data_1IEV
# 
_entry.id   1IEV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IEV         
RCSB  RCSB013217   
WWPDB D_1000013217 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EX1 'Three-dimensional structure of a barley beta-D-glucan exohydrolase, a family 3 glycosyl hydrolase.' unspecified 
PDB 1IEQ 'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1' unspecified 
PDB 1IEW 
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside' 
unspecified 
PDB 1IEX 
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose'   
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IEV 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hrmova, M.'     1 
'DeGori, R.'     2 
'Fincher, G.B.'  3 
'Varghese, J.N.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Catalytic mechanisms and reaction intermediates along the hydrolytic pathway of a plant beta-D-glucan glucohydrolase.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1005 
_citation.page_last                 1016 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11709165 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00673-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hrmova, M.'     1 ? 
primary 'Varghese, J.N.' 2 ? 
primary 'De Gori, R.'    3 ? 
primary 'Smith, B.J.'    4 ? 
primary 'Driguez, H.'    5 ? 
primary 'Fincher, G.B.'  6 ? 
# 
_cell.entry_id           1IEV 
_cell.length_a           101.01 
_cell.length_b           101.01 
_cell.length_c           181.55 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1IEV 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1' 65475.617 1   3.2.1.58 ? ? ? 
2 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-3)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1098.016  1   ?        ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?        ? ? ? 
4 non-polymer syn 1,2,3,4,5,6-HEXAHYDROXY-CYCLOHEXANE 180.156   1   ?        ? ? ? 
5 water       nat water 18.015    213 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETA-D-GLUCAN EXOHYDROLASE ISOENZYME EXOI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   TYR n 
1 3   VAL n 
1 4   LEU n 
1 5   TYR n 
1 6   LYS n 
1 7   ASP n 
1 8   ALA n 
1 9   THR n 
1 10  LYS n 
1 11  PRO n 
1 12  VAL n 
1 13  GLU n 
1 14  ASP n 
1 15  ARG n 
1 16  VAL n 
1 17  ALA n 
1 18  ASP n 
1 19  LEU n 
1 20  LEU n 
1 21  GLY n 
1 22  ARG n 
1 23  MET n 
1 24  THR n 
1 25  LEU n 
1 26  ALA n 
1 27  GLU n 
1 28  LYS n 
1 29  ILE n 
1 30  GLY n 
1 31  GLN n 
1 32  MET n 
1 33  THR n 
1 34  GLN n 
1 35  ILE n 
1 36  GLU n 
1 37  ARG n 
1 38  LEU n 
1 39  VAL n 
1 40  ALA n 
1 41  THR n 
1 42  PRO n 
1 43  ASP n 
1 44  VAL n 
1 45  LEU n 
1 46  ARG n 
1 47  ASP n 
1 48  ASN n 
1 49  PHE n 
1 50  ILE n 
1 51  GLY n 
1 52  SER n 
1 53  LEU n 
1 54  LEU n 
1 55  SER n 
1 56  GLY n 
1 57  GLY n 
1 58  GLY n 
1 59  SER n 
1 60  VAL n 
1 61  PRO n 
1 62  ARG n 
1 63  LYS n 
1 64  GLY n 
1 65  ALA n 
1 66  THR n 
1 67  ALA n 
1 68  LYS n 
1 69  GLU n 
1 70  TRP n 
1 71  GLN n 
1 72  ASP n 
1 73  MET n 
1 74  VAL n 
1 75  ASP n 
1 76  GLY n 
1 77  PHE n 
1 78  GLN n 
1 79  LYS n 
1 80  ALA n 
1 81  CYS n 
1 82  MET n 
1 83  SER n 
1 84  THR n 
1 85  ARG n 
1 86  LEU n 
1 87  GLY n 
1 88  ILE n 
1 89  PRO n 
1 90  MET n 
1 91  ILE n 
1 92  TYR n 
1 93  GLY n 
1 94  ILE n 
1 95  ASP n 
1 96  ALA n 
1 97  VAL n 
1 98  HIS n 
1 99  GLY n 
1 100 GLN n 
1 101 ASN n 
1 102 ASN n 
1 103 VAL n 
1 104 TYR n 
1 105 GLY n 
1 106 ALA n 
1 107 THR n 
1 108 ILE n 
1 109 PHE n 
1 110 PRO n 
1 111 HIS n 
1 112 ASN n 
1 113 VAL n 
1 114 GLY n 
1 115 LEU n 
1 116 GLY n 
1 117 ALA n 
1 118 THR n 
1 119 ARG n 
1 120 ASP n 
1 121 PRO n 
1 122 TYR n 
1 123 LEU n 
1 124 VAL n 
1 125 LYS n 
1 126 ARG n 
1 127 ILE n 
1 128 GLY n 
1 129 GLU n 
1 130 ALA n 
1 131 THR n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 VAL n 
1 136 ARG n 
1 137 ALA n 
1 138 THR n 
1 139 GLY n 
1 140 ILE n 
1 141 GLN n 
1 142 TYR n 
1 143 ALA n 
1 144 PHE n 
1 145 ALA n 
1 146 PRO n 
1 147 CYS n 
1 148 ILE n 
1 149 ALA n 
1 150 VAL n 
1 151 CYS n 
1 152 ARG n 
1 153 ASP n 
1 154 PRO n 
1 155 ARG n 
1 156 TRP n 
1 157 GLY n 
1 158 ARG n 
1 159 CYS n 
1 160 TYR n 
1 161 GLU n 
1 162 SER n 
1 163 TYR n 
1 164 SER n 
1 165 GLU n 
1 166 ASP n 
1 167 ARG n 
1 168 ARG n 
1 169 ILE n 
1 170 VAL n 
1 171 GLN n 
1 172 SER n 
1 173 MET n 
1 174 THR n 
1 175 GLU n 
1 176 LEU n 
1 177 ILE n 
1 178 PRO n 
1 179 GLY n 
1 180 LEU n 
1 181 GLN n 
1 182 GLY n 
1 183 ASP n 
1 184 VAL n 
1 185 PRO n 
1 186 LYS n 
1 187 ASP n 
1 188 PHE n 
1 189 THR n 
1 190 SER n 
1 191 GLY n 
1 192 MET n 
1 193 PRO n 
1 194 PHE n 
1 195 VAL n 
1 196 ALA n 
1 197 GLY n 
1 198 LYS n 
1 199 ASN n 
1 200 LYS n 
1 201 VAL n 
1 202 ALA n 
1 203 ALA n 
1 204 CYS n 
1 205 ALA n 
1 206 LYS n 
1 207 HIS n 
1 208 PHE n 
1 209 VAL n 
1 210 GLY n 
1 211 ASP n 
1 212 GLY n 
1 213 GLY n 
1 214 THR n 
1 215 VAL n 
1 216 ASP n 
1 217 GLY n 
1 218 ILE n 
1 219 ASN n 
1 220 GLU n 
1 221 ASN n 
1 222 ASN n 
1 223 THR n 
1 224 ILE n 
1 225 ILE n 
1 226 ASN n 
1 227 ARG n 
1 228 GLU n 
1 229 GLY n 
1 230 LEU n 
1 231 MET n 
1 232 ASN n 
1 233 ILE n 
1 234 HIS n 
1 235 MET n 
1 236 PRO n 
1 237 ALA n 
1 238 TYR n 
1 239 LYS n 
1 240 ASN n 
1 241 ALA n 
1 242 MET n 
1 243 ASP n 
1 244 LYS n 
1 245 GLY n 
1 246 VAL n 
1 247 SER n 
1 248 THR n 
1 249 VAL n 
1 250 MET n 
1 251 ILE n 
1 252 SER n 
1 253 TYR n 
1 254 SER n 
1 255 SER n 
1 256 TRP n 
1 257 ASN n 
1 258 GLY n 
1 259 VAL n 
1 260 LYS n 
1 261 MET n 
1 262 HIS n 
1 263 ALA n 
1 264 ASN n 
1 265 GLN n 
1 266 ASP n 
1 267 LEU n 
1 268 VAL n 
1 269 THR n 
1 270 GLY n 
1 271 TYR n 
1 272 LEU n 
1 273 LYS n 
1 274 ASP n 
1 275 THR n 
1 276 LEU n 
1 277 LYS n 
1 278 PHE n 
1 279 LYS n 
1 280 GLY n 
1 281 PHE n 
1 282 VAL n 
1 283 ILE n 
1 284 SER n 
1 285 ASP n 
1 286 TRP n 
1 287 GLU n 
1 288 GLY n 
1 289 ILE n 
1 290 ASP n 
1 291 ARG n 
1 292 ILE n 
1 293 THR n 
1 294 THR n 
1 295 PRO n 
1 296 ALA n 
1 297 GLY n 
1 298 SER n 
1 299 ASP n 
1 300 TYR n 
1 301 SER n 
1 302 TYR n 
1 303 SER n 
1 304 VAL n 
1 305 LYS n 
1 306 ALA n 
1 307 SER n 
1 308 ILE n 
1 309 LEU n 
1 310 ALA n 
1 311 GLY n 
1 312 LEU n 
1 313 ASP n 
1 314 MET n 
1 315 ILE n 
1 316 MET n 
1 317 VAL n 
1 318 PRO n 
1 319 ASN n 
1 320 LYS n 
1 321 TYR n 
1 322 GLN n 
1 323 GLN n 
1 324 PHE n 
1 325 ILE n 
1 326 SER n 
1 327 ILE n 
1 328 LEU n 
1 329 THR n 
1 330 GLY n 
1 331 HIS n 
1 332 VAL n 
1 333 ASN n 
1 334 GLY n 
1 335 GLY n 
1 336 VAL n 
1 337 ILE n 
1 338 PRO n 
1 339 MET n 
1 340 SER n 
1 341 ARG n 
1 342 ILE n 
1 343 ASP n 
1 344 ASP n 
1 345 ALA n 
1 346 VAL n 
1 347 THR n 
1 348 ARG n 
1 349 ILE n 
1 350 LEU n 
1 351 ARG n 
1 352 VAL n 
1 353 LYS n 
1 354 PHE n 
1 355 THR n 
1 356 MET n 
1 357 GLY n 
1 358 LEU n 
1 359 PHE n 
1 360 GLU n 
1 361 ASN n 
1 362 PRO n 
1 363 TYR n 
1 364 ALA n 
1 365 ASP n 
1 366 PRO n 
1 367 ALA n 
1 368 MET n 
1 369 ALA n 
1 370 GLU n 
1 371 GLN n 
1 372 LEU n 
1 373 GLY n 
1 374 LYS n 
1 375 GLN n 
1 376 GLU n 
1 377 HIS n 
1 378 ARG n 
1 379 ASP n 
1 380 LEU n 
1 381 ALA n 
1 382 ARG n 
1 383 GLU n 
1 384 ALA n 
1 385 ALA n 
1 386 ARG n 
1 387 LYS n 
1 388 SER n 
1 389 LEU n 
1 390 VAL n 
1 391 LEU n 
1 392 LEU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLY n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 THR n 
1 400 ASP n 
1 401 ALA n 
1 402 PRO n 
1 403 LEU n 
1 404 LEU n 
1 405 PRO n 
1 406 LEU n 
1 407 PRO n 
1 408 LYS n 
1 409 LYS n 
1 410 ALA n 
1 411 PRO n 
1 412 LYS n 
1 413 ILE n 
1 414 LEU n 
1 415 VAL n 
1 416 ALA n 
1 417 GLY n 
1 418 SER n 
1 419 HIS n 
1 420 ALA n 
1 421 ASP n 
1 422 ASN n 
1 423 LEU n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 CYS n 
1 428 GLY n 
1 429 GLY n 
1 430 TRP n 
1 431 THR n 
1 432 ILE n 
1 433 GLU n 
1 434 TRP n 
1 435 GLN n 
1 436 GLY n 
1 437 ASP n 
1 438 THR n 
1 439 GLY n 
1 440 ARG n 
1 441 THR n 
1 442 THR n 
1 443 VAL n 
1 444 GLY n 
1 445 THR n 
1 446 THR n 
1 447 ILE n 
1 448 LEU n 
1 449 GLU n 
1 450 ALA n 
1 451 VAL n 
1 452 LYS n 
1 453 ALA n 
1 454 ALA n 
1 455 VAL n 
1 456 ASP n 
1 457 PRO n 
1 458 SER n 
1 459 THR n 
1 460 VAL n 
1 461 VAL n 
1 462 VAL n 
1 463 PHE n 
1 464 ALA n 
1 465 GLU n 
1 466 ASN n 
1 467 PRO n 
1 468 ASP n 
1 469 ALA n 
1 470 GLU n 
1 471 PHE n 
1 472 VAL n 
1 473 LYS n 
1 474 SER n 
1 475 GLY n 
1 476 GLY n 
1 477 PHE n 
1 478 SER n 
1 479 TYR n 
1 480 ALA n 
1 481 ILE n 
1 482 VAL n 
1 483 ALA n 
1 484 VAL n 
1 485 GLY n 
1 486 GLU n 
1 487 HIS n 
1 488 PRO n 
1 489 TYR n 
1 490 THR n 
1 491 GLU n 
1 492 THR n 
1 493 LYS n 
1 494 GLY n 
1 495 ASP n 
1 496 ASN n 
1 497 LEU n 
1 498 ASN n 
1 499 LEU n 
1 500 THR n 
1 501 ILE n 
1 502 PRO n 
1 503 GLU n 
1 504 PRO n 
1 505 GLY n 
1 506 LEU n 
1 507 SER n 
1 508 THR n 
1 509 VAL n 
1 510 GLN n 
1 511 ALA n 
1 512 VAL n 
1 513 CYS n 
1 514 GLY n 
1 515 GLY n 
1 516 VAL n 
1 517 ARG n 
1 518 CYS n 
1 519 ALA n 
1 520 THR n 
1 521 VAL n 
1 522 LEU n 
1 523 ILE n 
1 524 SER n 
1 525 GLY n 
1 526 ARG n 
1 527 PRO n 
1 528 VAL n 
1 529 VAL n 
1 530 VAL n 
1 531 GLN n 
1 532 PRO n 
1 533 LEU n 
1 534 LEU n 
1 535 ALA n 
1 536 ALA n 
1 537 SER n 
1 538 ASP n 
1 539 ALA n 
1 540 LEU n 
1 541 VAL n 
1 542 ALA n 
1 543 ALA n 
1 544 TRP n 
1 545 LEU n 
1 546 PRO n 
1 547 GLY n 
1 548 SER n 
1 549 GLU n 
1 550 GLY n 
1 551 GLN n 
1 552 GLY n 
1 553 VAL n 
1 554 THR n 
1 555 ASP n 
1 556 ALA n 
1 557 LEU n 
1 558 PHE n 
1 559 GLY n 
1 560 ASP n 
1 561 PHE n 
1 562 GLY n 
1 563 PHE n 
1 564 THR n 
1 565 GLY n 
1 566 ARG n 
1 567 LEU n 
1 568 PRO n 
1 569 ARG n 
1 570 THR n 
1 571 TRP n 
1 572 PHE n 
1 573 LYS n 
1 574 SER n 
1 575 VAL n 
1 576 ASP n 
1 577 GLN n 
1 578 LEU n 
1 579 PRO n 
1 580 MET n 
1 581 ASN n 
1 582 VAL n 
1 583 GLY n 
1 584 ASP n 
1 585 ALA n 
1 586 HIS n 
1 587 TYR n 
1 588 ASP n 
1 589 PRO n 
1 590 LEU n 
1 591 PHE n 
1 592 ARG n 
1 593 LEU n 
1 594 GLY n 
1 595 TYR n 
1 596 GLY n 
1 597 LEU n 
1 598 THR n 
1 599 THR n 
1 600 ASN n 
1 601 ALA n 
1 602 THR n 
1 603 LYS n 
1 604 LYS n 
1 605 TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Hordeum vulgare' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      4513 
_entity_src_nat.genus                      Hordeum 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'CULTIVAR CLIPPER' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAD23382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNN
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_accession          4566505 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IEV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 605 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             4566505 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  630 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       605 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IEV 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      320 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             GB 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   4566505 
_struct_ref_seq_dif.db_mon_id                    ASN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          345 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            320 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?            'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?            'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ?            'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ?            'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ?            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?            'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?            'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?            'C6 H13 N O2'    131.173 
INS non-polymer                   . 1,2,3,4,5,6-HEXAHYDROXY-CYCLOHEXANE      MYO-INOSITOL 'C6 H12 O6'      180.156 
LEU 'L-peptide linking'           y LEUCINE                                  ?            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?            'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ?            'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ?            'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?            'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?            'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?            'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ?            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IEV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.53 
_exptl_crystal.density_percent_sol   65.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, PEG 400, sodium acetate, Hepes-NaOH, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-09-20 
_diffrn_detector.details                Monocapillary 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ELLIOTT GX-20' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1IEV 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             12.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   19994 
_reflns.number_all                   91211 
_reflns.percent_possible_obs         90.7 
_reflns.pdbx_Rmerge_I_obs            0.157 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.56 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.93 
_reflns_shell.percent_possible_all   50.8 
_reflns_shell.Rmerge_I_obs           0.497 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1IEV 
_refine.ls_number_reflns_obs                     18995 
_refine.ls_number_reflns_all                     19994 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             12.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  999 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EX1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IEV 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4566 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         99 
_refine_hist.number_atoms_solvent             213 
_refine_hist.number_atoms_total               4878 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        12.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.5  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1IEV 
_struct.title                     
'CRYSTAL STRUCTURE OF BARLEY BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1 IN COMPLEX WITH CYCLOHEXITOL' 
_struct.pdbx_descriptor           'BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1 (E.C.3.2.1.58)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IEV 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '2-domain fold, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The biological assembly is a monomer constructed from an (alpha/beta)8 barrel and an (alpha/beta)6 sandwich.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 3   ? ASP A 7   ? VAL A 3   ASP A 7   5 ? 5  
HELX_P HELX_P2  2  PRO A 11  ? GLY A 21  ? PRO A 11  GLY A 21  1 ? 11 
HELX_P HELX_P3  3  THR A 24  ? MET A 32  ? THR A 24  MET A 32  1 ? 9  
HELX_P HELX_P4  4  LEU A 38  ? ALA A 40  ? LEU A 38  ALA A 40  5 ? 3  
HELX_P HELX_P5  5  THR A 41  ? ASN A 48  ? THR A 41  ASN A 48  1 ? 8  
HELX_P HELX_P6  6  THR A 66  ? SER A 83  ? THR A 66  SER A 83  1 ? 18 
HELX_P HELX_P7  7  HIS A 111 ? ALA A 117 ? HIS A 111 ALA A 117 1 ? 7  
HELX_P HELX_P8  8  ASP A 120 ? ALA A 137 ? ASP A 120 ALA A 137 1 ? 18 
HELX_P HELX_P9  9  ARG A 158 ? SER A 162 ? ARG A 158 SER A 162 5 ? 5  
HELX_P HELX_P10 10 ASP A 166 ? THR A 174 ? ASP A 166 THR A 174 1 ? 9  
HELX_P HELX_P11 11 GLU A 175 ? GLY A 182 ? GLU A 175 GLY A 182 1 ? 8  
HELX_P HELX_P12 12 GLY A 210 ? THR A 214 ? GLY A 210 THR A 214 5 ? 5  
HELX_P HELX_P13 13 THR A 214 ? ILE A 218 ? THR A 214 ILE A 218 5 ? 5  
HELX_P HELX_P14 14 ASN A 226 ? HIS A 234 ? ASN A 226 HIS A 234 1 ? 9  
HELX_P HELX_P15 15 MET A 235 ? ASP A 243 ? MET A 235 ASP A 243 1 ? 9  
HELX_P HELX_P16 16 ASN A 264 ? THR A 269 ? ASN A 264 THR A 269 1 ? 6  
HELX_P HELX_P17 17 ILE A 289 ? THR A 293 ? ILE A 289 THR A 293 5 ? 5  
HELX_P HELX_P18 18 ASP A 299 ? GLY A 311 ? ASP A 299 GLY A 311 1 ? 13 
HELX_P HELX_P19 19 LYS A 320 ? GLY A 334 ? LYS A 320 GLY A 334 1 ? 15 
HELX_P HELX_P20 20 PRO A 338 ? MET A 356 ? PRO A 338 MET A 356 1 ? 19 
HELX_P HELX_P21 21 ASP A 365 ? LEU A 372 ? ASP A 365 LEU A 372 5 ? 8  
HELX_P HELX_P22 22 LYS A 374 ? LEU A 389 ? LYS A 374 LEU A 389 1 ? 16 
HELX_P HELX_P23 23 ASN A 422 ? GLY A 428 ? ASN A 422 GLY A 428 1 ? 7  
HELX_P HELX_P24 24 THR A 446 ? VAL A 455 ? THR A 446 VAL A 455 1 ? 10 
HELX_P HELX_P25 25 ASP A 468 ? SER A 474 ? ASP A 468 SER A 474 1 ? 7  
HELX_P HELX_P26 26 THR A 490 ? ASP A 495 ? THR A 490 ASP A 495 5 ? 6  
HELX_P HELX_P27 27 GLY A 505 ? VAL A 516 ? GLY A 505 VAL A 516 1 ? 12 
HELX_P HELX_P28 28 VAL A 530 ? SER A 537 ? VAL A 530 SER A 537 1 ? 8  
HELX_P HELX_P29 29 GLY A 550 ? PHE A 558 ? GLY A 550 PHE A 558 1 ? 9  
HELX_P HELX_P30 30 SER A 574 ? LEU A 578 ? SER A 574 LEU A 578 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 151 SG  ? ? ? 1_555 A CYS 159 SG ? ? A CYS 151 A CYS 159 1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf2 disulf ?    ? A CYS 513 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 513 A CYS 518 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1 covale one  ? A ASN 221 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 221 A NAG 610 1_555 ? ? ? ? ? ? ? 1.412 ? N-Glycosylation 
covale2 covale none ? A ASP 285 OD1 ? ? ? 1_555 D INS .   C1 ? ? A ASP 285 A INS 617 1_555 ? ? ? ? ? ? ? 1.329 ? ?               
covale3 covale one  ? A ASN 498 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 498 B NAG 1   1_555 ? ? ? ? ? ? ? 1.475 ? N-Glycosylation 
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.384 ? ?               
covale5 covale both ? B NAG .   O3  ? ? ? 1_555 B FUC .   C1 ? ? B NAG 1   B FUC 6   1_555 ? ? ? ? ? ? ? 1.486 ? ?               
covale6 covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale7 covale both ? B BMA .   O6  ? ? ? 1_555 B MAN .   C1 ? ? B BMA 3   B MAN 4   1_555 ? ? ? ? ? ? ? 1.407 ? ?               
covale8 covale both ? B MAN .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B MAN 4   B NAG 5   1_555 ? ? ? ? ? ? ? 1.686 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 145 A . ? ALA 145 A PRO 146 A ? PRO 146 A 1 10.80  
2 THR 294 A . ? THR 294 A PRO 295 A ? PRO 295 A 1 -5.56  
3 VAL 317 A . ? VAL 317 A PRO 318 A ? PRO 318 A 1 -12.38 
4 LEU 404 A . ? LEU 404 A PRO 405 A ? PRO 405 A 1 0.13   
5 GLU 503 A . ? GLU 503 A PRO 504 A ? PRO 504 A 1 2.95   
6 LEU 578 A . ? LEU 578 A PRO 579 A ? PRO 579 A 1 -3.69  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 3 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 142 ? ALA A 143 ? TYR A 142 ALA A 143 
A 2 ILE A 91  ? ILE A 94  ? ILE A 91  ILE A 94  
A 3 SER A 52  ? LEU A 54  ? SER A 52  LEU A 54  
A 4 THR A 33  ? GLU A 36  ? THR A 33  GLU A 36  
A 5 ILE A 315 ? MET A 316 ? ILE A 315 MET A 316 
B 1 CYS A 204 ? PHE A 208 ? CYS A 204 PHE A 208 
B 2 THR A 248 ? ILE A 251 ? THR A 248 ILE A 251 
B 3 PHE A 281 ? ILE A 283 ? PHE A 281 ILE A 283 
C 1 ASN A 222 ? THR A 223 ? ASN A 222 THR A 223 
C 2 SER A 255 ? TRP A 256 ? SER A 255 TRP A 256 
C 3 VAL A 259 ? LYS A 260 ? VAL A 259 LYS A 260 
D 1 VAL A 390 ? ASN A 394 ? VAL A 390 ASN A 394 
D 2 ALA A 539 ? ALA A 542 ? ALA A 539 ALA A 542 
D 3 CYS A 518 ? ILE A 523 ? CYS A 518 ILE A 523 
D 4 ALA A 480 ? GLY A 485 ? ALA A 480 GLY A 485 
D 5 LYS A 412 ? ALA A 416 ? LYS A 412 ALA A 416 
D 6 VAL A 460 ? ALA A 464 ? VAL A 460 ALA A 464 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 142 ? N TYR A 142 O TYR A 92  ? O TYR A 92  
A 2 3 N GLY A 93  ? N GLY A 93  O LEU A 53  ? O LEU A 53  
A 3 4 N SER A 52  ? N SER A 52  O THR A 33  ? O THR A 33  
A 4 5 N GLN A 34  ? N GLN A 34  O ILE A 315 ? O ILE A 315 
B 1 2 N ALA A 205 ? N ALA A 205 O THR A 248 ? O THR A 248 
B 2 3 N VAL A 249 ? N VAL A 249 O PHE A 281 ? O PHE A 281 
C 1 2 N THR A 223 ? N THR A 223 O SER A 255 ? O SER A 255 
C 2 3 N TRP A 256 ? N TRP A 256 O VAL A 259 ? O VAL A 259 
D 1 2 N LEU A 392 ? N LEU A 392 O LEU A 540 ? O LEU A 540 
D 2 3 N ALA A 539 ? N ALA A 539 O CYS A 518 ? O CYS A 518 
D 3 4 N ALA A 519 ? N ALA A 519 O ALA A 480 ? O ALA A 480 
D 4 5 N ILE A 481 ? N ILE A 481 O LEU A 414 ? O LEU A 414 
D 5 6 N ILE A 413 ? N ILE A 413 O VAL A 460 ? O VAL A 460 
# 
_database_PDB_matrix.entry_id          1IEV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IEV 
_atom_sites.fract_transf_matrix[1][1]   0.009900 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009900 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005508 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 30.714  5.324  -2.530 1.00 36.16 ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 29.888  4.197  -2.001 1.00 36.24 ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 29.041  4.500  -0.777 1.00 34.33 ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 29.106  5.589  -0.196 1.00 32.62 ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 30.742  2.978  -1.710 1.00 38.36 ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 31.625  3.146  -0.494 1.00 39.93 ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 31.866  4.275  0.003  1.00 41.46 ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 32.101  2.098  -0.032 1.00 42.57 ? 1   ASP A OD2 1 
ATOM   9    N N   . TYR A 1 2   ? 28.319  3.464  -0.356 1.00 32.80 ? 2   TYR A N   1 
ATOM   10   C CA  . TYR A 1 2   ? 27.368  3.510  0.760  1.00 30.53 ? 2   TYR A CA  1 
ATOM   11   C C   . TYR A 1 2   ? 27.936  3.888  2.077  1.00 30.18 ? 2   TYR A C   1 
ATOM   12   O O   . TYR A 1 2   ? 28.889  3.263  2.543  1.00 30.94 ? 2   TYR A O   1 
ATOM   13   C CB  . TYR A 1 2   ? 26.675  2.175  0.906  1.00 28.49 ? 2   TYR A CB  1 
ATOM   14   C CG  . TYR A 1 2   ? 25.845  1.999  2.163  1.00 25.97 ? 2   TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 2   ? 24.602  2.624  2.323  1.00 25.05 ? 2   TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 2   ? 26.246  1.097  3.139  1.00 25.03 ? 2   TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 2   ? 23.799  2.322  3.423  1.00 22.22 ? 2   TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 2   ? 25.452  0.806  4.220  1.00 22.34 ? 2   TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 2   ? 24.253  1.411  4.355  1.00 21.18 ? 2   TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 2   ? 23.557  1.093  5.469  1.00 20.57 ? 2   TYR A OH  1 
ATOM   21   N N   . VAL A 1 3   ? 27.271  4.854  2.710  1.00 29.36 ? 3   VAL A N   1 
ATOM   22   C CA  . VAL A 1 3   ? 27.693  5.375  4.014  1.00 27.78 ? 3   VAL A CA  1 
ATOM   23   C C   . VAL A 1 3   ? 26.715  4.887  5.096  1.00 25.81 ? 3   VAL A C   1 
ATOM   24   O O   . VAL A 1 3   ? 25.665  5.468  5.308  1.00 26.83 ? 3   VAL A O   1 
ATOM   25   C CB  . VAL A 1 3   ? 27.779  6.967  3.994  1.00 27.83 ? 3   VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 3   ? 28.196  7.534  5.344  1.00 27.65 ? 3   VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 3   ? 28.757  7.421  2.948  1.00 27.31 ? 3   VAL A CG2 1 
ATOM   28   N N   . LEU A 1 4   ? 27.066  3.803  5.765  1.00 23.53 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 26.239  3.228  6.816  1.00 20.38 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 25.765  4.215  7.883  1.00 19.94 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 24.642  4.081  8.349  1.00 21.37 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 27.021  2.113  7.484  1.00 19.12 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 26.602  1.102  8.555  1.00 18.58 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 25.589  1.572  9.482  1.00 20.31 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 26.082  -0.069 7.898  1.00 18.20 ? 4   LEU A CD2 1 
ATOM   36   N N   . TYR A 1 5   ? 26.569  5.205  8.276  1.00 18.01 ? 5   TYR A N   1 
ATOM   37   C CA  . TYR A 1 5   ? 26.121  6.104  9.345  1.00 15.58 ? 5   TYR A CA  1 
ATOM   38   C C   . TYR A 1 5   ? 24.979  7.035  8.940  1.00 15.82 ? 5   TYR A C   1 
ATOM   39   O O   . TYR A 1 5   ? 24.222  7.546  9.763  1.00 14.93 ? 5   TYR A O   1 
ATOM   40   C CB  . TYR A 1 5   ? 27.314  6.852  9.991  1.00 13.87 ? 5   TYR A CB  1 
ATOM   41   C CG  . TYR A 1 5   ? 27.727  8.163  9.353  1.00 12.91 ? 5   TYR A CG  1 
ATOM   42   C CD1 . TYR A 1 5   ? 27.049  9.337  9.636  1.00 11.67 ? 5   TYR A CD1 1 
ATOM   43   C CD2 . TYR A 1 5   ? 28.809  8.221  8.466  1.00 13.93 ? 5   TYR A CD2 1 
ATOM   44   C CE1 . TYR A 1 5   ? 27.424  10.528 9.059  1.00 12.60 ? 5   TYR A CE1 1 
ATOM   45   C CE2 . TYR A 1 5   ? 29.206  9.410  7.872  1.00 12.54 ? 5   TYR A CE2 1 
ATOM   46   C CZ  . TYR A 1 5   ? 28.506  10.562 8.173  1.00 13.59 ? 5   TYR A CZ  1 
ATOM   47   O OH  . TYR A 1 5   ? 28.886  11.751 7.579  1.00 14.00 ? 5   TYR A OH  1 
ATOM   48   N N   . LYS A 1 6   ? 24.840  7.238  7.650  1.00 16.78 ? 6   LYS A N   1 
ATOM   49   C CA  . LYS A 1 6   ? 23.792  8.105  7.165  1.00 17.18 ? 6   LYS A CA  1 
ATOM   50   C C   . LYS A 1 6   ? 22.500  7.359  6.957  1.00 17.42 ? 6   LYS A C   1 
ATOM   51   O O   . LYS A 1 6   ? 21.488  7.961  6.636  1.00 18.21 ? 6   LYS A O   1 
ATOM   52   C CB  . LYS A 1 6   ? 24.220  8.723  5.849  1.00 18.03 ? 6   LYS A CB  1 
ATOM   53   C CG  . LYS A 1 6   ? 25.090  9.928  5.996  1.00 19.04 ? 6   LYS A CG  1 
ATOM   54   C CD  . LYS A 1 6   ? 25.637  10.340 4.667  1.00 19.98 ? 6   LYS A CD  1 
ATOM   55   C CE  . LYS A 1 6   ? 26.790  11.296 4.871  1.00 22.04 ? 6   LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 6   ? 26.421  12.403 5.800  1.00 23.39 ? 6   LYS A NZ  1 
ATOM   57   N N   . ASP A 1 7   ? 22.547  6.040  7.082  1.00 18.38 ? 7   ASP A N   1 
ATOM   58   C CA  . ASP A 1 7   ? 21.380  5.177  6.891  1.00 18.75 ? 7   ASP A CA  1 
ATOM   59   C C   . ASP A 1 7   ? 20.541  5.135  8.174  1.00 19.13 ? 7   ASP A C   1 
ATOM   60   O O   . ASP A 1 7   ? 20.939  4.480  9.173  1.00 20.73 ? 7   ASP A O   1 
ATOM   61   C CB  . ASP A 1 7   ? 21.878  3.766  6.533  1.00 19.30 ? 7   ASP A CB  1 
ATOM   62   C CG  . ASP A 1 7   ? 20.752  2.785  6.198  1.00 21.68 ? 7   ASP A CG  1 
ATOM   63   O OD1 . ASP A 1 7   ? 19.535  3.066  6.390  1.00 21.32 ? 7   ASP A OD1 1 
ATOM   64   O OD2 . ASP A 1 7   ? 21.105  1.679  5.729  1.00 23.57 ? 7   ASP A OD2 1 
ATOM   65   N N   . ALA A 1 8   ? 19.371  5.774  8.143  1.00 16.26 ? 8   ALA A N   1 
ATOM   66   C CA  . ALA A 1 8   ? 18.509  5.760  9.310  1.00 17.17 ? 8   ALA A CA  1 
ATOM   67   C C   . ALA A 1 8   ? 17.936  4.396  9.703  1.00 19.42 ? 8   ALA A C   1 
ATOM   68   O O   . ALA A 1 8   ? 17.492  4.216  10.841 1.00 20.59 ? 8   ALA A O   1 
ATOM   69   C CB  . ALA A 1 8   ? 17.426  6.727  9.164  1.00 15.76 ? 8   ALA A CB  1 
ATOM   70   N N   . THR A 1 9   ? 18.012  3.410  8.820  1.00 22.13 ? 9   THR A N   1 
ATOM   71   C CA  . THR A 1 9   ? 17.488  2.083  9.142  1.00 22.89 ? 9   THR A CA  1 
ATOM   72   C C   . THR A 1 9   ? 18.442  1.161  9.923  1.00 24.72 ? 9   THR A C   1 
ATOM   73   O O   . THR A 1 9   ? 18.013  0.078  10.391 1.00 24.84 ? 9   THR A O   1 
ATOM   74   C CB  . THR A 1 9   ? 17.061  1.350  7.877  1.00 22.73 ? 9   THR A CB  1 
ATOM   75   O OG1 . THR A 1 9   ? 18.199  0.691  7.287  1.00 22.27 ? 9   THR A OG1 1 
ATOM   76   C CG2 . THR A 1 9   ? 16.456  2.352  6.894  1.00 21.40 ? 9   THR A CG2 1 
ATOM   77   N N   . LYS A 1 10  ? 19.703  1.582  10.083 1.00 24.12 ? 10  LYS A N   1 
ATOM   78   C CA  . LYS A 1 10  ? 20.710  0.778  10.782 1.00 24.39 ? 10  LYS A CA  1 
ATOM   79   C C   . LYS A 1 10  ? 20.667  0.892  12.285 1.00 23.81 ? 10  LYS A C   1 
ATOM   80   O O   . LYS A 1 10  ? 20.250  1.894  12.819 1.00 24.40 ? 10  LYS A O   1 
ATOM   81   C CB  . LYS A 1 10  ? 22.105  1.147  10.313 1.00 26.21 ? 10  LYS A CB  1 
ATOM   82   C CG  . LYS A 1 10  ? 22.187  1.250  8.825  1.00 28.88 ? 10  LYS A CG  1 
ATOM   83   C CD  . LYS A 1 10  ? 21.783  -0.054 8.188  1.00 29.80 ? 10  LYS A CD  1 
ATOM   84   C CE  . LYS A 1 10  ? 22.870  -1.068 8.349  1.00 31.96 ? 10  LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 10  ? 22.935  -1.964 7.151  1.00 34.63 ? 10  LYS A NZ  1 
ATOM   86   N N   . PRO A 1 11  ? 21.138  -0.136 12.992 1.00 24.61 ? 11  PRO A N   1 
ATOM   87   C CA  . PRO A 1 11  ? 21.381  -0.038 14.432 1.00 23.67 ? 11  PRO A CA  1 
ATOM   88   C C   . PRO A 1 11  ? 22.287  1.107  14.819 1.00 21.99 ? 11  PRO A C   1 
ATOM   89   O O   . PRO A 1 11  ? 23.273  1.369  14.160 1.00 22.81 ? 11  PRO A O   1 
ATOM   90   C CB  . PRO A 1 11  ? 22.053  -1.374 14.748 1.00 25.18 ? 11  PRO A CB  1 
ATOM   91   C CG  . PRO A 1 11  ? 21.379  -2.325 13.783 1.00 25.55 ? 11  PRO A CG  1 
ATOM   92   C CD  . PRO A 1 11  ? 21.398  -1.510 12.505 1.00 25.47 ? 11  PRO A CD  1 
ATOM   93   N N   . VAL A 1 12  ? 21.931  1.778  15.899 1.00 20.33 ? 12  VAL A N   1 
ATOM   94   C CA  . VAL A 1 12  ? 22.699  2.890  16.433 1.00 19.07 ? 12  VAL A CA  1 
ATOM   95   C C   . VAL A 1 12  ? 24.155  2.505  16.763 1.00 20.43 ? 12  VAL A C   1 
ATOM   96   O O   . VAL A 1 12  ? 25.029  3.393  16.832 1.00 20.89 ? 12  VAL A O   1 
ATOM   97   C CB  . VAL A 1 12  ? 22.025  3.446  17.737 1.00 17.75 ? 12  VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 12  ? 22.964  4.363  18.510 1.00 15.23 ? 12  VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 12  ? 20.727  4.184  17.401 1.00 17.63 ? 12  VAL A CG2 1 
ATOM   100  N N   . GLU A 1 13  ? 24.438  1.238  17.051 1.00 18.57 ? 13  GLU A N   1 
ATOM   101  C CA  . GLU A 1 13  ? 25.815  0.970  17.383 1.00 19.08 ? 13  GLU A CA  1 
ATOM   102  C C   . GLU A 1 13  ? 26.612  0.871  16.117 1.00 20.65 ? 13  GLU A C   1 
ATOM   103  O O   . GLU A 1 13  ? 27.795  1.202  16.101 1.00 23.68 ? 13  GLU A O   1 
ATOM   104  C CB  . GLU A 1 13  ? 25.992  -0.273 18.243 1.00 18.29 ? 13  GLU A CB  1 
ATOM   105  C CG  . GLU A 1 13  ? 25.528  -0.150 19.726 1.00 19.74 ? 13  GLU A CG  1 
ATOM   106  C CD  . GLU A 1 13  ? 26.163  1.001  20.559 1.00 20.45 ? 13  GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 13  ? 27.366  1.296  20.403 1.00 22.64 ? 13  GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 13  ? 25.448  1.612  21.388 1.00 20.79 ? 13  GLU A OE2 1 
ATOM   109  N N   . ASP A 1 14  ? 25.962  0.448  15.041 1.00 21.51 ? 14  ASP A N   1 
ATOM   110  C CA  . ASP A 1 14  ? 26.622  0.299  13.750 1.00 20.46 ? 14  ASP A CA  1 
ATOM   111  C C   . ASP A 1 14  ? 26.966  1.624  13.119 1.00 20.32 ? 14  ASP A C   1 
ATOM   112  O O   . ASP A 1 14  ? 27.977  1.746  12.409 1.00 20.79 ? 14  ASP A O   1 
ATOM   113  C CB  . ASP A 1 14  ? 25.701  -0.435 12.798 1.00 22.54 ? 14  ASP A CB  1 
ATOM   114  C CG  . ASP A 1 14  ? 25.347  -1.820 13.274 1.00 22.86 ? 14  ASP A CG  1 
ATOM   115  O OD1 . ASP A 1 14  ? 26.080  -2.400 14.063 1.00 24.95 ? 14  ASP A OD1 1 
ATOM   116  O OD2 . ASP A 1 14  ? 24.334  -2.352 12.839 1.00 25.61 ? 14  ASP A OD2 1 
ATOM   117  N N   . ARG A 1 15  ? 26.043  2.567  13.283 1.00 19.98 ? 15  ARG A N   1 
ATOM   118  C CA  . ARG A 1 15  ? 26.153  3.922  12.735 1.00 19.10 ? 15  ARG A CA  1 
ATOM   119  C C   . ARG A 1 15  ? 27.234  4.693  13.483 1.00 19.25 ? 15  ARG A C   1 
ATOM   120  O O   . ARG A 1 15  ? 27.992  5.457  12.887 1.00 20.38 ? 15  ARG A O   1 
ATOM   121  C CB  . ARG A 1 15  ? 24.793  4.669  12.828 1.00 17.31 ? 15  ARG A CB  1 
ATOM   122  C CG  . ARG A 1 15  ? 23.651  4.053  12.008 1.00 14.01 ? 15  ARG A CG  1 
ATOM   123  C CD  . ARG A 1 15  ? 22.359  4.852  12.104 1.00 13.46 ? 15  ARG A CD  1 
ATOM   124  N NE  . ARG A 1 15  ? 22.385  6.123  11.393 1.00 12.65 ? 15  ARG A NE  1 
ATOM   125  C CZ  . ARG A 1 15  ? 21.498  7.095  11.545 1.00 12.64 ? 15  ARG A CZ  1 
ATOM   126  N NH1 . ARG A 1 15  ? 20.494  6.976  12.398 1.00 10.43 ? 15  ARG A NH1 1 
ATOM   127  N NH2 . ARG A 1 15  ? 21.587  8.174  10.794 1.00 12.96 ? 15  ARG A NH2 1 
ATOM   128  N N   . VAL A 1 16  ? 27.301  4.460  14.793 1.00 18.49 ? 16  VAL A N   1 
ATOM   129  C CA  . VAL A 1 16  ? 28.258  5.115  15.670 1.00 17.47 ? 16  VAL A CA  1 
ATOM   130  C C   . VAL A 1 16  ? 29.607  4.607  15.301 1.00 16.85 ? 16  VAL A C   1 
ATOM   131  O O   . VAL A 1 16  ? 30.541  5.377  15.170 1.00 18.34 ? 16  VAL A O   1 
ATOM   132  C CB  . VAL A 1 16  ? 28.003  4.757  17.169 1.00 18.11 ? 16  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 16  ? 29.252  5.009  18.012 1.00 16.71 ? 16  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 16  ? 26.805  5.554  17.726 1.00 18.43 ? 16  VAL A CG2 1 
ATOM   135  N N   . ALA A 1 17  ? 29.705  3.298  15.143 1.00 15.10 ? 17  ALA A N   1 
ATOM   136  C CA  . ALA A 1 17  ? 30.970  2.713  14.808 1.00 14.56 ? 17  ALA A CA  1 
ATOM   137  C C   . ALA A 1 17  ? 31.451  3.171  13.451 1.00 15.83 ? 17  ALA A C   1 
ATOM   138  O O   . ALA A 1 17  ? 32.646  3.447  13.261 1.00 13.89 ? 17  ALA A O   1 
ATOM   139  C CB  . ALA A 1 17  ? 30.859  1.274  14.848 1.00 13.43 ? 17  ALA A CB  1 
ATOM   140  N N   . ASP A 1 18  ? 30.503  3.282  12.522 1.00 17.31 ? 18  ASP A N   1 
ATOM   141  C CA  . ASP A 1 18  ? 30.819  3.678  11.158 1.00 19.19 ? 18  ASP A CA  1 
ATOM   142  C C   . ASP A 1 18  ? 31.360  5.115  11.092 1.00 19.40 ? 18  ASP A C   1 
ATOM   143  O O   . ASP A 1 18  ? 32.405  5.384  10.498 1.00 18.91 ? 18  ASP A O   1 
ATOM   144  C CB  . ASP A 1 18  ? 29.578  3.499  10.282 1.00 20.86 ? 18  ASP A CB  1 
ATOM   145  C CG  . ASP A 1 18  ? 29.851  3.779  8.810  1.00 22.49 ? 18  ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 18  ? 29.508  4.870  8.322  1.00 25.30 ? 18  ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 18  ? 30.403  2.907  8.123  1.00 23.99 ? 18  ASP A OD2 1 
ATOM   148  N N   . LEU A 1 19  ? 30.638  6.024  11.725 1.00 19.13 ? 19  LEU A N   1 
ATOM   149  C CA  . LEU A 1 19  ? 30.997  7.409  11.744 1.00 18.82 ? 19  LEU A CA  1 
ATOM   150  C C   . LEU A 1 19  ? 32.314  7.598  12.442 1.00 19.66 ? 19  LEU A C   1 
ATOM   151  O O   . LEU A 1 19  ? 33.223  8.247  11.928 1.00 20.86 ? 19  LEU A O   1 
ATOM   152  C CB  . LEU A 1 19  ? 29.926  8.168  12.490 1.00 17.68 ? 19  LEU A CB  1 
ATOM   153  C CG  . LEU A 1 19  ? 30.107  9.672  12.559 1.00 17.34 ? 19  LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 19  ? 30.520  10.196 11.185 1.00 17.76 ? 19  LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 19  ? 28.801  10.353 13.061 1.00 17.53 ? 19  LEU A CD2 1 
ATOM   156  N N   . LEU A 1 20  ? 32.381  7.083  13.655 1.00 19.10 ? 20  LEU A N   1 
ATOM   157  C CA  . LEU A 1 20  ? 33.583  7.195  14.457 1.00 18.66 ? 20  LEU A CA  1 
ATOM   158  C C   . LEU A 1 20  ? 34.799  6.815  13.597 1.00 19.23 ? 20  LEU A C   1 
ATOM   159  O O   . LEU A 1 20  ? 35.843  7.488  13.607 1.00 21.83 ? 20  LEU A O   1 
ATOM   160  C CB  . LEU A 1 20  ? 33.481  6.264  15.686 1.00 15.80 ? 20  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 20  ? 34.659  6.374  16.639 1.00 14.21 ? 20  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 20  ? 34.777  7.836  17.113 1.00 12.77 ? 20  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 20  ? 34.551  5.379  17.772 1.00 12.46 ? 20  LEU A CD2 1 
ATOM   164  N N   . GLY A 1 21  ? 34.655  5.744  12.839 1.00 18.45 ? 21  GLY A N   1 
ATOM   165  C CA  . GLY A 1 21  ? 35.757  5.297  12.020 1.00 17.97 ? 21  GLY A CA  1 
ATOM   166  C C   . GLY A 1 21  ? 36.236  6.256  10.955 1.00 17.91 ? 21  GLY A C   1 
ATOM   167  O O   . GLY A 1 21  ? 37.354  6.105  10.459 1.00 20.11 ? 21  GLY A O   1 
ATOM   168  N N   . ARG A 1 22  ? 35.421  7.243  10.604 1.00 16.61 ? 22  ARG A N   1 
ATOM   169  C CA  . ARG A 1 22  ? 35.792  8.193  9.584  1.00 14.90 ? 22  ARG A CA  1 
ATOM   170  C C   . ARG A 1 22  ? 36.227  9.502  10.156 1.00 16.68 ? 22  ARG A C   1 
ATOM   171  O O   . ARG A 1 22  ? 36.572  10.398 9.392  1.00 21.71 ? 22  ARG A O   1 
ATOM   172  C CB  . ARG A 1 22  ? 34.602  8.517  8.704  1.00 13.13 ? 22  ARG A CB  1 
ATOM   173  C CG  . ARG A 1 22  ? 34.019  7.350  8.010  1.00 11.92 ? 22  ARG A CG  1 
ATOM   174  C CD  . ARG A 1 22  ? 32.594  7.633  7.807  1.00 12.93 ? 22  ARG A CD  1 
ATOM   175  N NE  . ARG A 1 22  ? 31.905  6.459  7.343  1.00 13.31 ? 22  ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 22  ? 31.818  6.144  6.070  1.00 14.51 ? 22  ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 22  ? 31.164  5.043  5.704  1.00 16.89 ? 22  ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 22  ? 32.369  6.949  5.166  1.00 15.20 ? 22  ARG A NH2 1 
ATOM   179  N N   . MET A 1 23  ? 36.197  9.674  11.470 1.00 16.53 ? 23  MET A N   1 
ATOM   180  C CA  . MET A 1 23  ? 36.527  10.987 12.023 1.00 14.54 ? 23  MET A CA  1 
ATOM   181  C C   . MET A 1 23  ? 37.990  11.318 12.222 1.00 13.18 ? 23  MET A C   1 
ATOM   182  O O   . MET A 1 23  ? 38.734  10.538 12.780 1.00 14.25 ? 23  MET A O   1 
ATOM   183  C CB  . MET A 1 23  ? 35.777  11.205 13.343 1.00 14.20 ? 23  MET A CB  1 
ATOM   184  C CG  . MET A 1 23  ? 34.268  10.896 13.299 1.00 15.41 ? 23  MET A CG  1 
ATOM   185  S SD  . MET A 1 23  ? 33.336  11.224 14.847 1.00 15.02 ? 23  MET A SD  1 
ATOM   186  C CE  . MET A 1 23  ? 33.605  12.970 15.128 1.00 12.72 ? 23  MET A CE  1 
ATOM   187  N N   . THR A 1 24  ? 38.416  12.456 11.722 1.00 11.46 ? 24  THR A N   1 
ATOM   188  C CA  . THR A 1 24  ? 39.779  12.895 11.992 1.00 11.71 ? 24  THR A CA  1 
ATOM   189  C C   . THR A 1 24  ? 39.839  13.295 13.518 1.00 12.49 ? 24  THR A C   1 
ATOM   190  O O   . THR A 1 24  ? 38.807  13.274 14.206 1.00 12.94 ? 24  THR A O   1 
ATOM   191  C CB  . THR A 1 24  ? 40.064  14.114 11.181 1.00 11.04 ? 24  THR A CB  1 
ATOM   192  O OG1 . THR A 1 24  ? 39.165  15.118 11.612 1.00 12.06 ? 24  THR A OG1 1 
ATOM   193  C CG2 . THR A 1 24  ? 39.775  13.873 9.745  1.00 10.35 ? 24  THR A CG2 1 
ATOM   194  N N   . LEU A 1 25  ? 41.009  13.693 14.046 1.00 12.70 ? 25  LEU A N   1 
ATOM   195  C CA  . LEU A 1 25  ? 41.132  14.059 15.473 1.00 10.44 ? 25  LEU A CA  1 
ATOM   196  C C   . LEU A 1 25  ? 40.446  15.352 15.802 1.00 11.23 ? 25  LEU A C   1 
ATOM   197  O O   . LEU A 1 25  ? 39.928  15.522 16.914 1.00 12.92 ? 25  LEU A O   1 
ATOM   198  C CB  . LEU A 1 25  ? 42.579  14.194 15.924 1.00 9.32  ? 25  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 25  ? 42.825  14.618 17.376 1.00 8.09  ? 25  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 25  ? 42.409  13.496 18.303 1.00 9.67  ? 25  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 25  ? 44.278  14.898 17.622 1.00 8.06  ? 25  LEU A CD2 1 
ATOM   202  N N   . ALA A 1 26  ? 40.434  16.258 14.839 1.00 10.42 ? 26  ALA A N   1 
ATOM   203  C CA  . ALA A 1 26  ? 39.828  17.556 15.039 1.00 9.70  ? 26  ALA A CA  1 
ATOM   204  C C   . ALA A 1 26  ? 38.359  17.386 15.154 1.00 10.23 ? 26  ALA A C   1 
ATOM   205  O O   . ALA A 1 26  ? 37.713  18.091 15.895 1.00 10.28 ? 26  ALA A O   1 
ATOM   206  C CB  . ALA A 1 26  ? 40.104  18.390 13.899 1.00 11.02 ? 26  ALA A CB  1 
ATOM   207  N N   . GLU A 1 27  ? 37.838  16.452 14.381 1.00 10.46 ? 27  GLU A N   1 
ATOM   208  C CA  . GLU A 1 27  ? 36.435  16.173 14.388 1.00 10.96 ? 27  GLU A CA  1 
ATOM   209  C C   . GLU A 1 27  ? 36.040  15.520 15.704 1.00 11.68 ? 27  GLU A C   1 
ATOM   210  O O   . GLU A 1 27  ? 34.958  15.796 16.247 1.00 10.14 ? 27  GLU A O   1 
ATOM   211  C CB  . GLU A 1 27  ? 36.101  15.311 13.180 1.00 11.21 ? 27  GLU A CB  1 
ATOM   212  C CG  . GLU A 1 27  ? 36.327  16.096 11.913 1.00 13.27 ? 27  GLU A CG  1 
ATOM   213  C CD  . GLU A 1 27  ? 36.107  15.292 10.663 1.00 15.09 ? 27  GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 27  ? 36.450  14.074 10.637 1.00 16.03 ? 27  GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 27  ? 35.590  15.906 9.698  1.00 16.11 ? 27  GLU A OE2 1 
ATOM   216  N N   . LYS A 1 28  ? 36.913  14.653 16.227 1.00 12.01 ? 28  LYS A N   1 
ATOM   217  C CA  . LYS A 1 28  ? 36.625  13.996 17.500 1.00 11.45 ? 28  LYS A CA  1 
ATOM   218  C C   . LYS A 1 28  ? 36.598  14.994 18.687 1.00 13.05 ? 28  LYS A C   1 
ATOM   219  O O   . LYS A 1 28  ? 35.657  15.006 19.513 1.00 15.13 ? 28  LYS A O   1 
ATOM   220  C CB  . LYS A 1 28  ? 37.616  12.881 17.750 1.00 10.24 ? 28  LYS A CB  1 
ATOM   221  C CG  . LYS A 1 28  ? 37.454  11.709 16.808 1.00 7.10  ? 28  LYS A CG  1 
ATOM   222  C CD  . LYS A 1 28  ? 38.313  10.596 17.221 1.00 3.55  ? 28  LYS A CD  1 
ATOM   223  C CE  . LYS A 1 28  ? 38.256  9.634  16.117 1.00 5.24  ? 28  LYS A CE  1 
ATOM   224  N NZ  . LYS A 1 28  ? 38.747  8.259  16.456 1.00 6.60  ? 28  LYS A NZ  1 
ATOM   225  N N   . ILE A 1 29  ? 37.651  15.775 18.827 1.00 11.68 ? 29  ILE A N   1 
ATOM   226  C CA  . ILE A 1 29  ? 37.675  16.773 19.867 1.00 10.68 ? 29  ILE A CA  1 
ATOM   227  C C   . ILE A 1 29  ? 36.533  17.810 19.660 1.00 12.05 ? 29  ILE A C   1 
ATOM   228  O O   . ILE A 1 29  ? 35.978  18.338 20.637 1.00 13.63 ? 29  ILE A O   1 
ATOM   229  C CB  . ILE A 1 29  ? 39.052  17.417 19.846 1.00 10.01 ? 29  ILE A CB  1 
ATOM   230  C CG1 . ILE A 1 29  ? 40.052  16.403 20.400 1.00 10.72 ? 29  ILE A CG1 1 
ATOM   231  C CG2 . ILE A 1 29  ? 39.058  18.760 20.545 1.00 9.19  ? 29  ILE A CG2 1 
ATOM   232  C CD1 . ILE A 1 29  ? 41.487  16.815 20.260 1.00 11.61 ? 29  ILE A CD1 1 
ATOM   233  N N   . GLY A 1 30  ? 36.163  18.085 18.413 1.00 11.58 ? 30  GLY A N   1 
ATOM   234  C CA  . GLY A 1 30  ? 35.102  19.050 18.155 1.00 10.88 ? 30  GLY A CA  1 
ATOM   235  C C   . GLY A 1 30  ? 33.752  18.622 18.722 1.00 10.78 ? 30  GLY A C   1 
ATOM   236  O O   . GLY A 1 30  ? 32.979  19.442 19.173 1.00 11.59 ? 30  GLY A O   1 
ATOM   237  N N   . GLN A 1 31  ? 33.479  17.327 18.688 1.00 10.67 ? 31  GLN A N   1 
ATOM   238  C CA  . GLN A 1 31  ? 32.282  16.736 19.212 1.00 9.54  ? 31  GLN A CA  1 
ATOM   239  C C   . GLN A 1 31  ? 32.254  16.900 20.715 1.00 10.97 ? 31  GLN A C   1 
ATOM   240  O O   . GLN A 1 31  ? 31.207  17.111 21.307 1.00 13.44 ? 31  GLN A O   1 
ATOM   241  C CB  . GLN A 1 31  ? 32.276  15.244 18.877 1.00 9.30  ? 31  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 31  ? 31.680  14.973 17.541 1.00 9.59  ? 31  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 31  ? 30.242  15.542 17.443 1.00 9.82  ? 31  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 31  ? 29.393  15.184 18.248 1.00 10.53 ? 31  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 31  ? 29.986  16.426 16.488 1.00 7.50  ? 31  GLN A NE2 1 
ATOM   246  N N   . MET A 1 32  ? 33.399  16.691 21.344 1.00 12.15 ? 32  MET A N   1 
ATOM   247  C CA  . MET A 1 32  ? 33.552  16.802 22.794 1.00 11.20 ? 32  MET A CA  1 
ATOM   248  C C   . MET A 1 32  ? 33.630  18.246 23.297 1.00 10.23 ? 32  MET A C   1 
ATOM   249  O O   . MET A 1 32  ? 33.979  18.473 24.459 1.00 10.32 ? 32  MET A O   1 
ATOM   250  C CB  . MET A 1 32  ? 34.842  16.096 23.206 1.00 12.62 ? 32  MET A CB  1 
ATOM   251  C CG  . MET A 1 32  ? 35.031  14.684 22.653 1.00 12.65 ? 32  MET A CG  1 
ATOM   252  S SD  . MET A 1 32  ? 36.703  14.120 23.083 1.00 14.29 ? 32  MET A SD  1 
ATOM   253  C CE  . MET A 1 32  ? 36.666  14.182 24.934 1.00 10.11 ? 32  MET A CE  1 
ATOM   254  N N   . THR A 1 33  ? 33.266  19.200 22.451 1.00 8.87  ? 33  THR A N   1 
ATOM   255  C CA  . THR A 1 33  ? 33.336  20.607 22.797 1.00 7.99  ? 33  THR A CA  1 
ATOM   256  C C   . THR A 1 33  ? 31.982  21.237 22.755 1.00 9.02  ? 33  THR A C   1 
ATOM   257  O O   . THR A 1 33  ? 31.346  21.209 21.700 1.00 9.81  ? 33  THR A O   1 
ATOM   258  C CB  . THR A 1 33  ? 34.275  21.391 21.816 1.00 7.38  ? 33  THR A CB  1 
ATOM   259  O OG1 . THR A 1 33  ? 35.615  20.977 22.028 1.00 9.06  ? 33  THR A OG1 1 
ATOM   260  C CG2 . THR A 1 33  ? 34.269  22.862 22.049 1.00 5.93  ? 33  THR A CG2 1 
ATOM   261  N N   . GLN A 1 34  ? 31.541  21.800 23.893 1.00 9.92  ? 34  GLN A N   1 
ATOM   262  C CA  . GLN A 1 34  ? 30.263  22.523 23.975 1.00 10.66 ? 34  GLN A CA  1 
ATOM   263  C C   . GLN A 1 34  ? 30.537  23.985 24.288 1.00 9.79  ? 34  GLN A C   1 
ATOM   264  O O   . GLN A 1 34  ? 31.147  24.298 25.311 1.00 9.56  ? 34  GLN A O   1 
ATOM   265  C CB  . GLN A 1 34  ? 29.340  21.958 25.034 1.00 12.43 ? 34  GLN A CB  1 
ATOM   266  C CG  . GLN A 1 34  ? 28.022  22.768 25.130 1.00 12.61 ? 34  GLN A CG  1 
ATOM   267  C CD  . GLN A 1 34  ? 27.239  22.392 26.365 1.00 13.49 ? 34  GLN A CD  1 
ATOM   268  O OE1 . GLN A 1 34  ? 27.680  22.679 27.488 1.00 13.24 ? 34  GLN A OE1 1 
ATOM   269  N NE2 . GLN A 1 34  ? 26.105  21.703 26.181 1.00 12.04 ? 34  GLN A NE2 1 
ATOM   270  N N   . ILE A 1 35  ? 30.031  24.878 23.443 1.00 9.17  ? 35  ILE A N   1 
ATOM   271  C CA  . ILE A 1 35  ? 30.310  26.312 23.572 1.00 10.00 ? 35  ILE A CA  1 
ATOM   272  C C   . ILE A 1 35  ? 29.042  27.128 23.694 1.00 10.52 ? 35  ILE A C   1 
ATOM   273  O O   . ILE A 1 35  ? 28.000  26.720 23.199 1.00 13.59 ? 35  ILE A O   1 
ATOM   274  C CB  . ILE A 1 35  ? 31.084  26.836 22.314 1.00 9.44  ? 35  ILE A CB  1 
ATOM   275  C CG1 . ILE A 1 35  ? 30.159  26.813 21.089 1.00 8.28  ? 35  ILE A CG1 1 
ATOM   276  C CG2 . ILE A 1 35  ? 32.366  25.973 22.001 1.00 8.74  ? 35  ILE A CG2 1 
ATOM   277  C CD1 . ILE A 1 35  ? 30.703  27.531 19.890 1.00 6.63  ? 35  ILE A CD1 1 
ATOM   278  N N   . GLU A 1 36  ? 29.141  28.306 24.294 1.00 10.39 ? 36  GLU A N   1 
ATOM   279  C CA  . GLU A 1 36  ? 27.992  29.193 24.498 1.00 10.10 ? 36  GLU A CA  1 
ATOM   280  C C   . GLU A 1 36  ? 27.561  29.901 23.201 1.00 9.59  ? 36  GLU A C   1 
ATOM   281  O O   . GLU A 1 36  ? 28.391  30.382 22.437 1.00 7.23  ? 36  GLU A O   1 
ATOM   282  C CB  . GLU A 1 36  ? 28.373  30.225 25.562 1.00 11.91 ? 36  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 36  ? 27.363  30.437 26.661 1.00 14.29 ? 36  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 36  ? 26.164  31.260 26.202 1.00 17.53 ? 36  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 36  ? 26.185  31.798 25.084 1.00 18.60 ? 36  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 36  ? 25.186  31.403 26.967 1.00 20.07 ? 36  GLU A OE2 1 
ATOM   287  N N   . ARG A 1 37  ? 26.259  29.945 22.942 1.00 10.59 ? 37  ARG A N   1 
ATOM   288  C CA  . ARG A 1 37  ? 25.762  30.630 21.748 1.00 11.76 ? 37  ARG A CA  1 
ATOM   289  C C   . ARG A 1 37  ? 26.491  32.005 21.590 1.00 11.80 ? 37  ARG A C   1 
ATOM   290  O O   . ARG A 1 37  ? 26.998  32.303 20.532 1.00 11.71 ? 37  ARG A O   1 
ATOM   291  C CB  . ARG A 1 37  ? 24.220  30.777 21.784 1.00 10.61 ? 37  ARG A CB  1 
ATOM   292  C CG  . ARG A 1 37  ? 23.673  31.614 22.915 1.00 12.36 ? 37  ARG A CG  1 
ATOM   293  C CD  . ARG A 1 37  ? 22.255  32.141 22.662 1.00 14.20 ? 37  ARG A CD  1 
ATOM   294  N NE  . ARG A 1 37  ? 22.194  33.374 21.842 1.00 15.99 ? 37  ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 37  ? 22.367  34.625 22.287 1.00 15.69 ? 37  ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 37  ? 22.305  35.644 21.446 1.00 15.72 ? 37  ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 37  ? 22.564  34.875 23.571 1.00 16.08 ? 37  ARG A NH2 1 
ATOM   298  N N   . LEU A 1 38  ? 26.687  32.740 22.680 1.00 10.78 ? 38  LEU A N   1 
ATOM   299  C CA  . LEU A 1 38  ? 27.371  34.017 22.643 1.00 10.77 ? 38  LEU A CA  1 
ATOM   300  C C   . LEU A 1 38  ? 28.746  34.095 21.975 1.00 13.09 ? 38  LEU A C   1 
ATOM   301  O O   . LEU A 1 38  ? 29.171  35.194 21.617 1.00 16.75 ? 38  LEU A O   1 
ATOM   302  C CB  . LEU A 1 38  ? 27.431  34.604 24.036 1.00 8.64  ? 38  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 38  ? 26.054  35.169 24.363 1.00 8.46  ? 38  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 38  ? 25.886  35.565 25.781 1.00 7.71  ? 38  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 38  ? 25.813  36.371 23.528 1.00 9.42  ? 38  LEU A CD2 1 
ATOM   306  N N   . VAL A 1 39  ? 29.488  32.987 21.890 1.00 13.58 ? 39  VAL A N   1 
ATOM   307  C CA  . VAL A 1 39  ? 30.809  32.985 21.212 1.00 10.69 ? 39  VAL A CA  1 
ATOM   308  C C   . VAL A 1 39  ? 30.770  32.191 19.875 1.00 13.11 ? 39  VAL A C   1 
ATOM   309  O O   . VAL A 1 39  ? 31.798  32.001 19.228 1.00 12.47 ? 39  VAL A O   1 
ATOM   310  C CB  . VAL A 1 39  ? 31.942  32.407 22.123 1.00 8.74  ? 39  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 39  ? 31.818  32.936 23.528 1.00 5.89  ? 39  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 39  ? 31.966  30.917 22.107 1.00 6.29  ? 39  VAL A CG2 1 
ATOM   313  N N   . ALA A 1 40  ? 29.574  31.709 19.502 1.00 14.03 ? 40  ALA A N   1 
ATOM   314  C CA  . ALA A 1 40  ? 29.336  30.903 18.302 1.00 13.71 ? 40  ALA A CA  1 
ATOM   315  C C   . ALA A 1 40  ? 29.192  31.642 16.984 1.00 15.86 ? 40  ALA A C   1 
ATOM   316  O O   . ALA A 1 40  ? 28.509  32.636 16.882 1.00 18.41 ? 40  ALA A O   1 
ATOM   317  C CB  . ALA A 1 40  ? 28.151  30.043 18.507 1.00 11.54 ? 40  ALA A CB  1 
ATOM   318  N N   . THR A 1 41  ? 29.669  31.031 15.920 1.00 18.27 ? 41  THR A N   1 
ATOM   319  C CA  . THR A 1 41  ? 29.601  31.670 14.629 1.00 15.84 ? 41  THR A CA  1 
ATOM   320  C C   . THR A 1 41  ? 29.464  30.531 13.638 1.00 17.86 ? 41  THR A C   1 
ATOM   321  O O   . THR A 1 41  ? 29.813  29.410 14.009 1.00 19.03 ? 41  THR A O   1 
ATOM   322  C CB  . THR A 1 41  ? 30.855  32.493 14.555 1.00 14.67 ? 41  THR A CB  1 
ATOM   323  O OG1 . THR A 1 41  ? 30.449  33.843 14.652 1.00 15.00 ? 41  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 41  ? 31.686  32.251 13.338 1.00 13.70 ? 41  THR A CG2 1 
ATOM   325  N N   . PRO A 1 42  ? 28.855  30.748 12.433 1.00 18.85 ? 42  PRO A N   1 
ATOM   326  C CA  . PRO A 1 42  ? 28.731  29.652 11.472 1.00 17.57 ? 42  PRO A CA  1 
ATOM   327  C C   . PRO A 1 42  ? 30.107  29.118 11.138 1.00 17.53 ? 42  PRO A C   1 
ATOM   328  O O   . PRO A 1 42  ? 30.268  27.925 10.976 1.00 17.85 ? 42  PRO A O   1 
ATOM   329  C CB  . PRO A 1 42  ? 28.055  30.309 10.283 1.00 17.71 ? 42  PRO A CB  1 
ATOM   330  C CG  . PRO A 1 42  ? 27.217  31.352 10.901 1.00 16.45 ? 42  PRO A CG  1 
ATOM   331  C CD  . PRO A 1 42  ? 28.220  31.953 11.862 1.00 19.74 ? 42  PRO A CD  1 
ATOM   332  N N   . ASP A 1 43  ? 31.105  29.990 11.047 1.00 19.38 ? 43  ASP A N   1 
ATOM   333  C CA  . ASP A 1 43  ? 32.480  29.526 10.814 1.00 20.69 ? 43  ASP A CA  1 
ATOM   334  C C   . ASP A 1 43  ? 33.092  28.797 11.974 1.00 19.68 ? 43  ASP A C   1 
ATOM   335  O O   . ASP A 1 43  ? 33.761  27.795 11.782 1.00 21.94 ? 43  ASP A O   1 
ATOM   336  C CB  . ASP A 1 43  ? 33.390  30.677 10.585 1.00 24.31 ? 43  ASP A CB  1 
ATOM   337  C CG  . ASP A 1 43  ? 33.132  31.299 9.321  1.00 28.41 ? 43  ASP A CG  1 
ATOM   338  O OD1 . ASP A 1 43  ? 32.780  32.512 9.321  1.00 29.57 ? 43  ASP A OD1 1 
ATOM   339  O OD2 . ASP A 1 43  ? 33.262  30.509 8.346  1.00 31.24 ? 43  ASP A OD2 1 
ATOM   340  N N   . VAL A 1 44  ? 33.001  29.406 13.151 1.00 17.37 ? 44  VAL A N   1 
ATOM   341  C CA  . VAL A 1 44  ? 33.554  28.821 14.369 1.00 14.08 ? 44  VAL A CA  1 
ATOM   342  C C   . VAL A 1 44  ? 33.003  27.413 14.492 1.00 13.72 ? 44  VAL A C   1 
ATOM   343  O O   . VAL A 1 44  ? 33.749  26.454 14.707 1.00 10.50 ? 44  VAL A O   1 
ATOM   344  C CB  . VAL A 1 44  ? 33.146  29.671 15.622 1.00 13.81 ? 44  VAL A CB  1 
ATOM   345  C CG1 . VAL A 1 44  ? 33.449  28.926 16.895 1.00 12.79 ? 44  VAL A CG1 1 
ATOM   346  C CG2 . VAL A 1 44  ? 33.856  30.998 15.622 1.00 10.98 ? 44  VAL A CG2 1 
ATOM   347  N N   . LEU A 1 45  ? 31.696  27.296 14.252 1.00 13.41 ? 45  LEU A N   1 
ATOM   348  C CA  . LEU A 1 45  ? 31.034  26.007 14.396 1.00 14.16 ? 45  LEU A CA  1 
ATOM   349  C C   . LEU A 1 45  ? 31.462  25.082 13.311 1.00 14.91 ? 45  LEU A C   1 
ATOM   350  O O   . LEU A 1 45  ? 31.730  23.905 13.558 1.00 14.72 ? 45  LEU A O   1 
ATOM   351  C CB  . LEU A 1 45  ? 29.490  26.141 14.434 1.00 12.89 ? 45  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 45  ? 28.933  26.762 15.720 1.00 11.89 ? 45  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 45  ? 27.737  27.655 15.451 1.00 11.59 ? 45  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 45  ? 28.627  25.694 16.722 1.00 10.88 ? 45  LEU A CD2 1 
ATOM   355  N N   . ARG A 1 46  ? 31.625  25.651 12.131 1.00 15.88 ? 46  ARG A N   1 
ATOM   356  C CA  . ARG A 1 46  ? 31.981  24.835 11.023 1.00 17.17 ? 46  ARG A CA  1 
ATOM   357  C C   . ARG A 1 46  ? 33.444  24.455 11.104 1.00 17.44 ? 46  ARG A C   1 
ATOM   358  O O   . ARG A 1 46  ? 33.771  23.283 11.171 1.00 18.74 ? 46  ARG A O   1 
ATOM   359  C CB  . ARG A 1 46  ? 31.604  25.530 9.706  1.00 20.22 ? 46  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 46  ? 31.488  24.596 8.474  1.00 24.30 ? 46  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 46  ? 31.404  25.371 7.193  1.00 26.53 ? 46  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 46  ? 30.066  25.957 7.094  1.00 32.08 ? 46  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 46  ? 29.753  27.269 7.132  1.00 35.16 ? 46  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 46  ? 30.698  28.216 7.283  1.00 36.64 ? 46  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 46  ? 28.482  27.657 6.935  1.00 34.67 ? 46  ARG A NH2 1 
ATOM   366  N N   . ASP A 1 47  ? 34.314  25.440 11.253 1.00 16.84 ? 47  ASP A N   1 
ATOM   367  C CA  . ASP A 1 47  ? 35.739  25.169 11.264 1.00 17.24 ? 47  ASP A CA  1 
ATOM   368  C C   . ASP A 1 47  ? 36.179  24.313 12.430 1.00 16.33 ? 47  ASP A C   1 
ATOM   369  O O   . ASP A 1 47  ? 37.051  23.444 12.310 1.00 15.65 ? 47  ASP A O   1 
ATOM   370  C CB  . ASP A 1 47  ? 36.525  26.484 11.221 1.00 20.21 ? 47  ASP A CB  1 
ATOM   371  C CG  . ASP A 1 47  ? 36.172  27.365 9.994  1.00 23.03 ? 47  ASP A CG  1 
ATOM   372  O OD1 . ASP A 1 47  ? 35.668  26.824 8.972  1.00 24.57 ? 47  ASP A OD1 1 
ATOM   373  O OD2 . ASP A 1 47  ? 36.386  28.606 10.068 1.00 23.68 ? 47  ASP A OD2 1 
ATOM   374  N N   . ASN A 1 48  ? 35.600  24.573 13.582 1.00 15.74 ? 48  ASN A N   1 
ATOM   375  C CA  . ASN A 1 48  ? 35.987  23.813 14.740 1.00 15.41 ? 48  ASN A CA  1 
ATOM   376  C C   . ASN A 1 48  ? 35.270  22.477 14.937 1.00 14.99 ? 48  ASN A C   1 
ATOM   377  O O   . ASN A 1 48  ? 35.553  21.767 15.916 1.00 12.67 ? 48  ASN A O   1 
ATOM   378  C CB  . ASN A 1 48  ? 35.851  24.692 15.968 1.00 16.05 ? 48  ASN A CB  1 
ATOM   379  C CG  . ASN A 1 48  ? 36.820  25.826 15.948 1.00 17.76 ? 48  ASN A CG  1 
ATOM   380  O OD1 . ASN A 1 48  ? 37.965  25.680 16.377 1.00 18.92 ? 48  ASN A OD1 1 
ATOM   381  N ND2 . ASN A 1 48  ? 36.408  26.950 15.387 1.00 19.80 ? 48  ASN A ND2 1 
ATOM   382  N N   . PHE A 1 49  ? 34.398  22.124 13.979 1.00 13.92 ? 49  PHE A N   1 
ATOM   383  C CA  . PHE A 1 49  ? 33.597  20.898 14.032 1.00 12.93 ? 49  PHE A CA  1 
ATOM   384  C C   . PHE A 1 49  ? 32.915  20.824 15.423 1.00 11.78 ? 49  PHE A C   1 
ATOM   385  O O   . PHE A 1 49  ? 32.970  19.783 16.092 1.00 10.83 ? 49  PHE A O   1 
ATOM   386  C CB  . PHE A 1 49  ? 34.511  19.675 13.838 1.00 14.34 ? 49  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 49  ? 35.369  19.731 12.593 1.00 17.16 ? 49  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 49  ? 36.736  20.010 12.676 1.00 18.35 ? 49  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 49  ? 34.825  19.454 11.331 1.00 18.26 ? 49  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 49  ? 37.552  20.009 11.514 1.00 19.14 ? 49  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 49  ? 35.628  19.449 10.170 1.00 18.54 ? 49  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 49  ? 36.990  19.724 10.267 1.00 19.18 ? 49  PHE A CZ  1 
ATOM   393  N N   . ILE A 1 50  ? 32.385  21.955 15.899 1.00 8.43  ? 50  ILE A N   1 
ATOM   394  C CA  . ILE A 1 50  ? 31.779  22.032 17.236 1.00 7.57  ? 50  ILE A CA  1 
ATOM   395  C C   . ILE A 1 50  ? 30.600  21.057 17.354 1.00 9.48  ? 50  ILE A C   1 
ATOM   396  O O   . ILE A 1 50  ? 29.738  21.023 16.475 1.00 9.98  ? 50  ILE A O   1 
ATOM   397  C CB  . ILE A 1 50  ? 31.385  23.513 17.610 1.00 7.13  ? 50  ILE A CB  1 
ATOM   398  C CG1 . ILE A 1 50  ? 32.633  24.402 17.676 1.00 3.58  ? 50  ILE A CG1 1 
ATOM   399  C CG2 . ILE A 1 50  ? 30.562  23.571 18.914 1.00 5.24  ? 50  ILE A CG2 1 
ATOM   400  C CD1 . ILE A 1 50  ? 33.433  24.245 18.907 1.00 3.63  ? 50  ILE A CD1 1 
ATOM   401  N N   . GLY A 1 51  ? 30.543  20.346 18.494 1.00 11.31 ? 51  GLY A N   1 
ATOM   402  C CA  . GLY A 1 51  ? 29.564  19.299 18.730 1.00 9.14  ? 51  GLY A CA  1 
ATOM   403  C C   . GLY A 1 51  ? 28.347  19.624 19.528 1.00 10.90 ? 51  GLY A C   1 
ATOM   404  O O   . GLY A 1 51  ? 27.426  18.812 19.569 1.00 12.22 ? 51  GLY A O   1 
ATOM   405  N N   . SER A 1 52  ? 28.355  20.728 20.268 1.00 10.26 ? 52  SER A N   1 
ATOM   406  C CA  . SER A 1 52  ? 27.150  21.093 21.006 1.00 9.99  ? 52  SER A CA  1 
ATOM   407  C C   . SER A 1 52  ? 27.179  22.567 21.349 1.00 9.91  ? 52  SER A C   1 
ATOM   408  O O   . SER A 1 52  ? 28.231  23.177 21.293 1.00 11.72 ? 52  SER A O   1 
ATOM   409  C CB  . SER A 1 52  ? 27.021  20.227 22.255 1.00 9.90  ? 52  SER A CB  1 
ATOM   410  O OG  . SER A 1 52  ? 25.994  20.671 23.118 1.00 9.05  ? 52  SER A OG  1 
ATOM   411  N N   . LEU A 1 53  ? 26.020  23.168 21.602 1.00 10.53 ? 53  LEU A N   1 
ATOM   412  C CA  . LEU A 1 53  ? 25.927  24.594 21.997 1.00 12.08 ? 53  LEU A CA  1 
ATOM   413  C C   . LEU A 1 53  ? 24.966  24.669 23.157 1.00 11.41 ? 53  LEU A C   1 
ATOM   414  O O   . LEU A 1 53  ? 24.129  23.785 23.322 1.00 11.29 ? 53  LEU A O   1 
ATOM   415  C CB  . LEU A 1 53  ? 25.362  25.504 20.894 1.00 12.38 ? 53  LEU A CB  1 
ATOM   416  C CG  . LEU A 1 53  ? 26.215  25.829 19.658 1.00 13.72 ? 53  LEU A CG  1 
ATOM   417  C CD1 . LEU A 1 53  ? 25.430  25.549 18.377 1.00 14.22 ? 53  LEU A CD1 1 
ATOM   418  C CD2 . LEU A 1 53  ? 26.575  27.306 19.703 1.00 13.06 ? 53  LEU A CD2 1 
ATOM   419  N N   . LEU A 1 54  ? 25.087  25.716 23.964 1.00 10.37 ? 54  LEU A N   1 
ATOM   420  C CA  . LEU A 1 54  ? 24.158  25.896 25.056 1.00 10.83 ? 54  LEU A CA  1 
ATOM   421  C C   . LEU A 1 54  ? 23.805  27.367 25.257 1.00 10.89 ? 54  LEU A C   1 
ATOM   422  O O   . LEU A 1 54  ? 24.519  28.282 24.826 1.00 10.96 ? 54  LEU A O   1 
ATOM   423  C CB  . LEU A 1 54  ? 24.738  25.363 26.364 1.00 12.23 ? 54  LEU A CB  1 
ATOM   424  C CG  . LEU A 1 54  ? 25.479  26.440 27.184 1.00 13.86 ? 54  LEU A CG  1 
ATOM   425  C CD1 . LEU A 1 54  ? 25.190  26.335 28.634 1.00 12.56 ? 54  LEU A CD1 1 
ATOM   426  C CD2 . LEU A 1 54  ? 26.958  26.377 26.925 1.00 15.14 ? 54  LEU A CD2 1 
ATOM   427  N N   . SER A 1 55  ? 22.668  27.582 25.897 1.00 10.90 ? 55  SER A N   1 
ATOM   428  C CA  . SER A 1 55  ? 22.260  28.924 26.295 1.00 10.68 ? 55  SER A CA  1 
ATOM   429  C C   . SER A 1 55  ? 22.516  28.936 27.815 1.00 10.03 ? 55  SER A C   1 
ATOM   430  O O   . SER A 1 55  ? 22.106  28.015 28.495 1.00 10.32 ? 55  SER A O   1 
ATOM   431  C CB  . SER A 1 55  ? 20.774  29.075 26.113 1.00 10.28 ? 55  SER A CB  1 
ATOM   432  O OG  . SER A 1 55  ? 20.510  30.136 25.255 1.00 12.63 ? 55  SER A OG  1 
ATOM   433  N N   . GLY A 1 56  ? 23.315  29.842 28.344 1.00 9.97  ? 56  GLY A N   1 
ATOM   434  C CA  . GLY A 1 56  ? 23.433  29.853 29.788 1.00 10.13 ? 56  GLY A CA  1 
ATOM   435  C C   . GLY A 1 56  ? 22.215  30.645 30.282 1.00 9.98  ? 56  GLY A C   1 
ATOM   436  O O   . GLY A 1 56  ? 21.560  31.321 29.507 1.00 12.10 ? 56  GLY A O   1 
ATOM   437  N N   . GLY A 1 57  ? 21.947  30.659 31.567 1.00 9.70  ? 57  GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? 20.801  31.400 32.025 1.00 8.57  ? 57  GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? 20.812  32.821 31.540 1.00 8.17  ? 57  GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? 21.818  33.485 31.564 1.00 7.31  ? 57  GLY A O   1 
ATOM   441  N N   . GLY A 1 58  ? 19.698  33.261 30.990 1.00 9.89  ? 58  GLY A N   1 
ATOM   442  C CA  . GLY A 1 58  ? 19.642  34.620 30.542 1.00 9.63  ? 58  GLY A CA  1 
ATOM   443  C C   . GLY A 1 58  ? 20.231  34.828 29.168 1.00 11.87 ? 58  GLY A C   1 
ATOM   444  O O   . GLY A 1 58  ? 20.031  35.926 28.607 1.00 13.75 ? 58  GLY A O   1 
ATOM   445  N N   . SER A 1 59  ? 20.908  33.807 28.608 1.00 10.09 ? 59  SER A N   1 
ATOM   446  C CA  . SER A 1 59  ? 21.564  33.878 27.277 1.00 7.38  ? 59  SER A CA  1 
ATOM   447  C C   . SER A 1 59  ? 20.526  33.661 26.215 1.00 8.93  ? 59  SER A C   1 
ATOM   448  O O   . SER A 1 59  ? 20.311  32.544 25.826 1.00 10.72 ? 59  SER A O   1 
ATOM   449  C CB  . SER A 1 59  ? 22.581  32.774 27.139 1.00 3.94  ? 59  SER A CB  1 
ATOM   450  O OG  . SER A 1 59  ? 23.319  32.956 25.964 1.00 3.01  ? 59  SER A OG  1 
ATOM   451  N N   . VAL A 1 60  ? 19.908  34.716 25.706 1.00 10.58 ? 60  VAL A N   1 
ATOM   452  C CA  . VAL A 1 60  ? 18.815  34.540 24.760 1.00 10.81 ? 60  VAL A CA  1 
ATOM   453  C C   . VAL A 1 60  ? 19.024  35.427 23.567 1.00 12.73 ? 60  VAL A C   1 
ATOM   454  O O   . VAL A 1 60  ? 19.784  36.380 23.649 1.00 12.49 ? 60  VAL A O   1 
ATOM   455  C CB  . VAL A 1 60  ? 17.468  34.909 25.455 1.00 10.71 ? 60  VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 60  ? 17.284  34.092 26.736 1.00 9.87  ? 60  VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 60  ? 17.435  36.413 25.795 1.00 9.19  ? 60  VAL A CG2 1 
ATOM   458  N N   . PRO A 1 61  ? 18.298  35.171 22.460 1.00 15.38 ? 61  PRO A N   1 
ATOM   459  C CA  . PRO A 1 61  ? 18.381  35.993 21.232 1.00 15.66 ? 61  PRO A CA  1 
ATOM   460  C C   . PRO A 1 61  ? 18.026  37.476 21.409 1.00 16.66 ? 61  PRO A C   1 
ATOM   461  O O   . PRO A 1 61  ? 18.740  38.321 20.925 1.00 16.61 ? 61  PRO A O   1 
ATOM   462  C CB  . PRO A 1 61  ? 17.445  35.299 20.237 1.00 14.58 ? 61  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 61  ? 16.826  34.147 20.965 1.00 15.14 ? 61  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 61  ? 17.252  34.129 22.386 1.00 14.63 ? 61  PRO A CD  1 
ATOM   465  N N   . ARG A 1 62  ? 16.875  37.772 22.007 1.00 19.12 ? 62  ARG A N   1 
ATOM   466  C CA  . ARG A 1 62  ? 16.429  39.147 22.299 1.00 22.05 ? 62  ARG A CA  1 
ATOM   467  C C   . ARG A 1 62  ? 15.518  38.977 23.505 1.00 22.40 ? 62  ARG A C   1 
ATOM   468  O O   . ARG A 1 62  ? 15.050  37.879 23.745 1.00 22.10 ? 62  ARG A O   1 
ATOM   469  C CB  . ARG A 1 62  ? 15.499  39.732 21.213 1.00 24.19 ? 62  ARG A CB  1 
ATOM   470  C CG  . ARG A 1 62  ? 15.947  39.665 19.766 1.00 30.03 ? 62  ARG A CG  1 
ATOM   471  C CD  . ARG A 1 62  ? 15.007  40.469 18.779 1.00 31.42 ? 62  ARG A CD  1 
ATOM   472  N NE  . ARG A 1 62  ? 13.592  40.097 18.922 1.00 32.97 ? 62  ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 62  ? 12.585  40.951 19.144 1.00 33.41 ? 62  ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 62  ? 12.795  42.273 19.260 1.00 33.84 ? 62  ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 62  ? 11.346  40.477 19.238 1.00 32.37 ? 62  ARG A NH2 1 
ATOM   476  N N   . LYS A 1 63  ? 15.217  40.052 24.232 1.00 23.32 ? 63  LYS A N   1 
ATOM   477  C CA  . LYS A 1 63  ? 14.243  39.954 25.319 1.00 23.23 ? 63  LYS A CA  1 
ATOM   478  C C   . LYS A 1 63  ? 12.954  39.797 24.561 1.00 22.23 ? 63  LYS A C   1 
ATOM   479  O O   . LYS A 1 63  ? 12.783  40.376 23.483 1.00 20.66 ? 63  LYS A O   1 
ATOM   480  C CB  . LYS A 1 63  ? 14.075  41.261 26.108 1.00 27.28 ? 63  LYS A CB  1 
ATOM   481  C CG  . LYS A 1 63  ? 14.653  41.274 27.541 1.00 31.65 ? 63  LYS A CG  1 
ATOM   482  C CD  . LYS A 1 63  ? 14.991  39.866 28.083 1.00 33.31 ? 63  LYS A CD  1 
ATOM   483  C CE  . LYS A 1 63  ? 15.629  39.975 29.459 1.00 34.42 ? 63  LYS A CE  1 
ATOM   484  N NZ  . LYS A 1 63  ? 14.704  40.703 30.395 1.00 36.28 ? 63  LYS A NZ  1 
ATOM   485  N N   . GLY A 1 64  ? 12.024  39.087 25.174 1.00 21.64 ? 64  GLY A N   1 
ATOM   486  C CA  . GLY A 1 64  ? 10.728  38.868 24.594 1.00 19.22 ? 64  GLY A CA  1 
ATOM   487  C C   . GLY A 1 64  ? 10.725  38.203 23.252 1.00 19.22 ? 64  GLY A C   1 
ATOM   488  O O   . GLY A 1 64  ? 9.749   38.418 22.524 1.00 21.64 ? 64  GLY A O   1 
ATOM   489  N N   . ALA A 1 65  ? 11.774  37.451 22.898 1.00 16.65 ? 65  ALA A N   1 
ATOM   490  C CA  . ALA A 1 65  ? 11.825  36.743 21.608 1.00 15.10 ? 65  ALA A CA  1 
ATOM   491  C C   . ALA A 1 65  ? 10.727  35.686 21.534 1.00 14.73 ? 65  ALA A C   1 
ATOM   492  O O   . ALA A 1 65  ? 10.368  35.078 22.528 1.00 16.08 ? 65  ALA A O   1 
ATOM   493  C CB  . ALA A 1 65  ? 13.178  36.083 21.431 1.00 13.80 ? 65  ALA A CB  1 
ATOM   494  N N   . THR A 1 66  ? 10.167  35.469 20.358 1.00 15.52 ? 66  THR A N   1 
ATOM   495  C CA  . THR A 1 66  ? 9.119   34.441 20.239 1.00 15.74 ? 66  THR A CA  1 
ATOM   496  C C   . THR A 1 66  ? 9.690   33.030 20.061 1.00 16.79 ? 66  THR A C   1 
ATOM   497  O O   . THR A 1 66  ? 10.908  32.824 20.030 1.00 18.28 ? 66  THR A O   1 
ATOM   498  C CB  . THR A 1 66  ? 8.153   34.755 19.099 1.00 14.44 ? 66  THR A CB  1 
ATOM   499  O OG1 . THR A 1 66  ? 8.843   34.690 17.848 1.00 15.22 ? 66  THR A OG1 1 
ATOM   500  C CG2 . THR A 1 66  ? 7.615   36.147 19.262 1.00 13.33 ? 66  THR A CG2 1 
ATOM   501  N N   . ALA A 1 67  ? 8.831   32.041 19.905 1.00 18.55 ? 67  ALA A N   1 
ATOM   502  C CA  . ALA A 1 67  ? 9.344   30.699 19.763 1.00 18.54 ? 67  ALA A CA  1 
ATOM   503  C C   . ALA A 1 67  ? 10.004  30.485 18.401 1.00 20.09 ? 67  ALA A C   1 
ATOM   504  O O   . ALA A 1 67  ? 10.928  29.673 18.317 1.00 21.72 ? 67  ALA A O   1 
ATOM   505  C CB  . ALA A 1 67  ? 8.258   29.686 20.020 1.00 17.22 ? 67  ALA A CB  1 
ATOM   506  N N   . LYS A 1 68  ? 9.605   31.210 17.350 1.00 18.86 ? 68  LYS A N   1 
ATOM   507  C CA  . LYS A 1 68  ? 10.253  30.955 16.069 1.00 20.69 ? 68  LYS A CA  1 
ATOM   508  C C   . LYS A 1 68  ? 11.635  31.627 15.978 1.00 19.47 ? 68  LYS A C   1 
ATOM   509  O O   . LYS A 1 68  ? 12.523  31.140 15.250 1.00 15.94 ? 68  LYS A O   1 
ATOM   510  C CB  . LYS A 1 68  ? 9.315   31.254 14.891 1.00 25.21 ? 68  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 68  ? 7.856   30.742 15.233 1.00 34.21 ? 68  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 68  ? 6.783   30.457 14.061 1.00 37.96 ? 68  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 68  ? 5.408   31.279 14.198 1.00 39.61 ? 68  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 68  ? 5.373   32.717 13.566 1.00 39.37 ? 68  LYS A NZ  1 
ATOM   515  N N   . GLU A 1 69  ? 11.836  32.651 16.832 1.00 16.63 ? 69  GLU A N   1 
ATOM   516  C CA  . GLU A 1 69  ? 13.099  33.394 16.955 1.00 12.32 ? 69  GLU A CA  1 
ATOM   517  C C   . GLU A 1 69  ? 14.064  32.428 17.585 1.00 12.89 ? 69  GLU A C   1 
ATOM   518  O O   . GLU A 1 69  ? 15.196  32.319 17.152 1.00 13.40 ? 69  GLU A O   1 
ATOM   519  C CB  . GLU A 1 69  ? 12.950  34.612 17.849 1.00 11.21 ? 69  GLU A CB  1 
ATOM   520  C CG  . GLU A 1 69  ? 12.149  35.738 17.240 1.00 11.14 ? 69  GLU A CG  1 
ATOM   521  C CD  . GLU A 1 69  ? 12.203  36.999 18.045 1.00 12.56 ? 69  GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 69  ? 13.311  37.487 18.353 1.00 12.03 ? 69  GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 69  ? 11.121  37.496 18.402 1.00 15.78 ? 69  GLU A OE2 1 
ATOM   524  N N   . TRP A 1 70  ? 13.605  31.676 18.589 1.00 11.88 ? 70  TRP A N   1 
ATOM   525  C CA  . TRP A 1 70  ? 14.477  30.677 19.167 1.00 9.99  ? 70  TRP A CA  1 
ATOM   526  C C   . TRP A 1 70  ? 14.774  29.615 18.120 1.00 9.54  ? 70  TRP A C   1 
ATOM   527  O O   . TRP A 1 70  ? 15.916  29.288 17.945 1.00 9.94  ? 70  TRP A O   1 
ATOM   528  C CB  . TRP A 1 70  ? 13.860  29.993 20.371 1.00 9.96  ? 70  TRP A CB  1 
ATOM   529  C CG  . TRP A 1 70  ? 13.975  30.758 21.596 1.00 8.51  ? 70  TRP A CG  1 
ATOM   530  C CD1 . TRP A 1 70  ? 13.106  31.715 22.035 1.00 8.18  ? 70  TRP A CD1 1 
ATOM   531  C CD2 . TRP A 1 70  ? 15.045  30.723 22.522 1.00 6.77  ? 70  TRP A CD2 1 
ATOM   532  N NE1 . TRP A 1 70  ? 13.587  32.288 23.164 1.00 8.22  ? 70  TRP A NE1 1 
ATOM   533  C CE2 . TRP A 1 70  ? 14.789  31.705 23.491 1.00 7.90  ? 70  TRP A CE2 1 
ATOM   534  C CE3 . TRP A 1 70  ? 16.199  29.968 22.633 1.00 7.18  ? 70  TRP A CE3 1 
ATOM   535  C CZ2 . TRP A 1 70  ? 15.655  31.964 24.566 1.00 7.27  ? 70  TRP A CZ2 1 
ATOM   536  C CZ3 . TRP A 1 70  ? 17.075  30.220 23.714 1.00 8.40  ? 70  TRP A CZ3 1 
ATOM   537  C CH2 . TRP A 1 70  ? 16.793  31.212 24.659 1.00 6.89  ? 70  TRP A CH2 1 
ATOM   538  N N   . GLN A 1 71  ? 13.753  29.057 17.464 1.00 10.28 ? 71  GLN A N   1 
ATOM   539  C CA  . GLN A 1 71  ? 13.923  28.007 16.433 1.00 10.44 ? 71  GLN A CA  1 
ATOM   540  C C   . GLN A 1 71  ? 14.907  28.470 15.318 1.00 10.25 ? 71  GLN A C   1 
ATOM   541  O O   . GLN A 1 71  ? 15.829  27.732 14.882 1.00 7.64  ? 71  GLN A O   1 
ATOM   542  C CB  . GLN A 1 71  ? 12.529  27.604 15.840 1.00 10.45 ? 71  GLN A CB  1 
ATOM   543  C CG  . GLN A 1 71  ? 11.504  26.998 16.879 1.00 11.88 ? 71  GLN A CG  1 
ATOM   544  C CD  . GLN A 1 71  ? 10.350  26.131 16.286 1.00 12.16 ? 71  GLN A CD  1 
ATOM   545  O OE1 . GLN A 1 71  ? 10.325  25.803 15.091 1.00 13.82 ? 71  GLN A OE1 1 
ATOM   546  N NE2 . GLN A 1 71  ? 9.395   25.780 17.130 1.00 10.93 ? 71  GLN A NE2 1 
ATOM   547  N N   . ASP A 1 72  ? 14.715  29.724 14.907 1.00 9.84  ? 72  ASP A N   1 
ATOM   548  C CA  . ASP A 1 72  ? 15.538  30.365 13.898 1.00 9.51  ? 72  ASP A CA  1 
ATOM   549  C C   . ASP A 1 72  ? 16.989  30.467 14.299 1.00 9.34  ? 72  ASP A C   1 
ATOM   550  O O   . ASP A 1 72  ? 17.877  30.466 13.473 1.00 11.07 ? 72  ASP A O   1 
ATOM   551  C CB  . ASP A 1 72  ? 15.060  31.783 13.696 1.00 11.38 ? 72  ASP A CB  1 
ATOM   552  C CG  . ASP A 1 72  ? 13.809  31.877 12.866 1.00 13.82 ? 72  ASP A CG  1 
ATOM   553  O OD1 . ASP A 1 72  ? 13.348  30.834 12.307 1.00 13.09 ? 72  ASP A OD1 1 
ATOM   554  O OD2 . ASP A 1 72  ? 13.313  33.042 12.796 1.00 15.16 ? 72  ASP A OD2 1 
ATOM   555  N N   . MET A 1 73  ? 17.229  30.707 15.571 1.00 10.25 ? 73  MET A N   1 
ATOM   556  C CA  . MET A 1 73  ? 18.590  30.853 16.049 1.00 8.25  ? 73  MET A CA  1 
ATOM   557  C C   . MET A 1 73  ? 19.256  29.480 16.096 1.00 7.79  ? 73  MET A C   1 
ATOM   558  O O   . MET A 1 73  ? 20.438  29.304 15.746 1.00 6.88  ? 73  MET A O   1 
ATOM   559  C CB  . MET A 1 73  ? 18.543  31.473 17.450 1.00 8.21  ? 73  MET A CB  1 
ATOM   560  C CG  . MET A 1 73  ? 19.878  31.569 18.136 1.00 10.20 ? 73  MET A CG  1 
ATOM   561  S SD  . MET A 1 73  ? 19.739  31.986 19.862 1.00 14.22 ? 73  MET A SD  1 
ATOM   562  C CE  . MET A 1 73  ? 18.787  30.467 20.515 1.00 9.92  ? 73  MET A CE  1 
ATOM   563  N N   . VAL A 1 74  ? 18.463  28.493 16.490 1.00 6.39  ? 74  VAL A N   1 
ATOM   564  C CA  . VAL A 1 74  ? 18.973  27.151 16.692 1.00 5.55  ? 74  VAL A CA  1 
ATOM   565  C C   . VAL A 1 74  ? 19.292  26.541 15.360 1.00 7.78  ? 74  VAL A C   1 
ATOM   566  O O   . VAL A 1 74  ? 20.414  26.052 15.153 1.00 9.18  ? 74  VAL A O   1 
ATOM   567  C CB  . VAL A 1 74  ? 18.003  26.322 17.564 1.00 3.68  ? 74  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 74  ? 18.492  24.945 17.766 1.00 3.59  ? 74  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 74  ? 17.839  26.966 18.915 1.00 2.00  ? 74  VAL A CG2 1 
ATOM   570  N N   . ASP A 1 75  ? 18.367  26.727 14.420 1.00 9.11  ? 75  ASP A N   1 
ATOM   571  C CA  . ASP A 1 75  ? 18.503  26.203 13.073 1.00 8.21  ? 75  ASP A CA  1 
ATOM   572  C C   . ASP A 1 75  ? 19.722  26.796 12.380 1.00 9.47  ? 75  ASP A C   1 
ATOM   573  O O   . ASP A 1 75  ? 20.451  26.096 11.676 1.00 10.03 ? 75  ASP A O   1 
ATOM   574  C CB  . ASP A 1 75  ? 17.240  26.535 12.315 1.00 8.59  ? 75  ASP A CB  1 
ATOM   575  C CG  . ASP A 1 75  ? 16.093  25.602 12.650 1.00 10.72 ? 75  ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 75  ? 16.322  24.545 13.253 1.00 9.97  ? 75  ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 75  ? 14.947  25.890 12.244 1.00 12.34 ? 75  ASP A OD2 1 
ATOM   578  N N   . GLY A 1 76  ? 19.929  28.096 12.600 1.00 11.24 ? 76  GLY A N   1 
ATOM   579  C CA  . GLY A 1 76  ? 21.017  28.847 12.011 1.00 10.72 ? 76  GLY A CA  1 
ATOM   580  C C   . GLY A 1 76  ? 22.341  28.227 12.354 1.00 12.12 ? 76  GLY A C   1 
ATOM   581  O O   . GLY A 1 76  ? 23.181  27.987 11.485 1.00 14.36 ? 76  GLY A O   1 
ATOM   582  N N   . PHE A 1 77  ? 22.504  27.918 13.626 1.00 12.41 ? 77  PHE A N   1 
ATOM   583  C CA  . PHE A 1 77  ? 23.707  27.294 14.103 1.00 11.47 ? 77  PHE A CA  1 
ATOM   584  C C   . PHE A 1 77  ? 23.786  25.889 13.521 1.00 11.01 ? 77  PHE A C   1 
ATOM   585  O O   . PHE A 1 77  ? 24.846  25.465 13.129 1.00 10.85 ? 77  PHE A O   1 
ATOM   586  C CB  . PHE A 1 77  ? 23.643  27.200 15.627 1.00 12.32 ? 77  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 23.747  28.540 16.349 1.00 11.51 ? 77  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 22.969  28.802 17.489 1.00 12.10 ? 77  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 24.679  29.489 15.968 1.00 9.98  ? 77  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 23.139  29.992 18.239 1.00 11.49 ? 77  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 24.847  30.682 16.728 1.00 10.10 ? 77  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 24.087  30.927 17.851 1.00 8.35  ? 77  PHE A CZ  1 
ATOM   593  N N   . GLN A 1 78  ? 22.656  25.172 13.503 1.00 12.08 ? 78  GLN A N   1 
ATOM   594  C CA  . GLN A 1 78  ? 22.572  23.782 13.001 1.00 12.92 ? 78  GLN A CA  1 
ATOM   595  C C   . GLN A 1 78  ? 23.054  23.626 11.599 1.00 15.09 ? 78  GLN A C   1 
ATOM   596  O O   . GLN A 1 78  ? 23.575  22.574 11.250 1.00 17.34 ? 78  GLN A O   1 
ATOM   597  C CB  . GLN A 1 78  ? 21.164  23.247 13.030 1.00 12.12 ? 78  GLN A CB  1 
ATOM   598  C CG  . GLN A 1 78  ? 21.089  21.751 12.780 1.00 11.81 ? 78  GLN A CG  1 
ATOM   599  C CD  . GLN A 1 78  ? 21.837  20.952 13.836 1.00 12.01 ? 78  GLN A CD  1 
ATOM   600  O OE1 . GLN A 1 78  ? 23.072  20.934 13.853 1.00 13.44 ? 78  GLN A OE1 1 
ATOM   601  N NE2 . GLN A 1 78  ? 21.102  20.274 14.708 1.00 9.86  ? 78  GLN A NE2 1 
ATOM   602  N N   . LYS A 1 79  ? 22.686  24.596 10.764 1.00 16.89 ? 79  LYS A N   1 
ATOM   603  C CA  . LYS A 1 79  ? 23.113  24.681 9.370  1.00 17.60 ? 79  LYS A CA  1 
ATOM   604  C C   . LYS A 1 79  ? 24.672  24.717 9.207  1.00 15.70 ? 79  LYS A C   1 
ATOM   605  O O   . LYS A 1 79  ? 25.230  24.120 8.284  1.00 15.03 ? 79  LYS A O   1 
ATOM   606  C CB  . LYS A 1 79  ? 22.479  25.934 8.749  1.00 20.06 ? 79  LYS A CB  1 
ATOM   607  C CG  . LYS A 1 79  ? 21.134  25.679 8.108  1.00 25.62 ? 79  LYS A CG  1 
ATOM   608  C CD  . LYS A 1 79  ? 20.471  26.995 7.686  1.00 30.10 ? 79  LYS A CD  1 
ATOM   609  C CE  . LYS A 1 79  ? 18.908  26.882 7.463  1.00 31.89 ? 79  LYS A CE  1 
ATOM   610  N NZ  . LYS A 1 79  ? 18.285  28.299 7.363  1.00 34.41 ? 79  LYS A NZ  1 
ATOM   611  N N   . ALA A 1 80  ? 25.361  25.474 10.056 1.00 12.91 ? 80  ALA A N   1 
ATOM   612  C CA  . ALA A 1 80  ? 26.814  25.551 9.978  1.00 12.34 ? 80  ALA A CA  1 
ATOM   613  C C   . ALA A 1 80  ? 27.410  24.119 10.159 1.00 13.47 ? 80  ALA A C   1 
ATOM   614  O O   . ALA A 1 80  ? 28.166  23.598 9.320  1.00 11.49 ? 80  ALA A O   1 
ATOM   615  C CB  . ALA A 1 80  ? 27.315  26.500 11.040 1.00 9.09  ? 80  ALA A CB  1 
ATOM   616  N N   . CYS A 1 81  ? 26.977  23.487 11.254 1.00 14.63 ? 81  CYS A N   1 
ATOM   617  C CA  . CYS A 1 81  ? 27.362  22.141 11.655 1.00 13.35 ? 81  CYS A CA  1 
ATOM   618  C C   . CYS A 1 81  ? 26.978  21.124 10.590 1.00 14.44 ? 81  CYS A C   1 
ATOM   619  O O   . CYS A 1 81  ? 27.784  20.304 10.159 1.00 16.43 ? 81  CYS A O   1 
ATOM   620  C CB  . CYS A 1 81  ? 26.663  21.810 12.951 1.00 10.82 ? 81  CYS A CB  1 
ATOM   621  S SG  . CYS A 1 81  ? 27.201  22.792 14.345 1.00 10.56 ? 81  CYS A SG  1 
ATOM   622  N N   . MET A 1 82  ? 25.732  21.145 10.155 1.00 15.43 ? 82  MET A N   1 
ATOM   623  C CA  . MET A 1 82  ? 25.357  20.186 9.135  1.00 15.81 ? 82  MET A CA  1 
ATOM   624  C C   . MET A 1 82  ? 26.228  20.392 7.895  1.00 13.84 ? 82  MET A C   1 
ATOM   625  O O   . MET A 1 82  ? 26.237  19.538 7.008  1.00 12.56 ? 82  MET A O   1 
ATOM   626  C CB  . MET A 1 82  ? 23.878  20.326 8.781  1.00 18.86 ? 82  MET A CB  1 
ATOM   627  C CG  . MET A 1 82  ? 22.955  19.875 9.876  1.00 20.70 ? 82  MET A CG  1 
ATOM   628  S SD  . MET A 1 82  ? 23.425  18.212 10.362 1.00 25.99 ? 82  MET A SD  1 
ATOM   629  C CE  . MET A 1 82  ? 22.706  17.305 9.026  1.00 23.52 ? 82  MET A CE  1 
ATOM   630  N N   . SER A 1 83  ? 26.922  21.528 7.817  1.00 11.35 ? 83  SER A N   1 
ATOM   631  C CA  . SER A 1 83  ? 27.756  21.785 6.657  1.00 9.82  ? 83  SER A CA  1 
ATOM   632  C C   . SER A 1 83  ? 29.215  21.408 6.840  1.00 11.01 ? 83  SER A C   1 
ATOM   633  O O   . SER A 1 83  ? 30.069  21.998 6.193  1.00 15.45 ? 83  SER A O   1 
ATOM   634  C CB  . SER A 1 83  ? 27.645  23.234 6.164  1.00 8.18  ? 83  SER A CB  1 
ATOM   635  O OG  . SER A 1 83  ? 28.466  24.146 6.856  1.00 6.48  ? 83  SER A OG  1 
ATOM   636  N N   . THR A 1 84  ? 29.524  20.501 7.760  1.00 9.83  ? 84  THR A N   1 
ATOM   637  C CA  . THR A 1 84  ? 30.905  20.072 7.948  1.00 9.29  ? 84  THR A CA  1 
ATOM   638  C C   . THR A 1 84  ? 31.056  18.893 7.005  1.00 8.80  ? 84  THR A C   1 
ATOM   639  O O   . THR A 1 84  ? 30.102  18.483 6.386  1.00 8.51  ? 84  THR A O   1 
ATOM   640  C CB  . THR A 1 84  ? 31.191  19.576 9.360  1.00 8.60  ? 84  THR A CB  1 
ATOM   641  O OG1 . THR A 1 84  ? 30.159  18.664 9.726  1.00 11.18 ? 84  THR A OG1 1 
ATOM   642  C CG2 . THR A 1 84  ? 31.233  20.692 10.337 1.00 6.99  ? 84  THR A CG2 1 
ATOM   643  N N   . ARG A 1 85  ? 32.265  18.379 6.876  1.00 10.23 ? 85  ARG A N   1 
ATOM   644  C CA  . ARG A 1 85  ? 32.546  17.268 5.995  1.00 12.50 ? 85  ARG A CA  1 
ATOM   645  C C   . ARG A 1 85  ? 31.711  16.035 6.302  1.00 14.78 ? 85  ARG A C   1 
ATOM   646  O O   . ARG A 1 85  ? 31.453  15.215 5.396  1.00 17.18 ? 85  ARG A O   1 
ATOM   647  C CB  . ARG A 1 85  ? 34.021  16.899 6.067  1.00 12.08 ? 85  ARG A CB  1 
ATOM   648  C CG  . ARG A 1 85  ? 34.359  15.718 5.212  1.00 11.21 ? 85  ARG A CG  1 
ATOM   649  C CD  . ARG A 1 85  ? 35.817  15.288 5.429  1.00 12.01 ? 85  ARG A CD  1 
ATOM   650  N NE  . ARG A 1 85  ? 36.071  14.667 6.730  1.00 10.98 ? 85  ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 85  ? 36.402  13.384 6.913  1.00 11.54 ? 85  ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 85  ? 36.518  12.554 5.886  1.00 11.80 ? 85  ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 85  ? 36.625  12.923 8.141  1.00 10.11 ? 85  ARG A NH2 1 
ATOM   654  N N   . LEU A 1 86  ? 31.407  15.843 7.588  1.00 15.05 ? 86  LEU A N   1 
ATOM   655  C CA  . LEU A 1 86  ? 30.616  14.697 8.033  1.00 14.32 ? 86  LEU A CA  1 
ATOM   656  C C   . LEU A 1 86  ? 29.150  15.107 8.302  1.00 13.77 ? 86  LEU A C   1 
ATOM   657  O O   . LEU A 1 86  ? 28.270  14.234 8.431  1.00 12.19 ? 86  LEU A O   1 
ATOM   658  C CB  . LEU A 1 86  ? 31.272  14.022 9.265  1.00 14.09 ? 86  LEU A CB  1 
ATOM   659  C CG  . LEU A 1 86  ? 32.666  13.395 9.006  1.00 16.04 ? 86  LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 86  ? 33.290  12.793 10.277 1.00 13.84 ? 86  LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 86  ? 32.563  12.313 7.883  1.00 15.95 ? 86  LEU A CD2 1 
ATOM   662  N N   . GLY A 1 87  ? 28.905  16.426 8.305  1.00 11.42 ? 87  GLY A N   1 
ATOM   663  C CA  . GLY A 1 87  ? 27.590  16.955 8.583  1.00 11.25 ? 87  GLY A CA  1 
ATOM   664  C C   . GLY A 1 87  ? 26.996  16.313 9.833  1.00 12.61 ? 87  GLY A C   1 
ATOM   665  O O   . GLY A 1 87  ? 25.895  15.724 9.846  1.00 11.67 ? 87  GLY A O   1 
ATOM   666  N N   . ILE A 1 88  ? 27.753  16.359 10.916 1.00 14.42 ? 88  ILE A N   1 
ATOM   667  C CA  . ILE A 1 88  ? 27.270  15.753 12.151 1.00 14.16 ? 88  ILE A CA  1 
ATOM   668  C C   . ILE A 1 88  ? 26.514  16.867 12.848 1.00 14.47 ? 88  ILE A C   1 
ATOM   669  O O   . ILE A 1 88  ? 27.083  17.916 13.088 1.00 15.10 ? 88  ILE A O   1 
ATOM   670  C CB  . ILE A 1 88  ? 28.425  15.269 13.057 1.00 11.82 ? 88  ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 88  ? 29.213  14.148 12.394 1.00 8.64  ? 88  ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 88  ? 27.845  14.761 14.362 1.00 12.26 ? 88  ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 88  ? 30.303  13.670 13.251 1.00 7.33  ? 88  ILE A CD1 1 
ATOM   674  N N   . PRO A 1 89  ? 25.188  16.687 13.086 1.00 14.06 ? 89  PRO A N   1 
ATOM   675  C CA  . PRO A 1 89  ? 24.388  17.773 13.675 1.00 12.39 ? 89  PRO A CA  1 
ATOM   676  C C   . PRO A 1 89  ? 24.810  18.061 15.129 1.00 11.87 ? 89  PRO A C   1 
ATOM   677  O O   . PRO A 1 89  ? 25.235  17.141 15.892 1.00 11.32 ? 89  PRO A O   1 
ATOM   678  C CB  . PRO A 1 89  ? 22.981  17.214 13.586 1.00 11.55 ? 89  PRO A CB  1 
ATOM   679  C CG  . PRO A 1 89  ? 23.227  15.736 13.786 1.00 11.50 ? 89  PRO A CG  1 
ATOM   680  C CD  . PRO A 1 89  ? 24.355  15.492 12.864 1.00 12.77 ? 89  PRO A CD  1 
ATOM   681  N N   . MET A 1 90  ? 24.710  19.327 15.506 1.00 8.87  ? 90  MET A N   1 
ATOM   682  C CA  . MET A 1 90  ? 25.052  19.702 16.858 1.00 10.51 ? 90  MET A CA  1 
ATOM   683  C C   . MET A 1 90  ? 23.785  19.506 17.781 1.00 11.92 ? 90  MET A C   1 
ATOM   684  O O   . MET A 1 90  ? 22.664  19.385 17.275 1.00 15.74 ? 90  MET A O   1 
ATOM   685  C CB  . MET A 1 90  ? 25.549  21.133 16.833 1.00 7.67  ? 90  MET A CB  1 
ATOM   686  C CG  . MET A 1 90  ? 24.490  22.093 16.520 1.00 7.04  ? 90  MET A CG  1 
ATOM   687  S SD  . MET A 1 90  ? 23.493  22.499 17.938 1.00 10.75 ? 90  MET A SD  1 
ATOM   688  C CE  . MET A 1 90  ? 22.026  23.309 17.230 1.00 8.24  ? 90  MET A CE  1 
ATOM   689  N N   . ILE A 1 91  ? 23.965  19.407 19.105 1.00 11.02 ? 91  ILE A N   1 
ATOM   690  C CA  . ILE A 1 91  ? 22.866  19.229 20.084 1.00 8.32  ? 91  ILE A CA  1 
ATOM   691  C C   . ILE A 1 91  ? 22.853  20.511 20.881 1.00 9.16  ? 91  ILE A C   1 
ATOM   692  O O   . ILE A 1 91  ? 23.908  20.987 21.277 1.00 11.03 ? 91  ILE A O   1 
ATOM   693  C CB  . ILE A 1 91  ? 23.112  18.009 21.042 1.00 7.08  ? 91  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 91  ? 21.995  17.881 22.035 1.00 6.15  ? 91  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 91  ? 24.343  18.164 21.899 1.00 6.83  ? 91  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 91  ? 21.922  16.482 22.594 1.00 5.46  ? 91  ILE A CD1 1 
ATOM   697  N N   . TYR A 1 92  ? 21.689  21.124 21.046 1.00 8.29  ? 92  TYR A N   1 
ATOM   698  C CA  . TYR A 1 92  ? 21.637  22.380 21.760 1.00 6.39  ? 92  TYR A CA  1 
ATOM   699  C C   . TYR A 1 92  ? 21.030  22.201 23.141 1.00 6.21  ? 92  TYR A C   1 
ATOM   700  O O   . TYR A 1 92  ? 19.877  21.804 23.255 1.00 4.44  ? 92  TYR A O   1 
ATOM   701  C CB  . TYR A 1 92  ? 20.856  23.406 20.936 1.00 6.24  ? 92  TYR A CB  1 
ATOM   702  C CG  . TYR A 1 92  ? 21.003  24.854 21.391 1.00 6.04  ? 92  TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 92  ? 21.705  25.773 20.614 1.00 5.94  ? 92  TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 92  ? 20.422  25.311 22.598 1.00 4.92  ? 92  TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 92  ? 21.824  27.106 21.014 1.00 5.06  ? 92  TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 92  ? 20.540  26.635 23.009 1.00 4.38  ? 92  TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 92  ? 21.237  27.519 22.212 1.00 4.81  ? 92  TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 92  ? 21.372  28.817 22.609 1.00 5.18  ? 92  TYR A OH  1 
ATOM   709  N N   . GLY A 1 93  ? 21.819  22.503 24.173 1.00 5.37  ? 93  GLY A N   1 
ATOM   710  C CA  . GLY A 1 93  ? 21.374  22.392 25.554 1.00 5.77  ? 93  GLY A CA  1 
ATOM   711  C C   . GLY A 1 93  ? 20.968  23.704 26.239 1.00 6.10  ? 93  GLY A C   1 
ATOM   712  O O   . GLY A 1 93  ? 21.410  24.798 25.854 1.00 8.09  ? 93  GLY A O   1 
ATOM   713  N N   . ILE A 1 94  ? 20.160  23.585 27.291 1.00 5.29  ? 94  ILE A N   1 
ATOM   714  C CA  . ILE A 1 94  ? 19.648  24.718 28.037 1.00 3.94  ? 94  ILE A CA  1 
ATOM   715  C C   . ILE A 1 94  ? 19.016  24.223 29.351 1.00 5.55  ? 94  ILE A C   1 
ATOM   716  O O   . ILE A 1 94  ? 18.598  23.083 29.480 1.00 2.28  ? 94  ILE A O   1 
ATOM   717  C CB  . ILE A 1 94  ? 18.560  25.419 27.216 1.00 4.40  ? 94  ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 94  ? 18.262  26.825 27.771 1.00 5.32  ? 94  ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 94  ? 17.277  24.550 27.193 1.00 2.76  ? 94  ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 94  ? 17.402  27.752 26.839 1.00 2.78  ? 94  ILE A CD1 1 
ATOM   721  N N   . ASP A 1 95  ? 19.104  25.069 30.365 1.00 8.90  ? 95  ASP A N   1 
ATOM   722  C CA  . ASP A 1 95  ? 18.521  24.842 31.684 1.00 10.38 ? 95  ASP A CA  1 
ATOM   723  C C   . ASP A 1 95  ? 17.008  25.049 31.664 1.00 11.68 ? 95  ASP A C   1 
ATOM   724  O O   . ASP A 1 95  ? 16.539  26.171 31.959 1.00 12.76 ? 95  ASP A O   1 
ATOM   725  C CB  . ASP A 1 95  ? 19.088  25.845 32.656 1.00 10.85 ? 95  ASP A CB  1 
ATOM   726  C CG  . ASP A 1 95  ? 20.494  25.571 32.952 1.00 14.08 ? 95  ASP A CG  1 
ATOM   727  O OD1 . ASP A 1 95  ? 21.356  26.285 32.396 1.00 15.58 ? 95  ASP A OD1 1 
ATOM   728  O OD2 . ASP A 1 95  ? 20.775  24.581 33.675 1.00 13.87 ? 95  ASP A OD2 1 
ATOM   729  N N   . ALA A 1 96  ? 16.270  24.034 31.203 1.00 9.82  ? 96  ALA A N   1 
ATOM   730  C CA  . ALA A 1 96  ? 14.818  24.068 31.234 1.00 8.02  ? 96  ALA A CA  1 
ATOM   731  C C   . ALA A 1 96  ? 14.608  23.331 32.550 1.00 8.61  ? 96  ALA A C   1 
ATOM   732  O O   . ALA A 1 96  ? 14.533  22.109 32.553 1.00 8.26  ? 96  ALA A O   1 
ATOM   733  C CB  . ALA A 1 96  ? 14.279  23.275 30.118 1.00 8.05  ? 96  ALA A CB  1 
ATOM   734  N N   . VAL A 1 97  ? 14.740  24.055 33.673 1.00 9.79  ? 97  VAL A N   1 
ATOM   735  C CA  . VAL A 1 97  ? 14.635  23.445 35.008 1.00 9.17  ? 97  VAL A CA  1 
ATOM   736  C C   . VAL A 1 97  ? 13.311  23.527 35.757 1.00 9.01  ? 97  VAL A C   1 
ATOM   737  O O   . VAL A 1 97  ? 13.179  22.837 36.740 1.00 11.09 ? 97  VAL A O   1 
ATOM   738  C CB  . VAL A 1 97  ? 15.846  23.761 35.922 1.00 7.94  ? 97  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 97  ? 17.144  23.441 35.205 1.00 6.59  ? 97  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 97  ? 15.826  25.192 36.376 1.00 9.18  ? 97  VAL A CG2 1 
ATOM   741  N N   . HIS A 1 98  ? 12.474  24.528 35.464 1.00 8.44  ? 98  HIS A N   1 
ATOM   742  C CA  . HIS A 1 98  ? 11.102  24.577 35.991 1.00 6.50  ? 98  HIS A CA  1 
ATOM   743  C C   . HIS A 1 98  ? 10.235  25.145 34.884 1.00 6.23  ? 98  HIS A C   1 
ATOM   744  O O   . HIS A 1 98  ? 9.496   26.107 35.053 1.00 6.13  ? 98  HIS A O   1 
ATOM   745  C CB  . HIS A 1 98  ? 10.915  25.253 37.337 1.00 5.64  ? 98  HIS A CB  1 
ATOM   746  C CG  . HIS A 1 98  ? 11.271  26.697 37.389 1.00 6.49  ? 98  HIS A CG  1 
ATOM   747  N ND1 . HIS A 1 98  ? 10.520  27.615 38.084 1.00 5.52  ? 98  HIS A ND1 1 
ATOM   748  C CD2 . HIS A 1 98  ? 12.358  27.386 36.934 1.00 6.79  ? 98  HIS A CD2 1 
ATOM   749  C CE1 . HIS A 1 98  ? 11.117  28.796 38.069 1.00 5.19  ? 98  HIS A CE1 1 
ATOM   750  N NE2 . HIS A 1 98  ? 12.233  28.668 37.372 1.00 4.82  ? 98  HIS A NE2 1 
ATOM   751  N N   . GLY A 1 99  ? 10.349  24.472 33.738 1.00 6.49  ? 99  GLY A N   1 
ATOM   752  C CA  . GLY A 1 99  ? 9.666   24.802 32.505 1.00 6.62  ? 99  GLY A CA  1 
ATOM   753  C C   . GLY A 1 99  ? 10.796  25.252 31.578 1.00 6.97  ? 99  GLY A C   1 
ATOM   754  O O   . GLY A 1 99  ? 11.961  25.064 31.926 1.00 7.56  ? 99  GLY A O   1 
ATOM   755  N N   . GLN A 1 100 ? 10.480  25.738 30.375 1.00 6.24  ? 100 GLN A N   1 
ATOM   756  C CA  . GLN A 1 100 ? 11.474  26.270 29.442 1.00 7.40  ? 100 GLN A CA  1 
ATOM   757  C C   . GLN A 1 100 ? 11.682  27.729 29.953 1.00 8.15  ? 100 GLN A C   1 
ATOM   758  O O   . GLN A 1 100 ? 11.323  28.707 29.294 1.00 7.28  ? 100 GLN A O   1 
ATOM   759  C CB  . GLN A 1 100 ? 10.893  26.244 28.020 1.00 7.84  ? 100 GLN A CB  1 
ATOM   760  C CG  . GLN A 1 100 ? 11.734  26.938 26.928 1.00 8.79  ? 100 GLN A CG  1 
ATOM   761  C CD  . GLN A 1 100 ? 13.180  26.429 26.840 1.00 8.89  ? 100 GLN A CD  1 
ATOM   762  O OE1 . GLN A 1 100 ? 13.821  26.151 27.862 1.00 7.28  ? 100 GLN A OE1 1 
ATOM   763  N NE2 . GLN A 1 100 ? 13.698  26.312 25.607 1.00 9.26  ? 100 GLN A NE2 1 
ATOM   764  N N   . ASN A 1 101 ? 12.212  27.832 31.171 1.00 8.74  ? 101 ASN A N   1 
ATOM   765  C CA  . ASN A 1 101 ? 12.390  29.073 31.906 1.00 9.66  ? 101 ASN A CA  1 
ATOM   766  C C   . ASN A 1 101 ? 13.144  30.314 31.412 1.00 11.16 ? 101 ASN A C   1 
ATOM   767  O O   . ASN A 1 101 ? 12.916  31.421 31.938 1.00 11.34 ? 101 ASN A O   1 
ATOM   768  C CB  . ASN A 1 101 ? 12.764  28.758 33.364 1.00 7.81  ? 101 ASN A CB  1 
ATOM   769  C CG  . ASN A 1 101 ? 13.943  27.769 33.506 1.00 7.51  ? 101 ASN A CG  1 
ATOM   770  O OD1 . ASN A 1 101 ? 15.101  28.070 33.220 1.00 4.10  ? 101 ASN A OD1 1 
ATOM   771  N ND2 . ASN A 1 101 ? 13.639  26.613 34.075 1.00 8.06  ? 101 ASN A ND2 1 
ATOM   772  N N   . ASN A 1 102 ? 13.993  30.179 30.399 1.00 10.98 ? 102 ASN A N   1 
ATOM   773  C CA  . ASN A 1 102 ? 14.732  31.362 29.906 1.00 10.81 ? 102 ASN A CA  1 
ATOM   774  C C   . ASN A 1 102 ? 13.875  32.101 28.872 1.00 9.56  ? 102 ASN A C   1 
ATOM   775  O O   . ASN A 1 102 ? 14.042  33.268 28.621 1.00 9.03  ? 102 ASN A O   1 
ATOM   776  C CB  . ASN A 1 102 ? 16.084  30.968 29.256 1.00 12.29 ? 102 ASN A CB  1 
ATOM   777  C CG  . ASN A 1 102 ? 17.219  30.638 30.290 1.00 13.87 ? 102 ASN A CG  1 
ATOM   778  O OD1 . ASN A 1 102 ? 17.823  29.563 30.212 1.00 15.91 ? 102 ASN A OD1 1 
ATOM   779  N ND2 . ASN A 1 102 ? 17.566  31.590 31.167 1.00 10.27 ? 102 ASN A ND2 1 
ATOM   780  N N   . VAL A 1 103 ? 12.891  31.395 28.366 1.00 8.08  ? 103 VAL A N   1 
ATOM   781  C CA  . VAL A 1 103 ? 12.022  31.863 27.324 1.00 8.03  ? 103 VAL A CA  1 
ATOM   782  C C   . VAL A 1 103 ? 10.786  32.659 27.751 1.00 10.53 ? 103 VAL A C   1 
ATOM   783  O O   . VAL A 1 103 ? 9.934   32.185 28.517 1.00 12.67 ? 103 VAL A O   1 
ATOM   784  C CB  . VAL A 1 103 ? 11.591  30.629 26.488 1.00 6.68  ? 103 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 103 ? 10.657  31.032 25.347 1.00 4.67  ? 103 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 103 ? 12.862  29.837 26.040 1.00 3.23  ? 103 VAL A CG2 1 
ATOM   787  N N   . TYR A 1 104 ? 10.641  33.850 27.186 1.00 11.53 ? 104 TYR A N   1 
ATOM   788  C CA  . TYR A 1 104 ? 9.498   34.688 27.494 1.00 10.57 ? 104 TYR A CA  1 
ATOM   789  C C   . TYR A 1 104 ? 8.193   33.961 27.085 1.00 10.95 ? 104 TYR A C   1 
ATOM   790  O O   . TYR A 1 104 ? 8.067   33.397 25.987 1.00 10.32 ? 104 TYR A O   1 
ATOM   791  C CB  . TYR A 1 104 ? 9.644   36.036 26.797 1.00 11.87 ? 104 TYR A CB  1 
ATOM   792  C CG  . TYR A 1 104 ? 8.437   36.897 27.009 1.00 14.16 ? 104 TYR A CG  1 
ATOM   793  C CD1 . TYR A 1 104 ? 8.348   37.748 28.101 1.00 14.05 ? 104 TYR A CD1 1 
ATOM   794  C CD2 . TYR A 1 104 ? 7.352   36.816 26.149 1.00 14.04 ? 104 TYR A CD2 1 
ATOM   795  C CE1 . TYR A 1 104 ? 7.214   38.485 28.321 1.00 14.42 ? 104 TYR A CE1 1 
ATOM   796  C CE2 . TYR A 1 104 ? 6.234   37.555 26.369 1.00 15.48 ? 104 TYR A CE2 1 
ATOM   797  C CZ  . TYR A 1 104 ? 6.168   38.394 27.441 1.00 14.47 ? 104 TYR A CZ  1 
ATOM   798  O OH  . TYR A 1 104 ? 5.091   39.256 27.541 1.00 16.68 ? 104 TYR A OH  1 
ATOM   799  N N   . GLY A 1 105 ? 7.212   34.016 27.970 1.00 10.91 ? 105 GLY A N   1 
ATOM   800  C CA  . GLY A 1 105 ? 5.975   33.324 27.728 1.00 9.12  ? 105 GLY A CA  1 
ATOM   801  C C   . GLY A 1 105 ? 6.048   31.843 28.066 1.00 9.09  ? 105 GLY A C   1 
ATOM   802  O O   . GLY A 1 105 ? 5.034   31.156 27.943 1.00 10.06 ? 105 GLY A O   1 
ATOM   803  N N   . ALA A 1 106 ? 7.217   31.282 28.372 1.00 8.09  ? 106 ALA A N   1 
ATOM   804  C CA  . ALA A 1 106 ? 7.205   29.856 28.744 1.00 8.29  ? 106 ALA A CA  1 
ATOM   805  C C   . ALA A 1 106 ? 6.456   29.660 30.065 1.00 8.45  ? 106 ALA A C   1 
ATOM   806  O O   . ALA A 1 106 ? 6.366   30.566 30.866 1.00 10.00 ? 106 ALA A O   1 
ATOM   807  C CB  . ALA A 1 106 ? 8.603   29.297 28.859 1.00 5.88  ? 106 ALA A CB  1 
ATOM   808  N N   . THR A 1 107 ? 5.808   28.521 30.219 1.00 8.94  ? 107 THR A N   1 
ATOM   809  C CA  . THR A 1 107 ? 5.092   28.191 31.445 1.00 7.50  ? 107 THR A CA  1 
ATOM   810  C C   . THR A 1 107 ? 6.116   27.878 32.518 1.00 8.04  ? 107 THR A C   1 
ATOM   811  O O   . THR A 1 107 ? 6.975   27.016 32.324 1.00 8.55  ? 107 THR A O   1 
ATOM   812  C CB  . THR A 1 107 ? 4.285   26.933 31.244 1.00 7.58  ? 107 THR A CB  1 
ATOM   813  O OG1 . THR A 1 107 ? 3.228   27.203 30.309 1.00 8.40  ? 107 THR A OG1 1 
ATOM   814  C CG2 . THR A 1 107 ? 3.762   26.423 32.537 1.00 6.50  ? 107 THR A CG2 1 
ATOM   815  N N   . ILE A 1 108 ? 6.055   28.607 33.630 1.00 8.00  ? 108 ILE A N   1 
ATOM   816  C CA  . ILE A 1 108 ? 6.984   28.386 34.729 1.00 6.69  ? 108 ILE A CA  1 
ATOM   817  C C   . ILE A 1 108 ? 6.313   27.508 35.801 1.00 6.97  ? 108 ILE A C   1 
ATOM   818  O O   . ILE A 1 108 ? 5.306   27.909 36.362 1.00 7.64  ? 108 ILE A O   1 
ATOM   819  C CB  . ILE A 1 108 ? 7.462   29.722 35.337 1.00 5.12  ? 108 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 108 ? 8.183   30.594 34.282 1.00 4.58  ? 108 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 108 ? 8.365   29.446 36.519 1.00 4.80  ? 108 ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 108 ? 9.295   29.897 33.419 1.00 2.14  ? 108 ILE A CD1 1 
ATOM   823  N N   . PHE A 1 109 ? 6.794   26.274 35.954 1.00 6.34  ? 109 PHE A N   1 
ATOM   824  C CA  . PHE A 1 109 ? 6.278   25.314 36.934 1.00 8.14  ? 109 PHE A CA  1 
ATOM   825  C C   . PHE A 1 109 ? 6.860   25.626 38.310 1.00 9.60  ? 109 PHE A C   1 
ATOM   826  O O   . PHE A 1 109 ? 7.832   26.390 38.431 1.00 12.96 ? 109 PHE A O   1 
ATOM   827  C CB  . PHE A 1 109 ? 6.643   23.856 36.522 1.00 9.21  ? 109 PHE A CB  1 
ATOM   828  C CG  . PHE A 1 109 ? 5.985   23.414 35.228 1.00 10.65 ? 109 PHE A CG  1 
ATOM   829  C CD1 . PHE A 1 109 ? 6.551   23.751 33.989 1.00 12.00 ? 109 PHE A CD1 1 
ATOM   830  C CD2 . PHE A 1 109 ? 4.753   22.808 35.239 1.00 11.19 ? 109 PHE A CD2 1 
ATOM   831  C CE1 . PHE A 1 109 ? 5.897   23.512 32.789 1.00 10.87 ? 109 PHE A CE1 1 
ATOM   832  C CE2 . PHE A 1 109 ? 4.081   22.559 34.045 1.00 12.50 ? 109 PHE A CE2 1 
ATOM   833  C CZ  . PHE A 1 109 ? 4.658   22.921 32.815 1.00 11.83 ? 109 PHE A CZ  1 
ATOM   834  N N   . PRO A 1 110 ? 6.278   25.067 39.379 1.00 9.31  ? 110 PRO A N   1 
ATOM   835  C CA  . PRO A 1 110 ? 6.889   25.196 40.707 1.00 8.74  ? 110 PRO A CA  1 
ATOM   836  C C   . PRO A 1 110 ? 8.320   24.630 40.745 1.00 7.75  ? 110 PRO A C   1 
ATOM   837  O O   . PRO A 1 110 ? 8.519   23.566 40.179 1.00 6.38  ? 110 PRO A O   1 
ATOM   838  C CB  . PRO A 1 110 ? 5.989   24.308 41.560 1.00 7.42  ? 110 PRO A CB  1 
ATOM   839  C CG  . PRO A 1 110 ? 4.768   24.417 40.953 1.00 8.11  ? 110 PRO A CG  1 
ATOM   840  C CD  . PRO A 1 110 ? 5.000   24.353 39.494 1.00 8.01  ? 110 PRO A CD  1 
ATOM   841  N N   . HIS A 1 111 ? 9.274   25.304 41.400 1.00 7.63  ? 111 HIS A N   1 
ATOM   842  C CA  . HIS A 1 111 ? 10.631  24.742 41.534 1.00 8.79  ? 111 HIS A CA  1 
ATOM   843  C C   . HIS A 1 111 ? 10.570  23.409 42.303 1.00 10.33 ? 111 HIS A C   1 
ATOM   844  O O   . HIS A 1 111 ? 9.562   23.093 42.956 1.00 11.16 ? 111 HIS A O   1 
ATOM   845  C CB  . HIS A 1 111 ? 11.602  25.722 42.188 1.00 8.56  ? 111 HIS A CB  1 
ATOM   846  C CG  . HIS A 1 111 ? 12.308  26.633 41.203 1.00 9.15  ? 111 HIS A CG  1 
ATOM   847  N ND1 . HIS A 1 111 ? 13.153  26.166 40.215 1.00 7.76  ? 111 HIS A ND1 1 
ATOM   848  C CD2 . HIS A 1 111 ? 12.365  27.984 41.128 1.00 7.30  ? 111 HIS A CD2 1 
ATOM   849  C CE1 . HIS A 1 111 ? 13.706  27.186 39.596 1.00 7.42  ? 111 HIS A CE1 1 
ATOM   850  N NE2 . HIS A 1 111 ? 13.246  28.300 40.128 1.00 5.88  ? 111 HIS A NE2 1 
ATOM   851  N N   . ASN A 1 112 ? 11.614  22.599 42.172 1.00 10.86 ? 112 ASN A N   1 
ATOM   852  C CA  . ASN A 1 112 ? 11.676  21.258 42.766 1.00 10.90 ? 112 ASN A CA  1 
ATOM   853  C C   . ASN A 1 112 ? 11.237  20.970 44.159 1.00 11.38 ? 112 ASN A C   1 
ATOM   854  O O   . ASN A 1 112 ? 10.649  19.937 44.368 1.00 14.29 ? 112 ASN A O   1 
ATOM   855  C CB  . ASN A 1 112 ? 13.060  20.687 42.651 1.00 12.82 ? 112 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 112 ? 13.328  20.169 41.317 1.00 13.22 ? 112 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 112 ? 12.516  20.324 40.423 1.00 14.47 ? 112 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 112 ? 14.447  19.489 41.169 1.00 14.46 ? 112 ASN A ND2 1 
ATOM   859  N N   . VAL A 1 113 ? 11.733  21.726 45.134 1.00 10.73 ? 113 VAL A N   1 
ATOM   860  C CA  . VAL A 1 113 ? 11.349  21.516 46.525 1.00 9.94  ? 113 VAL A CA  1 
ATOM   861  C C   . VAL A 1 113 ? 9.807   21.520 46.667 1.00 10.84 ? 113 VAL A C   1 
ATOM   862  O O   . VAL A 1 113 ? 9.226   20.673 47.353 1.00 13.66 ? 113 VAL A O   1 
ATOM   863  C CB  . VAL A 1 113 ? 12.061  22.562 47.476 1.00 9.89  ? 113 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 113 ? 11.773  24.012 47.077 1.00 8.62  ? 113 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 113 ? 11.691  22.307 48.913 1.00 9.19  ? 113 VAL A CG2 1 
ATOM   866  N N   . GLY A 1 114 ? 9.148   22.462 46.003 1.00 9.84  ? 114 GLY A N   1 
ATOM   867  C CA  . GLY A 1 114 ? 7.703   22.541 46.044 1.00 7.72  ? 114 GLY A CA  1 
ATOM   868  C C   . GLY A 1 114 ? 7.157   21.292 45.395 1.00 7.49  ? 114 GLY A C   1 
ATOM   869  O O   . GLY A 1 114 ? 6.099   20.801 45.763 1.00 7.62  ? 114 GLY A O   1 
ATOM   870  N N   . LEU A 1 115 ? 7.864   20.761 44.404 1.00 7.82  ? 115 LEU A N   1 
ATOM   871  C CA  . LEU A 1 115 ? 7.400   19.536 43.756 1.00 7.45  ? 115 LEU A CA  1 
ATOM   872  C C   . LEU A 1 115 ? 7.533   18.327 44.717 1.00 7.34  ? 115 LEU A C   1 
ATOM   873  O O   . LEU A 1 115 ? 6.688   17.438 44.731 1.00 5.79  ? 115 LEU A O   1 
ATOM   874  C CB  . LEU A 1 115 ? 8.103   19.335 42.401 1.00 6.01  ? 115 LEU A CB  1 
ATOM   875  C CG  . LEU A 1 115 ? 7.800   20.436 41.357 1.00 4.60  ? 115 LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 115 ? 8.573   20.210 40.054 1.00 3.98  ? 115 LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 115 ? 6.338   20.478 41.066 1.00 3.93  ? 115 LEU A CD2 1 
ATOM   878  N N   . GLY A 1 116 ? 8.546   18.360 45.573 1.00 7.57  ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? 8.737   17.311 46.545 1.00 9.18  ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? 7.540   17.302 47.483 1.00 12.04 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? 7.051   16.217 47.873 1.00 14.42 ? 116 GLY A O   1 
ATOM   882  N N   . ALA A 1 117 ? 7.040   18.492 47.844 1.00 11.84 ? 117 ALA A N   1 
ATOM   883  C CA  . ALA A 1 117 ? 5.878   18.606 48.747 1.00 10.35 ? 117 ALA A CA  1 
ATOM   884  C C   . ALA A 1 117 ? 4.646   17.908 48.236 1.00 10.03 ? 117 ALA A C   1 
ATOM   885  O O   . ALA A 1 117 ? 3.738   17.632 49.012 1.00 10.98 ? 117 ALA A O   1 
ATOM   886  C CB  . ALA A 1 117 ? 5.542   20.073 49.053 1.00 8.52  ? 117 ALA A CB  1 
ATOM   887  N N   . THR A 1 118 ? 4.612   17.657 46.930 1.00 10.63 ? 118 THR A N   1 
ATOM   888  C CA  . THR A 1 118 ? 3.458   17.021 46.307 1.00 11.47 ? 118 THR A CA  1 
ATOM   889  C C   . THR A 1 118 ? 3.475   15.523 46.444 1.00 12.25 ? 118 THR A C   1 
ATOM   890  O O   . THR A 1 118 ? 2.450   14.879 46.326 1.00 11.76 ? 118 THR A O   1 
ATOM   891  C CB  . THR A 1 118 ? 3.317   17.326 44.775 1.00 11.50 ? 118 THR A CB  1 
ATOM   892  O OG1 . THR A 1 118 ? 4.228   16.501 44.014 1.00 9.99  ? 118 THR A OG1 1 
ATOM   893  C CG2 . THR A 1 118 ? 3.450   18.844 44.482 1.00 8.67  ? 118 THR A CG2 1 
ATOM   894  N N   . ARG A 1 119 ? 4.652   14.946 46.602 1.00 12.99 ? 119 ARG A N   1 
ATOM   895  C CA  . ARG A 1 119 ? 4.716   13.502 46.737 1.00 15.17 ? 119 ARG A CA  1 
ATOM   896  C C   . ARG A 1 119 ? 3.941   12.867 45.575 1.00 16.48 ? 119 ARG A C   1 
ATOM   897  O O   . ARG A 1 119 ? 3.315   11.820 45.715 1.00 18.45 ? 119 ARG A O   1 
ATOM   898  C CB  . ARG A 1 119 ? 4.122   13.075 48.080 1.00 13.67 ? 119 ARG A CB  1 
ATOM   899  C CG  . ARG A 1 119 ? 4.734   13.758 49.271 1.00 11.31 ? 119 ARG A CG  1 
ATOM   900  C CD  . ARG A 1 119 ? 6.148   13.342 49.370 1.00 10.98 ? 119 ARG A CD  1 
ATOM   901  N NE  . ARG A 1 119 ? 6.586   13.388 50.753 1.00 9.88  ? 119 ARG A NE  1 
ATOM   902  C CZ  . ARG A 1 119 ? 6.757   14.511 51.419 1.00 9.15  ? 119 ARG A CZ  1 
ATOM   903  N NH1 . ARG A 1 119 ? 6.555   15.660 50.794 1.00 9.83  ? 119 ARG A NH1 1 
ATOM   904  N NH2 . ARG A 1 119 ? 6.989   14.482 52.721 1.00 8.50  ? 119 ARG A NH2 1 
ATOM   905  N N   . ASP A 1 120 ? 3.926   13.545 44.439 1.00 17.34 ? 120 ASP A N   1 
ATOM   906  C CA  . ASP A 1 120 ? 3.241   13.021 43.290 1.00 16.33 ? 120 ASP A CA  1 
ATOM   907  C C   . ASP A 1 120 ? 4.230   12.843 42.127 1.00 16.22 ? 120 ASP A C   1 
ATOM   908  O O   . ASP A 1 120 ? 4.490   13.770 41.350 1.00 16.34 ? 120 ASP A O   1 
ATOM   909  C CB  . ASP A 1 120 ? 2.132   13.976 42.921 1.00 18.29 ? 120 ASP A CB  1 
ATOM   910  C CG  . ASP A 1 120 ? 1.112   13.354 42.020 1.00 20.71 ? 120 ASP A CG  1 
ATOM   911  O OD1 . ASP A 1 120 ? 1.390   12.296 41.396 1.00 23.60 ? 120 ASP A OD1 1 
ATOM   912  O OD2 . ASP A 1 120 ? 0.006   13.925 41.948 1.00 23.41 ? 120 ASP A OD2 1 
ATOM   913  N N   . PRO A 1 121 ? 4.801   11.655 41.984 1.00 14.96 ? 121 PRO A N   1 
ATOM   914  C CA  . PRO A 1 121 ? 5.761   11.587 40.893 1.00 14.22 ? 121 PRO A CA  1 
ATOM   915  C C   . PRO A 1 121 ? 5.089   11.603 39.515 1.00 14.81 ? 121 PRO A C   1 
ATOM   916  O O   . PRO A 1 121 ? 5.737   11.967 38.534 1.00 17.94 ? 121 PRO A O   1 
ATOM   917  C CB  . PRO A 1 121 ? 6.478   10.271 41.133 1.00 13.69 ? 121 PRO A CB  1 
ATOM   918  C CG  . PRO A 1 121 ? 6.287   10.023 42.597 1.00 13.61 ? 121 PRO A CG  1 
ATOM   919  C CD  . PRO A 1 121 ? 4.879   10.455 42.834 1.00 14.25 ? 121 PRO A CD  1 
ATOM   920  N N   . TYR A 1 122 ? 3.804   11.259 39.418 1.00 13.20 ? 122 TYR A N   1 
ATOM   921  C CA  . TYR A 1 122 ? 3.143   11.228 38.098 1.00 12.25 ? 122 TYR A CA  1 
ATOM   922  C C   . TYR A 1 122 ? 2.947   12.603 37.522 1.00 10.65 ? 122 TYR A C   1 
ATOM   923  O O   . TYR A 1 122 ? 2.902   12.772 36.316 1.00 7.67  ? 122 TYR A O   1 
ATOM   924  C CB  . TYR A 1 122 ? 1.782   10.546 38.172 1.00 15.00 ? 122 TYR A CB  1 
ATOM   925  C CG  . TYR A 1 122 ? 1.059   10.537 36.851 1.00 16.73 ? 122 TYR A CG  1 
ATOM   926  C CD1 . TYR A 1 122 ? 1.667   9.984  35.725 1.00 17.62 ? 122 TYR A CD1 1 
ATOM   927  C CD2 . TYR A 1 122 ? -0.240  11.058 36.729 1.00 17.29 ? 122 TYR A CD2 1 
ATOM   928  C CE1 . TYR A 1 122 ? 1.024   9.937  34.520 1.00 18.67 ? 122 TYR A CE1 1 
ATOM   929  C CE2 . TYR A 1 122 ? -0.911  11.015 35.531 1.00 17.51 ? 122 TYR A CE2 1 
ATOM   930  C CZ  . TYR A 1 122 ? -0.262  10.449 34.426 1.00 20.14 ? 122 TYR A CZ  1 
ATOM   931  O OH  . TYR A 1 122 ? -0.874  10.388 33.194 1.00 23.16 ? 122 TYR A OH  1 
ATOM   932  N N   . LEU A 1 123 ? 2.605   13.524 38.419 1.00 11.27 ? 123 LEU A N   1 
ATOM   933  C CA  . LEU A 1 123 ? 2.430   14.940 38.105 1.00 11.69 ? 123 LEU A CA  1 
ATOM   934  C C   . LEU A 1 123 ? 3.819   15.446 37.696 1.00 12.86 ? 123 LEU A C   1 
ATOM   935  O O   . LEU A 1 123 ? 3.928   16.251 36.762 1.00 14.60 ? 123 LEU A O   1 
ATOM   936  C CB  . LEU A 1 123 ? 2.008   15.683 39.352 1.00 11.58 ? 123 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 123 ? 2.117   17.193 39.367 1.00 10.32 ? 123 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 123 ? 0.889   17.782 38.688 1.00 9.85  ? 123 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 123 ? 2.209   17.593 40.835 1.00 10.65 ? 123 LEU A CD2 1 
ATOM   940  N N   . VAL A 1 124 ? 4.867   15.068 38.442 1.00 10.67 ? 124 VAL A N   1 
ATOM   941  C CA  . VAL A 1 124 ? 6.213   15.471 38.021 1.00 8.86  ? 124 VAL A CA  1 
ATOM   942  C C   . VAL A 1 124 ? 6.491   14.916 36.609 1.00 9.80  ? 124 VAL A C   1 
ATOM   943  O O   . VAL A 1 124 ? 7.031   15.618 35.772 1.00 10.63 ? 124 VAL A O   1 
ATOM   944  C CB  . VAL A 1 124 ? 7.303   15.044 39.004 1.00 6.26  ? 124 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 124 ? 8.637   15.458 38.505 1.00 4.86  ? 124 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 124 ? 7.083   15.732 40.289 1.00 5.63  ? 124 VAL A CG2 1 
ATOM   947  N N   . LYS A 1 125 ? 6.059   13.696 36.309 1.00 10.96 ? 125 LYS A N   1 
ATOM   948  C CA  . LYS A 1 125 ? 6.305   13.132 34.966 1.00 12.42 ? 125 LYS A CA  1 
ATOM   949  C C   . LYS A 1 125 ? 5.565   13.934 33.871 1.00 14.45 ? 125 LYS A C   1 
ATOM   950  O O   . LYS A 1 125 ? 6.050   14.141 32.723 1.00 13.85 ? 125 LYS A O   1 
ATOM   951  C CB  . LYS A 1 125 ? 5.889   11.658 34.908 1.00 10.39 ? 125 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 125 ? 6.093   11.063 33.558 1.00 9.99  ? 125 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 125 ? 5.832   9.612  33.532 1.00 10.24 ? 125 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 125 ? 5.955   9.089  32.114 1.00 11.68 ? 125 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 125 ? 5.642   7.624  32.064 1.00 11.60 ? 125 LYS A NZ  1 
ATOM   956  N N   . ARG A 1 126 ? 4.363   14.358 34.235 1.00 15.30 ? 126 ARG A N   1 
ATOM   957  C CA  . ARG A 1 126 ? 3.544   15.140 33.345 1.00 15.90 ? 126 ARG A CA  1 
ATOM   958  C C   . ARG A 1 126 ? 4.159   16.523 33.112 1.00 14.96 ? 126 ARG A C   1 
ATOM   959  O O   . ARG A 1 126 ? 3.979   17.101 32.041 1.00 14.95 ? 126 ARG A O   1 
ATOM   960  C CB  . ARG A 1 126 ? 2.134   15.232 33.903 1.00 16.75 ? 126 ARG A CB  1 
ATOM   961  C CG  . ARG A 1 126 ? 1.424   13.947 33.778 1.00 19.46 ? 126 ARG A CG  1 
ATOM   962  C CD  . ARG A 1 126 ? 0.530   13.789 34.932 1.00 23.67 ? 126 ARG A CD  1 
ATOM   963  N NE  . ARG A 1 126 ? -0.513  14.793 34.885 1.00 28.30 ? 126 ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 126 ? -1.171  15.262 35.947 1.00 30.45 ? 126 ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 126 ? -0.906  14.811 37.186 1.00 29.58 ? 126 ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 126 ? -2.073  16.231 35.751 1.00 31.71 ? 126 ARG A NH2 1 
ATOM   967  N N   . ILE A 1 127 ? 4.860   17.065 34.112 1.00 13.43 ? 127 ILE A N   1 
ATOM   968  C CA  . ILE A 1 127 ? 5.491   18.381 33.947 1.00 11.37 ? 127 ILE A CA  1 
ATOM   969  C C   . ILE A 1 127 ? 6.650   18.195 32.948 1.00 11.84 ? 127 ILE A C   1 
ATOM   970  O O   . ILE A 1 127 ? 6.852   19.017 32.038 1.00 11.23 ? 127 ILE A O   1 
ATOM   971  C CB  . ILE A 1 127 ? 6.061   18.944 35.264 1.00 9.00  ? 127 ILE A CB  1 
ATOM   972  C CG1 . ILE A 1 127 ? 4.939   19.296 36.230 1.00 8.39  ? 127 ILE A CG1 1 
ATOM   973  C CG2 . ILE A 1 127 ? 6.892   20.159 34.961 1.00 8.29  ? 127 ILE A CG2 1 
ATOM   974  C CD1 . ILE A 1 127 ? 5.420   19.713 37.628 1.00 6.58  ? 127 ILE A CD1 1 
ATOM   975  N N   . GLY A 1 128 ? 7.370   17.090 33.132 1.00 9.74  ? 128 GLY A N   1 
ATOM   976  C CA  . GLY A 1 128 ? 8.468   16.746 32.269 1.00 9.02  ? 128 GLY A CA  1 
ATOM   977  C C   . GLY A 1 128 ? 7.953   16.579 30.866 1.00 9.80  ? 128 GLY A C   1 
ATOM   978  O O   . GLY A 1 128 ? 8.651   16.899 29.932 1.00 10.61 ? 128 GLY A O   1 
ATOM   979  N N   . GLU A 1 129 ? 6.754   16.049 30.690 1.00 11.40 ? 129 GLU A N   1 
ATOM   980  C CA  . GLU A 1 129 ? 6.239   15.907 29.330 1.00 12.70 ? 129 GLU A CA  1 
ATOM   981  C C   . GLU A 1 129 ? 5.948   17.269 28.742 1.00 10.86 ? 129 GLU A C   1 
ATOM   982  O O   . GLU A 1 129 ? 6.355   17.547 27.628 1.00 10.78 ? 129 GLU A O   1 
ATOM   983  C CB  . GLU A 1 129 ? 5.006   15.031 29.328 1.00 14.41 ? 129 GLU A CB  1 
ATOM   984  C CG  . GLU A 1 129 ? 5.249   13.742 30.095 1.00 18.84 ? 129 GLU A CG  1 
ATOM   985  C CD  . GLU A 1 129 ? 4.046   12.797 30.094 1.00 21.61 ? 129 GLU A CD  1 
ATOM   986  O OE1 . GLU A 1 129 ? 3.044   13.106 29.404 1.00 23.59 ? 129 GLU A OE1 1 
ATOM   987  O OE2 . GLU A 1 129 ? 4.086   11.751 30.782 1.00 22.87 ? 129 GLU A OE2 1 
ATOM   988  N N   . ALA A 1 130 ? 5.279   18.120 29.522 1.00 11.21 ? 130 ALA A N   1 
ATOM   989  C CA  . ALA A 1 130 ? 4.948   19.480 29.120 1.00 11.56 ? 130 ALA A CA  1 
ATOM   990  C C   . ALA A 1 130 ? 6.212   20.240 28.792 1.00 12.52 ? 130 ALA A C   1 
ATOM   991  O O   . ALA A 1 130 ? 6.293   20.878 27.761 1.00 13.55 ? 130 ALA A O   1 
ATOM   992  C CB  . ALA A 1 130 ? 4.246   20.171 30.217 1.00 10.46 ? 130 ALA A CB  1 
ATOM   993  N N   . THR A 1 131 ? 7.200   20.149 29.681 1.00 14.97 ? 131 THR A N   1 
ATOM   994  C CA  . THR A 1 131 ? 8.509   20.809 29.525 1.00 14.05 ? 131 THR A CA  1 
ATOM   995  C C   . THR A 1 131 ? 9.244   20.470 28.252 1.00 12.17 ? 131 THR A C   1 
ATOM   996  O O   . THR A 1 131 ? 9.865   21.364 27.649 1.00 11.44 ? 131 THR A O   1 
ATOM   997  C CB  . THR A 1 131 ? 9.439   20.533 30.731 1.00 15.32 ? 131 THR A CB  1 
ATOM   998  O OG1 . THR A 1 131 ? 8.797   21.049 31.913 1.00 16.24 ? 131 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 131 ? 10.853  21.189 30.523 1.00 13.49 ? 131 THR A CG2 1 
ATOM   1000 N N   . ALA A 1 132 ? 9.254   19.182 27.896 1.00 9.71  ? 132 ALA A N   1 
ATOM   1001 C CA  . ALA A 1 132 ? 9.893   18.727 26.659 1.00 7.37  ? 132 ALA A CA  1 
ATOM   1002 C C   . ALA A 1 132 ? 9.205   19.415 25.475 1.00 7.01  ? 132 ALA A C   1 
ATOM   1003 O O   . ALA A 1 132 ? 9.893   19.979 24.632 1.00 8.79  ? 132 ALA A O   1 
ATOM   1004 C CB  . ALA A 1 132 ? 9.832   17.253 26.529 1.00 6.14  ? 132 ALA A CB  1 
ATOM   1005 N N   . LEU A 1 133 ? 7.872   19.418 25.441 1.00 5.44  ? 133 LEU A N   1 
ATOM   1006 C CA  . LEU A 1 133 ? 7.103   20.099 24.397 1.00 5.36  ? 133 LEU A CA  1 
ATOM   1007 C C   . LEU A 1 133 ? 7.439   21.585 24.317 1.00 7.66  ? 133 LEU A C   1 
ATOM   1008 O O   . LEU A 1 133 ? 7.481   22.151 23.200 1.00 10.96 ? 133 LEU A O   1 
ATOM   1009 C CB  . LEU A 1 133 ? 5.586   19.979 24.649 1.00 3.49  ? 133 LEU A CB  1 
ATOM   1010 C CG  . LEU A 1 133 ? 5.106   18.533 24.474 1.00 4.45  ? 133 LEU A CG  1 
ATOM   1011 C CD1 . LEU A 1 133 ? 3.659   18.389 24.698 1.00 2.00  ? 133 LEU A CD1 1 
ATOM   1012 C CD2 . LEU A 1 133 ? 5.469   17.986 23.065 1.00 4.80  ? 133 LEU A CD2 1 
ATOM   1013 N N   . GLU A 1 134 ? 7.634   22.241 25.471 1.00 6.91  ? 134 GLU A N   1 
ATOM   1014 C CA  . GLU A 1 134 ? 7.921   23.676 25.461 1.00 6.70  ? 134 GLU A CA  1 
ATOM   1015 C C   . GLU A 1 134 ? 9.325   23.990 25.063 1.00 6.39  ? 134 GLU A C   1 
ATOM   1016 O O   . GLU A 1 134 ? 9.587   25.056 24.545 1.00 7.17  ? 134 GLU A O   1 
ATOM   1017 C CB  . GLU A 1 134 ? 7.544   24.358 26.770 1.00 7.10  ? 134 GLU A CB  1 
ATOM   1018 C CG  . GLU A 1 134 ? 6.030   24.362 27.004 1.00 7.08  ? 134 GLU A CG  1 
ATOM   1019 C CD  . GLU A 1 134 ? 5.563   25.612 27.715 1.00 7.11  ? 134 GLU A CD  1 
ATOM   1020 O OE1 . GLU A 1 134 ? 6.346   26.557 27.778 1.00 8.02  ? 134 GLU A OE1 1 
ATOM   1021 O OE2 . GLU A 1 134 ? 4.422   25.689 28.224 1.00 7.49  ? 134 GLU A OE2 1 
ATOM   1022 N N   . VAL A 1 135 ? 10.232  23.073 25.354 1.00 6.34  ? 135 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 135 ? 11.626  23.208 24.958 1.00 5.49  ? 135 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 135 ? 11.670  22.989 23.393 1.00 5.85  ? 135 VAL A C   1 
ATOM   1025 O O   . VAL A 1 135 ? 12.188  23.814 22.635 1.00 3.21  ? 135 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 135 ? 12.475  22.158 25.716 1.00 5.14  ? 135 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 135 ? 13.855  22.046 25.076 1.00 6.44  ? 135 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 135 ? 12.606  22.548 27.157 1.00 2.07  ? 135 VAL A CG2 1 
ATOM   1029 N N   . ARG A 1 136 ? 11.100  21.884 22.923 1.00 4.92  ? 136 ARG A N   1 
ATOM   1030 C CA  . ARG A 1 136 ? 11.032  21.650 21.497 1.00 5.75  ? 136 ARG A CA  1 
ATOM   1031 C C   . ARG A 1 136 ? 10.281  22.802 20.733 1.00 7.29  ? 136 ARG A C   1 
ATOM   1032 O O   . ARG A 1 136 ? 10.445  22.968 19.525 1.00 8.71  ? 136 ARG A O   1 
ATOM   1033 C CB  . ARG A 1 136 ? 10.391  20.292 21.218 1.00 3.12  ? 136 ARG A CB  1 
ATOM   1034 C CG  . ARG A 1 136 ? 11.316  19.133 21.488 1.00 3.20  ? 136 ARG A CG  1 
ATOM   1035 C CD  . ARG A 1 136 ? 12.566  19.137 20.553 1.00 5.05  ? 136 ARG A CD  1 
ATOM   1036 N NE  . ARG A 1 136 ? 13.288  17.844 20.568 1.00 6.08  ? 136 ARG A NE  1 
ATOM   1037 C CZ  . ARG A 1 136 ? 14.136  17.403 19.633 1.00 4.44  ? 136 ARG A CZ  1 
ATOM   1038 N NH1 . ARG A 1 136 ? 14.447  18.116 18.563 1.00 3.24  ? 136 ARG A NH1 1 
ATOM   1039 N NH2 . ARG A 1 136 ? 14.606  16.180 19.735 1.00 5.07  ? 136 ARG A NH2 1 
ATOM   1040 N N   . ALA A 1 137 ? 9.433   23.579 21.413 1.00 7.62  ? 137 ALA A N   1 
ATOM   1041 C CA  . ALA A 1 137 ? 8.729   24.694 20.742 1.00 5.99  ? 137 ALA A CA  1 
ATOM   1042 C C   . ALA A 1 137 ? 9.752   25.754 20.334 1.00 4.85  ? 137 ALA A C   1 
ATOM   1043 O O   . ALA A 1 137 ? 9.477   26.573 19.465 1.00 2.00  ? 137 ALA A O   1 
ATOM   1044 C CB  . ALA A 1 137 ? 7.671   25.330 21.678 1.00 5.76  ? 137 ALA A CB  1 
ATOM   1045 N N   . THR A 1 138 ? 10.899  25.779 21.023 1.00 4.90  ? 138 THR A N   1 
ATOM   1046 C CA  . THR A 1 138 ? 11.957  26.758 20.722 1.00 6.02  ? 138 THR A CA  1 
ATOM   1047 C C   . THR A 1 138 ? 13.061  26.111 19.907 1.00 5.28  ? 138 THR A C   1 
ATOM   1048 O O   . THR A 1 138 ? 14.040  26.753 19.568 1.00 6.59  ? 138 THR A O   1 
ATOM   1049 C CB  . THR A 1 138 ? 12.590  27.453 21.996 1.00 5.90  ? 138 THR A CB  1 
ATOM   1050 O OG1 . THR A 1 138 ? 13.260  26.474 22.799 1.00 9.21  ? 138 THR A OG1 1 
ATOM   1051 C CG2 . THR A 1 138 ? 11.558  28.133 22.863 1.00 4.20  ? 138 THR A CG2 1 
ATOM   1052 N N   . GLY A 1 139 ? 12.880  24.851 19.549 1.00 5.98  ? 139 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 139 ? 13.874  24.172 18.743 1.00 5.33  ? 139 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 139 ? 15.023  23.617 19.529 1.00 5.27  ? 139 GLY A C   1 
ATOM   1055 O O   . GLY A 1 139 ? 16.077  23.469 19.003 1.00 8.53  ? 139 GLY A O   1 
ATOM   1056 N N   . ILE A 1 140 ? 14.859  23.331 20.806 1.00 7.68  ? 140 ILE A N   1 
ATOM   1057 C CA  . ILE A 1 140 ? 15.980  22.788 21.584 1.00 8.36  ? 140 ILE A CA  1 
ATOM   1058 C C   . ILE A 1 140 ? 15.650  21.308 21.894 1.00 9.77  ? 140 ILE A C   1 
ATOM   1059 O O   . ILE A 1 140 ? 14.486  20.958 22.114 1.00 11.17 ? 140 ILE A O   1 
ATOM   1060 C CB  . ILE A 1 140 ? 16.313  23.710 22.847 1.00 7.14  ? 140 ILE A CB  1 
ATOM   1061 C CG1 . ILE A 1 140 ? 16.863  25.080 22.370 1.00 5.54  ? 140 ILE A CG1 1 
ATOM   1062 C CG2 . ILE A 1 140 ? 17.324  23.056 23.721 1.00 8.15  ? 140 ILE A CG2 1 
ATOM   1063 C CD1 . ILE A 1 140 ? 16.759  26.238 23.328 1.00 2.00  ? 140 ILE A CD1 1 
ATOM   1064 N N   . GLN A 1 141 ? 16.693  20.478 21.910 1.00 10.12 ? 141 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 141 ? 16.651  19.032 22.072 1.00 8.35  ? 141 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 141 ? 17.292  18.484 23.356 1.00 10.13 ? 141 GLN A C   1 
ATOM   1067 O O   . GLN A 1 141 ? 17.401  17.252 23.492 1.00 12.39 ? 141 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 141 ? 17.492  18.407 20.954 1.00 7.69  ? 141 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 141 ? 17.460  19.084 19.561 1.00 11.47 ? 141 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 141 ? 18.432  20.250 19.317 1.00 10.88 ? 141 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 141 ? 18.926  20.893 20.250 1.00 13.18 ? 141 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 141 ? 18.698  20.525 18.059 1.00 10.84 ? 141 GLN A NE2 1 
ATOM   1073 N N   . TYR A 1 142 ? 17.708  19.339 24.292 1.00 7.83  ? 142 TYR A N   1 
ATOM   1074 C CA  . TYR A 1 142 ? 18.421  18.847 25.470 1.00 6.36  ? 142 TYR A CA  1 
ATOM   1075 C C   . TYR A 1 142 ? 18.167  19.747 26.707 1.00 6.04  ? 142 TYR A C   1 
ATOM   1076 O O   . TYR A 1 142 ? 18.269  20.965 26.633 1.00 5.79  ? 142 TYR A O   1 
ATOM   1077 C CB  . TYR A 1 142 ? 19.908  18.809 25.065 1.00 5.85  ? 142 TYR A CB  1 
ATOM   1078 C CG  . TYR A 1 142 ? 20.960  18.433 26.090 1.00 8.37  ? 142 TYR A CG  1 
ATOM   1079 C CD1 . TYR A 1 142 ? 22.336  18.762 25.876 1.00 9.41  ? 142 TYR A CD1 1 
ATOM   1080 C CD2 . TYR A 1 142 ? 20.644  17.656 27.200 1.00 10.00 ? 142 TYR A CD2 1 
ATOM   1081 C CE1 . TYR A 1 142 ? 23.356  18.310 26.736 1.00 8.36  ? 142 TYR A CE1 1 
ATOM   1082 C CE2 . TYR A 1 142 ? 21.658  17.194 28.083 1.00 10.84 ? 142 TYR A CE2 1 
ATOM   1083 C CZ  . TYR A 1 142 ? 23.006  17.526 27.850 1.00 11.28 ? 142 TYR A CZ  1 
ATOM   1084 O OH  . TYR A 1 142 ? 23.946  17.140 28.804 1.00 11.63 ? 142 TYR A OH  1 
ATOM   1085 N N   . ALA A 1 143 ? 17.698  19.167 27.802 1.00 4.51  ? 143 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 143 ? 17.479  19.958 28.990 1.00 4.07  ? 143 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 143 ? 18.399  19.481 30.119 1.00 5.13  ? 143 ALA A C   1 
ATOM   1088 O O   . ALA A 1 143 ? 18.583  18.290 30.340 1.00 7.17  ? 143 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 143 ? 16.049  19.893 29.408 1.00 2.91  ? 143 ALA A CB  1 
ATOM   1090 N N   . PHE A 1 144 ? 19.051  20.429 30.775 1.00 4.73  ? 144 PHE A N   1 
ATOM   1091 C CA  . PHE A 1 144 ? 19.945  20.149 31.881 1.00 2.83  ? 144 PHE A CA  1 
ATOM   1092 C C   . PHE A 1 144 ? 19.101  19.926 33.116 1.00 2.35  ? 144 PHE A C   1 
ATOM   1093 O O   . PHE A 1 144 ? 19.213  20.620 34.106 1.00 2.00  ? 144 PHE A O   1 
ATOM   1094 C CB  . PHE A 1 144 ? 20.887  21.340 32.067 1.00 3.07  ? 144 PHE A CB  1 
ATOM   1095 C CG  . PHE A 1 144 ? 21.780  21.594 30.880 1.00 2.00  ? 144 PHE A CG  1 
ATOM   1096 C CD1 . PHE A 1 144 ? 22.060  22.869 30.472 1.00 2.37  ? 144 PHE A CD1 1 
ATOM   1097 C CD2 . PHE A 1 144 ? 22.397  20.543 30.218 1.00 2.00  ? 144 PHE A CD2 1 
ATOM   1098 C CE1 . PHE A 1 144 ? 22.963  23.097 29.412 1.00 3.48  ? 144 PHE A CE1 1 
ATOM   1099 C CE2 . PHE A 1 144 ? 23.287  20.777 29.178 1.00 2.00  ? 144 PHE A CE2 1 
ATOM   1100 C CZ  . PHE A 1 144 ? 23.572  22.048 28.774 1.00 2.00  ? 144 PHE A CZ  1 
ATOM   1101 N N   . ALA A 1 145 ? 18.305  18.883 33.079 1.00 3.00  ? 145 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 145 ? 17.432  18.599 34.196 1.00 5.69  ? 145 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 145 ? 17.158  17.117 34.125 1.00 6.71  ? 145 ALA A C   1 
ATOM   1104 O O   . ALA A 1 145 ? 17.213  16.552 33.033 1.00 7.83  ? 145 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 145 ? 16.152  19.374 34.021 1.00 5.44  ? 145 ALA A CB  1 
ATOM   1106 N N   . PRO A 1 146 ? 16.878  16.444 35.266 1.00 8.31  ? 146 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 146 ? 16.587  16.993 36.586 1.00 9.05  ? 146 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 146 ? 17.819  17.101 37.470 1.00 9.83  ? 146 PRO A C   1 
ATOM   1109 O O   . PRO A 1 146 ? 18.776  16.348 37.302 1.00 8.69  ? 146 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 146 ? 15.675  15.912 37.180 1.00 8.20  ? 146 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 146 ? 16.348  14.693 36.760 1.00 6.31  ? 146 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 146 ? 16.638  14.982 35.282 1.00 6.92  ? 146 PRO A CD  1 
ATOM   1113 N N   . CYS A 1 147 ? 17.734  18.013 38.440 1.00 11.60 ? 147 CYS A N   1 
ATOM   1114 C CA  . CYS A 1 147 ? 18.746  18.232 39.470 1.00 13.69 ? 147 CYS A CA  1 
ATOM   1115 C C   . CYS A 1 147 ? 18.288  17.254 40.535 1.00 13.80 ? 147 CYS A C   1 
ATOM   1116 O O   . CYS A 1 147 ? 17.247  17.470 41.150 1.00 14.32 ? 147 CYS A O   1 
ATOM   1117 C CB  . CYS A 1 147 ? 18.657  19.614 40.111 1.00 13.95 ? 147 CYS A CB  1 
ATOM   1118 S SG  . CYS A 1 147 ? 19.770  19.733 41.580 1.00 16.56 ? 147 CYS A SG  1 
ATOM   1119 N N   . ILE A 1 148 ? 18.992  16.140 40.687 1.00 13.83 ? 148 ILE A N   1 
ATOM   1120 C CA  . ILE A 1 148 ? 18.588  15.194 41.702 1.00 12.43 ? 148 ILE A CA  1 
ATOM   1121 C C   . ILE A 1 148 ? 19.470  15.270 42.941 1.00 13.43 ? 148 ILE A C   1 
ATOM   1122 O O   . ILE A 1 148 ? 19.688  14.248 43.590 1.00 15.38 ? 148 ILE A O   1 
ATOM   1123 C CB  . ILE A 1 148 ? 18.473  13.708 41.173 1.00 11.54 ? 148 ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 148 ? 19.782  13.262 40.510 1.00 10.58 ? 148 ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 148 ? 17.277  13.549 40.257 1.00 9.19  ? 148 ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 148 ? 19.826  11.826 40.117 1.00 8.64  ? 148 ILE A CD1 1 
ATOM   1127 N N   . ALA A 1 149 ? 19.984  16.456 43.274 1.00 12.68 ? 149 ALA A N   1 
ATOM   1128 C CA  . ALA A 1 149 ? 20.761  16.583 44.512 1.00 12.55 ? 149 ALA A CA  1 
ATOM   1129 C C   . ALA A 1 149 ? 19.805  16.263 45.650 1.00 14.31 ? 149 ALA A C   1 
ATOM   1130 O O   . ALA A 1 149 ? 18.563  16.314 45.483 1.00 14.83 ? 149 ALA A O   1 
ATOM   1131 C CB  . ALA A 1 149 ? 21.230  17.980 44.708 1.00 12.25 ? 149 ALA A CB  1 
ATOM   1132 N N   . VAL A 1 150 ? 20.378  15.911 46.796 1.00 14.67 ? 150 VAL A N   1 
ATOM   1133 C CA  . VAL A 1 150 ? 19.591  15.642 47.994 1.00 15.09 ? 150 VAL A CA  1 
ATOM   1134 C C   . VAL A 1 150 ? 20.090  16.693 48.995 1.00 15.98 ? 150 VAL A C   1 
ATOM   1135 O O   . VAL A 1 150 ? 20.981  16.409 49.772 1.00 18.13 ? 150 VAL A O   1 
ATOM   1136 C CB  . VAL A 1 150 ? 19.833  14.217 48.556 1.00 13.26 ? 150 VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 150 ? 18.983  14.014 49.775 1.00 12.67 ? 150 VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 150 ? 19.512  13.148 47.517 1.00 11.96 ? 150 VAL A CG2 1 
ATOM   1139 N N   . CYS A 1 151 ? 19.579  17.919 48.916 1.00 16.98 ? 151 CYS A N   1 
ATOM   1140 C CA  . CYS A 1 151 ? 20.007  19.013 49.802 1.00 18.14 ? 151 CYS A CA  1 
ATOM   1141 C C   . CYS A 1 151 ? 19.966  18.662 51.273 1.00 18.46 ? 151 CYS A C   1 
ATOM   1142 O O   . CYS A 1 151 ? 18.912  18.423 51.831 1.00 20.34 ? 151 CYS A O   1 
ATOM   1143 C CB  . CYS A 1 151 ? 19.163  20.258 49.579 1.00 18.55 ? 151 CYS A CB  1 
ATOM   1144 S SG  . CYS A 1 151 ? 19.666  21.697 50.561 1.00 18.60 ? 151 CYS A SG  1 
ATOM   1145 N N   . ARG A 1 152 ? 21.110  18.683 51.923 1.00 17.86 ? 152 ARG A N   1 
ATOM   1146 C CA  . ARG A 1 152 ? 21.116  18.318 53.293 1.00 16.05 ? 152 ARG A CA  1 
ATOM   1147 C C   . ARG A 1 152 ? 21.296  19.482 54.260 1.00 16.86 ? 152 ARG A C   1 
ATOM   1148 O O   . ARG A 1 152 ? 21.382  19.259 55.468 1.00 19.24 ? 152 ARG A O   1 
ATOM   1149 C CB  . ARG A 1 152 ? 22.153  17.228 53.498 1.00 16.07 ? 152 ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 152 ? 21.961  16.032 52.612 1.00 15.57 ? 152 ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 152 ? 21.949  14.740 53.378 1.00 15.52 ? 152 ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 152 ? 20.586  14.296 53.644 1.00 15.41 ? 152 ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 152 ? 20.175  13.820 54.818 1.00 15.43 ? 152 ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 152 ? 21.030  13.733 55.823 1.00 14.33 ? 152 ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 152 ? 18.911  13.413 54.987 1.00 15.49 ? 152 ARG A NH2 1 
ATOM   1156 N N   . ASP A 1 153 ? 21.247  20.720 53.764 1.00 15.86 ? 153 ASP A N   1 
ATOM   1157 C CA  . ASP A 1 153 ? 21.411  21.911 54.616 1.00 12.76 ? 153 ASP A CA  1 
ATOM   1158 C C   . ASP A 1 153 ? 20.770  23.061 53.891 1.00 12.42 ? 153 ASP A C   1 
ATOM   1159 O O   . ASP A 1 153 ? 21.297  23.522 52.894 1.00 14.93 ? 153 ASP A O   1 
ATOM   1160 C CB  . ASP A 1 153 ? 22.894  22.237 54.799 1.00 11.99 ? 153 ASP A CB  1 
ATOM   1161 C CG  . ASP A 1 153 ? 23.124  23.276 55.850 1.00 12.90 ? 153 ASP A CG  1 
ATOM   1162 O OD1 . ASP A 1 153 ? 23.963  23.056 56.735 1.00 10.74 ? 153 ASP A OD1 1 
ATOM   1163 O OD2 . ASP A 1 153 ? 22.438  24.324 55.822 1.00 15.59 ? 153 ASP A OD2 1 
ATOM   1164 N N   . PRO A 1 154 ? 19.640  23.577 54.365 1.00 11.46 ? 154 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 154 ? 19.072  24.598 53.489 1.00 11.32 ? 154 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 154 ? 19.856  25.919 53.329 1.00 13.40 ? 154 PRO A C   1 
ATOM   1167 O O   . PRO A 1 154 ? 19.420  26.844 52.633 1.00 17.28 ? 154 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 154 ? 17.676  24.778 54.042 1.00 9.85  ? 154 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 154 ? 17.829  24.461 55.425 1.00 10.32 ? 154 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 154 ? 18.680  23.226 55.413 1.00 11.41 ? 154 PRO A CD  1 
ATOM   1171 N N   . ARG A 1 155 ? 21.033  26.045 53.917 1.00 12.48 ? 155 ARG A N   1 
ATOM   1172 C CA  . ARG A 1 155 ? 21.747  27.312 53.709 1.00 13.24 ? 155 ARG A CA  1 
ATOM   1173 C C   . ARG A 1 155 ? 22.377  27.390 52.298 1.00 12.97 ? 155 ARG A C   1 
ATOM   1174 O O   . ARG A 1 155 ? 23.051  28.374 51.926 1.00 10.55 ? 155 ARG A O   1 
ATOM   1175 C CB  . ARG A 1 155 ? 22.802  27.459 54.809 1.00 14.16 ? 155 ARG A CB  1 
ATOM   1176 C CG  . ARG A 1 155 ? 22.146  27.639 56.165 1.00 16.35 ? 155 ARG A CG  1 
ATOM   1177 C CD  . ARG A 1 155 ? 23.094  27.585 57.308 1.00 15.83 ? 155 ARG A CD  1 
ATOM   1178 N NE  . ARG A 1 155 ? 23.587  26.237 57.477 1.00 14.56 ? 155 ARG A NE  1 
ATOM   1179 C CZ  . ARG A 1 155 ? 24.539  25.943 58.332 1.00 14.20 ? 155 ARG A CZ  1 
ATOM   1180 N NH1 . ARG A 1 155 ? 25.034  26.914 59.062 1.00 11.32 ? 155 ARG A NH1 1 
ATOM   1181 N NH2 . ARG A 1 155 ? 25.044  24.719 58.394 1.00 15.62 ? 155 ARG A NH2 1 
ATOM   1182 N N   . TRP A 1 156 ? 22.223  26.278 51.582 1.00 11.66 ? 156 TRP A N   1 
ATOM   1183 C CA  . TRP A 1 156 ? 22.744  26.100 50.250 1.00 12.08 ? 156 TRP A CA  1 
ATOM   1184 C C   . TRP A 1 156 ? 21.842  26.828 49.248 1.00 13.53 ? 156 TRP A C   1 
ATOM   1185 O O   . TRP A 1 156 ? 20.629  26.539 49.159 1.00 11.11 ? 156 TRP A O   1 
ATOM   1186 C CB  . TRP A 1 156 ? 22.834  24.616 49.945 1.00 12.31 ? 156 TRP A CB  1 
ATOM   1187 C CG  . TRP A 1 156 ? 23.394  24.336 48.615 1.00 12.15 ? 156 TRP A CG  1 
ATOM   1188 C CD1 . TRP A 1 156 ? 24.445  24.965 48.052 1.00 12.49 ? 156 TRP A CD1 1 
ATOM   1189 C CD2 . TRP A 1 156 ? 22.986  23.281 47.701 1.00 11.93 ? 156 TRP A CD2 1 
ATOM   1190 N NE1 . TRP A 1 156 ? 24.753  24.370 46.851 1.00 14.56 ? 156 TRP A NE1 1 
ATOM   1191 C CE2 . TRP A 1 156 ? 23.882  23.340 46.606 1.00 13.38 ? 156 TRP A CE2 1 
ATOM   1192 C CE3 . TRP A 1 156 ? 21.972  22.319 47.685 1.00 11.63 ? 156 TRP A CE3 1 
ATOM   1193 C CZ2 . TRP A 1 156 ? 23.781  22.454 45.507 1.00 11.24 ? 156 TRP A CZ2 1 
ATOM   1194 C CZ3 . TRP A 1 156 ? 21.875  21.441 46.583 1.00 11.35 ? 156 TRP A CZ3 1 
ATOM   1195 C CH2 . TRP A 1 156 ? 22.780  21.528 45.516 1.00 11.23 ? 156 TRP A CH2 1 
ATOM   1196 N N   . GLY A 1 157 ? 22.487  27.729 48.487 1.00 14.08 ? 157 GLY A N   1 
ATOM   1197 C CA  . GLY A 1 157 ? 21.840  28.584 47.515 1.00 12.84 ? 157 GLY A CA  1 
ATOM   1198 C C   . GLY A 1 157 ? 20.917  27.901 46.564 1.00 14.00 ? 157 GLY A C   1 
ATOM   1199 O O   . GLY A 1 157 ? 19.955  28.519 46.101 1.00 14.81 ? 157 GLY A O   1 
ATOM   1200 N N   . ARG A 1 158 ? 21.215  26.627 46.298 1.00 15.00 ? 158 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 158 ? 20.435  25.744 45.396 1.00 14.25 ? 158 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 158 ? 19.500  24.712 46.087 1.00 13.47 ? 158 ARG A C   1 
ATOM   1203 O O   . ARG A 1 158 ? 19.107  23.755 45.446 1.00 11.89 ? 158 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 158 ? 21.398  24.986 44.457 1.00 14.46 ? 158 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 158 ? 22.611  25.823 43.978 1.00 14.44 ? 158 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 158 ? 23.269  25.131 42.825 1.00 14.56 ? 158 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 158 ? 22.366  25.048 41.669 1.00 14.93 ? 158 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 158 ? 22.749  24.703 40.435 1.00 15.65 ? 158 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 158 ? 24.031  24.387 40.191 1.00 13.63 ? 158 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 158 ? 21.865  24.742 39.428 1.00 13.78 ? 158 ARG A NH2 1 
ATOM   1211 N N   . CYS A 1 159 ? 19.173  24.864 47.377 1.00 13.84 ? 159 CYS A N   1 
ATOM   1212 C CA  . CYS A 1 159 ? 18.287  23.909 48.052 1.00 14.85 ? 159 CYS A CA  1 
ATOM   1213 C C   . CYS A 1 159 ? 16.894  23.785 47.380 1.00 14.84 ? 159 CYS A C   1 
ATOM   1214 O O   . CYS A 1 159 ? 16.274  22.694 47.358 1.00 14.17 ? 159 CYS A O   1 
ATOM   1215 C CB  . CYS A 1 159 ? 18.165  24.242 49.552 1.00 16.78 ? 159 CYS A CB  1 
ATOM   1216 S SG  . CYS A 1 159 ? 17.901  22.787 50.673 1.00 23.01 ? 159 CYS A SG  1 
ATOM   1217 N N   . TYR A 1 160 ? 16.427  24.865 46.757 1.00 13.67 ? 160 TYR A N   1 
ATOM   1218 C CA  . TYR A 1 160 ? 15.131  24.783 46.085 1.00 12.97 ? 160 TYR A CA  1 
ATOM   1219 C C   . TYR A 1 160 ? 15.131  23.830 44.874 1.00 13.10 ? 160 TYR A C   1 
ATOM   1220 O O   . TYR A 1 160 ? 14.075  23.353 44.446 1.00 13.90 ? 160 TYR A O   1 
ATOM   1221 C CB  . TYR A 1 160 ? 14.611  26.171 45.696 1.00 12.01 ? 160 TYR A CB  1 
ATOM   1222 C CG  . TYR A 1 160 ? 15.416  26.905 44.679 1.00 10.72 ? 160 TYR A CG  1 
ATOM   1223 C CD1 . TYR A 1 160 ? 15.298  26.614 43.334 1.00 10.77 ? 160 TYR A CD1 1 
ATOM   1224 C CD2 . TYR A 1 160 ? 16.261  27.915 45.058 1.00 10.78 ? 160 TYR A CD2 1 
ATOM   1225 C CE1 . TYR A 1 160 ? 15.991  27.314 42.408 1.00 10.95 ? 160 TYR A CE1 1 
ATOM   1226 C CE2 . TYR A 1 160 ? 16.956  28.617 44.140 1.00 11.02 ? 160 TYR A CE2 1 
ATOM   1227 C CZ  . TYR A 1 160 ? 16.812  28.316 42.821 1.00 11.71 ? 160 TYR A CZ  1 
ATOM   1228 O OH  . TYR A 1 160 ? 17.428  29.086 41.889 1.00 15.24 ? 160 TYR A OH  1 
ATOM   1229 N N   . GLU A 1 161 ? 16.309  23.569 44.320 1.00 10.23 ? 161 GLU A N   1 
ATOM   1230 C CA  . GLU A 1 161 ? 16.393  22.685 43.197 1.00 9.73  ? 161 GLU A CA  1 
ATOM   1231 C C   . GLU A 1 161 ? 16.464  21.224 43.619 1.00 10.89 ? 161 GLU A C   1 
ATOM   1232 O O   . GLU A 1 161 ? 16.671  20.357 42.772 1.00 13.32 ? 161 GLU A O   1 
ATOM   1233 C CB  . GLU A 1 161 ? 17.605  23.041 42.360 1.00 8.86  ? 161 GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 161 ? 17.707  24.507 42.111 1.00 9.52  ? 161 GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 161 ? 18.713  24.873 41.018 1.00 10.90 ? 161 GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 161 ? 18.675  24.215 39.946 1.00 9.08  ? 161 GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 161 ? 19.505  25.843 41.233 1.00 10.65 ? 161 GLU A OE2 1 
ATOM   1238 N N   . SER A 1 162 ? 16.423  20.958 44.929 1.00 12.01 ? 162 SER A N   1 
ATOM   1239 C CA  . SER A 1 162 ? 16.449  19.575 45.478 1.00 12.02 ? 162 SER A CA  1 
ATOM   1240 C C   . SER A 1 162 ? 15.022  19.213 45.940 1.00 13.01 ? 162 SER A C   1 
ATOM   1241 O O   . SER A 1 162 ? 14.428  19.944 46.737 1.00 13.25 ? 162 SER A O   1 
ATOM   1242 C CB  . SER A 1 162 ? 17.403  19.479 46.672 1.00 11.54 ? 162 SER A CB  1 
ATOM   1243 O OG  . SER A 1 162 ? 17.211  18.292 47.440 1.00 9.85  ? 162 SER A OG  1 
ATOM   1244 N N   . TYR A 1 163 ? 14.454  18.119 45.418 1.00 12.81 ? 163 TYR A N   1 
ATOM   1245 C CA  . TYR A 1 163 ? 13.096  17.741 45.769 1.00 12.81 ? 163 TYR A CA  1 
ATOM   1246 C C   . TYR A 1 163 ? 12.896  17.536 47.229 1.00 14.00 ? 163 TYR A C   1 
ATOM   1247 O O   . TYR A 1 163 ? 11.858  17.871 47.734 1.00 18.21 ? 163 TYR A O   1 
ATOM   1248 C CB  . TYR A 1 163 ? 12.668  16.469 45.074 1.00 11.66 ? 163 TYR A CB  1 
ATOM   1249 C CG  . TYR A 1 163 ? 12.724  16.516 43.582 1.00 11.42 ? 163 TYR A CG  1 
ATOM   1250 C CD1 . TYR A 1 163 ? 13.698  15.807 42.889 1.00 10.02 ? 163 TYR A CD1 1 
ATOM   1251 C CD2 . TYR A 1 163 ? 11.776  17.234 42.859 1.00 11.12 ? 163 TYR A CD2 1 
ATOM   1252 C CE1 . TYR A 1 163 ? 13.739  15.811 41.534 1.00 10.50 ? 163 TYR A CE1 1 
ATOM   1253 C CE2 . TYR A 1 163 ? 11.793  17.231 41.481 1.00 11.70 ? 163 TYR A CE2 1 
ATOM   1254 C CZ  . TYR A 1 163 ? 12.783  16.514 40.815 1.00 11.94 ? 163 TYR A CZ  1 
ATOM   1255 O OH  . TYR A 1 163 ? 12.806  16.479 39.428 1.00 13.08 ? 163 TYR A OH  1 
ATOM   1256 N N   . SER A 1 164 ? 13.852  16.929 47.905 1.00 15.75 ? 164 SER A N   1 
ATOM   1257 C CA  . SER A 1 164 ? 13.713  16.666 49.336 1.00 15.64 ? 164 SER A CA  1 
ATOM   1258 C C   . SER A 1 164 ? 15.068  16.389 49.947 1.00 16.44 ? 164 SER A C   1 
ATOM   1259 O O   . SER A 1 164 ? 16.056  16.224 49.212 1.00 16.96 ? 164 SER A O   1 
ATOM   1260 C CB  . SER A 1 164 ? 12.823  15.446 49.515 1.00 14.31 ? 164 SER A CB  1 
ATOM   1261 O OG  . SER A 1 164 ? 12.872  14.960 50.838 1.00 13.84 ? 164 SER A OG  1 
ATOM   1262 N N   . GLU A 1 165 ? 15.130  16.430 51.282 1.00 17.40 ? 165 GLU A N   1 
ATOM   1263 C CA  . GLU A 1 165 ? 16.374  16.087 52.016 1.00 18.05 ? 165 GLU A CA  1 
ATOM   1264 C C   . GLU A 1 165 ? 16.422  14.571 52.160 1.00 17.49 ? 165 GLU A C   1 
ATOM   1265 O O   . GLU A 1 165 ? 17.444  14.032 52.564 1.00 18.05 ? 165 GLU A O   1 
ATOM   1266 C CB  . GLU A 1 165 ? 16.428  16.671 53.433 1.00 17.89 ? 165 GLU A CB  1 
ATOM   1267 C CG  . GLU A 1 165 ? 15.599  15.902 54.463 1.00 19.43 ? 165 GLU A CG  1 
ATOM   1268 C CD  . GLU A 1 165 ? 15.236  16.761 55.666 1.00 20.50 ? 165 GLU A CD  1 
ATOM   1269 O OE1 . GLU A 1 165 ? 14.839  16.218 56.722 1.00 21.70 ? 165 GLU A OE1 1 
ATOM   1270 O OE2 . GLU A 1 165 ? 15.353  17.993 55.555 1.00 20.91 ? 165 GLU A OE2 1 
ATOM   1271 N N   . ASP A 1 166 ? 15.308  13.923 51.809 1.00 17.36 ? 166 ASP A N   1 
ATOM   1272 C CA  . ASP A 1 166 ? 15.119  12.493 51.891 1.00 18.46 ? 166 ASP A CA  1 
ATOM   1273 C C   . ASP A 1 166 ? 15.255  11.894 50.521 1.00 19.98 ? 166 ASP A C   1 
ATOM   1274 O O   . ASP A 1 166 ? 14.300  11.933 49.732 1.00 21.26 ? 166 ASP A O   1 
ATOM   1275 C CB  . ASP A 1 166 ? 13.702  12.209 52.442 1.00 18.99 ? 166 ASP A CB  1 
ATOM   1276 C CG  . ASP A 1 166 ? 13.364  10.702 52.574 1.00 19.49 ? 166 ASP A CG  1 
ATOM   1277 O OD1 . ASP A 1 166 ? 14.132  9.819  52.128 1.00 18.59 ? 166 ASP A OD1 1 
ATOM   1278 O OD2 . ASP A 1 166 ? 12.273  10.409 53.118 1.00 20.52 ? 166 ASP A OD2 1 
ATOM   1279 N N   . ARG A 1 167 ? 16.367  11.212 50.277 1.00 20.44 ? 167 ARG A N   1 
ATOM   1280 C CA  . ARG A 1 167 ? 16.568  10.603 48.972 1.00 21.89 ? 167 ARG A CA  1 
ATOM   1281 C C   . ARG A 1 167 ? 15.455  9.684  48.505 1.00 20.68 ? 167 ARG A C   1 
ATOM   1282 O O   . ARG A 1 167 ? 15.261  9.516  47.319 1.00 18.98 ? 167 ARG A O   1 
ATOM   1283 C CB  . ARG A 1 167 ? 17.927  9.910  48.871 1.00 24.36 ? 167 ARG A CB  1 
ATOM   1284 C CG  . ARG A 1 167 ? 18.179  8.846  49.873 1.00 27.70 ? 167 ARG A CG  1 
ATOM   1285 C CD  . ARG A 1 167 ? 17.615  7.490  49.452 1.00 31.23 ? 167 ARG A CD  1 
ATOM   1286 N NE  . ARG A 1 167 ? 18.448  6.412  50.002 1.00 34.71 ? 167 ARG A NE  1 
ATOM   1287 C CZ  . ARG A 1 167 ? 18.081  5.134  50.094 1.00 34.94 ? 167 ARG A CZ  1 
ATOM   1288 N NH1 . ARG A 1 167 ? 16.872  4.770  49.669 1.00 34.33 ? 167 ARG A NH1 1 
ATOM   1289 N NH2 . ARG A 1 167 ? 18.962  4.216  50.526 1.00 34.16 ? 167 ARG A NH2 1 
ATOM   1290 N N   . ARG A 1 168 ? 14.680  9.132  49.421 1.00 21.04 ? 168 ARG A N   1 
ATOM   1291 C CA  . ARG A 1 168 ? 13.609  8.263  48.993 1.00 22.26 ? 168 ARG A CA  1 
ATOM   1292 C C   . ARG A 1 168 ? 12.654  9.061  48.072 1.00 21.95 ? 168 ARG A C   1 
ATOM   1293 O O   . ARG A 1 168 ? 12.123  8.509  47.073 1.00 20.22 ? 168 ARG A O   1 
ATOM   1294 C CB  . ARG A 1 168 ? 12.892  7.675  50.224 1.00 25.14 ? 168 ARG A CB  1 
ATOM   1295 C CG  . ARG A 1 168 ? 13.593  6.417  50.764 1.00 30.30 ? 168 ARG A CG  1 
ATOM   1296 C CD  . ARG A 1 168 ? 13.217  5.962  52.203 1.00 34.09 ? 168 ARG A CD  1 
ATOM   1297 N NE  . ARG A 1 168 ? 13.372  7.032  53.201 1.00 39.75 ? 168 ARG A NE  1 
ATOM   1298 C CZ  . ARG A 1 168 ? 12.748  7.069  54.388 1.00 42.48 ? 168 ARG A CZ  1 
ATOM   1299 N NH1 . ARG A 1 168 ? 11.938  6.074  54.740 1.00 45.02 ? 168 ARG A NH1 1 
ATOM   1300 N NH2 . ARG A 1 168 ? 12.849  8.134  55.201 1.00 42.95 ? 168 ARG A NH2 1 
ATOM   1301 N N   . ILE A 1 169 ? 12.486  10.364 48.398 1.00 19.29 ? 169 ILE A N   1 
ATOM   1302 C CA  . ILE A 1 169 ? 11.588  11.289 47.671 1.00 14.45 ? 169 ILE A CA  1 
ATOM   1303 C C   . ILE A 1 169 ? 12.215  11.699 46.361 1.00 12.56 ? 169 ILE A C   1 
ATOM   1304 O O   . ILE A 1 169 ? 11.564  11.663 45.307 1.00 10.23 ? 169 ILE A O   1 
ATOM   1305 C CB  . ILE A 1 169 ? 11.199  12.505 48.553 1.00 14.63 ? 169 ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 169 ? 10.396  12.006 49.766 1.00 14.07 ? 169 ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 169 ? 10.364  13.521 47.765 1.00 14.43 ? 169 ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 169 ? 9.801   13.093 50.618 1.00 13.11 ? 169 ILE A CD1 1 
ATOM   1309 N N   . VAL A 1 170 ? 13.499  12.051 46.426 1.00 10.51 ? 170 VAL A N   1 
ATOM   1310 C CA  . VAL A 1 170 ? 14.222  12.401 45.217 1.00 9.56  ? 170 VAL A CA  1 
ATOM   1311 C C   . VAL A 1 170 ? 14.179  11.204 44.262 1.00 9.44  ? 170 VAL A C   1 
ATOM   1312 O O   . VAL A 1 170 ? 13.940  11.377 43.070 1.00 9.02  ? 170 VAL A O   1 
ATOM   1313 C CB  . VAL A 1 170 ? 15.684  12.805 45.466 1.00 8.75  ? 170 VAL A CB  1 
ATOM   1314 C CG1 . VAL A 1 170 ? 16.338  13.146 44.122 1.00 7.50  ? 170 VAL A CG1 1 
ATOM   1315 C CG2 . VAL A 1 170 ? 15.764  14.012 46.428 1.00 8.16  ? 170 VAL A CG2 1 
ATOM   1316 N N   . GLN A 1 171 ? 14.359  9.990  44.782 1.00 9.84  ? 171 GLN A N   1 
ATOM   1317 C CA  . GLN A 1 171 ? 14.299  8.794  43.917 1.00 11.23 ? 171 GLN A CA  1 
ATOM   1318 C C   . GLN A 1 171 ? 12.960  8.717  43.239 1.00 11.29 ? 171 GLN A C   1 
ATOM   1319 O O   . GLN A 1 171 ? 12.895  8.405  42.079 1.00 11.90 ? 171 GLN A O   1 
ATOM   1320 C CB  . GLN A 1 171 ? 14.532  7.477  44.667 1.00 8.96  ? 171 GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 171 ? 15.824  7.465  45.392 1.00 11.08 ? 171 GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 171 ? 16.189  6.127  45.885 1.00 10.40 ? 171 GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 171 ? 16.670  5.350  45.108 1.00 12.33 ? 171 GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 171 ? 16.023  5.855  47.208 1.00 10.47 ? 171 GLN A NE2 1 
ATOM   1325 N N   . SER A 1 172 ? 11.903  9.035  43.968 1.00 12.25 ? 172 SER A N   1 
ATOM   1326 C CA  . SER A 1 172 ? 10.580  8.978  43.421 1.00 14.10 ? 172 SER A CA  1 
ATOM   1327 C C   . SER A 1 172 ? 10.375  10.007 42.306 1.00 15.11 ? 172 SER A C   1 
ATOM   1328 O O   . SER A 1 172 ? 9.693   9.733  41.303 1.00 15.74 ? 172 SER A O   1 
ATOM   1329 C CB  . SER A 1 172 ? 9.543   9.125  44.552 1.00 14.12 ? 172 SER A CB  1 
ATOM   1330 O OG  . SER A 1 172 ? 9.230   10.467 44.861 1.00 15.96 ? 172 SER A OG  1 
ATOM   1331 N N   . MET A 1 173 ? 10.960  11.187 42.463 1.00 16.11 ? 173 MET A N   1 
ATOM   1332 C CA  . MET A 1 173 ? 10.799  12.224 41.443 1.00 17.33 ? 173 MET A CA  1 
ATOM   1333 C C   . MET A 1 173 ? 11.573  12.055 40.107 1.00 16.64 ? 173 MET A C   1 
ATOM   1334 O O   . MET A 1 173 ? 11.324  12.799 39.171 1.00 17.01 ? 173 MET A O   1 
ATOM   1335 C CB  . MET A 1 173 ? 11.073  13.604 42.050 1.00 18.07 ? 173 MET A CB  1 
ATOM   1336 C CG  . MET A 1 173 ? 10.203  13.892 43.260 1.00 19.27 ? 173 MET A CG  1 
ATOM   1337 S SD  . MET A 1 173 ? 8.427   13.756 42.918 1.00 21.86 ? 173 MET A SD  1 
ATOM   1338 C CE  . MET A 1 173 ? 7.712   13.919 44.548 1.00 20.48 ? 173 MET A CE  1 
ATOM   1339 N N   . THR A 1 174 ? 12.529  11.128 40.024 1.00 15.70 ? 174 THR A N   1 
ATOM   1340 C CA  . THR A 1 174 ? 13.278  10.901 38.780 1.00 13.48 ? 174 THR A CA  1 
ATOM   1341 C C   . THR A 1 174 ? 12.319  10.549 37.601 1.00 14.23 ? 174 THR A C   1 
ATOM   1342 O O   . THR A 1 174 ? 12.745  10.360 36.442 1.00 13.14 ? 174 THR A O   1 
ATOM   1343 C CB  . THR A 1 174 ? 14.337  9.801  38.939 1.00 11.52 ? 174 THR A CB  1 
ATOM   1344 O OG1 . THR A 1 174 ? 13.674  8.554  39.010 1.00 9.96  ? 174 THR A OG1 1 
ATOM   1345 C CG2 . THR A 1 174 ? 15.140  9.972  40.190 1.00 9.41  ? 174 THR A CG2 1 
ATOM   1346 N N   . GLU A 1 175 ? 11.024  10.480 37.913 1.00 14.79 ? 175 GLU A N   1 
ATOM   1347 C CA  . GLU A 1 175 ? 9.972   10.225 36.931 1.00 14.74 ? 175 GLU A CA  1 
ATOM   1348 C C   . GLU A 1 175 ? 9.950   11.420 36.019 1.00 14.52 ? 175 GLU A C   1 
ATOM   1349 O O   . GLU A 1 175 ? 9.145   11.472 35.113 1.00 16.34 ? 175 GLU A O   1 
ATOM   1350 C CB  . GLU A 1 175 ? 8.605   10.169 37.589 1.00 14.55 ? 175 GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 175 ? 8.269   8.836  38.045 1.00 17.00 ? 175 GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 175 ? 8.243   7.891  36.899 1.00 19.08 ? 175 GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 175 ? 9.120   7.012  36.841 1.00 19.75 ? 175 GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 175 ? 7.337   8.031  36.042 1.00 21.86 ? 175 GLU A OE2 1 
ATOM   1355 N N   . LEU A 1 176 ? 10.742  12.439 36.320 1.00 13.51 ? 176 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 176 ? 10.780  13.595 35.442 1.00 13.97 ? 176 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 176 ? 11.475  13.147 34.167 1.00 15.84 ? 176 LEU A C   1 
ATOM   1358 O O   . LEU A 1 176 ? 11.079  13.562 33.083 1.00 18.71 ? 176 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 176 ? 11.559  14.762 36.036 1.00 10.59 ? 176 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 176 ? 11.522  16.029 35.193 1.00 7.28  ? 176 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 176 ? 10.281  16.888 35.522 1.00 3.59  ? 176 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 176 ? 12.806  16.753 35.480 1.00 4.47  ? 176 LEU A CD2 1 
ATOM   1363 N N   . ILE A 1 177 ? 12.468  12.263 34.292 1.00 15.97 ? 177 ILE A N   1 
ATOM   1364 C CA  . ILE A 1 177 ? 13.214  11.758 33.135 1.00 15.76 ? 177 ILE A CA  1 
ATOM   1365 C C   . ILE A 1 177 ? 12.398  11.090 32.017 1.00 15.92 ? 177 ILE A C   1 
ATOM   1366 O O   . ILE A 1 177 ? 12.405  11.573 30.900 1.00 17.43 ? 177 ILE A O   1 
ATOM   1367 C CB  . ILE A 1 177 ? 14.382  10.878 33.598 1.00 16.12 ? 177 ILE A CB  1 
ATOM   1368 C CG1 . ILE A 1 177 ? 15.413  11.762 34.330 1.00 16.15 ? 177 ILE A CG1 1 
ATOM   1369 C CG2 . ILE A 1 177 ? 14.982  10.093 32.428 1.00 15.34 ? 177 ILE A CG2 1 
ATOM   1370 C CD1 . ILE A 1 177 ? 16.468  10.970 35.095 1.00 15.12 ? 177 ILE A CD1 1 
ATOM   1371 N N   . PRO A 1 178 ? 11.662  10.003 32.291 1.00 16.56 ? 178 PRO A N   1 
ATOM   1372 C CA  . PRO A 1 178 ? 10.791  9.530  31.204 1.00 15.38 ? 178 PRO A CA  1 
ATOM   1373 C C   . PRO A 1 178 ? 9.733   10.558 30.801 1.00 15.87 ? 178 PRO A C   1 
ATOM   1374 O O   . PRO A 1 178 ? 9.079   10.417 29.767 1.00 16.53 ? 178 PRO A O   1 
ATOM   1375 C CB  . PRO A 1 178 ? 10.164  8.278  31.786 1.00 15.40 ? 178 PRO A CB  1 
ATOM   1376 C CG  . PRO A 1 178 ? 10.188  8.550  33.285 1.00 16.05 ? 178 PRO A CG  1 
ATOM   1377 C CD  . PRO A 1 178 ? 11.556  9.111  33.469 1.00 16.73 ? 178 PRO A CD  1 
ATOM   1378 N N   . GLY A 1 179 ? 9.508   11.551 31.658 1.00 13.51 ? 179 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 179 ? 8.545   12.569 31.294 1.00 10.88 ? 179 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 179 ? 9.154   13.282 30.097 1.00 9.72  ? 179 GLY A C   1 
ATOM   1381 O O   . GLY A 1 179 ? 8.560   13.311 29.045 1.00 7.06  ? 179 GLY A O   1 
ATOM   1382 N N   . LEU A 1 180 ? 10.385  13.794 30.273 1.00 9.76  ? 180 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 180 ? 11.150  14.528 29.261 1.00 7.88  ? 180 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 180 ? 11.637  13.674 28.101 1.00 9.51  ? 180 LEU A C   1 
ATOM   1385 O O   . LEU A 1 180 ? 11.619  14.097 26.950 1.00 12.63 ? 180 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 180 ? 12.367  15.172 29.885 1.00 5.58  ? 180 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 180 ? 12.349  16.345 30.864 1.00 4.30  ? 180 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 180 ? 13.716  16.404 31.509 1.00 2.00  ? 180 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 180 ? 12.039  17.651 30.168 1.00 3.00  ? 180 LEU A CD2 1 
ATOM   1390 N N   . GLN A 1 181 ? 12.088  12.472 28.377 1.00 9.79  ? 181 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 181 ? 12.597  11.661 27.302 1.00 10.26 ? 181 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 181 ? 11.548  10.718 26.704 1.00 13.16 ? 181 GLN A C   1 
ATOM   1393 O O   . GLN A 1 181 ? 11.641  10.291 25.547 1.00 12.88 ? 181 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 181 ? 13.777  10.870 27.842 1.00 7.09  ? 181 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 181 ? 14.832  11.728 28.549 1.00 6.97  ? 181 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 181 ? 16.170  11.016 28.730 1.00 7.25  ? 181 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 181 ? 16.207  9.829  29.084 1.00 8.01  ? 181 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 181 ? 17.273  11.724 28.481 1.00 3.96  ? 181 GLN A NE2 1 
ATOM   1399 N N   . GLY A 1 182 ? 10.499  10.457 27.472 1.00 17.14 ? 182 GLY A N   1 
ATOM   1400 C CA  . GLY A 1 182 ? 9.503   9.476  27.057 1.00 19.36 ? 182 GLY A CA  1 
ATOM   1401 C C   . GLY A 1 182 ? 9.961   8.160  27.686 1.00 20.36 ? 182 GLY A C   1 
ATOM   1402 O O   . GLY A 1 182 ? 11.141  7.969  27.930 1.00 21.26 ? 182 GLY A O   1 
ATOM   1403 N N   . ASP A 1 183 ? 9.039   7.238  27.928 1.00 22.55 ? 183 ASP A N   1 
ATOM   1404 C CA  . ASP A 1 183 ? 9.356   5.952  28.563 1.00 23.79 ? 183 ASP A CA  1 
ATOM   1405 C C   . ASP A 1 183 ? 10.239  5.016  27.753 1.00 24.89 ? 183 ASP A C   1 
ATOM   1406 O O   . ASP A 1 183 ? 10.122  4.940  26.538 1.00 25.44 ? 183 ASP A O   1 
ATOM   1407 C CB  . ASP A 1 183 ? 8.068   5.212  28.931 1.00 23.63 ? 183 ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 183 ? 7.096   6.084  29.684 1.00 23.40 ? 183 ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 183 ? 7.479   6.528  30.781 1.00 23.45 ? 183 ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 183 ? 5.986   6.342  29.160 1.00 23.49 ? 183 ASP A OD2 1 
ATOM   1411 N N   . VAL A 1 184 ? 11.086  4.280  28.464 1.00 27.46 ? 184 VAL A N   1 
ATOM   1412 C CA  . VAL A 1 184 ? 12.004  3.314  27.880 1.00 29.91 ? 184 VAL A CA  1 
ATOM   1413 C C   . VAL A 1 184 ? 11.249  2.072  27.472 1.00 32.46 ? 184 VAL A C   1 
ATOM   1414 O O   . VAL A 1 184 ? 10.191  1.747  28.022 1.00 32.93 ? 184 VAL A O   1 
ATOM   1415 C CB  . VAL A 1 184 ? 13.139  2.902  28.862 1.00 29.69 ? 184 VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 184 ? 14.052  4.096  29.161 1.00 29.78 ? 184 VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 184 ? 12.554  2.339  30.182 1.00 30.59 ? 184 VAL A CG2 1 
ATOM   1418 N N   . PRO A 1 185 ? 11.784  1.368  26.483 1.00 35.33 ? 185 PRO A N   1 
ATOM   1419 C CA  . PRO A 1 185 ? 11.246  0.109  25.989 1.00 38.41 ? 185 PRO A CA  1 
ATOM   1420 C C   . PRO A 1 185 ? 11.265  -0.994 27.017 1.00 42.02 ? 185 PRO A C   1 
ATOM   1421 O O   . PRO A 1 185 ? 11.927  -0.897 28.048 1.00 42.49 ? 185 PRO A O   1 
ATOM   1422 C CB  . PRO A 1 185 ? 12.172  -0.214 24.827 1.00 37.55 ? 185 PRO A CB  1 
ATOM   1423 C CG  . PRO A 1 185 ? 12.557  1.113  24.316 1.00 37.29 ? 185 PRO A CG  1 
ATOM   1424 C CD  . PRO A 1 185 ? 12.852  1.853  25.601 1.00 36.46 ? 185 PRO A CD  1 
ATOM   1425 N N   . LYS A 1 186 ? 10.492  -2.034 26.734 1.00 47.49 ? 186 LYS A N   1 
ATOM   1426 C CA  . LYS A 1 186 ? 10.406  -3.190 27.618 1.00 51.75 ? 186 LYS A CA  1 
ATOM   1427 C C   . LYS A 1 186 ? 11.766  -3.922 27.454 1.00 51.32 ? 186 LYS A C   1 
ATOM   1428 O O   . LYS A 1 186 ? 12.374  -4.461 28.392 1.00 50.29 ? 186 LYS A O   1 
ATOM   1429 C CB  . LYS A 1 186 ? 9.194   -4.044 27.180 1.00 55.34 ? 186 LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 186 ? 8.609   -4.951 28.280 1.00 59.95 ? 186 LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 186 ? 7.120   -5.299 28.055 1.00 63.11 ? 186 LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 186 ? 6.188   -4.097 28.383 1.00 64.64 ? 186 LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 186 ? 4.709   -4.422 28.318 1.00 65.73 ? 186 LYS A NZ  1 
ATOM   1434 N N   . ASP A 1 187 ? 12.282  -3.841 26.243 1.00 50.93 ? 187 ASP A N   1 
ATOM   1435 C CA  . ASP A 1 187 ? 13.554  -4.456 25.952 1.00 51.36 ? 187 ASP A CA  1 
ATOM   1436 C C   . ASP A 1 187 ? 14.689  -3.782 26.752 1.00 49.26 ? 187 ASP A C   1 
ATOM   1437 O O   . ASP A 1 187 ? 15.734  -4.391 26.979 1.00 50.81 ? 187 ASP A O   1 
ATOM   1438 C CB  . ASP A 1 187 ? 13.821  -4.340 24.446 1.00 53.16 ? 187 ASP A CB  1 
ATOM   1439 C CG  . ASP A 1 187 ? 13.748  -2.881 23.943 1.00 55.60 ? 187 ASP A CG  1 
ATOM   1440 O OD1 . ASP A 1 187 ? 14.424  -1.995 24.535 1.00 56.87 ? 187 ASP A OD1 1 
ATOM   1441 O OD2 . ASP A 1 187 ? 13.026  -2.613 22.948 1.00 56.89 ? 187 ASP A OD2 1 
ATOM   1442 N N   . PHE A 1 188 ? 14.452  -2.534 27.178 1.00 45.36 ? 188 PHE A N   1 
ATOM   1443 C CA  . PHE A 1 188 ? 15.439  -1.671 27.855 1.00 39.99 ? 188 PHE A CA  1 
ATOM   1444 C C   . PHE A 1 188 ? 16.446  -2.206 28.878 1.00 38.21 ? 188 PHE A C   1 
ATOM   1445 O O   . PHE A 1 188 ? 16.056  -2.881 29.808 1.00 39.59 ? 188 PHE A O   1 
ATOM   1446 C CB  . PHE A 1 188 ? 14.755  -0.409 28.401 1.00 37.24 ? 188 PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 188 ? 15.708  0.739  28.624 1.00 34.70 ? 188 PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 188 ? 16.256  1.414  27.537 1.00 32.72 ? 188 PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 188 ? 16.155  1.059  29.903 1.00 33.24 ? 188 PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 188 ? 17.220  2.351  27.717 1.00 30.29 ? 188 PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 188 ? 17.122  1.998  30.080 1.00 31.44 ? 188 PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 188 ? 17.653  2.637  28.988 1.00 31.37 ? 188 PHE A CZ  1 
ATOM   1453 N N   . THR A 1 189 ? 17.714  -1.802 28.732 1.00 35.15 ? 189 THR A N   1 
ATOM   1454 C CA  . THR A 1 189 ? 18.826  -2.182 29.623 1.00 32.33 ? 189 THR A CA  1 
ATOM   1455 C C   . THR A 1 189 ? 19.301  -0.965 30.418 1.00 30.93 ? 189 THR A C   1 
ATOM   1456 O O   . THR A 1 189 ? 19.706  0.030  29.808 1.00 32.39 ? 189 THR A O   1 
ATOM   1457 C CB  . THR A 1 189 ? 20.001  -2.568 28.790 1.00 32.42 ? 189 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 189 ? 19.623  -3.618 27.886 1.00 34.76 ? 189 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 189 ? 21.097  -3.010 29.650 1.00 32.17 ? 189 THR A CG2 1 
ATOM   1460 N N   . SER A 1 190 ? 19.308  -1.038 31.751 1.00 27.92 ? 190 SER A N   1 
ATOM   1461 C CA  . SER A 1 190 ? 19.723  0.116  32.577 1.00 24.16 ? 190 SER A CA  1 
ATOM   1462 C C   . SER A 1 190 ? 21.065  0.706  32.115 1.00 23.43 ? 190 SER A C   1 
ATOM   1463 O O   . SER A 1 190 ? 21.942  -0.019 31.661 1.00 24.10 ? 190 SER A O   1 
ATOM   1464 C CB  . SER A 1 190 ? 19.795  -0.268 34.057 1.00 22.60 ? 190 SER A CB  1 
ATOM   1465 O OG  . SER A 1 190 ? 19.807  0.869  34.928 1.00 21.05 ? 190 SER A OG  1 
ATOM   1466 N N   . GLY A 1 191 ? 21.216  2.022  32.211 1.00 22.00 ? 191 GLY A N   1 
ATOM   1467 C CA  . GLY A 1 191 ? 22.453  2.648  31.780 1.00 18.08 ? 191 GLY A CA  1 
ATOM   1468 C C   . GLY A 1 191 ? 22.386  3.056  30.334 1.00 16.80 ? 191 GLY A C   1 
ATOM   1469 O O   . GLY A 1 191 ? 23.098  3.925  29.917 1.00 15.49 ? 191 GLY A O   1 
ATOM   1470 N N   . MET A 1 192 ? 21.578  2.399  29.529 1.00 18.03 ? 192 MET A N   1 
ATOM   1471 C CA  . MET A 1 192 ? 21.497  2.792  28.128 1.00 20.16 ? 192 MET A CA  1 
ATOM   1472 C C   . MET A 1 192 ? 20.695  4.095  27.975 1.00 20.93 ? 192 MET A C   1 
ATOM   1473 O O   . MET A 1 192 ? 19.664  4.266  28.661 1.00 22.75 ? 192 MET A O   1 
ATOM   1474 C CB  . MET A 1 192 ? 20.895  1.640  27.299 1.00 21.27 ? 192 MET A CB  1 
ATOM   1475 C CG  . MET A 1 192 ? 21.859  0.432  27.053 1.00 22.54 ? 192 MET A CG  1 
ATOM   1476 S SD  . MET A 1 192 ? 23.359  1.002  26.122 1.00 25.73 ? 192 MET A SD  1 
ATOM   1477 C CE  . MET A 1 192 ? 22.628  1.310  24.516 1.00 25.79 ? 192 MET A CE  1 
ATOM   1478 N N   . PRO A 1 193 ? 21.186  5.065  27.135 1.00 19.42 ? 193 PRO A N   1 
ATOM   1479 C CA  . PRO A 1 193 ? 20.471  6.314  26.840 1.00 17.69 ? 193 PRO A CA  1 
ATOM   1480 C C   . PRO A 1 193 ? 19.181  6.162  26.018 1.00 16.65 ? 193 PRO A C   1 
ATOM   1481 O O   . PRO A 1 193 ? 18.994  5.180  25.310 1.00 18.02 ? 193 PRO A O   1 
ATOM   1482 C CB  . PRO A 1 193 ? 21.541  7.134  26.121 1.00 16.33 ? 193 PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 193 ? 22.324  6.161  25.476 1.00 15.83 ? 193 PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 193 ? 22.538  5.177  26.583 1.00 18.74 ? 193 PRO A CD  1 
ATOM   1485 N N   . PHE A 1 194 ? 18.250  7.091  26.140 1.00 15.53 ? 194 PHE A N   1 
ATOM   1486 C CA  . PHE A 1 194 ? 17.027  6.949  25.373 1.00 14.47 ? 194 PHE A CA  1 
ATOM   1487 C C   . PHE A 1 194 ? 16.321  8.267  25.216 1.00 14.58 ? 194 PHE A C   1 
ATOM   1488 O O   . PHE A 1 194 ? 16.379  9.062  26.124 1.00 16.82 ? 194 PHE A O   1 
ATOM   1489 C CB  . PHE A 1 194 ? 16.075  6.012  26.098 1.00 13.49 ? 194 PHE A CB  1 
ATOM   1490 C CG  . PHE A 1 194 ? 14.730  5.922  25.463 1.00 13.21 ? 194 PHE A CG  1 
ATOM   1491 C CD1 . PHE A 1 194 ? 14.484  4.970  24.476 1.00 14.14 ? 194 PHE A CD1 1 
ATOM   1492 C CD2 . PHE A 1 194 ? 13.718  6.798  25.812 1.00 13.20 ? 194 PHE A CD2 1 
ATOM   1493 C CE1 . PHE A 1 194 ? 13.239  4.885  23.830 1.00 13.92 ? 194 PHE A CE1 1 
ATOM   1494 C CE2 . PHE A 1 194 ? 12.471  6.731  25.178 1.00 13.98 ? 194 PHE A CE2 1 
ATOM   1495 C CZ  . PHE A 1 194 ? 12.237  5.765  24.181 1.00 13.56 ? 194 PHE A CZ  1 
ATOM   1496 N N   . VAL A 1 195 ? 15.737  8.528  24.047 1.00 12.96 ? 195 VAL A N   1 
ATOM   1497 C CA  . VAL A 1 195 ? 14.914  9.721  23.816 1.00 13.53 ? 195 VAL A CA  1 
ATOM   1498 C C   . VAL A 1 195 ? 13.904  9.192  22.800 1.00 14.51 ? 195 VAL A C   1 
ATOM   1499 O O   . VAL A 1 195 ? 14.298  8.520  21.865 1.00 16.53 ? 195 VAL A O   1 
ATOM   1500 C CB  . VAL A 1 195 ? 15.663  10.950 23.259 1.00 13.06 ? 195 VAL A CB  1 
ATOM   1501 C CG1 . VAL A 1 195 ? 14.649  12.039 22.939 1.00 12.17 ? 195 VAL A CG1 1 
ATOM   1502 C CG2 . VAL A 1 195 ? 16.645  11.507 24.289 1.00 12.23 ? 195 VAL A CG2 1 
ATOM   1503 N N   . ALA A 1 196 ? 12.609  9.405  22.998 1.00 14.96 ? 196 ALA A N   1 
ATOM   1504 C CA  . ALA A 1 196 ? 11.662  8.833  22.053 1.00 15.16 ? 196 ALA A CA  1 
ATOM   1505 C C   . ALA A 1 196 ? 11.662  9.425  20.667 1.00 17.28 ? 196 ALA A C   1 
ATOM   1506 O O   . ALA A 1 196 ? 11.191  8.772  19.763 1.00 19.82 ? 196 ALA A O   1 
ATOM   1507 C CB  . ALA A 1 196 ? 10.302  8.847  22.591 1.00 14.06 ? 196 ALA A CB  1 
ATOM   1508 N N   . GLY A 1 197 ? 12.226  10.610 20.476 1.00 18.23 ? 197 GLY A N   1 
ATOM   1509 C CA  . GLY A 1 197 ? 12.210  11.218 19.166 1.00 18.55 ? 197 GLY A CA  1 
ATOM   1510 C C   . GLY A 1 197 ? 12.063  12.733 19.245 1.00 21.32 ? 197 GLY A C   1 
ATOM   1511 O O   . GLY A 1 197 ? 12.310  13.299 20.330 1.00 23.59 ? 197 GLY A O   1 
ATOM   1512 N N   . LYS A 1 198 ? 11.565  13.375 18.171 1.00 20.84 ? 198 LYS A N   1 
ATOM   1513 C CA  . LYS A 1 198 ? 11.443  14.842 18.096 1.00 19.97 ? 198 LYS A CA  1 
ATOM   1514 C C   . LYS A 1 198 ? 10.564  15.615 19.041 1.00 20.68 ? 198 LYS A C   1 
ATOM   1515 O O   . LYS A 1 198 ? 10.796  16.792 19.230 1.00 21.57 ? 198 LYS A O   1 
ATOM   1516 C CB  . LYS A 1 198 ? 11.129  15.312 16.685 1.00 20.92 ? 198 LYS A CB  1 
ATOM   1517 C CG  . LYS A 1 198 ? 9.736   15.024 16.206 1.00 20.21 ? 198 LYS A CG  1 
ATOM   1518 C CD  . LYS A 1 198 ? 9.813   14.540 14.796 1.00 21.19 ? 198 LYS A CD  1 
ATOM   1519 C CE  . LYS A 1 198 ? 8.556   14.779 14.084 1.00 21.52 ? 198 LYS A CE  1 
ATOM   1520 N NZ  . LYS A 1 198 ? 8.562   16.222 13.729 1.00 25.16 ? 198 LYS A NZ  1 
ATOM   1521 N N   . ASN A 1 199 ? 9.540   15.022 19.630 1.00 21.15 ? 199 ASN A N   1 
ATOM   1522 C CA  . ASN A 1 199 ? 8.773   15.863 20.540 1.00 21.48 ? 199 ASN A CA  1 
ATOM   1523 C C   . ASN A 1 199 ? 9.209   15.652 22.004 1.00 19.72 ? 199 ASN A C   1 
ATOM   1524 O O   . ASN A 1 199 ? 8.480   15.943 22.945 1.00 20.62 ? 199 ASN A O   1 
ATOM   1525 C CB  . ASN A 1 199 ? 7.274   15.657 20.290 1.00 24.37 ? 199 ASN A CB  1 
ATOM   1526 C CG  . ASN A 1 199 ? 6.915   15.839 18.818 1.00 25.39 ? 199 ASN A CG  1 
ATOM   1527 O OD1 . ASN A 1 199 ? 6.593   14.880 18.124 1.00 27.19 ? 199 ASN A OD1 1 
ATOM   1528 N ND2 . ASN A 1 199 ? 7.019   17.059 18.332 1.00 25.63 ? 199 ASN A ND2 1 
ATOM   1529 N N   . LYS A 1 200 ? 10.411  15.107 22.148 1.00 17.44 ? 200 LYS A N   1 
ATOM   1530 C CA  . LYS A 1 200 ? 11.050  14.821 23.414 1.00 13.48 ? 200 LYS A CA  1 
ATOM   1531 C C   . LYS A 1 200 ? 12.479  15.394 23.368 1.00 14.14 ? 200 LYS A C   1 
ATOM   1532 O O   . LYS A 1 200 ? 13.034  15.704 22.274 1.00 10.93 ? 200 LYS A O   1 
ATOM   1533 C CB  . LYS A 1 200 ? 11.112  13.310 23.630 1.00 12.08 ? 200 LYS A CB  1 
ATOM   1534 C CG  . LYS A 1 200 ? 9.747   12.646 23.675 1.00 9.07  ? 200 LYS A CG  1 
ATOM   1535 C CD  . LYS A 1 200 ? 8.826   13.324 24.653 1.00 6.73  ? 200 LYS A CD  1 
ATOM   1536 C CE  . LYS A 1 200 ? 8.228   12.290 25.555 1.00 5.78  ? 200 LYS A CE  1 
ATOM   1537 N NZ  . LYS A 1 200 ? 7.234   12.848 26.511 1.00 5.46  ? 200 LYS A NZ  1 
ATOM   1538 N N   . VAL A 1 201 ? 13.063  15.520 24.566 1.00 13.21 ? 201 VAL A N   1 
ATOM   1539 C CA  . VAL A 1 201 ? 14.415  16.055 24.744 1.00 13.58 ? 201 VAL A CA  1 
ATOM   1540 C C   . VAL A 1 201 ? 15.376  15.076 25.539 1.00 14.36 ? 201 VAL A C   1 
ATOM   1541 O O   . VAL A 1 201 ? 14.911  14.169 26.226 1.00 15.33 ? 201 VAL A O   1 
ATOM   1542 C CB  . VAL A 1 201 ? 14.357  17.499 25.435 1.00 12.62 ? 201 VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 201 ? 13.380  18.384 24.709 1.00 12.72 ? 201 VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 201 ? 14.006  17.422 26.938 1.00 11.06 ? 201 VAL A CG2 1 
ATOM   1545 N N   . ALA A 1 202 ? 16.695  15.215 25.358 1.00 12.76 ? 202 ALA A N   1 
ATOM   1546 C CA  . ALA A 1 202 ? 17.679  14.429 26.079 1.00 11.41 ? 202 ALA A CA  1 
ATOM   1547 C C   . ALA A 1 202 ? 17.609  15.024 27.465 1.00 12.49 ? 202 ALA A C   1 
ATOM   1548 O O   . ALA A 1 202 ? 17.513  16.244 27.592 1.00 13.16 ? 202 ALA A O   1 
ATOM   1549 C CB  . ALA A 1 202 ? 19.035  14.684 25.514 1.00 10.44 ? 202 ALA A CB  1 
ATOM   1550 N N   . ALA A 1 203 ? 17.593  14.195 28.505 1.00 13.99 ? 203 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 203 ? 17.529  14.722 29.863 1.00 13.51 ? 203 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 203 ? 18.924  14.673 30.414 1.00 15.11 ? 203 ALA A C   1 
ATOM   1553 O O   . ALA A 1 203 ? 19.831  14.205 29.728 1.00 15.03 ? 203 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 203 ? 16.596  13.930 30.686 1.00 12.14 ? 203 ALA A CB  1 
ATOM   1555 N N   . CYS A 1 204 ? 19.080  15.105 31.668 1.00 16.27 ? 204 CYS A N   1 
ATOM   1556 C CA  . CYS A 1 204 ? 20.381  15.151 32.362 1.00 15.05 ? 204 CYS A CA  1 
ATOM   1557 C C   . CYS A 1 204 ? 20.282  15.035 33.907 1.00 15.80 ? 204 CYS A C   1 
ATOM   1558 O O   . CYS A 1 204 ? 19.784  15.950 34.570 1.00 16.49 ? 204 CYS A O   1 
ATOM   1559 C CB  . CYS A 1 204 ? 21.058  16.491 31.986 1.00 13.94 ? 204 CYS A CB  1 
ATOM   1560 S SG  . CYS A 1 204 ? 22.734  16.800 32.626 1.00 9.64  ? 204 CYS A SG  1 
ATOM   1561 N N   . ALA A 1 205 ? 20.681  13.891 34.450 1.00 14.13 ? 205 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 205 ? 20.682  13.712 35.887 1.00 14.99 ? 205 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 205 ? 21.826  14.579 36.471 1.00 15.65 ? 205 ALA A C   1 
ATOM   1564 O O   . ALA A 1 205 ? 22.999  14.264 36.364 1.00 14.31 ? 205 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 205 ? 20.935  12.250 36.239 1.00 16.36 ? 205 ALA A CB  1 
ATOM   1566 N N   . LYS A 1 206 ? 21.488  15.661 37.155 1.00 18.12 ? 206 LYS A N   1 
ATOM   1567 C CA  . LYS A 1 206 ? 22.559  16.546 37.595 1.00 19.58 ? 206 LYS A CA  1 
ATOM   1568 C C   . LYS A 1 206 ? 23.100  16.651 39.016 1.00 22.16 ? 206 LYS A C   1 
ATOM   1569 O O   . LYS A 1 206 ? 22.378  16.728 40.040 1.00 21.63 ? 206 LYS A O   1 
ATOM   1570 C CB  . LYS A 1 206 ? 22.607  17.857 36.861 1.00 16.44 ? 206 LYS A CB  1 
ATOM   1571 C CG  . LYS A 1 206 ? 21.637  18.894 37.310 1.00 15.10 ? 206 LYS A CG  1 
ATOM   1572 C CD  . LYS A 1 206 ? 21.681  20.072 36.383 1.00 14.81 ? 206 LYS A CD  1 
ATOM   1573 C CE  . LYS A 1 206 ? 20.659  21.085 36.838 1.00 16.92 ? 206 LYS A CE  1 
ATOM   1574 N NZ  . LYS A 1 206 ? 20.513  22.257 35.941 1.00 17.75 ? 206 LYS A NZ  1 
ATOM   1575 N N   . HIS A 1 207 ? 24.366  17.114 38.885 1.00 24.05 ? 207 HIS A N   1 
ATOM   1576 C CA  . HIS A 1 207 ? 25.456  17.374 39.757 1.00 21.37 ? 207 HIS A CA  1 
ATOM   1577 C C   . HIS A 1 207 ? 25.993  16.167 40.384 1.00 20.32 ? 207 HIS A C   1 
ATOM   1578 O O   . HIS A 1 207 ? 26.125  16.093 41.599 1.00 20.51 ? 207 HIS A O   1 
ATOM   1579 C CB  . HIS A 1 207 ? 25.220  18.538 40.641 1.00 21.86 ? 207 HIS A CB  1 
ATOM   1580 C CG  . HIS A 1 207 ? 24.619  19.704 39.918 1.00 21.69 ? 207 HIS A CG  1 
ATOM   1581 N ND1 . HIS A 1 207 ? 23.518  20.380 40.383 1.00 22.89 ? 207 HIS A ND1 1 
ATOM   1582 C CD2 . HIS A 1 207 ? 24.963  20.276 38.745 1.00 22.04 ? 207 HIS A CD2 1 
ATOM   1583 C CE1 . HIS A 1 207 ? 23.198  21.338 39.519 1.00 22.79 ? 207 HIS A CE1 1 
ATOM   1584 N NE2 . HIS A 1 207 ? 24.052  21.290 38.523 1.00 23.26 ? 207 HIS A NE2 1 
ATOM   1585 N N   . PHE A 1 208 ? 26.530  15.348 39.487 1.00 19.60 ? 208 PHE A N   1 
ATOM   1586 C CA  . PHE A 1 208 ? 27.054  14.084 39.872 1.00 17.99 ? 208 PHE A CA  1 
ATOM   1587 C C   . PHE A 1 208 ? 28.016  14.153 41.031 1.00 18.98 ? 208 PHE A C   1 
ATOM   1588 O O   . PHE A 1 208 ? 29.242  14.231 40.932 1.00 18.13 ? 208 PHE A O   1 
ATOM   1589 C CB  . PHE A 1 208 ? 27.658  13.292 38.771 1.00 15.81 ? 208 PHE A CB  1 
ATOM   1590 C CG  . PHE A 1 208 ? 28.019  11.890 39.199 1.00 14.47 ? 208 PHE A CG  1 
ATOM   1591 C CD1 . PHE A 1 208 ? 27.035  11.010 39.610 1.00 14.07 ? 208 PHE A CD1 1 
ATOM   1592 C CD2 . PHE A 1 208 ? 29.339  11.429 39.151 1.00 14.86 ? 208 PHE A CD2 1 
ATOM   1593 C CE1 . PHE A 1 208 ? 27.360  9.685  39.952 1.00 14.87 ? 208 PHE A CE1 1 
ATOM   1594 C CE2 . PHE A 1 208 ? 29.669  10.113 39.494 1.00 14.37 ? 208 PHE A CE2 1 
ATOM   1595 C CZ  . PHE A 1 208 ? 28.687  9.240  39.888 1.00 13.70 ? 208 PHE A CZ  1 
ATOM   1596 N N   . VAL A 1 209 ? 27.305  13.540 41.972 1.00 19.69 ? 209 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 209 ? 27.485  13.136 43.289 1.00 18.39 ? 209 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 209 ? 27.956  13.995 44.390 1.00 19.25 ? 209 VAL A C   1 
ATOM   1599 O O   . VAL A 1 209 ? 29.074  14.525 44.402 1.00 20.84 ? 209 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 209 ? 27.859  11.599 43.322 1.00 18.09 ? 209 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 209 ? 29.212  11.380 44.010 1.00 18.46 ? 209 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 209 ? 26.671  10.857 43.899 1.00 16.05 ? 209 VAL A CG2 1 
ATOM   1603 N N   . GLY A 1 210 ? 27.005  14.108 45.323 1.00 18.58 ? 210 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 210 ? 27.153  14.829 46.562 1.00 17.12 ? 210 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 210 ? 26.999  16.314 46.539 1.00 16.45 ? 210 GLY A C   1 
ATOM   1606 O O   . GLY A 1 210 ? 27.367  16.950 47.494 1.00 18.77 ? 210 GLY A O   1 
ATOM   1607 N N   . ASP A 1 211 ? 26.460  16.893 45.490 1.00 16.36 ? 211 ASP A N   1 
ATOM   1608 C CA  . ASP A 1 211 ? 26.328  18.354 45.495 1.00 16.18 ? 211 ASP A CA  1 
ATOM   1609 C C   . ASP A 1 211 ? 25.482  18.862 46.679 1.00 16.73 ? 211 ASP A C   1 
ATOM   1610 O O   . ASP A 1 211 ? 25.789  19.888 47.248 1.00 18.13 ? 211 ASP A O   1 
ATOM   1611 C CB  . ASP A 1 211 ? 25.766  18.861 44.159 1.00 15.45 ? 211 ASP A CB  1 
ATOM   1612 C CG  . ASP A 1 211 ? 24.553  18.045 43.661 1.00 15.47 ? 211 ASP A CG  1 
ATOM   1613 O OD1 . ASP A 1 211 ? 24.425  16.816 43.948 1.00 15.53 ? 211 ASP A OD1 1 
ATOM   1614 O OD2 . ASP A 1 211 ? 23.744  18.640 42.916 1.00 13.68 ? 211 ASP A OD2 1 
ATOM   1615 N N   . GLY A 1 212 ? 24.399  18.164 47.009 1.00 15.98 ? 212 GLY A N   1 
ATOM   1616 C CA  . GLY A 1 212 ? 23.572  18.580 48.129 1.00 15.10 ? 212 GLY A CA  1 
ATOM   1617 C C   . GLY A 1 212 ? 24.123  18.252 49.499 1.00 14.60 ? 212 GLY A C   1 
ATOM   1618 O O   . GLY A 1 212 ? 23.469  18.526 50.503 1.00 13.23 ? 212 GLY A O   1 
ATOM   1619 N N   . GLY A 1 213 ? 25.278  17.591 49.527 1.00 16.13 ? 213 GLY A N   1 
ATOM   1620 C CA  . GLY A 1 213 ? 25.937  17.254 50.790 1.00 17.19 ? 213 GLY A CA  1 
ATOM   1621 C C   . GLY A 1 213 ? 27.132  18.122 51.206 1.00 17.80 ? 213 GLY A C   1 
ATOM   1622 O O   . GLY A 1 213 ? 27.898  17.698 52.052 1.00 18.13 ? 213 GLY A O   1 
ATOM   1623 N N   . THR A 1 214 ? 27.317  19.312 50.631 1.00 20.00 ? 214 THR A N   1 
ATOM   1624 C CA  . THR A 1 214 ? 28.464  20.166 50.993 1.00 21.12 ? 214 THR A CA  1 
ATOM   1625 C C   . THR A 1 214 ? 28.483  20.659 52.452 1.00 22.43 ? 214 THR A C   1 
ATOM   1626 O O   . THR A 1 214 ? 27.430  20.759 53.057 1.00 24.17 ? 214 THR A O   1 
ATOM   1627 C CB  . THR A 1 214 ? 28.666  21.403 49.987 1.00 19.87 ? 214 THR A CB  1 
ATOM   1628 O OG1 . THR A 1 214 ? 27.576  22.331 50.055 1.00 16.92 ? 214 THR A OG1 1 
ATOM   1629 C CG2 . THR A 1 214 ? 28.899  20.922 48.559 1.00 16.63 ? 214 THR A CG2 1 
ATOM   1630 N N   . VAL A 1 215 ? 29.661  20.970 53.014 1.00 23.74 ? 215 VAL A N   1 
ATOM   1631 C CA  . VAL A 1 215 ? 29.726  21.469 54.415 1.00 25.31 ? 215 VAL A CA  1 
ATOM   1632 C C   . VAL A 1 215 ? 29.015  22.818 54.551 1.00 25.69 ? 215 VAL A C   1 
ATOM   1633 O O   . VAL A 1 215 ? 29.365  23.766 53.855 1.00 26.90 ? 215 VAL A O   1 
ATOM   1634 C CB  . VAL A 1 215 ? 31.205  21.618 54.964 1.00 23.67 ? 215 VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 215 ? 32.159  21.742 53.836 1.00 24.23 ? 215 VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 215 ? 31.340  22.883 55.862 1.00 22.46 ? 215 VAL A CG2 1 
ATOM   1637 N N   . ASP A 1 216 ? 28.123  22.943 55.525 1.00 26.12 ? 216 ASP A N   1 
ATOM   1638 C CA  . ASP A 1 216 ? 27.369  24.193 55.728 1.00 28.43 ? 216 ASP A CA  1 
ATOM   1639 C C   . ASP A 1 216 ? 26.579  24.586 54.519 1.00 28.88 ? 216 ASP A C   1 
ATOM   1640 O O   . ASP A 1 216 ? 26.114  25.726 54.459 1.00 29.30 ? 216 ASP A O   1 
ATOM   1641 C CB  . ASP A 1 216 ? 28.244  25.399 56.061 1.00 28.93 ? 216 ASP A CB  1 
ATOM   1642 C CG  . ASP A 1 216 ? 28.988  25.223 57.331 1.00 30.73 ? 216 ASP A CG  1 
ATOM   1643 O OD1 . ASP A 1 216 ? 28.610  24.252 58.059 1.00 30.77 ? 216 ASP A OD1 1 
ATOM   1644 O OD2 . ASP A 1 216 ? 29.910  26.062 57.586 1.00 30.32 ? 216 ASP A OD2 1 
ATOM   1645 N N   . GLY A 1 217 ? 26.453  23.654 53.572 1.00 27.64 ? 217 GLY A N   1 
ATOM   1646 C CA  . GLY A 1 217 ? 25.715  23.911 52.355 1.00 26.60 ? 217 GLY A CA  1 
ATOM   1647 C C   . GLY A 1 217 ? 26.368  25.043 51.576 1.00 25.66 ? 217 GLY A C   1 
ATOM   1648 O O   . GLY A 1 217 ? 25.689  25.911 51.020 1.00 26.57 ? 217 GLY A O   1 
ATOM   1649 N N   . ILE A 1 218 ? 27.693  25.086 51.593 1.00 24.14 ? 218 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 218 ? 28.393  26.103 50.834 1.00 22.94 ? 218 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 218 ? 28.416  25.509 49.439 1.00 22.81 ? 218 ILE A C   1 
ATOM   1652 O O   . ILE A 1 218 ? 28.785  24.350 49.259 1.00 21.71 ? 218 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 218 ? 29.838  26.350 51.343 1.00 21.73 ? 218 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 218 ? 29.783  26.778 52.803 1.00 20.52 ? 218 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 218 ? 30.505  27.467 50.546 1.00 21.21 ? 218 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 218 ? 31.124  26.861 53.426 1.00 21.10 ? 218 ILE A CD1 1 
ATOM   1657 N N   . ASN A 1 219 ? 27.960  26.295 48.473 1.00 22.07 ? 219 ASN A N   1 
ATOM   1658 C CA  . ASN A 1 219 ? 27.894  25.865 47.093 1.00 22.69 ? 219 ASN A CA  1 
ATOM   1659 C C   . ASN A 1 219 ? 29.291  25.551 46.503 1.00 24.78 ? 219 ASN A C   1 
ATOM   1660 O O   . ASN A 1 219 ? 30.244  26.326 46.728 1.00 25.99 ? 219 ASN A O   1 
ATOM   1661 C CB  . ASN A 1 219 ? 27.203  26.976 46.298 1.00 21.43 ? 219 ASN A CB  1 
ATOM   1662 C CG  . ASN A 1 219 ? 26.867  26.560 44.884 1.00 21.04 ? 219 ASN A CG  1 
ATOM   1663 O OD1 . ASN A 1 219 ? 27.172  27.270 43.935 1.00 20.88 ? 219 ASN A OD1 1 
ATOM   1664 N ND2 . ASN A 1 219 ? 26.209  25.433 44.745 1.00 19.55 ? 219 ASN A ND2 1 
ATOM   1665 N N   . GLU A 1 220 ? 29.411  24.446 45.747 1.00 24.50 ? 220 GLU A N   1 
ATOM   1666 C CA  . GLU A 1 220 ? 30.652  24.039 45.073 1.00 25.27 ? 220 GLU A CA  1 
ATOM   1667 C C   . GLU A 1 220 ? 31.759  23.660 46.025 1.00 27.20 ? 220 GLU A C   1 
ATOM   1668 O O   . GLU A 1 220 ? 32.899  23.455 45.607 1.00 28.40 ? 220 GLU A O   1 
ATOM   1669 C CB  . GLU A 1 220 ? 31.199  25.161 44.204 1.00 24.62 ? 220 GLU A CB  1 
ATOM   1670 C CG  . GLU A 1 220 ? 30.169  25.906 43.459 1.00 26.83 ? 220 GLU A CG  1 
ATOM   1671 C CD  . GLU A 1 220 ? 30.718  26.652 42.278 1.00 28.72 ? 220 GLU A CD  1 
ATOM   1672 O OE1 . GLU A 1 220 ? 31.931  26.618 42.012 1.00 29.76 ? 220 GLU A OE1 1 
ATOM   1673 O OE2 . GLU A 1 220 ? 29.915  27.274 41.579 1.00 30.08 ? 220 GLU A OE2 1 
ATOM   1674 N N   . ASN A 1 221 ? 31.422  23.586 47.306 1.00 28.93 ? 221 ASN A N   1 
ATOM   1675 C CA  . ASN A 1 221 ? 32.390  23.276 48.340 1.00 28.53 ? 221 ASN A CA  1 
ATOM   1676 C C   . ASN A 1 221 ? 32.650  21.773 48.517 1.00 27.69 ? 221 ASN A C   1 
ATOM   1677 O O   . ASN A 1 221 ? 32.469  20.992 47.585 1.00 28.16 ? 221 ASN A O   1 
ATOM   1678 C CB  . ASN A 1 221 ? 31.961  23.956 49.636 1.00 30.51 ? 221 ASN A CB  1 
ATOM   1679 C CG  . ASN A 1 221 ? 33.145  24.414 50.467 1.00 31.96 ? 221 ASN A CG  1 
ATOM   1680 O OD1 . ASN A 1 221 ? 33.376  23.919 51.565 1.00 31.70 ? 221 ASN A OD1 1 
ATOM   1681 N ND2 . ASN A 1 221 ? 33.862  25.393 49.944 1.00 33.95 ? 221 ASN A ND2 1 
ATOM   1682 N N   . ASN A 1 222 ? 32.990  21.352 49.728 1.00 25.89 ? 222 ASN A N   1 
ATOM   1683 C CA  . ASN A 1 222 ? 33.344  19.965 49.963 1.00 24.84 ? 222 ASN A CA  1 
ATOM   1684 C C   . ASN A 1 222 ? 32.283  19.131 50.702 1.00 24.49 ? 222 ASN A C   1 
ATOM   1685 O O   . ASN A 1 222 ? 31.571  19.630 51.568 1.00 24.33 ? 222 ASN A O   1 
ATOM   1686 C CB  . ASN A 1 222 ? 34.691  19.997 50.702 1.00 25.18 ? 222 ASN A CB  1 
ATOM   1687 C CG  . ASN A 1 222 ? 35.342  18.616 50.903 1.00 26.42 ? 222 ASN A CG  1 
ATOM   1688 O OD1 . ASN A 1 222 ? 35.000  17.594 50.289 1.00 26.36 ? 222 ASN A OD1 1 
ATOM   1689 N ND2 . ASN A 1 222 ? 36.306  18.600 51.806 1.00 27.07 ? 222 ASN A ND2 1 
ATOM   1690 N N   . THR A 1 223 ? 32.147  17.878 50.289 1.00 23.91 ? 223 THR A N   1 
ATOM   1691 C CA  . THR A 1 223 ? 31.226  16.933 50.901 1.00 25.53 ? 223 THR A CA  1 
ATOM   1692 C C   . THR A 1 223 ? 32.084  15.888 51.680 1.00 28.28 ? 223 THR A C   1 
ATOM   1693 O O   . THR A 1 223 ? 32.799  15.022 51.087 1.00 28.64 ? 223 THR A O   1 
ATOM   1694 C CB  . THR A 1 223 ? 30.339  16.243 49.839 1.00 24.77 ? 223 THR A CB  1 
ATOM   1695 O OG1 . THR A 1 223 ? 29.430  17.199 49.298 1.00 24.14 ? 223 THR A OG1 1 
ATOM   1696 C CG2 . THR A 1 223 ? 29.531  15.097 50.445 1.00 23.69 ? 223 THR A CG2 1 
ATOM   1697 N N   . ILE A 1 224 ? 32.048  16.017 53.009 1.00 27.96 ? 224 ILE A N   1 
ATOM   1698 C CA  . ILE A 1 224 ? 32.802  15.169 53.914 1.00 26.85 ? 224 ILE A CA  1 
ATOM   1699 C C   . ILE A 1 224 ? 31.861  14.126 54.481 1.00 27.69 ? 224 ILE A C   1 
ATOM   1700 O O   . ILE A 1 224 ? 31.101  14.376 55.395 1.00 28.41 ? 224 ILE A O   1 
ATOM   1701 C CB  . ILE A 1 224 ? 33.418  16.024 55.011 1.00 25.48 ? 224 ILE A CB  1 
ATOM   1702 C CG1 . ILE A 1 224 ? 34.425  16.995 54.385 1.00 24.41 ? 224 ILE A CG1 1 
ATOM   1703 C CG2 . ILE A 1 224 ? 34.075  15.145 56.039 1.00 25.34 ? 224 ILE A CG2 1 
ATOM   1704 C CD1 . ILE A 1 224 ? 34.582  18.270 55.140 1.00 21.40 ? 224 ILE A CD1 1 
ATOM   1705 N N   . ILE A 1 225 ? 31.907  12.944 53.907 1.00 28.95 ? 225 ILE A N   1 
ATOM   1706 C CA  . ILE A 1 225 ? 31.031  11.873 54.302 1.00 30.48 ? 225 ILE A CA  1 
ATOM   1707 C C   . ILE A 1 225 ? 31.706  10.623 53.813 1.00 33.43 ? 225 ILE A C   1 
ATOM   1708 O O   . ILE A 1 225 ? 32.418  10.648 52.805 1.00 35.33 ? 225 ILE A O   1 
ATOM   1709 C CB  . ILE A 1 225 ? 29.654  11.997 53.607 1.00 29.27 ? 225 ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 225 ? 28.682  10.958 54.160 1.00 29.23 ? 225 ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 225 ? 29.782  11.788 52.103 1.00 28.34 ? 225 ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 225 ? 27.274  11.120 53.675 1.00 29.48 ? 225 ILE A CD1 1 
ATOM   1713 N N   . ASN A 1 226 ? 31.545  9.533  54.547 1.00 37.10 ? 226 ASN A N   1 
ATOM   1714 C CA  . ASN A 1 226 ? 32.163  8.305  54.096 1.00 39.44 ? 226 ASN A CA  1 
ATOM   1715 C C   . ASN A 1 226 ? 31.449  7.715  52.902 1.00 39.27 ? 226 ASN A C   1 
ATOM   1716 O O   . ASN A 1 226 ? 30.380  8.130  52.532 1.00 39.97 ? 226 ASN A O   1 
ATOM   1717 C CB  . ASN A 1 226 ? 32.309  7.307  55.233 1.00 42.23 ? 226 ASN A CB  1 
ATOM   1718 C CG  . ASN A 1 226 ? 31.000  6.774  55.725 1.00 44.83 ? 226 ASN A CG  1 
ATOM   1719 O OD1 . ASN A 1 226 ? 29.918  7.337  55.467 1.00 46.31 ? 226 ASN A OD1 1 
ATOM   1720 N ND2 . ASN A 1 226 ? 31.084  5.685  56.487 1.00 45.94 ? 226 ASN A ND2 1 
ATOM   1721 N N   . ARG A 1 227 ? 32.072  6.753  52.277 1.00 41.47 ? 227 ARG A N   1 
ATOM   1722 C CA  . ARG A 1 227 ? 31.506  6.172  51.105 1.00 43.67 ? 227 ARG A CA  1 
ATOM   1723 C C   . ARG A 1 227 ? 30.177  5.541  51.366 1.00 45.68 ? 227 ARG A C   1 
ATOM   1724 O O   . ARG A 1 227 ? 29.408  5.407  50.431 1.00 46.97 ? 227 ARG A O   1 
ATOM   1725 C CB  . ARG A 1 227 ? 32.471  5.161  50.550 1.00 43.95 ? 227 ARG A CB  1 
ATOM   1726 C CG  . ARG A 1 227 ? 32.286  4.777  49.135 1.00 44.96 ? 227 ARG A CG  1 
ATOM   1727 C CD  . ARG A 1 227 ? 33.229  3.640  48.820 1.00 46.15 ? 227 ARG A CD  1 
ATOM   1728 N NE  . ARG A 1 227 ? 32.474  2.587  48.165 1.00 48.90 ? 227 ARG A NE  1 
ATOM   1729 C CZ  . ARG A 1 227 ? 32.347  2.477  46.848 1.00 49.88 ? 227 ARG A CZ  1 
ATOM   1730 N NH1 . ARG A 1 227 ? 32.968  3.377  46.069 1.00 50.72 ? 227 ARG A NH1 1 
ATOM   1731 N NH2 . ARG A 1 227 ? 31.560  1.515  46.325 1.00 49.22 ? 227 ARG A NH2 1 
ATOM   1732 N N   . GLU A 1 228 ? 29.903  5.113  52.600 1.00 48.82 ? 228 GLU A N   1 
ATOM   1733 C CA  . GLU A 1 228 ? 28.595  4.500  52.867 1.00 50.85 ? 228 GLU A CA  1 
ATOM   1734 C C   . GLU A 1 228 ? 27.531  5.586  52.889 1.00 48.71 ? 228 GLU A C   1 
ATOM   1735 O O   . GLU A 1 228 ? 26.403  5.344  52.497 1.00 48.73 ? 228 GLU A O   1 
ATOM   1736 C CB  . GLU A 1 228 ? 28.558  3.687  54.181 1.00 55.86 ? 228 GLU A CB  1 
ATOM   1737 C CG  . GLU A 1 228 ? 29.579  2.488  54.260 1.00 63.28 ? 228 GLU A CG  1 
ATOM   1738 C CD  . GLU A 1 228 ? 28.953  1.045  54.154 1.00 66.00 ? 228 GLU A CD  1 
ATOM   1739 O OE1 . GLU A 1 228 ? 27.724  0.887  54.423 1.00 67.97 ? 228 GLU A OE1 1 
ATOM   1740 O OE2 . GLU A 1 228 ? 29.711  0.077  53.823 1.00 67.14 ? 228 GLU A OE2 1 
ATOM   1741 N N   . GLY A 1 229 ? 27.895  6.784  53.330 1.00 45.81 ? 229 GLY A N   1 
ATOM   1742 C CA  . GLY A 1 229 ? 26.928  7.864  53.370 1.00 43.03 ? 229 GLY A CA  1 
ATOM   1743 C C   . GLY A 1 229 ? 26.607  8.391  51.991 1.00 41.82 ? 229 GLY A C   1 
ATOM   1744 O O   . GLY A 1 229 ? 25.457  8.677  51.646 1.00 43.07 ? 229 GLY A O   1 
ATOM   1745 N N   . LEU A 1 230 ? 27.655  8.539  51.201 1.00 40.35 ? 230 LEU A N   1 
ATOM   1746 C CA  . LEU A 1 230 ? 27.561  9.020  49.834 1.00 38.03 ? 230 LEU A CA  1 
ATOM   1747 C C   . LEU A 1 230 ? 26.563  8.153  49.073 1.00 36.33 ? 230 LEU A C   1 
ATOM   1748 O O   . LEU A 1 230 ? 25.585  8.643  48.518 1.00 34.97 ? 230 LEU A O   1 
ATOM   1749 C CB  . LEU A 1 230 ? 28.946  8.888  49.186 1.00 38.24 ? 230 LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 230 ? 29.523  9.785  48.071 1.00 39.18 ? 230 LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 230 ? 29.562  9.033  46.755 1.00 38.55 ? 230 LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 230 ? 28.832  11.167 47.975 1.00 38.50 ? 230 LEU A CD2 1 
ATOM   1753 N N   . MET A 1 231 ? 26.832  6.853  49.071 1.00 34.13 ? 231 MET A N   1 
ATOM   1754 C CA  . MET A 1 231 ? 26.031  5.897  48.339 1.00 32.57 ? 231 MET A CA  1 
ATOM   1755 C C   . MET A 1 231 ? 24.659  5.657  48.921 1.00 32.43 ? 231 MET A C   1 
ATOM   1756 O O   . MET A 1 231 ? 23.732  5.237  48.203 1.00 31.94 ? 231 MET A O   1 
ATOM   1757 C CB  . MET A 1 231 ? 26.781  4.561  48.212 1.00 30.72 ? 231 MET A CB  1 
ATOM   1758 C CG  . MET A 1 231 ? 28.231  4.670  47.783 1.00 30.21 ? 231 MET A CG  1 
ATOM   1759 S SD  . MET A 1 231 ? 28.511  4.794  46.008 1.00 29.55 ? 231 MET A SD  1 
ATOM   1760 C CE  . MET A 1 231 ? 27.425  3.607  45.594 1.00 28.96 ? 231 MET A CE  1 
ATOM   1761 N N   . ASN A 1 232 ? 24.513  5.917  50.214 1.00 33.23 ? 232 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 232 ? 23.234  5.655  50.861 1.00 33.03 ? 232 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 232 ? 22.336  6.835  50.821 1.00 30.14 ? 232 ASN A C   1 
ATOM   1764 O O   . ASN A 1 232 ? 21.113  6.672  50.652 1.00 26.78 ? 232 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 232 ? 23.422  5.023  52.242 1.00 38.70 ? 232 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 232 ? 22.622  5.698  53.342 1.00 43.59 ? 232 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 232 ? 21.431  5.378  53.570 1.00 46.73 ? 232 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 232 ? 23.300  6.566  54.112 1.00 44.88 ? 232 ASN A ND2 1 
ATOM   1769 N N   . ILE A 1 233 ? 22.977  8.012  50.778 1.00 26.68 ? 233 ILE A N   1 
ATOM   1770 C CA  . ILE A 1 233 ? 22.261  9.290  50.678 1.00 24.65 ? 233 ILE A CA  1 
ATOM   1771 C C   . ILE A 1 233 ? 22.284  9.938  49.274 1.00 23.88 ? 233 ILE A C   1 
ATOM   1772 O O   . ILE A 1 233 ? 21.255  10.093 48.635 1.00 24.66 ? 233 ILE A O   1 
ATOM   1773 C CB  . ILE A 1 233 ? 22.699  10.307 51.758 1.00 22.32 ? 233 ILE A CB  1 
ATOM   1774 C CG1 . ILE A 1 233 ? 22.497  9.718  53.137 1.00 19.99 ? 233 ILE A CG1 1 
ATOM   1775 C CG2 . ILE A 1 233 ? 21.838  11.575 51.685 1.00 22.06 ? 233 ILE A CG2 1 
ATOM   1776 C CD1 . ILE A 1 233 ? 23.408  10.290 54.131 1.00 20.12 ? 233 ILE A CD1 1 
ATOM   1777 N N   . HIS A 1 234 ? 23.459  10.321 48.803 1.00 24.37 ? 234 HIS A N   1 
ATOM   1778 C CA  . HIS A 1 234 ? 23.592  10.962 47.490 1.00 23.29 ? 234 HIS A CA  1 
ATOM   1779 C C   . HIS A 1 234 ? 23.623  10.091 46.212 1.00 23.76 ? 234 HIS A C   1 
ATOM   1780 O O   . HIS A 1 234 ? 23.377  10.597 45.109 1.00 25.09 ? 234 HIS A O   1 
ATOM   1781 C CB  . HIS A 1 234 ? 24.789  11.874 47.521 1.00 22.30 ? 234 HIS A CB  1 
ATOM   1782 C CG  . HIS A 1 234 ? 24.730  12.860 48.633 1.00 20.63 ? 234 HIS A CG  1 
ATOM   1783 N ND1 . HIS A 1 234 ? 25.579  12.811 49.711 1.00 21.21 ? 234 HIS A ND1 1 
ATOM   1784 C CD2 . HIS A 1 234 ? 23.841  13.840 48.894 1.00 21.93 ? 234 HIS A CD2 1 
ATOM   1785 C CE1 . HIS A 1 234 ? 25.207  13.722 50.598 1.00 21.95 ? 234 HIS A CE1 1 
ATOM   1786 N NE2 . HIS A 1 234 ? 24.157  14.356 50.126 1.00 21.21 ? 234 HIS A NE2 1 
ATOM   1787 N N   . MET A 1 235 ? 23.995  8.816  46.307 1.00 21.32 ? 235 MET A N   1 
ATOM   1788 C CA  . MET A 1 235 ? 23.975  8.018  45.104 1.00 19.09 ? 235 MET A CA  1 
ATOM   1789 C C   . MET A 1 235 ? 22.558  7.562  44.678 1.00 19.28 ? 235 MET A C   1 
ATOM   1790 O O   . MET A 1 235 ? 22.224  7.725  43.513 1.00 22.13 ? 235 MET A O   1 
ATOM   1791 C CB  . MET A 1 235 ? 24.974  6.872  45.183 1.00 18.64 ? 235 MET A CB  1 
ATOM   1792 C CG  . MET A 1 235 ? 25.371  6.238  43.846 1.00 18.52 ? 235 MET A CG  1 
ATOM   1793 S SD  . MET A 1 235 ? 26.259  7.295  42.632 1.00 19.92 ? 235 MET A SD  1 
ATOM   1794 C CE  . MET A 1 235 ? 27.742  7.778  43.520 1.00 17.60 ? 235 MET A CE  1 
ATOM   1795 N N   . PRO A 1 236 ? 21.694  7.038  45.590 1.00 18.45 ? 236 PRO A N   1 
ATOM   1796 C CA  . PRO A 1 236 ? 20.479  6.312  45.135 1.00 17.67 ? 236 PRO A CA  1 
ATOM   1797 C C   . PRO A 1 236 ? 19.786  6.762  43.822 1.00 17.28 ? 236 PRO A C   1 
ATOM   1798 O O   . PRO A 1 236 ? 19.657  5.975  42.869 1.00 15.07 ? 236 PRO A O   1 
ATOM   1799 C CB  . PRO A 1 236 ? 19.526  6.413  46.338 1.00 17.12 ? 236 PRO A CB  1 
ATOM   1800 C CG  . PRO A 1 236 ? 20.470  6.369  47.521 1.00 17.46 ? 236 PRO A CG  1 
ATOM   1801 C CD  . PRO A 1 236 ? 21.716  7.152  47.068 1.00 18.30 ? 236 PRO A CD  1 
ATOM   1802 N N   . ALA A 1 237 ? 19.365  8.022  43.779 1.00 17.84 ? 237 ALA A N   1 
ATOM   1803 C CA  . ALA A 1 237 ? 18.703  8.576  42.615 1.00 18.70 ? 237 ALA A CA  1 
ATOM   1804 C C   . ALA A 1 237 ? 19.428  8.338  41.284 1.00 19.52 ? 237 ALA A C   1 
ATOM   1805 O O   . ALA A 1 237 ? 18.749  8.207  40.246 1.00 22.00 ? 237 ALA A O   1 
ATOM   1806 C CB  . ALA A 1 237 ? 18.426  10.051 42.805 1.00 17.18 ? 237 ALA A CB  1 
ATOM   1807 N N   . TYR A 1 238 ? 20.766  8.363  41.260 1.00 17.60 ? 238 TYR A N   1 
ATOM   1808 C CA  . TYR A 1 238 ? 21.488  8.118  40.011 1.00 16.12 ? 238 TYR A CA  1 
ATOM   1809 C C   . TYR A 1 238 ? 21.264  6.778  39.341 1.00 17.76 ? 238 TYR A C   1 
ATOM   1810 O O   . TYR A 1 238 ? 21.363  6.679  38.132 1.00 18.91 ? 238 TYR A O   1 
ATOM   1811 C CB  . TYR A 1 238 ? 22.945  8.332  40.210 1.00 13.52 ? 238 TYR A CB  1 
ATOM   1812 C CG  . TYR A 1 238 ? 23.220  9.789  40.268 1.00 13.96 ? 238 TYR A CG  1 
ATOM   1813 C CD1 . TYR A 1 238 ? 23.323  10.448 41.487 1.00 13.73 ? 238 TYR A CD1 1 
ATOM   1814 C CD2 . TYR A 1 238 ? 23.340  10.537 39.097 1.00 13.90 ? 238 TYR A CD2 1 
ATOM   1815 C CE1 . TYR A 1 238 ? 23.546  11.827 41.543 1.00 13.10 ? 238 TYR A CE1 1 
ATOM   1816 C CE2 . TYR A 1 238 ? 23.553  11.909 39.146 1.00 13.78 ? 238 TYR A CE2 1 
ATOM   1817 C CZ  . TYR A 1 238 ? 23.664  12.545 40.377 1.00 12.46 ? 238 TYR A CZ  1 
ATOM   1818 O OH  . TYR A 1 238 ? 23.968  13.879 40.421 1.00 11.72 ? 238 TYR A OH  1 
ATOM   1819 N N   . LYS A 1 239 ? 20.966  5.752  40.130 1.00 18.87 ? 239 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 239 ? 20.722  4.414  39.640 1.00 18.20 ? 239 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 239 ? 19.330  4.261  39.008 1.00 17.56 ? 239 LYS A C   1 
ATOM   1822 O O   . LYS A 1 239 ? 19.140  3.494  38.093 1.00 19.14 ? 239 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 239 ? 20.914  3.473  40.803 1.00 20.53 ? 239 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 239 ? 20.388  2.114  40.507 1.00 23.81 ? 239 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 239 ? 21.096  1.481  39.343 1.00 25.09 ? 239 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 239 ? 20.477  0.156  39.034 1.00 26.29 ? 239 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 239 ? 21.437  -0.464 38.145 1.00 29.53 ? 239 LYS A NZ  1 
ATOM   1828 N N   . ASN A 1 240 ? 18.343  4.918  39.592 1.00 18.50 ? 240 ASN A N   1 
ATOM   1829 C CA  . ASN A 1 240 ? 16.966  4.977  39.103 1.00 17.22 ? 240 ASN A CA  1 
ATOM   1830 C C   . ASN A 1 240 ? 17.007  5.676  37.763 1.00 17.03 ? 240 ASN A C   1 
ATOM   1831 O O   . ASN A 1 240 ? 16.169  5.421  36.923 1.00 16.76 ? 240 ASN A O   1 
ATOM   1832 C CB  . ASN A 1 240 ? 16.167  5.919  39.979 1.00 20.12 ? 240 ASN A CB  1 
ATOM   1833 C CG  . ASN A 1 240 ? 15.970  5.394  41.352 1.00 22.06 ? 240 ASN A CG  1 
ATOM   1834 O OD1 . ASN A 1 240 ? 16.616  5.807  42.323 1.00 23.46 ? 240 ASN A OD1 1 
ATOM   1835 N ND2 . ASN A 1 240 ? 15.053  4.470  41.458 1.00 24.35 ? 240 ASN A ND2 1 
ATOM   1836 N N   . ALA A 1 241 ? 17.823  6.733  37.688 1.00 16.71 ? 241 ALA A N   1 
ATOM   1837 C CA  . ALA A 1 241 ? 18.028  7.510  36.476 1.00 15.89 ? 241 ALA A CA  1 
ATOM   1838 C C   . ALA A 1 241 ? 18.546  6.540  35.363 1.00 17.57 ? 241 ALA A C   1 
ATOM   1839 O O   . ALA A 1 241 ? 18.074  6.582  34.210 1.00 17.82 ? 241 ALA A O   1 
ATOM   1840 C CB  . ALA A 1 241 ? 19.023  8.628  36.769 1.00 15.28 ? 241 ALA A CB  1 
ATOM   1841 N N   . MET A 1 242 ? 19.509  5.672  35.711 1.00 17.81 ? 242 MET A N   1 
ATOM   1842 C CA  . MET A 1 242 ? 20.043  4.650  34.784 1.00 16.42 ? 242 MET A CA  1 
ATOM   1843 C C   . MET A 1 242 ? 18.907  3.705  34.349 1.00 15.43 ? 242 MET A C   1 
ATOM   1844 O O   . MET A 1 242 ? 18.786  3.353  33.178 1.00 14.40 ? 242 MET A O   1 
ATOM   1845 C CB  . MET A 1 242 ? 21.123  3.781  35.456 1.00 16.99 ? 242 MET A CB  1 
ATOM   1846 C CG  . MET A 1 242 ? 22.360  4.491  35.968 1.00 16.20 ? 242 MET A CG  1 
ATOM   1847 S SD  . MET A 1 242 ? 23.390  5.288  34.743 1.00 17.29 ? 242 MET A SD  1 
ATOM   1848 C CE  . MET A 1 242 ? 23.058  7.049  34.995 1.00 14.94 ? 242 MET A CE  1 
ATOM   1849 N N   . ASP A 1 243 ? 18.090  3.240  35.281 1.00 14.33 ? 243 ASP A N   1 
ATOM   1850 C CA  . ASP A 1 243 ? 17.018  2.365  34.828 1.00 15.80 ? 243 ASP A CA  1 
ATOM   1851 C C   . ASP A 1 243 ? 15.985  3.124  34.021 1.00 15.59 ? 243 ASP A C   1 
ATOM   1852 O O   . ASP A 1 243 ? 15.069  2.523  33.465 1.00 15.77 ? 243 ASP A O   1 
ATOM   1853 C CB  . ASP A 1 243 ? 16.277  1.743  35.974 1.00 18.02 ? 243 ASP A CB  1 
ATOM   1854 C CG  . ASP A 1 243 ? 17.145  1.423  37.125 1.00 19.27 ? 243 ASP A CG  1 
ATOM   1855 O OD1 . ASP A 1 243 ? 18.257  0.855  36.931 1.00 20.40 ? 243 ASP A OD1 1 
ATOM   1856 O OD2 . ASP A 1 243 ? 16.645  1.718  38.236 1.00 20.51 ? 243 ASP A OD2 1 
ATOM   1857 N N   . LYS A 1 244 ? 16.021  4.449  34.116 1.00 15.55 ? 244 LYS A N   1 
ATOM   1858 C CA  . LYS A 1 244 ? 15.080  5.274  33.395 1.00 13.79 ? 244 LYS A CA  1 
ATOM   1859 C C   . LYS A 1 244 ? 15.606  5.774  32.074 1.00 14.23 ? 244 LYS A C   1 
ATOM   1860 O O   . LYS A 1 244 ? 14.888  6.461  31.349 1.00 14.79 ? 244 LYS A O   1 
ATOM   1861 C CB  . LYS A 1 244 ? 14.577  6.382  34.277 1.00 12.69 ? 244 LYS A CB  1 
ATOM   1862 C CG  . LYS A 1 244 ? 13.532  5.808  35.188 1.00 14.05 ? 244 LYS A CG  1 
ATOM   1863 C CD  . LYS A 1 244 ? 12.955  6.782  36.170 1.00 14.29 ? 244 LYS A CD  1 
ATOM   1864 C CE  . LYS A 1 244 ? 12.164  6.023  37.212 1.00 14.84 ? 244 LYS A CE  1 
ATOM   1865 N NZ  . LYS A 1 244 ? 11.787  6.859  38.402 1.00 14.32 ? 244 LYS A NZ  1 
ATOM   1866 N N   . GLY A 1 245 ? 16.840  5.365  31.763 1.00 13.43 ? 245 GLY A N   1 
ATOM   1867 C CA  . GLY A 1 245 ? 17.507  5.709  30.524 1.00 11.95 ? 245 GLY A CA  1 
ATOM   1868 C C   . GLY A 1 245 ? 17.976  7.136  30.380 1.00 12.97 ? 245 GLY A C   1 
ATOM   1869 O O   . GLY A 1 245 ? 18.077  7.596  29.227 1.00 13.77 ? 245 GLY A O   1 
ATOM   1870 N N   . VAL A 1 246 ? 18.309  7.808  31.493 1.00 10.86 ? 246 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 246 ? 18.745  9.202  31.410 1.00 11.84 ? 246 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 246 ? 19.897  9.305  30.430 1.00 12.67 ? 246 VAL A C   1 
ATOM   1873 O O   . VAL A 1 246 ? 20.842  8.521  30.496 1.00 15.25 ? 246 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 246 ? 19.111  9.836  32.799 1.00 12.23 ? 246 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 246 ? 20.397  9.269  33.340 1.00 12.55 ? 246 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 246 ? 19.183  11.375 32.701 1.00 11.95 ? 246 VAL A CG2 1 
ATOM   1877 N N   . SER A 1 247 ? 19.757  10.202 29.457 1.00 13.02 ? 247 SER A N   1 
ATOM   1878 C CA  . SER A 1 247 ? 20.762  10.403 28.413 1.00 12.32 ? 247 SER A CA  1 
ATOM   1879 C C   . SER A 1 247 ? 22.154  10.842 28.844 1.00 12.30 ? 247 SER A C   1 
ATOM   1880 O O   . SER A 1 247 ? 23.155  10.200 28.479 1.00 11.53 ? 247 SER A O   1 
ATOM   1881 C CB  . SER A 1 247 ? 20.231  11.349 27.346 1.00 12.20 ? 247 SER A CB  1 
ATOM   1882 O OG  . SER A 1 247 ? 19.389  10.625 26.472 1.00 13.52 ? 247 SER A OG  1 
ATOM   1883 N N   . THR A 1 248 ? 22.221  11.938 29.602 1.00 11.82 ? 248 THR A N   1 
ATOM   1884 C CA  . THR A 1 248 ? 23.497  12.485 30.062 1.00 9.27  ? 248 THR A CA  1 
ATOM   1885 C C   . THR A 1 248 ? 23.580  12.574 31.596 1.00 9.14  ? 248 THR A C   1 
ATOM   1886 O O   . THR A 1 248 ? 22.635  12.195 32.293 1.00 6.49  ? 248 THR A O   1 
ATOM   1887 C CB  . THR A 1 248 ? 23.736  13.843 29.379 1.00 6.94  ? 248 THR A CB  1 
ATOM   1888 O OG1 . THR A 1 248 ? 22.889  14.837 29.961 1.00 6.85  ? 248 THR A OG1 1 
ATOM   1889 C CG2 . THR A 1 248 ? 23.355  13.733 27.886 1.00 4.98  ? 248 THR A CG2 1 
ATOM   1890 N N   . VAL A 1 249 ? 24.784  12.841 32.098 1.00 9.47  ? 249 VAL A N   1 
ATOM   1891 C CA  . VAL A 1 249 ? 25.034  13.014 33.531 1.00 11.32 ? 249 VAL A CA  1 
ATOM   1892 C C   . VAL A 1 249 ? 26.002  14.191 33.612 1.00 12.87 ? 249 VAL A C   1 
ATOM   1893 O O   . VAL A 1 249 ? 27.030  14.160 32.956 1.00 15.50 ? 249 VAL A O   1 
ATOM   1894 C CB  . VAL A 1 249 ? 25.693  11.773 34.182 1.00 10.47 ? 249 VAL A CB  1 
ATOM   1895 C CG1 . VAL A 1 249 ? 26.163  12.086 35.589 1.00 9.47  ? 249 VAL A CG1 1 
ATOM   1896 C CG2 . VAL A 1 249 ? 24.688  10.668 34.284 1.00 11.03 ? 249 VAL A CG2 1 
ATOM   1897 N N   . MET A 1 250 ? 25.649  15.237 34.355 1.00 13.68 ? 250 MET A N   1 
ATOM   1898 C CA  . MET A 1 250 ? 26.497  16.415 34.489 1.00 12.99 ? 250 MET A CA  1 
ATOM   1899 C C   . MET A 1 250 ? 27.267  16.272 35.787 1.00 13.01 ? 250 MET A C   1 
ATOM   1900 O O   . MET A 1 250 ? 26.720  15.828 36.778 1.00 10.54 ? 250 MET A O   1 
ATOM   1901 C CB  . MET A 1 250 ? 25.652  17.713 34.499 1.00 11.29 ? 250 MET A CB  1 
ATOM   1902 C CG  . MET A 1 250 ? 26.466  18.961 34.758 1.00 10.95 ? 250 MET A CG  1 
ATOM   1903 S SD  . MET A 1 250 ? 25.564  20.444 34.565 1.00 9.01  ? 250 MET A SD  1 
ATOM   1904 C CE  . MET A 1 250 ? 25.104  20.188 32.935 1.00 11.05 ? 250 MET A CE  1 
ATOM   1905 N N   . ILE A 1 251 ? 28.515  16.716 35.781 1.00 13.79 ? 251 ILE A N   1 
ATOM   1906 C CA  . ILE A 1 251 ? 29.370  16.602 36.941 1.00 15.14 ? 251 ILE A CA  1 
ATOM   1907 C C   . ILE A 1 251 ? 29.305  17.864 37.808 1.00 18.09 ? 251 ILE A C   1 
ATOM   1908 O O   . ILE A 1 251 ? 29.271  18.986 37.303 1.00 18.91 ? 251 ILE A O   1 
ATOM   1909 C CB  . ILE A 1 251 ? 30.811  16.234 36.506 1.00 13.16 ? 251 ILE A CB  1 
ATOM   1910 C CG1 . ILE A 1 251 ? 30.767  14.990 35.634 1.00 11.54 ? 251 ILE A CG1 1 
ATOM   1911 C CG2 . ILE A 1 251 ? 31.680  15.876 37.690 1.00 13.84 ? 251 ILE A CG2 1 
ATOM   1912 C CD1 . ILE A 1 251 ? 30.171  13.791 36.306 1.00 11.40 ? 251 ILE A CD1 1 
ATOM   1913 N N   . SER A 1 252 ? 29.302  17.650 39.121 1.00 21.39 ? 252 SER A N   1 
ATOM   1914 C CA  . SER A 1 252 ? 29.190  18.711 40.131 1.00 21.49 ? 252 SER A CA  1 
ATOM   1915 C C   . SER A 1 252 ? 30.509  19.417 40.376 1.00 21.55 ? 252 SER A C   1 
ATOM   1916 O O   . SER A 1 252 ? 31.561  18.797 40.236 1.00 23.21 ? 252 SER A O   1 
ATOM   1917 C CB  . SER A 1 252 ? 28.675  18.085 41.436 1.00 20.79 ? 252 SER A CB  1 
ATOM   1918 O OG  . SER A 1 252 ? 28.638  18.991 42.498 1.00 19.72 ? 252 SER A OG  1 
ATOM   1919 N N   . TYR A 1 253 ? 30.440  20.722 40.648 1.00 21.21 ? 253 TYR A N   1 
ATOM   1920 C CA  . TYR A 1 253 ? 31.609  21.553 40.965 1.00 21.64 ? 253 TYR A CA  1 
ATOM   1921 C C   . TYR A 1 253 ? 32.202  21.152 42.320 1.00 22.45 ? 253 TYR A C   1 
ATOM   1922 O O   . TYR A 1 253 ? 33.301  21.555 42.669 1.00 21.88 ? 253 TYR A O   1 
ATOM   1923 C CB  . TYR A 1 253 ? 31.189  23.007 41.168 1.00 20.34 ? 253 TYR A CB  1 
ATOM   1924 C CG  . TYR A 1 253 ? 30.739  23.780 39.959 1.00 21.17 ? 253 TYR A CG  1 
ATOM   1925 C CD1 . TYR A 1 253 ? 29.498  24.424 39.952 1.00 21.11 ? 253 TYR A CD1 1 
ATOM   1926 C CD2 . TYR A 1 253 ? 31.570  23.937 38.850 1.00 20.99 ? 253 TYR A CD2 1 
ATOM   1927 C CE1 . TYR A 1 253 ? 29.099  25.190 38.885 1.00 19.86 ? 253 TYR A CE1 1 
ATOM   1928 C CE2 . TYR A 1 253 ? 31.177  24.709 37.779 1.00 20.12 ? 253 TYR A CE2 1 
ATOM   1929 C CZ  . TYR A 1 253 ? 29.937  25.323 37.810 1.00 20.13 ? 253 TYR A CZ  1 
ATOM   1930 O OH  . TYR A 1 253 ? 29.503  26.038 36.727 1.00 21.76 ? 253 TYR A OH  1 
ATOM   1931 N N   . SER A 1 254 ? 31.396  20.469 43.130 1.00 24.24 ? 254 SER A N   1 
ATOM   1932 C CA  . SER A 1 254 ? 31.798  20.117 44.478 1.00 24.07 ? 254 SER A CA  1 
ATOM   1933 C C   . SER A 1 254 ? 32.819  19.035 44.527 1.00 26.09 ? 254 SER A C   1 
ATOM   1934 O O   . SER A 1 254 ? 33.050  18.313 43.545 1.00 25.44 ? 254 SER A O   1 
ATOM   1935 C CB  . SER A 1 254 ? 30.585  19.702 45.306 1.00 22.20 ? 254 SER A CB  1 
ATOM   1936 O OG  . SER A 1 254 ? 29.949  18.601 44.707 1.00 21.07 ? 254 SER A OG  1 
ATOM   1937 N N   . SER A 1 255 ? 33.392  18.921 45.718 1.00 28.35 ? 255 SER A N   1 
ATOM   1938 C CA  . SER A 1 255 ? 34.387  17.928 46.049 1.00 29.54 ? 255 SER A CA  1 
ATOM   1939 C C   . SER A 1 255 ? 33.873  16.843 47.026 1.00 30.20 ? 255 SER A C   1 
ATOM   1940 O O   . SER A 1 255 ? 32.903  17.051 47.760 1.00 30.30 ? 255 SER A O   1 
ATOM   1941 C CB  . SER A 1 255 ? 35.589  18.634 46.617 1.00 28.90 ? 255 SER A CB  1 
ATOM   1942 O OG  . SER A 1 255 ? 36.261  19.277 45.566 1.00 31.07 ? 255 SER A OG  1 
ATOM   1943 N N   . TRP A 1 256 ? 34.453  15.648 46.947 1.00 30.21 ? 256 TRP A N   1 
ATOM   1944 C CA  . TRP A 1 256 ? 34.087  14.594 47.869 1.00 29.95 ? 256 TRP A CA  1 
ATOM   1945 C C   . TRP A 1 256 ? 35.354  14.272 48.647 1.00 30.34 ? 256 TRP A C   1 
ATOM   1946 O O   . TRP A 1 256 ? 36.333  13.704 48.124 1.00 29.14 ? 256 TRP A O   1 
ATOM   1947 C CB  . TRP A 1 256 ? 33.527  13.347 47.175 1.00 29.97 ? 256 TRP A CB  1 
ATOM   1948 C CG  . TRP A 1 256 ? 33.168  12.214 48.169 1.00 29.54 ? 256 TRP A CG  1 
ATOM   1949 C CD1 . TRP A 1 256 ? 32.581  12.353 49.409 1.00 29.50 ? 256 TRP A CD1 1 
ATOM   1950 C CD2 . TRP A 1 256 ? 33.436  10.808 48.024 1.00 28.69 ? 256 TRP A CD2 1 
ATOM   1951 N NE1 . TRP A 1 256 ? 32.483  11.125 50.032 1.00 28.71 ? 256 TRP A NE1 1 
ATOM   1952 C CE2 . TRP A 1 256 ? 32.999  10.163 49.203 1.00 28.49 ? 256 TRP A CE2 1 
ATOM   1953 C CE3 . TRP A 1 256 ? 34.016  10.040 47.007 1.00 28.29 ? 256 TRP A CE3 1 
ATOM   1954 C CZ2 . TRP A 1 256 ? 33.113  8.792  49.402 1.00 28.34 ? 256 TRP A CZ2 1 
ATOM   1955 C CZ3 . TRP A 1 256 ? 34.130  8.677  47.204 1.00 28.79 ? 256 TRP A CZ3 1 
ATOM   1956 C CH2 . TRP A 1 256 ? 33.678  8.063  48.398 1.00 28.00 ? 256 TRP A CH2 1 
ATOM   1957 N N   . ASN A 1 257 ? 35.331  14.707 49.899 1.00 30.59 ? 257 ASN A N   1 
ATOM   1958 C CA  . ASN A 1 257 ? 36.432  14.490 50.814 1.00 30.97 ? 257 ASN A CA  1 
ATOM   1959 C C   . ASN A 1 257 ? 37.709  15.124 50.299 1.00 31.58 ? 257 ASN A C   1 
ATOM   1960 O O   . ASN A 1 257 ? 38.827  14.626 50.568 1.00 33.82 ? 257 ASN A O   1 
ATOM   1961 C CB  . ASN A 1 257 ? 36.636  12.996 51.112 1.00 29.83 ? 257 ASN A CB  1 
ATOM   1962 C CG  . ASN A 1 257 ? 35.505  12.417 51.934 1.00 30.09 ? 257 ASN A CG  1 
ATOM   1963 O OD1 . ASN A 1 257 ? 34.951  13.117 52.788 1.00 30.78 ? 257 ASN A OD1 1 
ATOM   1964 N ND2 . ASN A 1 257 ? 35.135  11.146 51.671 1.00 28.97 ? 257 ASN A ND2 1 
ATOM   1965 N N   . GLY A 1 258 ? 37.556  16.241 49.586 1.00 29.54 ? 258 GLY A N   1 
ATOM   1966 C CA  . GLY A 1 258 ? 38.736  16.948 49.113 1.00 25.82 ? 258 GLY A CA  1 
ATOM   1967 C C   . GLY A 1 258 ? 39.026  16.791 47.644 1.00 23.37 ? 258 GLY A C   1 
ATOM   1968 O O   . GLY A 1 258 ? 39.719  17.623 47.075 1.00 22.15 ? 258 GLY A O   1 
ATOM   1969 N N   . VAL A 1 259 ? 38.518  15.725 47.043 1.00 20.78 ? 259 VAL A N   1 
ATOM   1970 C CA  . VAL A 1 259 ? 38.686  15.499 45.616 1.00 19.36 ? 259 VAL A CA  1 
ATOM   1971 C C   . VAL A 1 259 ? 37.551  16.136 44.768 1.00 19.53 ? 259 VAL A C   1 
ATOM   1972 O O   . VAL A 1 259 ? 36.367  16.005 45.102 1.00 18.05 ? 259 VAL A O   1 
ATOM   1973 C CB  . VAL A 1 259 ? 38.725  14.023 45.343 1.00 18.46 ? 259 VAL A CB  1 
ATOM   1974 C CG1 . VAL A 1 259 ? 38.959  13.741 43.846 1.00 16.07 ? 259 VAL A CG1 1 
ATOM   1975 C CG2 . VAL A 1 259 ? 39.775  13.426 46.226 1.00 18.46 ? 259 VAL A CG2 1 
ATOM   1976 N N   . LYS A 1 260 ? 37.926  16.871 43.715 1.00 17.62 ? 260 LYS A N   1 
ATOM   1977 C CA  . LYS A 1 260 ? 36.943  17.492 42.827 1.00 16.77 ? 260 LYS A CA  1 
ATOM   1978 C C   . LYS A 1 260 ? 36.223  16.418 41.993 1.00 16.35 ? 260 LYS A C   1 
ATOM   1979 O O   . LYS A 1 260 ? 36.864  15.534 41.432 1.00 15.64 ? 260 LYS A O   1 
ATOM   1980 C CB  . LYS A 1 260 ? 37.653  18.427 41.849 1.00 16.01 ? 260 LYS A CB  1 
ATOM   1981 C CG  . LYS A 1 260 ? 38.398  19.575 42.465 1.00 15.79 ? 260 LYS A CG  1 
ATOM   1982 C CD  . LYS A 1 260 ? 37.475  20.748 42.792 1.00 17.23 ? 260 LYS A CD  1 
ATOM   1983 C CE  . LYS A 1 260 ? 38.266  22.007 43.143 1.00 16.52 ? 260 LYS A CE  1 
ATOM   1984 N NZ  . LYS A 1 260 ? 37.448  22.968 43.955 1.00 15.62 ? 260 LYS A NZ  1 
ATOM   1985 N N   . MET A 1 261 ? 34.915  16.524 41.833 1.00 15.95 ? 261 MET A N   1 
ATOM   1986 C CA  . MET A 1 261 ? 34.192  15.541 41.011 1.00 18.02 ? 261 MET A CA  1 
ATOM   1987 C C   . MET A 1 261 ? 34.645  15.521 39.505 1.00 18.64 ? 261 MET A C   1 
ATOM   1988 O O   . MET A 1 261 ? 34.585  14.499 38.789 1.00 18.07 ? 261 MET A O   1 
ATOM   1989 C CB  . MET A 1 261 ? 32.683  15.789 41.143 1.00 17.98 ? 261 MET A CB  1 
ATOM   1990 C CG  . MET A 1 261 ? 32.094  15.364 42.486 1.00 17.82 ? 261 MET A CG  1 
ATOM   1991 S SD  . MET A 1 261 ? 32.422  13.588 42.834 1.00 19.59 ? 261 MET A SD  1 
ATOM   1992 C CE  . MET A 1 261 ? 32.020  12.793 41.179 1.00 18.43 ? 261 MET A CE  1 
ATOM   1993 N N   . HIS A 1 262 ? 35.093  16.677 39.039 1.00 19.37 ? 262 HIS A N   1 
ATOM   1994 C CA  . HIS A 1 262 ? 35.576  16.872 37.673 1.00 18.79 ? 262 HIS A CA  1 
ATOM   1995 C C   . HIS A 1 262 ? 36.931  16.222 37.421 1.00 18.76 ? 262 HIS A C   1 
ATOM   1996 O O   . HIS A 1 262 ? 37.411  16.170 36.275 1.00 18.84 ? 262 HIS A O   1 
ATOM   1997 C CB  . HIS A 1 262 ? 35.698  18.358 37.389 1.00 17.79 ? 262 HIS A CB  1 
ATOM   1998 C CG  . HIS A 1 262 ? 34.388  19.025 37.133 1.00 17.68 ? 262 HIS A CG  1 
ATOM   1999 N ND1 . HIS A 1 262 ? 33.894  19.189 35.873 1.00 19.36 ? 262 HIS A ND1 1 
ATOM   2000 C CD2 . HIS A 1 262 ? 33.458  19.499 37.996 1.00 17.45 ? 262 HIS A CD2 1 
ATOM   2001 C CE1 . HIS A 1 262 ? 32.673  19.736 35.947 1.00 18.63 ? 262 HIS A CE1 1 
ATOM   2002 N NE2 . HIS A 1 262 ? 32.399  19.930 37.210 1.00 19.68 ? 262 HIS A NE2 1 
ATOM   2003 N N   . ALA A 1 263 ? 37.593  15.830 38.505 1.00 17.93 ? 263 ALA A N   1 
ATOM   2004 C CA  . ALA A 1 263 ? 38.889  15.190 38.392 1.00 15.79 ? 263 ALA A CA  1 
ATOM   2005 C C   . ALA A 1 263 ? 38.863  13.861 39.083 1.00 15.93 ? 263 ALA A C   1 
ATOM   2006 O O   . ALA A 1 263 ? 39.926  13.358 39.375 1.00 18.09 ? 263 ALA A O   1 
ATOM   2007 C CB  . ALA A 1 263 ? 39.934  16.027 38.991 1.00 11.55 ? 263 ALA A CB  1 
ATOM   2008 N N   . ASN A 1 264 ? 37.679  13.272 39.280 1.00 15.02 ? 264 ASN A N   1 
ATOM   2009 C CA  . ASN A 1 264 ? 37.561  12.018 39.981 1.00 14.51 ? 264 ASN A CA  1 
ATOM   2010 C C   . ASN A 1 264 ? 37.202  10.821 39.110 1.00 16.63 ? 264 ASN A C   1 
ATOM   2011 O O   . ASN A 1 264 ? 36.043  10.455 38.942 1.00 16.37 ? 264 ASN A O   1 
ATOM   2012 C CB  . ASN A 1 264 ? 36.557  12.177 41.136 1.00 16.26 ? 264 ASN A CB  1 
ATOM   2013 C CG  . ASN A 1 264 ? 36.404  10.901 41.999 1.00 16.75 ? 264 ASN A CG  1 
ATOM   2014 O OD1 . ASN A 1 264 ? 36.669  9.776  41.545 1.00 17.27 ? 264 ASN A OD1 1 
ATOM   2015 N ND2 . ASN A 1 264 ? 35.935  11.076 43.235 1.00 14.81 ? 264 ASN A ND2 1 
ATOM   2016 N N   . GLN A 1 265 ? 38.228  10.137 38.637 1.00 18.78 ? 265 GLN A N   1 
ATOM   2017 C CA  . GLN A 1 265 ? 38.037  8.956  37.815 1.00 21.31 ? 265 GLN A CA  1 
ATOM   2018 C C   . GLN A 1 265 ? 37.344  7.786  38.539 1.00 23.83 ? 265 GLN A C   1 
ATOM   2019 O O   . GLN A 1 265 ? 36.678  6.963  37.893 1.00 24.00 ? 265 GLN A O   1 
ATOM   2020 C CB  . GLN A 1 265 ? 39.384  8.518  37.306 1.00 20.45 ? 265 GLN A CB  1 
ATOM   2021 C CG  . GLN A 1 265 ? 39.395  7.502  36.198 1.00 22.43 ? 265 GLN A CG  1 
ATOM   2022 C CD  . GLN A 1 265 ? 40.832  7.224  35.764 1.00 23.65 ? 265 GLN A CD  1 
ATOM   2023 O OE1 . GLN A 1 265 ? 41.708  6.981  36.598 1.00 25.23 ? 265 GLN A OE1 1 
ATOM   2024 N NE2 . GLN A 1 265 ? 41.096  7.332  34.476 1.00 25.37 ? 265 GLN A NE2 1 
ATOM   2025 N N   . ASP A 1 266 ? 37.521  7.655  39.857 1.00 26.43 ? 266 ASP A N   1 
ATOM   2026 C CA  . ASP A 1 266 ? 36.869  6.520  40.530 1.00 28.43 ? 266 ASP A CA  1 
ATOM   2027 C C   . ASP A 1 266 ? 35.376  6.625  40.450 1.00 26.43 ? 266 ASP A C   1 
ATOM   2028 O O   . ASP A 1 266 ? 34.699  5.648  40.136 1.00 27.23 ? 266 ASP A O   1 
ATOM   2029 C CB  . ASP A 1 266 ? 37.248  6.385  41.991 1.00 33.25 ? 266 ASP A CB  1 
ATOM   2030 C CG  . ASP A 1 266 ? 38.717  6.344  42.191 1.00 38.00 ? 266 ASP A CG  1 
ATOM   2031 O OD1 . ASP A 1 266 ? 39.327  5.288  41.846 1.00 41.13 ? 266 ASP A OD1 1 
ATOM   2032 O OD2 . ASP A 1 266 ? 39.242  7.396  42.668 1.00 40.87 ? 266 ASP A OD2 1 
ATOM   2033 N N   . LEU A 1 267 ? 34.848  7.784  40.792 1.00 21.69 ? 267 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 267 ? 33.428  7.915  40.733 1.00 18.59 ? 267 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 267 ? 32.915  8.062  39.298 1.00 17.66 ? 267 LEU A C   1 
ATOM   2036 O O   . LEU A 1 267 ? 31.908  7.427  38.953 1.00 18.55 ? 267 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 267 ? 32.944  9.058  41.628 1.00 18.05 ? 267 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 267 ? 33.236  8.950  43.136 1.00 16.71 ? 267 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 267 ? 32.716  10.171 43.830 1.00 16.81 ? 267 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 267 ? 32.598  7.735  43.734 1.00 17.16 ? 267 LEU A CD2 1 
ATOM   2041 N N   . VAL A 1 268 ? 33.623  8.793  38.427 1.00 14.96 ? 268 VAL A N   1 
ATOM   2042 C CA  . VAL A 1 268 ? 33.113  9.001  37.052 1.00 13.64 ? 268 VAL A CA  1 
ATOM   2043 C C   . VAL A 1 268 ? 33.267  7.827  36.099 1.00 14.19 ? 268 VAL A C   1 
ATOM   2044 O O   . VAL A 1 268 ? 32.317  7.418  35.427 1.00 12.27 ? 268 VAL A O   1 
ATOM   2045 C CB  . VAL A 1 268 ? 33.651  10.308 36.385 1.00 13.16 ? 268 VAL A CB  1 
ATOM   2046 C CG1 . VAL A 1 268 ? 33.085  10.474 34.973 1.00 13.45 ? 268 VAL A CG1 1 
ATOM   2047 C CG2 . VAL A 1 268 ? 33.275  11.507 37.199 1.00 10.78 ? 268 VAL A CG2 1 
ATOM   2048 N N   . THR A 1 269 ? 34.470  7.297  36.017 1.00 16.18 ? 269 THR A N   1 
ATOM   2049 C CA  . THR A 1 269 ? 34.696  6.151  35.151 1.00 17.04 ? 269 THR A CA  1 
ATOM   2050 C C   . THR A 1 269 ? 34.425  4.786  35.796 1.00 17.55 ? 269 THR A C   1 
ATOM   2051 O O   . THR A 1 269 ? 33.747  3.921  35.235 1.00 17.42 ? 269 THR A O   1 
ATOM   2052 C CB  . THR A 1 269 ? 36.111  6.108  34.685 1.00 16.23 ? 269 THR A CB  1 
ATOM   2053 O OG1 . THR A 1 269 ? 36.444  7.333  34.012 1.00 15.12 ? 269 THR A OG1 1 
ATOM   2054 C CG2 . THR A 1 269 ? 36.249  4.914  33.771 1.00 17.01 ? 269 THR A CG2 1 
ATOM   2055 N N   . GLY A 1 270 ? 35.016  4.591  36.966 1.00 19.21 ? 270 GLY A N   1 
ATOM   2056 C CA  . GLY A 1 270 ? 34.869  3.335  37.674 1.00 20.58 ? 270 GLY A CA  1 
ATOM   2057 C C   . GLY A 1 270 ? 33.486  3.064  38.189 1.00 21.59 ? 270 GLY A C   1 
ATOM   2058 O O   . GLY A 1 270 ? 33.005  1.917  38.083 1.00 21.24 ? 270 GLY A O   1 
ATOM   2059 N N   . TYR A 1 271 ? 32.855  4.100  38.755 1.00 20.47 ? 271 TYR A N   1 
ATOM   2060 C CA  . TYR A 1 271 ? 31.527  3.920  39.299 1.00 19.84 ? 271 TYR A CA  1 
ATOM   2061 C C   . TYR A 1 271 ? 30.405  4.188  38.334 1.00 20.63 ? 271 TYR A C   1 
ATOM   2062 O O   . TYR A 1 271 ? 29.586  3.296  38.023 1.00 20.34 ? 271 TYR A O   1 
ATOM   2063 C CB  . TYR A 1 271 ? 31.274  4.758  40.562 1.00 18.16 ? 271 TYR A CB  1 
ATOM   2064 C CG  . TYR A 1 271 ? 30.061  4.215  41.291 1.00 16.51 ? 271 TYR A CG  1 
ATOM   2065 C CD1 . TYR A 1 271 ? 30.132  2.986  41.936 1.00 16.41 ? 271 TYR A CD1 1 
ATOM   2066 C CD2 . TYR A 1 271 ? 28.849  4.864  41.275 1.00 15.73 ? 271 TYR A CD2 1 
ATOM   2067 C CE1 . TYR A 1 271 ? 29.071  2.420  42.526 1.00 14.71 ? 271 TYR A CE1 1 
ATOM   2068 C CE2 . TYR A 1 271 ? 27.767  4.287  41.885 1.00 16.16 ? 271 TYR A CE2 1 
ATOM   2069 C CZ  . TYR A 1 271 ? 27.911  3.055  42.504 1.00 15.37 ? 271 TYR A CZ  1 
ATOM   2070 O OH  . TYR A 1 271 ? 26.893  2.426  43.136 1.00 16.97 ? 271 TYR A OH  1 
ATOM   2071 N N   . LEU A 1 272 ? 30.292  5.460  37.970 1.00 19.60 ? 272 LEU A N   1 
ATOM   2072 C CA  . LEU A 1 272 ? 29.230  5.851  37.083 1.00 20.33 ? 272 LEU A CA  1 
ATOM   2073 C C   . LEU A 1 272 ? 29.251  5.088  35.780 1.00 20.60 ? 272 LEU A C   1 
ATOM   2074 O O   . LEU A 1 272 ? 28.207  4.651  35.345 1.00 21.62 ? 272 LEU A O   1 
ATOM   2075 C CB  . LEU A 1 272 ? 29.232  7.360  36.851 1.00 19.31 ? 272 LEU A CB  1 
ATOM   2076 C CG  . LEU A 1 272 ? 28.343  7.890  35.739 1.00 18.65 ? 272 LEU A CG  1 
ATOM   2077 C CD1 . LEU A 1 272 ? 26.898  7.471  35.954 1.00 18.83 ? 272 LEU A CD1 1 
ATOM   2078 C CD2 . LEU A 1 272 ? 28.504  9.391  35.724 1.00 18.04 ? 272 LEU A CD2 1 
ATOM   2079 N N   . LYS A 1 273 ? 30.435  4.895  35.193 1.00 22.13 ? 273 LYS A N   1 
ATOM   2080 C CA  . LYS A 1 273 ? 30.561  4.192  33.911 1.00 21.03 ? 273 LYS A CA  1 
ATOM   2081 C C   . LYS A 1 273 ? 30.774  2.714  34.032 1.00 22.38 ? 273 LYS A C   1 
ATOM   2082 O O   . LYS A 1 273 ? 30.059  1.931  33.407 1.00 23.89 ? 273 LYS A O   1 
ATOM   2083 C CB  . LYS A 1 273 ? 31.649  4.806  33.028 1.00 17.92 ? 273 LYS A CB  1 
ATOM   2084 C CG  . LYS A 1 273 ? 31.215  6.091  32.374 1.00 15.86 ? 273 LYS A CG  1 
ATOM   2085 C CD  . LYS A 1 273 ? 32.354  6.670  31.601 1.00 15.60 ? 273 LYS A CD  1 
ATOM   2086 C CE  . LYS A 1 273 ? 31.969  7.938  30.886 1.00 15.41 ? 273 LYS A CE  1 
ATOM   2087 N NZ  . LYS A 1 273 ? 32.953  8.315  29.839 1.00 14.65 ? 273 LYS A NZ  1 
ATOM   2088 N N   . ASP A 1 274 ? 31.739  2.302  34.840 1.00 23.92 ? 274 ASP A N   1 
ATOM   2089 C CA  . ASP A 1 274 ? 31.980  0.864  34.949 1.00 26.14 ? 274 ASP A CA  1 
ATOM   2090 C C   . ASP A 1 274 ? 30.941  0.107  35.795 1.00 26.50 ? 274 ASP A C   1 
ATOM   2091 O O   . ASP A 1 274 ? 30.324  -0.848 35.322 1.00 28.29 ? 274 ASP A O   1 
ATOM   2092 C CB  . ASP A 1 274 ? 33.411  0.583  35.427 1.00 28.10 ? 274 ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 274 ? 34.478  1.041  34.422 1.00 28.94 ? 274 ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 274 ? 34.147  1.367  33.252 1.00 29.75 ? 274 ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 274 ? 35.659  1.085  34.821 1.00 29.50 ? 274 ASP A OD2 1 
ATOM   2096 N N   . THR A 1 275 ? 30.702  0.564  37.013 1.00 25.69 ? 275 THR A N   1 
ATOM   2097 C CA  . THR A 1 275 ? 29.754  -0.090 37.886 1.00 24.90 ? 275 THR A CA  1 
ATOM   2098 C C   . THR A 1 275 ? 28.290  0.026  37.455 1.00 24.38 ? 275 THR A C   1 
ATOM   2099 O O   . THR A 1 275 ? 27.624  -1.000 37.270 1.00 24.34 ? 275 THR A O   1 
ATOM   2100 C CB  . THR A 1 275 ? 29.947  0.405  39.309 1.00 26.03 ? 275 THR A CB  1 
ATOM   2101 O OG1 . THR A 1 275 ? 31.342  0.389  39.624 1.00 27.27 ? 275 THR A OG1 1 
ATOM   2102 C CG2 . THR A 1 275 ? 29.276  -0.498 40.276 1.00 25.47 ? 275 THR A CG2 1 
ATOM   2103 N N   . LEU A 1 276 ? 27.760  1.258  37.411 1.00 23.82 ? 276 LEU A N   1 
ATOM   2104 C CA  . LEU A 1 276 ? 26.365  1.526  36.984 1.00 21.62 ? 276 LEU A CA  1 
ATOM   2105 C C   . LEU A 1 276 ? 26.157  1.333  35.486 1.00 21.15 ? 276 LEU A C   1 
ATOM   2106 O O   . LEU A 1 276 ? 25.050  1.445  34.990 1.00 19.97 ? 276 LEU A O   1 
ATOM   2107 C CB  . LEU A 1 276 ? 25.954  2.950  37.335 1.00 20.79 ? 276 LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 276 ? 26.024  3.332  38.804 1.00 20.22 ? 276 LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 276 ? 25.298  4.671  39.049 1.00 17.65 ? 276 LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 276 ? 25.360  2.207  39.589 1.00 20.35 ? 276 LEU A CD2 1 
ATOM   2111 N N   . LYS A 1 277 ? 27.259  1.120  34.779 1.00 21.85 ? 277 LYS A N   1 
ATOM   2112 C CA  . LYS A 1 277 ? 27.267  0.879  33.358 1.00 23.00 ? 277 LYS A CA  1 
ATOM   2113 C C   . LYS A 1 277 ? 26.543  1.928  32.532 1.00 22.06 ? 277 LYS A C   1 
ATOM   2114 O O   . LYS A 1 277 ? 25.862  1.614  31.550 1.00 23.68 ? 277 LYS A O   1 
ATOM   2115 C CB  . LYS A 1 277 ? 26.737  -0.519 33.108 1.00 24.47 ? 277 LYS A CB  1 
ATOM   2116 C CG  . LYS A 1 277 ? 27.713  -1.537 33.569 1.00 28.64 ? 277 LYS A CG  1 
ATOM   2117 C CD  . LYS A 1 277 ? 27.003  -2.824 33.861 1.00 34.36 ? 277 LYS A CD  1 
ATOM   2118 C CE  . LYS A 1 277 ? 27.970  -4.009 34.249 1.00 39.00 ? 277 LYS A CE  1 
ATOM   2119 N NZ  . LYS A 1 277 ? 27.219  -5.389 34.412 1.00 41.16 ? 277 LYS A NZ  1 
ATOM   2120 N N   . PHE A 1 278 ? 26.695  3.184  32.923 1.00 18.85 ? 278 PHE A N   1 
ATOM   2121 C CA  . PHE A 1 278 ? 26.065  4.260  32.195 1.00 17.20 ? 278 PHE A CA  1 
ATOM   2122 C C   . PHE A 1 278 ? 26.690  4.285  30.816 1.00 18.42 ? 278 PHE A C   1 
ATOM   2123 O O   . PHE A 1 278 ? 27.908  4.222  30.683 1.00 18.89 ? 278 PHE A O   1 
ATOM   2124 C CB  . PHE A 1 278 ? 26.326  5.573  32.920 1.00 16.17 ? 278 PHE A CB  1 
ATOM   2125 C CG  . PHE A 1 278 ? 25.773  6.812  32.223 1.00 16.40 ? 278 PHE A CG  1 
ATOM   2126 C CD1 . PHE A 1 278 ? 24.419  6.898  31.845 1.00 14.37 ? 278 PHE A CD1 1 
ATOM   2127 C CD2 . PHE A 1 278 ? 26.622  7.915  31.971 1.00 14.74 ? 278 PHE A CD2 1 
ATOM   2128 C CE1 . PHE A 1 278 ? 23.930  8.035  31.242 1.00 13.24 ? 278 PHE A CE1 1 
ATOM   2129 C CE2 . PHE A 1 278 ? 26.137  9.046  31.369 1.00 13.62 ? 278 PHE A CE2 1 
ATOM   2130 C CZ  . PHE A 1 278 ? 24.789  9.116  30.999 1.00 13.48 ? 278 PHE A CZ  1 
ATOM   2131 N N   . LYS A 1 279 ? 25.847  4.402  29.795 1.00 19.24 ? 279 LYS A N   1 
ATOM   2132 C CA  . LYS A 1 279 ? 26.298  4.466  28.407 1.00 18.90 ? 279 LYS A CA  1 
ATOM   2133 C C   . LYS A 1 279 ? 25.961  5.776  27.637 1.00 17.65 ? 279 LYS A C   1 
ATOM   2134 O O   . LYS A 1 279 ? 26.091  5.855  26.405 1.00 17.09 ? 279 LYS A O   1 
ATOM   2135 C CB  . LYS A 1 279 ? 25.858  3.212  27.649 1.00 19.86 ? 279 LYS A CB  1 
ATOM   2136 C CG  . LYS A 1 279 ? 26.943  2.202  27.698 1.00 19.50 ? 279 LYS A CG  1 
ATOM   2137 C CD  . LYS A 1 279 ? 26.418  0.932  28.186 1.00 21.56 ? 279 LYS A CD  1 
ATOM   2138 C CE  . LYS A 1 279 ? 27.509  -0.084 28.170 1.00 21.83 ? 279 LYS A CE  1 
ATOM   2139 N NZ  . LYS A 1 279 ? 28.743  0.443  28.790 1.00 22.68 ? 279 LYS A NZ  1 
ATOM   2140 N N   . GLY A 1 280 ? 25.467  6.774  28.358 1.00 14.93 ? 280 GLY A N   1 
ATOM   2141 C CA  . GLY A 1 280 ? 25.188  8.053  27.732 1.00 14.61 ? 280 GLY A CA  1 
ATOM   2142 C C   . GLY A 1 280 ? 26.481  8.868  27.812 1.00 12.16 ? 280 GLY A C   1 
ATOM   2143 O O   . GLY A 1 280 ? 27.538  8.268  27.902 1.00 12.48 ? 280 GLY A O   1 
ATOM   2144 N N   . PHE A 1 281 ? 26.428  10.200 27.761 1.00 10.50 ? 281 PHE A N   1 
ATOM   2145 C CA  . PHE A 1 281 ? 27.651  10.969 27.872 1.00 8.99  ? 281 PHE A CA  1 
ATOM   2146 C C   . PHE A 1 281 ? 27.662  11.762 29.158 1.00 10.72 ? 281 PHE A C   1 
ATOM   2147 O O   . PHE A 1 281 ? 26.607  12.013 29.748 1.00 12.38 ? 281 PHE A O   1 
ATOM   2148 C CB  . PHE A 1 281 ? 28.011  11.807 26.599 1.00 7.75  ? 281 PHE A CB  1 
ATOM   2149 C CG  . PHE A 1 281 ? 27.041  12.947 26.241 1.00 7.09  ? 281 PHE A CG  1 
ATOM   2150 C CD1 . PHE A 1 281 ? 27.159  14.221 26.837 1.00 7.34  ? 281 PHE A CD1 1 
ATOM   2151 C CD2 . PHE A 1 281 ? 26.066  12.794 25.222 1.00 8.08  ? 281 PHE A CD2 1 
ATOM   2152 C CE1 . PHE A 1 281 ? 26.316  15.345 26.433 1.00 5.36  ? 281 PHE A CE1 1 
ATOM   2153 C CE2 . PHE A 1 281 ? 25.221  13.919 24.812 1.00 6.66  ? 281 PHE A CE2 1 
ATOM   2154 C CZ  . PHE A 1 281 ? 25.373  15.192 25.433 1.00 5.20  ? 281 PHE A CZ  1 
ATOM   2155 N N   . VAL A 1 282 ? 28.869  11.989 29.670 1.00 11.54 ? 282 VAL A N   1 
ATOM   2156 C CA  . VAL A 1 282 ? 29.101  12.743 30.906 1.00 11.98 ? 282 VAL A CA  1 
ATOM   2157 C C   . VAL A 1 282 ? 29.591  14.143 30.517 1.00 12.96 ? 282 VAL A C   1 
ATOM   2158 O O   . VAL A 1 282 ? 30.638  14.301 29.876 1.00 14.71 ? 282 VAL A O   1 
ATOM   2159 C CB  . VAL A 1 282 ? 30.183  12.063 31.767 1.00 11.32 ? 282 VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 282 ? 30.415  12.782 33.044 1.00 9.83  ? 282 VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 282 ? 29.799  10.691 32.044 1.00 12.77 ? 282 VAL A CG2 1 
ATOM   2162 N N   . ILE A 1 283 ? 28.834  15.157 30.902 1.00 12.53 ? 283 ILE A N   1 
ATOM   2163 C CA  . ILE A 1 283 ? 29.194  16.516 30.596 1.00 12.20 ? 283 ILE A CA  1 
ATOM   2164 C C   . ILE A 1 283 ? 29.620  17.290 31.870 1.00 13.19 ? 283 ILE A C   1 
ATOM   2165 O O   . ILE A 1 283 ? 29.143  17.007 32.987 1.00 12.63 ? 283 ILE A O   1 
ATOM   2166 C CB  . ILE A 1 283 ? 28.016  17.146 29.890 1.00 10.81 ? 283 ILE A CB  1 
ATOM   2167 C CG1 . ILE A 1 283 ? 28.297  18.601 29.482 1.00 10.35 ? 283 ILE A CG1 1 
ATOM   2168 C CG2 . ILE A 1 283 ? 26.799  16.948 30.755 1.00 10.81 ? 283 ILE A CG2 1 
ATOM   2169 C CD1 . ILE A 1 283 ? 27.332  19.171 28.380 1.00 7.81  ? 283 ILE A CD1 1 
ATOM   2170 N N   . SER A 1 284 ? 30.591  18.193 31.690 1.00 13.25 ? 284 SER A N   1 
ATOM   2171 C CA  . SER A 1 284 ? 31.134  19.034 32.759 1.00 12.82 ? 284 SER A CA  1 
ATOM   2172 C C   . SER A 1 284 ? 30.134  20.134 33.037 1.00 15.57 ? 284 SER A C   1 
ATOM   2173 O O   . SER A 1 284 ? 29.140  20.291 32.315 1.00 17.27 ? 284 SER A O   1 
ATOM   2174 C CB  . SER A 1 284 ? 32.407  19.712 32.287 1.00 11.18 ? 284 SER A CB  1 
ATOM   2175 O OG  . SER A 1 284 ? 32.111  20.916 31.604 1.00 6.24  ? 284 SER A OG  1 
ATOM   2176 N N   . ASP A 1 285 ? 30.369  20.901 34.087 1.00 16.71 ? 285 ASP A N   1 
ATOM   2177 C CA  . ASP A 1 285 ? 29.465  22.005 34.350 1.00 16.61 ? 285 ASP A CA  1 
ATOM   2178 C C   . ASP A 1 285 ? 30.203  23.217 33.776 1.00 16.72 ? 285 ASP A C   1 
ATOM   2179 O O   . ASP A 1 285 ? 31.383  23.120 33.403 1.00 17.58 ? 285 ASP A O   1 
ATOM   2180 C CB  . ASP A 1 285 ? 29.243  22.163 35.853 1.00 19.51 ? 285 ASP A CB  1 
ATOM   2181 C CG  . ASP A 1 285 ? 27.897  22.768 36.173 1.00 22.94 ? 285 ASP A CG  1 
ATOM   2182 O OD1 . ASP A 1 285 ? 27.392  23.693 35.233 1.00 26.00 ? 285 ASP A OD1 1 
ATOM   2183 O OD2 . ASP A 1 285 ? 27.267  22.380 37.183 1.00 23.14 ? 285 ASP A OD2 1 
ATOM   2184 N N   . TRP A 1 286 ? 29.543  24.366 33.766 1.00 15.69 ? 286 TRP A N   1 
ATOM   2185 C CA  . TRP A 1 286 ? 30.116  25.604 33.233 1.00 15.63 ? 286 TRP A CA  1 
ATOM   2186 C C   . TRP A 1 286 ? 31.459  25.928 33.870 1.00 16.54 ? 286 TRP A C   1 
ATOM   2187 O O   . TRP A 1 286 ? 31.499  26.385 35.000 1.00 19.63 ? 286 TRP A O   1 
ATOM   2188 C CB  . TRP A 1 286 ? 29.108  26.716 33.495 1.00 12.06 ? 286 TRP A CB  1 
ATOM   2189 C CG  . TRP A 1 286 ? 29.431  28.044 32.906 1.00 8.95  ? 286 TRP A CG  1 
ATOM   2190 C CD1 . TRP A 1 286 ? 30.408  28.893 33.328 1.00 9.33  ? 286 TRP A CD1 1 
ATOM   2191 C CD2 . TRP A 1 286 ? 28.679  28.727 31.926 1.00 6.10  ? 286 TRP A CD2 1 
ATOM   2192 N NE1 . TRP A 1 286 ? 30.294  30.113 32.680 1.00 9.40  ? 286 TRP A NE1 1 
ATOM   2193 C CE2 . TRP A 1 286 ? 29.231  30.041 31.792 1.00 6.35  ? 286 TRP A CE2 1 
ATOM   2194 C CE3 . TRP A 1 286 ? 27.588  28.425 31.120 1.00 5.33  ? 286 TRP A CE3 1 
ATOM   2195 C CZ2 . TRP A 1 286 ? 28.745  31.004 30.904 1.00 2.82  ? 286 TRP A CZ2 1 
ATOM   2196 C CZ3 . TRP A 1 286 ? 27.096  29.396 30.215 1.00 5.40  ? 286 TRP A CZ3 1 
ATOM   2197 C CH2 . TRP A 1 286 ? 27.689  30.666 30.126 1.00 2.00  ? 286 TRP A CH2 1 
ATOM   2198 N N   . GLU A 1 287 ? 32.544  25.825 33.117 1.00 18.09 ? 287 GLU A N   1 
ATOM   2199 C CA  . GLU A 1 287 ? 33.894  26.054 33.689 1.00 20.56 ? 287 GLU A CA  1 
ATOM   2200 C C   . GLU A 1 287 ? 34.218  25.089 34.817 1.00 19.90 ? 287 GLU A C   1 
ATOM   2201 O O   . GLU A 1 287 ? 35.040  25.361 35.693 1.00 17.90 ? 287 GLU A O   1 
ATOM   2202 C CB  . GLU A 1 287 ? 34.113  27.485 34.160 1.00 22.40 ? 287 GLU A CB  1 
ATOM   2203 C CG  . GLU A 1 287 ? 34.287  28.451 33.002 1.00 27.22 ? 287 GLU A CG  1 
ATOM   2204 C CD  . GLU A 1 287 ? 34.020  29.932 33.354 1.00 28.43 ? 287 GLU A CD  1 
ATOM   2205 O OE1 . GLU A 1 287 ? 33.640  30.246 34.528 1.00 28.08 ? 287 GLU A OE1 1 
ATOM   2206 O OE2 . GLU A 1 287 ? 34.203  30.763 32.415 1.00 29.82 ? 287 GLU A OE2 1 
ATOM   2207 N N   . GLY A 1 288 ? 33.513  23.968 34.790 1.00 20.76 ? 288 GLY A N   1 
ATOM   2208 C CA  . GLY A 1 288 ? 33.721  22.916 35.751 1.00 20.87 ? 288 GLY A CA  1 
ATOM   2209 C C   . GLY A 1 288 ? 35.171  22.492 35.817 1.00 19.74 ? 288 GLY A C   1 
ATOM   2210 O O   . GLY A 1 288 ? 35.672  22.380 36.903 1.00 21.24 ? 288 GLY A O   1 
ATOM   2211 N N   . ILE A 1 289 ? 35.850  22.258 34.701 1.00 18.96 ? 289 ILE A N   1 
ATOM   2212 C CA  . ILE A 1 289 ? 37.252  21.869 34.778 1.00 18.71 ? 289 ILE A CA  1 
ATOM   2213 C C   . ILE A 1 289 ? 38.229  22.999 35.193 1.00 19.50 ? 289 ILE A C   1 
ATOM   2214 O O   . ILE A 1 289 ? 39.176  22.739 35.934 1.00 19.42 ? 289 ILE A O   1 
ATOM   2215 C CB  . ILE A 1 289 ? 37.698  21.188 33.505 1.00 18.62 ? 289 ILE A CB  1 
ATOM   2216 C CG1 . ILE A 1 289 ? 37.980  22.215 32.403 1.00 17.12 ? 289 ILE A CG1 1 
ATOM   2217 C CG2 . ILE A 1 289 ? 36.615  20.172 33.100 1.00 17.90 ? 289 ILE A CG2 1 
ATOM   2218 C CD1 . ILE A 1 289 ? 38.645  21.581 31.190 1.00 16.93 ? 289 ILE A CD1 1 
ATOM   2219 N N   . ASP A 1 290 ? 37.949  24.251 34.809 1.00 18.48 ? 290 ASP A N   1 
ATOM   2220 C CA  . ASP A 1 290 ? 38.811  25.379 35.171 1.00 17.80 ? 290 ASP A CA  1 
ATOM   2221 C C   . ASP A 1 290 ? 38.962  25.365 36.690 1.00 18.81 ? 290 ASP A C   1 
ATOM   2222 O O   . ASP A 1 290 ? 39.962  25.783 37.240 1.00 19.13 ? 290 ASP A O   1 
ATOM   2223 C CB  . ASP A 1 290 ? 38.153  26.740 34.835 1.00 17.36 ? 290 ASP A CB  1 
ATOM   2224 C CG  . ASP A 1 290 ? 37.599  26.863 33.381 1.00 16.60 ? 290 ASP A CG  1 
ATOM   2225 O OD1 . ASP A 1 290 ? 36.885  25.981 32.890 1.00 18.37 ? 290 ASP A OD1 1 
ATOM   2226 O OD2 . ASP A 1 290 ? 37.760  27.931 32.758 1.00 16.25 ? 290 ASP A OD2 1 
ATOM   2227 N N   . ARG A 1 291 ? 37.834  25.061 37.329 1.00 20.18 ? 291 ARG A N   1 
ATOM   2228 C CA  . ARG A 1 291 ? 37.636  25.001 38.780 1.00 19.55 ? 291 ARG A CA  1 
ATOM   2229 C C   . ARG A 1 291 ? 38.321  23.903 39.601 1.00 18.33 ? 291 ARG A C   1 
ATOM   2230 O O   . ARG A 1 291 ? 38.370  23.951 40.809 1.00 16.14 ? 291 ARG A O   1 
ATOM   2231 C CB  . ARG A 1 291 ? 36.129  25.041 39.052 1.00 21.05 ? 291 ARG A CB  1 
ATOM   2232 C CG  . ARG A 1 291 ? 35.515  26.336 38.574 1.00 21.85 ? 291 ARG A CG  1 
ATOM   2233 C CD  . ARG A 1 291 ? 34.079  26.523 38.993 1.00 22.94 ? 291 ARG A CD  1 
ATOM   2234 N NE  . ARG A 1 291 ? 33.478  27.595 38.186 1.00 23.70 ? 291 ARG A NE  1 
ATOM   2235 C CZ  . ARG A 1 291 ? 32.291  28.152 38.415 1.00 22.96 ? 291 ARG A CZ  1 
ATOM   2236 N NH1 . ARG A 1 291 ? 31.581  27.751 39.460 1.00 23.19 ? 291 ARG A NH1 1 
ATOM   2237 N NH2 . ARG A 1 291 ? 31.768  29.009 37.538 1.00 21.31 ? 291 ARG A NH2 1 
ATOM   2238 N N   . ILE A 1 292 ? 38.875  22.912 38.940 1.00 20.15 ? 292 ILE A N   1 
ATOM   2239 C CA  . ILE A 1 292 ? 39.581  21.851 39.646 1.00 20.65 ? 292 ILE A CA  1 
ATOM   2240 C C   . ILE A 1 292 ? 40.777  22.506 40.365 1.00 22.83 ? 292 ILE A C   1 
ATOM   2241 O O   . ILE A 1 292 ? 41.196  22.050 41.434 1.00 22.94 ? 292 ILE A O   1 
ATOM   2242 C CB  . ILE A 1 292 ? 40.066  20.816 38.612 1.00 18.14 ? 292 ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 292 ? 38.853  20.138 38.016 1.00 17.46 ? 292 ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 292 ? 41.035  19.853 39.202 1.00 16.75 ? 292 ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 292 ? 39.149  19.058 37.055 1.00 17.82 ? 292 ILE A CD1 1 
ATOM   2246 N N   . THR A 1 293 ? 41.248  23.625 39.804 1.00 24.59 ? 293 THR A N   1 
ATOM   2247 C CA  . THR A 1 293 ? 42.423  24.349 40.299 1.00 25.88 ? 293 THR A CA  1 
ATOM   2248 C C   . THR A 1 293 ? 42.140  25.611 41.035 1.00 27.04 ? 293 THR A C   1 
ATOM   2249 O O   . THR A 1 293 ? 41.168  26.301 40.758 1.00 28.83 ? 293 THR A O   1 
ATOM   2250 C CB  . THR A 1 293 ? 43.374  24.814 39.162 1.00 25.55 ? 293 THR A CB  1 
ATOM   2251 O OG1 . THR A 1 293 ? 42.869  26.020 38.574 1.00 22.95 ? 293 THR A OG1 1 
ATOM   2252 C CG2 . THR A 1 293 ? 43.582  23.702 38.094 1.00 25.37 ? 293 THR A CG2 1 
ATOM   2253 N N   . THR A 1 294 ? 42.987  25.904 42.006 1.00 28.91 ? 294 THR A N   1 
ATOM   2254 C CA  . THR A 1 294 ? 42.845  27.152 42.734 1.00 30.76 ? 294 THR A CA  1 
ATOM   2255 C C   . THR A 1 294 ? 44.171  27.881 42.699 1.00 29.64 ? 294 THR A C   1 
ATOM   2256 O O   . THR A 1 294 ? 45.231  27.305 43.023 1.00 30.65 ? 294 THR A O   1 
ATOM   2257 C CB  . THR A 1 294 ? 42.260  27.014 44.177 1.00 31.73 ? 294 THR A CB  1 
ATOM   2258 O OG1 . THR A 1 294 ? 42.715  28.111 44.995 1.00 31.92 ? 294 THR A OG1 1 
ATOM   2259 C CG2 . THR A 1 294 ? 42.575  25.626 44.787 1.00 32.61 ? 294 THR A CG2 1 
ATOM   2260 N N   . PRO A 1 295 ? 44.133  29.101 42.157 1.00 27.41 ? 295 PRO A N   1 
ATOM   2261 C CA  . PRO A 1 295 ? 42.958  29.706 41.511 1.00 26.77 ? 295 PRO A CA  1 
ATOM   2262 C C   . PRO A 1 295 ? 42.372  28.921 40.311 1.00 26.79 ? 295 PRO A C   1 
ATOM   2263 O O   . PRO A 1 295 ? 43.074  28.161 39.669 1.00 26.28 ? 295 PRO A O   1 
ATOM   2264 C CB  . PRO A 1 295 ? 43.501  31.030 41.022 1.00 25.85 ? 295 PRO A CB  1 
ATOM   2265 C CG  . PRO A 1 295 ? 44.587  31.283 41.926 1.00 26.15 ? 295 PRO A CG  1 
ATOM   2266 C CD  . PRO A 1 295 ? 45.276  30.004 42.050 1.00 25.76 ? 295 PRO A CD  1 
ATOM   2267 N N   . ALA A 1 296 ? 41.096  29.142 40.017 1.00 27.00 ? 296 ALA A N   1 
ATOM   2268 C CA  . ALA A 1 296 ? 40.426  28.485 38.892 1.00 26.71 ? 296 ALA A CA  1 
ATOM   2269 C C   . ALA A 1 296 ? 41.101  28.892 37.632 1.00 27.50 ? 296 ALA A C   1 
ATOM   2270 O O   . ALA A 1 296 ? 41.449  30.069 37.451 1.00 26.46 ? 296 ALA A O   1 
ATOM   2271 C CB  . ALA A 1 296 ? 39.006  28.865 38.814 1.00 25.83 ? 296 ALA A CB  1 
ATOM   2272 N N   . GLY A 1 297 ? 41.166  27.937 36.715 1.00 29.02 ? 297 GLY A N   1 
ATOM   2273 C CA  . GLY A 1 297 ? 41.853  28.152 35.463 1.00 30.20 ? 297 GLY A CA  1 
ATOM   2274 C C   . GLY A 1 297 ? 43.315  28.518 35.682 1.00 30.40 ? 297 GLY A C   1 
ATOM   2275 O O   . GLY A 1 297 ? 43.913  29.100 34.800 1.00 32.15 ? 297 GLY A O   1 
ATOM   2276 N N   . SER A 1 298 ? 43.908  28.207 36.826 1.00 30.33 ? 298 SER A N   1 
ATOM   2277 C CA  . SER A 1 298 ? 45.281  28.585 37.015 1.00 30.32 ? 298 SER A CA  1 
ATOM   2278 C C   . SER A 1 298 ? 46.200  27.675 36.208 1.00 30.50 ? 298 SER A C   1 
ATOM   2279 O O   . SER A 1 298 ? 47.304  28.079 35.855 1.00 32.52 ? 298 SER A O   1 
ATOM   2280 C CB  . SER A 1 298 ? 45.629  28.598 38.507 1.00 31.59 ? 298 SER A CB  1 
ATOM   2281 O OG  . SER A 1 298 ? 45.978  27.312 39.055 1.00 33.75 ? 298 SER A OG  1 
ATOM   2282 N N   . ASP A 1 299 ? 45.758  26.457 35.903 1.00 28.82 ? 299 ASP A N   1 
ATOM   2283 C CA  . ASP A 1 299 ? 46.561  25.519 35.128 1.00 25.85 ? 299 ASP A CA  1 
ATOM   2284 C C   . ASP A 1 299 ? 45.602  24.726 34.261 1.00 25.50 ? 299 ASP A C   1 
ATOM   2285 O O   . ASP A 1 299 ? 45.405  23.522 34.442 1.00 25.49 ? 299 ASP A O   1 
ATOM   2286 C CB  . ASP A 1 299 ? 47.303  24.579 36.041 1.00 26.27 ? 299 ASP A CB  1 
ATOM   2287 C CG  . ASP A 1 299 ? 48.223  23.658 35.300 1.00 26.50 ? 299 ASP A CG  1 
ATOM   2288 O OD1 . ASP A 1 299 ? 48.348  23.787 34.078 1.00 29.07 ? 299 ASP A OD1 1 
ATOM   2289 O OD2 . ASP A 1 299 ? 48.844  22.799 35.932 1.00 26.98 ? 299 ASP A OD2 1 
ATOM   2290 N N   . TYR A 1 300 ? 45.073  25.412 33.266 1.00 24.10 ? 300 TYR A N   1 
ATOM   2291 C CA  . TYR A 1 300 ? 44.117  24.854 32.345 1.00 23.93 ? 300 TYR A CA  1 
ATOM   2292 C C   . TYR A 1 300 ? 44.596  23.598 31.610 1.00 23.48 ? 300 TYR A C   1 
ATOM   2293 O O   . TYR A 1 300 ? 43.773  22.757 31.179 1.00 23.67 ? 300 TYR A O   1 
ATOM   2294 C CB  . TYR A 1 300 ? 43.737  25.951 31.369 1.00 25.83 ? 300 TYR A CB  1 
ATOM   2295 C CG  . TYR A 1 300 ? 42.453  25.740 30.664 1.00 25.99 ? 300 TYR A CG  1 
ATOM   2296 C CD1 . TYR A 1 300 ? 41.282  25.495 31.376 1.00 25.71 ? 300 TYR A CD1 1 
ATOM   2297 C CD2 . TYR A 1 300 ? 42.413  25.738 29.280 1.00 26.26 ? 300 TYR A CD2 1 
ATOM   2298 C CE1 . TYR A 1 300 ? 40.094  25.243 30.712 1.00 26.60 ? 300 TYR A CE1 1 
ATOM   2299 C CE2 . TYR A 1 300 ? 41.231  25.494 28.601 1.00 27.42 ? 300 TYR A CE2 1 
ATOM   2300 C CZ  . TYR A 1 300 ? 40.081  25.244 29.316 1.00 26.81 ? 300 TYR A CZ  1 
ATOM   2301 O OH  . TYR A 1 300 ? 38.949  24.976 28.604 1.00 26.71 ? 300 TYR A OH  1 
ATOM   2302 N N   . SER A 1 301 ? 45.904  23.497 31.391 1.00 21.09 ? 301 SER A N   1 
ATOM   2303 C CA  . SER A 1 301 ? 46.427  22.317 30.739 1.00 19.14 ? 301 SER A CA  1 
ATOM   2304 C C   . SER A 1 301 ? 46.103  21.156 31.683 1.00 19.95 ? 301 SER A C   1 
ATOM   2305 O O   . SER A 1 301 ? 45.559  20.127 31.262 1.00 22.03 ? 301 SER A O   1 
ATOM   2306 C CB  . SER A 1 301 ? 47.927  22.452 30.559 1.00 18.50 ? 301 SER A CB  1 
ATOM   2307 O OG  . SER A 1 301 ? 48.456  21.367 29.824 1.00 17.02 ? 301 SER A OG  1 
ATOM   2308 N N   . TYR A 1 302 ? 46.380  21.352 32.969 1.00 18.18 ? 302 TYR A N   1 
ATOM   2309 C CA  . TYR A 1 302 ? 46.105  20.361 33.982 1.00 17.38 ? 302 TYR A CA  1 
ATOM   2310 C C   . TYR A 1 302 ? 44.613  20.067 34.057 1.00 18.07 ? 302 TYR A C   1 
ATOM   2311 O O   . TYR A 1 302 ? 44.205  18.931 34.338 1.00 18.33 ? 302 TYR A O   1 
ATOM   2312 C CB  . TYR A 1 302 ? 46.557  20.876 35.332 1.00 18.16 ? 302 TYR A CB  1 
ATOM   2313 C CG  . TYR A 1 302 ? 46.150  19.967 36.444 1.00 20.05 ? 302 TYR A CG  1 
ATOM   2314 C CD1 . TYR A 1 302 ? 46.486  18.600 36.409 1.00 20.43 ? 302 TYR A CD1 1 
ATOM   2315 C CD2 . TYR A 1 302 ? 45.307  20.425 37.449 1.00 20.99 ? 302 TYR A CD2 1 
ATOM   2316 C CE1 . TYR A 1 302 ? 45.972  17.713 37.340 1.00 21.93 ? 302 TYR A CE1 1 
ATOM   2317 C CE2 . TYR A 1 302 ? 44.782  19.556 38.383 1.00 22.58 ? 302 TYR A CE2 1 
ATOM   2318 C CZ  . TYR A 1 302 ? 45.103  18.205 38.326 1.00 23.52 ? 302 TYR A CZ  1 
ATOM   2319 O OH  . TYR A 1 302 ? 44.473  17.359 39.222 1.00 25.03 ? 302 TYR A OH  1 
ATOM   2320 N N   . SER A 1 303 ? 43.799  21.111 33.910 1.00 17.41 ? 303 SER A N   1 
ATOM   2321 C CA  . SER A 1 303 ? 42.343  20.946 33.952 1.00 16.36 ? 303 SER A CA  1 
ATOM   2322 C C   . SER A 1 303 ? 41.870  19.921 32.913 1.00 16.21 ? 303 SER A C   1 
ATOM   2323 O O   . SER A 1 303 ? 41.032  19.071 33.203 1.00 14.38 ? 303 SER A O   1 
ATOM   2324 C CB  . SER A 1 303 ? 41.629  22.278 33.650 1.00 15.41 ? 303 SER A CB  1 
ATOM   2325 O OG  . SER A 1 303 ? 41.538  23.115 34.769 1.00 13.56 ? 303 SER A OG  1 
ATOM   2326 N N   . VAL A 1 304 ? 42.379  20.075 31.692 1.00 16.24 ? 304 VAL A N   1 
ATOM   2327 C CA  . VAL A 1 304 ? 42.002  19.241 30.572 1.00 15.90 ? 304 VAL A CA  1 
ATOM   2328 C C   . VAL A 1 304 ? 42.427  17.827 30.771 1.00 15.77 ? 304 VAL A C   1 
ATOM   2329 O O   . VAL A 1 304 ? 41.629  16.916 30.599 1.00 15.53 ? 304 VAL A O   1 
ATOM   2330 C CB  . VAL A 1 304 ? 42.537  19.829 29.263 1.00 16.58 ? 304 VAL A CB  1 
ATOM   2331 C CG1 . VAL A 1 304 ? 42.150  18.921 28.068 1.00 16.09 ? 304 VAL A CG1 1 
ATOM   2332 C CG2 . VAL A 1 304 ? 41.960  21.267 29.083 1.00 15.18 ? 304 VAL A CG2 1 
ATOM   2333 N N   . LYS A 1 305 ? 43.669  17.653 31.195 1.00 16.92 ? 305 LYS A N   1 
ATOM   2334 C CA  . LYS A 1 305 ? 44.217  16.330 31.467 1.00 16.95 ? 305 LYS A CA  1 
ATOM   2335 C C   . LYS A 1 305 ? 43.364  15.673 32.542 1.00 14.19 ? 305 LYS A C   1 
ATOM   2336 O O   . LYS A 1 305 ? 42.781  14.622 32.304 1.00 14.21 ? 305 LYS A O   1 
ATOM   2337 C CB  . LYS A 1 305 ? 45.689  16.456 31.916 1.00 20.27 ? 305 LYS A CB  1 
ATOM   2338 C CG  . LYS A 1 305 ? 46.306  15.179 32.476 1.00 25.61 ? 305 LYS A CG  1 
ATOM   2339 C CD  . LYS A 1 305 ? 47.799  15.147 32.265 1.00 30.03 ? 305 LYS A CD  1 
ATOM   2340 C CE  . LYS A 1 305 ? 48.504  14.063 33.105 1.00 32.31 ? 305 LYS A CE  1 
ATOM   2341 N NZ  . LYS A 1 305 ? 49.979  13.958 32.681 1.00 36.92 ? 305 LYS A NZ  1 
ATOM   2342 N N   . ALA A 1 306 ? 43.269  16.328 33.697 1.00 11.52 ? 306 ALA A N   1 
ATOM   2343 C CA  . ALA A 1 306 ? 42.526  15.835 34.839 1.00 10.94 ? 306 ALA A CA  1 
ATOM   2344 C C   . ALA A 1 306 ? 41.070  15.437 34.538 1.00 12.58 ? 306 ALA A C   1 
ATOM   2345 O O   . ALA A 1 306 ? 40.636  14.307 34.829 1.00 13.89 ? 306 ALA A O   1 
ATOM   2346 C CB  . ALA A 1 306 ? 42.611  16.829 35.988 1.00 9.21  ? 306 ALA A CB  1 
ATOM   2347 N N   . SER A 1 307 ? 40.309  16.329 33.931 1.00 13.66 ? 307 SER A N   1 
ATOM   2348 C CA  . SER A 1 307 ? 38.939  15.990 33.604 1.00 13.31 ? 307 SER A CA  1 
ATOM   2349 C C   . SER A 1 307 ? 38.748  14.924 32.486 1.00 13.77 ? 307 SER A C   1 
ATOM   2350 O O   . SER A 1 307 ? 37.829  14.074 32.576 1.00 13.02 ? 307 SER A O   1 
ATOM   2351 C CB  . SER A 1 307 ? 38.194  17.257 33.276 1.00 13.43 ? 307 SER A CB  1 
ATOM   2352 O OG  . SER A 1 307 ? 38.916  17.998 32.321 1.00 14.82 ? 307 SER A OG  1 
ATOM   2353 N N   . ILE A 1 308 ? 39.559  14.963 31.425 1.00 11.91 ? 308 ILE A N   1 
ATOM   2354 C CA  . ILE A 1 308 ? 39.394  13.961 30.373 1.00 10.81 ? 308 ILE A CA  1 
ATOM   2355 C C   . ILE A 1 308 ? 39.843  12.581 30.824 1.00 10.36 ? 308 ILE A C   1 
ATOM   2356 O O   . ILE A 1 308 ? 39.212  11.577 30.500 1.00 8.77  ? 308 ILE A O   1 
ATOM   2357 C CB  . ILE A 1 308 ? 40.120  14.347 29.068 1.00 11.36 ? 308 ILE A CB  1 
ATOM   2358 C CG1 . ILE A 1 308 ? 39.694  15.748 28.613 1.00 12.97 ? 308 ILE A CG1 1 
ATOM   2359 C CG2 . ILE A 1 308 ? 39.846  13.325 27.965 1.00 11.35 ? 308 ILE A CG2 1 
ATOM   2360 C CD1 . ILE A 1 308 ? 38.193  15.955 28.459 1.00 14.47 ? 308 ILE A CD1 1 
ATOM   2361 N N   . LEU A 1 309 ? 40.951  12.493 31.551 1.00 11.00 ? 309 LEU A N   1 
ATOM   2362 C CA  . LEU A 1 309 ? 41.373  11.154 31.979 1.00 12.34 ? 309 LEU A CA  1 
ATOM   2363 C C   . LEU A 1 309 ? 40.340  10.591 32.954 1.00 13.67 ? 309 LEU A C   1 
ATOM   2364 O O   . LEU A 1 309 ? 39.975  9.415  32.875 1.00 14.32 ? 309 LEU A O   1 
ATOM   2365 C CB  . LEU A 1 309 ? 42.799  11.145 32.564 1.00 9.47  ? 309 LEU A CB  1 
ATOM   2366 C CG  . LEU A 1 309 ? 43.951  11.428 31.566 1.00 6.87  ? 309 LEU A CG  1 
ATOM   2367 C CD1 . LEU A 1 309 ? 45.306  11.279 32.210 1.00 4.68  ? 309 LEU A CD1 1 
ATOM   2368 C CD2 . LEU A 1 309 ? 43.867  10.529 30.374 1.00 5.40  ? 309 LEU A CD2 1 
ATOM   2369 N N   . ALA A 1 310 ? 39.761  11.486 33.762 1.00 15.55 ? 310 ALA A N   1 
ATOM   2370 C CA  . ALA A 1 310 ? 38.750  11.118 34.773 1.00 13.79 ? 310 ALA A CA  1 
ATOM   2371 C C   . ALA A 1 310 ? 37.566  10.487 34.140 1.00 14.13 ? 310 ALA A C   1 
ATOM   2372 O O   . ALA A 1 310 ? 36.870  9.735  34.791 1.00 15.95 ? 310 ALA A O   1 
ATOM   2373 C CB  . ALA A 1 310 ? 38.298  12.331 35.590 1.00 12.04 ? 310 ALA A CB  1 
ATOM   2374 N N   . GLY A 1 311 ? 37.306  10.809 32.880 1.00 14.96 ? 311 GLY A N   1 
ATOM   2375 C CA  . GLY A 1 311 ? 36.127  10.236 32.244 1.00 16.49 ? 311 GLY A CA  1 
ATOM   2376 C C   . GLY A 1 311 ? 35.099  11.154 31.580 1.00 15.54 ? 311 GLY A C   1 
ATOM   2377 O O   . GLY A 1 311 ? 34.252  10.660 30.838 1.00 15.94 ? 311 GLY A O   1 
ATOM   2378 N N   . LEU A 1 312 ? 35.116  12.458 31.854 1.00 16.89 ? 312 LEU A N   1 
ATOM   2379 C CA  . LEU A 1 312 ? 34.157  13.363 31.197 1.00 16.70 ? 312 LEU A CA  1 
ATOM   2380 C C   . LEU A 1 312 ? 34.275  13.248 29.682 1.00 17.17 ? 312 LEU A C   1 
ATOM   2381 O O   . LEU A 1 312 ? 35.374  13.043 29.119 1.00 17.11 ? 312 LEU A O   1 
ATOM   2382 C CB  . LEU A 1 312 ? 34.284  14.813 31.664 1.00 16.90 ? 312 LEU A CB  1 
ATOM   2383 C CG  . LEU A 1 312 ? 33.891  14.975 33.134 1.00 16.12 ? 312 LEU A CG  1 
ATOM   2384 C CD1 . LEU A 1 312 ? 34.999  14.377 34.004 1.00 16.65 ? 312 LEU A CD1 1 
ATOM   2385 C CD2 . LEU A 1 312 ? 33.757  16.436 33.463 1.00 15.77 ? 312 LEU A CD2 1 
ATOM   2386 N N   . ASP A 1 313 ? 33.097  13.288 29.060 1.00 16.72 ? 313 ASP A N   1 
ATOM   2387 C CA  . ASP A 1 313 ? 32.920  13.109 27.626 1.00 15.11 ? 313 ASP A CA  1 
ATOM   2388 C C   . ASP A 1 313 ? 32.815  14.404 26.834 1.00 12.45 ? 313 ASP A C   1 
ATOM   2389 O O   . ASP A 1 313 ? 33.415  14.543 25.767 1.00 10.18 ? 313 ASP A O   1 
ATOM   2390 C CB  . ASP A 1 313 ? 31.674  12.212 27.368 1.00 16.09 ? 313 ASP A CB  1 
ATOM   2391 C CG  . ASP A 1 313 ? 31.779  10.826 28.021 1.00 17.30 ? 313 ASP A CG  1 
ATOM   2392 O OD1 . ASP A 1 313 ? 30.790  10.367 28.611 1.00 19.19 ? 313 ASP A OD1 1 
ATOM   2393 O OD2 . ASP A 1 313 ? 32.834  10.178 27.959 1.00 16.96 ? 313 ASP A OD2 1 
ATOM   2394 N N   . MET A 1 314 ? 31.959  15.296 27.301 1.00 11.87 ? 314 MET A N   1 
ATOM   2395 C CA  . MET A 1 314 ? 31.760  16.588 26.647 1.00 11.54 ? 314 MET A CA  1 
ATOM   2396 C C   . MET A 1 314 ? 32.073  17.690 27.616 1.00 10.66 ? 314 MET A C   1 
ATOM   2397 O O   . MET A 1 314 ? 31.653  17.641 28.771 1.00 9.81  ? 314 MET A O   1 
ATOM   2398 C CB  . MET A 1 314 ? 30.317  16.763 26.170 1.00 11.22 ? 314 MET A CB  1 
ATOM   2399 C CG  . MET A 1 314 ? 30.029  18.138 25.525 1.00 9.95  ? 314 MET A CG  1 
ATOM   2400 S SD  . MET A 1 314 ? 28.337  18.189 24.864 1.00 9.95  ? 314 MET A SD  1 
ATOM   2401 C CE  . MET A 1 314 ? 28.390  16.971 23.568 1.00 7.29  ? 314 MET A CE  1 
ATOM   2402 N N   . ILE A 1 315 ? 32.807  18.686 27.139 1.00 11.18 ? 315 ILE A N   1 
ATOM   2403 C CA  . ILE A 1 315 ? 33.175  19.807 27.983 1.00 11.36 ? 315 ILE A CA  1 
ATOM   2404 C C   . ILE A 1 315 ? 32.408  21.134 27.728 1.00 11.36 ? 315 ILE A C   1 
ATOM   2405 O O   . ILE A 1 315 ? 32.445  21.731 26.625 1.00 10.84 ? 315 ILE A O   1 
ATOM   2406 C CB  . ILE A 1 315 ? 34.725  20.043 27.977 1.00 10.39 ? 315 ILE A CB  1 
ATOM   2407 C CG1 . ILE A 1 315 ? 35.469  18.792 28.509 1.00 9.81  ? 315 ILE A CG1 1 
ATOM   2408 C CG2 . ILE A 1 315 ? 35.095  21.318 28.789 1.00 10.30 ? 315 ILE A CG2 1 
ATOM   2409 C CD1 . ILE A 1 315 ? 34.870  18.102 29.757 1.00 7.38  ? 315 ILE A CD1 1 
ATOM   2410 N N   . MET A 1 316 ? 31.672  21.562 28.751 1.00 10.55 ? 316 MET A N   1 
ATOM   2411 C CA  . MET A 1 316 ? 30.956  22.824 28.682 1.00 11.28 ? 316 MET A CA  1 
ATOM   2412 C C   . MET A 1 316 ? 32.033  23.904 28.935 1.00 12.17 ? 316 MET A C   1 
ATOM   2413 O O   . MET A 1 316 ? 32.230  24.363 30.064 1.00 11.68 ? 316 MET A O   1 
ATOM   2414 C CB  . MET A 1 316 ? 29.893  22.847 29.743 1.00 10.67 ? 316 MET A CB  1 
ATOM   2415 C CG  . MET A 1 316 ? 29.033  24.042 29.675 1.00 9.71  ? 316 MET A CG  1 
ATOM   2416 S SD  . MET A 1 316 ? 27.834  23.843 30.905 1.00 10.63 ? 316 MET A SD  1 
ATOM   2417 C CE  . MET A 1 316 ? 27.534  25.367 31.247 1.00 11.02 ? 316 MET A CE  1 
ATOM   2418 N N   . VAL A 1 317 ? 32.698  24.337 27.861 1.00 13.44 ? 317 VAL A N   1 
ATOM   2419 C CA  . VAL A 1 317 ? 33.799  25.282 27.969 1.00 13.03 ? 317 VAL A CA  1 
ATOM   2420 C C   . VAL A 1 317 ? 33.581  26.531 28.844 1.00 15.03 ? 317 VAL A C   1 
ATOM   2421 O O   . VAL A 1 317 ? 34.270  26.687 29.882 1.00 17.32 ? 317 VAL A O   1 
ATOM   2422 C CB  . VAL A 1 317 ? 34.457  25.575 26.588 1.00 11.10 ? 317 VAL A CB  1 
ATOM   2423 C CG1 . VAL A 1 317 ? 35.719  26.310 26.774 1.00 11.46 ? 317 VAL A CG1 1 
ATOM   2424 C CG2 . VAL A 1 317 ? 34.803  24.288 25.892 1.00 9.65  ? 317 VAL A CG2 1 
ATOM   2425 N N   . PRO A 1 318 ? 32.577  27.378 28.519 1.00 15.86 ? 318 PRO A N   1 
ATOM   2426 C CA  . PRO A 1 318 ? 31.762  27.454 27.299 1.00 15.94 ? 318 PRO A CA  1 
ATOM   2427 C C   . PRO A 1 318 ? 32.235  28.578 26.351 1.00 17.61 ? 318 PRO A C   1 
ATOM   2428 O O   . PRO A 1 318 ? 31.695  28.750 25.264 1.00 17.29 ? 318 PRO A O   1 
ATOM   2429 C CB  . PRO A 1 318 ? 30.416  27.851 27.858 1.00 15.05 ? 318 PRO A CB  1 
ATOM   2430 C CG  . PRO A 1 318 ? 30.876  28.993 28.898 1.00 13.09 ? 318 PRO A CG  1 
ATOM   2431 C CD  . PRO A 1 318 ? 32.132  28.400 29.523 1.00 13.94 ? 318 PRO A CD  1 
ATOM   2432 N N   . ASN A 1 319 ? 33.247  29.329 26.755 1.00 18.09 ? 319 ASN A N   1 
ATOM   2433 C CA  . ASN A 1 319 ? 33.657  30.464 25.964 1.00 20.59 ? 319 ASN A CA  1 
ATOM   2434 C C   . ASN A 1 319 ? 34.958  30.324 25.152 1.00 22.98 ? 319 ASN A C   1 
ATOM   2435 O O   . ASN A 1 319 ? 34.963  30.534 23.926 1.00 23.61 ? 319 ASN A O   1 
ATOM   2436 C CB  . ASN A 1 319 ? 33.653  31.733 26.852 1.00 20.33 ? 319 ASN A CB  1 
ATOM   2437 C CG  . ASN A 1 319 ? 32.236  32.081 27.436 1.00 21.40 ? 319 ASN A CG  1 
ATOM   2438 O OD1 . ASN A 1 319 ? 31.280  32.427 26.725 1.00 21.66 ? 319 ASN A OD1 1 
ATOM   2439 N ND2 . ASN A 1 319 ? 32.137  32.035 28.748 1.00 21.50 ? 319 ASN A ND2 1 
ATOM   2440 N N   . LYS A 1 320 ? 36.050  29.998 25.839 1.00 24.51 ? 320 LYS A N   1 
ATOM   2441 C CA  . LYS A 1 320 ? 37.362  29.824 25.237 1.00 24.63 ? 320 LYS A CA  1 
ATOM   2442 C C   . LYS A 1 320 ? 37.567  28.428 24.643 1.00 23.09 ? 320 LYS A C   1 
ATOM   2443 O O   . LYS A 1 320 ? 38.410  27.655 25.117 1.00 22.61 ? 320 LYS A O   1 
ATOM   2444 C CB  . LYS A 1 320 ? 38.434  30.084 26.288 1.00 28.47 ? 320 LYS A CB  1 
ATOM   2445 C CG  . LYS A 1 320 ? 38.162  31.306 27.125 1.00 33.35 ? 320 LYS A CG  1 
ATOM   2446 C CD  . LYS A 1 320 ? 39.227  31.425 28.222 1.00 39.48 ? 320 LYS A CD  1 
ATOM   2447 C CE  . LYS A 1 320 ? 39.071  30.396 29.408 1.00 41.93 ? 320 LYS A CE  1 
ATOM   2448 N NZ  . LYS A 1 320 ? 40.174  30.425 30.508 1.00 44.64 ? 320 LYS A NZ  1 
ATOM   2449 N N   . TYR A 1 321 ? 36.752  28.076 23.651 1.00 19.59 ? 321 TYR A N   1 
ATOM   2450 C CA  . TYR A 1 321 ? 36.890  26.800 22.981 1.00 17.56 ? 321 TYR A CA  1 
ATOM   2451 C C   . TYR A 1 321 ? 38.256  26.680 22.280 1.00 19.30 ? 321 TYR A C   1 
ATOM   2452 O O   . TYR A 1 321 ? 38.774  25.556 22.092 1.00 18.41 ? 321 TYR A O   1 
ATOM   2453 C CB  . TYR A 1 321 ? 35.782  26.635 21.960 1.00 16.27 ? 321 TYR A CB  1 
ATOM   2454 C CG  . TYR A 1 321 ? 35.785  27.677 20.894 1.00 14.86 ? 321 TYR A CG  1 
ATOM   2455 C CD1 . TYR A 1 321 ? 36.423  27.464 19.661 1.00 13.59 ? 321 TYR A CD1 1 
ATOM   2456 C CD2 . TYR A 1 321 ? 35.187  28.900 21.132 1.00 14.90 ? 321 TYR A CD2 1 
ATOM   2457 C CE1 . TYR A 1 321 ? 36.464  28.465 18.716 1.00 13.31 ? 321 TYR A CE1 1 
ATOM   2458 C CE2 . TYR A 1 321 ? 35.212  29.900 20.196 1.00 14.62 ? 321 TYR A CE2 1 
ATOM   2459 C CZ  . TYR A 1 321 ? 35.849  29.704 19.001 1.00 14.88 ? 321 TYR A CZ  1 
ATOM   2460 O OH  . TYR A 1 321 ? 35.877  30.791 18.126 1.00 15.82 ? 321 TYR A OH  1 
ATOM   2461 N N   . GLN A 1 322 ? 38.818  27.818 21.848 1.00 21.52 ? 322 GLN A N   1 
ATOM   2462 C CA  . GLN A 1 322 ? 40.124  27.801 21.181 1.00 23.35 ? 322 GLN A CA  1 
ATOM   2463 C C   . GLN A 1 322 ? 41.148  27.129 22.086 1.00 24.14 ? 322 GLN A C   1 
ATOM   2464 O O   . GLN A 1 322 ? 41.701  26.063 21.731 1.00 25.67 ? 322 GLN A O   1 
ATOM   2465 C CB  . GLN A 1 322 ? 40.618  29.177 20.771 1.00 24.47 ? 322 GLN A CB  1 
ATOM   2466 C CG  . GLN A 1 322 ? 41.663  29.017 19.664 1.00 30.38 ? 322 GLN A CG  1 
ATOM   2467 C CD  . GLN A 1 322 ? 42.365  30.311 19.178 1.00 32.06 ? 322 GLN A CD  1 
ATOM   2468 O OE1 . GLN A 1 322 ? 41.703  31.298 18.775 1.00 33.05 ? 322 GLN A OE1 1 
ATOM   2469 N NE2 . GLN A 1 322 ? 43.714  30.280 19.155 1.00 31.16 ? 322 GLN A NE2 1 
ATOM   2470 N N   . GLN A 1 323 ? 41.322  27.699 23.279 1.00 22.64 ? 323 GLN A N   1 
ATOM   2471 C CA  . GLN A 1 323 ? 42.237  27.184 24.286 1.00 20.09 ? 323 GLN A CA  1 
ATOM   2472 C C   . GLN A 1 323 ? 41.972  25.729 24.640 1.00 17.40 ? 323 GLN A C   1 
ATOM   2473 O O   . GLN A 1 323 ? 42.900  24.948 24.806 1.00 16.26 ? 323 GLN A O   1 
ATOM   2474 C CB  . GLN A 1 323 ? 42.146  28.015 25.536 1.00 23.40 ? 323 GLN A CB  1 
ATOM   2475 C CG  . GLN A 1 323 ? 42.914  27.408 26.636 1.00 29.27 ? 323 GLN A CG  1 
ATOM   2476 C CD  . GLN A 1 323 ? 43.052  28.314 27.825 1.00 33.06 ? 323 GLN A CD  1 
ATOM   2477 O OE1 . GLN A 1 323 ? 42.052  28.675 28.499 1.00 35.83 ? 323 GLN A OE1 1 
ATOM   2478 N NE2 . GLN A 1 323 ? 44.308  28.647 28.151 1.00 34.72 ? 323 GLN A NE2 1 
ATOM   2479 N N   . PHE A 1 324 ? 40.706  25.371 24.812 1.00 14.77 ? 324 PHE A N   1 
ATOM   2480 C CA  . PHE A 1 324 ? 40.349  23.991 25.129 1.00 12.12 ? 324 PHE A CA  1 
ATOM   2481 C C   . PHE A 1 324 ? 40.814  23.054 24.011 1.00 11.56 ? 324 PHE A C   1 
ATOM   2482 O O   . PHE A 1 324 ? 41.555  22.081 24.267 1.00 8.55  ? 324 PHE A O   1 
ATOM   2483 C CB  . PHE A 1 324 ? 38.828  23.888 25.293 1.00 12.72 ? 324 PHE A CB  1 
ATOM   2484 C CG  . PHE A 1 324 ? 38.303  22.478 25.475 1.00 12.84 ? 324 PHE A CG  1 
ATOM   2485 C CD1 . PHE A 1 324 ? 38.645  21.715 26.596 1.00 14.25 ? 324 PHE A CD1 1 
ATOM   2486 C CD2 . PHE A 1 324 ? 37.478  21.913 24.505 1.00 12.60 ? 324 PHE A CD2 1 
ATOM   2487 C CE1 . PHE A 1 324 ? 38.171  20.393 26.739 1.00 15.43 ? 324 PHE A CE1 1 
ATOM   2488 C CE2 . PHE A 1 324 ? 36.999  20.609 24.619 1.00 13.54 ? 324 PHE A CE2 1 
ATOM   2489 C CZ  . PHE A 1 324 ? 37.339  19.837 25.728 1.00 15.08 ? 324 PHE A CZ  1 
ATOM   2490 N N   . ILE A 1 325 ? 40.442  23.375 22.768 1.00 9.31  ? 325 ILE A N   1 
ATOM   2491 C CA  . ILE A 1 325 ? 40.786  22.487 21.665 1.00 9.29  ? 325 ILE A CA  1 
ATOM   2492 C C   . ILE A 1 325 ? 42.281  22.349 21.384 1.00 10.54 ? 325 ILE A C   1 
ATOM   2493 O O   . ILE A 1 325 ? 42.780  21.273 21.027 1.00 10.09 ? 325 ILE A O   1 
ATOM   2494 C CB  . ILE A 1 325 ? 40.081  22.872 20.369 1.00 7.78  ? 325 ILE A CB  1 
ATOM   2495 C CG1 . ILE A 1 325 ? 38.576  22.933 20.560 1.00 7.28  ? 325 ILE A CG1 1 
ATOM   2496 C CG2 . ILE A 1 325 ? 40.288  21.799 19.369 1.00 6.43  ? 325 ILE A CG2 1 
ATOM   2497 C CD1 . ILE A 1 325 ? 37.870  23.225 19.300 1.00 5.42  ? 325 ILE A CD1 1 
ATOM   2498 N N   . SER A 1 326 ? 42.980  23.466 21.486 1.00 10.65 ? 326 SER A N   1 
ATOM   2499 C CA  . SER A 1 326 ? 44.405  23.483 21.247 1.00 9.70  ? 326 SER A CA  1 
ATOM   2500 C C   . SER A 1 326 ? 45.046  22.534 22.226 1.00 12.22 ? 326 SER A C   1 
ATOM   2501 O O   . SER A 1 326 ? 45.637  21.542 21.829 1.00 14.16 ? 326 SER A O   1 
ATOM   2502 C CB  . SER A 1 326 ? 44.918  24.883 21.491 1.00 7.87  ? 326 SER A CB  1 
ATOM   2503 O OG  . SER A 1 326 ? 46.119  25.085 20.834 1.00 5.64  ? 326 SER A OG  1 
ATOM   2504 N N   . ILE A 1 327 ? 44.736  22.743 23.509 1.00 14.47 ? 327 ILE A N   1 
ATOM   2505 C CA  . ILE A 1 327 ? 45.318  21.967 24.597 1.00 14.47 ? 327 ILE A CA  1 
ATOM   2506 C C   . ILE A 1 327 ? 45.045  20.500 24.507 1.00 16.42 ? 327 ILE A C   1 
ATOM   2507 O O   . ILE A 1 327 ? 45.956  19.678 24.696 1.00 18.45 ? 327 ILE A O   1 
ATOM   2508 C CB  . ILE A 1 327 ? 44.875  22.479 25.990 1.00 13.16 ? 327 ILE A CB  1 
ATOM   2509 C CG1 . ILE A 1 327 ? 45.433  23.865 26.246 1.00 11.79 ? 327 ILE A CG1 1 
ATOM   2510 C CG2 . ILE A 1 327 ? 45.429  21.596 27.083 1.00 13.29 ? 327 ILE A CG2 1 
ATOM   2511 C CD1 . ILE A 1 327 ? 44.965  24.445 27.545 1.00 12.98 ? 327 ILE A CD1 1 
ATOM   2512 N N   . LEU A 1 328 ? 43.786  20.146 24.275 1.00 16.69 ? 328 LEU A N   1 
ATOM   2513 C CA  . LEU A 1 328 ? 43.469  18.722 24.210 1.00 16.94 ? 328 LEU A CA  1 
ATOM   2514 C C   . LEU A 1 328 ? 44.131  18.075 22.978 1.00 16.45 ? 328 LEU A C   1 
ATOM   2515 O O   . LEU A 1 328 ? 44.567  16.913 23.014 1.00 16.57 ? 328 LEU A O   1 
ATOM   2516 C CB  . LEU A 1 328 ? 41.951  18.483 24.298 1.00 16.20 ? 328 LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 328 ? 41.455  17.040 24.118 1.00 17.24 ? 328 LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 328 ? 42.120  16.118 25.101 1.00 18.01 ? 328 LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 328 ? 39.953  16.965 24.286 1.00 17.71 ? 328 LEU A CD2 1 
ATOM   2520 N N   . THR A 1 329 ? 44.227  18.837 21.904 1.00 15.77 ? 329 THR A N   1 
ATOM   2521 C CA  . THR A 1 329 ? 44.846  18.335 20.695 1.00 18.54 ? 329 THR A CA  1 
ATOM   2522 C C   . THR A 1 329 ? 46.301  17.989 21.055 1.00 20.12 ? 329 THR A C   1 
ATOM   2523 O O   . THR A 1 329 ? 46.828  16.901 20.720 1.00 20.81 ? 329 THR A O   1 
ATOM   2524 C CB  . THR A 1 329 ? 44.753  19.420 19.589 1.00 17.88 ? 329 THR A CB  1 
ATOM   2525 O OG1 . THR A 1 329 ? 43.412  19.449 19.103 1.00 18.39 ? 329 THR A OG1 1 
ATOM   2526 C CG2 . THR A 1 329 ? 45.692  19.172 18.453 1.00 17.54 ? 329 THR A CG2 1 
ATOM   2527 N N   . GLY A 1 330 ? 46.894  18.877 21.849 1.00 19.62 ? 330 GLY A N   1 
ATOM   2528 C CA  . GLY A 1 330 ? 48.275  18.712 22.271 1.00 19.56 ? 330 GLY A CA  1 
ATOM   2529 C C   . GLY A 1 330 ? 48.520  17.483 23.125 1.00 18.74 ? 330 GLY A C   1 
ATOM   2530 O O   . GLY A 1 330 ? 49.489  16.755 22.890 1.00 18.82 ? 330 GLY A O   1 
ATOM   2531 N N   . HIS A 1 331 ? 47.653  17.266 24.118 1.00 17.22 ? 331 HIS A N   1 
ATOM   2532 C CA  . HIS A 1 331 ? 47.771  16.130 25.002 1.00 16.33 ? 331 HIS A CA  1 
ATOM   2533 C C   . HIS A 1 331 ? 47.633  14.816 24.235 1.00 16.51 ? 331 HIS A C   1 
ATOM   2534 O O   . HIS A 1 331 ? 48.267  13.821 24.574 1.00 16.41 ? 331 HIS A O   1 
ATOM   2535 C CB  . HIS A 1 331 ? 46.746  16.234 26.154 1.00 17.07 ? 331 HIS A CB  1 
ATOM   2536 C CG  . HIS A 1 331 ? 47.106  17.281 27.200 1.00 16.42 ? 331 HIS A CG  1 
ATOM   2537 N ND1 . HIS A 1 331 ? 46.138  17.989 27.888 1.00 14.71 ? 331 HIS A ND1 1 
ATOM   2538 C CD2 . HIS A 1 331 ? 48.290  17.789 27.566 1.00 15.56 ? 331 HIS A CD2 1 
ATOM   2539 C CE1 . HIS A 1 331 ? 46.736  18.913 28.614 1.00 13.75 ? 331 HIS A CE1 1 
ATOM   2540 N NE2 . HIS A 1 331 ? 48.031  18.826 28.446 1.00 13.63 ? 331 HIS A NE2 1 
ATOM   2541 N N   . VAL A 1 332 ? 46.788  14.789 23.215 1.00 16.73 ? 332 VAL A N   1 
ATOM   2542 C CA  . VAL A 1 332 ? 46.684  13.552 22.465 1.00 16.74 ? 332 VAL A CA  1 
ATOM   2543 C C   . VAL A 1 332 ? 47.966  13.411 21.635 1.00 17.45 ? 332 VAL A C   1 
ATOM   2544 O O   . VAL A 1 332 ? 48.622  12.382 21.717 1.00 19.13 ? 332 VAL A O   1 
ATOM   2545 C CB  . VAL A 1 332 ? 45.439  13.487 21.600 1.00 14.90 ? 332 VAL A CB  1 
ATOM   2546 C CG1 . VAL A 1 332 ? 45.247  12.084 21.050 1.00 14.14 ? 332 VAL A CG1 1 
ATOM   2547 C CG2 . VAL A 1 332 ? 44.279  13.844 22.438 1.00 15.19 ? 332 VAL A CG2 1 
ATOM   2548 N N   . ASN A 1 333 ? 48.351  14.449 20.881 1.00 16.09 ? 333 ASN A N   1 
ATOM   2549 C CA  . ASN A 1 333 ? 49.578  14.387 20.087 1.00 14.55 ? 333 ASN A CA  1 
ATOM   2550 C C   . ASN A 1 333 ? 50.780  13.901 20.918 1.00 14.76 ? 333 ASN A C   1 
ATOM   2551 O O   . ASN A 1 333 ? 51.603  13.127 20.440 1.00 14.37 ? 333 ASN A O   1 
ATOM   2552 C CB  . ASN A 1 333 ? 49.841  15.738 19.419 1.00 13.90 ? 333 ASN A CB  1 
ATOM   2553 C CG  . ASN A 1 333 ? 48.818  16.035 18.342 1.00 13.57 ? 333 ASN A CG  1 
ATOM   2554 O OD1 . ASN A 1 333 ? 48.312  15.111 17.731 1.00 17.22 ? 333 ASN A OD1 1 
ATOM   2555 N ND2 . ASN A 1 333 ? 48.495  17.278 18.118 1.00 11.89 ? 333 ASN A ND2 1 
ATOM   2556 N N   . GLY A 1 334 ? 50.823  14.288 22.186 1.00 16.28 ? 334 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 334 ? 51.894  13.877 23.061 1.00 16.36 ? 334 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 334 ? 51.578  12.588 23.772 1.00 17.55 ? 334 GLY A C   1 
ATOM   2559 O O   . GLY A 1 334 ? 52.297  12.170 24.675 1.00 20.61 ? 334 GLY A O   1 
ATOM   2560 N N   . GLY A 1 335 ? 50.515  11.924 23.370 1.00 17.80 ? 335 GLY A N   1 
ATOM   2561 C CA  . GLY A 1 335 ? 50.168  10.694 24.032 1.00 15.11 ? 335 GLY A CA  1 
ATOM   2562 C C   . GLY A 1 335 ? 49.792  10.894 25.496 1.00 15.67 ? 335 GLY A C   1 
ATOM   2563 O O   . GLY A 1 335 ? 49.567  9.895  26.171 1.00 19.05 ? 335 GLY A O   1 
ATOM   2564 N N   . VAL A 1 336 ? 49.773  12.110 26.044 1.00 13.68 ? 336 VAL A N   1 
ATOM   2565 C CA  . VAL A 1 336 ? 49.377  12.256 27.457 1.00 12.27 ? 336 VAL A CA  1 
ATOM   2566 C C   . VAL A 1 336 ? 47.990  11.629 27.727 1.00 14.50 ? 336 VAL A C   1 
ATOM   2567 O O   . VAL A 1 336 ? 47.755  11.102 28.812 1.00 14.79 ? 336 VAL A O   1 
ATOM   2568 C CB  . VAL A 1 336 ? 49.266  13.702 27.895 1.00 11.93 ? 336 VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 336 ? 48.884  13.758 29.369 1.00 11.20 ? 336 VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 336 ? 50.541  14.465 27.611 1.00 11.45 ? 336 VAL A CG2 1 
ATOM   2571 N N   . ILE A 1 337 ? 47.037  11.851 26.810 1.00 14.95 ? 337 ILE A N   1 
ATOM   2572 C CA  . ILE A 1 337 ? 45.689  11.267 26.879 1.00 13.96 ? 337 ILE A CA  1 
ATOM   2573 C C   . ILE A 1 337 ? 45.574  10.374 25.638 1.00 15.73 ? 337 ILE A C   1 
ATOM   2574 O O   . ILE A 1 337 ? 45.854  10.810 24.508 1.00 18.48 ? 337 ILE A O   1 
ATOM   2575 C CB  . ILE A 1 337 ? 44.588  12.311 26.727 1.00 12.81 ? 337 ILE A CB  1 
ATOM   2576 C CG1 . ILE A 1 337 ? 44.572  13.211 27.935 1.00 12.74 ? 337 ILE A CG1 1 
ATOM   2577 C CG2 . ILE A 1 337 ? 43.243  11.654 26.502 1.00 10.28 ? 337 ILE A CG2 1 
ATOM   2578 C CD1 . ILE A 1 337 ? 43.811  14.481 27.678 1.00 14.07 ? 337 ILE A CD1 1 
ATOM   2579 N N   . PRO A 1 338 ? 45.138  9.126  25.822 1.00 14.91 ? 338 PRO A N   1 
ATOM   2580 C CA  . PRO A 1 338 ? 45.083  8.203  24.699 1.00 14.75 ? 338 PRO A CA  1 
ATOM   2581 C C   . PRO A 1 338 ? 43.814  8.327  23.800 1.00 16.63 ? 338 PRO A C   1 
ATOM   2582 O O   . PRO A 1 338 ? 42.695  8.682  24.254 1.00 16.41 ? 338 PRO A O   1 
ATOM   2583 C CB  . PRO A 1 338 ? 45.185  6.848  25.412 1.00 15.00 ? 338 PRO A CB  1 
ATOM   2584 C CG  . PRO A 1 338 ? 44.401  7.042  26.626 1.00 14.48 ? 338 PRO A CG  1 
ATOM   2585 C CD  . PRO A 1 338 ? 44.784  8.448  27.083 1.00 15.13 ? 338 PRO A CD  1 
ATOM   2586 N N   . MET A 1 339 ? 43.984  7.974  22.530 1.00 17.01 ? 339 MET A N   1 
ATOM   2587 C CA  . MET A 1 339 ? 42.883  8.009  21.582 1.00 16.51 ? 339 MET A CA  1 
ATOM   2588 C C   . MET A 1 339 ? 41.691  7.200  22.049 1.00 16.58 ? 339 MET A C   1 
ATOM   2589 O O   . MET A 1 339 ? 40.575  7.462  21.594 1.00 15.42 ? 339 MET A O   1 
ATOM   2590 C CB  . MET A 1 339 ? 43.301  7.452  20.227 1.00 15.78 ? 339 MET A CB  1 
ATOM   2591 C CG  . MET A 1 339 ? 43.701  8.511  19.217 1.00 17.23 ? 339 MET A CG  1 
ATOM   2592 S SD  . MET A 1 339 ? 42.464  9.739  18.840 1.00 15.95 ? 339 MET A SD  1 
ATOM   2593 C CE  . MET A 1 339 ? 41.056  8.662  18.642 1.00 14.97 ? 339 MET A CE  1 
ATOM   2594 N N   . SER A 1 340 ? 41.936  6.187  22.892 1.00 17.36 ? 340 SER A N   1 
ATOM   2595 C CA  . SER A 1 340 ? 40.842  5.331  23.375 1.00 17.71 ? 340 SER A CA  1 
ATOM   2596 C C   . SER A 1 340 ? 39.921  6.123  24.250 1.00 18.00 ? 340 SER A C   1 
ATOM   2597 O O   . SER A 1 340 ? 38.708  5.906  24.214 1.00 18.38 ? 340 SER A O   1 
ATOM   2598 C CB  . SER A 1 340 ? 41.325  4.113  24.143 1.00 17.55 ? 340 SER A CB  1 
ATOM   2599 O OG  . SER A 1 340 ? 42.090  4.470  25.268 1.00 21.13 ? 340 SER A OG  1 
ATOM   2600 N N   . ARG A 1 341 ? 40.508  7.061  25.000 1.00 17.30 ? 341 ARG A N   1 
ATOM   2601 C CA  . ARG A 1 341 ? 39.769  7.933  25.893 1.00 15.13 ? 341 ARG A CA  1 
ATOM   2602 C C   . ARG A 1 341 ? 38.855  8.786  25.010 1.00 15.46 ? 341 ARG A C   1 
ATOM   2603 O O   . ARG A 1 341 ? 37.649  8.924  25.264 1.00 14.79 ? 341 ARG A O   1 
ATOM   2604 C CB  . ARG A 1 341 ? 40.755  8.815  26.647 1.00 13.85 ? 341 ARG A CB  1 
ATOM   2605 C CG  . ARG A 1 341 ? 40.106  9.743  27.664 1.00 13.95 ? 341 ARG A CG  1 
ATOM   2606 C CD  . ARG A 1 341 ? 39.205  9.006  28.701 1.00 12.69 ? 341 ARG A CD  1 
ATOM   2607 N NE  . ARG A 1 341 ? 37.821  8.788  28.267 1.00 12.02 ? 341 ARG A NE  1 
ATOM   2608 C CZ  . ARG A 1 341 ? 36.845  9.700  28.275 1.00 10.72 ? 341 ARG A CZ  1 
ATOM   2609 N NH1 . ARG A 1 341 ? 35.665  9.347  27.828 1.00 10.17 ? 341 ARG A NH1 1 
ATOM   2610 N NH2 . ARG A 1 341 ? 37.024  10.947 28.717 1.00 9.61  ? 341 ARG A NH2 1 
ATOM   2611 N N   . ILE A 1 342 ? 39.473  9.393  23.999 1.00 15.77 ? 342 ILE A N   1 
ATOM   2612 C CA  . ILE A 1 342 ? 38.795  10.242 23.028 1.00 13.39 ? 342 ILE A CA  1 
ATOM   2613 C C   . ILE A 1 342 ? 37.682  9.492  22.317 1.00 12.95 ? 342 ILE A C   1 
ATOM   2614 O O   . ILE A 1 342 ? 36.543  10.004 22.195 1.00 12.71 ? 342 ILE A O   1 
ATOM   2615 C CB  . ILE A 1 342 ? 39.785  10.746 21.972 1.00 12.00 ? 342 ILE A CB  1 
ATOM   2616 C CG1 . ILE A 1 342 ? 40.889  11.556 22.643 1.00 11.39 ? 342 ILE A CG1 1 
ATOM   2617 C CG2 . ILE A 1 342 ? 39.062  11.530 20.914 1.00 12.73 ? 342 ILE A CG2 1 
ATOM   2618 C CD1 . ILE A 1 342 ? 40.474  12.880 23.337 1.00 10.89 ? 342 ILE A CD1 1 
ATOM   2619 N N   . ASP A 1 343 ? 38.013  8.292  21.840 1.00 11.93 ? 343 ASP A N   1 
ATOM   2620 C CA  . ASP A 1 343 ? 37.030  7.490  21.128 1.00 12.36 ? 343 ASP A CA  1 
ATOM   2621 C C   . ASP A 1 343 ? 35.847  7.094  21.988 1.00 13.00 ? 343 ASP A C   1 
ATOM   2622 O O   . ASP A 1 343 ? 34.692  7.091  21.517 1.00 12.99 ? 343 ASP A O   1 
ATOM   2623 C CB  . ASP A 1 343 ? 37.676  6.297  20.461 1.00 10.62 ? 343 ASP A CB  1 
ATOM   2624 C CG  . ASP A 1 343 ? 38.528  6.708  19.284 1.00 11.02 ? 343 ASP A CG  1 
ATOM   2625 O OD1 . ASP A 1 343 ? 38.336  7.841  18.818 1.00 10.01 ? 343 ASP A OD1 1 
ATOM   2626 O OD2 . ASP A 1 343 ? 39.376  5.912  18.831 1.00 11.10 ? 343 ASP A OD2 1 
ATOM   2627 N N   . ASP A 1 344 ? 36.129  6.814  23.260 1.00 11.40 ? 344 ASP A N   1 
ATOM   2628 C CA  . ASP A 1 344 ? 35.079  6.458  24.171 1.00 10.41 ? 344 ASP A CA  1 
ATOM   2629 C C   . ASP A 1 344 ? 34.178  7.672  24.309 1.00 10.97 ? 344 ASP A C   1 
ATOM   2630 O O   . ASP A 1 344 ? 32.949  7.576  24.277 1.00 13.31 ? 344 ASP A O   1 
ATOM   2631 C CB  . ASP A 1 344 ? 35.630  6.073  25.542 1.00 9.12  ? 344 ASP A CB  1 
ATOM   2632 C CG  . ASP A 1 344 ? 34.533  5.966  26.563 1.00 10.01 ? 344 ASP A CG  1 
ATOM   2633 O OD1 . ASP A 1 344 ? 33.686  5.070  26.438 1.00 8.36  ? 344 ASP A OD1 1 
ATOM   2634 O OD2 . ASP A 1 344 ? 34.405  6.851  27.428 1.00 12.39 ? 344 ASP A OD2 1 
ATOM   2635 N N   . ALA A 1 345 ? 34.789  8.831  24.470 1.00 10.88 ? 345 ALA A N   1 
ATOM   2636 C CA  . ALA A 1 345 ? 34.013  10.048 24.627 1.00 10.79 ? 345 ALA A CA  1 
ATOM   2637 C C   . ALA A 1 345 ? 33.143  10.259 23.403 1.00 10.92 ? 345 ALA A C   1 
ATOM   2638 O O   . ALA A 1 345 ? 31.930  10.486 23.501 1.00 10.32 ? 345 ALA A O   1 
ATOM   2639 C CB  . ALA A 1 345 ? 34.941  11.283 24.853 1.00 10.02 ? 345 ALA A CB  1 
ATOM   2640 N N   . VAL A 1 346 ? 33.756  10.185 22.232 1.00 11.68 ? 346 VAL A N   1 
ATOM   2641 C CA  . VAL A 1 346 ? 32.972  10.430 21.035 1.00 11.01 ? 346 VAL A CA  1 
ATOM   2642 C C   . VAL A 1 346 ? 31.946  9.319  20.802 1.00 12.11 ? 346 VAL A C   1 
ATOM   2643 O O   . VAL A 1 346 ? 30.894  9.521  20.192 1.00 12.87 ? 346 VAL A O   1 
ATOM   2644 C CB  . VAL A 1 346 ? 33.884  10.662 19.834 1.00 9.55  ? 346 VAL A CB  1 
ATOM   2645 C CG1 . VAL A 1 346 ? 33.046  10.903 18.636 1.00 10.05 ? 346 VAL A CG1 1 
ATOM   2646 C CG2 . VAL A 1 346 ? 34.804  11.858 20.081 1.00 6.70  ? 346 VAL A CG2 1 
ATOM   2647 N N   . THR A 1 347 ? 32.247  8.137  21.301 1.00 12.53 ? 347 THR A N   1 
ATOM   2648 C CA  . THR A 1 347 ? 31.326  7.046  21.154 1.00 12.58 ? 347 THR A CA  1 
ATOM   2649 C C   . THR A 1 347 ? 30.020  7.318  21.902 1.00 12.94 ? 347 THR A C   1 
ATOM   2650 O O   . THR A 1 347 ? 28.923  7.087  21.381 1.00 12.60 ? 347 THR A O   1 
ATOM   2651 C CB  . THR A 1 347 ? 31.971  5.779  21.634 1.00 11.93 ? 347 THR A CB  1 
ATOM   2652 O OG1 . THR A 1 347 ? 32.867  5.336  20.610 1.00 13.12 ? 347 THR A OG1 1 
ATOM   2653 C CG2 . THR A 1 347 ? 30.934  4.718  21.869 1.00 12.61 ? 347 THR A CG2 1 
ATOM   2654 N N   . ARG A 1 348 ? 30.153  7.857  23.111 1.00 13.44 ? 348 ARG A N   1 
ATOM   2655 C CA  . ARG A 1 348 ? 29.016  8.171  23.979 1.00 9.82  ? 348 ARG A CA  1 
ATOM   2656 C C   . ARG A 1 348 ? 28.174  9.283  23.442 1.00 8.16  ? 348 ARG A C   1 
ATOM   2657 O O   . ARG A 1 348 ? 26.962  9.207  23.545 1.00 9.49  ? 348 ARG A O   1 
ATOM   2658 C CB  . ARG A 1 348 ? 29.525  8.527  25.368 1.00 10.06 ? 348 ARG A CB  1 
ATOM   2659 C CG  . ARG A 1 348 ? 29.853  7.307  26.159 1.00 10.24 ? 348 ARG A CG  1 
ATOM   2660 C CD  . ARG A 1 348 ? 31.009  7.482  27.074 1.00 9.23  ? 348 ARG A CD  1 
ATOM   2661 N NE  . ARG A 1 348 ? 31.183  6.206  27.753 1.00 7.67  ? 348 ARG A NE  1 
ATOM   2662 C CZ  . ARG A 1 348 ? 30.297  5.679  28.594 1.00 7.29  ? 348 ARG A CZ  1 
ATOM   2663 N NH1 . ARG A 1 348 ? 29.144  6.287  28.880 1.00 5.33  ? 348 ARG A NH1 1 
ATOM   2664 N NH2 . ARG A 1 348 ? 30.628  4.590  29.260 1.00 7.38  ? 348 ARG A NH2 1 
ATOM   2665 N N   . ILE A 1 349 ? 28.821  10.325 22.919 1.00 6.42  ? 349 ILE A N   1 
ATOM   2666 C CA  . ILE A 1 349 ? 28.136  11.481 22.351 1.00 6.60  ? 349 ILE A CA  1 
ATOM   2667 C C   . ILE A 1 349 ? 27.333  11.151 21.073 1.00 8.22  ? 349 ILE A C   1 
ATOM   2668 O O   . ILE A 1 349 ? 26.188  11.599 20.906 1.00 7.10  ? 349 ILE A O   1 
ATOM   2669 C CB  . ILE A 1 349 ? 29.119  12.644 22.092 1.00 5.57  ? 349 ILE A CB  1 
ATOM   2670 C CG1 . ILE A 1 349 ? 29.837  13.040 23.403 1.00 4.69  ? 349 ILE A CG1 1 
ATOM   2671 C CG2 . ILE A 1 349 ? 28.361  13.819 21.474 1.00 2.05  ? 349 ILE A CG2 1 
ATOM   2672 C CD1 . ILE A 1 349 ? 31.144  13.889 23.203 1.00 4.13  ? 349 ILE A CD1 1 
ATOM   2673 N N   . LEU A 1 350 ? 27.920  10.354 20.184 1.00 8.66  ? 350 LEU A N   1 
ATOM   2674 C CA  . LEU A 1 350 ? 27.207  9.955  18.976 1.00 8.92  ? 350 LEU A CA  1 
ATOM   2675 C C   . LEU A 1 350 ? 26.007  9.040  19.336 1.00 9.03  ? 350 LEU A C   1 
ATOM   2676 O O   . LEU A 1 350 ? 24.946  9.142  18.731 1.00 9.10  ? 350 LEU A O   1 
ATOM   2677 C CB  . LEU A 1 350 ? 28.156  9.237  17.988 1.00 8.38  ? 350 LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 350 ? 29.298  10.121 17.488 1.00 9.04  ? 350 LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 350 ? 30.233  9.326  16.686 1.00 8.64  ? 350 LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 350 ? 28.808  11.329 16.708 1.00 9.40  ? 350 LEU A CD2 1 
ATOM   2681 N N   . ARG A 1 351 ? 26.208  8.084  20.247 1.00 7.80  ? 351 ARG A N   1 
ATOM   2682 C CA  . ARG A 1 351 ? 25.130  7.186  20.662 1.00 7.18  ? 351 ARG A CA  1 
ATOM   2683 C C   . ARG A 1 351 ? 23.847  7.993  21.073 1.00 8.31  ? 351 ARG A C   1 
ATOM   2684 O O   . ARG A 1 351 ? 22.739  7.737  20.569 1.00 5.72  ? 351 ARG A O   1 
ATOM   2685 C CB  . ARG A 1 351 ? 25.642  6.299  21.791 1.00 5.34  ? 351 ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 351 ? 24.604  5.389  22.393 1.00 5.15  ? 351 ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 351 ? 25.133  4.599  23.551 1.00 2.00  ? 351 ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 351 ? 26.046  3.624  23.025 1.00 3.17  ? 351 ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 351 ? 27.308  3.510  23.425 1.00 6.20  ? 351 ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 351 ? 27.770  4.329  24.348 1.00 6.85  ? 351 ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 351 ? 28.106  2.564  22.926 1.00 6.60  ? 351 ARG A NH2 1 
ATOM   2692 N N   . VAL A 1 352 ? 24.038  8.991  21.935 1.00 7.28  ? 352 VAL A N   1 
ATOM   2693 C CA  . VAL A 1 352 ? 22.969  9.848  22.391 1.00 9.42  ? 352 VAL A CA  1 
ATOM   2694 C C   . VAL A 1 352 ? 22.306  10.555 21.171 1.00 13.25 ? 352 VAL A C   1 
ATOM   2695 O O   . VAL A 1 352 ? 21.047  10.579 20.990 1.00 15.27 ? 352 VAL A O   1 
ATOM   2696 C CB  . VAL A 1 352 ? 23.534  10.902 23.370 1.00 9.88  ? 352 VAL A CB  1 
ATOM   2697 C CG1 . VAL A 1 352 ? 22.471  11.976 23.669 1.00 8.23  ? 352 VAL A CG1 1 
ATOM   2698 C CG2 . VAL A 1 352 ? 24.101  10.226 24.666 1.00 7.31  ? 352 VAL A CG2 1 
ATOM   2699 N N   . LYS A 1 353 ? 23.160  11.166 20.351 1.00 15.18 ? 353 LYS A N   1 
ATOM   2700 C CA  . LYS A 1 353 ? 22.724  11.871 19.141 1.00 14.86 ? 353 LYS A CA  1 
ATOM   2701 C C   . LYS A 1 353 ? 21.928  10.975 18.145 1.00 14.09 ? 353 LYS A C   1 
ATOM   2702 O O   . LYS A 1 353 ? 20.838  11.318 17.666 1.00 12.38 ? 353 LYS A O   1 
ATOM   2703 C CB  . LYS A 1 353 ? 23.951  12.518 18.468 1.00 13.53 ? 353 LYS A CB  1 
ATOM   2704 C CG  . LYS A 1 353 ? 24.441  13.803 19.164 1.00 11.59 ? 353 LYS A CG  1 
ATOM   2705 C CD  . LYS A 1 353 ? 25.460  14.573 18.302 1.00 10.91 ? 353 LYS A CD  1 
ATOM   2706 C CE  . LYS A 1 353 ? 25.718  15.939 18.902 1.00 10.44 ? 353 LYS A CE  1 
ATOM   2707 N NZ  . LYS A 1 353 ? 26.779  16.662 18.210 1.00 10.27 ? 353 LYS A NZ  1 
ATOM   2708 N N   . PHE A 1 354 ? 22.494  9.814  17.864 1.00 15.08 ? 354 PHE A N   1 
ATOM   2709 C CA  . PHE A 1 354 ? 21.887  8.885  16.954 1.00 14.98 ? 354 PHE A CA  1 
ATOM   2710 C C   . PHE A 1 354 ? 20.611  8.415  17.588 1.00 14.63 ? 354 PHE A C   1 
ATOM   2711 O O   . PHE A 1 354 ? 19.559  8.481  16.988 1.00 14.32 ? 354 PHE A O   1 
ATOM   2712 C CB  . PHE A 1 354 ? 22.838  7.719  16.666 1.00 14.38 ? 354 PHE A CB  1 
ATOM   2713 C CG  . PHE A 1 354 ? 23.836  7.999  15.553 1.00 15.45 ? 354 PHE A CG  1 
ATOM   2714 C CD1 . PHE A 1 354 ? 25.223  7.964  15.801 1.00 15.88 ? 354 PHE A CD1 1 
ATOM   2715 C CD2 . PHE A 1 354 ? 23.390  8.237  14.242 1.00 14.82 ? 354 PHE A CD2 1 
ATOM   2716 C CE1 . PHE A 1 354 ? 26.147  8.148  14.767 1.00 15.92 ? 354 PHE A CE1 1 
ATOM   2717 C CE2 . PHE A 1 354 ? 24.287  8.422  13.205 1.00 15.13 ? 354 PHE A CE2 1 
ATOM   2718 C CZ  . PHE A 1 354 ? 25.676  8.378  13.459 1.00 15.97 ? 354 PHE A CZ  1 
ATOM   2719 N N   . THR A 1 355 ? 20.691  7.999  18.838 1.00 15.07 ? 355 THR A N   1 
ATOM   2720 C CA  . THR A 1 355 ? 19.512  7.505  19.510 1.00 15.64 ? 355 THR A CA  1 
ATOM   2721 C C   . THR A 1 355 ? 18.338  8.481  19.509 1.00 16.39 ? 355 THR A C   1 
ATOM   2722 O O   . THR A 1 355 ? 17.251  8.158  19.018 1.00 16.82 ? 355 THR A O   1 
ATOM   2723 C CB  . THR A 1 355 ? 19.828  7.096  20.944 1.00 15.98 ? 355 THR A CB  1 
ATOM   2724 O OG1 . THR A 1 355 ? 20.850  6.089  20.925 1.00 15.50 ? 355 THR A OG1 1 
ATOM   2725 C CG2 . THR A 1 355 ? 18.565  6.568  21.635 1.00 14.85 ? 355 THR A CG2 1 
ATOM   2726 N N   . MET A 1 356 ? 18.527  9.669  20.069 1.00 16.36 ? 356 MET A N   1 
ATOM   2727 C CA  . MET A 1 356 ? 17.415  10.611 20.103 1.00 16.27 ? 356 MET A CA  1 
ATOM   2728 C C   . MET A 1 356 ? 16.831  10.923 18.701 1.00 16.86 ? 356 MET A C   1 
ATOM   2729 O O   . MET A 1 356 ? 15.791  11.587 18.560 1.00 18.58 ? 356 MET A O   1 
ATOM   2730 C CB  . MET A 1 356 ? 17.862  11.892 20.795 1.00 16.55 ? 356 MET A CB  1 
ATOM   2731 C CG  . MET A 1 356 ? 19.003  12.650 20.146 1.00 15.91 ? 356 MET A CG  1 
ATOM   2732 S SD  . MET A 1 356 ? 19.193  14.273 20.970 1.00 16.47 ? 356 MET A SD  1 
ATOM   2733 C CE  . MET A 1 356 ? 20.452  13.879 21.934 1.00 19.07 ? 356 MET A CE  1 
ATOM   2734 N N   . GLY A 1 357 ? 17.521  10.447 17.674 1.00 16.15 ? 357 GLY A N   1 
ATOM   2735 C CA  . GLY A 1 357 ? 17.139  10.736 16.308 1.00 16.17 ? 357 GLY A CA  1 
ATOM   2736 C C   . GLY A 1 357 ? 17.658  12.066 15.733 1.00 15.27 ? 357 GLY A C   1 
ATOM   2737 O O   . GLY A 1 357 ? 17.116  12.525 14.703 1.00 17.15 ? 357 GLY A O   1 
ATOM   2738 N N   . LEU A 1 358 ? 18.677  12.694 16.345 1.00 12.23 ? 358 LEU A N   1 
ATOM   2739 C CA  . LEU A 1 358 ? 19.192  13.971 15.825 1.00 10.81 ? 358 LEU A CA  1 
ATOM   2740 C C   . LEU A 1 358 ? 19.622  13.906 14.351 1.00 11.37 ? 358 LEU A C   1 
ATOM   2741 O O   . LEU A 1 358 ? 19.572  14.906 13.658 1.00 10.14 ? 358 LEU A O   1 
ATOM   2742 C CB  . LEU A 1 358 ? 20.381  14.480 16.651 1.00 8.99  ? 358 LEU A CB  1 
ATOM   2743 C CG  . LEU A 1 358 ? 20.298  15.791 17.425 1.00 7.71  ? 358 LEU A CG  1 
ATOM   2744 C CD1 . LEU A 1 358 ? 21.648  16.394 17.620 1.00 5.70  ? 358 LEU A CD1 1 
ATOM   2745 C CD2 . LEU A 1 358 ? 19.432  16.726 16.700 1.00 8.65  ? 358 LEU A CD2 1 
ATOM   2746 N N   . PHE A 1 359 ? 20.163  12.779 13.899 1.00 12.86 ? 359 PHE A N   1 
ATOM   2747 C CA  . PHE A 1 359 ? 20.588  12.713 12.510 1.00 14.52 ? 359 PHE A CA  1 
ATOM   2748 C C   . PHE A 1 359 ? 19.424  12.722 11.553 1.00 14.06 ? 359 PHE A C   1 
ATOM   2749 O O   . PHE A 1 359 ? 19.541  13.265 10.465 1.00 14.65 ? 359 PHE A O   1 
ATOM   2750 C CB  . PHE A 1 359 ? 21.519  11.548 12.254 1.00 15.68 ? 359 PHE A CB  1 
ATOM   2751 C CG  . PHE A 1 359 ? 22.932  11.791 12.724 1.00 18.64 ? 359 PHE A CG  1 
ATOM   2752 C CD1 . PHE A 1 359 ? 23.266  11.669 14.079 1.00 19.37 ? 359 PHE A CD1 1 
ATOM   2753 C CD2 . PHE A 1 359 ? 23.968  12.022 11.783 1.00 19.71 ? 359 PHE A CD2 1 
ATOM   2754 C CE1 . PHE A 1 359 ? 24.630  11.752 14.508 1.00 20.64 ? 359 PHE A CE1 1 
ATOM   2755 C CE2 . PHE A 1 359 ? 25.342  12.112 12.177 1.00 20.36 ? 359 PHE A CE2 1 
ATOM   2756 C CZ  . PHE A 1 359 ? 25.678  11.968 13.553 1.00 21.05 ? 359 PHE A CZ  1 
ATOM   2757 N N   . GLU A 1 360 ? 18.270  12.241 12.007 1.00 15.00 ? 360 GLU A N   1 
ATOM   2758 C CA  . GLU A 1 360 ? 17.063  12.223 11.189 1.00 15.08 ? 360 GLU A CA  1 
ATOM   2759 C C   . GLU A 1 360 ? 16.257  13.514 11.256 1.00 14.49 ? 360 GLU A C   1 
ATOM   2760 O O   . GLU A 1 360 ? 15.639  13.886 10.272 1.00 14.09 ? 360 GLU A O   1 
ATOM   2761 C CB  . GLU A 1 360 ? 16.193  11.051 11.549 1.00 16.51 ? 360 GLU A CB  1 
ATOM   2762 C CG  . GLU A 1 360 ? 16.710  9.718  11.020 1.00 20.65 ? 360 GLU A CG  1 
ATOM   2763 C CD  . GLU A 1 360 ? 18.030  9.288  11.662 1.00 23.92 ? 360 GLU A CD  1 
ATOM   2764 O OE1 . GLU A 1 360 ? 18.029  9.137  12.915 1.00 23.75 ? 360 GLU A OE1 1 
ATOM   2765 O OE2 . GLU A 1 360 ? 19.045  9.116  10.915 1.00 25.91 ? 360 GLU A OE2 1 
ATOM   2766 N N   . ASN A 1 361 ? 16.315  14.228 12.379 1.00 14.22 ? 361 ASN A N   1 
ATOM   2767 C CA  . ASN A 1 361 ? 15.586  15.504 12.535 1.00 14.86 ? 361 ASN A CA  1 
ATOM   2768 C C   . ASN A 1 361 ? 16.411  16.630 13.184 1.00 16.28 ? 361 ASN A C   1 
ATOM   2769 O O   . ASN A 1 361 ? 16.253  16.939 14.351 1.00 17.45 ? 361 ASN A O   1 
ATOM   2770 C CB  . ASN A 1 361 ? 14.328  15.281 13.357 1.00 13.51 ? 361 ASN A CB  1 
ATOM   2771 C CG  . ASN A 1 361 ? 13.361  14.361 12.678 1.00 13.53 ? 361 ASN A CG  1 
ATOM   2772 O OD1 . ASN A 1 361 ? 12.600  14.791 11.812 1.00 12.22 ? 361 ASN A OD1 1 
ATOM   2773 N ND2 . ASN A 1 361 ? 13.402  13.065 13.037 1.00 12.77 ? 361 ASN A ND2 1 
ATOM   2774 N N   . PRO A 1 362 ? 17.384  17.185 12.458 1.00 16.73 ? 362 PRO A N   1 
ATOM   2775 C CA  . PRO A 1 362 ? 18.293  18.065 13.186 1.00 15.34 ? 362 PRO A CA  1 
ATOM   2776 C C   . PRO A 1 362 ? 17.766  19.498 13.337 1.00 16.18 ? 362 PRO A C   1 
ATOM   2777 O O   . PRO A 1 362 ? 18.427  20.355 13.920 1.00 15.48 ? 362 PRO A O   1 
ATOM   2778 C CB  . PRO A 1 362 ? 19.552  18.019 12.305 1.00 16.23 ? 362 PRO A CB  1 
ATOM   2779 C CG  . PRO A 1 362 ? 19.009  17.844 10.907 1.00 15.26 ? 362 PRO A CG  1 
ATOM   2780 C CD  . PRO A 1 362 ? 17.906  16.848 11.111 1.00 16.05 ? 362 PRO A CD  1 
ATOM   2781 N N   . TYR A 1 363 ? 16.679  19.799 12.640 1.00 15.83 ? 363 TYR A N   1 
ATOM   2782 C CA  . TYR A 1 363 ? 16.112  21.146 12.695 1.00 15.46 ? 363 TYR A CA  1 
ATOM   2783 C C   . TYR A 1 363 ? 14.789  21.224 13.453 1.00 15.94 ? 363 TYR A C   1 
ATOM   2784 O O   . TYR A 1 363 ? 14.077  20.215 13.600 1.00 15.63 ? 363 TYR A O   1 
ATOM   2785 C CB  . TYR A 1 363 ? 15.875  21.689 11.279 1.00 14.70 ? 363 TYR A CB  1 
ATOM   2786 C CG  . TYR A 1 363 ? 17.090  21.781 10.463 1.00 14.25 ? 363 TYR A CG  1 
ATOM   2787 C CD1 . TYR A 1 363 ? 17.498  20.709 9.724  1.00 14.11 ? 363 TYR A CD1 1 
ATOM   2788 C CD2 . TYR A 1 363 ? 17.913  22.916 10.529 1.00 16.30 ? 363 TYR A CD2 1 
ATOM   2789 C CE1 . TYR A 1 363 ? 18.705  20.736 9.068  1.00 16.82 ? 363 TYR A CE1 1 
ATOM   2790 C CE2 . TYR A 1 363 ? 19.152  22.960 9.863  1.00 16.46 ? 363 TYR A CE2 1 
ATOM   2791 C CZ  . TYR A 1 363 ? 19.526  21.856 9.145  1.00 16.84 ? 363 TYR A CZ  1 
ATOM   2792 O OH  . TYR A 1 363 ? 20.733  21.841 8.520  1.00 19.09 ? 363 TYR A OH  1 
ATOM   2793 N N   . ALA A 1 364 ? 14.383  22.464 13.732 1.00 15.41 ? 364 ALA A N   1 
ATOM   2794 C CA  . ALA A 1 364 ? 13.152  22.726 14.449 1.00 15.80 ? 364 ALA A CA  1 
ATOM   2795 C C   . ALA A 1 364 ? 11.903  22.519 13.607 1.00 17.05 ? 364 ALA A C   1 
ATOM   2796 O O   . ALA A 1 364 ? 11.904  22.714 12.379 1.00 17.64 ? 364 ALA A O   1 
ATOM   2797 C CB  . ALA A 1 364 ? 13.168  24.097 14.975 1.00 15.47 ? 364 ALA A CB  1 
ATOM   2798 N N   . ASP A 1 365 ? 10.818  22.163 14.290 1.00 16.95 ? 365 ASP A N   1 
ATOM   2799 C CA  . ASP A 1 365 ? 9.531   21.940 13.673 1.00 14.89 ? 365 ASP A CA  1 
ATOM   2800 C C   . ASP A 1 365 ? 8.764   23.177 13.932 1.00 14.75 ? 365 ASP A C   1 
ATOM   2801 O O   . ASP A 1 365 ? 8.503   23.521 15.052 1.00 15.49 ? 365 ASP A O   1 
ATOM   2802 C CB  . ASP A 1 365 ? 8.816   20.824 14.383 1.00 15.67 ? 365 ASP A CB  1 
ATOM   2803 C CG  . ASP A 1 365 ? 7.477   20.518 13.778 1.00 17.62 ? 365 ASP A CG  1 
ATOM   2804 O OD1 . ASP A 1 365 ? 6.839   21.361 13.088 1.00 19.22 ? 365 ASP A OD1 1 
ATOM   2805 O OD2 . ASP A 1 365 ? 7.060   19.379 13.992 1.00 18.63 ? 365 ASP A OD2 1 
ATOM   2806 N N   . PRO A 1 366 ? 8.351   23.861 12.898 1.00 16.19 ? 366 PRO A N   1 
ATOM   2807 C CA  . PRO A 1 366 ? 7.676   25.139 13.129 1.00 16.89 ? 366 PRO A CA  1 
ATOM   2808 C C   . PRO A 1 366 ? 6.332   24.932 13.797 1.00 17.04 ? 366 PRO A C   1 
ATOM   2809 O O   . PRO A 1 366 ? 5.746   25.875 14.300 1.00 19.21 ? 366 PRO A O   1 
ATOM   2810 C CB  . PRO A 1 366 ? 7.456   25.672 11.724 1.00 15.52 ? 366 PRO A CB  1 
ATOM   2811 C CG  . PRO A 1 366 ? 8.563   25.060 10.952 1.00 18.14 ? 366 PRO A CG  1 
ATOM   2812 C CD  . PRO A 1 366 ? 8.570   23.639 11.467 1.00 17.36 ? 366 PRO A CD  1 
ATOM   2813 N N   . ALA A 1 367 ? 5.814   23.716 13.704 1.00 16.91 ? 367 ALA A N   1 
ATOM   2814 C CA  . ALA A 1 367 ? 4.529   23.399 14.246 1.00 17.15 ? 367 ALA A CA  1 
ATOM   2815 C C   . ALA A 1 367 ? 4.508   23.343 15.761 1.00 18.95 ? 367 ALA A C   1 
ATOM   2816 O O   . ALA A 1 367 ? 3.454   23.496 16.363 1.00 20.84 ? 367 ALA A O   1 
ATOM   2817 C CB  . ALA A 1 367 ? 4.039   22.151 13.664 1.00 16.87 ? 367 ALA A CB  1 
ATOM   2818 N N   . MET A 1 368 ? 5.649   23.045 16.369 1.00 19.63 ? 368 MET A N   1 
ATOM   2819 C CA  . MET A 1 368 ? 5.781   23.013 17.825 1.00 19.60 ? 368 MET A CA  1 
ATOM   2820 C C   . MET A 1 368 ? 5.827   24.409 18.516 1.00 20.48 ? 368 MET A C   1 
ATOM   2821 O O   . MET A 1 368 ? 5.699   24.487 19.739 1.00 20.20 ? 368 MET A O   1 
ATOM   2822 C CB  . MET A 1 368 ? 7.036   22.267 18.184 1.00 19.11 ? 368 MET A CB  1 
ATOM   2823 C CG  . MET A 1 368 ? 6.979   20.879 17.720 1.00 20.17 ? 368 MET A CG  1 
ATOM   2824 S SD  . MET A 1 368 ? 5.923   19.894 18.764 1.00 21.96 ? 368 MET A SD  1 
ATOM   2825 C CE  . MET A 1 368 ? 7.106   19.344 20.028 1.00 21.45 ? 368 MET A CE  1 
ATOM   2826 N N   . ALA A 1 369 ? 5.986   25.499 17.749 1.00 20.75 ? 369 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 369 ? 6.060   26.860 18.306 1.00 21.31 ? 369 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 369 ? 4.874   27.206 19.237 1.00 22.81 ? 369 ALA A C   1 
ATOM   2829 O O   . ALA A 1 369 ? 5.062   27.759 20.313 1.00 24.69 ? 369 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 369 ? 6.225   27.887 17.194 1.00 19.52 ? 369 ALA A CB  1 
ATOM   2831 N N   . GLU A 1 370 ? 3.661   26.830 18.860 1.00 23.83 ? 370 GLU A N   1 
ATOM   2832 C CA  . GLU A 1 370 ? 2.511   27.087 19.711 1.00 23.28 ? 370 GLU A CA  1 
ATOM   2833 C C   . GLU A 1 370 ? 2.526   26.252 21.001 1.00 20.25 ? 370 GLU A C   1 
ATOM   2834 O O   . GLU A 1 370 ? 1.643   26.356 21.811 1.00 20.98 ? 370 GLU A O   1 
ATOM   2835 C CB  . GLU A 1 370 ? 1.220   26.829 18.932 1.00 27.44 ? 370 GLU A CB  1 
ATOM   2836 C CG  . GLU A 1 370 ? 1.028   27.818 17.773 1.00 34.43 ? 370 GLU A CG  1 
ATOM   2837 C CD  . GLU A 1 370 ? -0.399  28.423 17.711 1.00 38.24 ? 370 GLU A CD  1 
ATOM   2838 O OE1 . GLU A 1 370 ? -1.401  27.640 17.776 1.00 40.36 ? 370 GLU A OE1 1 
ATOM   2839 O OE2 . GLU A 1 370 ? -0.508  29.682 17.608 1.00 40.44 ? 370 GLU A OE2 1 
ATOM   2840 N N   . GLN A 1 371 ? 3.477   25.363 21.191 1.00 17.01 ? 371 GLN A N   1 
ATOM   2841 C CA  . GLN A 1 371 ? 3.479   24.605 22.444 1.00 15.15 ? 371 GLN A CA  1 
ATOM   2842 C C   . GLN A 1 371 ? 3.870   25.497 23.647 1.00 14.20 ? 371 GLN A C   1 
ATOM   2843 O O   . GLN A 1 371 ? 3.441   25.265 24.766 1.00 13.54 ? 371 GLN A O   1 
ATOM   2844 C CB  . GLN A 1 371 ? 4.476   23.447 22.364 1.00 15.80 ? 371 GLN A CB  1 
ATOM   2845 C CG  . GLN A 1 371 ? 4.059   22.301 21.511 1.00 15.67 ? 371 GLN A CG  1 
ATOM   2846 C CD  . GLN A 1 371 ? 2.825   21.632 22.048 1.00 16.63 ? 371 GLN A CD  1 
ATOM   2847 O OE1 . GLN A 1 371 ? 2.712   21.340 23.248 1.00 15.92 ? 371 GLN A OE1 1 
ATOM   2848 N NE2 . GLN A 1 371 ? 1.870   21.394 21.160 1.00 17.83 ? 371 GLN A NE2 1 
ATOM   2849 N N   . LEU A 1 372 ? 4.741   26.476 23.410 1.00 12.36 ? 372 LEU A N   1 
ATOM   2850 C CA  . LEU A 1 372 ? 5.238   27.388 24.428 1.00 9.02  ? 372 LEU A CA  1 
ATOM   2851 C C   . LEU A 1 372 ? 4.136   28.103 25.143 1.00 9.37  ? 372 LEU A C   1 
ATOM   2852 O O   . LEU A 1 372 ? 3.486   28.896 24.549 1.00 11.50 ? 372 LEU A O   1 
ATOM   2853 C CB  . LEU A 1 372 ? 6.107   28.445 23.774 1.00 6.69  ? 372 LEU A CB  1 
ATOM   2854 C CG  . LEU A 1 372 ? 6.924   29.373 24.675 1.00 5.33  ? 372 LEU A CG  1 
ATOM   2855 C CD1 . LEU A 1 372 ? 8.160   28.714 25.146 1.00 3.42  ? 372 LEU A CD1 1 
ATOM   2856 C CD2 . LEU A 1 372 ? 7.366   30.550 23.860 1.00 5.54  ? 372 LEU A CD2 1 
ATOM   2857 N N   . GLY A 1 373 ? 4.014   27.903 26.439 1.00 11.01 ? 373 GLY A N   1 
ATOM   2858 C CA  . GLY A 1 373 ? 2.988   28.564 27.190 1.00 11.60 ? 373 GLY A CA  1 
ATOM   2859 C C   . GLY A 1 373 ? 1.620   28.056 26.825 1.00 13.19 ? 373 GLY A C   1 
ATOM   2860 O O   . GLY A 1 373 ? 0.660   28.746 27.100 1.00 15.73 ? 373 GLY A O   1 
ATOM   2861 N N   . LYS A 1 374 ? 1.508   26.858 26.256 1.00 14.04 ? 374 LYS A N   1 
ATOM   2862 C CA  . LYS A 1 374 ? 0.195   26.320 25.856 1.00 15.29 ? 374 LYS A CA  1 
ATOM   2863 C C   . LYS A 1 374 ? -0.644  26.347 27.132 1.00 17.53 ? 374 LYS A C   1 
ATOM   2864 O O   . LYS A 1 374 ? -0.117  26.024 28.213 1.00 20.12 ? 374 LYS A O   1 
ATOM   2865 C CB  . LYS A 1 374 ? 0.366   24.885 25.325 1.00 14.22 ? 374 LYS A CB  1 
ATOM   2866 C CG  . LYS A 1 374 ? -0.791  24.292 24.580 1.00 13.84 ? 374 LYS A CG  1 
ATOM   2867 C CD  . LYS A 1 374 ? -0.344  23.014 23.885 1.00 16.18 ? 374 LYS A CD  1 
ATOM   2868 C CE  . LYS A 1 374 ? -0.961  21.681 24.450 1.00 18.90 ? 374 LYS A CE  1 
ATOM   2869 N NZ  . LYS A 1 374 ? -0.048  20.387 24.559 1.00 19.77 ? 374 LYS A NZ  1 
ATOM   2870 N N   . GLN A 1 375 ? -1.925  26.702 27.028 1.00 17.94 ? 375 GLN A N   1 
ATOM   2871 C CA  . GLN A 1 375 ? -2.805  26.785 28.196 1.00 17.63 ? 375 GLN A CA  1 
ATOM   2872 C C   . GLN A 1 375 ? -2.938  25.493 29.014 1.00 17.73 ? 375 GLN A C   1 
ATOM   2873 O O   . GLN A 1 375 ? -3.110  25.530 30.241 1.00 16.84 ? 375 GLN A O   1 
ATOM   2874 C CB  . GLN A 1 375 ? -4.188  27.263 27.780 1.00 17.27 ? 375 GLN A CB  1 
ATOM   2875 C CG  . GLN A 1 375 ? -5.091  27.573 28.932 1.00 18.17 ? 375 GLN A CG  1 
ATOM   2876 C CD  . GLN A 1 375 ? -4.439  28.527 29.887 1.00 19.35 ? 375 GLN A CD  1 
ATOM   2877 O OE1 . GLN A 1 375 ? -3.878  29.535 29.461 1.00 20.67 ? 375 GLN A OE1 1 
ATOM   2878 N NE2 . GLN A 1 375 ? -4.448  28.193 31.180 1.00 18.77 ? 375 GLN A NE2 1 
ATOM   2879 N N   . GLU A 1 376 ? -2.908  24.351 28.343 1.00 17.90 ? 376 GLU A N   1 
ATOM   2880 C CA  . GLU A 1 376 ? -3.026  23.092 29.053 1.00 18.95 ? 376 GLU A CA  1 
ATOM   2881 C C   . GLU A 1 376 ? -1.812  22.894 29.972 1.00 20.57 ? 376 GLU A C   1 
ATOM   2882 O O   . GLU A 1 376 ? -1.940  22.261 31.009 1.00 22.94 ? 376 GLU A O   1 
ATOM   2883 C CB  . GLU A 1 376 ? -3.130  21.909 28.084 1.00 19.85 ? 376 GLU A CB  1 
ATOM   2884 C CG  . GLU A 1 376 ? -4.430  21.760 27.328 1.00 20.42 ? 376 GLU A CG  1 
ATOM   2885 C CD  . GLU A 1 376 ? -4.568  22.689 26.127 1.00 22.29 ? 376 GLU A CD  1 
ATOM   2886 O OE1 . GLU A 1 376 ? -3.655  23.529 25.888 1.00 20.28 ? 376 GLU A OE1 1 
ATOM   2887 O OE2 . GLU A 1 376 ? -5.609  22.550 25.424 1.00 23.14 ? 376 GLU A OE2 1 
ATOM   2888 N N   . HIS A 1 377 ? -0.621  23.344 29.567 1.00 19.23 ? 377 HIS A N   1 
ATOM   2889 C CA  . HIS A 1 377 ? 0.546   23.201 30.427 1.00 17.54 ? 377 HIS A CA  1 
ATOM   2890 C C   . HIS A 1 377 ? 0.312   24.093 31.622 1.00 16.58 ? 377 HIS A C   1 
ATOM   2891 O O   . HIS A 1 377 ? 0.685   23.744 32.740 1.00 16.92 ? 377 HIS A O   1 
ATOM   2892 C CB  . HIS A 1 377 ? 1.805   23.709 29.750 1.00 18.82 ? 377 HIS A CB  1 
ATOM   2893 C CG  . HIS A 1 377 ? 2.104   23.052 28.457 1.00 19.05 ? 377 HIS A CG  1 
ATOM   2894 N ND1 . HIS A 1 377 ? 1.482   21.885 28.058 1.00 19.61 ? 377 HIS A ND1 1 
ATOM   2895 C CD2 . HIS A 1 377 ? 2.920   23.414 27.450 1.00 18.82 ? 377 HIS A CD2 1 
ATOM   2896 C CE1 . HIS A 1 377 ? 1.904   21.569 26.848 1.00 19.48 ? 377 HIS A CE1 1 
ATOM   2897 N NE2 . HIS A 1 377 ? 2.779   22.477 26.453 1.00 19.55 ? 377 HIS A NE2 1 
ATOM   2898 N N   . ARG A 1 378 ? -0.115  25.321 31.336 1.00 14.52 ? 378 ARG A N   1 
ATOM   2899 C CA  . ARG A 1 378 ? -0.422  26.290 32.377 1.00 12.10 ? 378 ARG A CA  1 
ATOM   2900 C C   . ARG A 1 378 ? -1.460  25.719 33.365 1.00 12.08 ? 378 ARG A C   1 
ATOM   2901 O O   . ARG A 1 378 ? -1.278  25.850 34.582 1.00 10.93 ? 378 ARG A O   1 
ATOM   2902 C CB  . ARG A 1 378 ? -0.917  27.589 31.764 1.00 10.26 ? 378 ARG A CB  1 
ATOM   2903 C CG  . ARG A 1 378 ? 0.195   28.396 31.177 1.00 8.95  ? 378 ARG A CG  1 
ATOM   2904 C CD  . ARG A 1 378 ? -0.257  29.793 30.859 1.00 9.40  ? 378 ARG A CD  1 
ATOM   2905 N NE  . ARG A 1 378 ? 0.639   30.394 29.896 1.00 10.53 ? 378 ARG A NE  1 
ATOM   2906 C CZ  . ARG A 1 378 ? 1.654   31.182 30.220 1.00 12.22 ? 378 ARG A CZ  1 
ATOM   2907 N NH1 . ARG A 1 378 ? 1.900   31.478 31.484 1.00 13.41 ? 378 ARG A NH1 1 
ATOM   2908 N NH2 . ARG A 1 378 ? 2.449   31.666 29.279 1.00 14.07 ? 378 ARG A NH2 1 
ATOM   2909 N N   . ASP A 1 379 ? -2.482  25.016 32.870 1.00 11.02 ? 379 ASP A N   1 
ATOM   2910 C CA  . ASP A 1 379 ? -3.441  24.429 33.781 1.00 11.19 ? 379 ASP A CA  1 
ATOM   2911 C C   . ASP A 1 379 ? -2.727  23.439 34.695 1.00 10.99 ? 379 ASP A C   1 
ATOM   2912 O O   . ASP A 1 379 ? -3.092  23.327 35.866 1.00 11.48 ? 379 ASP A O   1 
ATOM   2913 C CB  . ASP A 1 379 ? -4.529  23.688 33.048 1.00 14.35 ? 379 ASP A CB  1 
ATOM   2914 C CG  . ASP A 1 379 ? -5.422  24.593 32.233 1.00 18.78 ? 379 ASP A CG  1 
ATOM   2915 O OD1 . ASP A 1 379 ? -5.508  25.825 32.496 1.00 19.49 ? 379 ASP A OD1 1 
ATOM   2916 O OD2 . ASP A 1 379 ? -6.071  24.036 31.316 1.00 21.74 ? 379 ASP A OD2 1 
ATOM   2917 N N   . LEU A 1 380 ? -1.737  22.704 34.154 1.00 8.99  ? 380 LEU A N   1 
ATOM   2918 C CA  . LEU A 1 380 ? -0.912  21.711 34.900 1.00 7.08  ? 380 LEU A CA  1 
ATOM   2919 C C   . LEU A 1 380 ? -0.007  22.348 35.955 1.00 7.20  ? 380 LEU A C   1 
ATOM   2920 O O   . LEU A 1 380 ? 0.181   21.785 37.021 1.00 7.15  ? 380 LEU A O   1 
ATOM   2921 C CB  . LEU A 1 380 ? -0.013  20.879 33.951 1.00 5.82  ? 380 LEU A CB  1 
ATOM   2922 C CG  . LEU A 1 380 ? 1.076   19.956 34.536 1.00 4.01  ? 380 LEU A CG  1 
ATOM   2923 C CD1 . LEU A 1 380 ? 0.464   18.841 35.295 1.00 2.00  ? 380 LEU A CD1 1 
ATOM   2924 C CD2 . LEU A 1 380 ? 1.926   19.379 33.449 1.00 2.08  ? 380 LEU A CD2 1 
ATOM   2925 N N   . ALA A 1 381 ? 0.588   23.490 35.620 1.00 7.97  ? 381 ALA A N   1 
ATOM   2926 C CA  . ALA A 1 381 ? 1.473   24.213 36.519 1.00 8.40  ? 381 ALA A CA  1 
ATOM   2927 C C   . ALA A 1 381 ? 0.608   24.631 37.663 1.00 8.30  ? 381 ALA A C   1 
ATOM   2928 O O   . ALA A 1 381 ? 0.958   24.456 38.813 1.00 10.32 ? 381 ALA A O   1 
ATOM   2929 C CB  . ALA A 1 381 ? 2.086   25.437 35.821 1.00 7.34  ? 381 ALA A CB  1 
ATOM   2930 N N   . ARG A 1 382 ? -0.530  25.191 37.319 1.00 8.88  ? 382 ARG A N   1 
ATOM   2931 C CA  . ARG A 1 382 ? -1.507  25.609 38.298 1.00 10.41 ? 382 ARG A CA  1 
ATOM   2932 C C   . ARG A 1 382 ? -1.808  24.453 39.269 1.00 11.07 ? 382 ARG A C   1 
ATOM   2933 O O   . ARG A 1 382 ? -1.855  24.666 40.472 1.00 12.21 ? 382 ARG A O   1 
ATOM   2934 C CB  . ARG A 1 382 ? -2.802  26.040 37.591 1.00 9.03  ? 382 ARG A CB  1 
ATOM   2935 C CG  . ARG A 1 382 ? -3.873  26.456 38.517 1.00 8.39  ? 382 ARG A CG  1 
ATOM   2936 C CD  . ARG A 1 382 ? -4.903  27.248 37.774 1.00 10.31 ? 382 ARG A CD  1 
ATOM   2937 N NE  . ARG A 1 382 ? -5.976  27.672 38.655 1.00 9.66  ? 382 ARG A NE  1 
ATOM   2938 C CZ  . ARG A 1 382 ? -7.082  28.291 38.281 1.00 8.97  ? 382 ARG A CZ  1 
ATOM   2939 N NH1 . ARG A 1 382 ? -7.284  28.597 37.021 1.00 9.14  ? 382 ARG A NH1 1 
ATOM   2940 N NH2 . ARG A 1 382 ? -8.018  28.522 39.187 1.00 9.60  ? 382 ARG A NH2 1 
ATOM   2941 N N   . GLU A 1 383 ? -1.993  23.241 38.752 1.00 12.19 ? 383 GLU A N   1 
ATOM   2942 C CA  . GLU A 1 383 ? -2.290  22.073 39.592 1.00 13.02 ? 383 GLU A CA  1 
ATOM   2943 C C   . GLU A 1 383 ? -1.181  21.812 40.557 1.00 12.53 ? 383 GLU A C   1 
ATOM   2944 O O   . GLU A 1 383 ? -1.452  21.574 41.718 1.00 15.22 ? 383 GLU A O   1 
ATOM   2945 C CB  . GLU A 1 383 ? -2.472  20.811 38.762 1.00 13.62 ? 383 GLU A CB  1 
ATOM   2946 C CG  . GLU A 1 383 ? -2.826  19.582 39.576 1.00 14.76 ? 383 GLU A CG  1 
ATOM   2947 C CD  . GLU A 1 383 ? -2.834  18.335 38.707 1.00 16.30 ? 383 GLU A CD  1 
ATOM   2948 O OE1 . GLU A 1 383 ? -3.235  18.439 37.511 1.00 17.43 ? 383 GLU A OE1 1 
ATOM   2949 O OE2 . GLU A 1 383 ? -2.418  17.267 39.202 1.00 15.77 ? 383 GLU A OE2 1 
ATOM   2950 N N   . ALA A 1 384 ? 0.033   21.681 40.022 1.00 11.44 ? 384 ALA A N   1 
ATOM   2951 C CA  . ALA A 1 384 ? 1.256   21.467 40.789 1.00 9.75  ? 384 ALA A CA  1 
ATOM   2952 C C   . ALA A 1 384 ? 1.557   22.571 41.808 1.00 9.78  ? 384 ALA A C   1 
ATOM   2953 O O   . ALA A 1 384 ? 2.182   22.276 42.839 1.00 10.89 ? 384 ALA A O   1 
ATOM   2954 C CB  . ALA A 1 384 ? 2.435   21.344 39.859 1.00 10.87 ? 384 ALA A CB  1 
ATOM   2955 N N   . ALA A 1 385 ? 1.245   23.835 41.489 1.00 7.74  ? 385 ALA A N   1 
ATOM   2956 C CA  . ALA A 1 385 ? 1.496   24.916 42.441 1.00 8.29  ? 385 ALA A CA  1 
ATOM   2957 C C   . ALA A 1 385 ? 0.596   24.669 43.633 1.00 9.93  ? 385 ALA A C   1 
ATOM   2958 O O   . ALA A 1 385 ? 1.057   24.601 44.773 1.00 10.73 ? 385 ALA A O   1 
ATOM   2959 C CB  . ALA A 1 385 ? 1.216   26.253 41.844 1.00 6.57  ? 385 ALA A CB  1 
ATOM   2960 N N   . ARG A 1 386 ? -0.697  24.514 43.361 1.00 11.82 ? 386 ARG A N   1 
ATOM   2961 C CA  . ARG A 1 386 ? -1.690  24.246 44.408 1.00 12.89 ? 386 ARG A CA  1 
ATOM   2962 C C   . ARG A 1 386 ? -1.274  23.039 45.272 1.00 12.84 ? 386 ARG A C   1 
ATOM   2963 O O   . ARG A 1 386 ? -1.200  23.147 46.492 1.00 13.72 ? 386 ARG A O   1 
ATOM   2964 C CB  . ARG A 1 386 ? -3.073  24.013 43.785 1.00 13.70 ? 386 ARG A CB  1 
ATOM   2965 C CG  . ARG A 1 386 ? -4.166  23.685 44.795 1.00 17.26 ? 386 ARG A CG  1 
ATOM   2966 C CD  . ARG A 1 386 ? -4.492  22.156 44.845 1.00 18.96 ? 386 ARG A CD  1 
ATOM   2967 N NE  . ARG A 1 386 ? -4.993  21.686 43.542 1.00 19.96 ? 386 ARG A NE  1 
ATOM   2968 C CZ  . ARG A 1 386 ? -5.174  20.416 43.194 1.00 17.64 ? 386 ARG A CZ  1 
ATOM   2969 N NH1 . ARG A 1 386 ? -4.912  19.454 44.049 1.00 17.45 ? 386 ARG A NH1 1 
ATOM   2970 N NH2 . ARG A 1 386 ? -5.554  20.125 41.958 1.00 16.97 ? 386 ARG A NH2 1 
ATOM   2971 N N   . LYS A 1 387 ? -0.906  21.941 44.634 1.00 10.79 ? 387 LYS A N   1 
ATOM   2972 C CA  . LYS A 1 387 ? -0.518  20.756 45.352 1.00 10.03 ? 387 LYS A CA  1 
ATOM   2973 C C   . LYS A 1 387 ? 0.777   20.882 46.135 1.00 11.00 ? 387 LYS A C   1 
ATOM   2974 O O   . LYS A 1 387 ? 1.052   20.114 47.063 1.00 11.74 ? 387 LYS A O   1 
ATOM   2975 C CB  . LYS A 1 387 ? -0.375  19.613 44.375 1.00 10.39 ? 387 LYS A CB  1 
ATOM   2976 C CG  . LYS A 1 387 ? -1.648  19.155 43.719 1.00 10.58 ? 387 LYS A CG  1 
ATOM   2977 C CD  . LYS A 1 387 ? -1.380  17.781 43.161 1.00 11.69 ? 387 LYS A CD  1 
ATOM   2978 C CE  . LYS A 1 387 ? -2.515  17.278 42.328 1.00 10.60 ? 387 LYS A CE  1 
ATOM   2979 N NZ  . LYS A 1 387 ? -1.956  16.087 41.730 1.00 10.65 ? 387 LYS A NZ  1 
ATOM   2980 N N   . SER A 1 388 ? 1.624   21.809 45.744 1.00 10.16 ? 388 SER A N   1 
ATOM   2981 C CA  . SER A 1 388 ? 2.866   21.929 46.463 1.00 9.94  ? 388 SER A CA  1 
ATOM   2982 C C   . SER A 1 388 ? 2.769   22.736 47.762 1.00 10.18 ? 388 SER A C   1 
ATOM   2983 O O   . SER A 1 388 ? 3.724   22.752 48.531 1.00 11.14 ? 388 SER A O   1 
ATOM   2984 C CB  . SER A 1 388 ? 3.878   22.580 45.559 1.00 10.77 ? 388 SER A CB  1 
ATOM   2985 O OG  . SER A 1 388 ? 3.731   23.987 45.622 1.00 11.96 ? 388 SER A OG  1 
ATOM   2986 N N   . LEU A 1 389 ? 1.652   23.435 48.002 1.00 10.41 ? 389 LEU A N   1 
ATOM   2987 C CA  . LEU A 1 389 ? 1.496   24.281 49.210 1.00 10.07 ? 389 LEU A CA  1 
ATOM   2988 C C   . LEU A 1 389 ? 1.445   23.467 50.500 1.00 9.90  ? 389 LEU A C   1 
ATOM   2989 O O   . LEU A 1 389 ? 0.972   22.344 50.510 1.00 11.20 ? 389 LEU A O   1 
ATOM   2990 C CB  . LEU A 1 389 ? 0.221   25.162 49.105 1.00 8.98  ? 389 LEU A CB  1 
ATOM   2991 C CG  . LEU A 1 389 ? -0.059  25.875 47.756 1.00 7.97  ? 389 LEU A CG  1 
ATOM   2992 C CD1 . LEU A 1 389 ? -1.405  26.561 47.720 1.00 6.87  ? 389 LEU A CD1 1 
ATOM   2993 C CD2 . LEU A 1 389 ? 1.012   26.862 47.462 1.00 6.66  ? 389 LEU A CD2 1 
ATOM   2994 N N   . VAL A 1 390 ? 2.057   23.960 51.560 1.00 9.32  ? 390 VAL A N   1 
ATOM   2995 C CA  . VAL A 1 390 ? 1.935   23.238 52.816 1.00 8.85  ? 390 VAL A CA  1 
ATOM   2996 C C   . VAL A 1 390 ? 1.353   24.207 53.851 1.00 10.26 ? 390 VAL A C   1 
ATOM   2997 O O   . VAL A 1 390 ? 1.941   25.259 54.140 1.00 11.27 ? 390 VAL A O   1 
ATOM   2998 C CB  . VAL A 1 390 ? 3.262   22.677 53.329 1.00 8.89  ? 390 VAL A CB  1 
ATOM   2999 C CG1 . VAL A 1 390 ? 3.025   21.931 54.635 1.00 8.61  ? 390 VAL A CG1 1 
ATOM   3000 C CG2 . VAL A 1 390 ? 3.896   21.772 52.277 1.00 8.55  ? 390 VAL A CG2 1 
ATOM   3001 N N   . LEU A 1 391 ? 0.123   23.933 54.273 1.00 10.16 ? 391 LEU A N   1 
ATOM   3002 C CA  . LEU A 1 391 ? -0.548  24.717 55.286 1.00 8.68  ? 391 LEU A CA  1 
ATOM   3003 C C   . LEU A 1 391 ? 0.223   24.406 56.605 1.00 8.97  ? 391 LEU A C   1 
ATOM   3004 O O   . LEU A 1 391 ? 0.279   23.251 57.034 1.00 6.46  ? 391 LEU A O   1 
ATOM   3005 C CB  . LEU A 1 391 ? -2.001  24.218 55.362 1.00 9.03  ? 391 LEU A CB  1 
ATOM   3006 C CG  . LEU A 1 391 ? -2.946  24.979 56.306 1.00 8.74  ? 391 LEU A CG  1 
ATOM   3007 C CD1 . LEU A 1 391 ? -2.989  26.449 55.957 1.00 7.50  ? 391 LEU A CD1 1 
ATOM   3008 C CD2 . LEU A 1 391 ? -4.318  24.392 56.241 1.00 9.33  ? 391 LEU A CD2 1 
ATOM   3009 N N   . LEU A 1 392 ? 0.820   25.419 57.232 1.00 8.63  ? 392 LEU A N   1 
ATOM   3010 C CA  . LEU A 1 392 ? 1.595   25.224 58.463 1.00 10.38 ? 392 LEU A CA  1 
ATOM   3011 C C   . LEU A 1 392 ? 0.840   25.510 59.737 1.00 11.97 ? 392 LEU A C   1 
ATOM   3012 O O   . LEU A 1 392 ? 1.208   25.039 60.822 1.00 12.82 ? 392 LEU A O   1 
ATOM   3013 C CB  . LEU A 1 392 ? 2.814   26.123 58.444 1.00 11.68 ? 392 LEU A CB  1 
ATOM   3014 C CG  . LEU A 1 392 ? 3.933   25.754 57.465 1.00 12.12 ? 392 LEU A CG  1 
ATOM   3015 C CD1 . LEU A 1 392 ? 5.126   26.674 57.666 1.00 10.94 ? 392 LEU A CD1 1 
ATOM   3016 C CD2 . LEU A 1 392 ? 4.310   24.272 57.655 1.00 12.52 ? 392 LEU A CD2 1 
ATOM   3017 N N   . LYS A 1 393 ? -0.210  26.308 59.592 1.00 13.32 ? 393 LYS A N   1 
ATOM   3018 C CA  . LYS A 1 393 ? -1.059  26.727 60.704 1.00 13.14 ? 393 LYS A CA  1 
ATOM   3019 C C   . LYS A 1 393 ? -2.383  27.259 60.182 1.00 14.76 ? 393 LYS A C   1 
ATOM   3020 O O   . LYS A 1 393 ? -2.425  28.030 59.216 1.00 16.55 ? 393 LYS A O   1 
ATOM   3021 C CB  . LYS A 1 393 ? -0.355  27.853 61.436 1.00 10.65 ? 393 LYS A CB  1 
ATOM   3022 C CG  . LYS A 1 393 ? -1.144  28.543 62.436 1.00 9.31  ? 393 LYS A CG  1 
ATOM   3023 C CD  . LYS A 1 393 ? -0.334  29.696 62.907 1.00 10.60 ? 393 LYS A CD  1 
ATOM   3024 C CE  . LYS A 1 393 ? -0.943  30.296 64.138 1.00 10.22 ? 393 LYS A CE  1 
ATOM   3025 N NZ  . LYS A 1 393 ? -0.349  31.642 64.206 1.00 11.53 ? 393 LYS A NZ  1 
ATOM   3026 N N   . ASN A 1 394 ? -3.475  26.800 60.754 1.00 15.07 ? 394 ASN A N   1 
ATOM   3027 C CA  . ASN A 1 394 ? -4.735  27.337 60.322 1.00 15.58 ? 394 ASN A CA  1 
ATOM   3028 C C   . ASN A 1 394 ? -5.665  27.685 61.518 1.00 16.66 ? 394 ASN A C   1 
ATOM   3029 O O   . ASN A 1 394 ? -6.711  27.053 61.712 1.00 18.82 ? 394 ASN A O   1 
ATOM   3030 C CB  . ASN A 1 394 ? -5.373  26.405 59.321 1.00 15.26 ? 394 ASN A CB  1 
ATOM   3031 C CG  . ASN A 1 394 ? -6.662  26.936 58.817 1.00 16.27 ? 394 ASN A CG  1 
ATOM   3032 O OD1 . ASN A 1 394 ? -6.912  28.129 58.925 1.00 17.83 ? 394 ASN A OD1 1 
ATOM   3033 N ND2 . ASN A 1 394 ? -7.492  26.071 58.253 1.00 16.39 ? 394 ASN A ND2 1 
ATOM   3034 N N   . GLY A 1 395 ? -5.266  28.682 62.308 1.00 15.37 ? 395 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 395 ? -6.030  29.124 63.456 1.00 15.42 ? 395 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 395 ? -5.008  29.436 64.529 1.00 17.46 ? 395 GLY A C   1 
ATOM   3037 O O   . GLY A 1 395 ? -3.990  28.747 64.599 1.00 17.50 ? 395 GLY A O   1 
ATOM   3038 N N   . LYS A 1 396 ? -5.240  30.467 65.342 1.00 18.04 ? 396 LYS A N   1 
ATOM   3039 C CA  . LYS A 1 396 ? -4.310  30.828 66.407 1.00 19.67 ? 396 LYS A CA  1 
ATOM   3040 C C   . LYS A 1 396 ? -4.360  29.934 67.627 1.00 20.32 ? 396 LYS A C   1 
ATOM   3041 O O   . LYS A 1 396 ? -3.348  29.712 68.265 1.00 20.61 ? 396 LYS A O   1 
ATOM   3042 C CB  . LYS A 1 396 ? -4.454  32.297 66.800 1.00 19.98 ? 396 LYS A CB  1 
ATOM   3043 C CG  . LYS A 1 396 ? -3.727  33.197 65.815 1.00 21.96 ? 396 LYS A CG  1 
ATOM   3044 C CD  . LYS A 1 396 ? -3.742  34.650 66.214 1.00 22.48 ? 396 LYS A CD  1 
ATOM   3045 C CE  . LYS A 1 396 ? -2.702  35.450 65.427 1.00 24.26 ? 396 LYS A CE  1 
ATOM   3046 N NZ  . LYS A 1 396 ? -3.007  36.938 65.400 1.00 25.55 ? 396 LYS A NZ  1 
ATOM   3047 N N   . THR A 1 397 ? -5.526  29.391 67.940 1.00 22.51 ? 397 THR A N   1 
ATOM   3048 C CA  . THR A 1 397 ? -5.678  28.494 69.086 1.00 23.04 ? 397 THR A CA  1 
ATOM   3049 C C   . THR A 1 397 ? -6.590  27.351 68.678 1.00 25.11 ? 397 THR A C   1 
ATOM   3050 O O   . THR A 1 397 ? -7.471  27.520 67.826 1.00 25.69 ? 397 THR A O   1 
ATOM   3051 C CB  . THR A 1 397 ? -6.361  29.163 70.241 1.00 22.16 ? 397 THR A CB  1 
ATOM   3052 O OG1 . THR A 1 397 ? -7.772  29.041 70.057 1.00 21.08 ? 397 THR A OG1 1 
ATOM   3053 C CG2 . THR A 1 397 ? -5.938  30.638 70.346 1.00 22.30 ? 397 THR A CG2 1 
ATOM   3054 N N   . SER A 1 398 ? -6.377  26.193 69.286 1.00 28.30 ? 398 SER A N   1 
ATOM   3055 C CA  . SER A 1 398 ? -7.168  24.995 68.999 1.00 30.91 ? 398 SER A CA  1 
ATOM   3056 C C   . SER A 1 398 ? -8.664  25.233 69.058 1.00 30.57 ? 398 SER A C   1 
ATOM   3057 O O   . SER A 1 398 ? -9.458  24.345 68.701 1.00 31.43 ? 398 SER A O   1 
ATOM   3058 C CB  . SER A 1 398 ? -6.875  23.910 70.031 1.00 32.63 ? 398 SER A CB  1 
ATOM   3059 O OG  . SER A 1 398 ? -7.357  24.333 71.314 1.00 36.85 ? 398 SER A OG  1 
ATOM   3060 N N   . THR A 1 399 ? -9.066  26.380 69.571 1.00 28.68 ? 399 THR A N   1 
ATOM   3061 C CA  . THR A 1 399 ? -10.474 26.585 69.668 1.00 28.47 ? 399 THR A CA  1 
ATOM   3062 C C   . THR A 1 399 ? -11.051 27.647 68.729 1.00 27.63 ? 399 THR A C   1 
ATOM   3063 O O   . THR A 1 399 ? -12.282 27.828 68.621 1.00 28.70 ? 399 THR A O   1 
ATOM   3064 C CB  . THR A 1 399 ? -10.853 26.716 71.115 1.00 28.76 ? 399 THR A CB  1 
ATOM   3065 O OG1 . THR A 1 399 ? -10.360 27.935 71.631 1.00 31.20 ? 399 THR A OG1 1 
ATOM   3066 C CG2 . THR A 1 399 ? -10.134 25.665 71.873 1.00 29.97 ? 399 THR A CG2 1 
ATOM   3067 N N   . ASP A 1 400 ? -10.162 28.243 67.945 1.00 25.44 ? 400 ASP A N   1 
ATOM   3068 C CA  . ASP A 1 400 ? -10.561 29.222 66.948 1.00 21.88 ? 400 ASP A CA  1 
ATOM   3069 C C   . ASP A 1 400 ? -11.326 28.566 65.813 1.00 19.74 ? 400 ASP A C   1 
ATOM   3070 O O   . ASP A 1 400 ? -11.348 27.341 65.685 1.00 19.44 ? 400 ASP A O   1 
ATOM   3071 C CB  . ASP A 1 400 ? -9.337  29.903 66.350 1.00 20.11 ? 400 ASP A CB  1 
ATOM   3072 C CG  . ASP A 1 400 ? -8.810  30.971 67.233 1.00 20.95 ? 400 ASP A CG  1 
ATOM   3073 O OD1 . ASP A 1 400 ? -9.156  30.951 68.426 1.00 20.53 ? 400 ASP A OD1 1 
ATOM   3074 O OD2 . ASP A 1 400 ? -8.080  31.853 66.741 1.00 23.29 ? 400 ASP A OD2 1 
ATOM   3075 N N   . ALA A 1 401 ? -12.051 29.384 65.059 1.00 18.33 ? 401 ALA A N   1 
ATOM   3076 C CA  . ALA A 1 401 ? -12.737 28.918 63.859 1.00 16.42 ? 401 ALA A CA  1 
ATOM   3077 C C   . ALA A 1 401 ? -11.597 28.911 62.804 1.00 15.43 ? 401 ALA A C   1 
ATOM   3078 O O   . ALA A 1 401 ? -10.810 29.837 62.710 1.00 17.98 ? 401 ALA A O   1 
ATOM   3079 C CB  . ALA A 1 401 ? -13.826 29.876 63.486 1.00 12.95 ? 401 ALA A CB  1 
ATOM   3080 N N   . PRO A 1 402 ? -11.377 27.800 62.141 1.00 14.11 ? 402 PRO A N   1 
ATOM   3081 C CA  . PRO A 1 402 ? -10.288 27.783 61.158 1.00 13.26 ? 402 PRO A CA  1 
ATOM   3082 C C   . PRO A 1 402 ? -10.482 28.874 60.113 1.00 13.37 ? 402 PRO A C   1 
ATOM   3083 O O   . PRO A 1 402 ? -11.561 28.951 59.531 1.00 12.23 ? 402 PRO A O   1 
ATOM   3084 C CB  . PRO A 1 402 ? -10.457 26.422 60.505 1.00 12.74 ? 402 PRO A CB  1 
ATOM   3085 C CG  . PRO A 1 402 ? -11.931 26.243 60.619 1.00 13.74 ? 402 PRO A CG  1 
ATOM   3086 C CD  . PRO A 1 402 ? -12.220 26.613 62.017 1.00 13.05 ? 402 PRO A CD  1 
ATOM   3087 N N   . LEU A 1 403 ? -9.434  29.655 59.843 1.00 13.13 ? 403 LEU A N   1 
ATOM   3088 C CA  . LEU A 1 403 ? -9.500  30.739 58.845 1.00 12.20 ? 403 LEU A CA  1 
ATOM   3089 C C   . LEU A 1 403 ? -9.648  30.257 57.386 1.00 12.37 ? 403 LEU A C   1 
ATOM   3090 O O   . LEU A 1 403 ? -10.355 30.866 56.597 1.00 14.56 ? 403 LEU A O   1 
ATOM   3091 C CB  . LEU A 1 403 ? -8.282  31.681 58.929 1.00 9.22  ? 403 LEU A CB  1 
ATOM   3092 C CG  . LEU A 1 403 ? -8.271  32.707 57.782 1.00 9.08  ? 403 LEU A CG  1 
ATOM   3093 C CD1 . LEU A 1 403 ? -9.474  33.668 57.894 1.00 7.69  ? 403 LEU A CD1 1 
ATOM   3094 C CD2 . LEU A 1 403 ? -6.971  33.507 57.717 1.00 7.84  ? 403 LEU A CD2 1 
ATOM   3095 N N   . LEU A 1 404 ? -8.902  29.235 56.993 1.00 12.57 ? 404 LEU A N   1 
ATOM   3096 C CA  . LEU A 1 404 ? -8.965  28.739 55.620 1.00 12.87 ? 404 LEU A CA  1 
ATOM   3097 C C   . LEU A 1 404 ? -9.971  27.598 55.561 1.00 13.76 ? 404 LEU A C   1 
ATOM   3098 O O   . LEU A 1 404 ? -10.084 26.808 56.503 1.00 13.91 ? 404 LEU A O   1 
ATOM   3099 C CB  . LEU A 1 404 ? -7.577  28.243 55.158 1.00 10.95 ? 404 LEU A CB  1 
ATOM   3100 C CG  . LEU A 1 404 ? -6.428  29.244 55.314 1.00 9.19  ? 404 LEU A CG  1 
ATOM   3101 C CD1 . LEU A 1 404 ? -5.108  28.831 54.685 1.00 7.70  ? 404 LEU A CD1 1 
ATOM   3102 C CD2 . LEU A 1 404 ? -6.906  30.454 54.618 1.00 11.02 ? 404 LEU A CD2 1 
ATOM   3103 N N   . PRO A 1 405 ? -10.641 27.438 54.412 1.00 13.64 ? 405 PRO A N   1 
ATOM   3104 C CA  . PRO A 1 405 ? -10.477 28.274 53.211 1.00 13.20 ? 405 PRO A CA  1 
ATOM   3105 C C   . PRO A 1 405 ? -11.293 29.541 53.347 1.00 13.59 ? 405 PRO A C   1 
ATOM   3106 O O   . PRO A 1 405 ? -12.341 29.532 53.979 1.00 14.83 ? 405 PRO A O   1 
ATOM   3107 C CB  . PRO A 1 405 ? -11.020 27.380 52.104 1.00 12.22 ? 405 PRO A CB  1 
ATOM   3108 C CG  . PRO A 1 405 ? -12.066 26.579 52.801 1.00 12.73 ? 405 PRO A CG  1 
ATOM   3109 C CD  . PRO A 1 405 ? -11.494 26.261 54.146 1.00 12.75 ? 405 PRO A CD  1 
ATOM   3110 N N   . LEU A 1 406 ? -10.813 30.633 52.770 1.00 12.28 ? 406 LEU A N   1 
ATOM   3111 C CA  . LEU A 1 406 ? -11.515 31.919 52.859 1.00 9.65  ? 406 LEU A CA  1 
ATOM   3112 C C   . LEU A 1 406 ? -12.788 31.882 52.011 1.00 9.60  ? 406 LEU A C   1 
ATOM   3113 O O   . LEU A 1 406 ? -12.806 31.210 50.979 1.00 11.68 ? 406 LEU A O   1 
ATOM   3114 C CB  . LEU A 1 406 ? -10.571 33.027 52.367 1.00 7.98  ? 406 LEU A CB  1 
ATOM   3115 C CG  . LEU A 1 406 ? -9.236  33.227 53.125 1.00 6.31  ? 406 LEU A CG  1 
ATOM   3116 C CD1 . LEU A 1 406 ? -8.241  33.880 52.186 1.00 3.45  ? 406 LEU A CD1 1 
ATOM   3117 C CD2 . LEU A 1 406 ? -9.425  33.963 54.501 1.00 4.28  ? 406 LEU A CD2 1 
ATOM   3118 N N   . PRO A 1 407 ? -13.847 32.630 52.398 1.00 7.81  ? 407 PRO A N   1 
ATOM   3119 C CA  . PRO A 1 407 ? -15.030 32.885 51.565 1.00 6.62  ? 407 PRO A CA  1 
ATOM   3120 C C   . PRO A 1 407 ? -14.699 33.763 50.380 1.00 6.72  ? 407 PRO A C   1 
ATOM   3121 O O   . PRO A 1 407 ? -13.865 34.653 50.473 1.00 6.69  ? 407 PRO A O   1 
ATOM   3122 C CB  . PRO A 1 407 ? -15.924 33.625 52.499 1.00 5.41  ? 407 PRO A CB  1 
ATOM   3123 C CG  . PRO A 1 407 ? -14.940 34.455 53.238 1.00 6.98  ? 407 PRO A CG  1 
ATOM   3124 C CD  . PRO A 1 407 ? -13.907 33.457 53.607 1.00 6.86  ? 407 PRO A CD  1 
ATOM   3125 N N   . LYS A 1 408 ? -15.362 33.530 49.261 1.00 8.22  ? 408 LYS A N   1 
ATOM   3126 C CA  . LYS A 1 408 ? -15.083 34.312 48.077 1.00 9.83  ? 408 LYS A CA  1 
ATOM   3127 C C   . LYS A 1 408 ? -15.906 35.554 48.065 1.00 10.00 ? 408 LYS A C   1 
ATOM   3128 O O   . LYS A 1 408 ? -15.618 36.459 47.342 1.00 11.17 ? 408 LYS A O   1 
ATOM   3129 C CB  . LYS A 1 408 ? -15.383 33.509 46.824 1.00 10.28 ? 408 LYS A CB  1 
ATOM   3130 C CG  . LYS A 1 408 ? -14.354 32.483 46.438 1.00 11.37 ? 408 LYS A CG  1 
ATOM   3131 C CD  . LYS A 1 408 ? -14.974 31.503 45.481 1.00 11.88 ? 408 LYS A CD  1 
ATOM   3132 C CE  . LYS A 1 408 ? -14.010 30.452 45.075 1.00 14.09 ? 408 LYS A CE  1 
ATOM   3133 N NZ  . LYS A 1 408 ? -14.581 29.584 44.013 1.00 16.00 ? 408 LYS A NZ  1 
ATOM   3134 N N   . LYS A 1 409 ? -17.023 35.535 48.764 1.00 12.65 ? 409 LYS A N   1 
ATOM   3135 C CA  . LYS A 1 409 ? -17.883 36.700 48.824 1.00 14.29 ? 409 LYS A CA  1 
ATOM   3136 C C   . LYS A 1 409 ? -17.653 37.372 50.174 1.00 15.33 ? 409 LYS A C   1 
ATOM   3137 O O   . LYS A 1 409 ? -17.978 36.756 51.206 1.00 18.93 ? 409 LYS A O   1 
ATOM   3138 C CB  . LYS A 1 409 ? -19.329 36.240 48.756 1.00 14.99 ? 409 LYS A CB  1 
ATOM   3139 C CG  . LYS A 1 409 ? -20.310 37.384 48.599 1.00 19.08 ? 409 LYS A CG  1 
ATOM   3140 C CD  . LYS A 1 409 ? -21.721 36.869 48.422 1.00 21.87 ? 409 LYS A CD  1 
ATOM   3141 C CE  . LYS A 1 409 ? -22.694 37.988 48.209 1.00 23.77 ? 409 LYS A CE  1 
ATOM   3142 N NZ  . LYS A 1 409 ? -23.906 37.475 47.480 1.00 27.25 ? 409 LYS A NZ  1 
ATOM   3143 N N   . ALA A 1 410 ? -17.041 38.557 50.201 1.00 12.44 ? 410 ALA A N   1 
ATOM   3144 C CA  . ALA A 1 410 ? -16.825 39.301 51.456 1.00 12.12 ? 410 ALA A CA  1 
ATOM   3145 C C   . ALA A 1 410 ? -16.949 40.768 51.088 1.00 13.10 ? 410 ALA A C   1 
ATOM   3146 O O   . ALA A 1 410 ? -16.641 41.159 49.982 1.00 18.33 ? 410 ALA A O   1 
ATOM   3147 C CB  . ALA A 1 410 ? -15.472 39.029 52.020 1.00 10.66 ? 410 ALA A CB  1 
ATOM   3148 N N   . PRO A 1 411 ? -17.458 41.602 51.958 1.00 11.69 ? 411 PRO A N   1 
ATOM   3149 C CA  . PRO A 1 411 ? -17.676 42.981 51.528 1.00 9.60  ? 411 PRO A CA  1 
ATOM   3150 C C   . PRO A 1 411 ? -16.421 43.652 50.953 1.00 9.06  ? 411 PRO A C   1 
ATOM   3151 O O   . PRO A 1 411 ? -16.436 44.326 49.922 1.00 6.65  ? 411 PRO A O   1 
ATOM   3152 C CB  . PRO A 1 411 ? -18.091 43.637 52.825 1.00 10.29 ? 411 PRO A CB  1 
ATOM   3153 C CG  . PRO A 1 411 ? -18.840 42.525 53.520 1.00 10.12 ? 411 PRO A CG  1 
ATOM   3154 C CD  . PRO A 1 411 ? -17.896 41.404 53.351 1.00 11.84 ? 411 PRO A CD  1 
ATOM   3155 N N   . LYS A 1 412 ? -15.307 43.376 51.607 1.00 10.32 ? 412 LYS A N   1 
ATOM   3156 C CA  . LYS A 1 412 ? -14.052 43.977 51.209 1.00 12.48 ? 412 LYS A CA  1 
ATOM   3157 C C   . LYS A 1 412 ? -12.859 43.209 51.803 1.00 14.81 ? 412 LYS A C   1 
ATOM   3158 O O   . LYS A 1 412 ? -12.912 42.740 52.935 1.00 16.38 ? 412 LYS A O   1 
ATOM   3159 C CB  . LYS A 1 412 ? -14.092 45.417 51.705 1.00 11.73 ? 412 LYS A CB  1 
ATOM   3160 C CG  . LYS A 1 412 ? -12.862 46.239 51.591 1.00 10.47 ? 412 LYS A CG  1 
ATOM   3161 C CD  . LYS A 1 412 ? -13.122 47.447 52.382 1.00 7.15  ? 412 LYS A CD  1 
ATOM   3162 C CE  . LYS A 1 412 ? -12.499 48.538 51.702 1.00 8.28  ? 412 LYS A CE  1 
ATOM   3163 N NZ  . LYS A 1 412 ? -12.281 49.557 52.711 1.00 9.68  ? 412 LYS A NZ  1 
ATOM   3164 N N   . ILE A 1 413 ? -11.779 43.071 51.043 1.00 16.92 ? 413 ILE A N   1 
ATOM   3165 C CA  . ILE A 1 413 ? -10.604 42.338 51.534 1.00 17.34 ? 413 ILE A CA  1 
ATOM   3166 C C   . ILE A 1 413 ? -9.291  43.093 51.195 1.00 18.68 ? 413 ILE A C   1 
ATOM   3167 O O   . ILE A 1 413 ? -9.239  44.017 50.344 1.00 17.98 ? 413 ILE A O   1 
ATOM   3168 C CB  . ILE A 1 413 ? -10.529 40.845 50.904 1.00 17.06 ? 413 ILE A CB  1 
ATOM   3169 C CG1 . ILE A 1 413 ? -10.200 40.901 49.404 1.00 15.35 ? 413 ILE A CG1 1 
ATOM   3170 C CG2 . ILE A 1 413 ? -11.881 40.122 51.010 1.00 16.50 ? 413 ILE A CG2 1 
ATOM   3171 C CD1 . ILE A 1 413 ? -9.962  39.555 48.753 1.00 13.98 ? 413 ILE A CD1 1 
ATOM   3172 N N   . LEU A 1 414 ? -8.228  42.712 51.886 1.00 18.61 ? 414 LEU A N   1 
ATOM   3173 C CA  . LEU A 1 414 ? -6.926  43.308 51.620 1.00 18.65 ? 414 LEU A CA  1 
ATOM   3174 C C   . LEU A 1 414 ? -5.900  42.272 51.154 1.00 18.52 ? 414 LEU A C   1 
ATOM   3175 O O   . LEU A 1 414 ? -5.776  41.155 51.706 1.00 20.90 ? 414 LEU A O   1 
ATOM   3176 C CB  . LEU A 1 414 ? -6.401  44.028 52.864 1.00 18.15 ? 414 LEU A CB  1 
ATOM   3177 C CG  . LEU A 1 414 ? -4.962  44.538 52.856 1.00 17.17 ? 414 LEU A CG  1 
ATOM   3178 C CD1 . LEU A 1 414 ? -4.837  45.765 51.997 1.00 15.31 ? 414 LEU A CD1 1 
ATOM   3179 C CD2 . LEU A 1 414 ? -4.536  44.845 54.289 1.00 16.92 ? 414 LEU A CD2 1 
ATOM   3180 N N   . VAL A 1 415 ? -5.208  42.610 50.084 1.00 16.09 ? 415 VAL A N   1 
ATOM   3181 C CA  . VAL A 1 415 ? -4.145  41.745 49.601 1.00 13.68 ? 415 VAL A CA  1 
ATOM   3182 C C   . VAL A 1 415 ? -2.958  42.706 49.838 1.00 14.37 ? 415 VAL A C   1 
ATOM   3183 O O   . VAL A 1 415 ? -2.976  43.897 49.457 1.00 15.07 ? 415 VAL A O   1 
ATOM   3184 C CB  . VAL A 1 415 ? -4.352  41.310 48.119 1.00 11.58 ? 415 VAL A CB  1 
ATOM   3185 C CG1 . VAL A 1 415 ? -3.258  40.439 47.684 1.00 9.41  ? 415 VAL A CG1 1 
ATOM   3186 C CG2 . VAL A 1 415 ? -5.609  40.557 47.960 1.00 9.01  ? 415 VAL A CG2 1 
ATOM   3187 N N   . ALA A 1 416 ? -1.968  42.218 50.569 1.00 14.34 ? 416 ALA A N   1 
ATOM   3188 C CA  . ALA A 1 416 ? -0.805  43.041 50.923 1.00 14.32 ? 416 ALA A CA  1 
ATOM   3189 C C   . ALA A 1 416 ? 0.470   42.231 50.828 1.00 13.30 ? 416 ALA A C   1 
ATOM   3190 O O   . ALA A 1 416 ? 0.417   40.997 50.810 1.00 14.80 ? 416 ALA A O   1 
ATOM   3191 C CB  . ALA A 1 416 ? -0.962  43.591 52.422 1.00 12.39 ? 416 ALA A CB  1 
ATOM   3192 N N   . GLY A 1 417 ? 1.602   42.924 50.813 1.00 11.77 ? 417 GLY A N   1 
ATOM   3193 C CA  . GLY A 1 417 ? 2.885   42.248 50.796 1.00 11.94 ? 417 GLY A CA  1 
ATOM   3194 C C   . GLY A 1 417 ? 3.759   42.391 49.575 1.00 11.74 ? 417 GLY A C   1 
ATOM   3195 O O   . GLY A 1 417 ? 3.277   42.477 48.442 1.00 13.86 ? 417 GLY A O   1 
ATOM   3196 N N   . SER A 1 418 ? 5.059   42.354 49.804 1.00 10.48 ? 418 SER A N   1 
ATOM   3197 C CA  . SER A 1 418 ? 6.009   42.494 48.723 1.00 10.98 ? 418 SER A CA  1 
ATOM   3198 C C   . SER A 1 418 ? 5.875   41.397 47.693 1.00 12.85 ? 418 SER A C   1 
ATOM   3199 O O   . SER A 1 418 ? 6.410   41.523 46.605 1.00 15.46 ? 418 SER A O   1 
ATOM   3200 C CB  . SER A 1 418 ? 7.414   42.417 49.258 1.00 8.93  ? 418 SER A CB  1 
ATOM   3201 O OG  . SER A 1 418 ? 7.672   41.143 49.770 1.00 7.67  ? 418 SER A OG  1 
ATOM   3202 N N   . HIS A 1 419 ? 5.270   40.267 48.063 1.00 12.75 ? 419 HIS A N   1 
ATOM   3203 C CA  . HIS A 1 419 ? 5.133   39.160 47.131 1.00 11.52 ? 419 HIS A CA  1 
ATOM   3204 C C   . HIS A 1 419 ? 3.734   38.957 46.607 1.00 12.89 ? 419 HIS A C   1 
ATOM   3205 O O   . HIS A 1 419 ? 3.506   38.038 45.850 1.00 15.04 ? 419 HIS A O   1 
ATOM   3206 C CB  . HIS A 1 419 ? 5.642   37.862 47.765 1.00 9.96  ? 419 HIS A CB  1 
ATOM   3207 C CG  . HIS A 1 419 ? 7.122   37.826 47.954 1.00 8.88  ? 419 HIS A CG  1 
ATOM   3208 N ND1 . HIS A 1 419 ? 7.844   38.916 48.396 1.00 8.15  ? 419 HIS A ND1 1 
ATOM   3209 C CD2 . HIS A 1 419 ? 8.029   36.841 47.740 1.00 8.41  ? 419 HIS A CD2 1 
ATOM   3210 C CE1 . HIS A 1 419 ? 9.127   38.610 48.447 1.00 6.75  ? 419 HIS A CE1 1 
ATOM   3211 N NE2 . HIS A 1 419 ? 9.264   37.356 48.054 1.00 7.79  ? 419 HIS A NE2 1 
ATOM   3212 N N   . ALA A 1 420 ? 2.797   39.804 47.012 1.00 15.12 ? 420 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 420 ? 1.405   39.706 46.580 1.00 14.95 ? 420 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 420 ? 1.210   39.956 45.089 1.00 15.59 ? 420 ALA A C   1 
ATOM   3215 O O   . ALA A 1 420 ? 0.283   39.398 44.486 1.00 17.24 ? 420 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 420 ? 0.534   40.673 47.383 1.00 14.45 ? 420 ALA A CB  1 
ATOM   3217 N N   . ASP A 1 421 ? 2.003   40.854 44.511 1.00 13.79 ? 421 ASP A N   1 
ATOM   3218 C CA  . ASP A 1 421 ? 1.853   41.139 43.091 1.00 12.67 ? 421 ASP A CA  1 
ATOM   3219 C C   . ASP A 1 421 ? 3.202   41.252 42.408 1.00 12.85 ? 421 ASP A C   1 
ATOM   3220 O O   . ASP A 1 421 ? 3.464   42.216 41.726 1.00 15.07 ? 421 ASP A O   1 
ATOM   3221 C CB  . ASP A 1 421 ? 1.054   42.422 42.917 1.00 11.47 ? 421 ASP A CB  1 
ATOM   3222 C CG  . ASP A 1 421 ? 0.765   42.737 41.474 1.00 11.50 ? 421 ASP A CG  1 
ATOM   3223 O OD1 . ASP A 1 421 ? 0.519   41.806 40.687 1.00 12.06 ? 421 ASP A OD1 1 
ATOM   3224 O OD2 . ASP A 1 421 ? 0.775   43.931 41.113 1.00 13.46 ? 421 ASP A OD2 1 
ATOM   3225 N N   . ASN A 1 422 ? 4.032   40.231 42.528 1.00 11.58 ? 422 ASN A N   1 
ATOM   3226 C CA  . ASN A 1 422 ? 5.362   40.276 41.953 1.00 10.23 ? 422 ASN A CA  1 
ATOM   3227 C C   . ASN A 1 422 ? 5.696   38.930 41.366 1.00 11.20 ? 422 ASN A C   1 
ATOM   3228 O O   . ASN A 1 422 ? 6.175   38.025 42.094 1.00 11.22 ? 422 ASN A O   1 
ATOM   3229 C CB  . ASN A 1 422 ? 6.358   40.599 43.058 1.00 9.86  ? 422 ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 422 ? 7.687   40.969 42.534 1.00 9.72  ? 422 ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 422 ? 8.170   40.406 41.545 1.00 9.91  ? 422 ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 422 ? 8.310   41.923 43.184 1.00 8.53  ? 422 ASN A ND2 1 
ATOM   3233 N N   . LEU A 1 423 ? 5.495   38.838 40.042 1.00 12.08 ? 423 LEU A N   1 
ATOM   3234 C CA  . LEU A 1 423 ? 5.693   37.612 39.228 1.00 11.30 ? 423 LEU A CA  1 
ATOM   3235 C C   . LEU A 1 423 ? 7.087   37.026 39.296 1.00 11.64 ? 423 LEU A C   1 
ATOM   3236 O O   . LEU A 1 423 ? 7.259   35.793 39.346 1.00 11.59 ? 423 LEU A O   1 
ATOM   3237 C CB  . LEU A 1 423 ? 5.313   37.849 37.747 1.00 9.07  ? 423 LEU A CB  1 
ATOM   3238 C CG  . LEU A 1 423 ? 5.045   36.640 36.838 1.00 5.70  ? 423 LEU A CG  1 
ATOM   3239 C CD1 . LEU A 1 423 ? 4.201   35.646 37.550 1.00 5.35  ? 423 LEU A CD1 1 
ATOM   3240 C CD2 . LEU A 1 423 ? 4.356   37.130 35.652 1.00 4.55  ? 423 LEU A CD2 1 
ATOM   3241 N N   . GLY A 1 424 ? 8.081   37.909 39.279 1.00 12.27 ? 424 GLY A N   1 
ATOM   3242 C CA  . GLY A 1 424 ? 9.463   37.459 39.342 1.00 12.85 ? 424 GLY A CA  1 
ATOM   3243 C C   . GLY A 1 424 ? 9.770   36.869 40.695 1.00 12.47 ? 424 GLY A C   1 
ATOM   3244 O O   . GLY A 1 424 ? 10.495  35.897 40.802 1.00 14.04 ? 424 GLY A O   1 
ATOM   3245 N N   . TYR A 1 425 ? 9.260   37.486 41.752 1.00 12.98 ? 425 TYR A N   1 
ATOM   3246 C CA  . TYR A 1 425 ? 9.501   36.959 43.097 1.00 14.59 ? 425 TYR A CA  1 
ATOM   3247 C C   . TYR A 1 425 ? 8.873   35.541 43.206 1.00 14.51 ? 425 TYR A C   1 
ATOM   3248 O O   . TYR A 1 425 ? 9.486   34.565 43.678 1.00 15.09 ? 425 TYR A O   1 
ATOM   3249 C CB  . TYR A 1 425 ? 8.883   37.906 44.140 1.00 14.28 ? 425 TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 425 ? 9.764   39.061 44.532 1.00 15.05 ? 425 TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 425 ? 9.369   39.930 45.539 1.00 14.86 ? 425 TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 425 ? 10.982  39.304 43.880 1.00 14.24 ? 425 TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 425 ? 10.144  41.013 45.897 1.00 14.88 ? 425 TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 425 ? 11.763  40.378 44.226 1.00 14.95 ? 425 TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 425 ? 11.342  41.242 45.243 1.00 15.46 ? 425 TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 425 ? 12.111  42.347 45.607 1.00 16.54 ? 425 TYR A OH  1 
ATOM   3257 N N   . GLN A 1 426 ? 7.627   35.471 42.762 1.00 12.55 ? 426 GLN A N   1 
ATOM   3258 C CA  . GLN A 1 426 ? 6.824   34.272 42.751 1.00 10.49 ? 426 GLN A CA  1 
ATOM   3259 C C   . GLN A 1 426 ? 7.489   33.116 42.033 1.00 10.82 ? 426 GLN A C   1 
ATOM   3260 O O   . GLN A 1 426 ? 7.223   31.966 42.369 1.00 13.27 ? 426 GLN A O   1 
ATOM   3261 C CB  . GLN A 1 426 ? 5.521   34.628 42.039 1.00 10.41 ? 426 GLN A CB  1 
ATOM   3262 C CG  . GLN A 1 426 ? 4.532   33.536 41.840 1.00 6.95  ? 426 GLN A CG  1 
ATOM   3263 C CD  . GLN A 1 426 ? 3.248   34.047 41.223 1.00 5.82  ? 426 GLN A CD  1 
ATOM   3264 O OE1 . GLN A 1 426 ? 2.744   35.089 41.612 1.00 2.19  ? 426 GLN A OE1 1 
ATOM   3265 N NE2 . GLN A 1 426 ? 2.673   33.267 40.314 1.00 3.94  ? 426 GLN A NE2 1 
ATOM   3266 N N   . CYS A 1 427 ? 8.326   33.422 41.045 1.00 9.76  ? 427 CYS A N   1 
ATOM   3267 C CA  . CYS A 1 427 ? 8.991   32.409 40.229 1.00 9.37  ? 427 CYS A CA  1 
ATOM   3268 C C   . CYS A 1 427 ? 10.366  32.068 40.729 1.00 11.07 ? 427 CYS A C   1 
ATOM   3269 O O   . CYS A 1 427 ? 10.863  30.981 40.485 1.00 12.30 ? 427 CYS A O   1 
ATOM   3270 C CB  . CYS A 1 427 ? 9.154   32.909 38.799 1.00 10.44 ? 427 CYS A CB  1 
ATOM   3271 S SG  . CYS A 1 427 ? 7.687   33.120 37.816 1.00 6.07  ? 427 CYS A SG  1 
ATOM   3272 N N   . GLY A 1 428 ? 11.038  33.025 41.339 1.00 11.19 ? 428 GLY A N   1 
ATOM   3273 C CA  . GLY A 1 428 ? 12.342  32.692 41.862 1.00 11.79 ? 428 GLY A CA  1 
ATOM   3274 C C   . GLY A 1 428 ? 13.430  32.611 40.834 1.00 11.99 ? 428 GLY A C   1 
ATOM   3275 O O   . GLY A 1 428 ? 13.229  33.037 39.709 1.00 12.47 ? 428 GLY A O   1 
ATOM   3276 N N   . GLY A 1 429 ? 14.576  32.055 41.226 1.00 12.31 ? 429 GLY A N   1 
ATOM   3277 C CA  . GLY A 1 429 ? 15.723  31.947 40.345 1.00 12.85 ? 429 GLY A CA  1 
ATOM   3278 C C   . GLY A 1 429 ? 15.423  31.061 39.159 1.00 13.70 ? 429 GLY A C   1 
ATOM   3279 O O   . GLY A 1 429 ? 14.480  30.282 39.179 1.00 14.15 ? 429 GLY A O   1 
ATOM   3280 N N   . TRP A 1 430 ? 16.289  31.122 38.154 1.00 14.10 ? 430 TRP A N   1 
ATOM   3281 C CA  . TRP A 1 430 ? 16.140  30.334 36.930 1.00 13.35 ? 430 TRP A CA  1 
ATOM   3282 C C   . TRP A 1 430 ? 14.816  30.726 36.270 1.00 12.51 ? 430 TRP A C   1 
ATOM   3283 O O   . TRP A 1 430 ? 13.906  29.923 36.115 1.00 14.99 ? 430 TRP A O   1 
ATOM   3284 C CB  . TRP A 1 430 ? 16.238  28.824 37.225 1.00 12.06 ? 430 TRP A CB  1 
ATOM   3285 C CG  . TRP A 1 430 ? 17.682  28.320 37.542 1.00 12.04 ? 430 TRP A CG  1 
ATOM   3286 C CD1 . TRP A 1 430 ? 18.111  27.688 38.696 1.00 11.25 ? 430 TRP A CD1 1 
ATOM   3287 C CD2 . TRP A 1 430 ? 18.836  28.365 36.682 1.00 10.32 ? 430 TRP A CD2 1 
ATOM   3288 N NE1 . TRP A 1 430 ? 19.416  27.348 38.599 1.00 8.91  ? 430 TRP A NE1 1 
ATOM   3289 C CE2 . TRP A 1 430 ? 19.897  27.751 37.388 1.00 9.77  ? 430 TRP A CE2 1 
ATOM   3290 C CE3 . TRP A 1 430 ? 19.074  28.886 35.395 1.00 9.15  ? 430 TRP A CE3 1 
ATOM   3291 C CZ2 . TRP A 1 430 ? 21.192  27.625 36.838 1.00 9.16  ? 430 TRP A CZ2 1 
ATOM   3292 C CZ3 . TRP A 1 430 ? 20.374  28.754 34.850 1.00 7.25  ? 430 TRP A CZ3 1 
ATOM   3293 C CH2 . TRP A 1 430 ? 21.406  28.138 35.576 1.00 7.71  ? 430 TRP A CH2 1 
ATOM   3294 N N   . THR A 1 431 ? 14.728  31.979 35.875 1.00 10.76 ? 431 THR A N   1 
ATOM   3295 C CA  . THR A 1 431 ? 13.537  32.474 35.256 1.00 10.43 ? 431 THR A CA  1 
ATOM   3296 C C   . THR A 1 431 ? 13.883  33.706 34.468 1.00 10.02 ? 431 THR A C   1 
ATOM   3297 O O   . THR A 1 431 ? 14.134  34.766 35.051 1.00 11.12 ? 431 THR A O   1 
ATOM   3298 C CB  . THR A 1 431 ? 12.533  32.860 36.313 1.00 11.01 ? 431 THR A CB  1 
ATOM   3299 O OG1 . THR A 1 431 ? 12.293  31.734 37.188 1.00 10.67 ? 431 THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 431 ? 11.217  33.329 35.631 1.00 11.32 ? 431 THR A CG2 1 
ATOM   3301 N N   . ILE A 1 432 ? 13.878  33.594 33.139 1.00 9.35  ? 432 ILE A N   1 
ATOM   3302 C CA  . ILE A 1 432 ? 14.203  34.745 32.275 1.00 8.31  ? 432 ILE A CA  1 
ATOM   3303 C C   . ILE A 1 432 ? 15.715  35.140 32.516 1.00 9.15  ? 432 ILE A C   1 
ATOM   3304 O O   . ILE A 1 432 ? 16.551  35.046 31.608 1.00 6.80  ? 432 ILE A O   1 
ATOM   3305 C CB  . ILE A 1 432 ? 13.166  35.959 32.529 1.00 7.03  ? 432 ILE A CB  1 
ATOM   3306 C CG1 . ILE A 1 432 ? 11.713  35.510 32.349 1.00 6.52  ? 432 ILE A CG1 1 
ATOM   3307 C CG2 . ILE A 1 432 ? 13.388  37.098 31.622 1.00 5.88  ? 432 ILE A CG2 1 
ATOM   3308 C CD1 . ILE A 1 432 ? 11.417  34.676 31.150 1.00 6.47  ? 432 ILE A CD1 1 
ATOM   3309 N N   . GLU A 1 433 ? 16.056  35.628 33.704 1.00 9.75  ? 433 GLU A N   1 
ATOM   3310 C CA  . GLU A 1 433 ? 17.450  35.936 33.962 1.00 11.85 ? 433 GLU A CA  1 
ATOM   3311 C C   . GLU A 1 433 ? 17.995  34.711 34.666 1.00 12.13 ? 433 GLU A C   1 
ATOM   3312 O O   . GLU A 1 433 ? 17.211  33.834 35.054 1.00 11.72 ? 433 GLU A O   1 
ATOM   3313 C CB  . GLU A 1 433 ? 17.578  37.161 34.857 1.00 14.68 ? 433 GLU A CB  1 
ATOM   3314 C CG  . GLU A 1 433 ? 17.065  38.462 34.209 1.00 18.94 ? 433 GLU A CG  1 
ATOM   3315 C CD  . GLU A 1 433 ? 17.817  38.840 32.898 1.00 21.39 ? 433 GLU A CD  1 
ATOM   3316 O OE1 . GLU A 1 433 ? 18.795  38.132 32.562 1.00 23.28 ? 433 GLU A OE1 1 
ATOM   3317 O OE2 . GLU A 1 433 ? 17.438  39.832 32.201 1.00 21.72 ? 433 GLU A OE2 1 
ATOM   3318 N N   . TRP A 1 434 ? 19.316  34.612 34.790 1.00 10.03 ? 434 TRP A N   1 
ATOM   3319 C CA  . TRP A 1 434 ? 19.924  33.480 35.492 1.00 8.73  ? 434 TRP A CA  1 
ATOM   3320 C C   . TRP A 1 434 ? 19.449  33.513 36.966 1.00 8.93  ? 434 TRP A C   1 
ATOM   3321 O O   . TRP A 1 434 ? 18.884  32.544 37.501 1.00 6.02  ? 434 TRP A O   1 
ATOM   3322 C CB  . TRP A 1 434 ? 21.457  33.625 35.463 1.00 7.89  ? 434 TRP A CB  1 
ATOM   3323 C CG  . TRP A 1 434 ? 22.213  32.710 36.398 1.00 6.44  ? 434 TRP A CG  1 
ATOM   3324 C CD1 . TRP A 1 434 ? 21.982  31.384 36.614 1.00 6.39  ? 434 TRP A CD1 1 
ATOM   3325 C CD2 . TRP A 1 434 ? 23.367  33.038 37.153 1.00 5.04  ? 434 TRP A CD2 1 
ATOM   3326 N NE1 . TRP A 1 434 ? 22.947  30.855 37.430 1.00 5.82  ? 434 TRP A NE1 1 
ATOM   3327 C CE2 . TRP A 1 434 ? 23.827  31.855 37.765 1.00 4.89  ? 434 TRP A CE2 1 
ATOM   3328 C CE3 . TRP A 1 434 ? 24.103  34.204 37.329 1.00 3.40  ? 434 TRP A CE3 1 
ATOM   3329 C CZ2 . TRP A 1 434 ? 24.941  31.818 38.573 1.00 3.90  ? 434 TRP A CZ2 1 
ATOM   3330 C CZ3 . TRP A 1 434 ? 25.199  34.173 38.120 1.00 2.00  ? 434 TRP A CZ3 1 
ATOM   3331 C CH2 . TRP A 1 434 ? 25.628  32.993 38.716 1.00 3.28  ? 434 TRP A CH2 1 
ATOM   3332 N N   . GLN A 1 435 ? 19.689  34.649 37.603 1.00 8.15  ? 435 GLN A N   1 
ATOM   3333 C CA  . GLN A 1 435 ? 19.316  34.851 38.995 1.00 9.70  ? 435 GLN A CA  1 
ATOM   3334 C C   . GLN A 1 435 ? 17.813  35.154 39.231 1.00 10.81 ? 435 GLN A C   1 
ATOM   3335 O O   . GLN A 1 435 ? 17.389  35.457 40.354 1.00 11.22 ? 435 GLN A O   1 
ATOM   3336 C CB  . GLN A 1 435 ? 20.146  36.012 39.553 1.00 9.34  ? 435 GLN A CB  1 
ATOM   3337 C CG  . GLN A 1 435 ? 21.639  35.814 39.589 1.00 8.36  ? 435 GLN A CG  1 
ATOM   3338 C CD  . GLN A 1 435 ? 22.028  34.725 40.526 1.00 10.33 ? 435 GLN A CD  1 
ATOM   3339 O OE1 . GLN A 1 435 ? 21.643  34.760 41.710 1.00 11.46 ? 435 GLN A OE1 1 
ATOM   3340 N NE2 . GLN A 1 435 ? 22.795  33.740 40.029 1.00 8.38  ? 435 GLN A NE2 1 
ATOM   3341 N N   . GLY A 1 436 ? 17.006  35.072 38.188 1.00 10.91 ? 436 GLY A N   1 
ATOM   3342 C CA  . GLY A 1 436 ? 15.622  35.414 38.368 1.00 11.06 ? 436 GLY A CA  1 
ATOM   3343 C C   . GLY A 1 436 ? 15.601  36.926 38.297 1.00 11.75 ? 436 GLY A C   1 
ATOM   3344 O O   . GLY A 1 436 ? 16.614  37.526 37.924 1.00 12.52 ? 436 GLY A O   1 
ATOM   3345 N N   . ASP A 1 437 ? 14.488  37.555 38.650 1.00 11.48 ? 437 ASP A N   1 
ATOM   3346 C CA  . ASP A 1 437 ? 14.393  38.990 38.574 1.00 12.44 ? 437 ASP A CA  1 
ATOM   3347 C C   . ASP A 1 437 ? 13.147  39.419 39.268 1.00 12.97 ? 437 ASP A C   1 
ATOM   3348 O O   . ASP A 1 437 ? 12.355  38.600 39.674 1.00 14.49 ? 437 ASP A O   1 
ATOM   3349 C CB  . ASP A 1 437 ? 14.233  39.381 37.144 1.00 15.34 ? 437 ASP A CB  1 
ATOM   3350 C CG  . ASP A 1 437 ? 14.518  40.811 36.913 1.00 16.56 ? 437 ASP A CG  1 
ATOM   3351 O OD1 . ASP A 1 437 ? 14.845  41.521 37.889 1.00 18.88 ? 437 ASP A OD1 1 
ATOM   3352 O OD2 . ASP A 1 437 ? 14.460  41.193 35.731 1.00 18.63 ? 437 ASP A OD2 1 
ATOM   3353 N N   . THR A 1 438 ? 12.910  40.710 39.315 1.00 12.35 ? 438 THR A N   1 
ATOM   3354 C CA  . THR A 1 438 ? 11.733  41.194 39.981 1.00 13.38 ? 438 THR A CA  1 
ATOM   3355 C C   . THR A 1 438 ? 10.678  41.704 39.010 1.00 13.99 ? 438 THR A C   1 
ATOM   3356 O O   . THR A 1 438 ? 11.000  42.035 37.883 1.00 17.04 ? 438 THR A O   1 
ATOM   3357 C CB  . THR A 1 438 ? 12.153  42.315 40.898 1.00 12.40 ? 438 THR A CB  1 
ATOM   3358 O OG1 . THR A 1 438 ? 11.003  42.866 41.552 1.00 13.20 ? 438 THR A OG1 1 
ATOM   3359 C CG2 . THR A 1 438 ? 12.849  43.367 40.100 1.00 9.78  ? 438 THR A CG2 1 
ATOM   3360 N N   . GLY A 1 439 ? 9.430   41.791 39.440 1.00 14.45 ? 439 GLY A N   1 
ATOM   3361 C CA  . GLY A 1 439 ? 8.424   42.343 38.556 1.00 15.52 ? 439 GLY A CA  1 
ATOM   3362 C C   . GLY A 1 439 ? 7.856   41.453 37.485 1.00 16.47 ? 439 GLY A C   1 
ATOM   3363 O O   . GLY A 1 439 ? 8.096   40.257 37.508 1.00 17.78 ? 439 GLY A O   1 
ATOM   3364 N N   . ARG A 1 440 ? 7.132   42.056 36.541 1.00 17.72 ? 440 ARG A N   1 
ATOM   3365 C CA  . ARG A 1 440 ? 6.461   41.340 35.458 1.00 19.24 ? 440 ARG A CA  1 
ATOM   3366 C C   . ARG A 1 440 ? 7.362   41.034 34.287 1.00 18.53 ? 440 ARG A C   1 
ATOM   3367 O O   . ARG A 1 440 ? 7.264   41.652 33.211 1.00 18.97 ? 440 ARG A O   1 
ATOM   3368 C CB  . ARG A 1 440 ? 5.225   42.109 35.019 1.00 20.96 ? 440 ARG A CB  1 
ATOM   3369 C CG  . ARG A 1 440 ? 4.412   41.444 33.985 1.00 25.49 ? 440 ARG A CG  1 
ATOM   3370 C CD  . ARG A 1 440 ? 2.902   41.662 34.238 1.00 31.09 ? 440 ARG A CD  1 
ATOM   3371 N NE  . ARG A 1 440 ? 2.273   40.416 34.718 1.00 35.30 ? 440 ARG A NE  1 
ATOM   3372 C CZ  . ARG A 1 440 ? 1.675   40.253 35.900 1.00 36.47 ? 440 ARG A CZ  1 
ATOM   3373 N NH1 . ARG A 1 440 ? 1.582   41.273 36.774 1.00 37.24 ? 440 ARG A NH1 1 
ATOM   3374 N NH2 . ARG A 1 440 ? 1.252   39.037 36.238 1.00 36.90 ? 440 ARG A NH2 1 
ATOM   3375 N N   . THR A 1 441 ? 8.176   40.002 34.513 1.00 17.35 ? 441 THR A N   1 
ATOM   3376 C CA  . THR A 1 441 ? 9.187   39.489 33.597 1.00 13.93 ? 441 THR A CA  1 
ATOM   3377 C C   . THR A 1 441 ? 8.695   38.556 32.544 1.00 12.39 ? 441 THR A C   1 
ATOM   3378 O O   . THR A 1 441 ? 9.458   38.234 31.641 1.00 12.94 ? 441 THR A O   1 
ATOM   3379 C CB  . THR A 1 441 ? 10.264  38.694 34.346 1.00 14.29 ? 441 THR A CB  1 
ATOM   3380 O OG1 . THR A 1 441 ? 9.636   37.698 35.180 1.00 14.08 ? 441 THR A OG1 1 
ATOM   3381 C CG2 . THR A 1 441 ? 11.131  39.627 35.182 1.00 13.82 ? 441 THR A CG2 1 
ATOM   3382 N N   . THR A 1 442 ? 7.461   38.079 32.669 1.00 10.61 ? 442 THR A N   1 
ATOM   3383 C CA  . THR A 1 442 ? 6.941   37.130 31.686 1.00 9.95  ? 442 THR A CA  1 
ATOM   3384 C C   . THR A 1 442 ? 5.423   36.967 31.807 1.00 10.01 ? 442 THR A C   1 
ATOM   3385 O O   . THR A 1 442 ? 4.801   37.775 32.478 1.00 13.15 ? 442 THR A O   1 
ATOM   3386 C CB  . THR A 1 442 ? 7.692   35.776 31.786 1.00 8.65  ? 442 THR A CB  1 
ATOM   3387 O OG1 . THR A 1 442 ? 7.341   34.992 30.659 1.00 10.71 ? 442 THR A OG1 1 
ATOM   3388 C CG2 . THR A 1 442 ? 7.372   35.021 33.051 1.00 8.45  ? 442 THR A CG2 1 
ATOM   3389 N N   . VAL A 1 443 ? 4.805   36.020 31.110 1.00 7.95  ? 443 VAL A N   1 
ATOM   3390 C CA  . VAL A 1 443 ? 3.356   35.816 31.200 1.00 6.36  ? 443 VAL A CA  1 
ATOM   3391 C C   . VAL A 1 443 ? 2.917   34.960 32.448 1.00 9.33  ? 443 VAL A C   1 
ATOM   3392 O O   . VAL A 1 443 ? 3.486   33.898 32.744 1.00 10.56 ? 443 VAL A O   1 
ATOM   3393 C CB  . VAL A 1 443 ? 2.848   35.189 29.866 1.00 4.12  ? 443 VAL A CB  1 
ATOM   3394 C CG1 . VAL A 1 443 ? 1.373   34.916 29.903 1.00 2.55  ? 443 VAL A CG1 1 
ATOM   3395 C CG2 . VAL A 1 443 ? 3.179   36.078 28.731 1.00 2.07  ? 443 VAL A CG2 1 
ATOM   3396 N N   . GLY A 1 444 ? 1.924   35.449 33.194 1.00 10.07 ? 444 GLY A N   1 
ATOM   3397 C CA  . GLY A 1 444 ? 1.456   34.743 34.378 1.00 10.75 ? 444 GLY A CA  1 
ATOM   3398 C C   . GLY A 1 444 ? 0.473   35.517 35.270 1.00 13.03 ? 444 GLY A C   1 
ATOM   3399 O O   . GLY A 1 444 ? 0.041   36.651 34.951 1.00 13.91 ? 444 GLY A O   1 
ATOM   3400 N N   . THR A 1 445 ? 0.187   34.958 36.443 1.00 11.84 ? 445 THR A N   1 
ATOM   3401 C CA  . THR A 1 445 ? -0.789  35.557 37.345 1.00 10.03 ? 445 THR A CA  1 
ATOM   3402 C C   . THR A 1 445 ? -0.210  35.643 38.717 1.00 9.36  ? 445 THR A C   1 
ATOM   3403 O O   . THR A 1 445 ? 0.173   34.626 39.254 1.00 9.89  ? 445 THR A O   1 
ATOM   3404 C CB  . THR A 1 445 ? -2.082  34.696 37.433 1.00 9.15  ? 445 THR A CB  1 
ATOM   3405 O OG1 . THR A 1 445 ? -2.566  34.497 36.126 1.00 8.71  ? 445 THR A OG1 1 
ATOM   3406 C CG2 . THR A 1 445 ? -3.189  35.386 38.175 1.00 8.10  ? 445 THR A CG2 1 
ATOM   3407 N N   . THR A 1 446 ? -0.195  36.847 39.287 1.00 7.46  ? 446 THR A N   1 
ATOM   3408 C CA  . THR A 1 446 ? 0.344   37.074 40.601 1.00 7.40  ? 446 THR A CA  1 
ATOM   3409 C C   . THR A 1 446 ? -0.724  36.710 41.600 1.00 8.84  ? 446 THR A C   1 
ATOM   3410 O O   . THR A 1 446 ? -1.870  36.422 41.209 1.00 8.38  ? 446 THR A O   1 
ATOM   3411 C CB  . THR A 1 446 ? 0.722   38.524 40.776 1.00 6.61  ? 446 THR A CB  1 
ATOM   3412 O OG1 . THR A 1 446 ? -0.451  39.317 40.657 1.00 8.82  ? 446 THR A OG1 1 
ATOM   3413 C CG2 . THR A 1 446 ? 1.634   38.953 39.676 1.00 6.40  ? 446 THR A CG2 1 
ATOM   3414 N N   . ILE A 1 447 ? -0.356  36.656 42.887 1.00 10.36 ? 447 ILE A N   1 
ATOM   3415 C CA  . ILE A 1 447 ? -1.334  36.342 43.923 1.00 10.83 ? 447 ILE A CA  1 
ATOM   3416 C C   . ILE A 1 447 ? -2.448  37.413 43.953 1.00 12.55 ? 447 ILE A C   1 
ATOM   3417 O O   . ILE A 1 447 ? -3.584  37.117 44.333 1.00 14.88 ? 447 ILE A O   1 
ATOM   3418 C CB  . ILE A 1 447 ? -0.695  36.146 45.295 1.00 10.27 ? 447 ILE A CB  1 
ATOM   3419 C CG1 . ILE A 1 447 ? 0.156   34.857 45.295 1.00 11.39 ? 447 ILE A CG1 1 
ATOM   3420 C CG2 . ILE A 1 447 ? -1.787  36.067 46.369 1.00 8.65  ? 447 ILE A CG2 1 
ATOM   3421 C CD1 . ILE A 1 447 ? 1.477   34.892 46.187 1.00 9.87  ? 447 ILE A CD1 1 
ATOM   3422 N N   . LEU A 1 448 ? -2.136  38.651 43.568 1.00 12.12 ? 448 LEU A N   1 
ATOM   3423 C CA  . LEU A 1 448 ? -3.166  39.686 43.499 1.00 11.18 ? 448 LEU A CA  1 
ATOM   3424 C C   . LEU A 1 448 ? -4.164  39.379 42.325 1.00 11.51 ? 448 LEU A C   1 
ATOM   3425 O O   . LEU A 1 448 ? -5.385  39.264 42.536 1.00 11.67 ? 448 LEU A O   1 
ATOM   3426 C CB  . LEU A 1 448 ? -2.526  41.071 43.352 1.00 7.48  ? 448 LEU A CB  1 
ATOM   3427 C CG  . LEU A 1 448 ? -3.516  42.230 43.385 1.00 5.18  ? 448 LEU A CG  1 
ATOM   3428 C CD1 . LEU A 1 448 ? -4.578  42.068 44.428 1.00 3.42  ? 448 LEU A CD1 1 
ATOM   3429 C CD2 . LEU A 1 448 ? -2.740  43.440 43.641 1.00 5.57  ? 448 LEU A CD2 1 
ATOM   3430 N N   . GLU A 1 449 ? -3.642  39.246 41.109 1.00 11.51 ? 449 GLU A N   1 
ATOM   3431 C CA  . GLU A 1 449 ? -4.456  38.932 39.946 1.00 13.69 ? 449 GLU A CA  1 
ATOM   3432 C C   . GLU A 1 449 ? -5.344  37.683 40.191 1.00 14.03 ? 449 GLU A C   1 
ATOM   3433 O O   . GLU A 1 449 ? -6.562  37.673 39.921 1.00 13.59 ? 449 GLU A O   1 
ATOM   3434 C CB  . GLU A 1 449 ? -3.539  38.664 38.784 1.00 15.46 ? 449 GLU A CB  1 
ATOM   3435 C CG  . GLU A 1 449 ? -2.695  39.814 38.385 1.00 18.75 ? 449 GLU A CG  1 
ATOM   3436 C CD  . GLU A 1 449 ? -1.615  39.421 37.376 1.00 22.16 ? 449 GLU A CD  1 
ATOM   3437 O OE1 . GLU A 1 449 ? -0.909  38.412 37.538 1.00 23.47 ? 449 GLU A OE1 1 
ATOM   3438 O OE2 . GLU A 1 449 ? -1.427  40.152 36.400 1.00 25.95 ? 449 GLU A OE2 1 
ATOM   3439 N N   . ALA A 1 450 ? -4.716  36.639 40.714 1.00 12.41 ? 450 ALA A N   1 
ATOM   3440 C CA  . ALA A 1 450 ? -5.403  35.398 41.046 1.00 10.95 ? 450 ALA A CA  1 
ATOM   3441 C C   . ALA A 1 450 ? -6.558  35.649 42.081 1.00 10.02 ? 450 ALA A C   1 
ATOM   3442 O O   . ALA A 1 450 ? -7.621  35.026 42.036 1.00 7.19  ? 450 ALA A O   1 
ATOM   3443 C CB  . ALA A 1 450 ? -4.355  34.411 41.602 1.00 10.40 ? 450 ALA A CB  1 
ATOM   3444 N N   . VAL A 1 451 ? -6.328  36.563 43.018 1.00 9.70  ? 451 VAL A N   1 
ATOM   3445 C CA  . VAL A 1 451 ? -7.324  36.881 44.028 1.00 8.77  ? 451 VAL A CA  1 
ATOM   3446 C C   . VAL A 1 451 ? -8.504  37.573 43.357 1.00 10.46 ? 451 VAL A C   1 
ATOM   3447 O O   . VAL A 1 451 ? -9.686  37.250 43.652 1.00 10.51 ? 451 VAL A O   1 
ATOM   3448 C CB  . VAL A 1 451 ? -6.734  37.752 45.140 1.00 7.20  ? 451 VAL A CB  1 
ATOM   3449 C CG1 . VAL A 1 451 ? -7.789  38.346 45.946 1.00 6.83  ? 451 VAL A CG1 1 
ATOM   3450 C CG2 . VAL A 1 451 ? -5.892  36.922 46.055 1.00 8.93  ? 451 VAL A CG2 1 
ATOM   3451 N N   . LYS A 1 452 ? -8.196  38.553 42.494 1.00 9.99  ? 452 LYS A N   1 
ATOM   3452 C CA  . LYS A 1 452 ? -9.241  39.268 41.757 1.00 9.06  ? 452 LYS A CA  1 
ATOM   3453 C C   . LYS A 1 452 ? -9.988  38.333 40.807 1.00 9.06  ? 452 LYS A C   1 
ATOM   3454 O O   . LYS A 1 452 ? -11.171 38.482 40.569 1.00 8.34  ? 452 LYS A O   1 
ATOM   3455 C CB  . LYS A 1 452 ? -8.645  40.394 40.982 1.00 7.54  ? 452 LYS A CB  1 
ATOM   3456 C CG  . LYS A 1 452 ? -8.111  41.438 41.838 1.00 9.54  ? 452 LYS A CG  1 
ATOM   3457 C CD  . LYS A 1 452 ? -7.157  42.215 40.993 1.00 12.89 ? 452 LYS A CD  1 
ATOM   3458 C CE  . LYS A 1 452 ? -7.440  43.690 40.999 1.00 15.21 ? 452 LYS A CE  1 
ATOM   3459 N NZ  . LYS A 1 452 ? -6.237  44.486 40.472 1.00 19.63 ? 452 LYS A NZ  1 
ATOM   3460 N N   . ALA A 1 453 ? -9.282  37.333 40.302 1.00 9.84  ? 453 ALA A N   1 
ATOM   3461 C CA  . ALA A 1 453 ? -9.860  36.373 39.395 1.00 8.55  ? 453 ALA A CA  1 
ATOM   3462 C C   . ALA A 1 453 ? -10.753 35.427 40.155 1.00 9.30  ? 453 ALA A C   1 
ATOM   3463 O O   . ALA A 1 453 ? -11.682 34.914 39.589 1.00 11.50 ? 453 ALA A O   1 
ATOM   3464 C CB  . ALA A 1 453 ? -8.764  35.603 38.713 1.00 7.16  ? 453 ALA A CB  1 
ATOM   3465 N N   . ALA A 1 454 ? -10.554 35.313 41.458 1.00 9.88  ? 454 ALA A N   1 
ATOM   3466 C CA  . ALA A 1 454 ? -11.316 34.382 42.278 1.00 11.47 ? 454 ALA A CA  1 
ATOM   3467 C C   . ALA A 1 454 ? -12.576 34.870 42.989 1.00 13.34 ? 454 ALA A C   1 
ATOM   3468 O O   . ALA A 1 454 ? -13.542 34.141 43.209 1.00 15.45 ? 454 ALA A O   1 
ATOM   3469 C CB  . ALA A 1 454 ? -10.382 33.807 43.344 1.00 10.68 ? 454 ALA A CB  1 
ATOM   3470 N N   . VAL A 1 455 ? -12.511 36.069 43.509 1.00 14.35 ? 455 VAL A N   1 
ATOM   3471 C CA  . VAL A 1 455 ? -13.612 36.531 44.298 1.00 14.79 ? 455 VAL A CA  1 
ATOM   3472 C C   . VAL A 1 455 ? -14.890 36.907 43.557 1.00 16.11 ? 455 VAL A C   1 
ATOM   3473 O O   . VAL A 1 455 ? -14.894 37.157 42.341 1.00 14.20 ? 455 VAL A O   1 
ATOM   3474 C CB  . VAL A 1 455 ? -13.121 37.660 45.213 1.00 15.40 ? 455 VAL A CB  1 
ATOM   3475 C CG1 . VAL A 1 455 ? -11.890 37.173 46.019 1.00 13.77 ? 455 VAL A CG1 1 
ATOM   3476 C CG2 . VAL A 1 455 ? -12.729 38.901 44.337 1.00 17.28 ? 455 VAL A CG2 1 
ATOM   3477 N N   . ASP A 1 456 ? -15.973 36.884 44.328 1.00 16.57 ? 456 ASP A N   1 
ATOM   3478 C CA  . ASP A 1 456 ? -17.297 37.233 43.891 1.00 17.13 ? 456 ASP A CA  1 
ATOM   3479 C C   . ASP A 1 456 ? -17.213 38.654 43.364 1.00 17.21 ? 456 ASP A C   1 
ATOM   3480 O O   . ASP A 1 456 ? -16.601 39.475 44.013 1.00 18.59 ? 456 ASP A O   1 
ATOM   3481 C CB  . ASP A 1 456 ? -18.189 37.278 45.110 1.00 17.79 ? 456 ASP A CB  1 
ATOM   3482 C CG  . ASP A 1 456 ? -19.627 37.549 44.751 1.00 19.22 ? 456 ASP A CG  1 
ATOM   3483 O OD1 . ASP A 1 456 ? -20.060 38.734 44.702 1.00 17.52 ? 456 ASP A OD1 1 
ATOM   3484 O OD2 . ASP A 1 456 ? -20.301 36.534 44.480 1.00 19.63 ? 456 ASP A OD2 1 
ATOM   3485 N N   . PRO A 1 457 ? -17.957 38.999 42.286 1.00 16.11 ? 457 PRO A N   1 
ATOM   3486 C CA  . PRO A 1 457 ? -17.904 40.395 41.826 1.00 15.63 ? 457 PRO A CA  1 
ATOM   3487 C C   . PRO A 1 457 ? -18.289 41.454 42.906 1.00 16.65 ? 457 PRO A C   1 
ATOM   3488 O O   . PRO A 1 457 ? -17.909 42.658 42.835 1.00 17.27 ? 457 PRO A O   1 
ATOM   3489 C CB  . PRO A 1 457 ? -18.879 40.400 40.644 1.00 13.56 ? 457 PRO A CB  1 
ATOM   3490 C CG  . PRO A 1 457 ? -19.847 39.318 40.988 1.00 14.39 ? 457 PRO A CG  1 
ATOM   3491 C CD  . PRO A 1 457 ? -18.980 38.232 41.539 1.00 14.97 ? 457 PRO A CD  1 
ATOM   3492 N N   . SER A 1 458 ? -19.067 41.033 43.902 1.00 15.87 ? 458 SER A N   1 
ATOM   3493 C CA  . SER A 1 458 ? -19.488 41.996 44.903 1.00 15.88 ? 458 SER A CA  1 
ATOM   3494 C C   . SER A 1 458 ? -18.315 42.225 45.833 1.00 16.85 ? 458 SER A C   1 
ATOM   3495 O O   . SER A 1 458 ? -18.238 43.277 46.463 1.00 20.68 ? 458 SER A O   1 
ATOM   3496 C CB  . SER A 1 458 ? -20.746 41.531 45.643 1.00 14.88 ? 458 SER A CB  1 
ATOM   3497 O OG  . SER A 1 458 ? -20.432 40.480 46.547 1.00 17.60 ? 458 SER A OG  1 
ATOM   3498 N N   . THR A 1 459 ? -17.355 41.302 45.856 1.00 13.80 ? 459 THR A N   1 
ATOM   3499 C CA  . THR A 1 459 ? -16.202 41.462 46.733 1.00 10.88 ? 459 THR A CA  1 
ATOM   3500 C C   . THR A 1 459 ? -15.178 42.541 46.340 1.00 10.57 ? 459 THR A C   1 
ATOM   3501 O O   . THR A 1 459 ? -14.356 42.345 45.418 1.00 11.06 ? 459 THR A O   1 
ATOM   3502 C CB  . THR A 1 459 ? -15.446 40.118 46.931 1.00 11.38 ? 459 THR A CB  1 
ATOM   3503 O OG1 . THR A 1 459 ? -16.344 39.087 47.413 1.00 11.20 ? 459 THR A OG1 1 
ATOM   3504 C CG2 . THR A 1 459 ? -14.276 40.311 47.896 1.00 9.78  ? 459 THR A CG2 1 
ATOM   3505 N N   . VAL A 1 460 ? -15.191 43.669 47.062 1.00 7.63  ? 460 VAL A N   1 
ATOM   3506 C CA  . VAL A 1 460 ? -14.196 44.714 46.818 1.00 4.47  ? 460 VAL A CA  1 
ATOM   3507 C C   . VAL A 1 460 ? -12.781 44.199 47.230 1.00 5.52  ? 460 VAL A C   1 
ATOM   3508 O O   . VAL A 1 460 ? -12.592 43.570 48.292 1.00 6.26  ? 460 VAL A O   1 
ATOM   3509 C CB  . VAL A 1 460 ? -14.522 45.970 47.575 1.00 2.40  ? 460 VAL A CB  1 
ATOM   3510 C CG1 . VAL A 1 460 ? -13.483 47.013 47.275 1.00 2.00  ? 460 VAL A CG1 1 
ATOM   3511 C CG2 . VAL A 1 460 ? -15.861 46.464 47.211 1.00 2.00  ? 460 VAL A CG2 1 
ATOM   3512 N N   . VAL A 1 461 ? -11.797 44.393 46.355 1.00 6.25  ? 461 VAL A N   1 
ATOM   3513 C CA  . VAL A 1 461 ? -10.424 43.944 46.642 1.00 7.87  ? 461 VAL A CA  1 
ATOM   3514 C C   . VAL A 1 461 ? -9.384  45.084 46.796 1.00 9.19  ? 461 VAL A C   1 
ATOM   3515 O O   . VAL A 1 461 ? -9.052  45.757 45.842 1.00 11.52 ? 461 VAL A O   1 
ATOM   3516 C CB  . VAL A 1 461 ? -9.909  42.911 45.587 1.00 5.37  ? 461 VAL A CB  1 
ATOM   3517 C CG1 . VAL A 1 461 ? -8.516  42.523 45.951 1.00 6.77  ? 461 VAL A CG1 1 
ATOM   3518 C CG2 . VAL A 1 461 ? -10.780 41.660 45.557 1.00 2.73  ? 461 VAL A CG2 1 
ATOM   3519 N N   . VAL A 1 462 ? -8.806  45.249 47.972 1.00 9.27  ? 462 VAL A N   1 
ATOM   3520 C CA  . VAL A 1 462 ? -7.868  46.335 48.143 1.00 10.25 ? 462 VAL A CA  1 
ATOM   3521 C C   . VAL A 1 462 ? -6.431  45.904 48.180 1.00 12.48 ? 462 VAL A C   1 
ATOM   3522 O O   . VAL A 1 462 ? -6.042  45.074 48.997 1.00 15.16 ? 462 VAL A O   1 
ATOM   3523 C CB  . VAL A 1 462 ? -8.197  47.065 49.433 1.00 9.64  ? 462 VAL A CB  1 
ATOM   3524 C CG1 . VAL A 1 462 ? -7.220  48.170 49.747 1.00 7.94  ? 462 VAL A CG1 1 
ATOM   3525 C CG2 . VAL A 1 462 ? -9.566  47.610 49.323 1.00 11.38 ? 462 VAL A CG2 1 
ATOM   3526 N N   . PHE A 1 463 ? -5.606  46.506 47.343 1.00 14.97 ? 463 PHE A N   1 
ATOM   3527 C CA  . PHE A 1 463 ? -4.194  46.169 47.372 1.00 15.61 ? 463 PHE A CA  1 
ATOM   3528 C C   . PHE A 1 463 ? -3.389  47.243 48.059 1.00 17.51 ? 463 PHE A C   1 
ATOM   3529 O O   . PHE A 1 463 ? -3.606  48.452 47.821 1.00 19.78 ? 463 PHE A O   1 
ATOM   3530 C CB  . PHE A 1 463 ? -3.604  45.995 45.989 1.00 13.50 ? 463 PHE A CB  1 
ATOM   3531 C CG  . PHE A 1 463 ? -2.132  45.668 46.024 1.00 13.20 ? 463 PHE A CG  1 
ATOM   3532 C CD1 . PHE A 1 463 ? -1.658  44.594 46.760 1.00 11.86 ? 463 PHE A CD1 1 
ATOM   3533 C CD2 . PHE A 1 463 ? -1.218  46.430 45.330 1.00 10.96 ? 463 PHE A CD2 1 
ATOM   3534 C CE1 . PHE A 1 463 ? -0.288  44.313 46.776 1.00 12.68 ? 463 PHE A CE1 1 
ATOM   3535 C CE2 . PHE A 1 463 ? 0.126   46.128 45.365 1.00 9.41  ? 463 PHE A CE2 1 
ATOM   3536 C CZ  . PHE A 1 463 ? 0.590   45.090 46.073 1.00 8.74  ? 463 PHE A CZ  1 
ATOM   3537 N N   . ALA A 1 464 ? -2.460  46.817 48.909 1.00 18.50 ? 464 ALA A N   1 
ATOM   3538 C CA  . ALA A 1 464 ? -1.571  47.753 49.598 1.00 19.57 ? 464 ALA A CA  1 
ATOM   3539 C C   . ALA A 1 464 ? -0.337  46.952 49.869 1.00 21.90 ? 464 ALA A C   1 
ATOM   3540 O O   . ALA A 1 464 ? -0.361  46.033 50.692 1.00 22.89 ? 464 ALA A O   1 
ATOM   3541 C CB  . ALA A 1 464 ? -2.154  48.241 50.899 1.00 17.27 ? 464 ALA A CB  1 
ATOM   3542 N N   . GLU A 1 465 ? 0.742   47.269 49.171 1.00 22.91 ? 465 GLU A N   1 
ATOM   3543 C CA  . GLU A 1 465 ? 1.960   46.532 49.380 1.00 24.00 ? 465 GLU A CA  1 
ATOM   3544 C C   . GLU A 1 465 ? 2.462   46.490 50.814 1.00 25.21 ? 465 GLU A C   1 
ATOM   3545 O O   . GLU A 1 465 ? 2.927   45.460 51.288 1.00 25.86 ? 465 GLU A O   1 
ATOM   3546 C CB  . GLU A 1 465 ? 3.059   47.106 48.520 1.00 24.01 ? 465 GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 465 ? 4.371   46.391 48.740 1.00 24.88 ? 465 GLU A CG  1 
ATOM   3548 C CD  . GLU A 1 465 ? 5.322   46.528 47.577 1.00 26.21 ? 465 GLU A CD  1 
ATOM   3549 O OE1 . GLU A 1 465 ? 4.903   47.066 46.534 1.00 27.49 ? 465 GLU A OE1 1 
ATOM   3550 O OE2 . GLU A 1 465 ? 6.497   46.109 47.711 1.00 28.37 ? 465 GLU A OE2 1 
ATOM   3551 N N   . ASN A 1 466 ? 2.395   47.618 51.498 1.00 26.75 ? 466 ASN A N   1 
ATOM   3552 C CA  . ASN A 1 466 ? 2.932   47.688 52.842 1.00 27.83 ? 466 ASN A CA  1 
ATOM   3553 C C   . ASN A 1 466 ? 2.175   48.621 53.725 1.00 28.48 ? 466 ASN A C   1 
ATOM   3554 O O   . ASN A 1 466 ? 2.640   49.711 54.058 1.00 30.37 ? 466 ASN A O   1 
ATOM   3555 C CB  . ASN A 1 466 ? 4.368   48.157 52.771 1.00 28.49 ? 466 ASN A CB  1 
ATOM   3556 C CG  . ASN A 1 466 ? 5.308   47.107 53.214 1.00 29.83 ? 466 ASN A CG  1 
ATOM   3557 O OD1 . ASN A 1 466 ? 5.566   46.997 54.397 1.00 31.47 ? 466 ASN A OD1 1 
ATOM   3558 N ND2 . ASN A 1 466 ? 5.858   46.336 52.272 1.00 29.96 ? 466 ASN A ND2 1 
ATOM   3559 N N   . PRO A 1 467 ? 0.971   48.216 54.111 1.00 28.44 ? 467 PRO A N   1 
ATOM   3560 C CA  . PRO A 1 467 ? 0.071   49.103 54.847 1.00 29.74 ? 467 PRO A CA  1 
ATOM   3561 C C   . PRO A 1 467 ? 0.427   49.297 56.337 1.00 30.33 ? 467 PRO A C   1 
ATOM   3562 O O   . PRO A 1 467 ? 0.937   48.376 56.990 1.00 30.32 ? 467 PRO A O   1 
ATOM   3563 C CB  . PRO A 1 467 ? -1.284  48.415 54.644 1.00 28.64 ? 467 PRO A CB  1 
ATOM   3564 C CG  . PRO A 1 467 ? -0.922  47.007 54.574 1.00 28.47 ? 467 PRO A CG  1 
ATOM   3565 C CD  . PRO A 1 467 ? 0.274   47.006 53.671 1.00 27.74 ? 467 PRO A CD  1 
ATOM   3566 N N   . ASP A 1 468 ? 0.193   50.499 56.869 1.00 30.80 ? 468 ASP A N   1 
ATOM   3567 C CA  . ASP A 1 468 ? 0.475   50.717 58.286 1.00 32.34 ? 468 ASP A CA  1 
ATOM   3568 C C   . ASP A 1 468 ? -0.666  50.072 59.063 1.00 32.53 ? 468 ASP A C   1 
ATOM   3569 O O   . ASP A 1 468 ? -1.727  49.768 58.486 1.00 31.94 ? 468 ASP A O   1 
ATOM   3570 C CB  . ASP A 1 468 ? 0.647   52.204 58.636 1.00 34.95 ? 468 ASP A CB  1 
ATOM   3571 C CG  . ASP A 1 468 ? -0.504  53.071 58.133 1.00 38.40 ? 468 ASP A CG  1 
ATOM   3572 O OD1 . ASP A 1 468 ? -1.534  53.149 58.830 1.00 40.09 ? 468 ASP A OD1 1 
ATOM   3573 O OD2 . ASP A 1 468 ? -0.390  53.689 57.041 1.00 40.77 ? 468 ASP A OD2 1 
ATOM   3574 N N   . ALA A 1 469 ? -0.448  49.848 60.359 1.00 31.91 ? 469 ALA A N   1 
ATOM   3575 C CA  . ALA A 1 469 ? -1.449  49.201 61.188 1.00 32.06 ? 469 ALA A CA  1 
ATOM   3576 C C   . ALA A 1 469 ? -2.772  49.920 61.253 1.00 32.36 ? 469 ALA A C   1 
ATOM   3577 O O   . ALA A 1 469 ? -3.817  49.275 61.349 1.00 32.08 ? 469 ALA A O   1 
ATOM   3578 C CB  . ALA A 1 469 ? -0.921  48.937 62.573 1.00 32.45 ? 469 ALA A CB  1 
ATOM   3579 N N   . GLU A 1 470 ? -2.736  51.247 61.219 1.00 32.13 ? 470 GLU A N   1 
ATOM   3580 C CA  . GLU A 1 470 ? -3.981  52.001 61.269 1.00 33.01 ? 470 GLU A CA  1 
ATOM   3581 C C   . GLU A 1 470 ? -4.694  51.912 59.942 1.00 29.32 ? 470 GLU A C   1 
ATOM   3582 O O   . GLU A 1 470 ? -5.894  52.082 59.869 1.00 26.90 ? 470 GLU A O   1 
ATOM   3583 C CB  . GLU A 1 470 ? -3.758  53.484 61.651 1.00 38.68 ? 470 GLU A CB  1 
ATOM   3584 C CG  . GLU A 1 470 ? -3.406  53.760 63.145 1.00 47.15 ? 470 GLU A CG  1 
ATOM   3585 C CD  . GLU A 1 470 ? -3.191  55.280 63.464 1.00 51.79 ? 470 GLU A CD  1 
ATOM   3586 O OE1 . GLU A 1 470 ? -3.302  56.115 62.503 1.00 53.98 ? 470 GLU A OE1 1 
ATOM   3587 O OE2 . GLU A 1 470 ? -2.919  55.629 64.669 1.00 53.88 ? 470 GLU A OE2 1 
ATOM   3588 N N   . PHE A 1 471 ? -3.957  51.648 58.876 1.00 26.54 ? 471 PHE A N   1 
ATOM   3589 C CA  . PHE A 1 471 ? -4.606  51.582 57.586 1.00 24.45 ? 471 PHE A CA  1 
ATOM   3590 C C   . PHE A 1 471 ? -5.524  50.380 57.533 1.00 24.65 ? 471 PHE A C   1 
ATOM   3591 O O   . PHE A 1 471 ? -6.602  50.426 56.909 1.00 25.00 ? 471 PHE A O   1 
ATOM   3592 C CB  . PHE A 1 471 ? -3.573  51.512 56.478 1.00 23.71 ? 471 PHE A CB  1 
ATOM   3593 C CG  . PHE A 1 471 ? -4.141  51.110 55.129 1.00 24.43 ? 471 PHE A CG  1 
ATOM   3594 C CD1 . PHE A 1 471 ? -4.569  52.075 54.221 1.00 24.85 ? 471 PHE A CD1 1 
ATOM   3595 C CD2 . PHE A 1 471 ? -4.263  49.763 54.759 1.00 24.26 ? 471 PHE A CD2 1 
ATOM   3596 C CE1 . PHE A 1 471 ? -5.113  51.714 52.964 1.00 23.07 ? 471 PHE A CE1 1 
ATOM   3597 C CE2 . PHE A 1 471 ? -4.806  49.403 53.509 1.00 23.80 ? 471 PHE A CE2 1 
ATOM   3598 C CZ  . PHE A 1 471 ? -5.228  50.384 52.619 1.00 22.86 ? 471 PHE A CZ  1 
ATOM   3599 N N   . VAL A 1 472 ? -5.068  49.288 58.147 1.00 23.54 ? 472 VAL A N   1 
ATOM   3600 C CA  . VAL A 1 472 ? -5.824  48.042 58.144 1.00 22.25 ? 472 VAL A CA  1 
ATOM   3601 C C   . VAL A 1 472 ? -6.991  48.097 59.088 1.00 21.41 ? 472 VAL A C   1 
ATOM   3602 O O   . VAL A 1 472 ? -8.090  47.718 58.700 1.00 21.28 ? 472 VAL A O   1 
ATOM   3603 C CB  . VAL A 1 472 ? -4.947  46.787 58.493 1.00 22.67 ? 472 VAL A CB  1 
ATOM   3604 C CG1 . VAL A 1 472 ? -5.727  45.504 58.233 1.00 20.92 ? 472 VAL A CG1 1 
ATOM   3605 C CG2 . VAL A 1 472 ? -3.629  46.810 57.703 1.00 22.44 ? 472 VAL A CG2 1 
ATOM   3606 N N   . LYS A 1 473 ? -6.747  48.575 60.311 1.00 21.69 ? 473 LYS A N   1 
ATOM   3607 C CA  . LYS A 1 473 ? -7.787  48.669 61.336 1.00 21.28 ? 473 LYS A CA  1 
ATOM   3608 C C   . LYS A 1 473 ? -8.944  49.566 60.909 1.00 20.18 ? 473 LYS A C   1 
ATOM   3609 O O   . LYS A 1 473 ? -10.085 49.327 61.312 1.00 20.29 ? 473 LYS A O   1 
ATOM   3610 C CB  . LYS A 1 473 ? -7.236  49.123 62.701 1.00 22.06 ? 473 LYS A CB  1 
ATOM   3611 C CG  . LYS A 1 473 ? -6.141  48.283 63.304 1.00 24.53 ? 473 LYS A CG  1 
ATOM   3612 C CD  . LYS A 1 473 ? -6.106  48.503 64.823 1.00 28.24 ? 473 LYS A CD  1 
ATOM   3613 C CE  . LYS A 1 473 ? -4.675  48.489 65.485 1.00 30.46 ? 473 LYS A CE  1 
ATOM   3614 N NZ  . LYS A 1 473 ? -3.865  49.802 65.323 1.00 30.92 ? 473 LYS A NZ  1 
ATOM   3615 N N   . SER A 1 474 ? -8.679  50.595 60.106 1.00 18.58 ? 474 SER A N   1 
ATOM   3616 C CA  . SER A 1 474 ? -9.782  51.447 59.662 1.00 18.83 ? 474 SER A CA  1 
ATOM   3617 C C   . SER A 1 474 ? -10.357 51.045 58.321 1.00 19.06 ? 474 SER A C   1 
ATOM   3618 O O   . SER A 1 474 ? -11.360 51.608 57.907 1.00 21.94 ? 474 SER A O   1 
ATOM   3619 C CB  . SER A 1 474 ? -9.415  52.912 59.601 1.00 18.11 ? 474 SER A CB  1 
ATOM   3620 O OG  . SER A 1 474 ? -8.101  53.155 60.088 1.00 23.52 ? 474 SER A OG  1 
ATOM   3621 N N   . GLY A 1 475 ? -9.792  50.026 57.677 1.00 17.89 ? 475 GLY A N   1 
ATOM   3622 C CA  . GLY A 1 475 ? -10.281 49.622 56.380 1.00 13.48 ? 475 GLY A CA  1 
ATOM   3623 C C   . GLY A 1 475 ? -11.520 48.779 56.298 1.00 11.44 ? 475 GLY A C   1 
ATOM   3624 O O   . GLY A 1 475 ? -11.962 48.437 55.211 1.00 10.78 ? 475 GLY A O   1 
ATOM   3625 N N   . GLY A 1 476 ? -12.097 48.430 57.424 1.00 12.24 ? 476 GLY A N   1 
ATOM   3626 C CA  . GLY A 1 476 ? -13.276 47.598 57.369 1.00 10.74 ? 476 GLY A CA  1 
ATOM   3627 C C   . GLY A 1 476 ? -13.077 46.393 56.474 1.00 11.22 ? 476 GLY A C   1 
ATOM   3628 O O   . GLY A 1 476 ? -13.925 46.172 55.619 1.00 14.77 ? 476 GLY A O   1 
ATOM   3629 N N   . PHE A 1 477 ? -11.976 45.647 56.625 1.00 10.02 ? 477 PHE A N   1 
ATOM   3630 C CA  . PHE A 1 477 ? -11.693 44.469 55.797 1.00 7.91  ? 477 PHE A CA  1 
ATOM   3631 C C   . PHE A 1 477 ? -12.176 43.242 56.503 1.00 9.24  ? 477 PHE A C   1 
ATOM   3632 O O   . PHE A 1 477 ? -12.079 43.171 57.696 1.00 13.30 ? 477 PHE A O   1 
ATOM   3633 C CB  . PHE A 1 477 ? -10.204 44.302 55.643 1.00 7.41  ? 477 PHE A CB  1 
ATOM   3634 C CG  . PHE A 1 477 ? -9.535  45.405 54.881 1.00 8.25  ? 477 PHE A CG  1 
ATOM   3635 C CD1 . PHE A 1 477 ? -8.500  46.129 55.458 1.00 8.25  ? 477 PHE A CD1 1 
ATOM   3636 C CD2 . PHE A 1 477 ? -9.923  45.721 53.574 1.00 9.18  ? 477 PHE A CD2 1 
ATOM   3637 C CE1 . PHE A 1 477 ? -7.853  47.164 54.736 1.00 8.40  ? 477 PHE A CE1 1 
ATOM   3638 C CE2 . PHE A 1 477 ? -9.295  46.741 52.847 1.00 8.20  ? 477 PHE A CE2 1 
ATOM   3639 C CZ  . PHE A 1 477 ? -8.253  47.467 53.432 1.00 8.15  ? 477 PHE A CZ  1 
ATOM   3640 N N   . SER A 1 478 ? -12.534 42.195 55.788 1.00 10.42 ? 478 SER A N   1 
ATOM   3641 C CA  . SER A 1 478 ? -13.031 40.993 56.437 1.00 9.19  ? 478 SER A CA  1 
ATOM   3642 C C   . SER A 1 478 ? -11.897 40.068 56.833 1.00 9.94  ? 478 SER A C   1 
ATOM   3643 O O   . SER A 1 478 ? -12.001 39.251 57.759 1.00 10.50 ? 478 SER A O   1 
ATOM   3644 C CB  . SER A 1 478 ? -13.984 40.313 55.479 1.00 9.81  ? 478 SER A CB  1 
ATOM   3645 O OG  . SER A 1 478 ? -14.946 41.280 55.038 1.00 13.50 ? 478 SER A OG  1 
ATOM   3646 N N   . TYR A 1 479 ? -10.827 40.147 56.062 1.00 9.68  ? 479 TYR A N   1 
ATOM   3647 C CA  . TYR A 1 479 ? -9.650  39.336 56.299 1.00 10.32 ? 479 TYR A CA  1 
ATOM   3648 C C   . TYR A 1 479 ? -8.660  39.809 55.266 1.00 10.80 ? 479 TYR A C   1 
ATOM   3649 O O   . TYR A 1 479 ? -9.063  40.456 54.305 1.00 11.91 ? 479 TYR A O   1 
ATOM   3650 C CB  . TYR A 1 479 ? -9.970  37.842 56.104 1.00 11.21 ? 479 TYR A CB  1 
ATOM   3651 C CG  . TYR A 1 479 ? -10.461 37.456 54.695 1.00 12.17 ? 479 TYR A CG  1 
ATOM   3652 C CD1 . TYR A 1 479 ? -9.612  37.592 53.584 1.00 11.78 ? 479 TYR A CD1 1 
ATOM   3653 C CD2 . TYR A 1 479 ? -11.806 37.052 54.467 1.00 10.89 ? 479 TYR A CD2 1 
ATOM   3654 C CE1 . TYR A 1 479 ? -10.070 37.354 52.303 1.00 12.63 ? 479 TYR A CE1 1 
ATOM   3655 C CE2 . TYR A 1 479 ? -12.283 36.804 53.170 1.00 10.34 ? 479 TYR A CE2 1 
ATOM   3656 C CZ  . TYR A 1 479 ? -11.403 36.955 52.085 1.00 11.67 ? 479 TYR A CZ  1 
ATOM   3657 O OH  . TYR A 1 479 ? -11.778 36.687 50.775 1.00 10.13 ? 479 TYR A OH  1 
ATOM   3658 N N   . ALA A 1 480 ? -7.384  39.477 55.455 1.00 12.49 ? 480 ALA A N   1 
ATOM   3659 C CA  . ALA A 1 480 ? -6.319  39.831 54.521 1.00 12.69 ? 480 ALA A CA  1 
ATOM   3660 C C   . ALA A 1 480 ? -5.465  38.622 54.111 1.00 14.27 ? 480 ALA A C   1 
ATOM   3661 O O   . ALA A 1 480 ? -5.419  37.585 54.817 1.00 14.35 ? 480 ALA A O   1 
ATOM   3662 C CB  . ALA A 1 480 ? -5.407  40.889 55.134 1.00 12.38 ? 480 ALA A CB  1 
ATOM   3663 N N   . ILE A 1 481 ? -4.793  38.754 52.958 1.00 13.67 ? 481 ILE A N   1 
ATOM   3664 C CA  . ILE A 1 481 ? -3.871  37.718 52.470 1.00 10.33 ? 481 ILE A CA  1 
ATOM   3665 C C   . ILE A 1 481 ? -2.596  38.509 52.295 1.00 9.95  ? 481 ILE A C   1 
ATOM   3666 O O   . ILE A 1 481 ? -2.619  39.552 51.647 1.00 9.34  ? 481 ILE A O   1 
ATOM   3667 C CB  . ILE A 1 481 ? -4.318  37.081 51.117 1.00 9.18  ? 481 ILE A CB  1 
ATOM   3668 C CG1 . ILE A 1 481 ? -5.580  36.196 51.316 1.00 7.97  ? 481 ILE A CG1 1 
ATOM   3669 C CG2 . ILE A 1 481 ? -3.143  36.299 50.527 1.00 6.46  ? 481 ILE A CG2 1 
ATOM   3670 C CD1 . ILE A 1 481 ? -6.432  35.992 50.028 1.00 7.11  ? 481 ILE A CD1 1 
ATOM   3671 N N   . VAL A 1 482 ? -1.540  38.097 52.990 1.00 9.20  ? 482 VAL A N   1 
ATOM   3672 C CA  . VAL A 1 482 ? -0.265  38.807 52.922 1.00 11.02 ? 482 VAL A CA  1 
ATOM   3673 C C   . VAL A 1 482 ? 0.776   37.880 52.356 1.00 12.84 ? 482 VAL A C   1 
ATOM   3674 O O   . VAL A 1 482 ? 1.016   36.801 52.907 1.00 13.88 ? 482 VAL A O   1 
ATOM   3675 C CB  . VAL A 1 482 ? 0.302   39.207 54.301 1.00 10.75 ? 482 VAL A CB  1 
ATOM   3676 C CG1 . VAL A 1 482 ? 1.267   40.325 54.113 1.00 9.23  ? 482 VAL A CG1 1 
ATOM   3677 C CG2 . VAL A 1 482 ? -0.802  39.526 55.335 1.00 11.20 ? 482 VAL A CG2 1 
ATOM   3678 N N   . ALA A 1 483 ? 1.446   38.319 51.298 1.00 14.02 ? 483 ALA A N   1 
ATOM   3679 C CA  . ALA A 1 483 ? 2.452   37.500 50.666 1.00 11.83 ? 483 ALA A CA  1 
ATOM   3680 C C   . ALA A 1 483 ? 3.842   38.095 50.920 1.00 12.18 ? 483 ALA A C   1 
ATOM   3681 O O   . ALA A 1 483 ? 4.102   39.250 50.591 1.00 12.51 ? 483 ALA A O   1 
ATOM   3682 C CB  . ALA A 1 483 ? 2.142   37.425 49.190 1.00 10.58 ? 483 ALA A CB  1 
ATOM   3683 N N   . VAL A 1 484 ? 4.718   37.355 51.589 1.00 11.08 ? 484 VAL A N   1 
ATOM   3684 C CA  . VAL A 1 484 ? 6.069   37.883 51.820 1.00 10.55 ? 484 VAL A CA  1 
ATOM   3685 C C   . VAL A 1 484 ? 7.100   36.734 51.601 1.00 10.92 ? 484 VAL A C   1 
ATOM   3686 O O   . VAL A 1 484 ? 6.733   35.555 51.488 1.00 11.54 ? 484 VAL A O   1 
ATOM   3687 C CB  . VAL A 1 484 ? 6.225   38.583 53.255 1.00 8.90  ? 484 VAL A CB  1 
ATOM   3688 C CG1 . VAL A 1 484 ? 5.204   39.696 53.467 1.00 6.03  ? 484 VAL A CG1 1 
ATOM   3689 C CG2 . VAL A 1 484 ? 6.110   37.579 54.386 1.00 6.82  ? 484 VAL A CG2 1 
ATOM   3690 N N   . GLY A 1 485 ? 8.383   37.058 51.516 1.00 10.50 ? 485 GLY A N   1 
ATOM   3691 C CA  . GLY A 1 485 ? 9.359   36.003 51.302 1.00 10.66 ? 485 GLY A CA  1 
ATOM   3692 C C   . GLY A 1 485 ? 10.771  36.365 50.851 1.00 10.27 ? 485 GLY A C   1 
ATOM   3693 O O   . GLY A 1 485 ? 11.259  37.474 51.010 1.00 9.92  ? 485 GLY A O   1 
ATOM   3694 N N   . GLU A 1 486 ? 11.468  35.362 50.354 1.00 11.54 ? 486 GLU A N   1 
ATOM   3695 C CA  . GLU A 1 486 ? 12.820  35.543 49.876 1.00 11.46 ? 486 GLU A CA  1 
ATOM   3696 C C   . GLU A 1 486 ? 12.774  36.210 48.506 1.00 11.68 ? 486 GLU A C   1 
ATOM   3697 O O   . GLU A 1 486 ? 11.724  36.325 47.892 1.00 12.62 ? 486 GLU A O   1 
ATOM   3698 C CB  . GLU A 1 486 ? 13.512  34.184 49.731 1.00 11.05 ? 486 GLU A CB  1 
ATOM   3699 C CG  . GLU A 1 486 ? 13.735  33.324 50.990 1.00 12.24 ? 486 GLU A CG  1 
ATOM   3700 C CD  . GLU A 1 486 ? 14.633  32.086 50.673 1.00 14.56 ? 486 GLU A CD  1 
ATOM   3701 O OE1 . GLU A 1 486 ? 14.254  31.298 49.786 1.00 14.76 ? 486 GLU A OE1 1 
ATOM   3702 O OE2 . GLU A 1 486 ? 15.740  31.902 51.259 1.00 15.00 ? 486 GLU A OE2 1 
ATOM   3703 N N   . HIS A 1 487 ? 13.898  36.765 48.099 1.00 12.62 ? 487 HIS A N   1 
ATOM   3704 C CA  . HIS A 1 487 ? 14.033  37.361 46.786 1.00 12.97 ? 487 HIS A CA  1 
ATOM   3705 C C   . HIS A 1 487 ? 14.645  36.307 45.834 1.00 11.91 ? 487 HIS A C   1 
ATOM   3706 O O   . HIS A 1 487 ? 15.268  35.343 46.313 1.00 11.35 ? 487 HIS A O   1 
ATOM   3707 C CB  . HIS A 1 487 ? 14.924  38.583 46.917 1.00 14.41 ? 487 HIS A CB  1 
ATOM   3708 C CG  . HIS A 1 487 ? 14.258  39.708 47.622 1.00 15.45 ? 487 HIS A CG  1 
ATOM   3709 N ND1 . HIS A 1 487 ? 14.876  40.880 47.936 1.00 16.08 ? 487 HIS A ND1 1 
ATOM   3710 C CD2 . HIS A 1 487 ? 12.992  39.851 48.080 1.00 17.46 ? 487 HIS A CD2 1 
ATOM   3711 C CE1 . HIS A 1 487 ? 14.050  41.711 48.532 1.00 17.33 ? 487 HIS A CE1 1 
ATOM   3712 N NE2 . HIS A 1 487 ? 12.886  41.101 48.634 1.00 17.86 ? 487 HIS A NE2 1 
ATOM   3713 N N   . PRO A 1 488 ? 14.513  36.470 44.488 1.00 11.41 ? 488 PRO A N   1 
ATOM   3714 C CA  . PRO A 1 488 ? 14.972  35.363 43.634 1.00 10.62 ? 488 PRO A CA  1 
ATOM   3715 C C   . PRO A 1 488 ? 16.470  35.195 43.788 1.00 10.79 ? 488 PRO A C   1 
ATOM   3716 O O   . PRO A 1 488 ? 17.148  36.182 44.046 1.00 13.32 ? 488 PRO A O   1 
ATOM   3717 C CB  . PRO A 1 488 ? 14.624  35.845 42.230 1.00 8.40  ? 488 PRO A CB  1 
ATOM   3718 C CG  . PRO A 1 488 ? 13.424  36.700 42.455 1.00 8.75  ? 488 PRO A CG  1 
ATOM   3719 C CD  . PRO A 1 488 ? 13.903  37.516 43.632 1.00 9.81  ? 488 PRO A CD  1 
ATOM   3720 N N   . TYR A 1 489 ? 16.970  33.967 43.770 1.00 10.62 ? 489 TYR A N   1 
ATOM   3721 C CA  . TYR A 1 489 ? 18.412  33.720 43.871 1.00 10.41 ? 489 TYR A CA  1 
ATOM   3722 C C   . TYR A 1 489 ? 18.850  32.455 43.188 1.00 12.17 ? 489 TYR A C   1 
ATOM   3723 O O   . TYR A 1 489 ? 18.108  31.466 43.077 1.00 9.86  ? 489 TYR A O   1 
ATOM   3724 C CB  . TYR A 1 489 ? 18.911  33.681 45.317 1.00 8.49  ? 489 TYR A CB  1 
ATOM   3725 C CG  . TYR A 1 489 ? 18.254  32.668 46.208 1.00 6.43  ? 489 TYR A CG  1 
ATOM   3726 C CD1 . TYR A 1 489 ? 18.581  31.302 46.139 1.00 5.67  ? 489 TYR A CD1 1 
ATOM   3727 C CD2 . TYR A 1 489 ? 17.295  33.080 47.108 1.00 5.04  ? 489 TYR A CD2 1 
ATOM   3728 C CE1 . TYR A 1 489 ? 17.940  30.391 46.962 1.00 5.18  ? 489 TYR A CE1 1 
ATOM   3729 C CE2 . TYR A 1 489 ? 16.662  32.208 47.916 1.00 5.14  ? 489 TYR A CE2 1 
ATOM   3730 C CZ  . TYR A 1 489 ? 16.965  30.871 47.850 1.00 6.23  ? 489 TYR A CZ  1 
ATOM   3731 O OH  . TYR A 1 489 ? 16.230  30.037 48.656 1.00 7.02  ? 489 TYR A OH  1 
ATOM   3732 N N   . THR A 1 490 ? 20.090  32.470 42.748 1.00 14.44 ? 490 THR A N   1 
ATOM   3733 C CA  . THR A 1 490 ? 20.556  31.272 42.086 1.00 18.82 ? 490 THR A CA  1 
ATOM   3734 C C   . THR A 1 490 ? 21.984  30.984 42.511 1.00 19.24 ? 490 THR A C   1 
ATOM   3735 O O   . THR A 1 490 ? 22.768  31.903 42.803 1.00 20.27 ? 490 THR A O   1 
ATOM   3736 C CB  . THR A 1 490 ? 20.408  31.364 40.505 1.00 19.55 ? 490 THR A CB  1 
ATOM   3737 O OG1 . THR A 1 490 ? 19.109  31.905 40.158 1.00 21.74 ? 490 THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 490 ? 20.564  29.970 39.862 1.00 18.49 ? 490 THR A CG2 1 
ATOM   3739 N N   . GLU A 1 491 ? 22.268  29.709 42.711 1.00 18.52 ? 491 GLU A N   1 
ATOM   3740 C CA  . GLU A 1 491 ? 23.603  29.319 43.061 1.00 18.39 ? 491 GLU A CA  1 
ATOM   3741 C C   . GLU A 1 491 ? 24.207  30.075 44.247 1.00 17.53 ? 491 GLU A C   1 
ATOM   3742 O O   . GLU A 1 491 ? 23.504  30.428 45.171 1.00 17.62 ? 491 GLU A O   1 
ATOM   3743 C CB  . GLU A 1 491 ? 24.462  29.413 41.800 1.00 18.51 ? 491 GLU A CB  1 
ATOM   3744 C CG  . GLU A 1 491 ? 23.931  28.465 40.713 1.00 18.70 ? 491 GLU A CG  1 
ATOM   3745 C CD  . GLU A 1 491 ? 24.775  28.409 39.473 1.00 18.51 ? 491 GLU A CD  1 
ATOM   3746 O OE1 . GLU A 1 491 ? 25.980  28.079 39.649 1.00 17.88 ? 491 GLU A OE1 1 
ATOM   3747 O OE2 . GLU A 1 491 ? 24.221  28.671 38.357 1.00 15.55 ? 491 GLU A OE2 1 
ATOM   3748 N N   . THR A 1 492 ? 25.501  30.346 44.231 1.00 18.31 ? 492 THR A N   1 
ATOM   3749 C CA  . THR A 1 492 ? 26.097  31.001 45.376 1.00 17.91 ? 492 THR A CA  1 
ATOM   3750 C C   . THR A 1 492 ? 25.381  32.243 45.849 1.00 18.44 ? 492 THR A C   1 
ATOM   3751 O O   . THR A 1 492 ? 25.419  32.578 47.027 1.00 18.82 ? 492 THR A O   1 
ATOM   3752 C CB  . THR A 1 492 ? 27.567  31.235 45.181 1.00 15.74 ? 492 THR A CB  1 
ATOM   3753 O OG1 . THR A 1 492 ? 28.193  29.983 44.935 1.00 16.51 ? 492 THR A OG1 1 
ATOM   3754 C CG2 . THR A 1 492 ? 28.161  31.759 46.389 1.00 14.15 ? 492 THR A CG2 1 
ATOM   3755 N N   . LYS A 1 493 ? 24.658  32.902 44.961 1.00 20.41 ? 493 LYS A N   1 
ATOM   3756 C CA  . LYS A 1 493 ? 23.949  34.074 45.404 1.00 21.83 ? 493 LYS A CA  1 
ATOM   3757 C C   . LYS A 1 493 ? 22.973  33.688 46.479 1.00 21.14 ? 493 LYS A C   1 
ATOM   3758 O O   . LYS A 1 493 ? 22.632  34.509 47.316 1.00 23.92 ? 493 LYS A O   1 
ATOM   3759 C CB  . LYS A 1 493 ? 23.224  34.724 44.261 1.00 25.27 ? 493 LYS A CB  1 
ATOM   3760 C CG  . LYS A 1 493 ? 24.008  35.814 43.632 1.00 30.77 ? 493 LYS A CG  1 
ATOM   3761 C CD  . LYS A 1 493 ? 23.457  37.158 44.092 1.00 36.59 ? 493 LYS A CD  1 
ATOM   3762 C CE  . LYS A 1 493 ? 24.516  38.312 43.937 1.00 39.90 ? 493 LYS A CE  1 
ATOM   3763 N NZ  . LYS A 1 493 ? 23.862  39.678 44.202 1.00 43.11 ? 493 LYS A NZ  1 
ATOM   3764 N N   . GLY A 1 494 ? 22.590  32.418 46.502 1.00 19.18 ? 494 GLY A N   1 
ATOM   3765 C CA  . GLY A 1 494 ? 21.626  31.947 47.466 1.00 16.95 ? 494 GLY A CA  1 
ATOM   3766 C C   . GLY A 1 494 ? 22.179  31.443 48.772 1.00 18.15 ? 494 GLY A C   1 
ATOM   3767 O O   . GLY A 1 494 ? 21.408  31.269 49.720 1.00 18.14 ? 494 GLY A O   1 
ATOM   3768 N N   . ASP A 1 495 ? 23.464  31.079 48.805 1.00 17.75 ? 495 ASP A N   1 
ATOM   3769 C CA  . ASP A 1 495 ? 24.060  30.599 50.052 1.00 16.91 ? 495 ASP A CA  1 
ATOM   3770 C C   . ASP A 1 495 ? 23.688  31.629 51.122 1.00 16.41 ? 495 ASP A C   1 
ATOM   3771 O O   . ASP A 1 495 ? 23.904  32.819 50.987 1.00 15.58 ? 495 ASP A O   1 
ATOM   3772 C CB  . ASP A 1 495 ? 25.577  30.429 49.923 1.00 16.88 ? 495 ASP A CB  1 
ATOM   3773 C CG  . ASP A 1 495 ? 25.954  29.236 49.066 1.00 18.67 ? 495 ASP A CG  1 
ATOM   3774 O OD1 . ASP A 1 495 ? 25.084  28.342 48.866 1.00 18.78 ? 495 ASP A OD1 1 
ATOM   3775 O OD2 . ASP A 1 495 ? 27.118  29.183 48.587 1.00 18.89 ? 495 ASP A OD2 1 
ATOM   3776 N N   . ASN A 1 496 ? 23.027  31.168 52.152 1.00 17.71 ? 496 ASN A N   1 
ATOM   3777 C CA  . ASN A 1 496 ? 22.575  32.067 53.164 1.00 18.02 ? 496 ASN A CA  1 
ATOM   3778 C C   . ASN A 1 496 ? 22.693  31.362 54.495 1.00 19.31 ? 496 ASN A C   1 
ATOM   3779 O O   . ASN A 1 496 ? 22.143  30.264 54.658 1.00 19.72 ? 496 ASN A O   1 
ATOM   3780 C CB  . ASN A 1 496 ? 21.125  32.399 52.875 1.00 17.04 ? 496 ASN A CB  1 
ATOM   3781 C CG  . ASN A 1 496 ? 20.631  33.460 53.743 1.00 17.01 ? 496 ASN A CG  1 
ATOM   3782 O OD1 . ASN A 1 496 ? 20.977  33.511 54.901 1.00 18.16 ? 496 ASN A OD1 1 
ATOM   3783 N ND2 . ASN A 1 496 ? 19.837  34.352 53.199 1.00 19.03 ? 496 ASN A ND2 1 
ATOM   3784 N N   . LEU A 1 497 ? 23.398  31.995 55.442 1.00 19.97 ? 497 LEU A N   1 
ATOM   3785 C CA  . LEU A 1 497 ? 23.623  31.431 56.787 1.00 20.86 ? 497 LEU A CA  1 
ATOM   3786 C C   . LEU A 1 497 ? 22.577  31.796 57.854 1.00 22.43 ? 497 LEU A C   1 
ATOM   3787 O O   . LEU A 1 497 ? 22.413  31.082 58.832 1.00 21.60 ? 497 LEU A O   1 
ATOM   3788 C CB  . LEU A 1 497 ? 25.014  31.856 57.314 1.00 17.66 ? 497 LEU A CB  1 
ATOM   3789 C CG  . LEU A 1 497 ? 26.296  31.349 56.644 1.00 16.32 ? 497 LEU A CG  1 
ATOM   3790 C CD1 . LEU A 1 497 ? 27.479  31.968 57.311 1.00 13.38 ? 497 LEU A CD1 1 
ATOM   3791 C CD2 . LEU A 1 497 ? 26.375  29.823 56.665 1.00 14.77 ? 497 LEU A CD2 1 
ATOM   3792 N N   . ASN A 1 498 ? 21.912  32.927 57.677 1.00 26.29 ? 498 ASN A N   1 
ATOM   3793 C CA  . ASN A 1 498 ? 20.962  33.418 58.639 1.00 29.61 ? 498 ASN A CA  1 
ATOM   3794 C C   . ASN A 1 498 ? 19.545  32.984 58.368 1.00 27.15 ? 498 ASN A C   1 
ATOM   3795 O O   . ASN A 1 498 ? 18.738  32.966 59.275 1.00 26.92 ? 498 ASN A O   1 
ATOM   3796 C CB  . ASN A 1 498 ? 21.040  34.947 58.704 1.00 38.64 ? 498 ASN A CB  1 
ATOM   3797 C CG  . ASN A 1 498 ? 20.492  35.631 57.437 1.00 48.40 ? 498 ASN A CG  1 
ATOM   3798 O OD1 . ASN A 1 498 ? 19.318  35.457 57.046 1.00 49.46 ? 498 ASN A OD1 1 
ATOM   3799 N ND2 . ASN A 1 498 ? 21.354  36.417 56.795 1.00 55.96 ? 498 ASN A ND2 1 
ATOM   3800 N N   . LEU A 1 499 ? 19.247  32.656 57.116 1.00 24.48 ? 499 LEU A N   1 
ATOM   3801 C CA  . LEU A 1 499 ? 17.920  32.228 56.669 1.00 21.86 ? 499 LEU A CA  1 
ATOM   3802 C C   . LEU A 1 499 ? 16.662  32.972 57.237 1.00 22.72 ? 499 LEU A C   1 
ATOM   3803 O O   . LEU A 1 499 ? 15.622  32.364 57.607 1.00 21.91 ? 499 LEU A O   1 
ATOM   3804 C CB  . LEU A 1 499 ? 17.769  30.708 56.793 1.00 18.37 ? 499 LEU A CB  1 
ATOM   3805 C CG  . LEU A 1 499 ? 18.702  29.778 56.021 1.00 17.17 ? 499 LEU A CG  1 
ATOM   3806 C CD1 . LEU A 1 499 ? 18.220  28.328 56.212 1.00 17.83 ? 499 LEU A CD1 1 
ATOM   3807 C CD2 . LEU A 1 499 ? 18.788  30.123 54.582 1.00 14.60 ? 499 LEU A CD2 1 
ATOM   3808 N N   . THR A 1 500 ? 16.724  34.290 57.256 1.00 22.74 ? 500 THR A N   1 
ATOM   3809 C CA  . THR A 1 500 ? 15.586  35.061 57.754 1.00 24.15 ? 500 THR A CA  1 
ATOM   3810 C C   . THR A 1 500 ? 15.109  35.858 56.555 1.00 25.18 ? 500 THR A C   1 
ATOM   3811 O O   . THR A 1 500 ? 15.937  36.192 55.712 1.00 26.00 ? 500 THR A O   1 
ATOM   3812 C CB  . THR A 1 500 ? 16.044  35.988 58.846 1.00 22.34 ? 500 THR A CB  1 
ATOM   3813 O OG1 . THR A 1 500 ? 16.992  36.902 58.294 1.00 23.69 ? 500 THR A OG1 1 
ATOM   3814 C CG2 . THR A 1 500 ? 16.731  35.197 59.947 1.00 21.33 ? 500 THR A CG2 1 
ATOM   3815 N N   . ILE A 1 501 ? 13.808  36.113 56.405 1.00 25.85 ? 501 ILE A N   1 
ATOM   3816 C CA  . ILE A 1 501 ? 13.380  36.871 55.228 1.00 26.34 ? 501 ILE A CA  1 
ATOM   3817 C C   . ILE A 1 501 ? 13.593  38.376 55.277 1.00 27.57 ? 501 ILE A C   1 
ATOM   3818 O O   . ILE A 1 501 ? 13.490  39.009 56.331 1.00 27.46 ? 501 ILE A O   1 
ATOM   3819 C CB  . ILE A 1 501 ? 11.948  36.591 54.860 1.00 25.92 ? 501 ILE A CB  1 
ATOM   3820 C CG1 . ILE A 1 501 ? 11.008  37.297 55.841 1.00 25.27 ? 501 ILE A CG1 1 
ATOM   3821 C CG2 . ILE A 1 501 ? 11.754  35.106 54.777 1.00 25.09 ? 501 ILE A CG2 1 
ATOM   3822 C CD1 . ILE A 1 501 ? 9.551   37.029 55.623 1.00 25.91 ? 501 ILE A CD1 1 
ATOM   3823 N N   . PRO A 1 502 ? 13.870  38.980 54.106 1.00 28.45 ? 502 PRO A N   1 
ATOM   3824 C CA  . PRO A 1 502 ? 14.205  40.403 54.134 1.00 28.62 ? 502 PRO A CA  1 
ATOM   3825 C C   . PRO A 1 502 ? 12.976  41.213 54.509 1.00 28.66 ? 502 PRO A C   1 
ATOM   3826 O O   . PRO A 1 502 ? 11.861  40.750 54.363 1.00 28.06 ? 502 PRO A O   1 
ATOM   3827 C CB  . PRO A 1 502 ? 14.658  40.675 52.688 1.00 27.98 ? 502 PRO A CB  1 
ATOM   3828 C CG  . PRO A 1 502 ? 13.859  39.737 51.870 1.00 27.80 ? 502 PRO A CG  1 
ATOM   3829 C CD  . PRO A 1 502 ? 13.854  38.457 52.722 1.00 28.67 ? 502 PRO A CD  1 
ATOM   3830 N N   . GLU A 1 503 ? 13.203  42.381 55.083 1.00 30.28 ? 503 GLU A N   1 
ATOM   3831 C CA  . GLU A 1 503 ? 12.133  43.305 55.435 1.00 31.48 ? 503 GLU A CA  1 
ATOM   3832 C C   . GLU A 1 503 ? 11.866  44.349 54.342 1.00 30.96 ? 503 GLU A C   1 
ATOM   3833 O O   . GLU A 1 503 ? 12.761  44.720 53.572 1.00 31.49 ? 503 GLU A O   1 
ATOM   3834 C CB  . GLU A 1 503 ? 12.481  44.046 56.700 1.00 33.23 ? 503 GLU A CB  1 
ATOM   3835 C CG  . GLU A 1 503 ? 12.485  43.163 57.852 1.00 36.82 ? 503 GLU A CG  1 
ATOM   3836 C CD  . GLU A 1 503 ? 11.109  42.710 58.170 1.00 39.75 ? 503 GLU A CD  1 
ATOM   3837 O OE1 . GLU A 1 503 ? 10.322  43.595 58.594 1.00 40.31 ? 503 GLU A OE1 1 
ATOM   3838 O OE2 . GLU A 1 503 ? 10.822  41.495 57.961 1.00 40.17 ? 503 GLU A OE2 1 
ATOM   3839 N N   . PRO A 1 504 ? 10.649  44.912 54.336 1.00 29.69 ? 504 PRO A N   1 
ATOM   3840 C CA  . PRO A 1 504 ? 9.595   44.648 55.324 1.00 28.89 ? 504 PRO A CA  1 
ATOM   3841 C C   . PRO A 1 504 ? 8.966   43.300 54.959 1.00 28.89 ? 504 PRO A C   1 
ATOM   3842 O O   . PRO A 1 504 ? 8.832   42.972 53.787 1.00 32.29 ? 504 PRO A O   1 
ATOM   3843 C CB  . PRO A 1 504 ? 8.652   45.800 55.090 1.00 28.93 ? 504 PRO A CB  1 
ATOM   3844 C CG  . PRO A 1 504 ? 8.704   45.905 53.561 1.00 28.88 ? 504 PRO A CG  1 
ATOM   3845 C CD  . PRO A 1 504 ? 10.137  45.680 53.191 1.00 28.60 ? 504 PRO A CD  1 
ATOM   3846 N N   . GLY A 1 505 ? 8.728   42.458 55.945 1.00 25.92 ? 505 GLY A N   1 
ATOM   3847 C CA  . GLY A 1 505 ? 8.159   41.165 55.652 1.00 22.32 ? 505 GLY A CA  1 
ATOM   3848 C C   . GLY A 1 505 ? 7.425   40.787 56.914 1.00 22.65 ? 505 GLY A C   1 
ATOM   3849 O O   . GLY A 1 505 ? 6.201   40.565 56.920 1.00 23.07 ? 505 GLY A O   1 
ATOM   3850 N N   . LEU A 1 506 ? 8.166   40.798 58.012 1.00 19.48 ? 506 LEU A N   1 
ATOM   3851 C CA  . LEU A 1 506 ? 7.601   40.462 59.273 1.00 17.42 ? 506 LEU A CA  1 
ATOM   3852 C C   . LEU A 1 506 ? 6.780   41.604 59.725 1.00 18.47 ? 506 LEU A C   1 
ATOM   3853 O O   . LEU A 1 506 ? 5.665   41.383 60.208 1.00 17.78 ? 506 LEU A O   1 
ATOM   3854 C CB  . LEU A 1 506 ? 8.673   40.195 60.299 1.00 16.59 ? 506 LEU A CB  1 
ATOM   3855 C CG  . LEU A 1 506 ? 8.202   40.052 61.741 1.00 15.53 ? 506 LEU A CG  1 
ATOM   3856 C CD1 . LEU A 1 506 ? 7.121   38.959 61.909 1.00 15.72 ? 506 LEU A CD1 1 
ATOM   3857 C CD2 . LEU A 1 506 ? 9.399   39.708 62.549 1.00 14.15 ? 506 LEU A CD2 1 
ATOM   3858 N N   . SER A 1 507 ? 7.293   42.824 59.531 1.00 20.19 ? 507 SER A N   1 
ATOM   3859 C CA  . SER A 1 507 ? 6.559   44.028 59.999 1.00 22.80 ? 507 SER A CA  1 
ATOM   3860 C C   . SER A 1 507 ? 5.245   44.302 59.341 1.00 21.71 ? 507 SER A C   1 
ATOM   3861 O O   . SER A 1 507 ? 4.362   44.895 59.970 1.00 22.75 ? 507 SER A O   1 
ATOM   3862 C CB  . SER A 1 507 ? 7.384   45.301 59.945 1.00 22.84 ? 507 SER A CB  1 
ATOM   3863 O OG  . SER A 1 507 ? 7.742   45.571 58.607 1.00 29.70 ? 507 SER A OG  1 
ATOM   3864 N N   . THR A 1 508 ? 5.153   43.949 58.061 1.00 21.33 ? 508 THR A N   1 
ATOM   3865 C CA  . THR A 1 508 ? 3.912   44.119 57.306 1.00 20.32 ? 508 THR A CA  1 
ATOM   3866 C C   . THR A 1 508 ? 2.916   43.031 57.801 1.00 19.46 ? 508 THR A C   1 
ATOM   3867 O O   . THR A 1 508 ? 1.705   43.290 57.924 1.00 18.61 ? 508 THR A O   1 
ATOM   3868 C CB  . THR A 1 508 ? 4.123   43.914 55.771 1.00 19.97 ? 508 THR A CB  1 
ATOM   3869 O OG1 . THR A 1 508 ? 5.269   44.658 55.311 1.00 18.07 ? 508 THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 508 ? 2.827   44.232 55.003 1.00 16.65 ? 508 THR A CG2 1 
ATOM   3871 N N   . VAL A 1 509 ? 3.428   41.819 58.048 1.00 17.48 ? 509 VAL A N   1 
ATOM   3872 C CA  . VAL A 1 509 ? 2.562   40.754 58.485 1.00 15.39 ? 509 VAL A CA  1 
ATOM   3873 C C   . VAL A 1 509 ? 2.041   41.152 59.817 1.00 14.61 ? 509 VAL A C   1 
ATOM   3874 O O   . VAL A 1 509 ? 0.854   41.185 59.992 1.00 16.47 ? 509 VAL A O   1 
ATOM   3875 C CB  . VAL A 1 509 ? 3.235   39.409 58.520 1.00 15.11 ? 509 VAL A CB  1 
ATOM   3876 C CG1 . VAL A 1 509 ? 2.500   38.509 59.461 1.00 16.34 ? 509 VAL A CG1 1 
ATOM   3877 C CG2 . VAL A 1 509 ? 3.173   38.786 57.144 1.00 14.92 ? 509 VAL A CG2 1 
ATOM   3878 N N   . GLN A 1 510 ? 2.907   41.519 60.742 1.00 14.34 ? 510 GLN A N   1 
ATOM   3879 C CA  . GLN A 1 510 ? 2.426   41.955 62.042 1.00 13.11 ? 510 GLN A CA  1 
ATOM   3880 C C   . GLN A 1 510 ? 1.456   43.144 61.907 1.00 11.77 ? 510 GLN A C   1 
ATOM   3881 O O   . GLN A 1 510 ? 0.490   43.244 62.660 1.00 11.80 ? 510 GLN A O   1 
ATOM   3882 C CB  . GLN A 1 510 ? 3.605   42.373 62.915 1.00 14.68 ? 510 GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 510 ? 4.427   41.204 63.453 1.00 18.47 ? 510 GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 510 ? 5.843   41.595 63.887 1.00 19.36 ? 510 GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 510 ? 6.355   42.674 63.534 1.00 20.30 ? 510 GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 510 ? 6.496   40.709 64.616 1.00 18.50 ? 510 GLN A NE2 1 
ATOM   3887 N N   . ALA A 1 511 ? 1.715   44.051 60.959 1.00 10.53 ? 511 ALA A N   1 
ATOM   3888 C CA  . ALA A 1 511 ? 0.870   45.253 60.776 1.00 9.32  ? 511 ALA A CA  1 
ATOM   3889 C C   . ALA A 1 511 ? -0.546  44.886 60.360 1.00 9.91  ? 511 ALA A C   1 
ATOM   3890 O O   . ALA A 1 511 ? -1.530  45.345 60.905 1.00 9.16  ? 511 ALA A O   1 
ATOM   3891 C CB  . ALA A 1 511 ? 1.490   46.202 59.740 1.00 6.18  ? 511 ALA A CB  1 
ATOM   3892 N N   . VAL A 1 512 ? -0.612  44.071 59.331 1.00 12.66 ? 512 VAL A N   1 
ATOM   3893 C CA  . VAL A 1 512 ? -1.838  43.596 58.767 1.00 13.52 ? 512 VAL A CA  1 
ATOM   3894 C C   . VAL A 1 512 ? -2.593  42.659 59.706 1.00 13.92 ? 512 VAL A C   1 
ATOM   3895 O O   . VAL A 1 512 ? -3.811  42.748 59.826 1.00 14.95 ? 512 VAL A O   1 
ATOM   3896 C CB  . VAL A 1 512 ? -1.485  42.877 57.468 1.00 13.55 ? 512 VAL A CB  1 
ATOM   3897 C CG1 . VAL A 1 512 ? -2.672  42.053 56.967 1.00 15.24 ? 512 VAL A CG1 1 
ATOM   3898 C CG2 . VAL A 1 512 ? -0.993  43.914 56.421 1.00 13.05 ? 512 VAL A CG2 1 
ATOM   3899 N N   . CYS A 1 513 ? -1.868  41.733 60.316 1.00 14.31 ? 513 CYS A N   1 
ATOM   3900 C CA  . CYS A 1 513 ? -2.459  40.775 61.216 1.00 15.05 ? 513 CYS A CA  1 
ATOM   3901 C C   . CYS A 1 513 ? -2.880  41.413 62.523 1.00 15.75 ? 513 CYS A C   1 
ATOM   3902 O O   . CYS A 1 513 ? -3.845  40.971 63.164 1.00 16.20 ? 513 CYS A O   1 
ATOM   3903 C CB  . CYS A 1 513 ? -1.499  39.629 61.491 1.00 15.68 ? 513 CYS A CB  1 
ATOM   3904 S SG  . CYS A 1 513 ? -1.107  38.596 60.049 1.00 14.28 ? 513 CYS A SG  1 
ATOM   3905 N N   . GLY A 1 514 ? -2.158  42.435 62.952 1.00 15.60 ? 514 GLY A N   1 
ATOM   3906 C CA  . GLY A 1 514 ? -2.581  43.091 64.171 1.00 16.96 ? 514 GLY A CA  1 
ATOM   3907 C C   . GLY A 1 514 ? -3.976  43.694 63.976 1.00 17.90 ? 514 GLY A C   1 
ATOM   3908 O O   . GLY A 1 514 ? -4.840  43.661 64.865 1.00 19.74 ? 514 GLY A O   1 
ATOM   3909 N N   . GLY A 1 515 ? -4.228  44.216 62.787 1.00 17.85 ? 515 GLY A N   1 
ATOM   3910 C CA  . GLY A 1 515 ? -5.517  44.824 62.538 1.00 18.65 ? 515 GLY A CA  1 
ATOM   3911 C C   . GLY A 1 515 ? -6.623  43.923 62.030 1.00 18.64 ? 515 GLY A C   1 
ATOM   3912 O O   . GLY A 1 515 ? -7.773  44.205 62.310 1.00 19.54 ? 515 GLY A O   1 
ATOM   3913 N N   . VAL A 1 516 ? -6.304  42.886 61.245 1.00 19.38 ? 516 VAL A N   1 
ATOM   3914 C CA  . VAL A 1 516 ? -7.329  41.965 60.713 1.00 17.94 ? 516 VAL A CA  1 
ATOM   3915 C C   . VAL A 1 516 ? -6.834  40.526 60.658 1.00 17.91 ? 516 VAL A C   1 
ATOM   3916 O O   . VAL A 1 516 ? -5.640  40.304 60.522 1.00 17.55 ? 516 VAL A O   1 
ATOM   3917 C CB  . VAL A 1 516 ? -7.778  42.417 59.300 1.00 17.08 ? 516 VAL A CB  1 
ATOM   3918 C CG1 . VAL A 1 516 ? -6.662  42.162 58.290 1.00 15.64 ? 516 VAL A CG1 1 
ATOM   3919 C CG2 . VAL A 1 516 ? -9.134  41.771 58.921 1.00 15.30 ? 516 VAL A CG2 1 
ATOM   3920 N N   . ARG A 1 517 ? -7.740  39.554 60.758 1.00 20.25 ? 517 ARG A N   1 
ATOM   3921 C CA  . ARG A 1 517 ? -7.357  38.141 60.684 1.00 22.44 ? 517 ARG A CA  1 
ATOM   3922 C C   . ARG A 1 517 ? -6.737  38.014 59.306 1.00 22.68 ? 517 ARG A C   1 
ATOM   3923 O O   . ARG A 1 517 ? -7.264  38.587 58.339 1.00 22.22 ? 517 ARG A O   1 
ATOM   3924 C CB  . ARG A 1 517 ? -8.560  37.208 60.866 1.00 25.74 ? 517 ARG A CB  1 
ATOM   3925 C CG  . ARG A 1 517 ? -9.886  37.779 60.466 1.00 29.95 ? 517 ARG A CG  1 
ATOM   3926 C CD  . ARG A 1 517 ? -10.951 36.688 60.456 1.00 35.10 ? 517 ARG A CD  1 
ATOM   3927 N NE  . ARG A 1 517 ? -12.167 37.094 59.724 1.00 38.92 ? 517 ARG A NE  1 
ATOM   3928 C CZ  . ARG A 1 517 ? -13.030 36.257 59.130 1.00 40.45 ? 517 ARG A CZ  1 
ATOM   3929 N NH1 . ARG A 1 517 ? -12.811 34.938 59.157 1.00 39.58 ? 517 ARG A NH1 1 
ATOM   3930 N NH2 . ARG A 1 517 ? -14.159 36.735 58.574 1.00 41.28 ? 517 ARG A NH2 1 
ATOM   3931 N N   . CYS A 1 518 ? -5.628  37.275 59.217 1.00 21.58 ? 518 CYS A N   1 
ATOM   3932 C CA  . CYS A 1 518 ? -4.840  37.157 57.982 1.00 19.47 ? 518 CYS A CA  1 
ATOM   3933 C C   . CYS A 1 518 ? -4.347  35.760 57.647 1.00 19.50 ? 518 CYS A C   1 
ATOM   3934 O O   . CYS A 1 518 ? -4.121  34.923 58.544 1.00 20.74 ? 518 CYS A O   1 
ATOM   3935 C CB  . CYS A 1 518 ? -3.573  38.009 58.164 1.00 18.19 ? 518 CYS A CB  1 
ATOM   3936 S SG  . CYS A 1 518 ? -2.741  37.434 59.681 1.00 18.86 ? 518 CYS A SG  1 
ATOM   3937 N N   . ALA A 1 519 ? -4.182  35.511 56.350 1.00 18.14 ? 519 ALA A N   1 
ATOM   3938 C CA  . ALA A 1 519 ? -3.591  34.259 55.876 1.00 16.67 ? 519 ALA A CA  1 
ATOM   3939 C C   . ALA A 1 519 ? -2.234  34.665 55.250 1.00 16.07 ? 519 ALA A C   1 
ATOM   3940 O O   . ALA A 1 519 ? -2.172  35.474 54.319 1.00 16.16 ? 519 ALA A O   1 
ATOM   3941 C CB  . ALA A 1 519 ? -4.475  33.577 54.846 1.00 16.78 ? 519 ALA A CB  1 
ATOM   3942 N N   . THR A 1 520 ? -1.142  34.201 55.840 1.00 14.55 ? 520 THR A N   1 
ATOM   3943 C CA  . THR A 1 520 ? 0.156   34.542 55.318 1.00 12.97 ? 520 THR A CA  1 
ATOM   3944 C C   . THR A 1 520 ? 0.609   33.481 54.354 1.00 12.70 ? 520 THR A C   1 
ATOM   3945 O O   . THR A 1 520 ? 0.479   32.270 54.607 1.00 13.47 ? 520 THR A O   1 
ATOM   3946 C CB  . THR A 1 520 ? 1.189   34.732 56.427 1.00 13.49 ? 520 THR A CB  1 
ATOM   3947 O OG1 . THR A 1 520 ? 0.861   35.913 57.171 1.00 13.38 ? 520 THR A OG1 1 
ATOM   3948 C CG2 . THR A 1 520 ? 2.591   34.892 55.827 1.00 13.11 ? 520 THR A CG2 1 
ATOM   3949 N N   . VAL A 1 521 ? 1.025   33.957 53.195 1.00 10.43 ? 521 VAL A N   1 
ATOM   3950 C CA  . VAL A 1 521 ? 1.524   33.101 52.151 1.00 9.09  ? 521 VAL A CA  1 
ATOM   3951 C C   . VAL A 1 521 ? 3.056   33.370 52.107 1.00 11.28 ? 521 VAL A C   1 
ATOM   3952 O O   . VAL A 1 521 ? 3.504   34.497 51.758 1.00 13.04 ? 521 VAL A O   1 
ATOM   3953 C CB  . VAL A 1 521 ? 0.865   33.437 50.784 1.00 5.78  ? 521 VAL A CB  1 
ATOM   3954 C CG1 . VAL A 1 521 ? 1.434   32.563 49.703 1.00 4.04  ? 521 VAL A CG1 1 
ATOM   3955 C CG2 . VAL A 1 521 ? -0.660  33.300 50.855 1.00 3.90  ? 521 VAL A CG2 1 
ATOM   3956 N N   . LEU A 1 522 ? 3.845   32.384 52.528 1.00 8.77  ? 522 LEU A N   1 
ATOM   3957 C CA  . LEU A 1 522 ? 5.284   32.539 52.508 1.00 9.63  ? 522 LEU A CA  1 
ATOM   3958 C C   . LEU A 1 522 ? 5.940   32.046 51.207 1.00 11.14 ? 522 LEU A C   1 
ATOM   3959 O O   . LEU A 1 522 ? 5.906   30.853 50.900 1.00 15.91 ? 522 LEU A O   1 
ATOM   3960 C CB  . LEU A 1 522 ? 5.879   31.815 53.693 1.00 8.06  ? 522 LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 522 ? 7.365   32.001 53.944 1.00 8.23  ? 522 LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 522 ? 7.781   33.486 54.091 1.00 7.92  ? 522 LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 522 ? 7.697   31.192 55.201 1.00 8.17  ? 522 LEU A CD2 1 
ATOM   3964 N N   . ILE A 1 523 ? 6.533   32.937 50.428 1.00 10.28 ? 523 ILE A N   1 
ATOM   3965 C CA  . ILE A 1 523 ? 7.167   32.506 49.187 1.00 8.76  ? 523 ILE A CA  1 
ATOM   3966 C C   . ILE A 1 523 ? 8.632   32.414 49.570 1.00 10.87 ? 523 ILE A C   1 
ATOM   3967 O O   . ILE A 1 523 ? 9.218   33.432 49.972 1.00 10.16 ? 523 ILE A O   1 
ATOM   3968 C CB  . ILE A 1 523 ? 7.019   33.579 48.082 1.00 8.04  ? 523 ILE A CB  1 
ATOM   3969 C CG1 . ILE A 1 523 ? 5.556   33.734 47.610 1.00 6.49  ? 523 ILE A CG1 1 
ATOM   3970 C CG2 . ILE A 1 523 ? 8.058   33.386 46.999 1.00 8.59  ? 523 ILE A CG2 1 
ATOM   3971 C CD1 . ILE A 1 523 ? 4.903   32.535 47.023 1.00 3.66  ? 523 ILE A CD1 1 
ATOM   3972 N N   . SER A 1 524 ? 9.179   31.189 49.527 1.00 11.35 ? 524 SER A N   1 
ATOM   3973 C CA  . SER A 1 524 ? 10.596  30.903 49.839 1.00 11.79 ? 524 SER A CA  1 
ATOM   3974 C C   . SER A 1 524 ? 11.098  29.676 49.062 1.00 13.72 ? 524 SER A C   1 
ATOM   3975 O O   . SER A 1 524 ? 10.312  28.884 48.517 1.00 15.25 ? 524 SER A O   1 
ATOM   3976 C CB  . SER A 1 524 ? 10.829  30.663 51.340 1.00 9.65  ? 524 SER A CB  1 
ATOM   3977 O OG  . SER A 1 524 ? 10.405  29.377 51.751 1.00 6.97  ? 524 SER A OG  1 
ATOM   3978 N N   . GLY A 1 525 ? 12.415  29.539 48.971 1.00 13.97 ? 525 GLY A N   1 
ATOM   3979 C CA  . GLY A 1 525 ? 12.980  28.395 48.283 1.00 15.26 ? 525 GLY A CA  1 
ATOM   3980 C C   . GLY A 1 525 ? 13.348  27.317 49.287 1.00 15.80 ? 525 GLY A C   1 
ATOM   3981 O O   . GLY A 1 525 ? 13.580  26.173 48.941 1.00 16.41 ? 525 GLY A O   1 
ATOM   3982 N N   . ARG A 1 526 ? 13.264  27.647 50.563 1.00 16.75 ? 526 ARG A N   1 
ATOM   3983 C CA  . ARG A 1 526 ? 13.647  26.710 51.606 1.00 15.98 ? 526 ARG A CA  1 
ATOM   3984 C C   . ARG A 1 526 ? 12.919  27.047 52.910 1.00 16.80 ? 526 ARG A C   1 
ATOM   3985 O O   . ARG A 1 526 ? 12.354  28.139 53.046 1.00 16.65 ? 526 ARG A O   1 
ATOM   3986 C CB  . ARG A 1 526 ? 15.154  26.870 51.813 1.00 14.68 ? 526 ARG A CB  1 
ATOM   3987 C CG  . ARG A 1 526 ? 15.529  28.318 51.934 1.00 11.67 ? 526 ARG A CG  1 
ATOM   3988 C CD  . ARG A 1 526 ? 16.961  28.483 51.852 1.00 10.53 ? 526 ARG A CD  1 
ATOM   3989 N NE  . ARG A 1 526 ? 17.284  29.800 51.352 1.00 10.40 ? 526 ARG A NE  1 
ATOM   3990 C CZ  . ARG A 1 526 ? 18.530  30.205 51.143 1.00 11.03 ? 526 ARG A CZ  1 
ATOM   3991 N NH1 . ARG A 1 526 ? 19.545  29.385 51.405 1.00 11.40 ? 526 ARG A NH1 1 
ATOM   3992 N NH2 . ARG A 1 526 ? 18.762  31.416 50.676 1.00 9.69  ? 526 ARG A NH2 1 
ATOM   3993 N N   . PRO A 1 527 ? 13.035  26.166 53.927 1.00 18.27 ? 527 PRO A N   1 
ATOM   3994 C CA  . PRO A 1 527 ? 12.868  26.597 55.320 1.00 19.26 ? 527 PRO A CA  1 
ATOM   3995 C C   . PRO A 1 527 ? 13.656  27.850 55.654 1.00 19.94 ? 527 PRO A C   1 
ATOM   3996 O O   . PRO A 1 527 ? 14.841  27.984 55.284 1.00 20.38 ? 527 PRO A O   1 
ATOM   3997 C CB  . PRO A 1 527 ? 13.375  25.400 56.108 1.00 18.77 ? 527 PRO A CB  1 
ATOM   3998 C CG  . PRO A 1 527 ? 12.889  24.265 55.246 1.00 19.96 ? 527 PRO A CG  1 
ATOM   3999 C CD  . PRO A 1 527 ? 13.268  24.708 53.860 1.00 18.49 ? 527 PRO A CD  1 
ATOM   4000 N N   . VAL A 1 528 ? 12.951  28.784 56.288 1.00 19.10 ? 528 VAL A N   1 
ATOM   4001 C CA  . VAL A 1 528 ? 13.509  30.065 56.739 1.00 17.63 ? 528 VAL A CA  1 
ATOM   4002 C C   . VAL A 1 528 ? 12.973  30.290 58.147 1.00 17.71 ? 528 VAL A C   1 
ATOM   4003 O O   . VAL A 1 528 ? 11.990  29.644 58.559 1.00 16.83 ? 528 VAL A O   1 
ATOM   4004 C CB  . VAL A 1 528 ? 13.110  31.304 55.824 1.00 16.49 ? 528 VAL A CB  1 
ATOM   4005 C CG1 . VAL A 1 528 ? 13.753  31.184 54.434 1.00 13.91 ? 528 VAL A CG1 1 
ATOM   4006 C CG2 . VAL A 1 528 ? 11.571  31.476 55.750 1.00 14.11 ? 528 VAL A CG2 1 
ATOM   4007 N N   . VAL A 1 529 ? 13.641  31.176 58.878 1.00 17.35 ? 529 VAL A N   1 
ATOM   4008 C CA  . VAL A 1 529 ? 13.238  31.516 60.243 1.00 15.86 ? 529 VAL A CA  1 
ATOM   4009 C C   . VAL A 1 529 ? 11.768  31.917 60.135 1.00 15.12 ? 529 VAL A C   1 
ATOM   4010 O O   . VAL A 1 529 ? 11.441  32.904 59.489 1.00 14.43 ? 529 VAL A O   1 
ATOM   4011 C CB  . VAL A 1 529 ? 14.129  32.674 60.779 1.00 14.66 ? 529 VAL A CB  1 
ATOM   4012 C CG1 . VAL A 1 529 ? 13.799  32.975 62.224 1.00 13.91 ? 529 VAL A CG1 1 
ATOM   4013 C CG2 . VAL A 1 529 ? 15.584  32.268 60.662 1.00 12.81 ? 529 VAL A CG2 1 
ATOM   4014 N N   . VAL A 1 530 ? 10.882  31.123 60.730 1.00 14.84 ? 530 VAL A N   1 
ATOM   4015 C CA  . VAL A 1 530 ? 9.429   31.356 60.645 1.00 15.36 ? 530 VAL A CA  1 
ATOM   4016 C C   . VAL A 1 530 ? 8.598   31.586 61.980 1.00 15.20 ? 530 VAL A C   1 
ATOM   4017 O O   . VAL A 1 530 ? 7.421   31.961 61.901 1.00 16.46 ? 530 VAL A O   1 
ATOM   4018 C CB  . VAL A 1 530 ? 8.812   30.158 59.844 1.00 14.68 ? 530 VAL A CB  1 
ATOM   4019 C CG1 . VAL A 1 530 ? 8.749   28.950 60.727 1.00 16.16 ? 530 VAL A CG1 1 
ATOM   4020 C CG2 . VAL A 1 530 ? 7.452   30.435 59.356 1.00 14.45 ? 530 VAL A CG2 1 
ATOM   4021 N N   . GLN A 1 531 ? 9.162   31.415 63.178 1.00 13.56 ? 531 GLN A N   1 
ATOM   4022 C CA  . GLN A 1 531 ? 8.352   31.571 64.385 1.00 11.26 ? 531 GLN A CA  1 
ATOM   4023 C C   . GLN A 1 531 ? 7.680   32.892 64.606 1.00 10.65 ? 531 GLN A C   1 
ATOM   4024 O O   . GLN A 1 531 ? 6.543   32.925 65.063 1.00 11.84 ? 531 GLN A O   1 
ATOM   4025 C CB  . GLN A 1 531 ? 9.107   31.210 65.644 1.00 11.64 ? 531 GLN A CB  1 
ATOM   4026 C CG  . GLN A 1 531 ? 9.498   29.778 65.732 1.00 13.20 ? 531 GLN A CG  1 
ATOM   4027 C CD  . GLN A 1 531 ? 10.900  29.557 65.222 1.00 15.43 ? 531 GLN A CD  1 
ATOM   4028 O OE1 . GLN A 1 531 ? 11.370  30.262 64.307 1.00 15.59 ? 531 GLN A OE1 1 
ATOM   4029 N NE2 . GLN A 1 531 ? 11.615  28.625 65.860 1.00 16.66 ? 531 GLN A NE2 1 
ATOM   4030 N N   . PRO A 1 532 ? 8.385   34.001 64.362 1.00 10.10 ? 532 PRO A N   1 
ATOM   4031 C CA  . PRO A 1 532 ? 7.743   35.329 64.269 1.00 10.42 ? 532 PRO A CA  1 
ATOM   4032 C C   . PRO A 1 532 ? 6.549   35.412 63.296 1.00 12.13 ? 532 PRO A C   1 
ATOM   4033 O O   . PRO A 1 532 ? 5.488   35.899 63.653 1.00 14.43 ? 532 PRO A O   1 
ATOM   4034 C CB  . PRO A 1 532 ? 8.877   36.228 63.798 1.00 8.21  ? 532 PRO A CB  1 
ATOM   4035 C CG  . PRO A 1 532 ? 10.072  35.565 64.316 1.00 8.00  ? 532 PRO A CG  1 
ATOM   4036 C CD  . PRO A 1 532 ? 9.831   34.092 64.099 1.00 8.37  ? 532 PRO A CD  1 
ATOM   4037 N N   . LEU A 1 533 ? 6.733   34.983 62.046 1.00 13.78 ? 533 LEU A N   1 
ATOM   4038 C CA  . LEU A 1 533 ? 5.639   35.018 61.075 1.00 14.94 ? 533 LEU A CA  1 
ATOM   4039 C C   . LEU A 1 533 ? 4.477   34.168 61.563 1.00 15.90 ? 533 LEU A C   1 
ATOM   4040 O O   . LEU A 1 533 ? 3.313   34.462 61.324 1.00 17.87 ? 533 LEU A O   1 
ATOM   4041 C CB  . LEU A 1 533 ? 6.099   34.518 59.699 1.00 14.56 ? 533 LEU A CB  1 
ATOM   4042 C CG  . LEU A 1 533 ? 6.880   35.556 58.902 1.00 14.98 ? 533 LEU A CG  1 
ATOM   4043 C CD1 . LEU A 1 533 ? 7.429   34.985 57.593 1.00 14.77 ? 533 LEU A CD1 1 
ATOM   4044 C CD2 . LEU A 1 533 ? 5.945   36.772 58.664 1.00 15.37 ? 533 LEU A CD2 1 
ATOM   4045 N N   . LEU A 1 534 ? 4.807   33.053 62.177 1.00 16.60 ? 534 LEU A N   1 
ATOM   4046 C CA  . LEU A 1 534 ? 3.795   32.157 62.707 1.00 16.48 ? 534 LEU A CA  1 
ATOM   4047 C C   . LEU A 1 534 ? 3.107   32.868 63.887 1.00 16.98 ? 534 LEU A C   1 
ATOM   4048 O O   . LEU A 1 534 ? 1.891   32.815 64.045 1.00 18.03 ? 534 LEU A O   1 
ATOM   4049 C CB  . LEU A 1 534 ? 4.488   30.864 63.137 1.00 15.84 ? 534 LEU A CB  1 
ATOM   4050 C CG  . LEU A 1 534 ? 4.073   29.514 62.559 1.00 15.68 ? 534 LEU A CG  1 
ATOM   4051 C CD1 . LEU A 1 534 ? 3.398   29.637 61.209 1.00 14.33 ? 534 LEU A CD1 1 
ATOM   4052 C CD2 . LEU A 1 534 ? 5.280   28.578 62.549 1.00 14.71 ? 534 LEU A CD2 1 
ATOM   4053 N N   . ALA A 1 535 ? 3.882   33.563 64.707 1.00 17.25 ? 535 ALA A N   1 
ATOM   4054 C CA  . ALA A 1 535 ? 3.308   34.258 65.847 1.00 16.57 ? 535 ALA A CA  1 
ATOM   4055 C C   . ALA A 1 535 ? 2.198   35.238 65.435 1.00 17.47 ? 535 ALA A C   1 
ATOM   4056 O O   . ALA A 1 535 ? 1.100   35.208 66.003 1.00 21.59 ? 535 ALA A O   1 
ATOM   4057 C CB  . ALA A 1 535 ? 4.370   34.943 66.600 1.00 14.59 ? 535 ALA A CB  1 
ATOM   4058 N N   . ALA A 1 536 ? 2.424   36.050 64.414 1.00 15.45 ? 536 ALA A N   1 
ATOM   4059 C CA  . ALA A 1 536 ? 1.386   37.005 63.992 1.00 12.99 ? 536 ALA A CA  1 
ATOM   4060 C C   . ALA A 1 536 ? 0.182   36.495 63.166 1.00 11.61 ? 536 ALA A C   1 
ATOM   4061 O O   . ALA A 1 536 ? -0.890  37.107 63.192 1.00 8.64  ? 536 ALA A O   1 
ATOM   4062 C CB  . ALA A 1 536 ? 2.037   38.133 63.205 1.00 12.75 ? 536 ALA A CB  1 
ATOM   4063 N N   . SER A 1 537 ? 0.352   35.391 62.440 1.00 10.28 ? 537 SER A N   1 
ATOM   4064 C CA  . SER A 1 537 ? -0.697  34.958 61.530 1.00 9.60  ? 537 SER A CA  1 
ATOM   4065 C C   . SER A 1 537 ? -1.789  34.055 62.042 1.00 10.60 ? 537 SER A C   1 
ATOM   4066 O O   . SER A 1 537 ? -1.555  33.305 62.992 1.00 10.30 ? 537 SER A O   1 
ATOM   4067 C CB  . SER A 1 537 ? -0.073  34.315 60.303 1.00 7.83  ? 537 SER A CB  1 
ATOM   4068 O OG  . SER A 1 537 ? 1.037   35.068 59.849 1.00 7.18  ? 537 SER A OG  1 
ATOM   4069 N N   . ASP A 1 538 ? -2.988  34.143 61.432 1.00 10.39 ? 538 ASP A N   1 
ATOM   4070 C CA  . ASP A 1 538 ? -4.084  33.243 61.801 1.00 10.04 ? 538 ASP A CA  1 
ATOM   4071 C C   . ASP A 1 538 ? -3.815  31.961 61.012 1.00 8.01  ? 538 ASP A C   1 
ATOM   4072 O O   . ASP A 1 538 ? -3.806  30.869 61.576 1.00 6.76  ? 538 ASP A O   1 
ATOM   4073 C CB  . ASP A 1 538 ? -5.452  33.813 61.493 1.00 12.41 ? 538 ASP A CB  1 
ATOM   4074 C CG  . ASP A 1 538 ? -5.715  35.085 62.232 1.00 14.36 ? 538 ASP A CG  1 
ATOM   4075 O OD1 . ASP A 1 538 ? -5.425  36.131 61.625 1.00 17.58 ? 538 ASP A OD1 1 
ATOM   4076 O OD2 . ASP A 1 538 ? -6.197  35.066 63.387 1.00 14.63 ? 538 ASP A OD2 1 
ATOM   4077 N N   . ALA A 1 539 ? -3.578  32.074 59.712 1.00 5.53  ? 539 ALA A N   1 
ATOM   4078 C CA  . ALA A 1 539 ? -3.185  30.868 58.965 1.00 5.09  ? 539 ALA A CA  1 
ATOM   4079 C C   . ALA A 1 539 ? -1.879  31.240 58.224 1.00 6.08  ? 539 ALA A C   1 
ATOM   4080 O O   . ALA A 1 539 ? -1.585  32.420 58.014 1.00 7.70  ? 539 ALA A O   1 
ATOM   4081 C CB  . ALA A 1 539 ? -4.279  30.384 58.010 1.00 2.00  ? 539 ALA A CB  1 
ATOM   4082 N N   . LEU A 1 540 ? -1.021  30.268 57.965 1.00 6.21  ? 540 LEU A N   1 
ATOM   4083 C CA  . LEU A 1 540 ? 0.220   30.534 57.257 1.00 7.35  ? 540 LEU A CA  1 
ATOM   4084 C C   . LEU A 1 540 ? 0.432   29.367 56.316 1.00 9.69  ? 540 LEU A C   1 
ATOM   4085 O O   . LEU A 1 540 ? 0.267   28.210 56.727 1.00 11.06 ? 540 LEU A O   1 
ATOM   4086 C CB  . LEU A 1 540 ? 1.377   30.609 58.234 1.00 6.21  ? 540 LEU A CB  1 
ATOM   4087 C CG  . LEU A 1 540 ? 2.698   31.040 57.600 1.00 6.44  ? 540 LEU A CG  1 
ATOM   4088 C CD1 . LEU A 1 540 ? 3.481   31.990 58.556 1.00 6.76  ? 540 LEU A CD1 1 
ATOM   4089 C CD2 . LEU A 1 540 ? 3.498   29.820 57.222 1.00 6.13  ? 540 LEU A CD2 1 
ATOM   4090 N N   . VAL A 1 541 ? 0.757   29.669 55.059 1.00 10.75 ? 541 VAL A N   1 
ATOM   4091 C CA  . VAL A 1 541 ? 0.987   28.648 54.031 1.00 11.33 ? 541 VAL A CA  1 
ATOM   4092 C C   . VAL A 1 541 ? 2.396   28.811 53.415 1.00 11.37 ? 541 VAL A C   1 
ATOM   4093 O O   . VAL A 1 541 ? 2.854   29.934 53.126 1.00 10.55 ? 541 VAL A O   1 
ATOM   4094 C CB  . VAL A 1 541 ? -0.092  28.743 52.860 1.00 12.54 ? 541 VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 541 ? 0.040   27.595 51.888 1.00 13.02 ? 541 VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 541 ? -1.546  28.783 53.398 1.00 13.40 ? 541 VAL A CG2 1 
ATOM   4097 N N   . ALA A 1 542 ? 3.105   27.691 53.302 1.00 10.44 ? 542 ALA A N   1 
ATOM   4098 C CA  . ALA A 1 542 ? 4.434   27.641 52.681 1.00 9.77  ? 542 ALA A CA  1 
ATOM   4099 C C   . ALA A 1 542 ? 4.184   27.368 51.185 1.00 8.85  ? 542 ALA A C   1 
ATOM   4100 O O   . ALA A 1 542 ? 3.823   26.240 50.794 1.00 8.41  ? 542 ALA A O   1 
ATOM   4101 C CB  . ALA A 1 542 ? 5.238   26.504 53.299 1.00 11.05 ? 542 ALA A CB  1 
ATOM   4102 N N   . ALA A 1 543 ? 4.314   28.392 50.359 1.00 6.83  ? 543 ALA A N   1 
ATOM   4103 C CA  . ALA A 1 543 ? 4.031   28.231 48.943 1.00 8.23  ? 543 ALA A CA  1 
ATOM   4104 C C   . ALA A 1 543 ? 5.238   27.858 48.137 1.00 9.61  ? 543 ALA A C   1 
ATOM   4105 O O   . ALA A 1 543 ? 5.115   27.629 46.946 1.00 11.55 ? 543 ALA A O   1 
ATOM   4106 C CB  . ALA A 1 543 ? 3.410   29.537 48.356 1.00 6.39  ? 543 ALA A CB  1 
ATOM   4107 N N   . TRP A 1 544 ? 6.406   27.838 48.780 1.00 10.69 ? 544 TRP A N   1 
ATOM   4108 C CA  . TRP A 1 544 ? 7.692   27.581 48.120 1.00 8.59  ? 544 TRP A CA  1 
ATOM   4109 C C   . TRP A 1 544 ? 7.815   28.617 46.965 1.00 9.18  ? 544 TRP A C   1 
ATOM   4110 O O   . TRP A 1 544 ? 7.413   29.775 47.125 1.00 10.48 ? 544 TRP A O   1 
ATOM   4111 C CB  . TRP A 1 544 ? 7.795   26.137 47.636 1.00 6.27  ? 544 TRP A CB  1 
ATOM   4112 C CG  . TRP A 1 544 ? 7.453   25.161 48.658 1.00 5.12  ? 544 TRP A CG  1 
ATOM   4113 C CD1 . TRP A 1 544 ? 6.382   24.326 48.644 1.00 5.73  ? 544 TRP A CD1 1 
ATOM   4114 C CD2 . TRP A 1 544 ? 8.141   24.896 49.887 1.00 6.19  ? 544 TRP A CD2 1 
ATOM   4115 N NE1 . TRP A 1 544 ? 6.346   23.551 49.779 1.00 6.17  ? 544 TRP A NE1 1 
ATOM   4116 C CE2 . TRP A 1 544 ? 7.428   23.882 50.564 1.00 6.92  ? 544 TRP A CE2 1 
ATOM   4117 C CE3 . TRP A 1 544 ? 9.304   25.421 50.484 1.00 5.31  ? 544 TRP A CE3 1 
ATOM   4118 C CZ2 . TRP A 1 544 ? 7.832   23.370 51.817 1.00 5.26  ? 544 TRP A CZ2 1 
ATOM   4119 C CZ3 . TRP A 1 544 ? 9.704   24.918 51.711 1.00 3.68  ? 544 TRP A CZ3 1 
ATOM   4120 C CH2 . TRP A 1 544 ? 8.974   23.903 52.364 1.00 4.17  ? 544 TRP A CH2 1 
ATOM   4121 N N   . LEU A 1 545 ? 8.386   28.247 45.829 1.00 9.18  ? 545 LEU A N   1 
ATOM   4122 C CA  . LEU A 1 545 ? 8.510   29.178 44.703 1.00 7.84  ? 545 LEU A CA  1 
ATOM   4123 C C   . LEU A 1 545 ? 7.551   28.740 43.600 1.00 7.54  ? 545 LEU A C   1 
ATOM   4124 O O   . LEU A 1 545 ? 7.964   28.098 42.616 1.00 6.65  ? 545 LEU A O   1 
ATOM   4125 C CB  . LEU A 1 545 ? 9.960   29.228 44.177 1.00 6.17  ? 545 LEU A CB  1 
ATOM   4126 C CG  . LEU A 1 545 ? 10.952  29.819 45.166 1.00 5.32  ? 545 LEU A CG  1 
ATOM   4127 C CD1 . LEU A 1 545 ? 12.343  29.356 44.776 1.00 3.71  ? 545 LEU A CD1 1 
ATOM   4128 C CD2 . LEU A 1 545 ? 10.780  31.338 45.271 1.00 3.33  ? 545 LEU A CD2 1 
ATOM   4129 N N   . PRO A 1 546 ? 6.257   29.081 43.760 1.00 7.54  ? 546 PRO A N   1 
ATOM   4130 C CA  . PRO A 1 546 ? 5.189   28.356 43.065 1.00 6.14  ? 546 PRO A CA  1 
ATOM   4131 C C   . PRO A 1 546 ? 5.202   28.462 41.568 1.00 6.05  ? 546 PRO A C   1 
ATOM   4132 O O   . PRO A 1 546 ? 4.622   27.604 40.930 1.00 7.92  ? 546 PRO A O   1 
ATOM   4133 C CB  . PRO A 1 546 ? 3.929   28.948 43.623 1.00 6.24  ? 546 PRO A CB  1 
ATOM   4134 C CG  . PRO A 1 546 ? 4.389   30.388 44.039 1.00 7.73  ? 546 PRO A CG  1 
ATOM   4135 C CD  . PRO A 1 546 ? 5.731   30.172 44.603 1.00 6.43  ? 546 PRO A CD  1 
ATOM   4136 N N   . GLY A 1 547 ? 5.844   29.474 40.991 1.00 4.51  ? 547 GLY A N   1 
ATOM   4137 C CA  . GLY A 1 547 ? 5.828   29.573 39.540 1.00 5.62  ? 547 GLY A CA  1 
ATOM   4138 C C   . GLY A 1 547 ? 4.974   30.676 38.926 1.00 6.70  ? 547 GLY A C   1 
ATOM   4139 O O   . GLY A 1 547 ? 4.515   31.568 39.621 1.00 8.14  ? 547 GLY A O   1 
ATOM   4140 N N   . SER A 1 548 ? 4.761   30.632 37.619 1.00 7.51  ? 548 SER A N   1 
ATOM   4141 C CA  . SER A 1 548 ? 3.990   31.668 36.948 1.00 7.97  ? 548 SER A CA  1 
ATOM   4142 C C   . SER A 1 548 ? 2.476   31.632 37.224 1.00 9.03  ? 548 SER A C   1 
ATOM   4143 O O   . SER A 1 548 ? 1.839   32.696 37.254 1.00 11.56 ? 548 SER A O   1 
ATOM   4144 C CB  . SER A 1 548 ? 4.261   31.672 35.420 1.00 8.74  ? 548 SER A CB  1 
ATOM   4145 O OG  . SER A 1 548 ? 3.921   30.430 34.793 1.00 8.92  ? 548 SER A OG  1 
ATOM   4146 N N   . GLU A 1 549 ? 1.888   30.461 37.486 1.00 7.51  ? 549 GLU A N   1 
ATOM   4147 C CA  . GLU A 1 549 ? 0.445   30.433 37.674 1.00 6.25  ? 549 GLU A CA  1 
ATOM   4148 C C   . GLU A 1 549 ? -0.051  30.631 39.096 1.00 6.63  ? 549 GLU A C   1 
ATOM   4149 O O   . GLU A 1 549 ? -0.408  29.676 39.758 1.00 7.45  ? 549 GLU A O   1 
ATOM   4150 C CB  . GLU A 1 549 ? -0.132  29.156 37.084 1.00 6.58  ? 549 GLU A CB  1 
ATOM   4151 C CG  . GLU A 1 549 ? 0.276   28.888 35.648 1.00 7.11  ? 549 GLU A CG  1 
ATOM   4152 C CD  . GLU A 1 549 ? 0.005   30.047 34.723 1.00 8.07  ? 549 GLU A CD  1 
ATOM   4153 O OE1 . GLU A 1 549 ? -1.132  30.526 34.735 1.00 9.33  ? 549 GLU A OE1 1 
ATOM   4154 O OE2 . GLU A 1 549 ? 0.923   30.467 33.985 1.00 8.09  ? 549 GLU A OE2 1 
ATOM   4155 N N   . GLY A 1 550 ? -0.135  31.870 39.555 1.00 6.77  ? 550 GLY A N   1 
ATOM   4156 C CA  . GLY A 1 550 ? -0.561  32.122 40.917 1.00 7.37  ? 550 GLY A CA  1 
ATOM   4157 C C   . GLY A 1 550 ? -1.908  31.628 41.407 1.00 9.27  ? 550 GLY A C   1 
ATOM   4158 O O   . GLY A 1 550 ? -2.129  31.632 42.614 1.00 9.58  ? 550 GLY A O   1 
ATOM   4159 N N   . GLN A 1 551 ? -2.846  31.326 40.509 1.00 11.68 ? 551 GLN A N   1 
ATOM   4160 C CA  . GLN A 1 551 ? -4.181  30.790 40.874 1.00 11.43 ? 551 GLN A CA  1 
ATOM   4161 C C   . GLN A 1 551 ? -4.106  29.450 41.610 1.00 9.79  ? 551 GLN A C   1 
ATOM   4162 O O   . GLN A 1 551 ? -5.018  29.069 42.305 1.00 10.51 ? 551 GLN A O   1 
ATOM   4163 C CB  . GLN A 1 551 ? -5.041  30.631 39.618 1.00 14.30 ? 551 GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 551 ? -5.279  31.983 38.912 1.00 19.07 ? 551 GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 551 ? -6.119  31.879 37.637 1.00 21.17 ? 551 GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 551 ? -7.344  31.720 37.687 1.00 22.37 ? 551 GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 551 ? -5.455  31.973 36.485 1.00 22.77 ? 551 GLN A NE2 1 
ATOM   4168 N N   . GLY A 1 552 ? -3.022  28.717 41.434 1.00 8.38  ? 552 GLY A N   1 
ATOM   4169 C CA  . GLY A 1 552 ? -2.884  27.464 42.127 1.00 8.00  ? 552 GLY A CA  1 
ATOM   4170 C C   . GLY A 1 552 ? -2.924  27.754 43.603 1.00 9.01  ? 552 GLY A C   1 
ATOM   4171 O O   . GLY A 1 552 ? -3.389  26.925 44.356 1.00 9.73  ? 552 GLY A O   1 
ATOM   4172 N N   . VAL A 1 553 ? -2.366  28.899 44.017 1.00 10.80 ? 553 VAL A N   1 
ATOM   4173 C CA  . VAL A 1 553 ? -2.331  29.347 45.436 1.00 11.34 ? 553 VAL A CA  1 
ATOM   4174 C C   . VAL A 1 553 ? -3.733  29.683 45.958 1.00 12.18 ? 553 VAL A C   1 
ATOM   4175 O O   . VAL A 1 553 ? -4.067  29.312 47.080 1.00 13.45 ? 553 VAL A O   1 
ATOM   4176 C CB  . VAL A 1 553 ? -1.492  30.646 45.664 1.00 10.61 ? 553 VAL A CB  1 
ATOM   4177 C CG1 . VAL A 1 553 ? -1.571  31.051 47.135 1.00 9.93  ? 553 VAL A CG1 1 
ATOM   4178 C CG2 . VAL A 1 553 ? -0.069  30.448 45.224 1.00 9.64  ? 553 VAL A CG2 1 
ATOM   4179 N N   . THR A 1 554 ? -4.453  30.535 45.229 1.00 10.00 ? 554 THR A N   1 
ATOM   4180 C CA  . THR A 1 554 ? -5.798  30.867 45.616 1.00 10.58 ? 554 THR A CA  1 
ATOM   4181 C C   . THR A 1 554 ? -6.796  29.721 45.350 1.00 12.47 ? 554 THR A C   1 
ATOM   4182 O O   . THR A 1 554 ? -7.976  29.763 45.777 1.00 15.13 ? 554 THR A O   1 
ATOM   4183 C CB  . THR A 1 554 ? -6.281  32.119 44.969 1.00 9.37  ? 554 THR A CB  1 
ATOM   4184 O OG1 . THR A 1 554 ? -5.810  32.147 43.636 1.00 10.03 ? 554 THR A OG1 1 
ATOM   4185 C CG2 . THR A 1 554 ? -5.806  33.339 45.723 1.00 8.42  ? 554 THR A CG2 1 
ATOM   4186 N N   . ASP A 1 555 ? -6.350  28.681 44.660 1.00 12.89 ? 555 ASP A N   1 
ATOM   4187 C CA  . ASP A 1 555 ? -7.246  27.544 44.448 1.00 13.02 ? 555 ASP A CA  1 
ATOM   4188 C C   . ASP A 1 555 ? -7.434  26.821 45.794 1.00 12.39 ? 555 ASP A C   1 
ATOM   4189 O O   . ASP A 1 555 ? -8.373  26.021 45.981 1.00 11.98 ? 555 ASP A O   1 
ATOM   4190 C CB  . ASP A 1 555 ? -6.637  26.552 43.480 1.00 12.37 ? 555 ASP A CB  1 
ATOM   4191 C CG  . ASP A 1 555 ? -6.877  26.914 42.056 1.00 12.52 ? 555 ASP A CG  1 
ATOM   4192 O OD1 . ASP A 1 555 ? -7.848  27.615 41.736 1.00 12.72 ? 555 ASP A OD1 1 
ATOM   4193 O OD2 . ASP A 1 555 ? -6.089  26.452 41.223 1.00 15.53 ? 555 ASP A OD2 1 
ATOM   4194 N N   . ALA A 1 556 ? -6.491  27.066 46.702 1.00 9.85  ? 556 ALA A N   1 
ATOM   4195 C CA  . ALA A 1 556 ? -6.497  26.408 47.982 1.00 8.80  ? 556 ALA A CA  1 
ATOM   4196 C C   . ALA A 1 556 ? -7.000  27.355 49.049 1.00 9.30  ? 556 ALA A C   1 
ATOM   4197 O O   . ALA A 1 556 ? -7.843  26.968 49.881 1.00 6.77  ? 556 ALA A O   1 
ATOM   4198 C CB  . ALA A 1 556 ? -5.091  25.889 48.308 1.00 7.24  ? 556 ALA A CB  1 
ATOM   4199 N N   . LEU A 1 557 ? -6.509  28.604 49.023 1.00 8.82  ? 557 LEU A N   1 
ATOM   4200 C CA  . LEU A 1 557 ? -6.946  29.570 50.029 1.00 8.30  ? 557 LEU A CA  1 
ATOM   4201 C C   . LEU A 1 557 ? -8.463  29.651 50.031 1.00 9.48  ? 557 LEU A C   1 
ATOM   4202 O O   . LEU A 1 557 ? -9.091  29.676 51.092 1.00 11.23 ? 557 LEU A O   1 
ATOM   4203 C CB  . LEU A 1 557 ? -6.373  30.967 49.799 1.00 6.00  ? 557 LEU A CB  1 
ATOM   4204 C CG  . LEU A 1 557 ? -4.865  31.232 49.793 1.00 6.31  ? 557 LEU A CG  1 
ATOM   4205 C CD1 . LEU A 1 557 ? -4.678  32.714 49.454 1.00 4.38  ? 557 LEU A CD1 1 
ATOM   4206 C CD2 . LEU A 1 557 ? -4.137  30.870 51.098 1.00 4.40  ? 557 LEU A CD2 1 
ATOM   4207 N N   . PHE A 1 558 ? -9.046  29.652 48.839 1.00 9.88  ? 558 PHE A N   1 
ATOM   4208 C CA  . PHE A 1 558 ? -10.479 29.766 48.726 1.00 10.82 ? 558 PHE A CA  1 
ATOM   4209 C C   . PHE A 1 558 ? -11.299 28.490 48.772 1.00 12.14 ? 558 PHE A C   1 
ATOM   4210 O O   . PHE A 1 558 ? -12.505 28.521 48.516 1.00 13.52 ? 558 PHE A O   1 
ATOM   4211 C CB  . PHE A 1 558 ? -10.837 30.612 47.515 1.00 10.18 ? 558 PHE A CB  1 
ATOM   4212 C CG  . PHE A 1 558 ? -10.461 32.058 47.680 1.00 10.25 ? 558 PHE A CG  1 
ATOM   4213 C CD1 . PHE A 1 558 ? -9.393  32.610 46.971 1.00 10.42 ? 558 PHE A CD1 1 
ATOM   4214 C CD2 . PHE A 1 558 ? -11.117 32.850 48.593 1.00 8.94  ? 558 PHE A CD2 1 
ATOM   4215 C CE1 . PHE A 1 558 ? -8.993  33.922 47.185 1.00 9.64  ? 558 PHE A CE1 1 
ATOM   4216 C CE2 . PHE A 1 558 ? -10.708 34.157 48.803 1.00 9.79  ? 558 PHE A CE2 1 
ATOM   4217 C CZ  . PHE A 1 558 ? -9.649  34.688 48.096 1.00 8.75  ? 558 PHE A CZ  1 
ATOM   4218 N N   . GLY A 1 559 ? -10.668 27.366 49.093 1.00 11.86 ? 559 GLY A N   1 
ATOM   4219 C CA  . GLY A 1 559 ? -11.413 26.115 49.165 1.00 12.55 ? 559 GLY A CA  1 
ATOM   4220 C C   . GLY A 1 559 ? -11.788 25.360 47.898 1.00 12.96 ? 559 GLY A C   1 
ATOM   4221 O O   . GLY A 1 559 ? -12.410 24.307 47.969 1.00 13.88 ? 559 GLY A O   1 
ATOM   4222 N N   . ASP A 1 560 ? -11.408 25.855 46.729 1.00 14.35 ? 560 ASP A N   1 
ATOM   4223 C CA  . ASP A 1 560 ? -11.705 25.153 45.487 1.00 14.05 ? 560 ASP A CA  1 
ATOM   4224 C C   . ASP A 1 560 ? -11.068 23.795 45.555 1.00 13.51 ? 560 ASP A C   1 
ATOM   4225 O O   . ASP A 1 560 ? -11.444 22.915 44.819 1.00 18.35 ? 560 ASP A O   1 
ATOM   4226 C CB  . ASP A 1 560 ? -11.180 25.924 44.280 1.00 16.21 ? 560 ASP A CB  1 
ATOM   4227 C CG  . ASP A 1 560 ? -12.168 26.990 43.772 1.00 18.37 ? 560 ASP A CG  1 
ATOM   4228 O OD1 . ASP A 1 560 ? -13.218 27.260 44.418 1.00 17.89 ? 560 ASP A OD1 1 
ATOM   4229 O OD2 . ASP A 1 560 ? -11.901 27.532 42.674 1.00 20.16 ? 560 ASP A OD2 1 
ATOM   4230 N N   . PHE A 1 561 ? -10.027 23.640 46.343 1.00 10.49 ? 561 PHE A N   1 
ATOM   4231 C CA  . PHE A 1 561 ? -9.429  22.344 46.516 1.00 8.42  ? 561 PHE A CA  1 
ATOM   4232 C C   . PHE A 1 561 ? -8.919  22.459 47.890 1.00 11.48 ? 561 PHE A C   1 
ATOM   4233 O O   . PHE A 1 561 ? -8.757  23.584 48.381 1.00 12.68 ? 561 PHE A O   1 
ATOM   4234 C CB  . PHE A 1 561 ? -8.265  22.147 45.615 1.00 7.76  ? 561 PHE A CB  1 
ATOM   4235 C CG  . PHE A 1 561 ? -8.636  22.076 44.204 1.00 8.21  ? 561 PHE A CG  1 
ATOM   4236 C CD1 . PHE A 1 561 ? -8.753  23.248 43.433 1.00 6.95  ? 561 PHE A CD1 1 
ATOM   4237 C CD2 . PHE A 1 561 ? -8.887  20.836 43.617 1.00 6.92  ? 561 PHE A CD2 1 
ATOM   4238 C CE1 . PHE A 1 561 ? -9.112  23.165 42.112 1.00 5.83  ? 561 PHE A CE1 1 
ATOM   4239 C CE2 . PHE A 1 561 ? -9.244  20.752 42.289 1.00 5.53  ? 561 PHE A CE2 1 
ATOM   4240 C CZ  . PHE A 1 561 ? -9.355  21.916 41.536 1.00 4.77  ? 561 PHE A CZ  1 
ATOM   4241 N N   . GLY A 1 562 ? -8.625  21.315 48.508 1.00 11.88 ? 562 GLY A N   1 
ATOM   4242 C CA  . GLY A 1 562 ? -8.127  21.317 49.884 1.00 11.41 ? 562 GLY A CA  1 
ATOM   4243 C C   . GLY A 1 562 ? -6.634  21.214 49.906 1.00 10.29 ? 562 GLY A C   1 
ATOM   4244 O O   . GLY A 1 562 ? -6.085  20.822 48.906 1.00 9.96  ? 562 GLY A O   1 
ATOM   4245 N N   . PHE A 1 563 ? -5.976  21.584 51.000 1.00 11.54 ? 563 PHE A N   1 
ATOM   4246 C CA  . PHE A 1 563 ? -4.511  21.497 51.047 1.00 12.30 ? 563 PHE A CA  1 
ATOM   4247 C C   . PHE A 1 563 ? -4.053  20.071 51.199 1.00 13.78 ? 563 PHE A C   1 
ATOM   4248 O O   . PHE A 1 563 ? -4.573  19.330 52.030 1.00 14.83 ? 563 PHE A O   1 
ATOM   4249 C CB  . PHE A 1 563 ? -3.950  22.289 52.213 1.00 11.06 ? 563 PHE A CB  1 
ATOM   4250 C CG  . PHE A 1 563 ? -4.054  23.739 52.046 1.00 10.18 ? 563 PHE A CG  1 
ATOM   4251 C CD1 . PHE A 1 563 ? -5.254  24.378 52.258 1.00 10.45 ? 563 PHE A CD1 1 
ATOM   4252 C CD2 . PHE A 1 563 ? -2.957  24.479 51.680 1.00 11.56 ? 563 PHE A CD2 1 
ATOM   4253 C CE1 . PHE A 1 563 ? -5.374  25.748 52.118 1.00 10.36 ? 563 PHE A CE1 1 
ATOM   4254 C CE2 . PHE A 1 563 ? -3.056  25.869 51.532 1.00 11.87 ? 563 PHE A CE2 1 
ATOM   4255 C CZ  . PHE A 1 563 ? -4.271  26.500 51.748 1.00 11.30 ? 563 PHE A CZ  1 
ATOM   4256 N N   . THR A 1 564 ? -3.068  19.689 50.406 1.00 16.24 ? 564 THR A N   1 
ATOM   4257 C CA  . THR A 1 564 ? -2.538  18.330 50.455 1.00 16.30 ? 564 THR A CA  1 
ATOM   4258 C C   . THR A 1 564 ? -1.012  18.224 50.596 1.00 18.06 ? 564 THR A C   1 
ATOM   4259 O O   . THR A 1 564 ? -0.546  17.210 51.081 1.00 20.19 ? 564 THR A O   1 
ATOM   4260 C CB  . THR A 1 564 ? -3.023  17.467 49.244 1.00 14.55 ? 564 THR A CB  1 
ATOM   4261 O OG1 . THR A 1 564 ? -2.884  18.179 48.013 1.00 12.55 ? 564 THR A OG1 1 
ATOM   4262 C CG2 . THR A 1 564 ? -4.434  17.125 49.394 1.00 12.55 ? 564 THR A CG2 1 
ATOM   4263 N N   . GLY A 1 565 ? -0.238  19.254 50.256 1.00 18.96 ? 565 GLY A N   1 
ATOM   4264 C CA  . GLY A 1 565 ? 1.216   19.133 50.387 1.00 20.28 ? 565 GLY A CA  1 
ATOM   4265 C C   . GLY A 1 565 ? 1.798   18.829 51.788 1.00 21.15 ? 565 GLY A C   1 
ATOM   4266 O O   . GLY A 1 565 ? 1.203   19.156 52.824 1.00 21.52 ? 565 GLY A O   1 
ATOM   4267 N N   . ARG A 1 566 ? 2.985   18.224 51.848 1.00 19.99 ? 566 ARG A N   1 
ATOM   4268 C CA  . ARG A 1 566 ? 3.603   17.895 53.139 1.00 19.35 ? 566 ARG A CA  1 
ATOM   4269 C C   . ARG A 1 566 ? 5.065   18.230 53.037 1.00 16.78 ? 566 ARG A C   1 
ATOM   4270 O O   . ARG A 1 566 ? 5.675   17.901 52.037 1.00 14.61 ? 566 ARG A O   1 
ATOM   4271 C CB  . ARG A 1 566 ? 3.576   16.407 53.407 1.00 22.15 ? 566 ARG A CB  1 
ATOM   4272 C CG  . ARG A 1 566 ? 2.428   15.728 52.905 1.00 26.57 ? 566 ARG A CG  1 
ATOM   4273 C CD  . ARG A 1 566 ? 1.523   15.605 53.982 1.00 32.46 ? 566 ARG A CD  1 
ATOM   4274 N NE  . ARG A 1 566 ? 0.868   14.302 53.956 1.00 39.43 ? 566 ARG A NE  1 
ATOM   4275 C CZ  . ARG A 1 566 ? 1.443   13.118 53.703 1.00 41.30 ? 566 ARG A CZ  1 
ATOM   4276 N NH1 . ARG A 1 566 ? 2.731   13.030 53.409 1.00 42.33 ? 566 ARG A NH1 1 
ATOM   4277 N NH2 . ARG A 1 566 ? 0.745   11.987 53.903 1.00 43.79 ? 566 ARG A NH2 1 
ATOM   4278 N N   . LEU A 1 567 ? 5.643   18.740 54.123 1.00 15.10 ? 567 LEU A N   1 
ATOM   4279 C CA  . LEU A 1 567 ? 7.040   19.124 54.143 1.00 15.61 ? 567 LEU A CA  1 
ATOM   4280 C C   . LEU A 1 567 ? 7.873   18.023 53.492 1.00 17.00 ? 567 LEU A C   1 
ATOM   4281 O O   . LEU A 1 567 ? 7.738   16.842 53.872 1.00 17.67 ? 567 LEU A O   1 
ATOM   4282 C CB  . LEU A 1 567 ? 7.535   19.435 55.566 1.00 14.01 ? 567 LEU A CB  1 
ATOM   4283 C CG  . LEU A 1 567 ? 7.065   20.742 56.237 1.00 13.48 ? 567 LEU A CG  1 
ATOM   4284 C CD1 . LEU A 1 567 ? 7.738   20.883 57.548 1.00 13.84 ? 567 LEU A CD1 1 
ATOM   4285 C CD2 . LEU A 1 567 ? 7.375   21.974 55.428 1.00 14.13 ? 567 LEU A CD2 1 
ATOM   4286 N N   . PRO A 1 568 ? 8.630   18.383 52.407 1.00 16.56 ? 568 PRO A N   1 
ATOM   4287 C CA  . PRO A 1 568 ? 9.696   17.588 51.777 1.00 14.97 ? 568 PRO A CA  1 
ATOM   4288 C C   . PRO A 1 568 ? 11.061  17.819 52.478 1.00 16.80 ? 568 PRO A C   1 
ATOM   4289 O O   . PRO A 1 568 ? 12.124  17.318 52.063 1.00 16.91 ? 568 PRO A O   1 
ATOM   4290 C CB  . PRO A 1 568 ? 9.694   18.141 50.368 1.00 14.53 ? 568 PRO A CB  1 
ATOM   4291 C CG  . PRO A 1 568 ? 9.481   19.640 50.633 1.00 14.51 ? 568 PRO A CG  1 
ATOM   4292 C CD  . PRO A 1 568 ? 8.431   19.670 51.693 1.00 13.19 ? 568 PRO A CD  1 
ATOM   4293 N N   . ARG A 1 569 ? 11.023  18.627 53.533 1.00 17.16 ? 569 ARG A N   1 
ATOM   4294 C CA  . ARG A 1 569 ? 12.188  18.968 54.329 1.00 16.68 ? 569 ARG A CA  1 
ATOM   4295 C C   . ARG A 1 569 ? 11.778  19.203 55.784 1.00 17.14 ? 569 ARG A C   1 
ATOM   4296 O O   . ARG A 1 569 ? 10.606  19.530 56.090 1.00 17.29 ? 569 ARG A O   1 
ATOM   4297 C CB  . ARG A 1 569 ? 12.761  20.279 53.853 1.00 17.84 ? 569 ARG A CB  1 
ATOM   4298 C CG  . ARG A 1 569 ? 13.416  20.251 52.585 1.00 19.96 ? 569 ARG A CG  1 
ATOM   4299 C CD  . ARG A 1 569 ? 14.327  21.436 52.518 1.00 23.32 ? 569 ARG A CD  1 
ATOM   4300 N NE  . ARG A 1 569 ? 15.575  21.149 53.219 1.00 25.46 ? 569 ARG A NE  1 
ATOM   4301 C CZ  . ARG A 1 569 ? 16.562  20.402 52.727 1.00 26.14 ? 569 ARG A CZ  1 
ATOM   4302 N NH1 . ARG A 1 569 ? 17.651  20.176 53.455 1.00 26.79 ? 569 ARG A NH1 1 
ATOM   4303 N NH2 . ARG A 1 569 ? 16.487  19.921 51.493 1.00 26.62 ? 569 ARG A NH2 1 
ATOM   4304 N N   . THR A 1 570 ? 12.780  19.149 56.655 1.00 15.57 ? 570 THR A N   1 
ATOM   4305 C CA  . THR A 1 570 ? 12.606  19.399 58.077 1.00 15.00 ? 570 THR A CA  1 
ATOM   4306 C C   . THR A 1 570 ? 12.521  20.914 58.268 1.00 16.11 ? 570 THR A C   1 
ATOM   4307 O O   . THR A 1 570 ? 13.257  21.656 57.599 1.00 14.77 ? 570 THR A O   1 
ATOM   4308 C CB  . THR A 1 570 ? 13.850  18.920 58.850 1.00 14.15 ? 570 THR A CB  1 
ATOM   4309 O OG1 . THR A 1 570 ? 13.917  17.495 58.799 1.00 14.51 ? 570 THR A OG1 1 
ATOM   4310 C CG2 . THR A 1 570 ? 13.818  19.364 60.296 1.00 12.00 ? 570 THR A CG2 1 
ATOM   4311 N N   . TRP A 1 571 ? 11.594  21.399 59.104 1.00 16.26 ? 571 TRP A N   1 
ATOM   4312 C CA  . TRP A 1 571 ? 11.586  22.855 59.362 1.00 16.06 ? 571 TRP A CA  1 
ATOM   4313 C C   . TRP A 1 571 ? 12.311  22.985 60.705 1.00 16.24 ? 571 TRP A C   1 
ATOM   4314 O O   . TRP A 1 571 ? 11.969  22.291 61.672 1.00 17.69 ? 571 TRP A O   1 
ATOM   4315 C CB  . TRP A 1 571 ? 10.191  23.469 59.397 1.00 13.79 ? 571 TRP A CB  1 
ATOM   4316 C CG  . TRP A 1 571 ? 10.243  24.925 59.021 1.00 13.45 ? 571 TRP A CG  1 
ATOM   4317 C CD1 . TRP A 1 571 ? 10.881  25.925 59.706 1.00 13.27 ? 571 TRP A CD1 1 
ATOM   4318 C CD2 . TRP A 1 571 ? 9.640   25.550 57.879 1.00 13.01 ? 571 TRP A CD2 1 
ATOM   4319 N NE1 . TRP A 1 571 ? 10.710  27.130 59.069 1.00 12.90 ? 571 TRP A NE1 1 
ATOM   4320 C CE2 . TRP A 1 571 ? 9.956   26.937 57.952 1.00 13.55 ? 571 TRP A CE2 1 
ATOM   4321 C CE3 . TRP A 1 571 ? 8.873   25.069 56.808 1.00 13.78 ? 571 TRP A CE3 1 
ATOM   4322 C CZ2 . TRP A 1 571 ? 9.529   27.862 56.973 1.00 13.44 ? 571 TRP A CZ2 1 
ATOM   4323 C CZ3 . TRP A 1 571 ? 8.446   25.980 55.830 1.00 14.61 ? 571 TRP A CZ3 1 
ATOM   4324 C CH2 . TRP A 1 571 ? 8.779   27.374 55.925 1.00 15.53 ? 571 TRP A CH2 1 
ATOM   4325 N N   . PHE A 1 572 ? 13.416  23.718 60.690 1.00 15.49 ? 572 PHE A N   1 
ATOM   4326 C CA  . PHE A 1 572 ? 14.277  23.893 61.853 1.00 16.71 ? 572 PHE A CA  1 
ATOM   4327 C C   . PHE A 1 572 ? 13.825  24.959 62.816 1.00 19.15 ? 572 PHE A C   1 
ATOM   4328 O O   . PHE A 1 572 ? 13.213  25.952 62.414 1.00 20.40 ? 572 PHE A O   1 
ATOM   4329 C CB  . PHE A 1 572 ? 15.693  24.238 61.385 1.00 13.99 ? 572 PHE A CB  1 
ATOM   4330 C CG  . PHE A 1 572 ? 15.747  25.438 60.499 1.00 11.42 ? 572 PHE A CG  1 
ATOM   4331 C CD1 . PHE A 1 572 ? 15.634  26.713 61.030 1.00 10.86 ? 572 PHE A CD1 1 
ATOM   4332 C CD2 . PHE A 1 572 ? 15.923  25.304 59.139 1.00 11.10 ? 572 PHE A CD2 1 
ATOM   4333 C CE1 . PHE A 1 572 ? 15.700  27.852 60.210 1.00 12.06 ? 572 PHE A CE1 1 
ATOM   4334 C CE2 . PHE A 1 572 ? 15.988  26.437 58.314 1.00 12.27 ? 572 PHE A CE2 1 
ATOM   4335 C CZ  . PHE A 1 572 ? 15.877  27.712 58.852 1.00 11.10 ? 572 PHE A CZ  1 
ATOM   4336 N N   . LYS A 1 573 ? 14.211  24.795 64.080 1.00 21.28 ? 573 LYS A N   1 
ATOM   4337 C CA  . LYS A 1 573 ? 13.864  25.783 65.104 1.00 21.83 ? 573 LYS A CA  1 
ATOM   4338 C C   . LYS A 1 573 ? 14.838  26.915 64.962 1.00 22.53 ? 573 LYS A C   1 
ATOM   4339 O O   . LYS A 1 573 ? 14.446  28.063 65.115 1.00 24.34 ? 573 LYS A O   1 
ATOM   4340 C CB  . LYS A 1 573 ? 13.873  25.181 66.514 1.00 21.06 ? 573 LYS A CB  1 
ATOM   4341 C CG  . LYS A 1 573 ? 12.639  24.316 66.784 1.00 19.86 ? 573 LYS A CG  1 
ATOM   4342 C CD  . LYS A 1 573 ? 12.745  23.624 68.083 1.00 19.25 ? 573 LYS A CD  1 
ATOM   4343 C CE  . LYS A 1 573 ? 11.565  22.768 68.353 1.00 19.95 ? 573 LYS A CE  1 
ATOM   4344 N NZ  . LYS A 1 573 ? 11.710  22.210 69.735 1.00 21.23 ? 573 LYS A NZ  1 
ATOM   4345 N N   . SER A 1 574 ? 16.093  26.597 64.625 1.00 21.90 ? 574 SER A N   1 
ATOM   4346 C CA  . SER A 1 574 ? 17.108  27.637 64.389 1.00 22.71 ? 574 SER A CA  1 
ATOM   4347 C C   . SER A 1 574 ? 18.279  27.168 63.544 1.00 23.21 ? 574 SER A C   1 
ATOM   4348 O O   . SER A 1 574 ? 18.497  25.962 63.360 1.00 21.29 ? 574 SER A O   1 
ATOM   4349 C CB  . SER A 1 574 ? 17.614  28.308 65.680 1.00 22.59 ? 574 SER A CB  1 
ATOM   4350 O OG  . SER A 1 574 ? 18.170  27.409 66.627 1.00 24.64 ? 574 SER A OG  1 
ATOM   4351 N N   . VAL A 1 575 ? 19.011  28.127 62.986 1.00 25.00 ? 575 VAL A N   1 
ATOM   4352 C CA  . VAL A 1 575 ? 20.135  27.790 62.139 1.00 26.81 ? 575 VAL A CA  1 
ATOM   4353 C C   . VAL A 1 575 ? 21.286  27.157 62.884 1.00 29.77 ? 575 VAL A C   1 
ATOM   4354 O O   . VAL A 1 575 ? 22.063  26.425 62.245 1.00 33.65 ? 575 VAL A O   1 
ATOM   4355 C CB  . VAL A 1 575 ? 20.609  28.936 61.212 1.00 25.13 ? 575 VAL A CB  1 
ATOM   4356 C CG1 . VAL A 1 575 ? 19.451  29.436 60.398 1.00 25.80 ? 575 VAL A CG1 1 
ATOM   4357 C CG2 . VAL A 1 575 ? 21.178  30.075 61.985 1.00 25.89 ? 575 VAL A CG2 1 
ATOM   4358 N N   . ASP A 1 576 ? 21.436  27.393 64.199 1.00 30.18 ? 576 ASP A N   1 
ATOM   4359 C CA  . ASP A 1 576 ? 22.529  26.691 64.858 1.00 28.98 ? 576 ASP A CA  1 
ATOM   4360 C C   . ASP A 1 576 ? 22.098  25.271 65.023 1.00 26.70 ? 576 ASP A C   1 
ATOM   4361 O O   . ASP A 1 576 ? 22.865  24.470 65.533 1.00 26.81 ? 576 ASP A O   1 
ATOM   4362 C CB  . ASP A 1 576 ? 23.010  27.215 66.200 1.00 33.53 ? 576 ASP A CB  1 
ATOM   4363 C CG  . ASP A 1 576 ? 22.261  28.372 66.675 1.00 37.06 ? 576 ASP A CG  1 
ATOM   4364 O OD1 . ASP A 1 576 ? 21.135  28.173 67.203 1.00 40.40 ? 576 ASP A OD1 1 
ATOM   4365 O OD2 . ASP A 1 576 ? 22.830  29.474 66.544 1.00 39.09 ? 576 ASP A OD2 1 
ATOM   4366 N N   . GLN A 1 577 ? 20.857  24.951 64.682 1.00 22.20 ? 577 GLN A N   1 
ATOM   4367 C CA  . GLN A 1 577 ? 20.499  23.548 64.729 1.00 21.21 ? 577 GLN A CA  1 
ATOM   4368 C C   . GLN A 1 577 ? 21.075  22.769 63.513 1.00 21.18 ? 577 GLN A C   1 
ATOM   4369 O O   . GLN A 1 577 ? 21.360  21.577 63.628 1.00 21.11 ? 577 GLN A O   1 
ATOM   4370 C CB  . GLN A 1 577 ? 19.013  23.336 64.726 1.00 21.03 ? 577 GLN A CB  1 
ATOM   4371 C CG  . GLN A 1 577 ? 18.257  23.716 65.934 1.00 21.41 ? 577 GLN A CG  1 
ATOM   4372 C CD  . GLN A 1 577 ? 16.868  23.149 65.849 1.00 22.89 ? 577 GLN A CD  1 
ATOM   4373 O OE1 . GLN A 1 577 ? 16.123  23.457 64.908 1.00 24.52 ? 577 GLN A OE1 1 
ATOM   4374 N NE2 . GLN A 1 577 ? 16.523  22.264 66.781 1.00 23.26 ? 577 GLN A NE2 1 
ATOM   4375 N N   . LEU A 1 578 ? 21.279  23.440 62.375 1.00 19.01 ? 578 LEU A N   1 
ATOM   4376 C CA  . LEU A 1 578 ? 21.753  22.788 61.153 1.00 19.30 ? 578 LEU A CA  1 
ATOM   4377 C C   . LEU A 1 578 ? 23.198  22.216 61.035 1.00 19.47 ? 578 LEU A C   1 
ATOM   4378 O O   . LEU A 1 578 ? 24.174  22.833 61.477 1.00 22.11 ? 578 LEU A O   1 
ATOM   4379 C CB  . LEU A 1 578 ? 21.477  23.725 59.971 1.00 19.77 ? 578 LEU A CB  1 
ATOM   4380 C CG  . LEU A 1 578 ? 20.134  24.430 59.861 1.00 19.29 ? 578 LEU A CG  1 
ATOM   4381 C CD1 . LEU A 1 578 ? 20.144  25.260 58.612 1.00 18.85 ? 578 LEU A CD1 1 
ATOM   4382 C CD2 . LEU A 1 578 ? 19.022  23.405 59.818 1.00 19.47 ? 578 LEU A CD2 1 
ATOM   4383 N N   . PRO A 1 579 ? 23.372  21.157 60.240 1.00 18.34 ? 579 PRO A N   1 
ATOM   4384 C CA  . PRO A 1 579 ? 22.357  20.404 59.508 1.00 19.05 ? 579 PRO A CA  1 
ATOM   4385 C C   . PRO A 1 579 ? 21.573  19.623 60.506 1.00 19.57 ? 579 PRO A C   1 
ATOM   4386 O O   . PRO A 1 579 ? 22.034  19.472 61.608 1.00 23.37 ? 579 PRO A O   1 
ATOM   4387 C CB  . PRO A 1 579 ? 23.180  19.490 58.622 1.00 18.08 ? 579 PRO A CB  1 
ATOM   4388 C CG  . PRO A 1 579 ? 24.454  19.394 59.340 1.00 17.73 ? 579 PRO A CG  1 
ATOM   4389 C CD  . PRO A 1 579 ? 24.718  20.737 59.829 1.00 16.61 ? 579 PRO A CD  1 
ATOM   4390 N N   . MET A 1 580 ? 20.379  19.187 60.164 1.00 20.89 ? 580 MET A N   1 
ATOM   4391 C CA  . MET A 1 580 ? 19.535  18.431 61.066 1.00 20.38 ? 580 MET A CA  1 
ATOM   4392 C C   . MET A 1 580 ? 18.468  17.889 60.132 1.00 21.31 ? 580 MET A C   1 
ATOM   4393 O O   . MET A 1 580 ? 17.561  18.635 59.729 1.00 21.29 ? 580 MET A O   1 
ATOM   4394 C CB  . MET A 1 580 ? 18.905  19.359 62.100 1.00 21.71 ? 580 MET A CB  1 
ATOM   4395 C CG  . MET A 1 580 ? 17.877  18.645 62.990 1.00 24.17 ? 580 MET A CG  1 
ATOM   4396 S SD  . MET A 1 580 ? 17.130  19.740 64.203 1.00 25.80 ? 580 MET A SD  1 
ATOM   4397 C CE  . MET A 1 580 ? 15.755  20.344 63.384 1.00 24.46 ? 580 MET A CE  1 
ATOM   4398 N N   . ASN A 1 581 ? 18.630  16.636 59.707 1.00 21.01 ? 581 ASN A N   1 
ATOM   4399 C CA  . ASN A 1 581 ? 17.678  16.013 58.788 1.00 22.19 ? 581 ASN A CA  1 
ATOM   4400 C C   . ASN A 1 581 ? 17.038  14.852 59.484 1.00 22.91 ? 581 ASN A C   1 
ATOM   4401 O O   . ASN A 1 581 ? 17.555  14.400 60.498 1.00 21.94 ? 581 ASN A O   1 
ATOM   4402 C CB  . ASN A 1 581 ? 18.366  15.475 57.543 1.00 22.70 ? 581 ASN A CB  1 
ATOM   4403 C CG  . ASN A 1 581 ? 19.038  16.550 56.720 1.00 22.79 ? 581 ASN A CG  1 
ATOM   4404 O OD1 . ASN A 1 581 ? 20.236  16.656 56.753 1.00 23.66 ? 581 ASN A OD1 1 
ATOM   4405 N ND2 . ASN A 1 581 ? 18.287  17.255 55.891 1.00 22.89 ? 581 ASN A ND2 1 
ATOM   4406 N N   . VAL A 1 582 ? 15.928  14.350 58.951 1.00 25.50 ? 582 VAL A N   1 
ATOM   4407 C CA  . VAL A 1 582 ? 15.269  13.211 59.584 1.00 30.17 ? 582 VAL A CA  1 
ATOM   4408 C C   . VAL A 1 582 ? 16.306  12.120 59.843 1.00 33.66 ? 582 VAL A C   1 
ATOM   4409 O O   . VAL A 1 582 ? 17.298  12.007 59.115 1.00 36.52 ? 582 VAL A O   1 
ATOM   4410 C CB  . VAL A 1 582 ? 14.118  12.625 58.726 1.00 29.37 ? 582 VAL A CB  1 
ATOM   4411 C CG1 . VAL A 1 582 ? 12.805  12.868 59.393 1.00 29.13 ? 582 VAL A CG1 1 
ATOM   4412 C CG2 . VAL A 1 582 ? 14.099  13.223 57.349 1.00 29.78 ? 582 VAL A CG2 1 
ATOM   4413 N N   . GLY A 1 583 ? 16.098  11.350 60.903 1.00 37.13 ? 583 GLY A N   1 
ATOM   4414 C CA  . GLY A 1 583 ? 17.024  10.289 61.241 1.00 40.29 ? 583 GLY A CA  1 
ATOM   4415 C C   . GLY A 1 583 ? 18.169  10.782 62.084 1.00 44.22 ? 583 GLY A C   1 
ATOM   4416 O O   . GLY A 1 583 ? 18.910  9.952  62.561 1.00 47.76 ? 583 GLY A O   1 
ATOM   4417 N N   . ASP A 1 584 ? 18.367  12.089 62.231 1.00 46.66 ? 584 ASP A N   1 
ATOM   4418 C CA  . ASP A 1 584 ? 19.462  12.581 63.061 1.00 49.96 ? 584 ASP A CA  1 
ATOM   4419 C C   . ASP A 1 584 ? 19.281  12.279 64.542 1.00 51.20 ? 584 ASP A C   1 
ATOM   4420 O O   . ASP A 1 584 ? 18.241  11.790 64.958 1.00 50.86 ? 584 ASP A O   1 
ATOM   4421 C CB  . ASP A 1 584 ? 19.634  14.086 62.886 1.00 51.04 ? 584 ASP A CB  1 
ATOM   4422 C CG  . ASP A 1 584 ? 20.339  14.429 61.619 1.00 52.25 ? 584 ASP A CG  1 
ATOM   4423 O OD1 . ASP A 1 584 ? 20.405  13.544 60.728 1.00 53.17 ? 584 ASP A OD1 1 
ATOM   4424 O OD2 . ASP A 1 584 ? 20.827  15.574 61.525 1.00 53.34 ? 584 ASP A OD2 1 
ATOM   4425 N N   . ALA A 1 585 ? 20.325  12.550 65.324 1.00 53.76 ? 585 ALA A N   1 
ATOM   4426 C CA  . ALA A 1 585 ? 20.293  12.366 66.773 1.00 54.42 ? 585 ALA A CA  1 
ATOM   4427 C C   . ALA A 1 585 ? 19.670  13.605 67.473 1.00 53.74 ? 585 ALA A C   1 
ATOM   4428 O O   . ALA A 1 585 ? 18.759  13.469 68.277 1.00 53.58 ? 585 ALA A O   1 
ATOM   4429 C CB  . ALA A 1 585 ? 21.703  12.100 67.294 1.00 56.39 ? 585 ALA A CB  1 
ATOM   4430 N N   . HIS A 1 586 ? 20.184  14.804 67.209 1.00 52.89 ? 586 HIS A N   1 
ATOM   4431 C CA  . HIS A 1 586 ? 19.604  16.009 67.817 1.00 52.33 ? 586 HIS A CA  1 
ATOM   4432 C C   . HIS A 1 586 ? 18.358  16.383 67.000 1.00 49.04 ? 586 HIS A C   1 
ATOM   4433 O O   . HIS A 1 586 ? 18.166  17.552 66.683 1.00 49.16 ? 586 HIS A O   1 
ATOM   4434 C CB  . HIS A 1 586 ? 20.600  17.192 67.782 1.00 56.26 ? 586 HIS A CB  1 
ATOM   4435 C CG  . HIS A 1 586 ? 20.863  17.741 66.393 1.00 60.15 ? 586 HIS A CG  1 
ATOM   4436 N ND1 . HIS A 1 586 ? 21.051  19.081 66.132 1.00 60.57 ? 586 HIS A ND1 1 
ATOM   4437 C CD2 . HIS A 1 586 ? 20.966  17.103 65.196 1.00 61.62 ? 586 HIS A CD2 1 
ATOM   4438 C CE1 . HIS A 1 586 ? 21.260  19.249 64.834 1.00 61.33 ? 586 HIS A CE1 1 
ATOM   4439 N NE2 . HIS A 1 586 ? 21.214  18.068 64.247 1.00 62.01 ? 586 HIS A NE2 1 
ATOM   4440 N N   . TYR A 1 587 ? 17.539  15.418 66.590 1.00 42.48 ? 587 TYR A N   1 
ATOM   4441 C CA  . TYR A 1 587 ? 16.405  15.831 65.792 1.00 37.86 ? 587 TYR A CA  1 
ATOM   4442 C C   . TYR A 1 587 ? 15.368  16.623 66.573 1.00 35.02 ? 587 TYR A C   1 
ATOM   4443 O O   . TYR A 1 587 ? 14.518  16.070 67.245 1.00 33.53 ? 587 TYR A O   1 
ATOM   4444 C CB  . TYR A 1 587 ? 15.773  14.678 65.038 1.00 38.14 ? 587 TYR A CB  1 
ATOM   4445 C CG  . TYR A 1 587 ? 14.890  15.124 63.861 1.00 37.94 ? 587 TYR A CG  1 
ATOM   4446 C CD1 . TYR A 1 587 ? 15.412  15.874 62.793 1.00 37.63 ? 587 TYR A CD1 1 
ATOM   4447 C CD2 . TYR A 1 587 ? 13.540  14.742 63.794 1.00 37.97 ? 587 TYR A CD2 1 
ATOM   4448 C CE1 . TYR A 1 587 ? 14.601  16.214 61.690 1.00 37.10 ? 587 TYR A CE1 1 
ATOM   4449 C CE2 . TYR A 1 587 ? 12.732  15.068 62.707 1.00 36.57 ? 587 TYR A CE2 1 
ATOM   4450 C CZ  . TYR A 1 587 ? 13.263  15.795 61.660 1.00 36.99 ? 587 TYR A CZ  1 
ATOM   4451 O OH  . TYR A 1 587 ? 12.454  16.042 60.583 1.00 35.30 ? 587 TYR A OH  1 
ATOM   4452 N N   . ASP A 1 588 ? 15.344  17.924 66.353 1.00 32.28 ? 588 ASP A N   1 
ATOM   4453 C CA  . ASP A 1 588 ? 14.440  18.767 67.097 1.00 29.48 ? 588 ASP A CA  1 
ATOM   4454 C C   . ASP A 1 588 ? 13.782  19.890 66.268 1.00 26.38 ? 588 ASP A C   1 
ATOM   4455 O O   . ASP A 1 588 ? 13.903  21.079 66.556 1.00 25.14 ? 588 ASP A O   1 
ATOM   4456 C CB  . ASP A 1 588 ? 15.214  19.287 68.299 1.00 32.69 ? 588 ASP A CB  1 
ATOM   4457 C CG  . ASP A 1 588 ? 14.392  20.150 69.217 1.00 35.44 ? 588 ASP A CG  1 
ATOM   4458 O OD1 . ASP A 1 588 ? 13.133  20.073 69.208 1.00 36.61 ? 588 ASP A OD1 1 
ATOM   4459 O OD2 . ASP A 1 588 ? 15.047  20.929 69.944 1.00 37.34 ? 588 ASP A OD2 1 
ATOM   4460 N N   . PRO A 1 589 ? 12.979  19.493 65.277 1.00 22.69 ? 589 PRO A N   1 
ATOM   4461 C CA  . PRO A 1 589 ? 12.454  20.391 64.273 1.00 22.19 ? 589 PRO A CA  1 
ATOM   4462 C C   . PRO A 1 589 ? 11.290  21.212 64.795 1.00 22.35 ? 589 PRO A C   1 
ATOM   4463 O O   . PRO A 1 589 ? 10.795  20.965 65.890 1.00 24.94 ? 589 PRO A O   1 
ATOM   4464 C CB  . PRO A 1 589 ? 12.018  19.421 63.191 1.00 21.31 ? 589 PRO A CB  1 
ATOM   4465 C CG  . PRO A 1 589 ? 11.535  18.330 63.940 1.00 20.15 ? 589 PRO A CG  1 
ATOM   4466 C CD  . PRO A 1 589 ? 12.581  18.121 64.964 1.00 21.79 ? 589 PRO A CD  1 
ATOM   4467 N N   . LEU A 1 590 ? 10.926  22.253 64.059 1.00 20.77 ? 590 LEU A N   1 
ATOM   4468 C CA  . LEU A 1 590 ? 9.794   23.095 64.407 1.00 18.44 ? 590 LEU A CA  1 
ATOM   4469 C C   . LEU A 1 590 ? 8.685   22.338 63.715 1.00 19.22 ? 590 LEU A C   1 
ATOM   4470 O O   . LEU A 1 590 ? 7.544   22.334 64.153 1.00 19.79 ? 590 LEU A O   1 
ATOM   4471 C CB  . LEU A 1 590 ? 9.923   24.486 63.779 1.00 17.14 ? 590 LEU A CB  1 
ATOM   4472 C CG  . LEU A 1 590 ? 8.724   25.379 64.083 1.00 15.37 ? 590 LEU A CG  1 
ATOM   4473 C CD1 . LEU A 1 590 ? 8.679   25.472 65.576 1.00 15.23 ? 590 LEU A CD1 1 
ATOM   4474 C CD2 . LEU A 1 590 ? 8.795   26.754 63.449 1.00 14.11 ? 590 LEU A CD2 1 
ATOM   4475 N N   . PHE A 1 591 ? 9.022   21.758 62.573 1.00 19.27 ? 591 PHE A N   1 
ATOM   4476 C CA  . PHE A 1 591 ? 8.084   20.943 61.816 1.00 21.57 ? 591 PHE A CA  1 
ATOM   4477 C C   . PHE A 1 591 ? 8.923   19.817 61.210 1.00 24.04 ? 591 PHE A C   1 
ATOM   4478 O O   . PHE A 1 591 ? 9.961   20.055 60.552 1.00 24.23 ? 591 PHE A O   1 
ATOM   4479 C CB  . PHE A 1 591 ? 7.367   21.725 60.683 1.00 18.76 ? 591 PHE A CB  1 
ATOM   4480 C CG  . PHE A 1 591 ? 6.519   22.836 61.154 1.00 13.68 ? 591 PHE A CG  1 
ATOM   4481 C CD1 . PHE A 1 591 ? 7.002   24.122 61.111 1.00 13.28 ? 591 PHE A CD1 1 
ATOM   4482 C CD2 . PHE A 1 591 ? 5.280   22.585 61.699 1.00 12.05 ? 591 PHE A CD2 1 
ATOM   4483 C CE1 . PHE A 1 591 ? 6.293   25.143 61.596 1.00 12.45 ? 591 PHE A CE1 1 
ATOM   4484 C CE2 . PHE A 1 591 ? 4.558   23.580 62.188 1.00 11.02 ? 591 PHE A CE2 1 
ATOM   4485 C CZ  . PHE A 1 591 ? 5.063   24.879 62.142 1.00 13.32 ? 591 PHE A CZ  1 
ATOM   4486 N N   . ARG A 1 592 ? 8.507   18.597 61.506 1.00 26.49 ? 592 ARG A N   1 
ATOM   4487 C CA  . ARG A 1 592 ? 9.191   17.433 60.993 1.00 30.68 ? 592 ARG A CA  1 
ATOM   4488 C C   . ARG A 1 592 ? 8.895   17.273 59.500 1.00 28.16 ? 592 ARG A C   1 
ATOM   4489 O O   . ARG A 1 592 ? 7.892   17.793 58.995 1.00 27.06 ? 592 ARG A O   1 
ATOM   4490 C CB  . ARG A 1 592 ? 8.724   16.176 61.743 1.00 37.41 ? 592 ARG A CB  1 
ATOM   4491 C CG  . ARG A 1 592 ? 8.972   16.206 63.266 1.00 47.14 ? 592 ARG A CG  1 
ATOM   4492 C CD  . ARG A 1 592 ? 8.942   14.783 63.850 1.00 54.32 ? 592 ARG A CD  1 
ATOM   4493 N NE  . ARG A 1 592 ? 9.027   14.671 65.320 1.00 60.37 ? 592 ARG A NE  1 
ATOM   4494 C CZ  . ARG A 1 592 ? 7.968   14.526 66.136 1.00 63.93 ? 592 ARG A CZ  1 
ATOM   4495 N NH1 . ARG A 1 592 ? 6.723   14.513 65.639 1.00 65.78 ? 592 ARG A NH1 1 
ATOM   4496 N NH2 . ARG A 1 592 ? 8.155   14.240 67.433 1.00 65.79 ? 592 ARG A NH2 1 
ATOM   4497 N N   . LEU A 1 593 ? 9.772   16.562 58.800 1.00 23.93 ? 593 LEU A N   1 
ATOM   4498 C CA  . LEU A 1 593 ? 9.532   16.290 57.396 1.00 21.01 ? 593 LEU A CA  1 
ATOM   4499 C C   . LEU A 1 593 ? 8.148   15.598 57.298 1.00 19.20 ? 593 LEU A C   1 
ATOM   4500 O O   . LEU A 1 593 ? 7.765   14.858 58.174 1.00 17.93 ? 593 LEU A O   1 
ATOM   4501 C CB  . LEU A 1 593 ? 10.598  15.340 56.865 1.00 20.25 ? 593 LEU A CB  1 
ATOM   4502 C CG  . LEU A 1 593 ? 10.520  14.873 55.405 1.00 20.31 ? 593 LEU A CG  1 
ATOM   4503 C CD1 . LEU A 1 593 ? 11.827  15.208 54.710 1.00 20.45 ? 593 LEU A CD1 1 
ATOM   4504 C CD2 . LEU A 1 593 ? 10.270  13.373 55.303 1.00 20.86 ? 593 LEU A CD2 1 
ATOM   4505 N N   . GLY A 1 594 ? 7.382   15.857 56.256 1.00 18.37 ? 594 GLY A N   1 
ATOM   4506 C CA  . GLY A 1 594 ? 6.126   15.169 56.175 1.00 15.86 ? 594 GLY A CA  1 
ATOM   4507 C C   . GLY A 1 594 ? 5.000   15.902 56.862 1.00 16.06 ? 594 GLY A C   1 
ATOM   4508 O O   . GLY A 1 594 ? 3.845   15.492 56.747 1.00 16.26 ? 594 GLY A O   1 
ATOM   4509 N N   . TYR A 1 595 ? 5.309   16.987 57.557 1.00 14.22 ? 595 TYR A N   1 
ATOM   4510 C CA  . TYR A 1 595 ? 4.279   17.773 58.209 1.00 14.20 ? 595 TYR A CA  1 
ATOM   4511 C C   . TYR A 1 595 ? 3.406   18.612 57.225 1.00 15.69 ? 595 TYR A C   1 
ATOM   4512 O O   . TYR A 1 595 ? 3.895   19.131 56.229 1.00 15.96 ? 595 TYR A O   1 
ATOM   4513 C CB  . TYR A 1 595 ? 4.944   18.713 59.188 1.00 14.42 ? 595 TYR A CB  1 
ATOM   4514 C CG  . TYR A 1 595 ? 3.974   19.551 59.956 1.00 14.20 ? 595 TYR A CG  1 
ATOM   4515 C CD1 . TYR A 1 595 ? 3.352   19.042 61.039 1.00 14.25 ? 595 TYR A CD1 1 
ATOM   4516 C CD2 . TYR A 1 595 ? 3.658   20.836 59.564 1.00 15.00 ? 595 TYR A CD2 1 
ATOM   4517 C CE1 . TYR A 1 595 ? 2.465   19.743 61.710 1.00 15.16 ? 595 TYR A CE1 1 
ATOM   4518 C CE2 . TYR A 1 595 ? 2.751   21.557 60.237 1.00 15.26 ? 595 TYR A CE2 1 
ATOM   4519 C CZ  . TYR A 1 595 ? 2.158   20.987 61.319 1.00 15.70 ? 595 TYR A CZ  1 
ATOM   4520 O OH  . TYR A 1 595 ? 1.207   21.636 62.056 1.00 19.95 ? 595 TYR A OH  1 
ATOM   4521 N N   . GLY A 1 596 ? 2.124   18.784 57.534 1.00 16.01 ? 596 GLY A N   1 
ATOM   4522 C CA  . GLY A 1 596 ? 1.274   19.611 56.691 1.00 15.30 ? 596 GLY A CA  1 
ATOM   4523 C C   . GLY A 1 596 ? -0.183  19.518 57.098 1.00 14.93 ? 596 GLY A C   1 
ATOM   4524 O O   . GLY A 1 596 ? -0.681  18.412 57.213 1.00 18.56 ? 596 GLY A O   1 
ATOM   4525 N N   . LEU A 1 597 ? -0.839  20.612 57.448 1.00 12.76 ? 597 LEU A N   1 
ATOM   4526 C CA  . LEU A 1 597 ? -2.256  20.531 57.793 1.00 13.36 ? 597 LEU A CA  1 
ATOM   4527 C C   . LEU A 1 597 ? -3.153  20.314 56.532 1.00 14.28 ? 597 LEU A C   1 
ATOM   4528 O O   . LEU A 1 597 ? -2.789  20.650 55.438 1.00 16.02 ? 597 LEU A O   1 
ATOM   4529 C CB  . LEU A 1 597 ? -2.688  21.829 58.485 1.00 12.33 ? 597 LEU A CB  1 
ATOM   4530 C CG  . LEU A 1 597 ? -1.941  22.297 59.723 1.00 9.57  ? 597 LEU A CG  1 
ATOM   4531 C CD1 . LEU A 1 597 ? -2.580  23.452 60.382 1.00 7.92  ? 597 LEU A CD1 1 
ATOM   4532 C CD2 . LEU A 1 597 ? -1.955  21.193 60.615 1.00 9.31  ? 597 LEU A CD2 1 
ATOM   4533 N N   . THR A 1 598 ? -4.344  19.779 56.681 1.00 15.86 ? 598 THR A N   1 
ATOM   4534 C CA  . THR A 1 598 ? -5.192  19.611 55.508 1.00 17.30 ? 598 THR A CA  1 
ATOM   4535 C C   . THR A 1 598 ? -6.464  20.445 55.681 1.00 18.84 ? 598 THR A C   1 
ATOM   4536 O O   . THR A 1 598 ? -6.588  21.146 56.675 1.00 18.93 ? 598 THR A O   1 
ATOM   4537 C CB  . THR A 1 598 ? -5.515  18.112 55.253 1.00 17.21 ? 598 THR A CB  1 
ATOM   4538 O OG1 . THR A 1 598 ? -5.907  17.454 56.467 1.00 16.38 ? 598 THR A OG1 1 
ATOM   4539 C CG2 . THR A 1 598 ? -4.299  17.423 54.718 1.00 17.68 ? 598 THR A CG2 1 
ATOM   4540 N N   . THR A 1 599 ? -7.339  20.453 54.680 1.00 21.61 ? 599 THR A N   1 
ATOM   4541 C CA  . THR A 1 599 ? -8.636  21.165 54.691 1.00 25.18 ? 599 THR A CA  1 
ATOM   4542 C C   . THR A 1 599 ? -9.401  20.422 53.610 1.00 28.39 ? 599 THR A C   1 
ATOM   4543 O O   . THR A 1 599 ? -8.807  19.621 52.874 1.00 29.83 ? 599 THR A O   1 
ATOM   4544 C CB  . THR A 1 599 ? -8.569  22.623 54.171 1.00 23.78 ? 599 THR A CB  1 
ATOM   4545 O OG1 . THR A 1 599 ? -7.837  22.645 52.942 1.00 24.43 ? 599 THR A OG1 1 
ATOM   4546 C CG2 . THR A 1 599 ? -7.933  23.549 55.156 1.00 23.25 ? 599 THR A CG2 1 
ATOM   4547 N N   . ASN A 1 600 ? -10.699 20.669 53.499 1.00 32.04 ? 600 ASN A N   1 
ATOM   4548 C CA  . ASN A 1 600 ? -11.483 20.029 52.450 1.00 34.93 ? 600 ASN A CA  1 
ATOM   4549 C C   . ASN A 1 600 ? -12.043 21.087 51.479 1.00 34.38 ? 600 ASN A C   1 
ATOM   4550 O O   . ASN A 1 600 ? -12.334 22.220 51.856 1.00 33.10 ? 600 ASN A O   1 
ATOM   4551 C CB  . ASN A 1 600 ? -12.622 19.186 53.036 1.00 38.33 ? 600 ASN A CB  1 
ATOM   4552 C CG  . ASN A 1 600 ? -12.134 18.102 54.020 1.00 41.38 ? 600 ASN A CG  1 
ATOM   4553 O OD1 . ASN A 1 600 ? -12.529 18.115 55.207 1.00 42.96 ? 600 ASN A OD1 1 
ATOM   4554 N ND2 . ASN A 1 600 ? -11.344 17.116 53.525 1.00 43.69 ? 600 ASN A ND2 1 
ATOM   4555 N N   . ALA A 1 601 ? -12.190 20.729 50.220 1.00 34.61 ? 601 ALA A N   1 
ATOM   4556 C CA  . ALA A 1 601 ? -12.721 21.680 49.273 1.00 36.73 ? 601 ALA A CA  1 
ATOM   4557 C C   . ALA A 1 601 ? -14.121 22.078 49.704 1.00 37.89 ? 601 ALA A C   1 
ATOM   4558 O O   . ALA A 1 601 ? -14.817 21.265 50.313 1.00 39.23 ? 601 ALA A O   1 
ATOM   4559 C CB  . ALA A 1 601 ? -12.787 21.056 47.943 1.00 36.46 ? 601 ALA A CB  1 
ATOM   4560 N N   . THR A 1 602 ? -14.510 23.332 49.461 1.00 38.67 ? 602 THR A N   1 
ATOM   4561 C CA  . THR A 1 602 ? -15.866 23.768 49.774 1.00 40.14 ? 602 THR A CA  1 
ATOM   4562 C C   . THR A 1 602 ? -16.808 23.249 48.667 1.00 42.43 ? 602 THR A C   1 
ATOM   4563 O O   . THR A 1 602 ? -16.392 23.246 47.476 1.00 44.03 ? 602 THR A O   1 
ATOM   4564 C CB  . THR A 1 602 ? -16.014 25.296 49.844 1.00 38.64 ? 602 THR A CB  1 
ATOM   4565 O OG1 . THR A 1 602 ? -15.891 25.850 48.538 1.00 39.90 ? 602 THR A OG1 1 
ATOM   4566 C CG2 . THR A 1 602 ? -14.989 25.903 50.732 1.00 38.10 ? 602 THR A CG2 1 
HETATM 4567 C C1  . NAG B 2 .   ? 20.912  36.964 55.499 1.00 63.88 ? 1   NAG B C1  1 
HETATM 4568 C C2  . NAG B 2 .   ? 20.969  38.453 55.699 1.00 67.57 ? 1   NAG B C2  1 
HETATM 4569 C C3  . NAG B 2 .   ? 20.669  39.102 54.204 1.00 70.39 ? 1   NAG B C3  1 
HETATM 4570 C C4  . NAG B 2 .   ? 21.743  38.736 53.244 1.00 70.80 ? 1   NAG B C4  1 
HETATM 4571 C C5  . NAG B 2 .   ? 22.059  37.280 53.322 1.00 69.53 ? 1   NAG B C5  1 
HETATM 4572 C C6  . NAG B 2 .   ? 23.409  37.048 52.694 1.00 69.09 ? 1   NAG B C6  1 
HETATM 4573 C C7  . NAG B 2 .   ? 20.556  39.264 58.000 1.00 68.76 ? 1   NAG B C7  1 
HETATM 4574 C C8  . NAG B 2 .   ? 19.465  39.543 59.084 1.00 68.66 ? 1   NAG B C8  1 
HETATM 4575 N N2  . NAG B 2 .   ? 20.101  38.785 56.846 1.00 68.79 ? 1   NAG B N2  1 
HETATM 4576 O O3  . NAG B 2 .   ? 20.721  40.563 54.230 1.00 72.66 ? 1   NAG B O3  1 
HETATM 4577 O O4  . NAG B 2 .   ? 21.211  38.987 52.010 1.00 73.90 ? 1   NAG B O4  1 
HETATM 4578 O O5  . NAG B 2 .   ? 22.132  36.792 54.722 1.00 66.57 ? 1   NAG B O5  1 
HETATM 4579 O O6  . NAG B 2 .   ? 23.215  36.524 51.370 1.00 69.41 ? 1   NAG B O6  1 
HETATM 4580 O O7  . NAG B 2 .   ? 21.769  39.480 58.233 1.00 68.42 ? 1   NAG B O7  1 
HETATM 4581 C C1  . NAG B 2 .   ? 22.170  39.455 51.128 1.00 78.18 ? 2   NAG B C1  1 
HETATM 4582 C C2  . NAG B 2 .   ? 21.397  39.715 49.797 1.00 80.22 ? 2   NAG B C2  1 
HETATM 4583 C C3  . NAG B 2 .   ? 22.195  40.438 48.698 1.00 81.53 ? 2   NAG B C3  1 
HETATM 4584 C C4  . NAG B 2 .   ? 22.791  41.717 49.381 1.00 82.77 ? 2   NAG B C4  1 
HETATM 4585 C C5  . NAG B 2 .   ? 23.524  41.386 50.762 1.00 82.95 ? 2   NAG B C5  1 
HETATM 4586 C C6  . NAG B 2 .   ? 23.905  42.754 51.349 1.00 83.98 ? 2   NAG B C6  1 
HETATM 4587 C C7  . NAG B 2 .   ? 19.684  38.215 48.889 1.00 81.39 ? 2   NAG B C7  1 
HETATM 4588 C C8  . NAG B 2 .   ? 19.453  36.820 48.191 1.00 80.35 ? 2   NAG B C8  1 
HETATM 4589 N N2  . NAG B 2 .   ? 20.965  38.482 49.140 1.00 80.96 ? 2   NAG B N2  1 
HETATM 4590 O O3  . NAG B 2 .   ? 21.417  40.741 47.531 1.00 82.02 ? 2   NAG B O3  1 
HETATM 4591 O O4  . NAG B 2 .   ? 23.813  42.284 48.477 1.00 83.91 ? 2   NAG B O4  1 
HETATM 4592 O O5  . NAG B 2 .   ? 22.619  40.687 51.693 1.00 80.44 ? 2   NAG B O5  1 
HETATM 4593 O O6  . NAG B 2 .   ? 24.668  42.477 52.533 1.00 85.99 ? 2   NAG B O6  1 
HETATM 4594 O O7  . NAG B 2 .   ? 18.750  38.982 49.199 1.00 81.01 ? 2   NAG B O7  1 
HETATM 4595 C C1  . BMA B 2 .   ? 23.605  43.661 48.127 1.00 83.97 ? 3   BMA B C1  1 
HETATM 4596 C C2  . BMA B 2 .   ? 25.035  44.223 47.757 1.00 84.20 ? 3   BMA B C2  1 
HETATM 4597 C C3  . BMA B 2 .   ? 24.821  45.687 47.099 1.00 84.18 ? 3   BMA B C3  1 
HETATM 4598 C C4  . BMA B 2 .   ? 23.599  45.644 46.005 1.00 83.85 ? 3   BMA B C4  1 
HETATM 4599 C C5  . BMA B 2 .   ? 22.399  45.011 46.770 1.00 83.25 ? 3   BMA B C5  1 
HETATM 4600 C C6  . BMA B 2 .   ? 21.159  44.996 46.085 1.00 83.03 ? 3   BMA B C6  1 
HETATM 4601 O O2  . BMA B 2 .   ? 25.877  43.327 46.917 1.00 84.85 ? 3   BMA B O2  1 
HETATM 4602 O O3  . BMA B 2 .   ? 26.075  46.142 46.473 1.00 84.45 ? 3   BMA B O3  1 
HETATM 4603 O O4  . BMA B 2 .   ? 23.263  46.917 45.352 1.00 83.94 ? 3   BMA B O4  1 
HETATM 4604 O O5  . BMA B 2 .   ? 22.691  43.695 47.028 1.00 83.07 ? 3   BMA B O5  1 
HETATM 4605 O O6  . BMA B 2 .   ? 20.287  44.280 46.956 1.00 81.89 ? 3   BMA B O6  1 
HETATM 4606 C C1  . MAN B 2 .   ? 19.332  44.118 45.936 1.00 80.52 ? 4   MAN B C1  1 
HETATM 4607 C C2  . MAN B 2 .   ? 17.992  43.724 46.799 1.00 79.11 ? 4   MAN B C2  1 
HETATM 4608 C C3  . MAN B 2 .   ? 18.449  42.293 46.982 1.00 77.83 ? 4   MAN B C3  1 
HETATM 4609 C C4  . MAN B 2 .   ? 17.544  41.933 45.718 1.00 77.71 ? 4   MAN B C4  1 
HETATM 4610 C C5  . MAN B 2 .   ? 19.404  41.771 45.250 1.00 79.05 ? 4   MAN B C5  1 
HETATM 4611 C C6  . MAN B 2 .   ? 19.882  41.133 43.773 1.00 80.08 ? 4   MAN B C6  1 
HETATM 4612 O O2  . MAN B 2 .   ? 17.273  44.268 45.670 1.00 79.68 ? 4   MAN B O2  1 
HETATM 4613 O O3  . MAN B 2 .   ? 18.276  41.685 48.344 1.00 77.80 ? 4   MAN B O3  1 
HETATM 4614 O O4  . MAN B 2 .   ? 16.427  41.483 46.718 1.00 76.26 ? 4   MAN B O4  1 
HETATM 4615 O O5  . MAN B 2 .   ? 19.878  43.152 44.905 1.00 79.79 ? 4   MAN B O5  1 
HETATM 4616 O O6  . MAN B 2 .   ? 18.943  41.708 42.773 1.00 82.29 ? 4   MAN B O6  1 
HETATM 4617 C C1  . NAG B 2 .   ? 15.702  42.951 47.121 1.00 73.91 ? 5   NAG B C1  1 
HETATM 4618 C C2  . NAG B 2 .   ? 14.707  44.020 46.311 1.00 73.06 ? 5   NAG B C2  1 
HETATM 4619 C C3  . NAG B 2 .   ? 14.136  45.567 46.812 1.00 73.32 ? 5   NAG B C3  1 
HETATM 4620 C C4  . NAG B 2 .   ? 13.768  45.564 48.303 1.00 73.66 ? 5   NAG B C4  1 
HETATM 4621 C C5  . NAG B 2 .   ? 15.139  45.271 48.989 1.00 73.94 ? 5   NAG B C5  1 
HETATM 4622 C C6  . NAG B 2 .   ? 14.703  45.107 50.557 1.00 73.93 ? 5   NAG B C6  1 
HETATM 4623 C C7  . NAG B 2 .   ? 15.068  43.697 44.094 1.00 69.15 ? 5   NAG B C7  1 
HETATM 4624 C C8  . NAG B 2 .   ? 15.497  44.109 42.703 1.00 68.45 ? 5   NAG B C8  1 
HETATM 4625 N N2  . NAG B 2 .   ? 15.156  44.597 45.055 1.00 70.92 ? 5   NAG B N2  1 
HETATM 4626 O O3  . NAG B 2 .   ? 12.949  46.208 46.151 1.00 74.43 ? 5   NAG B O3  1 
HETATM 4627 O O4  . NAG B 2 .   ? 13.039  46.705 48.911 1.00 74.48 ? 5   NAG B O4  1 
HETATM 4628 O O5  . NAG B 2 .   ? 16.050  44.015 48.290 1.00 73.94 ? 5   NAG B O5  1 
HETATM 4629 O O6  . NAG B 2 .   ? 13.742  44.121 50.916 1.00 74.21 ? 5   NAG B O6  1 
HETATM 4630 O O7  . NAG B 2 .   ? 14.621  42.566 44.290 1.00 67.39 ? 5   NAG B O7  1 
HETATM 4631 C C1  . FUC B 2 .   ? 19.450  41.237 54.602 1.00 73.63 ? 6   FUC B C1  1 
HETATM 4632 C C2  . FUC B 2 .   ? 19.781  42.631 55.234 1.00 73.95 ? 6   FUC B C2  1 
HETATM 4633 C C3  . FUC B 2 .   ? 20.447  43.572 54.187 1.00 74.13 ? 6   FUC B C3  1 
HETATM 4634 C C4  . FUC B 2 .   ? 19.530  43.574 52.870 1.00 74.37 ? 6   FUC B C4  1 
HETATM 4635 C C5  . FUC B 2 .   ? 19.190  42.142 52.399 1.00 74.07 ? 6   FUC B C5  1 
HETATM 4636 C C6  . FUC B 2 .   ? 18.056  42.181 51.367 1.00 74.11 ? 6   FUC B C6  1 
HETATM 4637 O O2  . FUC B 2 .   ? 20.695  42.488 56.368 1.00 75.18 ? 6   FUC B O2  1 
HETATM 4638 O O3  . FUC B 2 .   ? 20.628  44.899 54.774 1.00 73.66 ? 6   FUC B O3  1 
HETATM 4639 O O4  . FUC B 2 .   ? 18.243  44.282 52.983 1.00 75.52 ? 6   FUC B O4  1 
HETATM 4640 O O5  . FUC B 2 .   ? 18.625  41.377 53.448 1.00 74.19 ? 6   FUC B O5  1 
HETATM 4641 C C1  . NAG C 3 .   ? 35.077  25.854 50.495 1.00 35.93 ? 610 NAG A C1  1 
HETATM 4642 C C2  . NAG C 3 .   ? 36.326  25.555 49.738 1.00 36.36 ? 610 NAG A C2  1 
HETATM 4643 C C3  . NAG C 3 .   ? 37.541  26.044 50.432 1.00 38.21 ? 610 NAG A C3  1 
HETATM 4644 C C4  . NAG C 3 .   ? 37.469  27.540 50.607 1.00 39.64 ? 610 NAG A C4  1 
HETATM 4645 C C5  . NAG C 3 .   ? 36.103  27.681 51.484 1.00 39.74 ? 610 NAG A C5  1 
HETATM 4646 C C6  . NAG C 3 .   ? 35.599  29.125 51.325 1.00 40.82 ? 610 NAG A C6  1 
HETATM 4647 C C7  . NAG C 3 .   ? 36.270  23.562 48.412 1.00 33.29 ? 610 NAG A C7  1 
HETATM 4648 C C8  . NAG C 3 .   ? 36.505  22.076 48.200 1.00 32.81 ? 610 NAG A C8  1 
HETATM 4649 N N2  . NAG C 3 .   ? 36.534  24.102 49.589 1.00 34.52 ? 610 NAG A N2  1 
HETATM 4650 O O3  . NAG C 3 .   ? 38.780  25.727 49.775 1.00 41.66 ? 610 NAG A O3  1 
HETATM 4651 O O4  . NAG C 3 .   ? 38.630  28.405 51.052 1.00 40.40 ? 610 NAG A O4  1 
HETATM 4652 O O5  . NAG C 3 .   ? 34.912  27.089 50.962 1.00 37.76 ? 610 NAG A O5  1 
HETATM 4653 O O6  . NAG C 3 .   ? 34.500  29.127 52.196 1.00 43.29 ? 610 NAG A O6  1 
HETATM 4654 O O7  . NAG C 3 .   ? 35.816  24.220 47.489 1.00 34.84 ? 610 NAG A O7  1 
HETATM 4655 C C1  . INS D 4 .   ? 26.859  24.885 35.479 1.00 27.31 ? 617 INS A C1  1 
HETATM 4656 C C2  . INS D 4 .   ? 26.171  25.106 34.173 1.00 28.72 ? 617 INS A C2  1 
HETATM 4657 C C3  . INS D 4 .   ? 24.953  24.229 33.717 1.00 29.47 ? 617 INS A C3  1 
HETATM 4658 C C4  . INS D 4 .   ? 23.912  24.219 34.812 1.00 28.52 ? 617 INS A C4  1 
HETATM 4659 C C5  . INS D 4 .   ? 24.388  23.960 36.193 1.00 28.39 ? 617 INS A C5  1 
HETATM 4660 C C6  . INS D 4 .   ? 25.570  24.969 36.475 1.00 27.59 ? 617 INS A C6  1 
HETATM 4661 O O2  . INS D 4 .   ? 25.911  26.460 34.448 1.00 32.55 ? 617 INS A O2  1 
HETATM 4662 O O3  . INS D 4 .   ? 24.250  24.776 32.532 1.00 31.36 ? 617 INS A O3  1 
HETATM 4663 O O4  . INS D 4 .   ? 23.170  23.071 34.538 1.00 27.15 ? 617 INS A O4  1 
HETATM 4664 O O5  . INS D 4 .   ? 23.179  23.916 37.079 1.00 28.60 ? 617 INS A O5  1 
HETATM 4665 O O6  . INS D 4 .   ? 26.057  24.676 37.764 1.00 27.45 ? 617 INS A O6  1 
HETATM 4666 O O   . HOH E 5 .   ? 27.562  26.608 41.307 1.00 2.00  ? 701 HOH A O   1 
HETATM 4667 O O   . HOH E 5 .   ? 3.223   27.486 37.895 1.00 13.50 ? 702 HOH A O   1 
HETATM 4668 O O   . HOH E 5 .   ? 24.328  29.376 32.788 1.00 75.00 ? 703 HOH A O   1 
HETATM 4669 O O   . HOH E 5 .   ? 10.406  21.433 34.142 1.00 14.21 ? 704 HOH A O   1 
HETATM 4670 O O   . HOH E 5 .   ? 20.085  28.001 30.671 1.00 4.29  ? 705 HOH A O   1 
HETATM 4671 O O   . HOH E 5 .   ? 15.288  27.909 29.692 1.00 5.11  ? 706 HOH A O   1 
HETATM 4672 O O   . HOH E 5 .   ? 32.995  16.928 15.120 1.00 2.00  ? 707 HOH A O   1 
HETATM 4673 O O   . HOH E 5 .   ? 7.793   28.489 51.418 1.00 20.19 ? 708 HOH A O   1 
HETATM 4674 O O   . HOH E 5 .   ? 12.297  34.189 24.387 1.00 2.00  ? 709 HOH A O   1 
HETATM 4675 O O   . HOH E 5 .   ? 16.579  31.023 33.649 1.00 2.52  ? 710 HOH A O   1 
HETATM 4676 O O   . HOH E 5 .   ? 19.802  24.461 37.483 1.00 10.34 ? 711 HOH A O   1 
HETATM 4677 O O   . HOH E 5 .   ? 10.518  22.592 38.757 1.00 2.00  ? 712 HOH A O   1 
HETATM 4678 O O   . HOH E 5 .   ? 7.820   25.658 29.847 1.00 16.47 ? 713 HOH A O   1 
HETATM 4679 O O   . HOH E 5 .   ? 13.492  23.751 40.113 1.00 2.00  ? 714 HOH A O   1 
HETATM 4680 O O   . HOH E 5 .   ? 12.586  35.403 38.959 1.00 16.02 ? 715 HOH A O   1 
HETATM 4681 O O   . HOH E 5 .   ? 34.908  19.304 40.695 1.00 3.88  ? 716 HOH A O   1 
HETATM 4682 O O   . HOH E 5 .   ? 29.993  21.434 13.450 1.00 6.26  ? 717 HOH A O   1 
HETATM 4683 O O   . HOH E 5 .   ? 11.363  18.794 38.297 1.00 3.89  ? 718 HOH A O   1 
HETATM 4684 O O   . HOH E 5 .   ? 8.221   25.230 44.689 1.00 18.12 ? 719 HOH A O   1 
HETATM 4685 O O   . HOH E 5 .   ? 8.917   28.773 40.287 1.00 20.30 ? 720 HOH A O   1 
HETATM 4686 O O   . HOH E 5 .   ? 27.928  18.339 15.767 1.00 15.06 ? 721 HOH A O   1 
HETATM 4687 O O   . HOH E 5 .   ? 11.657  36.650 36.290 1.00 8.64  ? 722 HOH A O   1 
HETATM 4688 O O   . HOH E 5 .   ? 21.140  6.104  31.574 1.00 30.57 ? 723 HOH A O   1 
HETATM 4689 O O   . HOH E 5 .   ? 4.582   32.213 31.073 1.00 15.09 ? 724 HOH A O   1 
HETATM 4690 O O   . HOH E 5 .   ? 11.792  34.848 45.139 1.00 17.35 ? 725 HOH A O   1 
HETATM 4691 O O   . HOH E 5 .   ? 16.230  16.371 43.431 1.00 14.21 ? 726 HOH A O   1 
HETATM 4692 O O   . HOH E 5 .   ? 9.569   20.711 36.906 1.00 9.70  ? 727 HOH A O   1 
HETATM 4693 O O   . HOH E 5 .   ? 37.882  20.748 16.897 1.00 5.96  ? 728 HOH A O   1 
HETATM 4694 O O   . HOH E 5 .   ? 13.948  20.258 36.340 1.00 15.05 ? 729 HOH A O   1 
HETATM 4695 O O   . HOH E 5 .   ? -7.536  33.944 68.851 1.00 38.43 ? 730 HOH A O   1 
HETATM 4696 O O   . HOH E 5 .   ? -0.139  17.700 47.298 1.00 23.78 ? 731 HOH A O   1 
HETATM 4697 O O   . HOH E 5 .   ? 14.976  31.668 44.038 1.00 3.55  ? 732 HOH A O   1 
HETATM 4698 O O   . HOH E 5 .   ? 11.059  21.771 17.132 1.00 17.80 ? 733 HOH A O   1 
HETATM 4699 O O   . HOH E 5 .   ? 29.377  19.099 12.298 1.00 11.49 ? 734 HOH A O   1 
HETATM 4700 O O   . HOH E 5 .   ? 20.794  36.920 36.399 1.00 11.37 ? 735 HOH A O   1 
HETATM 4701 O O   . HOH E 5 .   ? 42.747  25.534 35.569 1.00 10.04 ? 736 HOH A O   1 
HETATM 4702 O O   . HOH E 5 .   ? 47.820  22.142 20.351 1.00 7.18  ? 737 HOH A O   1 
HETATM 4703 O O   . HOH E 5 .   ? 22.613  34.163 19.133 1.00 7.42  ? 738 HOH A O   1 
HETATM 4704 O O   . HOH E 5 .   ? 6.273   43.538 52.382 1.00 11.89 ? 739 HOH A O   1 
HETATM 4705 O O   . HOH E 5 .   ? 31.794  17.272 12.090 1.00 2.00  ? 740 HOH A O   1 
HETATM 4706 O O   . HOH E 5 .   ? 12.928  20.160 33.246 1.00 8.65  ? 741 HOH A O   1 
HETATM 4707 O O   . HOH E 5 .   ? -1.364  21.662 49.388 1.00 13.61 ? 742 HOH A O   1 
HETATM 4708 O O   . HOH E 5 .   ? 16.534  22.786 39.575 1.00 11.31 ? 743 HOH A O   1 
HETATM 4709 O O   . HOH E 5 .   ? -14.934 41.421 42.926 1.00 32.78 ? 744 HOH A O   1 
HETATM 4710 O O   . HOH E 5 .   ? 26.269  23.975 42.287 1.00 20.19 ? 745 HOH A O   1 
HETATM 4711 O O   . HOH E 5 .   ? 20.889  36.597 33.500 1.00 16.60 ? 746 HOH A O   1 
HETATM 4712 O O   . HOH E 5 .   ? 33.270  17.010 9.650  1.00 11.44 ? 747 HOH A O   1 
HETATM 4713 O O   . HOH E 5 .   ? 14.906  23.698 50.645 1.00 38.62 ? 748 HOH A O   1 
HETATM 4714 O O   . HOH E 5 .   ? 19.745  9.970  14.367 1.00 7.91  ? 749 HOH A O   1 
HETATM 4715 O O   . HOH E 5 .   ? 20.216  27.736 42.836 1.00 6.75  ? 750 HOH A O   1 
HETATM 4716 O O   . HOH E 5 .   ? 30.330  16.054 46.208 1.00 23.93 ? 751 HOH A O   1 
HETATM 4717 O O   . HOH E 5 .   ? 16.297  20.084 38.482 1.00 2.95  ? 752 HOH A O   1 
HETATM 4718 O O   . HOH E 5 .   ? -8.636  24.798 51.396 1.00 8.03  ? 753 HOH A O   1 
HETATM 4719 O O   . HOH E 5 .   ? 13.450  32.649 45.846 1.00 9.75  ? 754 HOH A O   1 
HETATM 4720 O O   . HOH E 5 .   ? -1.347  32.968 33.245 1.00 4.26  ? 755 HOH A O   1 
HETATM 4721 O O   . HOH E 5 .   ? 17.551  27.403 48.445 1.00 2.00  ? 756 HOH A O   1 
HETATM 4722 O O   . HOH E 5 .   ? 12.324  28.603 62.179 1.00 2.00  ? 757 HOH A O   1 
HETATM 4723 O O   . HOH E 5 .   ? 25.240  20.779 49.607 1.00 18.19 ? 758 HOH A O   1 
HETATM 4724 O O   . HOH E 5 .   ? 3.502   43.159 45.529 1.00 34.39 ? 759 HOH A O   1 
HETATM 4725 O O   . HOH E 5 .   ? 36.400  25.168 30.573 1.00 6.68  ? 760 HOH A O   1 
HETATM 4726 O O   . HOH E 5 .   ? 23.232  15.457 46.786 1.00 8.88  ? 761 HOH A O   1 
HETATM 4727 O O   . HOH E 5 .   ? 27.366  22.644 46.016 1.00 26.51 ? 762 HOH A O   1 
HETATM 4728 O O   . HOH E 5 .   ? 34.574  23.175 31.872 1.00 21.64 ? 763 HOH A O   1 
HETATM 4729 O O   . HOH E 5 .   ? 5.334   26.122 44.882 1.00 15.68 ? 764 HOH A O   1 
HETATM 4730 O O   . HOH E 5 .   ? 12.555  35.019 58.917 1.00 22.76 ? 765 HOH A O   1 
HETATM 4731 O O   . HOH E 5 .   ? -2.453  30.869 37.426 1.00 16.19 ? 766 HOH A O   1 
HETATM 4732 O O   . HOH E 5 .   ? -7.112  32.553 64.340 1.00 6.74  ? 767 HOH A O   1 
HETATM 4733 O O   . HOH E 5 .   ? 34.145  20.297 6.823  1.00 21.02 ? 768 HOH A O   1 
HETATM 4734 O O   . HOH E 5 .   ? 13.301  8.192  29.639 1.00 11.75 ? 769 HOH A O   1 
HETATM 4735 O O   . HOH E 5 .   ? 22.736  15.076 42.378 1.00 33.71 ? 770 HOH A O   1 
HETATM 4736 O O   . HOH E 5 .   ? 6.366   10.291 28.270 1.00 21.70 ? 771 HOH A O   1 
HETATM 4737 O O   . HOH E 5 .   ? 9.866   40.265 52.140 1.00 27.66 ? 772 HOH A O   1 
HETATM 4738 O O   . HOH E 5 .   ? -0.447  21.094 53.576 1.00 21.70 ? 773 HOH A O   1 
HETATM 4739 O O   . HOH E 5 .   ? 4.342   41.251 38.675 1.00 24.00 ? 774 HOH A O   1 
HETATM 4740 O O   . HOH E 5 .   ? 17.053  37.070 29.382 1.00 25.55 ? 775 HOH A O   1 
HETATM 4741 O O   . HOH E 5 .   ? -7.797  30.336 42.359 1.00 18.08 ? 776 HOH A O   1 
HETATM 4742 O O   . HOH E 5 .   ? 7.111   43.871 45.384 1.00 30.41 ? 777 HOH A O   1 
HETATM 4743 O O   . HOH E 5 .   ? 8.617   32.360 31.143 1.00 7.58  ? 778 HOH A O   1 
HETATM 4744 O O   . HOH E 5 .   ? 23.109  21.619 51.616 1.00 6.79  ? 779 HOH A O   1 
HETATM 4745 O O   . HOH E 5 .   ? -10.821 30.737 70.286 1.00 24.21 ? 780 HOH A O   1 
HETATM 4746 O O   . HOH E 5 .   ? 21.956  31.427 14.282 1.00 38.00 ? 781 HOH A O   1 
HETATM 4747 O O   . HOH E 5 .   ? 27.579  21.846 42.976 1.00 18.99 ? 782 HOH A O   1 
HETATM 4748 O O   . HOH E 5 .   ? 14.496  36.206 28.369 1.00 7.96  ? 783 HOH A O   1 
HETATM 4749 O O   . HOH E 5 .   ? 14.028  35.759 25.812 1.00 2.00  ? 784 HOH A O   1 
HETATM 4750 O O   . HOH E 5 .   ? 16.268  18.877 16.084 1.00 17.78 ? 785 HOH A O   1 
HETATM 4751 O O   . HOH E 5 .   ? 2.764   37.559 43.018 1.00 2.87  ? 786 HOH A O   1 
HETATM 4752 O O   . HOH E 5 .   ? -8.090  32.732 40.444 1.00 6.43  ? 787 HOH A O   1 
HETATM 4753 O O   . HOH E 5 .   ? 24.331  13.959 44.734 1.00 57.47 ? 788 HOH A O   1 
HETATM 4754 O O   . HOH E 5 .   ? 34.994  29.407 29.015 1.00 16.54 ? 789 HOH A O   1 
HETATM 4755 O O   . HOH E 5 .   ? 20.506  20.830 57.648 1.00 41.05 ? 790 HOH A O   1 
HETATM 4756 O O   . HOH E 5 .   ? 15.615  15.945 17.171 1.00 11.73 ? 791 HOH A O   1 
HETATM 4757 O O   . HOH E 5 .   ? 48.731  20.621 25.394 1.00 7.18  ? 792 HOH A O   1 
HETATM 4758 O O   . HOH E 5 .   ? 12.059  37.752 27.618 1.00 12.38 ? 793 HOH A O   1 
HETATM 4759 O O   . HOH E 5 .   ? -14.175 31.597 42.321 1.00 53.82 ? 794 HOH A O   1 
HETATM 4760 O O   . HOH E 5 .   ? 39.509  17.498 10.265 1.00 22.89 ? 795 HOH A O   1 
HETATM 4761 O O   . HOH E 5 .   ? -5.361  27.352 34.806 1.00 39.61 ? 796 HOH A O   1 
HETATM 4762 O O   . HOH E 5 .   ? 15.708  22.018 16.272 1.00 52.47 ? 797 HOH A O   1 
HETATM 4763 O O   . HOH E 5 .   ? 27.655  21.678 39.604 1.00 23.98 ? 798 HOH A O   1 
HETATM 4764 O O   . HOH E 5 .   ? 35.482  21.595 39.468 1.00 19.29 ? 799 HOH A O   1 
HETATM 4765 O O   . HOH E 5 .   ? -9.515  32.212 62.435 1.00 7.10  ? 800 HOH A O   1 
HETATM 4766 O O   . HOH E 5 .   ? -11.570 33.681 61.778 1.00 33.37 ? 801 HOH A O   1 
HETATM 4767 O O   . HOH E 5 .   ? 21.727  33.741 16.305 1.00 17.16 ? 802 HOH A O   1 
HETATM 4768 O O   . HOH E 5 .   ? 15.059  20.733 48.942 1.00 33.71 ? 803 HOH A O   1 
HETATM 4769 O O   . HOH E 5 .   ? 11.383  39.619 30.031 1.00 27.86 ? 804 HOH A O   1 
HETATM 4770 O O   . HOH E 5 .   ? 5.679   37.958 65.345 1.00 9.96  ? 805 HOH A O   1 
HETATM 4771 O O   . HOH E 5 .   ? 17.825  30.686 63.866 1.00 38.16 ? 806 HOH A O   1 
HETATM 4772 O O   . HOH E 5 .   ? 15.465  36.835 17.517 1.00 25.66 ? 807 HOH A O   1 
HETATM 4773 O O   . HOH E 5 .   ? 15.306  21.969 56.143 1.00 41.38 ? 808 HOH A O   1 
HETATM 4774 O O   . HOH E 5 .   ? 10.017  18.543 17.148 1.00 43.02 ? 809 HOH A O   1 
HETATM 4775 O O   . HOH E 5 .   ? 17.632  19.800 56.280 1.00 45.93 ? 810 HOH A O   1 
HETATM 4776 O O   . HOH E 5 .   ? 17.318  39.481 56.210 1.00 40.93 ? 811 HOH A O   1 
HETATM 4777 O O   . HOH E 5 .   ? 35.018  23.504 41.527 1.00 10.68 ? 812 HOH A O   1 
HETATM 4778 O O   . HOH E 5 .   ? -4.590  37.966 63.299 1.00 9.65  ? 813 HOH A O   1 
HETATM 4779 O O   . HOH E 5 .   ? 11.971  18.261 14.206 1.00 40.23 ? 814 HOH A O   1 
HETATM 4780 O O   . HOH E 5 .   ? 14.852  18.327 10.364 1.00 51.87 ? 815 HOH A O   1 
HETATM 4781 O O   . HOH E 5 .   ? -18.686 32.496 49.777 1.00 21.13 ? 816 HOH A O   1 
HETATM 4782 O O   . HOH E 5 .   ? 10.343  39.056 15.478 1.00 41.51 ? 817 HOH A O   1 
HETATM 4783 O O   . HOH E 5 .   ? 19.736  9.646  45.849 1.00 5.48  ? 818 HOH A O   1 
HETATM 4784 O O   . HOH E 5 .   ? 22.497  0.689  36.234 1.00 23.66 ? 819 HOH A O   1 
HETATM 4785 O O   . HOH E 5 .   ? -13.416 33.517 37.548 1.00 41.14 ? 820 HOH A O   1 
HETATM 4786 O O   . HOH E 5 .   ? 14.034  21.018 17.990 1.00 7.00  ? 821 HOH A O   1 
HETATM 4787 O O   . HOH E 5 .   ? -10.729 31.872 39.332 1.00 86.29 ? 822 HOH A O   1 
HETATM 4788 O O   . HOH E 5 .   ? 20.967  11.315 43.937 1.00 14.81 ? 823 HOH A O   1 
HETATM 4789 O O   . HOH E 5 .   ? 18.315  22.955 14.953 1.00 27.24 ? 824 HOH A O   1 
HETATM 4790 O O   . HOH E 5 .   ? 29.919  1.803  30.525 1.00 58.24 ? 825 HOH A O   1 
HETATM 4791 O O   . HOH E 5 .   ? 37.394  28.395 30.216 1.00 22.88 ? 826 HOH A O   1 
HETATM 4792 O O   . HOH E 5 .   ? 35.138  21.885 45.762 1.00 4.73  ? 827 HOH A O   1 
HETATM 4793 O O   . HOH E 5 .   ? 34.130  26.113 42.809 1.00 14.33 ? 828 HOH A O   1 
HETATM 4794 O O   . HOH E 5 .   ? 24.752  19.508 53.363 1.00 32.46 ? 829 HOH A O   1 
HETATM 4795 O O   . HOH E 5 .   ? 40.574  30.348 24.437 1.00 19.96 ? 830 HOH A O   1 
HETATM 4796 O O   . HOH E 5 .   ? 28.460  14.592 5.024  1.00 32.85 ? 831 HOH A O   1 
HETATM 4797 O O   . HOH E 5 .   ? 47.789  9.750  22.562 1.00 48.76 ? 832 HOH A O   1 
HETATM 4798 O O   . HOH E 5 .   ? 24.304  -0.525 29.618 1.00 27.26 ? 833 HOH A O   1 
HETATM 4799 O O   . HOH E 5 .   ? -17.255 30.268 48.652 1.00 26.58 ? 834 HOH A O   1 
HETATM 4800 O O   . HOH E 5 .   ? -10.358 28.977 36.841 1.00 19.58 ? 835 HOH A O   1 
HETATM 4801 O O   . HOH E 5 .   ? 38.616  30.746 21.654 1.00 27.95 ? 836 HOH A O   1 
HETATM 4802 O O   . HOH E 5 .   ? 43.012  15.809 12.715 1.00 22.51 ? 837 HOH A O   1 
HETATM 4803 O O   . HOH E 5 .   ? -18.091 36.481 53.964 1.00 22.13 ? 838 HOH A O   1 
HETATM 4804 O O   . HOH E 5 .   ? 6.167   32.321 20.707 1.00 22.16 ? 839 HOH A O   1 
HETATM 4805 O O   . HOH E 5 .   ? 42.891  19.463 16.212 1.00 42.46 ? 840 HOH A O   1 
HETATM 4806 O O   . HOH E 5 .   ? 10.905  27.555 68.698 1.00 66.50 ? 841 HOH A O   1 
HETATM 4807 O O   . HOH E 5 .   ? 1.904   50.559 50.570 1.00 68.99 ? 843 HOH A O   1 
HETATM 4808 O O   . HOH E 5 .   ? 32.935  26.947 48.398 1.00 44.80 ? 844 HOH A O   1 
HETATM 4809 O O   . HOH E 5 .   ? 18.530  11.357 51.963 1.00 24.51 ? 845 HOH A O   1 
HETATM 4810 O O   . HOH E 5 .   ? 16.174  36.526 49.853 1.00 50.25 ? 846 HOH A O   1 
HETATM 4811 O O   . HOH E 5 .   ? 16.168  39.997 42.371 1.00 20.19 ? 847 HOH A O   1 
HETATM 4812 O O   . HOH E 5 .   ? -4.632  19.657 46.688 1.00 2.00  ? 848 HOH A O   1 
HETATM 4813 O O   . HOH E 5 .   ? -5.461  23.258 41.508 1.00 52.58 ? 849 HOH A O   1 
HETATM 4814 O O   . HOH E 5 .   ? 32.274  4.292  -4.306 1.00 3.85  ? 850 HOH A O   1 
HETATM 4815 O O   . HOH E 5 .   ? 14.489  28.185 11.033 1.00 36.67 ? 851 HOH A O   1 
HETATM 4816 O O   . HOH E 5 .   ? 6.458   32.296 17.346 1.00 2.00  ? 852 HOH A O   1 
HETATM 4817 O O   . HOH E 5 .   ? 34.663  2.403  14.561 1.00 18.75 ? 853 HOH A O   1 
HETATM 4818 O O   . HOH E 5 .   ? 13.109  24.399 10.466 1.00 50.15 ? 854 HOH A O   1 
HETATM 4819 O O   . HOH E 5 .   ? -11.993 21.831 55.679 1.00 29.53 ? 855 HOH A O   1 
HETATM 4820 O O   . HOH E 5 .   ? 28.830  30.867 49.965 1.00 23.90 ? 856 HOH A O   1 
HETATM 4821 O O   . HOH E 5 .   ? 34.852  8.267  5.293  1.00 31.13 ? 858 HOH A O   1 
HETATM 4822 O O   . HOH E 5 .   ? 31.380  17.296 1.924  1.00 61.79 ? 859 HOH A O   1 
HETATM 4823 O O   . HOH E 5 .   ? 1.562   15.191 49.760 1.00 9.66  ? 860 HOH A O   1 
HETATM 4824 O O   . HOH E 5 .   ? 27.671  30.311 53.081 1.00 24.24 ? 861 HOH A O   1 
HETATM 4825 O O   . HOH E 5 .   ? -10.734 24.315 57.297 1.00 32.07 ? 863 HOH A O   1 
HETATM 4826 O O   . HOH E 5 .   ? -14.579 28.810 50.648 1.00 30.75 ? 864 HOH A O   1 
HETATM 4827 O O   . HOH E 5 .   ? 7.657   17.442 15.864 1.00 24.03 ? 865 HOH A O   1 
HETATM 4828 O O   . HOH E 5 .   ? 43.486  12.073 12.675 1.00 41.82 ? 866 HOH A O   1 
HETATM 4829 O O   . HOH E 5 .   ? -22.917 39.364 43.831 1.00 55.24 ? 867 HOH A O   1 
HETATM 4830 O O   . HOH E 5 .   ? 25.306  34.674 18.908 1.00 10.25 ? 868 HOH A O   1 
HETATM 4831 O O   . HOH E 5 .   ? 26.148  22.045 30.398 1.00 62.16 ? 869 HOH A O   1 
HETATM 4832 O O   . HOH E 5 .   ? -3.714  25.560 63.151 1.00 28.24 ? 870 HOH A O   1 
HETATM 4833 O O   . HOH E 5 .   ? 23.731  14.498 55.791 1.00 31.83 ? 871 HOH A O   1 
HETATM 4834 O O   . HOH E 5 .   ? 25.606  14.622 53.170 1.00 31.19 ? 872 HOH A O   1 
HETATM 4835 O O   . HOH E 5 .   ? 6.566   10.770 53.137 1.00 47.78 ? 873 HOH A O   1 
HETATM 4836 O O   . HOH E 5 .   ? 24.082  29.456 60.029 1.00 19.33 ? 875 HOH A O   1 
HETATM 4837 O O   . HOH E 5 .   ? -0.811  27.807 22.181 1.00 32.30 ? 877 HOH A O   1 
HETATM 4838 O O   . HOH E 5 .   ? 24.571  13.505 8.260  1.00 39.14 ? 878 HOH A O   1 
HETATM 4839 O O   . HOH E 5 .   ? -8.976  31.172 35.413 1.00 8.55  ? 879 HOH A O   1 
HETATM 4840 O O   . HOH E 5 .   ? 7.815   34.214 23.378 1.00 23.09 ? 880 HOH A O   1 
HETATM 4841 O O   . HOH E 5 .   ? 44.536  13.753 9.829  1.00 44.65 ? 881 HOH A O   1 
HETATM 4842 O O   . HOH E 5 .   ? 25.945  28.125 53.382 1.00 11.99 ? 882 HOH A O   1 
HETATM 4843 O O   . HOH E 5 .   ? -10.420 45.712 59.477 1.00 30.39 ? 883 HOH A O   1 
HETATM 4844 O O   . HOH E 5 .   ? 35.289  13.644 44.110 1.00 21.84 ? 884 HOH A O   1 
HETATM 4845 O O   . HOH E 5 .   ? 34.760  22.585 8.540  1.00 14.36 ? 885 HOH A O   1 
HETATM 4846 O O   . HOH E 5 .   ? -1.914  30.186 27.281 1.00 36.13 ? 886 HOH A O   1 
HETATM 4847 O O   . HOH E 5 .   ? 19.306  33.288 62.184 1.00 24.32 ? 887 HOH A O   1 
HETATM 4848 O O   . HOH E 5 .   ? 30.059  17.861 54.484 1.00 70.80 ? 888 HOH A O   1 
HETATM 4849 O O   . HOH E 5 .   ? 34.217  33.176 18.467 1.00 27.17 ? 889 HOH A O   1 
HETATM 4850 O O   . HOH E 5 .   ? -12.678 32.602 56.539 1.00 53.85 ? 890 HOH A O   1 
HETATM 4851 O O   . HOH E 5 .   ? 12.156  39.633 58.344 1.00 46.14 ? 892 HOH A O   1 
HETATM 4852 O O   . HOH E 5 .   ? 9.427   4.509  34.928 1.00 82.56 ? 893 HOH A O   1 
HETATM 4853 O O   . HOH E 5 .   ? -6.078  22.653 37.005 1.00 40.40 ? 894 HOH A O   1 
HETATM 4854 O O   . HOH E 5 .   ? 10.579  33.024 11.273 1.00 51.95 ? 895 HOH A O   1 
HETATM 4855 O O   . HOH E 5 .   ? -1.222  39.289 65.362 1.00 21.06 ? 896 HOH A O   1 
HETATM 4856 O O   . HOH E 5 .   ? 16.933  34.370 15.845 1.00 33.46 ? 897 HOH A O   1 
HETATM 4857 O O   . HOH E 5 .   ? -6.085  49.101 45.206 1.00 50.46 ? 898 HOH A O   1 
HETATM 4858 O O   . HOH E 5 .   ? -14.734 36.504 55.555 1.00 84.48 ? 899 HOH A O   1 
HETATM 4859 O O   . HOH E 5 .   ? 9.653   43.054 19.348 1.00 44.86 ? 900 HOH A O   1 
HETATM 4860 O O   . HOH E 5 .   ? -12.015 17.846 50.046 1.00 41.61 ? 901 HOH A O   1 
HETATM 4861 O O   . HOH E 5 .   ? 42.623  11.097 8.220  1.00 73.02 ? 902 HOH A O   1 
HETATM 4862 O O   . HOH E 5 .   ? 6.208   15.378 25.311 1.00 28.11 ? 904 HOH A O   1 
HETATM 4863 O O   . HOH E 5 .   ? 0.691   41.670 64.785 1.00 7.05  ? 905 HOH A O   1 
HETATM 4864 O O   . HOH E 5 .   ? 19.284  19.866 67.867 1.00 28.89 ? 906 HOH A O   1 
HETATM 4865 O O   . HOH E 5 .   ? -7.285  45.761 42.997 1.00 62.52 ? 907 HOH A O   1 
HETATM 4866 O O   . HOH E 5 .   ? -3.478  29.127 34.327 1.00 42.69 ? 908 HOH A O   1 
HETATM 4867 O O   . HOH E 5 .   ? 4.277   30.104 20.415 1.00 12.04 ? 909 HOH A O   1 
HETATM 4868 O O   . HOH E 5 .   ? -4.683  33.754 70.957 1.00 49.55 ? 910 HOH A O   1 
HETATM 4869 O O   . HOH E 5 .   ? 26.822  21.180 57.250 1.00 48.54 ? 911 HOH A O   1 
HETATM 4870 O O   . HOH E 5 .   ? 7.091   45.188 36.552 1.00 54.10 ? 912 HOH A O   1 
HETATM 4871 O O   . HOH E 5 .   ? 6.534   10.754 46.052 1.00 47.72 ? 913 HOH A O   1 
HETATM 4872 O O   . HOH E 5 .   ? -11.006 29.747 43.639 1.00 13.53 ? 914 HOH A O   1 
HETATM 4873 O O   . HOH E 5 .   ? -12.220 45.136 43.358 1.00 39.87 ? 915 HOH A O   1 
HETATM 4874 O O   . HOH E 5 .   ? 11.043  44.440 47.520 1.00 50.44 ? 916 HOH A O   1 
HETATM 4875 O O   . HOH E 5 .   ? 33.046  3.256  24.088 1.00 13.47 ? 917 HOH A O   1 
HETATM 4876 O O   . HOH E 5 .   ? 22.405  -0.358 18.062 1.00 34.48 ? 918 HOH A O   1 
HETATM 4877 O O   . HOH E 5 .   ? -12.455 40.553 41.245 1.00 31.75 ? 919 HOH A O   1 
HETATM 4878 O O   . HOH E 5 .   ? -12.770 31.327 59.973 1.00 66.89 ? 920 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  TRP 70  70  70  TRP TRP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 CYS 147 147 147 CYS CYS A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 TRP 156 156 156 TRP TRP A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 MET 250 250 250 MET MET A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 TYR 253 253 253 TYR TYR A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 TRP 256 256 256 TRP TRP A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 LYS 305 305 305 LYS LYS A . n 
A 1 306 ALA 306 306 306 ALA ALA A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 MET 314 314 314 MET MET A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 MET 316 316 316 MET MET A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 PRO 318 318 318 PRO PRO A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 TYR 321 321 321 TYR TYR A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 GLN 323 323 323 GLN GLN A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 PRO 338 338 338 PRO PRO A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 ILE 349 349 349 ILE ILE A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 ARG 351 351 351 ARG ARG A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 TYR 363 363 363 TYR TYR A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 PRO 366 366 366 PRO PRO A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 MET 368 368 368 MET MET A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 GLN 371 371 371 GLN GLN A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 GLY 373 373 373 GLY GLY A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 HIS 377 377 377 HIS HIS A . n 
A 1 378 ARG 378 378 378 ARG ARG A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ALA 381 381 381 ALA ALA A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 LYS 387 387 387 LYS LYS A . n 
A 1 388 SER 388 388 388 SER SER A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 LYS 393 393 393 LYS LYS A . n 
A 1 394 ASN 394 394 394 ASN ASN A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 ASP 400 400 400 ASP ASP A . n 
A 1 401 ALA 401 401 401 ALA ALA A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 PRO 405 405 405 PRO PRO A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 LYS 409 409 409 LYS LYS A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 PRO 411 411 411 PRO PRO A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 VAL 415 415 415 VAL VAL A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 HIS 419 419 419 HIS HIS A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 CYS 427 427 427 CYS CYS A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 GLY 429 429 429 GLY GLY A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 THR 431 431 431 THR THR A . n 
A 1 432 ILE 432 432 432 ILE ILE A . n 
A 1 433 GLU 433 433 433 GLU GLU A . n 
A 1 434 TRP 434 434 434 TRP TRP A . n 
A 1 435 GLN 435 435 435 GLN GLN A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 ARG 440 440 440 ARG ARG A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 THR 442 442 442 THR THR A . n 
A 1 443 VAL 443 443 443 VAL VAL A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 THR 445 445 445 THR THR A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 ILE 447 447 447 ILE ILE A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 ALA 453 453 453 ALA ALA A . n 
A 1 454 ALA 454 454 454 ALA ALA A . n 
A 1 455 VAL 455 455 455 VAL VAL A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 PRO 457 457 457 PRO PRO A . n 
A 1 458 SER 458 458 458 SER SER A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 VAL 461 461 461 VAL VAL A . n 
A 1 462 VAL 462 462 462 VAL VAL A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 ASN 466 466 466 ASN ASN A . n 
A 1 467 PRO 467 467 467 PRO PRO A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 GLU 470 470 470 GLU GLU A . n 
A 1 471 PHE 471 471 471 PHE PHE A . n 
A 1 472 VAL 472 472 472 VAL VAL A . n 
A 1 473 LYS 473 473 473 LYS LYS A . n 
A 1 474 SER 474 474 474 SER SER A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 GLY 476 476 476 GLY GLY A . n 
A 1 477 PHE 477 477 477 PHE PHE A . n 
A 1 478 SER 478 478 478 SER SER A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 ALA 480 480 480 ALA ALA A . n 
A 1 481 ILE 481 481 481 ILE ILE A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 ALA 483 483 483 ALA ALA A . n 
A 1 484 VAL 484 484 484 VAL VAL A . n 
A 1 485 GLY 485 485 485 GLY GLY A . n 
A 1 486 GLU 486 486 486 GLU GLU A . n 
A 1 487 HIS 487 487 487 HIS HIS A . n 
A 1 488 PRO 488 488 488 PRO PRO A . n 
A 1 489 TYR 489 489 489 TYR TYR A . n 
A 1 490 THR 490 490 490 THR THR A . n 
A 1 491 GLU 491 491 491 GLU GLU A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 GLY 494 494 494 GLY GLY A . n 
A 1 495 ASP 495 495 495 ASP ASP A . n 
A 1 496 ASN 496 496 496 ASN ASN A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 ASN 498 498 498 ASN ASN A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 THR 500 500 500 THR THR A . n 
A 1 501 ILE 501 501 501 ILE ILE A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 PRO 504 504 504 PRO PRO A . n 
A 1 505 GLY 505 505 505 GLY GLY A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 VAL 509 509 509 VAL VAL A . n 
A 1 510 GLN 510 510 510 GLN GLN A . n 
A 1 511 ALA 511 511 511 ALA ALA A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 CYS 513 513 513 CYS CYS A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 GLY 515 515 515 GLY GLY A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 CYS 518 518 518 CYS CYS A . n 
A 1 519 ALA 519 519 519 ALA ALA A . n 
A 1 520 THR 520 520 520 THR THR A . n 
A 1 521 VAL 521 521 521 VAL VAL A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 ILE 523 523 523 ILE ILE A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 GLY 525 525 525 GLY GLY A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 VAL 528 528 528 VAL VAL A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 VAL 530 530 530 VAL VAL A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 PRO 532 532 532 PRO PRO A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 LEU 534 534 534 LEU LEU A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 SER 537 537 537 SER SER A . n 
A 1 538 ASP 538 538 538 ASP ASP A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 TRP 544 544 544 TRP TRP A . n 
A 1 545 LEU 545 545 545 LEU LEU A . n 
A 1 546 PRO 546 546 546 PRO PRO A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 SER 548 548 548 SER SER A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 GLY 550 550 550 GLY GLY A . n 
A 1 551 GLN 551 551 551 GLN GLN A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 VAL 553 553 553 VAL VAL A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 ASP 555 555 555 ASP ASP A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LEU 557 557 557 LEU LEU A . n 
A 1 558 PHE 558 558 558 PHE PHE A . n 
A 1 559 GLY 559 559 559 GLY GLY A . n 
A 1 560 ASP 560 560 560 ASP ASP A . n 
A 1 561 PHE 561 561 561 PHE PHE A . n 
A 1 562 GLY 562 562 562 GLY GLY A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 GLY 565 565 565 GLY GLY A . n 
A 1 566 ARG 566 566 566 ARG ARG A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 ARG 569 569 569 ARG ARG A . n 
A 1 570 THR 570 570 570 THR THR A . n 
A 1 571 TRP 571 571 571 TRP TRP A . n 
A 1 572 PHE 572 572 572 PHE PHE A . n 
A 1 573 LYS 573 573 573 LYS LYS A . n 
A 1 574 SER 574 574 574 SER SER A . n 
A 1 575 VAL 575 575 575 VAL VAL A . n 
A 1 576 ASP 576 576 576 ASP ASP A . n 
A 1 577 GLN 577 577 577 GLN GLN A . n 
A 1 578 LEU 578 578 578 LEU LEU A . n 
A 1 579 PRO 579 579 579 PRO PRO A . n 
A 1 580 MET 580 580 580 MET MET A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 VAL 582 582 582 VAL VAL A . n 
A 1 583 GLY 583 583 583 GLY GLY A . n 
A 1 584 ASP 584 584 584 ASP ASP A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 HIS 586 586 586 HIS HIS A . n 
A 1 587 TYR 587 587 587 TYR TYR A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 PHE 591 591 591 PHE PHE A . n 
A 1 592 ARG 592 592 592 ARG ARG A . n 
A 1 593 LEU 593 593 593 LEU LEU A . n 
A 1 594 GLY 594 594 594 GLY GLY A . n 
A 1 595 TYR 595 595 595 TYR TYR A . n 
A 1 596 GLY 596 596 596 GLY GLY A . n 
A 1 597 LEU 597 597 597 LEU LEU A . n 
A 1 598 THR 598 598 598 THR THR A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASN 600 600 600 ASN ASN A . n 
A 1 601 ALA 601 601 601 ALA ALA A . n 
A 1 602 THR 602 602 602 THR THR A . n 
A 1 603 LYS 603 603 ?   ?   ?   A . n 
A 1 604 LYS 604 604 ?   ?   ?   A . n 
A 1 605 TYR 605 605 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1   610 610 NAG NAG A . 
D 4 INS 1   617 617 INS EPX A . 
E 5 HOH 1   701 701 HOH TIP A . 
E 5 HOH 2   702 702 HOH TIP A . 
E 5 HOH 3   703 703 HOH TIP A . 
E 5 HOH 4   704 704 HOH TIP A . 
E 5 HOH 5   705 705 HOH TIP A . 
E 5 HOH 6   706 706 HOH TIP A . 
E 5 HOH 7   707 707 HOH TIP A . 
E 5 HOH 8   708 708 HOH TIP A . 
E 5 HOH 9   709 709 HOH TIP A . 
E 5 HOH 10  710 710 HOH TIP A . 
E 5 HOH 11  711 711 HOH TIP A . 
E 5 HOH 12  712 712 HOH TIP A . 
E 5 HOH 13  713 713 HOH TIP A . 
E 5 HOH 14  714 714 HOH TIP A . 
E 5 HOH 15  715 715 HOH TIP A . 
E 5 HOH 16  716 716 HOH TIP A . 
E 5 HOH 17  717 717 HOH TIP A . 
E 5 HOH 18  718 718 HOH TIP A . 
E 5 HOH 19  719 719 HOH TIP A . 
E 5 HOH 20  720 720 HOH TIP A . 
E 5 HOH 21  721 721 HOH TIP A . 
E 5 HOH 22  722 722 HOH TIP A . 
E 5 HOH 23  723 723 HOH TIP A . 
E 5 HOH 24  724 724 HOH TIP A . 
E 5 HOH 25  725 725 HOH TIP A . 
E 5 HOH 26  726 726 HOH TIP A . 
E 5 HOH 27  727 727 HOH TIP A . 
E 5 HOH 28  728 728 HOH TIP A . 
E 5 HOH 29  729 729 HOH TIP A . 
E 5 HOH 30  730 730 HOH TIP A . 
E 5 HOH 31  731 731 HOH TIP A . 
E 5 HOH 32  732 732 HOH TIP A . 
E 5 HOH 33  733 733 HOH TIP A . 
E 5 HOH 34  734 734 HOH TIP A . 
E 5 HOH 35  735 735 HOH TIP A . 
E 5 HOH 36  736 736 HOH TIP A . 
E 5 HOH 37  737 737 HOH TIP A . 
E 5 HOH 38  738 738 HOH TIP A . 
E 5 HOH 39  739 739 HOH TIP A . 
E 5 HOH 40  740 740 HOH TIP A . 
E 5 HOH 41  741 741 HOH TIP A . 
E 5 HOH 42  742 742 HOH TIP A . 
E 5 HOH 43  743 743 HOH TIP A . 
E 5 HOH 44  744 744 HOH TIP A . 
E 5 HOH 45  745 745 HOH TIP A . 
E 5 HOH 46  746 746 HOH TIP A . 
E 5 HOH 47  747 747 HOH TIP A . 
E 5 HOH 48  748 748 HOH TIP A . 
E 5 HOH 49  749 749 HOH TIP A . 
E 5 HOH 50  750 750 HOH TIP A . 
E 5 HOH 51  751 751 HOH TIP A . 
E 5 HOH 52  752 752 HOH TIP A . 
E 5 HOH 53  753 753 HOH TIP A . 
E 5 HOH 54  754 754 HOH TIP A . 
E 5 HOH 55  755 755 HOH TIP A . 
E 5 HOH 56  756 756 HOH TIP A . 
E 5 HOH 57  757 757 HOH TIP A . 
E 5 HOH 58  758 758 HOH TIP A . 
E 5 HOH 59  759 759 HOH TIP A . 
E 5 HOH 60  760 760 HOH TIP A . 
E 5 HOH 61  761 761 HOH TIP A . 
E 5 HOH 62  762 762 HOH TIP A . 
E 5 HOH 63  763 763 HOH TIP A . 
E 5 HOH 64  764 764 HOH TIP A . 
E 5 HOH 65  765 765 HOH TIP A . 
E 5 HOH 66  766 766 HOH TIP A . 
E 5 HOH 67  767 767 HOH TIP A . 
E 5 HOH 68  768 768 HOH TIP A . 
E 5 HOH 69  769 769 HOH TIP A . 
E 5 HOH 70  770 770 HOH TIP A . 
E 5 HOH 71  771 771 HOH TIP A . 
E 5 HOH 72  772 772 HOH TIP A . 
E 5 HOH 73  773 773 HOH TIP A . 
E 5 HOH 74  774 774 HOH TIP A . 
E 5 HOH 75  775 775 HOH TIP A . 
E 5 HOH 76  776 776 HOH TIP A . 
E 5 HOH 77  777 777 HOH TIP A . 
E 5 HOH 78  778 778 HOH TIP A . 
E 5 HOH 79  779 779 HOH TIP A . 
E 5 HOH 80  780 780 HOH TIP A . 
E 5 HOH 81  781 781 HOH TIP A . 
E 5 HOH 82  782 782 HOH TIP A . 
E 5 HOH 83  783 783 HOH TIP A . 
E 5 HOH 84  784 784 HOH TIP A . 
E 5 HOH 85  785 785 HOH TIP A . 
E 5 HOH 86  786 786 HOH TIP A . 
E 5 HOH 87  787 787 HOH TIP A . 
E 5 HOH 88  788 788 HOH TIP A . 
E 5 HOH 89  789 789 HOH TIP A . 
E 5 HOH 90  790 790 HOH TIP A . 
E 5 HOH 91  791 791 HOH TIP A . 
E 5 HOH 92  792 792 HOH TIP A . 
E 5 HOH 93  793 793 HOH TIP A . 
E 5 HOH 94  794 794 HOH TIP A . 
E 5 HOH 95  795 795 HOH TIP A . 
E 5 HOH 96  796 796 HOH TIP A . 
E 5 HOH 97  797 797 HOH TIP A . 
E 5 HOH 98  798 798 HOH TIP A . 
E 5 HOH 99  799 799 HOH TIP A . 
E 5 HOH 100 800 800 HOH TIP A . 
E 5 HOH 101 801 801 HOH TIP A . 
E 5 HOH 102 802 802 HOH TIP A . 
E 5 HOH 103 803 803 HOH TIP A . 
E 5 HOH 104 804 804 HOH TIP A . 
E 5 HOH 105 805 805 HOH TIP A . 
E 5 HOH 106 806 806 HOH TIP A . 
E 5 HOH 107 807 807 HOH TIP A . 
E 5 HOH 108 808 808 HOH TIP A . 
E 5 HOH 109 809 809 HOH TIP A . 
E 5 HOH 110 810 810 HOH TIP A . 
E 5 HOH 111 811 811 HOH TIP A . 
E 5 HOH 112 812 812 HOH TIP A . 
E 5 HOH 113 813 813 HOH TIP A . 
E 5 HOH 114 814 814 HOH TIP A . 
E 5 HOH 115 815 815 HOH TIP A . 
E 5 HOH 116 816 816 HOH TIP A . 
E 5 HOH 117 817 817 HOH TIP A . 
E 5 HOH 118 818 818 HOH TIP A . 
E 5 HOH 119 819 819 HOH TIP A . 
E 5 HOH 120 820 820 HOH TIP A . 
E 5 HOH 121 821 821 HOH TIP A . 
E 5 HOH 122 822 822 HOH TIP A . 
E 5 HOH 123 823 823 HOH TIP A . 
E 5 HOH 124 824 824 HOH TIP A . 
E 5 HOH 125 825 825 HOH TIP A . 
E 5 HOH 126 826 826 HOH TIP A . 
E 5 HOH 127 827 827 HOH TIP A . 
E 5 HOH 128 828 828 HOH TIP A . 
E 5 HOH 129 829 829 HOH TIP A . 
E 5 HOH 130 830 830 HOH TIP A . 
E 5 HOH 131 831 831 HOH TIP A . 
E 5 HOH 132 832 832 HOH TIP A . 
E 5 HOH 133 833 833 HOH TIP A . 
E 5 HOH 134 834 834 HOH TIP A . 
E 5 HOH 135 835 835 HOH TIP A . 
E 5 HOH 136 836 836 HOH TIP A . 
E 5 HOH 137 837 837 HOH TIP A . 
E 5 HOH 138 838 838 HOH TIP A . 
E 5 HOH 139 839 839 HOH TIP A . 
E 5 HOH 140 840 840 HOH TIP A . 
E 5 HOH 141 841 841 HOH TIP A . 
E 5 HOH 142 843 843 HOH TIP A . 
E 5 HOH 143 844 844 HOH TIP A . 
E 5 HOH 144 845 845 HOH TIP A . 
E 5 HOH 145 846 846 HOH TIP A . 
E 5 HOH 146 847 847 HOH TIP A . 
E 5 HOH 147 848 848 HOH TIP A . 
E 5 HOH 148 849 849 HOH TIP A . 
E 5 HOH 149 850 850 HOH TIP A . 
E 5 HOH 150 851 851 HOH TIP A . 
E 5 HOH 151 852 852 HOH TIP A . 
E 5 HOH 152 853 853 HOH TIP A . 
E 5 HOH 153 854 854 HOH TIP A . 
E 5 HOH 154 855 855 HOH TIP A . 
E 5 HOH 155 856 856 HOH TIP A . 
E 5 HOH 156 858 858 HOH TIP A . 
E 5 HOH 157 859 859 HOH TIP A . 
E 5 HOH 158 860 860 HOH TIP A . 
E 5 HOH 159 861 861 HOH TIP A . 
E 5 HOH 160 863 863 HOH TIP A . 
E 5 HOH 161 864 864 HOH TIP A . 
E 5 HOH 162 865 865 HOH TIP A . 
E 5 HOH 163 866 866 HOH TIP A . 
E 5 HOH 164 867 867 HOH TIP A . 
E 5 HOH 165 868 868 HOH TIP A . 
E 5 HOH 166 869 869 HOH TIP A . 
E 5 HOH 167 870 870 HOH TIP A . 
E 5 HOH 168 871 871 HOH TIP A . 
E 5 HOH 169 872 872 HOH TIP A . 
E 5 HOH 170 873 873 HOH TIP A . 
E 5 HOH 171 875 875 HOH TIP A . 
E 5 HOH 172 877 877 HOH TIP A . 
E 5 HOH 173 878 878 HOH TIP A . 
E 5 HOH 174 879 879 HOH TIP A . 
E 5 HOH 175 880 880 HOH TIP A . 
E 5 HOH 176 881 881 HOH TIP A . 
E 5 HOH 177 882 882 HOH TIP A . 
E 5 HOH 178 883 883 HOH TIP A . 
E 5 HOH 179 884 884 HOH TIP A . 
E 5 HOH 180 885 885 HOH TIP A . 
E 5 HOH 181 886 886 HOH TIP A . 
E 5 HOH 182 887 887 HOH TIP A . 
E 5 HOH 183 888 888 HOH TIP A . 
E 5 HOH 184 889 889 HOH TIP A . 
E 5 HOH 185 890 890 HOH TIP A . 
E 5 HOH 186 892 892 HOH TIP A . 
E 5 HOH 187 893 893 HOH TIP A . 
E 5 HOH 188 894 894 HOH TIP A . 
E 5 HOH 189 895 895 HOH TIP A . 
E 5 HOH 190 896 896 HOH TIP A . 
E 5 HOH 191 897 897 HOH TIP A . 
E 5 HOH 192 898 898 HOH TIP A . 
E 5 HOH 193 899 899 HOH TIP A . 
E 5 HOH 194 900 900 HOH TIP A . 
E 5 HOH 195 901 901 HOH TIP A . 
E 5 HOH 196 902 902 HOH TIP A . 
E 5 HOH 197 904 904 HOH TIP A . 
E 5 HOH 198 905 905 HOH TIP A . 
E 5 HOH 199 906 906 HOH TIP A . 
E 5 HOH 200 907 907 HOH TIP A . 
E 5 HOH 201 908 908 HOH TIP A . 
E 5 HOH 202 909 909 HOH TIP A . 
E 5 HOH 203 910 910 HOH TIP A . 
E 5 HOH 204 911 911 HOH TIP A . 
E 5 HOH 205 912 912 HOH TIP A . 
E 5 HOH 206 913 913 HOH TIP A . 
E 5 HOH 207 914 914 HOH TIP A . 
E 5 HOH 208 915 915 HOH TIP A . 
E 5 HOH 209 916 916 HOH TIP A . 
E 5 HOH 210 917 917 HOH TIP A . 
E 5 HOH 211 918 918 HOH TIP A . 
E 5 HOH 212 919 919 HOH TIP A . 
E 5 HOH 213 920 920 HOH TIP A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 221 A ASN 221 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 498 A ASN 498 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-14 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-02-17 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Derived calculations'      
5 5 'Structure model' Advisory                    
6 5 'Structure model' 'Atomic model'              
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' atom_site                     
2  5 'Structure model' chem_comp                     
3  5 'Structure model' entity                        
4  5 'Structure model' pdbx_branch_scheme            
5  5 'Structure model' pdbx_chem_comp_identifier     
6  5 'Structure model' pdbx_entity_branch            
7  5 'Structure model' pdbx_entity_branch_descriptor 
8  5 'Structure model' pdbx_entity_branch_link       
9  5 'Structure model' pdbx_entity_branch_list       
10 5 'Structure model' pdbx_entity_nonpoly           
11 5 'Structure model' pdbx_nonpoly_scheme           
12 5 'Structure model' pdbx_struct_assembly_gen      
13 5 'Structure model' pdbx_validate_close_contact   
14 5 'Structure model' struct_asym                   
15 5 'Structure model' struct_conn                   
16 5 'Structure model' struct_site                   
17 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  5 'Structure model' '_atom_site.Cartn_x'                          
3  5 'Structure model' '_atom_site.Cartn_y'                          
4  5 'Structure model' '_atom_site.Cartn_z'                          
5  5 'Structure model' '_atom_site.auth_asym_id'                     
6  5 'Structure model' '_atom_site.auth_atom_id'                     
7  5 'Structure model' '_atom_site.auth_comp_id'                     
8  5 'Structure model' '_atom_site.auth_seq_id'                      
9  5 'Structure model' '_atom_site.label_asym_id'                    
10 5 'Structure model' '_atom_site.label_atom_id'                    
11 5 'Structure model' '_atom_site.label_comp_id'                    
12 5 'Structure model' '_atom_site.label_entity_id'                  
13 5 'Structure model' '_atom_site.type_symbol'                      
14 5 'Structure model' '_chem_comp.name'                             
15 5 'Structure model' '_chem_comp.type'                             
16 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
17 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 
18 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
19 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
20 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
21 5 'Structure model' '_struct_conn.pdbx_dist_value'                
22 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
23 5 'Structure model' '_struct_conn.pdbx_role'                      
24 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
25 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
31 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
32 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
33 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
34 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
35 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
X-PLOR    refinement       . ? 4 
X-PLOR    phasing          . ? 5 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
600 
;HETEROGEN
CONDURITOL B EPOXIDE REACTS WITH THE ENZYME TO FORM 
A CYCLOHEXITOL RING COVALENTLY BOUND TO THE ENZYME.
;
999 
;SEQUENCE
The sequence in the GenBank entry might be
a sequencing error at residue 345.  The 
electron density unambiguously proved the 
presence of LYS instead of ASN at this residue.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 C6  B BMA 3   ? ? C1 B MAN 4   ? ? 2.03 
2 1 ND1 A HIS 487 ? ? O4 B MAN 4   ? ? 2.06 
3 1 OD1 A ASP 285 ? ? C2 A INS 617 ? ? 2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ASP 
_pdbx_validate_rmsd_bond.auth_seq_id_1             285 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OD1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ASP 
_pdbx_validate_rmsd_bond.auth_seq_id_2             285 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.412 
_pdbx_validate_rmsd_bond.bond_target_value         1.249 
_pdbx_validate_rmsd_bond.bond_deviation            0.163 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 4   ? ? CB A LEU 4   ? ? CG A LEU 4   ? ? 130.71 115.30 15.41  2.30 N 
2 1 CA A PHE 208 ? ? C  A PHE 208 ? ? N  A VAL 209 ? ? 100.47 117.20 -16.73 2.20 Y 
3 1 C  A PHE 208 ? ? N  A VAL 209 ? ? CA A VAL 209 ? ? 137.38 121.70 15.68  2.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 98  ? ? -142.79 54.32   
2  1 PRO A 154 ? ? -67.25  3.97    
3  1 THR A 174 ? ? -57.50  -1.63   
4  1 PHE A 188 ? ? -38.50  133.60  
5  1 HIS A 207 ? ? 65.48   64.92   
6  1 VAL A 209 ? ? 52.23   116.86  
7  1 ASP A 216 ? ? 58.28   12.88   
8  1 ASN A 221 ? ? -83.19  -150.11 
9  1 ILE A 233 ? ? -103.59 -64.39  
10 1 TYR A 271 ? ? -90.69  -67.46  
11 1 MET A 356 ? ? -56.45  -8.71   
12 1 TRP A 430 ? ? 60.41   63.05   
13 1 ILE A 432 ? ? 65.24   -66.72  
14 1 GLU A 491 ? ? 51.84   -144.79 
15 1 TRP A 544 ? ? 55.08   -143.48 
16 1 LEU A 545 ? ? -108.99 79.54   
17 1 MET A 580 ? ? -166.79 98.31   
18 1 HIS A 586 ? ? -80.24  41.38   
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 LYS A 206 ? ? -10.33 
2 1 PHE A 208 ? ? -12.13 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     302 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.068 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 603 ? A LYS 603 
2 1 Y 1 A LYS 604 ? A LYS 604 
3 1 Y 1 A TYR 605 ? A TYR 605 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 ? NAG 611 n 
B 2 NAG 2 B NAG 2 ? NAG 612 n 
B 2 BMA 3 B BMA 3 ? MAN 613 n 
B 2 MAN 4 B MAN 4 ? MAN 615 n 
B 2 NAG 5 B NAG 5 ? NAG 616 n 
B 2 FUC 6 B FUC 6 ? FUC 614 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4DManpa1-6DManpb1-4DGlcpNAcb1-4[LFucpa1-3]DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML       1.0   
2 2 
'WURCS=2.0/4,6,5/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5][a1122h-1b_1-5][a1122h-1a_1-5]/1-2-1-3-4-1/a3-b1_a4-c1_c4-d1_d6-e1_e4-f1' 
WURCS                       PDB2Glycan 1.1.0 
3 2 
'[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][a-D-Manp]{[(4+1)][a-D-GlcpNAc]{}}}}}}'  
LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 MAN C1 O1 3 BMA O6 HO6 sing ? 
4 2 5 NAG C1 O1 4 MAN O4 HO4 sing ? 
5 2 6 FUC C1 O1 1 NAG O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
2 MAN 4 n 
2 NAG 5 n 
2 FUC 6 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 1,2,3,4,5,6-HEXAHYDROXY-CYCLOHEXANE      INS 
5 water                                    HOH 
#