG  1 
ATOM   3782 O OD1 . ASN A 1 496 ? 20.846  33.906 54.973 1.00 22.86 ? 496 ASN A OD1 1 
ATOM   3783 N ND2 . ASN A 1 496 ? 19.748  34.653 53.164 1.00 22.30 ? 496 ASN A ND2 1 
ATOM   3784 N N   . LEU A 1 497 ? 23.342  32.337 55.471 1.00 25.77 ? 497 LEU A N   1 
ATOM   3785 C CA  . LEU A 1 497 ? 23.590  31.768 56.790 1.00 27.38 ? 497 LEU A CA  1 
ATOM   3786 C C   . LEU A 1 497 ? 22.592  32.142 57.882 1.00 27.77 ? 497 LEU A C   1 
ATOM   3787 O O   . LEU A 1 497 ? 22.531  31.473 58.912 1.00 27.72 ? 497 LEU A O   1 
ATOM   3788 C CB  . LEU A 1 497 ? 25.004  32.122 57.250 1.00 25.40 ? 497 LEU A CB  1 
ATOM   3789 C CG  . LEU A 1 497 ? 26.113  31.433 56.456 1.00 25.18 ? 497 LEU A CG  1 
ATOM   3790 C CD1 . LEU A 1 497 ? 27.465  31.876 56.983 1.00 23.15 ? 497 LEU A CD1 1 
ATOM   3791 C CD2 . LEU A 1 497 ? 25.953  29.921 56.567 1.00 22.98 ? 497 LEU A CD2 1 
ATOM   3792 N N   . ASN A 1 498 ? 21.811  33.196 57.661 1.00 29.14 ? 498 ASN A N   1 
ATOM   3793 C CA  . ASN A 1 498 ? 20.838  33.643 58.655 1.00 31.62 ? 498 ASN A CA  1 
ATOM   3794 C C   . ASN A 1 498 ? 19.415  33.192 58.338 1.00 29.27 ? 498 ASN A C   1 
ATOM   3795 O O   . ASN A 1 498 ? 18.561  33.150 59.222 1.00 27.79 ? 498 ASN A O   1 
ATOM   3796 C CB  . ASN A 1 498 ? 20.887  35.174 58.789 1.00 39.21 ? 498 ASN A CB  1 
ATOM   3797 C CG  . ASN A 1 498 ? 20.464  35.898 57.510 1.00 49.09 ? 498 ASN A CG  1 
ATOM   3798 O OD1 . ASN A 1 498 ? 19.313  35.774 57.059 1.00 50.28 ? 498 ASN A OD1 1 
ATOM   3799 N ND2 . ASN A 1 498 ? 21.392  36.659 56.927 1.00 55.74 ? 498 ASN A ND2 1 
ATOM   3800 N N   . LEU A 1 499 ? 19.183  32.861 57.069 1.00 27.45 ? 499 LEU A N   1 
ATOM   3801 C CA  . LEU A 1 499 ? 17.893  32.403 56.558 1.00 25.54 ? 499 LEU A CA  1 
ATOM   3802 C C   . LEU A 1 499 ? 16.643  33.133 57.051 1.00 26.41 ? 499 LEU A C   1 
ATOM   3803 O O   . LEU A 1 499 ? 15.617  32.503 57.327 1.00 25.51 ? 499 LEU A O   1 
ATOM   3804 C CB  . LEU A 1 499 ? 17.729  30.895 56.792 1.00 23.81 ? 499 LEU A CB  1 
ATOM   3805 C CG  . LEU A 1 499 ? 18.604  29.961 55.942 1.00 24.55 ? 499 LEU A CG  1 
ATOM   3806 C CD1 . LEU A 1 499 ? 18.175  28.517 56.154 1.00 22.40 ? 499 LEU A CD1 1 
ATOM   3807 C CD2 . LEU A 1 499 ? 18.480  30.321 54.464 1.00 23.52 ? 499 LEU A CD2 1 
ATOM   3808 N N   . THR A 1 500 ? 16.722  34.456 57.157 1.00 26.94 ? 500 THR A N   1 
ATOM   3809 C CA  . THR A 1 500 ? 15.570  35.247 57.582 1.00 29.42 ? 500 THR A CA  1 
ATOM   3810 C C   . THR A 1 500 ? 15.173  36.092 56.378 1.00 30.85 ? 500 THR A C   1 
ATOM   3811 O O   . THR A 1 500 ? 16.036  36.653 55.696 1.00 31.69 ? 500 THR A O   1 
ATOM   3812 C CB  . THR A 1 500 ? 15.902  36.175 58.780 1.00 29.23 ? 500 THR A CB  1 
ATOM   3813 O OG1 . THR A 1 500 ? 16.712  37.268 58.336 1.00 31.65 ? 500 THR A OG1 1 
ATOM   3814 C CG2 . THR A 1 500 ? 16.654  35.406 59.854 1.00 28.04 ? 500 THR A CG2 1 
ATOM   3815 N N   . ILE A 1 501 ? 13.875  36.182 56.110 1.00 32.36 ? 501 ILE A N   1 
ATOM   3816 C CA  . ILE A 1 501 ? 13.403  36.939 54.954 1.00 33.72 ? 501 ILE A CA  1 
ATOM   3817 C C   . ILE A 1 501 ? 13.684  38.438 55.016 1.00 34.11 ? 501 ILE A C   1 
ATOM   3818 O O   . ILE A 1 501 ? 13.768  39.028 56.094 1.00 34.93 ? 501 ILE A O   1 
ATOM   3819 C CB  . ILE A 1 501 ? 11.884  36.738 54.725 1.00 33.61 ? 501 ILE A CB  1 
ATOM   3820 C CG1 . ILE A 1 501 ? 11.097  37.241 55.931 1.00 32.79 ? 501 ILE A CG1 1 
ATOM   3821 C CG2 . ILE A 1 501 ? 11.585  35.268 54.485 1.00 33.45 ? 501 ILE A CG2 1 
ATOM   3822 C CD1 . ILE A 1 501 ? 9.598   37.148 55.743 1.00 34.56 ? 501 ILE A CD1 1 
ATOM   3823 N N   . PRO A 1 502 ? 13.843  39.073 53.844 1.00 34.72 ? 502 PRO A N   1 
ATOM   3824 C CA  . PRO A 1 502 ? 14.112  40.511 53.753 1.00 34.52 ? 502 PRO A CA  1 
ATOM   3825 C C   . PRO A 1 502 ? 12.923  41.317 54.275 1.00 34.47 ? 502 PRO A C   1 
ATOM   3826 O O   . PRO A 1 502 ? 11.791  40.838 54.267 1.00 32.74 ? 502 PRO A O   1 
ATOM   3827 C CB  . PRO A 1 502 ? 14.308  40.735 52.252 1.00 34.28 ? 502 PRO A CB  1 
ATOM   3828 C CG  . PRO A 1 502 ? 14.762  39.397 51.748 1.00 34.71 ? 502 PRO A CG  1 
ATOM   3829 C CD  . PRO A 1 502 ? 13.890  38.445 52.511 1.00 34.52 ? 502 PRO A CD  1 
ATOM   3830 N N   . GLU A 1 503 ? 13.185  42.536 54.733 1.00 35.47 ? 503 GLU A N   1 
ATOM   3831 C CA  . GLU A 1 503 ? 12.126  43.417 55.210 1.00 35.75 ? 503 GLU A CA  1 
ATOM   3832 C C   . GLU A 1 503 ? 11.865  44.437 54.108 1.00 35.65 ? 503 GLU A C   1 
ATOM   3833 O O   . GLU A 1 503 ? 12.753  44.720 53.301 1.00 36.28 ? 503 GLU A O   1 
ATOM   3834 C CB  . GLU A 1 503 ? 12.546  44.126 56.495 1.00 35.32 ? 503 GLU A CB  1 
ATOM   3835 C CG  . GLU A 1 503 ? 12.489  43.235 57.709 1.00 37.39 ? 503 GLU A CG  1 
ATOM   3836 C CD  . GLU A 1 503 ? 11.099  42.664 57.934 1.00 40.21 ? 503 GLU A CD  1 
ATOM   3837 O OE1 . GLU A 1 503 ? 10.153  43.459 58.146 1.00 40.63 ? 503 GLU A OE1 1 
ATOM   3838 O OE2 . GLU A 1 503 ? 10.952  41.420 57.894 1.00 40.02 ? 503 GLU A OE2 1 
ATOM   3839 N N   . PRO A 1 504 ? 10.640  44.989 54.045 1.00 35.37 ? 504 PRO A N   1 
ATOM   3840 C CA  . PRO A 1 504 ? 9.506   44.714 54.935 1.00 34.41 ? 504 PRO A CA  1 
ATOM   3841 C C   . PRO A 1 504 ? 8.886   43.368 54.609 1.00 33.94 ? 504 PRO A C   1 
ATOM   3842 O O   . PRO A 1 504 ? 8.614   43.058 53.445 1.00 34.60 ? 504 PRO A O   1 
ATOM   3843 C CB  . PRO A 1 504 ? 8.522   45.849 54.631 1.00 34.96 ? 504 PRO A CB  1 
ATOM   3844 C CG  . PRO A 1 504 ? 9.302   46.824 53.764 1.00 35.38 ? 504 PRO A CG  1 
ATOM   3845 C CD  . PRO A 1 504 ? 10.251  45.956 53.011 1.00 34.01 ? 504 PRO A CD  1 
ATOM   3846 N N   . GLY A 1 505 ? 8.656   42.574 55.641 1.00 32.56 ? 505 GLY A N   1 
ATOM   3847 C CA  . GLY A 1 505 ? 8.051   41.273 55.447 1.00 30.43 ? 505 GLY A CA  1 
ATOM   3848 C C   . GLY A 1 505 ? 7.294   40.966 56.713 1.00 29.64 ? 505 GLY A C   1 
ATOM   3849 O O   . GLY A 1 505 ? 6.065   40.916 56.727 1.00 30.27 ? 505 GLY A O   1 
ATOM   3850 N N   . LEU A 1 506 ? 8.046   40.782 57.790 1.00 28.04 ? 506 LEU A N   1 
ATOM   3851 C CA  . LEU A 1 506 ? 7.462   40.493 59.082 1.00 26.70 ? 506 LEU A CA  1 
ATOM   3852 C C   . LEU A 1 506 ? 6.624   41.678 59.541 1.00 26.62 ? 506 LEU A C   1 
ATOM   3853 O O   . LEU A 1 506 ? 5.511   41.501 60.039 1.00 27.01 ? 506 LEU A O   1 
ATOM   3854 C CB  . LEU A 1 506 ? 8.568   40.194 60.101 1.00 24.32 ? 506 LEU A CB  1 
ATOM   3855 C CG  . LEU A 1 506 ? 8.157   40.031 61.567 1.00 23.61 ? 506 LEU A CG  1 
ATOM   3856 C CD1 . LEU A 1 506 ? 6.992   39.057 61.698 1.00 25.18 ? 506 LEU A CD1 1 
ATOM   3857 C CD2 . LEU A 1 506 ? 9.351   39.541 62.356 1.00 20.88 ? 506 LEU A CD2 1 
ATOM   3858 N N   . SER A 1 507 ? 7.149   42.884 59.349 1.00 26.33 ? 507 SER A N   1 
ATOM   3859 C CA  . SER A 1 507 ? 6.445   44.092 59.770 1.00 27.64 ? 507 SER A CA  1 
ATOM   3860 C C   . SER A 1 507 ? 5.104   44.266 59.066 1.00 26.92 ? 507 SER A C   1 
ATOM   3861 O O   . SER A 1 507 ? 4.132   44.703 59.676 1.00 27.15 ? 507 SER A O   1 
ATOM   3862 C CB  . SER A 1 507 ? 7.311   45.330 59.531 1.00 27.10 ? 507 SER A CB  1 
ATOM   3863 O OG  . SER A 1 507 ? 7.528   45.525 58.146 1.00 32.92 ? 507 SER A OG  1 
ATOM   3864 N N   . THR A 1 508 ? 5.051   43.929 57.782 1.00 26.06 ? 508 THR A N   1 
ATOM   3865 C CA  . THR A 1 508 ? 3.809   44.057 57.031 1.00 26.00 ? 508 THR A CA  1 
ATOM   3866 C C   . THR A 1 508 ? 2.785   43.075 57.578 1.00 26.31 ? 508 THR A C   1 
ATOM   3867 O O   . THR A 1 508 ? 1.619   43.420 57.781 1.00 27.75 ? 508 THR A O   1 
ATOM   3868 C CB  . THR A 1 508 ? 4.020   43.745 55.543 1.00 26.72 ? 508 THR A CB  1 
ATOM   3869 O OG1 . THR A 1 508 ? 5.085   44.553 55.037 1.00 28.64 ? 508 THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 508 ? 2.753   44.035 54.754 1.00 24.93 ? 508 THR A CG2 1 
ATOM   3871 N N   . VAL A 1 509 ? 3.231   41.846 57.811 1.00 24.13 ? 509 VAL A N   1 
ATOM   3872 C CA  . VAL A 1 509 ? 2.358   40.814 58.331 1.00 22.33 ? 509 VAL A CA  1 
ATOM   3873 C C   . VAL A 1 509 ? 1.868   41.195 59.715 1.00 22.08 ? 509 VAL A C   1 
ATOM   3874 O O   . VAL A 1 509 ? 0.701   41.004 60.040 1.00 22.08 ? 509 VAL A O   1 
ATOM   3875 C CB  . VAL A 1 509 ? 3.082   39.454 58.385 1.00 22.12 ? 509 VAL A CB  1 
ATOM   3876 C CG1 . VAL A 1 509 ? 2.293   38.469 59.220 1.00 20.85 ? 509 VAL A CG1 1 
ATOM   3877 C CG2 . VAL A 1 509 ? 3.245   38.912 56.984 1.00 20.06 ? 509 VAL A CG2 1 
ATOM   3878 N N   . GLN A 1 510 ? 2.753   41.745 60.533 1.00 21.93 ? 510 GLN A N   1 
ATOM   3879 C CA  . GLN A 1 510 ? 2.355   42.140 61.875 1.00 22.74 ? 510 GLN A CA  1 
ATOM   3880 C C   . GLN A 1 510 ? 1.395   43.321 61.828 1.00 21.63 ? 510 GLN A C   1 
ATOM   3881 O O   . GLN A 1 510 ? 0.490   43.427 62.655 1.00 20.63 ? 510 GLN A O   1 
ATOM   3882 C CB  . GLN A 1 510 ? 3.584   42.490 62.712 1.00 23.78 ? 510 GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 510 ? 4.535   41.331 62.880 1.00 26.05 ? 510 GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 510 ? 5.772   41.707 63.655 1.00 28.05 ? 510 GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 510 ? 6.329   42.790 63.471 1.00 29.87 ? 510 GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 510 ? 6.222   40.808 64.518 1.00 29.22 ? 510 GLN A NE2 1 
ATOM   3887 N N   . ALA A 1 511 ? 1.589   44.207 60.857 1.00 21.18 ? 511 ALA A N   1 
ATOM   3888 C CA  . ALA A 1 511 ? 0.716   45.366 60.719 1.00 22.47 ? 511 ALA A CA  1 
ATOM   3889 C C   . ALA A 1 511 ? -0.658  44.895 60.253 1.00 23.25 ? 511 ALA A C   1 
ATOM   3890 O O   . ALA A 1 511 ? -1.675  45.221 60.866 1.00 25.54 ? 511 ALA A O   1 
ATOM   3891 C CB  . ALA A 1 511 ? 1.304   46.365 59.721 1.00 20.20 ? 511 ALA A CB  1 
ATOM   3892 N N   . VAL A 1 512 ? -0.680  44.113 59.178 1.00 22.07 ? 512 VAL A N   1 
ATOM   3893 C CA  . VAL A 1 512 ? -1.931  43.599 58.632 1.00 21.97 ? 512 VAL A CA  1 
ATOM   3894 C C   . VAL A 1 512 ? -2.680  42.705 59.618 1.00 22.45 ? 512 VAL A C   1 
ATOM   3895 O O   . VAL A 1 512 ? -3.830  42.975 59.956 1.00 23.00 ? 512 VAL A O   1 
ATOM   3896 C CB  . VAL A 1 512 ? -1.687  42.802 57.322 1.00 20.77 ? 512 VAL A CB  1 
ATOM   3897 C CG1 . VAL A 1 512 ? -2.990  42.207 56.821 1.00 16.80 ? 512 VAL A CG1 1 
ATOM   3898 C CG2 . VAL A 1 512 ? -1.076  43.716 56.263 1.00 17.49 ? 512 VAL A CG2 1 
ATOM   3899 N N   . CYS A 1 513 ? -2.026  41.641 60.076 1.00 23.84 ? 513 CYS A N   1 
ATOM   3900 C CA  . CYS A 1 513 ? -2.642  40.702 61.013 1.00 25.18 ? 513 CYS A CA  1 
ATOM   3901 C C   . CYS A 1 513 ? -3.104  41.351 62.313 1.00 25.79 ? 513 CYS A C   1 
ATOM   3902 O O   . CYS A 1 513 ? -4.037  40.872 62.959 1.00 25.85 ? 513 CYS A O   1 
ATOM   3903 C CB  . CYS A 1 513 ? -1.677  39.574 61.346 1.00 25.44 ? 513 CYS A CB  1 
ATOM   3904 S SG  . CYS A 1 513 ? -1.107  38.618 59.913 1.00 29.60 ? 513 CYS A SG  1 
ATOM   3905 N N   . GLY A 1 514 ? -2.443  42.428 62.711 1.00 25.29 ? 514 GLY A N   1 
ATOM   3906 C CA  . GLY A 1 514 ? -2.854  43.096 63.926 1.00 25.16 ? 514 GLY A CA  1 
ATOM   3907 C C   . GLY A 1 514 ? -4.200  43.775 63.731 1.00 25.46 ? 514 GLY A C   1 
ATOM   3908 O O   . GLY A 1 514 ? -4.944  43.972 64.687 1.00 24.88 ? 514 GLY A O   1 
ATOM   3909 N N   . GLY A 1 515 ? -4.523  44.115 62.486 1.00 26.22 ? 515 GLY A N   1 
ATOM   3910 C CA  . GLY A 1 515 ? -5.774  44.798 62.205 1.00 26.32 ? 515 GLY A CA  1 
ATOM   3911 C C   . GLY A 1 515 ? -6.941  43.950 61.738 1.00 26.57 ? 515 GLY A C   1 
ATOM   3912 O O   . GLY A 1 515 ? -8.090  44.381 61.832 1.00 27.06 ? 515 GLY A O   1 
ATOM   3913 N N   . VAL A 1 516 ? -6.668  42.754 61.230 1.00 26.18 ? 516 VAL A N   1 
ATOM   3914 C CA  . VAL A 1 516 ? -7.736  41.882 60.751 1.00 26.06 ? 516 VAL A CA  1 
ATOM   3915 C C   . VAL A 1 516 ? -7.183  40.474 60.594 1.00 27.33 ? 516 VAL A C   1 
ATOM   3916 O O   . VAL A 1 516 ? -5.977  40.309 60.413 1.00 26.65 ? 516 VAL A O   1 
ATOM   3917 C CB  . VAL A 1 516 ? -8.275  42.372 59.383 1.00 24.40 ? 516 VAL A CB  1 
ATOM   3918 C CG1 . VAL A 1 516 ? -7.150  42.368 58.355 1.00 24.48 ? 516 VAL A CG1 1 
ATOM   3919 C CG2 . VAL A 1 516 ? -9.426  41.491 58.918 1.00 22.58 ? 516 VAL A CG2 1 
ATOM   3920 N N   . ARG A 1 517 ? -8.053  39.465 60.671 1.00 28.72 ? 517 ARG A N   1 
ATOM   3921 C CA  . ARG A 1 517 ? -7.601  38.088 60.509 1.00 30.54 ? 517 ARG A CA  1 
ATOM   3922 C C   . ARG A 1 517 ? -6.897  37.991 59.164 1.00 30.12 ? 517 ARG A C   1 
ATOM   3923 O O   . ARG A 1 517 ? -7.399  38.461 58.139 1.00 29.89 ? 517 ARG A O   1 
ATOM   3924 C CB  . ARG A 1 517 ? -8.767  37.097 60.607 1.00 33.03 ? 517 ARG A CB  1 
ATOM   3925 C CG  . ARG A 1 517 ? -10.005 37.475 59.830 1.00 39.14 ? 517 ARG A CG  1 
ATOM   3926 C CD  . ARG A 1 517 ? -11.047 36.373 59.928 1.00 41.89 ? 517 ARG A CD  1 
ATOM   3927 N NE  . ARG A 1 517 ? -12.264 36.705 59.196 1.00 44.85 ? 517 ARG A NE  1 
ATOM   3928 C CZ  . ARG A 1 517 ? -13.208 35.822 58.893 1.00 47.74 ? 517 ARG A CZ  1 
ATOM   3929 N NH1 . ARG A 1 517 ? -13.065 34.556 59.257 1.00 48.99 ? 517 ARG A NH1 1 
ATOM   3930 N NH2 . ARG A 1 517 ? -14.295 36.204 58.233 1.00 49.22 ? 517 ARG A NH2 1 
ATOM   3931 N N   . CYS A 1 518 ? -5.722  37.378 59.185 1.00 29.70 ? 518 CYS A N   1 
ATOM   3932 C CA  . CYS A 1 518 ? -4.883  37.278 58.004 1.00 28.30 ? 518 CYS A CA  1 
ATOM   3933 C C   . CYS A 1 518 ? -4.432  35.866 57.648 1.00 27.69 ? 518 CYS A C   1 
ATOM   3934 O O   . CYS A 1 518 ? -4.261  34.999 58.510 1.00 27.40 ? 518 CYS A O   1 
ATOM   3935 C CB  . CYS A 1 518 ? -3.636  38.117 58.240 1.00 28.54 ? 518 CYS A CB  1 
ATOM   3936 S SG  . CYS A 1 518 ? -2.627  37.331 59.538 1.00 31.89 ? 518 CYS A SG  1 
ATOM   3937 N N   . ALA A 1 519 ? -4.220  35.660 56.356 1.00 26.83 ? 519 ALA A N   1 
ATOM   3938 C CA  . ALA A 1 519 ? -3.726  34.395 55.841 1.00 25.68 ? 519 ALA A CA  1 
ATOM   3939 C C   . ALA A 1 519 ? -2.401  34.765 55.169 1.00 24.82 ? 519 ALA A C   1 
ATOM   3940 O O   . ALA A 1 519 ? -2.375  35.429 54.133 1.00 24.24 ? 519 ALA A O   1 
ATOM   3941 C CB  . ALA A 1 519 ? -4.702  33.815 54.830 1.00 25.16 ? 519 ALA A CB  1 
ATOM   3942 N N   . THR A 1 520 ? -1.299  34.364 55.782 1.00 23.66 ? 520 THR A N   1 
ATOM   3943 C CA  . THR A 1 520 ? 0.012   34.672 55.244 1.00 21.94 ? 520 THR A CA  1 
ATOM   3944 C C   . THR A 1 520 ? 0.496   33.615 54.266 1.00 20.93 ? 520 THR A C   1 
ATOM   3945 O O   . THR A 1 520 ? 0.446   32.418 54.550 1.00 19.88 ? 520 THR A O   1 
ATOM   3946 C CB  . THR A 1 520 ? 1.046   34.817 56.382 1.00 23.62 ? 520 THR A CB  1 
ATOM   3947 O OG1 . THR A 1 520 ? 0.744   35.992 57.145 1.00 22.94 ? 520 THR A OG1 1 
ATOM   3948 C CG2 . THR A 1 520 ? 2.466   34.908 55.825 1.00 21.08 ? 520 THR A CG2 1 
ATOM   3949 N N   . VAL A 1 521 ? 0.951   34.075 53.106 1.00 20.28 ? 521 VAL A N   1 
ATOM   3950 C CA  . VAL A 1 521 ? 1.487   33.196 52.078 1.00 19.35 ? 521 VAL A CA  1 
ATOM   3951 C C   . VAL A 1 521 ? 2.981   33.468 52.049 1.00 20.89 ? 521 VAL A C   1 
ATOM   3952 O O   . VAL A 1 521 ? 3.417   34.587 51.746 1.00 20.88 ? 521 VAL A O   1 
ATOM   3953 C CB  . VAL A 1 521 ? 0.899   33.510 50.701 1.00 18.65 ? 521 VAL A CB  1 
ATOM   3954 C CG1 . VAL A 1 521 ? 1.527   32.598 49.652 1.00 17.74 ? 521 VAL A CG1 1 
ATOM   3955 C CG2 . VAL A 1 521 ? -0.612  33.337 50.735 1.00 17.65 ? 521 VAL A CG2 1 
ATOM   3956 N N   . LEU A 1 522 ? 3.761   32.445 52.381 1.00 19.64 ? 522 LEU A N   1 
ATOM   3957 C CA  . LEU A 1 522 ? 5.211   32.570 52.417 1.00 17.99 ? 522 LEU A CA  1 
ATOM   3958 C C   . LEU A 1 522 ? 5.866   32.064 51.138 1.00 17.37 ? 522 LEU A C   1 
ATOM   3959 O O   . LEU A 1 522 ? 5.799   30.876 50.820 1.00 17.23 ? 522 LEU A O   1 
ATOM   3960 C CB  . LEU A 1 522 ? 5.756   31.801 53.623 1.00 17.12 ? 522 LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 522 ? 7.261   31.835 53.868 1.00 15.03 ? 522 LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 522 ? 7.740   33.266 54.027 1.00 15.79 ? 522 LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 522 ? 7.567   31.030 55.101 1.00 15.16 ? 522 LEU A CD2 1 
ATOM   3964 N N   . ILE A 1 523 ? 6.497   32.973 50.401 1.00 17.51 ? 523 ILE A N   1 
ATOM   3965 C CA  . ILE A 1 523 ? 7.179   32.609 49.161 1.00 16.89 ? 523 ILE A CA  1 
ATOM   3966 C C   . ILE A 1 523 ? 8.668   32.453 49.465 1.00 17.82 ? 523 ILE A C   1 
ATOM   3967 O O   . ILE A 1 523 ? 9.335   33.419 49.848 1.00 19.13 ? 523 ILE A O   1 
ATOM   3968 C CB  . ILE A 1 523 ? 6.992   33.698 48.072 1.00 15.59 ? 523 ILE A CB  1 
ATOM   3969 C CG1 . ILE A 1 523 ? 5.505   33.885 47.762 1.00 14.89 ? 523 ILE A CG1 1 
ATOM   3970 C CG2 . ILE A 1 523 ? 7.749   33.314 46.805 1.00 13.07 ? 523 ILE A CG2 1 
ATOM   3971 C CD1 . ILE A 1 523 ? 4.844   32.668 47.162 1.00 15.75 ? 523 ILE A CD1 1 
ATOM   3972 N N   . SER A 1 524 ? 9.187   31.240 49.302 1.00 17.79 ? 524 SER A N   1 
ATOM   3973 C CA  . SER A 1 524 ? 10.599  30.979 49.575 1.00 19.47 ? 524 SER A CA  1 
ATOM   3974 C C   . SER A 1 524 ? 11.060  29.706 48.889 1.00 19.87 ? 524 SER A C   1 
ATOM   3975 O O   . SER A 1 524 ? 10.249  28.881 48.487 1.00 20.64 ? 524 SER A O   1 
ATOM   3976 C CB  . SER A 1 524 ? 10.829  30.840 51.080 1.00 19.57 ? 524 SER A CB  1 
ATOM   3977 O OG  . SER A 1 524 ? 10.155  29.699 51.582 1.00 19.67 ? 524 SER A OG  1 
ATOM   3978 N N   . GLY A 1 525 ? 12.368  29.540 48.760 1.00 20.54 ? 525 GLY A N   1 
ATOM   3979 C CA  . GLY A 1 525 ? 12.876  28.341 48.118 1.00 21.03 ? 525 GLY A CA  1 
ATOM   3980 C C   . GLY A 1 525 ? 13.359  27.338 49.143 1.00 20.15 ? 525 GLY A C   1 
ATOM   3981 O O   . GLY A 1 525 ? 13.973  26.338 48.801 1.00 21.13 ? 525 GLY A O   1 
ATOM   3982 N N   . ARG A 1 526 ? 13.046  27.591 50.407 1.00 20.50 ? 526 ARG A N   1 
ATOM   3983 C CA  . ARG A 1 526 ? 13.497  26.728 51.484 1.00 20.25 ? 526 ARG A CA  1 
ATOM   3984 C C   . ARG A 1 526 ? 12.901  27.221 52.795 1.00 21.15 ? 526 ARG A C   1 
ATOM   3985 O O   . ARG A 1 526 ? 12.343  28.319 52.858 1.00 21.33 ? 526 ARG A O   1 
ATOM   3986 C CB  . ARG A 1 526 ? 15.014  26.838 51.582 1.00 20.04 ? 526 ARG A CB  1 
ATOM   3987 C CG  . ARG A 1 526 ? 15.449  28.281 51.810 1.00 18.45 ? 526 ARG A CG  1 
ATOM   3988 C CD  . ARG A 1 526 ? 16.927  28.487 51.599 1.00 21.36 ? 526 ARG A CD  1 
ATOM   3989 N NE  . ARG A 1 526 ? 17.245  29.890 51.331 1.00 21.00 ? 526 ARG A NE  1 
ATOM   3990 C CZ  . ARG A 1 526 ? 18.455  30.327 51.001 1.00 20.50 ? 526 ARG A CZ  1 
ATOM   3991 N NH1 . ARG A 1 526 ? 19.459  29.469 50.903 1.00 21.23 ? 526 ARG A NH1 1 
ATOM   3992 N NH2 . ARG A 1 526 ? 18.660  31.614 50.754 1.00 19.89 ? 526 ARG A NH2 1 
ATOM   3993 N N   . PRO A 1 527 ? 13.008  26.412 53.862 1.00 21.91 ? 527 PRO A N   1 
ATOM   3994 C CA  . PRO A 1 527 ? 12.476  26.820 55.166 1.00 22.03 ? 527 PRO A CA  1 
ATOM   3995 C C   . PRO A 1 527 ? 13.271  28.037 55.637 1.00 21.57 ? 527 PRO A C   1 
ATOM   3996 O O   . PRO A 1 527 ? 14.477  28.129 55.395 1.00 21.96 ? 527 PRO A O   1 
ATOM   3997 C CB  . PRO A 1 527 ? 12.740  25.600 56.045 1.00 20.93 ? 527 PRO A CB  1 
ATOM   3998 C CG  . PRO A 1 527 ? 12.596  24.474 55.084 1.00 24.70 ? 527 PRO A CG  1 
ATOM   3999 C CD  . PRO A 1 527 ? 13.351  24.979 53.867 1.00 23.11 ? 527 PRO A CD  1 
ATOM   4000 N N   . VAL A 1 528 ? 12.597  28.971 56.296 1.00 20.83 ? 528 VAL A N   1 
ATOM   4001 C CA  . VAL A 1 528 ? 13.248  30.177 56.801 1.00 19.52 ? 528 VAL A CA  1 
ATOM   4002 C C   . VAL A 1 528 ? 12.741  30.421 58.220 1.00 19.24 ? 528 VAL A C   1 
ATOM   4003 O O   . VAL A 1 528 ? 11.755  29.810 58.633 1.00 18.98 ? 528 VAL A O   1 
ATOM   4004 C CB  . VAL A 1 528 ? 12.926  31.403 55.898 1.00 19.07 ? 528 VAL A CB  1 
ATOM   4005 C CG1 . VAL A 1 528 ? 13.663  31.277 54.567 1.00 17.62 ? 528 VAL A CG1 1 
ATOM   4006 C CG2 . VAL A 1 528 ? 11.419  31.492 55.649 1.00 16.11 ? 528 VAL A CG2 1 
ATOM   4007 N N   . VAL A 1 529 ? 13.409  31.288 58.976 1.00 19.04 ? 529 VAL A N   1 
ATOM   4008 C CA  . VAL A 1 529 ? 12.960  31.555 60.339 1.00 19.25 ? 529 VAL A CA  1 
ATOM   4009 C C   . VAL A 1 529 ? 11.505  31.972 60.198 1.00 20.26 ? 529 VAL A C   1 
ATOM   4010 O O   . VAL A 1 529 ? 11.197  32.958 59.525 1.00 18.70 ? 529 VAL A O   1 
ATOM   4011 C CB  . VAL A 1 529 ? 13.779  32.676 61.006 1.00 19.23 ? 529 VAL A CB  1 
ATOM   4012 C CG1 . VAL A 1 529 ? 13.341  32.845 62.451 1.00 16.16 ? 529 VAL A CG1 1 
ATOM   4013 C CG2 . VAL A 1 529 ? 15.257  32.341 60.940 1.00 17.94 ? 529 VAL A CG2 1 
ATOM   4014 N N   . VAL A 1 530 ? 10.615  31.216 60.836 1.00 20.92 ? 530 VAL A N   1 
ATOM   4015 C CA  . VAL A 1 530 ? 9.187   31.471 60.713 1.00 21.42 ? 530 VAL A CA  1 
ATOM   4016 C C   . VAL A 1 530 ? 8.381   31.609 62.008 1.00 22.31 ? 530 VAL A C   1 
ATOM   4017 O O   . VAL A 1 530 ? 7.166   31.772 61.953 1.00 23.50 ? 530 VAL A O   1 
ATOM   4018 C CB  . VAL A 1 530 ? 8.549   30.354 59.857 1.00 20.08 ? 530 VAL A CB  1 
ATOM   4019 C CG1 . VAL A 1 530 ? 8.561   29.051 60.639 1.00 16.98 ? 530 VAL A CG1 1 
ATOM   4020 C CG2 . VAL A 1 530 ? 7.143   30.742 59.425 1.00 17.59 ? 530 VAL A CG2 1 
ATOM   4021 N N   . GLN A 1 531 ? 9.025   31.544 63.168 1.00 23.24 ? 531 GLN A N   1 
ATOM   4022 C CA  . GLN A 1 531 ? 8.266   31.669 64.415 1.00 22.89 ? 531 GLN A CA  1 
ATOM   4023 C C   . GLN A 1 531 ? 7.549   33.013 64.533 1.00 23.38 ? 531 GLN A C   1 
ATOM   4024 O O   . GLN A 1 531 ? 6.374   33.063 64.911 1.00 24.16 ? 531 GLN A O   1 
ATOM   4025 C CB  . GLN A 1 531 ? 9.159   31.441 65.637 1.00 21.09 ? 531 GLN A CB  1 
ATOM   4026 C CG  . GLN A 1 531 ? 9.512   29.981 65.855 1.00 19.61 ? 531 GLN A CG  1 
ATOM   4027 C CD  . GLN A 1 531 ? 10.912  29.644 65.386 1.00 21.05 ? 531 GLN A CD  1 
ATOM   4028 O OE1 . GLN A 1 531 ? 11.392  30.178 64.383 1.00 19.47 ? 531 GLN A OE1 1 
ATOM   4029 N NE2 . GLN A 1 531 ? 11.574  28.742 66.106 1.00 20.48 ? 531 GLN A NE2 1 
ATOM   4030 N N   . PRO A 1 532 ? 8.244   34.121 64.222 1.00 22.71 ? 532 PRO A N   1 
ATOM   4031 C CA  . PRO A 1 532 ? 7.607   35.439 64.308 1.00 21.83 ? 532 PRO A CA  1 
ATOM   4032 C C   . PRO A 1 532 ? 6.371   35.536 63.411 1.00 22.21 ? 532 PRO A C   1 
ATOM   4033 O O   . PRO A 1 532 ? 5.319   36.007 63.850 1.00 23.29 ? 532 PRO A O   1 
ATOM   4034 C CB  . PRO A 1 532 ? 8.722   36.384 63.875 1.00 21.12 ? 532 PRO A CB  1 
ATOM   4035 C CG  . PRO A 1 532 ? 9.940   35.700 64.407 1.00 19.66 ? 532 PRO A CG  1 
ATOM   4036 C CD  . PRO A 1 532 ? 9.699   34.256 64.024 1.00 20.70 ? 532 PRO A CD  1 
ATOM   4037 N N   . LEU A 1 533 ? 6.505   35.086 62.162 1.00 21.89 ? 533 LEU A N   1 
ATOM   4038 C CA  . LEU A 1 533 ? 5.402   35.105 61.195 1.00 22.26 ? 533 LEU A CA  1 
ATOM   4039 C C   . LEU A 1 533 ? 4.225   34.293 61.714 1.00 23.64 ? 533 LEU A C   1 
ATOM   4040 O O   . LEU A 1 533 ? 3.075   34.722 61.638 1.00 25.04 ? 533 LEU A O   1 
ATOM   4041 C CB  . LEU A 1 533 ? 5.851   34.531 59.845 1.00 19.71 ? 533 LEU A CB  1 
ATOM   4042 C CG  . LEU A 1 533 ? 6.661   35.453 58.929 1.00 19.52 ? 533 LEU A CG  1 
ATOM   4043 C CD1 . LEU A 1 533 ? 7.248   34.657 57.788 1.00 18.13 ? 533 LEU A CD1 1 
ATOM   4044 C CD2 . LEU A 1 533 ? 5.766   36.571 58.399 1.00 19.72 ? 533 LEU A CD2 1 
ATOM   4045 N N   . LEU A 1 534 ? 4.527   33.110 62.233 1.00 24.17 ? 534 LEU A N   1 
ATOM   4046 C CA  . LEU A 1 534 ? 3.517   32.225 62.789 1.00 25.04 ? 534 LEU A CA  1 
ATOM   4047 C C   . LEU A 1 534 ? 2.753   32.951 63.893 1.00 24.55 ? 534 LEU A C   1 
ATOM   4048 O O   . LEU A 1 534 ? 1.523   32.932 63.939 1.00 24.66 ? 534 LEU A O   1 
ATOM   4049 C CB  . LEU A 1 534 ? 4.194   30.979 63.370 1.00 25.37 ? 534 LEU A CB  1 
ATOM   4050 C CG  . LEU A 1 534 ? 4.094   29.611 62.685 1.00 27.88 ? 534 LEU A CG  1 
ATOM   4051 C CD1 . LEU A 1 534 ? 3.608   29.716 61.243 1.00 27.72 ? 534 LEU A CD1 1 
ATOM   4052 C CD2 . LEU A 1 534 ? 5.469   28.965 62.756 1.00 27.37 ? 534 LEU A CD2 1 
ATOM   4053 N N   . ALA A 1 535 ? 3.506   33.598 64.774 1.00 23.94 ? 535 ALA A N   1 
ATOM   4054 C CA  . ALA A 1 535 ? 2.943   34.322 65.906 1.00 24.27 ? 535 ALA A CA  1 
ATOM   4055 C C   . ALA A 1 535 ? 1.894   35.373 65.524 1.00 24.70 ? 535 ALA A C   1 
ATOM   4056 O O   . ALA A 1 535 ? 0.873   35.521 66.199 1.00 24.04 ? 535 ALA A O   1 
ATOM   4057 C CB  . ALA A 1 535 ? 4.070   34.975 66.699 1.00 19.51 ? 535 ALA A CB  1 
ATOM   4058 N N   . ALA A 1 536 ? 2.149   36.095 64.440 1.00 24.57 ? 536 ALA A N   1 
ATOM   4059 C CA  . ALA A 1 536 ? 1.244   37.143 63.996 1.00 24.51 ? 536 ALA A CA  1 
ATOM   4060 C C   . ALA A 1 536 ? 0.068   36.670 63.139 1.00 24.57 ? 536 ALA A C   1 
ATOM   4061 O O   . ALA A 1 536 ? -0.972  37.329 63.090 1.00 25.16 ? 536 ALA A O   1 
ATOM   4062 C CB  . ALA A 1 536 ? 2.041   38.197 63.234 1.00 22.84 ? 536 ALA A CB  1 
ATOM   4063 N N   . SER A 1 537 ? 0.219   35.521 62.489 1.00 23.84 ? 537 SER A N   1 
ATOM   4064 C CA  . SER A 1 537 ? -0.808  35.017 61.584 1.00 23.59 ? 537 SER A CA  1 
ATOM   4065 C C   . SER A 1 537 ? -1.850  34.040 62.122 1.00 24.25 ? 537 SER A C   1 
ATOM   4066 O O   . SER A 1 537 ? -1.574  33.251 63.028 1.00 25.48 ? 537 SER A O   1 
ATOM   4067 C CB  . SER A 1 537 ? -0.122  34.385 60.375 1.00 22.96 ? 537 SER A CB  1 
ATOM   4068 O OG  . SER A 1 537 ? 0.877   35.244 59.850 1.00 20.84 ? 537 SER A OG  1 
ATOM   4069 N N   . ASP A 1 538 ? -3.053  34.101 61.551 1.00 22.92 ? 538 ASP A N   1 
ATOM   4070 C CA  . ASP A 1 538 ? -4.128  33.188 61.931 1.00 22.74 ? 538 ASP A CA  1 
ATOM   4071 C C   . ASP A 1 538 ? -3.902  31.902 61.130 1.00 22.30 ? 538 ASP A C   1 
ATOM   4072 O O   . ASP A 1 538 ? -4.102  30.797 61.632 1.00 22.46 ? 538 ASP A O   1 
ATOM   4073 C CB  . ASP A 1 538 ? -5.495  33.777 61.586 1.00 24.19 ? 538 ASP A CB  1 
ATOM   4074 C CG  . ASP A 1 538 ? -5.792  35.050 62.347 1.00 26.69 ? 538 ASP A CG  1 
ATOM   4075 O OD1 . ASP A 1 538 ? -5.952  35.000 63.586 1.00 27.36 ? 538 ASP A OD1 1 
ATOM   4076 O OD2 . ASP A 1 538 ? -5.863  36.114 61.700 1.00 30.07 ? 538 ASP A OD2 1 
ATOM   4077 N N   . ALA A 1 539 ? -3.480  32.063 59.878 1.00 20.88 ? 539 ALA A N   1 
ATOM   4078 C CA  . ALA A 1 539 ? -3.186  30.938 58.994 1.00 18.81 ? 539 ALA A CA  1 
ATOM   4079 C C   . ALA A 1 539 ? -1.925  31.289 58.206 1.00 17.88 ? 539 ALA A C   1 
ATOM   4080 O O   . ALA A 1 539 ? -1.723  32.445 57.845 1.00 17.61 ? 539 ALA A O   1 
ATOM   4081 C CB  . ALA A 1 539 ? -4.355  30.689 58.047 1.00 18.19 ? 539 ALA A CB  1 
ATOM   4082 N N   . LEU A 1 540 ? -1.070  30.305 57.954 1.00 17.39 ? 540 LEU A N   1 
ATOM   4083 C CA  . LEU A 1 540 ? 0.161   30.557 57.210 1.00 18.59 ? 540 LEU A CA  1 
ATOM   4084 C C   . LEU A 1 540 ? 0.432   29.407 56.269 1.00 19.56 ? 540 LEU A C   1 
ATOM   4085 O O   . LEU A 1 540 ? 0.372   28.243 56.669 1.00 21.60 ? 540 LEU A O   1 
ATOM   4086 C CB  . LEU A 1 540 ? 1.346   30.737 58.163 1.00 18.01 ? 540 LEU A CB  1 
ATOM   4087 C CG  . LEU A 1 540 ? 2.721   31.044 57.557 1.00 17.19 ? 540 LEU A CG  1 
ATOM   4088 C CD1 . LEU A 1 540 ? 3.535   31.872 58.533 1.00 18.68 ? 540 LEU A CD1 1 
ATOM   4089 C CD2 . LEU A 1 540 ? 3.450   29.763 57.217 1.00 16.98 ? 540 LEU A CD2 1 
ATOM   4090 N N   . VAL A 1 541 ? 0.733   29.740 55.017 1.00 19.93 ? 541 VAL A N   1 
ATOM   4091 C CA  . VAL A 1 541 ? 1.003   28.737 53.991 1.00 20.33 ? 541 VAL A CA  1 
ATOM   4092 C C   . VAL A 1 541 ? 2.405   28.869 53.407 1.00 20.76 ? 541 VAL A C   1 
ATOM   4093 O O   . VAL A 1 541 ? 2.885   29.977 53.149 1.00 21.93 ? 541 VAL A O   1 
ATOM   4094 C CB  . VAL A 1 541 ? -0.003  28.851 52.812 1.00 20.00 ? 541 VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 541 ? 0.245   27.732 51.805 1.00 19.98 ? 541 VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 541 ? -1.433  28.807 53.326 1.00 18.19 ? 541 VAL A CG2 1 
ATOM   4097 N N   . ALA A 1 542 ? 3.060   27.732 53.207 1.00 20.47 ? 542 ALA A N   1 
ATOM   4098 C CA  . ALA A 1 542 ? 4.390   27.717 52.613 1.00 20.24 ? 542 ALA A CA  1 
ATOM   4099 C C   . ALA A 1 542 ? 4.158   27.412 51.138 1.00 19.78 ? 542 ALA A C   1 
ATOM   4100 O O   . ALA A 1 542 ? 3.845   26.274 50.775 1.00 19.95 ? 542 ALA A O   1 
ATOM   4101 C CB  . ALA A 1 542 ? 5.245   26.631 53.255 1.00 21.10 ? 542 ALA A CB  1 
ATOM   4102 N N   . ALA A 1 543 ? 4.293   28.435 50.298 1.00 19.13 ? 543 ALA A N   1 
ATOM   4103 C CA  . ALA A 1 543 ? 4.072   28.298 48.861 1.00 19.04 ? 543 ALA A CA  1 
ATOM   4104 C C   . ALA A 1 543 ? 5.343   28.022 48.071 1.00 19.10 ? 543 ALA A C   1 
ATOM   4105 O O   . ALA A 1 543 ? 5.286   27.787 46.867 1.00 19.74 ? 543 ALA A O   1 
ATOM   4106 C CB  . ALA A 1 543 ? 3.401   29.556 48.322 1.00 19.22 ? 543 ALA A CB  1 
ATOM   4107 N N   . TRP A 1 544 ? 6.487   28.052 48.745 1.00 18.26 ? 544 TRP A N   1 
ATOM   4108 C CA  . TRP A 1 544 ? 7.761   27.815 48.085 1.00 16.70 ? 544 TRP A CA  1 
ATOM   4109 C C   . TRP A 1 544 ? 7.903   28.805 46.925 1.00 16.36 ? 544 TRP A C   1 
ATOM   4110 O O   . TRP A 1 544 ? 7.768   30.009 47.121 1.00 16.47 ? 544 TRP A O   1 
ATOM   4111 C CB  . TRP A 1 544 ? 7.837   26.371 47.579 1.00 16.18 ? 544 TRP A CB  1 
ATOM   4112 C CG  . TRP A 1 544 ? 7.381   25.351 48.590 1.00 18.45 ? 544 TRP A CG  1 
ATOM   4113 C CD1 . TRP A 1 544 ? 6.235   24.608 48.537 1.00 20.46 ? 544 TRP A CD1 1 
ATOM   4114 C CD2 . TRP A 1 544 ? 8.041   24.979 49.813 1.00 20.07 ? 544 TRP A CD2 1 
ATOM   4115 N NE1 . TRP A 1 544 ? 6.139   23.799 49.646 1.00 20.13 ? 544 TRP A NE1 1 
ATOM   4116 C CE2 . TRP A 1 544 ? 7.231   24.005 50.446 1.00 20.06 ? 544 TRP A CE2 1 
ATOM   4117 C CE3 . TRP A 1 544 ? 9.238   25.371 50.437 1.00 19.97 ? 544 TRP A CE3 1 
ATOM   4118 C CZ2 . TRP A 1 544 ? 7.577   23.417 51.674 1.00 20.14 ? 544 TRP A CZ2 1 
ATOM   4119 C CZ3 . TRP A 1 544 ? 9.583   24.786 51.660 1.00 18.75 ? 544 TRP A CZ3 1 
ATOM   4120 C CH2 . TRP A 1 544 ? 8.752   23.820 52.263 1.00 19.65 ? 544 TRP A CH2 1 
ATOM   4121 N N   . LEU A 1 545 ? 8.186   28.305 45.728 1.00 15.62 ? 545 LEU A N   1 
ATOM   4122 C CA  . LEU A 1 545 ? 8.330   29.160 44.551 1.00 16.92 ? 545 LEU A CA  1 
ATOM   4123 C C   . LEU A 1 545 ? 7.373   28.601 43.500 1.00 17.59 ? 545 LEU A C   1 
ATOM   4124 O O   . LEU A 1 545 ? 7.787   27.912 42.562 1.00 18.98 ? 545 LEU A O   1 
ATOM   4125 C CB  . LEU A 1 545 ? 9.778   29.134 44.047 1.00 15.80 ? 545 LEU A CB  1 
ATOM   4126 C CG  . LEU A 1 545 ? 10.841  29.627 45.040 1.00 16.99 ? 545 LEU A CG  1 
ATOM   4127 C CD1 . LEU A 1 545 ? 12.226  29.320 44.499 1.00 16.43 ? 545 LEU A CD1 1 
ATOM   4128 C CD2 . LEU A 1 545 ? 10.684  31.122 45.286 1.00 16.01 ? 545 LEU A CD2 1 
ATOM   4129 N N   . PRO A 1 546 ? 6.075   28.921 43.643 1.00 17.27 ? 546 PRO A N   1 
ATOM   4130 C CA  . PRO A 1 546 ? 4.915   28.537 42.829 1.00 16.70 ? 546 PRO A CA  1 
ATOM   4131 C C   . PRO A 1 546 ? 5.049   28.581 41.311 1.00 16.00 ? 546 PRO A C   1 
ATOM   4132 O O   . PRO A 1 546 ? 4.505   27.728 40.616 1.00 15.48 ? 546 PRO A O   1 
ATOM   4133 C CB  . PRO A 1 546 ? 3.818   29.485 43.319 1.00 16.71 ? 546 PRO A CB  1 
ATOM   4134 C CG  . PRO A 1 546 ? 4.239   29.820 44.693 1.00 18.02 ? 546 PRO A CG  1 
ATOM   4135 C CD  . PRO A 1 546 ? 5.707   30.034 44.534 1.00 16.49 ? 546 PRO A CD  1 
ATOM   4136 N N   . GLY A 1 547 ? 5.751   29.580 40.794 1.00 15.48 ? 547 GLY A N   1 
ATOM   4137 C CA  . GLY A 1 547 ? 5.886   29.688 39.354 1.00 15.75 ? 547 GLY A CA  1 
ATOM   4138 C C   . GLY A 1 547 ? 4.977   30.767 38.791 1.00 15.95 ? 547 GLY A C   1 
ATOM   4139 O O   . GLY A 1 547 ? 4.523   31.648 39.518 1.00 16.34 ? 547 GLY A O   1 
ATOM   4140 N N   . SER A 1 548 ? 4.687   30.686 37.501 1.00 15.32 ? 548 SER A N   1 
ATOM   4141 C CA  . SER A 1 548 ? 3.857   31.686 36.846 1.00 17.41 ? 548 SER A CA  1 
ATOM   4142 C C   . SER A 1 548 ? 2.347   31.636 37.102 1.00 17.57 ? 548 SER A C   1 
ATOM   4143 O O   . SER A 1 548 ? 1.662   32.638 36.915 1.00 18.23 ? 548 SER A O   1 
ATOM   4144 C CB  . SER A 1 548 ? 4.117   31.649 35.334 1.00 17.96 ? 548 SER A CB  1 
ATOM   4145 O OG  . SER A 1 548 ? 3.891   30.349 34.810 1.00 19.46 ? 548 SER A OG  1 
ATOM   4146 N N   . GLU A 1 549 ? 1.824   30.496 37.539 1.00 18.23 ? 549 GLU A N   1 
ATOM   4147 C CA  . GLU A 1 549 ? 0.380   30.370 37.764 1.00 19.61 ? 549 GLU A CA  1 
ATOM   4148 C C   . GLU A 1 549 ? -0.109  30.603 39.197 1.00 20.23 ? 549 GLU A C   1 
ATOM   4149 O O   . GLU A 1 549 ? -0.412  29.659 39.927 1.00 20.71 ? 549 GLU A O   1 
ATOM   4150 C CB  . GLU A 1 549 ? -0.081  28.998 37.281 1.00 20.14 ? 549 GLU A CB  1 
ATOM   4151 C CG  . GLU A 1 549 ? 0.348   28.696 35.864 1.00 21.69 ? 549 GLU A CG  1 
ATOM   4152 C CD  . GLU A 1 549 ? 0.034   29.837 34.920 1.00 23.98 ? 549 GLU A CD  1 
ATOM   4153 O OE1 . GLU A 1 549 ? -1.142  30.260 34.885 1.00 23.22 ? 549 GLU A OE1 1 
ATOM   4154 O OE2 . GLU A 1 549 ? 0.960   30.309 34.217 1.00 23.07 ? 549 GLU A OE2 1 
ATOM   4155 N N   . GLY A 1 550 ? -0.221  31.870 39.578 1.00 20.04 ? 550 GLY A N   1 
ATOM   4156 C CA  . GLY A 1 550 ? -0.652  32.207 40.922 1.00 18.15 ? 550 GLY A CA  1 
ATOM   4157 C C   . GLY A 1 550 ? -2.011  31.704 41.364 1.00 17.72 ? 550 GLY A C   1 
ATOM   4158 O O   . GLY A 1 550 ? -2.265  31.585 42.564 1.00 15.63 ? 550 GLY A O   1 
ATOM   4159 N N   . GLN A 1 551 ? -2.893  31.415 40.414 1.00 18.20 ? 551 GLN A N   1 
ATOM   4160 C CA  . GLN A 1 551 ? -4.223  30.928 40.766 1.00 18.33 ? 551 GLN A CA  1 
ATOM   4161 C C   . GLN A 1 551 ? -4.123  29.635 41.567 1.00 18.23 ? 551 GLN A C   1 
ATOM   4162 O O   . GLN A 1 551 ? -5.017  29.304 42.346 1.00 17.11 ? 551 GLN A O   1 
ATOM   4163 C CB  . GLN A 1 551 ? -5.062  30.755 39.500 1.00 18.79 ? 551 GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 551 ? -5.225  32.090 38.768 1.00 23.79 ? 551 GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 551 ? -5.946  31.981 37.442 1.00 25.75 ? 551 GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 551 ? -7.162  31.817 37.397 1.00 27.74 ? 551 GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 551 ? -5.192  32.072 36.348 1.00 28.47 ? 551 GLN A NE2 1 
ATOM   4168 N N   . GLY A 1 552 ? -3.015  28.920 41.390 1.00 18.55 ? 552 GLY A N   1 
ATOM   4169 C CA  . GLY A 1 552 ? -2.804  27.694 42.130 1.00 17.34 ? 552 GLY A CA  1 
ATOM   4170 C C   . GLY A 1 552 ? -2.823  28.003 43.616 1.00 18.25 ? 552 GLY A C   1 
ATOM   4171 O O   . GLY A 1 552 ? -3.266  27.182 44.418 1.00 17.92 ? 552 GLY A O   1 
ATOM   4172 N N   . VAL A 1 553 ? -2.339  29.190 43.987 1.00 18.02 ? 553 VAL A N   1 
ATOM   4173 C CA  . VAL A 1 553 ? -2.328  29.610 45.389 1.00 17.75 ? 553 VAL A CA  1 
ATOM   4174 C C   . VAL A 1 553 ? -3.754  29.870 45.878 1.00 18.77 ? 553 VAL A C   1 
ATOM   4175 O O   . VAL A 1 553 ? -4.167  29.388 46.930 1.00 19.51 ? 553 VAL A O   1 
ATOM   4176 C CB  . VAL A 1 553 ? -1.512  30.901 45.594 1.00 16.71 ? 553 VAL A CB  1 
ATOM   4177 C CG1 . VAL A 1 553 ? -1.663  31.385 47.028 1.00 14.63 ? 553 VAL A CG1 1 
ATOM   4178 C CG2 . VAL A 1 553 ? -0.036  30.656 45.265 1.00 16.66 ? 553 VAL A CG2 1 
ATOM   4179 N N   . THR A 1 554 ? -4.513  30.627 45.104 1.00 19.37 ? 554 THR A N   1 
ATOM   4180 C CA  . THR A 1 554 ? -5.877  30.934 45.488 1.00 20.06 ? 554 THR A CA  1 
ATOM   4181 C C   . THR A 1 554 ? -6.824  29.746 45.361 1.00 20.70 ? 554 THR A C   1 
ATOM   4182 O O   . THR A 1 554 ? -7.907  29.760 45.944 1.00 20.60 ? 554 THR A O   1 
ATOM   4183 C CB  . THR A 1 554 ? -6.420  32.113 44.677 1.00 20.07 ? 554 THR A CB  1 
ATOM   4184 O OG1 . THR A 1 554 ? -6.204  31.878 43.279 1.00 18.87 ? 554 THR A OG1 1 
ATOM   4185 C CG2 . THR A 1 554 ? -5.715  33.399 45.095 1.00 19.74 ? 554 THR A CG2 1 
ATOM   4186 N N   . ASP A 1 555 ? -6.428  28.722 44.605 1.00 21.38 ? 555 ASP A N   1 
ATOM   4187 C CA  . ASP A 1 555 ? -7.278  27.537 44.454 1.00 20.88 ? 555 ASP A CA  1 
ATOM   4188 C C   . ASP A 1 555 ? -7.426  26.845 45.806 1.00 21.46 ? 555 ASP A C   1 
ATOM   4189 O O   . ASP A 1 555 ? -8.440  26.198 46.086 1.00 21.92 ? 555 ASP A O   1 
ATOM   4190 C CB  . ASP A 1 555 ? -6.690  26.538 43.450 1.00 20.36 ? 555 ASP A CB  1 
ATOM   4191 C CG  . ASP A 1 555 ? -6.975  26.912 42.003 1.00 21.80 ? 555 ASP A CG  1 
ATOM   4192 O OD1 . ASP A 1 555 ? -7.877  27.743 41.748 1.00 20.89 ? 555 ASP A OD1 1 
ATOM   4193 O OD2 . ASP A 1 555 ? -6.299  26.354 41.113 1.00 22.60 ? 555 ASP A OD2 1 
ATOM   4194 N N   . ALA A 1 556 ? -6.405  26.981 46.644 1.00 20.65 ? 556 ALA A N   1 
ATOM   4195 C CA  . ALA A 1 556 ? -6.437  26.374 47.961 1.00 21.21 ? 556 ALA A CA  1 
ATOM   4196 C C   . ALA A 1 556 ? -6.985  27.364 48.981 1.00 20.99 ? 556 ALA A C   1 
ATOM   4197 O O   . ALA A 1 556 ? -7.808  27.002 49.816 1.00 20.21 ? 556 ALA A O   1 
ATOM   4198 C CB  . ALA A 1 556 ? -5.039  25.915 48.367 1.00 22.53 ? 556 ALA A CB  1 
ATOM   4199 N N   . LEU A 1 557 ? -6.541  28.614 48.903 1.00 20.43 ? 557 LEU A N   1 
ATOM   4200 C CA  . LEU A 1 557 ? -7.001  29.621 49.842 1.00 20.75 ? 557 LEU A CA  1 
ATOM   4201 C C   . LEU A 1 557 ? -8.520  29.773 49.852 1.00 22.85 ? 557 LEU A C   1 
ATOM   4202 O O   . LEU A 1 557 ? -9.115  30.008 50.907 1.00 23.18 ? 557 LEU A O   1 
ATOM   4203 C CB  . LEU A 1 557 ? -6.359  30.976 49.537 1.00 19.93 ? 557 LEU A CB  1 
ATOM   4204 C CG  . LEU A 1 557 ? -4.887  31.181 49.911 1.00 20.34 ? 557 LEU A CG  1 
ATOM   4205 C CD1 . LEU A 1 557 ? -4.450  32.584 49.491 1.00 19.49 ? 557 LEU A CD1 1 
ATOM   4206 C CD2 . LEU A 1 557 ? -4.698  30.991 51.405 1.00 18.53 ? 557 LEU A CD2 1 
ATOM   4207 N N   . PHE A 1 558 ? -9.154  29.626 48.691 1.00 22.72 ? 558 PHE A N   1 
ATOM   4208 C CA  . PHE A 1 558 ? -10.600 29.785 48.613 1.00 22.58 ? 558 PHE A CA  1 
ATOM   4209 C C   . PHE A 1 558 ? -11.427 28.506 48.649 1.00 23.74 ? 558 PHE A C   1 
ATOM   4210 O O   . PHE A 1 558 ? -12.643 28.542 48.469 1.00 24.39 ? 558 PHE A O   1 
ATOM   4211 C CB  . PHE A 1 558 ? -10.961 30.619 47.383 1.00 21.71 ? 558 PHE A CB  1 
ATOM   4212 C CG  . PHE A 1 558 ? -10.571 32.065 47.506 1.00 19.43 ? 558 PHE A CG  1 
ATOM   4213 C CD1 . PHE A 1 558 ? -11.195 32.887 48.434 1.00 18.09 ? 558 PHE A CD1 1 
ATOM   4214 C CD2 . PHE A 1 558 ? -9.551  32.595 46.726 1.00 19.88 ? 558 PHE A CD2 1 
ATOM   4215 C CE1 . PHE A 1 558 ? -10.808 34.212 48.587 1.00 16.82 ? 558 PHE A CE1 1 
ATOM   4216 C CE2 . PHE A 1 558 ? -9.159  33.920 46.874 1.00 18.49 ? 558 PHE A CE2 1 
ATOM   4217 C CZ  . PHE A 1 558 ? -9.792  34.728 47.810 1.00 16.37 ? 558 PHE A CZ  1 
ATOM   4218 N N   . GLY A 1 559 ? -10.769 27.377 48.878 1.00 24.74 ? 559 GLY A N   1 
ATOM   4219 C CA  . GLY A 1 559 ? -11.488 26.122 48.975 1.00 25.75 ? 559 GLY A CA  1 
ATOM   4220 C C   . GLY A 1 559 ? -11.849 25.334 47.729 1.00 27.27 ? 559 GLY A C   1 
ATOM   4221 O O   . GLY A 1 559 ? -12.533 24.318 47.844 1.00 28.41 ? 559 GLY A O   1 
ATOM   4222 N N   . ASP A 1 560 ? -11.425 25.765 46.546 1.00 28.95 ? 560 ASP A N   1 
ATOM   4223 C CA  . ASP A 1 560 ? -11.748 24.993 45.346 1.00 29.11 ? 560 ASP A CA  1 
ATOM   4224 C C   . ASP A 1 560 ? -11.074 23.633 45.433 1.00 27.75 ? 560 ASP A C   1 
ATOM   4225 O O   . ASP A 1 560 ? -11.473 22.686 44.766 1.00 28.72 ? 560 ASP A O   1 
ATOM   4226 C CB  . ASP A 1 560 ? -11.299 25.718 44.078 1.00 31.96 ? 560 ASP A CB  1 
ATOM   4227 C CG  . ASP A 1 560 ? -12.117 26.960 43.808 1.00 34.69 ? 560 ASP A CG  1 
ATOM   4228 O OD1 . ASP A 1 560 ? -13.328 26.955 44.129 1.00 35.28 ? 560 ASP A OD1 1 
ATOM   4229 O OD2 . ASP A 1 560 ? -11.558 27.934 43.266 1.00 37.07 ? 560 ASP A OD2 1 
ATOM   4230 N N   . PHE A 1 561 ? -10.038 23.554 46.258 1.00 26.44 ? 561 PHE A N   1 
ATOM   4231 C CA  . PHE A 1 561 ? -9.318  22.313 46.493 1.00 25.83 ? 561 PHE A CA  1 
ATOM   4232 C C   . PHE A 1 561 ? -8.784  22.410 47.912 1.00 26.81 ? 561 PHE A C   1 
ATOM   4233 O O   . PHE A 1 561 ? -8.540  23.516 48.405 1.00 28.80 ? 561 PHE A O   1 
ATOM   4234 C CB  . PHE A 1 561 ? -8.153  22.147 45.517 1.00 25.92 ? 561 PHE A CB  1 
ATOM   4235 C CG  . PHE A 1 561 ? -8.573  22.043 44.079 1.00 26.21 ? 561 PHE A CG  1 
ATOM   4236 C CD1 . PHE A 1 561 ? -8.787  23.194 43.314 1.00 25.61 ? 561 PHE A CD1 1 
ATOM   4237 C CD2 . PHE A 1 561 ? -8.776  20.794 43.491 1.00 24.36 ? 561 PHE A CD2 1 
ATOM   4238 C CE1 . PHE A 1 561 ? -9.200  23.103 41.983 1.00 24.13 ? 561 PHE A CE1 1 
ATOM   4239 C CE2 . PHE A 1 561 ? -9.188  20.690 42.159 1.00 24.29 ? 561 PHE A CE2 1 
ATOM   4240 C CZ  . PHE A 1 561 ? -9.401  21.850 41.404 1.00 24.24 ? 561 PHE A CZ  1 
ATOM   4241 N N   . GLY A 1 562 ? -8.618  21.269 48.576 1.00 25.10 ? 562 GLY A N   1 
ATOM   4242 C CA  . GLY A 1 562 ? -8.107  21.283 49.935 1.00 23.72 ? 562 GLY A CA  1 
ATOM   4243 C C   . GLY A 1 562 ? -6.596  21.172 49.934 1.00 24.36 ? 562 GLY A C   1 
ATOM   4244 O O   . GLY A 1 562 ? -6.026  20.614 48.994 1.00 24.55 ? 562 GLY A O   1 
ATOM   4245 N N   . PHE A 1 563 ? -5.942  21.711 50.964 1.00 23.68 ? 563 PHE A N   1 
ATOM   4246 C CA  . PHE A 1 563 ? -4.485  21.642 51.055 1.00 22.98 ? 563 PHE A CA  1 
ATOM   4247 C C   . PHE A 1 563 ? -4.072  20.194 51.264 1.00 23.06 ? 563 PHE A C   1 
ATOM   4248 O O   . PHE A 1 563 ? -4.647  19.495 52.098 1.00 23.74 ? 563 PHE A O   1 
ATOM   4249 C CB  . PHE A 1 563 ? -3.954  22.481 52.223 1.00 23.17 ? 563 PHE A CB  1 
ATOM   4250 C CG  . PHE A 1 563 ? -4.072  23.965 52.021 1.00 22.47 ? 563 PHE A CG  1 
ATOM   4251 C CD1 . PHE A 1 563 ? -5.251  24.632 52.320 1.00 22.38 ? 563 PHE A CD1 1 
ATOM   4252 C CD2 . PHE A 1 563 ? -2.994  24.696 51.535 1.00 22.91 ? 563 PHE A CD2 1 
ATOM   4253 C CE1 . PHE A 1 563 ? -5.357  26.008 52.141 1.00 23.05 ? 563 PHE A CE1 1 
ATOM   4254 C CE2 . PHE A 1 563 ? -3.088  26.070 51.350 1.00 22.99 ? 563 PHE A CE2 1 
ATOM   4255 C CZ  . PHE A 1 563 ? -4.275  26.727 51.656 1.00 24.02 ? 563 PHE A CZ  1 
ATOM   4256 N N   . THR A 1 564 ? -3.071  19.745 50.515 1.00 22.48 ? 564 THR A N   1 
ATOM   4257 C CA  . THR A 1 564 ? -2.605  18.371 50.633 1.00 21.78 ? 564 THR A CA  1 
ATOM   4258 C C   . THR A 1 564 ? -1.091  18.261 50.765 1.00 22.78 ? 564 THR A C   1 
ATOM   4259 O O   . THR A 1 564 ? -0.576  17.216 51.149 1.00 23.39 ? 564 THR A O   1 
ATOM   4260 C CB  . THR A 1 564 ? -3.057  17.523 49.418 1.00 21.61 ? 564 THR A CB  1 
ATOM   4261 O OG1 . THR A 1 564 ? -2.651  18.158 48.197 1.00 20.24 ? 564 THR A OG1 1 
ATOM   4262 C CG2 . THR A 1 564 ? -4.557  17.361 49.419 1.00 19.67 ? 564 THR A CG2 1 
ATOM   4263 N N   . GLY A 1 565 ? -0.379  19.340 50.466 1.00 23.14 ? 565 GLY A N   1 
ATOM   4264 C CA  . GLY A 1 565 ? 1.072   19.297 50.543 1.00 25.79 ? 565 GLY A CA  1 
ATOM   4265 C C   . GLY A 1 565 ? 1.685   18.995 51.899 1.00 26.95 ? 565 GLY A C   1 
ATOM   4266 O O   . GLY A 1 565 ? 1.150   19.382 52.936 1.00 28.97 ? 565 GLY A O   1 
ATOM   4267 N N   . ARG A 1 566 ? 2.817   18.295 51.889 1.00 27.56 ? 566 ARG A N   1 
ATOM   4268 C CA  . ARG A 1 566 ? 3.537   17.962 53.118 1.00 27.78 ? 566 ARG A CA  1 
ATOM   4269 C C   . ARG A 1 566 ? 5.008   18.341 52.965 1.00 26.05 ? 566 ARG A C   1 
ATOM   4270 O O   . ARG A 1 566 ? 5.586   18.183 51.893 1.00 24.96 ? 566 ARG A O   1 
ATOM   4271 C CB  . ARG A 1 566 ? 3.415   16.473 53.436 1.00 28.51 ? 566 ARG A CB  1 
ATOM   4272 C CG  . ARG A 1 566 ? 1.998   16.026 53.674 1.00 32.07 ? 566 ARG A CG  1 
ATOM   4273 C CD  . ARG A 1 566 ? 1.946   14.715 54.435 1.00 36.84 ? 566 ARG A CD  1 
ATOM   4274 N NE  . ARG A 1 566 ? 1.156   13.719 53.724 1.00 41.20 ? 566 ARG A NE  1 
ATOM   4275 C CZ  . ARG A 1 566 ? 1.646   12.914 52.788 1.00 43.73 ? 566 ARG A CZ  1 
ATOM   4276 N NH1 . ARG A 1 566 ? 2.929   12.983 52.458 1.00 44.52 ? 566 ARG A NH1 1 
ATOM   4277 N NH2 . ARG A 1 566 ? 0.848   12.055 52.165 1.00 44.35 ? 566 ARG A NH2 1 
ATOM   4278 N N   . LEU A 1 567 ? 5.607   18.837 54.042 1.00 23.98 ? 567 LEU A N   1 
ATOM   4279 C CA  . LEU A 1 567 ? 6.998   19.263 54.013 1.00 23.36 ? 567 LEU A CA  1 
ATOM   4280 C C   . LEU A 1 567 ? 7.966   18.215 53.467 1.00 24.76 ? 567 LEU A C   1 
ATOM   4281 O O   . LEU A 1 567 ? 7.988   17.069 53.925 1.00 25.81 ? 567 LEU A O   1 
ATOM   4282 C CB  . LEU A 1 567 ? 7.454   19.696 55.412 1.00 21.44 ? 567 LEU A CB  1 
ATOM   4283 C CG  . LEU A 1 567 ? 6.782   20.910 56.073 1.00 20.81 ? 567 LEU A CG  1 
ATOM   4284 C CD1 . LEU A 1 567 ? 7.448   21.180 57.420 1.00 18.65 ? 567 LEU A CD1 1 
ATOM   4285 C CD2 . LEU A 1 567 ? 6.888   22.134 55.177 1.00 17.27 ? 567 LEU A CD2 1 
ATOM   4286 N N   . PRO A 1 568 ? 8.778   18.600 52.465 1.00 24.54 ? 568 PRO A N   1 
ATOM   4287 C CA  . PRO A 1 568 ? 9.772   17.738 51.821 1.00 24.02 ? 568 PRO A CA  1 
ATOM   4288 C C   . PRO A 1 568 ? 11.089  17.885 52.580 1.00 25.35 ? 568 PRO A C   1 
ATOM   4289 O O   . PRO A 1 568 ? 12.023  17.097 52.406 1.00 25.48 ? 568 PRO A O   1 
ATOM   4290 C CB  . PRO A 1 568 ? 9.887   18.319 50.411 1.00 23.24 ? 568 PRO A CB  1 
ATOM   4291 C CG  . PRO A 1 568 ? 8.780   19.342 50.313 1.00 23.38 ? 568 PRO A CG  1 
ATOM   4292 C CD  . PRO A 1 568 ? 8.633   19.846 51.702 1.00 23.79 ? 568 PRO A CD  1 
ATOM   4293 N N   . ARG A 1 569 ? 11.156  18.926 53.405 1.00 24.63 ? 569 ARG A N   1 
ATOM   4294 C CA  . ARG A 1 569 ? 12.340  19.202 54.202 1.00 25.74 ? 569 ARG A CA  1 
ATOM   4295 C C   . ARG A 1 569 ? 11.955  19.266 55.666 1.00 27.05 ? 569 ARG A C   1 
ATOM   4296 O O   . ARG A 1 569 ? 10.793  19.081 56.030 1.00 28.06 ? 569 ARG A O   1 
ATOM   4297 C CB  . ARG A 1 569 ? 12.947  20.556 53.843 1.00 25.41 ? 569 ARG A CB  1 
ATOM   4298 C CG  . ARG A 1 569 ? 13.276  20.775 52.400 1.00 25.44 ? 569 ARG A CG  1 
ATOM   4299 C CD  . ARG A 1 569 ? 14.260  21.908 52.322 1.00 24.50 ? 569 ARG A CD  1 
ATOM   4300 N NE  . ARG A 1 569 ? 15.439  21.582 53.112 1.00 25.40 ? 569 ARG A NE  1 
ATOM   4301 C CZ  . ARG A 1 569 ? 16.354  20.683 52.757 1.00 25.56 ? 569 ARG A CZ  1 
ATOM   4302 N NH1 . ARG A 1 569 ? 16.235  20.021 51.613 1.00 24.46 ? 569 ARG A NH1 1 
ATOM   4303 N NH2 . ARG A 1 569 ? 17.379  20.429 53.558 1.00 26.34 ? 569 ARG A NH2 1 
ATOM   4304 N N   . THR A 1 570 ? 12.949  19.553 56.496 1.00 26.53 ? 570 THR A N   1 
ATOM   4305 C CA  . THR A 1 570 ? 12.744  19.692 57.924 1.00 25.42 ? 570 THR A CA  1 
ATOM   4306 C C   . THR A 1 570 ? 12.681  21.194 58.144 1.00 26.68 ? 570 THR A C   1 
ATOM   4307 O O   . THR A 1 570 ? 13.439  21.937 57.515 1.00 25.97 ? 570 THR A O   1 
ATOM   4308 C CB  . THR A 1 570 ? 13.933  19.112 58.716 1.00 23.68 ? 570 THR A CB  1 
ATOM   4309 O OG1 . THR A 1 570 ? 13.966  17.692 58.556 1.00 23.07 ? 570 THR A OG1 1 
ATOM   4310 C CG2 . THR A 1 570 ? 13.809  19.439 60.184 1.00 21.98 ? 570 THR A CG2 1 
ATOM   4311 N N   . TRP A 1 571 ? 11.766  21.648 58.997 1.00 25.97 ? 571 TRP A N   1 
ATOM   4312 C CA  . TRP A 1 571 ? 11.666  23.072 59.282 1.00 24.92 ? 571 TRP A CA  1 
ATOM   4313 C C   . TRP A 1 571 ? 12.267  23.277 60.661 1.00 25.68 ? 571 TRP A C   1 
ATOM   4314 O O   . TRP A 1 571 ? 11.696  22.861 61.665 1.00 26.87 ? 571 TRP A O   1 
ATOM   4315 C CB  . TRP A 1 571 ? 10.212  23.546 59.260 1.00 24.00 ? 571 TRP A CB  1 
ATOM   4316 C CG  . TRP A 1 571 ? 10.097  25.005 58.918 1.00 23.16 ? 571 TRP A CG  1 
ATOM   4317 C CD1 . TRP A 1 571 ? 10.583  26.057 59.641 1.00 22.15 ? 571 TRP A CD1 1 
ATOM   4318 C CD2 . TRP A 1 571 ? 9.518   25.568 57.731 1.00 23.50 ? 571 TRP A CD2 1 
ATOM   4319 N NE1 . TRP A 1 571 ? 10.349  27.236 58.977 1.00 23.25 ? 571 TRP A NE1 1 
ATOM   4320 C CE2 . TRP A 1 571 ? 9.696   26.967 57.803 1.00 23.77 ? 571 TRP A CE2 1 
ATOM   4321 C CE3 . TRP A 1 571 ? 8.869   25.026 56.613 1.00 22.74 ? 571 TRP A CE3 1 
ATOM   4322 C CZ2 . TRP A 1 571 ? 9.245   27.833 56.800 1.00 24.85 ? 571 TRP A CZ2 1 
ATOM   4323 C CZ3 . TRP A 1 571 ? 8.423   25.886 55.616 1.00 23.23 ? 571 TRP A CZ3 1 
ATOM   4324 C CH2 . TRP A 1 571 ? 8.614   27.274 55.717 1.00 24.28 ? 571 TRP A CH2 1 
ATOM   4325 N N   . PHE A 1 572 ? 13.427  23.920 60.692 1.00 25.36 ? 572 PHE A N   1 
ATOM   4326 C CA  . PHE A 1 572 ? 14.170  24.169 61.927 1.00 26.06 ? 572 PHE A CA  1 
ATOM   4327 C C   . PHE A 1 572 ? 13.613  25.263 62.819 1.00 25.75 ? 572 PHE A C   1 
ATOM   4328 O O   . PHE A 1 572 ? 12.811  26.084 62.386 1.00 25.68 ? 572 PHE A O   1 
ATOM   4329 C CB  . PHE A 1 572 ? 15.614  24.522 61.573 1.00 24.44 ? 572 PHE A CB  1 
ATOM   4330 C CG  . PHE A 1 572 ? 15.722  25.620 60.563 1.00 22.91 ? 572 PHE A CG  1 
ATOM   4331 C CD1 . PHE A 1 572 ? 15.489  26.941 60.925 1.00 22.42 ? 572 PHE A CD1 1 
ATOM   4332 C CD2 . PHE A 1 572 ? 15.994  25.328 59.230 1.00 22.14 ? 572 PHE A CD2 1 
ATOM   4333 C CE1 . PHE A 1 572 ? 15.522  27.961 59.969 1.00 22.96 ? 572 PHE A CE1 1 
ATOM   4334 C CE2 . PHE A 1 572 ? 16.029  26.336 58.270 1.00 21.09 ? 572 PHE A CE2 1 
ATOM   4335 C CZ  . PHE A 1 572 ? 15.792  27.655 58.639 1.00 20.99 ? 572 PHE A CZ  1 
ATOM   4336 N N   . LYS A 1 573 ? 14.060  25.263 64.073 1.00 26.48 ? 573 LYS A N   1 
ATOM   4337 C CA  . LYS A 1 573 ? 13.652  26.277 65.037 1.00 27.43 ? 573 LYS A CA  1 
ATOM   4338 C C   . LYS A 1 573 ? 14.615  27.450 64.900 1.00 28.39 ? 573 LYS A C   1 
ATOM   4339 O O   . LYS A 1 573 ? 14.209  28.612 64.996 1.00 28.86 ? 573 LYS A O   1 
ATOM   4340 C CB  . LYS A 1 573 ? 13.698  25.719 66.461 1.00 28.02 ? 573 LYS A CB  1 
ATOM   4341 C CG  . LYS A 1 573 ? 12.742  24.556 66.685 1.00 28.49 ? 573 LYS A CG  1 
ATOM   4342 C CD  . LYS A 1 573 ? 12.714  24.126 68.136 1.00 26.79 ? 573 LYS A CD  1 
ATOM   4343 C CE  . LYS A 1 573 ? 11.795  22.936 68.332 1.00 25.80 ? 573 LYS A CE  1 
ATOM   4344 N NZ  . LYS A 1 573 ? 11.803  22.488 69.745 1.00 24.96 ? 573 LYS A NZ  1 
ATOM   4345 N N   . SER A 1 574 ? 15.889  27.137 64.667 1.00 27.97 ? 574 SER A N   1 
ATOM   4346 C CA  . SER A 1 574 ? 16.922  28.157 64.480 1.00 28.24 ? 574 SER A CA  1 
ATOM   4347 C C   . SER A 1 574 ? 18.023  27.632 63.555 1.00 28.27 ? 574 SER A C   1 
ATOM   4348 O O   . SER A 1 574 ? 18.235  26.422 63.447 1.00 27.94 ? 574 SER A O   1 
ATOM   4349 C CB  . SER A 1 574 ? 17.522  28.570 65.829 1.00 29.27 ? 574 SER A CB  1 
ATOM   4350 O OG  . SER A 1 574 ? 18.098  27.464 66.500 1.00 29.49 ? 574 SER A OG  1 
ATOM   4351 N N   . VAL A 1 575 ? 18.732  28.540 62.892 1.00 27.90 ? 575 VAL A N   1 
ATOM   4352 C CA  . VAL A 1 575 ? 19.783  28.137 61.967 1.00 27.41 ? 575 VAL A CA  1 
ATOM   4353 C C   . VAL A 1 575 ? 20.966  27.384 62.572 1.00 29.19 ? 575 VAL A C   1 
ATOM   4354 O O   . VAL A 1 575 ? 21.616  26.611 61.871 1.00 30.20 ? 575 VAL A O   1 
ATOM   4355 C CB  . VAL A 1 575 ? 20.324  29.341 61.163 1.00 24.93 ? 575 VAL A CB  1 
ATOM   4356 C CG1 . VAL A 1 575 ? 19.239  29.872 60.254 1.00 23.72 ? 575 VAL A CG1 1 
ATOM   4357 C CG2 . VAL A 1 575 ? 20.811  30.426 62.097 1.00 24.32 ? 575 VAL A CG2 1 
ATOM   4358 N N   . ASP A 1 576 ? 21.258  27.583 63.855 1.00 30.50 ? 576 ASP A N   1 
ATOM   4359 C CA  . ASP A 1 576 ? 22.389  26.868 64.434 1.00 31.69 ? 576 ASP A CA  1 
ATOM   4360 C C   . ASP A 1 576 ? 22.113  25.413 64.796 1.00 30.72 ? 576 ASP A C   1 
ATOM   4361 O O   . ASP A 1 576 ? 22.927  24.767 65.449 1.00 31.42 ? 576 ASP A O   1 
ATOM   4362 C CB  . ASP A 1 576 ? 22.966  27.607 65.641 1.00 34.34 ? 576 ASP A CB  1 
ATOM   4363 C CG  . ASP A 1 576 ? 21.908  28.172 66.533 1.00 38.03 ? 576 ASP A CG  1 
ATOM   4364 O OD1 . ASP A 1 576 ? 20.906  27.473 66.783 1.00 42.61 ? 576 ASP A OD1 1 
ATOM   4365 O OD2 . ASP A 1 576 ? 22.085  29.317 66.992 1.00 40.80 ? 576 ASP A OD2 1 
ATOM   4366 N N   . GLN A 1 577 ? 20.968  24.892 64.379 1.00 29.89 ? 577 GLN A N   1 
ATOM   4367 C CA  . GLN A 1 577 ? 20.665  23.485 64.619 1.00 28.59 ? 577 GLN A CA  1 
ATOM   4368 C C   . GLN A 1 577 ? 21.182  22.732 63.396 1.00 28.05 ? 577 GLN A C   1 
ATOM   4369 O O   . GLN A 1 577 ? 21.447  21.540 63.456 1.00 28.65 ? 577 GLN A O   1 
ATOM   4370 C CB  . GLN A 1 577 ? 19.158  23.239 64.715 1.00 27.12 ? 577 GLN A CB  1 
ATOM   4371 C CG  . GLN A 1 577 ? 18.463  23.812 65.920 1.00 25.64 ? 577 GLN A CG  1 
ATOM   4372 C CD  . GLN A 1 577 ? 16.984  23.465 65.930 1.00 26.31 ? 577 GLN A CD  1 
ATOM   4373 O OE1 . GLN A 1 577 ? 16.239  23.856 65.029 1.00 28.11 ? 577 GLN A OE1 1 
ATOM   4374 N NE2 . GLN A 1 577 ? 16.552  22.723 66.945 1.00 25.65 ? 577 GLN A NE2 1 
ATOM   4375 N N   . LEU A 1 578 ? 21.320  23.460 62.292 1.00 27.68 ? 578 LEU A N   1 
ATOM   4376 C CA  . LEU A 1 578 ? 21.757  22.915 61.009 1.00 27.81 ? 578 LEU A CA  1 
ATOM   4377 C C   . LEU A 1 578 ? 23.221  22.487 60.926 1.00 28.30 ? 578 LEU A C   1 
ATOM   4378 O O   . LEU A 1 578 ? 24.117  23.162 61.445 1.00 29.53 ? 578 LEU A O   1 
ATOM   4379 C CB  . LEU A 1 578 ? 21.462  23.937 59.908 1.00 26.94 ? 578 LEU A CB  1 
ATOM   4380 C CG  . LEU A 1 578 ? 20.004  24.408 59.836 1.00 25.77 ? 578 LEU A CG  1 
ATOM   4381 C CD1 . LEU A 1 578 ? 19.895  25.594 58.887 1.00 25.95 ? 578 LEU A CD1 1 
ATOM   4382 C CD2 . LEU A 1 578 ? 19.107  23.261 59.396 1.00 23.02 ? 578 LEU A CD2 1 
ATOM   4383 N N   . PRO A 1 579 ? 23.489  21.360 60.249 1.00 27.19 ? 579 PRO A N   1 
ATOM   4384 C CA  . PRO A 1 579 ? 22.534  20.476 59.570 1.00 27.96 ? 579 PRO A CA  1 
ATOM   4385 C C   . PRO A 1 579 ? 21.571  19.835 60.559 1.00 28.42 ? 579 PRO A C   1 
ATOM   4386 O O   . PRO A 1 579 ? 21.829  19.826 61.757 1.00 30.15 ? 579 PRO A O   1 
ATOM   4387 C CB  . PRO A 1 579 ? 23.427  19.414 58.935 1.00 27.01 ? 579 PRO A CB  1 
ATOM   4388 C CG  . PRO A 1 579 ? 24.766  20.057 58.855 1.00 26.95 ? 579 PRO A CG  1 
ATOM   4389 C CD  . PRO A 1 579 ? 24.856  20.842 60.115 1.00 26.29 ? 579 PRO A CD  1 
ATOM   4390 N N   . MET A 1 580 ? 20.473  19.293 60.049 1.00 27.93 ? 580 MET A N   1 
ATOM   4391 C CA  . MET A 1 580 ? 19.476  18.611 60.871 1.00 28.57 ? 580 MET A CA  1 
ATOM   4392 C C   . MET A 1 580 ? 18.411  18.052 59.946 1.00 28.33 ? 580 MET A C   1 
ATOM   4393 O O   . MET A 1 580 ? 17.531  18.779 59.488 1.00 27.36 ? 580 MET A O   1 
ATOM   4394 C CB  . MET A 1 580 ? 18.831  19.562 61.893 1.00 29.05 ? 580 MET A CB  1 
ATOM   4395 C CG  . MET A 1 580 ? 17.812  18.866 62.799 1.00 30.27 ? 580 MET A CG  1 
ATOM   4396 S SD  . MET A 1 580 ? 17.189  19.836 64.206 1.00 35.60 ? 580 MET A SD  1 
ATOM   4397 C CE  . MET A 1 580 ? 15.657  20.454 63.543 1.00 34.55 ? 580 MET A CE  1 
ATOM   4398 N N   . ASN A 1 581 ? 18.506  16.758 59.662 1.00 29.33 ? 581 ASN A N   1 
ATOM   4399 C CA  . ASN A 1 581 ? 17.549  16.106 58.782 1.00 30.83 ? 581 ASN A CA  1 
ATOM   4400 C C   . ASN A 1 581 ? 16.859  14.955 59.489 1.00 31.74 ? 581 ASN A C   1 
ATOM   4401 O O   . ASN A 1 581 ? 17.308  14.500 60.539 1.00 31.74 ? 581 ASN A O   1 
ATOM   4402 C CB  . ASN A 1 581 ? 18.251  15.599 57.519 1.00 31.18 ? 581 ASN A CB  1 
ATOM   4403 C CG  . ASN A 1 581 ? 19.101  16.670 56.856 1.00 31.63 ? 581 ASN A CG  1 
ATOM   4404 O OD1 . ASN A 1 581 ? 20.192  16.978 57.320 1.00 32.94 ? 581 ASN A OD1 1 
ATOM   4405 N ND2 . ASN A 1 581 ? 18.595  17.252 55.775 1.00 32.00 ? 581 ASN A ND2 1 
ATOM   4406 N N   . VAL A 1 582 ? 15.755  14.493 58.912 1.00 34.13 ? 582 VAL A N   1 
ATOM   4407 C CA  . VAL A 1 582 ? 14.994  13.390 59.488 1.00 36.61 ? 582 VAL A CA  1 
ATOM   4408 C C   . VAL A 1 582 ? 15.919  12.208 59.734 1.00 37.85 ? 582 VAL A C   1 
ATOM   4409 O O   . VAL A 1 582 ? 16.779  11.897 58.903 1.00 39.16 ? 582 VAL A O   1 
ATOM   4410 C CB  . VAL A 1 582 ? 13.885  12.917 58.542 1.00 36.99 ? 582 VAL A CB  1 
ATOM   4411 C CG1 . VAL A 1 582 ? 12.811  12.195 59.327 1.00 36.56 ? 582 VAL A CG1 1 
ATOM   4412 C CG2 . VAL A 1 582 ? 13.318  14.089 57.784 1.00 38.80 ? 582 VAL A CG2 1 
ATOM   4413 N N   . GLY A 1 583 ? 15.739  11.548 60.871 1.00 38.11 ? 583 GLY A N   1 
ATOM   4414 C CA  . GLY A 1 583 ? 16.571  10.407 61.193 1.00 38.02 ? 583 GLY A CA  1 
ATOM   4415 C C   . GLY A 1 583 ? 17.839  10.806 61.919 1.00 38.82 ? 583 GLY A C   1 
ATOM   4416 O O   . GLY A 1 583 ? 18.679  9.959  62.204 1.00 39.29 ? 583 GLY A O   1 
ATOM   4417 N N   . ASP A 1 584 ? 17.983  12.096 62.210 1.00 39.76 ? 584 ASP A N   1 
ATOM   4418 C CA  . ASP A 1 584 ? 19.155  12.605 62.918 1.00 41.00 ? 584 ASP A CA  1 
ATOM   4419 C C   . ASP A 1 584 ? 19.048  12.335 64.410 1.00 42.52 ? 584 ASP A C   1 
ATOM   4420 O O   . ASP A 1 584 ? 17.961  12.084 64.926 1.00 42.23 ? 584 ASP A O   1 
ATOM   4421 C CB  . ASP A 1 584 ? 19.298  14.110 62.693 1.00 40.97 ? 584 ASP A CB  1 
ATOM   4422 C CG  . ASP A 1 584 ? 20.272  14.445 61.589 1.00 40.24 ? 584 ASP A CG  1 
ATOM   4423 O OD1 . ASP A 1 584 ? 20.553  13.559 60.749 1.00 39.92 ? 584 ASP A OD1 1 
ATOM   4424 O OD2 . ASP A 1 584 ? 20.747  15.600 61.560 1.00 38.29 ? 584 ASP A OD2 1 
ATOM   4425 N N   . ALA A 1 585 ? 20.181  12.404 65.099 1.00 45.41 ? 585 ALA A N   1 
ATOM   4426 C CA  . ALA A 1 585 ? 20.226  12.161 66.538 1.00 48.05 ? 585 ALA A CA  1 
ATOM   4427 C C   . ALA A 1 585 ? 19.587  13.290 67.351 1.00 49.45 ? 585 ALA A C   1 
ATOM   4428 O O   . ALA A 1 585 ? 18.795  13.039 68.261 1.00 49.39 ? 585 ALA A O   1 
ATOM   4429 C CB  . ALA A 1 585 ? 21.669  11.957 66.979 1.00 48.56 ? 585 ALA A CB  1 
ATOM   4430 N N   . HIS A 1 586 ? 19.936  14.531 67.030 1.00 50.87 ? 586 HIS A N   1 
ATOM   4431 C CA  . HIS A 1 586 ? 19.380  15.674 67.748 1.00 52.49 ? 586 HIS A CA  1 
ATOM   4432 C C   . HIS A 1 586 ? 18.171  16.254 67.007 1.00 50.70 ? 586 HIS A C   1 
ATOM   4433 O O   . HIS A 1 586 ? 17.997  17.474 66.959 1.00 52.84 ? 586 HIS A O   1 
ATOM   4434 C CB  . HIS A 1 586 ? 20.442  16.776 67.913 1.00 56.77 ? 586 HIS A CB  1 
ATOM   4435 C CG  . HIS A 1 586 ? 20.718  17.552 66.654 1.00 62.51 ? 586 HIS A CG  1 
ATOM   4436 N ND1 . HIS A 1 586 ? 20.925  18.918 66.651 1.00 63.29 ? 586 HIS A ND1 1 
ATOM   4437 C CD2 . HIS A 1 586 ? 20.814  17.156 65.360 1.00 63.38 ? 586 HIS A CD2 1 
ATOM   4438 C CE1 . HIS A 1 586 ? 21.134  19.328 65.412 1.00 63.36 ? 586 HIS A CE1 1 
ATOM   4439 N NE2 . HIS A 1 586 ? 21.073  18.279 64.610 1.00 63.93 ? 586 HIS A NE2 1 
ATOM   4440 N N   . TYR A 1 587 ? 17.327  15.398 66.438 1.00 45.55 ? 587 TYR A N   1 
ATOM   4441 C CA  . TYR A 1 587 ? 16.179  15.906 65.695 1.00 41.02 ? 587 TYR A CA  1 
ATOM   4442 C C   . TYR A 1 587 ? 15.183  16.685 66.557 1.00 38.19 ? 587 TYR A C   1 
ATOM   4443 O O   . TYR A 1 587 ? 14.350  16.106 67.251 1.00 37.70 ? 587 TYR A O   1 
ATOM   4444 C CB  . TYR A 1 587 ? 15.465  14.763 64.975 1.00 39.37 ? 587 TYR A CB  1 
ATOM   4445 C CG  . TYR A 1 587 ? 14.697  15.217 63.750 1.00 38.28 ? 587 TYR A CG  1 
ATOM   4446 C CD1 . TYR A 1 587 ? 15.336  15.916 62.721 1.00 37.67 ? 587 TYR A CD1 1 
ATOM   4447 C CD2 . TYR A 1 587 ? 13.338  14.934 63.608 1.00 36.46 ? 587 TYR A CD2 1 
ATOM   4448 C CE1 . TYR A 1 587 ? 14.639  16.323 61.580 1.00 37.10 ? 587 TYR A CE1 1 
ATOM   4449 C CE2 . TYR A 1 587 ? 12.632  15.331 62.473 1.00 36.20 ? 587 TYR A CE2 1 
ATOM   4450 C CZ  . TYR A 1 587 ? 13.286  16.026 61.462 1.00 36.65 ? 587 TYR A CZ  1 
ATOM   4451 O OH  . TYR A 1 587 ? 12.588  16.423 60.343 1.00 35.21 ? 587 TYR A OH  1 
ATOM   4452 N N   . ASP A 1 588 ? 15.275  18.008 66.502 1.00 34.67 ? 588 ASP A N   1 
ATOM   4453 C CA  . ASP A 1 588 ? 14.384  18.872 67.267 1.00 31.88 ? 588 ASP A CA  1 
ATOM   4454 C C   . ASP A 1 588 ? 13.823  19.938 66.326 1.00 30.30 ? 588 ASP A C   1 
ATOM   4455 O O   . ASP A 1 588 ? 14.129  21.121 66.451 1.00 28.72 ? 588 ASP A O   1 
ATOM   4456 C CB  . ASP A 1 588 ? 15.161  19.510 68.418 1.00 30.80 ? 588 ASP A CB  1 
ATOM   4457 C CG  . ASP A 1 588 ? 14.287  20.349 69.311 1.00 31.18 ? 588 ASP A CG  1 
ATOM   4458 O OD1 . ASP A 1 588 ? 13.078  20.047 69.400 1.00 31.69 ? 588 ASP A OD1 1 
ATOM   4459 O OD2 . ASP A 1 588 ? 14.809  21.299 69.930 1.00 31.36 ? 588 ASP A OD2 1 
ATOM   4460 N N   . PRO A 1 589 ? 12.979  19.518 65.372 1.00 30.09 ? 589 PRO A N   1 
ATOM   4461 C CA  . PRO A 1 589 ? 12.350  20.381 64.369 1.00 30.48 ? 589 PRO A CA  1 
ATOM   4462 C C   . PRO A 1 589 ? 11.159  21.190 64.838 1.00 30.57 ? 589 PRO A C   1 
ATOM   4463 O O   . PRO A 1 589 ? 10.479  20.801 65.785 1.00 32.36 ? 589 PRO A O   1 
ATOM   4464 C CB  . PRO A 1 589 ? 11.934  19.388 63.298 1.00 31.10 ? 589 PRO A CB  1 
ATOM   4465 C CG  . PRO A 1 589 ? 11.440  18.246 64.144 1.00 30.47 ? 589 PRO A CG  1 
ATOM   4466 C CD  . PRO A 1 589 ? 12.551  18.118 65.180 1.00 29.71 ? 589 PRO A CD  1 
ATOM   4467 N N   . LEU A 1 590 ? 10.918  22.317 64.166 1.00 29.66 ? 590 LEU A N   1 
ATOM   4468 C CA  . LEU A 1 590 ? 9.768   23.160 64.462 1.00 27.99 ? 590 LEU A CA  1 
ATOM   4469 C C   . LEU A 1 590 ? 8.602   22.403 63.826 1.00 28.03 ? 590 LEU A C   1 
ATOM   4470 O O   . LEU A 1 590 ? 7.499   22.364 64.364 1.00 26.47 ? 590 LEU A O   1 
ATOM   4471 C CB  . LEU A 1 590 ? 9.908   24.533 63.802 1.00 27.95 ? 590 LEU A CB  1 
ATOM   4472 C CG  . LEU A 1 590 ? 8.768   25.526 64.084 1.00 28.25 ? 590 LEU A CG  1 
ATOM   4473 C CD1 . LEU A 1 590 ? 8.849   25.993 65.528 1.00 25.43 ? 590 LEU A CD1 1 
ATOM   4474 C CD2 . LEU A 1 590 ? 8.866   26.722 63.151 1.00 28.50 ? 590 LEU A CD2 1 
ATOM   4475 N N   . PHE A 1 591 ? 8.879   21.800 62.671 1.00 27.82 ? 591 PHE A N   1 
ATOM   4476 C CA  . PHE A 1 591 ? 7.914   21.004 61.922 1.00 28.63 ? 591 PHE A CA  1 
ATOM   4477 C C   . PHE A 1 591 ? 8.669   19.814 61.342 1.00 31.18 ? 591 PHE A C   1 
ATOM   4478 O O   . PHE A 1 591 ? 9.623   19.992 60.585 1.00 32.04 ? 591 PHE A O   1 
ATOM   4479 C CB  . PHE A 1 591 ? 7.311   21.809 60.770 1.00 26.86 ? 591 PHE A CB  1 
ATOM   4480 C CG  . PHE A 1 591 ? 6.385   22.899 61.204 1.00 24.83 ? 591 PHE A CG  1 
ATOM   4481 C CD1 . PHE A 1 591 ? 5.157   22.598 61.786 1.00 25.41 ? 591 PHE A CD1 1 
ATOM   4482 C CD2 . PHE A 1 591 ? 6.731   24.231 61.022 1.00 23.56 ? 591 PHE A CD2 1 
ATOM   4483 C CE1 . PHE A 1 591 ? 4.285   23.612 62.182 1.00 23.43 ? 591 PHE A CE1 1 
ATOM   4484 C CE2 . PHE A 1 591 ? 5.870   25.250 61.412 1.00 24.20 ? 591 PHE A CE2 1 
ATOM   4485 C CZ  . PHE A 1 591 ? 4.643   24.940 61.993 1.00 23.29 ? 591 PHE A CZ  1 
ATOM   4486 N N   . ARG A 1 592 ? 8.251   18.602 61.696 1.00 33.09 ? 592 ARG A N   1 
ATOM   4487 C CA  . ARG A 1 592 ? 8.916   17.412 61.187 1.00 33.84 ? 592 ARG A CA  1 
ATOM   4488 C C   . ARG A 1 592 ? 8.740   17.351 59.686 1.00 31.85 ? 592 ARG A C   1 
ATOM   4489 O O   . ARG A 1 592 ? 7.836   17.977 59.133 1.00 30.69 ? 592 ARG A O   1 
ATOM   4490 C CB  . ARG A 1 592 ? 8.309   16.139 61.782 1.00 38.73 ? 592 ARG A CB  1 
ATOM   4491 C CG  . ARG A 1 592 ? 8.364   16.049 63.286 1.00 48.80 ? 592 ARG A CG  1 
ATOM   4492 C CD  . ARG A 1 592 ? 8.687   14.628 63.727 1.00 55.47 ? 592 ARG A CD  1 
ATOM   4493 N NE  . ARG A 1 592 ? 8.376   14.396 65.137 1.00 62.29 ? 592 ARG A NE  1 
ATOM   4494 C CZ  . ARG A 1 592 ? 7.142   14.409 65.645 1.00 65.72 ? 592 ARG A CZ  1 
ATOM   4495 N NH1 . ARG A 1 592 ? 6.096   14.647 64.857 1.00 66.06 ? 592 ARG A NH1 1 
ATOM   4496 N NH2 . ARG A 1 592 ? 6.948   14.169 66.939 1.00 67.16 ? 592 ARG A NH2 1 
ATOM   4497 N N   . LEU A 1 593 ? 9.611   16.600 59.023 1.00 28.85 ? 593 LEU A N   1 
ATOM   4498 C CA  . LEU A 1 593 ? 9.481   16.425 57.591 1.00 26.47 ? 593 LEU A CA  1 
ATOM   4499 C C   . LEU A 1 593 ? 8.191   15.620 57.448 1.00 25.71 ? 593 LEU A C   1 
ATOM   4500 O O   . LEU A 1 593 ? 7.913   14.747 58.264 1.00 25.10 ? 593 LEU A O   1 
ATOM   4501 C CB  . LEU A 1 593 ? 10.668  15.640 57.037 1.00 24.74 ? 593 LEU A CB  1 
ATOM   4502 C CG  . LEU A 1 593 ? 10.540  15.190 55.579 1.00 26.46 ? 593 LEU A CG  1 
ATOM   4503 C CD1 . LEU A 1 593 ? 11.919  15.079 54.965 1.00 26.44 ? 593 LEU A CD1 1 
ATOM   4504 C CD2 . LEU A 1 593 ? 9.786   13.868 55.493 1.00 22.71 ? 593 LEU A CD2 1 
ATOM   4505 N N   . GLY A 1 594 ? 7.397   15.925 56.430 1.00 24.91 ? 594 GLY A N   1 
ATOM   4506 C CA  . GLY A 1 594 ? 6.147   15.214 56.245 1.00 23.20 ? 594 GLY A CA  1 
ATOM   4507 C C   . GLY A 1 594 ? 4.968   15.947 56.864 1.00 23.30 ? 594 GLY A C   1 
ATOM   4508 O O   . GLY A 1 594 ? 3.822   15.548 56.679 1.00 21.73 ? 594 GLY A O   1 
ATOM   4509 N N   . TYR A 1 595 ? 5.243   17.023 57.596 1.00 24.49 ? 595 TYR A N   1 
ATOM   4510 C CA  . TYR A 1 595 ? 4.191   17.814 58.243 1.00 25.32 ? 595 TYR A CA  1 
ATOM   4511 C C   . TYR A 1 595 ? 3.329   18.602 57.260 1.00 24.62 ? 595 TYR A C   1 
ATOM   4512 O O   . TYR A 1 595 ? 3.817   19.105 56.244 1.00 23.67 ? 595 TYR A O   1 
ATOM   4513 C CB  . TYR A 1 595 ? 4.816   18.780 59.259 1.00 27.68 ? 595 TYR A CB  1 
ATOM   4514 C CG  . TYR A 1 595 ? 3.826   19.666 59.984 1.00 29.12 ? 595 TYR A CG  1 
ATOM   4515 C CD1 . TYR A 1 595 ? 3.343   20.839 59.400 1.00 30.77 ? 595 TYR A CD1 1 
ATOM   4516 C CD2 . TYR A 1 595 ? 3.355   19.320 61.247 1.00 29.93 ? 595 TYR A CD2 1 
ATOM   4517 C CE1 . TYR A 1 595 ? 2.414   21.642 60.058 1.00 31.16 ? 595 TYR A CE1 1 
ATOM   4518 C CE2 . TYR A 1 595 ? 2.429   20.113 61.913 1.00 30.75 ? 595 TYR A CE2 1 
ATOM   4519 C CZ  . TYR A 1 595 ? 1.961   21.270 61.316 1.00 32.86 ? 595 TYR A CZ  1 
ATOM   4520 O OH  . TYR A 1 595 ? 1.033   22.047 61.981 1.00 35.18 ? 595 TYR A OH  1 
ATOM   4521 N N   . GLY A 1 596 ? 2.041   18.707 57.570 1.00 24.99 ? 596 GLY A N   1 
ATOM   4522 C CA  . GLY A 1 596 ? 1.140   19.456 56.712 1.00 23.90 ? 596 GLY A CA  1 
ATOM   4523 C C   . GLY A 1 596 ? -0.309  19.430 57.156 1.00 24.07 ? 596 GLY A C   1 
ATOM   4524 O O   . GLY A 1 596 ? -0.923  18.367 57.217 1.00 25.37 ? 596 GLY A O   1 
ATOM   4525 N N   . LEU A 1 597 ? -0.866  20.591 57.479 1.00 22.19 ? 597 LEU A N   1 
ATOM   4526 C CA  . LEU A 1 597 ? -2.268  20.654 57.874 1.00 21.38 ? 597 LEU A CA  1 
ATOM   4527 C C   . LEU A 1 597 ? -3.103  20.504 56.606 1.00 21.87 ? 597 LEU A C   1 
ATOM   4528 O O   . LEU A 1 597 ? -2.654  20.868 55.521 1.00 22.67 ? 597 LEU A O   1 
ATOM   4529 C CB  . LEU A 1 597 ? -2.581  21.995 58.529 1.00 19.60 ? 597 LEU A CB  1 
ATOM   4530 C CG  . LEU A 1 597 ? -1.847  22.295 59.833 1.00 20.19 ? 597 LEU A CG  1 
ATOM   4531 C CD1 . LEU A 1 597 ? -2.259  23.670 60.341 1.00 18.72 ? 597 LEU A CD1 1 
ATOM   4532 C CD2 . LEU A 1 597 ? -2.162  21.221 60.851 1.00 17.21 ? 597 LEU A CD2 1 
ATOM   4533 N N   . THR A 1 598 ? -4.317  19.982 56.730 1.00 22.07 ? 598 THR A N   1 
ATOM   4534 C CA  . THR A 1 598 ? -5.159  19.811 55.548 1.00 22.94 ? 598 THR A CA  1 
ATOM   4535 C C   . THR A 1 598 ? -6.499  20.517 55.672 1.00 23.46 ? 598 THR A C   1 
ATOM   4536 O O   . THR A 1 598 ? -6.889  20.943 56.754 1.00 23.65 ? 598 THR A O   1 
ATOM   4537 C CB  . THR A 1 598 ? -5.446  18.323 55.270 1.00 21.20 ? 598 THR A CB  1 
ATOM   4538 O OG1 . THR A 1 598 ? -6.420  17.837 56.204 1.00 20.55 ? 598 THR A OG1 1 
ATOM   4539 C CG2 . THR A 1 598 ? -4.184  17.511 55.414 1.00 20.04 ? 598 THR A CG2 1 
ATOM   4540 N N   . THR A 1 599 ? -7.187  20.647 54.545 1.00 23.91 ? 599 THR A N   1 
ATOM   4541 C CA  . THR A 1 599 ? -8.510  21.260 54.492 1.00 26.50 ? 599 THR A CA  1 
ATOM   4542 C C   . THR A 1 599 ? -9.272  20.465 53.440 1.00 28.10 ? 599 THR A C   1 
ATOM   4543 O O   . THR A 1 599 ? -8.670  19.715 52.671 1.00 28.51 ? 599 THR A O   1 
ATOM   4544 C CB  . THR A 1 599 ? -8.470  22.758 54.054 1.00 26.85 ? 599 THR A CB  1 
ATOM   4545 O OG1 . THR A 1 599 ? -7.780  22.880 52.803 1.00 27.46 ? 599 THR A OG1 1 
ATOM   4546 C CG2 . THR A 1 599 ? -7.779  23.612 55.098 1.00 25.48 ? 599 THR A CG2 1 
ATOM   4547 N N   . ASN A 1 600 ? -10.592 20.603 53.418 1.00 30.16 ? 600 ASN A N   1 
ATOM   4548 C CA  . ASN A 1 600 ? -11.407 19.903 52.433 1.00 32.16 ? 600 ASN A CA  1 
ATOM   4549 C C   . ASN A 1 600 ? -12.076 20.952 51.559 1.00 33.24 ? 600 ASN A C   1 
ATOM   4550 O O   . ASN A 1 600 ? -12.510 21.997 52.053 1.00 32.65 ? 600 ASN A O   1 
ATOM   4551 C CB  . ASN A 1 600 ? -12.466 19.034 53.118 1.00 31.56 ? 600 ASN A CB  1 
ATOM   4552 C CG  . ASN A 1 600 ? -11.885 17.760 53.708 1.00 33.09 ? 600 ASN A CG  1 
ATOM   4553 O OD1 . ASN A 1 600 ? -12.149 17.429 54.867 1.00 33.23 ? 600 ASN A OD1 1 
ATOM   4554 N ND2 . ASN A 1 600 ? -11.101 17.030 52.909 1.00 32.70 ? 600 ASN A ND2 1 
ATOM   4555 N N   . ALA A 1 601 ? -12.141 20.682 50.259 1.00 34.16 ? 601 ALA A N   1 
ATOM   4556 C CA  . ALA A 1 601 ? -12.754 21.616 49.328 1.00 35.49 ? 601 ALA A CA  1 
ATOM   4557 C C   . ALA A 1 601 ? -14.157 21.997 49.798 1.00 37.23 ? 601 ALA A C   1 
ATOM   4558 O O   . ALA A 1 601 ? -14.909 21.153 50.295 1.00 36.60 ? 601 ALA A O   1 
ATOM   4559 C CB  . ALA A 1 601 ? -12.818 21.001 47.942 1.00 33.93 ? 601 ALA A CB  1 
ATOM   4560 N N   . THR A 1 602 ? -14.502 23.273 49.655 1.00 38.28 ? 602 THR A N   1 
ATOM   4561 C CA  . THR A 1 602 ? -15.823 23.738 50.047 1.00 40.01 ? 602 THR A CA  1 
ATOM   4562 C C   . THR A 1 602 ? -16.812 23.307 48.962 1.00 41.29 ? 602 THR A C   1 
ATOM   4563 O O   . THR A 1 602 ? -17.789 22.602 49.296 1.00 42.72 ? 602 THR A O   1 
ATOM   4564 C CB  . THR A 1 602 ? -15.876 25.279 50.184 1.00 39.73 ? 602 THR A CB  1 
ATOM   4565 O OG1 . THR A 1 602 ? -15.746 25.877 48.893 1.00 40.10 ? 602 THR A OG1 1 
ATOM   4566 C CG2 . THR A 1 602 ? -14.752 25.783 51.079 1.00 39.97 ? 602 THR A CG2 1 
HETATM 4567 C C1  . NAG B 2 .   ? 34.971  26.118 50.565 1.00 32.95 ? 1   NAG B C1  1 
HETATM 4568 C C2  . NAG B 2 .   ? 36.255  25.891 49.756 1.00 34.39 ? 1   NAG B C2  1 
HETATM 4569 C C3  . NAG B 2 .   ? 37.445  26.546 50.458 1.00 37.21 ? 1   NAG B C3  1 
HETATM 4570 C C4  . NAG B 2 .   ? 37.167  28.040 50.643 1.00 40.29 ? 1   NAG B C4  1 
HETATM 4571 C C5  . NAG B 2 .   ? 35.843  28.226 51.399 1.00 39.58 ? 1   NAG B C5  1 
HETATM 4572 C C6  . NAG B 2 .   ? 35.459  29.687 51.441 1.00 39.18 ? 1   NAG B C6  1 
HETATM 4573 C C7  . NAG B 2 .   ? 36.170  23.898 48.417 1.00 34.03 ? 1   NAG B C7  1 
HETATM 4574 C C8  . NAG B 2 .   ? 36.426  22.407 48.282 1.00 32.98 ? 1   NAG B C8  1 
HETATM 4575 N N2  . NAG B 2 .   ? 36.497  24.475 49.570 1.00 33.80 ? 1   NAG B N2  1 
HETATM 4576 O O3  . NAG B 2 .   ? 38.619  26.367 49.680 1.00 38.68 ? 1   NAG B O3  1 
HETATM 4577 O O4  . NAG B 2 .   ? 38.244  28.660 51.389 1.00 44.94 ? 1   NAG B O4  1 
HETATM 4578 O O5  . NAG B 2 .   ? 34.750  27.528 50.733 1.00 37.13 ? 1   NAG B O5  1 
HETATM 4579 O O6  . NAG B 2 .   ? 34.415  29.904 52.374 1.00 45.10 ? 1   NAG B O6  1 
HETATM 4580 O O7  . NAG B 2 .   ? 35.675  24.520 47.474 1.00 34.22 ? 1   NAG B O7  1 
HETATM 4581 C C1  . NAG B 2 .   ? 38.698  29.904 50.949 1.00 47.73 ? 2   NAG B C1  1 
HETATM 4582 C C2  . NAG B 2 .   ? 39.502  30.601 52.051 1.00 48.65 ? 2   NAG B C2  1 
HETATM 4583 C C3  . NAG B 2 .   ? 40.034  31.947 51.537 1.00 49.25 ? 2   NAG B C3  1 
HETATM 4584 C C4  . NAG B 2 .   ? 40.729  31.857 50.173 1.00 50.52 ? 2   NAG B C4  1 
HETATM 4585 C C5  . NAG B 2 .   ? 39.950  30.955 49.196 1.00 50.45 ? 2   NAG B C5  1 
HETATM 4586 C C6  . NAG B 2 .   ? 40.779  30.614 47.974 1.00 51.27 ? 2   NAG B C6  1 
HETATM 4587 C C7  . NAG B 2 .   ? 38.585  29.915 54.184 1.00 50.47 ? 2   NAG B C7  1 
HETATM 4588 C C8  . NAG B 2 .   ? 37.261  29.816 54.928 1.00 50.22 ? 2   NAG B C8  1 
HETATM 4589 N N2  . NAG B 2 .   ? 38.670  30.831 53.220 1.00 49.71 ? 2   NAG B N2  1 
HETATM 4590 O O3  . NAG B 2 .   ? 40.950  32.477 52.476 1.00 48.28 ? 2   NAG B O3  1 
HETATM 4591 O O4  . NAG B 2 .   ? 40.767  33.189 49.598 1.00 54.41 ? 2   NAG B O4  1 
HETATM 4592 O O5  . NAG B 2 .   ? 39.554  29.703 49.814 1.00 49.67 ? 2   NAG B O5  1 
HETATM 4593 O O6  . NAG B 2 .   ? 40.416  29.350 47.436 1.00 52.53 ? 2   NAG B O6  1 
HETATM 4594 O O7  . NAG B 2 .   ? 39.517  29.161 54.485 1.00 50.44 ? 2   NAG B O7  1 
HETATM 4595 C C1  . BMA B 2 .   ? 41.887  34.036 49.621 1.00 56.56 ? 3   BMA B C1  1 
HETATM 4596 C C2  . BMA B 2 .   ? 43.160  33.346 50.172 1.00 57.68 ? 3   BMA B C2  1 
HETATM 4597 C C3  . BMA B 2 .   ? 44.354  34.314 50.052 1.00 57.64 ? 3   BMA B C3  1 
HETATM 4598 C C4  . BMA B 2 .   ? 44.505  34.764 48.591 1.00 57.32 ? 3   BMA B C4  1 
HETATM 4599 C C5  . BMA B 2 .   ? 43.197  35.449 48.168 1.00 56.63 ? 3   BMA B C5  1 
HETATM 4600 C C6  . BMA B 2 .   ? 43.180  36.020 46.750 1.00 55.14 ? 3   BMA B C6  1 
HETATM 4601 O O2  . BMA B 2 .   ? 43.426  32.161 49.431 1.00 59.08 ? 3   BMA B O2  1 
HETATM 4602 O O3  . BMA B 2 .   ? 45.551  33.684 50.495 1.00 57.39 ? 3   BMA B O3  1 
HETATM 4603 O O4  . BMA B 2 .   ? 45.604  35.658 48.465 1.00 57.42 ? 3   BMA B O4  1 
HETATM 4604 O O5  . BMA B 2 .   ? 42.102  34.505 48.271 1.00 56.35 ? 3   BMA B O5  1 
HETATM 4605 O O6  . BMA B 2 .   ? 44.377  35.734 46.043 1.00 53.78 ? 3   BMA B O6  1 
HETATM 4606 C C1  . NAG C 3 .   ? 21.159  37.204 55.600 1.00 62.17 ? 1   NAG C C1  1 
HETATM 4607 C C2  . NAG C 3 .   ? 20.958  38.713 55.665 1.00 65.25 ? 1   NAG C C2  1 
HETATM 4608 C C3  . NAG C 3 .   ? 20.571  39.219 54.277 1.00 67.31 ? 1   NAG C C3  1 
HETATM 4609 C C4  . NAG C 3 .   ? 21.645  38.815 53.256 1.00 67.39 ? 1   NAG C C4  1 
HETATM 4610 C C5  . NAG C 3 .   ? 21.998  37.315 53.354 1.00 66.28 ? 1   NAG C C5  1 
HETATM 4611 C C6  . NAG C 3 .   ? 23.257  36.994 52.573 1.00 65.80 ? 1   NAG C C6  1 
HETATM 4612 C C7  . NAG C 3 .   ? 20.314  39.465 57.853 1.00 66.12 ? 1   NAG C C7  1 
HETATM 4613 C C8  . NAG C 3 .   ? 19.536  38.913 59.040 1.00 65.26 ? 1   NAG C C8  1 
HETATM 4614 N N2  . NAG C 3 .   ? 19.945  39.068 56.639 1.00 66.22 ? 1   NAG C N2  1 
HETATM 4615 O O3  . NAG C 3 .   ? 20.451  40.657 54.310 1.00 69.99 ? 1   NAG C O3  1 
HETATM 4616 O O4  . NAG C 3 .   ? 21.170  39.108 51.925 1.00 70.27 ? 1   NAG C O4  1 
HETATM 4617 O O5  . NAG C 3 .   ? 22.255  36.919 54.724 1.00 64.39 ? 1   NAG C O5  1 
HETATM 4618 O O6  . NAG C 3 .   ? 23.007  36.014 51.580 1.00 66.73 ? 1   NAG C O6  1 
HETATM 4619 O O7  . NAG C 3 .   ? 21.254  40.240 58.041 1.00 66.13 ? 1   NAG C O7  1 
HETATM 4620 C C1  . NAG C 3 .   ? 22.069  39.701 51.045 1.00 73.92 ? 2   NAG C C1  1 
HETATM 4621 C C2  . NAG C 3 .   ? 21.401  39.929 49.676 1.00 75.11 ? 2   NAG C C2  1 
HETATM 4622 C C3  . NAG C 3 .   ? 22.374  40.672 48.742 1.00 76.21 ? 2   NAG C C3  1 
HETATM 4623 C C4  . NAG C 3 .   ? 22.907  41.955 49.407 1.00 77.43 ? 2   NAG C C4  1 
HETATM 4624 C C5  . NAG C 3 .   ? 23.481  41.614 50.792 1.00 77.19 ? 2   NAG C C5  1 
HETATM 4625 C C6  . NAG C 3 .   ? 23.965  42.820 51.574 1.00 77.78 ? 2   NAG C C6  1 
HETATM 4626 C C7  . NAG C 3 .   ? 19.779  38.455 48.655 1.00 74.53 ? 2   NAG C C7  1 
HETATM 4627 C C8  . NAG C 3 .   ? 19.612  37.563 47.435 1.00 74.19 ? 2   NAG C C8  1 
HETATM 4628 N N2  . NAG C 3 .   ? 21.020  38.654 49.093 1.00 74.80 ? 2   NAG C N2  1 
HETATM 4629 O O3  . NAG C 3 .   ? 21.725  40.997 47.521 1.00 74.92 ? 2   NAG C O3  1 
HETATM 4630 O O4  . NAG C 3 .   ? 23.946  42.529 48.580 1.00 79.77 ? 2   NAG C O4  1 
HETATM 4631 O O5  . NAG C 3 .   ? 22.480  40.959 51.600 1.00 75.94 ? 2   NAG C O5  1 
HETATM 4632 O O6  . NAG C 3 .   ? 24.930  42.440 52.548 1.00 78.07 ? 2   NAG C O6  1 
HETATM 4633 O O7  . NAG C 3 .   ? 18.786  38.958 49.190 1.00 74.21 ? 2   NAG C O7  1 
HETATM 4634 C C1  . BMA C 3 .   ? 23.754  43.824 48.108 1.00 81.37 ? 3   BMA C C1  1 
HETATM 4635 C C2  . BMA C 3 .   ? 25.045  44.332 47.428 1.00 82.18 ? 3   BMA C C2  1 
HETATM 4636 C C3  . BMA C 3 .   ? 24.801  45.699 46.762 1.00 81.98 ? 3   BMA C C3  1 
HETATM 4637 C C4  . BMA C 3 .   ? 23.583  45.620 45.823 1.00 81.14 ? 3   BMA C C4  1 
HETATM 4638 C C5  . BMA C 3 .   ? 22.382  45.109 46.625 1.00 80.28 ? 3   BMA C C5  1 
HETATM 4639 C C6  . BMA C 3 .   ? 21.091  44.993 45.835 1.00 78.53 ? 3   BMA C C6  1 
HETATM 4640 O O2  . BMA C 3 .   ? 25.483  43.389 46.454 1.00 82.80 ? 3   BMA C O2  1 
HETATM 4641 O O3  . BMA C 3 .   ? 25.958  46.103 46.036 1.00 81.64 ? 3   BMA C O3  1 
HETATM 4642 O O4  . BMA C 3 .   ? 23.297  46.902 45.281 1.00 81.11 ? 3   BMA C O4  1 
HETATM 4643 O O5  . BMA C 3 .   ? 22.674  43.800 47.162 1.00 80.91 ? 3   BMA C O5  1 
HETATM 4644 O O6  . BMA C 3 .   ? 20.149  44.208 46.595 1.00 76.03 ? 3   BMA C O6  1 
HETATM 4645 C C1  . MAN C 3 .   ? 18.873  44.140 46.018 1.00 74.01 ? 4   MAN C C1  1 
HETATM 4646 C C2  . MAN C 3 .   ? 17.934  43.366 46.956 1.00 72.24 ? 4   MAN C C2  1 
HETATM 4647 C C3  . MAN C 3 .   ? 18.331  41.886 46.984 1.00 71.13 ? 4   MAN C C3  1 
HETATM 4648 C C4  . MAN C 3 .   ? 18.321  41.319 45.561 1.00 71.08 ? 4   MAN C C4  1 
HETATM 4649 C C5  . MAN C 3 .   ? 19.273  42.149 44.692 1.00 72.57 ? 4   MAN C C5  1 
HETATM 4650 C C6  . MAN C 3 .   ? 19.307  41.720 43.238 1.00 72.15 ? 4   MAN C C6  1 
HETATM 4651 O O2  . MAN C 3 .   ? 16.570  43.502 46.506 1.00 70.45 ? 4   MAN C O2  1 
HETATM 4652 O O3  . MAN C 3 .   ? 17.438  41.156 47.811 1.00 70.89 ? 4   MAN C O3  1 
HETATM 4653 O O4  . MAN C 3 .   ? 18.739  39.965 45.581 1.00 69.49 ? 4   MAN C O4  1 
HETATM 4654 O O5  . MAN C 3 .   ? 18.881  43.541 44.717 1.00 73.91 ? 4   MAN C O5  1 
HETATM 4655 O O6  . MAN C 3 .   ? 18.081  41.118 42.854 1.00 74.17 ? 4   MAN C O6  1 
HETATM 4656 C C1  . NAG C 3 .   ? 15.865  44.602 46.979 1.00 69.04 ? 5   NAG C C1  1 
HETATM 4657 C C2  . NAG C 3 .   ? 14.482  44.658 46.304 1.00 68.34 ? 5   NAG C C2  1 
HETATM 4658 C C3  . NAG C 3 .   ? 13.660  45.803 46.906 1.00 68.36 ? 5   NAG C C3  1 
HETATM 4659 C C4  . NAG C 3 .   ? 13.560  45.606 48.421 1.00 68.59 ? 5   NAG C C4  1 
HETATM 4660 C C5  . NAG C 3 .   ? 14.971  45.541 49.019 1.00 68.53 ? 5   NAG C C5  1 
HETATM 4661 C C6  . NAG C 3 .   ? 14.960  45.299 50.521 1.00 67.92 ? 5   NAG C C6  1 
HETATM 4662 C C7  . NAG C 3 .   ? 14.851  43.779 44.082 1.00 62.47 ? 5   NAG C C7  1 
HETATM 4663 C C8  . NAG C 3 .   ? 16.054  43.873 43.159 1.00 61.05 ? 5   NAG C C8  1 
HETATM 4664 N N2  . NAG C 3 .   ? 14.605  44.828 44.865 1.00 65.35 ? 5   NAG C N2  1 
HETATM 4665 O O3  . NAG C 3 .   ? 12.361  45.823 46.331 1.00 69.27 ? 5   NAG C O3  1 
HETATM 4666 O O4  . NAG C 3 .   ? 12.832  46.674 49.006 1.00 68.14 ? 5   NAG C O4  1 
HETATM 4667 O O5  . NAG C 3 .   ? 15.722  44.460 48.410 1.00 69.08 ? 5   NAG C O5  1 
HETATM 4668 O O6  . NAG C 3 .   ? 14.426  44.020 50.838 1.00 67.06 ? 5   NAG C O6  1 
HETATM 4669 O O7  . NAG C 3 .   ? 14.161  42.759 44.089 1.00 58.89 ? 5   NAG C O7  1 
HETATM 4670 C C1  . FUC C 3 .   ? 19.153  41.166 54.475 1.00 71.18 ? 6   FUC C C1  1 
HETATM 4671 C C2  . FUC C 3 .   ? 19.219  42.551 55.135 1.00 71.47 ? 6   FUC C C2  1 
HETATM 4672 C C3  . FUC C 3 .   ? 19.883  43.541 54.174 1.00 71.52 ? 6   FUC C C3  1 
HETATM 4673 C C4  . FUC C 3 .   ? 19.099  43.580 52.854 1.00 71.63 ? 6   FUC C C4  1 
HETATM 4674 C C5  . FUC C 3 .   ? 18.996  42.168 52.262 1.00 71.45 ? 6   FUC C C5  1 
HETATM 4675 C C6  . FUC C 3 .   ? 18.098  42.126 51.037 1.00 71.21 ? 6   FUC C C6  1 
HETATM 4676 O O2  . FUC C 3 .   ? 19.957  42.481 56.348 1.00 71.76 ? 6   FUC C O2  1 
HETATM 4677 O O3  . FUC C 3 .   ? 19.927  44.837 54.759 1.00 71.43 ? 6   FUC C O3  1 
HETATM 4678 O O4  . FUC C 3 .   ? 17.794  44.100 53.077 1.00 71.45 ? 6   FUC C O4  1 
HETATM 4679 O O5  . FUC C 3 .   ? 18.436  41.247 53.237 1.00 72.04 ? 6   FUC C O5  1 
HETATM 4680 C C2  . BGC D 4 .   ? 24.951  25.335 36.929 1.00 43.14 ? 619 BGC A C2  1 
HETATM 4681 C C3  . BGC D 4 .   ? 24.274  24.181 36.167 1.00 41.90 ? 619 BGC A C3  1 
HETATM 4682 C C4  . BGC D 4 .   ? 23.659  24.684 34.862 1.00 41.46 ? 619 BGC A C4  1 
HETATM 4683 C C5  . BGC D 4 .   ? 24.726  25.419 34.043 1.00 42.34 ? 619 BGC A C5  1 
HETATM 4684 C C6  . BGC D 4 .   ? 24.201  25.970 32.724 1.00 42.00 ? 619 BGC A C6  1 
HETATM 4685 C C1  . BGC D 4 .   ? 25.919  26.109 36.011 1.00 43.24 ? 619 BGC A C1  1 
HETATM 4686 O O1  . BGC D 4 .   ? 26.379  27.243 36.666 1.00 44.00 ? 619 BGC A O1  1 
HETATM 4687 O O2  . BGC D 4 .   ? 25.666  24.818 38.046 1.00 41.23 ? 619 BGC A O2  1 
HETATM 4688 O O3  . BGC D 4 .   ? 23.263  23.590 36.970 1.00 39.82 ? 619 BGC A O3  1 
HETATM 4689 O O4  . BGC D 4 .   ? 23.156  23.583 34.124 1.00 40.55 ? 619 BGC A O4  1 
HETATM 4690 O O5  . BGC D 4 .   ? 25.251  26.530 34.807 1.00 43.52 ? 619 BGC A O5  1 
HETATM 4691 O O6  . BGC D 4 .   ? 24.128  27.391 32.733 1.00 43.15 ? 619 BGC A O6  1 
HETATM 4692 O O   . HOH E 5 .   ? 27.370  26.596 41.338 1.00 8.01  ? 701 HOH A O   1 
HETATM 4693 O O   . HOH E 5 .   ? 2.915   27.969 38.153 1.00 14.39 ? 702 HOH A O   1 
HETATM 4694 O O   . HOH E 5 .   ? 24.912  29.590 33.812 1.00 19.27 ? 703 HOH A O   1 
HETATM 4695 O O   . HOH E 5 .   ? 10.319  21.573 34.441 1.00 3.27  ? 704 HOH A O   1 
HETATM 4696 O O   . HOH E 5 .   ? 20.053  27.970 30.790 1.00 7.00  ? 705 HOH A O   1 
HETATM 4697 O O   . HOH E 5 .   ? 15.179  27.769 29.601 1.00 19.23 ? 706 HOH A O   1 
HETATM 4698 O O   . HOH E 5 .   ? 32.578  17.011 15.046 1.00 19.02 ? 707 HOH A O   1 
HETATM 4699 O O   . HOH E 5 .   ? 7.673   28.770 51.631 1.00 21.30 ? 708 HOH A O   1 
HETATM 4700 O O   . HOH E 5 .   ? 12.126  34.437 24.620 1.00 23.05 ? 709 HOH A O   1 
HETATM 4701 O O   . HOH E 5 .   ? 16.394  31.454 33.392 1.00 16.94 ? 710 HOH A O   1 
HETATM 4702 O O   . HOH E 5 .   ? 19.731  24.488 37.140 1.00 22.39 ? 711 HOH A O   1 
HETATM 4703 O O   . HOH E 5 .   ? 10.732  22.313 39.061 1.00 12.33 ? 712 HOH A O   1 
HETATM 4704 O O   . HOH E 5 .   ? 7.405   26.260 29.819 1.00 23.39 ? 713 HOH A O   1 
HETATM 4705 O O   . HOH E 5 .   ? 13.477  23.465 40.189 1.00 11.46 ? 714 HOH A O   1 
HETATM 4706 O O   . HOH E 5 .   ? 12.274  35.533 38.780 1.00 22.43 ? 715 HOH A O   1 
HETATM 4707 O O   . HOH E 5 .   ? 34.793  19.336 40.524 1.00 12.01 ? 716 HOH A O   1 
HETATM 4708 O O   . HOH E 5 .   ? 29.856  20.865 13.550 1.00 19.53 ? 717 HOH A O   1 
HETATM 4709 O O   . HOH E 5 .   ? 11.496  18.829 38.048 1.00 18.64 ? 718 HOH A O   1 
HETATM 4710 O O   . HOH E 5 .   ? 8.228   25.352 44.463 1.00 21.86 ? 719 HOH A O   1 
HETATM 4711 O O   . HOH E 5 .   ? 9.042   28.597 39.848 1.00 32.33 ? 720 HOH A O   1 
HETATM 4712 O O   . HOH E 5 .   ? 28.098  18.461 15.974 1.00 12.56 ? 721 HOH A O   1 
HETATM 4713 O O   . HOH E 5 .   ? 11.909  36.475 36.247 1.00 15.38 ? 722 HOH A O   1 
HETATM 4714 O O   . HOH E 5 .   ? 20.564  5.892  31.346 1.00 31.85 ? 723 HOH A O   1 
HETATM 4715 O O   . HOH E 5 .   ? 4.583   32.565 30.761 1.00 24.88 ? 724 HOH A O   1 
HETATM 4716 O O   . HOH E 5 .   ? 11.655  34.985 45.040 1.00 22.51 ? 725 HOH A O   1 
HETATM 4717 O O   . HOH E 5 .   ? 16.207  16.876 43.854 1.00 14.54 ? 726 HOH A O   1 
HETATM 4718 O O   . HOH E 5 .   ? 9.967   20.841 36.911 1.00 8.25  ? 727 HOH A O   1 
HETATM 4719 O O   . HOH E 5 .   ? 37.954  20.856 16.611 1.00 13.75 ? 728 HOH A O   1 
HETATM 4720 O O   . HOH E 5 .   ? 13.401  20.207 36.494 1.00 15.11 ? 729 HOH A O   1 
HETATM 4721 O O   . HOH E 5 .   ? -7.460  34.252 68.437 1.00 36.71 ? 730 HOH A O   1 
HETATM 4722 O O   . HOH E 5 .   ? -0.007  17.704 47.582 1.00 18.38 ? 731 HOH A O   1 
HETATM 4723 O O   . HOH E 5 .   ? 15.179  31.965 43.833 1.00 19.62 ? 732 HOH A O   1 
HETATM 4724 O O   . HOH E 5 .   ? 11.043  21.357 17.378 1.00 24.88 ? 733 HOH A O   1 
HETATM 4725 O O   . HOH E 5 .   ? 29.331  18.512 12.668 1.00 18.08 ? 734 HOH A O   1 
HETATM 4726 O O   . HOH E 5 .   ? 20.868  37.088 36.302 1.00 16.92 ? 735 HOH A O   1 
HETATM 4727 O O   . HOH E 5 .   ? 42.812  25.792 35.503 1.00 13.11 ? 736 HOH A O   1 
HETATM 4728 O O   . HOH E 5 .   ? 47.856  22.197 20.325 1.00 23.08 ? 737 HOH A O   1 
HETATM 4729 O O   . HOH E 5 .   ? 22.517  34.162 18.952 1.00 17.59 ? 738 HOH A O   1 
HETATM 4730 O O   . HOH E 5 .   ? 6.010   43.223 52.454 1.00 23.54 ? 739 HOH A O   1 
HETATM 4731 O O   . HOH E 5 .   ? 31.642  17.311 12.199 1.00 14.02 ? 740 HOH A O   1 
HETATM 4732 O O   . HOH E 5 .   ? 12.475  20.233 33.712 1.00 12.26 ? 741 HOH A O   1 
HETATM 4733 O O   . HOH E 5 .   ? -1.730  21.717 49.036 1.00 26.20 ? 742 HOH A O   1 
HETATM 4734 O O   . HOH E 5 .   ? 16.230  22.713 39.499 1.00 22.37 ? 743 HOH A O   1 
HETATM 4735 O O   . HOH E 5 .   ? -14.916 41.495 42.825 1.00 14.27 ? 744 HOH A O   1 
HETATM 4736 O O   . HOH E 5 .   ? 26.440  24.367 42.165 1.00 18.79 ? 745 HOH A O   1 
HETATM 4737 O O   . HOH E 5 .   ? 20.464  36.550 33.495 1.00 18.90 ? 746 HOH A O   1 
HETATM 4738 O O   . HOH E 5 .   ? 32.901  17.035 9.570  1.00 26.60 ? 747 HOH A O   1 
HETATM 4739 O O   . HOH E 5 .   ? 15.060  23.927 50.303 1.00 42.13 ? 748 HOH A O   1 
HETATM 4740 O O   . HOH E 5 .   ? 19.401  9.908  14.561 1.00 24.00 ? 749 HOH A O   1 
HETATM 4741 O O   . HOH E 5 .   ? 20.156  27.959 42.716 1.00 26.44 ? 750 HOH A O   1 
HETATM 4742 O O   . HOH E 5 .   ? 30.638  16.518 45.820 1.00 30.96 ? 751 HOH A O   1 
HETATM 4743 O O   . HOH E 5 .   ? 15.643  20.265 38.012 1.00 11.49 ? 752 HOH A O   1 
HETATM 4744 O O   . HOH E 5 .   ? -8.623  24.591 51.079 1.00 23.38 ? 753 HOH A O   1 
HETATM 4745 O O   . HOH E 5 .   ? 13.618  33.237 45.830 1.00 16.58 ? 754 HOH A O   1 
HETATM 4746 O O   . HOH E 5 .   ? -1.512  33.073 33.761 1.00 15.03 ? 755 HOH A O   1 
HETATM 4747 O O   . HOH E 5 .   ? 17.349  27.512 48.528 1.00 16.07 ? 756 HOH A O   1 
HETATM 4748 O O   . HOH E 5 .   ? 12.028  28.945 62.110 1.00 27.37 ? 757 HOH A O   1 
HETATM 4749 O O   . HOH E 5 .   ? 25.231  21.158 49.311 1.00 21.43 ? 758 HOH A O   1 
HETATM 4750 O O   . HOH E 5 .   ? 3.196   42.696 45.711 1.00 23.50 ? 759 HOH A O   1 
HETATM 4751 O O   . HOH E 5 .   ? 36.346  25.142 30.349 1.00 22.22 ? 760 HOH A O   1 
HETATM 4752 O O   . HOH E 5 .   ? 23.490  15.888 46.432 1.00 22.09 ? 761 HOH A O   1 
HETATM 4753 O O   . HOH E 5 .   ? 27.373  22.514 45.694 1.00 21.07 ? 762 HOH A O   1 
HETATM 4754 O O   . HOH E 5 .   ? 34.618  23.168 32.031 1.00 37.57 ? 763 HOH A O   1 
HETATM 4755 O O   . HOH E 5 .   ? 5.579   25.742 45.026 1.00 18.56 ? 764 HOH A O   1 
HETATM 4756 O O   . HOH E 5 .   ? 12.510  35.257 58.408 1.00 21.22 ? 765 HOH A O   1 
HETATM 4757 O O   . HOH E 5 .   ? -2.910  31.042 37.199 1.00 22.57 ? 766 HOH A O   1 
HETATM 4758 O O   . HOH E 5 .   ? -7.008  32.569 64.289 1.00 21.66 ? 767 HOH A O   1 
HETATM 4759 O O   . HOH E 5 .   ? 34.055  20.525 6.940  1.00 20.62 ? 768 HOH A O   1 
HETATM 4760 O O   . HOH E 5 .   ? 13.571  8.356  29.739 1.00 28.65 ? 769 HOH A O   1 
HETATM 4761 O O   . HOH E 5 .   ? 22.820  15.060 42.432 1.00 23.36 ? 770 HOH A O   1 
HETATM 4762 O O   . HOH E 5 .   ? 6.569   10.346 28.438 1.00 22.16 ? 771 HOH A O   1 
HETATM 4763 O O   . HOH E 5 .   ? 9.839   40.320 52.134 1.00 18.66 ? 772 HOH A O   1 
HETATM 4764 O O   . HOH E 5 .   ? -0.383  21.369 53.397 1.00 27.09 ? 773 HOH A O   1 
HETATM 4765 O O   . HOH E 5 .   ? 4.527   41.223 38.505 1.00 13.51 ? 774 HOH A O   1 
HETATM 4766 O O   . HOH E 5 .   ? 16.288  36.929 29.317 1.00 25.25 ? 775 HOH A O   1 
HETATM 4767 O O   . HOH E 5 .   ? -8.111  30.494 42.250 1.00 13.22 ? 776 HOH A O   1 
HETATM 4768 O O   . HOH E 5 .   ? 7.585   43.854 45.143 1.00 30.67 ? 777 HOH A O   1 
HETATM 4769 O O   . HOH E 5 .   ? 8.217   32.425 30.973 1.00 21.57 ? 778 HOH A O   1 
HETATM 4770 O O   . HOH E 5 .   ? 23.234  21.341 51.335 1.00 25.09 ? 779 HOH A O   1 
HETATM 4771 O O   . HOH E 5 .   ? -10.879 30.608 70.157 1.00 27.61 ? 780 HOH A O   1 
HETATM 4772 O O   . HOH E 5 .   ? 21.590  31.509 14.763 1.00 17.66 ? 781 HOH A O   1 
HETATM 4773 O O   . HOH E 5 .   ? 27.949  21.901 43.007 1.00 16.37 ? 782 HOH A O   1 
HETATM 4774 O O   . HOH E 5 .   ? 14.128  36.031 28.070 1.00 8.87  ? 783 HOH A O   1 
HETATM 4775 O O   . HOH E 5 .   ? 14.017  35.860 25.544 1.00 19.83 ? 784 HOH A O   1 
HETATM 4776 O O   . HOH E 5 .   ? 15.900  19.129 16.212 1.00 21.69 ? 785 HOH A O   1 
HETATM 4777 O O   . HOH E 5 .   ? 2.351   37.448 43.066 1.00 26.11 ? 786 HOH A O   1 
HETATM 4778 O O   . HOH E 5 .   ? -8.224  32.507 40.403 1.00 17.95 ? 787 HOH A O   1 
HETATM 4779 O O   . HOH E 5 .   ? 24.042  13.636 44.767 1.00 14.85 ? 788 HOH A O   1 
HETATM 4780 O O   . HOH E 5 .   ? 35.184  29.821 28.756 1.00 26.21 ? 789 HOH A O   1 
HETATM 4781 O O   . HOH E 5 .   ? 19.711  20.690 57.517 1.00 25.71 ? 790 HOH A O   1 
HETATM 4782 O O   . HOH E 5 .   ? 15.908  16.173 17.110 1.00 20.98 ? 791 HOH A O   1 
HETATM 4783 O O   . HOH E 5 .   ? 48.762  20.916 25.235 1.00 20.91 ? 792 HOH A O   1 
HETATM 4784 O O   . HOH E 5 .   ? 12.177  38.104 27.721 1.00 16.18 ? 793 HOH A O   1 
HETATM 4785 O O   . HOH E 5 .   ? -14.044 31.600 41.806 1.00 24.27 ? 794 HOH A O   1 
HETATM 4786 O O   . HOH E 5 .   ? 39.504  17.537 10.051 1.00 22.63 ? 795 HOH A O   1 
HETATM 4787 O O   . HOH E 5 .   ? -5.351  27.645 34.740 1.00 20.48 ? 796 HOH A O   1 
HETATM 4788 O O   . HOH E 5 .   ? 15.993  21.985 16.577 1.00 33.46 ? 797 HOH A O   1 
HETATM 4789 O O   . HOH E 5 .   ? 27.692  21.648 39.927 1.00 30.76 ? 798 HOH A O   1 
HETATM 4790 O O   . HOH E 5 .   ? 35.113  22.101 39.599 1.00 30.22 ? 799 HOH A O   1 
HETATM 4791 O O   . HOH E 5 .   ? -9.674  32.478 62.361 1.00 20.76 ? 800 HOH A O   1 
HETATM 4792 O O   . HOH E 5 .   ? -11.946 33.290 61.478 1.00 36.04 ? 801 HOH A O   1 
HETATM 4793 O O   . HOH E 5 .   ? 22.031  33.767 16.218 1.00 13.30 ? 802 HOH A O   1 
HETATM 4794 O O   . HOH E 5 .   ? 14.960  20.709 49.195 1.00 32.15 ? 803 HOH A O   1 
HETATM 4795 O O   . HOH E 5 .   ? 11.228  39.415 30.016 1.00 24.31 ? 804 HOH A O   1 
HETATM 4796 O O   . HOH E 5 .   ? 5.615   38.400 65.459 1.00 21.22 ? 805 HOH A O   1 
HETATM 4797 O O   . HOH E 5 .   ? 18.011  31.160 63.501 1.00 11.29 ? 806 HOH A O   1 
HETATM 4798 O O   . HOH E 5 .   ? 15.736  36.826 17.568 1.00 23.01 ? 807 HOH A O   1 
HETATM 4799 O O   . HOH E 5 .   ? 15.414  21.621 56.076 1.00 33.50 ? 808 HOH A O   1 
HETATM 4800 O O   . HOH E 5 .   ? 10.207  18.619 16.876 1.00 23.74 ? 809 HOH A O   1 
HETATM 4801 O O   . HOH E 5 .   ? 17.485  19.628 56.501 1.00 38.64 ? 810 HOH A O   1 
HETATM 4802 O O   . HOH E 5 .   ? 17.152  39.312 55.971 1.00 48.06 ? 811 HOH A O   1 
HETATM 4803 O O   . HOH E 5 .   ? 34.800  23.782 41.851 1.00 23.64 ? 812 HOH A O   1 
HETATM 4804 O O   . HOH E 5 .   ? -4.413  38.167 63.420 1.00 20.25 ? 813 HOH A O   1 
HETATM 4805 O O   . HOH E 5 .   ? 12.433  18.331 14.894 1.00 18.40 ? 814 HOH A O   1 
HETATM 4806 O O   . HOH E 5 .   ? 14.518  18.175 11.304 1.00 27.53 ? 815 HOH A O   1 
HETATM 4807 O O   . HOH E 5 .   ? -18.376 32.320 49.425 1.00 8.54  ? 816 HOH A O   1 
HETATM 4808 O O   . HOH E 5 .   ? -11.088 39.918 60.901 1.00 32.13 ? 817 HOH A O   1 
HETATM 4809 O O   . HOH E 5 .   ? 19.855  9.938  46.036 1.00 22.87 ? 818 HOH A O   1 
HETATM 4810 O O   . HOH E 5 .   ? 22.234  0.703  36.214 1.00 26.46 ? 819 HOH A O   1 
HETATM 4811 O O   . HOH E 5 .   ? -12.627 33.374 37.235 1.00 19.84 ? 820 HOH A O   1 
HETATM 4812 O O   . HOH E 5 .   ? 13.789  20.766 17.775 1.00 23.74 ? 821 HOH A O   1 
HETATM 4813 O O   . HOH E 5 .   ? -10.244 31.587 38.622 1.00 38.76 ? 822 HOH A O   1 
HETATM 4814 O O   . HOH E 5 .   ? 20.800  11.768 44.115 1.00 18.52 ? 823 HOH A O   1 
HETATM 4815 O O   . HOH E 5 .   ? 17.808  22.781 14.820 1.00 34.99 ? 824 HOH A O   1 
HETATM 4816 O O   . HOH E 5 .   ? 29.715  2.052  30.792 1.00 23.11 ? 825 HOH A O   1 
HETATM 4817 O O   . HOH E 5 .   ? 37.511  28.269 30.001 1.00 28.69 ? 826 HOH A O   1 
HETATM 4818 O O   . HOH E 5 .   ? 34.941  22.379 45.518 1.00 16.03 ? 827 HOH A O   1 
HETATM 4819 O O   . HOH E 5 .   ? 34.349  26.243 42.453 1.00 10.24 ? 828 HOH A O   1 
HETATM 4820 O O   . HOH E 5 .   ? 24.783  19.972 53.270 1.00 34.60 ? 829 HOH A O   1 
HETATM 4821 O O   . HOH E 5 .   ? 40.271  30.652 24.340 1.00 32.01 ? 830 HOH A O   1 
HETATM 4822 O O   . HOH E 5 .   ? 28.148  14.614 5.200  1.00 22.91 ? 831 HOH A O   1 
HETATM 4823 O O   . HOH E 5 .   ? 47.224  10.210 22.501 1.00 21.23 ? 832 HOH A O   1 
HETATM 4824 O O   . HOH E 5 .   ? 23.969  0.077  30.189 1.00 24.04 ? 833 HOH A O   1 
HETATM 4825 O O   . HOH E 5 .   ? -16.645 30.494 48.736 1.00 16.01 ? 834 HOH A O   1 
HETATM 4826 O O   . HOH E 5 .   ? -10.418 29.565 36.832 1.00 41.00 ? 835 HOH A O   1 
HETATM 4827 O O   . HOH E 5 .   ? 38.107  30.745 21.822 1.00 37.18 ? 836 HOH A O   1 
HETATM 4828 O O   . HOH E 5 .   ? 42.558  16.337 12.670 1.00 21.37 ? 837 HOH A O   1 
HETATM 4829 O O   . HOH E 5 .   ? -17.627 36.779 53.883 1.00 31.38 ? 838 HOH A O   1 
HETATM 4830 O O   . HOH E 5 .   ? 6.134   32.471 20.852 1.00 26.90 ? 839 HOH A O   1 
HETATM 4831 O O   . HOH E 5 .   ? 42.133  20.660 16.503 1.00 43.36 ? 840 HOH A O   1 
HETATM 4832 O O   . HOH E 5 .   ? 10.930  27.266 68.682 1.00 32.17 ? 841 HOH A O   1 
HETATM 4833 O O   . HOH E 5 .   ? 36.601  19.258 6.479  1.00 25.25 ? 842 HOH A O   1 
HETATM 4834 O O   . HOH E 5 .   ? 1.507   50.724 50.227 1.00 17.86 ? 843 HOH A O   1 
HETATM 4835 O O   . HOH E 5 .   ? 32.607  26.800 47.821 1.00 31.06 ? 844 HOH A O   1 
HETATM 4836 O O   . HOH E 5 .   ? 18.393  11.465 52.298 1.00 17.21 ? 845 HOH A O   1 
HETATM 4837 O O   . HOH E 5 .   ? 16.196  36.745 49.872 1.00 28.90 ? 846 HOH A O   1 
HETATM 4838 O O   . HOH E 5 .   ? 15.050  40.854 42.363 1.00 42.98 ? 847 HOH A O   1 
HETATM 4839 O O   . HOH E 5 .   ? -4.655  19.601 46.697 1.00 23.90 ? 848 HOH A O   1 
HETATM 4840 O O   . HOH E 5 .   ? -5.357  23.360 41.307 1.00 34.81 ? 849 HOH A O   1 
HETATM 4841 O O   . HOH E 5 .   ? 32.011  4.302  -4.218 1.00 28.55 ? 850 HOH A O   1 
HETATM 4842 O O   . HOH E 5 .   ? 14.280  28.236 10.888 1.00 33.41 ? 851 HOH A O   1 
HETATM 4843 O O   . HOH E 5 .   ? 6.877   32.281 17.681 1.00 19.63 ? 852 HOH A O   1 
HETATM 4844 O O   . HOH E 5 .   ? 34.585  2.362  14.608 1.00 24.40 ? 853 HOH A O   1 
HETATM 4845 O O   . HOH E 5 .   ? 13.164  24.016 11.178 1.00 25.49 ? 854 HOH A O   1 
HETATM 4846 O O   . HOH E 5 .   ? -11.417 22.078 55.470 1.00 56.28 ? 855 HOH A O   1 
HETATM 4847 O O   . HOH E 5 .   ? 28.579  30.978 50.489 1.00 25.38 ? 856 HOH A O   1 
HETATM 4848 O O   . HOH E 5 .   ? -1.096  24.675 17.890 1.00 30.03 ? 857 HOH A O   1 
HETATM 4849 O O   . HOH E 5 .   ? 34.666  8.337  5.050  1.00 36.12 ? 858 HOH A O   1 
HETATM 4850 O O   . HOH E 5 .   ? 30.741  16.788 2.706  1.00 28.16 ? 859 HOH A O   1 
HETATM 4851 O O   . HOH E 5 .   ? 1.292   15.579 49.552 1.00 19.43 ? 860 HOH A O   1 
HETATM 4852 O O   . HOH E 5 .   ? 27.709  30.725 53.096 1.00 18.80 ? 861 HOH A O   1 
HETATM 4853 O O   . HOH E 5 .   ? 19.381  0.461  17.705 1.00 29.86 ? 862 HOH A O   1 
HETATM 4854 O O   . HOH E 5 .   ? -11.008 24.299 57.216 1.00 34.58 ? 863 HOH A O   1 
HETATM 4855 O O   . HOH E 5 .   ? -15.045 28.926 50.318 1.00 15.36 ? 864 HOH A O   1 
HETATM 4856 O O   . HOH E 5 .   ? 7.867   18.117 16.074 1.00 22.02 ? 865 HOH A O   1 
HETATM 4857 O O   . HOH E 5 .   ? 43.281  13.276 12.417 1.00 28.69 ? 866 HOH A O   1 
HETATM 4858 O O   . HOH E 5 .   ? -22.420 39.229 43.611 1.00 29.52 ? 867 HOH A O   1 
HETATM 4859 O O   . HOH E 5 .   ? 25.104  34.800 18.784 1.00 25.70 ? 868 HOH A O   1 
HETATM 4860 O O   . HOH E 5 .   ? 25.879  21.596 30.619 1.00 64.79 ? 869 HOH A O   1 
HETATM 4861 O O   . HOH E 5 .   ? -3.386  25.804 63.266 1.00 29.10 ? 870 HOH A O   1 
HETATM 4862 O O   . HOH E 5 .   ? 23.852  14.843 55.904 1.00 14.33 ? 871 HOH A O   1 
HETATM 4863 O O   . HOH E 5 .   ? 25.431  14.953 53.467 1.00 27.20 ? 872 HOH A O   1 
HETATM 4864 O O   . HOH E 5 .   ? 5.752   11.348 53.644 1.00 16.80 ? 873 HOH A O   1 
HETATM 4865 O O   . HOH E 5 .   ? 35.670  7.077  31.000 1.00 26.67 ? 874 HOH A O   1 
HETATM 4866 O O   . HOH E 5 .   ? 24.277  29.614 60.032 1.00 30.21 ? 875 HOH A O   1 
HETATM 4867 O O   . HOH E 5 .   ? 17.918  37.112 53.586 1.00 48.22 ? 876 HOH A O   1 
HETATM 4868 O O   . HOH E 5 .   ? -0.942  27.982 22.333 1.00 22.03 ? 877 HOH A O   1 
HETATM 4869 O O   . HOH E 5 .   ? 25.115  13.546 8.233  1.00 23.42 ? 878 HOH A O   1 
HETATM 4870 O O   . HOH E 5 .   ? -9.243  31.366 35.216 1.00 11.72 ? 879 HOH A O   1 
HETATM 4871 O O   . HOH E 5 .   ? 7.462   34.052 23.364 1.00 37.45 ? 880 HOH A O   1 
HETATM 4872 O O   . HOH E 5 .   ? 43.978  13.326 9.948  1.00 25.34 ? 881 HOH A O   1 
HETATM 4873 O O   . HOH E 5 .   ? 25.820  28.553 52.901 1.00 18.64 ? 882 HOH A O   1 
HETATM 4874 O O   . HOH E 5 .   ? -10.707 46.063 58.747 1.00 34.19 ? 883 HOH A O   1 
HETATM 4875 O O   . HOH E 5 .   ? 35.421  13.708 44.355 1.00 32.69 ? 884 HOH A O   1 
HETATM 4876 O O   . HOH E 5 .   ? 34.701  22.825 8.360  1.00 14.51 ? 885 HOH A O   1 
HETATM 4877 O O   . HOH E 5 .   ? -1.990  29.912 27.123 1.00 43.31 ? 886 HOH A O   1 
HETATM 4878 O O   . HOH E 5 .   ? 18.808  33.254 61.999 1.00 20.58 ? 887 HOH A O   1 
HETATM 4879 O O   . HOH E 5 .   ? 29.608  18.304 54.240 1.00 44.74 ? 888 HOH A O   1 
HETATM 4880 O O   . HOH E 5 .   ? 33.815  33.246 18.542 1.00 23.95 ? 889 HOH A O   1 
HETATM 4881 O O   . HOH E 5 .   ? -13.026 32.212 57.119 1.00 30.42 ? 890 HOH A O   1 
HETATM 4882 O O   . HOH E 5 .   ? 16.890  38.888 43.257 1.00 38.46 ? 891 HOH A O   1 
HETATM 4883 O O   . HOH E 5 .   ? 12.342  39.136 58.412 1.00 42.80 ? 892 HOH A O   1 
HETATM 4884 O O   . HOH E 5 .   ? 9.580   4.541  35.328 1.00 31.59 ? 893 HOH A O   1 
HETATM 4885 O O   . HOH E 5 .   ? -6.244  23.089 37.414 1.00 33.78 ? 894 HOH A O   1 
HETATM 4886 O O   . HOH E 5 .   ? 10.771  32.664 10.374 1.00 34.26 ? 895 HOH A O   1 
HETATM 4887 O O   . HOH E 5 .   ? -1.417  39.174 65.091 1.00 23.74 ? 896 HOH A O   1 
HETATM 4888 O O   . HOH E 5 .   ? 16.234  34.728 16.061 1.00 32.92 ? 897 HOH A O   1 
HETATM 4889 O O   . HOH E 5 .   ? -6.521  48.700 45.433 1.00 25.19 ? 898 HOH A O   1 
HETATM 4890 O O   . HOH E 5 .   ? 13.286  34.987 10.293 1.00 29.38 ? 899 HOH A O   1 
HETATM 4891 O O   . HOH E 5 .   ? 9.080   43.106 19.212 1.00 41.40 ? 900 HOH A O   1 
HETATM 4892 O O   . HOH E 5 .   ? -11.478 17.378 49.833 1.00 19.38 ? 901 HOH A O   1 
HETATM 4893 O O   . HOH E 5 .   ? 43.189  11.566 7.887  1.00 36.47 ? 902 HOH A O   1 
HETATM 4894 O O   . HOH E 5 .   ? 19.869  32.431 12.936 1.00 29.03 ? 903 HOH A O   1 
HETATM 4895 O O   . HOH E 5 .   ? 5.683   15.709 25.595 1.00 31.96 ? 904 HOH A O   1 
HETATM 4896 O O   . HOH E 5 .   ? 0.531   41.340 64.735 1.00 32.65 ? 905 HOH A O   1 
HETATM 4897 O O   . HOH E 5 .   ? 18.568  20.457 68.521 1.00 28.54 ? 906 HOH A O   1 
HETATM 4898 O O   . HOH E 5 .   ? -7.277  46.328 42.940 1.00 38.59 ? 907 HOH A O   1 
HETATM 4899 O O   . HOH E 5 .   ? -3.745  29.488 33.994 1.00 36.27 ? 908 HOH A O   1 
HETATM 4900 O O   . HOH E 5 .   ? 4.474   30.387 20.339 1.00 30.15 ? 909 HOH A O   1 
HETATM 4901 O O   . HOH E 5 .   ? -4.967  34.201 70.691 1.00 32.13 ? 910 HOH A O   1 
HETATM 4902 O O   . HOH E 5 .   ? 26.122  21.178 56.474 1.00 29.66 ? 911 HOH A O   1 
HETATM 4903 O O   . HOH E 5 .   ? 7.182   45.352 36.341 1.00 27.72 ? 912 HOH A O   1 
HETATM 4904 O O   . HOH E 5 .   ? 6.654   11.184 46.394 1.00 49.93 ? 913 HOH A O   1 
HETATM 4905 O O   . HOH E 5 .   ? -10.864 30.383 42.936 1.00 29.32 ? 914 HOH A O   1 
HETATM 4906 O O   . HOH E 5 .   ? -12.273 44.874 43.643 1.00 29.85 ? 915 HOH A O   1 
HETATM 4907 O O   . HOH E 5 .   ? 10.477  44.841 48.234 1.00 48.78 ? 916 HOH A O   1 
HETATM 4908 O O   . HOH E 5 .   ? 33.176  3.329  24.588 1.00 18.15 ? 917 HOH A O   1 
HETATM 4909 O O   . HOH E 5 .   ? 22.051  -0.262 18.403 1.00 22.85 ? 918 HOH A O   1 
HETATM 4910 O O   . HOH E 5 .   ? -12.594 40.721 41.627 1.00 28.08 ? 919 HOH A O   1 
HETATM 4911 O O   . HOH E 5 .   ? -13.048 31.612 59.795 1.00 25.07 ? 920 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  TRP 70  70  70  TRP TRP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 PRO 146 146 146 PRO CPR A . n 
A 1 147 CYS 147 147 147 CYS CYS A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 TRP 156 156 156 TRP TRP A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 MET 250 250 250 MET MET A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 TYR 253 253 253 TYR TYR A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 TRP 256 256 256 TRP TRP A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 PRO 295 295 295 PRO CPR A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 LYS 305 305 305 LYS LYS A . n 
A 1 306 ALA 306 306 306 ALA ALA A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 MET 314 314 314 MET MET A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 MET 316 316 316 MET MET A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 PRO 318 318 318 PRO CPR A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 TYR 321 321 321 TYR TYR A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 GLN 323 323 323 GLN GLN A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 PRO 338 338 338 PRO PRO A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 ILE 349 349 349 ILE ILE A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 ARG 351 351 351 ARG ARG A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 TYR 363 363 363 TYR TYR A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 PRO 366 366 366 PRO PRO A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 MET 368 368 368 MET MET A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 GLN 371 371 371 GLN GLN A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 GLY 373 373 373 GLY GLY A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 HIS 377 377 377 HIS HIS A . n 
A 1 378 ARG 378 378 378 ARG ARG A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ALA 381 381 381 ALA ALA A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 LYS 387 387 387 LYS LYS A . n 
A 1 388 SER 388 388 388 SER SER A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 LYS 393 393 393 LYS LYS A . n 
A 1 394 ASN 394 394 394 ASN ASN A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 ASP 400 400 400 ASP ASP A . n 
A 1 401 ALA 401 401 401 ALA ALA A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 PRO 405 405 405 PRO CPR A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 LYS 409 409 409 LYS LYS A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 PRO 411 411 411 PRO PRO A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 VAL 415 415 415 VAL VAL A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 HIS 419 419 419 HIS HIS A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 CYS 427 427 427 CYS CYS A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 GLY 429 429 429 GLY GLY A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 THR 431 431 431 THR THR A . n 
A 1 432 ILE 432 432 432 ILE ILE A . n 
A 1 433 GLU 433 433 433 GLU GLU A . n 
A 1 434 TRP 434 434 434 TRP TRP A . n 
A 1 435 GLN 435 435 435 GLN GLN A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 ARG 440 440 440 ARG ARG A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 THR 442 442 442 THR THR A . n 
A 1 443 VAL 443 443 443 VAL VAL A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 THR 445 445 445 THR THR A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 ILE 447 447 447 ILE ILE A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 ALA 453 453 453 ALA ALA A . n 
A 1 454 ALA 454 454 454 ALA ALA A . n 
A 1 455 VAL 455 455 455 VAL VAL A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 PRO 457 457 457 PRO PRO A . n 
A 1 458 SER 458 458 458 SER SER A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 VAL 461 461 461 VAL VAL A . n 
A 1 462 VAL 462 462 462 VAL VAL A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 ASN 466 466 466 ASN ASN A . n 
A 1 467 PRO 467 467 467 PRO PRO A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 GLU 470 470 470 GLU GLU A . n 
A 1 471 PHE 471 471 471 PHE PHE A . n 
A 1 472 VAL 472 472 472 VAL VAL A . n 
A 1 473 LYS 473 473 473 LYS LYS A . n 
A 1 474 SER 474 474 474 SER SER A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 GLY 476 476 476 GLY GLY A . n 
A 1 477 PHE 477 477 477 PHE PHE A . n 
A 1 478 SER 478 478 478 SER SER A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 ALA 480 480 480 ALA ALA A . n 
A 1 481 ILE 481 481 481 ILE ILE A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 ALA 483 483 483 ALA ALA A . n 
A 1 484 VAL 484 484 484 VAL VAL A . n 
A 1 485 GLY 485 485 485 GLY GLY A . n 
A 1 486 GLU 486 486 486 GLU GLU A . n 
A 1 487 HIS 487 487 487 HIS HIS A . n 
A 1 488 PRO 488 488 488 PRO PRO A . n 
A 1 489 TYR 489 489 489 TYR TYR A . n 
A 1 490 THR 490 490 490 THR THR A . n 
A 1 491 GLU 491 491 491 GLU GLU A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 GLY 494 494 494 GLY GLY A . n 
A 1 495 ASP 495 495 495 ASP ASP A . n 
A 1 496 ASN 496 496 496 ASN ASN A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 ASN 498 498 498 ASN ASN A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 THR 500 500 500 THR THR A . n 
A 1 501 ILE 501 501 501 ILE ILE A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 PRO 504 504 504 PRO CPR A . n 
A 1 505 GLY 505 505 505 GLY GLY A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 VAL 509 509 509 VAL VAL A . n 
A 1 510 GLN 510 510 510 GLN GLN A . n 
A 1 511 ALA 511 511 511 ALA ALA A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 CYS 513 513 513 CYS CYS A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 GLY 515 515 515 GLY GLY A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 CYS 518 518 518 CYS CYS A . n 
A 1 519 ALA 519 519 519 ALA ALA A . n 
A 1 520 THR 520 520 520 THR THR A . n 
A 1 521 VAL 521 521 521 VAL VAL A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 ILE 523 523 523 ILE ILE A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 GLY 525 525 525 GLY GLY A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 VAL 528 528 528 VAL VAL A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 VAL 530 530 530 VAL VAL A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 PRO 532 532 532 PRO PRO A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 LEU 534 534 534 LEU LEU A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 SER 537 537 537 SER SER A . n 
A 1 538 ASP 538 538 538 ASP ASP A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 TRP 544 544 544 TRP TRP A . n 
A 1 545 LEU 545 545 545 LEU LEU A . n 
A 1 546 PRO 546 546 546 PRO PRO A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 SER 548 548 548 SER SER A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 GLY 550 550 550 GLY GLY A . n 
A 1 551 GLN 551 551 551 GLN GLN A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 VAL 553 553 553 VAL VAL A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 ASP 555 555 555 ASP ASP A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LEU 557 557 557 LEU LEU A . n 
A 1 558 PHE 558 558 558 PHE PHE A . n 
A 1 559 GLY 559 559 559 GLY GLY A . n 
A 1 560 ASP 560 560 560 ASP ASP A . n 
A 1 561 PHE 561 561 561 PHE PHE A . n 
A 1 562 GLY 562 562 562 GLY GLY A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 GLY 565 565 565 GLY GLY A . n 
A 1 566 ARG 566 566 566 ARG ARG A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 ARG 569 569 569 ARG ARG A . n 
A 1 570 THR 570 570 570 THR THR A . n 
A 1 571 TRP 571 571 571 TRP TRP A . n 
A 1 572 PHE 572 572 572 PHE PHE A . n 
A 1 573 LYS 573 573 573 LYS LYS A . n 
A 1 574 SER 574 574 574 SER SER A . n 
A 1 575 VAL 575 575 575 VAL VAL A . n 
A 1 576 ASP 576 576 576 ASP ASP A . n 
A 1 577 GLN 577 577 577 GLN GLN A . n 
A 1 578 LEU 578 578 578 LEU LEU A . n 
A 1 579 PRO 579 579 579 PRO CPR A . n 
A 1 580 MET 580 580 580 MET MET A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 VAL 582 582 582 VAL VAL A . n 
A 1 583 GLY 583 583 583 GLY GLY A . n 
A 1 584 ASP 584 584 584 ASP ASP A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 HIS 586 586 586 HIS HIS A . n 
A 1 587 TYR 587 587 587 TYR TYR A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 PHE 591 591 591 PHE PHE A . n 
A 1 592 ARG 592 592 592 ARG ARG A . n 
A 1 593 LEU 593 593 593 LEU LEU A . n 
A 1 594 GLY 594 594 594 GLY GLY A . n 
A 1 595 TYR 595 595 595 TYR TYR A . n 
A 1 596 GLY 596 596 596 GLY GLY A . n 
A 1 597 LEU 597 597 597 LEU LEU A . n 
A 1 598 THR 598 598 598 THR THR A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASN 600 600 600 ASN ASN A . n 
A 1 601 ALA 601 601 601 ALA ALA A . n 
A 1 602 THR 602 602 602 THR THR A . n 
A 1 603 LYS 603 603 ?   ?   ?   A . n 
A 1 604 LYS 604 604 ?   ?   ?   A . n 
A 1 605 TYR 605 605 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 BGC 1   619 619 BGC BGC A . 
E 5 HOH 1   701 701 HOH WAT A . 
E 5 HOH 2   702 702 HOH WAT A . 
E 5 HOH 3   703 703 HOH WAT A . 
E 5 HOH 4   704 704 HOH WAT A . 
E 5 HOH 5   705 705 HOH WAT A . 
E 5 HOH 6   706 706 HOH WAT A . 
E 5 HOH 7   707 707 HOH WAT A . 
E 5 HOH 8   708 708 HOH WAT A . 
E 5 HOH 9   709 709 HOH WAT A . 
E 5 HOH 10  710 710 HOH WAT A . 
E 5 HOH 11  711 711 HOH WAT A . 
E 5 HOH 12  712 712 HOH WAT A . 
E 5 HOH 13  713 713 HOH WAT A . 
E 5 HOH 14  714 714 HOH WAT A . 
E 5 HOH 15  715 715 HOH WAT A . 
E 5 HOH 16  716 716 HOH WAT A . 
E 5 HOH 17  717 717 HOH WAT A . 
E 5 HOH 18  718 718 HOH WAT A . 
E 5 HOH 19  719 719 HOH WAT A . 
E 5 HOH 20  720 720 HOH WAT A . 
E 5 HOH 21  721 721 HOH WAT A . 
E 5 HOH 22  722 722 HOH WAT A . 
E 5 HOH 23  723 723 HOH WAT A . 
E 5 HOH 24  724 724 HOH WAT A . 
E 5 HOH 25  725 725 HOH WAT A . 
E 5 HOH 26  726 726 HOH WAT A . 
E 5 HOH 27  727 727 HOH WAT A . 
E 5 HOH 28  728 728 HOH WAT A . 
E 5 HOH 29  729 729 HOH WAT A . 
E 5 HOH 30  730 730 HOH WAT A . 
E 5 HOH 31  731 731 HOH WAT A . 
E 5 HOH 32  732 732 HOH WAT A . 
E 5 HOH 33  733 733 HOH WAT A . 
E 5 HOH 34  734 734 HOH WAT A . 
E 5 HOH 35  735 735 HOH WAT A . 
E 5 HOH 36  736 736 HOH WAT A . 
E 5 HOH 37  737 737 HOH WAT A . 
E 5 HOH 38  738 738 HOH WAT A . 
E 5 HOH 39  739 739 HOH WAT A . 
E 5 HOH 40  740 740 HOH WAT A . 
E 5 HOH 41  741 741 HOH WAT A . 
E 5 HOH 42  742 742 HOH WAT A . 
E 5 HOH 43  743 743 HOH WAT A . 
E 5 HOH 44  744 744 HOH WAT A . 
E 5 HOH 45  745 745 HOH WAT A . 
E 5 HOH 46  746 746 HOH WAT A . 
E 5 HOH 47  747 747 HOH WAT A . 
E 5 HOH 48  748 748 HOH WAT A . 
E 5 HOH 49  749 749 HOH WAT A . 
E 5 HOH 50  750 750 HOH WAT A . 
E 5 HOH 51  751 751 HOH WAT A . 
E 5 HOH 52  752 752 HOH WAT A . 
E 5 HOH 53  753 753 HOH WAT A . 
E 5 HOH 54  754 754 HOH WAT A . 
E 5 HOH 55  755 755 HOH WAT A . 
E 5 HOH 56  756 756 HOH WAT A . 
E 5 HOH 57  757 757 HOH WAT A . 
E 5 HOH 58  758 758 HOH WAT A . 
E 5 HOH 59  759 759 HOH WAT A . 
E 5 HOH 60  760 760 HOH WAT A . 
E 5 HOH 61  761 761 HOH WAT A . 
E 5 HOH 62  762 762 HOH WAT A . 
E 5 HOH 63  763 763 HOH WAT A . 
E 5 HOH 64  764 764 HOH WAT A . 
E 5 HOH 65  765 765 HOH WAT A . 
E 5 HOH 66  766 766 HOH WAT A . 
E 5 HOH 67  767 767 HOH WAT A . 
E 5 HOH 68  768 768 HOH WAT A . 
E 5 HOH 69  769 769 HOH WAT A . 
E 5 HOH 70  770 770 HOH WAT A . 
E 5 HOH 71  771 771 HOH WAT A . 
E 5 HOH 72  772 772 HOH WAT A . 
E 5 HOH 73  773 773 HOH WAT A . 
E 5 HOH 74  774 774 HOH WAT A . 
E 5 HOH 75  775 775 HOH WAT A . 
E 5 HOH 76  776 776 HOH WAT A . 
E 5 HOH 77  777 777 HOH WAT A . 
E 5 HOH 78  778 778 HOH WAT A . 
E 5 HOH 79  779 779 HOH WAT A . 
E 5 HOH 80  780 780 HOH WAT A . 
E 5 HOH 81  781 781 HOH WAT A . 
E 5 HOH 82  782 782 HOH WAT A . 
E 5 HOH 83  783 783 HOH WAT A . 
E 5 HOH 84  784 784 HOH WAT A . 
E 5 HOH 85  785 785 HOH WAT A . 
E 5 HOH 86  786 786 HOH WAT A . 
E 5 HOH 87  787 787 HOH WAT A . 
E 5 HOH 88  788 788 HOH WAT A . 
E 5 HOH 89  789 789 HOH WAT A . 
E 5 HOH 90  790 790 HOH WAT A . 
E 5 HOH 91  791 791 HOH WAT A . 
E 5 HOH 92  792 792 HOH WAT A . 
E 5 HOH 93  793 793 HOH WAT A . 
E 5 HOH 94  794 794 HOH WAT A . 
E 5 HOH 95  795 795 HOH WAT A . 
E 5 HOH 96  796 796 HOH WAT A . 
E 5 HOH 97  797 797 HOH WAT A . 
E 5 HOH 98  798 798 HOH WAT A . 
E 5 HOH 99  799 799 HOH WAT A . 
E 5 HOH 100 800 800 HOH WAT A . 
E 5 HOH 101 801 801 HOH WAT A . 
E 5 HOH 102 802 802 HOH WAT A . 
E 5 HOH 103 803 803 HOH WAT A . 
E 5 HOH 104 804 804 HOH WAT A . 
E 5 HOH 105 805 805 HOH WAT A . 
E 5 HOH 106 806 806 HOH WAT A . 
E 5 HOH 107 807 807 HOH WAT A . 
E 5 HOH 108 808 808 HOH WAT A . 
E 5 HOH 109 809 809 HOH WAT A . 
E 5 HOH 110 810 810 HOH WAT A . 
E 5 HOH 111 811 811 HOH WAT A . 
E 5 HOH 112 812 812 HOH WAT A . 
E 5 HOH 113 813 813 HOH WAT A . 
E 5 HOH 114 814 814 HOH WAT A . 
E 5 HOH 115 815 815 HOH WAT A . 
E 5 HOH 116 816 816 HOH WAT A . 
E 5 HOH 117 817 817 HOH WAT A . 
E 5 HOH 118 818 818 HOH WAT A . 
E 5 HOH 119 819 819 HOH WAT A . 
E 5 HOH 120 820 820 HOH WAT A . 
E 5 HOH 121 821 821 HOH WAT A . 
E 5 HOH 122 822 822 HOH WAT A . 
E 5 HOH 123 823 823 HOH WAT A . 
E 5 HOH 124 824 824 HOH WAT A . 
E 5 HOH 125 825 825 HOH WAT A . 
E 5 HOH 126 826 826 HOH WAT A . 
E 5 HOH 127 827 827 HOH WAT A . 
E 5 HOH 128 828 828 HOH WAT A . 
E 5 HOH 129 829 829 HOH WAT A . 
E 5 HOH 130 830 830 HOH WAT A . 
E 5 HOH 131 831 831 HOH WAT A . 
E 5 HOH 132 832 832 HOH WAT A . 
E 5 HOH 133 833 833 HOH WAT A . 
E 5 HOH 134 834 834 HOH WAT A . 
E 5 HOH 135 835 835 HOH WAT A . 
E 5 HOH 136 836 836 HOH WAT A . 
E 5 HOH 137 837 837 HOH WAT A . 
E 5 HOH 138 838 838 HOH WAT A . 
E 5 HOH 139 839 839 HOH WAT A . 
E 5 HOH 140 840 840 HOH WAT A . 
E 5 HOH 141 841 841 HOH WAT A . 
E 5 HOH 142 842 842 HOH WAT A . 
E 5 HOH 143 843 843 HOH WAT A . 
E 5 HOH 144 844 844 HOH WAT A . 
E 5 HOH 145 845 845 HOH WAT A . 
E 5 HOH 146 846 846 HOH WAT A . 
E 5 HOH 147 847 847 HOH WAT A . 
E 5 HOH 148 848 848 HOH WAT A . 
E 5 HOH 149 849 849 HOH WAT A . 
E 5 HOH 150 850 850 HOH WAT A . 
E 5 HOH 151 851 851 HOH WAT A . 
E 5 HOH 152 852 852 HOH WAT A . 
E 5 HOH 153 853 853 HOH WAT A . 
E 5 HOH 154 854 854 HOH WAT A . 
E 5 HOH 155 855 855 HOH WAT A . 
E 5 HOH 156 856 856 HOH WAT A . 
E 5 HOH 157 857 857 HOH WAT A . 
E 5 HOH 158 858 858 HOH WAT A . 
E 5 HOH 159 859 859 HOH WAT A . 
E 5 HOH 160 860 860 HOH WAT A . 
E 5 HOH 161 861 861 HOH WAT A . 
E 5 HOH 162 862 862 HOH WAT A . 
E 5 HOH 163 863 863 HOH WAT A . 
E 5 HOH 164 864 864 HOH WAT A . 
E 5 HOH 165 865 865 HOH WAT A . 
E 5 HOH 166 866 866 HOH WAT A . 
E 5 HOH 167 867 867 HOH WAT A . 
E 5 HOH 168 868 868 HOH WAT A . 
E 5 HOH 169 869 869 HOH WAT A . 
E 5 HOH 170 870 870 HOH WAT A . 
E 5 HOH 171 871 871 HOH WAT A . 
E 5 HOH 172 872 872 HOH WAT A . 
E 5 HOH 173 873 873 HOH WAT A . 
E 5 HOH 174 874 874 HOH WAT A . 
E 5 HOH 175 875 875 HOH WAT A . 
E 5 HOH 176 876 876 HOH WAT A . 
E 5 HOH 177 877 877 HOH WAT A . 
E 5 HOH 178 878 878 HOH WAT A . 
E 5 HOH 179 879 879 HOH WAT A . 
E 5 HOH 180 880 880 HOH WAT A . 
E 5 HOH 181 881 881 HOH WAT A . 
E 5 HOH 182 882 882 HOH WAT A . 
E 5 HOH 183 883 883 HOH WAT A . 
E 5 HOH 184 884 884 HOH WAT A . 
E 5 HOH 185 885 885 HOH WAT A . 
E 5 HOH 186 886 886 HOH WAT A . 
E 5 HOH 187 887 887 HOH WAT A . 
E 5 HOH 188 888 888 HOH WAT A . 
E 5 HOH 189 889 889 HOH WAT A . 
E 5 HOH 190 890 890 HOH WAT A . 
E 5 HOH 191 891 891 HOH WAT A . 
E 5 HOH 192 892 892 HOH WAT A . 
E 5 HOH 193 893 893 HOH WAT A . 
E 5 HOH 194 894 894 HOH WAT A . 
E 5 HOH 195 895 895 HOH WAT A . 
E 5 HOH 196 896 896 HOH WAT A . 
E 5 HOH 197 897 897 HOH WAT A . 
E 5 HOH 198 898 898 HOH WAT A . 
E 5 HOH 199 899 899 HOH WAT A . 
E 5 HOH 200 900 900 HOH WAT A . 
E 5 HOH 201 901 901 HOH WAT A . 
E 5 HOH 202 902 902 HOH WAT A . 
E 5 HOH 203 903 903 HOH WAT A . 
E 5 HOH 204 904 904 HOH WAT A . 
E 5 HOH 205 905 905 HOH WAT A . 
E 5 HOH 206 906 906 HOH WAT A . 
E 5 HOH 207 907 907 HOH WAT A . 
E 5 HOH 208 908 908 HOH WAT A . 
E 5 HOH 209 909 909 HOH WAT A . 
E 5 HOH 210 910 910 HOH WAT A . 
E 5 HOH 211 911 911 HOH WAT A . 
E 5 HOH 212 912 912 HOH WAT A . 
E 5 HOH 213 913 913 HOH WAT A . 
E 5 HOH 214 914 914 HOH WAT A . 
E 5 HOH 215 915 915 HOH WAT A . 
E 5 HOH 216 916 916 HOH WAT A . 
E 5 HOH 217 917 917 HOH WAT A . 
E 5 HOH 218 918 918 HOH WAT A . 
E 5 HOH 219 919 919 HOH WAT A . 
E 5 HOH 220 920 920 HOH WAT A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 221 A ASN 221 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 498 A ASN 498 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-14 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' struct_asym                   
14 4 'Structure model' struct_conn                   
15 4 'Structure model' struct_site                   
16 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 4 'Structure model' '_struct_conn.pdbx_dist_value'           
18 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
19 4 'Structure model' '_struct_conn.pdbx_role'                 
20 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
27 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;
SEQUENCE
The sequence in the GenBank entry might be
a sequencing error at residue 345.  The 
electron density unambiguously proved the 
presence of LYS instead of ASN at this residue.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              545 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              546 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              546 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.91 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.61 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 96  ? ? -102.69 77.29   
2  1 HIS A 98  ? ? -159.33 52.17   
3  1 PHE A 188 ? ? -2.08   126.42  
4  1 ASP A 216 ? ? 59.07   12.15   
5  1 ASN A 221 ? ? -82.04  -152.90 
6  1 TYR A 271 ? ? -96.30  -65.90  
7  1 TRP A 286 ? ? -52.01  102.62  
8  1 ASP A 299 ? ? -159.45 69.66   
9  1 ILE A 432 ? ? 68.96   -59.76  
10 1 GLU A 491 ? ? 43.38   -135.30 
11 1 TRP A 544 ? ? 55.67   -127.33 
12 1 MET A 580 ? ? -176.67 100.14  
13 1 HIS A 586 ? ? -95.67  39.35   
14 1 TYR A 587 ? ? -63.60  99.59   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 603 ? A LYS 603 
2 1 Y 1 A LYS 604 ? A LYS 604 
3 1 Y 1 A TYR 605 ? A TYR 605 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 ? NAG 610 n 
B 2 NAG 2 B NAG 2 ? NAG 611 n 
B 2 BMA 3 B BMA 3 ? MAN 612 n 
C 3 NAG 1 C NAG 1 ? NAG 613 n 
C 3 NAG 2 C NAG 2 ? NAG 614 n 
C 3 BMA 3 C BMA 3 ? MAN 615 n 
C 3 MAN 4 C MAN 4 ? MAN 617 n 
C 3 NAG 5 C NAG 5 ? NAG 618 n 
C 3 FUC 6 C FUC 6 ? FUC 616 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpb                         
BGC 'COMMON NAME'                         GMML     1.0 b-D-glucopyranose              
BGC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Glcp                       
BGC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                            
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}' LINUCS                      PDB-CARE   ?     
4 3 'DGlcpNAcb1-2DManpa1-6DManpb1-4DGlcpNAcb1-4[LFucpa1-3]DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML       1.0   
5 3 
'WURCS=2.0/4,6,5/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5][a1122h-1b_1-5][a1122h-1a_1-5]/1-2-1-3-4-1/a3-b1_a4-c1_c4-d1_d6-e1_e2-f1' 
WURCS                       PDB2Glycan 1.1.0 
6 3 
'[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][a-D-Manp]{[(2+1)][b-D-GlcpNAc]{}}}}}}'  
LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
4 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
5 3 4 MAN C1 O1 3 BMA O6 HO6 sing ? 
6 3 5 NAG C1 O1 4 MAN O2 HO2 sing ? 
7 3 6 FUC C1 O1 1 NAG O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 MAN 4 n 
3 NAG 5 n 
3 FUC 6 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 beta-D-glucopyranose BGC 
5 water                HOH 
#