data_1IEW
# 
_entry.id   1IEW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IEW         
RCSB  RCSB013218   
WWPDB D_1000013218 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EX1 'Three-dimensional structure of a barley beta-D-glucan exohydrolase, a family 3 glycosyl hydrolase.' unspecified 
PDB 1IEQ 'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1.' unspecified 
PDB 1IEV 'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with cyclohexitol.' unspecified 
PDB 1IEX 
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose.' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IEW 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hrmova, M.'     1 
'DeGori, R.'     2 
'Fincher, G.B.'  3 
'Smith, B.J.'    4 
'Varghese, J.N.' 5 
# 
_citation.id                        primary 
_citation.title                     
'Catalytic mechanisms and reaction intermediates along the hydrolytic pathway of a plant beta-D-glucan glucohydrolase.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                1005 
_citation.page_last                 1016 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11709165 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00673-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hrmova, M.'     1 ? 
primary 'Varghese, J.N.' 2 ? 
primary 'De Gori, R.'    3 ? 
primary 'Smith, B.J.'    4 ? 
primary 'Driguez, H.'    5 ? 
primary 'Fincher, G.B.'  6 ? 
# 
_cell.entry_id           1IEW 
_cell.length_a           100.962 
_cell.length_b           100.962 
_cell.length_c           181.254 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IEW 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1' 65475.617 1   3.2.1.58 ? ? ? 
2 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1   
?        ? ? ? 
3 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[beta-L-fucopyranose-(1-3)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
1098.016  1   ?        ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ?        ? ? ? 
5 non-polymer man 2-deoxy-2-fluoro-alpha-D-glucopyranose 182.147   1   ?        ? ? ? 
6 water       nat water 18.015    285 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BETA-D-GLUCAN EXOHYDROLASE ISOENZYME EXOI' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNK
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   TYR n 
1 3   VAL n 
1 4   LEU n 
1 5   TYR n 
1 6   LYS n 
1 7   ASP n 
1 8   ALA n 
1 9   THR n 
1 10  LYS n 
1 11  PRO n 
1 12  VAL n 
1 13  GLU n 
1 14  ASP n 
1 15  ARG n 
1 16  VAL n 
1 17  ALA n 
1 18  ASP n 
1 19  LEU n 
1 20  LEU n 
1 21  GLY n 
1 22  ARG n 
1 23  MET n 
1 24  THR n 
1 25  LEU n 
1 26  ALA n 
1 27  GLU n 
1 28  LYS n 
1 29  ILE n 
1 30  GLY n 
1 31  GLN n 
1 32  MET n 
1 33  THR n 
1 34  GLN n 
1 35  ILE n 
1 36  GLU n 
1 37  ARG n 
1 38  LEU n 
1 39  VAL n 
1 40  ALA n 
1 41  THR n 
1 42  PRO n 
1 43  ASP n 
1 44  VAL n 
1 45  LEU n 
1 46  ARG n 
1 47  ASP n 
1 48  ASN n 
1 49  PHE n 
1 50  ILE n 
1 51  GLY n 
1 52  SER n 
1 53  LEU n 
1 54  LEU n 
1 55  SER n 
1 56  GLY n 
1 57  GLY n 
1 58  GLY n 
1 59  SER n 
1 60  VAL n 
1 61  PRO n 
1 62  ARG n 
1 63  LYS n 
1 64  GLY n 
1 65  ALA n 
1 66  THR n 
1 67  ALA n 
1 68  LYS n 
1 69  GLU n 
1 70  TRP n 
1 71  GLN n 
1 72  ASP n 
1 73  MET n 
1 74  VAL n 
1 75  ASP n 
1 76  GLY n 
1 77  PHE n 
1 78  GLN n 
1 79  LYS n 
1 80  ALA n 
1 81  CYS n 
1 82  MET n 
1 83  SER n 
1 84  THR n 
1 85  ARG n 
1 86  LEU n 
1 87  GLY n 
1 88  ILE n 
1 89  PRO n 
1 90  MET n 
1 91  ILE n 
1 92  TYR n 
1 93  GLY n 
1 94  ILE n 
1 95  ASP n 
1 96  ALA n 
1 97  VAL n 
1 98  HIS n 
1 99  GLY n 
1 100 GLN n 
1 101 ASN n 
1 102 ASN n 
1 103 VAL n 
1 104 TYR n 
1 105 GLY n 
1 106 ALA n 
1 107 THR n 
1 108 ILE n 
1 109 PHE n 
1 110 PRO n 
1 111 HIS n 
1 112 ASN n 
1 113 VAL n 
1 114 GLY n 
1 115 LEU n 
1 116 GLY n 
1 117 ALA n 
1 118 THR n 
1 119 ARG n 
1 120 ASP n 
1 121 PRO n 
1 122 TYR n 
1 123 LEU n 
1 124 VAL n 
1 125 LYS n 
1 126 ARG n 
1 127 ILE n 
1 128 GLY n 
1 129 GLU n 
1 130 ALA n 
1 131 THR n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 VAL n 
1 136 ARG n 
1 137 ALA n 
1 138 THR n 
1 139 GLY n 
1 140 ILE n 
1 141 GLN n 
1 142 TYR n 
1 143 ALA n 
1 144 PHE n 
1 145 ALA n 
1 146 PRO n 
1 147 CYS n 
1 148 ILE n 
1 149 ALA n 
1 150 VAL n 
1 151 CYS n 
1 152 ARG n 
1 153 ASP n 
1 154 PRO n 
1 155 ARG n 
1 156 TRP n 
1 157 GLY n 
1 158 ARG n 
1 159 CYS n 
1 160 TYR n 
1 161 GLU n 
1 162 SER n 
1 163 TYR n 
1 164 SER n 
1 165 GLU n 
1 166 ASP n 
1 167 ARG n 
1 168 ARG n 
1 169 ILE n 
1 170 VAL n 
1 171 GLN n 
1 172 SER n 
1 173 MET n 
1 174 THR n 
1 175 GLU n 
1 176 LEU n 
1 177 ILE n 
1 178 PRO n 
1 179 GLY n 
1 180 LEU n 
1 181 GLN n 
1 182 GLY n 
1 183 ASP n 
1 184 VAL n 
1 185 PRO n 
1 186 LYS n 
1 187 ASP n 
1 188 PHE n 
1 189 THR n 
1 190 SER n 
1 191 GLY n 
1 192 MET n 
1 193 PRO n 
1 194 PHE n 
1 195 VAL n 
1 196 ALA n 
1 197 GLY n 
1 198 LYS n 
1 199 ASN n 
1 200 LYS n 
1 201 VAL n 
1 202 ALA n 
1 203 ALA n 
1 204 CYS n 
1 205 ALA n 
1 206 LYS n 
1 207 HIS n 
1 208 PHE n 
1 209 VAL n 
1 210 GLY n 
1 211 ASP n 
1 212 GLY n 
1 213 GLY n 
1 214 THR n 
1 215 VAL n 
1 216 ASP n 
1 217 GLY n 
1 218 ILE n 
1 219 ASN n 
1 220 GLU n 
1 221 ASN n 
1 222 ASN n 
1 223 THR n 
1 224 ILE n 
1 225 ILE n 
1 226 ASN n 
1 227 ARG n 
1 228 GLU n 
1 229 GLY n 
1 230 LEU n 
1 231 MET n 
1 232 ASN n 
1 233 ILE n 
1 234 HIS n 
1 235 MET n 
1 236 PRO n 
1 237 ALA n 
1 238 TYR n 
1 239 LYS n 
1 240 ASN n 
1 241 ALA n 
1 242 MET n 
1 243 ASP n 
1 244 LYS n 
1 245 GLY n 
1 246 VAL n 
1 247 SER n 
1 248 THR n 
1 249 VAL n 
1 250 MET n 
1 251 ILE n 
1 252 SER n 
1 253 TYR n 
1 254 SER n 
1 255 SER n 
1 256 TRP n 
1 257 ASN n 
1 258 GLY n 
1 259 VAL n 
1 260 LYS n 
1 261 MET n 
1 262 HIS n 
1 263 ALA n 
1 264 ASN n 
1 265 GLN n 
1 266 ASP n 
1 267 LEU n 
1 268 VAL n 
1 269 THR n 
1 270 GLY n 
1 271 TYR n 
1 272 LEU n 
1 273 LYS n 
1 274 ASP n 
1 275 THR n 
1 276 LEU n 
1 277 LYS n 
1 278 PHE n 
1 279 LYS n 
1 280 GLY n 
1 281 PHE n 
1 282 VAL n 
1 283 ILE n 
1 284 SER n 
1 285 ASP n 
1 286 TRP n 
1 287 GLU n 
1 288 GLY n 
1 289 ILE n 
1 290 ASP n 
1 291 ARG n 
1 292 ILE n 
1 293 THR n 
1 294 THR n 
1 295 PRO n 
1 296 ALA n 
1 297 GLY n 
1 298 SER n 
1 299 ASP n 
1 300 TYR n 
1 301 SER n 
1 302 TYR n 
1 303 SER n 
1 304 VAL n 
1 305 LYS n 
1 306 ALA n 
1 307 SER n 
1 308 ILE n 
1 309 LEU n 
1 310 ALA n 
1 311 GLY n 
1 312 LEU n 
1 313 ASP n 
1 314 MET n 
1 315 ILE n 
1 316 MET n 
1 317 VAL n 
1 318 PRO n 
1 319 ASN n 
1 320 LYS n 
1 321 TYR n 
1 322 GLN n 
1 323 GLN n 
1 324 PHE n 
1 325 ILE n 
1 326 SER n 
1 327 ILE n 
1 328 LEU n 
1 329 THR n 
1 330 GLY n 
1 331 HIS n 
1 332 VAL n 
1 333 ASN n 
1 334 GLY n 
1 335 GLY n 
1 336 VAL n 
1 337 ILE n 
1 338 PRO n 
1 339 MET n 
1 340 SER n 
1 341 ARG n 
1 342 ILE n 
1 343 ASP n 
1 344 ASP n 
1 345 ALA n 
1 346 VAL n 
1 347 THR n 
1 348 ARG n 
1 349 ILE n 
1 350 LEU n 
1 351 ARG n 
1 352 VAL n 
1 353 LYS n 
1 354 PHE n 
1 355 THR n 
1 356 MET n 
1 357 GLY n 
1 358 LEU n 
1 359 PHE n 
1 360 GLU n 
1 361 ASN n 
1 362 PRO n 
1 363 TYR n 
1 364 ALA n 
1 365 ASP n 
1 366 PRO n 
1 367 ALA n 
1 368 MET n 
1 369 ALA n 
1 370 GLU n 
1 371 GLN n 
1 372 LEU n 
1 373 GLY n 
1 374 LYS n 
1 375 GLN n 
1 376 GLU n 
1 377 HIS n 
1 378 ARG n 
1 379 ASP n 
1 380 LEU n 
1 381 ALA n 
1 382 ARG n 
1 383 GLU n 
1 384 ALA n 
1 385 ALA n 
1 386 ARG n 
1 387 LYS n 
1 388 SER n 
1 389 LEU n 
1 390 VAL n 
1 391 LEU n 
1 392 LEU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLY n 
1 396 LYS n 
1 397 THR n 
1 398 SER n 
1 399 THR n 
1 400 ASP n 
1 401 ALA n 
1 402 PRO n 
1 403 LEU n 
1 404 LEU n 
1 405 PRO n 
1 406 LEU n 
1 407 PRO n 
1 408 LYS n 
1 409 LYS n 
1 410 ALA n 
1 411 PRO n 
1 412 LYS n 
1 413 ILE n 
1 414 LEU n 
1 415 VAL n 
1 416 ALA n 
1 417 GLY n 
1 418 SER n 
1 419 HIS n 
1 420 ALA n 
1 421 ASP n 
1 422 ASN n 
1 423 LEU n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 CYS n 
1 428 GLY n 
1 429 GLY n 
1 430 TRP n 
1 431 THR n 
1 432 ILE n 
1 433 GLU n 
1 434 TRP n 
1 435 GLN n 
1 436 GLY n 
1 437 ASP n 
1 438 THR n 
1 439 GLY n 
1 440 ARG n 
1 441 THR n 
1 442 THR n 
1 443 VAL n 
1 444 GLY n 
1 445 THR n 
1 446 THR n 
1 447 ILE n 
1 448 LEU n 
1 449 GLU n 
1 450 ALA n 
1 451 VAL n 
1 452 LYS n 
1 453 ALA n 
1 454 ALA n 
1 455 VAL n 
1 456 ASP n 
1 457 PRO n 
1 458 SER n 
1 459 THR n 
1 460 VAL n 
1 461 VAL n 
1 462 VAL n 
1 463 PHE n 
1 464 ALA n 
1 465 GLU n 
1 466 ASN n 
1 467 PRO n 
1 468 ASP n 
1 469 ALA n 
1 470 GLU n 
1 471 PHE n 
1 472 VAL n 
1 473 LYS n 
1 474 SER n 
1 475 GLY n 
1 476 GLY n 
1 477 PHE n 
1 478 SER n 
1 479 TYR n 
1 480 ALA n 
1 481 ILE n 
1 482 VAL n 
1 483 ALA n 
1 484 VAL n 
1 485 GLY n 
1 486 GLU n 
1 487 HIS n 
1 488 PRO n 
1 489 TYR n 
1 490 THR n 
1 491 GLU n 
1 492 THR n 
1 493 LYS n 
1 494 GLY n 
1 495 ASP n 
1 496 ASN n 
1 497 LEU n 
1 498 ASN n 
1 499 LEU n 
1 500 THR n 
1 501 ILE n 
1 502 PRO n 
1 503 GLU n 
1 504 PRO n 
1 505 GLY n 
1 506 LEU n 
1 507 SER n 
1 508 THR n 
1 509 VAL n 
1 510 GLN n 
1 511 ALA n 
1 512 VAL n 
1 513 CYS n 
1 514 GLY n 
1 515 GLY n 
1 516 VAL n 
1 517 ARG n 
1 518 CYS n 
1 519 ALA n 
1 520 THR n 
1 521 VAL n 
1 522 LEU n 
1 523 ILE n 
1 524 SER n 
1 525 GLY n 
1 526 ARG n 
1 527 PRO n 
1 528 VAL n 
1 529 VAL n 
1 530 VAL n 
1 531 GLN n 
1 532 PRO n 
1 533 LEU n 
1 534 LEU n 
1 535 ALA n 
1 536 ALA n 
1 537 SER n 
1 538 ASP n 
1 539 ALA n 
1 540 LEU n 
1 541 VAL n 
1 542 ALA n 
1 543 ALA n 
1 544 TRP n 
1 545 LEU n 
1 546 PRO n 
1 547 GLY n 
1 548 SER n 
1 549 GLU n 
1 550 GLY n 
1 551 GLN n 
1 552 GLY n 
1 553 VAL n 
1 554 THR n 
1 555 ASP n 
1 556 ALA n 
1 557 LEU n 
1 558 PHE n 
1 559 GLY n 
1 560 ASP n 
1 561 PHE n 
1 562 GLY n 
1 563 PHE n 
1 564 THR n 
1 565 GLY n 
1 566 ARG n 
1 567 LEU n 
1 568 PRO n 
1 569 ARG n 
1 570 THR n 
1 571 TRP n 
1 572 PHE n 
1 573 LYS n 
1 574 SER n 
1 575 VAL n 
1 576 ASP n 
1 577 GLN n 
1 578 LEU n 
1 579 PRO n 
1 580 MET n 
1 581 ASN n 
1 582 VAL n 
1 583 GLY n 
1 584 ASP n 
1 585 ALA n 
1 586 HIS n 
1 587 TYR n 
1 588 ASP n 
1 589 PRO n 
1 590 LEU n 
1 591 PHE n 
1 592 ARG n 
1 593 LEU n 
1 594 GLY n 
1 595 TYR n 
1 596 GLY n 
1 597 LEU n 
1 598 THR n 
1 599 THR n 
1 600 ASN n 
1 601 ALA n 
1 602 THR n 
1 603 LYS n 
1 604 LYS n 
1 605 TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Hordeum vulgare' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      4513 
_entity_src_nat.genus                      Hordeum 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'CULTIVAR CLIPPER' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAD23382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DYVLYKDATKPVEDRVADLLGRMTLAEKIGQMTQIERLVATPDVLRDNFIGSLLSGGGSVPRKGATAKEWQDMVDGFQKA
CMSTRLGIPMIYGIDAVHGQNNVYGATIFPHNVGLGATRDPYLVKRIGEATALEVRATGIQYAFAPCIAVCRDPRWGRCY
ESYSEDRRIVQSMTELIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHFVGDGGTVDGINENNTIINREGLMNIHMPAYKN
AMDKGVSTVMISYSSWNGVKMHANQDLVTGYLKDTLKFKGFVISDWEGIDRITTPAGSDYSYSVKASILAGLDMIMVPNN
YQQFISILTGHVNGGVIPMSRIDDAVTRILRVKFTMGLFENPYADPAMAEQLGKQEHRDLAREAARKSLVLLKNGKTSTD
APLLPLPKKAPKILVAGSHADNLGYQCGGWTIEWQGDTGRTTVGTTILEAVKAAVDPSTVVVFAENPDAEFVKSGGFSYA
IVAVGEHPYTETKGDNLNLTIPEPGLSTVQAVCGGVRCATVLISGRPVVVQPLLAASDALVAAWLPGSEGQGVTDALFGD
FGFTGRLPRTWFKSVDQLPMNVGDAHYDPLFRLGYGLTTNATKKY
;
_struct_ref.pdbx_align_begin           26 
_struct_ref.pdbx_db_accession          4566505 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IEW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 605 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             4566505 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  630 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       605 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IEW 
_struct_ref_seq_dif.mon_id                       LYS 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      320 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             GB 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   4566505 
_struct_ref_seq_dif.db_mon_id                    ASN 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          345 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            320 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ?                        'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ?                        'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ?                        'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ?                        'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ?                        'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ?                        'C3 H7 N O2 S'   121.158 
FUL 'L-saccharide, beta linking'  . beta-L-fucopyranose                      6-DEOXY-BETA-L-GALACTOSE 'C6 H12 O5'      164.156 
G2F 'D-saccharide, alpha linking' . 2-deoxy-2-fluoro-alpha-D-glucopyranose   ?                        'C6 H11 F O5'    182.147 
GLN 'L-peptide linking'           y GLUTAMINE                                ?                        'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ?                        'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ?                        'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ?                        'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ?                        'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ?                        'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ?                        'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ?                        'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ?                        'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                               ?                        'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                        'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ?                        'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ?                        'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ?                        'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ?                        'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ?                        'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ?                        'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ?                        'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IEW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.53 
_exptl_crystal.density_percent_sol   65.11 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'ammonium sulfate, PEG 400, sodium acetate, Hepes-NaOH, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   1999-11-23 
_diffrn_detector.details                'Focussing mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1IEW 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             25.00 
_reflns.d_resolution_high            2.55 
_reflns.number_obs                   30853 
_reflns.number_all                   283040 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.138 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.48 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              15.00 
_reflns_shell.percent_possible_all   96.8 
_reflns_shell.Rmerge_I_obs           0.496 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IEW 
_refine.ls_number_reflns_obs                     26704 
_refine.ls_number_reflns_all                     29672 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             15.00 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.233 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  2968 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EX1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IEW 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4566 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         138 
_refine_hist.number_atoms_solvent             285 
_refine_hist.number_atoms_total               4989 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        15.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.01 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.3  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1IEW 
_struct.title                     
'Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside' 
_struct.pdbx_descriptor           'BETA-D-GLUCAN GLUCOHYDROLASE ISOENZYME EXO1 (E.C.3.2.1.58)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IEW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            '2-domain fold, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The biological assembly is a monomer constructed from an (alpha/beta)8 barrel and an (alpha/beta)6 sandwich.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 3   ? ASP A 7   ? VAL A 3   ASP A 7   5 ? 5  
HELX_P HELX_P2  2  PRO A 11  ? GLY A 21  ? PRO A 11  GLY A 21  1 ? 11 
HELX_P HELX_P3  3  THR A 24  ? MET A 32  ? THR A 24  MET A 32  1 ? 9  
HELX_P HELX_P4  4  LEU A 38  ? ALA A 40  ? LEU A 38  ALA A 40  5 ? 3  
HELX_P HELX_P5  5  THR A 41  ? ASN A 48  ? THR A 41  ASN A 48  1 ? 8  
HELX_P HELX_P6  6  THR A 66  ? SER A 83  ? THR A 66  SER A 83  1 ? 18 
HELX_P HELX_P7  7  HIS A 111 ? ARG A 119 ? HIS A 111 ARG A 119 1 ? 9  
HELX_P HELX_P8  8  ASP A 120 ? ALA A 137 ? ASP A 120 ALA A 137 1 ? 18 
HELX_P HELX_P9  9  ARG A 158 ? SER A 162 ? ARG A 158 SER A 162 5 ? 5  
HELX_P HELX_P10 10 ASP A 166 ? MET A 173 ? ASP A 166 MET A 173 1 ? 8  
HELX_P HELX_P11 11 GLU A 175 ? GLY A 182 ? GLU A 175 GLY A 182 1 ? 8  
HELX_P HELX_P12 12 GLY A 210 ? THR A 214 ? GLY A 210 THR A 214 5 ? 5  
HELX_P HELX_P13 13 THR A 214 ? ILE A 218 ? THR A 214 ILE A 218 5 ? 5  
HELX_P HELX_P14 14 ASN A 226 ? ILE A 233 ? ASN A 226 ILE A 233 1 ? 8  
HELX_P HELX_P15 15 MET A 235 ? LYS A 244 ? MET A 235 LYS A 244 1 ? 10 
HELX_P HELX_P16 16 ASN A 264 ? THR A 269 ? ASN A 264 THR A 269 1 ? 6  
HELX_P HELX_P17 17 ILE A 289 ? THR A 293 ? ILE A 289 THR A 293 5 ? 5  
HELX_P HELX_P18 18 ASP A 299 ? GLY A 311 ? ASP A 299 GLY A 311 1 ? 13 
HELX_P HELX_P19 19 LYS A 320 ? GLY A 334 ? LYS A 320 GLY A 334 1 ? 15 
HELX_P HELX_P20 20 PRO A 338 ? MET A 356 ? PRO A 338 MET A 356 1 ? 19 
HELX_P HELX_P21 21 ASP A 365 ? LEU A 372 ? ASP A 365 LEU A 372 5 ? 8  
HELX_P HELX_P22 22 LYS A 374 ? LEU A 389 ? LYS A 374 LEU A 389 1 ? 16 
HELX_P HELX_P23 23 ASN A 422 ? GLY A 428 ? ASN A 422 GLY A 428 1 ? 7  
HELX_P HELX_P24 24 THR A 446 ? ALA A 453 ? THR A 446 ALA A 453 1 ? 8  
HELX_P HELX_P25 25 ASP A 468 ? GLY A 475 ? ASP A 468 GLY A 475 1 ? 8  
HELX_P HELX_P26 26 THR A 490 ? ASP A 495 ? THR A 490 ASP A 495 5 ? 6  
HELX_P HELX_P27 27 GLY A 505 ? VAL A 516 ? GLY A 505 VAL A 516 1 ? 12 
HELX_P HELX_P28 28 VAL A 530 ? SER A 537 ? VAL A 530 SER A 537 1 ? 8  
HELX_P HELX_P29 29 GLY A 550 ? PHE A 558 ? GLY A 550 PHE A 558 1 ? 9  
HELX_P HELX_P30 30 SER A 574 ? LEU A 578 ? SER A 574 LEU A 578 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 151 SG  ? ? ? 1_555 A CYS 159 SG ? ? A CYS 151 A CYS 159 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2  disulf ?    ? A CYS 513 SG  ? ? ? 1_555 A CYS 518 SG ? ? A CYS 513 A CYS 518 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
covale1  covale one  ? A ASN 221 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 221 B NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale2  covale one  ? A ASP 285 OD1 ? ? ? 1_555 E G2F .   C1 ? ? A ASP 285 A G2F 620 1_555 ? ? ? ? ? ? ? 1.473 ? ?               
covale3  covale one  ? A ASN 498 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 498 C NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale4  covale one  ? A ASN 600 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 600 A NAG 619 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale5  covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
covale6  covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3   1_555 ? ? ? ? ? ? ? 1.401 ? ?               
covale7  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.391 ? ?               
covale8  covale both ? C NAG .   O3  ? ? ? 1_555 C FUL .   C1 ? ? C NAG 1   C FUL 6   1_555 ? ? ? ? ? ? ? 1.397 ? ?               
covale9  covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.385 ? ?               
covale10 covale both ? C BMA .   O6  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 3   C MAN 4   1_555 ? ? ? ? ? ? ? 1.401 ? ?               
covale11 covale both ? C MAN .   O2  ? ? ? 1_555 C NAG .   C1 ? ? C MAN 4   C NAG 5   1_555 ? ? ? ? ? ? ? 1.387 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 145 A . ? ALA 145 A PRO 146 A ? PRO 146 A 1 0.27  
2 LYS 206 A . ? LYS 206 A HIS 207 A ? HIS 207 A 1 -0.55 
3 PHE 208 A . ? PHE 208 A VAL 209 A ? VAL 209 A 1 -0.16 
4 THR 294 A . ? THR 294 A PRO 295 A ? PRO 295 A 1 0.07  
5 VAL 317 A . ? VAL 317 A PRO 318 A ? PRO 318 A 1 -0.27 
6 LEU 404 A . ? LEU 404 A PRO 405 A ? PRO 405 A 1 0.25  
7 GLU 503 A . ? GLU 503 A PRO 504 A ? PRO 504 A 1 0.00  
8 LEU 578 A . ? LEU 578 A PRO 579 A ? PRO 579 A 1 0.07  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 3 ? 
D ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 142 ? ALA A 143 ? TYR A 142 ALA A 143 
A 2 ILE A 91  ? ILE A 94  ? ILE A 91  ILE A 94  
A 3 SER A 52  ? SER A 55  ? SER A 52  SER A 55  
A 4 THR A 33  ? GLU A 36  ? THR A 33  GLU A 36  
A 5 ILE A 315 ? MET A 316 ? ILE A 315 MET A 316 
B 1 CYS A 204 ? PHE A 208 ? CYS A 204 PHE A 208 
B 2 THR A 248 ? ILE A 251 ? THR A 248 ILE A 251 
B 3 PHE A 281 ? ILE A 283 ? PHE A 281 ILE A 283 
C 1 ASN A 222 ? THR A 223 ? ASN A 222 THR A 223 
C 2 SER A 255 ? TRP A 256 ? SER A 255 TRP A 256 
C 3 VAL A 259 ? LYS A 260 ? VAL A 259 LYS A 260 
D 1 VAL A 390 ? ASN A 394 ? VAL A 390 ASN A 394 
D 2 ALA A 539 ? TRP A 544 ? ALA A 539 TRP A 544 
D 3 CYS A 518 ? ILE A 523 ? CYS A 518 ILE A 523 
D 4 ALA A 480 ? GLY A 485 ? ALA A 480 GLY A 485 
D 5 LYS A 412 ? ALA A 416 ? LYS A 412 ALA A 416 
D 6 VAL A 460 ? ALA A 464 ? VAL A 460 ALA A 464 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 142 ? N TYR A 142 O TYR A 92  ? O TYR A 92  
A 2 3 N GLY A 93  ? N GLY A 93  O LEU A 53  ? O LEU A 53  
A 3 4 N SER A 52  ? N SER A 52  O THR A 33  ? O THR A 33  
A 4 5 N GLN A 34  ? N GLN A 34  O ILE A 315 ? O ILE A 315 
B 1 2 N ALA A 205 ? N ALA A 205 O THR A 248 ? O THR A 248 
B 2 3 N VAL A 249 ? N VAL A 249 O PHE A 281 ? O PHE A 281 
C 1 2 N THR A 223 ? N THR A 223 O SER A 255 ? O SER A 255 
C 2 3 N TRP A 256 ? N TRP A 256 O VAL A 259 ? O VAL A 259 
D 1 2 N LEU A 392 ? N LEU A 392 O LEU A 540 ? O LEU A 540 
D 2 3 N ALA A 539 ? N ALA A 539 O CYS A 518 ? O CYS A 518 
D 3 4 N ALA A 519 ? N ALA A 519 O ALA A 480 ? O ALA A 480 
D 4 5 N ILE A 481 ? N ILE A 481 O LEU A 414 ? O LEU A 414 
D 5 6 N ILE A 413 ? N ILE A 413 O VAL A 460 ? O VAL A 460 
# 
_database_PDB_matrix.entry_id          1IEW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IEW 
_atom_sites.fract_transf_matrix[1][1]   0.009905 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009905 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005517 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 30.565  5.116  -2.106 1.00 34.18 ? 1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 29.807  3.885  -1.745 1.00 35.77 ? 1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 28.817  4.160  -0.614 1.00 35.71 ? 1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 28.721  5.281  -0.119 1.00 36.41 ? 1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 30.779  2.775  -1.336 1.00 36.46 ? 1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 31.557  3.111  -0.079 1.00 39.00 ? 1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 31.662  4.311  0.260  1.00 39.36 ? 1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 32.077  2.174  0.570  1.00 40.24 ? 1   ASP A OD2 1 
ATOM   9    N N   . TYR A 1 2   ? 28.082  3.130  -0.213 1.00 35.41 ? 2   TYR A N   1 
ATOM   10   C CA  . TYR A 1 2   ? 27.082  3.239  0.850  1.00 33.56 ? 2   TYR A CA  1 
ATOM   11   C C   . TYR A 1 2   ? 27.648  3.741  2.181  1.00 33.67 ? 2   TYR A C   1 
ATOM   12   O O   . TYR A 1 2   ? 28.673  3.242  2.660  1.00 33.59 ? 2   TYR A O   1 
ATOM   13   C CB  . TYR A 1 2   ? 26.428  1.875  1.054  1.00 31.37 ? 2   TYR A CB  1 
ATOM   14   C CG  . TYR A 1 2   ? 25.603  1.749  2.309  1.00 29.89 ? 2   TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 2   ? 24.384  2.422  2.441  1.00 28.82 ? 2   TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 2   ? 26.022  0.923  3.355  1.00 28.91 ? 2   TYR A CD2 1 
ATOM   17   C CE1 . TYR A 1 2   ? 23.598  2.267  3.581  1.00 27.29 ? 2   TYR A CE1 1 
ATOM   18   C CE2 . TYR A 1 2   ? 25.245  0.764  4.499  1.00 29.25 ? 2   TYR A CE2 1 
ATOM   19   C CZ  . TYR A 1 2   ? 24.034  1.436  4.601  1.00 27.98 ? 2   TYR A CZ  1 
ATOM   20   O OH  . TYR A 1 2   ? 23.249  1.248  5.707  1.00 27.84 ? 2   TYR A OH  1 
ATOM   21   N N   . VAL A 1 3   ? 26.971  4.722  2.777  1.00 32.87 ? 3   VAL A N   1 
ATOM   22   C CA  . VAL A 1 3   ? 27.400  5.283  4.059  1.00 32.68 ? 3   VAL A CA  1 
ATOM   23   C C   . VAL A 1 3   ? 26.473  4.808  5.177  1.00 32.59 ? 3   VAL A C   1 
ATOM   24   O O   . VAL A 1 3   ? 25.350  5.302  5.331  1.00 33.78 ? 3   VAL A O   1 
ATOM   25   C CB  . VAL A 1 3   ? 27.408  6.832  4.032  1.00 32.77 ? 3   VAL A CB  1 
ATOM   26   C CG1 . VAL A 1 3   ? 27.797  7.372  5.409  1.00 32.21 ? 3   VAL A CG1 1 
ATOM   27   C CG2 . VAL A 1 3   ? 28.380  7.331  2.962  1.00 29.46 ? 3   VAL A CG2 1 
ATOM   28   N N   . LEU A 1 4   ? 26.969  3.858  5.963  1.00 31.28 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 26.219  3.256  7.059  1.00 28.78 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 25.646  4.226  8.099  1.00 28.20 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 24.466  4.149  8.435  1.00 29.36 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 27.108  2.218  7.751  1.00 27.87 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 26.513  1.098  8.614  1.00 27.26 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 25.867  1.649  9.881  1.00 28.20 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 25.509  0.346  7.787  1.00 28.28 ? 4   LEU A CD2 1 
ATOM   36   N N   . TYR A 1 5   ? 26.463  5.145  8.601  1.00 26.74 ? 5   TYR A N   1 
ATOM   37   C CA  . TYR A 1 5   ? 25.989  6.061  9.632  1.00 25.68 ? 5   TYR A CA  1 
ATOM   38   C C   . TYR A 1 5   ? 24.861  6.981  9.193  1.00 25.21 ? 5   TYR A C   1 
ATOM   39   O O   . TYR A 1 5   ? 24.115  7.487  10.024 1.00 24.52 ? 5   TYR A O   1 
ATOM   40   C CB  . TYR A 1 5   ? 27.168  6.867  10.223 1.00 23.84 ? 5   TYR A CB  1 
ATOM   41   C CG  . TYR A 1 5   ? 27.579  8.136  9.494  1.00 22.30 ? 5   TYR A CG  1 
ATOM   42   C CD1 . TYR A 1 5   ? 26.852  9.321  9.638  1.00 19.85 ? 5   TYR A CD1 1 
ATOM   43   C CD2 . TYR A 1 5   ? 28.733  8.164  8.709  1.00 22.67 ? 5   TYR A CD2 1 
ATOM   44   C CE1 . TYR A 1 5   ? 27.271  10.505 9.025  1.00 20.61 ? 5   TYR A CE1 1 
ATOM   45   C CE2 . TYR A 1 5   ? 29.161  9.337  8.091  1.00 20.41 ? 5   TYR A CE2 1 
ATOM   46   C CZ  . TYR A 1 5   ? 28.430  10.504 8.253  1.00 21.63 ? 5   TYR A CZ  1 
ATOM   47   O OH  . TYR A 1 5   ? 28.870  11.661 7.652  1.00 17.66 ? 5   TYR A OH  1 
ATOM   48   N N   . LYS A 1 6   ? 24.720  7.185  7.890  1.00 26.48 ? 6   LYS A N   1 
ATOM   49   C CA  . LYS A 1 6   ? 23.660  8.054  7.373  1.00 27.29 ? 6   LYS A CA  1 
ATOM   50   C C   . LYS A 1 6   ? 22.348  7.301  7.132  1.00 26.58 ? 6   LYS A C   1 
ATOM   51   O O   . LYS A 1 6   ? 21.326  7.906  6.825  1.00 24.63 ? 6   LYS A O   1 
ATOM   52   C CB  . LYS A 1 6   ? 24.110  8.727  6.069  1.00 27.32 ? 6   LYS A CB  1 
ATOM   53   C CG  . LYS A 1 6   ? 24.945  9.992  6.255  1.00 27.88 ? 6   LYS A CG  1 
ATOM   54   C CD  . LYS A 1 6   ? 25.312  10.590 4.902  1.00 28.47 ? 6   LYS A CD  1 
ATOM   55   C CE  . LYS A 1 6   ? 25.667  12.071 4.994  1.00 29.31 ? 6   LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 6   ? 26.860  12.324 5.833  1.00 31.47 ? 6   LYS A NZ  1 
ATOM   57   N N   . ASP A 1 7   ? 22.393  5.981  7.284  1.00 27.26 ? 7   ASP A N   1 
ATOM   58   C CA  . ASP A 1 7   ? 21.231  5.118  7.087  1.00 27.43 ? 7   ASP A CA  1 
ATOM   59   C C   . ASP A 1 7   ? 20.420  4.979  8.379  1.00 26.99 ? 7   ASP A C   1 
ATOM   60   O O   . ASP A 1 7   ? 20.837  4.295  9.316  1.00 26.67 ? 7   ASP A O   1 
ATOM   61   C CB  . ASP A 1 7   ? 21.705  3.741  6.615  1.00 28.35 ? 7   ASP A CB  1 
ATOM   62   C CG  . ASP A 1 7   ? 20.564  2.774  6.373  1.00 31.45 ? 7   ASP A CG  1 
ATOM   63   O OD1 . ASP A 1 7   ? 19.394  3.115  6.661  1.00 33.52 ? 7   ASP A OD1 1 
ATOM   64   O OD2 . ASP A 1 7   ? 20.842  1.658  5.894  1.00 32.96 ? 7   ASP A OD2 1 
ATOM   65   N N   . ALA A 1 8   ? 19.251  5.611  8.411  1.00 26.46 ? 8   ALA A N   1 
ATOM   66   C CA  . ALA A 1 8   ? 18.380  5.585  9.587  1.00 26.90 ? 8   ALA A CA  1 
ATOM   67   C C   . ALA A 1 8   ? 17.802  4.218  9.989  1.00 27.03 ? 8   ALA A C   1 
ATOM   68   O O   . ALA A 1 8   ? 17.383  4.033  11.129 1.00 27.64 ? 8   ALA A O   1 
ATOM   69   C CB  . ALA A 1 8   ? 17.246  6.587  9.397  1.00 24.03 ? 8   ALA A CB  1 
ATOM   70   N N   . THR A 1 9   ? 17.781  3.262  9.068  1.00 28.06 ? 9   THR A N   1 
ATOM   71   C CA  . THR A 1 9   ? 17.226  1.942  9.369  1.00 27.82 ? 9   THR A CA  1 
ATOM   72   C C   . THR A 1 9   ? 18.231  1.016  10.040 1.00 28.86 ? 9   THR A C   1 
ATOM   73   O O   . THR A 1 9   ? 17.934  -0.154 10.284 1.00 29.80 ? 9   THR A O   1 
ATOM   74   C CB  . THR A 1 9   ? 16.742  1.228  8.095  1.00 27.96 ? 9   THR A CB  1 
ATOM   75   O OG1 . THR A 1 9   ? 17.865  0.653  7.413  1.00 25.90 ? 9   THR A OG1 1 
ATOM   76   C CG2 . THR A 1 9   ? 16.041  2.214  7.168  1.00 26.99 ? 9   THR A CG2 1 
ATOM   77   N N   . LYS A 1 10  ? 19.420  1.531  10.328 1.00 28.95 ? 10  LYS A N   1 
ATOM   78   C CA  . LYS A 1 10  ? 20.461  0.727  10.957 1.00 28.53 ? 10  LYS A CA  1 
ATOM   79   C C   . LYS A 1 10  ? 20.526  0.921  12.473 1.00 28.36 ? 10  LYS A C   1 
ATOM   80   O O   . LYS A 1 10  ? 20.173  1.984  12.992 1.00 28.80 ? 10  LYS A O   1 
ATOM   81   C CB  . LYS A 1 10  ? 21.814  1.070  10.334 1.00 29.39 ? 10  LYS A CB  1 
ATOM   82   C CG  . LYS A 1 10  ? 21.948  0.659  8.874  1.00 30.28 ? 10  LYS A CG  1 
ATOM   83   C CD  . LYS A 1 10  ? 22.088  -0.854 8.751  1.00 30.86 ? 10  LYS A CD  1 
ATOM   84   C CE  . LYS A 1 10  ? 22.343  -1.281 7.316  1.00 32.06 ? 10  LYS A CE  1 
ATOM   85   N NZ  . LYS A 1 10  ? 22.766  -2.714 7.231  1.00 36.21 ? 10  LYS A NZ  1 
ATOM   86   N N   . PRO A 1 11  ? 20.980  -0.111 13.205 1.00 27.64 ? 11  PRO A N   1 
ATOM   87   C CA  . PRO A 1 11  ? 21.085  -0.026 14.666 1.00 26.23 ? 11  PRO A CA  1 
ATOM   88   C C   . PRO A 1 11  ? 21.994  1.132  15.078 1.00 26.43 ? 11  PRO A C   1 
ATOM   89   O O   . PRO A 1 11  ? 22.970  1.442  14.388 1.00 26.18 ? 11  PRO A O   1 
ATOM   90   C CB  . PRO A 1 11  ? 21.673  -1.385 15.052 1.00 25.78 ? 11  PRO A CB  1 
ATOM   91   C CG  . PRO A 1 11  ? 21.194  -2.292 13.956 1.00 24.63 ? 11  PRO A CG  1 
ATOM   92   C CD  . PRO A 1 11  ? 21.381  -1.447 12.725 1.00 26.40 ? 11  PRO A CD  1 
ATOM   93   N N   . VAL A 1 12  ? 21.667  1.762  16.203 1.00 26.62 ? 12  VAL A N   1 
ATOM   94   C CA  . VAL A 1 12  ? 22.434  2.890  16.722 1.00 25.85 ? 12  VAL A CA  1 
ATOM   95   C C   . VAL A 1 12  ? 23.918  2.571  16.879 1.00 26.27 ? 12  VAL A C   1 
ATOM   96   O O   . VAL A 1 12  ? 24.776  3.341  16.440 1.00 26.21 ? 12  VAL A O   1 
ATOM   97   C CB  . VAL A 1 12  ? 21.877  3.353  18.095 1.00 24.60 ? 12  VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 12  ? 22.774  4.413  18.704 1.00 22.15 ? 12  VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 12  ? 20.488  3.903  17.918 1.00 23.86 ? 12  VAL A CG2 1 
ATOM   100  N N   . GLU A 1 13  ? 24.220  1.437  17.502 1.00 26.12 ? 13  GLU A N   1 
ATOM   101  C CA  . GLU A 1 13  ? 25.609  1.058  17.716 1.00 26.52 ? 13  GLU A CA  1 
ATOM   102  C C   . GLU A 1 13  ? 26.395  0.951  16.411 1.00 27.16 ? 13  GLU A C   1 
ATOM   103  O O   . GLU A 1 13  ? 27.571  1.318  16.358 1.00 27.83 ? 13  GLU A O   1 
ATOM   104  C CB  . GLU A 1 13  ? 25.680  -0.252 18.499 1.00 25.48 ? 13  GLU A CB  1 
ATOM   105  C CG  . GLU A 1 13  ? 25.152  -0.138 19.922 1.00 26.45 ? 13  GLU A CG  1 
ATOM   106  C CD  . GLU A 1 13  ? 25.888  0.913  20.743 1.00 28.44 ? 13  GLU A CD  1 
ATOM   107  O OE1 . GLU A 1 13  ? 27.128  0.841  20.817 1.00 29.66 ? 13  GLU A OE1 1 
ATOM   108  O OE2 . GLU A 1 13  ? 25.233  1.808  21.320 1.00 28.55 ? 13  GLU A OE2 1 
ATOM   109  N N   . ASP A 1 14  ? 25.752  0.461  15.357 1.00 27.49 ? 14  ASP A N   1 
ATOM   110  C CA  . ASP A 1 14  ? 26.425  0.345  14.072 1.00 27.94 ? 14  ASP A CA  1 
ATOM   111  C C   . ASP A 1 14  ? 26.699  1.715  13.494 1.00 26.83 ? 14  ASP A C   1 
ATOM   112  O O   . ASP A 1 14  ? 27.753  1.944  12.908 1.00 27.83 ? 14  ASP A O   1 
ATOM   113  C CB  . ASP A 1 14  ? 25.580  -0.438 13.076 1.00 30.38 ? 14  ASP A CB  1 
ATOM   114  C CG  . ASP A 1 14  ? 25.331  -1.851 13.518 1.00 30.97 ? 14  ASP A CG  1 
ATOM   115  O OD1 . ASP A 1 14  ? 26.224  -2.431 14.169 1.00 32.00 ? 14  ASP A OD1 1 
ATOM   116  O OD2 . ASP A 1 14  ? 24.247  -2.384 13.201 1.00 35.24 ? 14  ASP A OD2 1 
ATOM   117  N N   . ARG A 1 15  ? 25.741  2.621  13.653 1.00 25.92 ? 15  ARG A N   1 
ATOM   118  C CA  . ARG A 1 15  ? 25.892  3.974  13.136 1.00 26.44 ? 15  ARG A CA  1 
ATOM   119  C C   . ARG A 1 15  ? 26.986  4.722  13.892 1.00 25.96 ? 15  ARG A C   1 
ATOM   120  O O   . ARG A 1 15  ? 27.741  5.490  13.296 1.00 26.25 ? 15  ARG A O   1 
ATOM   121  C CB  . ARG A 1 15  ? 24.557  4.733  13.217 1.00 26.13 ? 15  ARG A CB  1 
ATOM   122  C CG  . ARG A 1 15  ? 23.443  4.094  12.384 1.00 25.79 ? 15  ARG A CG  1 
ATOM   123  C CD  . ARG A 1 15  ? 22.129  4.856  12.485 1.00 25.53 ? 15  ARG A CD  1 
ATOM   124  N NE  . ARG A 1 15  ? 22.172  6.151  11.810 1.00 25.05 ? 15  ARG A NE  1 
ATOM   125  C CZ  . ARG A 1 15  ? 21.183  7.042  11.838 1.00 25.99 ? 15  ARG A CZ  1 
ATOM   126  N NH1 . ARG A 1 15  ? 20.067  6.785  12.514 1.00 25.20 ? 15  ARG A NH1 1 
ATOM   127  N NH2 . ARG A 1 15  ? 21.305  8.191  11.184 1.00 23.65 ? 15  ARG A NH2 1 
ATOM   128  N N   . VAL A 1 16  ? 27.080  4.499  15.199 1.00 25.23 ? 16  VAL A N   1 
ATOM   129  C CA  . VAL A 1 16  ? 28.115  5.167  15.982 1.00 24.45 ? 16  VAL A CA  1 
ATOM   130  C C   . VAL A 1 16  ? 29.478  4.685  15.483 1.00 24.69 ? 16  VAL A C   1 
ATOM   131  O O   . VAL A 1 16  ? 30.333  5.493  15.109 1.00 25.53 ? 16  VAL A O   1 
ATOM   132  C CB  . VAL A 1 16  ? 27.980  4.866  17.504 1.00 23.09 ? 16  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 16  ? 29.226  5.326  18.245 1.00 20.87 ? 16  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 16  ? 26.767  5.582  18.071 1.00 22.10 ? 16  VAL A CG2 1 
ATOM   135  N N   . ALA A 1 17  ? 29.665  3.369  15.462 1.00 22.67 ? 17  ALA A N   1 
ATOM   136  C CA  . ALA A 1 17  ? 30.921  2.780  15.009 1.00 23.04 ? 17  ALA A CA  1 
ATOM   137  C C   . ALA A 1 17  ? 31.324  3.285  13.622 1.00 22.18 ? 17  ALA A C   1 
ATOM   138  O O   . ALA A 1 17  ? 32.452  3.733  13.411 1.00 19.85 ? 17  ALA A O   1 
ATOM   139  C CB  . ALA A 1 17  ? 30.800  1.262  14.989 1.00 22.76 ? 17  ALA A CB  1 
ATOM   140  N N   . ASP A 1 18  ? 30.392  3.210  12.681 1.00 21.32 ? 18  ASP A N   1 
ATOM   141  C CA  . ASP A 1 18  ? 30.653  3.636  11.315 1.00 22.57 ? 18  ASP A CA  1 
ATOM   142  C C   . ASP A 1 18  ? 31.118  5.085  11.205 1.00 23.28 ? 18  ASP A C   1 
ATOM   143  O O   . ASP A 1 18  ? 32.060  5.385  10.474 1.00 22.96 ? 18  ASP A O   1 
ATOM   144  C CB  . ASP A 1 18  ? 29.405  3.448  10.457 1.00 22.71 ? 18  ASP A CB  1 
ATOM   145  C CG  . ASP A 1 18  ? 29.688  3.640  8.988  1.00 25.14 ? 18  ASP A CG  1 
ATOM   146  O OD1 . ASP A 1 18  ? 30.315  2.740  8.389  1.00 26.01 ? 18  ASP A OD1 1 
ATOM   147  O OD2 . ASP A 1 18  ? 29.298  4.692  8.435  1.00 25.42 ? 18  ASP A OD2 1 
ATOM   148  N N   . LEU A 1 19  ? 30.448  5.983  11.923 1.00 23.99 ? 19  LEU A N   1 
ATOM   149  C CA  . LEU A 1 19  ? 30.798  7.399  11.894 1.00 23.87 ? 19  LEU A CA  1 
ATOM   150  C C   . LEU A 1 19  ? 32.126  7.649  12.596 1.00 23.13 ? 19  LEU A C   1 
ATOM   151  O O   . LEU A 1 19  ? 33.016  8.305  12.056 1.00 23.37 ? 19  LEU A O   1 
ATOM   152  C CB  . LEU A 1 19  ? 29.697  8.232  12.556 1.00 23.43 ? 19  LEU A CB  1 
ATOM   153  C CG  . LEU A 1 19  ? 29.988  9.722  12.764 1.00 23.32 ? 19  LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 19  ? 30.355  10.370 11.433 1.00 23.50 ? 19  LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 19  ? 28.769  10.403 13.392 1.00 24.29 ? 19  LEU A CD2 1 
ATOM   156  N N   . LEU A 1 20  ? 32.247  7.125  13.806 1.00 23.06 ? 20  LEU A N   1 
ATOM   157  C CA  . LEU A 1 20  ? 33.462  7.279  14.584 1.00 23.30 ? 20  LEU A CA  1 
ATOM   158  C C   . LEU A 1 20  ? 34.685  6.911  13.745 1.00 24.47 ? 20  LEU A C   1 
ATOM   159  O O   . LEU A 1 20  ? 35.684  7.641  13.714 1.00 26.07 ? 20  LEU A O   1 
ATOM   160  C CB  . LEU A 1 20  ? 33.403  6.378  15.807 1.00 21.58 ? 20  LEU A CB  1 
ATOM   161  C CG  . LEU A 1 20  ? 34.668  6.401  16.654 1.00 23.25 ? 20  LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 20  ? 34.886  7.820  17.196 1.00 24.12 ? 20  LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 20  ? 34.546  5.386  17.779 1.00 20.83 ? 20  LEU A CD2 1 
ATOM   164  N N   . GLY A 1 21  ? 34.591  5.779  13.055 1.00 23.82 ? 21  GLY A N   1 
ATOM   165  C CA  . GLY A 1 21  ? 35.691  5.313  12.237 1.00 23.54 ? 21  GLY A CA  1 
ATOM   166  C C   . GLY A 1 21  ? 36.103  6.180  11.059 1.00 24.75 ? 21  GLY A C   1 
ATOM   167  O O   . GLY A 1 21  ? 37.054  5.834  10.355 1.00 26.84 ? 21  GLY A O   1 
ATOM   168  N N   . ARG A 1 22  ? 35.417  7.297  10.831 1.00 24.09 ? 22  ARG A N   1 
ATOM   169  C CA  . ARG A 1 22  ? 35.759  8.171  9.710  1.00 23.37 ? 22  ARG A CA  1 
ATOM   170  C C   . ARG A 1 22  ? 36.228  9.528  10.215 1.00 23.76 ? 22  ARG A C   1 
ATOM   171  O O   . ARG A 1 22  ? 36.717  10.355 9.445  1.00 25.05 ? 22  ARG A O   1 
ATOM   172  C CB  . ARG A 1 22  ? 34.538  8.419  8.820  1.00 23.12 ? 22  ARG A CB  1 
ATOM   173  C CG  . ARG A 1 22  ? 33.760  7.199  8.387  1.00 24.57 ? 22  ARG A CG  1 
ATOM   174  C CD  . ARG A 1 22  ? 32.408  7.640  7.819  1.00 25.73 ? 22  ARG A CD  1 
ATOM   175  N NE  . ARG A 1 22  ? 31.565  6.515  7.423  1.00 26.88 ? 22  ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 22  ? 31.552  5.977  6.208  1.00 27.27 ? 22  ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 22  ? 32.337  6.466  5.256  1.00 28.50 ? 22  ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 22  ? 30.762  4.943  5.949  1.00 27.57 ? 22  ARG A NH2 1 
ATOM   179  N N   . MET A 1 23  ? 36.077  9.756  11.510 1.00 23.06 ? 23  MET A N   1 
ATOM   180  C CA  . MET A 1 23  ? 36.420  11.043 12.099 1.00 22.04 ? 23  MET A CA  1 
ATOM   181  C C   . MET A 1 23  ? 37.896  11.350 12.324 1.00 20.95 ? 23  MET A C   1 
ATOM   182  O O   . MET A 1 23  ? 38.653  10.495 12.763 1.00 21.45 ? 23  MET A O   1 
ATOM   183  C CB  . MET A 1 23  ? 35.660  11.190 13.418 1.00 21.73 ? 23  MET A CB  1 
ATOM   184  C CG  . MET A 1 23  ? 34.157  11.023 13.258 1.00 21.23 ? 23  MET A CG  1 
ATOM   185  S SD  . MET A 1 23  ? 33.267  11.076 14.809 1.00 23.56 ? 23  MET A SD  1 
ATOM   186  C CE  . MET A 1 23  ? 33.363  12.832 15.209 1.00 16.03 ? 23  MET A CE  1 
ATOM   187  N N   . THR A 1 24  ? 38.291  12.585 12.019 1.00 19.75 ? 24  THR A N   1 
ATOM   188  C CA  . THR A 1 24  ? 39.666  13.035 12.231 1.00 19.98 ? 24  THR A CA  1 
ATOM   189  C C   . THR A 1 24  ? 39.730  13.488 13.691 1.00 20.49 ? 24  THR A C   1 
ATOM   190  O O   . THR A 1 24  ? 38.694  13.739 14.306 1.00 21.18 ? 24  THR A O   1 
ATOM   191  C CB  . THR A 1 24  ? 40.018  14.252 11.350 1.00 18.43 ? 24  THR A CB  1 
ATOM   192  O OG1 . THR A 1 24  ? 39.251  15.385 11.777 1.00 17.96 ? 24  THR A OG1 1 
ATOM   193  C CG2 . THR A 1 24  ? 39.713  13.970 9.895  1.00 17.90 ? 24  THR A CG2 1 
ATOM   194  N N   . LEU A 1 25  ? 40.931  13.604 14.246 1.00 20.22 ? 25  LEU A N   1 
ATOM   195  C CA  . LEU A 1 25  ? 41.062  14.039 15.633 1.00 20.02 ? 25  LEU A CA  1 
ATOM   196  C C   . LEU A 1 25  ? 40.280  15.327 15.851 1.00 20.52 ? 25  LEU A C   1 
ATOM   197  O O   . LEU A 1 25  ? 39.554  15.471 16.835 1.00 20.92 ? 25  LEU A O   1 
ATOM   198  C CB  . LEU A 1 25  ? 42.529  14.276 15.992 1.00 19.98 ? 25  LEU A CB  1 
ATOM   199  C CG  . LEU A 1 25  ? 42.801  14.781 17.414 1.00 21.88 ? 25  LEU A CG  1 
ATOM   200  C CD1 . LEU A 1 25  ? 42.273  13.784 18.443 1.00 21.96 ? 25  LEU A CD1 1 
ATOM   201  C CD2 . LEU A 1 25  ? 44.301  14.988 17.599 1.00 23.99 ? 25  LEU A CD2 1 
ATOM   202  N N   . ALA A 1 26  ? 40.427  16.258 14.917 1.00 20.10 ? 26  ALA A N   1 
ATOM   203  C CA  . ALA A 1 26  ? 39.747  17.539 15.005 1.00 19.35 ? 26  ALA A CA  1 
ATOM   204  C C   . ALA A 1 26  ? 38.238  17.368 15.128 1.00 19.94 ? 26  ALA A C   1 
ATOM   205  O O   . ALA A 1 26  ? 37.582  18.088 15.884 1.00 18.41 ? 26  ALA A O   1 
ATOM   206  C CB  . ALA A 1 26  ? 40.076  18.380 13.783 1.00 18.11 ? 26  ALA A CB  1 
ATOM   207  N N   . GLU A 1 27  ? 37.691  16.411 14.385 1.00 19.20 ? 27  GLU A N   1 
ATOM   208  C CA  . GLU A 1 27  ? 36.258  16.178 14.405 1.00 20.63 ? 27  GLU A CA  1 
ATOM   209  C C   . GLU A 1 27  ? 35.822  15.487 15.692 1.00 21.61 ? 27  GLU A C   1 
ATOM   210  O O   . GLU A 1 27  ? 34.697  15.686 16.173 1.00 20.69 ? 27  GLU A O   1 
ATOM   211  C CB  . GLU A 1 27  ? 35.853  15.371 13.168 1.00 20.54 ? 27  GLU A CB  1 
ATOM   212  C CG  . GLU A 1 27  ? 36.177  16.110 11.874 1.00 22.46 ? 27  GLU A CG  1 
ATOM   213  C CD  . GLU A 1 27  ? 35.883  15.303 10.627 1.00 24.28 ? 27  GLU A CD  1 
ATOM   214  O OE1 . GLU A 1 27  ? 36.265  14.114 10.581 1.00 24.70 ? 27  GLU A OE1 1 
ATOM   215  O OE2 . GLU A 1 27  ? 35.283  15.867 9.685  1.00 26.27 ? 27  GLU A OE2 1 
ATOM   216  N N   . LYS A 1 28  ? 36.723  14.692 16.260 1.00 21.80 ? 28  LYS A N   1 
ATOM   217  C CA  . LYS A 1 28  ? 36.427  13.985 17.496 1.00 22.35 ? 28  LYS A CA  1 
ATOM   218  C C   . LYS A 1 28  ? 36.406  14.966 18.659 1.00 23.61 ? 28  LYS A C   1 
ATOM   219  O O   . LYS A 1 28  ? 35.451  15.001 19.441 1.00 25.27 ? 28  LYS A O   1 
ATOM   220  C CB  . LYS A 1 28  ? 37.466  12.896 17.748 1.00 20.80 ? 28  LYS A CB  1 
ATOM   221  C CG  . LYS A 1 28  ? 37.394  11.769 16.752 1.00 20.11 ? 28  LYS A CG  1 
ATOM   222  C CD  . LYS A 1 28  ? 38.319  10.626 17.121 1.00 19.78 ? 28  LYS A CD  1 
ATOM   223  C CE  . LYS A 1 28  ? 38.042  9.436  16.231 1.00 19.67 ? 28  LYS A CE  1 
ATOM   224  N NZ  . LYS A 1 28  ? 39.016  8.342  16.437 1.00 19.95 ? 28  LYS A NZ  1 
ATOM   225  N N   . ILE A 1 29  ? 37.456  15.769 18.769 1.00 22.65 ? 29  ILE A N   1 
ATOM   226  C CA  . ILE A 1 29  ? 37.532  16.747 19.840 1.00 22.03 ? 29  ILE A CA  1 
ATOM   227  C C   . ILE A 1 29  ? 36.438  17.792 19.659 1.00 22.62 ? 29  ILE A C   1 
ATOM   228  O O   . ILE A 1 29  ? 35.973  18.391 20.630 1.00 23.41 ? 29  ILE A O   1 
ATOM   229  C CB  . ILE A 1 29  ? 38.922  17.409 19.868 1.00 21.80 ? 29  ILE A CB  1 
ATOM   230  C CG1 . ILE A 1 29  ? 39.957  16.360 20.301 1.00 21.61 ? 29  ILE A CG1 1 
ATOM   231  C CG2 . ILE A 1 29  ? 38.907  18.644 20.770 1.00 21.15 ? 29  ILE A CG2 1 
ATOM   232  C CD1 . ILE A 1 29  ? 41.394  16.853 20.347 1.00 23.07 ? 29  ILE A CD1 1 
ATOM   233  N N   . GLY A 1 30  ? 36.016  17.998 18.413 1.00 22.44 ? 30  GLY A N   1 
ATOM   234  C CA  . GLY A 1 30  ? 34.958  18.961 18.146 1.00 20.91 ? 30  GLY A CA  1 
ATOM   235  C C   . GLY A 1 30  ? 33.644  18.517 18.771 1.00 20.44 ? 30  GLY A C   1 
ATOM   236  O O   . GLY A 1 30  ? 32.911  19.316 19.354 1.00 19.71 ? 30  GLY A O   1 
ATOM   237  N N   . GLN A 1 31  ? 33.345  17.229 18.647 1.00 19.26 ? 31  GLN A N   1 
ATOM   238  C CA  . GLN A 1 31  ? 32.130  16.683 19.219 1.00 17.99 ? 31  GLN A CA  1 
ATOM   239  C C   . GLN A 1 31  ? 32.130  16.851 20.724 1.00 17.92 ? 31  GLN A C   1 
ATOM   240  O O   . GLN A 1 31  ? 31.076  16.960 21.334 1.00 19.21 ? 31  GLN A O   1 
ATOM   241  C CB  . GLN A 1 31  ? 31.997  15.198 18.887 1.00 16.72 ? 31  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 31  ? 31.485  14.936 17.489 1.00 17.50 ? 31  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 31  ? 30.144  15.599 17.239 1.00 17.15 ? 31  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 31  ? 29.177  15.352 17.959 1.00 15.12 ? 31  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 31  ? 30.082  16.449 16.215 1.00 16.25 ? 31  GLN A NE2 1 
ATOM   246  N N   . MET A 1 32  ? 33.313  16.879 21.321 1.00 18.11 ? 32  MET A N   1 
ATOM   247  C CA  . MET A 1 32  ? 33.416  17.005 22.767 1.00 17.93 ? 32  MET A CA  1 
ATOM   248  C C   . MET A 1 32  ? 33.294  18.438 23.278 1.00 17.80 ? 32  MET A C   1 
ATOM   249  O O   . MET A 1 32  ? 33.305  18.672 24.486 1.00 19.33 ? 32  MET A O   1 
ATOM   250  C CB  . MET A 1 32  ? 34.740  16.401 23.238 1.00 18.21 ? 32  MET A CB  1 
ATOM   251  C CG  . MET A 1 32  ? 34.919  14.932 22.881 1.00 17.74 ? 32  MET A CG  1 
ATOM   252  S SD  . MET A 1 32  ? 36.581  14.306 23.268 1.00 20.46 ? 32  MET A SD  1 
ATOM   253  C CE  . MET A 1 32  ? 36.606  14.485 25.043 1.00 17.21 ? 32  MET A CE  1 
ATOM   254  N N   . THR A 1 33  ? 33.151  19.392 22.367 1.00 16.35 ? 33  THR A N   1 
ATOM   255  C CA  . THR A 1 33  ? 33.066  20.794 22.754 1.00 16.35 ? 33  THR A CA  1 
ATOM   256  C C   . THR A 1 33  ? 31.661  21.397 22.732 1.00 17.09 ? 33  THR A C   1 
ATOM   257  O O   . THR A 1 33  ? 30.957  21.299 21.729 1.00 17.31 ? 33  THR A O   1 
ATOM   258  C CB  . THR A 1 33  ? 33.952  21.649 21.830 1.00 16.66 ? 33  THR A CB  1 
ATOM   259  O OG1 . THR A 1 33  ? 35.255  21.066 21.753 1.00 18.05 ? 33  THR A OG1 1 
ATOM   260  C CG2 . THR A 1 33  ? 34.067  23.071 22.350 1.00 17.71 ? 33  THR A CG2 1 
ATOM   261  N N   . GLN A 1 34  ? 31.257  22.016 23.841 1.00 15.91 ? 34  GLN A N   1 
ATOM   262  C CA  . GLN A 1 34  ? 29.959  22.683 23.915 1.00 16.60 ? 34  GLN A CA  1 
ATOM   263  C C   . GLN A 1 34  ? 30.242  24.156 24.172 1.00 17.01 ? 34  GLN A C   1 
ATOM   264  O O   . GLN A 1 34  ? 30.860  24.507 25.175 1.00 17.07 ? 34  GLN A O   1 
ATOM   265  C CB  . GLN A 1 34  ? 29.097  22.135 25.048 1.00 17.32 ? 34  GLN A CB  1 
ATOM   266  C CG  . GLN A 1 34  ? 27.700  22.755 25.082 1.00 17.62 ? 34  GLN A CG  1 
ATOM   267  C CD  . GLN A 1 34  ? 26.892  22.339 26.297 1.00 16.88 ? 34  GLN A CD  1 
ATOM   268  O OE1 . GLN A 1 34  ? 27.164  22.761 27.418 1.00 16.31 ? 34  GLN A OE1 1 
ATOM   269  N NE2 . GLN A 1 34  ? 25.893  21.503 26.077 1.00 17.92 ? 34  GLN A NE2 1 
ATOM   270  N N   . ILE A 1 35  ? 29.792  25.020 23.271 1.00 17.49 ? 35  ILE A N   1 
ATOM   271  C CA  . ILE A 1 35  ? 30.048  26.445 23.412 1.00 18.04 ? 35  ILE A CA  1 
ATOM   272  C C   . ILE A 1 35  ? 28.772  27.254 23.631 1.00 19.15 ? 35  ILE A C   1 
ATOM   273  O O   . ILE A 1 35  ? 27.681  26.819 23.274 1.00 20.33 ? 35  ILE A O   1 
ATOM   274  C CB  . ILE A 1 35  ? 30.793  26.989 22.161 1.00 17.14 ? 35  ILE A CB  1 
ATOM   275  C CG1 . ILE A 1 35  ? 29.880  26.921 20.937 1.00 17.07 ? 35  ILE A CG1 1 
ATOM   276  C CG2 . ILE A 1 35  ? 32.038  26.150 21.884 1.00 15.01 ? 35  ILE A CG2 1 
ATOM   277  C CD1 . ILE A 1 35  ? 30.493  27.501 19.689 1.00 16.58 ? 35  ILE A CD1 1 
ATOM   278  N N   . GLU A 1 36  ? 28.918  28.430 24.231 1.00 19.72 ? 36  GLU A N   1 
ATOM   279  C CA  . GLU A 1 36  ? 27.788  29.313 24.496 1.00 20.91 ? 36  GLU A CA  1 
ATOM   280  C C   . GLU A 1 36  ? 27.347  29.933 23.170 1.00 22.19 ? 36  GLU A C   1 
ATOM   281  O O   . GLU A 1 36  ? 28.175  30.233 22.305 1.00 21.67 ? 36  GLU A O   1 
ATOM   282  C CB  . GLU A 1 36  ? 28.217  30.420 25.459 1.00 22.51 ? 36  GLU A CB  1 
ATOM   283  C CG  . GLU A 1 36  ? 27.304  30.660 26.661 1.00 25.05 ? 36  GLU A CG  1 
ATOM   284  C CD  . GLU A 1 36  ? 25.988  31.334 26.306 1.00 26.13 ? 36  GLU A CD  1 
ATOM   285  O OE1 . GLU A 1 36  ? 25.927  32.023 25.264 1.00 28.83 ? 36  GLU A OE1 1 
ATOM   286  O OE2 . GLU A 1 36  ? 25.018  31.191 27.083 1.00 27.67 ? 36  GLU A OE2 1 
ATOM   287  N N   . ARG A 1 37  ? 26.044  30.129 23.007 1.00 21.85 ? 37  ARG A N   1 
ATOM   288  C CA  . ARG A 1 37  ? 25.543  30.716 21.775 1.00 21.39 ? 37  ARG A CA  1 
ATOM   289  C C   . ARG A 1 37  ? 26.175  32.087 21.543 1.00 21.44 ? 37  ARG A C   1 
ATOM   290  O O   . ARG A 1 37  ? 26.382  32.497 20.401 1.00 21.08 ? 37  ARG A O   1 
ATOM   291  C CB  . ARG A 1 37  ? 24.017  30.841 21.821 1.00 20.20 ? 37  ARG A CB  1 
ATOM   292  C CG  . ARG A 1 37  ? 23.482  31.585 23.025 1.00 21.29 ? 37  ARG A CG  1 
ATOM   293  C CD  . ARG A 1 37  ? 22.030  31.989 22.802 1.00 22.84 ? 37  ARG A CD  1 
ATOM   294  N NE  . ARG A 1 37  ? 21.902  33.144 21.910 1.00 22.49 ? 37  ARG A NE  1 
ATOM   295  C CZ  . ARG A 1 37  ? 22.034  34.410 22.300 1.00 22.87 ? 37  ARG A CZ  1 
ATOM   296  N NH1 . ARG A 1 37  ? 22.293  34.692 23.573 1.00 21.70 ? 37  ARG A NH1 1 
ATOM   297  N NH2 . ARG A 1 37  ? 21.918  35.398 21.418 1.00 22.48 ? 37  ARG A NH2 1 
ATOM   298  N N   . LEU A 1 38  ? 26.496  32.781 22.632 1.00 21.81 ? 38  LEU A N   1 
ATOM   299  C CA  . LEU A 1 38  ? 27.095  34.110 22.548 1.00 22.02 ? 38  LEU A CA  1 
ATOM   300  C C   . LEU A 1 38  ? 28.449  34.174 21.850 1.00 22.75 ? 38  LEU A C   1 
ATOM   301  O O   . LEU A 1 38  ? 28.878  35.260 21.459 1.00 23.42 ? 38  LEU A O   1 
ATOM   302  C CB  . LEU A 1 38  ? 27.218  34.724 23.937 1.00 21.14 ? 38  LEU A CB  1 
ATOM   303  C CG  . LEU A 1 38  ? 25.867  35.093 24.548 1.00 23.06 ? 38  LEU A CG  1 
ATOM   304  C CD1 . LEU A 1 38  ? 26.038  35.498 26.009 1.00 21.71 ? 38  LEU A CD1 1 
ATOM   305  C CD2 . LEU A 1 38  ? 25.239  36.217 23.730 1.00 21.39 ? 38  LEU A CD2 1 
ATOM   306  N N   . VAL A 1 39  ? 29.129  33.036 21.698 1.00 21.10 ? 39  VAL A N   1 
ATOM   307  C CA  . VAL A 1 39  ? 30.425  33.034 21.008 1.00 19.87 ? 39  VAL A CA  1 
ATOM   308  C C   . VAL A 1 39  ? 30.377  32.171 19.751 1.00 19.92 ? 39  VAL A C   1 
ATOM   309  O O   . VAL A 1 39  ? 31.415  31.877 19.165 1.00 19.47 ? 39  VAL A O   1 
ATOM   310  C CB  . VAL A 1 39  ? 31.582  32.503 21.908 1.00 18.07 ? 39  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 39  ? 31.524  33.157 23.271 1.00 17.49 ? 39  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 39  ? 31.511  30.997 22.030 1.00 18.25 ? 39  VAL A CG2 1 
ATOM   313  N N   . ALA A 1 40  ? 29.171  31.778 19.341 1.00 19.25 ? 40  ALA A N   1 
ATOM   314  C CA  . ALA A 1 40  ? 28.990  30.932 18.167 1.00 19.08 ? 40  ALA A CA  1 
ATOM   315  C C   . ALA A 1 40  ? 28.731  31.688 16.876 1.00 20.76 ? 40  ALA A C   1 
ATOM   316  O O   . ALA A 1 40  ? 27.992  32.673 16.837 1.00 20.04 ? 40  ALA A O   1 
ATOM   317  C CB  . ALA A 1 40  ? 27.862  29.940 18.405 1.00 18.29 ? 40  ALA A CB  1 
ATOM   318  N N   . THR A 1 41  ? 29.337  31.179 15.812 1.00 23.14 ? 41  THR A N   1 
ATOM   319  C CA  . THR A 1 41  ? 29.232  31.737 14.470 1.00 24.29 ? 41  THR A CA  1 
ATOM   320  C C   . THR A 1 41  ? 29.140  30.553 13.520 1.00 25.04 ? 41  THR A C   1 
ATOM   321  O O   . THR A 1 41  ? 29.601  29.452 13.856 1.00 25.68 ? 41  THR A O   1 
ATOM   322  C CB  . THR A 1 41  ? 30.504  32.541 14.131 1.00 24.69 ? 41  THR A CB  1 
ATOM   323  O OG1 . THR A 1 41  ? 30.427  33.826 14.758 1.00 23.59 ? 41  THR A OG1 1 
ATOM   324  C CG2 . THR A 1 41  ? 30.680  32.696 12.622 1.00 27.97 ? 41  THR A CG2 1 
ATOM   325  N N   . PRO A 1 42  ? 28.528  30.744 12.334 1.00 24.82 ? 42  PRO A N   1 
ATOM   326  C CA  . PRO A 1 42  ? 28.444  29.614 11.402 1.00 24.48 ? 42  PRO A CA  1 
ATOM   327  C C   . PRO A 1 42  ? 29.860  29.094 11.144 1.00 24.85 ? 42  PRO A C   1 
ATOM   328  O O   . PRO A 1 42  ? 30.093  27.884 11.108 1.00 24.71 ? 42  PRO A O   1 
ATOM   329  C CB  . PRO A 1 42  ? 27.819  30.237 10.164 1.00 22.95 ? 42  PRO A CB  1 
ATOM   330  C CG  . PRO A 1 42  ? 26.899  31.263 10.751 1.00 23.34 ? 42  PRO A CG  1 
ATOM   331  C CD  . PRO A 1 42  ? 27.748  31.892 11.838 1.00 24.37 ? 42  PRO A CD  1 
ATOM   332  N N   . ASP A 1 43  ? 30.808  30.017 10.991 1.00 25.18 ? 43  ASP A N   1 
ATOM   333  C CA  . ASP A 1 43  ? 32.197  29.632 10.755 1.00 26.29 ? 43  ASP A CA  1 
ATOM   334  C C   . ASP A 1 43  ? 32.800  28.900 11.937 1.00 25.13 ? 43  ASP A C   1 
ATOM   335  O O   . ASP A 1 43  ? 33.411  27.842 11.776 1.00 24.44 ? 43  ASP A O   1 
ATOM   336  C CB  . ASP A 1 43  ? 33.064  30.851 10.456 1.00 28.25 ? 43  ASP A CB  1 
ATOM   337  C CG  . ASP A 1 43  ? 32.822  31.404 9.083  1.00 31.48 ? 43  ASP A CG  1 
ATOM   338  O OD1 . ASP A 1 43  ? 32.725  30.591 8.137  1.00 33.81 ? 43  ASP A OD1 1 
ATOM   339  O OD2 . ASP A 1 43  ? 32.740  32.644 8.951  1.00 33.55 ? 43  ASP A OD2 1 
ATOM   340  N N   . VAL A 1 44  ? 32.645  29.479 13.122 1.00 23.37 ? 44  VAL A N   1 
ATOM   341  C CA  . VAL A 1 44  ? 33.190  28.866 14.324 1.00 21.96 ? 44  VAL A CA  1 
ATOM   342  C C   . VAL A 1 44  ? 32.687  27.433 14.434 1.00 22.65 ? 44  VAL A C   1 
ATOM   343  O O   . VAL A 1 44  ? 33.466  26.497 14.641 1.00 22.36 ? 44  VAL A O   1 
ATOM   344  C CB  . VAL A 1 44  ? 32.779  29.658 15.588 1.00 21.70 ? 44  VAL A CB  1 
ATOM   345  C CG1 . VAL A 1 44  ? 33.191  28.902 16.839 1.00 18.79 ? 44  VAL A CG1 1 
ATOM   346  C CG2 . VAL A 1 44  ? 33.426  31.035 15.563 1.00 16.34 ? 44  VAL A CG2 1 
ATOM   347  N N   . LEU A 1 45  ? 31.381  27.269 14.267 1.00 21.33 ? 45  LEU A N   1 
ATOM   348  C CA  . LEU A 1 45  ? 30.770  25.957 14.357 1.00 21.76 ? 45  LEU A CA  1 
ATOM   349  C C   . LEU A 1 45  ? 31.277  24.996 13.288 1.00 21.71 ? 45  LEU A C   1 
ATOM   350  O O   . LEU A 1 45  ? 31.607  23.849 13.581 1.00 22.46 ? 45  LEU A O   1 
ATOM   351  C CB  . LEU A 1 45  ? 29.250  26.091 14.265 1.00 20.35 ? 45  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 45  ? 28.625  26.886 15.413 1.00 19.87 ? 45  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 45  ? 27.185  27.209 15.079 1.00 20.77 ? 45  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 45  ? 28.725  26.097 16.712 1.00 17.81 ? 45  LEU A CD2 1 
ATOM   355  N N   . ARG A 1 46  ? 31.346  25.470 12.052 1.00 22.08 ? 46  ARG A N   1 
ATOM   356  C CA  . ARG A 1 46  ? 31.792  24.642 10.942 1.00 23.76 ? 46  ARG A CA  1 
ATOM   357  C C   . ARG A 1 46  ? 33.284  24.312 11.017 1.00 23.77 ? 46  ARG A C   1 
ATOM   358  O O   . ARG A 1 46  ? 33.678  23.142 10.975 1.00 22.52 ? 46  ARG A O   1 
ATOM   359  C CB  . ARG A 1 46  ? 31.479  25.352 9.621  1.00 26.06 ? 46  ARG A CB  1 
ATOM   360  C CG  . ARG A 1 46  ? 31.747  24.524 8.383  1.00 30.27 ? 46  ARG A CG  1 
ATOM   361  C CD  . ARG A 1 46  ? 31.615  25.344 7.107  1.00 33.73 ? 46  ARG A CD  1 
ATOM   362  N NE  . ARG A 1 46  ? 30.318  26.016 7.008  1.00 40.41 ? 46  ARG A NE  1 
ATOM   363  C CZ  . ARG A 1 46  ? 30.058  27.242 7.470  1.00 41.90 ? 46  ARG A CZ  1 
ATOM   364  N NH1 . ARG A 1 46  ? 31.010  27.955 8.070  1.00 41.60 ? 46  ARG A NH1 1 
ATOM   365  N NH2 . ARG A 1 46  ? 28.842  27.760 7.328  1.00 40.80 ? 46  ARG A NH2 1 
ATOM   366  N N   . ASP A 1 47  ? 34.109  25.347 11.136 1.00 24.04 ? 47  ASP A N   1 
ATOM   367  C CA  . ASP A 1 47  ? 35.554  25.171 11.190 1.00 24.31 ? 47  ASP A CA  1 
ATOM   368  C C   . ASP A 1 47  ? 36.041  24.374 12.390 1.00 24.58 ? 47  ASP A C   1 
ATOM   369  O O   . ASP A 1 47  ? 37.026  23.644 12.293 1.00 26.30 ? 47  ASP A O   1 
ATOM   370  C CB  . ASP A 1 47  ? 36.258  26.531 11.165 1.00 25.57 ? 47  ASP A CB  1 
ATOM   371  C CG  . ASP A 1 47  ? 35.931  27.338 9.916  1.00 27.84 ? 47  ASP A CG  1 
ATOM   372  O OD1 . ASP A 1 47  ? 35.660  26.716 8.864  1.00 26.47 ? 47  ASP A OD1 1 
ATOM   373  O OD2 . ASP A 1 47  ? 35.958  28.591 9.988  1.00 29.06 ? 47  ASP A OD2 1 
ATOM   374  N N   . ASN A 1 48  ? 35.363  24.503 13.523 1.00 23.65 ? 48  ASN A N   1 
ATOM   375  C CA  . ASN A 1 48  ? 35.782  23.770 14.711 1.00 22.23 ? 48  ASN A CA  1 
ATOM   376  C C   . ASN A 1 48  ? 35.009  22.484 14.948 1.00 21.26 ? 48  ASN A C   1 
ATOM   377  O O   . ASN A 1 48  ? 35.251  21.791 15.932 1.00 19.61 ? 48  ASN A O   1 
ATOM   378  C CB  . ASN A 1 48  ? 35.688  24.677 15.932 1.00 23.08 ? 48  ASN A CB  1 
ATOM   379  C CG  . ASN A 1 48  ? 36.634  25.845 15.840 1.00 22.33 ? 48  ASN A CG  1 
ATOM   380  O OD1 . ASN A 1 48  ? 37.840  25.686 15.986 1.00 20.95 ? 48  ASN A OD1 1 
ATOM   381  N ND2 . ASN A 1 48  ? 36.095  27.026 15.568 1.00 23.83 ? 48  ASN A ND2 1 
ATOM   382  N N   . PHE A 1 49  ? 34.084  22.171 14.042 1.00 21.13 ? 49  PHE A N   1 
ATOM   383  C CA  . PHE A 1 49  ? 33.285  20.953 14.137 1.00 19.81 ? 49  PHE A CA  1 
ATOM   384  C C   . PHE A 1 49  ? 32.553  20.835 15.480 1.00 18.19 ? 49  PHE A C   1 
ATOM   385  O O   . PHE A 1 49  ? 32.381  19.738 16.000 1.00 16.64 ? 49  PHE A O   1 
ATOM   386  C CB  . PHE A 1 49  ? 34.199  19.735 13.937 1.00 21.96 ? 49  PHE A CB  1 
ATOM   387  C CG  . PHE A 1 49  ? 34.977  19.759 12.643 1.00 22.66 ? 49  PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 49  ? 34.347  19.502 11.426 1.00 24.20 ? 49  PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 49  ? 36.335  20.043 12.640 1.00 23.32 ? 49  PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 49  ? 35.061  19.527 10.225 1.00 23.64 ? 49  PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 49  ? 37.058  20.071 11.444 1.00 23.95 ? 49  PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 49  ? 36.418  19.813 10.235 1.00 22.68 ? 49  PHE A CZ  1 
ATOM   393  N N   . ILE A 1 50  ? 32.120  21.966 16.030 1.00 17.41 ? 50  ILE A N   1 
ATOM   394  C CA  . ILE A 1 50  ? 31.427  21.992 17.321 1.00 17.90 ? 50  ILE A CA  1 
ATOM   395  C C   . ILE A 1 50  ? 30.279  20.980 17.425 1.00 18.79 ? 50  ILE A C   1 
ATOM   396  O O   . ILE A 1 50  ? 29.364  20.962 16.593 1.00 18.93 ? 50  ILE A O   1 
ATOM   397  C CB  . ILE A 1 50  ? 30.892  23.409 17.626 1.00 17.64 ? 50  ILE A CB  1 
ATOM   398  C CG1 . ILE A 1 50  ? 32.046  24.415 17.568 1.00 18.25 ? 50  ILE A CG1 1 
ATOM   399  C CG2 . ILE A 1 50  ? 30.235  23.443 18.996 1.00 15.18 ? 50  ILE A CG2 1 
ATOM   400  C CD1 . ILE A 1 50  ? 33.192  24.101 18.507 1.00 16.20 ? 50  ILE A CD1 1 
ATOM   401  N N   . GLY A 1 51  ? 30.329  20.146 18.461 1.00 18.37 ? 51  GLY A N   1 
ATOM   402  C CA  . GLY A 1 51  ? 29.314  19.128 18.637 1.00 16.99 ? 51  GLY A CA  1 
ATOM   403  C C   . GLY A 1 51  ? 28.096  19.558 19.422 1.00 17.87 ? 51  GLY A C   1 
ATOM   404  O O   . GLY A 1 51  ? 27.076  18.868 19.421 1.00 16.74 ? 51  GLY A O   1 
ATOM   405  N N   . SER A 1 52  ? 28.177  20.707 20.079 1.00 17.63 ? 52  SER A N   1 
ATOM   406  C CA  . SER A 1 52  ? 27.053  21.154 20.878 1.00 18.63 ? 52  SER A CA  1 
ATOM   407  C C   . SER A 1 52  ? 27.107  22.615 21.297 1.00 18.95 ? 52  SER A C   1 
ATOM   408  O O   . SER A 1 52  ? 28.180  23.201 21.445 1.00 18.89 ? 52  SER A O   1 
ATOM   409  C CB  . SER A 1 52  ? 26.955  20.268 22.126 1.00 19.09 ? 52  SER A CB  1 
ATOM   410  O OG  . SER A 1 52  ? 25.984  20.749 23.034 1.00 18.99 ? 52  SER A OG  1 
ATOM   411  N N   . LEU A 1 53  ? 25.929  23.202 21.471 1.00 19.55 ? 53  LEU A N   1 
ATOM   412  C CA  . LEU A 1 53  ? 25.816  24.580 21.928 1.00 20.70 ? 53  LEU A CA  1 
ATOM   413  C C   . LEU A 1 53  ? 24.873  24.593 23.120 1.00 21.63 ? 53  LEU A C   1 
ATOM   414  O O   . LEU A 1 53  ? 24.093  23.655 23.320 1.00 22.31 ? 53  LEU A O   1 
ATOM   415  C CB  . LEU A 1 53  ? 25.238  25.500 20.854 1.00 19.95 ? 53  LEU A CB  1 
ATOM   416  C CG  . LEU A 1 53  ? 26.067  25.851 19.628 1.00 21.09 ? 53  LEU A CG  1 
ATOM   417  C CD1 . LEU A 1 53  ? 25.907  24.770 18.554 1.00 19.81 ? 53  LEU A CD1 1 
ATOM   418  C CD2 . LEU A 1 53  ? 25.588  27.197 19.109 1.00 19.27 ? 53  LEU A CD2 1 
ATOM   419  N N   . LEU A 1 54  ? 24.954  25.651 23.918 1.00 20.93 ? 54  LEU A N   1 
ATOM   420  C CA  . LEU A 1 54  ? 24.075  25.790 25.065 1.00 19.73 ? 54  LEU A CA  1 
ATOM   421  C C   . LEU A 1 54  ? 23.700  27.250 25.226 1.00 19.98 ? 54  LEU A C   1 
ATOM   422  O O   . LEU A 1 54  ? 24.308  28.149 24.642 1.00 19.52 ? 54  LEU A O   1 
ATOM   423  C CB  . LEU A 1 54  ? 24.740  25.313 26.362 1.00 18.89 ? 54  LEU A CB  1 
ATOM   424  C CG  . LEU A 1 54  ? 25.505  26.388 27.145 1.00 17.95 ? 54  LEU A CG  1 
ATOM   425  C CD1 . LEU A 1 54  ? 25.538  26.040 28.614 1.00 17.42 ? 54  LEU A CD1 1 
ATOM   426  C CD2 . LEU A 1 54  ? 26.904  26.533 26.581 1.00 17.73 ? 54  LEU A CD2 1 
ATOM   427  N N   . SER A 1 55  ? 22.691  27.475 26.044 1.00 20.54 ? 55  SER A N   1 
ATOM   428  C CA  . SER A 1 55  ? 22.228  28.810 26.321 1.00 18.92 ? 55  SER A CA  1 
ATOM   429  C C   . SER A 1 55  ? 22.257  28.873 27.836 1.00 17.80 ? 55  SER A C   1 
ATOM   430  O O   . SER A 1 55  ? 21.480  28.188 28.493 1.00 18.40 ? 55  SER A O   1 
ATOM   431  C CB  . SER A 1 55  ? 20.806  28.965 25.794 1.00 19.68 ? 55  SER A CB  1 
ATOM   432  O OG  . SER A 1 55  ? 20.496  30.316 25.566 1.00 19.88 ? 55  SER A OG  1 
ATOM   433  N N   . GLY A 1 56  ? 23.175  29.651 28.396 1.00 16.61 ? 56  GLY A N   1 
ATOM   434  C CA  . GLY A 1 56  ? 23.244  29.753 29.843 1.00 17.51 ? 56  GLY A CA  1 
ATOM   435  C C   . GLY A 1 56  ? 22.098  30.583 30.396 1.00 17.87 ? 56  GLY A C   1 
ATOM   436  O O   . GLY A 1 56  ? 21.321  31.156 29.636 1.00 18.72 ? 56  GLY A O   1 
ATOM   437  N N   . GLY A 1 57  ? 21.976  30.656 31.716 1.00 18.07 ? 57  GLY A N   1 
ATOM   438  C CA  . GLY A 1 57  ? 20.906  31.451 32.286 1.00 17.81 ? 57  GLY A CA  1 
ATOM   439  C C   . GLY A 1 57  ? 20.820  32.827 31.641 1.00 18.99 ? 57  GLY A C   1 
ATOM   440  O O   . GLY A 1 57  ? 21.814  33.553 31.562 1.00 17.94 ? 57  GLY A O   1 
ATOM   441  N N   . GLY A 1 58  ? 19.635  33.183 31.156 1.00 18.97 ? 58  GLY A N   1 
ATOM   442  C CA  . GLY A 1 58  ? 19.450  34.488 30.543 1.00 19.06 ? 58  GLY A CA  1 
ATOM   443  C C   . GLY A 1 58  ? 19.986  34.689 29.135 1.00 19.27 ? 58  GLY A C   1 
ATOM   444  O O   . GLY A 1 58  ? 19.710  35.721 28.517 1.00 20.46 ? 58  GLY A O   1 
ATOM   445  N N   . SER A 1 59  ? 20.750  33.724 28.621 1.00 20.05 ? 59  SER A N   1 
ATOM   446  C CA  . SER A 1 59  ? 21.318  33.816 27.268 1.00 19.31 ? 59  SER A CA  1 
ATOM   447  C C   . SER A 1 59  ? 20.209  33.621 26.222 1.00 20.60 ? 59  SER A C   1 
ATOM   448  O O   . SER A 1 59  ? 19.887  32.503 25.848 1.00 21.77 ? 59  SER A O   1 
ATOM   449  C CB  . SER A 1 59  ? 22.406  32.750 27.094 1.00 16.63 ? 59  SER A CB  1 
ATOM   450  O OG  . SER A 1 59  ? 23.136  32.939 25.896 1.00 17.06 ? 59  SER A OG  1 
ATOM   451  N N   . VAL A 1 60  ? 19.627  34.715 25.747 1.00 21.88 ? 60  VAL A N   1 
ATOM   452  C CA  . VAL A 1 60  ? 18.539  34.616 24.785 1.00 22.30 ? 60  VAL A CA  1 
ATOM   453  C C   . VAL A 1 60  ? 18.780  35.453 23.529 1.00 24.01 ? 60  VAL A C   1 
ATOM   454  O O   . VAL A 1 60  ? 19.599  36.373 23.532 1.00 22.77 ? 60  VAL A O   1 
ATOM   455  C CB  . VAL A 1 60  ? 17.203  35.049 25.440 1.00 21.64 ? 60  VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 60  ? 16.953  34.222 26.692 1.00 21.34 ? 60  VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 60  ? 17.244  36.528 25.797 1.00 18.77 ? 60  VAL A CG2 1 
ATOM   458  N N   . PRO A 1 61  ? 18.064  35.135 22.435 1.00 25.59 ? 61  PRO A N   1 
ATOM   459  C CA  . PRO A 1 61  ? 18.176  35.840 21.151 1.00 26.20 ? 61  PRO A CA  1 
ATOM   460  C C   . PRO A 1 61  ? 17.970  37.332 21.367 1.00 27.74 ? 61  PRO A C   1 
ATOM   461  O O   . PRO A 1 61  ? 18.724  38.166 20.864 1.00 28.19 ? 61  PRO A O   1 
ATOM   462  C CB  . PRO A 1 61  ? 17.051  35.230 20.324 1.00 26.24 ? 61  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 61  ? 16.922  33.856 20.883 1.00 27.78 ? 61  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 61  ? 17.038  34.080 22.364 1.00 25.93 ? 61  PRO A CD  1 
ATOM   465  N N   . ARG A 1 62  ? 16.921  37.651 22.115 1.00 28.73 ? 62  ARG A N   1 
ATOM   466  C CA  . ARG A 1 62  ? 16.582  39.024 22.453 1.00 30.91 ? 62  ARG A CA  1 
ATOM   467  C C   . ARG A 1 62  ? 15.416  38.960 23.425 1.00 31.66 ? 62  ARG A C   1 
ATOM   468  O O   . ARG A 1 62  ? 14.609  38.028 23.375 1.00 33.17 ? 62  ARG A O   1 
ATOM   469  C CB  . ARG A 1 62  ? 16.168  39.812 21.211 1.00 32.38 ? 62  ARG A CB  1 
ATOM   470  C CG  . ARG A 1 62  ? 14.874  39.337 20.584 1.00 35.27 ? 62  ARG A CG  1 
ATOM   471  C CD  . ARG A 1 62  ? 14.270  40.405 19.684 1.00 35.99 ? 62  ARG A CD  1 
ATOM   472  N NE  . ARG A 1 62  ? 12.894  40.069 19.328 1.00 37.54 ? 62  ARG A NE  1 
ATOM   473  C CZ  . ARG A 1 62  ? 11.956  40.959 19.019 1.00 36.66 ? 62  ARG A CZ  1 
ATOM   474  N NH1 . ARG A 1 62  ? 12.235  42.256 19.017 1.00 37.55 ? 62  ARG A NH1 1 
ATOM   475  N NH2 . ARG A 1 62  ? 10.734  40.547 18.723 1.00 36.91 ? 62  ARG A NH2 1 
ATOM   476  N N   . LYS A 1 63  ? 15.327  39.940 24.315 1.00 31.36 ? 63  LYS A N   1 
ATOM   477  C CA  . LYS A 1 63  ? 14.240  39.962 25.280 1.00 31.40 ? 63  LYS A CA  1 
ATOM   478  C C   . LYS A 1 63  ? 12.892  39.785 24.602 1.00 29.02 ? 63  LYS A C   1 
ATOM   479  O O   . LYS A 1 63  ? 12.632  40.380 23.556 1.00 28.53 ? 63  LYS A O   1 
ATOM   480  C CB  . LYS A 1 63  ? 14.251  41.270 26.073 1.00 34.17 ? 63  LYS A CB  1 
ATOM   481  C CG  . LYS A 1 63  ? 15.309  41.298 27.178 1.00 39.41 ? 63  LYS A CG  1 
ATOM   482  C CD  . LYS A 1 63  ? 15.094  40.147 28.173 1.00 40.77 ? 63  LYS A CD  1 
ATOM   483  C CE  . LYS A 1 63  ? 16.076  40.220 29.329 1.00 41.44 ? 63  LYS A CE  1 
ATOM   484  N NZ  . LYS A 1 63  ? 15.964  41.524 30.055 1.00 42.69 ? 63  LYS A NZ  1 
ATOM   485  N N   . GLY A 1 64  ? 12.054  38.941 25.198 1.00 26.56 ? 64  GLY A N   1 
ATOM   486  C CA  . GLY A 1 64  ? 10.724  38.696 24.677 1.00 23.18 ? 64  GLY A CA  1 
ATOM   487  C C   . GLY A 1 64  ? 10.646  38.000 23.334 1.00 22.52 ? 64  GLY A C   1 
ATOM   488  O O   . GLY A 1 64  ? 9.618   38.086 22.659 1.00 20.36 ? 64  GLY A O   1 
ATOM   489  N N   . ALA A 1 65  ? 11.713  37.306 22.944 1.00 21.13 ? 65  ALA A N   1 
ATOM   490  C CA  . ALA A 1 65  ? 11.738  36.596 21.666 1.00 19.39 ? 65  ALA A CA  1 
ATOM   491  C C   . ALA A 1 65  ? 10.606  35.573 21.592 1.00 19.21 ? 65  ALA A C   1 
ATOM   492  O O   . ALA A 1 65  ? 10.170  35.051 22.616 1.00 20.59 ? 65  ALA A O   1 
ATOM   493  C CB  . ALA A 1 65  ? 13.078  35.904 21.496 1.00 18.31 ? 65  ALA A CB  1 
ATOM   494  N N   . THR A 1 66  ? 10.124  35.290 20.387 1.00 18.57 ? 66  THR A N   1 
ATOM   495  C CA  . THR A 1 66  ? 9.042   34.315 20.210 1.00 19.00 ? 66  THR A CA  1 
ATOM   496  C C   . THR A 1 66  ? 9.615   32.905 20.035 1.00 18.96 ? 66  THR A C   1 
ATOM   497  O O   . THR A 1 66  ? 10.823  32.732 19.879 1.00 20.60 ? 66  THR A O   1 
ATOM   498  C CB  . THR A 1 66  ? 8.210   34.628 18.960 1.00 18.66 ? 66  THR A CB  1 
ATOM   499  O OG1 . THR A 1 66  ? 9.037   34.482 17.796 1.00 20.33 ? 66  THR A OG1 1 
ATOM   500  C CG2 . THR A 1 66  ? 7.676   36.045 19.017 1.00 15.53 ? 66  THR A CG2 1 
ATOM   501  N N   . ALA A 1 67  ? 8.752   31.898 20.049 1.00 18.68 ? 67  ALA A N   1 
ATOM   502  C CA  . ALA A 1 67  ? 9.220   30.532 19.875 1.00 18.07 ? 67  ALA A CA  1 
ATOM   503  C C   . ALA A 1 67  ? 9.849   30.405 18.493 1.00 19.61 ? 67  ALA A C   1 
ATOM   504  O O   . ALA A 1 67  ? 10.828  29.672 18.312 1.00 20.83 ? 67  ALA A O   1 
ATOM   505  C CB  . ALA A 1 67  ? 8.067   29.548 20.017 1.00 16.21 ? 67  ALA A CB  1 
ATOM   506  N N   . LYS A 1 68  ? 9.298   31.120 17.517 1.00 19.27 ? 68  LYS A N   1 
ATOM   507  C CA  . LYS A 1 68  ? 9.844   31.053 16.170 1.00 21.51 ? 68  LYS A CA  1 
ATOM   508  C C   . LYS A 1 68  ? 11.243  31.641 16.156 1.00 21.30 ? 68  LYS A C   1 
ATOM   509  O O   . LYS A 1 68  ? 12.132  31.126 15.471 1.00 20.40 ? 68  LYS A O   1 
ATOM   510  C CB  . LYS A 1 68  ? 8.968   31.807 15.170 1.00 24.23 ? 68  LYS A CB  1 
ATOM   511  C CG  . LYS A 1 68  ? 8.494   30.945 13.990 1.00 30.59 ? 68  LYS A CG  1 
ATOM   512  C CD  . LYS A 1 68  ? 7.499   29.860 14.455 1.00 33.81 ? 68  LYS A CD  1 
ATOM   513  C CE  . LYS A 1 68  ? 6.761   29.193 13.287 1.00 34.77 ? 68  LYS A CE  1 
ATOM   514  N NZ  . LYS A 1 68  ? 5.715   28.226 13.754 1.00 31.31 ? 68  LYS A NZ  1 
ATOM   515  N N   . GLU A 1 69  ? 11.441  32.718 16.911 1.00 19.41 ? 69  GLU A N   1 
ATOM   516  C CA  . GLU A 1 69  ? 12.752  33.342 16.961 1.00 19.96 ? 69  GLU A CA  1 
ATOM   517  C C   . GLU A 1 69  ? 13.787  32.353 17.484 1.00 19.75 ? 69  GLU A C   1 
ATOM   518  O O   . GLU A 1 69  ? 14.899  32.275 16.952 1.00 18.73 ? 69  GLU A O   1 
ATOM   519  C CB  . GLU A 1 69  ? 12.717  34.590 17.832 1.00 19.87 ? 69  GLU A CB  1 
ATOM   520  C CG  . GLU A 1 69  ? 11.886  35.700 17.230 1.00 21.43 ? 69  GLU A CG  1 
ATOM   521  C CD  . GLU A 1 69  ? 12.038  36.997 17.984 1.00 24.18 ? 69  GLU A CD  1 
ATOM   522  O OE1 . GLU A 1 69  ? 13.184  37.484 18.096 1.00 23.20 ? 69  GLU A OE1 1 
ATOM   523  O OE2 . GLU A 1 69  ? 11.016  37.528 18.467 1.00 25.87 ? 69  GLU A OE2 1 
ATOM   524  N N   . TRP A 1 70  ? 13.419  31.590 18.515 1.00 18.18 ? 70  TRP A N   1 
ATOM   525  C CA  . TRP A 1 70  ? 14.332  30.594 19.065 1.00 16.88 ? 70  TRP A CA  1 
ATOM   526  C C   . TRP A 1 70  ? 14.593  29.520 18.020 1.00 15.81 ? 70  TRP A C   1 
ATOM   527  O O   . TRP A 1 70  ? 15.739  29.163 17.761 1.00 15.25 ? 70  TRP A O   1 
ATOM   528  C CB  . TRP A 1 70  ? 13.760  29.943 20.334 1.00 16.43 ? 70  TRP A CB  1 
ATOM   529  C CG  . TRP A 1 70  ? 13.845  30.806 21.551 1.00 13.56 ? 70  TRP A CG  1 
ATOM   530  C CD1 . TRP A 1 70  ? 12.981  31.800 21.915 1.00 11.53 ? 70  TRP A CD1 1 
ATOM   531  C CD2 . TRP A 1 70  ? 14.884  30.795 22.535 1.00 13.77 ? 70  TRP A CD2 1 
ATOM   532  N NE1 . TRP A 1 70  ? 13.418  32.410 23.063 1.00 12.04 ? 70  TRP A NE1 1 
ATOM   533  C CE2 . TRP A 1 70  ? 14.587  31.816 23.467 1.00 13.13 ? 70  TRP A CE2 1 
ATOM   534  C CE3 . TRP A 1 70  ? 16.041  30.026 22.719 1.00 13.17 ? 70  TRP A CE3 1 
ATOM   535  C CZ2 . TRP A 1 70  ? 15.410  32.090 24.571 1.00 11.94 ? 70  TRP A CZ2 1 
ATOM   536  C CZ3 . TRP A 1 70  ? 16.861  30.300 23.818 1.00 14.89 ? 70  TRP A CZ3 1 
ATOM   537  C CH2 . TRP A 1 70  ? 16.537  31.327 24.729 1.00 11.88 ? 70  TRP A CH2 1 
ATOM   538  N N   . GLN A 1 71  ? 13.523  29.008 17.419 1.00 17.09 ? 71  GLN A N   1 
ATOM   539  C CA  . GLN A 1 71  ? 13.647  27.978 16.395 1.00 18.81 ? 71  GLN A CA  1 
ATOM   540  C C   . GLN A 1 71  ? 14.605  28.418 15.282 1.00 19.52 ? 71  GLN A C   1 
ATOM   541  O O   . GLN A 1 71  ? 15.457  27.644 14.835 1.00 19.10 ? 71  GLN A O   1 
ATOM   542  C CB  . GLN A 1 71  ? 12.264  27.644 15.808 1.00 19.38 ? 71  GLN A CB  1 
ATOM   543  C CG  . GLN A 1 71  ? 11.427  26.711 16.689 1.00 22.00 ? 71  GLN A CG  1 
ATOM   544  C CD  . GLN A 1 71  ? 10.173  26.162 15.994 1.00 23.55 ? 71  GLN A CD  1 
ATOM   545  O OE1 . GLN A 1 71  ? 10.106  26.063 14.763 1.00 23.88 ? 71  GLN A OE1 1 
ATOM   546  N NE2 . GLN A 1 71  ? 9.183   25.782 16.794 1.00 23.10 ? 71  GLN A NE2 1 
ATOM   547  N N   . ASP A 1 72  ? 14.471  29.668 14.848 1.00 19.83 ? 72  ASP A N   1 
ATOM   548  C CA  . ASP A 1 72  ? 15.323  30.193 13.797 1.00 19.72 ? 72  ASP A CA  1 
ATOM   549  C C   . ASP A 1 72  ? 16.765  30.265 14.250 1.00 20.61 ? 72  ASP A C   1 
ATOM   550  O O   . ASP A 1 72  ? 17.678  29.976 13.477 1.00 21.95 ? 72  ASP A O   1 
ATOM   551  C CB  . ASP A 1 72  ? 14.849  31.576 13.357 1.00 19.99 ? 72  ASP A CB  1 
ATOM   552  C CG  . ASP A 1 72  ? 13.500  31.532 12.666 1.00 21.45 ? 72  ASP A CG  1 
ATOM   553  O OD1 . ASP A 1 72  ? 13.172  30.469 12.084 1.00 19.83 ? 72  ASP A OD1 1 
ATOM   554  O OD2 . ASP A 1 72  ? 12.778  32.558 12.692 1.00 19.73 ? 72  ASP A OD2 1 
ATOM   555  N N   . MET A 1 73  ? 16.977  30.649 15.503 1.00 19.57 ? 73  MET A N   1 
ATOM   556  C CA  . MET A 1 73  ? 18.331  30.732 16.023 1.00 19.48 ? 73  MET A CA  1 
ATOM   557  C C   . MET A 1 73  ? 18.967  29.346 16.049 1.00 19.73 ? 73  MET A C   1 
ATOM   558  O O   . MET A 1 73  ? 20.066  29.144 15.536 1.00 20.22 ? 73  MET A O   1 
ATOM   559  C CB  . MET A 1 73  ? 18.332  31.309 17.435 1.00 19.80 ? 73  MET A CB  1 
ATOM   560  C CG  . MET A 1 73  ? 19.714  31.368 18.068 1.00 19.22 ? 73  MET A CG  1 
ATOM   561  S SD  . MET A 1 73  ? 19.644  31.805 19.816 1.00 20.07 ? 73  MET A SD  1 
ATOM   562  C CE  . MET A 1 73  ? 19.303  30.197 20.522 1.00 19.00 ? 73  MET A CE  1 
ATOM   563  N N   . VAL A 1 74  ? 18.270  28.387 16.644 1.00 18.78 ? 74  VAL A N   1 
ATOM   564  C CA  . VAL A 1 74  ? 18.803  27.040 16.731 1.00 17.96 ? 74  VAL A CA  1 
ATOM   565  C C   . VAL A 1 74  ? 19.040  26.475 15.342 1.00 18.92 ? 74  VAL A C   1 
ATOM   566  O O   . VAL A 1 74  ? 20.095  25.909 15.071 1.00 17.91 ? 74  VAL A O   1 
ATOM   567  C CB  . VAL A 1 74  ? 17.858  26.109 17.512 1.00 17.35 ? 74  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 74  ? 18.448  24.710 17.573 1.00 17.54 ? 74  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 74  ? 17.652  26.643 18.921 1.00 17.96 ? 74  VAL A CG2 1 
ATOM   570  N N   . ASP A 1 75  ? 18.060  26.638 14.457 1.00 20.61 ? 75  ASP A N   1 
ATOM   571  C CA  . ASP A 1 75  ? 18.194  26.134 13.096 1.00 20.93 ? 75  ASP A CA  1 
ATOM   572  C C   . ASP A 1 75  ? 19.398  26.753 12.401 1.00 21.44 ? 75  ASP A C   1 
ATOM   573  O O   . ASP A 1 75  ? 20.106  26.076 11.652 1.00 22.42 ? 75  ASP A O   1 
ATOM   574  C CB  . ASP A 1 75  ? 16.926  26.412 12.289 1.00 20.44 ? 75  ASP A CB  1 
ATOM   575  C CG  . ASP A 1 75  ? 15.830  25.388 12.549 1.00 21.69 ? 75  ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 75  ? 16.137  24.281 13.044 1.00 19.90 ? 75  ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 75  ? 14.657  25.684 12.236 1.00 21.61 ? 75  ASP A OD2 1 
ATOM   578  N N   . GLY A 1 76  ? 19.627  28.038 12.658 1.00 21.99 ? 76  GLY A N   1 
ATOM   579  C CA  . GLY A 1 76  ? 20.755  28.726 12.055 1.00 21.35 ? 76  GLY A CA  1 
ATOM   580  C C   . GLY A 1 76  ? 22.056  28.041 12.422 1.00 21.98 ? 76  GLY A C   1 
ATOM   581  O O   . GLY A 1 76  ? 22.886  27.748 11.556 1.00 22.49 ? 76  GLY A O   1 
ATOM   582  N N   . PHE A 1 77  ? 22.231  27.778 13.712 1.00 21.11 ? 77  PHE A N   1 
ATOM   583  C CA  . PHE A 1 77  ? 23.432  27.117 14.196 1.00 20.01 ? 77  PHE A CA  1 
ATOM   584  C C   . PHE A 1 77  ? 23.529  25.709 13.611 1.00 20.59 ? 77  PHE A C   1 
ATOM   585  O O   . PHE A 1 77  ? 24.609  25.262 13.218 1.00 21.00 ? 77  PHE A O   1 
ATOM   586  C CB  . PHE A 1 77  ? 23.417  27.021 15.727 1.00 18.64 ? 77  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 23.466  28.350 16.433 1.00 18.91 ? 77  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 24.347  29.350 16.016 1.00 15.99 ? 77  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 22.671  28.582 17.561 1.00 18.24 ? 77  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 24.439  30.564 16.713 1.00 15.69 ? 77  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 22.754  29.792 18.267 1.00 16.15 ? 77  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 23.642  30.785 17.842 1.00 16.63 ? 77  PHE A CZ  1 
ATOM   593  N N   . GLN A 1 78  ? 22.395  25.012 13.561 1.00 20.51 ? 78  GLN A N   1 
ATOM   594  C CA  . GLN A 1 78  ? 22.358  23.648 13.048 1.00 20.90 ? 78  GLN A CA  1 
ATOM   595  C C   . GLN A 1 78  ? 22.787  23.565 11.585 1.00 22.57 ? 78  GLN A C   1 
ATOM   596  O O   . GLN A 1 78  ? 23.529  22.659 11.209 1.00 22.77 ? 78  GLN A O   1 
ATOM   597  C CB  . GLN A 1 78  ? 20.959  23.058 13.205 1.00 19.14 ? 78  GLN A CB  1 
ATOM   598  C CG  . GLN A 1 78  ? 20.874  21.561 12.937 1.00 19.82 ? 78  GLN A CG  1 
ATOM   599  C CD  . GLN A 1 78  ? 21.614  20.731 13.980 1.00 21.75 ? 78  GLN A CD  1 
ATOM   600  O OE1 . GLN A 1 78  ? 22.844  20.674 13.991 1.00 22.74 ? 78  GLN A OE1 1 
ATOM   601  N NE2 . GLN A 1 78  ? 20.861  20.088 14.869 1.00 20.19 ? 78  GLN A NE2 1 
ATOM   602  N N   . LYS A 1 79  ? 22.329  24.503 10.759 1.00 23.03 ? 79  LYS A N   1 
ATOM   603  C CA  . LYS A 1 79  ? 22.702  24.480 9.351  1.00 25.36 ? 79  LYS A CA  1 
ATOM   604  C C   . LYS A 1 79  ? 24.207  24.552 9.175  1.00 23.33 ? 79  LYS A C   1 
ATOM   605  O O   . LYS A 1 79  ? 24.773  23.875 8.312  1.00 22.51 ? 79  LYS A O   1 
ATOM   606  C CB  . LYS A 1 79  ? 22.018  25.616 8.584  1.00 28.79 ? 79  LYS A CB  1 
ATOM   607  C CG  . LYS A 1 79  ? 20.581  25.281 8.220  1.00 35.92 ? 79  LYS A CG  1 
ATOM   608  C CD  . LYS A 1 79  ? 19.951  26.287 7.270  1.00 40.60 ? 79  LYS A CD  1 
ATOM   609  C CE  . LYS A 1 79  ? 18.537  25.839 6.893  1.00 43.95 ? 79  LYS A CE  1 
ATOM   610  N NZ  . LYS A 1 79  ? 17.915  26.714 5.858  1.00 46.97 ? 79  LYS A NZ  1 
ATOM   611  N N   . ALA A 1 80  ? 24.853  25.368 9.999  1.00 22.31 ? 80  ALA A N   1 
ATOM   612  C CA  . ALA A 1 80  ? 26.299  25.508 9.939  1.00 22.59 ? 80  ALA A CA  1 
ATOM   613  C C   . ALA A 1 80  ? 26.941  24.143 10.215 1.00 23.59 ? 80  ALA A C   1 
ATOM   614  O O   . ALA A 1 80  ? 27.787  23.673 9.450  1.00 23.26 ? 80  ALA A O   1 
ATOM   615  C CB  . ALA A 1 80  ? 26.770  26.539 10.965 1.00 20.38 ? 80  ALA A CB  1 
ATOM   616  N N   . CYS A 1 81  ? 26.519  23.504 11.302 1.00 23.55 ? 81  CYS A N   1 
ATOM   617  C CA  . CYS A 1 81  ? 27.053  22.202 11.671 1.00 23.23 ? 81  CYS A CA  1 
ATOM   618  C C   . CYS A 1 81  ? 26.735  21.146 10.625 1.00 23.76 ? 81  CYS A C   1 
ATOM   619  O O   . CYS A 1 81  ? 27.557  20.273 10.342 1.00 25.49 ? 81  CYS A O   1 
ATOM   620  C CB  . CYS A 1 81  ? 26.492  21.765 13.022 1.00 21.82 ? 81  CYS A CB  1 
ATOM   621  S SG  . CYS A 1 81  ? 26.936  22.859 14.372 1.00 22.46 ? 81  CYS A SG  1 
ATOM   622  N N   . MET A 1 82  ? 25.543  21.215 10.050 1.00 23.49 ? 82  MET A N   1 
ATOM   623  C CA  . MET A 1 82  ? 25.172  20.233 9.048  1.00 24.50 ? 82  MET A CA  1 
ATOM   624  C C   . MET A 1 82  ? 26.029  20.390 7.812  1.00 24.26 ? 82  MET A C   1 
ATOM   625  O O   . MET A 1 82  ? 26.138  19.462 7.018  1.00 24.29 ? 82  MET A O   1 
ATOM   626  C CB  . MET A 1 82  ? 23.692  20.359 8.668  1.00 25.86 ? 82  MET A CB  1 
ATOM   627  C CG  . MET A 1 82  ? 22.736  19.909 9.754  1.00 27.43 ? 82  MET A CG  1 
ATOM   628  S SD  . MET A 1 82  ? 23.169  18.275 10.384 1.00 32.94 ? 82  MET A SD  1 
ATOM   629  C CE  . MET A 1 82  ? 22.434  17.243 9.146  1.00 28.93 ? 82  MET A CE  1 
ATOM   630  N N   . SER A 1 83  ? 26.652  21.554 7.652  1.00 23.80 ? 83  SER A N   1 
ATOM   631  C CA  . SER A 1 83  ? 27.481  21.785 6.474  1.00 23.34 ? 83  SER A CA  1 
ATOM   632  C C   . SER A 1 83  ? 28.910  21.238 6.578  1.00 22.90 ? 83  SER A C   1 
ATOM   633  O O   . SER A 1 83  ? 29.691  21.380 5.643  1.00 25.08 ? 83  SER A O   1 
ATOM   634  C CB  . SER A 1 83  ? 27.512  23.282 6.112  1.00 20.94 ? 83  SER A CB  1 
ATOM   635  O OG  . SER A 1 83  ? 28.308  24.039 7.009  1.00 22.18 ? 83  SER A OG  1 
ATOM   636  N N   . THR A 1 84  ? 29.261  20.611 7.694  1.00 21.36 ? 84  THR A N   1 
ATOM   637  C CA  . THR A 1 84  ? 30.606  20.057 7.821  1.00 20.58 ? 84  THR A CA  1 
ATOM   638  C C   . THR A 1 84  ? 30.736  18.817 6.933  1.00 21.40 ? 84  THR A C   1 
ATOM   639  O O   . THR A 1 84  ? 29.738  18.281 6.442  1.00 21.57 ? 84  THR A O   1 
ATOM   640  C CB  . THR A 1 84  ? 30.925  19.655 9.268  1.00 19.20 ? 84  THR A CB  1 
ATOM   641  O OG1 . THR A 1 84  ? 29.932  18.736 9.737  1.00 19.23 ? 84  THR A OG1 1 
ATOM   642  C CG2 . THR A 1 84  ? 30.947  20.875 10.165 1.00 18.05 ? 84  THR A CG2 1 
ATOM   643  N N   . ARG A 1 85  ? 31.972  18.369 6.733  1.00 21.68 ? 85  ARG A N   1 
ATOM   644  C CA  . ARG A 1 85  ? 32.266  17.202 5.906  1.00 22.33 ? 85  ARG A CA  1 
ATOM   645  C C   . ARG A 1 85  ? 31.418  15.985 6.270  1.00 24.10 ? 85  ARG A C   1 
ATOM   646  O O   . ARG A 1 85  ? 30.936  15.266 5.387  1.00 26.43 ? 85  ARG A O   1 
ATOM   647  C CB  . ARG A 1 85  ? 33.749  16.836 6.027  1.00 21.71 ? 85  ARG A CB  1 
ATOM   648  C CG  . ARG A 1 85  ? 34.179  15.693 5.129  1.00 20.81 ? 85  ARG A CG  1 
ATOM   649  C CD  . ARG A 1 85  ? 35.605  15.293 5.414  1.00 22.29 ? 85  ARG A CD  1 
ATOM   650  N NE  . ARG A 1 85  ? 35.739  14.654 6.719  1.00 23.18 ? 85  ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 85  ? 36.031  13.367 6.891  1.00 24.39 ? 85  ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 85  ? 36.227  12.578 5.843  1.00 23.44 ? 85  ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 85  ? 36.121  12.864 8.113  1.00 25.16 ? 85  ARG A NH2 1 
ATOM   654  N N   . LEU A 1 86  ? 31.249  15.745 7.567  1.00 23.88 ? 86  LEU A N   1 
ATOM   655  C CA  . LEU A 1 86  ? 30.460  14.609 8.029  1.00 23.27 ? 86  LEU A CA  1 
ATOM   656  C C   . LEU A 1 86  ? 29.005  14.981 8.330  1.00 23.03 ? 86  LEU A C   1 
ATOM   657  O O   . LEU A 1 86  ? 28.142  14.107 8.441  1.00 21.52 ? 86  LEU A O   1 
ATOM   658  C CB  . LEU A 1 86  ? 31.124  13.991 9.262  1.00 21.01 ? 86  LEU A CB  1 
ATOM   659  C CG  . LEU A 1 86  ? 32.512  13.421 8.949  1.00 21.14 ? 86  LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 86  ? 33.177  12.900 10.208 1.00 17.91 ? 86  LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 86  ? 32.368  12.309 7.920  1.00 18.34 ? 86  LEU A CD2 1 
ATOM   662  N N   . GLY A 1 87  ? 28.741  16.281 8.446  1.00 23.19 ? 87  GLY A N   1 
ATOM   663  C CA  . GLY A 1 87  ? 27.394  16.755 8.727  1.00 23.62 ? 87  GLY A CA  1 
ATOM   664  C C   . GLY A 1 87  ? 26.778  16.211 10.008 1.00 24.17 ? 87  GLY A C   1 
ATOM   665  O O   . GLY A 1 87  ? 25.646  15.705 10.001 1.00 25.47 ? 87  GLY A O   1 
ATOM   666  N N   . ILE A 1 88  ? 27.522  16.312 11.108 1.00 23.70 ? 88  ILE A N   1 
ATOM   667  C CA  . ILE A 1 88  ? 27.054  15.840 12.405 1.00 22.88 ? 88  ILE A CA  1 
ATOM   668  C C   . ILE A 1 88  ? 26.250  16.954 13.059 1.00 22.67 ? 88  ILE A C   1 
ATOM   669  O O   . ILE A 1 88  ? 26.794  18.007 13.389 1.00 22.62 ? 88  ILE A O   1 
ATOM   670  C CB  . ILE A 1 88  ? 28.231  15.475 13.340 1.00 23.64 ? 88  ILE A CB  1 
ATOM   671  C CG1 . ILE A 1 88  ? 29.099  14.395 12.692 1.00 21.55 ? 88  ILE A CG1 1 
ATOM   672  C CG2 . ILE A 1 88  ? 27.692  14.995 14.687 1.00 21.62 ? 88  ILE A CG2 1 
ATOM   673  C CD1 . ILE A 1 88  ? 30.286  13.981 13.530 1.00 20.20 ? 88  ILE A CD1 1 
ATOM   674  N N   . PRO A 1 89  ? 24.940  16.736 13.255 1.00 22.00 ? 89  PRO A N   1 
ATOM   675  C CA  . PRO A 1 89  ? 24.102  17.763 13.875 1.00 20.44 ? 89  PRO A CA  1 
ATOM   676  C C   . PRO A 1 89  ? 24.519  18.035 15.309 1.00 19.71 ? 89  PRO A C   1 
ATOM   677  O O   . PRO A 1 89  ? 24.952  17.132 16.026 1.00 19.62 ? 89  PRO A O   1 
ATOM   678  C CB  . PRO A 1 89  ? 22.701  17.171 13.772 1.00 20.55 ? 89  PRO A CB  1 
ATOM   679  C CG  . PRO A 1 89  ? 22.958  15.703 13.893 1.00 21.10 ? 89  PRO A CG  1 
ATOM   680  C CD  . PRO A 1 89  ? 24.170  15.503 13.010 1.00 21.65 ? 89  PRO A CD  1 
ATOM   681  N N   . MET A 1 90  ? 24.393  19.290 15.713 1.00 17.05 ? 90  MET A N   1 
ATOM   682  C CA  . MET A 1 90  ? 24.748  19.689 17.057 1.00 17.84 ? 90  MET A CA  1 
ATOM   683  C C   . MET A 1 90  ? 23.532  19.547 17.966 1.00 18.96 ? 90  MET A C   1 
ATOM   684  O O   . MET A 1 90  ? 22.390  19.616 17.504 1.00 21.39 ? 90  MET A O   1 
ATOM   685  C CB  . MET A 1 90  ? 25.230  21.141 17.053 1.00 17.72 ? 90  MET A CB  1 
ATOM   686  C CG  . MET A 1 90  ? 24.159  22.187 16.711 1.00 17.51 ? 90  MET A CG  1 
ATOM   687  S SD  . MET A 1 90  ? 23.003  22.551 18.067 1.00 16.91 ? 90  MET A SD  1 
ATOM   688  C CE  . MET A 1 90  ? 21.417  22.485 17.223 1.00 17.50 ? 90  MET A CE  1 
ATOM   689  N N   . ILE A 1 91  ? 23.776  19.346 19.255 1.00 17.65 ? 91  ILE A N   1 
ATOM   690  C CA  . ILE A 1 91  ? 22.691  19.219 20.217 1.00 16.16 ? 91  ILE A CA  1 
ATOM   691  C C   . ILE A 1 91  ? 22.726  20.483 21.073 1.00 16.83 ? 91  ILE A C   1 
ATOM   692  O O   . ILE A 1 91  ? 23.745  20.787 21.694 1.00 16.81 ? 91  ILE A O   1 
ATOM   693  C CB  . ILE A 1 91  ? 22.879  17.952 21.093 1.00 15.77 ? 91  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 91  ? 21.678  17.780 22.020 1.00 14.53 ? 91  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 91  ? 24.180  18.038 21.891 1.00 12.79 ? 91  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 91  ? 21.708  16.480 22.800 1.00 13.57 ? 91  ILE A CD1 1 
ATOM   697  N N   . TYR A 1 92  ? 21.622  21.228 21.079 1.00 16.40 ? 92  TYR A N   1 
ATOM   698  C CA  . TYR A 1 92  ? 21.532  22.484 21.835 1.00 16.77 ? 92  TYR A CA  1 
ATOM   699  C C   . TYR A 1 92  ? 20.948  22.228 23.217 1.00 16.59 ? 92  TYR A C   1 
ATOM   700  O O   . TYR A 1 92  ? 19.854  21.687 23.334 1.00 17.08 ? 92  TYR A O   1 
ATOM   701  C CB  . TYR A 1 92  ? 20.642  23.479 21.074 1.00 17.60 ? 92  TYR A CB  1 
ATOM   702  C CG  . TYR A 1 92  ? 20.788  24.936 21.483 1.00 17.09 ? 92  TYR A CG  1 
ATOM   703  C CD1 . TYR A 1 92  ? 20.355  25.390 22.727 1.00 16.49 ? 92  TYR A CD1 1 
ATOM   704  C CD2 . TYR A 1 92  ? 21.378  25.859 20.621 1.00 17.24 ? 92  TYR A CD2 1 
ATOM   705  C CE1 . TYR A 1 92  ? 20.512  26.729 23.104 1.00 15.56 ? 92  TYR A CE1 1 
ATOM   706  C CE2 . TYR A 1 92  ? 21.539  27.198 20.990 1.00 16.79 ? 92  TYR A CE2 1 
ATOM   707  C CZ  . TYR A 1 92  ? 21.109  27.625 22.229 1.00 16.12 ? 92  TYR A CZ  1 
ATOM   708  O OH  . TYR A 1 92  ? 21.301  28.942 22.589 1.00 16.76 ? 92  TYR A OH  1 
ATOM   709  N N   . GLY A 1 93  ? 21.674  22.620 24.259 1.00 15.27 ? 93  GLY A N   1 
ATOM   710  C CA  . GLY A 1 93  ? 21.197  22.412 25.612 1.00 14.08 ? 93  GLY A CA  1 
ATOM   711  C C   . GLY A 1 93  ? 20.764  23.696 26.292 1.00 15.18 ? 93  GLY A C   1 
ATOM   712  O O   . GLY A 1 93  ? 21.202  24.784 25.922 1.00 14.56 ? 93  GLY A O   1 
ATOM   713  N N   . ILE A 1 94  ? 19.896  23.573 27.291 1.00 15.42 ? 94  ILE A N   1 
ATOM   714  C CA  . ILE A 1 94  ? 19.411  24.733 28.022 1.00 15.71 ? 94  ILE A CA  1 
ATOM   715  C C   . ILE A 1 94  ? 18.880  24.320 29.386 1.00 16.60 ? 94  ILE A C   1 
ATOM   716  O O   . ILE A 1 94  ? 18.544  23.157 29.611 1.00 16.05 ? 94  ILE A O   1 
ATOM   717  C CB  . ILE A 1 94  ? 18.285  25.459 27.240 1.00 15.79 ? 94  ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 94  ? 17.904  26.768 27.948 1.00 17.86 ? 94  ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 94  ? 17.072  24.557 27.122 1.00 14.47 ? 94  ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 94  ? 17.227  27.799 27.045 1.00 16.14 ? 94  ILE A CD1 1 
ATOM   721  N N   . ASP A 1 95  ? 18.810  25.280 30.299 1.00 17.29 ? 95  ASP A N   1 
ATOM   722  C CA  . ASP A 1 95  ? 18.304  25.006 31.631 1.00 17.76 ? 95  ASP A CA  1 
ATOM   723  C C   . ASP A 1 95  ? 16.790  25.140 31.744 1.00 17.68 ? 95  ASP A C   1 
ATOM   724  O O   . ASP A 1 95  ? 16.272  26.181 32.151 1.00 16.70 ? 95  ASP A O   1 
ATOM   725  C CB  . ASP A 1 95  ? 18.961  25.929 32.651 1.00 18.13 ? 95  ASP A CB  1 
ATOM   726  C CG  . ASP A 1 95  ? 20.382  25.537 32.949 1.00 19.96 ? 95  ASP A CG  1 
ATOM   727  O OD1 . ASP A 1 95  ? 20.589  24.437 33.498 1.00 21.51 ? 95  ASP A OD1 1 
ATOM   728  O OD2 . ASP A 1 95  ? 21.292  26.327 32.633 1.00 21.65 ? 95  ASP A OD2 1 
ATOM   729  N N   . ALA A 1 96  ? 16.080  24.093 31.352 1.00 16.15 ? 96  ALA A N   1 
ATOM   730  C CA  . ALA A 1 96  ? 14.636  24.089 31.485 1.00 17.29 ? 96  ALA A CA  1 
ATOM   731  C C   . ALA A 1 96  ? 14.452  23.255 32.763 1.00 18.42 ? 96  ALA A C   1 
ATOM   732  O O   . ALA A 1 96  ? 14.226  22.041 32.714 1.00 19.17 ? 96  ALA A O   1 
ATOM   733  C CB  . ALA A 1 96  ? 13.994  23.416 30.282 1.00 14.50 ? 96  ALA A CB  1 
ATOM   734  N N   . VAL A 1 97  ? 14.586  23.921 33.907 1.00 18.46 ? 97  VAL A N   1 
ATOM   735  C CA  . VAL A 1 97  ? 14.492  23.263 35.202 1.00 18.70 ? 97  VAL A CA  1 
ATOM   736  C C   . VAL A 1 97  ? 13.141  23.360 35.913 1.00 19.27 ? 97  VAL A C   1 
ATOM   737  O O   . VAL A 1 97  ? 12.924  22.694 36.921 1.00 19.86 ? 97  VAL A O   1 
ATOM   738  C CB  . VAL A 1 97  ? 15.615  23.759 36.131 1.00 17.98 ? 97  VAL A CB  1 
ATOM   739  C CG1 . VAL A 1 97  ? 16.954  23.350 35.554 1.00 14.28 ? 97  VAL A CG1 1 
ATOM   740  C CG2 . VAL A 1 97  ? 15.546  25.266 36.286 1.00 16.66 ? 97  VAL A CG2 1 
ATOM   741  N N   . HIS A 1 98  ? 12.254  24.211 35.409 1.00 18.41 ? 98  HIS A N   1 
ATOM   742  C CA  . HIS A 1 98  ? 10.894  24.325 35.939 1.00 18.50 ? 98  HIS A CA  1 
ATOM   743  C C   . HIS A 1 98  ? 10.078  24.993 34.839 1.00 18.19 ? 98  HIS A C   1 
ATOM   744  O O   . HIS A 1 98  ? 9.398   25.997 35.036 1.00 17.15 ? 98  HIS A O   1 
ATOM   745  C CB  . HIS A 1 98  ? 10.830  25.079 37.292 1.00 18.21 ? 98  HIS A CB  1 
ATOM   746  C CG  . HIS A 1 98  ? 11.155  26.543 37.231 1.00 19.47 ? 98  HIS A CG  1 
ATOM   747  N ND1 . HIS A 1 98  ? 10.592  27.457 38.099 1.00 16.27 ? 98  HIS A ND1 1 
ATOM   748  C CD2 . HIS A 1 98  ? 12.023  27.242 36.462 1.00 18.84 ? 98  HIS A CD2 1 
ATOM   749  C CE1 . HIS A 1 98  ? 11.098  28.653 37.867 1.00 14.77 ? 98  HIS A CE1 1 
ATOM   750  N NE2 . HIS A 1 98  ? 11.969  28.551 36.880 1.00 17.93 ? 98  HIS A NE2 1 
ATOM   751  N N   . GLY A 1 99  ? 10.168  24.369 33.666 1.00 18.83 ? 99  GLY A N   1 
ATOM   752  C CA  . GLY A 1 99  ? 9.522   24.843 32.458 1.00 17.44 ? 99  GLY A CA  1 
ATOM   753  C C   . GLY A 1 99  ? 10.662  25.293 31.553 1.00 17.19 ? 99  GLY A C   1 
ATOM   754  O O   . GLY A 1 99  ? 11.832  25.090 31.889 1.00 17.57 ? 99  GLY A O   1 
ATOM   755  N N   . GLN A 1 100 ? 10.343  25.868 30.400 1.00 15.89 ? 100 GLN A N   1 
ATOM   756  C CA  . GLN A 1 100 ? 11.372  26.375 29.495 1.00 15.90 ? 100 GLN A CA  1 
ATOM   757  C C   . GLN A 1 100 ? 11.571  27.804 30.023 1.00 16.25 ? 100 GLN A C   1 
ATOM   758  O O   . GLN A 1 100 ? 11.335  28.791 29.330 1.00 16.46 ? 100 GLN A O   1 
ATOM   759  C CB  . GLN A 1 100 ? 10.844  26.359 28.052 1.00 14.54 ? 100 GLN A CB  1 
ATOM   760  C CG  . GLN A 1 100 ? 11.747  27.024 27.013 1.00 16.34 ? 100 GLN A CG  1 
ATOM   761  C CD  . GLN A 1 100 ? 13.113  26.368 26.870 1.00 16.79 ? 100 GLN A CD  1 
ATOM   762  O OE1 . GLN A 1 100 ? 13.821  26.147 27.859 1.00 14.54 ? 100 GLN A OE1 1 
ATOM   763  N NE2 . GLN A 1 100 ? 13.494  26.067 25.633 1.00 15.20 ? 100 GLN A NE2 1 
ATOM   764  N N   . ASN A 1 101 ? 12.007  27.878 31.278 1.00 15.85 ? 101 ASN A N   1 
ATOM   765  C CA  . ASN A 1 101 ? 12.187  29.127 32.012 1.00 17.89 ? 101 ASN A CA  1 
ATOM   766  C C   . ASN A 1 101 ? 13.011  30.290 31.460 1.00 18.70 ? 101 ASN A C   1 
ATOM   767  O O   . ASN A 1 101 ? 12.832  31.424 31.912 1.00 19.69 ? 101 ASN A O   1 
ATOM   768  C CB  . ASN A 1 101 ? 12.651  28.810 33.440 1.00 17.28 ? 101 ASN A CB  1 
ATOM   769  C CG  . ASN A 1 101 ? 13.916  27.972 33.480 1.00 17.15 ? 101 ASN A CG  1 
ATOM   770  O OD1 . ASN A 1 101 ? 15.014  28.473 33.246 1.00 17.15 ? 101 ASN A OD1 1 
ATOM   771  N ND2 . ASN A 1 101 ? 13.764  26.684 33.779 1.00 16.21 ? 101 ASN A ND2 1 
ATOM   772  N N   . ASN A 1 102 ? 13.914  30.045 30.518 1.00 18.62 ? 102 ASN A N   1 
ATOM   773  C CA  . ASN A 1 102 ? 14.691  31.152 29.958 1.00 18.86 ? 102 ASN A CA  1 
ATOM   774  C C   . ASN A 1 102 ? 13.822  31.899 28.943 1.00 19.67 ? 102 ASN A C   1 
ATOM   775  O O   . ASN A 1 102 ? 13.982  33.098 28.732 1.00 19.05 ? 102 ASN A O   1 
ATOM   776  C CB  . ASN A 1 102 ? 15.950  30.634 29.249 1.00 18.70 ? 102 ASN A CB  1 
ATOM   777  C CG  . ASN A 1 102 ? 17.112  30.399 30.197 1.00 19.86 ? 102 ASN A CG  1 
ATOM   778  O OD1 . ASN A 1 102 ? 17.766  29.357 30.138 1.00 19.70 ? 102 ASN A OD1 1 
ATOM   779  N ND2 . ASN A 1 102 ? 17.388  31.374 31.061 1.00 17.76 ? 102 ASN A ND2 1 
ATOM   780  N N   . VAL A 1 103 ? 12.894  31.164 28.333 1.00 20.24 ? 103 VAL A N   1 
ATOM   781  C CA  . VAL A 1 103 ? 12.000  31.674 27.299 1.00 19.47 ? 103 VAL A CA  1 
ATOM   782  C C   . VAL A 1 103 ? 10.799  32.482 27.778 1.00 20.29 ? 103 VAL A C   1 
ATOM   783  O O   . VAL A 1 103 ? 10.062  32.068 28.676 1.00 21.16 ? 103 VAL A O   1 
ATOM   784  C CB  . VAL A 1 103 ? 11.486  30.508 26.420 1.00 18.52 ? 103 VAL A CB  1 
ATOM   785  C CG1 . VAL A 1 103 ? 10.470  31.009 25.410 1.00 15.93 ? 103 VAL A CG1 1 
ATOM   786  C CG2 . VAL A 1 103 ? 12.661  29.845 25.715 1.00 17.53 ? 103 VAL A CG2 1 
ATOM   787  N N   . TYR A 1 104 ? 10.611  33.638 27.148 1.00 20.20 ? 104 TYR A N   1 
ATOM   788  C CA  . TYR A 1 104 ? 9.505   34.530 27.459 1.00 19.86 ? 104 TYR A CA  1 
ATOM   789  C C   . TYR A 1 104 ? 8.194   33.870 27.060 1.00 19.37 ? 104 TYR A C   1 
ATOM   790  O O   . TYR A 1 104 ? 8.056   33.364 25.950 1.00 19.04 ? 104 TYR A O   1 
ATOM   791  C CB  . TYR A 1 104 ? 9.641   35.840 26.685 1.00 21.87 ? 104 TYR A CB  1 
ATOM   792  C CG  . TYR A 1 104 ? 8.458   36.752 26.887 1.00 24.06 ? 104 TYR A CG  1 
ATOM   793  C CD1 . TYR A 1 104 ? 8.400   37.610 27.984 1.00 24.71 ? 104 TYR A CD1 1 
ATOM   794  C CD2 . TYR A 1 104 ? 7.360   36.699 26.028 1.00 23.79 ? 104 TYR A CD2 1 
ATOM   795  C CE1 . TYR A 1 104 ? 7.278   38.390 28.227 1.00 24.20 ? 104 TYR A CE1 1 
ATOM   796  C CE2 . TYR A 1 104 ? 6.232   37.470 26.265 1.00 24.41 ? 104 TYR A CE2 1 
ATOM   797  C CZ  . TYR A 1 104 ? 6.198   38.311 27.367 1.00 25.48 ? 104 TYR A CZ  1 
ATOM   798  O OH  . TYR A 1 104 ? 5.074   39.056 27.633 1.00 28.97 ? 104 TYR A OH  1 
ATOM   799  N N   . GLY A 1 105 ? 7.229   33.890 27.968 1.00 19.40 ? 105 GLY A N   1 
ATOM   800  C CA  . GLY A 1 105 ? 5.942   33.295 27.678 1.00 17.16 ? 105 GLY A CA  1 
ATOM   801  C C   . GLY A 1 105 ? 5.855   31.812 27.972 1.00 16.97 ? 105 GLY A C   1 
ATOM   802  O O   . GLY A 1 105 ? 4.787   31.222 27.818 1.00 17.75 ? 105 GLY A O   1 
ATOM   803  N N   . ALA A 1 106 ? 6.957   31.196 28.387 1.00 15.37 ? 106 ALA A N   1 
ATOM   804  C CA  . ALA A 1 106 ? 6.925   29.767 28.689 1.00 15.55 ? 106 ALA A CA  1 
ATOM   805  C C   . ALA A 1 106 ? 6.234   29.529 30.022 1.00 15.04 ? 106 ALA A C   1 
ATOM   806  O O   . ALA A 1 106 ? 6.336   30.348 30.936 1.00 15.69 ? 106 ALA A O   1 
ATOM   807  C CB  . ALA A 1 106 ? 8.340   29.197 28.736 1.00 15.49 ? 106 ALA A CB  1 
ATOM   808  N N   . THR A 1 107 ? 5.529   28.409 30.130 1.00 14.35 ? 107 THR A N   1 
ATOM   809  C CA  . THR A 1 107 ? 4.843   28.062 31.365 1.00 15.44 ? 107 THR A CA  1 
ATOM   810  C C   . THR A 1 107 ? 5.869   27.859 32.475 1.00 15.87 ? 107 THR A C   1 
ATOM   811  O O   . THR A 1 107 ? 6.770   27.031 32.333 1.00 16.44 ? 107 THR A O   1 
ATOM   812  C CB  . THR A 1 107 ? 4.067   26.754 31.212 1.00 15.22 ? 107 THR A CB  1 
ATOM   813  O OG1 . THR A 1 107 ? 3.122   26.885 30.148 1.00 16.92 ? 107 THR A OG1 1 
ATOM   814  C CG2 . THR A 1 107 ? 3.331   26.419 32.504 1.00 15.23 ? 107 THR A CG2 1 
ATOM   815  N N   . ILE A 1 108 ? 5.744   28.604 33.575 1.00 15.85 ? 108 ILE A N   1 
ATOM   816  C CA  . ILE A 1 108 ? 6.688   28.449 34.683 1.00 16.10 ? 108 ILE A CA  1 
ATOM   817  C C   . ILE A 1 108 ? 6.068   27.599 35.788 1.00 17.34 ? 108 ILE A C   1 
ATOM   818  O O   . ILE A 1 108 ? 5.126   28.021 36.460 1.00 17.64 ? 108 ILE A O   1 
ATOM   819  C CB  . ILE A 1 108 ? 7.119   29.805 35.291 1.00 14.39 ? 108 ILE A CB  1 
ATOM   820  C CG1 . ILE A 1 108 ? 7.616   30.755 34.195 1.00 15.90 ? 108 ILE A CG1 1 
ATOM   821  C CG2 . ILE A 1 108 ? 8.229   29.578 36.308 1.00 12.04 ? 108 ILE A CG2 1 
ATOM   822  C CD1 . ILE A 1 108 ? 8.799   30.232 33.393 1.00 13.68 ? 108 ILE A CD1 1 
ATOM   823  N N   . PHE A 1 109 ? 6.608   26.396 35.964 1.00 17.47 ? 109 PHE A N   1 
ATOM   824  C CA  . PHE A 1 109 ? 6.136   25.454 36.973 1.00 17.68 ? 109 PHE A CA  1 
ATOM   825  C C   . PHE A 1 109 ? 6.820   25.706 38.317 1.00 18.35 ? 109 PHE A C   1 
ATOM   826  O O   . PHE A 1 109 ? 7.852   26.379 38.388 1.00 17.96 ? 109 PHE A O   1 
ATOM   827  C CB  . PHE A 1 109 ? 6.445   24.021 36.524 1.00 18.29 ? 109 PHE A CB  1 
ATOM   828  C CG  . PHE A 1 109 ? 5.744   23.610 35.257 1.00 19.50 ? 109 PHE A CG  1 
ATOM   829  C CD1 . PHE A 1 109 ? 4.492   23.002 35.304 1.00 18.36 ? 109 PHE A CD1 1 
ATOM   830  C CD2 . PHE A 1 109 ? 6.333   23.842 34.014 1.00 19.85 ? 109 PHE A CD2 1 
ATOM   831  C CE1 . PHE A 1 109 ? 3.834   22.631 34.138 1.00 20.27 ? 109 PHE A CE1 1 
ATOM   832  C CE2 . PHE A 1 109 ? 5.684   23.475 32.840 1.00 20.28 ? 109 PHE A CE2 1 
ATOM   833  C CZ  . PHE A 1 109 ? 4.430   22.868 32.903 1.00 20.90 ? 109 PHE A CZ  1 
ATOM   834  N N   . PRO A 1 110 ? 6.249   25.164 39.407 1.00 18.14 ? 110 PRO A N   1 
ATOM   835  C CA  . PRO A 1 110 ? 6.833   25.339 40.742 1.00 17.16 ? 110 PRO A CA  1 
ATOM   836  C C   . PRO A 1 110 ? 8.243   24.757 40.751 1.00 16.22 ? 110 PRO A C   1 
ATOM   837  O O   . PRO A 1 110 ? 8.512   23.794 40.031 1.00 14.91 ? 110 PRO A O   1 
ATOM   838  C CB  . PRO A 1 110 ? 5.900   24.524 41.639 1.00 16.31 ? 110 PRO A CB  1 
ATOM   839  C CG  . PRO A 1 110 ? 4.591   24.592 40.925 1.00 18.09 ? 110 PRO A CG  1 
ATOM   840  C CD  . PRO A 1 110 ? 4.983   24.414 39.480 1.00 17.16 ? 110 PRO A CD  1 
ATOM   841  N N   . HIS A 1 111 ? 9.141   25.329 41.550 1.00 15.35 ? 111 HIS A N   1 
ATOM   842  C CA  . HIS A 1 111 ? 10.489  24.785 41.630 1.00 15.00 ? 111 HIS A CA  1 
ATOM   843  C C   . HIS A 1 111 ? 10.452  23.456 42.372 1.00 15.86 ? 111 HIS A C   1 
ATOM   844  O O   . HIS A 1 111 ? 9.493   23.151 43.078 1.00 15.33 ? 111 HIS A O   1 
ATOM   845  C CB  . HIS A 1 111 ? 11.439  25.761 42.314 1.00 14.82 ? 111 HIS A CB  1 
ATOM   846  C CG  . HIS A 1 111 ? 12.143  26.670 41.356 1.00 17.07 ? 111 HIS A CG  1 
ATOM   847  N ND1 . HIS A 1 111 ? 12.922  26.195 40.322 1.00 16.20 ? 111 HIS A ND1 1 
ATOM   848  C CD2 . HIS A 1 111 ? 12.173  28.021 41.260 1.00 16.09 ? 111 HIS A CD2 1 
ATOM   849  C CE1 . HIS A 1 111 ? 13.402  27.215 39.632 1.00 15.80 ? 111 HIS A CE1 1 
ATOM   850  N NE2 . HIS A 1 111 ? 12.961  28.334 40.179 1.00 14.92 ? 111 HIS A NE2 1 
ATOM   851  N N   . ASN A 1 112 ? 11.501  22.665 42.214 1.00 16.11 ? 112 ASN A N   1 
ATOM   852  C CA  . ASN A 1 112 ? 11.553  21.351 42.829 1.00 17.55 ? 112 ASN A CA  1 
ATOM   853  C C   . ASN A 1 112 ? 11.089  21.171 44.269 1.00 17.35 ? 112 ASN A C   1 
ATOM   854  O O   . ASN A 1 112 ? 10.235  20.320 44.526 1.00 17.18 ? 112 ASN A O   1 
ATOM   855  C CB  . ASN A 1 112 ? 12.948  20.762 42.653 1.00 17.13 ? 112 ASN A CB  1 
ATOM   856  C CG  . ASN A 1 112 ? 13.195  20.311 41.237 1.00 17.58 ? 112 ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 112 ? 12.306  20.380 40.389 1.00 17.01 ? 112 ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 112 ? 14.399  19.844 40.969 1.00 19.18 ? 112 ASN A ND2 1 
ATOM   859  N N   . VAL A 1 113 ? 11.631  21.943 45.209 1.00 16.84 ? 113 VAL A N   1 
ATOM   860  C CA  . VAL A 1 113 ? 11.228  21.780 46.604 1.00 16.57 ? 113 VAL A CA  1 
ATOM   861  C C   . VAL A 1 113 ? 9.700   21.724 46.724 1.00 17.00 ? 113 VAL A C   1 
ATOM   862  O O   . VAL A 1 113 ? 9.151   20.890 47.451 1.00 16.30 ? 113 VAL A O   1 
ATOM   863  C CB  . VAL A 1 113 ? 11.812  22.909 47.516 1.00 15.85 ? 113 VAL A CB  1 
ATOM   864  C CG1 . VAL A 1 113 ? 11.421  24.275 46.997 1.00 16.96 ? 113 VAL A CG1 1 
ATOM   865  C CG2 . VAL A 1 113 ? 11.324  22.731 48.945 1.00 14.21 ? 113 VAL A CG2 1 
ATOM   866  N N   . GLY A 1 114 ? 9.018   22.591 45.988 1.00 15.84 ? 114 GLY A N   1 
ATOM   867  C CA  . GLY A 1 114 ? 7.571   22.599 46.032 1.00 16.83 ? 114 GLY A CA  1 
ATOM   868  C C   . GLY A 1 114 ? 6.993   21.318 45.463 1.00 16.97 ? 114 GLY A C   1 
ATOM   869  O O   . GLY A 1 114 ? 6.033   20.761 46.005 1.00 19.01 ? 114 GLY A O   1 
ATOM   870  N N   . LEU A 1 115 ? 7.573   20.841 44.368 1.00 16.32 ? 115 LEU A N   1 
ATOM   871  C CA  . LEU A 1 115 ? 7.096   19.616 43.735 1.00 16.61 ? 115 LEU A CA  1 
ATOM   872  C C   . LEU A 1 115 ? 7.277   18.423 44.660 1.00 17.05 ? 115 LEU A C   1 
ATOM   873  O O   . LEU A 1 115 ? 6.553   17.433 44.557 1.00 16.64 ? 115 LEU A O   1 
ATOM   874  C CB  . LEU A 1 115 ? 7.833   19.368 42.415 1.00 15.79 ? 115 LEU A CB  1 
ATOM   875  C CG  . LEU A 1 115 ? 7.613   20.391 41.296 1.00 16.18 ? 115 LEU A CG  1 
ATOM   876  C CD1 . LEU A 1 115 ? 8.338   19.923 40.052 1.00 16.18 ? 115 LEU A CD1 1 
ATOM   877  C CD2 . LEU A 1 115 ? 6.124   20.554 41.009 1.00 14.21 ? 115 LEU A CD2 1 
ATOM   878  N N   . GLY A 1 116 ? 8.246   18.525 45.564 1.00 16.10 ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? 8.488   17.450 46.504 1.00 15.91 ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? 7.382   17.401 47.538 1.00 17.82 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? 7.016   16.332 48.027 1.00 19.54 ? 116 GLY A O   1 
ATOM   882  N N   . ALA A 1 117 ? 6.837   18.566 47.868 1.00 17.71 ? 117 ALA A N   1 
ATOM   883  C CA  . ALA A 1 117 ? 5.768   18.655 48.850 1.00 17.60 ? 117 ALA A CA  1 
ATOM   884  C C   . ALA A 1 117 ? 4.481   18.003 48.349 1.00 18.05 ? 117 ALA A C   1 
ATOM   885  O O   . ALA A 1 117 ? 3.598   17.680 49.137 1.00 17.83 ? 117 ALA A O   1 
ATOM   886  C CB  . ALA A 1 117 ? 5.513   20.114 49.201 1.00 16.12 ? 117 ALA A CB  1 
ATOM   887  N N   . THR A 1 118 ? 4.375   17.806 47.041 1.00 18.50 ? 118 THR A N   1 
ATOM   888  C CA  . THR A 1 118 ? 3.174   17.208 46.470 1.00 19.58 ? 118 THR A CA  1 
ATOM   889  C C   . THR A 1 118 ? 3.159   15.698 46.618 1.00 20.32 ? 118 THR A C   1 
ATOM   890  O O   . THR A 1 118 ? 2.092   15.082 46.630 1.00 19.87 ? 118 THR A O   1 
ATOM   891  C CB  . THR A 1 118 ? 3.031   17.508 44.960 1.00 19.95 ? 118 THR A CB  1 
ATOM   892  O OG1 . THR A 1 118 ? 4.054   16.809 44.240 1.00 18.41 ? 118 THR A OG1 1 
ATOM   893  C CG2 . THR A 1 118 ? 3.132   19.006 44.686 1.00 18.67 ? 118 THR A CG2 1 
ATOM   894  N N   . ARG A 1 119 ? 4.343   15.104 46.714 1.00 20.66 ? 119 ARG A N   1 
ATOM   895  C CA  . ARG A 1 119 ? 4.457   13.656 46.828 1.00 21.37 ? 119 ARG A CA  1 
ATOM   896  C C   . ARG A 1 119 ? 3.746   12.963 45.662 1.00 21.96 ? 119 ARG A C   1 
ATOM   897  O O   . ARG A 1 119 ? 3.277   11.832 45.795 1.00 22.52 ? 119 ARG A O   1 
ATOM   898  C CB  . ARG A 1 119 ? 3.851   13.181 48.141 1.00 20.73 ? 119 ARG A CB  1 
ATOM   899  C CG  . ARG A 1 119 ? 4.564   13.691 49.360 1.00 22.19 ? 119 ARG A CG  1 
ATOM   900  C CD  . ARG A 1 119 ? 5.986   13.166 49.433 1.00 23.53 ? 119 ARG A CD  1 
ATOM   901  N NE  . ARG A 1 119 ? 6.497   13.265 50.795 1.00 24.94 ? 119 ARG A NE  1 
ATOM   902  C CZ  . ARG A 1 119 ? 6.699   14.411 51.435 1.00 26.44 ? 119 ARG A CZ  1 
ATOM   903  N NH1 . ARG A 1 119 ? 6.445   15.567 50.831 1.00 27.03 ? 119 ARG A NH1 1 
ATOM   904  N NH2 . ARG A 1 119 ? 7.126   14.402 52.693 1.00 27.28 ? 119 ARG A NH2 1 
ATOM   905  N N   . ASP A 1 120 ? 3.673   13.643 44.522 1.00 21.75 ? 120 ASP A N   1 
ATOM   906  C CA  . ASP A 1 120 ? 3.010   13.086 43.348 1.00 21.41 ? 120 ASP A CA  1 
ATOM   907  C C   . ASP A 1 120 ? 4.003   12.926 42.193 1.00 21.26 ? 120 ASP A C   1 
ATOM   908  O O   . ASP A 1 120 ? 4.214   13.848 41.405 1.00 21.19 ? 120 ASP A O   1 
ATOM   909  C CB  . ASP A 1 120 ? 1.865   14.000 42.915 1.00 21.24 ? 120 ASP A CB  1 
ATOM   910  C CG  . ASP A 1 120 ? 0.924   13.324 41.944 1.00 23.70 ? 120 ASP A CG  1 
ATOM   911  O OD1 . ASP A 1 120 ? 1.374   12.423 41.199 1.00 26.43 ? 120 ASP A OD1 1 
ATOM   912  O OD2 . ASP A 1 120 ? -0.266  13.699 41.917 1.00 25.29 ? 120 ASP A OD2 1 
ATOM   913  N N   . PRO A 1 121 ? 4.635   11.752 42.085 1.00 20.57 ? 121 PRO A N   1 
ATOM   914  C CA  . PRO A 1 121 ? 5.594   11.547 41.002 1.00 19.66 ? 121 PRO A CA  1 
ATOM   915  C C   . PRO A 1 121 ? 4.958   11.630 39.622 1.00 21.30 ? 121 PRO A C   1 
ATOM   916  O O   . PRO A 1 121 ? 5.576   12.131 38.677 1.00 22.25 ? 121 PRO A O   1 
ATOM   917  C CB  . PRO A 1 121 ? 6.157   10.169 41.308 1.00 19.34 ? 121 PRO A CB  1 
ATOM   918  C CG  . PRO A 1 121 ? 6.140   10.149 42.810 1.00 19.80 ? 121 PRO A CG  1 
ATOM   919  C CD  . PRO A 1 121 ? 4.756   10.686 43.093 1.00 19.74 ? 121 PRO A CD  1 
ATOM   920  N N   . TYR A 1 122 ? 3.722   11.157 39.499 1.00 20.23 ? 122 TYR A N   1 
ATOM   921  C CA  . TYR A 1 122 ? 3.051   11.202 38.208 1.00 19.67 ? 122 TYR A CA  1 
ATOM   922  C C   . TYR A 1 122 ? 2.852   12.647 37.741 1.00 20.20 ? 122 TYR A C   1 
ATOM   923  O O   . TYR A 1 122 ? 2.969   12.956 36.547 1.00 19.92 ? 122 TYR A O   1 
ATOM   924  C CB  . TYR A 1 122 ? 1.705   10.501 38.294 1.00 19.76 ? 122 TYR A CB  1 
ATOM   925  C CG  . TYR A 1 122 ? 0.960   10.494 36.983 1.00 22.08 ? 122 TYR A CG  1 
ATOM   926  C CD1 . TYR A 1 122 ? 1.544   9.961  35.832 1.00 24.20 ? 122 TYR A CD1 1 
ATOM   927  C CD2 . TYR A 1 122 ? -0.337  11.008 36.893 1.00 22.03 ? 122 TYR A CD2 1 
ATOM   928  C CE1 . TYR A 1 122 ? 0.851   9.939  34.618 1.00 25.63 ? 122 TYR A CE1 1 
ATOM   929  C CE2 . TYR A 1 122 ? -1.039  10.988 35.692 1.00 22.28 ? 122 TYR A CE2 1 
ATOM   930  C CZ  . TYR A 1 122 ? -0.442  10.454 34.560 1.00 24.45 ? 122 TYR A CZ  1 
ATOM   931  O OH  . TYR A 1 122 ? -1.139  10.423 33.373 1.00 26.11 ? 122 TYR A OH  1 
ATOM   932  N N   . LEU A 1 123 ? 2.530   13.521 38.692 1.00 18.67 ? 123 LEU A N   1 
ATOM   933  C CA  . LEU A 1 123 ? 2.340   14.938 38.408 1.00 18.22 ? 123 LEU A CA  1 
ATOM   934  C C   . LEU A 1 123 ? 3.654   15.467 37.839 1.00 18.38 ? 123 LEU A C   1 
ATOM   935  O O   . LEU A 1 123 ? 3.681   16.126 36.801 1.00 19.27 ? 123 LEU A O   1 
ATOM   936  C CB  . LEU A 1 123 ? 2.011   15.692 39.692 1.00 16.20 ? 123 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 123 ? 2.052   17.209 39.536 1.00 17.21 ? 123 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 123 ? 0.861   17.668 38.710 1.00 15.51 ? 123 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 123 ? 2.039   17.863 40.910 1.00 19.65 ? 123 LEU A CD2 1 
ATOM   940  N N   . VAL A 1 124 ? 4.748   15.170 38.531 1.00 17.15 ? 124 VAL A N   1 
ATOM   941  C CA  . VAL A 1 124 ? 6.060   15.600 38.085 1.00 17.63 ? 124 VAL A CA  1 
ATOM   942  C C   . VAL A 1 124 ? 6.340   15.015 36.696 1.00 19.32 ? 124 VAL A C   1 
ATOM   943  O O   . VAL A 1 124 ? 6.879   15.700 35.824 1.00 20.31 ? 124 VAL A O   1 
ATOM   944  C CB  . VAL A 1 124 ? 7.153   15.154 39.081 1.00 14.91 ? 124 VAL A CB  1 
ATOM   945  C CG1 . VAL A 1 124 ? 8.521   15.609 38.605 1.00 11.93 ? 124 VAL A CG1 1 
ATOM   946  C CG2 . VAL A 1 124 ? 6.856   15.734 40.459 1.00 13.69 ? 124 VAL A CG2 1 
ATOM   947  N N   . LYS A 1 125 ? 5.962   13.758 36.475 1.00 19.28 ? 125 LYS A N   1 
ATOM   948  C CA  . LYS A 1 125 ? 6.191   13.158 35.170 1.00 19.08 ? 125 LYS A CA  1 
ATOM   949  C C   . LYS A 1 125 ? 5.443   13.971 34.121 1.00 20.93 ? 125 LYS A C   1 
ATOM   950  O O   . LYS A 1 125 ? 5.984   14.274 33.054 1.00 21.32 ? 125 LYS A O   1 
ATOM   951  C CB  . LYS A 1 125 ? 5.715   11.705 35.130 1.00 18.14 ? 125 LYS A CB  1 
ATOM   952  C CG  . LYS A 1 125 ? 5.980   11.041 33.782 1.00 18.28 ? 125 LYS A CG  1 
ATOM   953  C CD  . LYS A 1 125 ? 5.482   9.602  33.730 1.00 20.22 ? 125 LYS A CD  1 
ATOM   954  C CE  . LYS A 1 125 ? 5.574   9.025  32.307 1.00 21.48 ? 125 LYS A CE  1 
ATOM   955  N NZ  . LYS A 1 125 ? 5.143   7.593  32.219 1.00 19.00 ? 125 LYS A NZ  1 
ATOM   956  N N   . ARG A 1 126 ? 4.197   14.326 34.429 1.00 22.11 ? 126 ARG A N   1 
ATOM   957  C CA  . ARG A 1 126 ? 3.380   15.109 33.507 1.00 21.98 ? 126 ARG A CA  1 
ATOM   958  C C   . ARG A 1 126 ? 4.025   16.463 33.241 1.00 20.78 ? 126 ARG A C   1 
ATOM   959  O O   . ARG A 1 126 ? 3.958   16.980 32.127 1.00 20.00 ? 126 ARG A O   1 
ATOM   960  C CB  . ARG A 1 126 ? 1.971   15.293 34.076 1.00 23.70 ? 126 ARG A CB  1 
ATOM   961  C CG  . ARG A 1 126 ? 1.068   14.089 33.865 1.00 27.90 ? 126 ARG A CG  1 
ATOM   962  C CD  . ARG A 1 126 ? 0.173   13.869 35.065 1.00 33.93 ? 126 ARG A CD  1 
ATOM   963  N NE  . ARG A 1 126 ? -0.670  15.025 35.343 1.00 38.32 ? 126 ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 126 ? -1.261  15.262 36.512 1.00 41.14 ? 126 ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 126 ? -1.108  14.424 37.532 1.00 41.60 ? 126 ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 126 ? -2.007  16.348 36.662 1.00 43.33 ? 126 ARG A NH2 1 
ATOM   967  N N   . ILE A 1 127 ? 4.652   17.030 34.270 1.00 20.35 ? 127 ILE A N   1 
ATOM   968  C CA  . ILE A 1 127 ? 5.329   18.314 34.135 1.00 19.14 ? 127 ILE A CA  1 
ATOM   969  C C   . ILE A 1 127 ? 6.491   18.152 33.151 1.00 18.71 ? 127 ILE A C   1 
ATOM   970  O O   . ILE A 1 127 ? 6.703   19.000 32.280 1.00 17.87 ? 127 ILE A O   1 
ATOM   971  C CB  . ILE A 1 127 ? 5.857   18.819 35.504 1.00 19.13 ? 127 ILE A CB  1 
ATOM   972  C CG1 . ILE A 1 127 ? 4.676   19.234 36.391 1.00 17.93 ? 127 ILE A CG1 1 
ATOM   973  C CG2 . ILE A 1 127 ? 6.817   19.990 35.304 1.00 17.99 ? 127 ILE A CG2 1 
ATOM   974  C CD1 . ILE A 1 127 ? 5.068   19.712 37.782 1.00 15.25 ? 127 ILE A CD1 1 
ATOM   975  N N   . GLY A 1 128 ? 7.232   17.054 33.288 1.00 17.76 ? 128 GLY A N   1 
ATOM   976  C CA  . GLY A 1 128 ? 8.339   16.788 32.391 1.00 17.92 ? 128 GLY A CA  1 
ATOM   977  C C   . GLY A 1 128 ? 7.864   16.676 30.952 1.00 19.18 ? 128 GLY A C   1 
ATOM   978  O O   . GLY A 1 128 ? 8.565   17.072 30.022 1.00 18.89 ? 128 GLY A O   1 
ATOM   979  N N   . GLU A 1 129 ? 6.664   16.138 30.757 1.00 19.65 ? 129 GLU A N   1 
ATOM   980  C CA  . GLU A 1 129 ? 6.123   15.992 29.409 1.00 20.86 ? 129 GLU A CA  1 
ATOM   981  C C   . GLU A 1 129 ? 5.796   17.366 28.830 1.00 20.03 ? 129 GLU A C   1 
ATOM   982  O O   . GLU A 1 129 ? 6.143   17.674 27.683 1.00 18.86 ? 129 GLU A O   1 
ATOM   983  C CB  . GLU A 1 129 ? 4.872   15.115 29.437 1.00 21.45 ? 129 GLU A CB  1 
ATOM   984  C CG  . GLU A 1 129 ? 5.047   13.854 30.264 1.00 26.46 ? 129 GLU A CG  1 
ATOM   985  C CD  . GLU A 1 129 ? 3.858   12.908 30.182 1.00 29.42 ? 129 GLU A CD  1 
ATOM   986  O OE1 . GLU A 1 129 ? 2.706   13.390 30.099 1.00 30.38 ? 129 GLU A OE1 1 
ATOM   987  O OE2 . GLU A 1 129 ? 4.080   11.675 30.218 1.00 31.08 ? 129 GLU A OE2 1 
ATOM   988  N N   . ALA A 1 130 ? 5.128   18.191 29.631 1.00 19.46 ? 130 ALA A N   1 
ATOM   989  C CA  . ALA A 1 130 ? 4.766   19.540 29.211 1.00 18.05 ? 130 ALA A CA  1 
ATOM   990  C C   . ALA A 1 130 ? 6.021   20.345 28.923 1.00 17.51 ? 130 ALA A C   1 
ATOM   991  O O   . ALA A 1 130 ? 6.056   21.123 27.978 1.00 19.03 ? 130 ALA A O   1 
ATOM   992  C CB  . ALA A 1 130 ? 3.954   20.223 30.291 1.00 16.63 ? 130 ALA A CB  1 
ATOM   993  N N   . THR A 1 131 ? 7.050   20.147 29.743 1.00 16.66 ? 131 THR A N   1 
ATOM   994  C CA  . THR A 1 131 ? 8.314   20.854 29.584 1.00 16.89 ? 131 THR A CA  1 
ATOM   995  C C   . THR A 1 131 ? 9.035   20.503 28.277 1.00 17.06 ? 131 THR A C   1 
ATOM   996  O O   . THR A 1 131 ? 9.514   21.387 27.571 1.00 18.38 ? 131 THR A O   1 
ATOM   997  C CB  . THR A 1 131 ? 9.265   20.575 30.772 1.00 17.58 ? 131 THR A CB  1 
ATOM   998  O OG1 . THR A 1 131 ? 8.676   21.057 31.987 1.00 16.04 ? 131 THR A OG1 1 
ATOM   999  C CG2 . THR A 1 131 ? 10.600  21.277 30.560 1.00 17.38 ? 131 THR A CG2 1 
ATOM   1000 N N   . ALA A 1 132 ? 9.118   19.220 27.950 1.00 17.08 ? 132 ALA A N   1 
ATOM   1001 C CA  . ALA A 1 132 ? 9.781   18.814 26.715 1.00 16.85 ? 132 ALA A CA  1 
ATOM   1002 C C   . ALA A 1 132 ? 9.110   19.482 25.518 1.00 17.07 ? 132 ALA A C   1 
ATOM   1003 O O   . ALA A 1 132 ? 9.782   20.003 24.628 1.00 17.40 ? 132 ALA A O   1 
ATOM   1004 C CB  . ALA A 1 132 ? 9.739   17.296 26.565 1.00 16.26 ? 132 ALA A CB  1 
ATOM   1005 N N   . LEU A 1 133 ? 7.782   19.466 25.502 1.00 17.61 ? 133 LEU A N   1 
ATOM   1006 C CA  . LEU A 1 133 ? 7.028   20.084 24.420 1.00 18.48 ? 133 LEU A CA  1 
ATOM   1007 C C   . LEU A 1 133 ? 7.368   21.562 24.296 1.00 18.80 ? 133 LEU A C   1 
ATOM   1008 O O   . LEU A 1 133 ? 7.596   22.062 23.192 1.00 20.07 ? 133 LEU A O   1 
ATOM   1009 C CB  . LEU A 1 133 ? 5.525   19.925 24.658 1.00 18.91 ? 133 LEU A CB  1 
ATOM   1010 C CG  . LEU A 1 133 ? 5.001   18.493 24.506 1.00 20.08 ? 133 LEU A CG  1 
ATOM   1011 C CD1 . LEU A 1 133 ? 3.563   18.379 24.998 1.00 17.10 ? 133 LEU A CD1 1 
ATOM   1012 C CD2 . LEU A 1 133 ? 5.106   18.094 23.044 1.00 20.32 ? 133 LEU A CD2 1 
ATOM   1013 N N   . GLU A 1 134 ? 7.413   22.263 25.424 1.00 17.35 ? 134 GLU A N   1 
ATOM   1014 C CA  . GLU A 1 134 ? 7.722   23.684 25.386 1.00 18.11 ? 134 GLU A CA  1 
ATOM   1015 C C   . GLU A 1 134 ? 9.179   23.991 25.036 1.00 18.22 ? 134 GLU A C   1 
ATOM   1016 O O   . GLU A 1 134 ? 9.481   25.063 24.520 1.00 18.78 ? 134 GLU A O   1 
ATOM   1017 C CB  . GLU A 1 134 ? 7.297   24.358 26.697 1.00 17.86 ? 134 GLU A CB  1 
ATOM   1018 C CG  . GLU A 1 134 ? 5.789   24.566 26.749 1.00 19.12 ? 134 GLU A CG  1 
ATOM   1019 C CD  . GLU A 1 134 ? 5.356   25.628 27.734 1.00 20.01 ? 134 GLU A CD  1 
ATOM   1020 O OE1 . GLU A 1 134 ? 6.033   26.670 27.832 1.00 20.87 ? 134 GLU A OE1 1 
ATOM   1021 O OE2 . GLU A 1 134 ? 4.319   25.429 28.398 1.00 22.70 ? 134 GLU A OE2 1 
ATOM   1022 N N   . VAL A 1 135 ? 10.080  23.053 25.310 1.00 18.07 ? 135 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 135 ? 11.484  23.235 24.948 1.00 18.23 ? 135 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 135 ? 11.575  23.004 23.430 1.00 18.65 ? 135 VAL A C   1 
ATOM   1025 O O   . VAL A 1 135 ? 12.178  23.798 22.703 1.00 18.85 ? 135 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 135 ? 12.396  22.222 25.673 1.00 17.85 ? 135 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 135 ? 13.779  22.221 25.049 1.00 17.67 ? 135 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 135 ? 12.495  22.580 27.137 1.00 17.16 ? 135 VAL A CG2 1 
ATOM   1029 N N   . ARG A 1 136 ? 10.974  21.915 22.955 1.00 17.20 ? 136 ARG A N   1 
ATOM   1030 C CA  . ARG A 1 136 ? 10.983  21.625 21.526 1.00 18.35 ? 136 ARG A CA  1 
ATOM   1031 C C   . ARG A 1 136 ? 10.265  22.742 20.767 1.00 18.43 ? 136 ARG A C   1 
ATOM   1032 O O   . ARG A 1 136 ? 10.574  23.008 19.600 1.00 17.99 ? 136 ARG A O   1 
ATOM   1033 C CB  . ARG A 1 136 ? 10.304  20.279 21.228 1.00 17.80 ? 136 ARG A CB  1 
ATOM   1034 C CG  . ARG A 1 136 ? 11.178  19.048 21.461 1.00 16.95 ? 136 ARG A CG  1 
ATOM   1035 C CD  . ARG A 1 136 ? 12.306  18.969 20.446 1.00 16.99 ? 136 ARG A CD  1 
ATOM   1036 N NE  . ARG A 1 136 ? 13.001  17.686 20.515 1.00 18.91 ? 136 ARG A NE  1 
ATOM   1037 C CZ  . ARG A 1 136 ? 13.894  17.266 19.621 1.00 19.91 ? 136 ARG A CZ  1 
ATOM   1038 N NH1 . ARG A 1 136 ? 14.216  18.024 18.576 1.00 19.65 ? 136 ARG A NH1 1 
ATOM   1039 N NH2 . ARG A 1 136 ? 14.461  16.076 19.765 1.00 19.09 ? 136 ARG A NH2 1 
ATOM   1040 N N   . ALA A 1 137 ? 9.306   23.388 21.428 1.00 17.45 ? 137 ALA A N   1 
ATOM   1041 C CA  . ALA A 1 137 ? 8.563   24.482 20.808 1.00 18.07 ? 137 ALA A CA  1 
ATOM   1042 C C   . ALA A 1 137 ? 9.528   25.591 20.408 1.00 17.47 ? 137 ALA A C   1 
ATOM   1043 O O   . ALA A 1 137 ? 9.215   26.415 19.553 1.00 17.13 ? 137 ALA A O   1 
ATOM   1044 C CB  . ALA A 1 137 ? 7.511   25.027 21.775 1.00 18.11 ? 137 ALA A CB  1 
ATOM   1045 N N   . THR A 1 138 ? 10.702  25.605 21.035 1.00 17.83 ? 138 THR A N   1 
ATOM   1046 C CA  . THR A 1 138 ? 11.718  26.607 20.740 1.00 17.71 ? 138 THR A CA  1 
ATOM   1047 C C   . THR A 1 138 ? 12.880  25.985 19.965 1.00 17.72 ? 138 THR A C   1 
ATOM   1048 O O   . THR A 1 138 ? 13.932  26.598 19.804 1.00 17.51 ? 138 THR A O   1 
ATOM   1049 C CB  . THR A 1 138 ? 12.255  27.287 22.043 1.00 18.22 ? 138 THR A CB  1 
ATOM   1050 O OG1 . THR A 1 138 ? 12.866  26.311 22.899 1.00 17.61 ? 138 THR A OG1 1 
ATOM   1051 C CG2 . THR A 1 138 ? 11.113  27.969 22.795 1.00 17.39 ? 138 THR A CG2 1 
ATOM   1052 N N   . GLY A 1 139 ? 12.682  24.758 19.492 1.00 17.98 ? 139 GLY A N   1 
ATOM   1053 C CA  . GLY A 1 139 ? 13.709  24.084 18.716 1.00 17.70 ? 139 GLY A CA  1 
ATOM   1054 C C   . GLY A 1 139 ? 14.894  23.532 19.486 1.00 17.98 ? 139 GLY A C   1 
ATOM   1055 O O   . GLY A 1 139 ? 15.869  23.085 18.887 1.00 18.17 ? 139 GLY A O   1 
ATOM   1056 N N   . ILE A 1 140 ? 14.826  23.559 20.811 1.00 17.91 ? 140 ILE A N   1 
ATOM   1057 C CA  . ILE A 1 140 ? 15.919  23.038 21.623 1.00 17.39 ? 140 ILE A CA  1 
ATOM   1058 C C   . ILE A 1 140 ? 15.635  21.565 21.905 1.00 18.00 ? 140 ILE A C   1 
ATOM   1059 O O   . ILE A 1 140 ? 14.486  21.179 22.101 1.00 18.59 ? 140 ILE A O   1 
ATOM   1060 C CB  . ILE A 1 140 ? 16.067  23.872 22.906 1.00 16.29 ? 140 ILE A CB  1 
ATOM   1061 C CG1 . ILE A 1 140 ? 16.463  25.302 22.511 1.00 14.24 ? 140 ILE A CG1 1 
ATOM   1062 C CG2 . ILE A 1 140 ? 17.098  23.246 23.829 1.00 15.15 ? 140 ILE A CG2 1 
ATOM   1063 C CD1 . ILE A 1 140 ? 16.588  26.274 23.651 1.00 15.34 ? 140 ILE A CD1 1 
ATOM   1064 N N   . GLN A 1 141 ? 16.678  20.739 21.915 1.00 18.55 ? 141 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 141 ? 16.489  19.298 22.095 1.00 19.67 ? 141 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 141 ? 17.118  18.673 23.334 1.00 19.15 ? 141 GLN A C   1 
ATOM   1067 O O   . GLN A 1 141 ? 17.162  17.447 23.448 1.00 19.01 ? 141 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 141 ? 17.022  18.549 20.861 1.00 18.99 ? 141 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 141 ? 16.920  19.316 19.541 1.00 20.54 ? 141 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 141 ? 18.165  20.153 19.239 1.00 20.72 ? 141 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 141 ? 18.857  20.615 20.148 1.00 23.20 ? 141 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 141 ? 18.440  20.361 17.958 1.00 18.42 ? 141 GLN A NE2 1 
ATOM   1073 N N   . TYR A 1 142 ? 17.579  19.492 24.270 1.00 17.58 ? 142 TYR A N   1 
ATOM   1074 C CA  . TYR A 1 142 ? 18.249  18.954 25.451 1.00 17.14 ? 142 TYR A CA  1 
ATOM   1075 C C   . TYR A 1 142 ? 18.033  19.864 26.657 1.00 16.26 ? 142 TYR A C   1 
ATOM   1076 O O   . TYR A 1 142 ? 18.264  21.070 26.587 1.00 17.10 ? 142 TYR A O   1 
ATOM   1077 C CB  . TYR A 1 142 ? 19.737  18.796 25.087 1.00 16.03 ? 142 TYR A CB  1 
ATOM   1078 C CG  . TYR A 1 142 ? 20.714  18.363 26.154 1.00 15.63 ? 142 TYR A CG  1 
ATOM   1079 C CD1 . TYR A 1 142 ? 20.333  17.546 27.215 1.00 17.12 ? 142 TYR A CD1 1 
ATOM   1080 C CD2 . TYR A 1 142 ? 22.059  18.725 26.053 1.00 17.09 ? 142 TYR A CD2 1 
ATOM   1081 C CE1 . TYR A 1 142 ? 21.275  17.101 28.153 1.00 16.76 ? 142 TYR A CE1 1 
ATOM   1082 C CE2 . TYR A 1 142 ? 23.001  18.288 26.970 1.00 15.87 ? 142 TYR A CE2 1 
ATOM   1083 C CZ  . TYR A 1 142 ? 22.607  17.481 28.015 1.00 17.03 ? 142 TYR A CZ  1 
ATOM   1084 O OH  . TYR A 1 142 ? 23.552  17.066 28.919 1.00 18.68 ? 142 TYR A OH  1 
ATOM   1085 N N   . ALA A 1 143 ? 17.562  19.286 27.755 1.00 14.52 ? 143 ALA A N   1 
ATOM   1086 C CA  . ALA A 1 143 ? 17.313  20.060 28.962 1.00 14.46 ? 143 ALA A CA  1 
ATOM   1087 C C   . ALA A 1 143 ? 18.194  19.579 30.108 1.00 15.34 ? 143 ALA A C   1 
ATOM   1088 O O   . ALA A 1 143 ? 18.273  18.380 30.378 1.00 16.36 ? 143 ALA A O   1 
ATOM   1089 C CB  . ALA A 1 143 ? 15.853  19.955 29.349 1.00 13.50 ? 143 ALA A CB  1 
ATOM   1090 N N   . PHE A 1 144 ? 18.850  20.517 30.787 1.00 16.00 ? 144 PHE A N   1 
ATOM   1091 C CA  . PHE A 1 144 ? 19.723  20.177 31.902 1.00 16.30 ? 144 PHE A CA  1 
ATOM   1092 C C   . PHE A 1 144 ? 18.918  19.934 33.160 1.00 17.53 ? 144 PHE A C   1 
ATOM   1093 O O   . PHE A 1 144 ? 19.027  20.682 34.128 1.00 17.51 ? 144 PHE A O   1 
ATOM   1094 C CB  . PHE A 1 144 ? 20.732  21.298 32.148 1.00 15.68 ? 144 PHE A CB  1 
ATOM   1095 C CG  . PHE A 1 144 ? 21.613  21.577 30.974 1.00 16.47 ? 144 PHE A CG  1 
ATOM   1096 C CD1 . PHE A 1 144 ? 22.250  20.532 30.305 1.00 17.43 ? 144 PHE A CD1 1 
ATOM   1097 C CD2 . PHE A 1 144 ? 21.813  22.878 30.534 1.00 17.15 ? 144 PHE A CD2 1 
ATOM   1098 C CE1 . PHE A 1 144 ? 23.076  20.777 29.214 1.00 17.29 ? 144 PHE A CE1 1 
ATOM   1099 C CE2 . PHE A 1 144 ? 22.640  23.140 29.440 1.00 17.15 ? 144 PHE A CE2 1 
ATOM   1100 C CZ  . PHE A 1 144 ? 23.273  22.085 28.779 1.00 18.54 ? 144 PHE A CZ  1 
ATOM   1101 N N   . ALA A 1 145 ? 18.102  18.885 33.133 1.00 17.97 ? 145 ALA A N   1 
ATOM   1102 C CA  . ALA A 1 145 ? 17.265  18.520 34.268 1.00 18.04 ? 145 ALA A CA  1 
ATOM   1103 C C   . ALA A 1 145 ? 17.020  17.018 34.212 1.00 18.85 ? 145 ALA A C   1 
ATOM   1104 O O   . ALA A 1 145 ? 17.145  16.409 33.151 1.00 20.24 ? 145 ALA A O   1 
ATOM   1105 C CB  . ALA A 1 145 ? 15.950  19.272 34.204 1.00 18.84 ? 145 ALA A CB  1 
ATOM   1106 N N   . PRO A 1 146 ? 16.631  16.403 35.342 1.00 19.30 ? 146 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 146 ? 16.396  16.991 36.663 1.00 19.45 ? 146 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 146 ? 17.611  17.070 37.568 1.00 20.21 ? 146 PRO A C   1 
ATOM   1109 O O   . PRO A 1 146 ? 18.534  16.261 37.472 1.00 19.42 ? 146 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 146 ? 15.361  16.057 37.253 1.00 20.15 ? 146 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 146 ? 15.897  14.727 36.818 1.00 18.74 ? 146 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 146 ? 16.258  14.975 35.350 1.00 19.22 ? 146 PRO A CD  1 
ATOM   1113 N N   . CYS A 1 147 ? 17.594  18.056 38.457 1.00 21.70 ? 147 CYS A N   1 
ATOM   1114 C CA  . CYS A 1 147 ? 18.657  18.214 39.431 1.00 21.46 ? 147 CYS A CA  1 
ATOM   1115 C C   . CYS A 1 147 ? 18.232  17.264 40.534 1.00 22.11 ? 147 CYS A C   1 
ATOM   1116 O O   . CYS A 1 147 ? 17.274  17.549 41.244 1.00 23.63 ? 147 CYS A O   1 
ATOM   1117 C CB  . CYS A 1 147 ? 18.683  19.638 39.982 1.00 20.41 ? 147 CYS A CB  1 
ATOM   1118 S SG  . CYS A 1 147 ? 19.583  19.781 41.560 1.00 20.41 ? 147 CYS A SG  1 
ATOM   1119 N N   . ILE A 1 148 ? 18.909  16.129 40.671 1.00 21.49 ? 148 ILE A N   1 
ATOM   1120 C CA  . ILE A 1 148 ? 18.531  15.184 41.709 1.00 19.52 ? 148 ILE A CA  1 
ATOM   1121 C C   . ILE A 1 148 ? 19.446  15.245 42.922 1.00 20.92 ? 148 ILE A C   1 
ATOM   1122 O O   . ILE A 1 148 ? 19.819  14.213 43.481 1.00 22.20 ? 148 ILE A O   1 
ATOM   1123 C CB  . ILE A 1 148 ? 18.497  13.728 41.188 1.00 18.29 ? 148 ILE A CB  1 
ATOM   1124 C CG1 . ILE A 1 148 ? 19.845  13.355 40.571 1.00 16.72 ? 148 ILE A CG1 1 
ATOM   1125 C CG2 . ILE A 1 148 ? 17.356  13.559 40.199 1.00 15.72 ? 148 ILE A CG2 1 
ATOM   1126 C CD1 . ILE A 1 148 ? 20.004  11.869 40.305 1.00 13.93 ? 148 ILE A CD1 1 
ATOM   1127 N N   . ALA A 1 149 ? 19.812  16.453 43.328 1.00 20.45 ? 149 ALA A N   1 
ATOM   1128 C CA  . ALA A 1 149 ? 20.655  16.619 44.505 1.00 21.04 ? 149 ALA A CA  1 
ATOM   1129 C C   . ALA A 1 149 ? 19.773  16.399 45.730 1.00 21.18 ? 149 ALA A C   1 
ATOM   1130 O O   . ALA A 1 149 ? 18.551  16.527 45.656 1.00 22.43 ? 149 ALA A O   1 
ATOM   1131 C CB  . ALA A 1 149 ? 21.245  18.027 44.539 1.00 20.53 ? 149 ALA A CB  1 
ATOM   1132 N N   . VAL A 1 150 ? 20.380  16.050 46.854 1.00 20.73 ? 150 VAL A N   1 
ATOM   1133 C CA  . VAL A 1 150 ? 19.610  15.866 48.074 1.00 20.93 ? 150 VAL A CA  1 
ATOM   1134 C C   . VAL A 1 150 ? 20.093  16.941 49.044 1.00 22.20 ? 150 VAL A C   1 
ATOM   1135 O O   . VAL A 1 150 ? 21.025  16.718 49.811 1.00 23.38 ? 150 VAL A O   1 
ATOM   1136 C CB  . VAL A 1 150 ? 19.824  14.459 48.681 1.00 19.69 ? 150 VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 150 ? 19.021  14.315 49.966 1.00 17.16 ? 150 VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 150 ? 19.403  13.394 47.676 1.00 16.75 ? 150 VAL A CG2 1 
ATOM   1139 N N   . CYS A 1 151 ? 19.468  18.115 48.983 1.00 23.07 ? 151 CYS A N   1 
ATOM   1140 C CA  . CYS A 1 151 ? 19.850  19.237 49.837 1.00 24.35 ? 151 CYS A CA  1 
ATOM   1141 C C   . CYS A 1 151 ? 19.744  18.879 51.312 1.00 24.87 ? 151 CYS A C   1 
ATOM   1142 O O   . CYS A 1 151 ? 18.658  18.579 51.812 1.00 26.01 ? 151 CYS A O   1 
ATOM   1143 C CB  . CYS A 1 151 ? 18.983  20.471 49.530 1.00 24.41 ? 151 CYS A CB  1 
ATOM   1144 S SG  . CYS A 1 151 ? 19.202  21.813 50.740 1.00 24.61 ? 151 CYS A SG  1 
ATOM   1145 N N   . ARG A 1 152 ? 20.877  18.915 52.009 1.00 24.49 ? 152 ARG A N   1 
ATOM   1146 C CA  . ARG A 1 152 ? 20.901  18.579 53.428 1.00 24.86 ? 152 ARG A CA  1 
ATOM   1147 C C   . ARG A 1 152 ? 21.128  19.782 54.337 1.00 24.41 ? 152 ARG A C   1 
ATOM   1148 O O   . ARG A 1 152 ? 21.224  19.639 55.555 1.00 25.39 ? 152 ARG A O   1 
ATOM   1149 C CB  . ARG A 1 152 ? 21.965  17.520 53.694 1.00 24.36 ? 152 ARG A CB  1 
ATOM   1150 C CG  . ARG A 1 152 ? 21.747  16.232 52.921 1.00 26.52 ? 152 ARG A CG  1 
ATOM   1151 C CD  . ARG A 1 152 ? 21.777  15.044 53.858 1.00 28.54 ? 152 ARG A CD  1 
ATOM   1152 N NE  . ARG A 1 152 ? 20.446  14.520 54.131 1.00 28.13 ? 152 ARG A NE  1 
ATOM   1153 C CZ  . ARG A 1 152 ? 20.125  13.831 55.221 1.00 28.64 ? 152 ARG A CZ  1 
ATOM   1154 N NH1 . ARG A 1 152 ? 21.034  13.587 56.157 1.00 27.71 ? 152 ARG A NH1 1 
ATOM   1155 N NH2 . ARG A 1 152 ? 18.893  13.361 55.364 1.00 31.33 ? 152 ARG A NH2 1 
ATOM   1156 N N   . ASP A 1 153 ? 21.217  20.962 53.739 1.00 21.81 ? 153 ASP A N   1 
ATOM   1157 C CA  . ASP A 1 153 ? 21.398  22.186 54.495 1.00 21.94 ? 153 ASP A CA  1 
ATOM   1158 C C   . ASP A 1 153 ? 20.705  23.301 53.714 1.00 22.75 ? 153 ASP A C   1 
ATOM   1159 O O   . ASP A 1 153 ? 21.166  23.701 52.644 1.00 23.82 ? 153 ASP A O   1 
ATOM   1160 C CB  . ASP A 1 153 ? 22.880  22.500 54.657 1.00 23.00 ? 153 ASP A CB  1 
ATOM   1161 C CG  . ASP A 1 153 ? 23.152  23.416 55.831 1.00 24.92 ? 153 ASP A CG  1 
ATOM   1162 O OD1 . ASP A 1 153 ? 22.441  24.431 55.972 1.00 28.44 ? 153 ASP A OD1 1 
ATOM   1163 O OD2 . ASP A 1 153 ? 24.077  23.125 56.613 1.00 25.12 ? 153 ASP A OD2 1 
ATOM   1164 N N   . PRO A 1 154 ? 19.581  23.814 54.241 1.00 22.02 ? 154 PRO A N   1 
ATOM   1165 C CA  . PRO A 1 154 ? 18.783  24.881 53.628 1.00 20.81 ? 154 PRO A CA  1 
ATOM   1166 C C   . PRO A 1 154 ? 19.574  26.144 53.297 1.00 21.43 ? 154 PRO A C   1 
ATOM   1167 O O   . PRO A 1 154 ? 19.127  26.977 52.510 1.00 22.26 ? 154 PRO A O   1 
ATOM   1168 C CB  . PRO A 1 154 ? 17.706  25.148 54.672 1.00 20.41 ? 154 PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 154 ? 17.588  23.842 55.387 1.00 22.17 ? 154 PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 154 ? 19.011  23.423 55.540 1.00 21.41 ? 154 PRO A CD  1 
ATOM   1171 N N   . ARG A 1 155 ? 20.744  26.295 53.906 1.00 21.26 ? 155 ARG A N   1 
ATOM   1172 C CA  . ARG A 1 155 ? 21.569  27.467 53.652 1.00 21.25 ? 155 ARG A CA  1 
ATOM   1173 C C   . ARG A 1 155 ? 22.150  27.460 52.236 1.00 20.67 ? 155 ARG A C   1 
ATOM   1174 O O   . ARG A 1 155 ? 22.675  28.466 51.759 1.00 21.93 ? 155 ARG A O   1 
ATOM   1175 C CB  . ARG A 1 155 ? 22.672  27.544 54.707 1.00 22.08 ? 155 ARG A CB  1 
ATOM   1176 C CG  . ARG A 1 155 ? 22.106  27.772 56.098 1.00 24.47 ? 155 ARG A CG  1 
ATOM   1177 C CD  . ARG A 1 155 ? 23.156  27.717 57.182 1.00 26.26 ? 155 ARG A CD  1 
ATOM   1178 N NE  . ARG A 1 155 ? 23.612  26.354 57.435 1.00 26.90 ? 155 ARG A NE  1 
ATOM   1179 C CZ  . ARG A 1 155 ? 24.507  26.031 58.359 1.00 26.55 ? 155 ARG A CZ  1 
ATOM   1180 N NH1 . ARG A 1 155 ? 25.043  26.973 59.122 1.00 25.75 ? 155 ARG A NH1 1 
ATOM   1181 N NH2 . ARG A 1 155 ? 24.872  24.768 58.516 1.00 27.41 ? 155 ARG A NH2 1 
ATOM   1182 N N   . TRP A 1 156 ? 22.036  26.318 51.565 1.00 20.11 ? 156 TRP A N   1 
ATOM   1183 C CA  . TRP A 1 156 ? 22.518  26.164 50.197 1.00 21.23 ? 156 TRP A CA  1 
ATOM   1184 C C   . TRP A 1 156 ? 21.603  26.942 49.251 1.00 21.95 ? 156 TRP A C   1 
ATOM   1185 O O   . TRP A 1 156 ? 20.389  26.733 49.241 1.00 22.98 ? 156 TRP A O   1 
ATOM   1186 C CB  . TRP A 1 156 ? 22.524  24.683 49.811 1.00 20.29 ? 156 TRP A CB  1 
ATOM   1187 C CG  . TRP A 1 156 ? 23.123  24.395 48.467 1.00 19.25 ? 156 TRP A CG  1 
ATOM   1188 C CD1 . TRP A 1 156 ? 24.195  25.019 47.900 1.00 19.92 ? 156 TRP A CD1 1 
ATOM   1189 C CD2 . TRP A 1 156 ? 22.745  23.346 47.561 1.00 18.31 ? 156 TRP A CD2 1 
ATOM   1190 N NE1 . TRP A 1 156 ? 24.514  24.422 46.701 1.00 20.98 ? 156 TRP A NE1 1 
ATOM   1191 C CE2 . TRP A 1 156 ? 23.640  23.393 46.468 1.00 18.49 ? 156 TRP A CE2 1 
ATOM   1192 C CE3 . TRP A 1 156 ? 21.740  22.370 47.567 1.00 15.44 ? 156 TRP A CE3 1 
ATOM   1193 C CZ2 . TRP A 1 156 ? 23.561  22.501 45.392 1.00 16.69 ? 156 TRP A CZ2 1 
ATOM   1194 C CZ3 . TRP A 1 156 ? 21.663  21.482 46.492 1.00 15.88 ? 156 TRP A CZ3 1 
ATOM   1195 C CH2 . TRP A 1 156 ? 22.568  21.557 45.423 1.00 15.65 ? 156 TRP A CH2 1 
ATOM   1196 N N   . GLY A 1 157 ? 22.186  27.834 48.459 1.00 22.11 ? 157 GLY A N   1 
ATOM   1197 C CA  . GLY A 1 157 ? 21.396  28.630 47.535 1.00 20.94 ? 157 GLY A CA  1 
ATOM   1198 C C   . GLY A 1 157 ? 20.669  27.830 46.469 1.00 20.74 ? 157 GLY A C   1 
ATOM   1199 O O   . GLY A 1 157 ? 19.865  28.383 45.721 1.00 20.29 ? 157 GLY A O   1 
ATOM   1200 N N   . ARG A 1 158 ? 20.944  26.533 46.388 1.00 20.41 ? 158 ARG A N   1 
ATOM   1201 C CA  . ARG A 1 158 ? 20.287  25.696 45.390 1.00 20.39 ? 158 ARG A CA  1 
ATOM   1202 C C   . ARG A 1 158 ? 19.352  24.673 46.021 1.00 19.41 ? 158 ARG A C   1 
ATOM   1203 O O   . ARG A 1 158 ? 18.904  23.743 45.353 1.00 18.63 ? 158 ARG A O   1 
ATOM   1204 C CB  . ARG A 1 158 ? 21.325  24.968 44.530 1.00 19.31 ? 158 ARG A CB  1 
ATOM   1205 C CG  . ARG A 1 158 ? 22.413  25.865 43.982 1.00 20.34 ? 158 ARG A CG  1 
ATOM   1206 C CD  . ARG A 1 158 ? 23.170  25.185 42.862 1.00 20.39 ? 158 ARG A CD  1 
ATOM   1207 N NE  . ARG A 1 158 ? 22.348  25.053 41.663 1.00 20.72 ? 158 ARG A NE  1 
ATOM   1208 C CZ  . ARG A 1 158 ? 22.804  24.628 40.488 1.00 21.19 ? 158 ARG A CZ  1 
ATOM   1209 N NH1 . ARG A 1 158 ? 24.081  24.286 40.356 1.00 18.19 ? 158 ARG A NH1 1 
ATOM   1210 N NH2 . ARG A 1 158 ? 21.989  24.565 39.437 1.00 20.28 ? 158 ARG A NH2 1 
ATOM   1211 N N   . CYS A 1 159 ? 19.048  24.848 47.302 1.00 19.59 ? 159 CYS A N   1 
ATOM   1212 C CA  . CYS A 1 159 ? 18.174  23.915 47.996 1.00 19.94 ? 159 CYS A CA  1 
ATOM   1213 C C   . CYS A 1 159 ? 16.806  23.833 47.325 1.00 19.32 ? 159 CYS A C   1 
ATOM   1214 O O   . CYS A 1 159 ? 16.207  22.758 47.261 1.00 20.42 ? 159 CYS A O   1 
ATOM   1215 C CB  . CYS A 1 159 ? 18.021  24.325 49.460 1.00 21.20 ? 159 CYS A CB  1 
ATOM   1216 S SG  . CYS A 1 159 ? 17.525  22.978 50.594 1.00 29.09 ? 159 CYS A SG  1 
ATOM   1217 N N   . TYR A 1 160 ? 16.314  24.954 46.808 1.00 18.33 ? 160 TYR A N   1 
ATOM   1218 C CA  . TYR A 1 160 ? 15.009  24.946 46.150 1.00 18.87 ? 160 TYR A CA  1 
ATOM   1219 C C   . TYR A 1 160 ? 14.993  24.077 44.894 1.00 18.86 ? 160 TYR A C   1 
ATOM   1220 O O   . TYR A 1 160 ? 13.925  23.726 44.389 1.00 20.86 ? 160 TYR A O   1 
ATOM   1221 C CB  . TYR A 1 160 ? 14.549  26.377 45.823 1.00 16.68 ? 160 TYR A CB  1 
ATOM   1222 C CG  . TYR A 1 160 ? 15.294  27.091 44.719 1.00 15.70 ? 160 TYR A CG  1 
ATOM   1223 C CD1 . TYR A 1 160 ? 15.041  26.809 43.371 1.00 16.11 ? 160 TYR A CD1 1 
ATOM   1224 C CD2 . TYR A 1 160 ? 16.215  28.092 45.020 1.00 15.07 ? 160 TYR A CD2 1 
ATOM   1225 C CE1 . TYR A 1 160 ? 15.688  27.515 42.350 1.00 15.10 ? 160 TYR A CE1 1 
ATOM   1226 C CE2 . TYR A 1 160 ? 16.866  28.805 44.012 1.00 14.62 ? 160 TYR A CE2 1 
ATOM   1227 C CZ  . TYR A 1 160 ? 16.599  28.517 42.682 1.00 16.24 ? 160 TYR A CZ  1 
ATOM   1228 O OH  . TYR A 1 160 ? 17.231  29.252 41.699 1.00 15.42 ? 160 TYR A OH  1 
ATOM   1229 N N   . GLU A 1 161 ? 16.174  23.726 44.393 1.00 18.03 ? 161 GLU A N   1 
ATOM   1230 C CA  . GLU A 1 161 ? 16.265  22.871 43.215 1.00 18.66 ? 161 GLU A CA  1 
ATOM   1231 C C   . GLU A 1 161 ? 16.310  21.407 43.640 1.00 19.11 ? 161 GLU A C   1 
ATOM   1232 O O   . GLU A 1 161 ? 16.533  20.520 42.818 1.00 18.26 ? 161 GLU A O   1 
ATOM   1233 C CB  . GLU A 1 161 ? 17.509  23.201 42.389 1.00 18.44 ? 161 GLU A CB  1 
ATOM   1234 C CG  . GLU A 1 161 ? 17.519  24.612 41.817 1.00 18.73 ? 161 GLU A CG  1 
ATOM   1235 C CD  . GLU A 1 161 ? 18.593  24.796 40.762 1.00 20.45 ? 161 GLU A CD  1 
ATOM   1236 O OE1 . GLU A 1 161 ? 18.421  24.263 39.640 1.00 20.55 ? 161 GLU A OE1 1 
ATOM   1237 O OE2 . GLU A 1 161 ? 19.611  25.462 41.059 1.00 20.06 ? 161 GLU A OE2 1 
ATOM   1238 N N   . SER A 1 162 ? 16.106  21.162 44.933 1.00 19.34 ? 162 SER A N   1 
ATOM   1239 C CA  . SER A 1 162 ? 16.101  19.804 45.463 1.00 19.77 ? 162 SER A CA  1 
ATOM   1240 C C   . SER A 1 162 ? 14.684  19.427 45.897 1.00 20.13 ? 162 SER A C   1 
ATOM   1241 O O   . SER A 1 162 ? 14.025  20.172 46.623 1.00 19.74 ? 162 SER A O   1 
ATOM   1242 C CB  . SER A 1 162 ? 17.058  19.689 46.657 1.00 20.16 ? 162 SER A CB  1 
ATOM   1243 O OG  . SER A 1 162 ? 17.039  18.386 47.217 1.00 15.33 ? 162 SER A OG  1 
ATOM   1244 N N   . TYR A 1 163 ? 14.218  18.272 45.435 1.00 20.29 ? 163 TYR A N   1 
ATOM   1245 C CA  . TYR A 1 163 ? 12.889  17.795 45.782 1.00 19.86 ? 163 TYR A CA  1 
ATOM   1246 C C   . TYR A 1 163 ? 12.767  17.572 47.284 1.00 22.05 ? 163 TYR A C   1 
ATOM   1247 O O   . TYR A 1 163 ? 11.721  17.847 47.870 1.00 22.70 ? 163 TYR A O   1 
ATOM   1248 C CB  . TYR A 1 163 ? 12.591  16.475 45.073 1.00 18.24 ? 163 TYR A CB  1 
ATOM   1249 C CG  . TYR A 1 163 ? 12.565  16.557 43.562 1.00 19.00 ? 163 TYR A CG  1 
ATOM   1250 C CD1 . TYR A 1 163 ? 11.555  17.258 42.897 1.00 19.04 ? 163 TYR A CD1 1 
ATOM   1251 C CD2 . TYR A 1 163 ? 13.548  15.926 42.793 1.00 15.80 ? 163 TYR A CD2 1 
ATOM   1252 C CE1 . TYR A 1 163 ? 11.525  17.324 41.508 1.00 18.75 ? 163 TYR A CE1 1 
ATOM   1253 C CE2 . TYR A 1 163 ? 13.527  15.989 41.410 1.00 15.54 ? 163 TYR A CE2 1 
ATOM   1254 C CZ  . TYR A 1 163 ? 12.516  16.687 40.771 1.00 17.30 ? 163 TYR A CZ  1 
ATOM   1255 O OH  . TYR A 1 163 ? 12.492  16.753 39.398 1.00 14.63 ? 163 TYR A OH  1 
ATOM   1256 N N   . SER A 1 164 ? 13.829  17.075 47.915 1.00 22.45 ? 164 SER A N   1 
ATOM   1257 C CA  . SER A 1 164 ? 13.769  16.805 49.344 1.00 23.57 ? 164 SER A CA  1 
ATOM   1258 C C   . SER A 1 164 ? 15.115  16.533 49.995 1.00 25.16 ? 164 SER A C   1 
ATOM   1259 O O   . SER A 1 164 ? 16.134  16.417 49.314 1.00 27.41 ? 164 SER A O   1 
ATOM   1260 C CB  . SER A 1 164 ? 12.856  15.606 49.587 1.00 22.75 ? 164 SER A CB  1 
ATOM   1261 O OG  . SER A 1 164 ? 12.911  15.202 50.937 1.00 25.87 ? 164 SER A OG  1 
ATOM   1262 N N   . GLU A 1 165 ? 15.114  16.442 51.323 1.00 25.31 ? 165 GLU A N   1 
ATOM   1263 C CA  . GLU A 1 165 ? 16.334  16.134 52.063 1.00 26.05 ? 165 GLU A CA  1 
ATOM   1264 C C   . GLU A 1 165 ? 16.330  14.624 52.269 1.00 25.70 ? 165 GLU A C   1 
ATOM   1265 O O   . GLU A 1 165 ? 17.270  14.050 52.820 1.00 25.98 ? 165 GLU A O   1 
ATOM   1266 C CB  . GLU A 1 165 ? 16.345  16.833 53.425 1.00 26.29 ? 165 GLU A CB  1 
ATOM   1267 C CG  . GLU A 1 165 ? 15.206  16.413 54.341 1.00 27.57 ? 165 GLU A CG  1 
ATOM   1268 C CD  . GLU A 1 165 ? 15.260  17.096 55.693 1.00 27.41 ? 165 GLU A CD  1 
ATOM   1269 O OE1 . GLU A 1 165 ? 15.338  18.341 55.733 1.00 27.78 ? 165 GLU A OE1 1 
ATOM   1270 O OE2 . GLU A 1 165 ? 15.218  16.385 56.715 1.00 27.89 ? 165 GLU A OE2 1 
ATOM   1271 N N   . ASP A 1 166 ? 15.252  13.996 51.810 1.00 25.16 ? 166 ASP A N   1 
ATOM   1272 C CA  . ASP A 1 166 ? 15.054  12.557 51.922 1.00 25.91 ? 166 ASP A CA  1 
ATOM   1273 C C   . ASP A 1 166 ? 15.244  11.905 50.553 1.00 26.91 ? 166 ASP A C   1 
ATOM   1274 O O   . ASP A 1 166 ? 14.359  11.996 49.697 1.00 27.58 ? 166 ASP A O   1 
ATOM   1275 C CB  . ASP A 1 166 ? 13.637  12.287 52.429 1.00 25.63 ? 166 ASP A CB  1 
ATOM   1276 C CG  . ASP A 1 166 ? 13.326  10.814 52.537 1.00 26.82 ? 166 ASP A CG  1 
ATOM   1277 O OD1 . ASP A 1 166 ? 14.040  10.002 51.917 1.00 25.97 ? 166 ASP A OD1 1 
ATOM   1278 O OD2 . ASP A 1 166 ? 12.351  10.469 53.235 1.00 27.58 ? 166 ASP A OD2 1 
ATOM   1279 N N   . ARG A 1 167 ? 16.381  11.237 50.351 1.00 27.16 ? 167 ARG A N   1 
ATOM   1280 C CA  . ARG A 1 167 ? 16.663  10.596 49.071 1.00 27.01 ? 167 ARG A CA  1 
ATOM   1281 C C   . ARG A 1 167 ? 15.490  9.815  48.512 1.00 26.09 ? 167 ARG A C   1 
ATOM   1282 O O   . ARG A 1 167 ? 15.257  9.831  47.306 1.00 25.28 ? 167 ARG A O   1 
ATOM   1283 C CB  . ARG A 1 167 ? 17.899  9.688  49.159 1.00 29.39 ? 167 ARG A CB  1 
ATOM   1284 C CG  . ARG A 1 167 ? 18.134  8.990  50.491 1.00 34.34 ? 167 ARG A CG  1 
ATOM   1285 C CD  . ARG A 1 167 ? 17.183  7.833  50.785 1.00 36.86 ? 167 ARG A CD  1 
ATOM   1286 N NE  . ARG A 1 167 ? 17.326  6.703  49.868 1.00 39.92 ? 167 ARG A NE  1 
ATOM   1287 C CZ  . ARG A 1 167 ? 17.128  5.429  50.210 1.00 40.80 ? 167 ARG A CZ  1 
ATOM   1288 N NH1 . ARG A 1 167 ? 16.790  5.108  51.455 1.00 41.41 ? 167 ARG A NH1 1 
ATOM   1289 N NH2 . ARG A 1 167 ? 17.232  4.472  49.298 1.00 39.87 ? 167 ARG A NH2 1 
ATOM   1290 N N   . ARG A 1 168 ? 14.745  9.144  49.381 1.00 26.41 ? 168 ARG A N   1 
ATOM   1291 C CA  . ARG A 1 168 ? 13.592  8.370  48.938 1.00 27.32 ? 168 ARG A CA  1 
ATOM   1292 C C   . ARG A 1 168 ? 12.621  9.223  48.124 1.00 26.02 ? 168 ARG A C   1 
ATOM   1293 O O   . ARG A 1 168 ? 12.091  8.768  47.103 1.00 26.32 ? 168 ARG A O   1 
ATOM   1294 C CB  . ARG A 1 168 ? 12.880  7.736  50.138 1.00 29.92 ? 168 ARG A CB  1 
ATOM   1295 C CG  . ARG A 1 168 ? 13.589  6.485  50.655 1.00 36.54 ? 168 ARG A CG  1 
ATOM   1296 C CD  . ARG A 1 168 ? 13.070  6.016  52.012 1.00 41.85 ? 168 ARG A CD  1 
ATOM   1297 N NE  . ARG A 1 168 ? 13.325  7.001  53.063 1.00 48.62 ? 168 ARG A NE  1 
ATOM   1298 C CZ  . ARG A 1 168 ? 13.061  6.816  54.355 1.00 52.06 ? 168 ARG A CZ  1 
ATOM   1299 N NH1 . ARG A 1 168 ? 12.530  5.670  54.775 1.00 53.96 ? 168 ARG A NH1 1 
ATOM   1300 N NH2 . ARG A 1 168 ? 13.322  7.782  55.229 1.00 53.21 ? 168 ARG A NH2 1 
ATOM   1301 N N   . ILE A 1 169 ? 12.398  10.463 48.554 1.00 22.83 ? 169 ILE A N   1 
ATOM   1302 C CA  . ILE A 1 169 ? 11.496  11.342 47.823 1.00 20.57 ? 169 ILE A CA  1 
ATOM   1303 C C   . ILE A 1 169 ? 12.129  11.788 46.501 1.00 19.93 ? 169 ILE A C   1 
ATOM   1304 O O   . ILE A 1 169 ? 11.459  11.858 45.473 1.00 20.20 ? 169 ILE A O   1 
ATOM   1305 C CB  . ILE A 1 169 ? 11.112  12.575 48.671 1.00 20.49 ? 169 ILE A CB  1 
ATOM   1306 C CG1 . ILE A 1 169 ? 10.311  12.118 49.890 1.00 19.48 ? 169 ILE A CG1 1 
ATOM   1307 C CG2 . ILE A 1 169 ? 10.298  13.557 47.842 1.00 17.43 ? 169 ILE A CG2 1 
ATOM   1308 C CD1 . ILE A 1 169 ? 9.799   13.239 50.755 1.00 18.36 ? 169 ILE A CD1 1 
ATOM   1309 N N   . VAL A 1 170 ? 13.424  12.080 46.527 1.00 19.05 ? 170 VAL A N   1 
ATOM   1310 C CA  . VAL A 1 170 ? 14.118  12.499 45.320 1.00 18.60 ? 170 VAL A CA  1 
ATOM   1311 C C   . VAL A 1 170 ? 14.118  11.361 44.314 1.00 20.09 ? 170 VAL A C   1 
ATOM   1312 O O   . VAL A 1 170 ? 13.976  11.587 43.115 1.00 20.02 ? 170 VAL A O   1 
ATOM   1313 C CB  . VAL A 1 170 ? 15.573  12.897 45.612 1.00 16.66 ? 170 VAL A CB  1 
ATOM   1314 C CG1 . VAL A 1 170 ? 16.303  13.211 44.314 1.00 13.72 ? 170 VAL A CG1 1 
ATOM   1315 C CG2 . VAL A 1 170 ? 15.595  14.095 46.523 1.00 15.17 ? 170 VAL A CG2 1 
ATOM   1316 N N   . GLN A 1 171 ? 14.280  10.134 44.799 1.00 21.30 ? 171 GLN A N   1 
ATOM   1317 C CA  . GLN A 1 171 ? 14.286  8.985  43.904 1.00 21.82 ? 171 GLN A CA  1 
ATOM   1318 C C   . GLN A 1 171 ? 12.963  8.911  43.164 1.00 22.53 ? 171 GLN A C   1 
ATOM   1319 O O   . GLN A 1 171 ? 12.930  8.729  41.944 1.00 22.68 ? 171 GLN A O   1 
ATOM   1320 C CB  . GLN A 1 171 ? 14.480  7.684  44.678 1.00 20.54 ? 171 GLN A CB  1 
ATOM   1321 C CG  . GLN A 1 171 ? 15.750  7.626  45.487 1.00 22.82 ? 171 GLN A CG  1 
ATOM   1322 C CD  . GLN A 1 171 ? 15.987  6.259  46.080 1.00 23.15 ? 171 GLN A CD  1 
ATOM   1323 O OE1 . GLN A 1 171 ? 16.324  5.311  45.364 1.00 22.94 ? 171 GLN A OE1 1 
ATOM   1324 N NE2 . GLN A 1 171 ? 15.801  6.141  47.392 1.00 22.08 ? 171 GLN A NE2 1 
ATOM   1325 N N   . SER A 1 172 ? 11.873  9.058  43.911 1.00 22.00 ? 172 SER A N   1 
ATOM   1326 C CA  . SER A 1 172 ? 10.546  8.978  43.324 1.00 22.73 ? 172 SER A CA  1 
ATOM   1327 C C   . SER A 1 172 ? 10.294  10.053 42.281 1.00 23.15 ? 172 SER A C   1 
ATOM   1328 O O   . SER A 1 172 ? 9.551   9.820  41.332 1.00 24.27 ? 172 SER A O   1 
ATOM   1329 C CB  . SER A 1 172 ? 9.468   9.055  44.412 1.00 22.88 ? 172 SER A CB  1 
ATOM   1330 O OG  . SER A 1 172 ? 9.380   10.356 44.967 1.00 26.94 ? 172 SER A OG  1 
ATOM   1331 N N   . MET A 1 173 ? 10.910  11.222 42.441 1.00 22.40 ? 173 MET A N   1 
ATOM   1332 C CA  . MET A 1 173 ? 10.700  12.308 41.485 1.00 22.61 ? 173 MET A CA  1 
ATOM   1333 C C   . MET A 1 173 ? 11.496  12.191 40.187 1.00 21.18 ? 173 MET A C   1 
ATOM   1334 O O   . MET A 1 173 ? 11.368  13.038 39.304 1.00 21.58 ? 173 MET A O   1 
ATOM   1335 C CB  . MET A 1 173 ? 10.984  13.664 42.139 1.00 23.69 ? 173 MET A CB  1 
ATOM   1336 C CG  . MET A 1 173 ? 10.084  13.980 43.323 1.00 25.77 ? 173 MET A CG  1 
ATOM   1337 S SD  . MET A 1 173 ? 8.325   13.910 42.929 1.00 27.34 ? 173 MET A SD  1 
ATOM   1338 C CE  . MET A 1 173 ? 7.616   14.111 44.545 1.00 27.00 ? 173 MET A CE  1 
ATOM   1339 N N   . THR A 1 174 ? 12.313  11.149 40.066 1.00 20.34 ? 174 THR A N   1 
ATOM   1340 C CA  . THR A 1 174 ? 13.090  10.947 38.844 1.00 20.01 ? 174 THR A CA  1 
ATOM   1341 C C   . THR A 1 174 ? 12.116  10.631 37.709 1.00 19.86 ? 174 THR A C   1 
ATOM   1342 O O   . THR A 1 174 ? 12.516  10.385 36.570 1.00 19.19 ? 174 THR A O   1 
ATOM   1343 C CB  . THR A 1 174 ? 14.097  9.779  38.984 1.00 19.34 ? 174 THR A CB  1 
ATOM   1344 O OG1 . THR A 1 174 ? 13.390  8.559  39.247 1.00 18.55 ? 174 THR A OG1 1 
ATOM   1345 C CG2 . THR A 1 174 ? 15.077  10.054 40.115 1.00 18.23 ? 174 THR A CG2 1 
ATOM   1346 N N   . GLU A 1 175 ? 10.830  10.629 38.037 1.00 19.36 ? 175 GLU A N   1 
ATOM   1347 C CA  . GLU A 1 175 ? 9.806   10.366 37.043 1.00 20.29 ? 175 GLU A CA  1 
ATOM   1348 C C   . GLU A 1 175 ? 9.752   11.506 36.035 1.00 20.03 ? 175 GLU A C   1 
ATOM   1349 O O   . GLU A 1 175 ? 9.076   11.407 35.015 1.00 22.35 ? 175 GLU A O   1 
ATOM   1350 C CB  . GLU A 1 175 ? 8.446   10.193 37.717 1.00 18.94 ? 175 GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 175 ? 8.195   8.782  38.191 1.00 19.53 ? 175 GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 175 ? 8.105   7.805  37.033 1.00 21.48 ? 175 GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 175 ? 7.096   7.841  36.297 1.00 22.78 ? 175 GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 175 ? 9.050   7.006  36.849 1.00 22.93 ? 175 GLU A OE2 1 
ATOM   1355 N N   . LEU A 1 176 ? 10.461  12.591 36.323 1.00 18.48 ? 176 LEU A N   1 
ATOM   1356 C CA  . LEU A 1 176 ? 10.490  13.722 35.410 1.00 19.76 ? 176 LEU A CA  1 
ATOM   1357 C C   . LEU A 1 176 ? 11.222  13.266 34.154 1.00 21.02 ? 176 LEU A C   1 
ATOM   1358 O O   . LEU A 1 176 ? 10.896  13.689 33.044 1.00 22.49 ? 176 LEU A O   1 
ATOM   1359 C CB  . LEU A 1 176 ? 11.245  14.905 36.029 1.00 18.23 ? 176 LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 176 ? 11.342  16.171 35.167 1.00 17.12 ? 176 LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 176 ? 10.095  17.011 35.370 1.00 15.01 ? 176 LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 176 ? 12.589  16.980 35.543 1.00 16.48 ? 176 LEU A CD2 1 
ATOM   1363 N N   . ILE A 1 177 ? 12.211  12.397 34.336 1.00 20.65 ? 177 ILE A N   1 
ATOM   1364 C CA  . ILE A 1 177 ? 13.002  11.895 33.221 1.00 21.29 ? 177 ILE A CA  1 
ATOM   1365 C C   . ILE A 1 177 ? 12.158  11.217 32.136 1.00 23.03 ? 177 ILE A C   1 
ATOM   1366 O O   . ILE A 1 177 ? 12.258  11.565 30.959 1.00 23.45 ? 177 ILE A O   1 
ATOM   1367 C CB  . ILE A 1 177 ? 14.093  10.940 33.729 1.00 18.96 ? 177 ILE A CB  1 
ATOM   1368 C CG1 . ILE A 1 177 ? 15.071  11.727 34.606 1.00 16.52 ? 177 ILE A CG1 1 
ATOM   1369 C CG2 . ILE A 1 177 ? 14.808  10.282 32.559 1.00 16.75 ? 177 ILE A CG2 1 
ATOM   1370 C CD1 . ILE A 1 177 ? 16.077  10.868 35.337 1.00 16.07 ? 177 ILE A CD1 1 
ATOM   1371 N N   . PRO A 1 178 ? 11.325  10.235 32.509 1.00 24.92 ? 178 PRO A N   1 
ATOM   1372 C CA  . PRO A 1 178 ? 10.506  9.585  31.480 1.00 24.90 ? 178 PRO A CA  1 
ATOM   1373 C C   . PRO A 1 178 ? 9.530   10.599 30.881 1.00 25.10 ? 178 PRO A C   1 
ATOM   1374 O O   . PRO A 1 178 ? 9.027   10.419 29.771 1.00 24.72 ? 178 PRO A O   1 
ATOM   1375 C CB  . PRO A 1 178 ? 9.789   8.483  32.252 1.00 25.06 ? 178 PRO A CB  1 
ATOM   1376 C CG  . PRO A 1 178 ? 10.765  8.147  33.340 1.00 26.74 ? 178 PRO A CG  1 
ATOM   1377 C CD  . PRO A 1 178 ? 11.228  9.511  33.790 1.00 26.63 ? 178 PRO A CD  1 
ATOM   1378 N N   . GLY A 1 179 ? 9.260   11.664 31.632 1.00 24.73 ? 179 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 179 ? 8.366   12.699 31.147 1.00 23.72 ? 179 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 179 ? 9.066   13.474 30.048 1.00 23.01 ? 179 GLY A C   1 
ATOM   1381 O O   . GLY A 1 179 ? 8.500   13.732 28.984 1.00 22.73 ? 179 GLY A O   1 
ATOM   1382 N N   . LEU A 1 180 ? 10.320  13.826 30.310 1.00 21.58 ? 180 LEU A N   1 
ATOM   1383 C CA  . LEU A 1 180 ? 11.134  14.567 29.362 1.00 20.89 ? 180 LEU A CA  1 
ATOM   1384 C C   . LEU A 1 180 ? 11.580  13.735 28.166 1.00 21.61 ? 180 LEU A C   1 
ATOM   1385 O O   . LEU A 1 180 ? 11.482  14.177 27.024 1.00 24.11 ? 180 LEU A O   1 
ATOM   1386 C CB  . LEU A 1 180 ? 12.373  15.110 30.061 1.00 18.37 ? 180 LEU A CB  1 
ATOM   1387 C CG  . LEU A 1 180 ? 12.131  16.227 31.060 1.00 17.35 ? 180 LEU A CG  1 
ATOM   1388 C CD1 . LEU A 1 180 ? 13.361  16.408 31.934 1.00 18.22 ? 180 LEU A CD1 1 
ATOM   1389 C CD2 . LEU A 1 180 ? 11.796  17.498 30.306 1.00 16.32 ? 180 LEU A CD2 1 
ATOM   1390 N N   . GLN A 1 181 ? 12.072  12.529 28.421 1.00 21.21 ? 181 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 181 ? 12.566  11.690 27.337 1.00 21.31 ? 181 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 181 ? 11.540  10.725 26.766 1.00 22.07 ? 181 GLN A C   1 
ATOM   1393 O O   . GLN A 1 181 ? 11.638  10.319 25.608 1.00 22.02 ? 181 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 181 ? 13.794  10.909 27.812 1.00 20.63 ? 181 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 181 ? 14.823  11.768 28.541 1.00 19.07 ? 181 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 181 ? 16.125  11.035 28.803 1.00 19.98 ? 181 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 181 ? 16.126  9.908  29.292 1.00 19.77 ? 181 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 181 ? 17.241  11.678 28.485 1.00 18.03 ? 181 GLN A NE2 1 
ATOM   1399 N N   . GLY A 1 182 ? 10.549  10.373 27.575 1.00 22.51 ? 182 GLY A N   1 
ATOM   1400 C CA  . GLY A 1 182 ? 9.543   9.426  27.137 1.00 22.99 ? 182 GLY A CA  1 
ATOM   1401 C C   . GLY A 1 182 ? 9.863   8.116  27.825 1.00 24.09 ? 182 GLY A C   1 
ATOM   1402 O O   . GLY A 1 182 ? 11.000  7.900  28.241 1.00 23.75 ? 182 GLY A O   1 
ATOM   1403 N N   . ASP A 1 183 ? 8.877   7.239  27.959 1.00 26.04 ? 183 ASP A N   1 
ATOM   1404 C CA  . ASP A 1 183 ? 9.108   5.959  28.619 1.00 28.14 ? 183 ASP A CA  1 
ATOM   1405 C C   . ASP A 1 183 ? 9.990   5.017  27.820 1.00 28.13 ? 183 ASP A C   1 
ATOM   1406 O O   . ASP A 1 183 ? 9.868   4.924  26.602 1.00 29.06 ? 183 ASP A O   1 
ATOM   1407 C CB  . ASP A 1 183 ? 7.780   5.272  28.919 1.00 28.89 ? 183 ASP A CB  1 
ATOM   1408 C CG  . ASP A 1 183 ? 6.959   6.030  29.931 1.00 30.37 ? 183 ASP A CG  1 
ATOM   1409 O OD1 . ASP A 1 183 ? 7.492   6.314  31.028 1.00 30.71 ? 183 ASP A OD1 1 
ATOM   1410 O OD2 . ASP A 1 183 ? 5.786   6.340  29.629 1.00 31.91 ? 183 ASP A OD2 1 
ATOM   1411 N N   . VAL A 1 184 ? 10.882  4.323  28.518 1.00 29.33 ? 184 VAL A N   1 
ATOM   1412 C CA  . VAL A 1 184 ? 11.790  3.374  27.882 1.00 31.83 ? 184 VAL A CA  1 
ATOM   1413 C C   . VAL A 1 184 ? 11.059  2.061  27.619 1.00 34.88 ? 184 VAL A C   1 
ATOM   1414 O O   . VAL A 1 184 ? 10.150  1.690  28.365 1.00 35.36 ? 184 VAL A O   1 
ATOM   1415 C CB  . VAL A 1 184 ? 13.012  3.056  28.784 1.00 29.73 ? 184 VAL A CB  1 
ATOM   1416 C CG1 . VAL A 1 184 ? 13.770  4.330  29.124 1.00 28.62 ? 184 VAL A CG1 1 
ATOM   1417 C CG2 . VAL A 1 184 ? 12.549  2.359  30.058 1.00 28.34 ? 184 VAL A CG2 1 
ATOM   1418 N N   . PRO A 1 185 ? 11.445  1.340  26.553 1.00 37.98 ? 185 PRO A N   1 
ATOM   1419 C CA  . PRO A 1 185 ? 10.797  0.061  26.240 1.00 40.59 ? 185 PRO A CA  1 
ATOM   1420 C C   . PRO A 1 185 ? 10.898  -0.877 27.442 1.00 42.80 ? 185 PRO A C   1 
ATOM   1421 O O   . PRO A 1 185 ? 11.715  -0.658 28.336 1.00 42.58 ? 185 PRO A O   1 
ATOM   1422 C CB  . PRO A 1 185 ? 11.581  -0.435 25.024 1.00 40.40 ? 185 PRO A CB  1 
ATOM   1423 C CG  . PRO A 1 185 ? 12.925  0.213  25.183 1.00 40.02 ? 185 PRO A CG  1 
ATOM   1424 C CD  . PRO A 1 185 ? 12.548  1.607  25.617 1.00 39.05 ? 185 PRO A CD  1 
ATOM   1425 N N   . LYS A 1 186 ? 10.078  -1.920 27.471 1.00 46.09 ? 186 LYS A N   1 
ATOM   1426 C CA  . LYS A 1 186 ? 10.102  -2.825 28.612 1.00 49.52 ? 186 LYS A CA  1 
ATOM   1427 C C   . LYS A 1 186 ? 11.371  -3.669 28.712 1.00 49.79 ? 186 LYS A C   1 
ATOM   1428 O O   . LYS A 1 186 ? 11.769  -4.081 29.803 1.00 50.02 ? 186 LYS A O   1 
ATOM   1429 C CB  . LYS A 1 186 ? 8.860   -3.715 28.594 1.00 52.27 ? 186 LYS A CB  1 
ATOM   1430 C CG  . LYS A 1 186 ? 8.131   -3.736 29.940 1.00 57.40 ? 186 LYS A CG  1 
ATOM   1431 C CD  . LYS A 1 186 ? 6.626   -3.945 29.769 1.00 60.23 ? 186 LYS A CD  1 
ATOM   1432 C CE  . LYS A 1 186 ? 5.985   -2.785 29.004 1.00 61.59 ? 186 LYS A CE  1 
ATOM   1433 N NZ  . LYS A 1 186 ? 4.528   -2.998 28.750 1.00 62.76 ? 186 LYS A NZ  1 
ATOM   1434 N N   . ASP A 1 187 ? 12.013  -3.907 27.575 1.00 49.34 ? 187 ASP A N   1 
ATOM   1435 C CA  . ASP A 1 187 ? 13.247  -4.690 27.533 1.00 49.79 ? 187 ASP A CA  1 
ATOM   1436 C C   . ASP A 1 187 ? 14.434  -3.885 28.081 1.00 47.82 ? 187 ASP A C   1 
ATOM   1437 O O   . ASP A 1 187 ? 15.339  -4.433 28.709 1.00 47.94 ? 187 ASP A O   1 
ATOM   1438 C CB  . ASP A 1 187 ? 13.543  -5.082 26.087 1.00 52.51 ? 187 ASP A CB  1 
ATOM   1439 C CG  . ASP A 1 187 ? 13.767  -3.868 25.197 1.00 55.53 ? 187 ASP A CG  1 
ATOM   1440 O OD1 . ASP A 1 187 ? 14.840  -3.229 25.316 1.00 57.17 ? 187 ASP A OD1 1 
ATOM   1441 O OD2 . ASP A 1 187 ? 12.865  -3.543 24.392 1.00 56.28 ? 187 ASP A OD2 1 
ATOM   1442 N N   . PHE A 1 188 ? 14.407  -2.582 27.814 1.00 44.59 ? 188 PHE A N   1 
ATOM   1443 C CA  . PHE A 1 188 ? 15.435  -1.619 28.207 1.00 39.99 ? 188 PHE A CA  1 
ATOM   1444 C C   . PHE A 1 188 ? 16.466  -2.001 29.269 1.00 36.85 ? 188 PHE A C   1 
ATOM   1445 O O   . PHE A 1 188 ? 16.119  -2.452 30.356 1.00 36.77 ? 188 PHE A O   1 
ATOM   1446 C CB  . PHE A 1 188 ? 14.772  -0.315 28.641 1.00 38.63 ? 188 PHE A CB  1 
ATOM   1447 C CG  . PHE A 1 188 ? 15.693  0.858  28.597 1.00 37.62 ? 188 PHE A CG  1 
ATOM   1448 C CD1 . PHE A 1 188 ? 16.068  1.410  27.372 1.00 36.16 ? 188 PHE A CD1 1 
ATOM   1449 C CD2 . PHE A 1 188 ? 16.231  1.382  29.768 1.00 36.69 ? 188 PHE A CD2 1 
ATOM   1450 C CE1 . PHE A 1 188 ? 16.968  2.464  27.313 1.00 36.21 ? 188 PHE A CE1 1 
ATOM   1451 C CE2 . PHE A 1 188 ? 17.137  2.442  29.721 1.00 36.51 ? 188 PHE A CE2 1 
ATOM   1452 C CZ  . PHE A 1 188 ? 17.506  2.984  28.489 1.00 36.69 ? 188 PHE A CZ  1 
ATOM   1453 N N   . THR A 1 189 ? 17.737  -1.775 28.947 1.00 33.26 ? 189 THR A N   1 
ATOM   1454 C CA  . THR A 1 189 ? 18.848  -2.064 29.855 1.00 30.78 ? 189 THR A CA  1 
ATOM   1455 C C   . THR A 1 189 ? 19.199  -0.814 30.674 1.00 29.84 ? 189 THR A C   1 
ATOM   1456 O O   . THR A 1 189 ? 19.404  0.262  30.113 1.00 30.63 ? 189 THR A O   1 
ATOM   1457 C CB  . THR A 1 189 ? 20.122  -2.489 29.072 1.00 30.08 ? 189 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 189 ? 19.859  -3.671 28.303 1.00 28.76 ? 189 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 189 ? 21.264  -2.760 30.029 1.00 27.76 ? 189 THR A CG2 1 
ATOM   1460 N N   . SER A 1 190 ? 19.273  -0.946 31.993 1.00 27.61 ? 190 SER A N   1 
ATOM   1461 C CA  . SER A 1 190 ? 19.613  0.201  32.827 1.00 25.77 ? 190 SER A CA  1 
ATOM   1462 C C   . SER A 1 190 ? 20.973  0.726  32.410 1.00 26.89 ? 190 SER A C   1 
ATOM   1463 O O   . SER A 1 190 ? 21.894  -0.055 32.166 1.00 28.40 ? 190 SER A O   1 
ATOM   1464 C CB  . SER A 1 190 ? 19.662  -0.192 34.301 1.00 24.09 ? 190 SER A CB  1 
ATOM   1465 O OG  . SER A 1 190 ? 20.244  0.840  35.083 1.00 21.98 ? 190 SER A OG  1 
ATOM   1466 N N   . GLY A 1 191 ? 21.100  2.045  32.320 1.00 25.86 ? 191 GLY A N   1 
ATOM   1467 C CA  . GLY A 1 191 ? 22.371  2.628  31.936 1.00 24.24 ? 191 GLY A CA  1 
ATOM   1468 C C   . GLY A 1 191 ? 22.409  3.168  30.520 1.00 23.61 ? 191 GLY A C   1 
ATOM   1469 O O   . GLY A 1 191 ? 23.182  4.074  30.229 1.00 24.12 ? 191 GLY A O   1 
ATOM   1470 N N   . MET A 1 192 ? 21.588  2.618  29.634 1.00 22.26 ? 192 MET A N   1 
ATOM   1471 C CA  . MET A 1 192 ? 21.558  3.080  28.249 1.00 23.03 ? 192 MET A CA  1 
ATOM   1472 C C   . MET A 1 192 ? 20.793  4.390  28.136 1.00 22.38 ? 192 MET A C   1 
ATOM   1473 O O   . MET A 1 192 ? 19.869  4.640  28.903 1.00 23.53 ? 192 MET A O   1 
ATOM   1474 C CB  . MET A 1 192 ? 20.893  2.031  27.352 1.00 23.41 ? 192 MET A CB  1 
ATOM   1475 C CG  . MET A 1 192 ? 21.764  0.819  27.056 1.00 23.83 ? 192 MET A CG  1 
ATOM   1476 S SD  . MET A 1 192 ? 23.200  1.261  26.049 1.00 30.16 ? 192 MET A SD  1 
ATOM   1477 C CE  . MET A 1 192 ? 22.446  1.263  24.391 1.00 26.83 ? 192 MET A CE  1 
ATOM   1478 N N   . PRO A 1 193 ? 21.181  5.258  27.188 1.00 21.77 ? 193 PRO A N   1 
ATOM   1479 C CA  . PRO A 1 193 ? 20.468  6.528  27.039 1.00 20.69 ? 193 PRO A CA  1 
ATOM   1480 C C   . PRO A 1 193 ? 19.195  6.288  26.227 1.00 20.97 ? 193 PRO A C   1 
ATOM   1481 O O   . PRO A 1 193 ? 19.090  5.294  25.510 1.00 20.36 ? 193 PRO A O   1 
ATOM   1482 C CB  . PRO A 1 193 ? 21.483  7.402  26.309 1.00 19.48 ? 193 PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 193 ? 22.158  6.426  25.419 1.00 18.67 ? 193 PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 193 ? 22.376  5.226  26.326 1.00 20.78 ? 193 PRO A CD  1 
ATOM   1485 N N   . PHE A 1 194 ? 18.226  7.188  26.345 1.00 21.33 ? 194 PHE A N   1 
ATOM   1486 C CA  . PHE A 1 194 ? 16.974  7.038  25.612 1.00 20.32 ? 194 PHE A CA  1 
ATOM   1487 C C   . PHE A 1 194 ? 16.192  8.336  25.445 1.00 20.64 ? 194 PHE A C   1 
ATOM   1488 O O   . PHE A 1 194 ? 16.158  9.180  26.344 1.00 20.35 ? 194 PHE A O   1 
ATOM   1489 C CB  . PHE A 1 194 ? 16.068  6.030  26.314 1.00 19.59 ? 194 PHE A CB  1 
ATOM   1490 C CG  . PHE A 1 194 ? 14.730  5.881  25.661 1.00 20.21 ? 194 PHE A CG  1 
ATOM   1491 C CD1 . PHE A 1 194 ? 14.558  5.011  24.585 1.00 21.54 ? 194 PHE A CD1 1 
ATOM   1492 C CD2 . PHE A 1 194 ? 13.650  6.646  26.084 1.00 19.57 ? 194 PHE A CD2 1 
ATOM   1493 C CE1 . PHE A 1 194 ? 13.324  4.907  23.938 1.00 21.60 ? 194 PHE A CE1 1 
ATOM   1494 C CE2 . PHE A 1 194 ? 12.411  6.553  25.445 1.00 20.52 ? 194 PHE A CE2 1 
ATOM   1495 C CZ  . PHE A 1 194 ? 12.247  5.682  24.370 1.00 20.45 ? 194 PHE A CZ  1 
ATOM   1496 N N   . VAL A 1 195 ? 15.553  8.470  24.288 1.00 18.92 ? 195 VAL A N   1 
ATOM   1497 C CA  . VAL A 1 195 ? 14.721  9.620  23.964 1.00 19.43 ? 195 VAL A CA  1 
ATOM   1498 C C   . VAL A 1 195 ? 13.758  9.131  22.881 1.00 20.51 ? 195 VAL A C   1 
ATOM   1499 O O   . VAL A 1 195 ? 14.192  8.668  21.828 1.00 21.24 ? 195 VAL A O   1 
ATOM   1500 C CB  . VAL A 1 195 ? 15.553  10.806 23.429 1.00 19.01 ? 195 VAL A CB  1 
ATOM   1501 C CG1 . VAL A 1 195 ? 14.624  11.941 23.015 1.00 17.45 ? 195 VAL A CG1 1 
ATOM   1502 C CG2 . VAL A 1 195 ? 16.517  11.293 24.496 1.00 16.67 ? 195 VAL A CG2 1 
ATOM   1503 N N   . ALA A 1 196 ? 12.457  9.226  23.159 1.00 20.85 ? 196 ALA A N   1 
ATOM   1504 C CA  . ALA A 1 196 ? 11.404  8.765  22.251 1.00 21.10 ? 196 ALA A CA  1 
ATOM   1505 C C   . ALA A 1 196 ? 11.463  9.301  20.832 1.00 21.89 ? 196 ALA A C   1 
ATOM   1506 O O   . ALA A 1 196 ? 11.241  8.559  19.876 1.00 23.08 ? 196 ALA A O   1 
ATOM   1507 C CB  . ALA A 1 196 ? 10.041  9.071  22.840 1.00 19.87 ? 196 ALA A CB  1 
ATOM   1508 N N   . GLY A 1 197 ? 11.745  10.585 20.683 1.00 22.23 ? 197 GLY A N   1 
ATOM   1509 C CA  . GLY A 1 197 ? 11.798  11.137 19.349 1.00 22.62 ? 197 GLY A CA  1 
ATOM   1510 C C   . GLY A 1 197 ? 11.858  12.645 19.319 1.00 23.98 ? 197 GLY A C   1 
ATOM   1511 O O   . GLY A 1 197 ? 12.188  13.291 20.315 1.00 23.77 ? 197 GLY A O   1 
ATOM   1512 N N   . LYS A 1 198 ? 11.514  13.208 18.169 1.00 24.62 ? 198 LYS A N   1 
ATOM   1513 C CA  . LYS A 1 198 ? 11.569  14.646 17.981 1.00 25.86 ? 198 LYS A CA  1 
ATOM   1514 C C   . LYS A 1 198 ? 10.654  15.475 18.876 1.00 25.96 ? 198 LYS A C   1 
ATOM   1515 O O   . LYS A 1 198 ? 10.817  16.691 18.958 1.00 25.96 ? 198 LYS A O   1 
ATOM   1516 C CB  . LYS A 1 198 ? 11.292  14.987 16.520 1.00 26.44 ? 198 LYS A CB  1 
ATOM   1517 C CG  . LYS A 1 198 ? 9.908   14.626 16.048 1.00 26.81 ? 198 LYS A CG  1 
ATOM   1518 C CD  . LYS A 1 198 ? 9.676   15.192 14.667 1.00 30.25 ? 198 LYS A CD  1 
ATOM   1519 C CE  . LYS A 1 198 ? 8.246   14.978 14.213 1.00 33.71 ? 198 LYS A CE  1 
ATOM   1520 N NZ  . LYS A 1 198 ? 8.020   15.616 12.886 1.00 36.81 ? 198 LYS A NZ  1 
ATOM   1521 N N   . ASN A 1 199 ? 9.699   14.838 19.545 1.00 25.33 ? 199 ASN A N   1 
ATOM   1522 C CA  . ASN A 1 199 ? 8.792   15.583 20.415 1.00 26.55 ? 199 ASN A CA  1 
ATOM   1523 C C   . ASN A 1 199 ? 9.161   15.446 21.887 1.00 26.12 ? 199 ASN A C   1 
ATOM   1524 O O   . ASN A 1 199 ? 8.394   15.819 22.779 1.00 26.21 ? 199 ASN A O   1 
ATOM   1525 C CB  . ASN A 1 199 ? 7.349   15.140 20.163 1.00 28.16 ? 199 ASN A CB  1 
ATOM   1526 C CG  . ASN A 1 199 ? 6.815   15.654 18.832 1.00 31.14 ? 199 ASN A CG  1 
ATOM   1527 O OD1 . ASN A 1 199 ? 6.156   14.928 18.092 1.00 32.77 ? 199 ASN A OD1 1 
ATOM   1528 N ND2 . ASN A 1 199 ? 7.101   16.919 18.525 1.00 32.67 ? 199 ASN A ND2 1 
ATOM   1529 N N   . LYS A 1 200 ? 10.353  14.903 22.117 1.00 24.44 ? 200 LYS A N   1 
ATOM   1530 C CA  . LYS A 1 200 ? 10.895  14.714 23.452 1.00 21.89 ? 200 LYS A CA  1 
ATOM   1531 C C   . LYS A 1 200 ? 12.306  15.290 23.462 1.00 21.58 ? 200 LYS A C   1 
ATOM   1532 O O   . LYS A 1 200 ? 12.856  15.636 22.410 1.00 20.21 ? 200 LYS A O   1 
ATOM   1533 C CB  . LYS A 1 200 ? 10.936  13.228 23.814 1.00 20.97 ? 200 LYS A CB  1 
ATOM   1534 C CG  . LYS A 1 200 ? 9.563   12.594 23.990 1.00 20.10 ? 200 LYS A CG  1 
ATOM   1535 C CD  . LYS A 1 200 ? 8.793   13.242 25.128 1.00 17.72 ? 200 LYS A CD  1 
ATOM   1536 C CE  . LYS A 1 200 ? 7.509   12.487 25.419 1.00 17.69 ? 200 LYS A CE  1 
ATOM   1537 N NZ  . LYS A 1 200 ? 6.811   13.014 26.639 1.00 19.55 ? 200 LYS A NZ  1 
ATOM   1538 N N   . VAL A 1 201 ? 12.892  15.381 24.650 1.00 20.27 ? 201 VAL A N   1 
ATOM   1539 C CA  . VAL A 1 201 ? 14.230  15.929 24.795 1.00 19.12 ? 201 VAL A CA  1 
ATOM   1540 C C   . VAL A 1 201 ? 15.139  15.029 25.625 1.00 19.41 ? 201 VAL A C   1 
ATOM   1541 O O   . VAL A 1 201 ? 14.669  14.182 26.386 1.00 20.54 ? 201 VAL A O   1 
ATOM   1542 C CB  . VAL A 1 201 ? 14.183  17.319 25.479 1.00 18.42 ? 201 VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 201 ? 13.355  18.284 24.650 1.00 18.90 ? 201 VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 201 ? 13.602  17.190 26.878 1.00 16.35 ? 201 VAL A CG2 1 
ATOM   1545 N N   . ALA A 1 202 ? 16.446  15.218 25.462 1.00 18.10 ? 202 ALA A N   1 
ATOM   1546 C CA  . ALA A 1 202 ? 17.434  14.467 26.214 1.00 17.18 ? 202 ALA A CA  1 
ATOM   1547 C C   . ALA A 1 202 ? 17.447  15.112 27.591 1.00 16.60 ? 202 ALA A C   1 
ATOM   1548 O O   . ALA A 1 202 ? 17.385  16.339 27.702 1.00 16.39 ? 202 ALA A O   1 
ATOM   1549 C CB  . ALA A 1 202 ? 18.803  14.597 25.558 1.00 17.19 ? 202 ALA A CB  1 
ATOM   1550 N N   . ALA A 1 203 ? 17.523  14.293 28.633 1.00 15.42 ? 203 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 203 ? 17.528  14.800 29.999 1.00 15.07 ? 203 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 203 ? 18.936  14.816 30.580 1.00 16.40 ? 203 ALA A C   1 
ATOM   1553 O O   . ALA A 1 203 ? 19.878  14.317 29.967 1.00 18.43 ? 203 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 203 ? 16.608  13.953 30.872 1.00 13.37 ? 203 ALA A CB  1 
ATOM   1555 N N   . CYS A 1 204 ? 19.075  15.390 31.769 1.00 16.42 ? 204 CYS A N   1 
ATOM   1556 C CA  . CYS A 1 204 ? 20.373  15.474 32.417 1.00 16.82 ? 204 CYS A CA  1 
ATOM   1557 C C   . CYS A 1 204 ? 20.258  15.368 33.932 1.00 17.13 ? 204 CYS A C   1 
ATOM   1558 O O   . CYS A 1 204 ? 19.727  16.261 34.581 1.00 16.82 ? 204 CYS A O   1 
ATOM   1559 C CB  . CYS A 1 204 ? 21.052  16.798 32.043 1.00 17.76 ? 204 CYS A CB  1 
ATOM   1560 S SG  . CYS A 1 204 ? 22.684  17.067 32.786 1.00 19.00 ? 204 CYS A SG  1 
ATOM   1561 N N   . ALA A 1 205 ? 20.756  14.270 34.490 1.00 18.11 ? 205 ALA A N   1 
ATOM   1562 C CA  . ALA A 1 205 ? 20.725  14.072 35.933 1.00 19.32 ? 205 ALA A CA  1 
ATOM   1563 C C   . ALA A 1 205 ? 21.924  14.818 36.496 1.00 20.59 ? 205 ALA A C   1 
ATOM   1564 O O   . ALA A 1 205 ? 23.064  14.517 36.146 1.00 21.67 ? 205 ALA A O   1 
ATOM   1565 C CB  . ALA A 1 205 ? 20.820  12.596 36.261 1.00 19.82 ? 205 ALA A CB  1 
ATOM   1566 N N   . LYS A 1 206 ? 21.666  15.794 37.362 1.00 20.55 ? 206 LYS A N   1 
ATOM   1567 C CA  . LYS A 1 206 ? 22.740  16.597 37.937 1.00 22.18 ? 206 LYS A CA  1 
ATOM   1568 C C   . LYS A 1 206 ? 22.524  16.904 39.423 1.00 22.80 ? 206 LYS A C   1 
ATOM   1569 O O   . LYS A 1 206 ? 21.383  16.843 39.881 1.00 23.88 ? 206 LYS A O   1 
ATOM   1570 C CB  . LYS A 1 206 ? 22.871  17.910 37.147 1.00 21.21 ? 206 LYS A CB  1 
ATOM   1571 C CG  . LYS A 1 206 ? 21.626  18.788 37.198 1.00 20.23 ? 206 LYS A CG  1 
ATOM   1572 C CD  . LYS A 1 206 ? 21.781  20.072 36.398 1.00 19.24 ? 206 LYS A CD  1 
ATOM   1573 C CE  . LYS A 1 206 ? 20.626  21.021 36.698 1.00 18.53 ? 206 LYS A CE  1 
ATOM   1574 N NZ  . LYS A 1 206 ? 20.564  22.211 35.806 1.00 15.59 ? 206 LYS A NZ  1 
ATOM   1575 N N   . HIS A 1 207 ? 23.585  17.201 40.174 1.00 22.33 ? 207 HIS A N   1 
ATOM   1576 C CA  . HIS A 1 207 ? 24.976  17.259 39.732 1.00 21.36 ? 207 HIS A CA  1 
ATOM   1577 C C   . HIS A 1 207 ? 25.766  16.158 40.440 1.00 20.90 ? 207 HIS A C   1 
ATOM   1578 O O   . HIS A 1 207 ? 25.863  16.143 41.667 1.00 18.84 ? 207 HIS A O   1 
ATOM   1579 C CB  . HIS A 1 207 ? 25.584  18.627 40.039 1.00 19.92 ? 207 HIS A CB  1 
ATOM   1580 C CG  . HIS A 1 207 ? 24.714  19.775 39.639 1.00 21.21 ? 207 HIS A CG  1 
ATOM   1581 N ND1 . HIS A 1 207 ? 23.731  20.284 40.460 1.00 21.06 ? 207 HIS A ND1 1 
ATOM   1582 C CD2 . HIS A 1 207 ? 24.663  20.502 38.497 1.00 22.66 ? 207 HIS A CD2 1 
ATOM   1583 C CE1 . HIS A 1 207 ? 23.114  21.276 39.844 1.00 20.36 ? 207 HIS A CE1 1 
ATOM   1584 N NE2 . HIS A 1 207 ? 23.660  21.428 38.651 1.00 21.44 ? 207 HIS A NE2 1 
ATOM   1585 N N   . PHE A 1 208 ? 26.317  15.243 39.642 1.00 20.04 ? 208 PHE A N   1 
ATOM   1586 C CA  . PHE A 1 208 ? 27.082  14.096 40.119 1.00 20.60 ? 208 PHE A CA  1 
ATOM   1587 C C   . PHE A 1 208 ? 28.378  14.487 40.829 1.00 21.57 ? 208 PHE A C   1 
ATOM   1588 O O   . PHE A 1 208 ? 29.289  14.971 40.163 1.00 22.28 ? 208 PHE A O   1 
ATOM   1589 C CB  . PHE A 1 208 ? 27.404  13.177 38.935 1.00 20.36 ? 208 PHE A CB  1 
ATOM   1590 C CG  . PHE A 1 208 ? 27.935  11.827 39.333 1.00 21.33 ? 208 PHE A CG  1 
ATOM   1591 C CD1 . PHE A 1 208 ? 27.082  10.849 39.826 1.00 21.42 ? 208 PHE A CD1 1 
ATOM   1592 C CD2 . PHE A 1 208 ? 29.289  11.541 39.229 1.00 20.97 ? 208 PHE A CD2 1 
ATOM   1593 C CE1 . PHE A 1 208 ? 27.569  9.607  40.209 1.00 22.56 ? 208 PHE A CE1 1 
ATOM   1594 C CE2 . PHE A 1 208 ? 29.788  10.303 39.611 1.00 22.61 ? 208 PHE A CE2 1 
ATOM   1595 C CZ  . PHE A 1 208 ? 28.925  9.332  40.102 1.00 22.40 ? 208 PHE A CZ  1 
ATOM   1596 N N   . VAL A 1 209 ? 28.486  14.270 42.138 1.00 22.78 ? 209 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 209 ? 27.491  13.686 43.032 1.00 23.02 ? 209 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 209 ? 27.685  14.300 44.416 1.00 24.06 ? 209 VAL A C   1 
ATOM   1599 O O   . VAL A 1 209 ? 28.782  14.745 44.754 1.00 23.44 ? 209 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 209 ? 27.658  12.140 43.137 1.00 25.29 ? 209 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 209 ? 29.018  11.797 43.720 1.00 25.44 ? 209 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 209 ? 26.550  11.540 43.998 1.00 22.79 ? 209 VAL A CG2 1 
ATOM   1603 N N   . GLY A 1 210 ? 26.617  14.336 45.208 1.00 25.20 ? 210 GLY A N   1 
ATOM   1604 C CA  . GLY A 1 210 ? 26.707  14.889 46.550 1.00 23.94 ? 210 GLY A CA  1 
ATOM   1605 C C   . GLY A 1 210 ? 26.696  16.404 46.593 1.00 23.65 ? 210 GLY A C   1 
ATOM   1606 O O   . GLY A 1 210 ? 27.134  17.007 47.571 1.00 23.60 ? 210 GLY A O   1 
ATOM   1607 N N   . ASP A 1 211 ? 26.197  17.024 45.530 1.00 23.47 ? 211 ASP A N   1 
ATOM   1608 C CA  . ASP A 1 211 ? 26.128  18.478 45.462 1.00 23.99 ? 211 ASP A CA  1 
ATOM   1609 C C   . ASP A 1 211 ? 25.235  19.042 46.569 1.00 24.80 ? 211 ASP A C   1 
ATOM   1610 O O   . ASP A 1 211 ? 25.422  20.172 47.020 1.00 23.10 ? 211 ASP A O   1 
ATOM   1611 C CB  . ASP A 1 211 ? 25.626  18.916 44.076 1.00 23.70 ? 211 ASP A CB  1 
ATOM   1612 C CG  . ASP A 1 211 ? 24.383  18.152 43.617 1.00 23.43 ? 211 ASP A CG  1 
ATOM   1613 O OD1 . ASP A 1 211 ? 24.236  16.956 43.946 1.00 22.12 ? 211 ASP A OD1 1 
ATOM   1614 O OD2 . ASP A 1 211 ? 23.558  18.748 42.897 1.00 23.71 ? 211 ASP A OD2 1 
ATOM   1615 N N   . GLY A 1 212 ? 24.276  18.239 47.014 1.00 26.10 ? 212 GLY A N   1 
ATOM   1616 C CA  . GLY A 1 212 ? 23.383  18.678 48.065 1.00 28.97 ? 212 GLY A CA  1 
ATOM   1617 C C   . GLY A 1 212 ? 23.933  18.402 49.453 1.00 30.57 ? 212 GLY A C   1 
ATOM   1618 O O   . GLY A 1 212 ? 23.200  18.470 50.440 1.00 30.10 ? 212 GLY A O   1 
ATOM   1619 N N   . GLY A 1 213 ? 25.224  18.100 49.538 1.00 31.67 ? 213 GLY A N   1 
ATOM   1620 C CA  . GLY A 1 213 ? 25.814  17.816 50.832 1.00 33.69 ? 213 GLY A CA  1 
ATOM   1621 C C   . GLY A 1 213 ? 27.042  18.619 51.227 1.00 35.48 ? 213 GLY A C   1 
ATOM   1622 O O   . GLY A 1 213 ? 27.847  18.131 52.021 1.00 35.94 ? 213 GLY A O   1 
ATOM   1623 N N   . THR A 1 214 ? 27.209  19.833 50.700 1.00 36.39 ? 214 THR A N   1 
ATOM   1624 C CA  . THR A 1 214 ? 28.379  20.638 51.067 1.00 37.93 ? 214 THR A CA  1 
ATOM   1625 C C   . THR A 1 214 ? 28.208  21.180 52.484 1.00 39.22 ? 214 THR A C   1 
ATOM   1626 O O   . THR A 1 214 ? 27.083  21.406 52.938 1.00 39.90 ? 214 THR A O   1 
ATOM   1627 C CB  . THR A 1 214 ? 28.616  21.845 50.103 1.00 37.23 ? 214 THR A CB  1 
ATOM   1628 O OG1 . THR A 1 214 ? 27.502  22.745 50.160 1.00 37.65 ? 214 THR A OG1 1 
ATOM   1629 C CG2 . THR A 1 214 ? 28.827  21.361 48.672 1.00 34.72 ? 214 THR A CG2 1 
ATOM   1630 N N   . VAL A 1 215 ? 29.325  21.386 53.177 1.00 40.65 ? 215 VAL A N   1 
ATOM   1631 C CA  . VAL A 1 215 ? 29.301  21.892 54.546 1.00 41.03 ? 215 VAL A CA  1 
ATOM   1632 C C   . VAL A 1 215 ? 28.692  23.296 54.618 1.00 41.66 ? 215 VAL A C   1 
ATOM   1633 O O   . VAL A 1 215 ? 29.041  24.179 53.826 1.00 41.42 ? 215 VAL A O   1 
ATOM   1634 C CB  . VAL A 1 215 ? 30.733  21.897 55.164 1.00 40.39 ? 215 VAL A CB  1 
ATOM   1635 C CG1 . VAL A 1 215 ? 31.417  20.560 54.883 1.00 40.19 ? 215 VAL A CG1 1 
ATOM   1636 C CG2 . VAL A 1 215 ? 31.558  23.037 54.609 1.00 39.88 ? 215 VAL A CG2 1 
ATOM   1637 N N   . ASP A 1 216 ? 27.767  23.480 55.563 1.00 42.00 ? 216 ASP A N   1 
ATOM   1638 C CA  . ASP A 1 216 ? 27.080  24.757 55.769 1.00 42.69 ? 216 ASP A CA  1 
ATOM   1639 C C   . ASP A 1 216 ? 26.336  25.196 54.517 1.00 42.35 ? 216 ASP A C   1 
ATOM   1640 O O   . ASP A 1 216 ? 26.021  26.377 54.349 1.00 41.85 ? 216 ASP A O   1 
ATOM   1641 C CB  . ASP A 1 216 ? 28.083  25.833 56.175 1.00 44.81 ? 216 ASP A CB  1 
ATOM   1642 C CG  . ASP A 1 216 ? 28.773  25.509 57.477 1.00 47.08 ? 216 ASP A CG  1 
ATOM   1643 O OD1 . ASP A 1 216 ? 29.269  24.373 57.610 1.00 49.21 ? 216 ASP A OD1 1 
ATOM   1644 O OD2 . ASP A 1 216 ? 28.826  26.380 58.369 1.00 49.21 ? 216 ASP A OD2 1 
ATOM   1645 N N   . GLY A 1 217 ? 26.061  24.230 53.645 1.00 42.19 ? 217 GLY A N   1 
ATOM   1646 C CA  . GLY A 1 217 ? 25.360  24.512 52.407 1.00 41.16 ? 217 GLY A CA  1 
ATOM   1647 C C   . GLY A 1 217 ? 26.109  25.459 51.487 1.00 40.21 ? 217 GLY A C   1 
ATOM   1648 O O   . GLY A 1 217 ? 25.516  26.042 50.579 1.00 40.95 ? 217 GLY A O   1 
ATOM   1649 N N   . ILE A 1 218 ? 27.406  25.628 51.720 1.00 39.16 ? 218 ILE A N   1 
ATOM   1650 C CA  . ILE A 1 218 ? 28.204  26.513 50.880 1.00 38.05 ? 218 ILE A CA  1 
ATOM   1651 C C   . ILE A 1 218 ? 28.274  25.873 49.497 1.00 38.58 ? 218 ILE A C   1 
ATOM   1652 O O   . ILE A 1 218 ? 28.785  24.762 49.340 1.00 39.02 ? 218 ILE A O   1 
ATOM   1653 C CB  . ILE A 1 218 ? 29.627  26.688 51.446 1.00 36.93 ? 218 ILE A CB  1 
ATOM   1654 C CG1 . ILE A 1 218 ? 29.547  27.138 52.907 1.00 35.60 ? 218 ILE A CG1 1 
ATOM   1655 C CG2 . ILE A 1 218 ? 30.390  27.714 50.628 1.00 34.53 ? 218 ILE A CG2 1 
ATOM   1656 C CD1 . ILE A 1 218 ? 30.876  27.148 53.618 1.00 34.21 ? 218 ILE A CD1 1 
ATOM   1657 N N   . ASN A 1 219 ? 27.746  26.574 48.499 1.00 38.50 ? 219 ASN A N   1 
ATOM   1658 C CA  . ASN A 1 219 ? 27.719  26.063 47.133 1.00 39.04 ? 219 ASN A CA  1 
ATOM   1659 C C   . ASN A 1 219 ? 29.104  25.758 46.557 1.00 40.05 ? 219 ASN A C   1 
ATOM   1660 O O   . ASN A 1 219 ? 30.097  26.405 46.904 1.00 39.74 ? 219 ASN A O   1 
ATOM   1661 C CB  . ASN A 1 219 ? 27.000  27.054 46.212 1.00 37.17 ? 219 ASN A CB  1 
ATOM   1662 C CG  . ASN A 1 219 ? 26.643  26.445 44.866 1.00 36.80 ? 219 ASN A CG  1 
ATOM   1663 O OD1 . ASN A 1 219 ? 26.546  27.152 43.862 1.00 38.67 ? 219 ASN A OD1 1 
ATOM   1664 N ND2 . ASN A 1 219 ? 26.432  25.130 44.841 1.00 32.92 ? 219 ASN A ND2 1 
ATOM   1665 N N   . GLU A 1 220 ? 29.156  24.762 45.676 1.00 41.30 ? 220 GLU A N   1 
ATOM   1666 C CA  . GLU A 1 220 ? 30.399  24.371 45.022 1.00 43.43 ? 220 GLU A CA  1 
ATOM   1667 C C   . GLU A 1 220 ? 31.507  24.020 46.003 1.00 44.81 ? 220 GLU A C   1 
ATOM   1668 O O   . GLU A 1 220 ? 32.669  23.894 45.610 1.00 45.87 ? 220 GLU A O   1 
ATOM   1669 C CB  . GLU A 1 220 ? 30.876  25.500 44.103 1.00 43.27 ? 220 GLU A CB  1 
ATOM   1670 C CG  . GLU A 1 220 ? 29.904  25.816 42.980 1.00 46.34 ? 220 GLU A CG  1 
ATOM   1671 C CD  . GLU A 1 220 ? 30.315  27.024 42.164 1.00 47.81 ? 220 GLU A CD  1 
ATOM   1672 O OE1 . GLU A 1 220 ? 31.486  27.077 41.718 1.00 48.59 ? 220 GLU A OE1 1 
ATOM   1673 O OE2 . GLU A 1 220 ? 29.460  27.917 41.963 1.00 48.05 ? 220 GLU A OE2 1 
ATOM   1674 N N   . ASN A 1 221 ? 31.152  23.849 47.273 1.00 45.90 ? 221 ASN A N   1 
ATOM   1675 C CA  . ASN A 1 221 ? 32.147  23.537 48.293 1.00 46.56 ? 221 ASN A CA  1 
ATOM   1676 C C   . ASN A 1 221 ? 32.478  22.052 48.427 1.00 45.37 ? 221 ASN A C   1 
ATOM   1677 O O   . ASN A 1 221 ? 32.289  21.267 47.495 1.00 45.14 ? 221 ASN A O   1 
ATOM   1678 C CB  . ASN A 1 221 ? 31.698  24.077 49.653 1.00 49.73 ? 221 ASN A CB  1 
ATOM   1679 C CG  . ASN A 1 221 ? 32.837  24.709 50.426 1.00 52.90 ? 221 ASN A CG  1 
ATOM   1680 O OD1 . ASN A 1 221 ? 32.772  24.844 51.647 1.00 53.80 ? 221 ASN A OD1 1 
ATOM   1681 N ND2 . ASN A 1 221 ? 33.880  25.113 49.707 1.00 56.10 ? 221 ASN A ND2 1 
ATOM   1682 N N   . ASN A 1 222 ? 32.974  21.678 49.602 1.00 44.21 ? 222 ASN A N   1 
ATOM   1683 C CA  . ASN A 1 222 ? 33.360  20.302 49.871 1.00 43.89 ? 222 ASN A CA  1 
ATOM   1684 C C   . ASN A 1 222 ? 32.306  19.534 50.662 1.00 43.14 ? 222 ASN A C   1 
ATOM   1685 O O   . ASN A 1 222 ? 31.748  20.039 51.634 1.00 42.73 ? 222 ASN A O   1 
ATOM   1686 C CB  . ASN A 1 222 ? 34.705  20.286 50.611 1.00 43.69 ? 222 ASN A CB  1 
ATOM   1687 C CG  . ASN A 1 222 ? 35.180  18.880 50.940 1.00 43.76 ? 222 ASN A CG  1 
ATOM   1688 O OD1 . ASN A 1 222 ? 35.017  17.955 50.145 1.00 43.87 ? 222 ASN A OD1 1 
ATOM   1689 N ND2 . ASN A 1 222 ? 35.787  18.719 52.112 1.00 43.96 ? 222 ASN A ND2 1 
ATOM   1690 N N   . THR A 1 223 ? 32.033  18.312 50.220 1.00 42.45 ? 223 THR A N   1 
ATOM   1691 C CA  . THR A 1 223 ? 31.062  17.447 50.879 1.00 42.87 ? 223 THR A CA  1 
ATOM   1692 C C   . THR A 1 223 ? 31.846  16.431 51.696 1.00 43.69 ? 223 THR A C   1 
ATOM   1693 O O   . THR A 1 223 ? 32.376  15.460 51.149 1.00 44.34 ? 223 THR A O   1 
ATOM   1694 C CB  . THR A 1 223 ? 30.189  16.687 49.852 1.00 41.94 ? 223 THR A CB  1 
ATOM   1695 O OG1 . THR A 1 223 ? 29.395  17.624 49.114 1.00 42.61 ? 223 THR A OG1 1 
ATOM   1696 C CG2 . THR A 1 223 ? 29.277  15.683 50.552 1.00 40.02 ? 223 THR A CG2 1 
ATOM   1697 N N   . ILE A 1 224 ? 31.924  16.659 53.003 1.00 43.70 ? 224 ILE A N   1 
ATOM   1698 C CA  . ILE A 1 224 ? 32.661  15.761 53.884 1.00 43.50 ? 224 ILE A CA  1 
ATOM   1699 C C   . ILE A 1 224 ? 31.748  14.667 54.430 1.00 43.83 ? 224 ILE A C   1 
ATOM   1700 O O   . ILE A 1 224 ? 30.873  14.931 55.255 1.00 44.80 ? 224 ILE A O   1 
ATOM   1701 C CB  . ILE A 1 224 ? 33.298  16.550 55.049 1.00 42.38 ? 224 ILE A CB  1 
ATOM   1702 C CG1 . ILE A 1 224 ? 34.218  17.637 54.485 1.00 40.52 ? 224 ILE A CG1 1 
ATOM   1703 C CG2 . ILE A 1 224 ? 34.086  15.614 55.945 1.00 41.40 ? 224 ILE A CG2 1 
ATOM   1704 C CD1 . ILE A 1 224 ? 34.788  18.557 55.528 1.00 38.60 ? 224 ILE A CD1 1 
ATOM   1705 N N   . ILE A 1 225 ? 31.960  13.438 53.964 1.00 43.61 ? 225 ILE A N   1 
ATOM   1706 C CA  . ILE A 1 225 ? 31.145  12.301 54.385 1.00 43.75 ? 225 ILE A CA  1 
ATOM   1707 C C   . ILE A 1 225 ? 31.766  11.014 53.865 1.00 44.75 ? 225 ILE A C   1 
ATOM   1708 O O   . ILE A 1 225 ? 32.406  11.016 52.817 1.00 44.48 ? 225 ILE A O   1 
ATOM   1709 C CB  . ILE A 1 225 ? 29.708  12.411 53.823 1.00 43.20 ? 225 ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 225 ? 28.866  11.222 54.287 1.00 42.99 ? 225 ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 225 ? 29.745  12.453 52.293 1.00 43.13 ? 225 ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 225 ? 27.413  11.299 53.850 1.00 42.18 ? 225 ILE A CD1 1 
ATOM   1713 N N   . ASN A 1 226 ? 31.582  9.914  54.589 1.00 46.53 ? 226 ASN A N   1 
ATOM   1714 C CA  . ASN A 1 226 ? 32.147  8.642  54.152 1.00 47.16 ? 226 ASN A CA  1 
ATOM   1715 C C   . ASN A 1 226 ? 31.393  8.103  52.938 1.00 46.79 ? 226 ASN A C   1 
ATOM   1716 O O   . ASN A 1 226 ? 30.282  8.541  52.641 1.00 45.99 ? 226 ASN A O   1 
ATOM   1717 C CB  . ASN A 1 226 ? 32.120  7.611  55.287 1.00 47.49 ? 226 ASN A CB  1 
ATOM   1718 C CG  . ASN A 1 226 ? 30.730  7.391  55.853 1.00 49.10 ? 226 ASN A CG  1 
ATOM   1719 O OD1 . ASN A 1 226 ? 29.744  7.347  55.120 1.00 49.74 ? 226 ASN A OD1 1 
ATOM   1720 N ND2 . ASN A 1 226 ? 30.649  7.232  57.167 1.00 50.06 ? 226 ASN A ND2 1 
ATOM   1721 N N   . ARG A 1 227 ? 32.008  7.155  52.238 1.00 47.07 ? 227 ARG A N   1 
ATOM   1722 C CA  . ARG A 1 227 ? 31.396  6.558  51.057 1.00 47.87 ? 227 ARG A CA  1 
ATOM   1723 C C   . ARG A 1 227 ? 30.091  5.868  51.439 1.00 48.23 ? 227 ARG A C   1 
ATOM   1724 O O   . ARG A 1 227 ? 29.281  5.532  50.577 1.00 48.76 ? 227 ARG A O   1 
ATOM   1725 C CB  . ARG A 1 227 ? 32.363  5.553  50.415 1.00 47.88 ? 227 ARG A CB  1 
ATOM   1726 C CG  . ARG A 1 227 ? 31.808  4.818  49.200 1.00 49.47 ? 227 ARG A CG  1 
ATOM   1727 C CD  . ARG A 1 227 ? 32.796  3.781  48.666 1.00 49.70 ? 227 ARG A CD  1 
ATOM   1728 N NE  . ARG A 1 227 ? 32.105  2.638  48.067 1.00 51.26 ? 227 ARG A NE  1 
ATOM   1729 C CZ  . ARG A 1 227 ? 31.959  2.437  46.760 1.00 51.91 ? 227 ARG A CZ  1 
ATOM   1730 N NH1 . ARG A 1 227 ? 32.463  3.304  45.891 1.00 51.47 ? 227 ARG A NH1 1 
ATOM   1731 N NH2 . ARG A 1 227 ? 31.298  1.368  46.323 1.00 51.56 ? 227 ARG A NH2 1 
ATOM   1732 N N   . GLU A 1 228 ? 29.897  5.659  52.737 1.00 48.72 ? 228 GLU A N   1 
ATOM   1733 C CA  . GLU A 1 228 ? 28.688  5.018  53.247 1.00 47.97 ? 228 GLU A CA  1 
ATOM   1734 C C   . GLU A 1 228 ? 27.499  5.955  53.054 1.00 45.86 ? 228 GLU A C   1 
ATOM   1735 O O   . GLU A 1 228 ? 26.460  5.556  52.532 1.00 44.23 ? 228 GLU A O   1 
ATOM   1736 C CB  . GLU A 1 228 ? 28.855  4.704  54.737 1.00 51.82 ? 228 GLU A CB  1 
ATOM   1737 C CG  . GLU A 1 228 ? 27.599  4.177  55.431 1.00 57.37 ? 228 GLU A CG  1 
ATOM   1738 C CD  . GLU A 1 228 ? 27.345  2.704  55.153 1.00 60.67 ? 228 GLU A CD  1 
ATOM   1739 O OE1 . GLU A 1 228 ? 27.267  2.330  53.959 1.00 62.78 ? 228 GLU A OE1 1 
ATOM   1740 O OE2 . GLU A 1 228 ? 27.224  1.923  56.129 1.00 60.67 ? 228 GLU A OE2 1 
ATOM   1741 N N   . GLY A 1 229 ? 27.668  7.203  53.482 1.00 43.91 ? 229 GLY A N   1 
ATOM   1742 C CA  . GLY A 1 229 ? 26.611  8.190  53.360 1.00 42.25 ? 229 GLY A CA  1 
ATOM   1743 C C   . GLY A 1 229 ? 26.494  8.721  51.948 1.00 41.44 ? 229 GLY A C   1 
ATOM   1744 O O   . GLY A 1 229 ? 25.405  9.066  51.486 1.00 41.42 ? 229 GLY A O   1 
ATOM   1745 N N   . LEU A 1 230 ? 27.627  8.793  51.261 1.00 39.85 ? 230 LEU A N   1 
ATOM   1746 C CA  . LEU A 1 230 ? 27.652  9.266  49.886 1.00 38.83 ? 230 LEU A CA  1 
ATOM   1747 C C   . LEU A 1 230 ? 26.748  8.335  49.089 1.00 37.88 ? 230 LEU A C   1 
ATOM   1748 O O   . LEU A 1 230 ? 25.864  8.778  48.356 1.00 37.34 ? 230 LEU A O   1 
ATOM   1749 C CB  . LEU A 1 230 ? 29.092  9.217  49.348 1.00 39.66 ? 230 LEU A CB  1 
ATOM   1750 C CG  . LEU A 1 230 ? 29.488  9.689  47.938 1.00 40.10 ? 230 LEU A CG  1 
ATOM   1751 C CD1 . LEU A 1 230 ? 28.959  8.719  46.895 1.00 40.78 ? 230 LEU A CD1 1 
ATOM   1752 C CD2 . LEU A 1 230 ? 28.972  11.101 47.693 1.00 40.42 ? 230 LEU A CD2 1 
ATOM   1753 N N   . MET A 1 231 ? 26.963  7.037  49.275 1.00 37.46 ? 231 MET A N   1 
ATOM   1754 C CA  . MET A 1 231 ? 26.207  6.006  48.578 1.00 36.98 ? 231 MET A CA  1 
ATOM   1755 C C   . MET A 1 231 ? 24.809  5.790  49.138 1.00 35.88 ? 231 MET A C   1 
ATOM   1756 O O   . MET A 1 231 ? 23.923  5.312  48.436 1.00 35.62 ? 231 MET A O   1 
ATOM   1757 C CB  . MET A 1 231 ? 26.975  4.685  48.626 1.00 38.12 ? 231 MET A CB  1 
ATOM   1758 C CG  . MET A 1 231 ? 28.358  4.736  47.993 1.00 40.08 ? 231 MET A CG  1 
ATOM   1759 S SD  . MET A 1 231 ? 28.303  5.052  46.221 1.00 41.91 ? 231 MET A SD  1 
ATOM   1760 C CE  . MET A 1 231 ? 27.049  3.886  45.769 1.00 42.97 ? 231 MET A CE  1 
ATOM   1761 N N   . ASN A 1 232 ? 24.613  6.140  50.401 1.00 36.04 ? 232 ASN A N   1 
ATOM   1762 C CA  . ASN A 1 232 ? 23.318  5.964  51.045 1.00 36.14 ? 232 ASN A CA  1 
ATOM   1763 C C   . ASN A 1 232 ? 22.361  7.131  50.810 1.00 34.17 ? 232 ASN A C   1 
ATOM   1764 O O   . ASN A 1 232 ? 21.153  6.936  50.642 1.00 32.38 ? 232 ASN A O   1 
ATOM   1765 C CB  . ASN A 1 232 ? 23.519  5.759  52.551 1.00 41.00 ? 232 ASN A CB  1 
ATOM   1766 C CG  . ASN A 1 232 ? 22.206  5.596  53.303 1.00 44.98 ? 232 ASN A CG  1 
ATOM   1767 O OD1 . ASN A 1 232 ? 21.390  4.735  52.964 1.00 46.54 ? 232 ASN A OD1 1 
ATOM   1768 N ND2 . ASN A 1 232 ? 21.997  6.422  54.334 1.00 45.59 ? 232 ASN A ND2 1 
ATOM   1769 N N   . ILE A 1 233 ? 22.911  8.342  50.792 1.00 32.85 ? 233 ILE A N   1 
ATOM   1770 C CA  . ILE A 1 233 ? 22.107  9.542  50.606 1.00 30.40 ? 233 ILE A CA  1 
ATOM   1771 C C   . ILE A 1 233 ? 22.119  10.170 49.213 1.00 29.99 ? 233 ILE A C   1 
ATOM   1772 O O   . ILE A 1 233 ? 21.075  10.268 48.568 1.00 30.79 ? 233 ILE A O   1 
ATOM   1773 C CB  . ILE A 1 233 ? 22.516  10.648 51.610 1.00 28.84 ? 233 ILE A CB  1 
ATOM   1774 C CG1 . ILE A 1 233 ? 22.329  10.151 53.045 1.00 27.94 ? 233 ILE A CG1 1 
ATOM   1775 C CG2 . ILE A 1 233 ? 21.684  11.905 51.374 1.00 25.43 ? 233 ILE A CG2 1 
ATOM   1776 C CD1 . ILE A 1 233 ? 22.869  11.109 54.098 1.00 24.31 ? 233 ILE A CD1 1 
ATOM   1777 N N   . HIS A 1 234 ? 23.289  10.587 48.742 1.00 27.80 ? 234 HIS A N   1 
ATOM   1778 C CA  . HIS A 1 234 ? 23.362  11.268 47.457 1.00 26.68 ? 234 HIS A CA  1 
ATOM   1779 C C   . HIS A 1 234 ? 23.454  10.440 46.187 1.00 26.36 ? 234 HIS A C   1 
ATOM   1780 O O   . HIS A 1 234 ? 23.301  10.983 45.096 1.00 28.46 ? 234 HIS A O   1 
ATOM   1781 C CB  . HIS A 1 234 ? 24.518  12.264 47.469 1.00 25.09 ? 234 HIS A CB  1 
ATOM   1782 C CG  . HIS A 1 234 ? 24.588  13.088 48.713 1.00 25.02 ? 234 HIS A CG  1 
ATOM   1783 N ND1 . HIS A 1 234 ? 25.303  12.697 49.823 1.00 25.47 ? 234 HIS A ND1 1 
ATOM   1784 C CD2 . HIS A 1 234 ? 24.016  14.273 49.031 1.00 25.99 ? 234 HIS A CD2 1 
ATOM   1785 C CE1 . HIS A 1 234 ? 25.170  13.607 50.772 1.00 25.22 ? 234 HIS A CE1 1 
ATOM   1786 N NE2 . HIS A 1 234 ? 24.394  14.573 50.317 1.00 25.65 ? 234 HIS A NE2 1 
ATOM   1787 N N   . MET A 1 235 ? 23.685  9.140  46.306 1.00 25.22 ? 235 MET A N   1 
ATOM   1788 C CA  . MET A 1 235 ? 23.824  8.308  45.117 1.00 23.44 ? 235 MET A CA  1 
ATOM   1789 C C   . MET A 1 235 ? 22.554  7.627  44.588 1.00 23.75 ? 235 MET A C   1 
ATOM   1790 O O   . MET A 1 235 ? 22.349  7.564  43.379 1.00 25.86 ? 235 MET A O   1 
ATOM   1791 C CB  . MET A 1 235 ? 24.909  7.259  45.366 1.00 22.36 ? 235 MET A CB  1 
ATOM   1792 C CG  . MET A 1 235 ? 25.330  6.453  44.144 1.00 23.00 ? 235 MET A CG  1 
ATOM   1793 S SD  . MET A 1 235 ? 26.105  7.428  42.834 1.00 23.15 ? 235 MET A SD  1 
ATOM   1794 C CE  . MET A 1 235 ? 27.717  7.817  43.608 1.00 20.26 ? 235 MET A CE  1 
ATOM   1795 N N   . PRO A 1 236 ? 21.684  7.119  45.478 1.00 23.37 ? 236 PRO A N   1 
ATOM   1796 C CA  . PRO A 1 236 ? 20.451  6.442  45.061 1.00 22.83 ? 236 PRO A CA  1 
ATOM   1797 C C   . PRO A 1 236 ? 19.744  6.937  43.795 1.00 23.41 ? 236 PRO A C   1 
ATOM   1798 O O   . PRO A 1 236 ? 19.655  6.208  42.809 1.00 24.08 ? 236 PRO A O   1 
ATOM   1799 C CB  . PRO A 1 236 ? 19.579  6.546  46.304 1.00 23.32 ? 236 PRO A CB  1 
ATOM   1800 C CG  . PRO A 1 236 ? 20.587  6.332  47.392 1.00 22.45 ? 236 PRO A CG  1 
ATOM   1801 C CD  . PRO A 1 236 ? 21.742  7.215  46.951 1.00 23.13 ? 236 PRO A CD  1 
ATOM   1802 N N   . ALA A 1 237 ? 19.242  8.166  43.826 1.00 23.99 ? 237 ALA A N   1 
ATOM   1803 C CA  . ALA A 1 237 ? 18.530  8.749  42.687 1.00 23.62 ? 237 ALA A CA  1 
ATOM   1804 C C   . ALA A 1 237 ? 19.197  8.512  41.321 1.00 23.12 ? 237 ALA A C   1 
ATOM   1805 O O   . ALA A 1 237 ? 18.511  8.377  40.299 1.00 21.57 ? 237 ALA A O   1 
ATOM   1806 C CB  . ALA A 1 237 ? 18.335  10.254 42.921 1.00 23.62 ? 237 ALA A CB  1 
ATOM   1807 N N   . TYR A 1 238 ? 20.527  8.473  41.305 1.00 21.74 ? 238 TYR A N   1 
ATOM   1808 C CA  . TYR A 1 238 ? 21.261  8.256  40.065 1.00 21.72 ? 238 TYR A CA  1 
ATOM   1809 C C   . TYR A 1 238 ? 21.014  6.862  39.514 1.00 23.47 ? 238 TYR A C   1 
ATOM   1810 O O   . TYR A 1 238 ? 20.902  6.676  38.302 1.00 23.25 ? 238 TYR A O   1 
ATOM   1811 C CB  . TYR A 1 238 ? 22.753  8.499  40.287 1.00 19.79 ? 238 TYR A CB  1 
ATOM   1812 C CG  . TYR A 1 238 ? 23.095  9.971  40.270 1.00 20.14 ? 238 TYR A CG  1 
ATOM   1813 C CD1 . TYR A 1 238 ? 23.173  10.672 39.068 1.00 19.66 ? 238 TYR A CD1 1 
ATOM   1814 C CD2 . TYR A 1 238 ? 23.270  10.682 41.456 1.00 20.20 ? 238 TYR A CD2 1 
ATOM   1815 C CE1 . TYR A 1 238 ? 23.412  12.046 39.046 1.00 19.49 ? 238 TYR A CE1 1 
ATOM   1816 C CE2 . TYR A 1 238 ? 23.508  12.056 41.448 1.00 18.49 ? 238 TYR A CE2 1 
ATOM   1817 C CZ  . TYR A 1 238 ? 23.577  12.731 40.239 1.00 19.39 ? 238 TYR A CZ  1 
ATOM   1818 O OH  . TYR A 1 238 ? 23.797  14.088 40.226 1.00 17.48 ? 238 TYR A OH  1 
ATOM   1819 N N   . LYS A 1 239 ? 20.917  5.885  40.409 1.00 24.55 ? 239 LYS A N   1 
ATOM   1820 C CA  . LYS A 1 239 ? 20.660  4.517  39.994 1.00 25.56 ? 239 LYS A CA  1 
ATOM   1821 C C   . LYS A 1 239 ? 19.287  4.462  39.337 1.00 25.25 ? 239 LYS A C   1 
ATOM   1822 O O   . LYS A 1 239 ? 19.069  3.693  38.400 1.00 25.13 ? 239 LYS A O   1 
ATOM   1823 C CB  . LYS A 1 239 ? 20.710  3.576  41.200 1.00 27.86 ? 239 LYS A CB  1 
ATOM   1824 C CG  . LYS A 1 239 ? 20.134  2.188  40.932 1.00 31.98 ? 239 LYS A CG  1 
ATOM   1825 C CD  . LYS A 1 239 ? 20.873  1.441  39.821 1.00 34.47 ? 239 LYS A CD  1 
ATOM   1826 C CE  . LYS A 1 239 ? 20.171  0.125  39.496 1.00 35.33 ? 239 LYS A CE  1 
ATOM   1827 N NZ  . LYS A 1 239 ? 20.913  -0.676 38.486 1.00 37.91 ? 239 LYS A NZ  1 
ATOM   1828 N N   . ASN A 1 240 ? 18.364  5.284  39.828 1.00 24.90 ? 240 ASN A N   1 
ATOM   1829 C CA  . ASN A 1 240 ? 17.015  5.334  39.267 1.00 25.52 ? 240 ASN A CA  1 
ATOM   1830 C C   . ASN A 1 240 ? 17.072  5.969  37.877 1.00 25.18 ? 240 ASN A C   1 
ATOM   1831 O O   . ASN A 1 240 ? 16.366  5.544  36.955 1.00 24.41 ? 240 ASN A O   1 
ATOM   1832 C CB  . ASN A 1 240 ? 16.084  6.161  40.156 1.00 26.23 ? 240 ASN A CB  1 
ATOM   1833 C CG  . ASN A 1 240 ? 16.013  5.641  41.577 1.00 28.08 ? 240 ASN A CG  1 
ATOM   1834 O OD1 . ASN A 1 240 ? 16.949  5.803  42.363 1.00 30.80 ? 240 ASN A OD1 1 
ATOM   1835 N ND2 . ASN A 1 240 ? 14.899  5.013  41.915 1.00 25.74 ? 240 ASN A ND2 1 
ATOM   1836 N N   . ALA A 1 241 ? 17.913  6.992  37.736 1.00 23.50 ? 241 ALA A N   1 
ATOM   1837 C CA  . ALA A 1 241 ? 18.060  7.667  36.456 1.00 23.01 ? 241 ALA A CA  1 
ATOM   1838 C C   . ALA A 1 241 ? 18.599  6.670  35.439 1.00 22.87 ? 241 ALA A C   1 
ATOM   1839 O O   . ALA A 1 241 ? 18.201  6.685  34.277 1.00 22.87 ? 241 ALA A O   1 
ATOM   1840 C CB  . ALA A 1 241 ? 19.000  8.853  36.589 1.00 23.01 ? 241 ALA A CB  1 
ATOM   1841 N N   . MET A 1 242 ? 19.502  5.800  35.879 1.00 22.03 ? 242 MET A N   1 
ATOM   1842 C CA  . MET A 1 242 ? 20.068  4.793  34.994 1.00 22.48 ? 242 MET A CA  1 
ATOM   1843 C C   . MET A 1 242 ? 18.958  3.873  34.483 1.00 23.14 ? 242 MET A C   1 
ATOM   1844 O O   . MET A 1 242 ? 18.909  3.559  33.297 1.00 22.55 ? 242 MET A O   1 
ATOM   1845 C CB  . MET A 1 242 ? 21.117  3.956  35.729 1.00 24.33 ? 242 MET A CB  1 
ATOM   1846 C CG  . MET A 1 242 ? 22.318  4.731  36.254 1.00 26.71 ? 242 MET A CG  1 
ATOM   1847 S SD  . MET A 1 242 ? 23.363  5.444  34.962 1.00 29.47 ? 242 MET A SD  1 
ATOM   1848 C CE  . MET A 1 242 ? 22.775  7.125  34.953 1.00 26.31 ? 242 MET A CE  1 
ATOM   1849 N N   . ASP A 1 243 ? 18.068  3.446  35.381 1.00 23.59 ? 243 ASP A N   1 
ATOM   1850 C CA  . ASP A 1 243 ? 16.965  2.556  35.012 1.00 23.70 ? 243 ASP A CA  1 
ATOM   1851 C C   . ASP A 1 243 ? 15.958  3.230  34.103 1.00 23.73 ? 243 ASP A C   1 
ATOM   1852 O O   . ASP A 1 243 ? 15.254  2.567  33.346 1.00 24.54 ? 243 ASP A O   1 
ATOM   1853 C CB  . ASP A 1 243 ? 16.198  2.066  36.240 1.00 24.53 ? 243 ASP A CB  1 
ATOM   1854 C CG  . ASP A 1 243 ? 17.082  1.419  37.267 1.00 26.57 ? 243 ASP A CG  1 
ATOM   1855 O OD1 . ASP A 1 243 ? 18.147  0.877  36.901 1.00 26.94 ? 243 ASP A OD1 1 
ATOM   1856 O OD2 . ASP A 1 243 ? 16.692  1.441  38.451 1.00 27.77 ? 243 ASP A OD2 1 
ATOM   1857 N N   . LYS A 1 244 ? 15.865  4.549  34.188 1.00 23.33 ? 244 LYS A N   1 
ATOM   1858 C CA  . LYS A 1 244 ? 14.907  5.259  33.363 1.00 21.94 ? 244 LYS A CA  1 
ATOM   1859 C C   . LYS A 1 244 ? 15.529  5.837  32.097 1.00 21.64 ? 244 LYS A C   1 
ATOM   1860 O O   . LYS A 1 244 ? 14.901  6.617  31.375 1.00 22.06 ? 244 LYS A O   1 
ATOM   1861 C CB  . LYS A 1 244 ? 14.224  6.322  34.211 1.00 21.89 ? 244 LYS A CB  1 
ATOM   1862 C CG  . LYS A 1 244 ? 13.563  5.695  35.422 1.00 21.35 ? 244 LYS A CG  1 
ATOM   1863 C CD  . LYS A 1 244 ? 12.749  6.677  36.217 1.00 23.36 ? 244 LYS A CD  1 
ATOM   1864 C CE  . LYS A 1 244 ? 12.169  6.000  37.442 1.00 22.34 ? 244 LYS A CE  1 
ATOM   1865 N NZ  . LYS A 1 244 ? 11.334  6.935  38.239 1.00 23.32 ? 244 LYS A NZ  1 
ATOM   1866 N N   . GLY A 1 245 ? 16.769  5.431  31.837 1.00 20.29 ? 245 GLY A N   1 
ATOM   1867 C CA  . GLY A 1 245 ? 17.479  5.856  30.645 1.00 18.00 ? 245 GLY A CA  1 
ATOM   1868 C C   . GLY A 1 245 ? 17.886  7.306  30.516 1.00 16.67 ? 245 GLY A C   1 
ATOM   1869 O O   . GLY A 1 245 ? 17.879  7.843  29.412 1.00 15.63 ? 245 GLY A O   1 
ATOM   1870 N N   . VAL A 1 246 ? 18.252  7.947  31.617 1.00 16.26 ? 246 VAL A N   1 
ATOM   1871 C CA  . VAL A 1 246 ? 18.657  9.340  31.536 1.00 17.47 ? 246 VAL A CA  1 
ATOM   1872 C C   . VAL A 1 246 ? 19.794  9.426  30.512 1.00 18.52 ? 246 VAL A C   1 
ATOM   1873 O O   . VAL A 1 246 ? 20.792  8.715  30.618 1.00 20.61 ? 246 VAL A O   1 
ATOM   1874 C CB  . VAL A 1 246 ? 19.102  9.875  32.921 1.00 16.91 ? 246 VAL A CB  1 
ATOM   1875 C CG1 . VAL A 1 246 ? 20.434  9.269  33.331 1.00 15.14 ? 246 VAL A CG1 1 
ATOM   1876 C CG2 . VAL A 1 246 ? 19.169  11.391 32.891 1.00 17.68 ? 246 VAL A CG2 1 
ATOM   1877 N N   . SER A 1 247 ? 19.625  10.282 29.506 1.00 19.30 ? 247 SER A N   1 
ATOM   1878 C CA  . SER A 1 247 ? 20.614  10.437 28.435 1.00 19.12 ? 247 SER A CA  1 
ATOM   1879 C C   . SER A 1 247 ? 21.987  10.967 28.839 1.00 19.47 ? 247 SER A C   1 
ATOM   1880 O O   . SER A 1 247 ? 23.009  10.458 28.372 1.00 19.38 ? 247 SER A O   1 
ATOM   1881 C CB  . SER A 1 247 ? 20.049  11.316 27.314 1.00 17.73 ? 247 SER A CB  1 
ATOM   1882 O OG  . SER A 1 247 ? 19.035  10.636 26.595 1.00 16.74 ? 247 SER A OG  1 
ATOM   1883 N N   . THR A 1 248 ? 22.022  11.983 29.694 1.00 17.96 ? 248 THR A N   1 
ATOM   1884 C CA  . THR A 1 248 ? 23.297  12.550 30.120 1.00 17.73 ? 248 THR A CA  1 
ATOM   1885 C C   . THR A 1 248 ? 23.374  12.742 31.627 1.00 18.60 ? 248 THR A C   1 
ATOM   1886 O O   . THR A 1 248 ? 22.383  12.586 32.339 1.00 20.91 ? 248 THR A O   1 
ATOM   1887 C CB  . THR A 1 248 ? 23.545  13.927 29.467 1.00 16.86 ? 248 THR A CB  1 
ATOM   1888 O OG1 . THR A 1 248 ? 22.610  14.882 29.995 1.00 16.76 ? 248 THR A OG1 1 
ATOM   1889 C CG2 . THR A 1 248 ? 23.385  13.835 27.963 1.00 13.34 ? 248 THR A CG2 1 
ATOM   1890 N N   . VAL A 1 249 ? 24.566  13.092 32.096 1.00 17.87 ? 249 VAL A N   1 
ATOM   1891 C CA  . VAL A 1 249 ? 24.819  13.349 33.505 1.00 16.52 ? 249 VAL A CA  1 
ATOM   1892 C C   . VAL A 1 249 ? 25.826  14.490 33.583 1.00 17.47 ? 249 VAL A C   1 
ATOM   1893 O O   . VAL A 1 249 ? 26.860  14.457 32.919 1.00 17.73 ? 249 VAL A O   1 
ATOM   1894 C CB  . VAL A 1 249 ? 25.417  12.112 34.212 1.00 16.31 ? 249 VAL A CB  1 
ATOM   1895 C CG1 . VAL A 1 249 ? 25.927  12.492 35.593 1.00 12.65 ? 249 VAL A CG1 1 
ATOM   1896 C CG2 . VAL A 1 249 ? 24.371  11.020 34.320 1.00 15.39 ? 249 VAL A CG2 1 
ATOM   1897 N N   . MET A 1 250 ? 25.515  15.503 34.383 1.00 18.33 ? 250 MET A N   1 
ATOM   1898 C CA  . MET A 1 250 ? 26.406  16.644 34.548 1.00 17.61 ? 250 MET A CA  1 
ATOM   1899 C C   . MET A 1 250 ? 27.160  16.502 35.862 1.00 19.46 ? 250 MET A C   1 
ATOM   1900 O O   . MET A 1 250 ? 26.583  16.117 36.879 1.00 20.43 ? 250 MET A O   1 
ATOM   1901 C CB  . MET A 1 250 ? 25.608  17.942 34.557 1.00 15.62 ? 250 MET A CB  1 
ATOM   1902 C CG  . MET A 1 250 ? 26.468  19.183 34.606 1.00 15.39 ? 250 MET A CG  1 
ATOM   1903 S SD  . MET A 1 250 ? 25.486  20.682 34.500 1.00 16.16 ? 250 MET A SD  1 
ATOM   1904 C CE  . MET A 1 250 ? 24.546  20.357 33.022 1.00 16.02 ? 250 MET A CE  1 
ATOM   1905 N N   . ILE A 1 251 ? 28.450  16.811 35.838 1.00 20.22 ? 251 ILE A N   1 
ATOM   1906 C CA  . ILE A 1 251 ? 29.272  16.715 37.033 1.00 21.20 ? 251 ILE A CA  1 
ATOM   1907 C C   . ILE A 1 251 ? 29.180  17.986 37.872 1.00 22.07 ? 251 ILE A C   1 
ATOM   1908 O O   . ILE A 1 251 ? 29.103  19.095 37.342 1.00 22.68 ? 251 ILE A O   1 
ATOM   1909 C CB  . ILE A 1 251 ? 30.747  16.452 36.662 1.00 22.34 ? 251 ILE A CB  1 
ATOM   1910 C CG1 . ILE A 1 251 ? 30.831  15.224 35.749 1.00 21.54 ? 251 ILE A CG1 1 
ATOM   1911 C CG2 . ILE A 1 251 ? 31.581  16.247 37.922 1.00 19.31 ? 251 ILE A CG2 1 
ATOM   1912 C CD1 . ILE A 1 251 ? 30.144  13.985 36.318 1.00 21.42 ? 251 ILE A CD1 1 
ATOM   1913 N N   . SER A 1 252 ? 29.194  17.806 39.188 1.00 22.84 ? 252 SER A N   1 
ATOM   1914 C CA  . SER A 1 252 ? 29.099  18.900 40.146 1.00 23.33 ? 252 SER A CA  1 
ATOM   1915 C C   . SER A 1 252 ? 30.408  19.669 40.340 1.00 24.96 ? 252 SER A C   1 
ATOM   1916 O O   . SER A 1 252 ? 31.493  19.106 40.187 1.00 25.89 ? 252 SER A O   1 
ATOM   1917 C CB  . SER A 1 252 ? 28.640  18.333 41.491 1.00 22.81 ? 252 SER A CB  1 
ATOM   1918 O OG  . SER A 1 252 ? 28.689  19.307 42.514 1.00 22.08 ? 252 SER A OG  1 
ATOM   1919 N N   . TYR A 1 253 ? 30.295  20.955 40.676 1.00 25.97 ? 253 TYR A N   1 
ATOM   1920 C CA  . TYR A 1 253 ? 31.464  21.803 40.935 1.00 27.21 ? 253 TYR A CA  1 
ATOM   1921 C C   . TYR A 1 253 ? 32.060  21.385 42.271 1.00 26.72 ? 253 TYR A C   1 
ATOM   1922 O O   . TYR A 1 253 ? 33.244  21.592 42.526 1.00 27.04 ? 253 TYR A O   1 
ATOM   1923 C CB  . TYR A 1 253 ? 31.081  23.276 41.106 1.00 29.52 ? 253 TYR A CB  1 
ATOM   1924 C CG  . TYR A 1 253 ? 30.598  24.024 39.892 1.00 34.40 ? 253 TYR A CG  1 
ATOM   1925 C CD1 . TYR A 1 253 ? 31.426  24.221 38.785 1.00 37.50 ? 253 TYR A CD1 1 
ATOM   1926 C CD2 . TYR A 1 253 ? 29.336  24.620 39.886 1.00 36.37 ? 253 TYR A CD2 1 
ATOM   1927 C CE1 . TYR A 1 253 ? 31.009  25.004 37.699 1.00 39.77 ? 253 TYR A CE1 1 
ATOM   1928 C CE2 . TYR A 1 253 ? 28.909  25.402 38.815 1.00 39.43 ? 253 TYR A CE2 1 
ATOM   1929 C CZ  . TYR A 1 253 ? 29.748  25.594 37.725 1.00 40.47 ? 253 TYR A CZ  1 
ATOM   1930 O OH  . TYR A 1 253 ? 29.327  26.395 36.685 1.00 41.93 ? 253 TYR A OH  1 
ATOM   1931 N N   . SER A 1 254 ? 31.213  20.828 43.132 1.00 26.20 ? 254 SER A N   1 
ATOM   1932 C CA  . SER A 1 254 ? 31.624  20.424 44.468 1.00 26.96 ? 254 SER A CA  1 
ATOM   1933 C C   . SER A 1 254 ? 32.668  19.322 44.513 1.00 27.79 ? 254 SER A C   1 
ATOM   1934 O O   . SER A 1 254 ? 32.985  18.690 43.505 1.00 28.12 ? 254 SER A O   1 
ATOM   1935 C CB  . SER A 1 254 ? 30.400  20.018 45.310 1.00 25.01 ? 254 SER A CB  1 
ATOM   1936 O OG  . SER A 1 254 ? 29.682  18.938 44.741 1.00 24.10 ? 254 SER A OG  1 
ATOM   1937 N N   . SER A 1 255 ? 33.208  19.113 45.705 1.00 28.44 ? 255 SER A N   1 
ATOM   1938 C CA  . SER A 1 255 ? 34.215  18.095 45.915 1.00 30.47 ? 255 SER A CA  1 
ATOM   1939 C C   . SER A 1 255 ? 33.672  17.077 46.897 1.00 31.52 ? 255 SER A C   1 
ATOM   1940 O O   . SER A 1 255 ? 32.665  17.319 47.559 1.00 33.31 ? 255 SER A O   1 
ATOM   1941 C CB  . SER A 1 255 ? 35.485  18.722 46.486 1.00 29.15 ? 255 SER A CB  1 
ATOM   1942 O OG  . SER A 1 255 ? 35.979  19.742 45.640 1.00 30.66 ? 255 SER A OG  1 
ATOM   1943 N N   . TRP A 1 256 ? 34.338  15.933 46.978 1.00 33.64 ? 256 TRP A N   1 
ATOM   1944 C CA  . TRP A 1 256 ? 33.954  14.878 47.905 1.00 35.09 ? 256 TRP A CA  1 
ATOM   1945 C C   . TRP A 1 256 ? 35.207  14.485 48.683 1.00 35.98 ? 256 TRP A C   1 
ATOM   1946 O O   . TRP A 1 256 ? 36.117  13.847 48.144 1.00 36.72 ? 256 TRP A O   1 
ATOM   1947 C CB  . TRP A 1 256 ? 33.403  13.677 47.152 1.00 35.52 ? 256 TRP A CB  1 
ATOM   1948 C CG  . TRP A 1 256 ? 33.069  12.541 48.045 1.00 38.07 ? 256 TRP A CG  1 
ATOM   1949 C CD1 . TRP A 1 256 ? 32.251  12.569 49.136 1.00 38.06 ? 256 TRP A CD1 1 
ATOM   1950 C CD2 . TRP A 1 256 ? 33.532  11.188 47.921 1.00 39.58 ? 256 TRP A CD2 1 
ATOM   1951 N NE1 . TRP A 1 256 ? 32.172  11.317 49.700 1.00 39.47 ? 256 TRP A NE1 1 
ATOM   1952 C CE2 . TRP A 1 256 ? 32.949  10.450 48.975 1.00 39.56 ? 256 TRP A CE2 1 
ATOM   1953 C CE3 . TRP A 1 256 ? 34.381  10.526 47.018 1.00 39.26 ? 256 TRP A CE3 1 
ATOM   1954 C CZ2 . TRP A 1 256 ? 33.190  9.077  49.156 1.00 40.03 ? 256 TRP A CZ2 1 
ATOM   1955 C CZ3 . TRP A 1 256 ? 34.619  9.160  47.197 1.00 38.85 ? 256 TRP A CZ3 1 
ATOM   1956 C CH2 . TRP A 1 256 ? 34.024  8.454  48.259 1.00 39.10 ? 256 TRP A CH2 1 
ATOM   1957 N N   . ASN A 1 257 ? 35.247  14.874 49.951 1.00 35.31 ? 257 ASN A N   1 
ATOM   1958 C CA  . ASN A 1 257 ? 36.396  14.594 50.795 1.00 36.40 ? 257 ASN A CA  1 
ATOM   1959 C C   . ASN A 1 257 ? 37.638  15.232 50.193 1.00 36.51 ? 257 ASN A C   1 
ATOM   1960 O O   . ASN A 1 257 ? 38.693  14.600 50.100 1.00 36.65 ? 257 ASN A O   1 
ATOM   1961 C CB  . ASN A 1 257 ? 36.612  13.088 50.957 1.00 36.83 ? 257 ASN A CB  1 
ATOM   1962 C CG  . ASN A 1 257 ? 35.524  12.430 51.788 1.00 39.92 ? 257 ASN A CG  1 
ATOM   1963 O OD1 . ASN A 1 257 ? 35.091  12.971 52.816 1.00 40.00 ? 257 ASN A OD1 1 
ATOM   1964 N ND2 . ASN A 1 257 ? 35.080  11.250 51.355 1.00 39.89 ? 257 ASN A ND2 1 
ATOM   1965 N N   . GLY A 1 258 ? 37.490  16.484 49.764 1.00 35.97 ? 258 GLY A N   1 
ATOM   1966 C CA  . GLY A 1 258 ? 38.606  17.225 49.200 1.00 34.43 ? 258 GLY A CA  1 
ATOM   1967 C C   . GLY A 1 258 ? 38.920  17.047 47.726 1.00 33.69 ? 258 GLY A C   1 
ATOM   1968 O O   . GLY A 1 258 ? 39.744  17.788 47.189 1.00 34.52 ? 258 GLY A O   1 
ATOM   1969 N N   . VAL A 1 259 ? 38.282  16.084 47.064 1.00 32.16 ? 259 VAL A N   1 
ATOM   1970 C CA  . VAL A 1 259 ? 38.541  15.852 45.642 1.00 30.67 ? 259 VAL A CA  1 
ATOM   1971 C C   . VAL A 1 259 ? 37.482  16.477 44.737 1.00 29.74 ? 259 VAL A C   1 
ATOM   1972 O O   . VAL A 1 259 ? 36.291  16.218 44.896 1.00 30.98 ? 259 VAL A O   1 
ATOM   1973 C CB  . VAL A 1 259 ? 38.603  14.344 45.323 1.00 30.63 ? 259 VAL A CB  1 
ATOM   1974 C CG1 . VAL A 1 259 ? 38.943  14.141 43.849 1.00 27.73 ? 259 VAL A CG1 1 
ATOM   1975 C CG2 . VAL A 1 259 ? 39.624  13.662 46.224 1.00 28.30 ? 259 VAL A CG2 1 
ATOM   1976 N N   . LYS A 1 260 ? 37.917  17.296 43.786 1.00 27.11 ? 260 LYS A N   1 
ATOM   1977 C CA  . LYS A 1 260 ? 36.988  17.932 42.859 1.00 25.13 ? 260 LYS A CA  1 
ATOM   1978 C C   . LYS A 1 260 ? 36.270  16.841 42.066 1.00 25.64 ? 260 LYS A C   1 
ATOM   1979 O O   . LYS A 1 260 ? 36.923  15.921 41.564 1.00 26.76 ? 260 LYS A O   1 
ATOM   1980 C CB  . LYS A 1 260 ? 37.753  18.843 41.896 1.00 23.34 ? 260 LYS A CB  1 
ATOM   1981 C CG  . LYS A 1 260 ? 38.341  20.089 42.534 1.00 23.06 ? 260 LYS A CG  1 
ATOM   1982 C CD  . LYS A 1 260 ? 37.251  21.062 42.957 1.00 24.42 ? 260 LYS A CD  1 
ATOM   1983 C CE  . LYS A 1 260 ? 37.837  22.372 43.458 1.00 24.53 ? 260 LYS A CE  1 
ATOM   1984 N NZ  . LYS A 1 260 ? 36.775  23.311 43.914 1.00 25.53 ? 260 LYS A NZ  1 
ATOM   1985 N N   . MET A 1 261 ? 34.941  16.925 41.957 1.00 23.62 ? 261 MET A N   1 
ATOM   1986 C CA  . MET A 1 261 ? 34.191  15.920 41.200 1.00 22.70 ? 261 MET A CA  1 
ATOM   1987 C C   . MET A 1 261 ? 34.659  15.868 39.742 1.00 23.57 ? 261 MET A C   1 
ATOM   1988 O O   . MET A 1 261 ? 34.800  14.793 39.156 1.00 22.28 ? 261 MET A O   1 
ATOM   1989 C CB  . MET A 1 261 ? 32.688  16.213 41.242 1.00 22.09 ? 261 MET A CB  1 
ATOM   1990 C CG  . MET A 1 261 ? 31.968  15.701 42.483 1.00 22.44 ? 261 MET A CG  1 
ATOM   1991 S SD  . MET A 1 261 ? 32.271  13.930 42.827 1.00 22.29 ? 261 MET A SD  1 
ATOM   1992 C CE  . MET A 1 261 ? 31.714  13.146 41.314 1.00 21.22 ? 261 MET A CE  1 
ATOM   1993 N N   . HIS A 1 262 ? 34.904  17.043 39.168 1.00 23.88 ? 262 HIS A N   1 
ATOM   1994 C CA  . HIS A 1 262 ? 35.359  17.160 37.785 1.00 24.74 ? 262 HIS A CA  1 
ATOM   1995 C C   . HIS A 1 262 ? 36.709  16.500 37.559 1.00 25.54 ? 262 HIS A C   1 
ATOM   1996 O O   . HIS A 1 262 ? 37.233  16.522 36.443 1.00 25.23 ? 262 HIS A O   1 
ATOM   1997 C CB  . HIS A 1 262 ? 35.456  18.632 37.386 1.00 24.26 ? 262 HIS A CB  1 
ATOM   1998 C CG  . HIS A 1 262 ? 34.134  19.267 37.110 1.00 24.70 ? 262 HIS A CG  1 
ATOM   1999 N ND1 . HIS A 1 262 ? 33.716  19.588 35.837 1.00 26.59 ? 262 HIS A ND1 1 
ATOM   2000 C CD2 . HIS A 1 262 ? 33.115  19.599 37.935 1.00 24.77 ? 262 HIS A CD2 1 
ATOM   2001 C CE1 . HIS A 1 262 ? 32.495  20.088 35.889 1.00 26.68 ? 262 HIS A CE1 1 
ATOM   2002 N NE2 . HIS A 1 262 ? 32.107  20.105 37.151 1.00 26.07 ? 262 HIS A NE2 1 
ATOM   2003 N N   . ALA A 1 263 ? 37.276  15.922 38.614 1.00 25.20 ? 263 ALA A N   1 
ATOM   2004 C CA  . ALA A 1 263 ? 38.572  15.261 38.506 1.00 25.92 ? 263 ALA A CA  1 
ATOM   2005 C C   . ALA A 1 263 ? 38.577  13.902 39.203 1.00 27.09 ? 263 ALA A C   1 
ATOM   2006 O O   . ALA A 1 263 ? 39.625  13.267 39.330 1.00 28.47 ? 263 ALA A O   1 
ATOM   2007 C CB  . ALA A 1 263 ? 39.664  16.154 39.090 1.00 23.25 ? 263 ALA A CB  1 
ATOM   2008 N N   . ASN A 1 264 ? 37.409  13.450 39.649 1.00 27.03 ? 264 ASN A N   1 
ATOM   2009 C CA  . ASN A 1 264 ? 37.322  12.168 40.334 1.00 26.79 ? 264 ASN A CA  1 
ATOM   2010 C C   . ASN A 1 264 ? 37.069  11.023 39.367 1.00 27.05 ? 264 ASN A C   1 
ATOM   2011 O O   . ASN A 1 264 ? 35.925  10.728 39.015 1.00 25.68 ? 264 ASN A O   1 
ATOM   2012 C CB  . ASN A 1 264 ? 36.211  12.191 41.381 1.00 27.56 ? 264 ASN A CB  1 
ATOM   2013 C CG  . ASN A 1 264 ? 36.260  10.987 42.302 1.00 27.73 ? 264 ASN A CG  1 
ATOM   2014 O OD1 . ASN A 1 264 ? 36.454  9.853  41.857 1.00 30.09 ? 264 ASN A OD1 1 
ATOM   2015 N ND2 . ASN A 1 264 ? 36.076  11.227 43.593 1.00 26.80 ? 264 ASN A ND2 1 
ATOM   2016 N N   . GLN A 1 265 ? 38.148  10.371 38.953 1.00 28.49 ? 265 GLN A N   1 
ATOM   2017 C CA  . GLN A 1 265 ? 38.062  9.251  38.027 1.00 29.48 ? 265 GLN A CA  1 
ATOM   2018 C C   . GLN A 1 265 ? 37.401  8.026  38.648 1.00 30.95 ? 265 GLN A C   1 
ATOM   2019 O O   . GLN A 1 265 ? 36.793  7.220  37.941 1.00 30.48 ? 265 GLN A O   1 
ATOM   2020 C CB  . GLN A 1 265 ? 39.457  8.883  37.544 1.00 29.39 ? 265 GLN A CB  1 
ATOM   2021 C CG  . GLN A 1 265 ? 39.496  7.688  36.629 1.00 29.24 ? 265 GLN A CG  1 
ATOM   2022 C CD  . GLN A 1 265 ? 40.911  7.320  36.265 1.00 29.38 ? 265 GLN A CD  1 
ATOM   2023 O OE1 . GLN A 1 265 ? 41.590  8.052  35.549 1.00 27.95 ? 265 GLN A OE1 1 
ATOM   2024 N NE2 . GLN A 1 265 ? 41.373  6.185  36.772 1.00 32.41 ? 265 GLN A NE2 1 
ATOM   2025 N N   . ASP A 1 266 ? 37.526  7.882  39.966 1.00 31.81 ? 266 ASP A N   1 
ATOM   2026 C CA  . ASP A 1 266 ? 36.930  6.746  40.662 1.00 32.66 ? 266 ASP A CA  1 
ATOM   2027 C C   . ASP A 1 266 ? 35.412  6.777  40.565 1.00 30.46 ? 266 ASP A C   1 
ATOM   2028 O O   . ASP A 1 266 ? 34.774  5.766  40.270 1.00 29.97 ? 266 ASP A O   1 
ATOM   2029 C CB  . ASP A 1 266 ? 37.329  6.743  42.139 1.00 37.89 ? 266 ASP A CB  1 
ATOM   2030 C CG  . ASP A 1 266 ? 38.828  6.650  42.341 1.00 43.90 ? 266 ASP A CG  1 
ATOM   2031 O OD1 . ASP A 1 266 ? 39.445  5.689  41.826 1.00 46.14 ? 266 ASP A OD1 1 
ATOM   2032 O OD2 . ASP A 1 266 ? 39.388  7.539  43.023 1.00 48.10 ? 266 ASP A OD2 1 
ATOM   2033 N N   . LEU A 1 267 ? 34.836  7.946  40.817 1.00 27.74 ? 267 LEU A N   1 
ATOM   2034 C CA  . LEU A 1 267 ? 33.393  8.098  40.773 1.00 25.71 ? 267 LEU A CA  1 
ATOM   2035 C C   . LEU A 1 267 ? 32.827  8.182  39.359 1.00 24.72 ? 267 LEU A C   1 
ATOM   2036 O O   . LEU A 1 267 ? 31.933  7.420  38.996 1.00 23.85 ? 267 LEU A O   1 
ATOM   2037 C CB  . LEU A 1 267 ? 32.988  9.329  41.579 1.00 25.52 ? 267 LEU A CB  1 
ATOM   2038 C CG  . LEU A 1 267 ? 33.262  9.213  43.083 1.00 23.89 ? 267 LEU A CG  1 
ATOM   2039 C CD1 . LEU A 1 267 ? 33.058  10.557 43.760 1.00 24.24 ? 267 LEU A CD1 1 
ATOM   2040 C CD2 . LEU A 1 267 ? 32.340  8.164  43.687 1.00 21.48 ? 267 LEU A CD2 1 
ATOM   2041 N N   . VAL A 1 268 ? 33.356  9.100  38.560 1.00 23.89 ? 268 VAL A N   1 
ATOM   2042 C CA  . VAL A 1 268 ? 32.878  9.285  37.194 1.00 23.33 ? 268 VAL A CA  1 
ATOM   2043 C C   . VAL A 1 268 ? 33.082  8.046  36.317 1.00 24.40 ? 268 VAL A C   1 
ATOM   2044 O O   . VAL A 1 268 ? 32.137  7.547  35.701 1.00 24.19 ? 268 VAL A O   1 
ATOM   2045 C CB  . VAL A 1 268 ? 33.573  10.503 36.529 1.00 23.02 ? 268 VAL A CB  1 
ATOM   2046 C CG1 . VAL A 1 268 ? 33.005  10.739 35.139 1.00 20.68 ? 268 VAL A CG1 1 
ATOM   2047 C CG2 . VAL A 1 268 ? 33.396  11.739 37.393 1.00 18.29 ? 268 VAL A CG2 1 
ATOM   2048 N N   . THR A 1 269 ? 34.308  7.539  36.262 1.00 24.19 ? 269 THR A N   1 
ATOM   2049 C CA  . THR A 1 269 ? 34.582  6.370  35.433 1.00 24.02 ? 269 THR A CA  1 
ATOM   2050 C C   . THR A 1 269 ? 34.414  5.048  36.184 1.00 23.92 ? 269 THR A C   1 
ATOM   2051 O O   . THR A 1 269 ? 33.699  4.150  35.737 1.00 21.49 ? 269 THR A O   1 
ATOM   2052 C CB  . THR A 1 269 ? 36.007  6.436  34.844 1.00 23.20 ? 269 THR A CB  1 
ATOM   2053 O OG1 . THR A 1 269 ? 36.139  7.616  34.037 1.00 23.66 ? 269 THR A OG1 1 
ATOM   2054 C CG2 . THR A 1 269 ? 36.281  5.213  33.990 1.00 19.78 ? 269 THR A CG2 1 
ATOM   2055 N N   . GLY A 1 270 ? 35.069  4.938  37.330 1.00 25.14 ? 270 GLY A N   1 
ATOM   2056 C CA  . GLY A 1 270 ? 34.980  3.716  38.105 1.00 27.13 ? 270 GLY A CA  1 
ATOM   2057 C C   . GLY A 1 270 ? 33.573  3.333  38.520 1.00 29.28 ? 270 GLY A C   1 
ATOM   2058 O O   . GLY A 1 270 ? 33.161  2.178  38.351 1.00 29.81 ? 270 GLY A O   1 
ATOM   2059 N N   . TYR A 1 271 ? 32.825  4.298  39.051 1.00 29.26 ? 271 TYR A N   1 
ATOM   2060 C CA  . TYR A 1 271 ? 31.469  4.029  39.513 1.00 29.16 ? 271 TYR A CA  1 
ATOM   2061 C C   . TYR A 1 271 ? 30.347  4.300  38.514 1.00 28.49 ? 271 TYR A C   1 
ATOM   2062 O O   . TYR A 1 271 ? 29.639  3.377  38.097 1.00 29.98 ? 271 TYR A O   1 
ATOM   2063 C CB  . TYR A 1 271 ? 31.180  4.811  40.795 1.00 30.64 ? 271 TYR A CB  1 
ATOM   2064 C CG  . TYR A 1 271 ? 29.986  4.259  41.527 1.00 32.47 ? 271 TYR A CG  1 
ATOM   2065 C CD1 . TYR A 1 271 ? 30.062  3.034  42.190 1.00 33.58 ? 271 TYR A CD1 1 
ATOM   2066 C CD2 . TYR A 1 271 ? 28.762  4.919  41.503 1.00 33.01 ? 271 TYR A CD2 1 
ATOM   2067 C CE1 . TYR A 1 271 ? 28.949  2.476  42.808 1.00 33.28 ? 271 TYR A CE1 1 
ATOM   2068 C CE2 . TYR A 1 271 ? 27.639  4.367  42.117 1.00 33.93 ? 271 TYR A CE2 1 
ATOM   2069 C CZ  . TYR A 1 271 ? 27.743  3.145  42.765 1.00 33.68 ? 271 TYR A CZ  1 
ATOM   2070 O OH  . TYR A 1 271 ? 26.639  2.587  43.358 1.00 33.96 ? 271 TYR A OH  1 
ATOM   2071 N N   . LEU A 1 272 ? 30.170  5.563  38.140 1.00 25.95 ? 272 LEU A N   1 
ATOM   2072 C CA  . LEU A 1 272 ? 29.106  5.925  37.212 1.00 23.39 ? 272 LEU A CA  1 
ATOM   2073 C C   . LEU A 1 272 ? 29.119  5.145  35.905 1.00 23.63 ? 272 LEU A C   1 
ATOM   2074 O O   . LEU A 1 272 ? 28.082  4.646  35.471 1.00 23.51 ? 272 LEU A O   1 
ATOM   2075 C CB  . LEU A 1 272 ? 29.152  7.421  36.909 1.00 22.34 ? 272 LEU A CB  1 
ATOM   2076 C CG  . LEU A 1 272 ? 28.163  7.901  35.844 1.00 20.94 ? 272 LEU A CG  1 
ATOM   2077 C CD1 . LEU A 1 272 ? 26.741  7.548  36.244 1.00 19.68 ? 272 LEU A CD1 1 
ATOM   2078 C CD2 . LEU A 1 272 ? 28.316  9.398  35.665 1.00 20.28 ? 272 LEU A CD2 1 
ATOM   2079 N N   . LYS A 1 273 ? 30.282  5.038  35.272 1.00 23.13 ? 273 LYS A N   1 
ATOM   2080 C CA  . LYS A 1 273 ? 30.370  4.315  34.009 1.00 23.68 ? 273 LYS A CA  1 
ATOM   2081 C C   . LYS A 1 273 ? 30.569  2.811  34.169 1.00 25.25 ? 273 LYS A C   1 
ATOM   2082 O O   . LYS A 1 273 ? 29.809  2.017  33.607 1.00 25.99 ? 273 LYS A O   1 
ATOM   2083 C CB  . LYS A 1 273 ? 31.500  4.878  33.144 1.00 23.06 ? 273 LYS A CB  1 
ATOM   2084 C CG  . LYS A 1 273 ? 31.247  6.270  32.605 1.00 21.74 ? 273 LYS A CG  1 
ATOM   2085 C CD  . LYS A 1 273 ? 32.372  6.702  31.698 1.00 19.66 ? 273 LYS A CD  1 
ATOM   2086 C CE  . LYS A 1 273 ? 32.035  7.989  30.977 1.00 19.84 ? 273 LYS A CE  1 
ATOM   2087 N NZ  . LYS A 1 273 ? 33.047  8.286  29.934 1.00 17.87 ? 273 LYS A NZ  1 
ATOM   2088 N N   . ASP A 1 274 ? 31.582  2.417  34.936 1.00 26.74 ? 274 ASP A N   1 
ATOM   2089 C CA  . ASP A 1 274 ? 31.876  1.000  35.125 1.00 28.40 ? 274 ASP A CA  1 
ATOM   2090 C C   . ASP A 1 274 ? 30.924  0.243  36.050 1.00 29.43 ? 274 ASP A C   1 
ATOM   2091 O O   . ASP A 1 274 ? 30.544  -0.891 35.757 1.00 29.20 ? 274 ASP A O   1 
ATOM   2092 C CB  . ASP A 1 274 ? 33.311  0.820  35.614 1.00 29.62 ? 274 ASP A CB  1 
ATOM   2093 C CG  . ASP A 1 274 ? 34.332  1.333  34.616 1.00 32.29 ? 274 ASP A CG  1 
ATOM   2094 O OD1 . ASP A 1 274 ? 33.974  1.483  33.426 1.00 32.51 ? 274 ASP A OD1 1 
ATOM   2095 O OD2 . ASP A 1 274 ? 35.495  1.573  35.019 1.00 33.66 ? 274 ASP A OD2 1 
ATOM   2096 N N   . THR A 1 275 ? 30.533  0.853  37.160 1.00 29.00 ? 275 THR A N   1 
ATOM   2097 C CA  . THR A 1 275 ? 29.636  0.168  38.075 1.00 29.38 ? 275 THR A CA  1 
ATOM   2098 C C   . THR A 1 275 ? 28.166  0.337  37.688 1.00 30.24 ? 275 THR A C   1 
ATOM   2099 O O   . THR A 1 275 ? 27.466  -0.659 37.469 1.00 31.05 ? 275 THR A O   1 
ATOM   2100 C CB  . THR A 1 275 ? 29.848  0.641  39.517 1.00 29.44 ? 275 THR A CB  1 
ATOM   2101 O OG1 . THR A 1 275 ? 31.229  0.493  39.868 1.00 28.34 ? 275 THR A OG1 1 
ATOM   2102 C CG2 . THR A 1 275 ? 29.008  -0.187 40.466 1.00 27.63 ? 275 THR A CG2 1 
ATOM   2103 N N   . LEU A 1 276 ? 27.698  1.584  37.601 1.00 29.78 ? 276 LEU A N   1 
ATOM   2104 C CA  . LEU A 1 276 ? 26.306  1.848  37.229 1.00 28.91 ? 276 LEU A CA  1 
ATOM   2105 C C   . LEU A 1 276 ? 26.028  1.527  35.759 1.00 28.42 ? 276 LEU A C   1 
ATOM   2106 O O   . LEU A 1 276 ? 24.875  1.498  35.327 1.00 26.94 ? 276 LEU A O   1 
ATOM   2107 C CB  . LEU A 1 276 ? 25.944  3.308  37.513 1.00 28.68 ? 276 LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 276 ? 25.818  3.701  38.987 1.00 29.64 ? 276 LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 276 ? 25.495  5.182  39.088 1.00 29.52 ? 276 LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 276 ? 24.724  2.873  39.654 1.00 27.27 ? 276 LEU A CD2 1 
ATOM   2111 N N   . LYS A 1 277 ? 27.097  1.292  35.002 1.00 28.66 ? 277 LYS A N   1 
ATOM   2112 C CA  . LYS A 1 277 ? 27.002  0.959  33.586 1.00 29.73 ? 277 LYS A CA  1 
ATOM   2113 C C   . LYS A 1 277 ? 26.332  2.037  32.738 1.00 30.05 ? 277 LYS A C   1 
ATOM   2114 O O   . LYS A 1 277 ? 25.591  1.733  31.801 1.00 30.80 ? 277 LYS A O   1 
ATOM   2115 C CB  . LYS A 1 277 ? 26.276  -0.378 33.418 1.00 31.16 ? 277 LYS A CB  1 
ATOM   2116 C CG  . LYS A 1 277 ? 27.075  -1.556 33.957 1.00 34.04 ? 277 LYS A CG  1 
ATOM   2117 C CD  . LYS A 1 277 ? 28.364  -1.736 33.156 1.00 38.32 ? 277 LYS A CD  1 
ATOM   2118 C CE  . LYS A 1 277 ? 29.416  -2.547 33.912 1.00 40.02 ? 277 LYS A CE  1 
ATOM   2119 N NZ  . LYS A 1 277 ? 28.919  -3.875 34.355 1.00 43.06 ? 277 LYS A NZ  1 
ATOM   2120 N N   . PHE A 1 278 ? 26.605  3.298  33.065 1.00 28.80 ? 278 PHE A N   1 
ATOM   2121 C CA  . PHE A 1 278 ? 26.043  4.418  32.325 1.00 26.45 ? 278 PHE A CA  1 
ATOM   2122 C C   . PHE A 1 278 ? 26.623  4.425  30.912 1.00 25.32 ? 278 PHE A C   1 
ATOM   2123 O O   . PHE A 1 278 ? 27.835  4.347  30.719 1.00 24.21 ? 278 PHE A O   1 
ATOM   2124 C CB  . PHE A 1 278 ? 26.355  5.735  33.044 1.00 26.66 ? 278 PHE A CB  1 
ATOM   2125 C CG  . PHE A 1 278 ? 25.819  6.951  32.341 1.00 27.14 ? 278 PHE A CG  1 
ATOM   2126 C CD1 . PHE A 1 278 ? 24.481  7.025  31.970 1.00 27.03 ? 278 PHE A CD1 1 
ATOM   2127 C CD2 . PHE A 1 278 ? 26.652  8.024  32.046 1.00 27.16 ? 278 PHE A CD2 1 
ATOM   2128 C CE1 . PHE A 1 278 ? 23.983  8.152  31.313 1.00 26.47 ? 278 PHE A CE1 1 
ATOM   2129 C CE2 . PHE A 1 278 ? 26.162  9.151  31.390 1.00 26.42 ? 278 PHE A CE2 1 
ATOM   2130 C CZ  . PHE A 1 278 ? 24.826  9.213  31.024 1.00 26.22 ? 278 PHE A CZ  1 
ATOM   2131 N N   . LYS A 1 279 ? 25.737  4.525  29.930 1.00 24.70 ? 279 LYS A N   1 
ATOM   2132 C CA  . LYS A 1 279 ? 26.110  4.509  28.524 1.00 23.60 ? 279 LYS A CA  1 
ATOM   2133 C C   . LYS A 1 279 ? 25.936  5.845  27.810 1.00 22.84 ? 279 LYS A C   1 
ATOM   2134 O O   . LYS A 1 279 ? 26.434  6.024  26.702 1.00 22.65 ? 279 LYS A O   1 
ATOM   2135 C CB  . LYS A 1 279 ? 25.288  3.436  27.802 1.00 25.05 ? 279 LYS A CB  1 
ATOM   2136 C CG  . LYS A 1 279 ? 26.066  2.196  27.424 1.00 26.43 ? 279 LYS A CG  1 
ATOM   2137 C CD  . LYS A 1 279 ? 26.976  1.727  28.542 1.00 26.90 ? 279 LYS A CD  1 
ATOM   2138 C CE  . LYS A 1 279 ? 27.831  0.560  28.071 1.00 28.11 ? 279 LYS A CE  1 
ATOM   2139 N NZ  . LYS A 1 279 ? 28.905  0.215  29.042 1.00 27.36 ? 279 LYS A NZ  1 
ATOM   2140 N N   . GLY A 1 280 ? 25.218  6.776  28.426 1.00 21.88 ? 280 GLY A N   1 
ATOM   2141 C CA  . GLY A 1 280 ? 25.028  8.073  27.800 1.00 21.49 ? 280 GLY A CA  1 
ATOM   2142 C C   . GLY A 1 280 ? 26.306  8.869  27.960 1.00 20.19 ? 280 GLY A C   1 
ATOM   2143 O O   . GLY A 1 280 ? 27.345  8.283  28.255 1.00 18.94 ? 280 GLY A O   1 
ATOM   2144 N N   . PHE A 1 281 ? 26.255  10.188 27.777 1.00 20.21 ? 281 PHE A N   1 
ATOM   2145 C CA  . PHE A 1 281 ? 27.471  10.975 27.940 1.00 19.51 ? 281 PHE A CA  1 
ATOM   2146 C C   . PHE A 1 281 ? 27.500  11.865 29.176 1.00 20.32 ? 281 PHE A C   1 
ATOM   2147 O O   . PHE A 1 281 ? 26.470  12.351 29.654 1.00 20.58 ? 281 PHE A O   1 
ATOM   2148 C CB  . PHE A 1 281 ? 27.797  11.777 26.657 1.00 17.79 ? 281 PHE A CB  1 
ATOM   2149 C CG  . PHE A 1 281 ? 26.860  12.928 26.350 1.00 17.63 ? 281 PHE A CG  1 
ATOM   2150 C CD1 . PHE A 1 281 ? 27.000  14.158 26.992 1.00 17.95 ? 281 PHE A CD1 1 
ATOM   2151 C CD2 . PHE A 1 281 ? 25.908  12.816 25.334 1.00 17.68 ? 281 PHE A CD2 1 
ATOM   2152 C CE1 . PHE A 1 281 ? 26.214  15.261 26.618 1.00 16.65 ? 281 PHE A CE1 1 
ATOM   2153 C CE2 . PHE A 1 281 ? 25.119  13.916 24.956 1.00 17.53 ? 281 PHE A CE2 1 
ATOM   2154 C CZ  . PHE A 1 281 ? 25.277  15.137 25.599 1.00 15.42 ? 281 PHE A CZ  1 
ATOM   2155 N N   . VAL A 1 282 ? 28.705  12.031 29.711 1.00 20.21 ? 282 VAL A N   1 
ATOM   2156 C CA  . VAL A 1 282 ? 28.939  12.846 30.891 1.00 18.97 ? 282 VAL A CA  1 
ATOM   2157 C C   . VAL A 1 282 ? 29.388  14.235 30.444 1.00 19.68 ? 282 VAL A C   1 
ATOM   2158 O O   . VAL A 1 282 ? 30.363  14.378 29.709 1.00 20.50 ? 282 VAL A O   1 
ATOM   2159 C CB  . VAL A 1 282 ? 30.032  12.222 31.767 1.00 18.38 ? 282 VAL A CB  1 
ATOM   2160 C CG1 . VAL A 1 282 ? 30.240  13.047 33.019 1.00 17.43 ? 282 VAL A CG1 1 
ATOM   2161 C CG2 . VAL A 1 282 ? 29.656  10.799 32.115 1.00 18.33 ? 282 VAL A CG2 1 
ATOM   2162 N N   . ILE A 1 283 ? 28.670  15.255 30.893 1.00 19.15 ? 283 ILE A N   1 
ATOM   2163 C CA  . ILE A 1 283 ? 28.981  16.627 30.535 1.00 17.94 ? 283 ILE A CA  1 
ATOM   2164 C C   . ILE A 1 283 ? 29.458  17.384 31.772 1.00 19.43 ? 283 ILE A C   1 
ATOM   2165 O O   . ILE A 1 283 ? 29.120  17.026 32.896 1.00 20.25 ? 283 ILE A O   1 
ATOM   2166 C CB  . ILE A 1 283 ? 27.731  17.314 29.948 1.00 16.75 ? 283 ILE A CB  1 
ATOM   2167 C CG1 . ILE A 1 283 ? 28.097  18.681 29.370 1.00 14.61 ? 283 ILE A CG1 1 
ATOM   2168 C CG2 . ILE A 1 283 ? 26.655  17.436 31.024 1.00 15.50 ? 283 ILE A CG2 1 
ATOM   2169 C CD1 . ILE A 1 283 ? 26.966  19.340 28.598 1.00 10.75 ? 283 ILE A CD1 1 
ATOM   2170 N N   . SER A 1 284 ? 30.256  18.426 31.566 1.00 20.99 ? 284 SER A N   1 
ATOM   2171 C CA  . SER A 1 284 ? 30.754  19.221 32.683 1.00 21.43 ? 284 SER A CA  1 
ATOM   2172 C C   . SER A 1 284 ? 29.794  20.368 32.970 1.00 22.01 ? 284 SER A C   1 
ATOM   2173 O O   . SER A 1 284 ? 28.791  20.551 32.281 1.00 22.40 ? 284 SER A O   1 
ATOM   2174 C CB  . SER A 1 284 ? 32.120  19.813 32.349 1.00 21.92 ? 284 SER A CB  1 
ATOM   2175 O OG  . SER A 1 284 ? 31.974  20.891 31.440 1.00 20.39 ? 284 SER A OG  1 
ATOM   2176 N N   . ASP A 1 285 ? 30.107  21.144 33.994 1.00 22.15 ? 285 ASP A N   1 
ATOM   2177 C CA  . ASP A 1 285 ? 29.284  22.285 34.328 1.00 22.27 ? 285 ASP A CA  1 
ATOM   2178 C C   . ASP A 1 285 ? 30.062  23.484 33.805 1.00 22.50 ? 285 ASP A C   1 
ATOM   2179 O O   . ASP A 1 285 ? 31.234  23.364 33.448 1.00 22.99 ? 285 ASP A O   1 
ATOM   2180 C CB  . ASP A 1 285 ? 29.111  22.404 35.840 1.00 24.97 ? 285 ASP A CB  1 
ATOM   2181 C CG  . ASP A 1 285 ? 27.792  23.058 36.237 1.00 28.21 ? 285 ASP A CG  1 
ATOM   2182 O OD1 . ASP A 1 285 ? 27.341  24.166 35.552 1.00 28.21 ? 285 ASP A OD1 1 
ATOM   2183 O OD2 . ASP A 1 285 ? 27.174  22.552 37.195 1.00 32.67 ? 285 ASP A OD2 1 
ATOM   2184 N N   . TRP A 1 286 ? 29.397  24.630 33.765 1.00 21.20 ? 286 TRP A N   1 
ATOM   2185 C CA  . TRP A 1 286 ? 29.965  25.890 33.302 1.00 20.91 ? 286 TRP A CA  1 
ATOM   2186 C C   . TRP A 1 286 ? 31.336  26.158 33.920 1.00 21.95 ? 286 TRP A C   1 
ATOM   2187 O O   . TRP A 1 286 ? 31.443  26.483 35.104 1.00 22.33 ? 286 TRP A O   1 
ATOM   2188 C CB  . TRP A 1 286 ? 28.974  26.997 33.658 1.00 18.72 ? 286 TRP A CB  1 
ATOM   2189 C CG  . TRP A 1 286 ? 29.251  28.349 33.112 1.00 16.27 ? 286 TRP A CG  1 
ATOM   2190 C CD1 . TRP A 1 286 ? 30.115  29.272 33.613 1.00 14.30 ? 286 TRP A CD1 1 
ATOM   2191 C CD2 . TRP A 1 286 ? 28.575  28.979 32.018 1.00 15.53 ? 286 TRP A CD2 1 
ATOM   2192 N NE1 . TRP A 1 286 ? 30.013  30.445 32.908 1.00 16.11 ? 286 TRP A NE1 1 
ATOM   2193 C CE2 . TRP A 1 286 ? 29.074  30.292 31.922 1.00 14.76 ? 286 TRP A CE2 1 
ATOM   2194 C CE3 . TRP A 1 286 ? 27.591  28.561 31.113 1.00 13.64 ? 286 TRP A CE3 1 
ATOM   2195 C CZ2 . TRP A 1 286 ? 28.622  31.196 30.955 1.00 12.23 ? 286 TRP A CZ2 1 
ATOM   2196 C CZ3 . TRP A 1 286 ? 27.142  29.459 30.152 1.00 13.78 ? 286 TRP A CZ3 1 
ATOM   2197 C CH2 . TRP A 1 286 ? 27.659  30.761 30.082 1.00 14.25 ? 286 TRP A CH2 1 
ATOM   2198 N N   . GLU A 1 287 ? 32.382  26.023 33.111 1.00 22.68 ? 287 GLU A N   1 
ATOM   2199 C CA  . GLU A 1 287 ? 33.751  26.236 33.578 1.00 24.70 ? 287 GLU A CA  1 
ATOM   2200 C C   . GLU A 1 287 ? 34.053  25.301 34.756 1.00 25.23 ? 287 GLU A C   1 
ATOM   2201 O O   . GLU A 1 287 ? 34.869  25.614 35.623 1.00 25.50 ? 287 GLU A O   1 
ATOM   2202 C CB  . GLU A 1 287 ? 33.957  27.694 34.012 1.00 24.92 ? 287 GLU A CB  1 
ATOM   2203 C CG  . GLU A 1 287 ? 33.465  28.737 33.010 1.00 27.33 ? 287 GLU A CG  1 
ATOM   2204 C CD  . GLU A 1 287 ? 33.723  30.173 33.465 1.00 28.75 ? 287 GLU A CD  1 
ATOM   2205 O OE1 . GLU A 1 287 ? 33.522  30.477 34.664 1.00 28.85 ? 287 GLU A OE1 1 
ATOM   2206 O OE2 . GLU A 1 287 ? 34.112  31.003 32.617 1.00 28.69 ? 287 GLU A OE2 1 
ATOM   2207 N N   . GLY A 1 288 ? 33.383  24.152 34.786 1.00 26.26 ? 288 GLY A N   1 
ATOM   2208 C CA  . GLY A 1 288 ? 33.606  23.199 35.856 1.00 26.12 ? 288 GLY A CA  1 
ATOM   2209 C C   . GLY A 1 288 ? 35.059  22.767 35.958 1.00 26.62 ? 288 GLY A C   1 
ATOM   2210 O O   . GLY A 1 288 ? 35.605  22.681 37.058 1.00 25.16 ? 288 GLY A O   1 
ATOM   2211 N N   . ILE A 1 289 ? 35.692  22.498 34.815 1.00 27.77 ? 289 ILE A N   1 
ATOM   2212 C CA  . ILE A 1 289 ? 37.090  22.073 34.808 1.00 28.31 ? 289 ILE A CA  1 
ATOM   2213 C C   . ILE A 1 289 ? 38.038  23.214 35.185 1.00 28.42 ? 289 ILE A C   1 
ATOM   2214 O O   . ILE A 1 289 ? 39.106  22.974 35.744 1.00 28.86 ? 289 ILE A O   1 
ATOM   2215 C CB  . ILE A 1 289 ? 37.524  21.470 33.427 1.00 27.71 ? 289 ILE A CB  1 
ATOM   2216 C CG1 . ILE A 1 289 ? 37.671  22.559 32.368 1.00 27.66 ? 289 ILE A CG1 1 
ATOM   2217 C CG2 . ILE A 1 289 ? 36.503  20.455 32.959 1.00 27.55 ? 289 ILE A CG2 1 
ATOM   2218 C CD1 . ILE A 1 289 ? 38.180  22.023 31.042 1.00 24.99 ? 289 ILE A CD1 1 
ATOM   2219 N N   . ASP A 1 290 ? 37.651  24.450 34.888 1.00 27.92 ? 290 ASP A N   1 
ATOM   2220 C CA  . ASP A 1 290 ? 38.489  25.596 35.233 1.00 28.34 ? 290 ASP A CA  1 
ATOM   2221 C C   . ASP A 1 290 ? 38.634  25.633 36.750 1.00 29.39 ? 290 ASP A C   1 
ATOM   2222 O O   . ASP A 1 290 ? 39.707  25.908 37.286 1.00 28.84 ? 290 ASP A O   1 
ATOM   2223 C CB  . ASP A 1 290 ? 37.836  26.914 34.799 1.00 27.39 ? 290 ASP A CB  1 
ATOM   2224 C CG  . ASP A 1 290 ? 37.546  26.977 33.313 1.00 26.87 ? 290 ASP A CG  1 
ATOM   2225 O OD1 . ASP A 1 290 ? 36.841  26.089 32.792 1.00 28.15 ? 290 ASP A OD1 1 
ATOM   2226 O OD2 . ASP A 1 290 ? 38.015  27.933 32.667 1.00 27.94 ? 290 ASP A OD2 1 
ATOM   2227 N N   . ARG A 1 291 ? 37.530  25.349 37.430 1.00 30.10 ? 291 ARG A N   1 
ATOM   2228 C CA  . ARG A 1 291 ? 37.465  25.387 38.881 1.00 31.03 ? 291 ARG A CA  1 
ATOM   2229 C C   . ARG A 1 291 ? 38.098  24.208 39.602 1.00 31.75 ? 291 ARG A C   1 
ATOM   2230 O O   . ARG A 1 291 ? 38.065  24.136 40.832 1.00 30.64 ? 291 ARG A O   1 
ATOM   2231 C CB  . ARG A 1 291 ? 36.006  25.558 39.295 1.00 32.03 ? 291 ARG A CB  1 
ATOM   2232 C CG  . ARG A 1 291 ? 35.380  26.742 38.573 1.00 35.77 ? 291 ARG A CG  1 
ATOM   2233 C CD  . ARG A 1 291 ? 33.926  26.993 38.923 1.00 38.52 ? 291 ARG A CD  1 
ATOM   2234 N NE  . ARG A 1 291 ? 33.372  28.007 38.029 1.00 41.83 ? 291 ARG A NE  1 
ATOM   2235 C CZ  . ARG A 1 291 ? 32.130  28.478 38.096 1.00 44.04 ? 291 ARG A CZ  1 
ATOM   2236 N NH1 . ARG A 1 291 ? 31.297  28.028 39.030 1.00 44.40 ? 291 ARG A NH1 1 
ATOM   2237 N NH2 . ARG A 1 291 ? 31.716  29.388 37.217 1.00 42.76 ? 291 ARG A NH2 1 
ATOM   2238 N N   . ILE A 1 292 ? 38.671  23.280 38.844 1.00 32.94 ? 292 ILE A N   1 
ATOM   2239 C CA  . ILE A 1 292 ? 39.326  22.131 39.457 1.00 33.12 ? 292 ILE A CA  1 
ATOM   2240 C C   . ILE A 1 292 ? 40.496  22.695 40.241 1.00 33.76 ? 292 ILE A C   1 
ATOM   2241 O O   . ILE A 1 292 ? 40.744  22.295 41.379 1.00 34.96 ? 292 ILE A O   1 
ATOM   2242 C CB  . ILE A 1 292 ? 39.867  21.144 38.405 1.00 32.08 ? 292 ILE A CB  1 
ATOM   2243 C CG1 . ILE A 1 292 ? 38.705  20.383 37.764 1.00 32.08 ? 292 ILE A CG1 1 
ATOM   2244 C CG2 . ILE A 1 292 ? 40.854  20.194 39.050 1.00 30.73 ? 292 ILE A CG2 1 
ATOM   2245 C CD1 . ILE A 1 292 ? 39.124  19.452 36.653 1.00 32.19 ? 292 ILE A CD1 1 
ATOM   2246 N N   . THR A 1 293 ? 41.197  23.639 39.616 1.00 32.42 ? 293 THR A N   1 
ATOM   2247 C CA  . THR A 1 293 ? 42.341  24.299 40.223 1.00 31.35 ? 293 THR A CA  1 
ATOM   2248 C C   . THR A 1 293 ? 41.859  25.500 41.010 1.00 32.29 ? 293 THR A C   1 
ATOM   2249 O O   . THR A 1 293 ? 40.692  25.873 40.953 1.00 33.19 ? 293 THR A O   1 
ATOM   2250 C CB  . THR A 1 293 ? 43.344  24.820 39.167 1.00 29.81 ? 293 THR A CB  1 
ATOM   2251 O OG1 . THR A 1 293 ? 42.776  25.939 38.471 1.00 26.86 ? 293 THR A OG1 1 
ATOM   2252 C CG2 . THR A 1 293 ? 43.697  23.724 38.172 1.00 28.80 ? 293 THR A CG2 1 
ATOM   2253 N N   . THR A 1 294 ? 42.777  26.110 41.740 1.00 33.95 ? 294 THR A N   1 
ATOM   2254 C CA  . THR A 1 294 ? 42.466  27.279 42.539 1.00 34.83 ? 294 THR A CA  1 
ATOM   2255 C C   . THR A 1 294 ? 43.738  28.116 42.656 1.00 34.70 ? 294 THR A C   1 
ATOM   2256 O O   . THR A 1 294 ? 44.753  27.656 43.180 1.00 36.35 ? 294 THR A O   1 
ATOM   2257 C CB  . THR A 1 294 ? 41.931  26.860 43.935 1.00 35.86 ? 294 THR A CB  1 
ATOM   2258 O OG1 . THR A 1 294 ? 42.397  27.780 44.929 1.00 36.56 ? 294 THR A OG1 1 
ATOM   2259 C CG2 . THR A 1 294 ? 42.370  25.432 44.282 1.00 36.57 ? 294 THR A CG2 1 
ATOM   2260 N N   . PRO A 1 295 ? 43.710  29.351 42.135 1.00 33.87 ? 295 PRO A N   1 
ATOM   2261 C CA  . PRO A 1 295 ? 42.579  29.996 41.458 1.00 35.16 ? 295 PRO A CA  1 
ATOM   2262 C C   . PRO A 1 295 ? 42.011  29.174 40.302 1.00 36.27 ? 295 PRO A C   1 
ATOM   2263 O O   . PRO A 1 295 ? 42.673  28.278 39.765 1.00 35.91 ? 295 PRO A O   1 
ATOM   2264 C CB  . PRO A 1 295 ? 43.177  31.312 40.966 1.00 34.02 ? 295 PRO A CB  1 
ATOM   2265 C CG  . PRO A 1 295 ? 44.273  31.569 41.939 1.00 33.66 ? 295 PRO A CG  1 
ATOM   2266 C CD  . PRO A 1 295 ? 44.895  30.216 42.083 1.00 32.45 ? 295 PRO A CD  1 
ATOM   2267 N N   . ALA A 1 296 ? 40.777  29.483 39.923 1.00 36.55 ? 296 ALA A N   1 
ATOM   2268 C CA  . ALA A 1 296 ? 40.136  28.778 38.825 1.00 35.26 ? 296 ALA A CA  1 
ATOM   2269 C C   . ALA A 1 296 ? 40.829  29.192 37.540 1.00 35.02 ? 296 ALA A C   1 
ATOM   2270 O O   . ALA A 1 296 ? 41.204  30.354 37.377 1.00 34.66 ? 296 ALA A O   1 
ATOM   2271 C CB  . ALA A 1 296 ? 38.660  29.131 38.765 1.00 34.87 ? 296 ALA A CB  1 
ATOM   2272 N N   . GLY A 1 297 ? 41.013  28.234 36.640 1.00 34.66 ? 297 GLY A N   1 
ATOM   2273 C CA  . GLY A 1 297 ? 41.663  28.521 35.375 1.00 34.16 ? 297 GLY A CA  1 
ATOM   2274 C C   . GLY A 1 297 ? 43.139  28.882 35.462 1.00 34.16 ? 297 GLY A C   1 
ATOM   2275 O O   . GLY A 1 297 ? 43.717  29.329 34.474 1.00 34.98 ? 297 GLY A O   1 
ATOM   2276 N N   . SER A 1 298 ? 43.763  28.688 36.621 1.00 33.36 ? 298 SER A N   1 
ATOM   2277 C CA  . SER A 1 298 ? 45.177  29.024 36.765 1.00 33.07 ? 298 SER A CA  1 
ATOM   2278 C C   . SER A 1 298 ? 46.097  27.946 36.191 1.00 32.53 ? 298 SER A C   1 
ATOM   2279 O O   . SER A 1 298 ? 47.310  27.988 36.384 1.00 33.93 ? 298 SER A O   1 
ATOM   2280 C CB  . SER A 1 298 ? 45.519  29.263 38.237 1.00 33.45 ? 298 SER A CB  1 
ATOM   2281 O OG  . SER A 1 298 ? 45.381  28.074 38.993 1.00 36.38 ? 298 SER A OG  1 
ATOM   2282 N N   . ASP A 1 299 ? 45.516  26.982 35.486 1.00 31.07 ? 299 ASP A N   1 
ATOM   2283 C CA  . ASP A 1 299 ? 46.280  25.896 34.877 1.00 28.97 ? 299 ASP A CA  1 
ATOM   2284 C C   . ASP A 1 299 ? 45.311  25.106 34.005 1.00 27.89 ? 299 ASP A C   1 
ATOM   2285 O O   . ASP A 1 299 ? 45.074  23.917 34.234 1.00 26.78 ? 299 ASP A O   1 
ATOM   2286 C CB  . ASP A 1 299 ? 46.858  24.984 35.958 1.00 29.20 ? 299 ASP A CB  1 
ATOM   2287 C CG  . ASP A 1 299 ? 47.898  24.013 35.414 1.00 30.23 ? 299 ASP A CG  1 
ATOM   2288 O OD1 . ASP A 1 299 ? 47.839  23.658 34.218 1.00 31.98 ? 299 ASP A OD1 1 
ATOM   2289 O OD2 . ASP A 1 299 ? 48.775  23.587 36.189 1.00 31.30 ? 299 ASP A OD2 1 
ATOM   2290 N N   . TYR A 1 300 ? 44.748  25.775 33.006 1.00 27.39 ? 300 TYR A N   1 
ATOM   2291 C CA  . TYR A 1 300 ? 43.779  25.137 32.135 1.00 27.31 ? 300 TYR A CA  1 
ATOM   2292 C C   . TYR A 1 300 ? 44.315  23.841 31.561 1.00 27.31 ? 300 TYR A C   1 
ATOM   2293 O O   . TYR A 1 300 ? 43.568  22.880 31.371 1.00 27.15 ? 300 TYR A O   1 
ATOM   2294 C CB  . TYR A 1 300 ? 43.383  26.072 31.001 1.00 27.13 ? 300 TYR A CB  1 
ATOM   2295 C CG  . TYR A 1 300 ? 42.033  25.752 30.410 1.00 27.90 ? 300 TYR A CG  1 
ATOM   2296 C CD1 . TYR A 1 300 ? 40.866  25.979 31.136 1.00 28.08 ? 300 TYR A CD1 1 
ATOM   2297 C CD2 . TYR A 1 300 ? 41.919  25.234 29.119 1.00 28.19 ? 300 TYR A CD2 1 
ATOM   2298 C CE1 . TYR A 1 300 ? 39.612  25.702 30.592 1.00 29.78 ? 300 TYR A CE1 1 
ATOM   2299 C CE2 . TYR A 1 300 ? 40.672  24.951 28.562 1.00 29.51 ? 300 TYR A CE2 1 
ATOM   2300 C CZ  . TYR A 1 300 ? 39.520  25.188 29.302 1.00 30.32 ? 300 TYR A CZ  1 
ATOM   2301 O OH  . TYR A 1 300 ? 38.283  24.925 28.753 1.00 27.50 ? 300 TYR A OH  1 
ATOM   2302 N N   . SER A 1 301 ? 45.612  23.816 31.281 1.00 26.48 ? 301 SER A N   1 
ATOM   2303 C CA  . SER A 1 301 ? 46.225  22.618 30.737 1.00 26.03 ? 301 SER A CA  1 
ATOM   2304 C C   . SER A 1 301 ? 45.904  21.446 31.656 1.00 26.04 ? 301 SER A C   1 
ATOM   2305 O O   . SER A 1 301 ? 45.441  20.397 31.205 1.00 26.58 ? 301 SER A O   1 
ATOM   2306 C CB  . SER A 1 301 ? 47.735  22.792 30.629 1.00 26.09 ? 301 SER A CB  1 
ATOM   2307 O OG  . SER A 1 301 ? 48.323  21.635 30.071 1.00 24.52 ? 301 SER A OG  1 
ATOM   2308 N N   . TYR A 1 302 ? 46.142  21.633 32.950 1.00 24.88 ? 302 TYR A N   1 
ATOM   2309 C CA  . TYR A 1 302 ? 45.865  20.589 33.926 1.00 24.60 ? 302 TYR A CA  1 
ATOM   2310 C C   . TYR A 1 302 ? 44.367  20.277 33.969 1.00 24.25 ? 302 TYR A C   1 
ATOM   2311 O O   . TYR A 1 302 ? 43.964  19.118 34.085 1.00 22.63 ? 302 TYR A O   1 
ATOM   2312 C CB  . TYR A 1 302 ? 46.338  21.019 35.316 1.00 24.46 ? 302 TYR A CB  1 
ATOM   2313 C CG  . TYR A 1 302 ? 45.964  20.024 36.389 1.00 25.99 ? 302 TYR A CG  1 
ATOM   2314 C CD1 . TYR A 1 302 ? 46.523  18.745 36.407 1.00 26.30 ? 302 TYR A CD1 1 
ATOM   2315 C CD2 . TYR A 1 302 ? 45.000  20.336 37.348 1.00 26.14 ? 302 TYR A CD2 1 
ATOM   2316 C CE1 . TYR A 1 302 ? 46.122  17.797 37.356 1.00 27.89 ? 302 TYR A CE1 1 
ATOM   2317 C CE2 . TYR A 1 302 ? 44.594  19.401 38.295 1.00 26.72 ? 302 TYR A CE2 1 
ATOM   2318 C CZ  . TYR A 1 302 ? 45.155  18.136 38.294 1.00 28.29 ? 302 TYR A CZ  1 
ATOM   2319 O OH  . TYR A 1 302 ? 44.739  17.211 39.222 1.00 30.16 ? 302 TYR A OH  1 
ATOM   2320 N N   . SER A 1 303 ? 43.549  21.321 33.876 1.00 24.29 ? 303 SER A N   1 
ATOM   2321 C CA  . SER A 1 303 ? 42.098  21.163 33.904 1.00 24.28 ? 303 SER A CA  1 
ATOM   2322 C C   . SER A 1 303 ? 41.618  20.185 32.846 1.00 23.88 ? 303 SER A C   1 
ATOM   2323 O O   . SER A 1 303 ? 40.822  19.296 33.131 1.00 25.76 ? 303 SER A O   1 
ATOM   2324 C CB  . SER A 1 303 ? 41.410  22.510 33.689 1.00 23.90 ? 303 SER A CB  1 
ATOM   2325 O OG  . SER A 1 303 ? 41.695  23.399 34.748 1.00 23.92 ? 303 SER A OG  1 
ATOM   2326 N N   . VAL A 1 304 ? 42.103  20.353 31.621 1.00 23.47 ? 304 VAL A N   1 
ATOM   2327 C CA  . VAL A 1 304 ? 41.704  19.478 30.531 1.00 23.40 ? 304 VAL A CA  1 
ATOM   2328 C C   . VAL A 1 304 ? 42.170  18.047 30.760 1.00 24.95 ? 304 VAL A C   1 
ATOM   2329 O O   . VAL A 1 304 ? 41.414  17.101 30.545 1.00 25.75 ? 304 VAL A O   1 
ATOM   2330 C CB  . VAL A 1 304 ? 42.258  19.987 29.188 1.00 22.50 ? 304 VAL A CB  1 
ATOM   2331 C CG1 . VAL A 1 304 ? 41.827  19.063 28.044 1.00 21.75 ? 304 VAL A CG1 1 
ATOM   2332 C CG2 . VAL A 1 304 ? 41.760  21.394 28.946 1.00 22.34 ? 304 VAL A CG2 1 
ATOM   2333 N N   . LYS A 1 305 ? 43.410  17.891 31.210 1.00 25.53 ? 305 LYS A N   1 
ATOM   2334 C CA  . LYS A 1 305 ? 43.960  16.566 31.457 1.00 26.67 ? 305 LYS A CA  1 
ATOM   2335 C C   . LYS A 1 305 ? 43.168  15.823 32.531 1.00 25.80 ? 305 LYS A C   1 
ATOM   2336 O O   . LYS A 1 305 ? 42.653  14.724 32.301 1.00 25.67 ? 305 LYS A O   1 
ATOM   2337 C CB  . LYS A 1 305 ? 45.428  16.668 31.888 1.00 28.91 ? 305 LYS A CB  1 
ATOM   2338 C CG  . LYS A 1 305 ? 46.222  15.414 31.570 1.00 33.09 ? 305 LYS A CG  1 
ATOM   2339 C CD  . LYS A 1 305 ? 47.649  15.447 32.106 1.00 37.53 ? 305 LYS A CD  1 
ATOM   2340 C CE  . LYS A 1 305 ? 47.734  14.869 33.520 1.00 40.34 ? 305 LYS A CE  1 
ATOM   2341 N NZ  . LYS A 1 305 ? 49.147  14.672 33.978 1.00 40.98 ? 305 LYS A NZ  1 
ATOM   2342 N N   . ALA A 1 306 ? 43.066  16.436 33.703 1.00 24.14 ? 306 ALA A N   1 
ATOM   2343 C CA  . ALA A 1 306 ? 42.357  15.829 34.818 1.00 24.03 ? 306 ALA A CA  1 
ATOM   2344 C C   . ALA A 1 306 ? 40.915  15.450 34.481 1.00 24.53 ? 306 ALA A C   1 
ATOM   2345 O O   . ALA A 1 306 ? 40.498  14.304 34.684 1.00 24.17 ? 306 ALA A O   1 
ATOM   2346 C CB  . ALA A 1 306 ? 42.386  16.772 36.020 1.00 24.72 ? 306 ALA A CB  1 
ATOM   2347 N N   . SER A 1 307 ? 40.161  16.414 33.961 1.00 23.38 ? 307 SER A N   1 
ATOM   2348 C CA  . SER A 1 307 ? 38.765  16.186 33.623 1.00 21.53 ? 307 SER A CA  1 
ATOM   2349 C C   . SER A 1 307 ? 38.557  15.092 32.583 1.00 21.30 ? 307 SER A C   1 
ATOM   2350 O O   . SER A 1 307 ? 37.781  14.161 32.797 1.00 21.41 ? 307 SER A O   1 
ATOM   2351 C CB  . SER A 1 307 ? 38.131  17.488 33.138 1.00 20.33 ? 307 SER A CB  1 
ATOM   2352 O OG  . SER A 1 307 ? 38.811  17.984 32.007 1.00 21.34 ? 307 SER A OG  1 
ATOM   2353 N N   . ILE A 1 308 ? 39.245  15.193 31.454 1.00 21.57 ? 308 ILE A N   1 
ATOM   2354 C CA  . ILE A 1 308 ? 39.079  14.189 30.416 1.00 22.50 ? 308 ILE A CA  1 
ATOM   2355 C C   . ILE A 1 308 ? 39.498  12.797 30.894 1.00 23.89 ? 308 ILE A C   1 
ATOM   2356 O O   . ILE A 1 308 ? 38.770  11.825 30.683 1.00 23.91 ? 308 ILE A O   1 
ATOM   2357 C CB  . ILE A 1 308 ? 39.852  14.577 29.137 1.00 21.25 ? 308 ILE A CB  1 
ATOM   2358 C CG1 . ILE A 1 308 ? 39.294  15.889 28.590 1.00 19.87 ? 308 ILE A CG1 1 
ATOM   2359 C CG2 . ILE A 1 308 ? 39.706  13.501 28.080 1.00 19.53 ? 308 ILE A CG2 1 
ATOM   2360 C CD1 . ILE A 1 308 ? 37.817  15.847 28.322 1.00 18.06 ? 308 ILE A CD1 1 
ATOM   2361 N N   . LEU A 1 309 ? 40.656  12.692 31.546 1.00 24.38 ? 309 LEU A N   1 
ATOM   2362 C CA  . LEU A 1 309 ? 41.097  11.387 32.037 1.00 24.20 ? 309 LEU A CA  1 
ATOM   2363 C C   . LEU A 1 309 ? 40.158  10.894 33.143 1.00 24.04 ? 309 LEU A C   1 
ATOM   2364 O O   . LEU A 1 309 ? 40.012  9.688  33.355 1.00 25.35 ? 309 LEU A O   1 
ATOM   2365 C CB  . LEU A 1 309 ? 42.546  11.451 32.544 1.00 22.56 ? 309 LEU A CB  1 
ATOM   2366 C CG  . LEU A 1 309 ? 43.644  11.662 31.485 1.00 24.10 ? 309 LEU A CG  1 
ATOM   2367 C CD1 . LEU A 1 309 ? 44.977  11.894 32.170 1.00 23.88 ? 309 LEU A CD1 1 
ATOM   2368 C CD2 . LEU A 1 309 ? 43.740  10.467 30.558 1.00 21.33 ? 309 LEU A CD2 1 
ATOM   2369 N N   . ALA A 1 310 ? 39.508  11.823 33.838 1.00 22.93 ? 310 ALA A N   1 
ATOM   2370 C CA  . ALA A 1 310 ? 38.580  11.445 34.894 1.00 22.60 ? 310 ALA A CA  1 
ATOM   2371 C C   . ALA A 1 310 ? 37.382  10.724 34.283 1.00 23.16 ? 310 ALA A C   1 
ATOM   2372 O O   . ALA A 1 310 ? 36.744  9.899  34.938 1.00 23.98 ? 310 ALA A O   1 
ATOM   2373 C CB  . ALA A 1 310 ? 38.117  12.675 35.663 1.00 22.22 ? 310 ALA A CB  1 
ATOM   2374 N N   . GLY A 1 311 ? 37.072  11.035 33.028 1.00 23.32 ? 311 GLY A N   1 
ATOM   2375 C CA  . GLY A 1 311 ? 35.951  10.375 32.382 1.00 23.55 ? 311 GLY A CA  1 
ATOM   2376 C C   . GLY A 1 311 ? 34.894  11.248 31.714 1.00 23.20 ? 311 GLY A C   1 
ATOM   2377 O O   . GLY A 1 311 ? 33.988  10.723 31.066 1.00 23.39 ? 311 GLY A O   1 
ATOM   2378 N N   . LEU A 1 312 ? 34.983  12.566 31.863 1.00 22.64 ? 312 LEU A N   1 
ATOM   2379 C CA  . LEU A 1 312 ? 33.996  13.441 31.236 1.00 22.12 ? 312 LEU A CA  1 
ATOM   2380 C C   . LEU A 1 312 ? 34.086  13.294 29.713 1.00 22.08 ? 312 LEU A C   1 
ATOM   2381 O O   . LEU A 1 312 ? 35.169  13.102 29.161 1.00 22.92 ? 312 LEU A O   1 
ATOM   2382 C CB  . LEU A 1 312 ? 34.220  14.902 31.657 1.00 20.74 ? 312 LEU A CB  1 
ATOM   2383 C CG  . LEU A 1 312 ? 33.874  15.244 33.113 1.00 21.40 ? 312 LEU A CG  1 
ATOM   2384 C CD1 . LEU A 1 312 ? 34.879  14.581 34.039 1.00 20.40 ? 312 LEU A CD1 1 
ATOM   2385 C CD2 . LEU A 1 312 ? 33.878  16.753 33.326 1.00 18.96 ? 312 LEU A CD2 1 
ATOM   2386 N N   . ASP A 1 313 ? 32.944  13.379 29.041 1.00 20.16 ? 313 ASP A N   1 
ATOM   2387 C CA  . ASP A 1 313 ? 32.900  13.227 27.594 1.00 18.97 ? 313 ASP A CA  1 
ATOM   2388 C C   . ASP A 1 313 ? 32.717  14.540 26.828 1.00 19.32 ? 313 ASP A C   1 
ATOM   2389 O O   . ASP A 1 313 ? 33.301  14.730 25.762 1.00 18.84 ? 313 ASP A O   1 
ATOM   2390 C CB  . ASP A 1 313 ? 31.783  12.254 27.242 1.00 17.69 ? 313 ASP A CB  1 
ATOM   2391 C CG  . ASP A 1 313 ? 31.842  10.997 28.078 1.00 19.56 ? 313 ASP A CG  1 
ATOM   2392 O OD1 . ASP A 1 313 ? 32.879  10.312 28.030 1.00 21.87 ? 313 ASP A OD1 1 
ATOM   2393 O OD2 . ASP A 1 313 ? 30.863  10.692 28.790 1.00 20.87 ? 313 ASP A OD2 1 
ATOM   2394 N N   . MET A 1 314 ? 31.905  15.441 27.371 1.00 19.38 ? 314 MET A N   1 
ATOM   2395 C CA  . MET A 1 314 ? 31.653  16.726 26.729 1.00 19.10 ? 314 MET A CA  1 
ATOM   2396 C C   . MET A 1 314 ? 31.958  17.842 27.710 1.00 19.08 ? 314 MET A C   1 
ATOM   2397 O O   . MET A 1 314 ? 31.536  17.802 28.868 1.00 18.84 ? 314 MET A O   1 
ATOM   2398 C CB  . MET A 1 314 ? 30.192  16.833 26.281 1.00 18.91 ? 314 MET A CB  1 
ATOM   2399 C CG  . MET A 1 314 ? 29.883  18.118 25.518 1.00 19.51 ? 314 MET A CG  1 
ATOM   2400 S SD  . MET A 1 314 ? 28.152  18.311 25.050 1.00 18.21 ? 314 MET A SD  1 
ATOM   2401 C CE  . MET A 1 314 ? 27.953  16.964 23.901 1.00 14.18 ? 314 MET A CE  1 
ATOM   2402 N N   . ILE A 1 315 ? 32.683  18.849 27.249 1.00 17.89 ? 315 ILE A N   1 
ATOM   2403 C CA  . ILE A 1 315 ? 33.031  19.943 28.130 1.00 17.75 ? 315 ILE A CA  1 
ATOM   2404 C C   . ILE A 1 315 ? 32.269  21.218 27.834 1.00 18.63 ? 315 ILE A C   1 
ATOM   2405 O O   . ILE A 1 315 ? 32.248  21.709 26.705 1.00 17.08 ? 315 ILE A O   1 
ATOM   2406 C CB  . ILE A 1 315 ? 34.534  20.245 28.069 1.00 17.27 ? 315 ILE A CB  1 
ATOM   2407 C CG1 . ILE A 1 315 ? 35.331  18.975 28.380 1.00 17.32 ? 315 ILE A CG1 1 
ATOM   2408 C CG2 . ILE A 1 315 ? 34.875  21.360 29.044 1.00 16.55 ? 315 ILE A CG2 1 
ATOM   2409 C CD1 . ILE A 1 315 ? 35.036  18.375 29.741 1.00 16.85 ? 315 ILE A CD1 1 
ATOM   2410 N N   . MET A 1 316 ? 31.635  21.745 28.872 1.00 20.49 ? 316 MET A N   1 
ATOM   2411 C CA  . MET A 1 316 ? 30.884  22.985 28.768 1.00 21.37 ? 316 MET A CA  1 
ATOM   2412 C C   . MET A 1 316 ? 31.918  24.081 29.014 1.00 21.75 ? 316 MET A C   1 
ATOM   2413 O O   . MET A 1 316 ? 32.046  24.594 30.127 1.00 21.80 ? 316 MET A O   1 
ATOM   2414 C CB  . MET A 1 316 ? 29.805  23.015 29.844 1.00 22.13 ? 316 MET A CB  1 
ATOM   2415 C CG  . MET A 1 316 ? 28.651  23.934 29.536 1.00 22.95 ? 316 MET A CG  1 
ATOM   2416 S SD  . MET A 1 316 ? 27.365  23.773 30.772 1.00 24.41 ? 316 MET A SD  1 
ATOM   2417 C CE  . MET A 1 316 ? 27.455  25.312 31.455 1.00 21.21 ? 316 MET A CE  1 
ATOM   2418 N N   . VAL A 1 317 ? 32.654  24.426 27.963 1.00 21.65 ? 317 VAL A N   1 
ATOM   2419 C CA  . VAL A 1 317 ? 33.719  25.414 28.058 1.00 22.07 ? 317 VAL A CA  1 
ATOM   2420 C C   . VAL A 1 317 ? 33.391  26.679 28.868 1.00 22.09 ? 317 VAL A C   1 
ATOM   2421 O O   . VAL A 1 317 ? 33.979  26.897 29.928 1.00 22.19 ? 317 VAL A O   1 
ATOM   2422 C CB  . VAL A 1 317 ? 34.251  25.782 26.647 1.00 21.30 ? 317 VAL A CB  1 
ATOM   2423 C CG1 . VAL A 1 317 ? 35.497  26.643 26.769 1.00 21.91 ? 317 VAL A CG1 1 
ATOM   2424 C CG2 . VAL A 1 317 ? 34.583  24.513 25.872 1.00 18.66 ? 317 VAL A CG2 1 
ATOM   2425 N N   . PRO A 1 318 ? 32.467  27.532 28.393 1.00 22.43 ? 318 PRO A N   1 
ATOM   2426 C CA  . PRO A 1 318 ? 31.671  27.477 27.170 1.00 22.52 ? 318 PRO A CA  1 
ATOM   2427 C C   . PRO A 1 318 ? 32.076  28.608 26.216 1.00 22.79 ? 318 PRO A C   1 
ATOM   2428 O O   . PRO A 1 318 ? 31.441  28.805 25.182 1.00 24.07 ? 318 PRO A O   1 
ATOM   2429 C CB  . PRO A 1 318 ? 30.267  27.679 27.699 1.00 22.36 ? 318 PRO A CB  1 
ATOM   2430 C CG  . PRO A 1 318 ? 30.495  28.803 28.696 1.00 21.58 ? 318 PRO A CG  1 
ATOM   2431 C CD  . PRO A 1 318 ? 31.845  28.467 29.353 1.00 20.98 ? 318 PRO A CD  1 
ATOM   2432 N N   . ASN A 1 319 ? 33.122  29.350 26.571 1.00 22.06 ? 319 ASN A N   1 
ATOM   2433 C CA  . ASN A 1 319 ? 33.575  30.468 25.752 1.00 22.20 ? 319 ASN A CA  1 
ATOM   2434 C C   . ASN A 1 319 ? 34.928  30.282 25.062 1.00 24.68 ? 319 ASN A C   1 
ATOM   2435 O O   . ASN A 1 319 ? 35.012  30.350 23.838 1.00 25.40 ? 319 ASN A O   1 
ATOM   2436 C CB  . ASN A 1 319 ? 33.602  31.741 26.597 1.00 20.22 ? 319 ASN A CB  1 
ATOM   2437 C CG  . ASN A 1 319 ? 32.256  32.050 27.214 1.00 21.17 ? 319 ASN A CG  1 
ATOM   2438 O OD1 . ASN A 1 319 ? 31.231  32.038 26.532 1.00 21.89 ? 319 ASN A OD1 1 
ATOM   2439 N ND2 . ASN A 1 319 ? 32.249  32.332 28.509 1.00 18.26 ? 319 ASN A ND2 1 
ATOM   2440 N N   . LYS A 1 320 ? 35.987  30.067 25.838 1.00 26.74 ? 320 LYS A N   1 
ATOM   2441 C CA  . LYS A 1 320 ? 37.317  29.876 25.263 1.00 28.11 ? 320 LYS A CA  1 
ATOM   2442 C C   . LYS A 1 320 ? 37.461  28.493 24.628 1.00 27.61 ? 320 LYS A C   1 
ATOM   2443 O O   . LYS A 1 320 ? 38.272  27.674 25.074 1.00 28.26 ? 320 LYS A O   1 
ATOM   2444 C CB  . LYS A 1 320 ? 38.397  30.034 26.333 1.00 31.32 ? 320 LYS A CB  1 
ATOM   2445 C CG  . LYS A 1 320 ? 38.506  31.411 26.950 1.00 36.73 ? 320 LYS A CG  1 
ATOM   2446 C CD  . LYS A 1 320 ? 39.614  31.421 28.013 1.00 43.32 ? 320 LYS A CD  1 
ATOM   2447 C CE  . LYS A 1 320 ? 39.364  30.381 29.123 1.00 46.02 ? 320 LYS A CE  1 
ATOM   2448 N NZ  . LYS A 1 320 ? 40.506  30.217 30.087 1.00 47.71 ? 320 LYS A NZ  1 
ATOM   2449 N N   . TYR A 1 321 ? 36.676  28.233 23.590 1.00 25.93 ? 321 TYR A N   1 
ATOM   2450 C CA  . TYR A 1 321 ? 36.727  26.950 22.905 1.00 24.41 ? 321 TYR A CA  1 
ATOM   2451 C C   . TYR A 1 321 ? 38.059  26.764 22.187 1.00 25.32 ? 321 TYR A C   1 
ATOM   2452 O O   . TYR A 1 321 ? 38.540  25.638 22.034 1.00 24.37 ? 321 TYR A O   1 
ATOM   2453 C CB  . TYR A 1 321 ? 35.575  26.849 21.905 1.00 22.79 ? 321 TYR A CB  1 
ATOM   2454 C CG  . TYR A 1 321 ? 35.547  27.964 20.883 1.00 21.11 ? 321 TYR A CG  1 
ATOM   2455 C CD1 . TYR A 1 321 ? 36.380  27.934 19.768 1.00 20.64 ? 321 TYR A CD1 1 
ATOM   2456 C CD2 . TYR A 1 321 ? 34.706  29.062 21.048 1.00 21.08 ? 321 TYR A CD2 1 
ATOM   2457 C CE1 . TYR A 1 321 ? 36.379  28.969 18.843 1.00 20.94 ? 321 TYR A CE1 1 
ATOM   2458 C CE2 . TYR A 1 321 ? 34.696  30.106 20.130 1.00 22.59 ? 321 TYR A CE2 1 
ATOM   2459 C CZ  . TYR A 1 321 ? 35.536  30.053 19.028 1.00 23.79 ? 321 TYR A CZ  1 
ATOM   2460 O OH  . TYR A 1 321 ? 35.532  31.083 18.109 1.00 25.31 ? 321 TYR A OH  1 
ATOM   2461 N N   . GLN A 1 322 ? 38.654  27.868 21.742 1.00 26.54 ? 322 GLN A N   1 
ATOM   2462 C CA  . GLN A 1 322 ? 39.928  27.781 21.045 1.00 28.45 ? 322 GLN A CA  1 
ATOM   2463 C C   . GLN A 1 322 ? 40.981  27.203 21.981 1.00 27.78 ? 322 GLN A C   1 
ATOM   2464 O O   . GLN A 1 322 ? 41.707  26.275 21.619 1.00 27.94 ? 322 GLN A O   1 
ATOM   2465 C CB  . GLN A 1 322 ? 40.386  29.150 20.549 1.00 29.65 ? 322 GLN A CB  1 
ATOM   2466 C CG  . GLN A 1 322 ? 41.617  29.044 19.656 1.00 36.48 ? 322 GLN A CG  1 
ATOM   2467 C CD  . GLN A 1 322 ? 42.158  30.390 19.210 1.00 40.15 ? 322 GLN A CD  1 
ATOM   2468 O OE1 . GLN A 1 322 ? 41.414  31.242 18.711 1.00 42.75 ? 322 GLN A OE1 1 
ATOM   2469 N NE2 . GLN A 1 322 ? 43.466  30.586 19.377 1.00 40.51 ? 322 GLN A NE2 1 
ATOM   2470 N N   . GLN A 1 323 ? 41.051  27.757 23.187 1.00 26.77 ? 323 GLN A N   1 
ATOM   2471 C CA  . GLN A 1 323 ? 42.000  27.310 24.197 1.00 26.69 ? 323 GLN A CA  1 
ATOM   2472 C C   . GLN A 1 323 ? 41.755  25.840 24.537 1.00 24.75 ? 323 GLN A C   1 
ATOM   2473 O O   . GLN A 1 323 ? 42.690  25.040 24.605 1.00 24.22 ? 323 GLN A O   1 
ATOM   2474 C CB  . GLN A 1 323 ? 41.851  28.176 25.448 1.00 30.10 ? 323 GLN A CB  1 
ATOM   2475 C CG  . GLN A 1 323 ? 42.854  27.897 26.561 1.00 36.21 ? 323 GLN A CG  1 
ATOM   2476 C CD  . GLN A 1 323 ? 42.629  28.804 27.763 1.00 41.06 ? 323 GLN A CD  1 
ATOM   2477 O OE1 . GLN A 1 323 ? 42.708  30.034 27.653 1.00 44.08 ? 323 GLN A OE1 1 
ATOM   2478 N NE2 . GLN A 1 323 ? 42.332  28.205 28.911 1.00 41.62 ? 323 GLN A NE2 1 
ATOM   2479 N N   . PHE A 1 324 ? 40.489  25.491 24.743 1.00 23.34 ? 324 PHE A N   1 
ATOM   2480 C CA  . PHE A 1 324 ? 40.114  24.118 25.066 1.00 21.90 ? 324 PHE A CA  1 
ATOM   2481 C C   . PHE A 1 324 ? 40.513  23.131 23.981 1.00 21.01 ? 324 PHE A C   1 
ATOM   2482 O O   . PHE A 1 324 ? 41.122  22.107 24.270 1.00 20.98 ? 324 PHE A O   1 
ATOM   2483 C CB  . PHE A 1 324 ? 38.603  23.995 25.286 1.00 19.95 ? 324 PHE A CB  1 
ATOM   2484 C CG  . PHE A 1 324 ? 38.145  22.579 25.498 1.00 18.71 ? 324 PHE A CG  1 
ATOM   2485 C CD1 . PHE A 1 324 ? 38.460  21.898 26.675 1.00 18.29 ? 324 PHE A CD1 1 
ATOM   2486 C CD2 . PHE A 1 324 ? 37.446  21.905 24.501 1.00 16.03 ? 324 PHE A CD2 1 
ATOM   2487 C CE1 . PHE A 1 324 ? 38.088  20.567 26.852 1.00 15.99 ? 324 PHE A CE1 1 
ATOM   2488 C CE2 . PHE A 1 324 ? 37.071  20.575 24.670 1.00 14.30 ? 324 PHE A CE2 1 
ATOM   2489 C CZ  . PHE A 1 324 ? 37.395  19.906 25.848 1.00 15.25 ? 324 PHE A CZ  1 
ATOM   2490 N N   . ILE A 1 325 ? 40.152  23.431 22.737 1.00 21.00 ? 325 ILE A N   1 
ATOM   2491 C CA  . ILE A 1 325 ? 40.469  22.541 21.627 1.00 22.02 ? 325 ILE A CA  1 
ATOM   2492 C C   . ILE A 1 325 ? 41.972  22.460 21.383 1.00 21.90 ? 325 ILE A C   1 
ATOM   2493 O O   . ILE A 1 325 ? 42.518  21.383 21.142 1.00 22.70 ? 325 ILE A O   1 
ATOM   2494 C CB  . ILE A 1 325 ? 39.762  22.991 20.313 1.00 22.85 ? 325 ILE A CB  1 
ATOM   2495 C CG1 . ILE A 1 325 ? 38.246  23.031 20.522 1.00 23.35 ? 325 ILE A CG1 1 
ATOM   2496 C CG2 . ILE A 1 325 ? 40.093  22.026 19.182 1.00 19.00 ? 325 ILE A CG2 1 
ATOM   2497 C CD1 . ILE A 1 325 ? 37.467  23.527 19.326 1.00 23.38 ? 325 ILE A CD1 1 
ATOM   2498 N N   . SER A 1 326 ? 42.643  23.602 21.451 1.00 21.87 ? 326 SER A N   1 
ATOM   2499 C CA  . SER A 1 326 ? 44.078  23.632 21.230 1.00 22.03 ? 326 SER A CA  1 
ATOM   2500 C C   . SER A 1 326 ? 44.780  22.735 22.243 1.00 22.76 ? 326 SER A C   1 
ATOM   2501 O O   . SER A 1 326 ? 45.581  21.871 21.877 1.00 23.10 ? 326 SER A O   1 
ATOM   2502 C CB  . SER A 1 326 ? 44.597  25.062 21.356 1.00 21.30 ? 326 SER A CB  1 
ATOM   2503 O OG  . SER A 1 326 ? 45.946  25.138 20.942 1.00 24.32 ? 326 SER A OG  1 
ATOM   2504 N N   . ILE A 1 327 ? 44.458  22.933 23.517 1.00 21.98 ? 327 ILE A N   1 
ATOM   2505 C CA  . ILE A 1 327 ? 45.062  22.156 24.590 1.00 21.44 ? 327 ILE A CA  1 
ATOM   2506 C C   . ILE A 1 327 ? 44.746  20.664 24.546 1.00 22.41 ? 327 ILE A C   1 
ATOM   2507 O O   . ILE A 1 327 ? 45.641  19.829 24.713 1.00 22.29 ? 327 ILE A O   1 
ATOM   2508 C CB  . ILE A 1 327 ? 44.651  22.714 25.956 1.00 20.43 ? 327 ILE A CB  1 
ATOM   2509 C CG1 . ILE A 1 327 ? 45.218  24.122 26.110 1.00 19.42 ? 327 ILE A CG1 1 
ATOM   2510 C CG2 . ILE A 1 327 ? 45.152  21.802 27.078 1.00 19.20 ? 327 ILE A CG2 1 
ATOM   2511 C CD1 . ILE A 1 327 ? 44.859  24.778 27.414 1.00 21.79 ? 327 ILE A CD1 1 
ATOM   2512 N N   . LEU A 1 328 ? 43.483  20.317 24.331 1.00 22.27 ? 328 LEU A N   1 
ATOM   2513 C CA  . LEU A 1 328 ? 43.120  18.909 24.279 1.00 22.60 ? 328 LEU A CA  1 
ATOM   2514 C C   . LEU A 1 328 ? 43.851  18.242 23.107 1.00 23.27 ? 328 LEU A C   1 
ATOM   2515 O O   . LEU A 1 328 ? 44.311  17.105 23.209 1.00 23.65 ? 328 LEU A O   1 
ATOM   2516 C CB  . LEU A 1 328 ? 41.602  18.751 24.134 1.00 20.27 ? 328 LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 328 ? 41.091  17.309 24.139 1.00 18.95 ? 328 LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 328 ? 41.719  16.549 25.289 1.00 17.85 ? 328 LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 328 ? 39.576  17.297 24.250 1.00 19.06 ? 328 LEU A CD2 1 
ATOM   2520 N N   . THR A 1 329 ? 43.970  18.962 21.998 1.00 22.75 ? 329 THR A N   1 
ATOM   2521 C CA  . THR A 1 329 ? 44.657  18.428 20.834 1.00 23.44 ? 329 THR A CA  1 
ATOM   2522 C C   . THR A 1 329 ? 46.119  18.134 21.191 1.00 24.40 ? 329 THR A C   1 
ATOM   2523 O O   . THR A 1 329 ? 46.634  17.047 20.911 1.00 24.11 ? 329 THR A O   1 
ATOM   2524 C CB  . THR A 1 329 ? 44.600  19.426 19.663 1.00 22.22 ? 329 THR A CB  1 
ATOM   2525 O OG1 . THR A 1 329 ? 43.233  19.675 19.324 1.00 22.72 ? 329 THR A OG1 1 
ATOM   2526 C CG2 . THR A 1 329 ? 45.312  18.868 18.444 1.00 20.23 ? 329 THR A CG2 1 
ATOM   2527 N N   . GLY A 1 330 ? 46.779  19.105 21.817 1.00 24.27 ? 330 GLY A N   1 
ATOM   2528 C CA  . GLY A 1 330 ? 48.163  18.922 22.209 1.00 23.50 ? 330 GLY A CA  1 
ATOM   2529 C C   . GLY A 1 330 ? 48.341  17.685 23.067 1.00 23.81 ? 330 GLY A C   1 
ATOM   2530 O O   . GLY A 1 330 ? 49.246  16.885 22.838 1.00 24.42 ? 330 GLY A O   1 
ATOM   2531 N N   . HIS A 1 331 ? 47.470  17.518 24.055 1.00 23.95 ? 331 HIS A N   1 
ATOM   2532 C CA  . HIS A 1 331 ? 47.546  16.366 24.943 1.00 24.77 ? 331 HIS A CA  1 
ATOM   2533 C C   . HIS A 1 331 ? 47.400  15.046 24.200 1.00 24.29 ? 331 HIS A C   1 
ATOM   2534 O O   . HIS A 1 331 ? 48.064  14.058 24.533 1.00 25.80 ? 331 HIS A O   1 
ATOM   2535 C CB  . HIS A 1 331 ? 46.481  16.480 26.031 1.00 26.44 ? 331 HIS A CB  1 
ATOM   2536 C CG  . HIS A 1 331 ? 46.821  17.477 27.094 1.00 29.00 ? 331 HIS A CG  1 
ATOM   2537 N ND1 . HIS A 1 331 ? 45.869  18.050 27.912 1.00 30.00 ? 331 HIS A ND1 1 
ATOM   2538 C CD2 . HIS A 1 331 ? 48.013  17.988 27.488 1.00 29.05 ? 331 HIS A CD2 1 
ATOM   2539 C CE1 . HIS A 1 331 ? 46.460  18.871 28.762 1.00 29.73 ? 331 HIS A CE1 1 
ATOM   2540 N NE2 . HIS A 1 331 ? 47.760  18.851 28.526 1.00 28.35 ? 331 HIS A NE2 1 
ATOM   2541 N N   . VAL A 1 332 ? 46.530  15.021 23.196 1.00 22.26 ? 332 VAL A N   1 
ATOM   2542 C CA  . VAL A 1 332 ? 46.344  13.803 22.428 1.00 20.74 ? 332 VAL A CA  1 
ATOM   2543 C C   . VAL A 1 332 ? 47.583  13.582 21.582 1.00 21.25 ? 332 VAL A C   1 
ATOM   2544 O O   . VAL A 1 332 ? 48.142  12.490 21.588 1.00 21.10 ? 332 VAL A O   1 
ATOM   2545 C CB  . VAL A 1 332 ? 45.104  13.879 21.522 1.00 19.03 ? 332 VAL A CB  1 
ATOM   2546 C CG1 . VAL A 1 332 ? 45.049  12.662 20.605 1.00 16.69 ? 332 VAL A CG1 1 
ATOM   2547 C CG2 . VAL A 1 332 ? 43.858  13.940 22.380 1.00 17.23 ? 332 VAL A CG2 1 
ATOM   2548 N N   . ASN A 1 333 ? 48.017  14.621 20.869 1.00 21.99 ? 333 ASN A N   1 
ATOM   2549 C CA  . ASN A 1 333 ? 49.211  14.521 20.030 1.00 22.57 ? 333 ASN A CA  1 
ATOM   2550 C C   . ASN A 1 333 ? 50.427  14.074 20.849 1.00 23.48 ? 333 ASN A C   1 
ATOM   2551 O O   . ASN A 1 333 ? 51.304  13.376 20.344 1.00 23.03 ? 333 ASN A O   1 
ATOM   2552 C CB  . ASN A 1 333 ? 49.524  15.863 19.352 1.00 20.99 ? 333 ASN A CB  1 
ATOM   2553 C CG  . ASN A 1 333 ? 48.534  16.217 18.244 1.00 21.37 ? 333 ASN A CG  1 
ATOM   2554 O OD1 . ASN A 1 333 ? 48.013  15.343 17.552 1.00 22.31 ? 333 ASN A OD1 1 
ATOM   2555 N ND2 . ASN A 1 333 ? 48.293  17.508 18.059 1.00 19.23 ? 333 ASN A ND2 1 
ATOM   2556 N N   . GLY A 1 334 ? 50.464  14.463 22.119 1.00 23.90 ? 334 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 334 ? 51.582  14.097 22.969 1.00 24.94 ? 334 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 334 ? 51.461  12.777 23.714 1.00 25.53 ? 334 GLY A C   1 
ATOM   2559 O O   . GLY A 1 334 ? 52.375  12.396 24.449 1.00 25.21 ? 334 GLY A O   1 
ATOM   2560 N N   . GLY A 1 335 ? 50.343  12.078 23.541 1.00 26.03 ? 335 GLY A N   1 
ATOM   2561 C CA  . GLY A 1 335 ? 50.162  10.803 24.213 1.00 25.64 ? 335 GLY A CA  1 
ATOM   2562 C C   . GLY A 1 335 ? 49.674  10.895 25.649 1.00 26.36 ? 335 GLY A C   1 
ATOM   2563 O O   . GLY A 1 335 ? 49.419  9.866  26.284 1.00 26.51 ? 335 GLY A O   1 
ATOM   2564 N N   . VAL A 1 336 ? 49.540  12.114 26.166 1.00 26.02 ? 336 VAL A N   1 
ATOM   2565 C CA  . VAL A 1 336 ? 49.072  12.319 27.539 1.00 26.84 ? 336 VAL A CA  1 
ATOM   2566 C C   . VAL A 1 336 ? 47.638  11.811 27.737 1.00 27.03 ? 336 VAL A C   1 
ATOM   2567 O O   . VAL A 1 336 ? 47.263  11.381 28.832 1.00 27.71 ? 336 VAL A O   1 
ATOM   2568 C CB  . VAL A 1 336 ? 49.146  13.806 27.919 1.00 28.69 ? 336 VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 336 ? 48.546  14.028 29.304 1.00 30.49 ? 336 VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 336 ? 50.594  14.263 27.893 1.00 28.57 ? 336 VAL A CG2 1 
ATOM   2571 N N   . ILE A 1 337 ? 46.834  11.886 26.680 1.00 26.14 ? 337 ILE A N   1 
ATOM   2572 C CA  . ILE A 1 337 ? 45.462  11.388 26.713 1.00 24.04 ? 337 ILE A CA  1 
ATOM   2573 C C   . ILE A 1 337 ? 45.364  10.435 25.533 1.00 23.77 ? 337 ILE A C   1 
ATOM   2574 O O   . ILE A 1 337 ? 45.538  10.839 24.388 1.00 23.34 ? 337 ILE A O   1 
ATOM   2575 C CB  . ILE A 1 337 ? 44.422  12.508 26.542 1.00 23.33 ? 337 ILE A CB  1 
ATOM   2576 C CG1 . ILE A 1 337 ? 44.457  13.445 27.748 1.00 22.50 ? 337 ILE A CG1 1 
ATOM   2577 C CG2 . ILE A 1 337 ? 43.038  11.904 26.399 1.00 21.26 ? 337 ILE A CG2 1 
ATOM   2578 C CD1 . ILE A 1 337 ? 43.467  14.577 27.664 1.00 19.99 ? 337 ILE A CD1 1 
ATOM   2579 N N   . PRO A 1 338 ? 45.081  9.154  25.800 1.00 23.19 ? 338 PRO A N   1 
ATOM   2580 C CA  . PRO A 1 338 ? 44.968  8.133  24.760 1.00 22.86 ? 338 PRO A CA  1 
ATOM   2581 C C   . PRO A 1 338 ? 43.752  8.274  23.854 1.00 24.21 ? 338 PRO A C   1 
ATOM   2582 O O   . PRO A 1 338 ? 42.683  8.703  24.286 1.00 25.15 ? 338 PRO A O   1 
ATOM   2583 C CB  . PRO A 1 338 ? 44.938  6.844  25.565 1.00 21.82 ? 338 PRO A CB  1 
ATOM   2584 C CG  . PRO A 1 338 ? 44.151  7.241  26.760 1.00 21.70 ? 338 PRO A CG  1 
ATOM   2585 C CD  . PRO A 1 338 ? 44.725  8.595  27.118 1.00 22.75 ? 338 PRO A CD  1 
ATOM   2586 N N   . MET A 1 339 ? 43.921  7.902  22.593 1.00 24.53 ? 339 MET A N   1 
ATOM   2587 C CA  . MET A 1 339 ? 42.826  7.968  21.642 1.00 25.59 ? 339 MET A CA  1 
ATOM   2588 C C   . MET A 1 339 ? 41.605  7.194  22.139 1.00 24.85 ? 339 MET A C   1 
ATOM   2589 O O   . MET A 1 339 ? 40.474  7.505  21.754 1.00 25.03 ? 339 MET A O   1 
ATOM   2590 C CB  . MET A 1 339 ? 43.260  7.415  20.282 1.00 25.91 ? 339 MET A CB  1 
ATOM   2591 C CG  . MET A 1 339 ? 43.726  8.481  19.300 1.00 29.77 ? 339 MET A CG  1 
ATOM   2592 S SD  . MET A 1 339 ? 42.447  9.721  18.949 1.00 31.06 ? 339 MET A SD  1 
ATOM   2593 C CE  . MET A 1 339 ? 41.048  8.638  18.589 1.00 31.32 ? 339 MET A CE  1 
ATOM   2594 N N   . SER A 1 340 ? 41.826  6.193  22.988 1.00 23.12 ? 340 SER A N   1 
ATOM   2595 C CA  . SER A 1 340 ? 40.714  5.404  23.510 1.00 23.01 ? 340 SER A CA  1 
ATOM   2596 C C   . SER A 1 340 ? 39.806  6.267  24.386 1.00 22.45 ? 340 SER A C   1 
ATOM   2597 O O   . SER A 1 340 ? 38.586  6.095  24.383 1.00 20.68 ? 340 SER A O   1 
ATOM   2598 C CB  . SER A 1 340 ? 41.225  4.198  24.308 1.00 21.88 ? 340 SER A CB  1 
ATOM   2599 O OG  . SER A 1 340 ? 42.055  4.594  25.384 1.00 24.29 ? 340 SER A OG  1 
ATOM   2600 N N   . ARG A 1 341 ? 40.404  7.193  25.133 1.00 21.41 ? 341 ARG A N   1 
ATOM   2601 C CA  . ARG A 1 341 ? 39.629  8.080  25.990 1.00 21.79 ? 341 ARG A CA  1 
ATOM   2602 C C   . ARG A 1 341 ? 38.747  8.943  25.084 1.00 22.80 ? 341 ARG A C   1 
ATOM   2603 O O   . ARG A 1 341 ? 37.541  9.065  25.308 1.00 23.34 ? 341 ARG A O   1 
ATOM   2604 C CB  . ARG A 1 341 ? 40.564  8.961  26.818 1.00 20.77 ? 341 ARG A CB  1 
ATOM   2605 C CG  . ARG A 1 341 ? 39.869  9.851  27.844 1.00 20.32 ? 341 ARG A CG  1 
ATOM   2606 C CD  . ARG A 1 341 ? 39.066  9.047  28.868 1.00 18.49 ? 341 ARG A CD  1 
ATOM   2607 N NE  . ARG A 1 341 ? 37.695  8.769  28.441 1.00 18.33 ? 341 ARG A NE  1 
ATOM   2608 C CZ  . ARG A 1 341 ? 36.720  9.674  28.394 1.00 16.61 ? 341 ARG A CZ  1 
ATOM   2609 N NH1 . ARG A 1 341 ? 36.950  10.928 28.747 1.00 15.41 ? 341 ARG A NH1 1 
ATOM   2610 N NH2 . ARG A 1 341 ? 35.509  9.323  27.995 1.00 16.68 ? 341 ARG A NH2 1 
ATOM   2611 N N   . ILE A 1 342 ? 39.363  9.524  24.055 1.00 22.90 ? 342 ILE A N   1 
ATOM   2612 C CA  . ILE A 1 342 ? 38.661  10.361 23.091 1.00 21.92 ? 342 ILE A CA  1 
ATOM   2613 C C   . ILE A 1 342 ? 37.588  9.553  22.367 1.00 23.18 ? 342 ILE A C   1 
ATOM   2614 O O   . ILE A 1 342 ? 36.449  10.011 22.232 1.00 23.10 ? 342 ILE A O   1 
ATOM   2615 C CB  . ILE A 1 342 ? 39.631  10.939 22.029 1.00 21.88 ? 342 ILE A CB  1 
ATOM   2616 C CG1 . ILE A 1 342 ? 40.720  11.782 22.707 1.00 22.08 ? 342 ILE A CG1 1 
ATOM   2617 C CG2 . ILE A 1 342 ? 38.853  11.763 21.002 1.00 19.51 ? 342 ILE A CG2 1 
ATOM   2618 C CD1 . ILE A 1 342 ? 40.206  12.971 23.502 1.00 21.18 ? 342 ILE A CD1 1 
ATOM   2619 N N   . ASP A 1 343 ? 37.946  8.358  21.896 1.00 22.84 ? 343 ASP A N   1 
ATOM   2620 C CA  . ASP A 1 343 ? 36.982  7.515  21.194 1.00 23.89 ? 343 ASP A CA  1 
ATOM   2621 C C   . ASP A 1 343 ? 35.785  7.183  22.081 1.00 23.90 ? 343 ASP A C   1 
ATOM   2622 O O   . ASP A 1 343 ? 34.636  7.217  21.628 1.00 24.39 ? 343 ASP A O   1 
ATOM   2623 C CB  . ASP A 1 343 ? 37.632  6.217  20.694 1.00 24.69 ? 343 ASP A CB  1 
ATOM   2624 C CG  . ASP A 1 343 ? 38.483  6.432  19.444 1.00 27.61 ? 343 ASP A CG  1 
ATOM   2625 O OD1 . ASP A 1 343 ? 38.195  7.386  18.692 1.00 28.03 ? 343 ASP A OD1 1 
ATOM   2626 O OD2 . ASP A 1 343 ? 39.427  5.645  19.199 1.00 29.66 ? 343 ASP A OD2 1 
ATOM   2627 N N   . ASP A 1 344 ? 36.045  6.873  23.344 1.00 23.07 ? 344 ASP A N   1 
ATOM   2628 C CA  . ASP A 1 344 ? 34.958  6.547  24.262 1.00 23.56 ? 344 ASP A CA  1 
ATOM   2629 C C   . ASP A 1 344 ? 34.011  7.739  24.414 1.00 23.49 ? 344 ASP A C   1 
ATOM   2630 O O   . ASP A 1 344 ? 32.790  7.587  24.331 1.00 24.84 ? 344 ASP A O   1 
ATOM   2631 C CB  . ASP A 1 344 ? 35.510  6.153  25.634 1.00 22.84 ? 344 ASP A CB  1 
ATOM   2632 C CG  . ASP A 1 344 ? 34.418  5.975  26.666 1.00 23.72 ? 344 ASP A CG  1 
ATOM   2633 O OD1 . ASP A 1 344 ? 33.612  5.024  26.540 1.00 21.13 ? 344 ASP A OD1 1 
ATOM   2634 O OD2 . ASP A 1 344 ? 34.363  6.803  27.603 1.00 24.77 ? 344 ASP A OD2 1 
ATOM   2635 N N   . ALA A 1 345 ? 34.583  8.918  24.636 1.00 21.77 ? 345 ALA A N   1 
ATOM   2636 C CA  . ALA A 1 345 ? 33.803  10.137 24.797 1.00 21.24 ? 345 ALA A CA  1 
ATOM   2637 C C   . ALA A 1 345 ? 32.942  10.408 23.562 1.00 21.67 ? 345 ALA A C   1 
ATOM   2638 O O   . ALA A 1 345 ? 31.755  10.717 23.672 1.00 21.17 ? 345 ALA A O   1 
ATOM   2639 C CB  . ALA A 1 345 ? 34.736  11.318 25.055 1.00 21.01 ? 345 ALA A CB  1 
ATOM   2640 N N   . VAL A 1 346 ? 33.543  10.289 22.383 1.00 21.88 ? 346 VAL A N   1 
ATOM   2641 C CA  . VAL A 1 346 ? 32.808  10.530 21.150 1.00 21.18 ? 346 VAL A CA  1 
ATOM   2642 C C   . VAL A 1 346 ? 31.771  9.431  20.919 1.00 21.78 ? 346 VAL A C   1 
ATOM   2643 O O   . VAL A 1 346 ? 30.686  9.687  20.391 1.00 21.57 ? 346 VAL A O   1 
ATOM   2644 C CB  . VAL A 1 346 ? 33.768  10.634 19.941 1.00 20.41 ? 346 VAL A CB  1 
ATOM   2645 C CG1 . VAL A 1 346 ? 32.970  10.763 18.639 1.00 17.80 ? 346 VAL A CG1 1 
ATOM   2646 C CG2 . VAL A 1 346 ? 34.688  11.837 20.124 1.00 16.45 ? 346 VAL A CG2 1 
ATOM   2647 N N   . THR A 1 347 ? 32.098  8.209  21.325 1.00 21.94 ? 347 THR A N   1 
ATOM   2648 C CA  . THR A 1 347 ? 31.158  7.103  21.172 1.00 21.93 ? 347 THR A CA  1 
ATOM   2649 C C   . THR A 1 347 ? 29.858  7.417  21.925 1.00 20.88 ? 347 THR A C   1 
ATOM   2650 O O   . THR A 1 347 ? 28.768  7.247  21.391 1.00 20.62 ? 347 THR A O   1 
ATOM   2651 C CB  . THR A 1 347 ? 31.754  5.772  21.711 1.00 21.55 ? 347 THR A CB  1 
ATOM   2652 O OG1 . THR A 1 347 ? 32.793  5.320  20.832 1.00 19.26 ? 347 THR A OG1 1 
ATOM   2653 C CG2 . THR A 1 347 ? 30.676  4.699  21.811 1.00 18.83 ? 347 THR A CG2 1 
ATOM   2654 N N   . ARG A 1 348 ? 29.991  7.896  23.158 1.00 20.88 ? 348 ARG A N   1 
ATOM   2655 C CA  . ARG A 1 348 ? 28.843  8.225  24.003 1.00 21.32 ? 348 ARG A CA  1 
ATOM   2656 C C   . ARG A 1 348 ? 28.022  9.402  23.497 1.00 21.50 ? 348 ARG A C   1 
ATOM   2657 O O   . ARG A 1 348 ? 26.792  9.371  23.546 1.00 21.88 ? 348 ARG A O   1 
ATOM   2658 C CB  . ARG A 1 348 ? 29.317  8.500  25.429 1.00 20.69 ? 348 ARG A CB  1 
ATOM   2659 C CG  . ARG A 1 348 ? 29.858  7.262  26.127 1.00 20.95 ? 348 ARG A CG  1 
ATOM   2660 C CD  . ARG A 1 348 ? 30.827  7.609  27.240 1.00 20.88 ? 348 ARG A CD  1 
ATOM   2661 N NE  . ARG A 1 348 ? 31.200  6.426  28.007 1.00 21.40 ? 348 ARG A NE  1 
ATOM   2662 C CZ  . ARG A 1 348 ? 30.370  5.766  28.808 1.00 20.95 ? 348 ARG A CZ  1 
ATOM   2663 N NH1 . ARG A 1 348 ? 29.121  6.171  28.951 1.00 22.78 ? 348 ARG A NH1 1 
ATOM   2664 N NH2 . ARG A 1 348 ? 30.787  4.697  29.466 1.00 22.25 ? 348 ARG A NH2 1 
ATOM   2665 N N   . ILE A 1 349 ? 28.695  10.440 23.011 1.00 22.10 ? 349 ILE A N   1 
ATOM   2666 C CA  . ILE A 1 349 ? 27.997  11.616 22.500 1.00 20.99 ? 349 ILE A CA  1 
ATOM   2667 C C   . ILE A 1 349 ? 27.186  11.252 21.256 1.00 21.86 ? 349 ILE A C   1 
ATOM   2668 O O   . ILE A 1 349 ? 26.025  11.661 21.109 1.00 22.11 ? 349 ILE A O   1 
ATOM   2669 C CB  . ILE A 1 349 ? 28.996  12.748 22.158 1.00 19.49 ? 349 ILE A CB  1 
ATOM   2670 C CG1 . ILE A 1 349 ? 29.671  13.233 23.448 1.00 18.44 ? 349 ILE A CG1 1 
ATOM   2671 C CG2 . ILE A 1 349 ? 28.284  13.887 21.446 1.00 15.63 ? 349 ILE A CG2 1 
ATOM   2672 C CD1 . ILE A 1 349 ? 30.770  14.248 23.238 1.00 16.78 ? 349 ILE A CD1 1 
ATOM   2673 N N   . LEU A 1 350 ? 27.797  10.472 20.369 1.00 21.21 ? 350 LEU A N   1 
ATOM   2674 C CA  . LEU A 1 350 ? 27.131  10.060 19.146 1.00 19.68 ? 350 LEU A CA  1 
ATOM   2675 C C   . LEU A 1 350 ? 25.994  9.108  19.456 1.00 19.61 ? 350 LEU A C   1 
ATOM   2676 O O   . LEU A 1 350 ? 24.935  9.187  18.837 1.00 19.16 ? 350 LEU A O   1 
ATOM   2677 C CB  . LEU A 1 350 ? 28.124  9.395  18.194 1.00 18.79 ? 350 LEU A CB  1 
ATOM   2678 C CG  . LEU A 1 350 ? 29.165  10.340 17.591 1.00 18.59 ? 350 LEU A CG  1 
ATOM   2679 C CD1 . LEU A 1 350 ? 30.134  9.549  16.730 1.00 17.91 ? 350 LEU A CD1 1 
ATOM   2680 C CD2 . LEU A 1 350 ? 28.469  11.415 16.770 1.00 16.34 ? 350 LEU A CD2 1 
ATOM   2681 N N   . ARG A 1 351 ? 26.206  8.213  20.416 1.00 19.27 ? 351 ARG A N   1 
ATOM   2682 C CA  . ARG A 1 351 ? 25.161  7.261  20.786 1.00 19.99 ? 351 ARG A CA  1 
ATOM   2683 C C   . ARG A 1 351 ? 23.891  8.018  21.174 1.00 19.57 ? 351 ARG A C   1 
ATOM   2684 O O   . ARG A 1 351 ? 22.789  7.690  20.718 1.00 18.01 ? 351 ARG A O   1 
ATOM   2685 C CB  . ARG A 1 351 ? 25.604  6.377  21.960 1.00 19.62 ? 351 ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 351 ? 24.554  5.348  22.366 1.00 18.74 ? 351 ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 351 ? 25.036  4.455  23.484 1.00 19.66 ? 351 ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 351 ? 26.149  3.615  23.063 1.00 21.44 ? 351 ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 351 ? 27.342  3.614  23.647 1.00 21.63 ? 351 ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 351 ? 27.574  4.411  24.677 1.00 21.80 ? 351 ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 351 ? 28.301  2.817  23.206 1.00 21.32 ? 351 ARG A NH2 1 
ATOM   2692 N N   . VAL A 1 352 ? 24.059  9.040  22.010 1.00 18.44 ? 352 VAL A N   1 
ATOM   2693 C CA  . VAL A 1 352 ? 22.935  9.845  22.461 1.00 18.00 ? 352 VAL A CA  1 
ATOM   2694 C C   . VAL A 1 352 ? 22.253  10.546 21.289 1.00 19.18 ? 352 VAL A C   1 
ATOM   2695 O O   . VAL A 1 352 ? 21.029  10.511 21.172 1.00 20.29 ? 352 VAL A O   1 
ATOM   2696 C CB  . VAL A 1 352 ? 23.380  10.900 23.502 1.00 17.59 ? 352 VAL A CB  1 
ATOM   2697 C CG1 . VAL A 1 352 ? 22.180  11.660 24.010 1.00 14.81 ? 352 VAL A CG1 1 
ATOM   2698 C CG2 . VAL A 1 352 ? 24.096  10.222 24.657 1.00 14.49 ? 352 VAL A CG2 1 
ATOM   2699 N N   . LYS A 1 353 ? 23.042  11.169 20.415 1.00 20.17 ? 353 LYS A N   1 
ATOM   2700 C CA  . LYS A 1 353 ? 22.490  11.877 19.261 1.00 19.12 ? 353 LYS A CA  1 
ATOM   2701 C C   . LYS A 1 353 ? 21.741  10.964 18.289 1.00 19.91 ? 353 LYS A C   1 
ATOM   2702 O O   . LYS A 1 353 ? 20.676  11.322 17.776 1.00 19.01 ? 353 LYS A O   1 
ATOM   2703 C CB  . LYS A 1 353 ? 23.598  12.609 18.517 1.00 17.71 ? 353 LYS A CB  1 
ATOM   2704 C CG  . LYS A 1 353 ? 24.251  13.713 19.316 1.00 16.78 ? 353 LYS A CG  1 
ATOM   2705 C CD  . LYS A 1 353 ? 25.219  14.477 18.428 1.00 16.05 ? 353 LYS A CD  1 
ATOM   2706 C CE  . LYS A 1 353 ? 25.765  15.700 19.123 1.00 15.55 ? 353 LYS A CE  1 
ATOM   2707 N NZ  . LYS A 1 353 ? 26.527  16.551 18.174 1.00 15.14 ? 353 LYS A NZ  1 
ATOM   2708 N N   . PHE A 1 354 ? 22.298  9.786  18.029 1.00 20.34 ? 354 PHE A N   1 
ATOM   2709 C CA  . PHE A 1 354 ? 21.645  8.844  17.129 1.00 21.03 ? 354 PHE A CA  1 
ATOM   2710 C C   . PHE A 1 354 ? 20.356  8.346  17.770 1.00 22.63 ? 354 PHE A C   1 
ATOM   2711 O O   . PHE A 1 354 ? 19.293  8.359  17.150 1.00 23.73 ? 354 PHE A O   1 
ATOM   2712 C CB  . PHE A 1 354 ? 22.562  7.653  16.829 1.00 18.91 ? 354 PHE A CB  1 
ATOM   2713 C CG  . PHE A 1 354 ? 23.540  7.899  15.709 1.00 19.42 ? 354 PHE A CG  1 
ATOM   2714 C CD1 . PHE A 1 354 ? 23.083  8.177  14.416 1.00 19.49 ? 354 PHE A CD1 1 
ATOM   2715 C CD2 . PHE A 1 354 ? 24.916  7.833  15.938 1.00 18.16 ? 354 PHE A CD2 1 
ATOM   2716 C CE1 . PHE A 1 354 ? 23.977  8.382  13.371 1.00 18.76 ? 354 PHE A CE1 1 
ATOM   2717 C CE2 . PHE A 1 354 ? 25.821  8.037  14.899 1.00 19.42 ? 354 PHE A CE2 1 
ATOM   2718 C CZ  . PHE A 1 354 ? 25.349  8.312  13.610 1.00 19.80 ? 354 PHE A CZ  1 
ATOM   2719 N N   . THR A 1 355 ? 20.458  7.922  19.025 1.00 23.44 ? 355 THR A N   1 
ATOM   2720 C CA  . THR A 1 355 ? 19.310  7.403  19.751 1.00 23.51 ? 355 THR A CA  1 
ATOM   2721 C C   . THR A 1 355 ? 18.110  8.350  19.760 1.00 24.24 ? 355 THR A C   1 
ATOM   2722 O O   . THR A 1 355 ? 16.969  7.922  19.549 1.00 24.24 ? 355 THR A O   1 
ATOM   2723 C CB  . THR A 1 355 ? 19.691  7.074  21.201 1.00 23.86 ? 355 THR A CB  1 
ATOM   2724 O OG1 . THR A 1 355 ? 20.741  6.098  21.204 1.00 22.93 ? 355 THR A OG1 1 
ATOM   2725 C CG2 . THR A 1 355 ? 18.489  6.525  21.958 1.00 22.05 ? 355 THR A CG2 1 
ATOM   2726 N N   . MET A 1 356 ? 18.360  9.633  19.998 1.00 22.29 ? 356 MET A N   1 
ATOM   2727 C CA  . MET A 1 356 ? 17.272  10.592 20.044 1.00 21.28 ? 356 MET A CA  1 
ATOM   2728 C C   . MET A 1 356 ? 16.775  10.991 18.661 1.00 20.89 ? 356 MET A C   1 
ATOM   2729 O O   . MET A 1 356 ? 15.857  11.801 18.535 1.00 21.78 ? 356 MET A O   1 
ATOM   2730 C CB  . MET A 1 356 ? 17.694  11.834 20.824 1.00 22.05 ? 356 MET A CB  1 
ATOM   2731 C CG  . MET A 1 356 ? 18.670  12.746 20.102 1.00 23.59 ? 356 MET A CG  1 
ATOM   2732 S SD  . MET A 1 356 ? 19.085  14.175 21.131 1.00 23.95 ? 356 MET A SD  1 
ATOM   2733 C CE  . MET A 1 356 ? 20.530  13.537 21.913 1.00 25.15 ? 356 MET A CE  1 
ATOM   2734 N N   . GLY A 1 357 ? 17.379  10.424 17.624 1.00 19.19 ? 357 GLY A N   1 
ATOM   2735 C CA  . GLY A 1 357 ? 16.954  10.742 16.272 1.00 19.35 ? 357 GLY A CA  1 
ATOM   2736 C C   . GLY A 1 357 ? 17.458  12.064 15.721 1.00 20.32 ? 357 GLY A C   1 
ATOM   2737 O O   . GLY A 1 357 ? 16.957  12.557 14.705 1.00 21.31 ? 357 GLY A O   1 
ATOM   2738 N N   . LEU A 1 358 ? 18.459  12.640 16.378 1.00 20.46 ? 358 LEU A N   1 
ATOM   2739 C CA  . LEU A 1 358 ? 19.024  13.915 15.946 1.00 20.03 ? 358 LEU A CA  1 
ATOM   2740 C C   . LEU A 1 358 ? 19.430  13.929 14.472 1.00 20.04 ? 358 LEU A C   1 
ATOM   2741 O O   . LEU A 1 358 ? 19.238  14.934 13.792 1.00 19.56 ? 358 LEU A O   1 
ATOM   2742 C CB  . LEU A 1 358 ? 20.252  14.264 16.785 1.00 19.91 ? 358 LEU A CB  1 
ATOM   2743 C CG  . LEU A 1 358 ? 20.280  15.598 17.525 1.00 19.95 ? 358 LEU A CG  1 
ATOM   2744 C CD1 . LEU A 1 358 ? 21.741  15.967 17.794 1.00 19.32 ? 358 LEU A CD1 1 
ATOM   2745 C CD2 . LEU A 1 358 ? 19.590  16.677 16.705 1.00 19.86 ? 358 LEU A CD2 1 
ATOM   2746 N N   . PHE A 1 359 ? 20.009  12.832 13.984 1.00 19.46 ? 359 PHE A N   1 
ATOM   2747 C CA  . PHE A 1 359 ? 20.436  12.772 12.589 1.00 19.95 ? 359 PHE A CA  1 
ATOM   2748 C C   . PHE A 1 359 ? 19.246  12.763 11.641 1.00 20.78 ? 359 PHE A C   1 
ATOM   2749 O O   . PHE A 1 359 ? 19.361  13.171 10.486 1.00 20.39 ? 359 PHE A O   1 
ATOM   2750 C CB  . PHE A 1 359 ? 21.312  11.545 12.335 1.00 19.18 ? 359 PHE A CB  1 
ATOM   2751 C CG  . PHE A 1 359 ? 22.707  11.665 12.889 1.00 20.67 ? 359 PHE A CG  1 
ATOM   2752 C CD1 . PHE A 1 359 ? 22.938  11.601 14.259 1.00 20.64 ? 359 PHE A CD1 1 
ATOM   2753 C CD2 . PHE A 1 359 ? 23.794  11.846 12.035 1.00 21.36 ? 359 PHE A CD2 1 
ATOM   2754 C CE1 . PHE A 1 359 ? 24.229  11.712 14.769 1.00 21.59 ? 359 PHE A CE1 1 
ATOM   2755 C CE2 . PHE A 1 359 ? 25.084  11.959 12.535 1.00 21.46 ? 359 PHE A CE2 1 
ATOM   2756 C CZ  . PHE A 1 359 ? 25.304  11.891 13.903 1.00 21.64 ? 359 PHE A CZ  1 
ATOM   2757 N N   . GLU A 1 360 ? 18.098  12.304 12.127 1.00 21.65 ? 360 GLU A N   1 
ATOM   2758 C CA  . GLU A 1 360 ? 16.900  12.278 11.303 1.00 21.38 ? 360 GLU A CA  1 
ATOM   2759 C C   . GLU A 1 360 ? 16.134  13.594 11.388 1.00 21.49 ? 360 GLU A C   1 
ATOM   2760 O O   . GLU A 1 360 ? 15.567  14.051 10.398 1.00 21.63 ? 360 GLU A O   1 
ATOM   2761 C CB  . GLU A 1 360 ? 15.995  11.119 11.719 1.00 21.63 ? 360 GLU A CB  1 
ATOM   2762 C CG  . GLU A 1 360 ? 16.448  9.778  11.173 1.00 22.29 ? 360 GLU A CG  1 
ATOM   2763 C CD  . GLU A 1 360 ? 17.876  9.448  11.547 1.00 25.46 ? 360 GLU A CD  1 
ATOM   2764 O OE1 . GLU A 1 360 ? 18.149  9.247  12.753 1.00 26.65 ? 360 GLU A OE1 1 
ATOM   2765 O OE2 . GLU A 1 360 ? 18.724  9.395  10.631 1.00 24.29 ? 360 GLU A OE2 1 
ATOM   2766 N N   . ASN A 1 361 ? 16.121  14.207 12.568 1.00 21.05 ? 361 ASN A N   1 
ATOM   2767 C CA  . ASN A 1 361 ? 15.417  15.471 12.752 1.00 21.05 ? 361 ASN A CA  1 
ATOM   2768 C C   . ASN A 1 361 ? 16.303  16.515 13.417 1.00 21.64 ? 361 ASN A C   1 
ATOM   2769 O O   . ASN A 1 361 ? 16.112  16.864 14.583 1.00 22.11 ? 361 ASN A O   1 
ATOM   2770 C CB  . ASN A 1 361 ? 14.144  15.236 13.565 1.00 21.00 ? 361 ASN A CB  1 
ATOM   2771 C CG  . ASN A 1 361 ? 13.062  14.547 12.752 1.00 20.49 ? 361 ASN A CG  1 
ATOM   2772 O OD1 . ASN A 1 361 ? 12.375  15.184 11.948 1.00 20.69 ? 361 ASN A OD1 1 
ATOM   2773 N ND2 . ASN A 1 361 ? 12.920  13.240 12.938 1.00 16.96 ? 361 ASN A ND2 1 
ATOM   2774 N N   . PRO A 1 362 ? 17.288  17.033 12.665 1.00 21.55 ? 362 PRO A N   1 
ATOM   2775 C CA  . PRO A 1 362 ? 18.257  18.041 13.097 1.00 21.02 ? 362 PRO A CA  1 
ATOM   2776 C C   . PRO A 1 362 ? 17.641  19.417 13.249 1.00 21.39 ? 362 PRO A C   1 
ATOM   2777 O O   . PRO A 1 362 ? 18.190  20.277 13.931 1.00 22.21 ? 362 PRO A O   1 
ATOM   2778 C CB  . PRO A 1 362 ? 19.293  18.039 11.971 1.00 23.06 ? 362 PRO A CB  1 
ATOM   2779 C CG  . PRO A 1 362 ? 19.069  16.735 11.251 1.00 22.57 ? 362 PRO A CG  1 
ATOM   2780 C CD  . PRO A 1 362 ? 17.591  16.589 11.294 1.00 21.54 ? 362 PRO A CD  1 
ATOM   2781 N N   . TYR A 1 363 ? 16.500  19.626 12.610 1.00 21.48 ? 363 TYR A N   1 
ATOM   2782 C CA  . TYR A 1 363 ? 15.858  20.932 12.651 1.00 22.66 ? 363 TYR A CA  1 
ATOM   2783 C C   . TYR A 1 363 ? 14.551  21.044 13.439 1.00 22.68 ? 363 TYR A C   1 
ATOM   2784 O O   . TYR A 1 363 ? 13.859  20.053 13.684 1.00 22.36 ? 363 TYR A O   1 
ATOM   2785 C CB  . TYR A 1 363 ? 15.654  21.410 11.222 1.00 20.57 ? 363 TYR A CB  1 
ATOM   2786 C CG  . TYR A 1 363 ? 16.948  21.499 10.458 1.00 20.38 ? 363 TYR A CG  1 
ATOM   2787 C CD1 . TYR A 1 363 ? 17.860  22.520 10.714 1.00 20.58 ? 363 TYR A CD1 1 
ATOM   2788 C CD2 . TYR A 1 363 ? 17.259  20.570 9.471  1.00 19.63 ? 363 TYR A CD2 1 
ATOM   2789 C CE1 . TYR A 1 363 ? 19.049  22.617 9.997  1.00 21.90 ? 363 TYR A CE1 1 
ATOM   2790 C CE2 . TYR A 1 363 ? 18.439  20.655 8.753  1.00 19.43 ? 363 TYR A CE2 1 
ATOM   2791 C CZ  . TYR A 1 363 ? 19.330  21.680 9.016  1.00 21.50 ? 363 TYR A CZ  1 
ATOM   2792 O OH  . TYR A 1 363 ? 20.492  21.776 8.288  1.00 20.97 ? 363 TYR A OH  1 
ATOM   2793 N N   . ALA A 1 364 ? 14.224  22.275 13.829 1.00 21.98 ? 364 ALA A N   1 
ATOM   2794 C CA  . ALA A 1 364 ? 13.026  22.542 14.604 1.00 21.75 ? 364 ALA A CA  1 
ATOM   2795 C C   . ALA A 1 364 ? 11.759  22.356 13.779 1.00 22.77 ? 364 ALA A C   1 
ATOM   2796 O O   . ALA A 1 364 ? 11.787  22.453 12.550 1.00 21.60 ? 364 ALA A O   1 
ATOM   2797 C CB  . ALA A 1 364 ? 13.081  23.952 15.161 1.00 20.53 ? 364 ALA A CB  1 
ATOM   2798 N N   . ASP A 1 365 ? 10.655  22.083 14.473 1.00 23.53 ? 365 ASP A N   1 
ATOM   2799 C CA  . ASP A 1 365 ? 9.355   21.892 13.844 1.00 23.31 ? 365 ASP A CA  1 
ATOM   2800 C C   . ASP A 1 365 ? 8.479   23.100 14.153 1.00 23.43 ? 365 ASP A C   1 
ATOM   2801 O O   . ASP A 1 365 ? 8.081   23.316 15.291 1.00 25.03 ? 365 ASP A O   1 
ATOM   2802 C CB  . ASP A 1 365 ? 8.694   20.622 14.379 1.00 23.02 ? 365 ASP A CB  1 
ATOM   2803 C CG  . ASP A 1 365 ? 7.285   20.432 13.850 1.00 24.27 ? 365 ASP A CG  1 
ATOM   2804 O OD1 . ASP A 1 365 ? 6.802   21.287 13.078 1.00 24.01 ? 365 ASP A OD1 1 
ATOM   2805 O OD2 . ASP A 1 365 ? 6.653   19.420 14.214 1.00 27.07 ? 365 ASP A OD2 1 
ATOM   2806 N N   . PRO A 1 366 ? 8.157   23.898 13.132 1.00 23.38 ? 366 PRO A N   1 
ATOM   2807 C CA  . PRO A 1 366 ? 7.326   25.098 13.282 1.00 23.77 ? 366 PRO A CA  1 
ATOM   2808 C C   . PRO A 1 366 ? 5.997   24.799 13.960 1.00 24.32 ? 366 PRO A C   1 
ATOM   2809 O O   . PRO A 1 366 ? 5.481   25.609 14.728 1.00 25.60 ? 366 PRO A O   1 
ATOM   2810 C CB  . PRO A 1 366 ? 7.114   25.559 11.842 1.00 22.61 ? 366 PRO A CB  1 
ATOM   2811 C CG  . PRO A 1 366 ? 8.274   24.987 11.109 1.00 23.41 ? 366 PRO A CG  1 
ATOM   2812 C CD  . PRO A 1 366 ? 8.401   23.615 11.712 1.00 22.56 ? 366 PRO A CD  1 
ATOM   2813 N N   . ALA A 1 367 ? 5.440   23.632 13.658 1.00 24.29 ? 367 ALA A N   1 
ATOM   2814 C CA  . ALA A 1 367 ? 4.163   23.234 14.228 1.00 24.82 ? 367 ALA A CA  1 
ATOM   2815 C C   . ALA A 1 367 ? 4.210   23.180 15.754 1.00 24.90 ? 367 ALA A C   1 
ATOM   2816 O O   . ALA A 1 367 ? 3.179   23.278 16.418 1.00 25.91 ? 367 ALA A O   1 
ATOM   2817 C CB  . ALA A 1 367 ? 3.752   21.888 13.667 1.00 23.05 ? 367 ALA A CB  1 
ATOM   2818 N N   . MET A 1 368 ? 5.406   23.039 16.310 1.00 25.21 ? 368 MET A N   1 
ATOM   2819 C CA  . MET A 1 368 ? 5.570   22.965 17.760 1.00 25.25 ? 368 MET A CA  1 
ATOM   2820 C C   . MET A 1 368 ? 5.579   24.324 18.462 1.00 24.62 ? 368 MET A C   1 
ATOM   2821 O O   . MET A 1 368 ? 5.500   24.385 19.687 1.00 24.75 ? 368 MET A O   1 
ATOM   2822 C CB  . MET A 1 368 ? 6.864   22.223 18.098 1.00 26.30 ? 368 MET A CB  1 
ATOM   2823 C CG  . MET A 1 368 ? 6.861   20.760 17.708 1.00 27.49 ? 368 MET A CG  1 
ATOM   2824 S SD  . MET A 1 368 ? 5.728   19.848 18.750 1.00 32.11 ? 368 MET A SD  1 
ATOM   2825 C CE  . MET A 1 368 ? 6.817   19.459 20.168 1.00 30.38 ? 368 MET A CE  1 
ATOM   2826 N N   . ALA A 1 369 ? 5.672   25.408 17.700 1.00 24.15 ? 369 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 369 ? 5.712   26.740 18.295 1.00 23.72 ? 369 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 369 ? 4.590   26.989 19.303 1.00 24.90 ? 369 ALA A C   1 
ATOM   2829 O O   . ALA A 1 369 ? 4.836   27.497 20.393 1.00 24.37 ? 369 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 369 ? 5.679   27.795 17.204 1.00 21.84 ? 369 ALA A CB  1 
ATOM   2831 N N   . GLU A 1 370 ? 3.366   26.618 18.937 1.00 27.64 ? 370 GLU A N   1 
ATOM   2832 C CA  . GLU A 1 370 ? 2.188   26.809 19.792 1.00 29.84 ? 370 GLU A CA  1 
ATOM   2833 C C   . GLU A 1 370 ? 2.283   26.114 21.151 1.00 28.34 ? 370 GLU A C   1 
ATOM   2834 O O   . GLU A 1 370 ? 1.513   26.414 22.063 1.00 29.90 ? 370 GLU A O   1 
ATOM   2835 C CB  . GLU A 1 370 ? 0.927   26.308 19.076 1.00 33.70 ? 370 GLU A CB  1 
ATOM   2836 C CG  . GLU A 1 370 ? 0.694   26.894 17.682 1.00 42.31 ? 370 GLU A CG  1 
ATOM   2837 C CD  . GLU A 1 370 ? 0.205   28.337 17.700 1.00 45.28 ? 370 GLU A CD  1 
ATOM   2838 O OE1 . GLU A 1 370 ? -0.924  28.584 18.183 1.00 46.50 ? 370 GLU A OE1 1 
ATOM   2839 O OE2 . GLU A 1 370 ? 0.948   29.225 17.224 1.00 47.57 ? 370 GLU A OE2 1 
ATOM   2840 N N   . GLN A 1 371 ? 3.209   25.176 21.290 1.00 26.38 ? 371 GLN A N   1 
ATOM   2841 C CA  . GLN A 1 371 ? 3.353   24.469 22.554 1.00 26.30 ? 371 GLN A CA  1 
ATOM   2842 C C   . GLN A 1 371 ? 3.794   25.400 23.678 1.00 26.19 ? 371 GLN A C   1 
ATOM   2843 O O   . GLN A 1 371 ? 3.453   25.188 24.845 1.00 26.05 ? 371 GLN A O   1 
ATOM   2844 C CB  . GLN A 1 371 ? 4.361   23.330 22.412 1.00 25.84 ? 371 GLN A CB  1 
ATOM   2845 C CG  . GLN A 1 371 ? 3.854   22.170 21.592 1.00 28.99 ? 371 GLN A CG  1 
ATOM   2846 C CD  . GLN A 1 371 ? 2.633   21.518 22.208 1.00 30.18 ? 371 GLN A CD  1 
ATOM   2847 O OE1 . GLN A 1 371 ? 2.664   21.070 23.352 1.00 33.38 ? 371 GLN A OE1 1 
ATOM   2848 N NE2 . GLN A 1 371 ? 1.548   21.463 21.450 1.00 32.74 ? 371 GLN A NE2 1 
ATOM   2849 N N   . LEU A 1 372 ? 4.551   26.434 23.326 1.00 25.30 ? 372 LEU A N   1 
ATOM   2850 C CA  . LEU A 1 372 ? 5.040   27.379 24.317 1.00 24.51 ? 372 LEU A CA  1 
ATOM   2851 C C   . LEU A 1 372 ? 3.895   28.110 25.005 1.00 25.23 ? 372 LEU A C   1 
ATOM   2852 O O   . LEU A 1 372 ? 3.127   28.820 24.358 1.00 25.66 ? 372 LEU A O   1 
ATOM   2853 C CB  . LEU A 1 372 ? 5.966   28.401 23.664 1.00 23.53 ? 372 LEU A CB  1 
ATOM   2854 C CG  . LEU A 1 372 ? 6.682   29.335 24.641 1.00 21.51 ? 372 LEU A CG  1 
ATOM   2855 C CD1 . LEU A 1 372 ? 7.670   28.538 25.469 1.00 20.60 ? 372 LEU A CD1 1 
ATOM   2856 C CD2 . LEU A 1 372 ? 7.405   30.419 23.876 1.00 22.36 ? 372 LEU A CD2 1 
ATOM   2857 N N   . GLY A 1 373 ? 3.789   27.930 26.318 1.00 24.76 ? 373 GLY A N   1 
ATOM   2858 C CA  . GLY A 1 373 ? 2.746   28.591 27.080 1.00 23.20 ? 373 GLY A CA  1 
ATOM   2859 C C   . GLY A 1 373 ? 1.333   28.115 26.797 1.00 23.50 ? 373 GLY A C   1 
ATOM   2860 O O   . GLY A 1 373 ? 0.371   28.826 27.095 1.00 23.67 ? 373 GLY A O   1 
ATOM   2861 N N   . LYS A 1 374 ? 1.189   26.921 26.228 1.00 23.43 ? 374 LYS A N   1 
ATOM   2862 C CA  . LYS A 1 374 ? -0.142  26.401 25.929 1.00 24.92 ? 374 LYS A CA  1 
ATOM   2863 C C   . LYS A 1 374 ? -0.937  26.345 27.233 1.00 24.51 ? 374 LYS A C   1 
ATOM   2864 O O   . LYS A 1 374 ? -0.430  25.887 28.260 1.00 25.68 ? 374 LYS A O   1 
ATOM   2865 C CB  . LYS A 1 374 ? -0.044  25.007 25.291 1.00 26.63 ? 374 LYS A CB  1 
ATOM   2866 C CG  . LYS A 1 374 ? -1.298  24.578 24.536 1.00 30.83 ? 374 LYS A CG  1 
ATOM   2867 C CD  . LYS A 1 374 ? -1.077  23.325 23.687 1.00 33.67 ? 374 LYS A CD  1 
ATOM   2868 C CE  . LYS A 1 374 ? -0.959  22.069 24.538 1.00 38.51 ? 374 LYS A CE  1 
ATOM   2869 N NZ  . LYS A 1 374 ? -0.766  20.831 23.719 1.00 39.28 ? 374 LYS A NZ  1 
ATOM   2870 N N   . GLN A 1 375 ? -2.179  26.821 27.188 1.00 23.92 ? 375 GLN A N   1 
ATOM   2871 C CA  . GLN A 1 375 ? -3.045  26.850 28.366 1.00 23.13 ? 375 GLN A CA  1 
ATOM   2872 C C   . GLN A 1 375 ? -3.059  25.551 29.182 1.00 23.11 ? 375 GLN A C   1 
ATOM   2873 O O   . GLN A 1 375 ? -2.984  25.587 30.417 1.00 22.77 ? 375 GLN A O   1 
ATOM   2874 C CB  . GLN A 1 375 ? -4.474  27.220 27.957 1.00 22.76 ? 375 GLN A CB  1 
ATOM   2875 C CG  . GLN A 1 375 ? -5.369  27.559 29.124 1.00 22.71 ? 375 GLN A CG  1 
ATOM   2876 C CD  . GLN A 1 375 ? -4.702  28.520 30.102 1.00 25.74 ? 375 GLN A CD  1 
ATOM   2877 O OE1 . GLN A 1 375 ? -4.234  29.597 29.721 1.00 25.61 ? 375 GLN A OE1 1 
ATOM   2878 N NE2 . GLN A 1 375 ? -4.659  28.131 31.370 1.00 25.33 ? 375 GLN A NE2 1 
ATOM   2879 N N   . GLU A 1 376 ? -3.157  24.408 28.505 1.00 21.79 ? 376 GLU A N   1 
ATOM   2880 C CA  . GLU A 1 376 ? -3.166  23.133 29.211 1.00 22.07 ? 376 GLU A CA  1 
ATOM   2881 C C   . GLU A 1 376 ? -1.941  23.016 30.114 1.00 21.82 ? 376 GLU A C   1 
ATOM   2882 O O   . GLU A 1 376 ? -2.046  22.566 31.256 1.00 22.44 ? 376 GLU A O   1 
ATOM   2883 C CB  . GLU A 1 376 ? -3.178  21.954 28.230 1.00 23.11 ? 376 GLU A CB  1 
ATOM   2884 C CG  . GLU A 1 376 ? -4.499  21.726 27.514 1.00 25.92 ? 376 GLU A CG  1 
ATOM   2885 C CD  . GLU A 1 376 ? -4.715  22.668 26.346 1.00 28.50 ? 376 GLU A CD  1 
ATOM   2886 O OE1 . GLU A 1 376 ? -3.856  23.550 26.118 1.00 27.11 ? 376 GLU A OE1 1 
ATOM   2887 O OE2 . GLU A 1 376 ? -5.748  22.521 25.656 1.00 30.60 ? 376 GLU A OE2 1 
ATOM   2888 N N   . HIS A 1 377 ? -0.780  23.416 29.604 1.00 19.99 ? 377 HIS A N   1 
ATOM   2889 C CA  . HIS A 1 377 ? 0.438   23.333 30.395 1.00 19.94 ? 377 HIS A CA  1 
ATOM   2890 C C   . HIS A 1 377 ? 0.272   24.215 31.625 1.00 19.82 ? 377 HIS A C   1 
ATOM   2891 O O   . HIS A 1 377 ? 0.579   23.799 32.745 1.00 19.86 ? 377 HIS A O   1 
ATOM   2892 C CB  . HIS A 1 377 ? 1.656   23.786 29.577 1.00 22.24 ? 377 HIS A CB  1 
ATOM   2893 C CG  . HIS A 1 377 ? 1.890   22.979 28.334 1.00 23.36 ? 377 HIS A CG  1 
ATOM   2894 N ND1 . HIS A 1 377 ? 1.222   21.803 28.068 1.00 23.99 ? 377 HIS A ND1 1 
ATOM   2895 C CD2 . HIS A 1 377 ? 2.721   23.182 27.284 1.00 23.30 ? 377 HIS A CD2 1 
ATOM   2896 C CE1 . HIS A 1 377 ? 1.630   21.316 26.910 1.00 23.09 ? 377 HIS A CE1 1 
ATOM   2897 N NE2 . HIS A 1 377 ? 2.539   22.134 26.413 1.00 22.59 ? 377 HIS A NE2 1 
ATOM   2898 N N   . ARG A 1 378 ? -0.219  25.433 31.417 1.00 19.04 ? 378 ARG A N   1 
ATOM   2899 C CA  . ARG A 1 378 ? -0.436  26.352 32.526 1.00 17.94 ? 378 ARG A CA  1 
ATOM   2900 C C   . ARG A 1 378 ? -1.428  25.747 33.531 1.00 18.53 ? 378 ARG A C   1 
ATOM   2901 O O   . ARG A 1 378 ? -1.253  25.893 34.742 1.00 18.22 ? 378 ARG A O   1 
ATOM   2902 C CB  . ARG A 1 378 ? -0.947  27.695 32.006 1.00 16.47 ? 378 ARG A CB  1 
ATOM   2903 C CG  . ARG A 1 378 ? 0.066   28.451 31.155 1.00 15.42 ? 378 ARG A CG  1 
ATOM   2904 C CD  . ARG A 1 378 ? -0.535  29.736 30.615 1.00 15.46 ? 378 ARG A CD  1 
ATOM   2905 N NE  . ARG A 1 378 ? 0.406   30.515 29.815 1.00 16.53 ? 378 ARG A NE  1 
ATOM   2906 C CZ  . ARG A 1 378 ? 1.474   31.139 30.304 1.00 18.85 ? 378 ARG A CZ  1 
ATOM   2907 N NH1 . ARG A 1 378 ? 1.748   31.077 31.600 1.00 20.57 ? 378 ARG A NH1 1 
ATOM   2908 N NH2 . ARG A 1 378 ? 2.258   31.839 29.498 1.00 16.69 ? 378 ARG A NH2 1 
ATOM   2909 N N   . ASP A 1 379 ? -2.463  25.068 33.036 1.00 17.07 ? 379 ASP A N   1 
ATOM   2910 C CA  . ASP A 1 379 ? -3.427  24.436 33.933 1.00 18.08 ? 379 ASP A CA  1 
ATOM   2911 C C   . ASP A 1 379 ? -2.706  23.389 34.780 1.00 17.86 ? 379 ASP A C   1 
ATOM   2912 O O   . ASP A 1 379 ? -2.971  23.256 35.982 1.00 16.89 ? 379 ASP A O   1 
ATOM   2913 C CB  . ASP A 1 379 ? -4.559  23.772 33.149 1.00 19.46 ? 379 ASP A CB  1 
ATOM   2914 C CG  . ASP A 1 379 ? -5.412  24.777 32.394 1.00 24.63 ? 379 ASP A CG  1 
ATOM   2915 O OD1 . ASP A 1 379 ? -5.671  25.871 32.953 1.00 25.47 ? 379 ASP A OD1 1 
ATOM   2916 O OD2 . ASP A 1 379 ? -5.834  24.474 31.250 1.00 27.89 ? 379 ASP A OD2 1 
ATOM   2917 N N   . LEU A 1 380 ? -1.792  22.652 34.144 1.00 16.99 ? 380 LEU A N   1 
ATOM   2918 C CA  . LEU A 1 380 ? -1.008  21.631 34.831 1.00 16.02 ? 380 LEU A CA  1 
ATOM   2919 C C   . LEU A 1 380 ? -0.174  22.302 35.913 1.00 16.66 ? 380 LEU A C   1 
ATOM   2920 O O   . LEU A 1 380 ? -0.117  21.831 37.053 1.00 18.14 ? 380 LEU A O   1 
ATOM   2921 C CB  . LEU A 1 380 ? -0.067  20.909 33.856 1.00 14.32 ? 380 LEU A CB  1 
ATOM   2922 C CG  . LEU A 1 380 ? 0.934   19.942 34.506 1.00 13.05 ? 380 LEU A CG  1 
ATOM   2923 C CD1 . LEU A 1 380 ? 0.182   18.812 35.163 1.00 11.74 ? 380 LEU A CD1 1 
ATOM   2924 C CD2 . LEU A 1 380 ? 1.908   19.397 33.483 1.00 11.51 ? 380 LEU A CD2 1 
ATOM   2925 N N   . ALA A 1 381 ? 0.472   23.406 35.544 1.00 15.92 ? 381 ALA A N   1 
ATOM   2926 C CA  . ALA A 1 381 ? 1.313   24.151 36.471 1.00 15.03 ? 381 ALA A CA  1 
ATOM   2927 C C   . ALA A 1 381 ? 0.459   24.625 37.627 1.00 14.53 ? 381 ALA A C   1 
ATOM   2928 O O   . ALA A 1 381 ? 0.864   24.552 38.785 1.00 15.13 ? 381 ALA A O   1 
ATOM   2929 C CB  . ALA A 1 381 ? 1.941   25.337 35.768 1.00 14.16 ? 381 ALA A CB  1 
ATOM   2930 N N   . ARG A 1 382 ? -0.730  25.109 37.298 1.00 14.59 ? 382 ARG A N   1 
ATOM   2931 C CA  . ARG A 1 382 ? -1.659  25.596 38.296 1.00 14.73 ? 382 ARG A CA  1 
ATOM   2932 C C   . ARG A 1 382 ? -1.932  24.485 39.304 1.00 14.81 ? 382 ARG A C   1 
ATOM   2933 O O   . ARG A 1 382 ? -1.888  24.702 40.512 1.00 14.72 ? 382 ARG A O   1 
ATOM   2934 C CB  . ARG A 1 382 ? -2.952  26.037 37.608 1.00 16.19 ? 382 ARG A CB  1 
ATOM   2935 C CG  . ARG A 1 382 ? -3.991  26.630 38.533 1.00 16.77 ? 382 ARG A CG  1 
ATOM   2936 C CD  . ARG A 1 382 ? -5.104  27.260 37.725 1.00 17.61 ? 382 ARG A CD  1 
ATOM   2937 N NE  . ARG A 1 382 ? -6.244  27.618 38.559 1.00 21.11 ? 382 ARG A NE  1 
ATOM   2938 C CZ  . ARG A 1 382 ? -7.312  28.272 38.119 1.00 23.15 ? 382 ARG A CZ  1 
ATOM   2939 N NH1 . ARG A 1 382 ? -7.383  28.646 36.845 1.00 21.77 ? 382 ARG A NH1 1 
ATOM   2940 N NH2 . ARG A 1 382 ? -8.311  28.545 38.950 1.00 21.22 ? 382 ARG A NH2 1 
ATOM   2941 N N   . GLU A 1 383 ? -2.203  23.289 38.797 1.00 15.73 ? 383 GLU A N   1 
ATOM   2942 C CA  . GLU A 1 383 ? -2.464  22.147 39.656 1.00 16.95 ? 383 GLU A CA  1 
ATOM   2943 C C   . GLU A 1 383 ? -1.260  21.850 40.555 1.00 17.73 ? 383 GLU A C   1 
ATOM   2944 O O   . GLU A 1 383 ? -1.416  21.597 41.754 1.00 18.17 ? 383 GLU A O   1 
ATOM   2945 C CB  . GLU A 1 383 ? -2.767  20.910 38.819 1.00 17.64 ? 383 GLU A CB  1 
ATOM   2946 C CG  . GLU A 1 383 ? -3.034  19.670 39.656 1.00 18.73 ? 383 GLU A CG  1 
ATOM   2947 C CD  . GLU A 1 383 ? -2.953  18.401 38.839 1.00 20.98 ? 383 GLU A CD  1 
ATOM   2948 O OE1 . GLU A 1 383 ? -3.465  18.407 37.701 1.00 23.72 ? 383 GLU A OE1 1 
ATOM   2949 O OE2 . GLU A 1 383 ? -2.391  17.399 39.330 1.00 20.31 ? 383 GLU A OE2 1 
ATOM   2950 N N   . ALA A 1 384 ? -0.064  21.865 39.975 1.00 15.37 ? 384 ALA A N   1 
ATOM   2951 C CA  . ALA A 1 384 ? 1.142   21.587 40.747 1.00 15.44 ? 384 ALA A CA  1 
ATOM   2952 C C   . ALA A 1 384 ? 1.331   22.613 41.868 1.00 14.86 ? 384 ALA A C   1 
ATOM   2953 O O   . ALA A 1 384 ? 1.651   22.263 43.004 1.00 14.54 ? 384 ALA A O   1 
ATOM   2954 C CB  . ALA A 1 384 ? 2.358   21.577 39.827 1.00 13.97 ? 384 ALA A CB  1 
ATOM   2955 N N   . ALA A 1 385 ? 1.133   23.883 41.540 1.00 14.21 ? 385 ALA A N   1 
ATOM   2956 C CA  . ALA A 1 385 ? 1.281   24.943 42.521 1.00 14.86 ? 385 ALA A CA  1 
ATOM   2957 C C   . ALA A 1 385 ? 0.334   24.690 43.694 1.00 16.24 ? 385 ALA A C   1 
ATOM   2958 O O   . ALA A 1 385 ? 0.748   24.717 44.852 1.00 16.05 ? 385 ALA A O   1 
ATOM   2959 C CB  . ALA A 1 385 ? 0.979   26.295 41.878 1.00 13.34 ? 385 ALA A CB  1 
ATOM   2960 N N   . ARG A 1 386 ? -0.938  24.446 43.390 1.00 16.93 ? 386 ARG A N   1 
ATOM   2961 C CA  . ARG A 1 386 ? -1.927  24.191 44.427 1.00 17.83 ? 386 ARG A CA  1 
ATOM   2962 C C   . ARG A 1 386 ? -1.478  23.042 45.331 1.00 18.37 ? 386 ARG A C   1 
ATOM   2963 O O   . ARG A 1 386 ? -1.455  23.171 46.559 1.00 18.95 ? 386 ARG A O   1 
ATOM   2964 C CB  . ARG A 1 386 ? -3.282  23.866 43.785 1.00 18.31 ? 386 ARG A CB  1 
ATOM   2965 C CG  . ARG A 1 386 ? -4.396  23.549 44.779 1.00 17.65 ? 386 ARG A CG  1 
ATOM   2966 C CD  . ARG A 1 386 ? -4.768  22.085 44.719 1.00 18.87 ? 386 ARG A CD  1 
ATOM   2967 N NE  . ARG A 1 386 ? -5.201  21.704 43.377 1.00 20.79 ? 386 ARG A NE  1 
ATOM   2968 C CZ  . ARG A 1 386 ? -5.534  20.468 43.015 1.00 22.19 ? 386 ARG A CZ  1 
ATOM   2969 N NH1 . ARG A 1 386 ? -5.488  19.477 43.898 1.00 21.93 ? 386 ARG A NH1 1 
ATOM   2970 N NH2 . ARG A 1 386 ? -5.906  20.220 41.764 1.00 22.57 ? 386 ARG A NH2 1 
ATOM   2971 N N   . LYS A 1 387 ? -1.099  21.931 44.708 1.00 18.63 ? 387 LYS A N   1 
ATOM   2972 C CA  . LYS A 1 387 ? -0.656  20.745 45.421 1.00 19.17 ? 387 LYS A CA  1 
ATOM   2973 C C   . LYS A 1 387 ? 0.658   20.895 46.183 1.00 20.17 ? 387 LYS A C   1 
ATOM   2974 O O   . LYS A 1 387 ? 0.962   20.080 47.057 1.00 21.38 ? 387 LYS A O   1 
ATOM   2975 C CB  . LYS A 1 387 ? -0.523  19.576 44.446 1.00 18.98 ? 387 LYS A CB  1 
ATOM   2976 C CG  . LYS A 1 387 ? -1.799  19.233 43.704 1.00 19.94 ? 387 LYS A CG  1 
ATOM   2977 C CD  . LYS A 1 387 ? -1.644  17.913 42.973 1.00 22.25 ? 387 LYS A CD  1 
ATOM   2978 C CE  . LYS A 1 387 ? -2.943  17.469 42.318 1.00 20.95 ? 387 LYS A CE  1 
ATOM   2979 N NZ  . LYS A 1 387 ? -2.799  16.092 41.763 1.00 21.56 ? 387 LYS A NZ  1 
ATOM   2980 N N   . SER A 1 388 ? 1.447   21.917 45.865 1.00 19.16 ? 388 SER A N   1 
ATOM   2981 C CA  . SER A 1 388 ? 2.723   22.095 46.557 1.00 18.82 ? 388 SER A CA  1 
ATOM   2982 C C   . SER A 1 388 ? 2.595   22.920 47.830 1.00 19.28 ? 388 SER A C   1 
ATOM   2983 O O   . SER A 1 388 ? 3.481   22.898 48.683 1.00 19.72 ? 388 SER A O   1 
ATOM   2984 C CB  . SER A 1 388 ? 3.760   22.744 45.626 1.00 17.73 ? 388 SER A CB  1 
ATOM   2985 O OG  . SER A 1 388 ? 3.449   24.095 45.331 1.00 15.34 ? 388 SER A OG  1 
ATOM   2986 N N   . LEU A 1 389 ? 1.488   23.644 47.960 1.00 20.45 ? 389 LEU A N   1 
ATOM   2987 C CA  . LEU A 1 389 ? 1.257   24.488 49.132 1.00 20.43 ? 389 LEU A CA  1 
ATOM   2988 C C   . LEU A 1 389 ? 1.204   23.661 50.408 1.00 19.64 ? 389 LEU A C   1 
ATOM   2989 O O   . LEU A 1 389 ? 0.536   22.630 50.461 1.00 20.39 ? 389 LEU A O   1 
ATOM   2990 C CB  . LEU A 1 389 ? -0.059  25.254 48.974 1.00 19.96 ? 389 LEU A CB  1 
ATOM   2991 C CG  . LEU A 1 389 ? -0.247  26.019 47.664 1.00 20.36 ? 389 LEU A CG  1 
ATOM   2992 C CD1 . LEU A 1 389 ? -1.638  26.629 47.622 1.00 17.80 ? 389 LEU A CD1 1 
ATOM   2993 C CD2 . LEU A 1 389 ? 0.828   27.093 47.544 1.00 18.38 ? 389 LEU A CD2 1 
ATOM   2994 N N   . VAL A 1 390 ? 1.917   24.103 51.435 1.00 19.44 ? 390 VAL A N   1 
ATOM   2995 C CA  . VAL A 1 390 ? 1.893   23.394 52.705 1.00 19.98 ? 390 VAL A CA  1 
ATOM   2996 C C   . VAL A 1 390 ? 1.326   24.323 53.769 1.00 20.11 ? 390 VAL A C   1 
ATOM   2997 O O   . VAL A 1 390 ? 1.931   25.345 54.094 1.00 21.38 ? 390 VAL A O   1 
ATOM   2998 C CB  . VAL A 1 390 ? 3.299   22.933 53.132 1.00 20.00 ? 390 VAL A CB  1 
ATOM   2999 C CG1 . VAL A 1 390 ? 3.239   22.272 54.509 1.00 21.15 ? 390 VAL A CG1 1 
ATOM   3000 C CG2 . VAL A 1 390 ? 3.846   21.942 52.113 1.00 21.65 ? 390 VAL A CG2 1 
ATOM   3001 N N   . LEU A 1 391 ? 0.150   23.970 54.285 1.00 20.37 ? 391 LEU A N   1 
ATOM   3002 C CA  . LEU A 1 391 ? -0.528  24.752 55.317 1.00 20.62 ? 391 LEU A CA  1 
ATOM   3003 C C   . LEU A 1 391 ? 0.184   24.474 56.637 1.00 21.26 ? 391 LEU A C   1 
ATOM   3004 O O   . LEU A 1 391 ? 0.253   23.329 57.071 1.00 22.56 ? 391 LEU A O   1 
ATOM   3005 C CB  . LEU A 1 391 ? -1.997  24.321 55.401 1.00 20.01 ? 391 LEU A CB  1 
ATOM   3006 C CG  . LEU A 1 391 ? -2.965  25.080 56.317 1.00 23.06 ? 391 LEU A CG  1 
ATOM   3007 C CD1 . LEU A 1 391 ? -3.040  26.556 55.921 1.00 22.80 ? 391 LEU A CD1 1 
ATOM   3008 C CD2 . LEU A 1 391 ? -4.340  24.436 56.218 1.00 20.29 ? 391 LEU A CD2 1 
ATOM   3009 N N   . LEU A 1 392 ? 0.719   25.510 57.274 1.00 22.06 ? 392 LEU A N   1 
ATOM   3010 C CA  . LEU A 1 392 ? 1.443   25.321 58.528 1.00 23.15 ? 392 LEU A CA  1 
ATOM   3011 C C   . LEU A 1 392 ? 0.639   25.691 59.758 1.00 23.75 ? 392 LEU A C   1 
ATOM   3012 O O   . LEU A 1 392 ? 0.887   25.185 60.854 1.00 23.85 ? 392 LEU A O   1 
ATOM   3013 C CB  . LEU A 1 392 ? 2.724   26.144 58.522 1.00 22.87 ? 392 LEU A CB  1 
ATOM   3014 C CG  . LEU A 1 392 ? 3.770   25.737 57.493 1.00 23.39 ? 392 LEU A CG  1 
ATOM   3015 C CD1 . LEU A 1 392 ? 4.988   26.637 57.640 1.00 24.46 ? 392 LEU A CD1 1 
ATOM   3016 C CD2 . LEU A 1 392 ? 4.140   24.275 57.694 1.00 22.06 ? 392 LEU A CD2 1 
ATOM   3017 N N   . LYS A 1 393 ? -0.320  26.585 59.572 1.00 24.19 ? 393 LYS A N   1 
ATOM   3018 C CA  . LYS A 1 393 ? -1.159  27.043 60.666 1.00 23.08 ? 393 LYS A CA  1 
ATOM   3019 C C   . LYS A 1 393 ? -2.485  27.471 60.066 1.00 23.22 ? 393 LYS A C   1 
ATOM   3020 O O   . LYS A 1 393 ? -2.517  28.043 58.976 1.00 22.86 ? 393 LYS A O   1 
ATOM   3021 C CB  . LYS A 1 393 ? -0.490  28.229 61.366 1.00 21.97 ? 393 LYS A CB  1 
ATOM   3022 C CG  . LYS A 1 393 ? -1.289  28.812 62.512 1.00 21.27 ? 393 LYS A CG  1 
ATOM   3023 C CD  . LYS A 1 393 ? -0.539  29.947 63.176 1.00 20.44 ? 393 LYS A CD  1 
ATOM   3024 C CE  . LYS A 1 393 ? -1.359  30.573 64.290 1.00 20.77 ? 393 LYS A CE  1 
ATOM   3025 N NZ  . LYS A 1 393 ? -0.657  31.742 64.900 1.00 22.13 ? 393 LYS A NZ  1 
ATOM   3026 N N   . ASN A 1 394 ? -3.575  27.180 60.767 1.00 22.99 ? 394 ASN A N   1 
ATOM   3027 C CA  . ASN A 1 394 ? -4.897  27.558 60.285 1.00 23.51 ? 394 ASN A CA  1 
ATOM   3028 C C   . ASN A 1 394 ? -5.818  27.841 61.467 1.00 24.11 ? 394 ASN A C   1 
ATOM   3029 O O   . ASN A 1 394 ? -6.869  27.218 61.620 1.00 25.19 ? 394 ASN A O   1 
ATOM   3030 C CB  . ASN A 1 394 ? -5.472  26.452 59.389 1.00 23.17 ? 394 ASN A CB  1 
ATOM   3031 C CG  . ASN A 1 394 ? -6.676  26.915 58.585 1.00 24.56 ? 394 ASN A CG  1 
ATOM   3032 O OD1 . ASN A 1 394 ? -6.765  28.079 58.190 1.00 25.19 ? 394 ASN A OD1 1 
ATOM   3033 N ND2 . ASN A 1 394 ? -7.601  25.999 58.322 1.00 25.17 ? 394 ASN A ND2 1 
ATOM   3034 N N   . GLY A 1 395 ? -5.401  28.801 62.290 1.00 23.90 ? 395 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 395 ? -6.149  29.201 63.466 1.00 23.80 ? 395 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 395 ? -5.170  29.504 64.586 1.00 26.44 ? 395 GLY A C   1 
ATOM   3037 O O   . GLY A 1 395 ? -4.253  28.719 64.829 1.00 26.98 ? 395 GLY A O   1 
ATOM   3038 N N   . LYS A 1 396 ? -5.344  30.628 65.273 1.00 26.98 ? 396 LYS A N   1 
ATOM   3039 C CA  . LYS A 1 396 ? -4.430  30.978 66.353 1.00 26.88 ? 396 LYS A CA  1 
ATOM   3040 C C   . LYS A 1 396 ? -4.559  30.097 67.588 1.00 27.19 ? 396 LYS A C   1 
ATOM   3041 O O   . LYS A 1 396 ? -3.632  30.023 68.384 1.00 28.93 ? 396 LYS A O   1 
ATOM   3042 C CB  . LYS A 1 396 ? -4.602  32.447 66.746 1.00 26.59 ? 396 LYS A CB  1 
ATOM   3043 C CG  . LYS A 1 396 ? -4.029  33.403 65.715 1.00 26.94 ? 396 LYS A CG  1 
ATOM   3044 C CD  . LYS A 1 396 ? -4.154  34.853 66.140 1.00 26.01 ? 396 LYS A CD  1 
ATOM   3045 C CE  . LYS A 1 396 ? -3.384  35.759 65.193 1.00 27.04 ? 396 LYS A CE  1 
ATOM   3046 N NZ  . LYS A 1 396 ? -3.424  37.189 65.609 1.00 29.79 ? 396 LYS A NZ  1 
ATOM   3047 N N   . THR A 1 397 ? -5.699  29.438 67.765 1.00 26.88 ? 397 THR A N   1 
ATOM   3048 C CA  . THR A 1 397 ? -5.877  28.563 68.929 1.00 26.89 ? 397 THR A CA  1 
ATOM   3049 C C   . THR A 1 397 ? -6.757  27.379 68.564 1.00 28.42 ? 397 THR A C   1 
ATOM   3050 O O   . THR A 1 397 ? -7.520  27.432 67.597 1.00 28.95 ? 397 THR A O   1 
ATOM   3051 C CB  . THR A 1 397 ? -6.543  29.287 70.136 1.00 24.87 ? 397 THR A CB  1 
ATOM   3052 O OG1 . THR A 1 397 ? -7.969  29.204 70.019 1.00 24.20 ? 397 THR A OG1 1 
ATOM   3053 C CG2 . THR A 1 397 ? -6.130  30.758 70.185 1.00 24.11 ? 397 THR A CG2 1 
ATOM   3054 N N   . SER A 1 398 ? -6.657  26.318 69.354 1.00 28.74 ? 398 SER A N   1 
ATOM   3055 C CA  . SER A 1 398 ? -7.435  25.112 69.118 1.00 29.03 ? 398 SER A CA  1 
ATOM   3056 C C   . SER A 1 398 ? -8.938  25.360 69.045 1.00 29.04 ? 398 SER A C   1 
ATOM   3057 O O   . SER A 1 398 ? -9.674  24.525 68.529 1.00 30.13 ? 398 SER A O   1 
ATOM   3058 C CB  . SER A 1 398 ? -7.160  24.089 70.217 1.00 29.87 ? 398 SER A CB  1 
ATOM   3059 O OG  . SER A 1 398 ? -7.624  24.565 71.469 1.00 32.15 ? 398 SER A OG  1 
ATOM   3060 N N   . THR A 1 399 ? -9.405  26.489 69.559 1.00 27.63 ? 399 THR A N   1 
ATOM   3061 C CA  . THR A 1 399 ? -10.834 26.758 69.518 1.00 28.35 ? 399 THR A CA  1 
ATOM   3062 C C   . THR A 1 399 ? -11.245 27.788 68.470 1.00 26.83 ? 399 THR A C   1 
ATOM   3063 O O   . THR A 1 399 ? -12.436 27.992 68.212 1.00 25.64 ? 399 THR A O   1 
ATOM   3064 C CB  . THR A 1 399 ? -11.345 27.202 70.890 1.00 30.57 ? 399 THR A CB  1 
ATOM   3065 O OG1 . THR A 1 399 ? -10.561 28.303 71.359 1.00 33.84 ? 399 THR A OG1 1 
ATOM   3066 C CG2 . THR A 1 399 ? -11.242 26.056 71.874 1.00 32.68 ? 399 THR A CG2 1 
ATOM   3067 N N   . ASP A 1 400 ? -10.260 28.436 67.864 1.00 25.63 ? 400 ASP A N   1 
ATOM   3068 C CA  . ASP A 1 400 ? -10.546 29.421 66.838 1.00 23.96 ? 400 ASP A CA  1 
ATOM   3069 C C   . ASP A 1 400 ? -11.183 28.727 65.647 1.00 23.18 ? 400 ASP A C   1 
ATOM   3070 O O   . ASP A 1 400 ? -10.898 27.568 65.373 1.00 22.19 ? 400 ASP A O   1 
ATOM   3071 C CB  . ASP A 1 400 ? -9.255  30.109 66.395 1.00 25.03 ? 400 ASP A CB  1 
ATOM   3072 C CG  . ASP A 1 400 ? -8.837  31.233 67.328 1.00 27.20 ? 400 ASP A CG  1 
ATOM   3073 O OD1 . ASP A 1 400 ? -8.906  31.060 68.565 1.00 25.97 ? 400 ASP A OD1 1 
ATOM   3074 O OD2 . ASP A 1 400 ? -8.425  32.296 66.818 1.00 29.94 ? 400 ASP A OD2 1 
ATOM   3075 N N   . ALA A 1 401 ? -12.070 29.427 64.955 1.00 22.69 ? 401 ALA A N   1 
ATOM   3076 C CA  . ALA A 1 401 ? -12.687 28.873 63.759 1.00 21.48 ? 401 ALA A CA  1 
ATOM   3077 C C   . ALA A 1 401 ? -11.578 28.929 62.707 1.00 20.74 ? 401 ALA A C   1 
ATOM   3078 O O   . ALA A 1 401 ? -10.860 29.928 62.596 1.00 20.64 ? 401 ALA A O   1 
ATOM   3079 C CB  . ALA A 1 401 ? -13.869 29.733 63.325 1.00 19.84 ? 401 ALA A CB  1 
ATOM   3080 N N   . PRO A 1 402 ? -11.410 27.858 61.927 1.00 20.10 ? 402 PRO A N   1 
ATOM   3081 C CA  . PRO A 1 402 ? -10.353 27.885 60.912 1.00 19.51 ? 402 PRO A CA  1 
ATOM   3082 C C   . PRO A 1 402 ? -10.582 28.998 59.896 1.00 18.79 ? 402 PRO A C   1 
ATOM   3083 O O   . PRO A 1 402 ? -11.680 29.138 59.362 1.00 16.95 ? 402 PRO A O   1 
ATOM   3084 C CB  . PRO A 1 402 ? -10.444 26.500 60.292 1.00 19.44 ? 402 PRO A CB  1 
ATOM   3085 C CG  . PRO A 1 402 ? -11.906 26.204 60.390 1.00 20.38 ? 402 PRO A CG  1 
ATOM   3086 C CD  . PRO A 1 402 ? -12.247 26.656 61.791 1.00 19.40 ? 402 PRO A CD  1 
ATOM   3087 N N   . LEU A 1 403 ? -9.550  29.796 59.638 1.00 19.13 ? 403 LEU A N   1 
ATOM   3088 C CA  . LEU A 1 403 ? -9.674  30.891 58.677 1.00 19.35 ? 403 LEU A CA  1 
ATOM   3089 C C   . LEU A 1 403 ? -9.827  30.394 57.231 1.00 19.58 ? 403 LEU A C   1 
ATOM   3090 O O   . LEU A 1 403 ? -10.592 30.966 56.451 1.00 19.76 ? 403 LEU A O   1 
ATOM   3091 C CB  . LEU A 1 403 ? -8.467  31.831 58.772 1.00 19.23 ? 403 LEU A CB  1 
ATOM   3092 C CG  . LEU A 1 403 ? -8.435  32.965 57.738 1.00 21.13 ? 403 LEU A CG  1 
ATOM   3093 C CD1 . LEU A 1 403 ? -9.637  33.897 57.941 1.00 21.66 ? 403 LEU A CD1 1 
ATOM   3094 C CD2 . LEU A 1 403 ? -7.140  33.742 57.872 1.00 21.61 ? 403 LEU A CD2 1 
ATOM   3095 N N   . LEU A 1 404 ? -9.097  29.337 56.880 1.00 19.55 ? 404 LEU A N   1 
ATOM   3096 C CA  . LEU A 1 404 ? -9.160  28.778 55.533 1.00 20.31 ? 404 LEU A CA  1 
ATOM   3097 C C   . LEU A 1 404 ? -10.093 27.568 55.470 1.00 21.32 ? 404 LEU A C   1 
ATOM   3098 O O   . LEU A 1 404 ? -10.119 26.746 56.383 1.00 22.07 ? 404 LEU A O   1 
ATOM   3099 C CB  . LEU A 1 404 ? -7.760  28.377 55.066 1.00 19.16 ? 404 LEU A CB  1 
ATOM   3100 C CG  . LEU A 1 404 ? -6.694  29.476 55.119 1.00 17.97 ? 404 LEU A CG  1 
ATOM   3101 C CD1 . LEU A 1 404 ? -5.380  28.938 54.565 1.00 17.42 ? 404 LEU A CD1 1 
ATOM   3102 C CD2 . LEU A 1 404 ? -7.155  30.681 54.325 1.00 16.52 ? 404 LEU A CD2 1 
ATOM   3103 N N   . PRO A 1 405 ? -10.857 27.432 54.374 1.00 22.41 ? 405 PRO A N   1 
ATOM   3104 C CA  . PRO A 1 405 ? -10.880 28.338 53.217 1.00 23.28 ? 405 PRO A CA  1 
ATOM   3105 C C   . PRO A 1 405 ? -11.611 29.644 53.482 1.00 24.05 ? 405 PRO A C   1 
ATOM   3106 O O   . PRO A 1 405 ? -12.565 29.693 54.262 1.00 24.98 ? 405 PRO A O   1 
ATOM   3107 C CB  . PRO A 1 405 ? -11.599 27.524 52.136 1.00 23.46 ? 405 PRO A CB  1 
ATOM   3108 C CG  . PRO A 1 405 ? -11.505 26.092 52.621 1.00 24.54 ? 405 PRO A CG  1 
ATOM   3109 C CD  . PRO A 1 405 ? -11.671 26.237 54.107 1.00 22.86 ? 405 PRO A CD  1 
ATOM   3110 N N   . LEU A 1 406 ? -11.157 30.697 52.813 1.00 23.85 ? 406 LEU A N   1 
ATOM   3111 C CA  . LEU A 1 406 ? -11.768 32.012 52.924 1.00 23.08 ? 406 LEU A CA  1 
ATOM   3112 C C   . LEU A 1 406 ? -13.005 32.022 52.021 1.00 22.89 ? 406 LEU A C   1 
ATOM   3113 O O   . LEU A 1 406 ? -13.109 31.227 51.081 1.00 23.63 ? 406 LEU A O   1 
ATOM   3114 C CB  . LEU A 1 406 ? -10.775 33.090 52.462 1.00 22.72 ? 406 LEU A CB  1 
ATOM   3115 C CG  . LEU A 1 406 ? -9.454  33.249 53.239 1.00 22.82 ? 406 LEU A CG  1 
ATOM   3116 C CD1 . LEU A 1 406 ? -8.480  34.132 52.448 1.00 22.84 ? 406 LEU A CD1 1 
ATOM   3117 C CD2 . LEU A 1 406 ? -9.727  33.844 54.616 1.00 19.98 ? 406 LEU A CD2 1 
ATOM   3118 N N   . PRO A 1 407 ? -13.961 32.920 52.296 1.00 22.24 ? 407 PRO A N   1 
ATOM   3119 C CA  . PRO A 1 407 ? -15.192 33.035 51.507 1.00 20.58 ? 407 PRO A CA  1 
ATOM   3120 C C   . PRO A 1 407 ? -14.906 33.835 50.243 1.00 19.91 ? 407 PRO A C   1 
ATOM   3121 O O   . PRO A 1 407 ? -14.171 34.822 50.285 1.00 19.32 ? 407 PRO A O   1 
ATOM   3122 C CB  . PRO A 1 407 ? -16.134 33.807 52.429 1.00 21.52 ? 407 PRO A CB  1 
ATOM   3123 C CG  . PRO A 1 407 ? -15.423 33.833 53.780 1.00 22.62 ? 407 PRO A CG  1 
ATOM   3124 C CD  . PRO A 1 407 ? -13.984 33.857 53.425 1.00 21.72 ? 407 PRO A CD  1 
ATOM   3125 N N   . LYS A 1 408 ? -15.481 33.432 49.119 1.00 19.98 ? 408 LYS A N   1 
ATOM   3126 C CA  . LYS A 1 408 ? -15.241 34.184 47.895 1.00 19.99 ? 408 LYS A CA  1 
ATOM   3127 C C   . LYS A 1 408 ? -16.090 35.448 47.892 1.00 19.95 ? 408 LYS A C   1 
ATOM   3128 O O   . LYS A 1 408 ? -15.806 36.403 47.163 1.00 18.51 ? 408 LYS A O   1 
ATOM   3129 C CB  . LYS A 1 408 ? -15.559 33.339 46.663 1.00 17.97 ? 408 LYS A CB  1 
ATOM   3130 C CG  . LYS A 1 408 ? -14.639 32.153 46.478 1.00 18.64 ? 408 LYS A CG  1 
ATOM   3131 C CD  . LYS A 1 408 ? -14.925 31.428 45.173 1.00 17.27 ? 408 LYS A CD  1 
ATOM   3132 C CE  . LYS A 1 408 ? -13.971 30.271 44.970 1.00 17.82 ? 408 LYS A CE  1 
ATOM   3133 N NZ  . LYS A 1 408 ? -14.202 29.613 43.664 1.00 18.37 ? 408 LYS A NZ  1 
ATOM   3134 N N   . LYS A 1 409 ? -17.132 35.451 48.717 1.00 20.40 ? 409 LYS A N   1 
ATOM   3135 C CA  . LYS A 1 409 ? -18.011 36.604 48.796 1.00 21.85 ? 409 LYS A CA  1 
ATOM   3136 C C   . LYS A 1 409 ? -17.846 37.322 50.132 1.00 22.19 ? 409 LYS A C   1 
ATOM   3137 O O   . LYS A 1 409 ? -18.179 36.781 51.191 1.00 22.98 ? 409 LYS A O   1 
ATOM   3138 C CB  . LYS A 1 409 ? -19.464 36.167 48.598 1.00 23.07 ? 409 LYS A CB  1 
ATOM   3139 C CG  . LYS A 1 409 ? -20.436 37.331 48.445 1.00 25.54 ? 409 LYS A CG  1 
ATOM   3140 C CD  . LYS A 1 409 ? -21.844 36.859 48.105 1.00 27.37 ? 409 LYS A CD  1 
ATOM   3141 C CE  . LYS A 1 409 ? -22.769 38.044 47.876 1.00 30.38 ? 409 LYS A CE  1 
ATOM   3142 N NZ  . LYS A 1 409 ? -24.151 37.614 47.536 1.00 34.43 ? 409 LYS A NZ  1 
ATOM   3143 N N   . ALA A 1 410 ? -17.314 38.539 50.066 1.00 21.56 ? 410 ALA A N   1 
ATOM   3144 C CA  . ALA A 1 410 ? -17.084 39.378 51.241 1.00 20.75 ? 410 ALA A CA  1 
ATOM   3145 C C   . ALA A 1 410 ? -17.184 40.821 50.783 1.00 21.25 ? 410 ALA A C   1 
ATOM   3146 O O   . ALA A 1 410 ? -16.802 41.156 49.663 1.00 23.37 ? 410 ALA A O   1 
ATOM   3147 C CB  . ALA A 1 410 ? -15.706 39.112 51.832 1.00 20.14 ? 410 ALA A CB  1 
ATOM   3148 N N   . PRO A 1 411 ? -17.686 41.703 51.648 1.00 21.10 ? 411 PRO A N   1 
ATOM   3149 C CA  . PRO A 1 411 ? -17.828 43.112 51.281 1.00 20.21 ? 411 PRO A CA  1 
ATOM   3150 C C   . PRO A 1 411 ? -16.550 43.791 50.813 1.00 20.93 ? 411 PRO A C   1 
ATOM   3151 O O   . PRO A 1 411 ? -16.547 44.504 49.814 1.00 24.00 ? 411 PRO A O   1 
ATOM   3152 C CB  . PRO A 1 411 ? -18.364 43.748 52.560 1.00 18.79 ? 411 PRO A CB  1 
ATOM   3153 C CG  . PRO A 1 411 ? -19.072 42.628 53.233 1.00 17.77 ? 411 PRO A CG  1 
ATOM   3154 C CD  . PRO A 1 411 ? -18.146 41.470 53.024 1.00 19.55 ? 411 PRO A CD  1 
ATOM   3155 N N   . LYS A 1 412 ? -15.456 43.557 51.523 1.00 20.70 ? 412 LYS A N   1 
ATOM   3156 C CA  . LYS A 1 412 ? -14.200 44.217 51.194 1.00 20.11 ? 412 LYS A CA  1 
ATOM   3157 C C   . LYS A 1 412 ? -13.045 43.392 51.756 1.00 20.25 ? 412 LYS A C   1 
ATOM   3158 O O   . LYS A 1 412 ? -13.092 42.959 52.909 1.00 21.40 ? 412 LYS A O   1 
ATOM   3159 C CB  . LYS A 1 412 ? -14.234 45.611 51.827 1.00 20.33 ? 412 LYS A CB  1 
ATOM   3160 C CG  . LYS A 1 412 ? -13.166 46.595 51.406 1.00 22.34 ? 412 LYS A CG  1 
ATOM   3161 C CD  . LYS A 1 412 ? -13.459 47.943 52.059 1.00 20.28 ? 412 LYS A CD  1 
ATOM   3162 C CE  . LYS A 1 412 ? -12.468 49.006 51.650 1.00 23.69 ? 412 LYS A CE  1 
ATOM   3163 N NZ  . LYS A 1 412 ? -12.767 50.313 52.295 1.00 25.33 ? 412 LYS A NZ  1 
ATOM   3164 N N   . ILE A 1 413 ? -12.013 43.163 50.951 1.00 19.68 ? 413 ILE A N   1 
ATOM   3165 C CA  . ILE A 1 413 ? -10.877 42.378 51.418 1.00 18.26 ? 413 ILE A CA  1 
ATOM   3166 C C   . ILE A 1 413 ? -9.555  43.044 51.066 1.00 19.81 ? 413 ILE A C   1 
ATOM   3167 O O   . ILE A 1 413 ? -9.464  43.789 50.090 1.00 21.20 ? 413 ILE A O   1 
ATOM   3168 C CB  . ILE A 1 413 ? -10.890 40.945 50.821 1.00 16.33 ? 413 ILE A CB  1 
ATOM   3169 C CG1 . ILE A 1 413 ? -10.699 40.998 49.308 1.00 14.67 ? 413 ILE A CG1 1 
ATOM   3170 C CG2 . ILE A 1 413 ? -12.202 40.250 51.154 1.00 14.00 ? 413 ILE A CG2 1 
ATOM   3171 C CD1 . ILE A 1 413 ? -10.549 39.639 48.679 1.00 12.46 ? 413 ILE A CD1 1 
ATOM   3172 N N   . LEU A 1 414 ? -8.530  42.772 51.867 1.00 19.95 ? 414 LEU A N   1 
ATOM   3173 C CA  . LEU A 1 414 ? -7.210  43.346 51.634 1.00 20.09 ? 414 LEU A CA  1 
ATOM   3174 C C   . LEU A 1 414 ? -6.176  42.329 51.142 1.00 20.25 ? 414 LEU A C   1 
ATOM   3175 O O   . LEU A 1 414 ? -6.031  41.243 51.704 1.00 21.94 ? 414 LEU A O   1 
ATOM   3176 C CB  . LEU A 1 414 ? -6.683  44.009 52.912 1.00 19.71 ? 414 LEU A CB  1 
ATOM   3177 C CG  . LEU A 1 414 ? -5.258  44.570 52.821 1.00 20.97 ? 414 LEU A CG  1 
ATOM   3178 C CD1 . LEU A 1 414 ? -5.219  45.700 51.810 1.00 20.60 ? 414 LEU A CD1 1 
ATOM   3179 C CD2 . LEU A 1 414 ? -4.797  45.071 54.181 1.00 20.42 ? 414 LEU A CD2 1 
ATOM   3180 N N   . VAL A 1 415 ? -5.471  42.683 50.077 1.00 19.26 ? 415 VAL A N   1 
ATOM   3181 C CA  . VAL A 1 415 ? -4.419  41.833 49.540 1.00 18.51 ? 415 VAL A CA  1 
ATOM   3182 C C   . VAL A 1 415 ? -3.188  42.707 49.711 1.00 19.32 ? 415 VAL A C   1 
ATOM   3183 O O   . VAL A 1 415 ? -3.153  43.837 49.222 1.00 21.07 ? 415 VAL A O   1 
ATOM   3184 C CB  . VAL A 1 415 ? -4.642  41.501 48.045 1.00 16.63 ? 415 VAL A CB  1 
ATOM   3185 C CG1 . VAL A 1 415 ? -3.459  40.733 47.502 1.00 16.08 ? 415 VAL A CG1 1 
ATOM   3186 C CG2 . VAL A 1 415 ? -5.901  40.676 47.877 1.00 14.25 ? 415 VAL A CG2 1 
ATOM   3187 N N   . ALA A 1 416 ? -2.192  42.206 50.430 1.00 18.99 ? 416 ALA A N   1 
ATOM   3188 C CA  . ALA A 1 416 ? -0.995  43.001 50.673 1.00 19.27 ? 416 ALA A CA  1 
ATOM   3189 C C   . ALA A 1 416 ? 0.266   42.176 50.714 1.00 19.14 ? 416 ALA A C   1 
ATOM   3190 O O   . ALA A 1 416 ? 0.219   40.946 50.713 1.00 18.46 ? 416 ALA A O   1 
ATOM   3191 C CB  . ALA A 1 416 ? -1.136  43.766 51.988 1.00 19.07 ? 416 ALA A CB  1 
ATOM   3192 N N   . GLY A 1 417 ? 1.393   42.878 50.776 1.00 19.39 ? 417 GLY A N   1 
ATOM   3193 C CA  . GLY A 1 417 ? 2.680   42.218 50.824 1.00 19.33 ? 417 GLY A CA  1 
ATOM   3194 C C   . GLY A 1 417 ? 3.529   42.487 49.595 1.00 19.80 ? 417 GLY A C   1 
ATOM   3195 O O   . GLY A 1 417 ? 3.022   42.789 48.510 1.00 18.50 ? 417 GLY A O   1 
ATOM   3196 N N   . SER A 1 418 ? 4.838   42.372 49.776 1.00 18.41 ? 418 SER A N   1 
ATOM   3197 C CA  . SER A 1 418 ? 5.790   42.595 48.707 1.00 18.39 ? 418 SER A CA  1 
ATOM   3198 C C   . SER A 1 418 ? 5.644   41.542 47.619 1.00 18.75 ? 418 SER A C   1 
ATOM   3199 O O   . SER A 1 418 ? 6.002   41.780 46.466 1.00 18.35 ? 418 SER A O   1 
ATOM   3200 C CB  . SER A 1 418 ? 7.209   42.545 49.273 1.00 17.71 ? 418 SER A CB  1 
ATOM   3201 O OG  . SER A 1 418 ? 7.427   41.325 49.961 1.00 15.62 ? 418 SER A OG  1 
ATOM   3202 N N   . HIS A 1 419 ? 5.116   40.379 47.991 1.00 20.09 ? 419 HIS A N   1 
ATOM   3203 C CA  . HIS A 1 419 ? 4.953   39.272 47.049 1.00 20.15 ? 419 HIS A CA  1 
ATOM   3204 C C   . HIS A 1 419 ? 3.524   39.032 46.579 1.00 20.89 ? 419 HIS A C   1 
ATOM   3205 O O   . HIS A 1 419 ? 3.270   38.073 45.856 1.00 22.66 ? 419 HIS A O   1 
ATOM   3206 C CB  . HIS A 1 419 ? 5.484   37.975 47.661 1.00 19.56 ? 419 HIS A CB  1 
ATOM   3207 C CG  . HIS A 1 419 ? 6.958   37.984 47.918 1.00 20.09 ? 419 HIS A CG  1 
ATOM   3208 N ND1 . HIS A 1 419 ? 7.577   38.955 48.675 1.00 20.21 ? 419 HIS A ND1 1 
ATOM   3209 C CD2 . HIS A 1 419 ? 7.931   37.120 47.543 1.00 20.48 ? 419 HIS A CD2 1 
ATOM   3210 C CE1 . HIS A 1 419 ? 8.868   38.687 48.757 1.00 20.81 ? 419 HIS A CE1 1 
ATOM   3211 N NE2 . HIS A 1 419 ? 9.109   37.578 48.081 1.00 20.50 ? 419 HIS A NE2 1 
ATOM   3212 N N   . ALA A 1 420 ? 2.593   39.890 46.979 1.00 21.29 ? 420 ALA A N   1 
ATOM   3213 C CA  . ALA A 1 420 ? 1.205   39.723 46.571 1.00 21.07 ? 420 ALA A CA  1 
ATOM   3214 C C   . ALA A 1 420 ? 0.998   39.958 45.071 1.00 21.03 ? 420 ALA A C   1 
ATOM   3215 O O   . ALA A 1 420 ? 0.148   39.322 44.450 1.00 21.77 ? 420 ALA A O   1 
ATOM   3216 C CB  . ALA A 1 420 ? 0.317   40.662 47.371 1.00 22.86 ? 420 ALA A CB  1 
ATOM   3217 N N   . ASP A 1 421 ? 1.786   40.858 44.490 1.00 20.49 ? 421 ASP A N   1 
ATOM   3218 C CA  . ASP A 1 421 ? 1.664   41.183 43.071 1.00 19.55 ? 421 ASP A CA  1 
ATOM   3219 C C   . ASP A 1 421 ? 3.031   41.363 42.406 1.00 19.35 ? 421 ASP A C   1 
ATOM   3220 O O   . ASP A 1 421 ? 3.327   42.427 41.869 1.00 18.65 ? 421 ASP A O   1 
ATOM   3221 C CB  . ASP A 1 421 ? 0.832   42.465 42.931 1.00 19.24 ? 421 ASP A CB  1 
ATOM   3222 C CG  . ASP A 1 421 ? 0.576   42.852 41.488 1.00 18.65 ? 421 ASP A CG  1 
ATOM   3223 O OD1 . ASP A 1 421 ? 0.123   41.986 40.708 1.00 17.60 ? 421 ASP A OD1 1 
ATOM   3224 O OD2 . ASP A 1 421 ? 0.818   44.031 41.141 1.00 18.20 ? 421 ASP A OD2 1 
ATOM   3225 N N   . ASN A 1 422 ? 3.855   40.318 42.439 1.00 19.32 ? 422 ASN A N   1 
ATOM   3226 C CA  . ASN A 1 422 ? 5.198   40.359 41.848 1.00 19.08 ? 422 ASN A CA  1 
ATOM   3227 C C   . ASN A 1 422 ? 5.519   39.002 41.199 1.00 18.57 ? 422 ASN A C   1 
ATOM   3228 O O   . ASN A 1 422 ? 6.033   38.090 41.857 1.00 18.81 ? 422 ASN A O   1 
ATOM   3229 C CB  . ASN A 1 422 ? 6.238   40.680 42.936 1.00 18.59 ? 422 ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 422 ? 7.616   40.972 42.367 1.00 19.45 ? 422 ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 422 ? 8.047   40.342 41.405 1.00 20.55 ? 422 ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 422 ? 8.319   41.921 42.973 1.00 17.39 ? 422 ASN A ND2 1 
ATOM   3233 N N   . LEU A 1 423 ? 5.228   38.887 39.904 1.00 18.34 ? 423 LEU A N   1 
ATOM   3234 C CA  . LEU A 1 423 ? 5.437   37.644 39.160 1.00 16.71 ? 423 LEU A CA  1 
ATOM   3235 C C   . LEU A 1 423 ? 6.855   37.091 39.233 1.00 17.59 ? 423 LEU A C   1 
ATOM   3236 O O   . LEU A 1 423 ? 7.047   35.879 39.300 1.00 17.73 ? 423 LEU A O   1 
ATOM   3237 C CB  . LEU A 1 423 ? 5.025   37.828 37.697 1.00 13.83 ? 423 LEU A CB  1 
ATOM   3238 C CG  . LEU A 1 423 ? 4.971   36.556 36.849 1.00 11.01 ? 423 LEU A CG  1 
ATOM   3239 C CD1 . LEU A 1 423 ? 4.080   35.521 37.507 1.00 9.97  ? 423 LEU A CD1 1 
ATOM   3240 C CD2 . LEU A 1 423 ? 4.457   36.895 35.466 1.00 10.20 ? 423 LEU A CD2 1 
ATOM   3241 N N   . GLY A 1 424 ? 7.847   37.971 39.216 1.00 17.14 ? 424 GLY A N   1 
ATOM   3242 C CA  . GLY A 1 424 ? 9.220   37.509 39.301 1.00 17.41 ? 424 GLY A CA  1 
ATOM   3243 C C   . GLY A 1 424 ? 9.520   36.848 40.640 1.00 17.86 ? 424 GLY A C   1 
ATOM   3244 O O   . GLY A 1 424 ? 10.085  35.757 40.687 1.00 18.27 ? 424 GLY A O   1 
ATOM   3245 N N   . TYR A 1 425 ? 9.144   37.508 41.731 1.00 17.61 ? 425 TYR A N   1 
ATOM   3246 C CA  . TYR A 1 425 ? 9.376   36.978 43.070 1.00 17.53 ? 425 TYR A CA  1 
ATOM   3247 C C   . TYR A 1 425 ? 8.741   35.604 43.208 1.00 18.50 ? 425 TYR A C   1 
ATOM   3248 O O   . TYR A 1 425 ? 9.323   34.674 43.769 1.00 18.97 ? 425 TYR A O   1 
ATOM   3249 C CB  . TYR A 1 425 ? 8.769   37.914 44.115 1.00 16.56 ? 425 TYR A CB  1 
ATOM   3250 C CG  . TYR A 1 425 ? 9.576   39.158 44.414 1.00 17.42 ? 425 TYR A CG  1 
ATOM   3251 C CD1 . TYR A 1 425 ? 10.731  39.468 43.692 1.00 16.39 ? 425 TYR A CD1 1 
ATOM   3252 C CD2 . TYR A 1 425 ? 9.199   40.012 45.448 1.00 18.21 ? 425 TYR A CD2 1 
ATOM   3253 C CE1 . TYR A 1 425 ? 11.489  40.592 43.999 1.00 18.11 ? 425 TYR A CE1 1 
ATOM   3254 C CE2 . TYR A 1 425 ? 9.947   41.139 45.764 1.00 18.84 ? 425 TYR A CE2 1 
ATOM   3255 C CZ  . TYR A 1 425 ? 11.092  41.423 45.041 1.00 19.00 ? 425 TYR A CZ  1 
ATOM   3256 O OH  . TYR A 1 425 ? 11.848  42.520 45.386 1.00 19.79 ? 425 TYR A OH  1 
ATOM   3257 N N   . GLN A 1 426 ? 7.531   35.503 42.684 1.00 18.32 ? 426 GLN A N   1 
ATOM   3258 C CA  . GLN A 1 426 ? 6.727   34.292 42.713 1.00 18.10 ? 426 GLN A CA  1 
ATOM   3259 C C   . GLN A 1 426 ? 7.365   33.120 41.942 1.00 17.95 ? 426 GLN A C   1 
ATOM   3260 O O   . GLN A 1 426 ? 7.079   31.957 42.214 1.00 17.88 ? 426 GLN A O   1 
ATOM   3261 C CB  . GLN A 1 426 ? 5.368   34.670 42.137 1.00 19.21 ? 426 GLN A CB  1 
ATOM   3262 C CG  . GLN A 1 426 ? 4.326   33.612 41.994 1.00 20.18 ? 426 GLN A CG  1 
ATOM   3263 C CD  . GLN A 1 426 ? 3.132   34.164 41.227 1.00 20.48 ? 426 GLN A CD  1 
ATOM   3264 O OE1 . GLN A 1 426 ? 2.601   35.220 41.575 1.00 19.36 ? 426 GLN A OE1 1 
ATOM   3265 N NE2 . GLN A 1 426 ? 2.713   33.462 40.180 1.00 17.46 ? 426 GLN A NE2 1 
ATOM   3266 N N   . CYS A 1 427 ? 8.239   33.427 40.990 1.00 17.05 ? 427 CYS A N   1 
ATOM   3267 C CA  . CYS A 1 427 ? 8.889   32.391 40.193 1.00 17.03 ? 427 CYS A CA  1 
ATOM   3268 C C   . CYS A 1 427 ? 10.271  32.038 40.724 1.00 17.61 ? 427 CYS A C   1 
ATOM   3269 O O   . CYS A 1 427 ? 10.753  30.925 40.523 1.00 16.87 ? 427 CYS A O   1 
ATOM   3270 C CB  . CYS A 1 427 ? 9.016   32.840 38.735 1.00 17.80 ? 427 CYS A CB  1 
ATOM   3271 S SG  . CYS A 1 427 ? 7.459   33.056 37.856 1.00 19.19 ? 427 CYS A SG  1 
ATOM   3272 N N   . GLY A 1 428 ? 10.911  32.992 41.392 1.00 17.18 ? 428 GLY A N   1 
ATOM   3273 C CA  . GLY A 1 428 ? 12.233  32.745 41.940 1.00 18.34 ? 428 GLY A CA  1 
ATOM   3274 C C   . GLY A 1 428 ? 13.308  32.571 40.880 1.00 18.75 ? 428 GLY A C   1 
ATOM   3275 O O   . GLY A 1 428 ? 13.094  32.907 39.710 1.00 17.84 ? 428 GLY A O   1 
ATOM   3276 N N   . GLY A 1 429 ? 14.458  32.034 41.294 1.00 18.33 ? 429 GLY A N   1 
ATOM   3277 C CA  . GLY A 1 429 ? 15.576  31.828 40.386 1.00 18.71 ? 429 GLY A CA  1 
ATOM   3278 C C   . GLY A 1 429 ? 15.255  31.054 39.119 1.00 19.17 ? 429 GLY A C   1 
ATOM   3279 O O   . GLY A 1 429 ? 14.231  30.373 39.039 1.00 20.10 ? 429 GLY A O   1 
ATOM   3280 N N   . TRP A 1 430 ? 16.142  31.161 38.130 1.00 18.32 ? 430 TRP A N   1 
ATOM   3281 C CA  . TRP A 1 430 ? 15.989  30.486 36.838 1.00 18.67 ? 430 TRP A CA  1 
ATOM   3282 C C   . TRP A 1 430 ? 14.685  30.842 36.133 1.00 19.22 ? 430 TRP A C   1 
ATOM   3283 O O   . TRP A 1 430 ? 13.915  29.959 35.759 1.00 19.59 ? 430 TRP A O   1 
ATOM   3284 C CB  . TRP A 1 430 ? 16.059  28.963 36.998 1.00 18.75 ? 430 TRP A CB  1 
ATOM   3285 C CG  . TRP A 1 430 ? 17.399  28.440 37.423 1.00 20.75 ? 430 TRP A CG  1 
ATOM   3286 C CD1 . TRP A 1 430 ? 17.725  27.911 38.638 1.00 20.77 ? 430 TRP A CD1 1 
ATOM   3287 C CD2 . TRP A 1 430 ? 18.587  28.384 36.629 1.00 20.94 ? 430 TRP A CD2 1 
ATOM   3288 N NE1 . TRP A 1 430 ? 19.041  27.526 38.650 1.00 21.25 ? 430 TRP A NE1 1 
ATOM   3289 C CE2 . TRP A 1 430 ? 19.596  27.807 37.430 1.00 21.55 ? 430 TRP A CE2 1 
ATOM   3290 C CE3 . TRP A 1 430 ? 18.900  28.766 35.319 1.00 20.35 ? 430 TRP A CE3 1 
ATOM   3291 C CZ2 . TRP A 1 430 ? 20.899  27.602 36.962 1.00 21.42 ? 430 TRP A CZ2 1 
ATOM   3292 C CZ3 . TRP A 1 430 ? 20.199  28.562 34.853 1.00 19.04 ? 430 TRP A CZ3 1 
ATOM   3293 C CH2 . TRP A 1 430 ? 21.179  27.987 35.673 1.00 20.36 ? 430 TRP A CH2 1 
ATOM   3294 N N   . THR A 1 431 ? 14.439  32.135 35.948 1.00 18.14 ? 431 THR A N   1 
ATOM   3295 C CA  . THR A 1 431 ? 13.224  32.580 35.280 1.00 17.71 ? 431 THR A CA  1 
ATOM   3296 C C   . THR A 1 431 ? 13.538  33.839 34.482 1.00 18.21 ? 431 THR A C   1 
ATOM   3297 O O   . THR A 1 431 ? 13.728  34.910 35.056 1.00 17.12 ? 431 THR A O   1 
ATOM   3298 C CB  . THR A 1 431 ? 12.105  32.879 36.303 1.00 17.48 ? 431 THR A CB  1 
ATOM   3299 O OG1 . THR A 1 431 ? 12.079  31.855 37.308 1.00 14.32 ? 431 THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 431 ? 10.757  32.905 35.609 1.00 16.03 ? 431 THR A CG2 1 
ATOM   3301 N N   . ILE A 1 432 ? 13.585  33.693 33.157 1.00 18.75 ? 432 ILE A N   1 
ATOM   3302 C CA  . ILE A 1 432 ? 13.904  34.789 32.235 1.00 19.25 ? 432 ILE A CA  1 
ATOM   3303 C C   . ILE A 1 432 ? 15.391  35.128 32.389 1.00 20.92 ? 432 ILE A C   1 
ATOM   3304 O O   . ILE A 1 432 ? 16.183  34.956 31.456 1.00 21.12 ? 432 ILE A O   1 
ATOM   3305 C CB  . ILE A 1 432 ? 13.044  36.052 32.514 1.00 19.13 ? 432 ILE A CB  1 
ATOM   3306 C CG1 . ILE A 1 432 ? 11.551  35.711 32.406 1.00 20.15 ? 432 ILE A CG1 1 
ATOM   3307 C CG2 . ILE A 1 432 ? 13.400  37.149 31.536 1.00 16.29 ? 432 ILE A CG2 1 
ATOM   3308 C CD1 . ILE A 1 432 ? 11.135  35.077 31.078 1.00 21.12 ? 432 ILE A CD1 1 
ATOM   3309 N N   . GLU A 1 433 ? 15.767  35.606 33.570 1.00 21.26 ? 433 GLU A N   1 
ATOM   3310 C CA  . GLU A 1 433 ? 17.161  35.914 33.852 1.00 22.18 ? 433 GLU A CA  1 
ATOM   3311 C C   . GLU A 1 433 ? 17.732  34.704 34.583 1.00 22.92 ? 433 GLU A C   1 
ATOM   3312 O O   . GLU A 1 433 ? 16.989  33.820 35.010 1.00 22.11 ? 433 GLU A O   1 
ATOM   3313 C CB  . GLU A 1 433 ? 17.281  37.140 34.755 1.00 22.86 ? 433 GLU A CB  1 
ATOM   3314 C CG  . GLU A 1 433 ? 16.769  38.438 34.153 1.00 26.92 ? 433 GLU A CG  1 
ATOM   3315 C CD  . GLU A 1 433 ? 17.476  38.819 32.864 1.00 28.73 ? 433 GLU A CD  1 
ATOM   3316 O OE1 . GLU A 1 433 ? 18.579  38.295 32.598 1.00 29.91 ? 433 GLU A OE1 1 
ATOM   3317 O OE2 . GLU A 1 433 ? 16.929  39.660 32.119 1.00 30.52 ? 433 GLU A OE2 1 
ATOM   3318 N N   . TRP A 1 434 ? 19.051  34.660 34.725 1.00 23.51 ? 434 TRP A N   1 
ATOM   3319 C CA  . TRP A 1 434 ? 19.693  33.558 35.428 1.00 22.05 ? 434 TRP A CA  1 
ATOM   3320 C C   . TRP A 1 434 ? 19.321  33.616 36.904 1.00 22.82 ? 434 TRP A C   1 
ATOM   3321 O O   . TRP A 1 434 ? 18.849  32.633 37.477 1.00 22.15 ? 434 TRP A O   1 
ATOM   3322 C CB  . TRP A 1 434 ? 21.210  33.651 35.278 1.00 20.72 ? 434 TRP A CB  1 
ATOM   3323 C CG  . TRP A 1 434 ? 21.979  32.689 36.143 1.00 19.90 ? 434 TRP A CG  1 
ATOM   3324 C CD1 . TRP A 1 434 ? 21.775  31.338 36.261 1.00 20.57 ? 434 TRP A CD1 1 
ATOM   3325 C CD2 . TRP A 1 434 ? 23.115  32.995 36.960 1.00 17.33 ? 434 TRP A CD2 1 
ATOM   3326 N NE1 . TRP A 1 434 ? 22.719  30.788 37.097 1.00 20.39 ? 434 TRP A NE1 1 
ATOM   3327 C CE2 . TRP A 1 434 ? 23.554  31.781 37.539 1.00 17.94 ? 434 TRP A CE2 1 
ATOM   3328 C CE3 . TRP A 1 434 ? 23.808  34.177 37.255 1.00 15.32 ? 434 TRP A CE3 1 
ATOM   3329 C CZ2 . TRP A 1 434 ? 24.657  31.715 38.396 1.00 17.39 ? 434 TRP A CZ2 1 
ATOM   3330 C CZ3 . TRP A 1 434 ? 24.904  34.114 38.106 1.00 14.52 ? 434 TRP A CZ3 1 
ATOM   3331 C CH2 . TRP A 1 434 ? 25.320  32.887 38.667 1.00 16.60 ? 434 TRP A CH2 1 
ATOM   3332 N N   . GLN A 1 435 ? 19.537  34.781 37.507 1.00 23.35 ? 435 GLN A N   1 
ATOM   3333 C CA  . GLN A 1 435 ? 19.237  34.997 38.922 1.00 23.10 ? 435 GLN A CA  1 
ATOM   3334 C C   . GLN A 1 435 ? 17.758  35.286 39.176 1.00 23.26 ? 435 GLN A C   1 
ATOM   3335 O O   . GLN A 1 435 ? 17.362  35.582 40.302 1.00 24.10 ? 435 GLN A O   1 
ATOM   3336 C CB  . GLN A 1 435 ? 20.061  36.175 39.465 1.00 21.13 ? 435 GLN A CB  1 
ATOM   3337 C CG  . GLN A 1 435 ? 21.554  35.913 39.643 1.00 19.53 ? 435 GLN A CG  1 
ATOM   3338 C CD  . GLN A 1 435 ? 21.843  34.850 40.686 1.00 20.87 ? 435 GLN A CD  1 
ATOM   3339 O OE1 . GLN A 1 435 ? 21.217  34.818 41.755 1.00 20.84 ? 435 GLN A OE1 1 
ATOM   3340 N NE2 . GLN A 1 435 ? 22.806  33.980 40.390 1.00 18.92 ? 435 GLN A NE2 1 
ATOM   3341 N N   . GLY A 1 436 ? 16.936  35.191 38.142 1.00 23.26 ? 436 GLY A N   1 
ATOM   3342 C CA  . GLY A 1 436 ? 15.535  35.504 38.332 1.00 23.26 ? 436 GLY A CA  1 
ATOM   3343 C C   . GLY A 1 436 ? 15.437  37.018 38.295 1.00 23.54 ? 436 GLY A C   1 
ATOM   3344 O O   . GLY A 1 436 ? 16.441  37.702 38.092 1.00 23.54 ? 436 GLY A O   1 
ATOM   3345 N N   . ASP A 1 437 ? 14.248  37.562 38.506 1.00 23.47 ? 437 ASP A N   1 
ATOM   3346 C CA  . ASP A 1 437 ? 14.105  39.005 38.449 1.00 23.64 ? 437 ASP A CA  1 
ATOM   3347 C C   . ASP A 1 437 ? 12.855  39.446 39.193 1.00 24.07 ? 437 ASP A C   1 
ATOM   3348 O O   . ASP A 1 437 ? 12.042  38.615 39.606 1.00 25.07 ? 437 ASP A O   1 
ATOM   3349 C CB  . ASP A 1 437 ? 14.003  39.438 36.988 1.00 24.91 ? 437 ASP A CB  1 
ATOM   3350 C CG  . ASP A 1 437 ? 14.474  40.850 36.764 1.00 25.26 ? 437 ASP A CG  1 
ATOM   3351 O OD1 . ASP A 1 437 ? 14.454  41.642 37.723 1.00 26.98 ? 437 ASP A OD1 1 
ATOM   3352 O OD2 . ASP A 1 437 ? 14.854  41.170 35.619 1.00 26.04 ? 437 ASP A OD2 1 
ATOM   3353 N N   . THR A 1 438 ? 12.703  40.758 39.348 1.00 21.35 ? 438 THR A N   1 
ATOM   3354 C CA  . THR A 1 438 ? 11.546  41.324 40.026 1.00 21.27 ? 438 THR A CA  1 
ATOM   3355 C C   . THR A 1 438 ? 10.549  41.882 39.008 1.00 22.01 ? 438 THR A C   1 
ATOM   3356 O O   . THR A 1 438 ? 10.944  42.336 37.934 1.00 22.40 ? 438 THR A O   1 
ATOM   3357 C CB  . THR A 1 438 ? 11.958  42.479 40.954 1.00 20.88 ? 438 THR A CB  1 
ATOM   3358 O OG1 . THR A 1 438 ? 10.797  43.004 41.607 1.00 20.08 ? 438 THR A OG1 1 
ATOM   3359 C CG2 . THR A 1 438 ? 12.610  43.592 40.151 1.00 16.72 ? 438 THR A CG2 1 
ATOM   3360 N N   . GLY A 1 439 ? 9.262   41.837 39.341 1.00 21.56 ? 439 GLY A N   1 
ATOM   3361 C CA  . GLY A 1 439 ? 8.259   42.390 38.450 1.00 22.32 ? 439 GLY A CA  1 
ATOM   3362 C C   . GLY A 1 439 ? 7.605   41.464 37.449 1.00 23.17 ? 439 GLY A C   1 
ATOM   3363 O O   . GLY A 1 439 ? 7.683   40.241 37.566 1.00 25.38 ? 439 GLY A O   1 
ATOM   3364 N N   . ARG A 1 440 ? 6.944   42.061 36.461 1.00 22.60 ? 440 ARG A N   1 
ATOM   3365 C CA  . ARG A 1 440 ? 6.251   41.304 35.427 1.00 24.09 ? 440 ARG A CA  1 
ATOM   3366 C C   . ARG A 1 440 ? 7.200   40.978 34.273 1.00 22.93 ? 440 ARG A C   1 
ATOM   3367 O O   . ARG A 1 440 ? 7.175   41.623 33.222 1.00 21.53 ? 440 ARG A O   1 
ATOM   3368 C CB  . ARG A 1 440 ? 5.035   42.103 34.938 1.00 25.32 ? 440 ARG A CB  1 
ATOM   3369 C CG  . ARG A 1 440 ? 4.325   41.506 33.744 1.00 29.74 ? 440 ARG A CG  1 
ATOM   3370 C CD  . ARG A 1 440 ? 2.871   41.940 33.680 1.00 35.93 ? 440 ARG A CD  1 
ATOM   3371 N NE  . ARG A 1 440 ? 1.997   40.958 34.322 1.00 44.01 ? 440 ARG A NE  1 
ATOM   3372 C CZ  . ARG A 1 440 ? 1.762   40.880 35.631 1.00 46.33 ? 440 ARG A CZ  1 
ATOM   3373 N NH1 . ARG A 1 440 ? 2.329   41.740 36.472 1.00 46.70 ? 440 ARG A NH1 1 
ATOM   3374 N NH2 . ARG A 1 440 ? 0.970   39.920 36.102 1.00 46.81 ? 440 ARG A NH2 1 
ATOM   3375 N N   . THR A 1 441 ? 8.021   39.952 34.482 1.00 21.09 ? 441 THR A N   1 
ATOM   3376 C CA  . THR A 1 441 ? 9.018   39.526 33.505 1.00 19.88 ? 441 THR A CA  1 
ATOM   3377 C C   . THR A 1 441 ? 8.540   38.525 32.462 1.00 18.98 ? 441 THR A C   1 
ATOM   3378 O O   . THR A 1 441 ? 9.300   38.148 31.565 1.00 17.78 ? 441 THR A O   1 
ATOM   3379 C CB  . THR A 1 441 ? 10.217  38.909 34.209 1.00 19.38 ? 441 THR A CB  1 
ATOM   3380 O OG1 . THR A 1 441 ? 9.806   37.711 34.883 1.00 18.07 ? 441 THR A OG1 1 
ATOM   3381 C CG2 . THR A 1 441 ? 10.781  39.887 35.220 1.00 20.00 ? 441 THR A CG2 1 
ATOM   3382 N N   . THR A 1 442 ? 7.294   38.087 32.575 1.00 17.28 ? 442 THR A N   1 
ATOM   3383 C CA  . THR A 1 442 ? 6.772   37.128 31.618 1.00 16.54 ? 442 THR A CA  1 
ATOM   3384 C C   . THR A 1 442 ? 5.255   37.036 31.737 1.00 17.46 ? 442 THR A C   1 
ATOM   3385 O O   . THR A 1 442 ? 4.632   37.865 32.400 1.00 19.19 ? 442 THR A O   1 
ATOM   3386 C CB  . THR A 1 442 ? 7.410   35.740 31.847 1.00 14.69 ? 442 THR A CB  1 
ATOM   3387 O OG1 . THR A 1 442 ? 7.026   34.858 30.792 1.00 15.32 ? 442 THR A OG1 1 
ATOM   3388 C CG2 . THR A 1 442 ? 6.961   35.158 33.161 1.00 14.38 ? 442 THR A CG2 1 
ATOM   3389 N N   . VAL A 1 443 ? 4.664   36.038 31.090 1.00 16.89 ? 443 VAL A N   1 
ATOM   3390 C CA  . VAL A 1 443 ? 3.220   35.845 31.134 1.00 16.48 ? 443 VAL A CA  1 
ATOM   3391 C C   . VAL A 1 443 ? 2.820   34.966 32.327 1.00 17.16 ? 443 VAL A C   1 
ATOM   3392 O O   . VAL A 1 443 ? 3.346   33.864 32.507 1.00 16.83 ? 443 VAL A O   1 
ATOM   3393 C CB  . VAL A 1 443 ? 2.713   35.185 29.832 1.00 16.09 ? 443 VAL A CB  1 
ATOM   3394 C CG1 . VAL A 1 443 ? 1.207   34.984 29.898 1.00 12.81 ? 443 VAL A CG1 1 
ATOM   3395 C CG2 . VAL A 1 443 ? 3.092   36.047 28.636 1.00 16.58 ? 443 VAL A CG2 1 
ATOM   3396 N N   . GLY A 1 444 ? 1.883   35.464 33.133 1.00 16.06 ? 444 GLY A N   1 
ATOM   3397 C CA  . GLY A 1 444 ? 1.427   34.723 34.293 1.00 14.92 ? 444 GLY A CA  1 
ATOM   3398 C C   . GLY A 1 444 ? 0.369   35.469 35.089 1.00 15.72 ? 444 GLY A C   1 
ATOM   3399 O O   . GLY A 1 444 ? -0.158  36.488 34.647 1.00 17.18 ? 444 GLY A O   1 
ATOM   3400 N N   . THR A 1 445 ? 0.062   34.961 36.275 1.00 15.07 ? 445 THR A N   1 
ATOM   3401 C CA  . THR A 1 445 ? -0.938  35.565 37.137 1.00 12.65 ? 445 THR A CA  1 
ATOM   3402 C C   . THR A 1 445 ? -0.372  35.672 38.540 1.00 12.75 ? 445 THR A C   1 
ATOM   3403 O O   . THR A 1 445 ? -0.024  34.661 39.146 1.00 12.08 ? 445 THR A O   1 
ATOM   3404 C CB  . THR A 1 445 ? -2.209  34.696 37.204 1.00 13.11 ? 445 THR A CB  1 
ATOM   3405 O OG1 . THR A 1 445 ? -2.701  34.455 35.881 1.00 13.23 ? 445 THR A OG1 1 
ATOM   3406 C CG2 . THR A 1 445 ? -3.287  35.391 38.017 1.00 13.59 ? 445 THR A CG2 1 
ATOM   3407 N N   . THR A 1 446 ? -0.278  36.892 39.055 1.00 13.22 ? 446 THR A N   1 
ATOM   3408 C CA  . THR A 1 446 ? 0.236   37.107 40.402 1.00 15.08 ? 446 THR A CA  1 
ATOM   3409 C C   . THR A 1 446 ? -0.844  36.717 41.410 1.00 15.47 ? 446 THR A C   1 
ATOM   3410 O O   . THR A 1 446 ? -1.989  36.433 41.031 1.00 16.52 ? 446 THR A O   1 
ATOM   3411 C CB  . THR A 1 446 ? 0.618   38.587 40.628 1.00 17.04 ? 446 THR A CB  1 
ATOM   3412 O OG1 . THR A 1 446 ? -0.544  39.411 40.460 1.00 17.71 ? 446 THR A OG1 1 
ATOM   3413 C CG2 . THR A 1 446 ? 1.694   39.024 39.632 1.00 16.85 ? 446 THR A CG2 1 
ATOM   3414 N N   . ILE A 1 447 ? -0.489  36.694 42.689 1.00 13.56 ? 447 ILE A N   1 
ATOM   3415 C CA  . ILE A 1 447 ? -1.465  36.342 43.705 1.00 13.36 ? 447 ILE A CA  1 
ATOM   3416 C C   . ILE A 1 447 ? -2.613  37.345 43.706 1.00 15.51 ? 447 ILE A C   1 
ATOM   3417 O O   . ILE A 1 447 ? -3.773  36.959 43.831 1.00 16.32 ? 447 ILE A O   1 
ATOM   3418 C CB  . ILE A 1 447 ? -0.808  36.259 45.092 1.00 13.70 ? 447 ILE A CB  1 
ATOM   3419 C CG1 . ILE A 1 447 ? 0.065   34.992 45.146 1.00 14.62 ? 447 ILE A CG1 1 
ATOM   3420 C CG2 . ILE A 1 447 ? -1.876  36.243 46.193 1.00 10.02 ? 447 ILE A CG2 1 
ATOM   3421 C CD1 . ILE A 1 447 ? 0.893   34.830 46.410 1.00 14.33 ? 447 ILE A CD1 1 
ATOM   3422 N N   . LEU A 1 448 ? -2.299  38.628 43.543 1.00 15.94 ? 448 LEU A N   1 
ATOM   3423 C CA  . LEU A 1 448 ? -3.335  39.658 43.511 1.00 16.58 ? 448 LEU A CA  1 
ATOM   3424 C C   . LEU A 1 448 ? -4.291  39.396 42.351 1.00 18.68 ? 448 LEU A C   1 
ATOM   3425 O O   . LEU A 1 448 ? -5.509  39.391 42.527 1.00 19.46 ? 448 LEU A O   1 
ATOM   3426 C CB  . LEU A 1 448 ? -2.714  41.050 43.364 1.00 14.03 ? 448 LEU A CB  1 
ATOM   3427 C CG  . LEU A 1 448 ? -3.690  42.205 43.115 1.00 13.16 ? 448 LEU A CG  1 
ATOM   3428 C CD1 . LEU A 1 448 ? -4.726  42.270 44.230 1.00 13.18 ? 448 LEU A CD1 1 
ATOM   3429 C CD2 . LEU A 1 448 ? -2.922  43.509 43.030 1.00 12.54 ? 448 LEU A CD2 1 
ATOM   3430 N N   . GLU A 1 449 ? -3.733  39.170 41.166 1.00 21.54 ? 449 GLU A N   1 
ATOM   3431 C CA  . GLU A 1 449 ? -4.547  38.894 39.985 1.00 22.31 ? 449 GLU A CA  1 
ATOM   3432 C C   . GLU A 1 449 ? -5.423  37.662 40.210 1.00 20.66 ? 449 GLU A C   1 
ATOM   3433 O O   . GLU A 1 449 ? -6.607  37.664 39.873 1.00 21.26 ? 449 GLU A O   1 
ATOM   3434 C CB  . GLU A 1 449 ? -3.655  38.671 38.756 1.00 24.52 ? 449 GLU A CB  1 
ATOM   3435 C CG  . GLU A 1 449 ? -2.845  39.884 38.318 1.00 27.68 ? 449 GLU A CG  1 
ATOM   3436 C CD  . GLU A 1 449 ? -1.864  39.553 37.192 1.00 31.59 ? 449 GLU A CD  1 
ATOM   3437 O OE1 . GLU A 1 449 ? -0.943  38.729 37.404 1.00 31.25 ? 449 GLU A OE1 1 
ATOM   3438 O OE2 . GLU A 1 449 ? -2.017  40.118 36.088 1.00 34.18 ? 449 GLU A OE2 1 
ATOM   3439 N N   . ALA A 1 450 ? -4.843  36.612 40.783 1.00 19.19 ? 450 ALA A N   1 
ATOM   3440 C CA  . ALA A 1 450 ? -5.598  35.387 41.037 1.00 18.65 ? 450 ALA A CA  1 
ATOM   3441 C C   . ALA A 1 450 ? -6.756  35.636 42.002 1.00 18.17 ? 450 ALA A C   1 
ATOM   3442 O O   . ALA A 1 450 ? -7.834  35.056 41.857 1.00 16.92 ? 450 ALA A O   1 
ATOM   3443 C CB  . ALA A 1 450 ? -4.679  34.311 41.593 1.00 18.03 ? 450 ALA A CB  1 
ATOM   3444 N N   . VAL A 1 451 ? -6.529  36.498 42.988 1.00 17.85 ? 451 VAL A N   1 
ATOM   3445 C CA  . VAL A 1 451 ? -7.565  36.817 43.955 1.00 18.75 ? 451 VAL A CA  1 
ATOM   3446 C C   . VAL A 1 451 ? -8.731  37.503 43.249 1.00 19.98 ? 451 VAL A C   1 
ATOM   3447 O O   . VAL A 1 451 ? -9.894  37.104 43.406 1.00 18.24 ? 451 VAL A O   1 
ATOM   3448 C CB  . VAL A 1 451 ? -7.039  37.745 45.062 1.00 17.65 ? 451 VAL A CB  1 
ATOM   3449 C CG1 . VAL A 1 451 ? -8.200  38.242 45.911 1.00 18.57 ? 451 VAL A CG1 1 
ATOM   3450 C CG2 . VAL A 1 451 ? -6.047  36.999 45.933 1.00 17.21 ? 451 VAL A CG2 1 
ATOM   3451 N N   . LYS A 1 452 ? -8.413  38.534 42.471 1.00 19.35 ? 452 LYS A N   1 
ATOM   3452 C CA  . LYS A 1 452 ? -9.434  39.267 41.743 1.00 20.39 ? 452 LYS A CA  1 
ATOM   3453 C C   . LYS A 1 452 ? -10.204 38.344 40.796 1.00 21.40 ? 452 LYS A C   1 
ATOM   3454 O O   . LYS A 1 452 ? -11.410 38.516 40.574 1.00 20.97 ? 452 LYS A O   1 
ATOM   3455 C CB  . LYS A 1 452 ? -8.799  40.398 40.940 1.00 19.72 ? 452 LYS A CB  1 
ATOM   3456 C CG  . LYS A 1 452 ? -8.230  41.525 41.774 1.00 21.94 ? 452 LYS A CG  1 
ATOM   3457 C CD  . LYS A 1 452 ? -7.741  42.649 40.869 1.00 24.40 ? 452 LYS A CD  1 
ATOM   3458 C CE  . LYS A 1 452 ? -7.185  43.820 41.666 1.00 28.85 ? 452 LYS A CE  1 
ATOM   3459 N NZ  . LYS A 1 452 ? -6.600  44.872 40.777 1.00 30.50 ? 452 LYS A NZ  1 
ATOM   3460 N N   . ALA A 1 453 ? -9.505  37.357 40.246 1.00 21.00 ? 453 ALA A N   1 
ATOM   3461 C CA  . ALA A 1 453 ? -10.120 36.427 39.309 1.00 19.80 ? 453 ALA A CA  1 
ATOM   3462 C C   . ALA A 1 453 ? -10.934 35.350 39.998 1.00 18.61 ? 453 ALA A C   1 
ATOM   3463 O O   . ALA A 1 453 ? -11.570 34.538 39.332 1.00 17.80 ? 453 ALA A O   1 
ATOM   3464 C CB  . ALA A 1 453 ? -9.045  35.781 38.445 1.00 19.52 ? 453 ALA A CB  1 
ATOM   3465 N N   . ALA A 1 454 ? -10.930 35.346 41.326 1.00 18.11 ? 454 ALA A N   1 
ATOM   3466 C CA  . ALA A 1 454 ? -11.651 34.315 42.058 1.00 18.20 ? 454 ALA A CA  1 
ATOM   3467 C C   . ALA A 1 454 ? -12.841 34.805 42.858 1.00 19.38 ? 454 ALA A C   1 
ATOM   3468 O O   . ALA A 1 454 ? -13.877 34.147 42.906 1.00 21.54 ? 454 ALA A O   1 
ATOM   3469 C CB  . ALA A 1 454 ? -10.690 33.580 42.979 1.00 16.08 ? 454 ALA A CB  1 
ATOM   3470 N N   . VAL A 1 455 ? -12.698 35.958 43.492 1.00 20.48 ? 455 VAL A N   1 
ATOM   3471 C CA  . VAL A 1 455 ? -13.768 36.492 44.318 1.00 20.36 ? 455 VAL A CA  1 
ATOM   3472 C C   . VAL A 1 455 ? -15.077 36.774 43.578 1.00 21.32 ? 455 VAL A C   1 
ATOM   3473 O O   . VAL A 1 455 ? -15.111 36.904 42.352 1.00 20.48 ? 455 VAL A O   1 
ATOM   3474 C CB  . VAL A 1 455 ? -13.308 37.777 45.021 1.00 19.79 ? 455 VAL A CB  1 
ATOM   3475 C CG1 . VAL A 1 455 ? -12.135 37.468 45.939 1.00 18.34 ? 455 VAL A CG1 1 
ATOM   3476 C CG2 . VAL A 1 455 ? -12.923 38.821 43.986 1.00 18.63 ? 455 VAL A CG2 1 
ATOM   3477 N N   . ASP A 1 456 ? -16.155 36.855 44.349 1.00 21.25 ? 456 ASP A N   1 
ATOM   3478 C CA  . ASP A 1 456 ? -17.475 37.150 43.813 1.00 23.01 ? 456 ASP A CA  1 
ATOM   3479 C C   . ASP A 1 456 ? -17.487 38.590 43.283 1.00 23.37 ? 456 ASP A C   1 
ATOM   3480 O O   . ASP A 1 456 ? -16.802 39.467 43.814 1.00 23.71 ? 456 ASP A O   1 
ATOM   3481 C CB  . ASP A 1 456 ? -18.526 36.976 44.918 1.00 23.00 ? 456 ASP A CB  1 
ATOM   3482 C CG  . ASP A 1 456 ? -19.917 37.394 44.481 1.00 25.12 ? 456 ASP A CG  1 
ATOM   3483 O OD1 . ASP A 1 456 ? -20.202 38.614 44.461 1.00 23.31 ? 456 ASP A OD1 1 
ATOM   3484 O OD2 . ASP A 1 456 ? -20.723 36.496 44.151 1.00 25.67 ? 456 ASP A OD2 1 
ATOM   3485 N N   . PRO A 1 457 ? -18.265 38.849 42.224 1.00 23.26 ? 457 PRO A N   1 
ATOM   3486 C CA  . PRO A 1 457 ? -18.350 40.190 41.634 1.00 22.88 ? 457 PRO A CA  1 
ATOM   3487 C C   . PRO A 1 457 ? -18.522 41.293 42.673 1.00 22.51 ? 457 PRO A C   1 
ATOM   3488 O O   . PRO A 1 457 ? -18.012 42.400 42.504 1.00 22.56 ? 457 PRO A O   1 
ATOM   3489 C CB  . PRO A 1 457 ? -19.568 40.094 40.725 1.00 23.14 ? 457 PRO A CB  1 
ATOM   3490 C CG  . PRO A 1 457 ? -19.551 38.665 40.304 1.00 26.41 ? 457 PRO A CG  1 
ATOM   3491 C CD  . PRO A 1 457 ? -19.194 37.916 41.564 1.00 23.09 ? 457 PRO A CD  1 
ATOM   3492 N N   . SER A 1 458 ? -19.241 40.986 43.747 1.00 22.74 ? 458 SER A N   1 
ATOM   3493 C CA  . SER A 1 458 ? -19.504 41.972 44.787 1.00 22.35 ? 458 SER A CA  1 
ATOM   3494 C C   . SER A 1 458 ? -18.312 42.258 45.686 1.00 22.08 ? 458 SER A C   1 
ATOM   3495 O O   . SER A 1 458 ? -18.190 43.356 46.215 1.00 24.33 ? 458 SER A O   1 
ATOM   3496 C CB  . SER A 1 458 ? -20.695 41.533 45.645 1.00 21.40 ? 458 SER A CB  1 
ATOM   3497 O OG  . SER A 1 458 ? -20.390 40.369 46.396 1.00 24.12 ? 458 SER A OG  1 
ATOM   3498 N N   . THR A 1 459 ? -17.435 41.279 45.859 1.00 21.25 ? 459 THR A N   1 
ATOM   3499 C CA  . THR A 1 459 ? -16.265 41.452 46.717 1.00 20.71 ? 459 THR A CA  1 
ATOM   3500 C C   . THR A 1 459 ? -15.311 42.544 46.232 1.00 20.68 ? 459 THR A C   1 
ATOM   3501 O O   . THR A 1 459 ? -14.677 42.405 45.181 1.00 21.52 ? 459 THR A O   1 
ATOM   3502 C CB  . THR A 1 459 ? -15.456 40.140 46.833 1.00 20.69 ? 459 THR A CB  1 
ATOM   3503 O OG1 . THR A 1 459 ? -16.291 39.101 47.367 1.00 20.69 ? 459 THR A OG1 1 
ATOM   3504 C CG2 . THR A 1 459 ? -14.242 40.346 47.736 1.00 19.54 ? 459 THR A CG2 1 
ATOM   3505 N N   . VAL A 1 460 ? -15.208 43.631 46.993 1.00 19.07 ? 460 VAL A N   1 
ATOM   3506 C CA  . VAL A 1 460 ? -14.295 44.698 46.620 1.00 19.08 ? 460 VAL A CA  1 
ATOM   3507 C C   . VAL A 1 460 ? -12.916 44.252 47.074 1.00 20.59 ? 460 VAL A C   1 
ATOM   3508 O O   . VAL A 1 460 ? -12.729 43.846 48.228 1.00 20.65 ? 460 VAL A O   1 
ATOM   3509 C CB  . VAL A 1 460 ? -14.624 46.033 47.313 1.00 19.02 ? 460 VAL A CB  1 
ATOM   3510 C CG1 . VAL A 1 460 ? -13.588 47.088 46.912 1.00 14.43 ? 460 VAL A CG1 1 
ATOM   3511 C CG2 . VAL A 1 460 ? -16.021 46.496 46.925 1.00 15.61 ? 460 VAL A CG2 1 
ATOM   3512 N N   . VAL A 1 461 ? -11.957 44.319 46.157 1.00 21.35 ? 461 VAL A N   1 
ATOM   3513 C CA  . VAL A 1 461 ? -10.591 43.912 46.451 1.00 21.76 ? 461 VAL A CA  1 
ATOM   3514 C C   . VAL A 1 461 ? -9.640  45.101 46.457 1.00 22.03 ? 461 VAL A C   1 
ATOM   3515 O O   . VAL A 1 461 ? -9.478  45.786 45.451 1.00 23.58 ? 461 VAL A O   1 
ATOM   3516 C CB  . VAL A 1 461 ? -10.096 42.878 45.423 1.00 20.38 ? 461 VAL A CB  1 
ATOM   3517 C CG1 . VAL A 1 461 ? -8.656  42.504 45.716 1.00 20.85 ? 461 VAL A CG1 1 
ATOM   3518 C CG2 . VAL A 1 461 ? -10.988 41.645 45.464 1.00 20.82 ? 461 VAL A CG2 1 
ATOM   3519 N N   . VAL A 1 462 ? -9.009  45.341 47.598 1.00 21.30 ? 462 VAL A N   1 
ATOM   3520 C CA  . VAL A 1 462 ? -8.075  46.447 47.720 1.00 21.53 ? 462 VAL A CA  1 
ATOM   3521 C C   . VAL A 1 462 ? -6.641  45.944 47.795 1.00 22.78 ? 462 VAL A C   1 
ATOM   3522 O O   . VAL A 1 462 ? -6.356  44.938 48.447 1.00 23.19 ? 462 VAL A O   1 
ATOM   3523 C CB  . VAL A 1 462 ? -8.358  47.267 48.984 1.00 20.08 ? 462 VAL A CB  1 
ATOM   3524 C CG1 . VAL A 1 462 ? -7.317  48.348 49.135 1.00 18.72 ? 462 VAL A CG1 1 
ATOM   3525 C CG2 . VAL A 1 462 ? -9.750  47.865 48.913 1.00 18.98 ? 462 VAL A CG2 1 
ATOM   3526 N N   . PHE A 1 463 ? -5.732  46.643 47.125 1.00 22.82 ? 463 PHE A N   1 
ATOM   3527 C CA  . PHE A 1 463 ? -4.331  46.249 47.165 1.00 24.08 ? 463 PHE A CA  1 
ATOM   3528 C C   . PHE A 1 463 ? -3.496  47.344 47.815 1.00 26.09 ? 463 PHE A C   1 
ATOM   3529 O O   . PHE A 1 463 ? -3.677  48.526 47.526 1.00 27.93 ? 463 PHE A O   1 
ATOM   3530 C CB  . PHE A 1 463 ? -3.793  45.972 45.760 1.00 21.84 ? 463 PHE A CB  1 
ATOM   3531 C CG  . PHE A 1 463 ? -2.327  45.677 45.734 1.00 20.87 ? 463 PHE A CG  1 
ATOM   3532 C CD1 . PHE A 1 463 ? -1.829  44.524 46.325 1.00 21.92 ? 463 PHE A CD1 1 
ATOM   3533 C CD2 . PHE A 1 463 ? -1.432  46.578 45.173 1.00 20.62 ? 463 PHE A CD2 1 
ATOM   3534 C CE1 . PHE A 1 463 ? -0.456  44.273 46.360 1.00 20.50 ? 463 PHE A CE1 1 
ATOM   3535 C CE2 . PHE A 1 463 ? -0.058  46.333 45.204 1.00 20.31 ? 463 PHE A CE2 1 
ATOM   3536 C CZ  . PHE A 1 463 ? 0.428   45.181 45.799 1.00 18.71 ? 463 PHE A CZ  1 
ATOM   3537 N N   . ALA A 1 464 ? -2.591  46.946 48.702 1.00 27.18 ? 464 ALA A N   1 
ATOM   3538 C CA  . ALA A 1 464 ? -1.701  47.881 49.388 1.00 28.43 ? 464 ALA A CA  1 
ATOM   3539 C C   . ALA A 1 464 ? -0.436  47.093 49.668 1.00 29.87 ? 464 ALA A C   1 
ATOM   3540 O O   . ALA A 1 464 ? -0.442  46.210 50.527 1.00 31.20 ? 464 ALA A O   1 
ATOM   3541 C CB  . ALA A 1 464 ? -2.326  48.354 50.689 1.00 28.09 ? 464 ALA A CB  1 
ATOM   3542 N N   . GLU A 1 465 ? 0.641   47.398 48.947 1.00 29.62 ? 465 GLU A N   1 
ATOM   3543 C CA  . GLU A 1 465 ? 1.880   46.657 49.126 1.00 29.98 ? 465 GLU A CA  1 
ATOM   3544 C C   . GLU A 1 465 ? 2.363   46.632 50.559 1.00 30.71 ? 465 GLU A C   1 
ATOM   3545 O O   . GLU A 1 465 ? 2.770   45.583 51.055 1.00 31.13 ? 465 GLU A O   1 
ATOM   3546 C CB  . GLU A 1 465 ? 2.996   47.213 48.243 1.00 30.71 ? 465 GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 465 ? 4.217   46.303 48.213 1.00 32.29 ? 465 GLU A CG  1 
ATOM   3548 C CD  . GLU A 1 465 ? 5.268   46.732 47.201 1.00 34.88 ? 465 GLU A CD  1 
ATOM   3549 O OE1 . GLU A 1 465 ? 4.887   47.237 46.122 1.00 36.51 ? 465 GLU A OE1 1 
ATOM   3550 O OE2 . GLU A 1 465 ? 6.478   46.546 47.474 1.00 36.57 ? 465 GLU A OE2 1 
ATOM   3551 N N   . ASN A 1 466 ? 2.311   47.781 51.227 1.00 30.80 ? 466 ASN A N   1 
ATOM   3552 C CA  . ASN A 1 466 ? 2.782   47.868 52.601 1.00 31.22 ? 466 ASN A CA  1 
ATOM   3553 C C   . ASN A 1 466 ? 1.968   48.783 53.492 1.00 30.93 ? 466 ASN A C   1 
ATOM   3554 O O   . ASN A 1 466 ? 2.487   49.752 54.042 1.00 31.00 ? 466 ASN A O   1 
ATOM   3555 C CB  . ASN A 1 466 ? 4.232   48.325 52.609 1.00 33.07 ? 466 ASN A CB  1 
ATOM   3556 C CG  . ASN A 1 466 ? 5.135   47.320 53.256 1.00 37.14 ? 466 ASN A CG  1 
ATOM   3557 O OD1 . ASN A 1 466 ? 5.194   47.225 54.485 1.00 36.75 ? 466 ASN A OD1 1 
ATOM   3558 N ND2 . ASN A 1 466 ? 5.831   46.529 52.431 1.00 39.15 ? 466 ASN A ND2 1 
ATOM   3559 N N   . PRO A 1 467 ? 0.685   48.466 53.677 1.00 30.43 ? 467 PRO A N   1 
ATOM   3560 C CA  . PRO A 1 467 ? -0.193  49.282 54.515 1.00 30.74 ? 467 PRO A CA  1 
ATOM   3561 C C   . PRO A 1 467 ? 0.228   49.283 55.980 1.00 30.17 ? 467 PRO A C   1 
ATOM   3562 O O   . PRO A 1 467 ? 0.790   48.302 56.465 1.00 28.55 ? 467 PRO A O   1 
ATOM   3563 C CB  . PRO A 1 467 ? -1.551  48.617 54.317 1.00 30.71 ? 467 PRO A CB  1 
ATOM   3564 C CG  . PRO A 1 467 ? -1.171  47.165 54.242 1.00 30.19 ? 467 PRO A CG  1 
ATOM   3565 C CD  . PRO A 1 467 ? 0.024   47.203 53.301 1.00 30.21 ? 467 PRO A CD  1 
ATOM   3566 N N   . ASP A 1 468 ? -0.036  50.386 56.680 1.00 30.96 ? 468 ASP A N   1 
ATOM   3567 C CA  . ASP A 1 468 ? 0.290   50.446 58.100 1.00 32.00 ? 468 ASP A CA  1 
ATOM   3568 C C   . ASP A 1 468 ? -0.928  49.986 58.904 1.00 31.32 ? 468 ASP A C   1 
ATOM   3569 O O   . ASP A 1 468 ? -2.036  49.872 58.367 1.00 30.17 ? 468 ASP A O   1 
ATOM   3570 C CB  . ASP A 1 468 ? 0.722   51.857 58.533 1.00 34.34 ? 468 ASP A CB  1 
ATOM   3571 C CG  . ASP A 1 468 ? -0.313  52.922 58.217 1.00 37.71 ? 468 ASP A CG  1 
ATOM   3572 O OD1 . ASP A 1 468 ? -1.517  52.682 58.452 1.00 40.56 ? 468 ASP A OD1 1 
ATOM   3573 O OD2 . ASP A 1 468 ? 0.084   54.014 57.748 1.00 38.63 ? 468 ASP A OD2 1 
ATOM   3574 N N   . ALA A 1 469 ? -0.713  49.717 60.187 1.00 30.85 ? 469 ALA A N   1 
ATOM   3575 C CA  . ALA A 1 469 ? -1.765  49.240 61.072 1.00 30.07 ? 469 ALA A CA  1 
ATOM   3576 C C   . ALA A 1 469 ? -3.061  50.028 60.982 1.00 29.91 ? 469 ALA A C   1 
ATOM   3577 O O   . ALA A 1 469 ? -4.139  49.437 60.921 1.00 29.46 ? 469 ALA A O   1 
ATOM   3578 C CB  . ALA A 1 469 ? -1.268  49.233 62.504 1.00 28.59 ? 469 ALA A CB  1 
ATOM   3579 N N   . GLU A 1 470 ? -2.967  51.355 60.977 1.00 29.92 ? 470 GLU A N   1 
ATOM   3580 C CA  . GLU A 1 470 ? -4.173  52.173 60.917 1.00 31.29 ? 470 GLU A CA  1 
ATOM   3581 C C   . GLU A 1 470 ? -4.971  51.978 59.634 1.00 29.49 ? 470 GLU A C   1 
ATOM   3582 O O   . GLU A 1 470 ? -6.202  51.956 59.654 1.00 29.79 ? 470 GLU A O   1 
ATOM   3583 C CB  . GLU A 1 470 ? -3.848  53.658 61.065 1.00 34.03 ? 470 GLU A CB  1 
ATOM   3584 C CG  . GLU A 1 470 ? -5.100  54.508 60.894 1.00 40.54 ? 470 GLU A CG  1 
ATOM   3585 C CD  . GLU A 1 470 ? -4.838  55.994 60.939 1.00 43.83 ? 470 GLU A CD  1 
ATOM   3586 O OE1 . GLU A 1 470 ? -5.796  56.764 60.688 1.00 46.40 ? 470 GLU A OE1 1 
ATOM   3587 O OE2 . GLU A 1 470 ? -3.686  56.389 61.228 1.00 45.52 ? 470 GLU A OE2 1 
ATOM   3588 N N   . PHE A 1 471 ? -4.266  51.851 58.519 1.00 27.79 ? 471 PHE A N   1 
ATOM   3589 C CA  . PHE A 1 471 ? -4.918  51.661 57.236 1.00 26.45 ? 471 PHE A CA  1 
ATOM   3590 C C   . PHE A 1 471 ? -5.777  50.407 57.273 1.00 26.41 ? 471 PHE A C   1 
ATOM   3591 O O   . PHE A 1 471 ? -6.922  50.406 56.813 1.00 25.71 ? 471 PHE A O   1 
ATOM   3592 C CB  . PHE A 1 471 ? -3.866  51.554 56.129 1.00 26.42 ? 471 PHE A CB  1 
ATOM   3593 C CG  . PHE A 1 471 ? -4.433  51.214 54.777 1.00 26.53 ? 471 PHE A CG  1 
ATOM   3594 C CD1 . PHE A 1 471 ? -4.637  49.887 54.404 1.00 26.04 ? 471 PHE A CD1 1 
ATOM   3595 C CD2 . PHE A 1 471 ? -4.760  52.220 53.873 1.00 26.76 ? 471 PHE A CD2 1 
ATOM   3596 C CE1 . PHE A 1 471 ? -5.157  49.569 53.151 1.00 26.46 ? 471 PHE A CE1 1 
ATOM   3597 C CE2 . PHE A 1 471 ? -5.281  51.912 52.618 1.00 25.86 ? 471 PHE A CE2 1 
ATOM   3598 C CZ  . PHE A 1 471 ? -5.479  50.585 52.256 1.00 26.18 ? 471 PHE A CZ  1 
ATOM   3599 N N   . VAL A 1 472 ? -5.219  49.342 57.832 1.00 24.34 ? 472 VAL A N   1 
ATOM   3600 C CA  . VAL A 1 472 ? -5.930  48.086 57.921 1.00 23.37 ? 472 VAL A CA  1 
ATOM   3601 C C   . VAL A 1 472 ? -7.107  48.196 58.875 1.00 24.56 ? 472 VAL A C   1 
ATOM   3602 O O   . VAL A 1 472 ? -8.211  47.769 58.547 1.00 25.40 ? 472 VAL A O   1 
ATOM   3603 C CB  . VAL A 1 472 ? -4.999  46.956 58.387 1.00 22.02 ? 472 VAL A CB  1 
ATOM   3604 C CG1 . VAL A 1 472 ? -5.726  45.629 58.340 1.00 20.44 ? 472 VAL A CG1 1 
ATOM   3605 C CG2 . VAL A 1 472 ? -3.769  46.915 57.507 1.00 21.07 ? 472 VAL A CG2 1 
ATOM   3606 N N   . LYS A 1 473 ? -6.886  48.774 60.051 1.00 25.21 ? 473 LYS A N   1 
ATOM   3607 C CA  . LYS A 1 473 ? -7.963  48.904 61.029 1.00 26.57 ? 473 LYS A CA  1 
ATOM   3608 C C   . LYS A 1 473 ? -9.110  49.784 60.559 1.00 25.72 ? 473 LYS A C   1 
ATOM   3609 O O   . LYS A 1 473 ? -10.229 49.636 61.030 1.00 26.52 ? 473 LYS A O   1 
ATOM   3610 C CB  . LYS A 1 473 ? -7.443  49.458 62.358 1.00 29.26 ? 473 LYS A CB  1 
ATOM   3611 C CG  . LYS A 1 473 ? -6.587  48.500 63.164 1.00 34.31 ? 473 LYS A CG  1 
ATOM   3612 C CD  . LYS A 1 473 ? -6.291  49.062 64.553 1.00 36.69 ? 473 LYS A CD  1 
ATOM   3613 C CE  . LYS A 1 473 ? -5.438  48.095 65.364 1.00 40.37 ? 473 LYS A CE  1 
ATOM   3614 N NZ  . LYS A 1 473 ? -5.303  48.502 66.795 1.00 41.74 ? 473 LYS A NZ  1 
ATOM   3615 N N   . SER A 1 474 ? -8.843  50.699 59.637 1.00 24.85 ? 474 SER A N   1 
ATOM   3616 C CA  . SER A 1 474 ? -9.890  51.594 59.159 1.00 24.92 ? 474 SER A CA  1 
ATOM   3617 C C   . SER A 1 474 ? -10.530 51.153 57.842 1.00 24.84 ? 474 SER A C   1 
ATOM   3618 O O   . SER A 1 474 ? -11.563 51.684 57.444 1.00 25.88 ? 474 SER A O   1 
ATOM   3619 C CB  . SER A 1 474 ? -9.322  53.005 58.990 1.00 25.17 ? 474 SER A CB  1 
ATOM   3620 O OG  . SER A 1 474 ? -8.698  53.469 60.176 1.00 29.25 ? 474 SER A OG  1 
ATOM   3621 N N   . GLY A 1 475 ? -9.932  50.171 57.179 1.00 24.04 ? 475 GLY A N   1 
ATOM   3622 C CA  . GLY A 1 475 ? -10.445 49.731 55.894 1.00 23.79 ? 475 GLY A CA  1 
ATOM   3623 C C   . GLY A 1 475 ? -11.707 48.896 55.836 1.00 23.93 ? 475 GLY A C   1 
ATOM   3624 O O   . GLY A 1 475 ? -12.243 48.672 54.752 1.00 24.31 ? 475 GLY A O   1 
ATOM   3625 N N   . GLY A 1 476 ? -12.181 48.420 56.979 1.00 22.76 ? 476 GLY A N   1 
ATOM   3626 C CA  . GLY A 1 476 ? -13.385 47.613 56.983 1.00 22.96 ? 476 GLY A CA  1 
ATOM   3627 C C   . GLY A 1 476 ? -13.238 46.337 56.176 1.00 24.15 ? 476 GLY A C   1 
ATOM   3628 O O   . GLY A 1 476 ? -14.127 45.963 55.405 1.00 25.46 ? 476 GLY A O   1 
ATOM   3629 N N   . PHE A 1 477 ? -12.108 45.662 56.351 1.00 23.60 ? 477 PHE A N   1 
ATOM   3630 C CA  . PHE A 1 477 ? -11.844 44.424 55.637 1.00 23.01 ? 477 PHE A CA  1 
ATOM   3631 C C   . PHE A 1 477 ? -12.411 43.229 56.386 1.00 23.58 ? 477 PHE A C   1 
ATOM   3632 O O   . PHE A 1 477 ? -12.492 43.238 57.609 1.00 25.53 ? 477 PHE A O   1 
ATOM   3633 C CB  . PHE A 1 477 ? -10.340 44.245 55.464 1.00 21.39 ? 477 PHE A CB  1 
ATOM   3634 C CG  . PHE A 1 477 ? -9.684  45.356 54.704 1.00 21.61 ? 477 PHE A CG  1 
ATOM   3635 C CD1 . PHE A 1 477 ? -9.999  45.581 53.370 1.00 21.59 ? 477 PHE A CD1 1 
ATOM   3636 C CD2 . PHE A 1 477 ? -8.746  46.178 55.321 1.00 21.13 ? 477 PHE A CD2 1 
ATOM   3637 C CE1 . PHE A 1 477 ? -9.385  46.614 52.660 1.00 23.85 ? 477 PHE A CE1 1 
ATOM   3638 C CE2 . PHE A 1 477 ? -8.129  47.210 54.622 1.00 20.84 ? 477 PHE A CE2 1 
ATOM   3639 C CZ  . PHE A 1 477 ? -8.447  47.430 53.289 1.00 23.14 ? 477 PHE A CZ  1 
ATOM   3640 N N   . SER A 1 478 ? -12.811 42.200 55.653 1.00 23.43 ? 478 SER A N   1 
ATOM   3641 C CA  . SER A 1 478 ? -13.347 40.998 56.280 1.00 23.66 ? 478 SER A CA  1 
ATOM   3642 C C   . SER A 1 478 ? -12.165 40.114 56.659 1.00 23.13 ? 478 SER A C   1 
ATOM   3643 O O   . SER A 1 478 ? -12.197 39.384 57.659 1.00 23.44 ? 478 SER A O   1 
ATOM   3644 C CB  . SER A 1 478 ? -14.250 40.251 55.303 1.00 23.66 ? 478 SER A CB  1 
ATOM   3645 O OG  . SER A 1 478 ? -15.228 41.118 54.763 1.00 27.42 ? 478 SER A OG  1 
ATOM   3646 N N   . TYR A 1 479 ? -11.123 40.191 55.840 1.00 20.93 ? 479 TYR A N   1 
ATOM   3647 C CA  . TYR A 1 479 ? -9.902  39.428 56.052 1.00 19.84 ? 479 TYR A CA  1 
ATOM   3648 C C   . TYR A 1 479 ? -8.829  39.950 55.103 1.00 18.68 ? 479 TYR A C   1 
ATOM   3649 O O   . TYR A 1 479 ? -9.106  40.789 54.246 1.00 18.77 ? 479 TYR A O   1 
ATOM   3650 C CB  . TYR A 1 479 ? -10.169 37.939 55.808 1.00 21.08 ? 479 TYR A CB  1 
ATOM   3651 C CG  . TYR A 1 479 ? -10.678 37.603 54.418 1.00 20.74 ? 479 TYR A CG  1 
ATOM   3652 C CD1 . TYR A 1 479 ? -9.821  37.620 53.314 1.00 20.11 ? 479 TYR A CD1 1 
ATOM   3653 C CD2 . TYR A 1 479 ? -12.014 37.255 54.209 1.00 20.06 ? 479 TYR A CD2 1 
ATOM   3654 C CE1 . TYR A 1 479 ? -10.276 37.300 52.042 1.00 20.11 ? 479 TYR A CE1 1 
ATOM   3655 C CE2 . TYR A 1 479 ? -12.481 36.931 52.936 1.00 20.56 ? 479 TYR A CE2 1 
ATOM   3656 C CZ  . TYR A 1 479 ? -11.604 36.957 51.859 1.00 21.09 ? 479 TYR A CZ  1 
ATOM   3657 O OH  . TYR A 1 479 ? -12.048 36.643 50.597 1.00 21.30 ? 479 TYR A OH  1 
ATOM   3658 N N   . ALA A 1 480 ? -7.606  39.463 55.253 1.00 18.19 ? 480 ALA A N   1 
ATOM   3659 C CA  . ALA A 1 480 ? -6.526  39.909 54.389 1.00 17.30 ? 480 ALA A CA  1 
ATOM   3660 C C   . ALA A 1 480 ? -5.612  38.768 53.966 1.00 18.48 ? 480 ALA A C   1 
ATOM   3661 O O   . ALA A 1 480 ? -5.410  37.809 54.709 1.00 20.03 ? 480 ALA A O   1 
ATOM   3662 C CB  . ALA A 1 480 ? -5.717  40.975 55.092 1.00 15.03 ? 480 ALA A CB  1 
ATOM   3663 N N   . ILE A 1 481 ? -5.077  38.867 52.757 1.00 18.49 ? 481 ILE A N   1 
ATOM   3664 C CA  . ILE A 1 481 ? -4.141  37.869 52.258 1.00 17.92 ? 481 ILE A CA  1 
ATOM   3665 C C   . ILE A 1 481 ? -2.850  38.651 52.111 1.00 18.73 ? 481 ILE A C   1 
ATOM   3666 O O   . ILE A 1 481 ? -2.793  39.630 51.365 1.00 20.14 ? 481 ILE A O   1 
ATOM   3667 C CB  . ILE A 1 481 ? -4.565  37.306 50.878 1.00 17.40 ? 481 ILE A CB  1 
ATOM   3668 C CG1 . ILE A 1 481 ? -5.835  36.459 51.023 1.00 17.41 ? 481 ILE A CG1 1 
ATOM   3669 C CG2 . ILE A 1 481 ? -3.458  36.460 50.302 1.00 13.64 ? 481 ILE A CG2 1 
ATOM   3670 C CD1 . ILE A 1 481 ? -6.465  36.041 49.692 1.00 16.03 ? 481 ILE A CD1 1 
ATOM   3671 N N   . VAL A 1 482 ? -1.826  38.252 52.853 1.00 19.31 ? 482 VAL A N   1 
ATOM   3672 C CA  . VAL A 1 482 ? -0.542  38.938 52.790 1.00 19.01 ? 482 VAL A CA  1 
ATOM   3673 C C   . VAL A 1 482 ? 0.530   37.971 52.316 1.00 19.77 ? 482 VAL A C   1 
ATOM   3674 O O   . VAL A 1 482 ? 0.702   36.885 52.880 1.00 19.78 ? 482 VAL A O   1 
ATOM   3675 C CB  . VAL A 1 482 ? -0.135  39.501 54.166 1.00 19.31 ? 482 VAL A CB  1 
ATOM   3676 C CG1 . VAL A 1 482 ? 1.157   40.284 54.041 1.00 19.52 ? 482 VAL A CG1 1 
ATOM   3677 C CG2 . VAL A 1 482 ? -1.225  40.390 54.700 1.00 20.41 ? 482 VAL A CG2 1 
ATOM   3678 N N   . ALA A 1 483 ? 1.246   38.374 51.274 1.00 19.66 ? 483 ALA A N   1 
ATOM   3679 C CA  . ALA A 1 483 ? 2.292   37.548 50.701 1.00 18.46 ? 483 ALA A CA  1 
ATOM   3680 C C   . ALA A 1 483 ? 3.644   38.224 50.854 1.00 19.05 ? 483 ALA A C   1 
ATOM   3681 O O   . ALA A 1 483 ? 3.823   39.383 50.466 1.00 19.62 ? 483 ALA A O   1 
ATOM   3682 C CB  . ALA A 1 483 ? 1.995   37.286 49.230 1.00 17.92 ? 483 ALA A CB  1 
ATOM   3683 N N   . VAL A 1 484 ? 4.588   37.489 51.431 1.00 18.24 ? 484 VAL A N   1 
ATOM   3684 C CA  . VAL A 1 484 ? 5.942   37.982 51.643 1.00 17.48 ? 484 VAL A CA  1 
ATOM   3685 C C   . VAL A 1 484 ? 6.918   36.822 51.478 1.00 18.03 ? 484 VAL A C   1 
ATOM   3686 O O   . VAL A 1 484 ? 6.504   35.670 51.361 1.00 18.34 ? 484 VAL A O   1 
ATOM   3687 C CB  . VAL A 1 484 ? 6.106   38.580 53.063 1.00 17.02 ? 484 VAL A CB  1 
ATOM   3688 C CG1 . VAL A 1 484 ? 5.265   39.838 53.202 1.00 14.43 ? 484 VAL A CG1 1 
ATOM   3689 C CG2 . VAL A 1 484 ? 5.709   37.554 54.104 1.00 14.42 ? 484 VAL A CG2 1 
ATOM   3690 N N   . GLY A 1 485 ? 8.212   37.122 51.460 1.00 18.21 ? 485 GLY A N   1 
ATOM   3691 C CA  . GLY A 1 485 ? 9.187   36.056 51.321 1.00 18.24 ? 485 GLY A CA  1 
ATOM   3692 C C   . GLY A 1 485 ? 10.543  36.444 50.764 1.00 17.78 ? 485 GLY A C   1 
ATOM   3693 O O   . GLY A 1 485 ? 10.921  37.620 50.728 1.00 16.02 ? 485 GLY A O   1 
ATOM   3694 N N   . GLU A 1 486 ? 11.281  35.430 50.327 1.00 18.35 ? 486 GLU A N   1 
ATOM   3695 C CA  . GLU A 1 486 ? 12.610  35.630 49.767 1.00 18.30 ? 486 GLU A CA  1 
ATOM   3696 C C   . GLU A 1 486 ? 12.557  36.290 48.407 1.00 18.75 ? 486 GLU A C   1 
ATOM   3697 O O   . GLU A 1 486 ? 11.498  36.371 47.776 1.00 18.04 ? 486 GLU A O   1 
ATOM   3698 C CB  . GLU A 1 486 ? 13.337  34.297 49.607 1.00 17.39 ? 486 GLU A CB  1 
ATOM   3699 C CG  . GLU A 1 486 ? 13.702  33.588 50.896 1.00 17.34 ? 486 GLU A CG  1 
ATOM   3700 C CD  . GLU A 1 486 ? 14.563  32.363 50.635 1.00 18.54 ? 486 GLU A CD  1 
ATOM   3701 O OE1 . GLU A 1 486 ? 14.083  31.421 49.956 1.00 16.27 ? 486 GLU A OE1 1 
ATOM   3702 O OE2 . GLU A 1 486 ? 15.724  32.351 51.105 1.00 18.57 ? 486 GLU A OE2 1 
ATOM   3703 N N   . HIS A 1 487 ? 13.716  36.757 47.960 1.00 19.25 ? 487 HIS A N   1 
ATOM   3704 C CA  . HIS A 1 487 ? 13.837  37.372 46.647 1.00 19.83 ? 487 HIS A CA  1 
ATOM   3705 C C   . HIS A 1 487 ? 14.458  36.322 45.718 1.00 18.18 ? 487 HIS A C   1 
ATOM   3706 O O   . HIS A 1 487 ? 15.069  35.361 46.182 1.00 16.70 ? 487 HIS A O   1 
ATOM   3707 C CB  . HIS A 1 487 ? 14.712  38.628 46.733 1.00 19.42 ? 487 HIS A CB  1 
ATOM   3708 C CG  . HIS A 1 487 ? 14.049  39.767 47.445 1.00 21.34 ? 487 HIS A CG  1 
ATOM   3709 N ND1 . HIS A 1 487 ? 14.711  40.930 47.774 1.00 21.80 ? 487 HIS A ND1 1 
ATOM   3710 C CD2 . HIS A 1 487 ? 12.779  39.921 47.889 1.00 23.18 ? 487 HIS A CD2 1 
ATOM   3711 C CE1 . HIS A 1 487 ? 13.879  41.750 48.391 1.00 21.89 ? 487 HIS A CE1 1 
ATOM   3712 N NE2 . HIS A 1 487 ? 12.700  41.162 48.473 1.00 22.97 ? 487 HIS A NE2 1 
ATOM   3713 N N   . PRO A 1 488 ? 14.292  36.479 44.396 1.00 18.06 ? 488 PRO A N   1 
ATOM   3714 C CA  . PRO A 1 488 ? 14.874  35.485 43.488 1.00 18.03 ? 488 PRO A CA  1 
ATOM   3715 C C   . PRO A 1 488 ? 16.382  35.354 43.659 1.00 17.66 ? 488 PRO A C   1 
ATOM   3716 O O   . PRO A 1 488 ? 17.081  36.338 43.896 1.00 18.95 ? 488 PRO A O   1 
ATOM   3717 C CB  . PRO A 1 488 ? 14.495  36.013 42.104 1.00 17.30 ? 488 PRO A CB  1 
ATOM   3718 C CG  . PRO A 1 488 ? 13.207  36.753 42.363 1.00 18.10 ? 488 PRO A CG  1 
ATOM   3719 C CD  . PRO A 1 488 ? 13.525  37.489 43.646 1.00 17.64 ? 488 PRO A CD  1 
ATOM   3720 N N   . TYR A 1 489 ? 16.878  34.131 43.551 1.00 16.71 ? 489 TYR A N   1 
ATOM   3721 C CA  . TYR A 1 489 ? 18.301  33.898 43.665 1.00 17.30 ? 489 TYR A CA  1 
ATOM   3722 C C   . TYR A 1 489 ? 18.680  32.579 43.015 1.00 17.88 ? 489 TYR A C   1 
ATOM   3723 O O   . TYR A 1 489 ? 17.843  31.704 42.811 1.00 18.54 ? 489 TYR A O   1 
ATOM   3724 C CB  . TYR A 1 489 ? 18.729  33.937 45.132 1.00 16.60 ? 489 TYR A CB  1 
ATOM   3725 C CG  . TYR A 1 489 ? 18.043  32.928 46.017 1.00 16.46 ? 489 TYR A CG  1 
ATOM   3726 C CD1 . TYR A 1 489 ? 18.357  31.569 45.941 1.00 16.75 ? 489 TYR A CD1 1 
ATOM   3727 C CD2 . TYR A 1 489 ? 17.091  33.332 46.943 1.00 16.06 ? 489 TYR A CD2 1 
ATOM   3728 C CE1 . TYR A 1 489 ? 17.733  30.640 46.775 1.00 16.86 ? 489 TYR A CE1 1 
ATOM   3729 C CE2 . TYR A 1 489 ? 16.464  32.416 47.778 1.00 15.84 ? 489 TYR A CE2 1 
ATOM   3730 C CZ  . TYR A 1 489 ? 16.787  31.076 47.691 1.00 16.98 ? 489 TYR A CZ  1 
ATOM   3731 O OH  . TYR A 1 489 ? 16.164  30.178 48.525 1.00 17.63 ? 489 TYR A OH  1 
ATOM   3732 N N   . THR A 1 490 ? 19.949  32.443 42.674 1.00 19.45 ? 490 THR A N   1 
ATOM   3733 C CA  . THR A 1 490 ? 20.414  31.229 42.031 1.00 20.35 ? 490 THR A CA  1 
ATOM   3734 C C   . THR A 1 490 ? 21.866  30.929 42.392 1.00 21.09 ? 490 THR A C   1 
ATOM   3735 O O   . THR A 1 490 ? 22.706  31.832 42.449 1.00 20.19 ? 490 THR A O   1 
ATOM   3736 C CB  . THR A 1 490 ? 20.310  31.357 40.508 1.00 20.83 ? 490 THR A CB  1 
ATOM   3737 O OG1 . THR A 1 490 ? 19.006  31.833 40.153 1.00 21.05 ? 490 THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 490 ? 20.559  30.014 39.851 1.00 21.15 ? 490 THR A CG2 1 
ATOM   3739 N N   . GLU A 1 491 ? 22.151  29.656 42.632 1.00 21.76 ? 491 GLU A N   1 
ATOM   3740 C CA  . GLU A 1 491 ? 23.494  29.221 42.978 1.00 22.68 ? 491 GLU A CA  1 
ATOM   3741 C C   . GLU A 1 491 ? 24.066  30.007 44.162 1.00 22.29 ? 491 GLU A C   1 
ATOM   3742 O O   . GLU A 1 491 ? 23.350  30.293 45.120 1.00 22.58 ? 491 GLU A O   1 
ATOM   3743 C CB  . GLU A 1 491 ? 24.403  29.313 41.738 1.00 23.17 ? 491 GLU A CB  1 
ATOM   3744 C CG  . GLU A 1 491 ? 23.935  28.387 40.601 1.00 25.54 ? 491 GLU A CG  1 
ATOM   3745 C CD  . GLU A 1 491 ? 24.794  28.453 39.345 1.00 26.97 ? 491 GLU A CD  1 
ATOM   3746 O OE1 . GLU A 1 491 ? 26.024  28.251 39.455 1.00 28.49 ? 491 GLU A OE1 1 
ATOM   3747 O OE2 . GLU A 1 491 ? 24.233  28.690 38.247 1.00 23.90 ? 491 GLU A OE2 1 
ATOM   3748 N N   . THR A 1 492 ? 25.344  30.363 44.098 1.00 23.29 ? 492 THR A N   1 
ATOM   3749 C CA  . THR A 1 492 ? 25.990  31.068 45.199 1.00 22.99 ? 492 THR A CA  1 
ATOM   3750 C C   . THR A 1 492 ? 25.323  32.351 45.703 1.00 23.15 ? 492 THR A C   1 
ATOM   3751 O O   . THR A 1 492 ? 25.427  32.673 46.887 1.00 23.41 ? 492 THR A O   1 
ATOM   3752 C CB  . THR A 1 492 ? 27.464  31.335 44.862 1.00 22.78 ? 492 THR A CB  1 
ATOM   3753 O OG1 . THR A 1 492 ? 28.091  30.090 44.526 1.00 24.05 ? 492 THR A OG1 1 
ATOM   3754 C CG2 . THR A 1 492 ? 28.187  31.932 46.055 1.00 20.84 ? 492 THR A CG2 1 
ATOM   3755 N N   . LYS A 1 493 ? 24.639  33.086 44.831 1.00 25.12 ? 493 LYS A N   1 
ATOM   3756 C CA  . LYS A 1 493 ? 23.951  34.306 45.270 1.00 26.76 ? 493 LYS A CA  1 
ATOM   3757 C C   . LYS A 1 493 ? 22.862  33.921 46.269 1.00 26.76 ? 493 LYS A C   1 
ATOM   3758 O O   . LYS A 1 493 ? 22.336  34.768 46.993 1.00 27.12 ? 493 LYS A O   1 
ATOM   3759 C CB  . LYS A 1 493 ? 23.294  35.025 44.091 1.00 29.25 ? 493 LYS A CB  1 
ATOM   3760 C CG  . LYS A 1 493 ? 24.221  35.893 43.256 1.00 35.74 ? 493 LYS A CG  1 
ATOM   3761 C CD  . LYS A 1 493 ? 24.562  37.198 43.966 1.00 41.32 ? 493 LYS A CD  1 
ATOM   3762 C CE  . LYS A 1 493 ? 25.367  38.136 43.054 1.00 45.46 ? 493 LYS A CE  1 
ATOM   3763 N NZ  . LYS A 1 493 ? 25.804  39.401 43.746 1.00 48.61 ? 493 LYS A NZ  1 
ATOM   3764 N N   . GLY A 1 494 ? 22.534  32.633 46.302 1.00 25.31 ? 494 GLY A N   1 
ATOM   3765 C CA  . GLY A 1 494 ? 21.496  32.156 47.192 1.00 24.81 ? 494 GLY A CA  1 
ATOM   3766 C C   . GLY A 1 494 ? 21.971  31.600 48.517 1.00 24.75 ? 494 GLY A C   1 
ATOM   3767 O O   . GLY A 1 494 ? 21.155  31.281 49.382 1.00 23.46 ? 494 GLY A O   1 
ATOM   3768 N N   . ASP A 1 495 ? 23.280  31.459 48.684 1.00 23.81 ? 495 ASP A N   1 
ATOM   3769 C CA  . ASP A 1 495 ? 23.798  30.948 49.946 1.00 24.35 ? 495 ASP A CA  1 
ATOM   3770 C C   . ASP A 1 495 ? 23.377  31.927 51.050 1.00 24.61 ? 495 ASP A C   1 
ATOM   3771 O O   . ASP A 1 495 ? 23.531  33.140 50.912 1.00 24.24 ? 495 ASP A O   1 
ATOM   3772 C CB  . ASP A 1 495 ? 25.325  30.814 49.876 1.00 24.16 ? 495 ASP A CB  1 
ATOM   3773 C CG  . ASP A 1 495 ? 25.774  29.646 49.008 1.00 24.77 ? 495 ASP A CG  1 
ATOM   3774 O OD1 . ASP A 1 495 ? 26.988  29.535 48.742 1.00 23.99 ? 495 ASP A OD1 1 
ATOM   3775 O OD2 . ASP A 1 495 ? 24.919  28.833 48.598 1.00 24.90 ? 495 ASP A OD2 1 
ATOM   3776 N N   . ASN A 1 496 ? 22.829  31.404 52.138 1.00 24.84 ? 496 ASN A N   1 
ATOM   3777 C CA  . ASN A 1 496 ? 22.373  32.264 53.220 1.00 25.37 ? 496 ASN A CA  1 
ATOM   3778 C C   . ASN A 1 496 ? 22.566  31.598 54.585 1.00 25.86 ? 496 ASN A C   1 
ATOM   3779 O O   . ASN A 1 496 ? 22.098  30.483 54.817 1.00 25.59 ? 496 ASN A O   1 
ATOM   3780 C CB  . ASN A 1 496 ? 20.896  32.604 53.008 1.00 25.49 ? 496 ASN A CB  1 
ATOM   3781 C CG  . ASN A 1 496 ? 20.437  33.765 53.864 1.00 27.63 ? 496 ASN A CG  1 
ATOM   3782 O OD1 . ASN A 1 496 ? 20.753  33.841 55.055 1.00 26.56 ? 496 ASN A OD1 1 
ATOM   3783 N ND2 . ASN A 1 496 ? 19.677  34.677 53.263 1.00 27.14 ? 496 ASN A ND2 1 
ATOM   3784 N N   . LEU A 1 497 ? 23.244  32.291 55.493 1.00 25.28 ? 497 LEU A N   1 
ATOM   3785 C CA  . LEU A 1 497 ? 23.500  31.737 56.814 1.00 26.04 ? 497 LEU A CA  1 
ATOM   3786 C C   . LEU A 1 497 ? 22.476  32.116 57.878 1.00 27.64 ? 497 LEU A C   1 
ATOM   3787 O O   . LEU A 1 497 ? 22.302  31.389 58.854 1.00 29.03 ? 497 LEU A O   1 
ATOM   3788 C CB  . LEU A 1 497 ? 24.887  32.155 57.285 1.00 22.40 ? 497 LEU A CB  1 
ATOM   3789 C CG  . LEU A 1 497 ? 26.035  31.672 56.409 1.00 20.61 ? 497 LEU A CG  1 
ATOM   3790 C CD1 . LEU A 1 497 ? 27.317  32.331 56.870 1.00 16.99 ? 497 LEU A CD1 1 
ATOM   3791 C CD2 . LEU A 1 497 ? 26.138  30.150 56.474 1.00 17.84 ? 497 LEU A CD2 1 
ATOM   3792 N N   . ASN A 1 498 ? 21.806  33.250 57.696 1.00 29.13 ? 498 ASN A N   1 
ATOM   3793 C CA  . ASN A 1 498 ? 20.817  33.711 58.665 1.00 31.03 ? 498 ASN A CA  1 
ATOM   3794 C C   . ASN A 1 498 ? 19.405  33.247 58.315 1.00 28.56 ? 498 ASN A C   1 
ATOM   3795 O O   . ASN A 1 498 ? 18.543  33.162 59.187 1.00 27.74 ? 498 ASN A O   1 
ATOM   3796 C CB  . ASN A 1 498 ? 20.858  35.234 58.761 1.00 37.68 ? 498 ASN A CB  1 
ATOM   3797 C CG  . ASN A 1 498 ? 20.477  35.900 57.464 1.00 47.04 ? 498 ASN A CG  1 
ATOM   3798 O OD1 . ASN A 1 498 ? 19.304  35.875 57.061 1.00 48.90 ? 498 ASN A OD1 1 
ATOM   3799 N ND2 . ASN A 1 498 ? 21.461  36.487 56.787 1.00 53.34 ? 498 ASN A ND2 1 
ATOM   3800 N N   . LEU A 1 499 ? 19.183  32.959 57.035 1.00 27.30 ? 499 LEU A N   1 
ATOM   3801 C CA  . LEU A 1 499 ? 17.898  32.478 56.526 1.00 25.84 ? 499 LEU A CA  1 
ATOM   3802 C C   . LEU A 1 499 ? 16.635  33.203 57.007 1.00 26.11 ? 499 LEU A C   1 
ATOM   3803 O O   . LEU A 1 499 ? 15.600  32.567 57.241 1.00 25.72 ? 499 LEU A O   1 
ATOM   3804 C CB  . LEU A 1 499 ? 17.763  30.979 56.812 1.00 24.12 ? 499 LEU A CB  1 
ATOM   3805 C CG  . LEU A 1 499 ? 17.917  30.008 55.638 1.00 25.02 ? 499 LEU A CG  1 
ATOM   3806 C CD1 . LEU A 1 499 ? 19.100  30.388 54.775 1.00 23.85 ? 499 LEU A CD1 1 
ATOM   3807 C CD2 . LEU A 1 499 ? 18.078  28.596 56.178 1.00 23.83 ? 499 LEU A CD2 1 
ATOM   3808 N N   . THR A 1 500 ? 16.709  34.523 57.148 1.00 25.91 ? 500 THR A N   1 
ATOM   3809 C CA  . THR A 1 500 ? 15.544  35.292 57.578 1.00 27.99 ? 500 THR A CA  1 
ATOM   3810 C C   . THR A 1 500 ? 15.100  36.124 56.384 1.00 28.33 ? 500 THR A C   1 
ATOM   3811 O O   . THR A 1 500 ? 15.937  36.687 55.674 1.00 30.12 ? 500 THR A O   1 
ATOM   3812 C CB  . THR A 1 500 ? 15.874  36.237 58.755 1.00 29.06 ? 500 THR A CB  1 
ATOM   3813 O OG1 . THR A 1 500 ? 16.686  37.319 58.286 1.00 32.61 ? 500 THR A OG1 1 
ATOM   3814 C CG2 . THR A 1 500 ? 16.621  35.486 59.851 1.00 28.09 ? 500 THR A CG2 1 
ATOM   3815 N N   . ILE A 1 501 ? 13.793  36.205 56.155 1.00 27.98 ? 501 ILE A N   1 
ATOM   3816 C CA  . ILE A 1 501 ? 13.289  36.959 55.011 1.00 27.66 ? 501 ILE A CA  1 
ATOM   3817 C C   . ILE A 1 501 ? 13.541  38.459 55.129 1.00 28.14 ? 501 ILE A C   1 
ATOM   3818 O O   . ILE A 1 501 ? 13.475  39.033 56.220 1.00 28.66 ? 501 ILE A O   1 
ATOM   3819 C CB  . ILE A 1 501 ? 11.779  36.730 54.800 1.00 26.61 ? 501 ILE A CB  1 
ATOM   3820 C CG1 . ILE A 1 501 ? 10.985  37.396 55.919 1.00 25.74 ? 501 ILE A CG1 1 
ATOM   3821 C CG2 . ILE A 1 501 ? 11.483  35.244 54.777 1.00 25.00 ? 501 ILE A CG2 1 
ATOM   3822 C CD1 . ILE A 1 501 ? 9.510   37.462 55.633 1.00 27.54 ? 501 ILE A CD1 1 
ATOM   3823 N N   . PRO A 1 502 ? 13.824  39.118 53.996 1.00 28.39 ? 502 PRO A N   1 
ATOM   3824 C CA  . PRO A 1 502 ? 14.085  40.558 53.980 1.00 28.56 ? 502 PRO A CA  1 
ATOM   3825 C C   . PRO A 1 502 ? 12.851  41.359 54.350 1.00 29.13 ? 502 PRO A C   1 
ATOM   3826 O O   . PRO A 1 502 ? 11.734  40.866 54.236 1.00 28.60 ? 502 PRO A O   1 
ATOM   3827 C CB  . PRO A 1 502 ? 14.506  40.809 52.537 1.00 28.71 ? 502 PRO A CB  1 
ATOM   3828 C CG  . PRO A 1 502 ? 13.660  39.837 51.785 1.00 28.38 ? 502 PRO A CG  1 
ATOM   3829 C CD  . PRO A 1 502 ? 13.819  38.578 52.623 1.00 28.96 ? 502 PRO A CD  1 
ATOM   3830 N N   . GLU A 1 503 ? 13.062  42.592 54.798 1.00 30.21 ? 503 GLU A N   1 
ATOM   3831 C CA  . GLU A 1 503 ? 11.961  43.470 55.153 1.00 30.89 ? 503 GLU A CA  1 
ATOM   3832 C C   . GLU A 1 503 ? 11.784  44.498 54.048 1.00 31.14 ? 503 GLU A C   1 
ATOM   3833 O O   . GLU A 1 503 ? 12.706  44.753 53.276 1.00 33.32 ? 503 GLU A O   1 
ATOM   3834 C CB  . GLU A 1 503 ? 12.239  44.167 56.476 1.00 30.31 ? 503 GLU A CB  1 
ATOM   3835 C CG  . GLU A 1 503 ? 12.161  43.234 57.651 1.00 31.94 ? 503 GLU A CG  1 
ATOM   3836 C CD  . GLU A 1 503 ? 10.800  42.587 57.770 1.00 33.76 ? 503 GLU A CD  1 
ATOM   3837 O OE1 . GLU A 1 503 ? 9.802   43.330 57.914 1.00 34.20 ? 503 GLU A OE1 1 
ATOM   3838 O OE2 . GLU A 1 503 ? 10.727  41.338 57.715 1.00 33.67 ? 503 GLU A OE2 1 
ATOM   3839 N N   . PRO A 1 504 ? 10.586  45.090 53.943 1.00 31.39 ? 504 PRO A N   1 
ATOM   3840 C CA  . PRO A 1 504 ? 9.433   44.825 54.809 1.00 30.60 ? 504 PRO A CA  1 
ATOM   3841 C C   . PRO A 1 504 ? 8.896   43.434 54.516 1.00 30.05 ? 504 PRO A C   1 
ATOM   3842 O O   . PRO A 1 504 ? 8.809   43.022 53.355 1.00 30.45 ? 504 PRO A O   1 
ATOM   3843 C CB  . PRO A 1 504 ? 8.419   45.895 54.400 1.00 30.47 ? 504 PRO A CB  1 
ATOM   3844 C CG  . PRO A 1 504 ? 9.204   46.861 53.521 1.00 31.82 ? 504 PRO A CG  1 
ATOM   3845 C CD  . PRO A 1 504 ? 10.213  45.995 52.849 1.00 31.14 ? 504 PRO A CD  1 
ATOM   3846 N N   . GLY A 1 505 ? 8.542   42.718 55.570 1.00 27.93 ? 505 GLY A N   1 
ATOM   3847 C CA  . GLY A 1 505 ? 8.005   41.384 55.413 1.00 25.70 ? 505 GLY A CA  1 
ATOM   3848 C C   . GLY A 1 505 ? 7.222   41.100 56.670 1.00 25.42 ? 505 GLY A C   1 
ATOM   3849 O O   . GLY A 1 505 ? 5.995   41.215 56.695 1.00 25.92 ? 505 GLY A O   1 
ATOM   3850 N N   . LEU A 1 506 ? 7.948   40.744 57.722 1.00 23.67 ? 506 LEU A N   1 
ATOM   3851 C CA  . LEU A 1 506 ? 7.347   40.460 59.007 1.00 22.64 ? 506 LEU A CA  1 
ATOM   3852 C C   . LEU A 1 506 ? 6.516   41.659 59.448 1.00 23.66 ? 506 LEU A C   1 
ATOM   3853 O O   . LEU A 1 506 ? 5.381   41.505 59.912 1.00 24.08 ? 506 LEU A O   1 
ATOM   3854 C CB  . LEU A 1 506 ? 8.439   40.189 60.034 1.00 20.91 ? 506 LEU A CB  1 
ATOM   3855 C CG  . LEU A 1 506 ? 7.973   39.938 61.463 1.00 20.39 ? 506 LEU A CG  1 
ATOM   3856 C CD1 . LEU A 1 506 ? 7.036   38.738 61.512 1.00 18.00 ? 506 LEU A CD1 1 
ATOM   3857 C CD2 . LEU A 1 506 ? 9.190   39.700 62.324 1.00 18.95 ? 506 LEU A CD2 1 
ATOM   3858 N N   . SER A 1 507 ? 7.086   42.852 59.290 1.00 23.35 ? 507 SER A N   1 
ATOM   3859 C CA  . SER A 1 507 ? 6.410   44.087 59.678 1.00 24.48 ? 507 SER A CA  1 
ATOM   3860 C C   . SER A 1 507 ? 5.051   44.245 58.990 1.00 25.02 ? 507 SER A C   1 
ATOM   3861 O O   . SER A 1 507 ? 4.058   44.612 59.630 1.00 25.67 ? 507 SER A O   1 
ATOM   3862 C CB  . SER A 1 507 ? 7.294   45.292 59.354 1.00 24.42 ? 507 SER A CB  1 
ATOM   3863 O OG  . SER A 1 507 ? 7.572   45.354 57.963 1.00 31.84 ? 507 SER A OG  1 
ATOM   3864 N N   . THR A 1 508 ? 5.005   43.975 57.689 1.00 24.21 ? 508 THR A N   1 
ATOM   3865 C CA  . THR A 1 508 ? 3.756   44.091 56.951 1.00 24.44 ? 508 THR A CA  1 
ATOM   3866 C C   . THR A 1 508 ? 2.748   43.083 57.495 1.00 24.40 ? 508 THR A C   1 
ATOM   3867 O O   . THR A 1 508 ? 1.578   43.408 57.709 1.00 25.87 ? 508 THR A O   1 
ATOM   3868 C CB  . THR A 1 508 ? 3.967   43.825 55.452 1.00 24.93 ? 508 THR A CB  1 
ATOM   3869 O OG1 . THR A 1 508 ? 5.003   44.682 54.959 1.00 27.64 ? 508 THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 508 ? 2.688   44.101 54.679 1.00 22.85 ? 508 THR A CG2 1 
ATOM   3871 N N   . VAL A 1 509 ? 3.205   41.856 57.721 1.00 22.87 ? 509 VAL A N   1 
ATOM   3872 C CA  . VAL A 1 509 ? 2.336   40.814 58.243 1.00 20.92 ? 509 VAL A CA  1 
ATOM   3873 C C   . VAL A 1 509 ? 1.803   41.213 59.616 1.00 20.79 ? 509 VAL A C   1 
ATOM   3874 O O   . VAL A 1 509 ? 0.615   41.085 59.894 1.00 20.30 ? 509 VAL A O   1 
ATOM   3875 C CB  . VAL A 1 509 ? 3.093   39.470 58.347 1.00 19.97 ? 509 VAL A CB  1 
ATOM   3876 C CG1 . VAL A 1 509 ? 2.296   38.474 59.160 1.00 19.57 ? 509 VAL A CG1 1 
ATOM   3877 C CG2 . VAL A 1 509 ? 3.338   38.914 56.965 1.00 19.42 ? 509 VAL A CG2 1 
ATOM   3878 N N   . GLN A 1 510 ? 2.687   41.708 60.471 1.00 20.39 ? 510 GLN A N   1 
ATOM   3879 C CA  . GLN A 1 510 ? 2.282   42.111 61.808 1.00 21.29 ? 510 GLN A CA  1 
ATOM   3880 C C   . GLN A 1 510 ? 1.305   43.278 61.742 1.00 21.47 ? 510 GLN A C   1 
ATOM   3881 O O   . GLN A 1 510 ? 0.335   43.331 62.498 1.00 21.40 ? 510 GLN A O   1 
ATOM   3882 C CB  . GLN A 1 510 ? 3.510   42.497 62.634 1.00 21.42 ? 510 GLN A CB  1 
ATOM   3883 C CG  . GLN A 1 510 ? 4.542   41.389 62.715 1.00 26.37 ? 510 GLN A CG  1 
ATOM   3884 C CD  . GLN A 1 510 ? 5.767   41.762 63.534 1.00 27.32 ? 510 GLN A CD  1 
ATOM   3885 O OE1 . GLN A 1 510 ? 6.321   42.853 63.385 1.00 28.08 ? 510 GLN A OE1 1 
ATOM   3886 N NE2 . GLN A 1 510 ? 6.208   40.842 64.392 1.00 28.39 ? 510 GLN A NE2 1 
ATOM   3887 N N   . ALA A 1 511 ? 1.560   44.214 60.835 1.00 20.72 ? 511 ALA A N   1 
ATOM   3888 C CA  . ALA A 1 511 ? 0.690   45.370 60.701 1.00 20.68 ? 511 ALA A CA  1 
ATOM   3889 C C   . ALA A 1 511 ? -0.678  44.916 60.214 1.00 21.67 ? 511 ALA A C   1 
ATOM   3890 O O   . ALA A 1 511 ? -1.699  45.234 60.823 1.00 23.68 ? 511 ALA A O   1 
ATOM   3891 C CB  . ALA A 1 511 ? 1.300   46.390 59.728 1.00 18.66 ? 511 ALA A CB  1 
ATOM   3892 N N   . VAL A 1 512 ? -0.695  44.153 59.125 1.00 21.36 ? 512 VAL A N   1 
ATOM   3893 C CA  . VAL A 1 512 ? -1.947  43.668 58.566 1.00 20.98 ? 512 VAL A CA  1 
ATOM   3894 C C   . VAL A 1 512 ? -2.706  42.769 59.538 1.00 22.17 ? 512 VAL A C   1 
ATOM   3895 O O   . VAL A 1 512 ? -3.877  43.014 59.832 1.00 23.09 ? 512 VAL A O   1 
ATOM   3896 C CB  . VAL A 1 512 ? -1.707  42.894 57.252 1.00 20.73 ? 512 VAL A CB  1 
ATOM   3897 C CG1 . VAL A 1 512 ? -3.024  42.362 56.713 1.00 19.00 ? 512 VAL A CG1 1 
ATOM   3898 C CG2 . VAL A 1 512 ? -1.052  43.804 56.232 1.00 20.43 ? 512 VAL A CG2 1 
ATOM   3899 N N   . CYS A 1 513 ? -2.039  41.733 60.037 1.00 21.80 ? 513 CYS A N   1 
ATOM   3900 C CA  . CYS A 1 513 ? -2.670  40.793 60.959 1.00 22.00 ? 513 CYS A CA  1 
ATOM   3901 C C   . CYS A 1 513 ? -3.140  41.430 62.261 1.00 22.00 ? 513 CYS A C   1 
ATOM   3902 O O   . CYS A 1 513 ? -4.101  40.965 62.879 1.00 20.40 ? 513 CYS A O   1 
ATOM   3903 C CB  . CYS A 1 513 ? -1.715  39.649 61.277 1.00 23.44 ? 513 CYS A CB  1 
ATOM   3904 S SG  . CYS A 1 513 ? -1.189  38.676 59.836 1.00 24.65 ? 513 CYS A SG  1 
ATOM   3905 N N   . GLY A 1 514 ? -2.456  42.483 62.688 1.00 21.66 ? 514 GLY A N   1 
ATOM   3906 C CA  . GLY A 1 514 ? -2.865  43.146 63.907 1.00 21.88 ? 514 GLY A CA  1 
ATOM   3907 C C   . GLY A 1 514 ? -4.242  43.753 63.709 1.00 22.91 ? 514 GLY A C   1 
ATOM   3908 O O   . GLY A 1 514 ? -5.067  43.739 64.613 1.00 22.45 ? 514 GLY A O   1 
ATOM   3909 N N   . GLY A 1 515 ? -4.495  44.264 62.506 1.00 24.45 ? 515 GLY A N   1 
ATOM   3910 C CA  . GLY A 1 515 ? -5.772  44.893 62.212 1.00 26.34 ? 515 GLY A CA  1 
ATOM   3911 C C   . GLY A 1 515 ? -6.944  44.001 61.828 1.00 27.70 ? 515 GLY A C   1 
ATOM   3912 O O   . GLY A 1 515 ? -8.087  44.300 62.179 1.00 28.22 ? 515 GLY A O   1 
ATOM   3913 N N   . VAL A 1 516 ? -6.685  42.913 61.109 1.00 27.76 ? 516 VAL A N   1 
ATOM   3914 C CA  . VAL A 1 516 ? -7.763  42.018 60.690 1.00 27.63 ? 516 VAL A CA  1 
ATOM   3915 C C   . VAL A 1 516 ? -7.244  40.593 60.545 1.00 27.26 ? 516 VAL A C   1 
ATOM   3916 O O   . VAL A 1 516 ? -6.050  40.391 60.333 1.00 27.77 ? 516 VAL A O   1 
ATOM   3917 C CB  . VAL A 1 516 ? -8.354  42.474 59.339 1.00 26.76 ? 516 VAL A CB  1 
ATOM   3918 C CG1 . VAL A 1 516 ? -7.285  42.384 58.257 1.00 26.47 ? 516 VAL A CG1 1 
ATOM   3919 C CG2 . VAL A 1 516 ? -9.563  41.626 58.976 1.00 25.96 ? 516 VAL A CG2 1 
ATOM   3920 N N   . ARG A 1 517 ? -8.133  39.610 60.668 1.00 28.24 ? 517 ARG A N   1 
ATOM   3921 C CA  . ARG A 1 517 ? -7.725  38.216 60.533 1.00 29.70 ? 517 ARG A CA  1 
ATOM   3922 C C   . ARG A 1 517 ? -7.019  38.081 59.185 1.00 28.72 ? 517 ARG A C   1 
ATOM   3923 O O   . ARG A 1 517 ? -7.510  38.546 58.153 1.00 27.74 ? 517 ARG A O   1 
ATOM   3924 C CB  . ARG A 1 517 ? -8.937  37.275 60.646 1.00 32.41 ? 517 ARG A CB  1 
ATOM   3925 C CG  . ARG A 1 517 ? -10.062 37.543 59.665 1.00 39.47 ? 517 ARG A CG  1 
ATOM   3926 C CD  . ARG A 1 517 ? -11.241 36.622 59.935 1.00 42.45 ? 517 ARG A CD  1 
ATOM   3927 N NE  . ARG A 1 517 ? -12.101 36.471 58.765 1.00 45.73 ? 517 ARG A NE  1 
ATOM   3928 C CZ  . ARG A 1 517 ? -13.094 35.591 58.690 1.00 48.83 ? 517 ARG A CZ  1 
ATOM   3929 N NH1 . ARG A 1 517 ? -13.343 34.798 59.725 1.00 50.12 ? 517 ARG A NH1 1 
ATOM   3930 N NH2 . ARG A 1 517 ? -13.821 35.482 57.577 1.00 49.55 ? 517 ARG A NH2 1 
ATOM   3931 N N   . CYS A 1 518 ? -5.856  37.442 59.209 1.00 28.15 ? 518 CYS A N   1 
ATOM   3932 C CA  . CYS A 1 518 ? -5.026  37.319 58.019 1.00 26.32 ? 518 CYS A CA  1 
ATOM   3933 C C   . CYS A 1 518 ? -4.604  35.907 57.644 1.00 25.02 ? 518 CYS A C   1 
ATOM   3934 O O   . CYS A 1 518 ? -4.555  35.001 58.472 1.00 26.40 ? 518 CYS A O   1 
ATOM   3935 C CB  . CYS A 1 518 ? -3.759  38.144 58.231 1.00 25.37 ? 518 CYS A CB  1 
ATOM   3936 S SG  . CYS A 1 518 ? -2.715  37.378 59.512 1.00 25.69 ? 518 CYS A SG  1 
ATOM   3937 N N   . ALA A 1 519 ? -4.278  35.749 56.373 1.00 23.65 ? 519 ALA A N   1 
ATOM   3938 C CA  . ALA A 1 519 ? -3.797  34.489 55.838 1.00 22.48 ? 519 ALA A CA  1 
ATOM   3939 C C   . ALA A 1 519 ? -2.470  34.857 55.161 1.00 21.42 ? 519 ALA A C   1 
ATOM   3940 O O   . ALA A 1 519 ? -2.456  35.484 54.103 1.00 21.09 ? 519 ALA A O   1 
ATOM   3941 C CB  . ALA A 1 519 ? -4.786  33.933 54.825 1.00 21.74 ? 519 ALA A CB  1 
ATOM   3942 N N   . THR A 1 520 ? -1.359  34.494 55.794 1.00 20.28 ? 520 THR A N   1 
ATOM   3943 C CA  . THR A 1 520 ? -0.043  34.809 55.258 1.00 19.46 ? 520 THR A CA  1 
ATOM   3944 C C   . THR A 1 520 ? 0.477   33.765 54.288 1.00 18.70 ? 520 THR A C   1 
ATOM   3945 O O   . THR A 1 520 ? 0.522   32.575 54.600 1.00 19.28 ? 520 THR A O   1 
ATOM   3946 C CB  . THR A 1 520 ? 0.996   34.975 56.386 1.00 19.61 ? 520 THR A CB  1 
ATOM   3947 O OG1 . THR A 1 520 ? 0.680   36.139 57.153 1.00 21.11 ? 520 THR A OG1 1 
ATOM   3948 C CG2 . THR A 1 520 ? 2.400   35.115 55.814 1.00 18.43 ? 520 THR A CG2 1 
ATOM   3949 N N   . VAL A 1 521 ? 0.865   34.227 53.106 1.00 17.54 ? 521 VAL A N   1 
ATOM   3950 C CA  . VAL A 1 521 ? 1.419   33.355 52.084 1.00 16.05 ? 521 VAL A CA  1 
ATOM   3951 C C   . VAL A 1 521 ? 2.927   33.625 52.069 1.00 17.61 ? 521 VAL A C   1 
ATOM   3952 O O   . VAL A 1 521 ? 3.374   34.760 51.836 1.00 15.12 ? 521 VAL A O   1 
ATOM   3953 C CB  . VAL A 1 521 ? 0.811   33.656 50.695 1.00 14.92 ? 521 VAL A CB  1 
ATOM   3954 C CG1 . VAL A 1 521 ? 1.464   32.770 49.627 1.00 12.60 ? 521 VAL A CG1 1 
ATOM   3955 C CG2 . VAL A 1 521 ? -0.696  33.431 50.737 1.00 12.97 ? 521 VAL A CG2 1 
ATOM   3956 N N   . LEU A 1 522 ? 3.701   32.580 52.345 1.00 16.29 ? 522 LEU A N   1 
ATOM   3957 C CA  . LEU A 1 522 ? 5.148   32.692 52.380 1.00 14.73 ? 522 LEU A CA  1 
ATOM   3958 C C   . LEU A 1 522 ? 5.777   32.145 51.107 1.00 14.79 ? 522 LEU A C   1 
ATOM   3959 O O   . LEU A 1 522 ? 5.642   30.966 50.782 1.00 15.19 ? 522 LEU A O   1 
ATOM   3960 C CB  . LEU A 1 522 ? 5.697   31.951 53.600 1.00 12.68 ? 522 LEU A CB  1 
ATOM   3961 C CG  . LEU A 1 522 ? 7.209   31.977 53.823 1.00 13.96 ? 522 LEU A CG  1 
ATOM   3962 C CD1 . LEU A 1 522 ? 7.701   33.403 54.017 1.00 11.62 ? 522 LEU A CD1 1 
ATOM   3963 C CD2 . LEU A 1 522 ? 7.541   31.132 55.032 1.00 11.94 ? 522 LEU A CD2 1 
ATOM   3964 N N   . ILE A 1 523 ? 6.457   33.026 50.384 1.00 15.34 ? 523 ILE A N   1 
ATOM   3965 C CA  . ILE A 1 523 ? 7.134   32.668 49.146 1.00 14.66 ? 523 ILE A CA  1 
ATOM   3966 C C   . ILE A 1 523 ? 8.610   32.529 49.491 1.00 16.06 ? 523 ILE A C   1 
ATOM   3967 O O   . ILE A 1 523 ? 9.247   33.496 49.912 1.00 17.20 ? 523 ILE A O   1 
ATOM   3968 C CB  . ILE A 1 523 ? 6.958   33.781 48.085 1.00 13.32 ? 523 ILE A CB  1 
ATOM   3969 C CG1 . ILE A 1 523 ? 5.476   33.933 47.729 1.00 11.83 ? 523 ILE A CG1 1 
ATOM   3970 C CG2 . ILE A 1 523 ? 7.779   33.474 46.849 1.00 11.36 ? 523 ILE A CG2 1 
ATOM   3971 C CD1 . ILE A 1 523 ? 4.851   32.693 47.120 1.00 11.59 ? 523 ILE A CD1 1 
ATOM   3972 N N   . SER A 1 524 ? 9.145   31.323 49.332 1.00 16.04 ? 524 SER A N   1 
ATOM   3973 C CA  . SER A 1 524 ? 10.548  31.068 49.635 1.00 18.11 ? 524 SER A CA  1 
ATOM   3974 C C   . SER A 1 524 ? 11.003  29.804 48.925 1.00 20.03 ? 524 SER A C   1 
ATOM   3975 O O   . SER A 1 524 ? 10.182  28.987 48.515 1.00 20.62 ? 524 SER A O   1 
ATOM   3976 C CB  . SER A 1 524 ? 10.744  30.887 51.139 1.00 17.89 ? 524 SER A CB  1 
ATOM   3977 O OG  . SER A 1 524 ? 10.196  29.652 51.564 1.00 16.63 ? 524 SER A OG  1 
ATOM   3978 N N   . GLY A 1 525 ? 12.314  29.638 48.783 1.00 20.71 ? 525 GLY A N   1 
ATOM   3979 C CA  . GLY A 1 525 ? 12.822  28.446 48.126 1.00 20.99 ? 525 GLY A CA  1 
ATOM   3980 C C   . GLY A 1 525 ? 13.289  27.427 49.145 1.00 19.93 ? 525 GLY A C   1 
ATOM   3981 O O   . GLY A 1 525 ? 13.893  26.418 48.802 1.00 20.61 ? 525 GLY A O   1 
ATOM   3982 N N   . ARG A 1 526 ? 12.980  27.677 50.409 1.00 19.38 ? 526 ARG A N   1 
ATOM   3983 C CA  . ARG A 1 526 ? 13.420  26.787 51.469 1.00 20.16 ? 526 ARG A CA  1 
ATOM   3984 C C   . ARG A 1 526 ? 12.805  27.237 52.788 1.00 21.15 ? 526 ARG A C   1 
ATOM   3985 O O   . ARG A 1 526 ? 12.249  28.336 52.885 1.00 21.25 ? 526 ARG A O   1 
ATOM   3986 C CB  . ARG A 1 526 ? 14.933  26.891 51.581 1.00 19.10 ? 526 ARG A CB  1 
ATOM   3987 C CG  . ARG A 1 526 ? 15.364  28.341 51.765 1.00 18.88 ? 526 ARG A CG  1 
ATOM   3988 C CD  . ARG A 1 526 ? 16.855  28.528 51.645 1.00 21.01 ? 526 ARG A CD  1 
ATOM   3989 N NE  . ARG A 1 526 ? 17.205  29.910 51.323 1.00 18.04 ? 526 ARG A NE  1 
ATOM   3990 C CZ  . ARG A 1 526 ? 18.439  30.316 51.046 1.00 19.21 ? 526 ARG A CZ  1 
ATOM   3991 N NH1 . ARG A 1 526 ? 19.440  29.441 51.060 1.00 18.20 ? 526 ARG A NH1 1 
ATOM   3992 N NH2 . ARG A 1 526 ? 18.672  31.588 50.742 1.00 17.40 ? 526 ARG A NH2 1 
ATOM   3993 N N   . PRO A 1 527 ? 12.873  26.383 53.820 1.00 22.03 ? 527 PRO A N   1 
ATOM   3994 C CA  . PRO A 1 527 ? 12.297  26.829 55.090 1.00 22.75 ? 527 PRO A CA  1 
ATOM   3995 C C   . PRO A 1 527 ? 13.138  27.992 55.621 1.00 22.62 ? 527 PRO A C   1 
ATOM   3996 O O   . PRO A 1 527 ? 14.360  28.020 55.454 1.00 22.02 ? 527 PRO A O   1 
ATOM   3997 C CB  . PRO A 1 527 ? 12.370  25.577 55.972 1.00 21.99 ? 527 PRO A CB  1 
ATOM   3998 C CG  . PRO A 1 527 ? 13.473  24.772 55.358 1.00 23.75 ? 527 PRO A CG  1 
ATOM   3999 C CD  . PRO A 1 527 ? 13.239  24.959 53.882 1.00 22.77 ? 527 PRO A CD  1 
ATOM   4000 N N   . VAL A 1 528 ? 12.473  28.961 56.238 1.00 21.87 ? 528 VAL A N   1 
ATOM   4001 C CA  . VAL A 1 528 ? 13.148  30.129 56.782 1.00 20.32 ? 528 VAL A CA  1 
ATOM   4002 C C   . VAL A 1 528 ? 12.624  30.399 58.188 1.00 19.92 ? 528 VAL A C   1 
ATOM   4003 O O   . VAL A 1 528 ? 11.614  29.818 58.596 1.00 18.71 ? 528 VAL A O   1 
ATOM   4004 C CB  . VAL A 1 528 ? 12.894  31.356 55.882 1.00 20.36 ? 528 VAL A CB  1 
ATOM   4005 C CG1 . VAL A 1 528 ? 13.620  31.185 54.549 1.00 19.10 ? 528 VAL A CG1 1 
ATOM   4006 C CG2 . VAL A 1 528 ? 11.398  31.505 55.628 1.00 17.43 ? 528 VAL A CG2 1 
ATOM   4007 N N   . VAL A 1 529 ? 13.312  31.259 58.933 1.00 20.08 ? 529 VAL A N   1 
ATOM   4008 C CA  . VAL A 1 529 ? 12.875  31.585 60.287 1.00 21.29 ? 529 VAL A CA  1 
ATOM   4009 C C   . VAL A 1 529 ? 11.419  31.994 60.144 1.00 22.25 ? 529 VAL A C   1 
ATOM   4010 O O   . VAL A 1 529 ? 11.114  32.950 59.431 1.00 21.89 ? 529 VAL A O   1 
ATOM   4011 C CB  . VAL A 1 529 ? 13.690  32.753 60.887 1.00 22.07 ? 529 VAL A CB  1 
ATOM   4012 C CG1 . VAL A 1 529 ? 13.119  33.131 62.249 1.00 18.55 ? 529 VAL A CG1 1 
ATOM   4013 C CG2 . VAL A 1 529 ? 15.166  32.350 61.020 1.00 19.85 ? 529 VAL A CG2 1 
ATOM   4014 N N   . VAL A 1 530 ? 10.525  31.281 60.825 1.00 22.16 ? 530 VAL A N   1 
ATOM   4015 C CA  . VAL A 1 530 ? 9.102   31.553 60.678 1.00 23.72 ? 530 VAL A CA  1 
ATOM   4016 C C   . VAL A 1 530 ? 8.273   31.663 61.960 1.00 24.37 ? 530 VAL A C   1 
ATOM   4017 O O   . VAL A 1 530 ? 7.047   31.724 61.897 1.00 25.75 ? 530 VAL A O   1 
ATOM   4018 C CB  . VAL A 1 530 ? 8.466   30.460 59.768 1.00 23.17 ? 530 VAL A CB  1 
ATOM   4019 C CG1 . VAL A 1 530 ? 8.363   29.154 60.532 1.00 20.67 ? 530 VAL A CG1 1 
ATOM   4020 C CG2 . VAL A 1 530 ? 7.104   30.903 59.259 1.00 22.29 ? 530 VAL A CG2 1 
ATOM   4021 N N   . GLN A 1 531 ? 8.911   31.679 63.123 1.00 24.37 ? 531 GLN A N   1 
ATOM   4022 C CA  . GLN A 1 531 ? 8.135   31.785 64.354 1.00 23.33 ? 531 GLN A CA  1 
ATOM   4023 C C   . GLN A 1 531 ? 7.445   33.143 64.445 1.00 23.81 ? 531 GLN A C   1 
ATOM   4024 O O   . GLN A 1 531 ? 6.257   33.219 64.773 1.00 24.14 ? 531 GLN A O   1 
ATOM   4025 C CB  . GLN A 1 531 ? 9.014   31.551 65.586 1.00 22.12 ? 531 GLN A CB  1 
ATOM   4026 C CG  . GLN A 1 531 ? 9.471   30.111 65.743 1.00 22.04 ? 531 GLN A CG  1 
ATOM   4027 C CD  . GLN A 1 531 ? 10.815  29.849 65.100 1.00 22.51 ? 531 GLN A CD  1 
ATOM   4028 O OE1 . GLN A 1 531 ? 11.146  30.422 64.061 1.00 22.36 ? 531 GLN A OE1 1 
ATOM   4029 N NE2 . GLN A 1 531 ? 11.593  28.965 65.710 1.00 23.47 ? 531 GLN A NE2 1 
ATOM   4030 N N   . PRO A 1 532 ? 8.180   34.235 64.160 1.00 22.99 ? 532 PRO A N   1 
ATOM   4031 C CA  . PRO A 1 532 ? 7.613   35.590 64.210 1.00 23.49 ? 532 PRO A CA  1 
ATOM   4032 C C   . PRO A 1 532 ? 6.394   35.722 63.302 1.00 25.10 ? 532 PRO A C   1 
ATOM   4033 O O   . PRO A 1 532 ? 5.341   36.218 63.728 1.00 27.13 ? 532 PRO A O   1 
ATOM   4034 C CB  . PRO A 1 532 ? 8.771   36.460 63.745 1.00 23.08 ? 532 PRO A CB  1 
ATOM   4035 C CG  . PRO A 1 532 ? 9.953   35.721 64.291 1.00 22.17 ? 532 PRO A CG  1 
ATOM   4036 C CD  . PRO A 1 532 ? 9.636   34.288 63.947 1.00 20.72 ? 532 PRO A CD  1 
ATOM   4037 N N   . LEU A 1 533 ? 6.546   35.281 62.050 1.00 24.90 ? 533 LEU A N   1 
ATOM   4038 C CA  . LEU A 1 533 ? 5.460   35.324 61.064 1.00 24.77 ? 533 LEU A CA  1 
ATOM   4039 C C   . LEU A 1 533 ? 4.295   34.473 61.547 1.00 24.26 ? 533 LEU A C   1 
ATOM   4040 O O   . LEU A 1 533 ? 3.129   34.856 61.421 1.00 24.78 ? 533 LEU A O   1 
ATOM   4041 C CB  . LEU A 1 533 ? 5.934   34.786 59.707 1.00 24.29 ? 533 LEU A CB  1 
ATOM   4042 C CG  . LEU A 1 533 ? 6.773   35.717 58.830 1.00 22.47 ? 533 LEU A CG  1 
ATOM   4043 C CD1 . LEU A 1 533 ? 7.382   34.939 57.692 1.00 22.76 ? 533 LEU A CD1 1 
ATOM   4044 C CD2 . LEU A 1 533 ? 5.897   36.832 58.300 1.00 22.24 ? 533 LEU A CD2 1 
ATOM   4045 N N   . LEU A 1 534 ? 4.630   33.312 62.096 1.00 22.83 ? 534 LEU A N   1 
ATOM   4046 C CA  . LEU A 1 534 ? 3.643   32.381 62.618 1.00 23.51 ? 534 LEU A CA  1 
ATOM   4047 C C   . LEU A 1 534 ? 2.851   33.043 63.753 1.00 24.27 ? 534 LEU A C   1 
ATOM   4048 O O   . LEU A 1 534 ? 1.613   33.052 63.754 1.00 23.55 ? 534 LEU A O   1 
ATOM   4049 C CB  . LEU A 1 534 ? 4.366   31.130 63.128 1.00 22.34 ? 534 LEU A CB  1 
ATOM   4050 C CG  . LEU A 1 534 ? 3.998   29.755 62.567 1.00 23.91 ? 534 LEU A CG  1 
ATOM   4051 C CD1 . LEU A 1 534 ? 3.769   29.806 61.073 1.00 24.02 ? 534 LEU A CD1 1 
ATOM   4052 C CD2 . LEU A 1 534 ? 5.118   28.792 62.897 1.00 24.05 ? 534 LEU A CD2 1 
ATOM   4053 N N   . ALA A 1 535 ? 3.580   33.609 64.711 1.00 23.76 ? 535 ALA A N   1 
ATOM   4054 C CA  . ALA A 1 535 ? 2.979   34.269 65.863 1.00 23.29 ? 535 ALA A CA  1 
ATOM   4055 C C   . ALA A 1 535 ? 1.904   35.295 65.493 1.00 22.85 ? 535 ALA A C   1 
ATOM   4056 O O   . ALA A 1 535 ? 0.862   35.376 66.142 1.00 21.65 ? 535 ALA A O   1 
ATOM   4057 C CB  . ALA A 1 535 ? 4.070   34.941 66.694 1.00 19.99 ? 535 ALA A CB  1 
ATOM   4058 N N   . ALA A 1 536 ? 2.158   36.073 64.447 1.00 23.16 ? 536 ALA A N   1 
ATOM   4059 C CA  . ALA A 1 536 ? 1.222   37.112 64.023 1.00 23.53 ? 536 ALA A CA  1 
ATOM   4060 C C   . ALA A 1 536 ? 0.042   36.651 63.164 1.00 23.80 ? 536 ALA A C   1 
ATOM   4061 O O   . ALA A 1 536 ? -1.023  37.274 63.177 1.00 24.54 ? 536 ALA A O   1 
ATOM   4062 C CB  . ALA A 1 536 ? 1.986   38.199 63.285 1.00 21.52 ? 536 ALA A CB  1 
ATOM   4063 N N   . SER A 1 537 ? 0.226   35.557 62.436 1.00 23.70 ? 537 SER A N   1 
ATOM   4064 C CA  . SER A 1 537 ? -0.798  35.058 61.529 1.00 22.89 ? 537 SER A CA  1 
ATOM   4065 C C   . SER A 1 537 ? -1.872  34.128 62.086 1.00 22.92 ? 537 SER A C   1 
ATOM   4066 O O   . SER A 1 537 ? -1.646  33.387 63.041 1.00 23.84 ? 537 SER A O   1 
ATOM   4067 C CB  . SER A 1 537 ? -0.109  34.366 60.352 1.00 24.05 ? 537 SER A CB  1 
ATOM   4068 O OG  . SER A 1 537 ? 0.891   35.201 59.791 1.00 23.80 ? 537 SER A OG  1 
ATOM   4069 N N   . ASP A 1 538 ? -3.052  34.182 61.474 1.00 21.82 ? 538 ASP A N   1 
ATOM   4070 C CA  . ASP A 1 538 ? -4.150  33.304 61.856 1.00 21.26 ? 538 ASP A CA  1 
ATOM   4071 C C   . ASP A 1 538 ? -3.902  32.000 61.103 1.00 20.45 ? 538 ASP A C   1 
ATOM   4072 O O   . ASP A 1 538 ? -4.013  30.914 61.664 1.00 22.50 ? 538 ASP A O   1 
ATOM   4073 C CB  . ASP A 1 538 ? -5.496  33.892 61.431 1.00 21.70 ? 538 ASP A CB  1 
ATOM   4074 C CG  . ASP A 1 538 ? -5.873  35.114 62.230 1.00 22.45 ? 538 ASP A CG  1 
ATOM   4075 O OD1 . ASP A 1 538 ? -6.149  34.978 63.440 1.00 23.33 ? 538 ASP A OD1 1 
ATOM   4076 O OD2 . ASP A 1 538 ? -5.886  36.218 61.651 1.00 25.33 ? 538 ASP A OD2 1 
ATOM   4077 N N   . ALA A 1 539 ? -3.566  32.129 59.823 1.00 18.50 ? 539 ALA A N   1 
ATOM   4078 C CA  . ALA A 1 539 ? -3.260  30.993 58.961 1.00 16.46 ? 539 ALA A CA  1 
ATOM   4079 C C   . ALA A 1 539 ? -2.013  31.374 58.174 1.00 16.27 ? 539 ALA A C   1 
ATOM   4080 O O   . ALA A 1 539 ? -1.831  32.539 57.806 1.00 15.47 ? 539 ALA A O   1 
ATOM   4081 C CB  . ALA A 1 539 ? -4.417  30.715 58.007 1.00 14.32 ? 539 ALA A CB  1 
ATOM   4082 N N   . LEU A 1 540 ? -1.147  30.399 57.928 1.00 16.32 ? 540 LEU A N   1 
ATOM   4083 C CA  . LEU A 1 540 ? 0.079   30.655 57.184 1.00 16.71 ? 540 LEU A CA  1 
ATOM   4084 C C   . LEU A 1 540 ? 0.346   29.491 56.251 1.00 17.10 ? 540 LEU A C   1 
ATOM   4085 O O   . LEU A 1 540 ? 0.375   28.332 56.677 1.00 17.57 ? 540 LEU A O   1 
ATOM   4086 C CB  . LEU A 1 540 ? 1.260   30.851 58.146 1.00 15.51 ? 540 LEU A CB  1 
ATOM   4087 C CG  . LEU A 1 540 ? 2.636   31.170 57.545 1.00 15.81 ? 540 LEU A CG  1 
ATOM   4088 C CD1 . LEU A 1 540 ? 3.432   32.057 58.504 1.00 16.43 ? 540 LEU A CD1 1 
ATOM   4089 C CD2 . LEU A 1 540 ? 3.388   29.877 57.242 1.00 13.36 ? 540 LEU A CD2 1 
ATOM   4090 N N   . VAL A 1 541 ? 0.532   29.813 54.973 1.00 17.21 ? 541 VAL A N   1 
ATOM   4091 C CA  . VAL A 1 541 ? 0.789   28.811 53.947 1.00 17.70 ? 541 VAL A CA  1 
ATOM   4092 C C   . VAL A 1 541 ? 2.195   28.931 53.367 1.00 18.94 ? 541 VAL A C   1 
ATOM   4093 O O   . VAL A 1 541 ? 2.653   30.027 53.036 1.00 20.14 ? 541 VAL A O   1 
ATOM   4094 C CB  . VAL A 1 541 ? -0.214  28.941 52.775 1.00 16.99 ? 541 VAL A CB  1 
ATOM   4095 C CG1 . VAL A 1 541 ? 0.155   27.960 51.664 1.00 17.08 ? 541 VAL A CG1 1 
ATOM   4096 C CG2 . VAL A 1 541 ? -1.634  28.690 53.262 1.00 15.27 ? 541 VAL A CG2 1 
ATOM   4097 N N   . ALA A 1 542 ? 2.876   27.799 53.251 1.00 17.97 ? 542 ALA A N   1 
ATOM   4098 C CA  . ALA A 1 542 ? 4.210   27.776 52.668 1.00 18.09 ? 542 ALA A CA  1 
ATOM   4099 C C   . ALA A 1 542 ? 3.996   27.473 51.187 1.00 17.98 ? 542 ALA A C   1 
ATOM   4100 O O   . ALA A 1 542 ? 3.670   26.342 50.822 1.00 17.91 ? 542 ALA A O   1 
ATOM   4101 C CB  . ALA A 1 542 ? 5.045   26.687 53.319 1.00 18.98 ? 542 ALA A CB  1 
ATOM   4102 N N   . ALA A 1 543 ? 4.167   28.482 50.341 1.00 16.62 ? 543 ALA A N   1 
ATOM   4103 C CA  . ALA A 1 543 ? 3.952   28.318 48.907 1.00 17.19 ? 543 ALA A CA  1 
ATOM   4104 C C   . ALA A 1 543 ? 5.216   28.068 48.091 1.00 18.47 ? 543 ALA A C   1 
ATOM   4105 O O   . ALA A 1 543 ? 5.143   27.862 46.878 1.00 17.32 ? 543 ALA A O   1 
ATOM   4106 C CB  . ALA A 1 543 ? 3.227   29.536 48.357 1.00 16.04 ? 543 ALA A CB  1 
ATOM   4107 N N   . TRP A 1 544 ? 6.371   28.082 48.751 1.00 18.91 ? 544 TRP A N   1 
ATOM   4108 C CA  . TRP A 1 544 ? 7.638   27.869 48.066 1.00 18.24 ? 544 TRP A CA  1 
ATOM   4109 C C   . TRP A 1 544 ? 7.744   28.884 46.931 1.00 18.75 ? 544 TRP A C   1 
ATOM   4110 O O   . TRP A 1 544 ? 7.554   30.080 47.143 1.00 19.06 ? 544 TRP A O   1 
ATOM   4111 C CB  . TRP A 1 544 ? 7.710   26.442 47.516 1.00 17.66 ? 544 TRP A CB  1 
ATOM   4112 C CG  . TRP A 1 544 ? 7.286   25.402 48.517 1.00 20.36 ? 544 TRP A CG  1 
ATOM   4113 C CD1 . TRP A 1 544 ? 6.169   24.614 48.456 1.00 21.07 ? 544 TRP A CD1 1 
ATOM   4114 C CD2 . TRP A 1 544 ? 7.938   25.076 49.755 1.00 20.77 ? 544 TRP A CD2 1 
ATOM   4115 N NE1 . TRP A 1 544 ? 6.084   23.823 49.579 1.00 20.47 ? 544 TRP A NE1 1 
ATOM   4116 C CE2 . TRP A 1 544 ? 7.154   24.086 50.393 1.00 20.18 ? 544 TRP A CE2 1 
ATOM   4117 C CE3 . TRP A 1 544 ? 9.108   25.525 50.389 1.00 21.42 ? 544 TRP A CE3 1 
ATOM   4118 C CZ2 . TRP A 1 544 ? 7.499   23.538 51.636 1.00 19.13 ? 544 TRP A CZ2 1 
ATOM   4119 C CZ3 . TRP A 1 544 ? 9.453   24.976 51.628 1.00 21.30 ? 544 TRP A CZ3 1 
ATOM   4120 C CH2 . TRP A 1 544 ? 8.646   23.992 52.235 1.00 19.79 ? 544 TRP A CH2 1 
ATOM   4121 N N   . LEU A 1 545 ? 8.052   28.403 45.732 1.00 18.09 ? 545 LEU A N   1 
ATOM   4122 C CA  . LEU A 1 545 ? 8.167   29.257 44.553 1.00 17.61 ? 545 LEU A CA  1 
ATOM   4123 C C   . LEU A 1 545 ? 7.190   28.678 43.523 1.00 17.31 ? 545 LEU A C   1 
ATOM   4124 O O   . LEU A 1 545 ? 7.573   27.924 42.626 1.00 17.94 ? 545 LEU A O   1 
ATOM   4125 C CB  . LEU A 1 545 ? 9.610   29.238 44.031 1.00 17.80 ? 545 LEU A CB  1 
ATOM   4126 C CG  . LEU A 1 545 ? 10.678  29.653 45.058 1.00 18.65 ? 545 LEU A CG  1 
ATOM   4127 C CD1 . LEU A 1 545 ? 12.063  29.322 44.523 1.00 16.37 ? 545 LEU A CD1 1 
ATOM   4128 C CD2 . LEU A 1 545 ? 10.560  31.136 45.376 1.00 16.28 ? 545 LEU A CD2 1 
ATOM   4129 N N   . PRO A 1 546 ? 5.906   29.044 43.651 1.00 16.46 ? 546 PRO A N   1 
ATOM   4130 C CA  . PRO A 1 546 ? 4.734   28.661 42.853 1.00 14.80 ? 546 PRO A CA  1 
ATOM   4131 C C   . PRO A 1 546 ? 4.895   28.586 41.342 1.00 14.90 ? 546 PRO A C   1 
ATOM   4132 O O   . PRO A 1 546 ? 4.434   27.645 40.707 1.00 14.79 ? 546 PRO A O   1 
ATOM   4133 C CB  . PRO A 1 546 ? 3.694   29.706 43.248 1.00 15.64 ? 546 PRO A CB  1 
ATOM   4134 C CG  . PRO A 1 546 ? 4.090   30.085 44.617 1.00 16.73 ? 546 PRO A CG  1 
ATOM   4135 C CD  . PRO A 1 546 ? 5.577   30.199 44.504 1.00 15.63 ? 546 PRO A CD  1 
ATOM   4136 N N   . GLY A 1 547 ? 5.536   29.591 40.765 1.00 14.27 ? 547 GLY A N   1 
ATOM   4137 C CA  . GLY A 1 547 ? 5.695   29.611 39.329 1.00 14.56 ? 547 GLY A CA  1 
ATOM   4138 C C   . GLY A 1 547 ? 4.832   30.730 38.785 1.00 15.67 ? 547 GLY A C   1 
ATOM   4139 O O   . GLY A 1 547 ? 4.434   31.623 39.529 1.00 17.32 ? 547 GLY A O   1 
ATOM   4140 N N   . SER A 1 548 ? 4.512   30.681 37.501 1.00 14.97 ? 548 SER A N   1 
ATOM   4141 C CA  . SER A 1 548 ? 3.716   31.733 36.891 1.00 15.96 ? 548 SER A CA  1 
ATOM   4142 C C   . SER A 1 548 ? 2.207   31.673 37.144 1.00 16.40 ? 548 SER A C   1 
ATOM   4143 O O   . SER A 1 548 ? 1.514   32.687 37.022 1.00 15.59 ? 548 SER A O   1 
ATOM   4144 C CB  . SER A 1 548 ? 3.982   31.749 35.385 1.00 15.56 ? 548 SER A CB  1 
ATOM   4145 O OG  . SER A 1 548 ? 3.798   30.456 34.835 1.00 14.14 ? 548 SER A OG  1 
ATOM   4146 N N   . GLU A 1 549 ? 1.698   30.498 37.505 1.00 15.70 ? 549 GLU A N   1 
ATOM   4147 C CA  . GLU A 1 549 ? 0.261   30.338 37.729 1.00 16.71 ? 549 GLU A CA  1 
ATOM   4148 C C   . GLU A 1 549 ? -0.197  30.525 39.182 1.00 16.95 ? 549 GLU A C   1 
ATOM   4149 O O   . GLU A 1 549 ? -0.490  29.564 39.888 1.00 16.07 ? 549 GLU A O   1 
ATOM   4150 C CB  . GLU A 1 549 ? -0.174  28.971 37.197 1.00 16.26 ? 549 GLU A CB  1 
ATOM   4151 C CG  . GLU A 1 549 ? 0.308   28.707 35.776 1.00 17.95 ? 549 GLU A CG  1 
ATOM   4152 C CD  . GLU A 1 549 ? 0.012   29.874 34.834 1.00 20.70 ? 549 GLU A CD  1 
ATOM   4153 O OE1 . GLU A 1 549 ? -1.171  30.256 34.721 1.00 22.40 ? 549 GLU A OE1 1 
ATOM   4154 O OE2 . GLU A 1 549 ? 0.954   30.413 34.206 1.00 18.57 ? 549 GLU A OE2 1 
ATOM   4155 N N   . GLY A 1 550 ? -0.286  31.779 39.607 1.00 17.45 ? 550 GLY A N   1 
ATOM   4156 C CA  . GLY A 1 550 ? -0.687  32.079 40.969 1.00 18.43 ? 550 GLY A CA  1 
ATOM   4157 C C   . GLY A 1 550 ? -2.050  31.578 41.402 1.00 19.49 ? 550 GLY A C   1 
ATOM   4158 O O   . GLY A 1 550 ? -2.298  31.395 42.599 1.00 19.88 ? 550 GLY A O   1 
ATOM   4159 N N   . GLN A 1 551 ? -2.947  31.362 40.450 1.00 19.58 ? 551 GLN A N   1 
ATOM   4160 C CA  . GLN A 1 551 ? -4.272  30.876 40.799 1.00 19.81 ? 551 GLN A CA  1 
ATOM   4161 C C   . GLN A 1 551 ? -4.155  29.544 41.526 1.00 18.96 ? 551 GLN A C   1 
ATOM   4162 O O   . GLN A 1 551 ? -5.096  29.094 42.178 1.00 18.73 ? 551 GLN A O   1 
ATOM   4163 C CB  . GLN A 1 551 ? -5.132  30.761 39.543 1.00 21.46 ? 551 GLN A CB  1 
ATOM   4164 C CG  . GLN A 1 551 ? -5.282  32.114 38.859 1.00 26.20 ? 551 GLN A CG  1 
ATOM   4165 C CD  . GLN A 1 551 ? -6.000  32.042 37.534 1.00 27.45 ? 551 GLN A CD  1 
ATOM   4166 O OE1 . GLN A 1 551 ? -7.195  31.752 37.478 1.00 30.12 ? 551 GLN A OE1 1 
ATOM   4167 N NE2 . GLN A 1 551 ? -5.271  32.307 36.452 1.00 28.72 ? 551 GLN A NE2 1 
ATOM   4168 N N   . GLY A 1 552 ? -2.988  28.921 41.425 1.00 17.50 ? 552 GLY A N   1 
ATOM   4169 C CA  . GLY A 1 552 ? -2.783  27.670 42.124 1.00 18.02 ? 552 GLY A CA  1 
ATOM   4170 C C   . GLY A 1 552 ? -2.874  27.966 43.609 1.00 18.58 ? 552 GLY A C   1 
ATOM   4171 O O   . GLY A 1 552 ? -3.344  27.141 44.393 1.00 18.67 ? 552 GLY A O   1 
ATOM   4172 N N   . VAL A 1 553 ? -2.430  29.162 43.995 1.00 18.49 ? 553 VAL A N   1 
ATOM   4173 C CA  . VAL A 1 553 ? -2.463  29.592 45.392 1.00 17.56 ? 553 VAL A CA  1 
ATOM   4174 C C   . VAL A 1 553 ? -3.892  29.857 45.861 1.00 19.47 ? 553 VAL A C   1 
ATOM   4175 O O   . VAL A 1 553 ? -4.309  29.382 46.917 1.00 20.02 ? 553 VAL A O   1 
ATOM   4176 C CB  . VAL A 1 553 ? -1.648  30.879 45.605 1.00 15.73 ? 553 VAL A CB  1 
ATOM   4177 C CG1 . VAL A 1 553 ? -1.783  31.344 47.041 1.00 14.30 ? 553 VAL A CG1 1 
ATOM   4178 C CG2 . VAL A 1 553 ? -0.193  30.633 45.269 1.00 15.67 ? 553 VAL A CG2 1 
ATOM   4179 N N   . THR A 1 554 ? -4.647  30.614 45.075 1.00 20.13 ? 554 THR A N   1 
ATOM   4180 C CA  . THR A 1 554 ? -6.017  30.926 45.445 1.00 19.03 ? 554 THR A CA  1 
ATOM   4181 C C   . THR A 1 554 ? -6.931  29.714 45.368 1.00 19.57 ? 554 THR A C   1 
ATOM   4182 O O   . THR A 1 554 ? -7.937  29.658 46.073 1.00 19.99 ? 554 THR A O   1 
ATOM   4183 C CB  . THR A 1 554 ? -6.578  32.057 44.576 1.00 19.04 ? 554 THR A CB  1 
ATOM   4184 O OG1 . THR A 1 554 ? -6.273  31.801 43.200 1.00 20.17 ? 554 THR A OG1 1 
ATOM   4185 C CG2 . THR A 1 554 ? -5.963  33.393 44.993 1.00 18.93 ? 554 THR A CG2 1 
ATOM   4186 N N   . ASP A 1 555 ? -6.589  28.740 44.525 1.00 19.48 ? 555 ASP A N   1 
ATOM   4187 C CA  . ASP A 1 555 ? -7.410  27.537 44.412 1.00 19.83 ? 555 ASP A CA  1 
ATOM   4188 C C   . ASP A 1 555 ? -7.553  26.882 45.788 1.00 19.49 ? 555 ASP A C   1 
ATOM   4189 O O   . ASP A 1 555 ? -8.583  26.284 46.105 1.00 19.15 ? 555 ASP A O   1 
ATOM   4190 C CB  . ASP A 1 555 ? -6.792  26.521 43.438 1.00 21.85 ? 555 ASP A CB  1 
ATOM   4191 C CG  . ASP A 1 555 ? -6.970  26.913 41.970 1.00 24.60 ? 555 ASP A CG  1 
ATOM   4192 O OD1 . ASP A 1 555 ? -7.914  27.669 41.642 1.00 24.11 ? 555 ASP A OD1 1 
ATOM   4193 O OD2 . ASP A 1 555 ? -6.168  26.440 41.136 1.00 26.37 ? 555 ASP A OD2 1 
ATOM   4194 N N   . ALA A 1 556 ? -6.511  27.000 46.604 1.00 18.51 ? 556 ALA A N   1 
ATOM   4195 C CA  . ALA A 1 556 ? -6.533  26.422 47.937 1.00 17.58 ? 556 ALA A CA  1 
ATOM   4196 C C   . ALA A 1 556 ? -7.053  27.421 48.965 1.00 17.35 ? 556 ALA A C   1 
ATOM   4197 O O   . ALA A 1 556 ? -7.851  27.063 49.831 1.00 15.94 ? 556 ALA A O   1 
ATOM   4198 C CB  . ALA A 1 556 ? -5.143  25.945 48.327 1.00 17.67 ? 556 ALA A CB  1 
ATOM   4199 N N   . LEU A 1 557 ? -6.611  28.672 48.865 1.00 16.85 ? 557 LEU A N   1 
ATOM   4200 C CA  . LEU A 1 557 ? -7.048  29.684 49.813 1.00 16.89 ? 557 LEU A CA  1 
ATOM   4201 C C   . LEU A 1 557 ? -8.564  29.812 49.876 1.00 18.41 ? 557 LEU A C   1 
ATOM   4202 O O   . LEU A 1 557 ? -9.126  29.976 50.954 1.00 18.51 ? 557 LEU A O   1 
ATOM   4203 C CB  . LEU A 1 557 ? -6.439  31.047 49.481 1.00 14.98 ? 557 LEU A CB  1 
ATOM   4204 C CG  . LEU A 1 557 ? -4.962  31.284 49.810 1.00 14.45 ? 557 LEU A CG  1 
ATOM   4205 C CD1 . LEU A 1 557 ? -4.604  32.734 49.501 1.00 12.61 ? 557 LEU A CD1 1 
ATOM   4206 C CD2 . LEU A 1 557 ? -4.697  30.979 51.274 1.00 13.05 ? 557 LEU A CD2 1 
ATOM   4207 N N   . PHE A 1 558 ? -9.230  29.718 48.729 1.00 19.31 ? 558 PHE A N   1 
ATOM   4208 C CA  . PHE A 1 558 ? -10.682 29.859 48.700 1.00 19.61 ? 558 PHE A CA  1 
ATOM   4209 C C   . PHE A 1 558 ? -11.485 28.560 48.741 1.00 21.58 ? 558 PHE A C   1 
ATOM   4210 O O   . PHE A 1 558 ? -12.707 28.565 48.571 1.00 23.10 ? 558 PHE A O   1 
ATOM   4211 C CB  . PHE A 1 558 ? -11.088 30.707 47.492 1.00 16.76 ? 558 PHE A CB  1 
ATOM   4212 C CG  . PHE A 1 558 ? -10.670 32.140 47.611 1.00 15.10 ? 558 PHE A CG  1 
ATOM   4213 C CD1 . PHE A 1 558 ? -11.329 32.996 48.485 1.00 14.06 ? 558 PHE A CD1 1 
ATOM   4214 C CD2 . PHE A 1 558 ? -9.581  32.622 46.898 1.00 12.95 ? 558 PHE A CD2 1 
ATOM   4215 C CE1 . PHE A 1 558 ? -10.908 34.305 48.650 1.00 11.50 ? 558 PHE A CE1 1 
ATOM   4216 C CE2 . PHE A 1 558 ? -9.153  33.930 47.057 1.00 12.12 ? 558 PHE A CE2 1 
ATOM   4217 C CZ  . PHE A 1 558 ? -9.817  34.772 47.936 1.00 11.72 ? 558 PHE A CZ  1 
ATOM   4218 N N   . GLY A 1 559 ? -10.801 27.446 48.962 1.00 21.60 ? 559 GLY A N   1 
ATOM   4219 C CA  . GLY A 1 559 ? -11.501 26.182 49.063 1.00 22.42 ? 559 GLY A CA  1 
ATOM   4220 C C   . GLY A 1 559 ? -11.884 25.400 47.819 1.00 23.44 ? 559 GLY A C   1 
ATOM   4221 O O   . GLY A 1 559 ? -12.569 24.385 47.946 1.00 23.23 ? 559 GLY A O   1 
ATOM   4222 N N   . ASP A 1 560 ? -11.486 25.831 46.625 1.00 24.68 ? 560 ASP A N   1 
ATOM   4223 C CA  . ASP A 1 560 ? -11.838 25.043 45.447 1.00 25.19 ? 560 ASP A CA  1 
ATOM   4224 C C   . ASP A 1 560 ? -11.188 23.667 45.565 1.00 24.84 ? 560 ASP A C   1 
ATOM   4225 O O   . ASP A 1 560 ? -11.655 22.689 44.985 1.00 25.55 ? 560 ASP A O   1 
ATOM   4226 C CB  . ASP A 1 560 ? -11.389 25.733 44.167 1.00 27.87 ? 560 ASP A CB  1 
ATOM   4227 C CG  . ASP A 1 560 ? -12.159 27.002 43.905 1.00 31.25 ? 560 ASP A CG  1 
ATOM   4228 O OD1 . ASP A 1 560 ? -13.375 27.022 44.206 1.00 32.77 ? 560 ASP A OD1 1 
ATOM   4229 O OD2 . ASP A 1 560 ? -11.558 27.972 43.396 1.00 34.19 ? 560 ASP A OD2 1 
ATOM   4230 N N   . PHE A 1 561 ? -10.098 23.604 46.319 1.00 22.58 ? 561 PHE A N   1 
ATOM   4231 C CA  . PHE A 1 561 ? -9.410  22.351 46.569 1.00 22.09 ? 561 PHE A CA  1 
ATOM   4232 C C   . PHE A 1 561 ? -8.864  22.469 47.975 1.00 23.19 ? 561 PHE A C   1 
ATOM   4233 O O   . PHE A 1 561 ? -8.592  23.579 48.441 1.00 24.27 ? 561 PHE A O   1 
ATOM   4234 C CB  . PHE A 1 561 ? -8.263  22.136 45.586 1.00 21.82 ? 561 PHE A CB  1 
ATOM   4235 C CG  . PHE A 1 561 ? -8.699  22.071 44.156 1.00 22.85 ? 561 PHE A CG  1 
ATOM   4236 C CD1 . PHE A 1 561 ? -8.826  23.239 43.397 1.00 21.55 ? 561 PHE A CD1 1 
ATOM   4237 C CD2 . PHE A 1 561 ? -8.998  20.846 43.564 1.00 21.09 ? 561 PHE A CD2 1 
ATOM   4238 C CE1 . PHE A 1 561 ? -9.242  23.188 42.074 1.00 18.57 ? 561 PHE A CE1 1 
ATOM   4239 C CE2 . PHE A 1 561 ? -9.416  20.784 42.238 1.00 20.27 ? 561 PHE A CE2 1 
ATOM   4240 C CZ  . PHE A 1 561 ? -9.539  21.959 41.493 1.00 19.87 ? 561 PHE A CZ  1 
ATOM   4241 N N   . GLY A 1 562 ? -8.714  21.338 48.659 1.00 21.97 ? 562 GLY A N   1 
ATOM   4242 C CA  . GLY A 1 562 ? -8.192  21.373 50.013 1.00 21.19 ? 562 GLY A CA  1 
ATOM   4243 C C   . GLY A 1 562 ? -6.686  21.228 49.992 1.00 21.82 ? 562 GLY A C   1 
ATOM   4244 O O   . GLY A 1 562 ? -6.145  20.652 49.048 1.00 22.55 ? 562 GLY A O   1 
ATOM   4245 N N   . PHE A 1 563 ? -6.003  21.756 51.006 1.00 21.67 ? 563 PHE A N   1 
ATOM   4246 C CA  . PHE A 1 563 ? -4.552  21.642 51.068 1.00 22.03 ? 563 PHE A CA  1 
ATOM   4247 C C   . PHE A 1 563 ? -4.164  20.188 51.264 1.00 22.53 ? 563 PHE A C   1 
ATOM   4248 O O   . PHE A 1 563 ? -4.762  19.485 52.077 1.00 23.45 ? 563 PHE A O   1 
ATOM   4249 C CB  . PHE A 1 563 ? -3.984  22.456 52.227 1.00 22.06 ? 563 PHE A CB  1 
ATOM   4250 C CG  . PHE A 1 563 ? -4.105  23.931 52.045 1.00 22.00 ? 563 PHE A CG  1 
ATOM   4251 C CD1 . PHE A 1 563 ? -5.309  24.578 52.289 1.00 21.82 ? 563 PHE A CD1 1 
ATOM   4252 C CD2 . PHE A 1 563 ? -3.016  24.676 51.610 1.00 21.54 ? 563 PHE A CD2 1 
ATOM   4253 C CE1 . PHE A 1 563 ? -5.425  25.951 52.103 1.00 22.27 ? 563 PHE A CE1 1 
ATOM   4254 C CE2 . PHE A 1 563 ? -3.120  26.045 51.419 1.00 21.32 ? 563 PHE A CE2 1 
ATOM   4255 C CZ  . PHE A 1 563 ? -4.329  26.686 51.667 1.00 21.89 ? 563 PHE A CZ  1 
ATOM   4256 N N   . THR A 1 564 ? -3.156  19.739 50.528 1.00 22.88 ? 564 THR A N   1 
ATOM   4257 C CA  . THR A 1 564 ? -2.705  18.359 50.638 1.00 23.25 ? 564 THR A CA  1 
ATOM   4258 C C   . THR A 1 564 ? -1.195  18.250 50.770 1.00 24.09 ? 564 THR A C   1 
ATOM   4259 O O   . THR A 1 564 ? -0.683  17.235 51.239 1.00 25.67 ? 564 THR A O   1 
ATOM   4260 C CB  . THR A 1 564 ? -3.146  17.544 49.423 1.00 21.81 ? 564 THR A CB  1 
ATOM   4261 O OG1 . THR A 1 564 ? -2.709  18.200 48.227 1.00 20.86 ? 564 THR A OG1 1 
ATOM   4262 C CG2 . THR A 1 564 ? -4.655  17.418 49.403 1.00 21.16 ? 564 THR A CG2 1 
ATOM   4263 N N   . GLY A 1 565 ? -0.489  19.302 50.371 1.00 23.97 ? 565 GLY A N   1 
ATOM   4264 C CA  . GLY A 1 565 ? 0.961   19.292 50.443 1.00 25.32 ? 565 GLY A CA  1 
ATOM   4265 C C   . GLY A 1 565 ? 1.563   19.036 51.817 1.00 26.58 ? 565 GLY A C   1 
ATOM   4266 O O   . GLY A 1 565 ? 1.032   19.479 52.844 1.00 26.81 ? 565 GLY A O   1 
ATOM   4267 N N   . ARG A 1 566 ? 2.686   18.322 51.833 1.00 26.63 ? 566 ARG A N   1 
ATOM   4268 C CA  . ARG A 1 566 ? 3.384   18.009 53.075 1.00 26.85 ? 566 ARG A CA  1 
ATOM   4269 C C   . ARG A 1 566 ? 4.866   18.369 52.980 1.00 25.49 ? 566 ARG A C   1 
ATOM   4270 O O   . ARG A 1 566 ? 5.525   18.092 51.971 1.00 24.47 ? 566 ARG A O   1 
ATOM   4271 C CB  . ARG A 1 566 ? 3.208   16.529 53.414 1.00 28.18 ? 566 ARG A CB  1 
ATOM   4272 C CG  . ARG A 1 566 ? 1.845   16.206 54.003 1.00 31.11 ? 566 ARG A CG  1 
ATOM   4273 C CD  . ARG A 1 566 ? 1.638   14.706 54.157 1.00 33.82 ? 566 ARG A CD  1 
ATOM   4274 N NE  . ARG A 1 566 ? 1.101   14.103 52.941 1.00 35.67 ? 566 ARG A NE  1 
ATOM   4275 C CZ  . ARG A 1 566 ? 1.625   13.040 52.337 1.00 37.52 ? 566 ARG A CZ  1 
ATOM   4276 N NH1 . ARG A 1 566 ? 2.713   12.453 52.836 1.00 37.80 ? 566 ARG A NH1 1 
ATOM   4277 N NH2 . ARG A 1 566 ? 1.064   12.570 51.226 1.00 39.11 ? 566 ARG A NH2 1 
ATOM   4278 N N   . LEU A 1 567 ? 5.383   18.992 54.036 1.00 23.92 ? 567 LEU A N   1 
ATOM   4279 C CA  . LEU A 1 567 ? 6.772   19.413 54.058 1.00 23.48 ? 567 LEU A CA  1 
ATOM   4280 C C   . LEU A 1 567 ? 7.719   18.355 53.516 1.00 25.11 ? 567 LEU A C   1 
ATOM   4281 O O   . LEU A 1 567 ? 7.733   17.215 53.981 1.00 26.12 ? 567 LEU A O   1 
ATOM   4282 C CB  . LEU A 1 567 ? 7.203   19.808 55.475 1.00 21.80 ? 567 LEU A CB  1 
ATOM   4283 C CG  . LEU A 1 567 ? 6.648   21.110 56.071 1.00 23.28 ? 567 LEU A CG  1 
ATOM   4284 C CD1 . LEU A 1 567 ? 7.296   21.354 57.430 1.00 21.32 ? 567 LEU A CD1 1 
ATOM   4285 C CD2 . LEU A 1 567 ? 6.920   22.282 55.142 1.00 18.98 ? 567 LEU A CD2 1 
ATOM   4286 N N   . PRO A 1 568 ? 8.505   18.717 52.491 1.00 25.38 ? 568 PRO A N   1 
ATOM   4287 C CA  . PRO A 1 568 ? 9.473   17.809 51.874 1.00 24.39 ? 568 PRO A CA  1 
ATOM   4288 C C   . PRO A 1 568 ? 10.830  17.983 52.566 1.00 24.64 ? 568 PRO A C   1 
ATOM   4289 O O   . PRO A 1 568 ? 11.792  17.271 52.276 1.00 25.26 ? 568 PRO A O   1 
ATOM   4290 C CB  . PRO A 1 568 ? 9.488   18.278 50.432 1.00 23.87 ? 568 PRO A CB  1 
ATOM   4291 C CG  . PRO A 1 568 ? 9.374   19.757 50.595 1.00 24.31 ? 568 PRO A CG  1 
ATOM   4292 C CD  . PRO A 1 568 ? 8.294   19.905 51.643 1.00 24.23 ? 568 PRO A CD  1 
ATOM   4293 N N   . ARG A 1 569 ? 10.894  18.954 53.475 1.00 24.35 ? 569 ARG A N   1 
ATOM   4294 C CA  . ARG A 1 569 ? 12.109  19.237 54.239 1.00 24.65 ? 569 ARG A CA  1 
ATOM   4295 C C   . ARG A 1 569 ? 11.776  19.369 55.721 1.00 24.44 ? 569 ARG A C   1 
ATOM   4296 O O   . ARG A 1 569 ? 10.613  19.339 56.119 1.00 24.77 ? 569 ARG A O   1 
ATOM   4297 C CB  . ARG A 1 569 ? 12.753  20.557 53.809 1.00 24.26 ? 569 ARG A CB  1 
ATOM   4298 C CG  . ARG A 1 569 ? 13.291  20.622 52.407 1.00 25.81 ? 569 ARG A CG  1 
ATOM   4299 C CD  . ARG A 1 569 ? 14.240  21.802 52.304 1.00 25.09 ? 569 ARG A CD  1 
ATOM   4300 N NE  . ARG A 1 569 ? 15.405  21.581 53.151 1.00 25.43 ? 569 ARG A NE  1 
ATOM   4301 C CZ  . ARG A 1 569 ? 16.346  20.676 52.894 1.00 26.19 ? 569 ARG A CZ  1 
ATOM   4302 N NH1 . ARG A 1 569 ? 16.258  19.920 51.806 1.00 25.70 ? 569 ARG A NH1 1 
ATOM   4303 N NH2 . ARG A 1 569 ? 17.359  20.504 53.736 1.00 24.73 ? 569 ARG A NH2 1 
ATOM   4304 N N   . THR A 1 570 ? 12.815  19.530 56.530 1.00 23.60 ? 570 THR A N   1 
ATOM   4305 C CA  . THR A 1 570 ? 12.647  19.714 57.961 1.00 22.76 ? 570 THR A CA  1 
ATOM   4306 C C   . THR A 1 570 ? 12.605  21.219 58.204 1.00 23.68 ? 570 THR A C   1 
ATOM   4307 O O   . THR A 1 570 ? 13.439  21.954 57.670 1.00 23.16 ? 570 THR A O   1 
ATOM   4308 C CB  . THR A 1 570 ? 13.847  19.146 58.754 1.00 20.74 ? 570 THR A CB  1 
ATOM   4309 O OG1 . THR A 1 570 ? 13.864  17.720 58.650 1.00 19.89 ? 570 THR A OG1 1 
ATOM   4310 C CG2 . THR A 1 570 ? 13.758  19.547 60.216 1.00 17.93 ? 570 THR A CG2 1 
ATOM   4311 N N   . TRP A 1 571 ? 11.630  21.692 58.977 1.00 23.25 ? 571 TRP A N   1 
ATOM   4312 C CA  . TRP A 1 571 ? 11.589  23.118 59.274 1.00 23.11 ? 571 TRP A CA  1 
ATOM   4313 C C   . TRP A 1 571 ? 12.266  23.242 60.627 1.00 23.12 ? 571 TRP A C   1 
ATOM   4314 O O   . TRP A 1 571 ? 11.838  22.635 61.603 1.00 24.83 ? 571 TRP A O   1 
ATOM   4315 C CB  . TRP A 1 571 ? 10.156  23.652 59.335 1.00 21.50 ? 571 TRP A CB  1 
ATOM   4316 C CG  . TRP A 1 571 ? 10.086  25.123 58.992 1.00 20.36 ? 571 TRP A CG  1 
ATOM   4317 C CD1 . TRP A 1 571 ? 10.614  26.160 59.711 1.00 18.90 ? 571 TRP A CD1 1 
ATOM   4318 C CD2 . TRP A 1 571 ? 9.518   25.707 57.807 1.00 19.06 ? 571 TRP A CD2 1 
ATOM   4319 N NE1 . TRP A 1 571 ? 10.415  27.349 59.045 1.00 19.43 ? 571 TRP A NE1 1 
ATOM   4320 C CE2 . TRP A 1 571 ? 9.745   27.100 57.876 1.00 18.82 ? 571 TRP A CE2 1 
ATOM   4321 C CE3 . TRP A 1 571 ? 8.844   25.186 56.692 1.00 18.82 ? 571 TRP A CE3 1 
ATOM   4322 C CZ2 . TRP A 1 571 ? 9.322   27.982 56.873 1.00 19.85 ? 571 TRP A CZ2 1 
ATOM   4323 C CZ3 . TRP A 1 571 ? 8.423   26.063 55.691 1.00 19.10 ? 571 TRP A CZ3 1 
ATOM   4324 C CH2 . TRP A 1 571 ? 8.666   27.448 55.791 1.00 19.07 ? 571 TRP A CH2 1 
ATOM   4325 N N   . PHE A 1 572 ? 13.343  24.012 60.666 1.00 23.21 ? 572 PHE A N   1 
ATOM   4326 C CA  . PHE A 1 572 ? 14.126  24.206 61.878 1.00 23.60 ? 572 PHE A CA  1 
ATOM   4327 C C   . PHE A 1 572 ? 13.583  25.313 62.772 1.00 24.24 ? 572 PHE A C   1 
ATOM   4328 O O   . PHE A 1 572 ? 12.814  26.164 62.326 1.00 24.69 ? 572 PHE A O   1 
ATOM   4329 C CB  . PHE A 1 572 ? 15.561  24.542 61.476 1.00 20.96 ? 572 PHE A CB  1 
ATOM   4330 C CG  . PHE A 1 572 ? 15.648  25.676 60.502 1.00 19.48 ? 572 PHE A CG  1 
ATOM   4331 C CD1 . PHE A 1 572 ? 15.468  26.989 60.925 1.00 19.27 ? 572 PHE A CD1 1 
ATOM   4332 C CD2 . PHE A 1 572 ? 15.840  25.429 59.147 1.00 19.58 ? 572 PHE A CD2 1 
ATOM   4333 C CE1 . PHE A 1 572 ? 15.474  28.043 60.012 1.00 19.44 ? 572 PHE A CE1 1 
ATOM   4334 C CE2 . PHE A 1 572 ? 15.848  26.476 58.223 1.00 18.52 ? 572 PHE A CE2 1 
ATOM   4335 C CZ  . PHE A 1 572 ? 15.663  27.786 58.655 1.00 17.51 ? 572 PHE A CZ  1 
ATOM   4336 N N   . LYS A 1 573 ? 13.992  25.299 64.037 1.00 25.76 ? 573 LYS A N   1 
ATOM   4337 C CA  . LYS A 1 573 ? 13.577  26.335 64.976 1.00 27.52 ? 573 LYS A CA  1 
ATOM   4338 C C   . LYS A 1 573 ? 14.582  27.473 64.876 1.00 27.47 ? 573 LYS A C   1 
ATOM   4339 O O   . LYS A 1 573 ? 14.228  28.646 64.997 1.00 27.54 ? 573 LYS A O   1 
ATOM   4340 C CB  . LYS A 1 573 ? 13.564  25.806 66.407 1.00 27.78 ? 573 LYS A CB  1 
ATOM   4341 C CG  . LYS A 1 573 ? 12.575  24.694 66.649 1.00 28.78 ? 573 LYS A CG  1 
ATOM   4342 C CD  . LYS A 1 573 ? 12.633  24.247 68.094 1.00 27.23 ? 573 LYS A CD  1 
ATOM   4343 C CE  . LYS A 1 573 ? 11.799  23.003 68.312 1.00 28.36 ? 573 LYS A CE  1 
ATOM   4344 N NZ  . LYS A 1 573 ? 11.900  22.528 69.718 1.00 29.86 ? 573 LYS A NZ  1 
ATOM   4345 N N   . SER A 1 574 ? 15.842  27.114 64.652 1.00 27.60 ? 574 SER A N   1 
ATOM   4346 C CA  . SER A 1 574 ? 16.911  28.098 64.529 1.00 28.86 ? 574 SER A CA  1 
ATOM   4347 C C   . SER A 1 574 ? 17.934  27.623 63.512 1.00 28.89 ? 574 SER A C   1 
ATOM   4348 O O   . SER A 1 574 ? 18.059  26.420 63.276 1.00 30.07 ? 574 SER A O   1 
ATOM   4349 C CB  . SER A 1 574 ? 17.603  28.292 65.875 1.00 29.51 ? 574 SER A CB  1 
ATOM   4350 O OG  . SER A 1 574 ? 18.698  29.185 65.742 1.00 34.26 ? 574 SER A OG  1 
ATOM   4351 N N   . VAL A 1 575 ? 18.675  28.553 62.917 1.00 28.65 ? 575 VAL A N   1 
ATOM   4352 C CA  . VAL A 1 575 ? 19.679  28.171 61.932 1.00 28.65 ? 575 VAL A CA  1 
ATOM   4353 C C   . VAL A 1 575 ? 20.862  27.438 62.551 1.00 30.10 ? 575 VAL A C   1 
ATOM   4354 O O   . VAL A 1 575 ? 21.471  26.587 61.898 1.00 30.84 ? 575 VAL A O   1 
ATOM   4355 C CB  . VAL A 1 575 ? 20.215  29.386 61.138 1.00 26.90 ? 575 VAL A CB  1 
ATOM   4356 C CG1 . VAL A 1 575 ? 19.124  29.944 60.259 1.00 25.41 ? 575 VAL A CG1 1 
ATOM   4357 C CG2 . VAL A 1 575 ? 20.727  30.447 62.081 1.00 27.02 ? 575 VAL A CG2 1 
ATOM   4358 N N   . ASP A 1 576 ? 21.189  27.742 63.805 1.00 30.64 ? 576 ASP A N   1 
ATOM   4359 C CA  . ASP A 1 576 ? 22.315  27.064 64.426 1.00 31.33 ? 576 ASP A CA  1 
ATOM   4360 C C   . ASP A 1 576 ? 22.054  25.603 64.763 1.00 30.25 ? 576 ASP A C   1 
ATOM   4361 O O   . ASP A 1 576 ? 22.898  24.945 65.359 1.00 30.93 ? 576 ASP A O   1 
ATOM   4362 C CB  . ASP A 1 576 ? 22.818  27.813 65.663 1.00 34.88 ? 576 ASP A CB  1 
ATOM   4363 C CG  . ASP A 1 576 ? 21.713  28.223 66.589 1.00 38.77 ? 576 ASP A CG  1 
ATOM   4364 O OD1 . ASP A 1 576 ? 20.861  27.371 66.919 1.00 43.16 ? 576 ASP A OD1 1 
ATOM   4365 O OD2 . ASP A 1 576 ? 21.709  29.404 66.996 1.00 40.46 ? 576 ASP A OD2 1 
ATOM   4366 N N   . GLN A 1 577 ? 20.891  25.088 64.384 1.00 29.08 ? 577 GLN A N   1 
ATOM   4367 C CA  . GLN A 1 577 ? 20.598  23.676 64.611 1.00 27.92 ? 577 GLN A CA  1 
ATOM   4368 C C   . GLN A 1 577 ? 21.146  22.909 63.406 1.00 27.78 ? 577 GLN A C   1 
ATOM   4369 O O   . GLN A 1 577 ? 21.401  21.705 63.479 1.00 25.92 ? 577 GLN A O   1 
ATOM   4370 C CB  . GLN A 1 577 ? 19.098  23.416 64.661 1.00 27.72 ? 577 GLN A CB  1 
ATOM   4371 C CG  . GLN A 1 577 ? 18.362  23.943 65.851 1.00 27.24 ? 577 GLN A CG  1 
ATOM   4372 C CD  . GLN A 1 577 ? 16.906  23.528 65.811 1.00 27.34 ? 577 GLN A CD  1 
ATOM   4373 O OE1 . GLN A 1 577 ? 16.155  23.953 64.932 1.00 28.89 ? 577 GLN A OE1 1 
ATOM   4374 N NE2 . GLN A 1 577 ? 16.502  22.681 66.751 1.00 25.83 ? 577 GLN A NE2 1 
ATOM   4375 N N   . LEU A 1 578 ? 21.313  23.635 62.301 1.00 27.67 ? 578 LEU A N   1 
ATOM   4376 C CA  . LEU A 1 578 ? 21.775  23.080 61.031 1.00 28.50 ? 578 LEU A CA  1 
ATOM   4377 C C   . LEU A 1 578 ? 23.226  22.616 60.985 1.00 28.83 ? 578 LEU A C   1 
ATOM   4378 O O   . LEU A 1 578 ? 24.121  23.261 61.531 1.00 29.87 ? 578 LEU A O   1 
ATOM   4379 C CB  . LEU A 1 578 ? 21.530  24.101 59.917 1.00 27.36 ? 578 LEU A CB  1 
ATOM   4380 C CG  . LEU A 1 578 ? 20.093  24.629 59.844 1.00 26.23 ? 578 LEU A CG  1 
ATOM   4381 C CD1 . LEU A 1 578 ? 20.013  25.746 58.817 1.00 26.06 ? 578 LEU A CD1 1 
ATOM   4382 C CD2 . LEU A 1 578 ? 19.134  23.494 59.503 1.00 23.43 ? 578 LEU A CD2 1 
ATOM   4383 N N   . PRO A 1 579 ? 23.477  21.492 60.301 1.00 28.50 ? 579 PRO A N   1 
ATOM   4384 C CA  . PRO A 1 579 ? 22.460  20.697 59.606 1.00 28.99 ? 579 PRO A CA  1 
ATOM   4385 C C   . PRO A 1 579 ? 21.578  19.976 60.602 1.00 29.11 ? 579 PRO A C   1 
ATOM   4386 O O   . PRO A 1 579 ? 21.929  19.861 61.769 1.00 31.52 ? 579 PRO A O   1 
ATOM   4387 C CB  . PRO A 1 579 ? 23.285  19.711 58.785 1.00 28.79 ? 579 PRO A CB  1 
ATOM   4388 C CG  . PRO A 1 579 ? 24.608  20.392 58.628 1.00 29.51 ? 579 PRO A CG  1 
ATOM   4389 C CD  . PRO A 1 579 ? 24.822  20.996 59.983 1.00 28.99 ? 579 PRO A CD  1 
ATOM   4390 N N   . MET A 1 580 ? 20.434  19.496 60.131 1.00 29.60 ? 580 MET A N   1 
ATOM   4391 C CA  . MET A 1 580 ? 19.481  18.755 60.951 1.00 29.76 ? 580 MET A CA  1 
ATOM   4392 C C   . MET A 1 580 ? 18.433  18.162 60.016 1.00 30.12 ? 580 MET A C   1 
ATOM   4393 O O   . MET A 1 580 ? 17.537  18.865 59.544 1.00 29.60 ? 580 MET A O   1 
ATOM   4394 C CB  . MET A 1 580 ? 18.809  19.674 61.982 1.00 29.52 ? 580 MET A CB  1 
ATOM   4395 C CG  . MET A 1 580 ? 17.802  18.953 62.885 1.00 29.40 ? 580 MET A CG  1 
ATOM   4396 S SD  . MET A 1 580 ? 17.207  19.947 64.276 1.00 32.31 ? 580 MET A SD  1 
ATOM   4397 C CE  . MET A 1 580 ? 15.785  20.755 63.531 1.00 32.32 ? 580 MET A CE  1 
ATOM   4398 N N   . ASN A 1 581 ? 18.560  16.869 59.734 1.00 31.49 ? 581 ASN A N   1 
ATOM   4399 C CA  . ASN A 1 581 ? 17.629  16.192 58.837 1.00 32.77 ? 581 ASN A CA  1 
ATOM   4400 C C   . ASN A 1 581 ? 16.905  15.049 59.532 1.00 34.18 ? 581 ASN A C   1 
ATOM   4401 O O   . ASN A 1 581 ? 17.355  14.552 60.562 1.00 34.51 ? 581 ASN A O   1 
ATOM   4402 C CB  . ASN A 1 581 ? 18.368  15.653 57.603 1.00 31.29 ? 581 ASN A CB  1 
ATOM   4403 C CG  . ASN A 1 581 ? 19.100  16.739 56.837 1.00 31.31 ? 581 ASN A CG  1 
ATOM   4404 O OD1 . ASN A 1 581 ? 20.169  17.188 57.247 1.00 30.22 ? 581 ASN A OD1 1 
ATOM   4405 N ND2 . ASN A 1 581 ? 18.520  17.176 55.722 1.00 31.55 ? 581 ASN A ND2 1 
ATOM   4406 N N   . VAL A 1 582 ? 15.778  14.635 58.963 1.00 35.81 ? 582 VAL A N   1 
ATOM   4407 C CA  . VAL A 1 582 ? 15.001  13.545 59.535 1.00 37.88 ? 582 VAL A CA  1 
ATOM   4408 C C   . VAL A 1 582 ? 15.916  12.367 59.818 1.00 39.49 ? 582 VAL A C   1 
ATOM   4409 O O   . VAL A 1 582 ? 16.886  12.136 59.095 1.00 40.47 ? 582 VAL A O   1 
ATOM   4410 C CB  . VAL A 1 582 ? 13.904  13.075 58.575 1.00 38.30 ? 582 VAL A CB  1 
ATOM   4411 C CG1 . VAL A 1 582 ? 13.023  12.041 59.257 1.00 37.25 ? 582 VAL A CG1 1 
ATOM   4412 C CG2 . VAL A 1 582 ? 13.088  14.257 58.114 1.00 40.00 ? 582 VAL A CG2 1 
ATOM   4413 N N   . GLY A 1 583 ? 15.606  11.627 60.875 1.00 41.19 ? 583 GLY A N   1 
ATOM   4414 C CA  . GLY A 1 583 ? 16.412  10.478 61.228 1.00 41.57 ? 583 GLY A CA  1 
ATOM   4415 C C   . GLY A 1 583 ? 17.705  10.863 61.911 1.00 42.37 ? 583 GLY A C   1 
ATOM   4416 O O   . GLY A 1 583 ? 18.507  9.997  62.237 1.00 43.30 ? 583 GLY A O   1 
ATOM   4417 N N   . ASP A 1 584 ? 17.913  12.157 62.129 1.00 43.64 ? 584 ASP A N   1 
ATOM   4418 C CA  . ASP A 1 584 ? 19.130  12.632 62.782 1.00 46.16 ? 584 ASP A CA  1 
ATOM   4419 C C   . ASP A 1 584 ? 19.162  12.307 64.270 1.00 47.98 ? 584 ASP A C   1 
ATOM   4420 O O   . ASP A 1 584 ? 18.202  11.769 64.824 1.00 48.52 ? 584 ASP A O   1 
ATOM   4421 C CB  . ASP A 1 584 ? 19.282  14.144 62.591 1.00 46.28 ? 584 ASP A CB  1 
ATOM   4422 C CG  . ASP A 1 584 ? 20.187  14.498 61.430 1.00 45.17 ? 584 ASP A CG  1 
ATOM   4423 O OD1 . ASP A 1 584 ? 20.248  13.715 60.459 1.00 45.12 ? 584 ASP A OD1 1 
ATOM   4424 O OD2 . ASP A 1 584 ? 20.829  15.567 61.486 1.00 44.45 ? 584 ASP A OD2 1 
ATOM   4425 N N   . ALA A 1 585 ? 20.277  12.650 64.907 1.00 50.43 ? 585 ALA A N   1 
ATOM   4426 C CA  . ALA A 1 585 ? 20.473  12.407 66.332 1.00 52.38 ? 585 ALA A CA  1 
ATOM   4427 C C   . ALA A 1 585 ? 19.626  13.334 67.207 1.00 53.75 ? 585 ALA A C   1 
ATOM   4428 O O   . ALA A 1 585 ? 18.745  12.876 67.942 1.00 53.86 ? 585 ALA A O   1 
ATOM   4429 C CB  . ALA A 1 585 ? 21.947  12.575 66.681 1.00 52.91 ? 585 ALA A CB  1 
ATOM   4430 N N   . HIS A 1 586 ? 19.898  14.636 67.128 1.00 53.99 ? 586 HIS A N   1 
ATOM   4431 C CA  . HIS A 1 586 ? 19.167  15.613 67.929 1.00 54.38 ? 586 HIS A CA  1 
ATOM   4432 C C   . HIS A 1 586 ? 17.949  16.196 67.211 1.00 51.73 ? 586 HIS A C   1 
ATOM   4433 O O   . HIS A 1 586 ? 17.592  17.351 67.445 1.00 53.82 ? 586 HIS A O   1 
ATOM   4434 C CB  . HIS A 1 586 ? 20.100  16.769 68.350 1.00 58.86 ? 586 HIS A CB  1 
ATOM   4435 C CG  . HIS A 1 586 ? 20.371  17.776 67.263 1.00 63.77 ? 586 HIS A CG  1 
ATOM   4436 N ND1 . HIS A 1 586 ? 20.858  19.041 67.528 1.00 65.80 ? 586 HIS A ND1 1 
ATOM   4437 C CD2 . HIS A 1 586 ? 20.224  17.709 65.916 1.00 64.91 ? 586 HIS A CD2 1 
ATOM   4438 C CE1 . HIS A 1 586 ? 20.997  19.708 66.395 1.00 65.05 ? 586 HIS A CE1 1 
ATOM   4439 N NE2 . HIS A 1 586 ? 20.619  18.923 65.402 1.00 65.28 ? 586 HIS A NE2 1 
ATOM   4440 N N   . TYR A 1 587 ? 17.298  15.417 66.354 1.00 46.28 ? 587 TYR A N   1 
ATOM   4441 C CA  . TYR A 1 587 ? 16.152  15.944 65.624 1.00 41.60 ? 587 TYR A CA  1 
ATOM   4442 C C   . TYR A 1 587 ? 15.161  16.701 66.512 1.00 38.51 ? 587 TYR A C   1 
ATOM   4443 O O   . TYR A 1 587 ? 14.357  16.106 67.225 1.00 38.02 ? 587 TYR A O   1 
ATOM   4444 C CB  . TYR A 1 587 ? 15.437  14.822 64.879 1.00 41.62 ? 587 TYR A CB  1 
ATOM   4445 C CG  . TYR A 1 587 ? 14.647  15.308 63.680 1.00 41.96 ? 587 TYR A CG  1 
ATOM   4446 C CD1 . TYR A 1 587 ? 15.222  16.178 62.745 1.00 41.80 ? 587 TYR A CD1 1 
ATOM   4447 C CD2 . TYR A 1 587 ? 13.341  14.873 63.458 1.00 41.60 ? 587 TYR A CD2 1 
ATOM   4448 C CE1 . TYR A 1 587 ? 14.513  16.598 61.622 1.00 41.09 ? 587 TYR A CE1 1 
ATOM   4449 C CE2 . TYR A 1 587 ? 12.626  15.287 62.338 1.00 41.81 ? 587 TYR A CE2 1 
ATOM   4450 C CZ  . TYR A 1 587 ? 13.215  16.146 61.427 1.00 41.58 ? 587 TYR A CZ  1 
ATOM   4451 O OH  . TYR A 1 587 ? 12.499  16.545 60.324 1.00 41.74 ? 587 TYR A OH  1 
ATOM   4452 N N   . ASP A 1 588 ? 15.231  18.027 66.452 1.00 34.48 ? 588 ASP A N   1 
ATOM   4453 C CA  . ASP A 1 588 ? 14.367  18.901 67.233 1.00 30.58 ? 588 ASP A CA  1 
ATOM   4454 C C   . ASP A 1 588 ? 13.794  19.980 66.307 1.00 28.51 ? 588 ASP A C   1 
ATOM   4455 O O   . ASP A 1 588 ? 14.090  21.166 66.446 1.00 26.82 ? 588 ASP A O   1 
ATOM   4456 C CB  . ASP A 1 588 ? 15.185  19.526 68.363 1.00 30.50 ? 588 ASP A CB  1 
ATOM   4457 C CG  . ASP A 1 588 ? 14.387  20.505 69.189 1.00 31.27 ? 588 ASP A CG  1 
ATOM   4458 O OD1 . ASP A 1 588 ? 13.195  20.235 69.448 1.00 30.20 ? 588 ASP A OD1 1 
ATOM   4459 O OD2 . ASP A 1 588 ? 14.960  21.540 69.588 1.00 32.47 ? 588 ASP A OD2 1 
ATOM   4460 N N   . PRO A 1 589 ? 12.945  19.569 65.350 1.00 27.74 ? 589 PRO A N   1 
ATOM   4461 C CA  . PRO A 1 589 ? 12.304  20.444 64.364 1.00 26.70 ? 589 PRO A CA  1 
ATOM   4462 C C   . PRO A 1 589 ? 11.147  21.288 64.861 1.00 26.39 ? 589 PRO A C   1 
ATOM   4463 O O   . PRO A 1 589 ? 10.486  20.939 65.837 1.00 26.93 ? 589 PRO A O   1 
ATOM   4464 C CB  . PRO A 1 589 ? 11.840  19.459 63.306 1.00 26.59 ? 589 PRO A CB  1 
ATOM   4465 C CG  . PRO A 1 589 ? 11.370  18.318 64.157 1.00 26.22 ? 589 PRO A CG  1 
ATOM   4466 C CD  . PRO A 1 589 ? 12.503  18.173 65.159 1.00 26.58 ? 589 PRO A CD  1 
ATOM   4467 N N   . LEU A 1 590 ? 10.916  22.407 64.177 1.00 26.17 ? 590 LEU A N   1 
ATOM   4468 C CA  . LEU A 1 590 ? 9.797   23.287 64.495 1.00 25.58 ? 590 LEU A CA  1 
ATOM   4469 C C   . LEU A 1 590 ? 8.608   22.559 63.873 1.00 26.78 ? 590 LEU A C   1 
ATOM   4470 O O   . LEU A 1 590 ? 7.513   22.536 64.427 1.00 27.23 ? 590 LEU A O   1 
ATOM   4471 C CB  . LEU A 1 590 ? 9.966   24.655 63.837 1.00 24.16 ? 590 LEU A CB  1 
ATOM   4472 C CG  . LEU A 1 590 ? 8.791   25.619 64.057 1.00 24.84 ? 590 LEU A CG  1 
ATOM   4473 C CD1 . LEU A 1 590 ? 8.689   25.957 65.541 1.00 21.60 ? 590 LEU A CD1 1 
ATOM   4474 C CD2 . LEU A 1 590 ? 8.979   26.889 63.231 1.00 22.60 ? 590 LEU A CD2 1 
ATOM   4475 N N   . PHE A 1 591 ? 8.859   21.966 62.708 1.00 26.67 ? 591 PHE A N   1 
ATOM   4476 C CA  . PHE A 1 591 ? 7.882   21.178 61.966 1.00 27.43 ? 591 PHE A CA  1 
ATOM   4477 C C   . PHE A 1 591 ? 8.695   20.050 61.364 1.00 28.79 ? 591 PHE A C   1 
ATOM   4478 O O   . PHE A 1 591 ? 9.642   20.296 60.616 1.00 29.96 ? 591 PHE A O   1 
ATOM   4479 C CB  . PHE A 1 591 ? 7.248   21.985 60.834 1.00 26.40 ? 591 PHE A CB  1 
ATOM   4480 C CG  . PHE A 1 591 ? 6.307   23.046 61.299 1.00 24.81 ? 591 PHE A CG  1 
ATOM   4481 C CD1 . PHE A 1 591 ? 5.122   22.708 61.934 1.00 24.20 ? 591 PHE A CD1 1 
ATOM   4482 C CD2 . PHE A 1 591 ? 6.607   24.388 61.105 1.00 24.18 ? 591 PHE A CD2 1 
ATOM   4483 C CE1 . PHE A 1 591 ? 4.243   23.697 62.372 1.00 23.88 ? 591 PHE A CE1 1 
ATOM   4484 C CE2 . PHE A 1 591 ? 5.739   25.384 61.536 1.00 23.29 ? 591 PHE A CE2 1 
ATOM   4485 C CZ  . PHE A 1 591 ? 4.555   25.039 62.171 1.00 22.89 ? 591 PHE A CZ  1 
ATOM   4486 N N   . ARG A 1 592 ? 8.340   18.815 61.695 1.00 29.60 ? 592 ARG A N   1 
ATOM   4487 C CA  . ARG A 1 592 ? 9.071   17.669 61.176 1.00 30.62 ? 592 ARG A CA  1 
ATOM   4488 C C   . ARG A 1 592 ? 8.719   17.463 59.711 1.00 29.19 ? 592 ARG A C   1 
ATOM   4489 O O   . ARG A 1 592 ? 7.674   17.922 59.246 1.00 28.62 ? 592 ARG A O   1 
ATOM   4490 C CB  . ARG A 1 592 ? 8.706   16.408 61.963 1.00 33.26 ? 592 ARG A CB  1 
ATOM   4491 C CG  . ARG A 1 592 ? 7.357   15.817 61.568 1.00 39.10 ? 592 ARG A CG  1 
ATOM   4492 C CD  . ARG A 1 592 ? 7.023   14.579 62.378 1.00 44.60 ? 592 ARG A CD  1 
ATOM   4493 N NE  . ARG A 1 592 ? 6.744   14.892 63.780 1.00 52.78 ? 592 ARG A NE  1 
ATOM   4494 C CZ  . ARG A 1 592 ? 5.698   15.604 64.205 1.00 55.85 ? 592 ARG A CZ  1 
ATOM   4495 N NH1 . ARG A 1 592 ? 4.817   16.089 63.332 1.00 56.81 ? 592 ARG A NH1 1 
ATOM   4496 N NH2 . ARG A 1 592 ? 5.529   15.827 65.506 1.00 55.78 ? 592 ARG A NH2 1 
ATOM   4497 N N   . LEU A 1 593 ? 9.597   16.777 58.986 1.00 27.10 ? 593 LEU A N   1 
ATOM   4498 C CA  . LEU A 1 593 ? 9.339   16.477 57.583 1.00 25.50 ? 593 LEU A CA  1 
ATOM   4499 C C   . LEU A 1 593 ? 8.033   15.687 57.538 1.00 24.02 ? 593 LEU A C   1 
ATOM   4500 O O   . LEU A 1 593 ? 7.743   14.907 58.441 1.00 23.56 ? 593 LEU A O   1 
ATOM   4501 C CB  . LEU A 1 593 ? 10.481  15.643 56.997 1.00 24.23 ? 593 LEU A CB  1 
ATOM   4502 C CG  . LEU A 1 593 ? 10.333  15.156 55.553 1.00 25.53 ? 593 LEU A CG  1 
ATOM   4503 C CD1 . LEU A 1 593 ? 11.705  14.889 54.967 1.00 25.34 ? 593 LEU A CD1 1 
ATOM   4504 C CD2 . LEU A 1 593 ? 9.469   13.907 55.503 1.00 22.48 ? 593 LEU A CD2 1 
ATOM   4505 N N   . GLY A 1 594 ? 7.239   15.901 56.496 1.00 23.56 ? 594 GLY A N   1 
ATOM   4506 C CA  . GLY A 1 594 ? 5.976   15.196 56.385 1.00 22.50 ? 594 GLY A CA  1 
ATOM   4507 C C   . GLY A 1 594 ? 4.802   15.946 56.993 1.00 22.84 ? 594 GLY A C   1 
ATOM   4508 O O   . GLY A 1 594 ? 3.654   15.559 56.797 1.00 22.90 ? 594 GLY A O   1 
ATOM   4509 N N   . TYR A 1 595 ? 5.079   17.021 57.725 1.00 23.39 ? 595 TYR A N   1 
ATOM   4510 C CA  . TYR A 1 595 ? 4.020   17.811 58.347 1.00 24.19 ? 595 TYR A CA  1 
ATOM   4511 C C   . TYR A 1 595 ? 3.221   18.658 57.354 1.00 23.64 ? 595 TYR A C   1 
ATOM   4512 O O   . TYR A 1 595 ? 3.750   19.165 56.364 1.00 23.54 ? 595 TYR A O   1 
ATOM   4513 C CB  . TYR A 1 595 ? 4.616   18.711 59.438 1.00 26.83 ? 595 TYR A CB  1 
ATOM   4514 C CG  . TYR A 1 595 ? 3.634   19.679 60.072 1.00 29.30 ? 595 TYR A CG  1 
ATOM   4515 C CD1 . TYR A 1 595 ? 3.321   20.892 59.455 1.00 30.96 ? 595 TYR A CD1 1 
ATOM   4516 C CD2 . TYR A 1 595 ? 3.011   19.380 61.284 1.00 30.42 ? 595 TYR A CD2 1 
ATOM   4517 C CE1 . TYR A 1 595 ? 2.413   21.783 60.028 1.00 31.46 ? 595 TYR A CE1 1 
ATOM   4518 C CE2 . TYR A 1 595 ? 2.100   20.264 61.866 1.00 30.59 ? 595 TYR A CE2 1 
ATOM   4519 C CZ  . TYR A 1 595 ? 1.808   21.461 61.232 1.00 31.90 ? 595 TYR A CZ  1 
ATOM   4520 O OH  . TYR A 1 595 ? 0.919   22.344 61.803 1.00 33.90 ? 595 TYR A OH  1 
ATOM   4521 N N   . GLY A 1 596 ? 1.935   18.810 57.635 1.00 23.84 ? 596 GLY A N   1 
ATOM   4522 C CA  . GLY A 1 596 ? 1.087   19.604 56.771 1.00 24.16 ? 596 GLY A CA  1 
ATOM   4523 C C   . GLY A 1 596 ? -0.370  19.533 57.179 1.00 24.32 ? 596 GLY A C   1 
ATOM   4524 O O   . GLY A 1 596 ? -0.954  18.454 57.208 1.00 25.88 ? 596 GLY A O   1 
ATOM   4525 N N   . LEU A 1 597 ? -0.957  20.677 57.509 1.00 23.46 ? 597 LEU A N   1 
ATOM   4526 C CA  . LEU A 1 597 ? -2.365  20.727 57.887 1.00 23.35 ? 597 LEU A CA  1 
ATOM   4527 C C   . LEU A 1 597 ? -3.189  20.551 56.618 1.00 24.71 ? 597 LEU A C   1 
ATOM   4528 O O   . LEU A 1 597 ? -2.727  20.889 55.525 1.00 25.56 ? 597 LEU A O   1 
ATOM   4529 C CB  . LEU A 1 597 ? -2.694  22.079 58.520 1.00 20.67 ? 597 LEU A CB  1 
ATOM   4530 C CG  . LEU A 1 597 ? -1.894  22.439 59.770 1.00 20.25 ? 597 LEU A CG  1 
ATOM   4531 C CD1 . LEU A 1 597 ? -2.330  23.800 60.296 1.00 20.50 ? 597 LEU A CD1 1 
ATOM   4532 C CD2 . LEU A 1 597 ? -2.104  21.365 60.819 1.00 19.15 ? 597 LEU A CD2 1 
ATOM   4533 N N   . THR A 1 598 ? -4.401  20.026 56.746 1.00 25.12 ? 598 THR A N   1 
ATOM   4534 C CA  . THR A 1 598 ? -5.244  19.837 55.565 1.00 27.01 ? 598 THR A CA  1 
ATOM   4535 C C   . THR A 1 598 ? -6.564  20.591 55.684 1.00 27.92 ? 598 THR A C   1 
ATOM   4536 O O   . THR A 1 598 ? -6.899  21.116 56.743 1.00 28.18 ? 598 THR A O   1 
ATOM   4537 C CB  . THR A 1 598 ? -5.587  18.347 55.338 1.00 26.40 ? 598 THR A CB  1 
ATOM   4538 O OG1 . THR A 1 598 ? -6.428  17.882 56.401 1.00 25.87 ? 598 THR A OG1 1 
ATOM   4539 C CG2 . THR A 1 598 ? -4.331  17.510 55.297 1.00 25.05 ? 598 THR A CG2 1 
ATOM   4540 N N   . THR A 1 599 ? -7.294  20.658 54.579 1.00 28.71 ? 599 THR A N   1 
ATOM   4541 C CA  . THR A 1 599 ? -8.602  21.293 54.550 1.00 30.79 ? 599 THR A CA  1 
ATOM   4542 C C   . THR A 1 599 ? -9.351  20.544 53.467 1.00 32.44 ? 599 THR A C   1 
ATOM   4543 O O   . THR A 1 599 ? -8.745  19.818 52.680 1.00 31.56 ? 599 THR A O   1 
ATOM   4544 C CB  . THR A 1 599 ? -8.545  22.796 54.167 1.00 31.07 ? 599 THR A CB  1 
ATOM   4545 O OG1 . THR A 1 599 ? -7.991  22.941 52.854 1.00 31.97 ? 599 THR A OG1 1 
ATOM   4546 C CG2 . THR A 1 599 ? -7.711  23.577 55.165 1.00 29.97 ? 599 THR A CG2 1 
ATOM   4547 N N   . ASN A 1 600 ? -10.668 20.697 53.432 1.00 35.74 ? 600 ASN A N   1 
ATOM   4548 C CA  . ASN A 1 600 ? -11.456 20.023 52.413 1.00 38.61 ? 600 ASN A CA  1 
ATOM   4549 C C   . ASN A 1 600 ? -12.151 21.058 51.541 1.00 38.84 ? 600 ASN A C   1 
ATOM   4550 O O   . ASN A 1 600 ? -12.536 22.126 52.018 1.00 37.95 ? 600 ASN A O   1 
ATOM   4551 C CB  . ASN A 1 600 ? -12.474 19.075 53.061 1.00 40.84 ? 600 ASN A CB  1 
ATOM   4552 C CG  . ASN A 1 600 ? -11.811 17.879 53.734 1.00 45.08 ? 600 ASN A CG  1 
ATOM   4553 O OD1 . ASN A 1 600 ? -11.931 17.703 54.949 1.00 43.75 ? 600 ASN A OD1 1 
ATOM   4554 N ND2 . ASN A 1 600 ? -11.113 17.060 52.944 1.00 50.60 ? 600 ASN A ND2 1 
ATOM   4555 N N   . ALA A 1 601 ? -12.291 20.746 50.258 1.00 39.48 ? 601 ALA A N   1 
ATOM   4556 C CA  . ALA A 1 601 ? -12.933 21.658 49.325 1.00 40.57 ? 601 ALA A CA  1 
ATOM   4557 C C   . ALA A 1 601 ? -14.337 22.021 49.793 1.00 41.95 ? 601 ALA A C   1 
ATOM   4558 O O   . ALA A 1 601 ? -15.093 21.163 50.248 1.00 41.78 ? 601 ALA A O   1 
ATOM   4559 C CB  . ALA A 1 601 ? -12.987 21.032 47.933 1.00 40.45 ? 601 ALA A CB  1 
ATOM   4560 N N   . THR A 1 602 ? -14.673 23.302 49.688 1.00 43.78 ? 602 THR A N   1 
ATOM   4561 C CA  . THR A 1 602 ? -15.988 23.783 50.087 1.00 46.71 ? 602 THR A CA  1 
ATOM   4562 C C   . THR A 1 602 ? -17.004 23.472 48.989 1.00 47.83 ? 602 THR A C   1 
ATOM   4563 O O   . THR A 1 602 ? -18.086 22.936 49.314 1.00 49.48 ? 602 THR A O   1 
ATOM   4564 C CB  . THR A 1 602 ? -15.977 25.310 50.351 1.00 47.66 ? 602 THR A CB  1 
ATOM   4565 O OG1 . THR A 1 602 ? -15.566 25.998 49.166 1.00 48.73 ? 602 THR A OG1 1 
ATOM   4566 C CG2 . THR A 1 602 ? -15.018 25.658 51.485 1.00 47.47 ? 602 THR A CG2 1 
HETATM 4567 C C1  . NAG B 2 .   ? 35.024  25.707 50.366 1.00 59.07 ? 1   NAG B C1  1 
HETATM 4568 C C2  . NAG B 2 .   ? 36.298  25.466 49.544 1.00 60.39 ? 1   NAG B C2  1 
HETATM 4569 C C3  . NAG B 2 .   ? 37.499  26.116 50.236 1.00 62.92 ? 1   NAG B C3  1 
HETATM 4570 C C4  . NAG B 2 .   ? 37.210  27.595 50.521 1.00 64.92 ? 1   NAG B C4  1 
HETATM 4571 C C5  . NAG B 2 .   ? 35.895  27.716 51.309 1.00 63.23 ? 1   NAG B C5  1 
HETATM 4572 C C6  . NAG B 2 .   ? 35.487  29.141 51.601 1.00 61.62 ? 1   NAG B C6  1 
HETATM 4573 C C7  . NAG B 2 .   ? 36.476  23.469 48.213 1.00 60.54 ? 1   NAG B C7  1 
HETATM 4574 C C8  . NAG B 2 .   ? 37.728  22.743 47.736 1.00 61.07 ? 1   NAG B C8  1 
HETATM 4575 N N2  . NAG B 2 .   ? 36.524  24.041 49.411 1.00 60.40 ? 1   NAG B N2  1 
HETATM 4576 O O3  . NAG B 2 .   ? 38.656  25.999 49.418 1.00 63.00 ? 1   NAG B O3  1 
HETATM 4577 O O4  . NAG B 2 .   ? 38.294  28.155 51.290 1.00 70.77 ? 1   NAG B O4  1 
HETATM 4578 O O5  . NAG B 2 .   ? 34.815  27.108 50.572 1.00 60.43 ? 1   NAG B O5  1 
HETATM 4579 O O6  . NAG B 2 .   ? 34.769  29.214 52.820 1.00 62.65 ? 1   NAG B O6  1 
HETATM 4580 O O7  . NAG B 2 .   ? 35.479  23.515 47.492 1.00 60.29 ? 1   NAG B O7  1 
HETATM 4581 C C1  . NAG B 2 .   ? 38.633  29.474 51.027 1.00 75.25 ? 2   NAG B C1  1 
HETATM 4582 C C2  . NAG B 2 .   ? 39.446  30.041 52.187 1.00 77.14 ? 2   NAG B C2  1 
HETATM 4583 C C3  . NAG B 2 .   ? 39.894  31.477 51.865 1.00 79.20 ? 2   NAG B C3  1 
HETATM 4584 C C4  . NAG B 2 .   ? 40.439  31.681 50.425 1.00 79.96 ? 2   NAG B C4  1 
HETATM 4585 C C5  . NAG B 2 .   ? 39.656  30.854 49.376 1.00 79.27 ? 2   NAG B C5  1 
HETATM 4586 C C6  . NAG B 2 .   ? 40.384  30.741 48.047 1.00 79.57 ? 2   NAG B C6  1 
HETATM 4587 C C7  . NAG B 2 .   ? 38.535  28.934 54.144 1.00 77.61 ? 2   NAG B C7  1 
HETATM 4588 C C8  . NAG B 2 .   ? 37.165  28.270 54.219 1.00 76.50 ? 2   NAG B C8  1 
HETATM 4589 N N2  . NAG B 2 .   ? 38.648  30.039 53.405 1.00 77.15 ? 2   NAG B N2  1 
HETATM 4590 O O3  . NAG B 2 .   ? 40.894  31.871 52.793 1.00 79.44 ? 2   NAG B O3  1 
HETATM 4591 O O4  . NAG B 2 .   ? 40.308  33.090 50.097 1.00 82.36 ? 2   NAG B O4  1 
HETATM 4592 O O5  . NAG B 2 .   ? 39.428  29.506 49.840 1.00 77.27 ? 2   NAG B O5  1 
HETATM 4593 O O6  . NAG B 2 .   ? 40.221  29.448 47.477 1.00 80.35 ? 2   NAG B O6  1 
HETATM 4594 O O7  . NAG B 2 .   ? 39.483  28.439 54.757 1.00 77.23 ? 2   NAG B O7  1 
HETATM 4595 C C1  . BMA B 2 .   ? 41.383  33.856 49.629 1.00 84.17 ? 3   BMA B C1  1 
HETATM 4596 C C2  . BMA B 2 .   ? 42.717  33.525 50.327 1.00 84.92 ? 3   BMA B C2  1 
HETATM 4597 C C3  . BMA B 2 .   ? 43.794  34.478 49.792 1.00 85.02 ? 3   BMA B C3  1 
HETATM 4598 C C4  . BMA B 2 .   ? 43.852  34.417 48.255 1.00 85.14 ? 3   BMA B C4  1 
HETATM 4599 C C5  . BMA B 2 .   ? 42.455  34.642 47.644 1.00 85.15 ? 3   BMA B C5  1 
HETATM 4600 C C6  . BMA B 2 .   ? 42.433  34.452 46.136 1.00 85.85 ? 3   BMA B C6  1 
HETATM 4601 O O2  . BMA B 2 .   ? 43.095  32.180 50.058 1.00 85.17 ? 3   BMA B O2  1 
HETATM 4602 O O3  . BMA B 2 .   ? 45.059  34.130 50.337 1.00 84.42 ? 3   BMA B O3  1 
HETATM 4603 O O4  . BMA B 2 .   ? 44.748  35.407 47.770 1.00 84.26 ? 3   BMA B O4  1 
HETATM 4604 O O5  . BMA B 2 .   ? 41.502  33.707 48.208 1.00 84.90 ? 3   BMA B O5  1 
HETATM 4605 O O6  . BMA B 2 .   ? 43.235  35.423 45.479 1.00 85.53 ? 3   BMA B O6  1 
HETATM 4606 C C1  . NAG C 3 .   ? 21.175  37.036 55.479 1.00 59.18 ? 1   NAG C C1  1 
HETATM 4607 C C2  . NAG C 3 .   ? 20.743  38.484 55.574 1.00 62.11 ? 1   NAG C C2  1 
HETATM 4608 C C3  . NAG C 3 .   ? 20.129  38.781 54.227 1.00 65.46 ? 1   NAG C C3  1 
HETATM 4609 C C4  . NAG C 3 .   ? 21.299  38.776 53.216 1.00 65.02 ? 1   NAG C C4  1 
HETATM 4610 C C5  . NAG C 3 .   ? 21.948  37.363 53.222 1.00 63.31 ? 1   NAG C C5  1 
HETATM 4611 C C6  . NAG C 3 .   ? 23.223  37.280 52.408 1.00 62.73 ? 1   NAG C C6  1 
HETATM 4612 C C7  . NAG C 3 .   ? 20.265  39.317 57.779 1.00 61.21 ? 1   NAG C C7  1 
HETATM 4613 C C8  . NAG C 3 .   ? 19.299  39.410 58.951 1.00 59.80 ? 1   NAG C C8  1 
HETATM 4614 N N2  . NAG C 3 .   ? 19.826  38.714 56.673 1.00 62.05 ? 1   NAG C N2  1 
HETATM 4615 O O3  . NAG C 3 .   ? 19.345  40.004 54.269 1.00 68.97 ? 1   NAG C O3  1 
HETATM 4616 O O4  . NAG C 3 .   ? 20.830  39.090 51.889 1.00 68.38 ? 1   NAG C O4  1 
HETATM 4617 O O5  . NAG C 3 .   ? 22.285  36.936 54.575 1.00 61.82 ? 1   NAG C O5  1 
HETATM 4618 O O6  . NAG C 3 .   ? 24.032  36.195 52.835 1.00 62.62 ? 1   NAG C O6  1 
HETATM 4619 O O7  . NAG C 3 .   ? 21.404  39.786 57.883 1.00 59.21 ? 1   NAG C O7  1 
HETATM 4620 C C1  . NAG C 3 .   ? 21.791  39.548 50.993 1.00 71.56 ? 2   NAG C C1  1 
HETATM 4621 C C2  . NAG C 3 .   ? 21.189  39.681 49.582 1.00 72.76 ? 2   NAG C C2  1 
HETATM 4622 C C3  . NAG C 3 .   ? 22.209  40.313 48.625 1.00 73.41 ? 2   NAG C C3  1 
HETATM 4623 C C4  . NAG C 3 .   ? 22.793  41.603 49.220 1.00 73.86 ? 2   NAG C C4  1 
HETATM 4624 C C5  . NAG C 3 .   ? 23.322  41.343 50.632 1.00 73.57 ? 2   NAG C C5  1 
HETATM 4625 C C6  . NAG C 3 .   ? 23.842  42.596 51.312 1.00 73.27 ? 2   NAG C C6  1 
HETATM 4626 C C7  . NAG C 3 .   ? 19.590  38.159 48.598 1.00 73.24 ? 2   NAG C C7  1 
HETATM 4627 C C8  . NAG C 3 .   ? 19.499  37.331 47.326 1.00 73.30 ? 2   NAG C C8  1 
HETATM 4628 N N2  . NAG C 3 .   ? 20.807  38.367 49.095 1.00 73.29 ? 2   NAG C N2  1 
HETATM 4629 O O3  . NAG C 3 .   ? 21.576  40.609 47.390 1.00 73.24 ? 2   NAG C O3  1 
HETATM 4630 O O4  . NAG C 3 .   ? 23.860  42.096 48.383 1.00 74.65 ? 2   NAG C O4  1 
HETATM 4631 O O5  . NAG C 3 .   ? 22.264  40.820 51.458 1.00 72.62 ? 2   NAG C O5  1 
HETATM 4632 O O6  . NAG C 3 .   ? 23.953  42.408 52.716 1.00 73.99 ? 2   NAG C O6  1 
HETATM 4633 O O7  . NAG C 3 .   ? 18.563  38.602 49.119 1.00 72.57 ? 2   NAG C O7  1 
HETATM 4634 C C1  . BMA C 3 .   ? 23.726  43.411 47.968 1.00 74.20 ? 3   BMA C C1  1 
HETATM 4635 C C2  . BMA C 3 .   ? 25.014  43.900 47.288 1.00 74.83 ? 3   BMA C C2  1 
HETATM 4636 C C3  . BMA C 3 .   ? 24.802  45.330 46.764 1.00 74.38 ? 3   BMA C C3  1 
HETATM 4637 C C4  . BMA C 3 .   ? 23.548  45.404 45.877 1.00 73.37 ? 3   BMA C C4  1 
HETATM 4638 C C5  . BMA C 3 .   ? 22.344  44.825 46.632 1.00 72.67 ? 3   BMA C C5  1 
HETATM 4639 C C6  . BMA C 3 .   ? 21.060  44.772 45.822 1.00 71.02 ? 3   BMA C C6  1 
HETATM 4640 O O2  . BMA C 3 .   ? 25.366  43.031 46.217 1.00 74.24 ? 3   BMA C O2  1 
HETATM 4641 O O3  . BMA C 3 .   ? 25.943  45.756 46.030 1.00 74.61 ? 3   BMA C O3  1 
HETATM 4642 O O4  . BMA C 3 .   ? 23.289  46.757 45.529 1.00 73.00 ? 3   BMA C O4  1 
HETATM 4643 O O5  . BMA C 3 .   ? 22.630  43.476 47.050 1.00 73.29 ? 3   BMA C O5  1 
HETATM 4644 O O6  . BMA C 3 .   ? 20.140  43.863 46.462 1.00 68.28 ? 3   BMA C O6  1 
HETATM 4645 C C1  . MAN C 3 .   ? 18.840  43.914 45.941 1.00 65.08 ? 4   MAN C C1  1 
HETATM 4646 C C2  . MAN C 3 .   ? 17.882  43.221 46.917 1.00 63.05 ? 4   MAN C C2  1 
HETATM 4647 C C3  . MAN C 3 .   ? 18.212  41.728 46.964 1.00 61.44 ? 4   MAN C C3  1 
HETATM 4648 C C4  . MAN C 3 .   ? 18.094  41.135 45.557 1.00 61.06 ? 4   MAN C C4  1 
HETATM 4649 C C5  . MAN C 3 .   ? 19.017  41.894 44.593 1.00 61.78 ? 4   MAN C C5  1 
HETATM 4650 C C6  . MAN C 3 .   ? 18.841  41.449 43.153 1.00 60.43 ? 4   MAN C C6  1 
HETATM 4651 O O2  . MAN C 3 .   ? 16.521  43.406 46.477 1.00 62.63 ? 4   MAN C O2  1 
HETATM 4652 O O3  . MAN C 3 .   ? 17.332  41.062 47.854 1.00 59.80 ? 4   MAN C O3  1 
HETATM 4653 O O4  . MAN C 3 .   ? 18.451  39.763 45.581 1.00 60.05 ? 4   MAN C O4  1 
HETATM 4654 O O5  . MAN C 3 .   ? 18.739  43.317 44.640 1.00 63.78 ? 4   MAN C O5  1 
HETATM 4655 O O6  . MAN C 3 .   ? 19.534  42.307 42.259 1.00 58.65 ? 4   MAN C O6  1 
HETATM 4656 C C1  . NAG C 3 .   ? 15.832  44.495 46.991 1.00 62.93 ? 5   NAG C C1  1 
HETATM 4657 C C2  . NAG C 3 .   ? 14.486  44.632 46.265 1.00 62.87 ? 5   NAG C C2  1 
HETATM 4658 C C3  . NAG C 3 .   ? 13.689  45.781 46.892 1.00 62.68 ? 5   NAG C C3  1 
HETATM 4659 C C4  . NAG C 3 .   ? 13.505  45.509 48.388 1.00 62.92 ? 5   NAG C C4  1 
HETATM 4660 C C5  . NAG C 3 .   ? 14.876  45.331 49.049 1.00 63.05 ? 5   NAG C C5  1 
HETATM 4661 C C6  . NAG C 3 .   ? 14.756  44.967 50.520 1.00 62.82 ? 5   NAG C C6  1 
HETATM 4662 C C7  . NAG C 3 .   ? 14.837  43.833 44.010 1.00 59.44 ? 5   NAG C C7  1 
HETATM 4663 C C8  . NAG C 3 .   ? 16.072  43.838 43.127 1.00 58.96 ? 5   NAG C C8  1 
HETATM 4664 N N2  . NAG C 3 .   ? 14.682  44.861 44.843 1.00 61.25 ? 5   NAG C N2  1 
HETATM 4665 O O3  . NAG C 3 .   ? 12.422  45.894 46.262 1.00 63.06 ? 5   NAG C O3  1 
HETATM 4666 O O4  . NAG C 3 .   ? 12.810  46.584 49.000 1.00 62.29 ? 5   NAG C O4  1 
HETATM 4667 O O5  . NAG C 3 .   ? 15.616  44.264 48.399 1.00 63.53 ? 5   NAG C O5  1 
HETATM 4668 O O6  . NAG C 3 .   ? 13.853  43.887 50.712 1.00 60.34 ? 5   NAG C O6  1 
HETATM 4669 O O7  . NAG C 3 .   ? 14.037  42.900 43.936 1.00 57.77 ? 5   NAG C O7  1 
HETATM 4670 C C1  . FUL C 3 .   ? 19.843  41.211 53.772 1.00 71.46 ? 6   FUL C C1  1 
HETATM 4671 C C2  . FUL C 3 .   ? 19.647  42.303 54.840 1.00 71.94 ? 6   FUL C C2  1 
HETATM 4672 O O2  . FUL C 3 .   ? 20.406  41.990 55.997 1.00 71.47 ? 6   FUL C O2  1 
HETATM 4673 C C3  . FUL C 3 .   ? 20.079  43.668 54.299 1.00 72.96 ? 6   FUL C C3  1 
HETATM 4674 O O3  . FUL C 3 .   ? 19.799  44.676 55.259 1.00 73.41 ? 6   FUL C O3  1 
HETATM 4675 C C4  . FUL C 3 .   ? 19.333  43.967 52.995 1.00 73.36 ? 6   FUL C C4  1 
HETATM 4676 O O4  . FUL C 3 .   ? 17.936  44.053 53.251 1.00 73.68 ? 6   FUL C O4  1 
HETATM 4677 C C5  . FUL C 3 .   ? 19.594  42.840 51.998 1.00 73.30 ? 6   FUL C C5  1 
HETATM 4678 C C6  . FUL C 3 .   ? 18.835  43.024 50.696 1.00 73.26 ? 6   FUL C C6  1 
HETATM 4679 O O5  . FUL C 3 .   ? 19.167  41.583 52.568 1.00 72.64 ? 6   FUL C O5  1 
HETATM 4680 C C1  . NAG D 4 .   ? -10.499 15.855 53.481 1.00 55.91 ? 619 NAG A C1  1 
HETATM 4681 C C2  . NAG D 4 .   ? -11.157 14.614 52.858 1.00 58.69 ? 619 NAG A C2  1 
HETATM 4682 C C3  . NAG D 4 .   ? -10.459 13.323 53.312 1.00 59.94 ? 619 NAG A C3  1 
HETATM 4683 C C4  . NAG D 4 .   ? -8.950  13.428 53.080 1.00 59.37 ? 619 NAG A C4  1 
HETATM 4684 C C5  . NAG D 4 .   ? -8.428  14.674 53.787 1.00 58.86 ? 619 NAG A C5  1 
HETATM 4685 C C6  . NAG D 4 .   ? -6.924  14.849 53.638 1.00 58.90 ? 619 NAG A C6  1 
HETATM 4686 C C7  . NAG D 4 .   ? -13.496 14.476 52.319 1.00 63.90 ? 619 NAG A C7  1 
HETATM 4687 C C8  . NAG D 4 .   ? -14.933 14.360 52.806 1.00 63.39 ? 619 NAG A C8  1 
HETATM 4688 N N2  . NAG D 4 .   ? -12.551 14.564 53.248 1.00 61.71 ? 619 NAG A N2  1 
HETATM 4689 O O3  . NAG D 4 .   ? -10.985 12.213 52.594 1.00 59.85 ? 619 NAG A O3  1 
HETATM 4690 O O4  . NAG D 4 .   ? -8.294  12.275 53.586 1.00 60.37 ? 619 NAG A O4  1 
HETATM 4691 O O5  . NAG D 4 .   ? -9.079  15.848 53.242 1.00 57.50 ? 619 NAG A O5  1 
HETATM 4692 O O6  . NAG D 4 .   ? -6.602  15.982 52.844 1.00 60.34 ? 619 NAG A O6  1 
HETATM 4693 O O7  . NAG D 4 .   ? -13.250 14.484 51.109 1.00 64.87 ? 619 NAG A O7  1 
HETATM 4694 C C1  . G2F E 5 .   ? 26.292  25.169 35.802 1.00 28.72 ? 620 G2F A C1  1 
HETATM 4695 C C2  . G2F E 5 .   ? 25.228  24.967 36.827 1.00 29.48 ? 620 G2F A C2  1 
HETATM 4696 C C3  . G2F E 5 .   ? 24.268  23.875 36.311 1.00 28.70 ? 620 G2F A C3  1 
HETATM 4697 C C4  . G2F E 5 .   ? 23.648  24.381 35.001 1.00 29.02 ? 620 G2F A C4  1 
HETATM 4698 C C5  . G2F E 5 .   ? 24.784  24.615 33.957 1.00 28.57 ? 620 G2F A C5  1 
HETATM 4699 C C6  . G2F E 5 .   ? 24.290  25.174 32.587 1.00 26.47 ? 620 G2F A C6  1 
HETATM 4700 O O3  . G2F E 5 .   ? 23.246  23.653 37.285 1.00 28.97 ? 620 G2F A O3  1 
HETATM 4701 O O4  . G2F E 5 .   ? 22.732  23.427 34.464 1.00 29.86 ? 620 G2F A O4  1 
HETATM 4702 O O5  . G2F E 5 .   ? 25.727  25.571 34.513 1.00 28.39 ? 620 G2F A O5  1 
HETATM 4703 O O6  . G2F E 5 .   ? 23.891  26.535 32.708 1.00 27.33 ? 620 G2F A O6  1 
HETATM 4704 F F2  . G2F E 5 .   ? 25.823  24.570 38.030 1.00 29.06 ? 620 G2F A F2  1 
HETATM 4705 O O   . HOH F 6 .   ? 34.586  19.569 40.438 1.00 8.92  ? 700 HOH A O   1 
HETATM 4706 O O   . HOH F 6 .   ? 2.747   28.090 38.188 1.00 15.00 ? 701 HOH A O   1 
HETATM 4707 O O   . HOH F 6 .   ? 10.209  21.541 34.265 1.00 5.29  ? 702 HOH A O   1 
HETATM 4708 O O   . HOH F 6 .   ? 15.099  27.852 29.831 1.00 11.81 ? 703 HOH A O   1 
HETATM 4709 O O   . HOH F 6 .   ? 7.405   29.056 51.469 1.00 15.17 ? 704 HOH A O   1 
HETATM 4710 O O   . HOH F 6 .   ? 12.069  34.369 24.800 1.00 8.65  ? 705 HOH A O   1 
HETATM 4711 O O   . HOH F 6 .   ? 16.218  31.282 33.335 1.00 18.09 ? 706 HOH A O   1 
HETATM 4712 O O   . HOH F 6 .   ? 19.778  24.347 37.249 1.00 27.17 ? 707 HOH A O   1 
HETATM 4713 O O   . HOH F 6 .   ? 10.650  22.374 39.093 1.00 9.61  ? 708 HOH A O   1 
HETATM 4714 O O   . HOH F 6 .   ? 13.393  23.318 40.137 1.00 16.84 ? 709 HOH A O   1 
HETATM 4715 O O   . HOH F 6 .   ? 12.284  35.447 38.818 1.00 16.84 ? 710 HOH A O   1 
HETATM 4716 O O   . HOH F 6 .   ? 29.735  21.074 13.627 1.00 21.01 ? 711 HOH A O   1 
HETATM 4717 O O   . HOH F 6 .   ? 11.514  18.927 37.996 1.00 12.91 ? 712 HOH A O   1 
HETATM 4718 O O   . HOH F 6 .   ? 8.408   25.188 44.423 1.00 14.81 ? 713 HOH A O   1 
HETATM 4719 O O   . HOH F 6 .   ? 8.912   28.998 40.075 1.00 31.99 ? 714 HOH A O   1 
HETATM 4720 O O   . HOH F 6 .   ? 4.872   32.646 30.813 1.00 23.63 ? 715 HOH A O   1 
HETATM 4721 O O   . HOH F 6 .   ? 11.660  35.044 45.202 1.00 22.14 ? 716 HOH A O   1 
HETATM 4722 O O   . HOH F 6 .   ? 16.174  16.653 43.931 1.00 20.77 ? 717 HOH A O   1 
HETATM 4723 O O   . HOH F 6 .   ? 9.894   20.760 36.755 1.00 8.98  ? 718 HOH A O   1 
HETATM 4724 O O   . HOH F 6 .   ? 37.718  20.811 16.734 1.00 4.81  ? 719 HOH A O   1 
HETATM 4725 O O   . HOH F 6 .   ? 13.415  20.199 36.335 1.00 14.08 ? 720 HOH A O   1 
HETATM 4726 O O   . HOH F 6 .   ? -7.683  34.103 68.545 1.00 31.22 ? 721 HOH A O   1 
HETATM 4727 O O   . HOH F 6 .   ? -0.260  17.912 47.737 1.00 26.98 ? 722 HOH A O   1 
HETATM 4728 O O   . HOH F 6 .   ? 15.065  31.787 43.864 1.00 11.84 ? 723 HOH A O   1 
HETATM 4729 O O   . HOH F 6 .   ? 11.104  21.523 17.170 1.00 27.75 ? 724 HOH A O   1 
HETATM 4730 O O   . HOH F 6 .   ? 22.386  34.188 18.986 1.00 13.34 ? 725 HOH A O   1 
HETATM 4731 O O   . HOH F 6 .   ? 5.970   43.313 52.441 1.00 24.76 ? 726 HOH A O   1 
HETATM 4732 O O   . HOH F 6 .   ? 31.754  17.234 11.714 1.00 21.51 ? 727 HOH A O   1 
HETATM 4733 O O   . HOH F 6 .   ? 12.502  20.264 33.852 1.00 17.25 ? 728 HOH A O   1 
HETATM 4734 O O   . HOH F 6 .   ? -1.666  21.647 49.138 1.00 23.82 ? 729 HOH A O   1 
HETATM 4735 O O   . HOH F 6 .   ? 16.163  22.533 39.358 1.00 17.16 ? 730 HOH A O   1 
HETATM 4736 O O   . HOH F 6 .   ? -14.953 41.424 42.834 1.00 18.96 ? 731 HOH A O   1 
HETATM 4737 O O   . HOH F 6 .   ? 26.613  24.442 42.187 1.00 32.96 ? 732 HOH A O   1 
HETATM 4738 O O   . HOH F 6 .   ? 19.502  10.043 14.834 1.00 17.92 ? 733 HOH A O   1 
HETATM 4739 O O   . HOH F 6 .   ? 19.951  27.851 42.711 1.00 23.95 ? 734 HOH A O   1 
HETATM 4740 O O   . HOH F 6 .   ? 30.736  16.633 45.674 1.00 40.21 ? 735 HOH A O   1 
HETATM 4741 O O   . HOH F 6 .   ? 15.474  20.161 38.055 1.00 11.12 ? 736 HOH A O   1 
HETATM 4742 O O   . HOH F 6 .   ? -8.792  24.731 50.913 1.00 18.76 ? 737 HOH A O   1 
HETATM 4743 O O   . HOH F 6 .   ? 13.573  33.108 45.907 1.00 14.82 ? 738 HOH A O   1 
HETATM 4744 O O   . HOH F 6 .   ? -1.441  32.926 33.913 1.00 7.73  ? 739 HOH A O   1 
HETATM 4745 O O   . HOH F 6 .   ? 17.378  27.459 48.458 1.00 19.38 ? 740 HOH A O   1 
HETATM 4746 O O   . HOH F 6 .   ? 11.906  28.936 61.952 1.00 18.72 ? 741 HOH A O   1 
HETATM 4747 O O   . HOH F 6 .   ? 25.145  21.485 49.501 1.00 16.23 ? 742 HOH A O   1 
HETATM 4748 O O   . HOH F 6 .   ? 3.098   42.764 45.772 1.00 23.89 ? 743 HOH A O   1 
HETATM 4749 O O   . HOH F 6 .   ? 36.092  25.199 30.460 1.00 29.24 ? 744 HOH A O   1 
HETATM 4750 O O   . HOH F 6 .   ? 23.360  15.663 46.481 1.00 19.26 ? 745 HOH A O   1 
HETATM 4751 O O   . HOH F 6 .   ? 34.355  23.075 31.964 1.00 24.34 ? 746 HOH A O   1 
HETATM 4752 O O   . HOH F 6 .   ? 5.408   25.935 45.080 1.00 22.87 ? 747 HOH A O   1 
HETATM 4753 O O   . HOH F 6 .   ? 12.145  35.152 58.451 1.00 21.50 ? 748 HOH A O   1 
HETATM 4754 O O   . HOH F 6 .   ? -2.807  31.065 37.285 1.00 21.22 ? 749 HOH A O   1 
HETATM 4755 O O   . HOH F 6 .   ? -7.220  32.488 64.058 1.00 25.95 ? 750 HOH A O   1 
HETATM 4756 O O   . HOH F 6 .   ? 34.050  20.401 7.025  1.00 17.73 ? 751 HOH A O   1 
HETATM 4757 O O   . HOH F 6 .   ? 13.273  8.318  29.642 1.00 18.34 ? 752 HOH A O   1 
HETATM 4758 O O   . HOH F 6 .   ? 22.867  15.177 42.470 1.00 11.58 ? 753 HOH A O   1 
HETATM 4759 O O   . HOH F 6 .   ? 6.324   10.399 28.612 1.00 31.83 ? 754 HOH A O   1 
HETATM 4760 O O   . HOH F 6 .   ? 9.500   40.076 52.269 1.00 14.97 ? 755 HOH A O   1 
HETATM 4761 O O   . HOH F 6 .   ? -0.395  21.441 53.475 1.00 30.41 ? 756 HOH A O   1 
HETATM 4762 O O   . HOH F 6 .   ? 4.465   41.388 38.421 1.00 16.87 ? 757 HOH A O   1 
HETATM 4763 O O   . HOH F 6 .   ? 16.206  36.630 29.373 1.00 17.41 ? 758 HOH A O   1 
HETATM 4764 O O   . HOH F 6 .   ? -8.360  30.426 42.320 1.00 20.86 ? 759 HOH A O   1 
HETATM 4765 O O   . HOH F 6 .   ? 7.314   43.658 45.159 1.00 22.68 ? 760 HOH A O   1 
HETATM 4766 O O   . HOH F 6 .   ? 8.227   32.578 30.921 1.00 18.98 ? 761 HOH A O   1 
HETATM 4767 O O   . HOH F 6 .   ? -11.037 30.690 70.147 1.00 27.60 ? 762 HOH A O   1 
HETATM 4768 O O   . HOH F 6 .   ? 21.529  31.381 14.875 1.00 16.35 ? 763 HOH A O   1 
HETATM 4769 O O   . HOH F 6 .   ? 13.981  35.854 28.051 1.00 11.85 ? 764 HOH A O   1 
HETATM 4770 O O   . HOH F 6 .   ? 13.914  35.931 25.256 1.00 15.65 ? 765 HOH A O   1 
HETATM 4771 O O   . HOH F 6 .   ? 15.839  19.091 16.293 1.00 21.14 ? 766 HOH A O   1 
HETATM 4772 O O   . HOH F 6 .   ? 2.394   37.426 43.198 1.00 10.67 ? 767 HOH A O   1 
HETATM 4773 O O   . HOH F 6 .   ? -8.488  32.573 40.297 1.00 20.84 ? 768 HOH A O   1 
HETATM 4774 O O   . HOH F 6 .   ? 23.970  13.712 44.566 1.00 16.91 ? 769 HOH A O   1 
HETATM 4775 O O   . HOH F 6 .   ? 19.710  20.533 57.492 1.00 24.65 ? 770 HOH A O   1 
HETATM 4776 O O   . HOH F 6 .   ? 14.510  13.511 17.149 1.00 22.36 ? 771 HOH A O   1 
HETATM 4777 O O   . HOH F 6 .   ? 48.550  20.728 25.103 1.00 28.04 ? 772 HOH A O   1 
HETATM 4778 O O   . HOH F 6 .   ? 12.115  38.024 27.552 1.00 23.39 ? 773 HOH A O   1 
HETATM 4779 O O   . HOH F 6 .   ? -13.674 31.645 41.751 1.00 23.26 ? 774 HOH A O   1 
HETATM 4780 O O   . HOH F 6 .   ? 39.998  17.762 10.171 1.00 14.41 ? 775 HOH A O   1 
HETATM 4781 O O   . HOH F 6 .   ? -5.609  27.771 34.654 1.00 16.96 ? 776 HOH A O   1 
HETATM 4782 O O   . HOH F 6 .   ? 35.131  22.132 39.737 1.00 26.88 ? 777 HOH A O   1 
HETATM 4783 O O   . HOH F 6 .   ? -10.101 32.388 62.100 1.00 22.50 ? 778 HOH A O   1 
HETATM 4784 O O   . HOH F 6 .   ? 21.722  33.753 16.236 1.00 11.33 ? 779 HOH A O   1 
HETATM 4785 O O   . HOH F 6 .   ? 14.719  20.709 49.181 1.00 35.55 ? 780 HOH A O   1 
HETATM 4786 O O   . HOH F 6 .   ? 11.204  39.609 30.103 1.00 39.97 ? 781 HOH A O   1 
HETATM 4787 O O   . HOH F 6 .   ? 5.240   38.364 65.302 1.00 21.23 ? 782 HOH A O   1 
HETATM 4788 O O   . HOH F 6 .   ? 17.783  30.903 63.440 1.00 25.49 ? 783 HOH A O   1 
HETATM 4789 O O   . HOH F 6 .   ? 15.907  37.121 17.225 1.00 28.09 ? 784 HOH A O   1 
HETATM 4790 O O   . HOH F 6 .   ? 15.325  21.820 55.982 1.00 22.55 ? 785 HOH A O   1 
HETATM 4791 O O   . HOH F 6 .   ? 10.174  18.800 16.930 1.00 29.77 ? 786 HOH A O   1 
HETATM 4792 O O   . HOH F 6 .   ? 17.256  19.767 56.461 1.00 23.77 ? 787 HOH A O   1 
HETATM 4793 O O   . HOH F 6 .   ? 16.945  39.520 55.825 1.00 34.41 ? 788 HOH A O   1 
HETATM 4794 O O   . HOH F 6 .   ? 34.724  23.954 41.637 1.00 33.19 ? 789 HOH A O   1 
HETATM 4795 O O   . HOH F 6 .   ? -4.789  38.213 63.324 1.00 25.62 ? 790 HOH A O   1 
HETATM 4796 O O   . HOH F 6 .   ? 12.351  18.301 14.797 1.00 32.08 ? 791 HOH A O   1 
HETATM 4797 O O   . HOH F 6 .   ? 14.370  18.194 11.573 1.00 27.25 ? 792 HOH A O   1 
HETATM 4798 O O   . HOH F 6 .   ? -18.586 32.359 49.620 1.00 22.20 ? 793 HOH A O   1 
HETATM 4799 O O   . HOH F 6 .   ? 10.099  38.935 15.637 1.00 31.54 ? 794 HOH A O   1 
HETATM 4800 O O   . HOH F 6 .   ? 19.849  9.943  46.009 1.00 17.43 ? 795 HOH A O   1 
HETATM 4801 O O   . HOH F 6 .   ? -12.436 33.266 36.897 1.00 37.96 ? 796 HOH A O   1 
HETATM 4802 O O   . HOH F 6 .   ? 13.781  20.833 17.750 1.00 28.77 ? 797 HOH A O   1 
HETATM 4803 O O   . HOH F 6 .   ? -10.690 31.241 38.747 1.00 38.14 ? 798 HOH A O   1 
HETATM 4804 O O   . HOH F 6 .   ? 20.770  11.782 44.255 1.00 26.98 ? 799 HOH A O   1 
HETATM 4805 O O   . HOH F 6 .   ? 15.829  22.007 16.484 1.00 10.93 ? 800 HOH A O   1 
HETATM 4806 O O   . HOH F 6 .   ? 30.048  1.978  30.958 1.00 25.85 ? 801 HOH A O   1 
HETATM 4807 O O   . HOH F 6 .   ? 37.525  28.340 29.980 1.00 30.14 ? 802 HOH A O   1 
HETATM 4808 O O   . HOH F 6 .   ? 34.664  22.106 45.406 1.00 26.14 ? 803 HOH A O   1 
HETATM 4809 O O   . HOH F 6 .   ? 33.753  26.346 42.745 1.00 30.09 ? 804 HOH A O   1 
HETATM 4810 O O   . HOH F 6 .   ? 39.901  30.722 24.084 1.00 36.60 ? 805 HOH A O   1 
HETATM 4811 O O   . HOH F 6 .   ? 28.003  14.985 5.117  1.00 30.85 ? 806 HOH A O   1 
HETATM 4812 O O   . HOH F 6 .   ? 46.776  10.433 22.105 1.00 43.46 ? 807 HOH A O   1 
HETATM 4813 O O   . HOH F 6 .   ? 24.222  0.159  30.251 1.00 36.75 ? 808 HOH A O   1 
HETATM 4814 O O   . HOH F 6 .   ? -16.710 30.827 48.816 1.00 14.19 ? 809 HOH A O   1 
HETATM 4815 O O   . HOH F 6 .   ? 38.142  30.673 21.606 1.00 30.86 ? 810 HOH A O   1 
HETATM 4816 O O   . HOH F 6 .   ? 42.375  15.988 12.881 1.00 25.70 ? 811 HOH A O   1 
HETATM 4817 O O   . HOH F 6 .   ? 6.108   32.630 20.993 1.00 29.02 ? 812 HOH A O   1 
HETATM 4818 O O   . HOH F 6 .   ? 41.903  21.736 16.230 1.00 34.78 ? 813 HOH A O   1 
HETATM 4819 O O   . HOH F 6 .   ? 10.815  27.245 68.729 1.00 44.00 ? 814 HOH A O   1 
HETATM 4820 O O   . HOH F 6 .   ? 36.474  18.947 6.351  1.00 39.75 ? 815 HOH A O   1 
HETATM 4821 O O   . HOH F 6 .   ? 1.354   50.631 50.128 1.00 24.56 ? 816 HOH A O   1 
HETATM 4822 O O   . HOH F 6 .   ? 18.336  11.527 52.162 1.00 27.40 ? 817 HOH A O   1 
HETATM 4823 O O   . HOH F 6 .   ? 16.309  36.172 50.274 1.00 31.66 ? 818 HOH A O   1 
HETATM 4824 O O   . HOH F 6 .   ? 15.112  40.732 42.366 1.00 33.01 ? 819 HOH A O   1 
HETATM 4825 O O   . HOH F 6 .   ? -4.536  19.864 47.153 1.00 27.33 ? 820 HOH A O   1 
HETATM 4826 O O   . HOH F 6 .   ? -5.488  23.487 41.462 1.00 32.31 ? 821 HOH A O   1 
HETATM 4827 O O   . HOH F 6 .   ? 32.054  4.182  -4.149 1.00 28.76 ? 822 HOH A O   1 
HETATM 4828 O O   . HOH F 6 .   ? 14.553  28.270 10.504 1.00 39.25 ? 823 HOH A O   1 
HETATM 4829 O O   . HOH F 6 .   ? 6.538   31.941 17.625 1.00 24.35 ? 824 HOH A O   1 
HETATM 4830 O O   . HOH F 6 .   ? 34.609  2.730  14.843 1.00 25.08 ? 825 HOH A O   1 
HETATM 4831 O O   . HOH F 6 .   ? 28.743  30.817 50.196 1.00 32.11 ? 826 HOH A O   1 
HETATM 4832 O O   . HOH F 6 .   ? -1.162  24.698 17.647 1.00 27.22 ? 827 HOH A O   1 
HETATM 4833 O O   . HOH F 6 .   ? 34.743  8.025  5.089  1.00 30.48 ? 828 HOH A O   1 
HETATM 4834 O O   . HOH F 6 .   ? 30.264  16.728 2.799  1.00 38.33 ? 829 HOH A O   1 
HETATM 4835 O O   . HOH F 6 .   ? 1.357   15.548 49.612 1.00 13.47 ? 830 HOH A O   1 
HETATM 4836 O O   . HOH F 6 .   ? 28.131  30.576 52.852 1.00 40.67 ? 831 HOH A O   1 
HETATM 4837 O O   . HOH F 6 .   ? 18.933  0.602  17.477 1.00 29.48 ? 832 HOH A O   1 
HETATM 4838 O O   . HOH F 6 .   ? -11.008 24.436 57.334 1.00 22.92 ? 833 HOH A O   1 
HETATM 4839 O O   . HOH F 6 .   ? -14.916 28.948 50.529 1.00 16.02 ? 834 HOH A O   1 
HETATM 4840 O O   . HOH F 6 .   ? 7.862   17.986 15.977 1.00 22.95 ? 835 HOH A O   1 
HETATM 4841 O O   . HOH F 6 .   ? 43.048  12.823 12.412 1.00 21.43 ? 836 HOH A O   1 
HETATM 4842 O O   . HOH F 6 .   ? -22.759 38.522 43.015 1.00 47.59 ? 837 HOH A O   1 
HETATM 4843 O O   . HOH F 6 .   ? 24.928  34.811 18.683 1.00 18.43 ? 838 HOH A O   1 
HETATM 4844 O O   . HOH F 6 .   ? -3.851  25.904 63.539 1.00 33.28 ? 839 HOH A O   1 
HETATM 4845 O O   . HOH F 6 .   ? 23.614  14.643 55.913 1.00 22.83 ? 840 HOH A O   1 
HETATM 4846 O O   . HOH F 6 .   ? 25.625  15.111 53.489 1.00 21.85 ? 841 HOH A O   1 
HETATM 4847 O O   . HOH F 6 .   ? 35.897  6.855  30.882 1.00 39.33 ? 842 HOH A O   1 
HETATM 4848 O O   . HOH F 6 .   ? 24.438  29.447 59.711 1.00 24.16 ? 843 HOH A O   1 
HETATM 4849 O O   . HOH F 6 .   ? -1.197  28.026 22.124 1.00 24.52 ? 844 HOH A O   1 
HETATM 4850 O O   . HOH F 6 .   ? 24.885  13.287 8.204  1.00 28.31 ? 845 HOH A O   1 
HETATM 4851 O O   . HOH F 6 .   ? -9.452  30.593 35.465 1.00 20.65 ? 846 HOH A O   1 
HETATM 4852 O O   . HOH F 6 .   ? 7.448   34.006 23.421 1.00 29.55 ? 847 HOH A O   1 
HETATM 4853 O O   . HOH F 6 .   ? 44.184  14.293 10.531 1.00 34.42 ? 848 HOH A O   1 
HETATM 4854 O O   . HOH F 6 .   ? -10.732 46.274 58.495 1.00 26.84 ? 849 HOH A O   1 
HETATM 4855 O O   . HOH F 6 .   ? 35.221  13.721 44.082 1.00 45.49 ? 850 HOH A O   1 
HETATM 4856 O O   . HOH F 6 .   ? 34.730  22.789 8.385  1.00 16.54 ? 851 HOH A O   1 
HETATM 4857 O O   . HOH F 6 .   ? 27.770  16.776 54.813 1.00 34.88 ? 852 HOH A O   1 
HETATM 4858 O O   . HOH F 6 .   ? 33.967  33.068 18.581 1.00 25.26 ? 853 HOH A O   1 
HETATM 4859 O O   . HOH F 6 .   ? -13.150 32.173 56.878 1.00 36.73 ? 854 HOH A O   1 
HETATM 4860 O O   . HOH F 6 .   ? 16.819  39.187 43.554 1.00 23.12 ? 855 HOH A O   1 
HETATM 4861 O O   . HOH F 6 .   ? 11.843  39.085 58.448 1.00 29.53 ? 856 HOH A O   1 
HETATM 4862 O O   . HOH F 6 .   ? 9.347   4.832  35.003 1.00 23.44 ? 857 HOH A O   1 
HETATM 4863 O O   . HOH F 6 .   ? -6.008  23.443 37.348 1.00 46.95 ? 858 HOH A O   1 
HETATM 4864 O O   . HOH F 6 .   ? -1.337  39.444 64.920 1.00 31.66 ? 859 HOH A O   1 
HETATM 4865 O O   . HOH F 6 .   ? 16.106  34.429 15.996 1.00 25.27 ? 860 HOH A O   1 
HETATM 4866 O O   . HOH F 6 .   ? -6.444  48.743 45.063 1.00 19.65 ? 861 HOH A O   1 
HETATM 4867 O O   . HOH F 6 .   ? 9.022   43.438 19.175 1.00 28.83 ? 862 HOH A O   1 
HETATM 4868 O O   . HOH F 6 .   ? 19.553  32.483 12.855 1.00 47.39 ? 863 HOH A O   1 
HETATM 4869 O O   . HOH F 6 .   ? 5.793   15.609 26.018 1.00 24.86 ? 864 HOH A O   1 
HETATM 4870 O O   . HOH F 6 .   ? 0.310   41.448 64.693 1.00 37.72 ? 865 HOH A O   1 
HETATM 4871 O O   . HOH F 6 .   ? 18.505  20.306 68.314 1.00 36.60 ? 866 HOH A O   1 
HETATM 4872 O O   . HOH F 6 .   ? -6.453  46.560 42.745 1.00 30.04 ? 867 HOH A O   1 
HETATM 4873 O O   . HOH F 6 .   ? 4.500   30.296 19.902 1.00 31.71 ? 868 HOH A O   1 
HETATM 4874 O O   . HOH F 6 .   ? -4.969  33.805 70.429 1.00 55.19 ? 869 HOH A O   1 
HETATM 4875 O O   . HOH F 6 .   ? 26.452  21.448 56.564 1.00 30.78 ? 870 HOH A O   1 
HETATM 4876 O O   . HOH F 6 .   ? 6.657   45.390 36.747 1.00 26.71 ? 871 HOH A O   1 
HETATM 4877 O O   . HOH F 6 .   ? -11.176 30.341 43.112 1.00 30.36 ? 872 HOH A O   1 
HETATM 4878 O O   . HOH F 6 .   ? -12.543 44.718 43.576 1.00 34.26 ? 873 HOH A O   1 
HETATM 4879 O O   . HOH F 6 .   ? 33.081  3.645  24.385 1.00 23.71 ? 874 HOH A O   1 
HETATM 4880 O O   . HOH F 6 .   ? 22.061  -0.308 18.438 1.00 20.96 ? 875 HOH A O   1 
HETATM 4881 O O   . HOH F 6 .   ? -12.670 40.667 41.582 1.00 25.19 ? 876 HOH A O   1 
HETATM 4882 O O   . HOH F 6 .   ? -13.016 31.729 60.013 1.00 34.83 ? 877 HOH A O   1 
HETATM 4883 O O   . HOH F 6 .   ? 32.821  29.673 42.915 1.00 28.71 ? 878 HOH A O   1 
HETATM 4884 O O   . HOH F 6 .   ? 40.100  9.318  8.736  1.00 18.35 ? 879 HOH A O   1 
HETATM 4885 O O   . HOH F 6 .   ? -0.038  19.304 25.687 1.00 20.72 ? 880 HOH A O   1 
HETATM 4886 O O   . HOH F 6 .   ? -3.016  33.062 32.079 1.00 15.30 ? 881 HOH A O   1 
HETATM 4887 O O   . HOH F 6 .   ? 6.054   8.057  27.140 1.00 22.04 ? 882 HOH A O   1 
HETATM 4888 O O   . HOH F 6 .   ? 6.237   18.601 64.203 1.00 27.03 ? 883 HOH A O   1 
HETATM 4889 O O   . HOH F 6 .   ? 18.618  38.241 29.161 1.00 31.97 ? 884 HOH A O   1 
HETATM 4890 O O   . HOH F 6 .   ? 34.904  3.856  29.941 1.00 36.27 ? 885 HOH A O   1 
HETATM 4891 O O   . HOH F 6 .   ? 39.840  9.453  41.397 1.00 40.28 ? 886 HOH A O   1 
HETATM 4892 O O   . HOH F 6 .   ? 8.443   11.845 19.511 1.00 26.73 ? 887 HOH A O   1 
HETATM 4893 O O   . HOH F 6 .   ? 16.598  31.004 10.065 1.00 35.79 ? 888 HOH A O   1 
HETATM 4894 O O   . HOH F 6 .   ? -9.645  51.362 52.056 1.00 24.59 ? 889 HOH A O   1 
HETATM 4895 O O   . HOH F 6 .   ? 13.501  12.171 15.270 1.00 32.02 ? 890 HOH A O   1 
HETATM 4896 O O   . HOH F 6 .   ? -16.056 31.744 60.192 1.00 20.58 ? 891 HOH A O   1 
HETATM 4897 O O   . HOH F 6 .   ? 30.268  2.891  25.270 1.00 18.83 ? 892 HOH A O   1 
HETATM 4898 O O   . HOH F 6 .   ? 34.423  25.874 45.574 1.00 33.13 ? 893 HOH A O   1 
HETATM 4899 O O   . HOH F 6 .   ? 23.071  -2.236 33.678 1.00 21.51 ? 894 HOH A O   1 
HETATM 4900 O O   . HOH F 6 .   ? 4.401   45.176 44.448 1.00 20.90 ? 895 HOH A O   1 
HETATM 4901 O O   . HOH F 6 .   ? 37.984  5.885  28.175 1.00 25.33 ? 896 HOH A O   1 
HETATM 4902 O O   . HOH F 6 .   ? 35.957  32.831 22.162 1.00 30.54 ? 897 HOH A O   1 
HETATM 4903 O O   . HOH F 6 .   ? 25.402  33.982 29.128 1.00 29.41 ? 898 HOH A O   1 
HETATM 4904 O O   . HOH F 6 .   ? 7.430   41.532 19.788 1.00 30.01 ? 899 HOH A O   1 
HETATM 4905 O O   . HOH F 6 .   ? 21.063  37.157 36.523 1.00 17.76 ? 900 HOH A O   1 
HETATM 4906 O O   . HOH F 6 .   ? -4.524  19.727 35.221 1.00 36.71 ? 901 HOH A O   1 
HETATM 4907 O O   . HOH F 6 .   ? 31.413  30.984 52.814 1.00 36.41 ? 902 HOH A O   1 
HETATM 4908 O O   . HOH F 6 .   ? -12.143 20.102 44.569 1.00 25.92 ? 903 HOH A O   1 
HETATM 4909 O O   . HOH F 6 .   ? 37.988  16.933 53.248 1.00 31.91 ? 904 HOH A O   1 
HETATM 4910 O O   . HOH F 6 .   ? 47.342  26.114 39.880 1.00 27.17 ? 905 HOH A O   1 
HETATM 4911 O O   . HOH F 6 .   ? 47.982  7.691  27.650 1.00 36.77 ? 906 HOH A O   1 
HETATM 4912 O O   . HOH F 6 .   ? 9.875   34.908 60.796 1.00 28.35 ? 907 HOH A O   1 
HETATM 4913 O O   . HOH F 6 .   ? 35.324  29.628 36.765 1.00 35.31 ? 908 HOH A O   1 
HETATM 4914 O O   . HOH F 6 .   ? -18.759 23.626 52.053 1.00 35.91 ? 909 HOH A O   1 
HETATM 4915 O O   . HOH F 6 .   ? 3.017   26.136 16.028 1.00 33.69 ? 910 HOH A O   1 
HETATM 4916 O O   . HOH F 6 .   ? 10.226  44.664 46.970 1.00 30.12 ? 911 HOH A O   1 
HETATM 4917 O O   . HOH F 6 .   ? 40.732  17.448 43.254 1.00 27.97 ? 912 HOH A O   1 
HETATM 4918 O O   . HOH F 6 .   ? -12.158 49.245 59.397 1.00 33.89 ? 913 HOH A O   1 
HETATM 4919 O O   . HOH F 6 .   ? 37.637  9.346  45.253 1.00 36.99 ? 914 HOH A O   1 
HETATM 4920 O O   . HOH F 6 .   ? 19.357  11.775 58.605 1.00 33.14 ? 915 HOH A O   1 
HETATM 4921 O O   . HOH F 6 .   ? -0.633  53.145 61.916 1.00 33.56 ? 916 HOH A O   1 
HETATM 4922 O O   . HOH F 6 .   ? 30.295  -0.131 25.813 1.00 37.57 ? 917 HOH A O   1 
HETATM 4923 O O   . HOH F 6 .   ? 34.035  3.492  43.082 1.00 36.22 ? 918 HOH A O   1 
HETATM 4924 O O   . HOH F 6 .   ? 25.346  37.870 50.044 1.00 40.44 ? 919 HOH A O   1 
HETATM 4925 O O   . HOH F 6 .   ? 17.709  37.036 53.488 1.00 48.42 ? 920 HOH A O   1 
HETATM 4926 O O   . HOH F 6 .   ? 28.636  0.262  46.518 1.00 51.42 ? 921 HOH A O   1 
HETATM 4927 O O   . HOH F 6 .   ? 48.478  12.643 36.226 1.00 36.96 ? 922 HOH A O   1 
HETATM 4928 O O   . HOH F 6 .   ? 34.524  31.791 30.174 1.00 17.62 ? 923 HOH A O   1 
HETATM 4929 O O   . HOH F 6 .   ? 23.808  22.723 5.707  1.00 29.02 ? 924 HOH A O   1 
HETATM 4930 O O   . HOH F 6 .   ? 40.713  5.526  16.806 1.00 23.23 ? 925 HOH A O   1 
HETATM 4931 O O   . HOH F 6 .   ? 27.449  26.570 41.164 1.00 22.47 ? 926 HOH A O   1 
HETATM 4932 O O   . HOH F 6 .   ? 20.124  28.006 30.808 1.00 11.34 ? 927 HOH A O   1 
HETATM 4933 O O   . HOH F 6 .   ? -11.473 17.540 49.949 1.00 23.67 ? 928 HOH A O   1 
HETATM 4934 O O   . HOH F 6 .   ? 25.934  28.799 35.759 1.00 17.37 ? 929 HOH A O   1 
HETATM 4935 O O   . HOH F 6 .   ? 7.504   26.065 29.871 1.00 14.98 ? 930 HOH A O   1 
HETATM 4936 O O   . HOH F 6 .   ? 0.237   25.209 15.244 1.00 49.78 ? 931 HOH A O   1 
HETATM 4937 O O   . HOH F 6 .   ? 38.313  30.450 34.074 1.00 26.98 ? 932 HOH A O   1 
HETATM 4938 O O   . HOH F 6 .   ? 42.651  25.827 35.722 1.00 21.21 ? 933 HOH A O   1 
HETATM 4939 O O   . HOH F 6 .   ? 27.935  18.344 16.046 1.00 15.99 ? 934 HOH A O   1 
HETATM 4940 O O   . HOH F 6 .   ? 15.974  41.510 39.798 1.00 31.84 ? 935 HOH A O   1 
HETATM 4941 O O   . HOH F 6 .   ? 5.061   31.248 66.642 1.00 34.13 ? 936 HOH A O   1 
HETATM 4942 O O   . HOH F 6 .   ? -1.565  12.899 39.725 1.00 37.14 ? 937 HOH A O   1 
HETATM 4943 O O   . HOH F 6 .   ? 0.675   50.088 47.401 1.00 26.78 ? 938 HOH A O   1 
HETATM 4944 O O   . HOH F 6 .   ? 10.654  18.040 12.454 1.00 35.12 ? 939 HOH A O   1 
HETATM 4945 O O   . HOH F 6 .   ? 27.276  40.841 45.651 1.00 47.93 ? 940 HOH A O   1 
HETATM 4946 O O   . HOH F 6 .   ? 5.660   11.257 53.543 1.00 25.45 ? 941 HOH A O   1 
HETATM 4947 O O   . HOH F 6 .   ? 24.667  29.396 33.636 1.00 16.26 ? 942 HOH A O   1 
HETATM 4948 O O   . HOH F 6 .   ? 34.355  4.790  45.712 1.00 27.16 ? 943 HOH A O   1 
HETATM 4949 O O   . HOH F 6 .   ? 16.377  7.824  14.197 1.00 26.35 ? 944 HOH A O   1 
HETATM 4950 O O   . HOH F 6 .   ? 29.012  4.316  57.859 1.00 43.95 ? 945 HOH A O   1 
HETATM 4951 O O   . HOH F 6 .   ? 4.516   30.574 14.969 1.00 50.25 ? 946 HOH A O   1 
HETATM 4952 O O   . HOH F 6 .   ? -11.102 44.451 60.980 1.00 28.04 ? 947 HOH A O   1 
HETATM 4953 O O   . HOH F 6 .   ? 24.108  6.189  2.681  1.00 30.20 ? 948 HOH A O   1 
HETATM 4954 O O   . HOH F 6 .   ? 1.954   30.344 66.012 1.00 32.77 ? 949 HOH A O   1 
HETATM 4955 O O   . HOH F 6 .   ? 8.325   36.239 15.438 1.00 28.23 ? 950 HOH A O   1 
HETATM 4956 O O   . HOH F 6 .   ? 11.732  36.605 36.233 1.00 15.02 ? 951 HOH A O   1 
HETATM 4957 O O   . HOH F 6 .   ? 29.380  18.644 12.776 1.00 17.38 ? 952 HOH A O   1 
HETATM 4958 O O   . HOH F 6 .   ? 34.910  29.710 28.687 1.00 24.53 ? 953 HOH A O   1 
HETATM 4959 O O   . HOH F 6 .   ? 20.583  36.593 33.521 1.00 23.82 ? 954 HOH A O   1 
HETATM 4960 O O   . HOH F 6 .   ? -6.282  11.272 54.865 1.00 23.83 ? 955 HOH A O   1 
HETATM 4961 O O   . HOH F 6 .   ? 33.813  28.130 7.524  1.00 24.34 ? 956 HOH A O   1 
HETATM 4962 O O   . HOH F 6 .   ? -3.307  32.784 29.684 1.00 33.29 ? 957 HOH A O   1 
HETATM 4963 O O   . HOH F 6 .   ? 14.026  34.445 13.815 1.00 24.69 ? 958 HOH A O   1 
HETATM 4964 O O   . HOH F 6 .   ? 11.269  37.220 60.245 1.00 21.81 ? 959 HOH A O   1 
HETATM 4965 O O   . HOH F 6 .   ? 6.980   38.265 67.019 1.00 23.78 ? 960 HOH A O   1 
HETATM 4966 O O   . HOH F 6 .   ? 32.652  16.974 14.899 1.00 28.80 ? 961 HOH A O   1 
HETATM 4967 O O   . HOH F 6 .   ? 17.699  22.693 14.891 1.00 26.30 ? 962 HOH A O   1 
HETATM 4968 O O   . HOH F 6 .   ? -15.877 43.603 54.731 1.00 24.97 ? 963 HOH A O   1 
HETATM 4969 O O   . HOH F 6 .   ? 49.951  15.958 36.731 1.00 28.27 ? 964 HOH A O   1 
HETATM 4970 O O   . HOH F 6 .   ? 27.256  31.010 41.204 1.00 25.88 ? 965 HOH A O   1 
HETATM 4971 O O   . HOH F 6 .   ? 22.776  1.210  21.234 1.00 29.28 ? 966 HOH A O   1 
HETATM 4972 O O   . HOH F 6 .   ? 36.090  27.581 41.741 1.00 33.23 ? 967 HOH A O   1 
HETATM 4973 O O   . HOH F 6 .   ? -16.562 44.621 43.478 1.00 31.77 ? 968 HOH A O   1 
HETATM 4974 O O   . HOH F 6 .   ? 2.459   31.846 68.140 1.00 39.01 ? 969 HOH A O   1 
HETATM 4975 O O   . HOH F 6 .   ? -2.543  28.457 24.958 1.00 25.72 ? 970 HOH A O   1 
HETATM 4976 O O   . HOH F 6 .   ? 6.136   28.527 66.469 1.00 24.57 ? 971 HOH A O   1 
HETATM 4977 O O   . HOH F 6 .   ? 47.626  25.125 23.255 1.00 16.95 ? 972 HOH A O   1 
HETATM 4978 O O   . HOH F 6 .   ? 41.002  6.141  39.487 1.00 35.91 ? 973 HOH A O   1 
HETATM 4979 O O   . HOH F 6 .   ? 11.841  10.985 11.387 1.00 26.22 ? 974 HOH A O   1 
HETATM 4980 O O   . HOH F 6 .   ? 18.379  33.598 62.047 1.00 31.40 ? 975 HOH A O   1 
HETATM 4981 O O   . HOH F 6 .   ? -14.453 52.816 51.575 1.00 36.27 ? 976 HOH A O   1 
HETATM 4982 O O   . HOH F 6 .   ? -1.218  51.782 51.207 1.00 30.93 ? 977 HOH A O   1 
HETATM 4983 O O   . HOH F 6 .   ? -8.778  52.560 54.498 1.00 48.97 ? 978 HOH A O   1 
HETATM 4984 O O   . HOH F 6 .   ? -11.632 10.957 50.608 1.00 32.57 ? 979 HOH A O   1 
HETATM 4985 O O   . HOH F 6 .   ? 39.059  31.395 42.706 1.00 18.20 ? 980 HOH A O   1 
HETATM 4986 O O   . HOH F 6 .   ? -7.527  25.369 27.581 1.00 22.77 ? 981 HOH A O   1 
HETATM 4987 O O   . HOH F 6 .   ? 10.249  11.251 15.739 1.00 22.91 ? 982 HOH A O   1 
HETATM 4988 O O   . HOH F 6 .   ? 15.719  16.046 17.079 1.00 28.89 ? 983 HOH A O   1 
HETATM 4989 O O   . HOH F 6 .   ? 5.198   14.164 60.197 1.00 34.83 ? 984 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   TYR 2   2   2   TYR TYR A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  ARG 22  22  22  ARG ARG A . n 
A 1 23  MET 23  23  23  MET MET A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  TRP 70  70  70  TRP TRP A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ARG 85  85  85  ARG ARG A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ALA 96  96  96  ALA ALA A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 TYR 104 104 104 TYR TYR A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 ASP 120 120 120 ASP ASP A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 TYR 142 142 142 TYR TYR A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 PRO 146 146 146 PRO CPR A . n 
A 1 147 CYS 147 147 147 CYS CYS A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 TRP 156 156 156 TRP TRP A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 ASP 187 187 187 ASP ASP A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 ALA 196 196 196 ALA ALA A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 ALA 205 205 205 ALA ALA A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 HIS 207 207 207 HIS HIS A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 ILE 225 225 225 ILE ILE A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 ARG 227 227 227 ARG ARG A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 ASN 232 232 232 ASN ASN A . n 
A 1 233 ILE 233 233 233 ILE ILE A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 ASN 240 240 240 ASN ASN A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 MET 242 242 242 MET MET A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 MET 250 250 250 MET MET A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 TYR 253 253 253 TYR TYR A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 TRP 256 256 256 TRP TRP A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 HIS 262 262 262 HIS HIS A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 GLY 270 270 270 GLY GLY A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 ASP 290 290 290 ASP ASP A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 PRO 295 295 295 PRO CPR A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLY 297 297 297 GLY GLY A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 TYR 300 300 300 TYR TYR A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 TYR 302 302 302 TYR TYR A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 LYS 305 305 305 LYS LYS A . n 
A 1 306 ALA 306 306 306 ALA ALA A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 MET 314 314 314 MET MET A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 MET 316 316 316 MET MET A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 PRO 318 318 318 PRO CPR A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 TYR 321 321 321 TYR TYR A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 GLN 323 323 323 GLN GLN A . n 
A 1 324 PHE 324 324 324 PHE PHE A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 SER 326 326 326 SER SER A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 HIS 331 331 331 HIS HIS A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 PRO 338 338 338 PRO PRO A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ARG 341 341 341 ARG ARG A . n 
A 1 342 ILE 342 342 342 ILE ILE A . n 
A 1 343 ASP 343 343 343 ASP ASP A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 VAL 346 346 346 VAL VAL A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 ILE 349 349 349 ILE ILE A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 ARG 351 351 351 ARG ARG A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 PHE 354 354 354 PHE PHE A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 MET 356 356 356 MET MET A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 TYR 363 363 363 TYR TYR A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 PRO 366 366 366 PRO PRO A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 MET 368 368 368 MET MET A . n 
A 1 369 ALA 369 369 369 ALA ALA A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 GLN 371 371 371 GLN GLN A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 GLY 373 373 373 GLY GLY A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 HIS 377 377 377 HIS HIS A . n 
A 1 378 ARG 378 378 378 ARG ARG A . n 
A 1 379 ASP 379 379 379 ASP ASP A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 ALA 381 381 381 ALA ALA A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 GLU 383 383 383 GLU GLU A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 ARG 386 386 386 ARG ARG A . n 
A 1 387 LYS 387 387 387 LYS LYS A . n 
A 1 388 SER 388 388 388 SER SER A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 VAL 390 390 390 VAL VAL A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 LYS 393 393 393 LYS LYS A . n 
A 1 394 ASN 394 394 394 ASN ASN A . n 
A 1 395 GLY 395 395 395 GLY GLY A . n 
A 1 396 LYS 396 396 396 LYS LYS A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 SER 398 398 398 SER SER A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 ASP 400 400 400 ASP ASP A . n 
A 1 401 ALA 401 401 401 ALA ALA A . n 
A 1 402 PRO 402 402 402 PRO PRO A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 PRO 405 405 405 PRO CPR A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 PRO 407 407 407 PRO PRO A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 LYS 409 409 409 LYS LYS A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 PRO 411 411 411 PRO PRO A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 VAL 415 415 415 VAL VAL A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 HIS 419 419 419 HIS HIS A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 CYS 427 427 427 CYS CYS A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 GLY 429 429 429 GLY GLY A . n 
A 1 430 TRP 430 430 430 TRP TRP A . n 
A 1 431 THR 431 431 431 THR THR A . n 
A 1 432 ILE 432 432 432 ILE ILE A . n 
A 1 433 GLU 433 433 433 GLU GLU A . n 
A 1 434 TRP 434 434 434 TRP TRP A . n 
A 1 435 GLN 435 435 435 GLN GLN A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 ARG 440 440 440 ARG ARG A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 THR 442 442 442 THR THR A . n 
A 1 443 VAL 443 443 443 VAL VAL A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 THR 445 445 445 THR THR A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 ILE 447 447 447 ILE ILE A . n 
A 1 448 LEU 448 448 448 LEU LEU A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 ALA 453 453 453 ALA ALA A . n 
A 1 454 ALA 454 454 454 ALA ALA A . n 
A 1 455 VAL 455 455 455 VAL VAL A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 PRO 457 457 457 PRO PRO A . n 
A 1 458 SER 458 458 458 SER SER A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 VAL 461 461 461 VAL VAL A . n 
A 1 462 VAL 462 462 462 VAL VAL A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 GLU 465 465 465 GLU GLU A . n 
A 1 466 ASN 466 466 466 ASN ASN A . n 
A 1 467 PRO 467 467 467 PRO PRO A . n 
A 1 468 ASP 468 468 468 ASP ASP A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 GLU 470 470 470 GLU GLU A . n 
A 1 471 PHE 471 471 471 PHE PHE A . n 
A 1 472 VAL 472 472 472 VAL VAL A . n 
A 1 473 LYS 473 473 473 LYS LYS A . n 
A 1 474 SER 474 474 474 SER SER A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 GLY 476 476 476 GLY GLY A . n 
A 1 477 PHE 477 477 477 PHE PHE A . n 
A 1 478 SER 478 478 478 SER SER A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 ALA 480 480 480 ALA ALA A . n 
A 1 481 ILE 481 481 481 ILE ILE A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 ALA 483 483 483 ALA ALA A . n 
A 1 484 VAL 484 484 484 VAL VAL A . n 
A 1 485 GLY 485 485 485 GLY GLY A . n 
A 1 486 GLU 486 486 486 GLU GLU A . n 
A 1 487 HIS 487 487 487 HIS HIS A . n 
A 1 488 PRO 488 488 488 PRO PRO A . n 
A 1 489 TYR 489 489 489 TYR TYR A . n 
A 1 490 THR 490 490 490 THR THR A . n 
A 1 491 GLU 491 491 491 GLU GLU A . n 
A 1 492 THR 492 492 492 THR THR A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 GLY 494 494 494 GLY GLY A . n 
A 1 495 ASP 495 495 495 ASP ASP A . n 
A 1 496 ASN 496 496 496 ASN ASN A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 ASN 498 498 498 ASN ASN A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 THR 500 500 500 THR THR A . n 
A 1 501 ILE 501 501 501 ILE ILE A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 GLU 503 503 503 GLU GLU A . n 
A 1 504 PRO 504 504 504 PRO CPR A . n 
A 1 505 GLY 505 505 505 GLY GLY A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 SER 507 507 507 SER SER A . n 
A 1 508 THR 508 508 508 THR THR A . n 
A 1 509 VAL 509 509 509 VAL VAL A . n 
A 1 510 GLN 510 510 510 GLN GLN A . n 
A 1 511 ALA 511 511 511 ALA ALA A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 CYS 513 513 513 CYS CYS A . n 
A 1 514 GLY 514 514 514 GLY GLY A . n 
A 1 515 GLY 515 515 515 GLY GLY A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 CYS 518 518 518 CYS CYS A . n 
A 1 519 ALA 519 519 519 ALA ALA A . n 
A 1 520 THR 520 520 520 THR THR A . n 
A 1 521 VAL 521 521 521 VAL VAL A . n 
A 1 522 LEU 522 522 522 LEU LEU A . n 
A 1 523 ILE 523 523 523 ILE ILE A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 GLY 525 525 525 GLY GLY A . n 
A 1 526 ARG 526 526 526 ARG ARG A . n 
A 1 527 PRO 527 527 527 PRO PRO A . n 
A 1 528 VAL 528 528 528 VAL VAL A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 VAL 530 530 530 VAL VAL A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 PRO 532 532 532 PRO PRO A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 LEU 534 534 534 LEU LEU A . n 
A 1 535 ALA 535 535 535 ALA ALA A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 SER 537 537 537 SER SER A . n 
A 1 538 ASP 538 538 538 ASP ASP A . n 
A 1 539 ALA 539 539 539 ALA ALA A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 VAL 541 541 541 VAL VAL A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 ALA 543 543 543 ALA ALA A . n 
A 1 544 TRP 544 544 544 TRP TRP A . n 
A 1 545 LEU 545 545 545 LEU LEU A . n 
A 1 546 PRO 546 546 546 PRO PRO A . n 
A 1 547 GLY 547 547 547 GLY GLY A . n 
A 1 548 SER 548 548 548 SER SER A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 GLY 550 550 550 GLY GLY A . n 
A 1 551 GLN 551 551 551 GLN GLN A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 VAL 553 553 553 VAL VAL A . n 
A 1 554 THR 554 554 554 THR THR A . n 
A 1 555 ASP 555 555 555 ASP ASP A . n 
A 1 556 ALA 556 556 556 ALA ALA A . n 
A 1 557 LEU 557 557 557 LEU LEU A . n 
A 1 558 PHE 558 558 558 PHE PHE A . n 
A 1 559 GLY 559 559 559 GLY GLY A . n 
A 1 560 ASP 560 560 560 ASP ASP A . n 
A 1 561 PHE 561 561 561 PHE PHE A . n 
A 1 562 GLY 562 562 562 GLY GLY A . n 
A 1 563 PHE 563 563 563 PHE PHE A . n 
A 1 564 THR 564 564 564 THR THR A . n 
A 1 565 GLY 565 565 565 GLY GLY A . n 
A 1 566 ARG 566 566 566 ARG ARG A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 ARG 569 569 569 ARG ARG A . n 
A 1 570 THR 570 570 570 THR THR A . n 
A 1 571 TRP 571 571 571 TRP TRP A . n 
A 1 572 PHE 572 572 572 PHE PHE A . n 
A 1 573 LYS 573 573 573 LYS LYS A . n 
A 1 574 SER 574 574 574 SER SER A . n 
A 1 575 VAL 575 575 575 VAL VAL A . n 
A 1 576 ASP 576 576 576 ASP ASP A . n 
A 1 577 GLN 577 577 577 GLN GLN A . n 
A 1 578 LEU 578 578 578 LEU LEU A . n 
A 1 579 PRO 579 579 579 PRO CPR A . n 
A 1 580 MET 580 580 580 MET MET A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 VAL 582 582 582 VAL VAL A . n 
A 1 583 GLY 583 583 583 GLY GLY A . n 
A 1 584 ASP 584 584 584 ASP ASP A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 HIS 586 586 586 HIS HIS A . n 
A 1 587 TYR 587 587 587 TYR TYR A . n 
A 1 588 ASP 588 588 588 ASP ASP A . n 
A 1 589 PRO 589 589 589 PRO PRO A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 PHE 591 591 591 PHE PHE A . n 
A 1 592 ARG 592 592 592 ARG ARG A . n 
A 1 593 LEU 593 593 593 LEU LEU A . n 
A 1 594 GLY 594 594 594 GLY GLY A . n 
A 1 595 TYR 595 595 595 TYR TYR A . n 
A 1 596 GLY 596 596 596 GLY GLY A . n 
A 1 597 LEU 597 597 597 LEU LEU A . n 
A 1 598 THR 598 598 598 THR THR A . n 
A 1 599 THR 599 599 599 THR THR A . n 
A 1 600 ASN 600 600 600 ASN ASN A . n 
A 1 601 ALA 601 601 601 ALA ALA A . n 
A 1 602 THR 602 602 602 THR THR A . n 
A 1 603 LYS 603 603 ?   ?   ?   A . n 
A 1 604 LYS 604 604 ?   ?   ?   A . n 
A 1 605 TYR 605 605 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NAG 1   619 619 NAG NAG A . 
E 5 G2F 1   620 620 G2F G2F A . 
F 6 HOH 1   700 700 HOH WAT A . 
F 6 HOH 2   701 701 HOH WAT A . 
F 6 HOH 3   702 702 HOH WAT A . 
F 6 HOH 4   703 703 HOH WAT A . 
F 6 HOH 5   704 704 HOH WAT A . 
F 6 HOH 6   705 705 HOH WAT A . 
F 6 HOH 7   706 706 HOH WAT A . 
F 6 HOH 8   707 707 HOH WAT A . 
F 6 HOH 9   708 708 HOH WAT A . 
F 6 HOH 10  709 709 HOH WAT A . 
F 6 HOH 11  710 710 HOH WAT A . 
F 6 HOH 12  711 711 HOH WAT A . 
F 6 HOH 13  712 712 HOH WAT A . 
F 6 HOH 14  713 713 HOH WAT A . 
F 6 HOH 15  714 714 HOH WAT A . 
F 6 HOH 16  715 715 HOH WAT A . 
F 6 HOH 17  716 716 HOH WAT A . 
F 6 HOH 18  717 717 HOH WAT A . 
F 6 HOH 19  718 718 HOH WAT A . 
F 6 HOH 20  719 719 HOH WAT A . 
F 6 HOH 21  720 720 HOH WAT A . 
F 6 HOH 22  721 721 HOH WAT A . 
F 6 HOH 23  722 722 HOH WAT A . 
F 6 HOH 24  723 723 HOH WAT A . 
F 6 HOH 25  724 724 HOH WAT A . 
F 6 HOH 26  725 725 HOH WAT A . 
F 6 HOH 27  726 726 HOH WAT A . 
F 6 HOH 28  727 727 HOH WAT A . 
F 6 HOH 29  728 728 HOH WAT A . 
F 6 HOH 30  729 729 HOH WAT A . 
F 6 HOH 31  730 730 HOH WAT A . 
F 6 HOH 32  731 731 HOH WAT A . 
F 6 HOH 33  732 732 HOH WAT A . 
F 6 HOH 34  733 733 HOH WAT A . 
F 6 HOH 35  734 734 HOH WAT A . 
F 6 HOH 36  735 735 HOH WAT A . 
F 6 HOH 37  736 736 HOH WAT A . 
F 6 HOH 38  737 737 HOH WAT A . 
F 6 HOH 39  738 738 HOH WAT A . 
F 6 HOH 40  739 739 HOH WAT A . 
F 6 HOH 41  740 740 HOH WAT A . 
F 6 HOH 42  741 741 HOH WAT A . 
F 6 HOH 43  742 742 HOH WAT A . 
F 6 HOH 44  743 743 HOH WAT A . 
F 6 HOH 45  744 744 HOH WAT A . 
F 6 HOH 46  745 745 HOH WAT A . 
F 6 HOH 47  746 746 HOH WAT A . 
F 6 HOH 48  747 747 HOH WAT A . 
F 6 HOH 49  748 748 HOH WAT A . 
F 6 HOH 50  749 749 HOH WAT A . 
F 6 HOH 51  750 750 HOH WAT A . 
F 6 HOH 52  751 751 HOH WAT A . 
F 6 HOH 53  752 752 HOH WAT A . 
F 6 HOH 54  753 753 HOH WAT A . 
F 6 HOH 55  754 754 HOH WAT A . 
F 6 HOH 56  755 755 HOH WAT A . 
F 6 HOH 57  756 756 HOH WAT A . 
F 6 HOH 58  757 757 HOH WAT A . 
F 6 HOH 59  758 758 HOH WAT A . 
F 6 HOH 60  759 759 HOH WAT A . 
F 6 HOH 61  760 760 HOH WAT A . 
F 6 HOH 62  761 761 HOH WAT A . 
F 6 HOH 63  762 762 HOH WAT A . 
F 6 HOH 64  763 763 HOH WAT A . 
F 6 HOH 65  764 764 HOH WAT A . 
F 6 HOH 66  765 765 HOH WAT A . 
F 6 HOH 67  766 766 HOH WAT A . 
F 6 HOH 68  767 767 HOH WAT A . 
F 6 HOH 69  768 768 HOH WAT A . 
F 6 HOH 70  769 769 HOH WAT A . 
F 6 HOH 71  770 770 HOH WAT A . 
F 6 HOH 72  771 771 HOH WAT A . 
F 6 HOH 73  772 772 HOH WAT A . 
F 6 HOH 74  773 773 HOH WAT A . 
F 6 HOH 75  774 774 HOH WAT A . 
F 6 HOH 76  775 775 HOH WAT A . 
F 6 HOH 77  776 776 HOH WAT A . 
F 6 HOH 78  777 777 HOH WAT A . 
F 6 HOH 79  778 778 HOH WAT A . 
F 6 HOH 80  779 779 HOH WAT A . 
F 6 HOH 81  780 780 HOH WAT A . 
F 6 HOH 82  781 781 HOH WAT A . 
F 6 HOH 83  782 782 HOH WAT A . 
F 6 HOH 84  783 783 HOH WAT A . 
F 6 HOH 85  784 784 HOH WAT A . 
F 6 HOH 86  785 785 HOH WAT A . 
F 6 HOH 87  786 786 HOH WAT A . 
F 6 HOH 88  787 787 HOH WAT A . 
F 6 HOH 89  788 788 HOH WAT A . 
F 6 HOH 90  789 789 HOH WAT A . 
F 6 HOH 91  790 790 HOH WAT A . 
F 6 HOH 92  791 791 HOH WAT A . 
F 6 HOH 93  792 792 HOH WAT A . 
F 6 HOH 94  793 793 HOH WAT A . 
F 6 HOH 95  794 794 HOH WAT A . 
F 6 HOH 96  795 795 HOH WAT A . 
F 6 HOH 97  796 796 HOH WAT A . 
F 6 HOH 98  797 797 HOH WAT A . 
F 6 HOH 99  798 798 HOH WAT A . 
F 6 HOH 100 799 799 HOH WAT A . 
F 6 HOH 101 800 800 HOH WAT A . 
F 6 HOH 102 801 801 HOH WAT A . 
F 6 HOH 103 802 802 HOH WAT A . 
F 6 HOH 104 803 803 HOH WAT A . 
F 6 HOH 105 804 804 HOH WAT A . 
F 6 HOH 106 805 805 HOH WAT A . 
F 6 HOH 107 806 806 HOH WAT A . 
F 6 HOH 108 807 807 HOH WAT A . 
F 6 HOH 109 808 808 HOH WAT A . 
F 6 HOH 110 809 809 HOH WAT A . 
F 6 HOH 111 810 810 HOH WAT A . 
F 6 HOH 112 811 811 HOH WAT A . 
F 6 HOH 113 812 812 HOH WAT A . 
F 6 HOH 114 813 813 HOH WAT A . 
F 6 HOH 115 814 814 HOH WAT A . 
F 6 HOH 116 815 815 HOH WAT A . 
F 6 HOH 117 816 816 HOH WAT A . 
F 6 HOH 118 817 817 HOH WAT A . 
F 6 HOH 119 818 818 HOH WAT A . 
F 6 HOH 120 819 819 HOH WAT A . 
F 6 HOH 121 820 820 HOH WAT A . 
F 6 HOH 122 821 821 HOH WAT A . 
F 6 HOH 123 822 822 HOH WAT A . 
F 6 HOH 124 823 823 HOH WAT A . 
F 6 HOH 125 824 824 HOH WAT A . 
F 6 HOH 126 825 825 HOH WAT A . 
F 6 HOH 127 826 826 HOH WAT A . 
F 6 HOH 128 827 827 HOH WAT A . 
F 6 HOH 129 828 828 HOH WAT A . 
F 6 HOH 130 829 829 HOH WAT A . 
F 6 HOH 131 830 830 HOH WAT A . 
F 6 HOH 132 831 831 HOH WAT A . 
F 6 HOH 133 832 832 HOH WAT A . 
F 6 HOH 134 833 833 HOH WAT A . 
F 6 HOH 135 834 834 HOH WAT A . 
F 6 HOH 136 835 835 HOH WAT A . 
F 6 HOH 137 836 836 HOH WAT A . 
F 6 HOH 138 837 837 HOH WAT A . 
F 6 HOH 139 838 838 HOH WAT A . 
F 6 HOH 140 839 839 HOH WAT A . 
F 6 HOH 141 840 840 HOH WAT A . 
F 6 HOH 142 841 841 HOH WAT A . 
F 6 HOH 143 842 842 HOH WAT A . 
F 6 HOH 144 843 843 HOH WAT A . 
F 6 HOH 145 844 844 HOH WAT A . 
F 6 HOH 146 845 845 HOH WAT A . 
F 6 HOH 147 846 846 HOH WAT A . 
F 6 HOH 148 847 847 HOH WAT A . 
F 6 HOH 149 848 848 HOH WAT A . 
F 6 HOH 150 849 849 HOH WAT A . 
F 6 HOH 151 850 850 HOH WAT A . 
F 6 HOH 152 851 851 HOH WAT A . 
F 6 HOH 153 852 852 HOH WAT A . 
F 6 HOH 154 853 853 HOH WAT A . 
F 6 HOH 155 854 854 HOH WAT A . 
F 6 HOH 156 855 855 HOH WAT A . 
F 6 HOH 157 856 856 HOH WAT A . 
F 6 HOH 158 857 857 HOH WAT A . 
F 6 HOH 159 858 858 HOH WAT A . 
F 6 HOH 160 859 859 HOH WAT A . 
F 6 HOH 161 860 860 HOH WAT A . 
F 6 HOH 162 861 861 HOH WAT A . 
F 6 HOH 163 862 862 HOH WAT A . 
F 6 HOH 164 863 863 HOH WAT A . 
F 6 HOH 165 864 864 HOH WAT A . 
F 6 HOH 166 865 865 HOH WAT A . 
F 6 HOH 167 866 866 HOH WAT A . 
F 6 HOH 168 867 867 HOH WAT A . 
F 6 HOH 169 868 868 HOH WAT A . 
F 6 HOH 170 869 869 HOH WAT A . 
F 6 HOH 171 870 870 HOH WAT A . 
F 6 HOH 172 871 871 HOH WAT A . 
F 6 HOH 173 872 872 HOH WAT A . 
F 6 HOH 174 873 873 HOH WAT A . 
F 6 HOH 175 874 874 HOH WAT A . 
F 6 HOH 176 875 875 HOH WAT A . 
F 6 HOH 177 876 876 HOH WAT A . 
F 6 HOH 178 877 877 HOH WAT A . 
F 6 HOH 179 878 878 HOH WAT A . 
F 6 HOH 180 879 879 HOH WAT A . 
F 6 HOH 181 880 880 HOH WAT A . 
F 6 HOH 182 881 881 HOH WAT A . 
F 6 HOH 183 882 882 HOH WAT A . 
F 6 HOH 184 883 883 HOH WAT A . 
F 6 HOH 185 884 884 HOH WAT A . 
F 6 HOH 186 885 885 HOH WAT A . 
F 6 HOH 187 886 886 HOH WAT A . 
F 6 HOH 188 887 887 HOH WAT A . 
F 6 HOH 189 888 888 HOH WAT A . 
F 6 HOH 190 889 889 HOH WAT A . 
F 6 HOH 191 890 890 HOH WAT A . 
F 6 HOH 192 891 891 HOH WAT A . 
F 6 HOH 193 892 892 HOH WAT A . 
F 6 HOH 194 893 893 HOH WAT A . 
F 6 HOH 195 894 894 HOH WAT A . 
F 6 HOH 196 895 895 HOH WAT A . 
F 6 HOH 197 896 896 HOH WAT A . 
F 6 HOH 198 897 897 HOH WAT A . 
F 6 HOH 199 898 898 HOH WAT A . 
F 6 HOH 200 899 899 HOH WAT A . 
F 6 HOH 201 900 900 HOH WAT A . 
F 6 HOH 202 901 901 HOH WAT A . 
F 6 HOH 203 902 902 HOH WAT A . 
F 6 HOH 204 903 903 HOH WAT A . 
F 6 HOH 205 904 904 HOH WAT A . 
F 6 HOH 206 905 905 HOH WAT A . 
F 6 HOH 207 906 906 HOH WAT A . 
F 6 HOH 208 907 907 HOH WAT A . 
F 6 HOH 209 908 908 HOH WAT A . 
F 6 HOH 210 909 909 HOH WAT A . 
F 6 HOH 211 910 910 HOH WAT A . 
F 6 HOH 212 911 911 HOH WAT A . 
F 6 HOH 213 912 912 HOH WAT A . 
F 6 HOH 214 913 913 HOH WAT A . 
F 6 HOH 215 914 914 HOH WAT A . 
F 6 HOH 216 915 915 HOH WAT A . 
F 6 HOH 217 916 916 HOH WAT A . 
F 6 HOH 218 917 917 HOH WAT A . 
F 6 HOH 219 918 918 HOH WAT A . 
F 6 HOH 220 919 919 HOH WAT A . 
F 6 HOH 221 920 920 HOH WAT A . 
F 6 HOH 222 921 921 HOH WAT A . 
F 6 HOH 223 922 922 HOH WAT A . 
F 6 HOH 224 923 923 HOH WAT A . 
F 6 HOH 225 924 924 HOH WAT A . 
F 6 HOH 226 925 925 HOH WAT A . 
F 6 HOH 227 926 926 HOH WAT A . 
F 6 HOH 228 927 927 HOH WAT A . 
F 6 HOH 229 928 928 HOH WAT A . 
F 6 HOH 230 929 929 HOH WAT A . 
F 6 HOH 231 930 930 HOH WAT A . 
F 6 HOH 232 931 931 HOH WAT A . 
F 6 HOH 233 932 932 HOH WAT A . 
F 6 HOH 234 933 933 HOH WAT A . 
F 6 HOH 235 934 934 HOH WAT A . 
F 6 HOH 236 935 935 HOH WAT A . 
F 6 HOH 237 936 936 HOH WAT A . 
F 6 HOH 238 937 937 HOH WAT A . 
F 6 HOH 239 938 938 HOH WAT A . 
F 6 HOH 240 939 939 HOH WAT A . 
F 6 HOH 241 940 940 HOH WAT A . 
F 6 HOH 242 941 941 HOH WAT A . 
F 6 HOH 243 942 942 HOH WAT A . 
F 6 HOH 244 943 943 HOH WAT A . 
F 6 HOH 245 944 944 HOH WAT A . 
F 6 HOH 246 945 945 HOH WAT A . 
F 6 HOH 247 946 946 HOH WAT A . 
F 6 HOH 248 947 947 HOH WAT A . 
F 6 HOH 249 948 948 HOH WAT A . 
F 6 HOH 250 949 949 HOH WAT A . 
F 6 HOH 251 950 950 HOH WAT A . 
F 6 HOH 252 951 951 HOH WAT A . 
F 6 HOH 253 952 952 HOH WAT A . 
F 6 HOH 254 953 953 HOH WAT A . 
F 6 HOH 255 954 954 HOH WAT A . 
F 6 HOH 256 955 955 HOH WAT A . 
F 6 HOH 257 956 956 HOH WAT A . 
F 6 HOH 258 957 957 HOH WAT A . 
F 6 HOH 259 958 958 HOH WAT A . 
F 6 HOH 260 959 959 HOH WAT A . 
F 6 HOH 261 960 960 HOH WAT A . 
F 6 HOH 262 961 961 HOH WAT A . 
F 6 HOH 263 962 962 HOH WAT A . 
F 6 HOH 264 963 963 HOH WAT A . 
F 6 HOH 265 964 964 HOH WAT A . 
F 6 HOH 266 965 965 HOH WAT A . 
F 6 HOH 267 966 966 HOH WAT A . 
F 6 HOH 268 967 967 HOH WAT A . 
F 6 HOH 269 968 968 HOH WAT A . 
F 6 HOH 270 969 969 HOH WAT A . 
F 6 HOH 271 970 970 HOH WAT A . 
F 6 HOH 272 971 971 HOH WAT A . 
F 6 HOH 273 972 972 HOH WAT A . 
F 6 HOH 274 973 973 HOH WAT A . 
F 6 HOH 275 974 974 HOH WAT A . 
F 6 HOH 276 975 975 HOH WAT A . 
F 6 HOH 277 976 976 HOH WAT A . 
F 6 HOH 278 977 977 HOH WAT A . 
F 6 HOH 279 978 978 HOH WAT A . 
F 6 HOH 280 979 979 HOH WAT A . 
F 6 HOH 281 980 980 HOH WAT A . 
F 6 HOH 282 981 981 HOH WAT A . 
F 6 HOH 283 982 982 HOH WAT A . 
F 6 HOH 284 983 983 HOH WAT A . 
F 6 HOH 285 984 984 HOH WAT A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 600 A ASN 600 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 221 A ASN 221 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 498 A ASN 498 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-11-14 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' struct_asym                   
14 4 'Structure model' struct_conn                   
15 4 'Structure model' struct_site                   
16 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_atom_id'                
7  4 'Structure model' '_atom_site.auth_comp_id'                
8  4 'Structure model' '_atom_site.auth_seq_id'                 
9  4 'Structure model' '_atom_site.label_asym_id'               
10 4 'Structure model' '_atom_site.label_atom_id'               
11 4 'Structure model' '_atom_site.label_comp_id'               
12 4 'Structure model' '_atom_site.label_entity_id'             
13 4 'Structure model' '_atom_site.type_symbol'                 
14 4 'Structure model' '_chem_comp.name'                        
15 4 'Structure model' '_chem_comp.type'                        
16 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
17 4 'Structure model' '_struct_conn.pdbx_dist_value'           
18 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
19 4 'Structure model' '_struct_conn.pdbx_role'                 
20 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
27 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
600 
;HETEROGEN
2', 4'-dinitrophenyl 2-deoxy-2-fluoro-beta-D-glucopyranoside
REACTS WITH THE ENZYME TO FORM A  
2-deoxy-2-fluoro-alpha-D-glucopyranoside moiety COVALENTLY 
BOUND TO THE ENZYME.
;
999 
;SEQUENCE
The sequence in the GenBank entry might be
a sequencing error at residue 345.  The 
electron density unambiguously proved the 
presence of LYS instead of ASN at this residue.
;
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              545 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              546 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              546 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.86 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            10.56 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 62  ? ? -174.42 149.83  
2  1 HIS A 98  ? ? -160.53 53.63   
3  1 ILE A 148 ? ? -101.71 41.44   
4  1 THR A 174 ? ? -66.90  1.19    
5  1 PHE A 188 ? ? -15.29  130.03  
6  1 GLU A 220 ? ? 56.06   13.05   
7  1 ASN A 221 ? ? -85.36  -156.68 
8  1 ILE A 225 ? ? -170.81 149.95  
9  1 ILE A 233 ? ? -101.66 -60.60  
10 1 HIS A 262 ? ? -62.40  0.09    
11 1 TYR A 271 ? ? -93.88  -64.80  
12 1 TRP A 286 ? ? -47.36  107.29  
13 1 ASP A 299 ? ? -172.46 61.47   
14 1 ASN A 394 ? ? -148.70 58.47   
15 1 ILE A 432 ? ? 70.71   -64.45  
16 1 THR A 442 ? ? -166.16 -168.73 
17 1 GLU A 491 ? ? 53.23   -139.38 
18 1 TRP A 544 ? ? 55.05   -129.43 
19 1 MET A 580 ? ? -170.00 102.06  
20 1 HIS A 586 ? ? -92.33  32.03   
21 1 TYR A 587 ? ? -46.92  101.85  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 603 ? A LYS 603 
2 1 Y 1 A LYS 604 ? A LYS 604 
3 1 Y 1 A TYR 605 ? A TYR 605 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 ? NAG 610 n 
B 2 NAG 2 B NAG 2 ? NAG 611 n 
B 2 BMA 3 B BMA 3 ? MAN 612 n 
C 3 NAG 1 C NAG 1 ? NAG 613 n 
C 3 NAG 2 C NAG 2 ? NAG 614 n 
C 3 BMA 3 C BMA 3 ? MAN 615 n 
C 3 MAN 4 C MAN 4 ? MAN 617 n 
C 3 NAG 5 C NAG 5 ? NAG 618 n 
C 3 FUL 6 C FUL 6 ? FUC 616 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
FUL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpb                         
FUL 'COMMON NAME'                         GMML     1.0 b-L-fucopyranose               
FUL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-L-Fucp                       
FUL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
G2F 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp2fluoro                
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}' LINUCS                      PDB-CARE   ?     
4 3 'DGlcpNAcb1-2DManpa1-6DManpb1-4DGlcpNAcb1-4[LFucpb1-3]DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML       1.0   
5 3 
'WURCS=2.0/4,6,5/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1b_1-5][a1122h-1b_1-5][a1122h-1a_1-5]/1-2-1-3-4-1/a3-b1_a4-c1_c4-d1_d6-e1_e2-f1' 
WURCS                       PDB2Glycan 1.1.0 
6 3 
'[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-L-Fucp]{}[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][a-D-Manp]{[(2+1)][b-D-GlcpNAc]{}}}}}}'  
LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
4 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
5 3 4 MAN C1 O1 3 BMA O6 HO6 sing ? 
6 3 5 NAG C1 O1 4 MAN O2 HO2 sing ? 
7 3 6 FUL C1 O1 1 NAG O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 MAN 4 n 
3 NAG 5 n 
3 FUL 6 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 2-deoxy-2-fluoro-alpha-D-glucopyranose   G2F 
6 water                                    HOH 
#