data_1IFC
# 
_entry.id   1IFC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IFC         
WWPDB D_1000174129 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IFC 
_pdbx_database_status.recvd_initial_deposition_date   1991-12-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scapin, G.'        1 
'Gordon, J.I.'      2 
'Sacchettini, J.C.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Refinement of the structure of recombinant rat intestinal fatty acid-binding apoprotein at 1.2-A resolution.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            267 
_citation.page_first                4253 
_citation.page_last                 4269 
_citation.year                      1992 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   1740465 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Scapin, G.'        1 ? 
primary 'Gordon, J.I.'      2 ? 
primary 'Sacchettini, J.C.' 3 ? 
# 
_cell.entry_id           1IFC 
_cell.length_a           35.830 
_cell.length_b           51.420 
_cell.length_c           31.340 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.44 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IFC 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTESTINAL FATTY ACID BINDING PROTEIN' 15146.212 1   ? ? ? ? 
2 water   nat water                                   18.015    238 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELT
GTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELT
GTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   PHE n 
1 4   ASP n 
1 5   GLY n 
1 6   THR n 
1 7   TRP n 
1 8   LYS n 
1 9   VAL n 
1 10  ASP n 
1 11  ARG n 
1 12  ASN n 
1 13  GLU n 
1 14  ASN n 
1 15  TYR n 
1 16  GLU n 
1 17  LYS n 
1 18  PHE n 
1 19  MET n 
1 20  GLU n 
1 21  LYS n 
1 22  MET n 
1 23  GLY n 
1 24  ILE n 
1 25  ASN n 
1 26  VAL n 
1 27  VAL n 
1 28  LYS n 
1 29  ARG n 
1 30  LYS n 
1 31  LEU n 
1 32  GLY n 
1 33  ALA n 
1 34  HIS n 
1 35  ASP n 
1 36  ASN n 
1 37  LEU n 
1 38  LYS n 
1 39  LEU n 
1 40  THR n 
1 41  ILE n 
1 42  THR n 
1 43  GLN n 
1 44  GLU n 
1 45  GLY n 
1 46  ASN n 
1 47  LYS n 
1 48  PHE n 
1 49  THR n 
1 50  VAL n 
1 51  LYS n 
1 52  GLU n 
1 53  SER n 
1 54  SER n 
1 55  ASN n 
1 56  PHE n 
1 57  ARG n 
1 58  ASN n 
1 59  ILE n 
1 60  ASP n 
1 61  VAL n 
1 62  VAL n 
1 63  PHE n 
1 64  GLU n 
1 65  LEU n 
1 66  GLY n 
1 67  VAL n 
1 68  ASP n 
1 69  PHE n 
1 70  ALA n 
1 71  TYR n 
1 72  SER n 
1 73  LEU n 
1 74  ALA n 
1 75  ASP n 
1 76  GLY n 
1 77  THR n 
1 78  GLU n 
1 79  LEU n 
1 80  THR n 
1 81  GLY n 
1 82  THR n 
1 83  TRP n 
1 84  THR n 
1 85  MET n 
1 86  GLU n 
1 87  GLY n 
1 88  ASN n 
1 89  LYS n 
1 90  LEU n 
1 91  VAL n 
1 92  GLY n 
1 93  LYS n 
1 94  PHE n 
1 95  LYS n 
1 96  ARG n 
1 97  VAL n 
1 98  ASP n 
1 99  ASN n 
1 100 GLY n 
1 101 LYS n 
1 102 GLU n 
1 103 LEU n 
1 104 ILE n 
1 105 ALA n 
1 106 VAL n 
1 107 ARG n 
1 108 GLU n 
1 109 ILE n 
1 110 SER n 
1 111 GLY n 
1 112 ASN n 
1 113 GLU n 
1 114 LEU n 
1 115 ILE n 
1 116 GLN n 
1 117 THR n 
1 118 TYR n 
1 119 THR n 
1 120 TYR n 
1 121 GLU n 
1 122 GLY n 
1 123 VAL n 
1 124 GLU n 
1 125 ALA n 
1 126 LYS n 
1 127 ARG n 
1 128 ILE n 
1 129 PHE n 
1 130 LYS n 
1 131 LYS n 
1 132 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FABPI_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02693 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTG
TWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IFC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 132 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02693 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  131 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       131 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IFC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.91 
_exptl_crystal.density_percent_sol   35.45 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1IFC 
_refine.ls_number_reflns_obs                     34290 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             9.0 
_refine.ls_d_res_high                            1.19 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1690000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1690000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1057 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               1295 
_refine_hist.d_res_high                       1.19 
_refine_hist.d_res_low                        9.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.368 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.51 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1IFC 
_struct.title                     
'REFINEMENT OF THE STRUCTURE OF RECOMBINANT RAT INTESTINAL FATTY ACID-BINDING APOPROTEIN AT 1.2 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           'INTESTINAL FATTY ACID BINDING PROTEIN (APO FORM 2)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IFC 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
_struct_keywords.text            'LIPID-BINDING PROTEIN, LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A1 TYR A 15 ? LYS A 21 ? TYR A 14 LYS A 20 1 ? 7 
HELX_P HELX_P2 A2 VAL A 26 ? HIS A 34 ? VAL A 25 HIS A 33 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 2   ? GLU A 13  ? ALA A 1   GLU A 12  
A 2 ASP A 35  ? GLN A 43  ? ASP A 34  GLN A 42  
A 3 PHE A 48  ? SER A 53  ? PHE A 47  SER A 52  
A 4 ASN A 58  ? PHE A 63  ? ASN A 57  PHE A 62  
A 5 ASP A 68  ? SER A 72  ? ASP A 67  SER A 71  
A 6 THR A 77  ? GLY A 81  ? THR A 76  GLY A 80  
B 1 THR A 82  ? MET A 85  ? THR A 81  MET A 84  
B 2 LEU A 90  ? LYS A 95  ? LEU A 89  LYS A 94  
B 3 LYS A 101 ? ILE A 109 ? LYS A 100 ILE A 108 
B 4 LEU A 114 ? THR A 119 ? LEU A 113 THR A 118 
B 5 GLU A 124 ? GLU A 132 ? GLU A 123 GLU A 131 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 5   ? O GLY A 4   N ILE A 41  ? N ILE A 40  
A 2 3 O THR A 42  ? O THR A 41  N THR A 49  ? N THR A 48  
A 3 4 O VAL A 50  ? O VAL A 49  N VAL A 61  ? N VAL A 60  
A 5 6 O TYR A 71  ? O TYR A 70  N LEU A 79  ? N LEU A 78  
B 1 2 O THR A 84  ? O THR A 83  N VAL A 91  ? N VAL A 90  
B 2 3 O GLY A 92  ? O GLY A 91  N ALA A 105 ? N ALA A 104 
B 3 4 O VAL A 106 ? O VAL A 105 N THR A 117 ? N THR A 116 
B 4 5 O GLN A 116 ? O GLN A 115 N ARG A 127 ? N ARG A 126 
# 
_database_PDB_matrix.entry_id          1IFC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IFC 
_atom_sites.fract_transf_matrix[1][1]   0.027910 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000702 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019448 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.031918 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   A ALA A 1 2   ? -8.122 -3.691  11.350  0.52 65.46 ? 1   ALA A N   1 
ATOM   2    N N   B ALA A 1 2   ? -8.119 -3.681  11.356  0.48 66.14 ? 1   ALA A N   1 
ATOM   3    C CA  A ALA A 1 2   ? -7.159 -4.586  10.739  0.52 29.68 ? 1   ALA A CA  1 
ATOM   4    C CA  B ALA A 1 2   ? -7.160 -4.581  10.758  0.48 29.57 ? 1   ALA A CA  1 
ATOM   5    C C   A ALA A 1 2   ? -5.927 -3.707  10.485  0.49 14.63 ? 1   ALA A C   1 
ATOM   6    C C   B ALA A 1 2   ? -5.927 -3.707  10.485  0.49 14.64 ? 1   ALA A C   1 
ATOM   7    O O   A ALA A 1 2   ? -5.602 -3.002  11.425  0.45 19.87 ? 1   ALA A O   1 
ATOM   8    O O   B ALA A 1 2   ? -5.598 -3.002  11.422  0.45 19.89 ? 1   ALA A O   1 
ATOM   9    C CB  A ALA A 1 2   ? -7.858 -5.080  9.498   0.48 38.83 ? 1   ALA A CB  1 
ATOM   10   C CB  B ALA A 1 2   ? -7.892 -5.085  9.542   0.48 39.04 ? 1   ALA A CB  1 
ATOM   11   N N   A PHE A 1 3   ? -5.295 -3.645  9.285   0.52 14.33 ? 2   PHE A N   1 
ATOM   12   N N   B PHE A 1 3   ? -5.299 -3.645  9.285   0.48 14.31 ? 2   PHE A N   1 
ATOM   13   C CA  A PHE A 1 3   ? -4.171 -2.684  9.085   0.52 10.59 ? 2   PHE A CA  1 
ATOM   14   C CA  B PHE A 1 3   ? -4.171 -2.684  9.085   0.48 10.61 ? 2   PHE A CA  1 
ATOM   15   C C   A PHE A 1 3   ? -4.631 -1.331  8.521   0.50 10.70 ? 2   PHE A C   1 
ATOM   16   C C   B PHE A 1 3   ? -4.631 -1.331  8.521   0.50 10.71 ? 2   PHE A C   1 
ATOM   17   O O   A PHE A 1 3   ? -3.900 -0.355  8.502   0.52 11.00 ? 2   PHE A O   1 
ATOM   18   O O   B PHE A 1 3   ? -3.900 -0.355  8.502   0.48 11.00 ? 2   PHE A O   1 
ATOM   19   C CB  A PHE A 1 3   ? -3.058 -3.188  8.136   0.52 14.27 ? 2   PHE A CB  1 
ATOM   20   C CB  B PHE A 1 3   ? -3.058 -3.188  8.136   0.48 14.27 ? 2   PHE A CB  1 
ATOM   21   C CG  A PHE A 1 3   ? -2.264 -4.324  8.747   0.52 13.36 ? 2   PHE A CG  1 
ATOM   22   C CG  B PHE A 1 3   ? -2.264 -4.324  8.747   0.48 13.36 ? 2   PHE A CG  1 
ATOM   23   C CD1 A PHE A 1 3   ? -1.320 -4.077  9.727   0.52 15.04 ? 2   PHE A CD1 1 
ATOM   24   C CD1 B PHE A 1 3   ? -1.320 -4.077  9.727   0.48 15.04 ? 2   PHE A CD1 1 
ATOM   25   C CD2 A PHE A 1 3   ? -2.505 -5.645  8.393   0.50 17.32 ? 2   PHE A CD2 1 
ATOM   26   C CD2 B PHE A 1 3   ? -2.505 -5.645  8.393   0.50 17.31 ? 2   PHE A CD2 1 
ATOM   27   C CE1 A PHE A 1 3   ? -0.641 -5.110  10.347  0.44 15.93 ? 2   PHE A CE1 1 
ATOM   28   C CE1 B PHE A 1 3   ? -0.641 -5.110  10.347  0.44 15.94 ? 2   PHE A CE1 1 
ATOM   29   C CE2 A PHE A 1 3   ? -1.832 -6.699  8.988   0.49 17.09 ? 2   PHE A CE2 1 
ATOM   30   C CE2 B PHE A 1 3   ? -1.832 -6.699  8.988   0.49 17.09 ? 2   PHE A CE2 1 
ATOM   31   C CZ  A PHE A 1 3   ? -0.891 -6.437  9.975   0.51 17.23 ? 2   PHE A CZ  1 
ATOM   32   C CZ  B PHE A 1 3   ? -0.891 -6.437  9.975   0.49 17.23 ? 2   PHE A CZ  1 
ATOM   33   N N   A ASP A 1 4   ? -5.869 -1.259  8.017   0.46 11.12 ? 3   ASP A N   1 
ATOM   34   N N   B ASP A 1 4   ? -5.869 -1.259  8.017   0.46 11.12 ? 3   ASP A N   1 
ATOM   35   C CA  A ASP A 1 4   ? -6.408 -0.062  7.359   0.46 10.70 ? 3   ASP A CA  1 
ATOM   36   C CA  B ASP A 1 4   ? -6.408 -0.062  7.359   0.46 10.70 ? 3   ASP A CA  1 
ATOM   37   C C   A ASP A 1 4   ? -6.397 1.167   8.208   0.45 11.08 ? 3   ASP A C   1 
ATOM   38   C C   B ASP A 1 4   ? -6.397 1.167   8.208   0.45 11.08 ? 3   ASP A C   1 
ATOM   39   O O   A ASP A 1 4   ? -6.797 1.137   9.376   0.48 13.52 ? 3   ASP A O   1 
ATOM   40   O O   B ASP A 1 4   ? -6.797 1.137   9.376   0.48 13.52 ? 3   ASP A O   1 
ATOM   41   C CB  A ASP A 1 4   ? -7.860 -0.293  6.858   0.50 14.08 ? 3   ASP A CB  1 
ATOM   42   C CB  B ASP A 1 4   ? -7.860 -0.293  6.858   0.50 14.08 ? 3   ASP A CB  1 
ATOM   43   C CG  A ASP A 1 4   ? -7.966 -1.655  6.247   0.43 15.43 ? 3   ASP A CG  1 
ATOM   44   C CG  B ASP A 1 4   ? -7.966 -1.655  6.247   0.43 15.43 ? 3   ASP A CG  1 
ATOM   45   O OD1 A ASP A 1 4   ? -8.265 -2.576  7.124   0.47 14.34 ? 3   ASP A OD1 1 
ATOM   46   O OD1 B ASP A 1 4   ? -8.265 -2.576  7.124   0.47 14.34 ? 3   ASP A OD1 1 
ATOM   47   O OD2 A ASP A 1 4   ? -7.751 -1.882  5.059   0.46 14.85 ? 3   ASP A OD2 1 
ATOM   48   O OD2 B ASP A 1 4   ? -7.751 -1.882  5.059   0.46 14.85 ? 3   ASP A OD2 1 
ATOM   49   N N   A GLY A 1 5   ? -5.980 2.283   7.622   0.48 10.07 ? 4   GLY A N   1 
ATOM   50   N N   B GLY A 1 5   ? -5.980 2.283   7.622   0.48 10.08 ? 4   GLY A N   1 
ATOM   51   C CA  A GLY A 1 5   ? -6.028 3.491   8.414   0.45 10.33 ? 4   GLY A CA  1 
ATOM   52   C CA  B GLY A 1 5   ? -6.028 3.486   8.414   0.45 10.32 ? 4   GLY A CA  1 
ATOM   53   C C   A GLY A 1 5   ? -4.707 4.242   8.555   0.45 7.78  ? 4   GLY A C   1 
ATOM   54   C C   B GLY A 1 5   ? -4.707 4.242   8.555   0.45 7.78  ? 4   GLY A C   1 
ATOM   55   O O   A GLY A 1 5   ? -3.726 3.862   7.932   0.48 9.38  ? 4   GLY A O   1 
ATOM   56   O O   B GLY A 1 5   ? -3.726 3.862   7.932   0.48 9.38  ? 4   GLY A O   1 
ATOM   57   N N   A THR A 1 6   ? -4.745 5.265   9.373   0.49 7.77  ? 5   THR A N   1 
ATOM   58   N N   B THR A 1 6   ? -4.745 5.265   9.370   0.49 7.77  ? 5   THR A N   1 
ATOM   59   C CA  A THR A 1 6   ? -3.590 6.119   9.643   0.50 7.98  ? 5   THR A CA  1 
ATOM   60   C CA  B THR A 1 6   ? -3.590 6.119   9.639   0.50 8.00  ? 5   THR A CA  1 
ATOM   61   C C   A THR A 1 6   ? -3.068 5.831   10.999  0.49 9.32  ? 5   THR A C   1 
ATOM   62   C C   B THR A 1 6   ? -3.072 5.841   10.996  0.49 9.26  ? 5   THR A C   1 
ATOM   63   O O   A THR A 1 6   ? -3.837 5.738   11.951  0.48 10.31 ? 5   THR A O   1 
ATOM   64   O O   B THR A 1 6   ? -3.840 5.738   11.951  0.48 10.31 ? 5   THR A O   1 
ATOM   65   C CB  A THR A 1 6   ? -3.935 7.600   9.458   0.46 11.59 ? 5   THR A CB  1 
ATOM   66   C CB  B THR A 1 6   ? -3.935 7.600   9.455   0.46 11.60 ? 5   THR A CB  1 
ATOM   67   O OG1 A THR A 1 6   ? -4.342 7.754   8.098   0.40 14.55 ? 5   THR A OG1 1 
ATOM   68   O OG1 B THR A 1 6   ? -4.342 7.754   8.098   0.40 14.53 ? 5   THR A OG1 1 
ATOM   69   C CG2 A THR A 1 6   ? -2.712 8.474   9.721   0.52 13.12 ? 5   THR A CG2 1 
ATOM   70   C CG2 B THR A 1 6   ? -2.712 8.474   9.721   0.48 13.13 ? 5   THR A CG2 1 
ATOM   71   N N   A TRP A 1 7   ? -1.759 5.651   11.071  0.49 7.89  ? 6   TRP A N   1 
ATOM   72   N N   B TRP A 1 7   ? -1.766 5.682   11.071  0.49 7.79  ? 6   TRP A N   1 
ATOM   73   C CA  A TRP A 1 7   ? -1.053 5.286   12.296  0.53 7.86  ? 6   TRP A CA  1 
ATOM   74   C CA  B TRP A 1 7   ? -1.074 5.332   12.305  0.47 8.00  ? 6   TRP A CA  1 
ATOM   75   C C   A TRP A 1 7   ? 0.050  6.299   12.528  0.49 9.15  ? 6   TRP A C   1 
ATOM   76   C C   B TRP A 1 7   ? 0.046  6.319   12.528  0.49 9.13  ? 6   TRP A C   1 
ATOM   77   O O   A TRP A 1 7   ? 0.722  6.664   11.569  0.47 10.73 ? 6   TRP A O   1 
ATOM   78   O O   B TRP A 1 7   ? 0.726  6.669   11.566  0.47 10.73 ? 6   TRP A O   1 
ATOM   79   C CB  A TRP A 1 7   ? -0.409 3.908   12.080  0.55 9.09  ? 6   TRP A CB  1 
ATOM   80   C CB  B TRP A 1 7   ? -0.471 3.949   12.099  0.45 9.34  ? 6   TRP A CB  1 
ATOM   81   C CG  A TRP A 1 7   ? -1.413 2.823   11.745  0.50 7.87  ? 6   TRP A CG  1 
ATOM   82   C CG  B TRP A 1 7   ? -1.509 2.910   11.748  0.50 7.97  ? 6   TRP A CG  1 
ATOM   83   C CD1 A TRP A 1 7   ? -1.795 2.437   10.510  0.52 9.52  ? 6   TRP A CD1 1 
ATOM   84   C CD1 B TRP A 1 7   ? -1.834 2.489   10.510  0.48 9.64  ? 6   TRP A CD1 1 
ATOM   85   C CD2 A TRP A 1 7   ? -2.116 1.990   12.666  0.50 7.89  ? 6   TRP A CD2 1 
ATOM   86   C CD2 B TRP A 1 7   ? -2.141 2.016   12.662  0.50 7.84  ? 6   TRP A CD2 1 
ATOM   87   N NE1 A TRP A 1 7   ? -2.724 1.430   10.592  0.52 11.03 ? 6   TRP A NE1 1 
ATOM   88   N NE1 B TRP A 1 7   ? -2.748 1.466   10.585  0.48 10.97 ? 6   TRP A NE1 1 
ATOM   89   C CE2 A TRP A 1 7   ? -2.906 1.101   11.898  0.56 9.02  ? 6   TRP A CE2 1 
ATOM   90   C CE2 B TRP A 1 7   ? -2.920 1.121   11.892  0.44 9.04  ? 6   TRP A CE2 1 
ATOM   91   C CE3 A TRP A 1 7   ? -2.133 1.882   14.053  0.51 10.07 ? 6   TRP A CE3 1 
ATOM   92   C CE3 B TRP A 1 7   ? -2.148 1.898   14.050  0.49 10.11 ? 6   TRP A CE3 1 
ATOM   93   C CZ2 A TRP A 1 7   ? -3.740 0.165   12.481  0.58 12.66 ? 6   TRP A CZ2 1 
ATOM   94   C CZ2 B TRP A 1 7   ? -3.733 0.170   12.474  0.42 12.70 ? 6   TRP A CZ2 1 
ATOM   95   C CZ3 A TRP A 1 7   ? -2.949 0.941   14.627  0.54 13.92 ? 6   TRP A CZ3 1 
ATOM   96   C CZ3 B TRP A 1 7   ? -2.946 0.941   14.620  0.46 13.91 ? 6   TRP A CZ3 1 
ATOM   97   C CH2 A TRP A 1 7   ? -3.728 0.093   13.843  0.54 11.38 ? 6   TRP A CH2 1 
ATOM   98   C CH2 B TRP A 1 7   ? -3.713 0.088   13.837  0.46 11.23 ? 6   TRP A CH2 1 
ATOM   99   N N   A LYS A 1 8   ? 0.247  6.746   13.768  0.47 8.39  ? 7   LYS A N   1 
ATOM   100  N N   B LYS A 1 8   ? 0.243  6.762   13.765  0.47 8.42  ? 7   LYS A N   1 
ATOM   101  C CA  A LYS A 1 8   ? 1.294  7.728   14.066  0.49 7.26  ? 7   LYS A CA  1 
ATOM   102  C CA  B LYS A 1 8   ? 1.301  7.728   14.066  0.49 7.24  ? 7   LYS A CA  1 
ATOM   103  C C   A LYS A 1 8   ? 2.189  7.142   15.137  0.50 7.79  ? 7   LYS A C   1 
ATOM   104  C C   B LYS A 1 8   ? 2.193  7.142   15.137  0.50 7.80  ? 7   LYS A C   1 
ATOM   105  O O   A LYS A 1 8   ? 1.740  6.597   16.137  0.53 8.03  ? 7   LYS A O   1 
ATOM   106  O O   B LYS A 1 8   ? 1.740  6.597   16.140  0.47 8.03  ? 7   LYS A O   1 
ATOM   107  C CB  A LYS A 1 8   ? 0.717  9.075   14.476  0.49 11.76 ? 7   LYS A CB  1 
ATOM   108  C CB  B LYS A 1 8   ? 0.720  9.080   14.479  0.49 11.78 ? 7   LYS A CB  1 
ATOM   109  C CG  A LYS A 1 8   ? 1.748  10.134  14.862  0.42 29.19 ? 7   LYS A CG  1 
ATOM   110  C CG  B LYS A 1 8   ? 1.748  10.140  14.862  0.42 29.23 ? 7   LYS A CG  1 
ATOM   111  C CD  A LYS A 1 8   ? 2.726  10.551  13.762  0.36 41.58 ? 7   LYS A CD  1 
ATOM   112  C CD  B LYS A 1 8   ? 2.726  10.551  13.762  0.36 41.58 ? 7   LYS A CD  1 
ATOM   113  C CE  A LYS A 1 8   ? 2.967  12.063  13.671  0.37 35.19 ? 7   LYS A CE  1 
ATOM   114  C CE  B LYS A 1 8   ? 2.967  12.063  13.671  0.37 35.20 ? 7   LYS A CE  1 
ATOM   115  N NZ  A LYS A 1 8   ? 2.218  12.746  12.600  0.35 38.06 ? 7   LYS A NZ  1 
ATOM   116  N NZ  B LYS A 1 8   ? 2.218  12.746  12.600  0.35 38.07 ? 7   LYS A NZ  1 
ATOM   117  N N   A VAL A 1 9   ? 3.502  7.235   14.924  0.51 7.86  ? 8   VAL A N   1 
ATOM   118  N N   B VAL A 1 9   ? 3.502  7.235   14.924  0.49 7.85  ? 8   VAL A N   1 
ATOM   119  C CA  A VAL A 1 9   ? 4.409  6.633   15.861  0.48 6.24  ? 8   VAL A CA  1 
ATOM   120  C CA  B VAL A 1 9   ? 4.408  6.633   15.864  0.48 6.24  ? 8   VAL A CA  1 
ATOM   121  C C   A VAL A 1 9   ? 4.252  7.183   17.271  0.44 7.59  ? 8   VAL A C   1 
ATOM   122  C C   B VAL A 1 9   ? 4.252  7.183   17.271  0.44 7.59  ? 8   VAL A C   1 
ATOM   123  O O   A VAL A 1 9   ? 4.141  8.386   17.421  0.48 10.19 ? 8   VAL A O   1 
ATOM   124  O O   B VAL A 1 9   ? 4.141  8.386   17.421  0.48 10.19 ? 8   VAL A O   1 
ATOM   125  C CB  A VAL A 1 9   ? 5.870  6.674   15.382  0.45 7.84  ? 8   VAL A CB  1 
ATOM   126  C CB  B VAL A 1 9   ? 5.870  6.674   15.382  0.45 7.84  ? 8   VAL A CB  1 
ATOM   127  C CG1 A VAL A 1 9   ? 6.432  8.093   15.303  0.51 13.29 ? 8   VAL A CG1 1 
ATOM   128  C CG1 B VAL A 1 9   ? 6.432  8.093   15.303  0.49 13.29 ? 8   VAL A CG1 1 
ATOM   129  C CG2 A VAL A 1 9   ? 6.762  5.723   16.202  0.50 12.99 ? 8   VAL A CG2 1 
ATOM   130  C CG2 B VAL A 1 9   ? 6.762  5.723   16.202  0.50 12.99 ? 8   VAL A CG2 1 
ATOM   131  N N   A ASP A 1 10  ? 4.273  6.304   18.264  0.50 7.25  ? 9   ASP A N   1 
ATOM   132  N N   B ASP A 1 10  ? 4.273  6.304   18.264  0.50 7.25  ? 9   ASP A N   1 
ATOM   133  C CA  A ASP A 1 10  ? 4.103  6.705   19.652  0.51 9.57  ? 9   ASP A CA  1 
ATOM   134  C CA  B ASP A 1 10  ? 4.103  6.705   19.652  0.49 9.57  ? 9   ASP A CA  1 
ATOM   135  C C   A ASP A 1 10  ? 5.380  6.520   20.466  0.44 13.06 ? 9   ASP A C   1 
ATOM   136  C C   B ASP A 1 10  ? 5.380  6.520   20.466  0.44 13.06 ? 9   ASP A C   1 
ATOM   137  O O   A ASP A 1 10  ? 5.777  7.389   21.230  0.49 14.11 ? 9   ASP A O   1 
ATOM   138  O O   B ASP A 1 10  ? 5.777  7.389   21.230  0.49 14.11 ? 9   ASP A O   1 
ATOM   139  C CB  A ASP A 1 10  ? 2.958  5.913   20.272  0.52 11.61 ? 9   ASP A CB  1 
ATOM   140  C CB  B ASP A 1 10  ? 2.958  5.913   20.272  0.48 11.61 ? 9   ASP A CB  1 
ATOM   141  C CG  A ASP A 1 10  ? 2.726  6.155   21.741  0.51 18.36 ? 9   ASP A CG  1 
ATOM   142  C CG  B ASP A 1 10  ? 2.726  6.155   21.741  0.49 18.36 ? 9   ASP A CG  1 
ATOM   143  O OD1 A ASP A 1 10  ? 2.295  7.363   22.014  0.50 19.02 ? 9   ASP A OD1 1 
ATOM   144  O OD1 B ASP A 1 10  ? 2.295  7.363   22.014  0.50 19.02 ? 9   ASP A OD1 1 
ATOM   145  O OD2 A ASP A 1 10  ? 2.918  5.312   22.577  0.49 16.46 ? 9   ASP A OD2 1 
ATOM   146  O OD2 B ASP A 1 10  ? 2.918  5.312   22.577  0.49 16.46 ? 9   ASP A OD2 1 
ATOM   147  N N   A ARG A 1 11  ? 6.018  5.374   20.306  0.50 8.97  ? 10  ARG A N   1 
ATOM   148  N N   B ARG A 1 11  ? 6.018  5.374   20.306  0.50 8.97  ? 10  ARG A N   1 
ATOM   149  C CA  A ARG A 1 11  ? 7.192  5.122   21.068  0.51 9.13  ? 10  ARG A CA  1 
ATOM   150  C CA  B ARG A 1 11  ? 7.192  5.122   21.068  0.49 9.13  ? 10  ARG A CA  1 
ATOM   151  C C   A ARG A 1 11  ? 8.050  4.088   20.381  0.49 8.75  ? 10  ARG A C   1 
ATOM   152  C C   B ARG A 1 11  ? 8.050  4.088   20.381  0.49 8.75  ? 10  ARG A C   1 
ATOM   153  O O   A ARG A 1 11  ? 7.591  3.312   19.526  0.51 10.27 ? 10  ARG A O   1 
ATOM   154  O O   B ARG A 1 11  ? 7.591  3.312   19.526  0.49 10.27 ? 10  ARG A O   1 
ATOM   155  C CB  A ARG A 1 11  ? 6.805  4.654   22.462  0.49 13.80 ? 10  ARG A CB  1 
ATOM   156  C CB  B ARG A 1 11  ? 6.805  4.654   22.462  0.49 13.80 ? 10  ARG A CB  1 
ATOM   157  C CG  A ARG A 1 11  ? 6.070  3.327   22.496  0.52 10.61 ? 10  ARG A CG  1 
ATOM   158  C CG  B ARG A 1 11  ? 6.070  3.327   22.496  0.48 10.61 ? 10  ARG A CG  1 
ATOM   159  C CD  A ARG A 1 11  ? 5.356  3.086   23.843  0.52 12.76 ? 10  ARG A CD  1 
ATOM   160  C CD  B ARG A 1 11  ? 5.356  3.086   23.843  0.48 12.76 ? 10  ARG A CD  1 
ATOM   161  N NE  A ARG A 1 11  ? 4.728  1.780   23.853  0.52 11.84 ? 10  ARG A NE  1 
ATOM   162  N NE  B ARG A 1 11  ? 4.728  1.780   23.853  0.48 11.84 ? 10  ARG A NE  1 
ATOM   163  C CZ  A ARG A 1 11  ? 3.470  1.523   23.445  0.49 10.76 ? 10  ARG A CZ  1 
ATOM   164  C CZ  B ARG A 1 11  ? 3.470  1.523   23.445  0.49 10.76 ? 10  ARG A CZ  1 
ATOM   165  N NH1 A ARG A 1 11  ? 2.705  2.520   23.010  0.53 12.21 ? 10  ARG A NH1 1 
ATOM   166  N NH1 B ARG A 1 11  ? 2.705  2.520   23.010  0.47 12.21 ? 10  ARG A NH1 1 
ATOM   167  N NH2 A ARG A 1 11  ? 2.986  0.294   23.445  0.51 11.82 ? 10  ARG A NH2 1 
ATOM   168  N NH2 B ARG A 1 11  ? 2.986  0.294   23.445  0.49 11.82 ? 10  ARG A NH2 1 
ATOM   169  N N   A ASN A 1 12  ? 9.305  4.083   20.779  0.52 8.06  ? 11  ASN A N   1 
ATOM   170  N N   B ASN A 1 12  ? 9.305  4.083   20.779  0.48 8.06  ? 11  ASN A N   1 
ATOM   171  C CA  A ASN A 1 12  ? 10.246 3.163   20.193  0.49 7.12  ? 11  ASN A CA  1 
ATOM   172  C CA  B ASN A 1 12  ? 10.246 3.163   20.193  0.49 7.12  ? 11  ASN A CA  1 
ATOM   173  C C   A ASN A 1 12  ? 10.910 2.325   21.271  0.47 6.69  ? 11  ASN A C   1 
ATOM   174  C C   B ASN A 1 12  ? 10.910 2.325   21.271  0.47 6.69  ? 11  ASN A C   1 
ATOM   175  O O   A ASN A 1 12  ? 10.977 2.757   22.440  0.47 8.72  ? 11  ASN A O   1 
ATOM   176  O O   B ASN A 1 12  ? 10.977 2.757   22.440  0.47 8.72  ? 11  ASN A O   1 
ATOM   177  C CB  A ASN A 1 12  ? 11.354 3.934   19.460  0.50 11.58 ? 11  ASN A CB  1 
ATOM   178  C CB  B ASN A 1 12  ? 11.354 3.934   19.460  0.50 11.58 ? 11  ASN A CB  1 
ATOM   179  C CG  A ASN A 1 12  ? 10.886 5.029   18.527  0.54 13.50 ? 11  ASN A CG  1 
ATOM   180  C CG  B ASN A 1 12  ? 10.886 5.029   18.527  0.46 13.50 ? 11  ASN A CG  1 
ATOM   181  O OD1 A ASN A 1 12  ? 10.093 4.792   17.625  0.49 16.12 ? 11  ASN A OD1 1 
ATOM   182  O OD1 B ASN A 1 12  ? 10.093 4.792   17.625  0.49 16.12 ? 11  ASN A OD1 1 
ATOM   183  N ND2 A ASN A 1 12  ? 11.415 6.222   18.731  0.50 18.43 ? 11  ASN A ND2 1 
ATOM   184  N ND2 B ASN A 1 12  ? 11.415 6.222   18.731  0.50 18.43 ? 11  ASN A ND2 1 
ATOM   185  N N   A GLU A 1 13  ? 11.436 1.188   20.870  0.51 6.62  ? 12  GLU A N   1 
ATOM   186  N N   B GLU A 1 13  ? 11.436 1.188   20.873  0.49 6.62  ? 12  GLU A N   1 
ATOM   187  C CA  A GLU A 1 13  ? 12.201 0.335   21.779  0.48 8.35  ? 12  GLU A CA  1 
ATOM   188  C CA  B GLU A 1 13  ? 12.201 0.335   21.779  0.48 8.35  ? 12  GLU A CA  1 
ATOM   189  C C   A GLU A 1 13  ? 13.484 -0.066  21.052  0.51 8.77  ? 12  GLU A C   1 
ATOM   190  C C   B GLU A 1 13  ? 13.484 -0.066  21.052  0.49 8.77  ? 12  GLU A C   1 
ATOM   191  O O   A GLU A 1 13  ? 13.433 -0.627  19.968  0.52 8.79  ? 12  GLU A O   1 
ATOM   192  O O   B GLU A 1 13  ? 13.433 -0.627  19.968  0.48 8.79  ? 12  GLU A O   1 
ATOM   193  C CB  A GLU A 1 13  ? 11.422 -0.904  22.292  0.50 10.71 ? 12  GLU A CB  1 
ATOM   194  C CB  B GLU A 1 13  ? 11.426 -0.904  22.292  0.50 10.71 ? 12  GLU A CB  1 
ATOM   195  C CG  A GLU A 1 13  ? 10.145 -0.596  23.088  0.49 13.12 ? 12  GLU A CG  1 
ATOM   196  C CG  B GLU A 1 13  ? 10.145 -0.596  23.088  0.49 13.12 ? 12  GLU A CG  1 
ATOM   197  C CD  A GLU A 1 13  ? 9.477  -1.814  23.721  0.43 14.93 ? 12  GLU A CD  1 
ATOM   198  C CD  B GLU A 1 13  ? 9.477  -1.814  23.721  0.43 14.93 ? 12  GLU A CD  1 
ATOM   199  O OE1 A GLU A 1 13  ? 10.186 -2.899  23.686  0.50 15.66 ? 12  GLU A OE1 1 
ATOM   200  O OE1 B GLU A 1 13  ? 10.186 -2.899  23.686  0.50 15.66 ? 12  GLU A OE1 1 
ATOM   201  O OE2 A GLU A 1 13  ? 8.367  -1.778  24.203  0.47 25.77 ? 12  GLU A OE2 1 
ATOM   202  O OE2 B GLU A 1 13  ? 8.367  -1.778  24.203  0.47 25.77 ? 12  GLU A OE2 1 
ATOM   203  N N   A ASN A 1 14  ? 14.631 0.289   21.616  0.51 7.27  ? 13  ASN A N   1 
ATOM   204  N N   B ASN A 1 14  ? 14.631 0.289   21.616  0.49 7.27  ? 13  ASN A N   1 
ATOM   205  C CA  A ASN A 1 14  ? 15.938 -0.056  21.074  0.48 7.52  ? 13  ASN A CA  1 
ATOM   206  C CA  B ASN A 1 14  ? 15.938 -0.056  21.074  0.48 7.51  ? 13  ASN A CA  1 
ATOM   207  C C   A ASN A 1 14  ? 16.194 0.458   19.664  0.48 7.79  ? 13  ASN A C   1 
ATOM   208  C C   B ASN A 1 14  ? 16.194 0.458   19.664  0.48 7.79  ? 13  ASN A C   1 
ATOM   209  O O   A ASN A 1 14  ? 17.056 -0.056  18.965  0.50 8.95  ? 13  ASN A O   1 
ATOM   210  O O   B ASN A 1 14  ? 17.056 -0.056  18.965  0.50 8.95  ? 13  ASN A O   1 
ATOM   211  C CB  A ASN A 1 14  ? 16.157 -1.588  21.136  0.49 9.85  ? 13  ASN A CB  1 
ATOM   212  C CB  B ASN A 1 14  ? 16.157 -1.588  21.136  0.49 9.85  ? 13  ASN A CB  1 
ATOM   213  C CG  A ASN A 1 14  ? 17.586 -1.984  21.415  0.47 13.30 ? 13  ASN A CG  1 
ATOM   214  C CG  B ASN A 1 14  ? 17.586 -1.984  21.415  0.47 13.29 ? 13  ASN A CG  1 
ATOM   215  O OD1 A ASN A 1 14  ? 18.279 -1.321  22.180  0.46 14.82 ? 13  ASN A OD1 1 
ATOM   216  O OD1 B ASN A 1 14  ? 18.279 -1.326  22.180  0.46 14.82 ? 13  ASN A OD1 1 
ATOM   217  N ND2 A ASN A 1 14  ? 18.036 -3.064  20.779  0.48 14.28 ? 13  ASN A ND2 1 
ATOM   218  N ND2 B ASN A 1 14  ? 18.036 -3.064  20.779  0.48 14.28 ? 13  ASN A ND2 1 
ATOM   219  N N   A TYR A 1 15  ? 15.478 1.517   19.247  0.53 7.75  ? 14  TYR A N   1 
ATOM   220  N N   B TYR A 1 15  ? 15.478 1.512   19.247  0.47 7.76  ? 14  TYR A N   1 
ATOM   221  C CA  A TYR A 1 15  ? 15.636 2.016   17.894  0.51 8.72  ? 14  TYR A CA  1 
ATOM   222  C CA  B TYR A 1 15  ? 15.633 2.006   17.891  0.49 8.70  ? 14  TYR A CA  1 
ATOM   223  C C   A TYR A 1 15  ? 16.984 2.659   17.587  0.51 8.03  ? 14  TYR A C   1 
ATOM   224  C C   B TYR A 1 15  ? 16.976 2.654   17.587  0.49 8.04  ? 14  TYR A C   1 
ATOM   225  O O   A TYR A 1 15  ? 17.541 2.458   16.516  0.51 8.80  ? 14  TYR A O   1 
ATOM   226  O O   B TYR A 1 15  ? 17.538 2.463   16.516  0.49 8.79  ? 14  TYR A O   1 
ATOM   227  C CB  A TYR A 1 15  ? 14.423 2.875   17.537  0.53 8.65  ? 14  TYR A CB  1 
ATOM   228  C CB  B TYR A 1 15  ? 14.423 2.875   17.537  0.47 8.67  ? 14  TYR A CB  1 
ATOM   229  C CG  A TYR A 1 15  ? 14.320 3.255   16.108  0.48 8.99  ? 14  TYR A CG  1 
ATOM   230  C CG  B TYR A 1 15  ? 14.320 3.255   16.108  0.48 8.99  ? 14  TYR A CG  1 
ATOM   231  C CD1 A TYR A 1 15  ? 14.531 2.335   15.078  0.50 8.79  ? 14  TYR A CD1 1 
ATOM   232  C CD1 B TYR A 1 15  ? 14.531 2.335   15.075  0.50 8.79  ? 14  TYR A CD1 1 
ATOM   233  C CD2 A TYR A 1 15  ? 14.001 4.582   15.776  0.49 9.16  ? 14  TYR A CD2 1 
ATOM   234  C CD2 B TYR A 1 15  ? 14.001 4.582   15.776  0.49 9.16  ? 14  TYR A CD2 1 
ATOM   235  C CE1 A TYR A 1 15  ? 14.380 2.720   13.737  0.51 9.85  ? 14  TYR A CE1 1 
ATOM   236  C CE1 B TYR A 1 15  ? 14.380 2.720   13.737  0.49 9.85  ? 14  TYR A CE1 1 
ATOM   237  C CE2 A TYR A 1 15  ? 13.849 4.972   14.442  0.52 9.59  ? 14  TYR A CE2 1 
ATOM   238  C CE2 B TYR A 1 15  ? 13.849 4.972   14.442  0.48 9.59  ? 14  TYR A CE2 1 
ATOM   239  C CZ  A TYR A 1 15  ? 14.049 4.037   13.430  0.50 8.74  ? 14  TYR A CZ  1 
ATOM   240  C CZ  B TYR A 1 15  ? 14.049 4.037   13.430  0.50 8.74  ? 14  TYR A CZ  1 
ATOM   241  O OH  A TYR A 1 15  ? 13.911 4.412   12.108  0.53 11.78 ? 14  TYR A OH  1 
ATOM   242  O OH  B TYR A 1 15  ? 13.911 4.412   12.108  0.47 11.78 ? 14  TYR A OH  1 
ATOM   243  N N   A GLU A 1 16  ? 17.530 3.415   18.533  0.52 10.06 ? 15  GLU A N   1 
ATOM   244  N N   B GLU A 1 16  ? 17.501 3.420   18.536  0.48 9.90  ? 15  GLU A N   1 
ATOM   245  C CA  A GLU A 1 16  ? 18.836 4.001   18.289  0.50 9.78  ? 15  GLU A CA  1 
ATOM   246  C CA  B GLU A 1 16  ? 18.790 4.032   18.279  0.50 9.49  ? 15  GLU A CA  1 
ATOM   247  C C   A GLU A 1 16  ? 19.936 2.926   18.204  0.51 10.99 ? 15  GLU A C   1 
ATOM   248  C C   B GLU A 1 16  ? 19.907 2.998   18.085  0.49 11.35 ? 15  GLU A C   1 
ATOM   249  O O   A GLU A 1 16  ? 20.922 3.080   17.499  0.52 11.07 ? 15  GLU A O   1 
ATOM   250  O O   B GLU A 1 16  ? 20.696 3.168   17.164  0.48 10.22 ? 15  GLU A O   1 
ATOM   251  C CB  A GLU A 1 16  ? 19.220 5.075   19.319  0.46 13.66 ? 15  GLU A CB  1 
ATOM   252  C CB  B GLU A 1 16  ? 19.202 5.080   19.323  0.46 13.73 ? 15  GLU A CB  1 
ATOM   253  C CG  A GLU A 1 16  ? 18.307 6.309   19.238  0.37 15.09 ? 15  GLU A CG  1 
ATOM   254  C CG  B GLU A 1 16  ? 18.303 6.314   19.241  0.37 15.09 ? 15  GLU A CG  1 
ATOM   255  C CD  A GLU A 1 16  ? 18.797 7.404   20.134  0.43 25.89 ? 15  GLU A CD  1 
ATOM   256  C CD  B GLU A 1 16  ? 18.797 7.404   20.137  0.43 25.79 ? 15  GLU A CD  1 
ATOM   257  O OE1 A GLU A 1 16  ? 19.972 7.641   20.303  0.48 26.76 ? 15  GLU A OE1 1 
ATOM   258  O OE1 B GLU A 1 16  ? 19.972 7.641   20.303  0.48 26.77 ? 15  GLU A OE1 1 
ATOM   259  O OE2 A GLU A 1 16  ? 17.817 8.037   20.707  0.49 20.52 ? 15  GLU A OE2 1 
ATOM   260  O OE2 B GLU A 1 16  ? 17.817 8.037   20.710  0.49 20.53 ? 15  GLU A OE2 1 
ATOM   261  N N   A LYS A 1 17  ? 19.775 1.810   18.925  0.50 10.85 ? 16  LYS A N   1 
ATOM   262  N N   B LYS A 1 17  ? 19.956 1.954   18.944  0.50 10.94 ? 16  LYS A N   1 
ATOM   263  C CA  A LYS A 1 17  ? 20.754 0.731   18.809  0.53 10.59 ? 16  LYS A CA  1 
ATOM   264  C CA  B LYS A 1 17  ? 20.946 0.864   18.831  0.47 10.66 ? 16  LYS A CA  1 
ATOM   265  C C   A LYS A 1 17  ? 20.710 0.093   17.427  0.53 12.66 ? 16  LYS A C   1 
ATOM   266  C C   B LYS A 1 17  ? 20.801 0.196   17.515  0.47 10.39 ? 16  LYS A C   1 
ATOM   267  O O   A LYS A 1 17  ? 21.732 -0.277  16.876  0.49 10.34 ? 16  LYS A O   1 
ATOM   268  O O   B LYS A 1 17  ? 21.743 -0.241  16.867  0.49 10.36 ? 16  LYS A O   1 
ATOM   269  C CB  A LYS A 1 17  ? 20.650 -0.262  19.965  0.47 13.91 ? 16  LYS A CB  1 
ATOM   270  C CB  B LYS A 1 17  ? 20.685 -0.226  19.852  0.47 15.27 ? 16  LYS A CB  1 
ATOM   271  C CG  A LYS A 1 17  ? 21.410 0.196   21.202  0.44 20.90 ? 16  LYS A CG  1 
ATOM   272  C CG  B LYS A 1 17  ? 21.599 -0.123  21.049  0.44 31.38 ? 16  LYS A CG  1 
ATOM   273  C CD  A LYS A 1 17  ? 22.872 0.386   20.861  0.40 17.94 ? 16  LYS A CD  1 
ATOM   274  C CD  B LYS A 1 17  ? 22.886 -0.904  20.867  0.39 43.66 ? 16  LYS A CD  1 
ATOM   275  C CE  A LYS A 1 17  ? 23.771 0.942   21.951  0.44 41.94 ? 16  LYS A CE  1 
ATOM   276  C CE  B LYS A 1 17  ? 23.715 -0.514  19.642  0.45 43.80 ? 16  LYS A CE  1 
ATOM   277  N NZ  A LYS A 1 17  ? 23.961 -0.005  23.054  0.51 32.94 ? 16  LYS A NZ  1 
ATOM   278  N NZ  B LYS A 1 17  ? 23.929 -1.573  18.633  0.47 20.52 ? 16  LYS A NZ  1 
ATOM   279  N N   A PHE A 1 18  ? 19.511 -0.056  16.816  0.50 7.99  ? 17  PHE A N   1 
ATOM   280  N N   B PHE A 1 18  ? 19.542 0.031   17.127  0.50 9.19  ? 17  PHE A N   1 
ATOM   281  C CA  A PHE A 1 18  ? 19.331 -0.617  15.476  0.50 6.90  ? 17  PHE A CA  1 
ATOM   282  C CA  B PHE A 1 18  ? 19.296 -0.575  15.867  0.50 7.17  ? 17  PHE A CA  1 
ATOM   283  C C   A PHE A 1 18  ? 19.977 0.278   14.401  0.49 7.84  ? 17  PHE A C   1 
ATOM   284  C C   B PHE A 1 18  ? 19.925 0.304   14.783  0.49 6.73  ? 17  PHE A C   1 
ATOM   285  O O   A PHE A 1 18  ? 20.713 -0.164  13.496  0.51 7.50  ? 17  PHE A O   1 
ATOM   286  O O   B PHE A 1 18  ? 20.645 -0.205  13.922  0.49 7.80  ? 17  PHE A O   1 
ATOM   287  C CB  A PHE A 1 18  ? 17.830 -0.807  15.209  0.54 8.05  ? 17  PHE A CB  1 
ATOM   288  C CB  B PHE A 1 18  ? 17.802 -0.807  15.635  0.46 9.09  ? 17  PHE A CB  1 
ATOM   289  C CG  A PHE A 1 18  ? 17.479 -0.946  13.746  0.52 6.16  ? 17  PHE A CG  1 
ATOM   290  C CG  B PHE A 1 18  ? 17.502 -1.249  14.229  0.48 6.83  ? 17  PHE A CG  1 
ATOM   291  C CD1 A PHE A 1 18  ? 17.612 -2.185  13.129  0.51 8.92  ? 17  PHE A CD1 1 
ATOM   292  C CD1 B PHE A 1 18  ? 17.582 -2.586  13.872  0.49 9.04  ? 17  PHE A CD1 1 
ATOM   293  C CD2 A PHE A 1 18  ? 17.027 0.144   13.020  0.53 9.46  ? 17  PHE A CD2 1 
ATOM   294  C CD2 B PHE A 1 18  ? 17.156 -0.308  13.251  0.47 9.42  ? 17  PHE A CD2 1 
ATOM   295  C CE1 A PHE A 1 18  ? 17.289 -2.344  11.779  0.48 10.50 ? 17  PHE A CE1 1 
ATOM   296  C CE1 B PHE A 1 18  ? 17.298 -2.992  12.565  0.47 8.80  ? 17  PHE A CE1 1 
ATOM   297  C CE2 A PHE A 1 18  ? 16.682 -0.005  11.685  0.51 8.97  ? 17  PHE A CE2 1 
ATOM   298  C CE2 B PHE A 1 18  ? 16.847 -0.694  11.951  0.47 11.99 ? 17  PHE A CE2 1 
ATOM   299  C CZ  A PHE A 1 18  ? 16.830 -1.244  11.058  0.52 10.96 ? 17  PHE A CZ  1 
ATOM   300  C CZ  B PHE A 1 18  ? 16.948 -2.041  11.604  0.48 10.99 ? 17  PHE A CZ  1 
ATOM   301  N N   A MET A 1 19  ? 19.701 1.574   14.504  0.51 6.56  ? 18  MET A N   1 
ATOM   302  N N   B MET A 1 19  ? 19.678 1.625   14.824  0.49 6.36  ? 18  MET A N   1 
ATOM   303  C CA  A MET A 1 19  ? 20.261 2.566   13.609  0.49 8.08  ? 18  MET A CA  1 
ATOM   304  C CA  B MET A 1 19  ? 20.246 2.494   13.787  0.49 7.15  ? 18  MET A CA  1 
ATOM   305  C C   A MET A 1 19  ? 21.780 2.576   13.715  0.48 6.75  ? 18  MET A C   1 
ATOM   306  C C   B MET A 1 19  ? 21.760 2.530   13.796  0.48 6.97  ? 18  MET A C   1 
ATOM   307  O O   A MET A 1 19  ? 22.471 2.592   12.709  0.49 9.01  ? 18  MET A O   1 
ATOM   308  O O   B MET A 1 19  ? 22.395 2.597   12.750  0.49 8.81  ? 18  MET A O   1 
ATOM   309  C CB  A MET A 1 19  ? 19.690 3.959   13.931  0.52 8.96  ? 18  MET A CB  1 
ATOM   310  C CB  B MET A 1 19  ? 19.703 3.939   13.715  0.48 8.81  ? 18  MET A CB  1 
ATOM   311  C CG  A MET A 1 19  ? 18.263 4.011   13.446  0.49 8.35  ? 18  MET A CG  1 
ATOM   312  C CG  B MET A 1 19  ? 18.220 4.006   13.442  0.49 8.29  ? 18  MET A CG  1 
ATOM   313  S SD  A MET A 1 19  ? 17.581 5.666   13.370  0.48 12.21 ? 18  MET A SD  1 
ATOM   314  S SD  B MET A 1 19  ? 17.591 5.692   13.518  0.48 12.17 ? 18  MET A SD  1 
ATOM   315  C CE  A MET A 1 19  ? 17.255 5.862   15.128  0.52 14.37 ? 18  MET A CE  1 
ATOM   316  C CE  B MET A 1 19  ? 17.234 5.852   15.266  0.48 15.72 ? 18  MET A CE  1 
ATOM   317  N N   A GLU A 1 20  ? 22.269 2.489   14.934  0.52 8.53  ? 19  GLU A N   1 
ATOM   318  N N   B GLU A 1 20  ? 22.293 2.443   14.981  0.48 8.69  ? 19  GLU A N   1 
ATOM   319  C CA  A GLU A 1 20  ? 23.722 2.412   15.115  0.52 11.04 ? 19  GLU A CA  1 
ATOM   320  C CA  B GLU A 1 20  ? 23.743 2.407   15.115  0.48 10.86 ? 19  GLU A CA  1 
ATOM   321  C C   A GLU A 1 20  ? 24.292 1.193   14.398  0.52 10.30 ? 19  GLU A C   1 
ATOM   322  C C   B GLU A 1 20  ? 24.306 1.188   14.395  0.48 10.37 ? 19  GLU A C   1 
ATOM   323  O O   A GLU A 1 20  ? 25.303 1.275   13.696  0.52 10.86 ? 19  GLU A O   1 
ATOM   324  O O   B GLU A 1 20  ? 25.307 1.275   13.690  0.48 10.83 ? 19  GLU A O   1 
ATOM   325  C CB  A GLU A 1 20  ? 24.062 2.335   16.603  0.50 11.02 ? 19  GLU A CB  1 
ATOM   326  C CB  B GLU A 1 20  ? 24.076 2.345   16.600  0.50 11.04 ? 19  GLU A CB  1 
ATOM   327  C CG  A GLU A 1 20  ? 25.569 2.160   16.888  0.47 14.36 ? 19  GLU A CG  1 
ATOM   328  C CG  B GLU A 1 20  ? 25.576 2.160   16.888  0.47 14.23 ? 19  GLU A CG  1 
ATOM   329  C CD  A GLU A 1 20  ? 25.917 2.432   18.330  0.53 23.37 ? 19  GLU A CD  1 
ATOM   330  C CD  B GLU A 1 20  ? 25.921 2.432   18.330  0.47 23.38 ? 19  GLU A CD  1 
ATOM   331  O OE1 A GLU A 1 20  ? 24.941 2.278   19.182  0.52 40.78 ? 19  GLU A OE1 1 
ATOM   332  O OE1 B GLU A 1 20  ? 24.941 2.278   19.182  0.48 40.78 ? 19  GLU A OE1 1 
ATOM   333  O OE2 A GLU A 1 20  ? 27.017 2.798   18.665  0.47 40.27 ? 19  GLU A OE2 1 
ATOM   334  O OE2 B GLU A 1 20  ? 27.017 2.798   18.665  0.47 40.27 ? 19  GLU A OE2 1 
ATOM   335  N N   A LYS A 1 21  ? 23.640 0.047   14.542  0.50 9.29  ? 20  LYS A N   1 
ATOM   336  N N   B LYS A 1 21  ? 23.643 0.052   14.539  0.50 9.30  ? 20  LYS A N   1 
ATOM   337  C CA  A LYS A 1 21  ? 24.076 -1.187  13.890  0.46 10.23 ? 20  LYS A CA  1 
ATOM   338  C CA  B LYS A 1 21  ? 24.076 -1.182  13.890  0.46 10.23 ? 20  LYS A CA  1 
ATOM   339  C C   A LYS A 1 21  ? 24.065 -1.069  12.371  0.47 12.40 ? 20  LYS A C   1 
ATOM   340  C C   B LYS A 1 21  ? 24.065 -1.069  12.371  0.47 12.40 ? 20  LYS A C   1 
ATOM   341  O O   A LYS A 1 21  ? 24.916 -1.619  11.669  0.51 12.63 ? 20  LYS A O   1 
ATOM   342  O O   B LYS A 1 21  ? 24.916 -1.619  11.673  0.49 12.63 ? 20  LYS A O   1 
ATOM   343  C CB  A LYS A 1 21  ? 23.220 -2.339  14.389  0.50 10.65 ? 20  LYS A CB  1 
ATOM   344  C CB  B LYS A 1 21  ? 23.219 -2.339  14.392  0.50 10.65 ? 20  LYS A CB  1 
ATOM   345  C CG  A LYS A 1 21  ? 23.749 -3.696  14.013  0.49 13.36 ? 20  LYS A CG  1 
ATOM   346  C CG  B LYS A 1 21  ? 23.749 -3.696  14.013  0.49 13.37 ? 20  LYS A CG  1 
ATOM   347  C CD  A LYS A 1 21  ? 24.818 -4.046  15.009  0.55 18.48 ? 20  LYS A CD  1 
ATOM   348  C CD  B LYS A 1 21  ? 24.818 -4.041  15.009  0.45 18.48 ? 20  LYS A CD  1 
ATOM   349  C CE  A LYS A 1 21  ? 25.432 -5.398  14.796  0.50 25.96 ? 20  LYS A CE  1 
ATOM   350  C CE  B LYS A 1 21  ? 25.432 -5.398  14.796  0.50 25.96 ? 20  LYS A CE  1 
ATOM   351  N NZ  A LYS A 1 21  ? 26.374 -5.660  15.883  0.46 31.14 ? 20  LYS A NZ  1 
ATOM   352  N NZ  B LYS A 1 21  ? 26.374 -5.660  15.883  0.46 31.14 ? 20  LYS A NZ  1 
ATOM   353  N N   A MET A 1 22  ? 23.095 -0.313  11.845  0.47 10.02 ? 21  MET A N   1 
ATOM   354  N N   B MET A 1 22  ? 23.095 -0.313  11.845  0.47 10.02 ? 21  MET A N   1 
ATOM   355  C CA  A MET A 1 22  ? 22.913 -0.087  10.423  0.48 9.21  ? 21  MET A CA  1 
ATOM   356  C CA  B MET A 1 22  ? 22.913 -0.087  10.423  0.48 9.21  ? 21  MET A CA  1 
ATOM   357  C C   A MET A 1 22  ? 23.969 0.843   9.805   0.47 15.28 ? 21  MET A C   1 
ATOM   358  C C   B MET A 1 22  ? 23.969 0.843   9.805   0.47 15.28 ? 21  MET A C   1 
ATOM   359  O O   A MET A 1 22  ? 24.063 0.905   8.581   0.48 16.82 ? 21  MET A O   1 
ATOM   360  O O   B MET A 1 22  ? 24.063 0.905   8.581   0.48 16.82 ? 21  MET A O   1 
ATOM   361  C CB  A MET A 1 22  ? 21.493 0.401   10.084  0.51 9.82  ? 21  MET A CB  1 
ATOM   362  C CB  B MET A 1 22  ? 21.493 0.401   10.084  0.49 9.82  ? 21  MET A CB  1 
ATOM   363  C CG  A MET A 1 22  ? 20.446 -0.678  10.350  0.53 11.72 ? 21  MET A CG  1 
ATOM   364  C CG  B MET A 1 22  ? 20.446 -0.678  10.350  0.47 11.72 ? 21  MET A CG  1 
ATOM   365  S SD  A MET A 1 22  ? 20.239 -1.774  8.941   0.49 13.20 ? 21  MET A SD  1 
ATOM   366  S SD  B MET A 1 22  ? 20.239 -1.774  8.941   0.49 13.20 ? 21  MET A SD  1 
ATOM   367  C CE  A MET A 1 22  ? 19.526 -0.535  7.838   0.51 19.25 ? 21  MET A CE  1 
ATOM   368  C CE  B MET A 1 22  ? 19.526 -0.535  7.838   0.49 19.25 ? 21  MET A CE  1 
ATOM   369  N N   A GLY A 1 23  ? 24.702 1.558   10.667  0.49 12.17 ? 22  GLY A N   1 
ATOM   370  N N   B GLY A 1 23  ? 24.702 1.558   10.667  0.49 12.17 ? 22  GLY A N   1 
ATOM   371  C CA  A GLY A 1 23  ? 25.753 2.499   10.257  0.50 11.70 ? 22  GLY A CA  1 
ATOM   372  C CA  B GLY A 1 23  ? 25.753 2.499   10.257  0.50 11.70 ? 22  GLY A CA  1 
ATOM   373  C C   A GLY A 1 23  ? 25.321 3.964   10.291  0.44 13.47 ? 22  GLY A C   1 
ATOM   374  C C   B GLY A 1 23  ? 25.321 3.964   10.291  0.44 13.47 ? 22  GLY A C   1 
ATOM   375  O O   A GLY A 1 23  ? 25.960 4.833   9.686   0.44 16.27 ? 22  GLY A O   1 
ATOM   376  O O   B GLY A 1 23  ? 25.960 4.833   9.686   0.44 16.27 ? 22  GLY A O   1 
ATOM   377  N N   A ILE A 1 24  ? 24.238 4.288   10.993  0.50 10.56 ? 23  ILE A N   1 
ATOM   378  N N   B ILE A 1 24  ? 24.238 4.288   10.993  0.50 10.56 ? 23  ILE A N   1 
ATOM   379  C CA  A ILE A 1 24  ? 23.756 5.656   11.046  0.51 13.39 ? 23  ILE A CA  1 
ATOM   380  C CA  B ILE A 1 24  ? 23.756 5.656   11.046  0.49 13.39 ? 23  ILE A CA  1 
ATOM   381  C C   A ILE A 1 24  ? 24.434 6.438   12.139  0.47 10.75 ? 23  ILE A C   1 
ATOM   382  C C   B ILE A 1 24  ? 24.434 6.438   12.139  0.47 10.75 ? 23  ILE A C   1 
ATOM   383  O O   A ILE A 1 24  ? 24.588 5.949   13.258  0.49 12.44 ? 23  ILE A O   1 
ATOM   384  O O   B ILE A 1 24  ? 24.588 5.949   13.258  0.49 12.44 ? 23  ILE A O   1 
ATOM   385  C CB  A ILE A 1 24  ? 22.242 5.656   11.203  0.52 14.08 ? 23  ILE A CB  1 
ATOM   386  C CB  B ILE A 1 24  ? 22.242 5.656   11.203  0.48 14.08 ? 23  ILE A CB  1 
ATOM   387  C CG1 A ILE A 1 24  ? 21.632 4.864   10.069  0.52 18.01 ? 23  ILE A CG1 1 
ATOM   388  C CG1 B ILE A 1 24  ? 21.632 4.864   10.069  0.48 18.01 ? 23  ILE A CG1 1 
ATOM   389  C CG2 A ILE A 1 24  ? 21.663 7.075   11.253  0.54 20.59 ? 23  ILE A CG2 1 
ATOM   390  C CG2 B ILE A 1 24  ? 21.663 7.075   11.253  0.46 20.59 ? 23  ILE A CG2 1 
ATOM   391  C CD1 A ILE A 1 24  ? 20.122 4.808   10.219  0.49 24.85 ? 23  ILE A CD1 1 
ATOM   392  C CD1 B ILE A 1 24  ? 20.122 4.808   10.219  0.49 24.85 ? 23  ILE A CD1 1 
ATOM   393  N N   A ASN A 1 25  ? 24.873 7.672   11.835  0.46 12.27 ? 24  ASN A N   1 
ATOM   394  N N   B ASN A 1 25  ? 24.873 7.672   11.835  0.46 12.27 ? 24  ASN A N   1 
ATOM   395  C CA  A ASN A 1 25  ? 25.578 8.458   12.822  0.51 10.47 ? 24  ASN A CA  1 
ATOM   396  C CA  B ASN A 1 25  ? 25.578 8.458   12.822  0.49 10.47 ? 24  ASN A CA  1 
ATOM   397  C C   A ASN A 1 25  ? 24.741 8.993   13.953  0.48 13.76 ? 24  ASN A C   1 
ATOM   398  C C   B ASN A 1 25  ? 24.741 8.993   13.953  0.48 13.76 ? 24  ASN A C   1 
ATOM   399  O O   A ASN A 1 25  ? 23.522 9.055   13.865  0.50 12.33 ? 24  ASN A O   1 
ATOM   400  O O   B ASN A 1 25  ? 23.522 9.055   13.865  0.50 12.33 ? 24  ASN A O   1 
ATOM   401  C CB  A ASN A 1 25  ? 26.513 9.533   12.221  0.46 15.24 ? 24  ASN A CB  1 
ATOM   402  C CB  B ASN A 1 25  ? 26.513 9.533   12.221  0.46 15.24 ? 24  ASN A CB  1 
ATOM   403  C CG  A ASN A 1 25  ? 25.778 10.741  11.682  0.46 22.15 ? 24  ASN A CG  1 
ATOM   404  C CG  B ASN A 1 25  ? 25.778 10.741  11.682  0.46 22.15 ? 24  ASN A CG  1 
ATOM   405  O OD1 A ASN A 1 25  ? 24.892 11.296  12.340  0.45 19.54 ? 24  ASN A OD1 1 
ATOM   406  O OD1 B ASN A 1 25  ? 24.892 11.296  12.340  0.45 19.54 ? 24  ASN A OD1 1 
ATOM   407  N ND2 A ASN A 1 25  ? 26.139 11.163  10.479  0.47 28.18 ? 24  ASN A ND2 1 
ATOM   408  N ND2 B ASN A 1 25  ? 26.139 11.163  10.479  0.47 28.18 ? 24  ASN A ND2 1 
ATOM   409  N N   A VAL A 1 26  ? 25.409 9.379   15.021  0.49 11.73 ? 25  VAL A N   1 
ATOM   410  N N   B VAL A 1 26  ? 25.409 9.379   15.021  0.49 11.73 ? 25  VAL A N   1 
ATOM   411  C CA  A VAL A 1 26  ? 24.756 9.841   16.227  0.45 13.00 ? 25  VAL A CA  1 
ATOM   412  C CA  B VAL A 1 26  ? 24.756 9.841   16.227  0.45 13.00 ? 25  VAL A CA  1 
ATOM   413  C C   A VAL A 1 26  ? 23.659 10.890  16.046  0.44 14.16 ? 25  VAL A C   1 
ATOM   414  C C   B VAL A 1 26  ? 23.659 10.890  16.046  0.44 14.16 ? 25  VAL A C   1 
ATOM   415  O O   A VAL A 1 26  ? 22.556 10.746  16.581  0.49 14.18 ? 25  VAL A O   1 
ATOM   416  O O   B VAL A 1 26  ? 22.556 10.746  16.581  0.49 14.18 ? 25  VAL A O   1 
ATOM   417  C CB  A VAL A 1 26  ? 25.724 10.124  17.371  0.55 19.03 ? 25  VAL A CB  1 
ATOM   418  C CB  B VAL A 1 26  ? 25.724 10.124  17.371  0.45 19.03 ? 25  VAL A CB  1 
ATOM   419  C CG1 A VAL A 1 26  ? 26.505 11.394  17.064  0.41 25.92 ? 25  VAL A CG1 1 
ATOM   420  C CG1 B VAL A 1 26  ? 26.505 11.394  17.064  0.41 25.92 ? 25  VAL A CG1 1 
ATOM   421  C CG2 A VAL A 1 26  ? 24.955 10.366  18.655  0.51 17.57 ? 25  VAL A CG2 1 
ATOM   422  C CG2 B VAL A 1 26  ? 24.955 10.366  18.655  0.49 17.57 ? 25  VAL A CG2 1 
ATOM   423  N N   A VAL A 1 27  ? 23.966 11.955  15.313  0.49 12.20 ? 26  VAL A N   1 
ATOM   424  N N   B VAL A 1 27  ? 23.966 11.955  15.313  0.49 12.20 ? 26  VAL A N   1 
ATOM   425  C CA  A VAL A 1 27  ? 23.028 13.034  15.087  0.53 12.94 ? 26  VAL A CA  1 
ATOM   426  C CA  B VAL A 1 27  ? 23.028 13.034  15.087  0.47 12.94 ? 26  VAL A CA  1 
ATOM   427  C C   A VAL A 1 27  ? 21.814 12.546  14.351  0.49 11.28 ? 26  VAL A C   1 
ATOM   428  C C   B VAL A 1 27  ? 21.814 12.546  14.354  0.49 11.28 ? 26  VAL A C   1 
ATOM   429  O O   A VAL A 1 27  ? 20.674 12.829  14.761  0.52 14.00 ? 26  VAL A O   1 
ATOM   430  O O   B VAL A 1 27  ? 20.674 12.829  14.761  0.48 14.00 ? 26  VAL A O   1 
ATOM   431  C CB  A VAL A 1 27  ? 23.683 14.227  14.401  0.54 14.60 ? 26  VAL A CB  1 
ATOM   432  C CB  B VAL A 1 27  ? 23.683 14.227  14.401  0.46 14.61 ? 26  VAL A CB  1 
ATOM   433  C CG1 A VAL A 1 27  ? 22.664 15.266  13.956  0.53 16.86 ? 26  VAL A CG1 1 
ATOM   434  C CG1 B VAL A 1 27  ? 22.664 15.266  13.956  0.47 16.86 ? 26  VAL A CG1 1 
ATOM   435  C CG2 A VAL A 1 27  ? 24.562 14.875  15.435  0.52 17.52 ? 26  VAL A CG2 1 
ATOM   436  C CG2 B VAL A 1 27  ? 24.562 14.875  15.435  0.48 17.52 ? 26  VAL A CG2 1 
ATOM   437  N N   A LYS A 1 28  ? 22.037 11.805  13.267  0.50 11.33 ? 27  LYS A N   1 
ATOM   438  N N   B LYS A 1 28  ? 22.037 11.805  13.270  0.50 11.33 ? 27  LYS A N   1 
ATOM   439  C CA  A LYS A 1 28  ? 20.963 11.296  12.471  0.53 10.26 ? 27  LYS A CA  1 
ATOM   440  C CA  B LYS A 1 28  ? 20.963 11.296  12.474  0.47 10.28 ? 27  LYS A CA  1 
ATOM   441  C C   A LYS A 1 28  ? 20.120 10.278  13.258  0.45 9.59  ? 27  LYS A C   1 
ATOM   442  C C   B LYS A 1 28  ? 20.120 10.273  13.261  0.45 9.57  ? 27  LYS A C   1 
ATOM   443  O O   A LYS A 1 28  ? 18.923 10.109  12.969  0.50 11.10 ? 27  LYS A O   1 
ATOM   444  O O   B LYS A 1 28  ? 18.923 10.104  12.973  0.50 11.11 ? 27  LYS A O   1 
ATOM   445  C CB  A LYS A 1 28  ? 21.467 10.741  11.140  0.54 13.09 ? 27  LYS A CB  1 
ATOM   446  C CB  B LYS A 1 28  ? 21.470 10.746  11.140  0.46 13.09 ? 27  LYS A CB  1 
ATOM   447  C CG  A LYS A 1 28  ? 22.131 11.780  10.222  0.51 17.14 ? 27  LYS A CG  1 
ATOM   448  C CG  B LYS A 1 28  ? 22.120 11.790  10.216  0.49 17.03 ? 27  LYS A CG  1 
ATOM   449  C CD  A LYS A 1 28  ? 21.334 13.039  9.890   0.45 26.16 ? 27  LYS A CD  1 
ATOM   450  C CD  B LYS A 1 28  ? 21.323 13.055  9.915   0.45 26.91 ? 27  LYS A CD  1 
ATOM   451  C CE  A LYS A 1 28  ? 21.964 13.908  8.794   0.43 51.96 ? 27  LYS A CE  1 
ATOM   452  C CE  B LYS A 1 28  ? 21.924 13.955  8.825   0.43 53.08 ? 27  LYS A CE  1 
ATOM   453  N NZ  A LYS A 1 28  ? 22.760 15.050  9.282   0.47 38.66 ? 27  LYS A NZ  1 
ATOM   454  N NZ  B LYS A 1 28  ? 22.770 15.060  9.310   0.47 38.24 ? 27  LYS A NZ  1 
ATOM   455  N N   A ARG A 1 29  ? 20.708 9.605   14.251  0.50 9.71  ? 28  ARG A N   1 
ATOM   456  N N   B ARG A 1 29  ? 20.708 9.600   14.257  0.50 9.71  ? 28  ARG A N   1 
ATOM   457  C CA  A ARG A 1 29  ? 19.940 8.669   15.065  0.52 8.96  ? 28  ARG A CA  1 
ATOM   458  C CA  B ARG A 1 29  ? 19.939 8.664   15.071  0.48 8.98  ? 28  ARG A CA  1 
ATOM   459  C C   A ARG A 1 29  ? 18.939 9.435   15.905  0.49 9.72  ? 28  ARG A C   1 
ATOM   460  C C   B ARG A 1 29  ? 18.939 9.435   15.908  0.49 9.78  ? 28  ARG A C   1 
ATOM   461  O O   A ARG A 1 29  ? 17.788 9.009   16.065  0.51 10.00 ? 28  ARG A O   1 
ATOM   462  O O   B ARG A 1 29  ? 17.787 9.009   16.087  0.49 9.97  ? 28  ARG A O   1 
ATOM   463  C CB  A ARG A 1 29  ? 20.797 7.821   15.980  0.55 10.37 ? 28  ARG A CB  1 
ATOM   464  C CB  B ARG A 1 29  ? 20.807 7.826   15.993  0.45 10.39 ? 28  ARG A CB  1 
ATOM   465  C CG  A ARG A 1 29  ? 21.700 6.916   15.197  0.52 11.68 ? 28  ARG A CG  1 
ATOM   466  C CG  B ARG A 1 29  ? 21.696 6.916   15.203  0.48 11.65 ? 28  ARG A CG  1 
ATOM   467  C CD  A ARG A 1 29  ? 22.287 5.805   16.052  0.47 16.17 ? 28  ARG A CD  1 
ATOM   468  C CD  B ARG A 1 29  ? 22.291 5.805   16.052  0.47 16.17 ? 28  ARG A CD  1 
ATOM   469  N NE  A ARG A 1 29  ? 23.132 6.176   17.180  0.50 20.67 ? 28  ARG A NE  1 
ATOM   470  N NE  B ARG A 1 29  ? 23.132 6.170   17.180  0.50 20.71 ? 28  ARG A NE  1 
ATOM   471  C CZ  A ARG A 1 29  ? 24.466 6.165   17.136  0.47 22.80 ? 28  ARG A CZ  1 
ATOM   472  C CZ  B ARG A 1 29  ? 24.466 6.165   17.136  0.47 22.79 ? 28  ARG A CZ  1 
ATOM   473  N NH1 A ARG A 1 29  ? 25.096 5.924   15.989  0.46 23.87 ? 28  ARG A NH1 1 
ATOM   474  N NH1 B ARG A 1 29  ? 25.096 5.924   15.989  0.46 23.87 ? 28  ARG A NH1 1 
ATOM   475  N NH2 A ARG A 1 29  ? 25.191 6.443   18.201  0.47 22.37 ? 28  ARG A NH2 1 
ATOM   476  N NH2 B ARG A 1 29  ? 25.191 6.443   18.201  0.47 22.37 ? 28  ARG A NH2 1 
ATOM   477  N N   A LYS A 1 30  ? 19.360 10.566  16.459  0.52 10.06 ? 29  LYS A N   1 
ATOM   478  N N   B LYS A 1 30  ? 19.378 10.572  16.425  0.48 10.05 ? 29  LYS A N   1 
ATOM   479  C CA  A LYS A 1 30  ? 18.460 11.394  17.268  0.50 9.39  ? 29  LYS A CA  1 
ATOM   480  C CA  B LYS A 1 30  ? 18.539 11.461  17.236  0.50 9.94  ? 29  LYS A CA  1 
ATOM   481  C C   A LYS A 1 30  ? 17.370 11.980  16.403  0.54 11.45 ? 29  LYS A C   1 
ATOM   482  C C   B LYS A 1 30  ? 17.388 11.970  16.394  0.46 11.09 ? 29  LYS A C   1 
ATOM   483  O O   A LYS A 1 30  ? 16.229 12.165  16.851  0.52 13.74 ? 29  LYS A O   1 
ATOM   484  O O   B LYS A 1 30  ? 16.212 11.965  16.807  0.48 14.26 ? 29  LYS A O   1 
ATOM   485  C CB  A LYS A 1 30  ? 19.177 12.469  18.066  0.49 12.99 ? 29  LYS A CB  1 
ATOM   486  C CB  B LYS A 1 30  ? 19.372 12.592  17.825  0.50 11.63 ? 29  LYS A CB  1 
ATOM   487  C CG  A LYS A 1 30  ? 20.091 11.878  19.135  0.46 12.76 ? 29  LYS A CG  1 
ATOM   488  C CG  B LYS A 1 30  ? 20.477 12.099  18.774  0.45 12.68 ? 29  LYS A CG  1 
ATOM   489  C CD  A LYS A 1 30  ? 19.337 11.348  20.344  0.49 10.65 ? 29  LYS A CD  1 
ATOM   490  C CD  B LYS A 1 30  ? 20.088 11.029  19.802  0.49 9.98  ? 29  LYS A CD  1 
ATOM   491  C CE  A LYS A 1 30  ? 20.240 10.736  21.403  0.53 15.59 ? 29  LYS A CE  1 
ATOM   492  C CE  B LYS A 1 30  ? 21.241 10.623  20.729  0.47 18.02 ? 29  LYS A CE  1 
ATOM   493  N NZ  A LYS A 1 30  ? 19.483 10.119  22.490  0.57 12.68 ? 29  LYS A NZ  1 
ATOM   494  N NZ  B LYS A 1 30  ? 20.848 9.806   21.898  0.43 16.33 ? 29  LYS A NZ  1 
ATOM   495  N N   A LEU A 1 31  ? 17.682 12.299  15.165  0.53 8.54  ? 30  LEU A N   1 
ATOM   496  N N   B LEU A 1 31  ? 17.689 12.417  15.197  0.47 8.58  ? 30  LEU A N   1 
ATOM   497  C CA  A LEU A 1 31  ? 16.661 12.829  14.282  0.48 10.09 ? 30  LEU A CA  1 
ATOM   498  C CA  B LEU A 1 31  ? 16.649 12.880  14.304  0.48 10.01 ? 30  LEU A CA  1 
ATOM   499  C C   A LEU A 1 31  ? 15.676 11.713  13.912  0.43 10.38 ? 30  LEU A C   1 
ATOM   500  C C   B LEU A 1 31  ? 15.686 11.734  13.931  0.44 10.37 ? 30  LEU A C   1 
ATOM   501  O O   A LEU A 1 31  ? 14.458 11.913  13.890  0.49 11.09 ? 30  LEU A O   1 
ATOM   502  O O   B LEU A 1 31  ? 14.469 11.913  13.884  0.49 11.13 ? 30  LEU A O   1 
ATOM   503  C CB  A LEU A 1 31  ? 17.242 13.420  12.988  0.49 10.52 ? 30  LEU A CB  1 
ATOM   504  C CB  B LEU A 1 31  ? 17.245 13.435  13.001  0.49 10.60 ? 30  LEU A CB  1 
ATOM   505  C CG  A LEU A 1 31  ? 18.166 14.623  13.189  0.43 13.00 ? 30  LEU A CG  1 
ATOM   506  C CG  B LEU A 1 31  ? 18.173 14.628  13.192  0.43 13.04 ? 30  LEU A CG  1 
ATOM   507  C CD1 A LEU A 1 31  ? 18.678 15.081  11.820  0.46 13.53 ? 30  LEU A CD1 1 
ATOM   508  C CD1 B LEU A 1 31  ? 18.678 15.086  11.817  0.46 13.50 ? 30  LEU A CD1 1 
ATOM   509  C CD2 A LEU A 1 31  ? 17.478 15.770  13.922  0.49 14.11 ? 30  LEU A CD2 1 
ATOM   510  C CD2 B LEU A 1 31  ? 17.478 15.780  13.922  0.49 14.14 ? 30  LEU A CD2 1 
ATOM   511  N N   A GLY A 1 32  ? 16.221 10.536  13.618  0.52 9.70  ? 31  GLY A N   1 
ATOM   512  N N   B GLY A 1 32  ? 16.238 10.551  13.640  0.48 9.81  ? 31  GLY A N   1 
ATOM   513  C CA  A GLY A 1 32  ? 15.440 9.379   13.236  0.54 10.00 ? 31  GLY A CA  1 
ATOM   514  C CA  B GLY A 1 32  ? 15.454 9.399   13.248  0.46 10.01 ? 31  GLY A CA  1 
ATOM   515  C C   A GLY A 1 32  ? 14.490 8.926   14.323  0.51 9.46  ? 31  GLY A C   1 
ATOM   516  C C   B GLY A 1 32  ? 14.490 8.936   14.323  0.49 9.43  ? 31  GLY A C   1 
ATOM   517  O O   A GLY A 1 32  ? 13.375 8.479   14.035  0.49 10.62 ? 31  GLY A O   1 
ATOM   518  O O   B GLY A 1 32  ? 13.378 8.479   14.031  0.49 10.61 ? 31  GLY A O   1 
ATOM   519  N N   A ALA A 1 33  ? 14.890 9.039   15.563  0.52 10.50 ? 32  ALA A N   1 
ATOM   520  N N   B ALA A 1 33  ? 14.890 9.044   15.566  0.48 10.48 ? 32  ALA A N   1 
ATOM   521  C CA  A ALA A 1 33  ? 14.043 8.597   16.644  0.56 11.63 ? 32  ALA A CA  1 
ATOM   522  C CA  B ALA A 1 33  ? 14.040 8.597   16.647  0.44 11.64 ? 32  ALA A CA  1 
ATOM   523  C C   A ALA A 1 33  ? 12.914 9.569   16.920  0.49 8.60  ? 32  ALA A C   1 
ATOM   524  C C   B ALA A 1 33  ? 12.914 9.569   16.923  0.49 8.62  ? 32  ALA A C   1 
ATOM   525  O O   A ALA A 1 33  ? 12.008 9.225   17.672  0.50 12.73 ? 32  ALA A O   1 
ATOM   526  O O   B ALA A 1 33  ? 12.008 9.225   17.672  0.50 12.73 ? 32  ALA A O   1 
ATOM   527  C CB  A ALA A 1 33  ? 14.856 8.335   17.913  0.52 14.67 ? 32  ALA A CB  1 
ATOM   528  C CB  B ALA A 1 33  ? 14.856 8.335   17.913  0.48 14.66 ? 32  ALA A CB  1 
ATOM   529  N N   A HIS A 1 34  ? 12.954 10.777  16.331  0.49 6.38  ? 33  HIS A N   1 
ATOM   530  N N   B HIS A 1 34  ? 12.965 10.782  16.337  0.49 6.36  ? 33  HIS A N   1 
ATOM   531  C CA  A HIS A 1 34  ? 11.906 11.770  16.509  0.51 8.47  ? 33  HIS A CA  1 
ATOM   532  C CA  B HIS A 1 34  ? 11.931 11.785  16.494  0.49 8.41  ? 33  HIS A CA  1 
ATOM   533  C C   A HIS A 1 34  ? 11.423 12.258  15.175  0.53 7.90  ? 33  HIS A C   1 
ATOM   534  C C   B HIS A 1 34  ? 11.509 12.237  15.131  0.47 7.82  ? 33  HIS A C   1 
ATOM   535  O O   A HIS A 1 34  ? 11.267 13.466  14.981  0.53 10.67 ? 33  HIS A O   1 
ATOM   536  O O   B HIS A 1 34  ? 11.506 13.435  14.824  0.47 10.26 ? 33  HIS A O   1 
ATOM   537  C CB  A HIS A 1 34  ? 12.476 13.019  17.202  0.54 10.02 ? 33  HIS A CB  1 
ATOM   538  C CB  B HIS A 1 34  ? 12.480 13.029  17.202  0.46 10.05 ? 33  HIS A CB  1 
ATOM   539  C CG  A HIS A 1 34  ? 12.829 12.772  18.605  0.50 15.27 ? 33  HIS A CG  1 
ATOM   540  C CG  B HIS A 1 34  ? 12.829 12.772  18.605  0.50 15.32 ? 33  HIS A CG  1 
ATOM   541  N ND1 A HIS A 1 34  ? 14.092 12.366  18.991  0.50 25.47 ? 33  HIS A ND1 1 
ATOM   542  N ND1 B HIS A 1 34  ? 14.092 12.366  18.987  0.50 25.46 ? 33  HIS A ND1 1 
ATOM   543  C CD2 A HIS A 1 34  ? 12.057 12.906  19.702  0.51 28.19 ? 33  HIS A CD2 1 
ATOM   544  C CD2 B HIS A 1 34  ? 12.057 12.906  19.702  0.49 28.17 ? 33  HIS A CD2 1 
ATOM   545  C CE1 A HIS A 1 34  ? 14.051 12.253  20.309  0.50 31.30 ? 33  HIS A CE1 1 
ATOM   546  C CE1 B HIS A 1 34  ? 14.051 12.253  20.309  0.50 31.30 ? 33  HIS A CE1 1 
ATOM   547  N NE2 A HIS A 1 34  ? 12.850 12.567  20.764  0.46 28.54 ? 33  HIS A NE2 1 
ATOM   548  N NE2 B HIS A 1 34  ? 12.850 12.567  20.764  0.46 28.58 ? 33  HIS A NE2 1 
ATOM   549  N N   A ASP A 1 35  ? 11.171 11.307  14.251  0.49 7.73  ? 34  ASP A N   1 
ATOM   550  N N   B ASP A 1 35  ? 11.167 11.255  14.288  0.49 7.54  ? 34  ASP A N   1 
ATOM   551  C CA  A ASP A 1 35  ? 10.811 11.595  12.872  0.49 7.09  ? 34  ASP A CA  1 
ATOM   552  C CA  B ASP A 1 35  ? 10.820 11.548  12.919  0.49 7.17  ? 34  ASP A CA  1 
ATOM   553  C C   A ASP A 1 35  ? 9.369  11.883  12.518  0.47 6.82  ? 34  ASP A C   1 
ATOM   554  C C   B ASP A 1 35  ? 9.373  11.898  12.656  0.47 6.71  ? 34  ASP A C   1 
ATOM   555  O O   A ASP A 1 35  ? 9.082  12.129  11.340  0.52 8.81  ? 34  ASP A O   1 
ATOM   556  O O   B ASP A 1 35  ? 9.023  12.309  11.563  0.48 8.00  ? 34  ASP A O   1 
ATOM   557  C CB  A ASP A 1 35  ? 11.322 10.469  11.951  0.54 9.88  ? 34  ASP A CB  1 
ATOM   558  C CB  B ASP A 1 35  ? 11.322 10.443  11.958  0.46 9.66  ? 34  ASP A CB  1 
ATOM   559  C CG  A ASP A 1 35  ? 10.671 9.137   12.180  0.52 8.61  ? 34  ASP A CG  1 
ATOM   560  C CG  B ASP A 1 35  ? 10.661 9.116   12.161  0.48 8.74  ? 34  ASP A CG  1 
ATOM   561  O OD1 A ASP A 1 35  ? 9.897  9.039   13.217  0.52 8.08  ? 34  ASP A OD1 1 
ATOM   562  O OD1 B ASP A 1 35  ? 9.841  9.039   13.157  0.48 7.89  ? 34  ASP A OD1 1 
ATOM   563  O OD2 A ASP A 1 35  ? 10.885 8.196   11.456  0.49 11.35 ? 34  ASP A OD2 1 
ATOM   564  O OD2 B ASP A 1 35  ? 10.892 8.170   11.456  0.49 11.36 ? 34  ASP A OD2 1 
ATOM   565  N N   A ASN A 1 36  ? 8.521  11.805  13.546  0.47 7.50  ? 35  ASN A N   1 
ATOM   566  N N   B ASN A 1 36  ? 8.525  11.744  13.649  0.47 7.35  ? 35  ASN A N   1 
ATOM   567  C CA  A ASN A 1 36  ? 7.088  12.032  13.436  0.47 8.22  ? 35  ASN A CA  1 
ATOM   568  C CA  B ASN A 1 36  ? 7.143  12.088  13.386  0.47 8.68  ? 35  ASN A CA  1 
ATOM   569  C C   A ASN A 1 36  ? 6.508  11.106  12.409  0.50 9.46  ? 35  ASN A C   1 
ATOM   570  C C   B ASN A 1 36  ? 6.475  11.245  12.315  0.50 11.05 ? 35  ASN A C   1 
ATOM   571  O O   A ASN A 1 36  ? 5.655  11.538  11.622  0.49 11.81 ? 35  ASN A O   1 
ATOM   572  O O   B ASN A 1 36  ? 5.467  11.661  11.741  0.49 10.75 ? 35  ASN A O   1 
ATOM   573  C CB  A ASN A 1 36  ? 6.832  13.482  12.973  0.52 12.04 ? 35  ASN A CB  1 
ATOM   574  C CB  B ASN A 1 36  ? 7.005  13.584  13.048  0.48 8.85  ? 35  ASN A CB  1 
ATOM   575  C CG  A ASN A 1 36  ? 7.032  14.479  14.094  0.52 13.12 ? 35  ASN A CG  1 
ATOM   576  C CG  B ASN A 1 36  ? 5.627  14.022  13.430  0.45 11.96 ? 35  ASN A CG  1 
ATOM   577  O OD1 A ASN A 1 36  ? 6.661  14.196  15.247  0.48 21.14 ? 35  ASN A OD1 1 
ATOM   578  O OD1 B ASN A 1 36  ? 5.141  13.636  14.508  0.43 14.20 ? 35  ASN A OD1 1 
ATOM   579  N ND2 A ASN A 1 36  ? 7.624  15.626  13.790  0.55 17.13 ? 35  ASN A ND2 1 
ATOM   580  N ND2 B ASN A 1 36  ? 4.998  14.782  12.547  0.42 16.28 ? 35  ASN A ND2 1 
ATOM   581  N N   A LEU A 1 37  ? 6.951  9.872   12.355  0.54 6.20  ? 36  LEU A N   1 
ATOM   582  N N   B LEU A 1 37  ? 6.980  10.057  12.045  0.46 7.83  ? 36  LEU A N   1 
ATOM   583  C CA  A LEU A 1 37  ? 6.465  9.029   11.287  0.52 6.17  ? 36  LEU A CA  1 
ATOM   584  C CA  B LEU A 1 37  ? 6.446  9.163   11.024  0.48 5.77  ? 36  LEU A CA  1 
ATOM   585  C C   A LEU A 1 37  ? 4.970  8.746   11.353  0.52 8.23  ? 36  LEU A C   1 
ATOM   586  C C   B LEU A 1 37  ? 4.984  8.787   11.228  0.48 7.94  ? 36  LEU A C   1 
ATOM   587  O O   A LEU A 1 37  ? 4.452  8.422   12.418  0.52 8.97  ? 36  LEU A O   1 
ATOM   588  O O   B LEU A 1 37  ? 4.555  8.340   12.299  0.48 8.90  ? 36  LEU A O   1 
ATOM   589  C CB  A LEU A 1 37  ? 7.264  7.723   11.221  0.47 6.78  ? 36  LEU A CB  1 
ATOM   590  C CB  B LEU A 1 37  ? 7.254  7.857   11.087  0.47 7.25  ? 36  LEU A CB  1 
ATOM   591  C CG  A LEU A 1 37  ? 6.849  6.705   10.150  0.50 8.23  ? 36  LEU A CG  1 
ATOM   592  C CG  B LEU A 1 37  ? 6.850  6.741   10.125  0.50 8.33  ? 36  LEU A CG  1 
ATOM   593  C CD1 A LEU A 1 37  ? 7.099  7.240   8.737   0.52 10.45 ? 36  LEU A CD1 1 
ATOM   594  C CD1 B LEU A 1 37  ? 7.100  7.204   8.690   0.48 10.28 ? 36  LEU A CD1 1 
ATOM   595  C CD2 A LEU A 1 37  ? 7.660  5.425   10.366  0.54 10.50 ? 36  LEU A CD2 1 
ATOM   596  C CD2 B LEU A 1 37  ? 7.666  5.471   10.413  0.46 10.36 ? 36  LEU A CD2 1 
ATOM   597  N N   A LYS A 1 38  ? 4.329  8.844   10.203  0.52 7.11  ? 37  LYS A N   1 
ATOM   598  N N   B LYS A 1 38  ? 4.278  8.906   10.137  0.48 6.98  ? 37  LYS A N   1 
ATOM   599  C CA  A LYS A 1 38  ? 2.916  8.566   10.028  0.51 8.31  ? 37  LYS A CA  1 
ATOM   600  C CA  B LYS A 1 38  ? 2.884  8.566   10.031  0.49 8.25  ? 37  LYS A CA  1 
ATOM   601  C C   A LYS A 1 38  ? 2.763  7.600   8.866   0.45 8.28  ? 37  LYS A C   1 
ATOM   602  C C   B LYS A 1 38  ? 2.749  7.600   8.866   0.45 8.37  ? 37  LYS A C   1 
ATOM   603  O O   A LYS A 1 38  ? 3.342  7.805   7.794   0.51 10.46 ? 37  LYS A O   1 
ATOM   604  O O   B LYS A 1 38  ? 3.342  7.810   7.800   0.49 10.45 ? 37  LYS A O   1 
ATOM   605  C CB  A LYS A 1 38  ? 2.213  9.867   9.658   0.53 12.64 ? 37  LYS A CB  1 
ATOM   606  C CB  B LYS A 1 38  ? 2.184  9.857   9.661   0.47 12.53 ? 37  LYS A CB  1 
ATOM   607  C CG  A LYS A 1 38  ? 0.714  9.785   9.492   0.51 21.19 ? 37  LYS A CG  1 
ATOM   608  C CG  B LYS A 1 38  ? 0.692  9.780   9.489   0.49 20.92 ? 37  LYS A CG  1 
ATOM   609  C CD  A LYS A 1 38  ? 0.128  11.168  9.699   0.49 21.76 ? 37  LYS A CD  1 
ATOM   610  C CD  B LYS A 1 38  ? 0.124  11.173  9.699   0.49 21.75 ? 37  LYS A CD  1 
ATOM   611  C CE  A LYS A 1 38  ? 0.485  12.088  8.540   0.52 49.14 ? 37  LYS A CE  1 
ATOM   612  C CE  B LYS A 1 38  ? 0.485  12.088  8.540   0.48 49.14 ? 37  LYS A CE  1 
ATOM   613  N NZ  A LYS A 1 38  ? -0.249 13.358  8.521   0.45 32.26 ? 37  LYS A NZ  1 
ATOM   614  N NZ  B LYS A 1 38  ? -0.249 13.363  8.521   0.45 32.43 ? 37  LYS A NZ  1 
ATOM   615  N N   A LEU A 1 39  ? 1.957  6.551   9.057   0.51 8.16  ? 38  LEU A N   1 
ATOM   616  N N   B LEU A 1 39  ? 1.946  6.551   9.054   0.49 8.15  ? 38  LEU A N   1 
ATOM   617  C CA  A LEU A 1 39  ? 1.742  5.605   7.988   0.53 7.22  ? 38  LEU A CA  1 
ATOM   618  C CA  B LEU A 1 39  ? 1.742  5.599   7.985   0.47 7.21  ? 38  LEU A CA  1 
ATOM   619  C C   A LEU A 1 39  ? 0.275  5.569   7.666   0.52 8.90  ? 38  LEU A C   1 
ATOM   620  C C   B LEU A 1 39  ? 0.275  5.569   7.666   0.48 8.89  ? 38  LEU A C   1 
ATOM   621  O O   A LEU A 1 39  ? -0.529 5.435   8.606   0.52 11.82 ? 38  LEU A O   1 
ATOM   622  O O   B LEU A 1 39  ? -0.529 5.435   8.606   0.48 11.82 ? 38  LEU A O   1 
ATOM   623  C CB  A LEU A 1 39  ? 2.109  4.170   8.374   0.52 9.49  ? 38  LEU A CB  1 
ATOM   624  C CB  B LEU A 1 39  ? 2.109  4.170   8.377   0.48 9.51  ? 38  LEU A CB  1 
ATOM   625  C CG  A LEU A 1 39  ? 3.522  3.908   8.872   0.53 10.28 ? 38  LEU A CG  1 
ATOM   626  C CG  B LEU A 1 39  ? 3.522  3.908   8.872   0.47 10.28 ? 38  LEU A CG  1 
ATOM   627  C CD1 A LEU A 1 39  ? 3.619  2.443   9.282   0.48 14.88 ? 38  LEU A CD1 1 
ATOM   628  C CD1 B LEU A 1 39  ? 3.619  2.443   9.282   0.48 14.88 ? 38  LEU A CD1 1 
ATOM   629  C CD2 A LEU A 1 39  ? 4.526  4.139   7.763   0.56 14.44 ? 38  LEU A CD2 1 
ATOM   630  C CD2 B LEU A 1 39  ? 4.526  4.139   7.763   0.44 14.44 ? 38  LEU A CD2 1 
ATOM   631  N N   A THR A 1 40  ? -0.057 5.687   6.397   0.52 7.67  ? 39  THR A N   1 
ATOM   632  N N   B THR A 1 40  ? -0.057 5.687   6.394   0.48 7.67  ? 39  THR A N   1 
ATOM   633  C CA  A THR A 1 40  ? -1.452 5.584   5.936   0.49 9.10  ? 39  THR A CA  1 
ATOM   634  C CA  B THR A 1 40  ? -1.452 5.584   5.936   0.49 9.10  ? 39  THR A CA  1 
ATOM   635  C C   A THR A 1 40  ? -1.496 4.314   5.100   0.53 9.83  ? 39  THR A C   1 
ATOM   636  C C   B THR A 1 40  ? -1.496 4.314   5.100   0.47 9.83  ? 39  THR A C   1 
ATOM   637  O O   A THR A 1 40  ? -0.854 4.257   4.076   0.52 9.81  ? 39  THR A O   1 
ATOM   638  O O   B THR A 1 40  ? -0.854 4.257   4.076   0.48 9.81  ? 39  THR A O   1 
ATOM   639  C CB  A THR A 1 40  ? -1.938 6.813   5.128   0.50 11.87 ? 39  THR A CB  1 
ATOM   640  C CB  B THR A 1 40  ? -1.938 6.813   5.128   0.50 11.87 ? 39  THR A CB  1 
ATOM   641  O OG1 A THR A 1 40  ? -1.884 7.949   5.962   0.52 14.26 ? 39  THR A OG1 1 
ATOM   642  O OG1 B THR A 1 40  ? -1.884 7.949   5.962   0.48 14.26 ? 39  THR A OG1 1 
ATOM   643  C CG2 A THR A 1 40  ? -3.387 6.612   4.646   0.54 13.95 ? 39  THR A CG2 1 
ATOM   644  C CG2 B THR A 1 40  ? -3.387 6.617   4.646   0.46 13.95 ? 39  THR A CG2 1 
ATOM   645  N N   A ILE A 1 41  ? -2.223 3.306   5.545   0.53 8.14  ? 40  ILE A N   1 
ATOM   646  N N   B ILE A 1 41  ? -2.223 3.306   5.545   0.47 8.14  ? 40  ILE A N   1 
ATOM   647  C CA  A ILE A 1 41  ? -2.224 2.016   4.875   0.52 9.23  ? 40  ILE A CA  1 
ATOM   648  C CA  B ILE A 1 41  ? -2.224 2.016   4.875   0.48 9.23  ? 40  ILE A CA  1 
ATOM   649  C C   A ILE A 1 41  ? -3.546 1.728   4.176   0.49 8.77  ? 40  ILE A C   1 
ATOM   650  C C   B ILE A 1 41  ? -3.546 1.728   4.176   0.49 8.77  ? 40  ILE A C   1 
ATOM   651  O O   A ILE A 1 41  ? -4.594 1.846   4.790   0.51 12.09 ? 40  ILE A O   1 
ATOM   652  O O   B ILE A 1 41  ? -4.598 1.846   4.790   0.49 12.09 ? 40  ILE A O   1 
ATOM   653  C CB  A ILE A 1 41  ? -1.897 0.915   5.890   0.45 9.85  ? 40  ILE A CB  1 
ATOM   654  C CB  B ILE A 1 41  ? -1.897 0.915   5.890   0.45 9.85  ? 40  ILE A CB  1 
ATOM   655  C CG1 A ILE A 1 41  ? -0.513 1.157   6.532   0.50 11.60 ? 40  ILE A CG1 1 
ATOM   656  C CG1 B ILE A 1 41  ? -0.513 1.157   6.532   0.50 11.60 ? 40  ILE A CG1 1 
ATOM   657  C CG2 A ILE A 1 41  ? -2.014 -0.499  5.310   0.50 11.49 ? 40  ILE A CG2 1 
ATOM   658  C CG2 B ILE A 1 41  ? -2.014 -0.499  5.310   0.50 11.49 ? 40  ILE A CG2 1 
ATOM   659  C CD1 A ILE A 1 41  ? -0.091 0.149   7.613   0.55 13.30 ? 40  ILE A CD1 1 
ATOM   660  C CD1 B ILE A 1 41  ? -0.091 0.149   7.613   0.45 13.30 ? 40  ILE A CD1 1 
ATOM   661  N N   A THR A 1 42  ? -3.485 1.383   2.898   0.52 9.02  ? 41  THR A N   1 
ATOM   662  N N   B THR A 1 42  ? -3.485 1.383   2.898   0.48 9.02  ? 41  THR A N   1 
ATOM   663  C CA  A THR A 1 42  ? -4.693 1.023   2.165   0.54 9.64  ? 41  THR A CA  1 
ATOM   664  C CA  B THR A 1 42  ? -4.693 1.023   2.165   0.46 9.64  ? 41  THR A CA  1 
ATOM   665  C C   A THR A 1 42  ? -4.413 -0.231  1.372   0.45 11.04 ? 41  THR A C   1 
ATOM   666  C C   B THR A 1 42  ? -4.413 -0.231  1.372   0.45 11.04 ? 41  THR A C   1 
ATOM   667  O O   A THR A 1 42  ? -3.303 -0.447  0.887   0.51 11.53 ? 41  THR A O   1 
ATOM   668  O O   B THR A 1 42  ? -3.303 -0.452  0.887   0.49 11.52 ? 41  THR A O   1 
ATOM   669  C CB  A THR A 1 42  ? -5.229 2.124   1.259   0.55 13.95 ? 41  THR A CB  1 
ATOM   670  C CB  B THR A 1 42  ? -5.229 2.124   1.259   0.45 13.95 ? 41  THR A CB  1 
ATOM   671  O OG1 A THR A 1 42  ? -4.255 2.483   0.329   0.47 17.35 ? 41  THR A OG1 1 
ATOM   672  O OG1 B THR A 1 42  ? -4.255 2.483   0.329   0.47 17.35 ? 41  THR A OG1 1 
ATOM   673  C CG2 A THR A 1 42  ? -5.581 3.342   2.083   0.51 19.67 ? 41  THR A CG2 1 
ATOM   674  C CG2 B THR A 1 42  ? -5.581 3.342   2.083   0.49 19.67 ? 41  THR A CG2 1 
ATOM   675  N N   A GLN A 1 43  ? -5.424 -1.054  1.209   0.52 10.07 ? 42  GLN A N   1 
ATOM   676  N N   B GLN A 1 43  ? -5.424 -1.054  1.209   0.48 10.07 ? 42  GLN A N   1 
ATOM   677  C CA  A GLN A 1 43  ? -5.228 -2.288  0.482   0.55 13.80 ? 42  GLN A CA  1 
ATOM   678  C CA  B GLN A 1 43  ? -5.231 -2.288  0.486   0.45 13.80 ? 42  GLN A CA  1 
ATOM   679  C C   A GLN A 1 43  ? -6.168 -2.360  -0.674  0.50 10.14 ? 42  GLN A C   1 
ATOM   680  C C   B GLN A 1 43  ? -6.164 -2.360  -0.674  0.50 10.12 ? 42  GLN A C   1 
ATOM   681  O O   A GLN A 1 43  ? -7.270 -1.830  -0.627  0.53 12.58 ? 42  GLN A O   1 
ATOM   682  O O   B GLN A 1 43  ? -7.270 -1.830  -0.630  0.47 12.57 ? 42  GLN A O   1 
ATOM   683  C CB  A GLN A 1 43  ? -5.555 -3.419  1.479   0.51 14.51 ? 42  GLN A CB  1 
ATOM   684  C CB  B GLN A 1 43  ? -5.559 -3.419  1.479   0.49 14.50 ? 42  GLN A CB  1 
ATOM   685  C CG  A GLN A 1 43  ? -5.350 -4.833  0.937   0.55 20.09 ? 42  GLN A CG  1 
ATOM   686  C CG  B GLN A 1 43  ? -5.350 -4.838  0.937   0.45 20.09 ? 42  GLN A CG  1 
ATOM   687  C CD  A GLN A 1 43  ? -5.589 -5.933  1.967   0.51 15.22 ? 42  GLN A CD  1 
ATOM   688  C CD  B GLN A 1 43  ? -5.589 -5.933  1.967   0.49 15.22 ? 42  GLN A CD  1 
ATOM   689  O OE1 A GLN A 1 43  ? -5.684 -5.733  3.205   0.57 18.75 ? 42  GLN A OE1 1 
ATOM   690  O OE1 B GLN A 1 43  ? -5.684 -5.733  3.205   0.43 18.75 ? 42  GLN A OE1 1 
ATOM   691  N NE2 A GLN A 1 43  ? -5.654 -7.142  1.416   0.49 23.62 ? 42  GLN A NE2 1 
ATOM   692  N NE2 B GLN A 1 43  ? -5.654 -7.142  1.416   0.49 23.62 ? 42  GLN A NE2 1 
ATOM   693  N N   A GLU A 1 44  ? -5.753 -3.018  -1.723  0.49 10.20 ? 43  GLU A N   1 
ATOM   694  N N   B GLU A 1 44  ? -5.739 -2.998  -1.726  0.49 10.11 ? 43  GLU A N   1 
ATOM   695  C CA  A GLU A 1 44  ? -6.579 -3.239  -2.891  0.47 10.95 ? 43  GLU A CA  1 
ATOM   696  C CA  B GLU A 1 44  ? -6.561 -3.203  -2.895  0.47 10.96 ? 43  GLU A CA  1 
ATOM   697  C C   A GLU A 1 44  ? -6.190 -4.638  -3.339  0.47 13.75 ? 43  GLU A C   1 
ATOM   698  C C   B GLU A 1 44  ? -6.204 -4.592  -3.352  0.47 13.78 ? 43  GLU A C   1 
ATOM   699  O O   A GLU A 1 44  ? -5.200 -4.782  -4.038  0.50 13.42 ? 43  GLU A O   1 
ATOM   700  O O   B GLU A 1 44  ? -5.204 -4.797  -4.026  0.50 13.31 ? 43  GLU A O   1 
ATOM   701  C CB  A GLU A 1 44  ? -6.296 -2.175  -3.938  0.55 19.49 ? 43  GLU A CB  1 
ATOM   702  C CB  B GLU A 1 44  ? -6.289 -2.149  -3.947  0.45 19.50 ? 43  GLU A CB  1 
ATOM   703  C CG  A GLU A 1 44  ? -7.069 -2.350  -5.238  0.58 31.36 ? 43  GLU A CG  1 
ATOM   704  C CG  B GLU A 1 44  ? -7.069 -2.345  -5.238  0.42 31.52 ? 43  GLU A CG  1 
ATOM   705  C CD  A GLU A 1 44  ? -7.220 -0.956  -5.742  0.49 49.97 ? 43  GLU A CD  1 
ATOM   706  C CD  B GLU A 1 44  ? -7.223 -0.956  -5.745  0.49 50.11 ? 43  GLU A CD  1 
ATOM   707  O OE1 A GLU A 1 44  ? -6.284 -0.288  -6.124  0.47 41.27 ? 43  GLU A OE1 1 
ATOM   708  O OE1 B GLU A 1 44  ? -6.284 -0.288  -6.128  0.47 41.27 ? 43  GLU A OE1 1 
ATOM   709  O OE2 A GLU A 1 44  ? -8.434 -0.514  -5.639  0.37 55.51 ? 43  GLU A OE2 1 
ATOM   710  O OE2 B GLU A 1 44  ? -8.434 -0.514  -5.639  0.37 55.51 ? 43  GLU A OE2 1 
ATOM   711  N N   A GLY A 1 45  ? -6.888 -5.640  -2.798  0.52 17.39 ? 44  GLY A N   1 
ATOM   712  N N   B GLY A 1 45  ? -6.980 -5.522  -2.823  0.48 18.25 ? 44  GLY A N   1 
ATOM   713  C CA  A GLY A 1 45  ? -6.593 -7.039  -3.029  0.52 16.45 ? 44  GLY A CA  1 
ATOM   714  C CA  B GLY A 1 45  ? -6.792 -6.916  -3.048  0.48 18.04 ? 44  GLY A CA  1 
ATOM   715  C C   A GLY A 1 45  ? -5.345 -7.404  -2.252  0.49 13.30 ? 44  GLY A C   1 
ATOM   716  C C   B GLY A 1 45  ? -5.489 -7.353  -2.456  0.49 11.07 ? 44  GLY A C   1 
ATOM   717  O O   A GLY A 1 45  ? -5.200 -7.101  -1.065  0.51 19.40 ? 44  GLY A O   1 
ATOM   718  O O   B GLY A 1 45  ? -5.234 -7.281  -1.244  0.49 18.40 ? 44  GLY A O   1 
ATOM   719  N N   A ASN A 1 46  ? -4.411 -8.057  -2.973  0.50 11.14 ? 45  ASN A N   1 
ATOM   720  N N   B ASN A 1 46  ? -4.643 -7.810  -3.380  0.50 10.51 ? 45  ASN A N   1 
ATOM   721  C CA  A ASN A 1 46  ? -3.138 -8.437  -2.447  0.50 11.10 ? 45  ASN A CA  1 
ATOM   722  C CA  B ASN A 1 46  ? -3.363 -8.324  -3.007  0.50 10.05 ? 45  ASN A CA  1 
ATOM   723  C C   A ASN A 1 46  ? -2.158 -7.260  -2.594  0.51 12.60 ? 45  ASN A C   1 
ATOM   724  C C   B ASN A 1 46  ? -2.244 -7.265  -2.998  0.49 10.27 ? 45  ASN A C   1 
ATOM   725  O O   A ASN A 1 46  ? -0.979 -7.389  -2.324  0.52 13.07 ? 45  ASN A O   1 
ATOM   726  O O   B ASN A 1 46  ? -1.100 -7.620  -2.732  0.48 13.04 ? 45  ASN A O   1 
ATOM   727  C CB  A ASN A 1 46  ? -2.564 -9.692  -3.167  0.51 16.92 ? 45  ASN A CB  1 
ATOM   728  C CB  B ASN A 1 46  ? -3.001 -9.517  -3.928  0.49 10.19 ? 45  ASN A CB  1 
ATOM   729  C CG  A ASN A 1 46  ? -2.766 -10.972 -2.375  0.50 20.49 ? 45  ASN A CG  1 
ATOM   730  C CG  B ASN A 1 46  ? -2.141 -10.592 -3.296  0.43 20.19 ? 45  ASN A CG  1 
ATOM   731  O OD1 A ASN A 1 46  ? -2.098 -12.016 -2.578  0.48 20.89 ? 45  ASN A OD1 1 
ATOM   732  O OD1 B ASN A 1 46  ? -1.167 -11.070 -3.897  0.47 24.40 ? 45  ASN A OD1 1 
ATOM   733  N ND2 A ASN A 1 46  ? -3.708 -10.900 -1.450  0.49 19.92 ? 45  ASN A ND2 1 
ATOM   734  N ND2 B ASN A 1 46  ? -2.502 -10.998 -2.083  0.46 22.43 ? 45  ASN A ND2 1 
ATOM   735  N N   A LYS A 1 47  ? -2.613 -6.108  -3.054  0.50 8.33  ? 46  LYS A N   1 
ATOM   736  N N   B LYS A 1 47  ? -2.590 -6.016  -3.280  0.50 8.34  ? 46  LYS A N   1 
ATOM   737  C CA  A LYS A 1 47  ? -1.673 -4.998  -3.173  0.52 10.96 ? 46  LYS A CA  1 
ATOM   738  C CA  B LYS A 1 47  ? -1.630 -4.895  -3.343  0.48 9.10  ? 46  LYS A CA  1 
ATOM   739  C C   A LYS A 1 47  ? -1.895 -4.036  -2.017  0.48 8.30  ? 46  LYS A C   1 
ATOM   740  C C   B LYS A 1 47  ? -1.906 -3.820  -2.293  0.48 8.44  ? 46  LYS A C   1 
ATOM   741  O O   A LYS A 1 47  ? -3.031 -3.784  -1.585  0.50 10.06 ? 46  LYS A O   1 
ATOM   742  O O   B LYS A 1 47  ? -3.013 -3.265  -2.177  0.50 10.01 ? 46  LYS A O   1 
ATOM   743  C CB  A LYS A 1 47  ? -1.862 -4.227  -4.474  0.52 9.54  ? 46  LYS A CB  1 
ATOM   744  C CB  B LYS A 1 47  ? -1.763 -4.263  -4.702  0.48 13.60 ? 46  LYS A CB  1 
ATOM   745  C CG  A LYS A 1 47  ? -1.215 -4.874  -5.692  0.53 11.58 ? 46  LYS A CG  1 
ATOM   746  C CG  B LYS A 1 47  ? -0.830 -3.116  -4.978  0.47 9.77  ? 46  LYS A CG  1 
ATOM   747  C CD  A LYS A 1 47  ? -1.400 -4.057  -6.973  0.54 11.33 ? 46  LYS A CD  1 
ATOM   748  C CD  B LYS A 1 47  ? -1.094 -2.648  -6.397  0.46 22.25 ? 46  LYS A CD  1 
ATOM   749  C CE  A LYS A 1 47  ? -0.396 -2.921  -7.096  0.52 15.86 ? 46  LYS A CE  1 
ATOM   750  C CE  B LYS A 1 47  ? -0.528 -3.656  -7.378  0.48 17.74 ? 46  LYS A CE  1 
ATOM   751  N NZ  A LYS A 1 47  ? -0.305 -2.314  -8.436  0.53 15.31 ? 46  LYS A NZ  1 
ATOM   752  N NZ  B LYS A 1 47  ? -0.451 -3.137  -8.747  0.47 16.62 ? 46  LYS A NZ  1 
ATOM   753  N N   A PHE A 1 48  ? -0.810 -3.460  -1.519  0.51 8.22  ? 47  PHE A N   1 
ATOM   754  N N   B PHE A 1 48  ? -0.856 -3.507  -1.541  0.49 8.41  ? 47  PHE A N   1 
ATOM   755  C CA  A PHE A 1 48  ? -0.879 -2.478  -0.451  0.43 7.12  ? 47  PHE A CA  1 
ATOM   756  C CA  B PHE A 1 48  ? -0.876 -2.535  -0.457  0.44 6.91  ? 47  PHE A CA  1 
ATOM   757  C C   A PHE A 1 48  ? -0.247 -1.162  -0.937  0.43 6.98  ? 47  PHE A C   1 
ATOM   758  C C   B PHE A 1 48  ? -0.139 -1.244  -0.840  0.43 7.58  ? 47  PHE A C   1 
ATOM   759  O O   A PHE A 1 48  ? 0.639  -1.141  -1.773  0.50 8.60  ? 47  PHE A O   1 
ATOM   760  O O   B PHE A 1 48  ? 0.930  -1.316  -1.425  0.50 8.18  ? 47  PHE A O   1 
ATOM   761  C CB  A PHE A 1 48  ? -0.128 -2.864  0.846   0.50 10.26 ? 47  PHE A CB  1 
ATOM   762  C CB  B PHE A 1 48  ? -0.105 -3.064  0.771   0.50 9.40  ? 47  PHE A CB  1 
ATOM   763  C CG  A PHE A 1 48  ? -0.921 -3.728  1.783   0.50 7.56  ? 47  PHE A CG  1 
ATOM   764  C CG  B PHE A 1 48  ? -0.794 -4.154  1.551   0.50 7.85  ? 47  PHE A CG  1 
ATOM   765  C CD1 A PHE A 1 48  ? -0.881 -5.121  1.616   0.51 11.70 ? 47  PHE A CD1 1 
ATOM   766  C CD1 B PHE A 1 48  ? -0.885 -5.450  1.034   0.49 10.79 ? 47  PHE A CD1 1 
ATOM   767  C CD2 A PHE A 1 48  ? -1.726 -3.198  2.776   0.54 10.47 ? 47  PHE A CD2 1 
ATOM   768  C CD2 B PHE A 1 48  ? -1.363 -3.877  2.794   0.46 12.75 ? 47  PHE A CD2 1 
ATOM   769  C CE1 A PHE A 1 48  ? -1.632 -5.969  2.437   0.49 15.87 ? 47  PHE A CE1 1 
ATOM   770  C CE1 B PHE A 1 48  ? -1.526 -6.458  1.748   0.50 10.26 ? 47  PHE A CE1 1 
ATOM   771  C CE2 A PHE A 1 48  ? -2.484 -4.026  3.596   0.51 13.54 ? 47  PHE A CE2 1 
ATOM   772  C CE2 B PHE A 1 48  ? -2.033 -4.869  3.518   0.49 17.43 ? 47  PHE A CE2 1 
ATOM   773  C CZ  A PHE A 1 48  ? -2.448 -5.409  3.427   0.56 13.27 ? 47  PHE A CZ  1 
ATOM   774  C CZ  B PHE A 1 48  ? -2.116 -6.160  2.985   0.44 13.74 ? 47  PHE A CZ  1 
ATOM   775  N N   A THR A 1 49  ? -0.732 -0.077  -0.379  0.49 8.98  ? 48  THR A N   1 
ATOM   776  N N   B THR A 1 49  ? -0.726 -0.113  -0.464  0.49 8.36  ? 48  THR A N   1 
ATOM   777  C CA  A THR A 1 49  ? -0.149 1.213   -0.586  0.52 8.70  ? 48  THR A CA  1 
ATOM   778  C CA  B THR A 1 49  ? -0.113 1.183   -0.592  0.48 8.80  ? 48  THR A CA  1 
ATOM   779  C C   A THR A 1 49  ? 0.080  1.712   0.793   0.49 8.53  ? 48  THR A C   1 
ATOM   780  C C   B THR A 1 49  ? 0.090  1.686   0.799   0.49 8.59  ? 48  THR A C   1 
ATOM   781  O O   A THR A 1 49  ? -0.880 1.830   1.582   0.49 10.39 ? 48  THR A O   1 
ATOM   782  O O   B THR A 1 49  ? -0.880 1.825   1.579   0.49 10.41 ? 48  THR A O   1 
ATOM   783  C CB  A THR A 1 49  ? -1.027 2.216   -1.369  0.49 9.39  ? 48  THR A CB  1 
ATOM   784  C CB  B THR A 1 49  ? -0.992 2.201   -1.356  0.49 9.30  ? 48  THR A CB  1 
ATOM   785  O OG1 A THR A 1 49  ? -1.241 1.712   -2.663  0.49 12.35 ? 48  THR A OG1 1 
ATOM   786  O OG1 B THR A 1 49  ? -1.234 1.707   -2.647  0.49 12.30 ? 48  THR A OG1 1 
ATOM   787  C CG2 A THR A 1 49  ? -0.363 3.599   -1.429  0.55 11.88 ? 48  THR A CG2 1 
ATOM   788  C CG2 B THR A 1 49  ? -0.349 3.589   -1.413  0.45 11.80 ? 48  THR A CG2 1 
ATOM   789  N N   A VAL A 1 50  ? 1.315  1.980   1.137   0.52 8.22  ? 49  VAL A N   1 
ATOM   790  N N   B VAL A 1 50  ? 1.318  1.964   1.153   0.48 8.26  ? 49  VAL A N   1 
ATOM   791  C CA  A VAL A 1 50  ? 1.648  2.499   2.478   0.54 7.96  ? 49  VAL A CA  1 
ATOM   792  C CA  B VAL A 1 50  ? 1.651  2.494   2.484   0.46 7.90  ? 49  VAL A CA  1 
ATOM   793  C C   A VAL A 1 50  ? 2.245  3.856   2.243   0.50 10.79 ? 49  VAL A C   1 
ATOM   794  C C   B VAL A 1 50  ? 2.242  3.856   2.240   0.50 10.80 ? 49  VAL A C   1 
ATOM   795  O O   A VAL A 1 50  ? 3.319  3.944   1.629   0.52 13.37 ? 49  VAL A O   1 
ATOM   796  O O   B VAL A 1 50  ? 3.309  3.954   1.610   0.48 13.42 ? 49  VAL A O   1 
ATOM   797  C CB  A VAL A 1 50  ? 2.616  1.604   3.217   0.55 10.48 ? 49  VAL A CB  1 
ATOM   798  C CB  B VAL A 1 50  ? 2.623  1.604   3.220   0.45 10.47 ? 49  VAL A CB  1 
ATOM   799  C CG1 A VAL A 1 50  ? 2.942  2.175   4.596   0.51 13.03 ? 49  VAL A CG1 1 
ATOM   800  C CG1 B VAL A 1 50  ? 2.941  2.175   4.602   0.49 13.01 ? 49  VAL A CG1 1 
ATOM   801  C CG2 A VAL A 1 50  ? 2.045  0.206   3.424   0.53 12.49 ? 49  VAL A CG2 1 
ATOM   802  C CG2 B VAL A 1 50  ? 2.048  0.206   3.427   0.47 12.46 ? 49  VAL A CG2 1 
ATOM   803  N N   A LYS A 1 51  ? 1.548  4.895   2.641   0.48 9.59  ? 50  LYS A N   1 
ATOM   804  N N   B LYS A 1 51  ? 1.548  4.895   2.647   0.48 9.60  ? 50  LYS A N   1 
ATOM   805  C CA  A LYS A 1 51  ? 2.054  6.247   2.494   0.51 9.78  ? 50  LYS A CA  1 
ATOM   806  C CA  B LYS A 1 51  ? 2.054  6.247   2.494   0.49 9.78  ? 50  LYS A CA  1 
ATOM   807  C C   A LYS A 1 51  ? 2.803  6.592   3.725   0.52 12.33 ? 50  LYS A C   1 
ATOM   808  C C   B LYS A 1 51  ? 2.807  6.592   3.725   0.48 12.33 ? 50  LYS A C   1 
ATOM   809  O O   A LYS A 1 51  ? 2.231  6.561   4.824   0.50 11.73 ? 50  LYS A O   1 
ATOM   810  O O   B LYS A 1 51  ? 2.231  6.561   4.824   0.50 11.73 ? 50  LYS A O   1 
ATOM   811  C CB  A LYS A 1 51  ? 0.957  7.265   2.328   0.49 14.46 ? 50  LYS A CB  1 
ATOM   812  C CB  B LYS A 1 51  ? 0.957  7.265   2.328   0.49 14.45 ? 50  LYS A CB  1 
ATOM   813  C CG  A LYS A 1 51  ? 0.173  7.018   1.068   0.53 19.88 ? 50  LYS A CG  1 
ATOM   814  C CG  B LYS A 1 51  ? 0.169  7.023   1.068   0.47 19.88 ? 50  LYS A CG  1 
ATOM   815  C CD  A LYS A 1 51  ? -0.613 8.237   0.714   0.57 19.87 ? 50  LYS A CD  1 
ATOM   816  C CD  B LYS A 1 51  ? -0.613 8.237   0.714   0.43 19.85 ? 50  LYS A CD  1 
ATOM   817  C CE  A LYS A 1 51  ? -1.786 7.784   -0.088  0.37 32.86 ? 50  LYS A CE  1 
ATOM   818  C CE  B LYS A 1 51  ? -1.786 7.784   -0.088  0.37 32.86 ? 50  LYS A CE  1 
ATOM   819  N NZ  A LYS A 1 51  ? -1.469 7.867   -1.510  0.59 39.17 ? 50  LYS A NZ  1 
ATOM   820  N NZ  B LYS A 1 51  ? -1.469 7.867   -1.510  0.41 39.17 ? 50  LYS A NZ  1 
ATOM   821  N N   A GLU A 1 52  ? 4.093  6.864   3.556   0.51 9.57  ? 51  GLU A N   1 
ATOM   822  N N   B GLU A 1 52  ? 4.097  6.864   3.556   0.49 9.57  ? 51  GLU A N   1 
ATOM   823  C CA  A GLU A 1 52  ? 4.946  7.224   4.649   0.50 10.86 ? 51  GLU A CA  1 
ATOM   824  C CA  B GLU A 1 52  ? 4.950  7.214   4.649   0.50 10.88 ? 51  GLU A CA  1 
ATOM   825  C C   A GLU A 1 52  ? 5.134  8.715   4.677   0.49 11.12 ? 51  GLU A C   1 
ATOM   826  C C   B GLU A 1 52  ? 5.138  8.710   4.677   0.49 11.12 ? 51  GLU A C   1 
ATOM   827  O O   A GLU A 1 52  ? 5.540  9.296   3.675   0.49 14.98 ? 51  GLU A O   1 
ATOM   828  O O   B GLU A 1 52  ? 5.544  9.291   3.675   0.49 15.00 ? 51  GLU A O   1 
ATOM   829  C CB  A GLU A 1 52  ? 6.356  6.700   4.405   0.52 20.71 ? 51  GLU A CB  1 
ATOM   830  C CB  B GLU A 1 52  ? 6.359  6.679   4.411   0.48 20.10 ? 51  GLU A CB  1 
ATOM   831  C CG  A GLU A 1 52  ? 6.632  5.296   4.893   0.50 25.17 ? 51  GLU A CG  1 
ATOM   832  C CG  B GLU A 1 52  ? 6.653  5.265   4.890   0.50 25.77 ? 51  GLU A CG  1 
ATOM   833  C CD  A GLU A 1 52  ? 8.083  4.967   4.834   0.46 23.40 ? 51  GLU A CD  1 
ATOM   834  C CD  B GLU A 1 52  ? 8.116  4.951   4.812   0.46 22.56 ? 51  GLU A CD  1 
ATOM   835  O OE1 A GLU A 1 52  ? 8.990  5.959   5.069   0.51 24.55 ? 51  GLU A OE1 1 
ATOM   836  O OE1 B GLU A 1 52  ? 8.989  5.959   5.072   0.49 24.54 ? 51  GLU A OE1 1 
ATOM   837  O OE2 A GLU A 1 52  ? 8.332  3.825   4.564   0.51 20.77 ? 51  GLU A OE2 1 
ATOM   838  O OE2 B GLU A 1 52  ? 8.423  3.831   4.517   0.49 22.52 ? 51  GLU A OE2 1 
ATOM   839  N N   A SER A 1 53  ? 4.881  9.337   5.805   0.49 8.82  ? 52  SER A N   1 
ATOM   840  N N   B SER A 1 53  ? 4.885  9.332   5.805   0.49 8.82  ? 52  SER A N   1 
ATOM   841  C CA  A SER A 1 53  ? 5.110  10.762  5.911   0.52 9.55  ? 52  SER A CA  1 
ATOM   842  C CA  B SER A 1 53  ? 5.110  10.762  5.911   0.48 9.55  ? 52  SER A CA  1 
ATOM   843  C C   A SER A 1 53  ? 5.920  11.014  7.174   0.48 10.47 ? 52  SER A C   1 
ATOM   844  C C   B SER A 1 53  ? 5.920  11.014  7.174   0.48 10.46 ? 52  SER A C   1 
ATOM   845  O O   A SER A 1 53  ? 5.554  10.571  8.267   0.51 12.07 ? 52  SER A O   1 
ATOM   846  O O   B SER A 1 53  ? 5.554  10.571  8.267   0.49 12.07 ? 52  SER A O   1 
ATOM   847  C CB  A SER A 1 53  ? 3.834  11.538  5.949   0.49 15.38 ? 52  SER A CB  1 
ATOM   848  C CB  B SER A 1 53  ? 3.834  11.538  5.946   0.49 15.36 ? 52  SER A CB  1 
ATOM   849  O OG  A SER A 1 53  ? 4.147  12.885  6.244   0.46 23.72 ? 52  SER A OG  1 
ATOM   850  O OG  B SER A 1 53  ? 4.147  12.885  6.244   0.46 23.67 ? 52  SER A OG  1 
ATOM   851  N N   A SER A 1 54  ? 7.063  11.682  7.045   0.50 9.81  ? 53  SER A N   1 
ATOM   852  N N   B SER A 1 54  ? 7.059  11.687  7.049   0.50 9.81  ? 53  SER A N   1 
ATOM   853  C CA  A SER A 1 54  ? 7.892  11.934  8.208   0.51 8.55  ? 53  SER A CA  1 
ATOM   854  C CA  B SER A 1 54  ? 7.888  11.939  8.214   0.49 8.55  ? 53  SER A CA  1 
ATOM   855  C C   A SER A 1 54  ? 8.642  13.235  7.998   0.51 11.09 ? 53  SER A C   1 
ATOM   856  C C   B SER A 1 54  ? 8.667  13.219  7.988   0.49 11.16 ? 53  SER A C   1 
ATOM   857  O O   A SER A 1 54  ? 8.443  13.883  6.983   0.52 11.28 ? 53  SER A O   1 
ATOM   858  O O   B SER A 1 54  ? 8.544  13.816  6.930   0.48 11.45 ? 53  SER A O   1 
ATOM   859  C CB  A SER A 1 54  ? 8.919  10.834  8.446   0.56 10.54 ? 53  SER A CB  1 
ATOM   860  C CB  B SER A 1 54  ? 8.912  10.834  8.446   0.44 10.54 ? 53  SER A CB  1 
ATOM   861  O OG  A SER A 1 54  ? 9.900  10.849  7.428   0.53 11.85 ? 53  SER A OG  1 
ATOM   862  O OG  B SER A 1 54  ? 9.896  10.854  7.431   0.47 11.87 ? 53  SER A OG  1 
ATOM   863  N N   A ASN A 1 55  ? 9.484  13.579  8.953   0.51 10.10 ? 54  ASN A N   1 
ATOM   864  N N   B ASN A 1 55  ? 9.473  13.595  8.969   0.49 10.02 ? 54  ASN A N   1 
ATOM   865  C CA  A ASN A 1 55  ? 10.289 14.808  8.797   0.50 11.67 ? 54  ASN A CA  1 
ATOM   866  C CA  B ASN A 1 55  ? 10.311 14.798  8.800   0.50 11.63 ? 54  ASN A CA  1 
ATOM   867  C C   A ASN A 1 55  ? 11.272 14.669  7.666   0.50 13.07 ? 54  ASN A C   1 
ATOM   868  C C   B ASN A 1 55  ? 11.301 14.602  7.678   0.50 11.94 ? 54  ASN A C   1 
ATOM   869  O O   A ASN A 1 55  ? 11.812 15.667  7.165   0.52 18.88 ? 54  ASN A O   1 
ATOM   870  O O   B ASN A 1 55  ? 11.842 15.574  7.121   0.48 18.45 ? 54  ASN A O   1 
ATOM   871  C CB  A ASN A 1 55  ? 11.094 15.117  10.075  0.53 12.56 ? 54  ASN A CB  1 
ATOM   872  C CB  B ASN A 1 55  ? 11.102 15.122  10.078  0.47 12.56 ? 54  ASN A CB  1 
ATOM   873  C CG  A ASN A 1 55  ? 10.218 15.471  11.237  0.50 13.14 ? 54  ASN A CG  1 
ATOM   874  C CG  B ASN A 1 55  ? 10.218 15.477  11.237  0.50 13.14 ? 54  ASN A CG  1 
ATOM   875  O OD1 A ASN A 1 55  ? 9.097  15.944  11.030  0.49 15.12 ? 54  ASN A OD1 1 
ATOM   876  O OD1 B ASN A 1 55  ? 9.097  15.944  11.027  0.49 15.14 ? 54  ASN A OD1 1 
ATOM   877  N ND2 A ASN A 1 55  ? 10.689 15.240  12.468  0.49 14.07 ? 54  ASN A ND2 1 
ATOM   878  N ND2 B ASN A 1 55  ? 10.685 15.240  12.471  0.49 14.06 ? 54  ASN A ND2 1 
ATOM   879  N N   A PHE A 1 56  ? 11.568 13.451  7.262   0.50 11.85 ? 55  PHE A N   1 
ATOM   880  N N   B PHE A 1 56  ? 11.609 13.363  7.331   0.50 12.70 ? 55  PHE A N   1 
ATOM   881  C CA  A PHE A 1 56  ? 12.548 13.235  6.218   0.52 14.96 ? 55  PHE A CA  1 
ATOM   882  C CA  B PHE A 1 56  ? 12.582 13.147  6.281   0.48 15.36 ? 55  PHE A CA  1 
ATOM   883  C C   A PHE A 1 56  ? 12.027 13.199  4.837   0.52 14.70 ? 55  PHE A C   1 
ATOM   884  C C   B PHE A 1 56  ? 12.040 13.214  4.896   0.48 13.71 ? 55  PHE A C   1 
ATOM   885  O O   A PHE A 1 56  ? 12.756 13.528  3.913   0.51 16.94 ? 55  PHE A O   1 
ATOM   886  O O   B PHE A 1 56  ? 12.704 13.718  4.004   0.49 16.97 ? 55  PHE A O   1 
ATOM   887  C CB  A PHE A 1 56  ? 13.179 11.846  6.350   0.49 20.22 ? 55  PHE A CB  1 
ATOM   888  C CB  B PHE A 1 56  ? 13.226 11.754  6.337   0.49 20.22 ? 55  PHE A CB  1 
ATOM   889  C CG  A PHE A 1 56  ? 13.899 11.692  7.641   0.43 29.19 ? 55  PHE A CG  1 
ATOM   890  C CG  B PHE A 1 56  ? 14.155 11.538  7.490   0.44 17.18 ? 55  PHE A CG  1 
ATOM   891  C CD1 A PHE A 1 56  ? 14.975 12.535  7.920   0.44 18.90 ? 55  PHE A CD1 1 
ATOM   892  C CD1 B PHE A 1 56  ? 15.482 11.944  7.425   0.41 24.72 ? 55  PHE A CD1 1 
ATOM   893  C CD2 A PHE A 1 56  ? 13.501 10.751  8.587   0.53 30.64 ? 55  PHE A CD2 1 
ATOM   894  C CD2 B PHE A 1 56  ? 13.692 10.916  8.649   0.47 26.36 ? 55  PHE A CD2 1 
ATOM   895  C CE1 A PHE A 1 56  ? 15.671 12.443  9.122   0.45 22.44 ? 55  PHE A CE1 1 
ATOM   896  C CE1 B PHE A 1 56  ? 16.349 11.749  8.499   0.46 26.44 ? 55  PHE A CE1 1 
ATOM   897  C CE2 A PHE A 1 56  ? 14.190 10.649  9.793   0.43 26.47 ? 55  PHE A CE2 1 
ATOM   898  C CE2 B PHE A 1 56  ? 14.544 10.715  9.730   0.46 17.54 ? 55  PHE A CE2 1 
ATOM   899  C CZ  A PHE A 1 56  ? 15.259 11.497  10.056  0.43 17.57 ? 55  PHE A CZ  1 
ATOM   900  C CZ  B PHE A 1 56  ? 15.868 11.132  9.649   0.41 24.93 ? 55  PHE A CZ  1 
ATOM   901  N N   A ARG A 1 57  ? 10.831 12.643  4.677   0.48 11.62 ? 56  ARG A N   1 
ATOM   902  N N   B ARG A 1 57  ? 10.877 12.587  4.696   0.48 12.20 ? 56  ARG A N   1 
ATOM   903  C CA  A ARG A 1 57  ? 10.294 12.448  3.352   0.46 11.15 ? 56  ARG A CA  1 
ATOM   904  C CA  B ARG A 1 57  ? 10.304 12.453  3.374   0.46 11.15 ? 56  ARG A CA  1 
ATOM   905  C C   A ARG A 1 57  ? 8.847  12.067  3.377   0.50 10.33 ? 56  ARG A C   1 
ATOM   906  C C   B ARG A 1 57  ? 8.854  12.073  3.390   0.50 10.41 ? 56  ARG A C   1 
ATOM   907  O O   A ARG A 1 57  ? 8.290  11.713  4.411   0.51 13.94 ? 56  ARG A O   1 
ATOM   908  O O   B ARG A 1 57  ? 8.294  11.702  4.414   0.49 13.93 ? 56  ARG A O   1 
ATOM   909  C CB  A ARG A 1 57  ? 11.014 11.306  2.625   0.53 17.02 ? 56  ARG A CB  1 
ATOM   910  C CB  B ARG A 1 57  ? 11.003 11.312  2.622   0.47 17.12 ? 56  ARG A CB  1 
ATOM   911  C CG  A ARG A 1 57  ? 10.844 9.949   3.296   0.56 17.30 ? 56  ARG A CG  1 
ATOM   912  C CG  B ARG A 1 57  ? 10.844 9.959   3.292   0.44 17.23 ? 56  ARG A CG  1 
ATOM   913  C CD  A ARG A 1 57  ? 11.596 8.844   2.572   0.52 19.83 ? 56  ARG A CD  1 
ATOM   914  C CD  B ARG A 1 57  ? 11.596 8.849   2.572   0.48 19.84 ? 56  ARG A CD  1 
ATOM   915  N NE  A ARG A 1 57  ? 11.398 7.543   3.205   0.52 18.29 ? 56  ARG A NE  1 
ATOM   916  N NE  B ARG A 1 57  ? 11.398 7.548   3.205   0.48 18.24 ? 56  ARG A NE  1 
ATOM   917  C CZ  A ARG A 1 57  ? 11.982 6.417   2.779   0.53 19.48 ? 56  ARG A CZ  1 
ATOM   918  C CZ  B ARG A 1 57  ? 11.982 6.417   2.779   0.47 19.54 ? 56  ARG A CZ  1 
ATOM   919  N NH1 A ARG A 1 57  ? 12.785 6.417   1.732   0.49 17.05 ? 56  ARG A NH1 1 
ATOM   920  N NH1 B ARG A 1 57  ? 12.785 6.417   1.729   0.49 17.04 ? 56  ARG A NH1 1 
ATOM   921  N NH2 A ARG A 1 57  ? 11.746 5.270   3.402   0.55 18.74 ? 56  ARG A NH2 1 
ATOM   922  N NH2 B ARG A 1 57  ? 11.742 5.270   3.402   0.45 18.72 ? 56  ARG A NH2 1 
ATOM   923  N N   A ASN A 1 58  ? 8.267  12.145  2.212   0.52 10.72 ? 57  ASN A N   1 
ATOM   924  N N   B ASN A 1 58  ? 8.274  12.150  2.221   0.48 10.71 ? 57  ASN A N   1 
ATOM   925  C CA  A ASN A 1 58  ? 6.900  11.779  2.014   0.49 10.97 ? 57  ASN A CA  1 
ATOM   926  C CA  B ASN A 1 58  ? 6.904  11.779  2.017   0.49 10.94 ? 57  ASN A CA  1 
ATOM   927  C C   A ASN A 1 58  ? 6.900  10.926  0.752   0.48 18.13 ? 57  ASN A C   1 
ATOM   928  C C   B ASN A 1 58  ? 6.903  10.926  0.752   0.48 18.16 ? 57  ASN A C   1 
ATOM   929  O O   A ASN A 1 58  ? 7.215  11.425  -0.326  0.49 20.30 ? 57  ASN A O   1 
ATOM   930  O O   B ASN A 1 58  ? 7.215  11.425  -0.326  0.49 20.30 ? 57  ASN A O   1 
ATOM   931  C CB  A ASN A 1 58  ? 6.031  13.029  1.876   0.52 13.27 ? 57  ASN A CB  1 
ATOM   932  C CB  B ASN A 1 58  ? 6.031  13.029  1.880   0.48 13.24 ? 57  ASN A CB  1 
ATOM   933  C CG  A ASN A 1 58  ? 6.153  13.893  3.123   0.48 16.05 ? 57  ASN A CG  1 
ATOM   934  C CG  B ASN A 1 58  ? 6.153  13.893  3.123   0.48 16.05 ? 57  ASN A CG  1 
ATOM   935  O OD1 A ASN A 1 58  ? 6.882  14.906  3.173   0.45 20.76 ? 57  ASN A OD1 1 
ATOM   936  O OD1 B ASN A 1 58  ? 6.882  14.906  3.173   0.45 20.76 ? 57  ASN A OD1 1 
ATOM   937  N ND2 A ASN A 1 58  ? 5.450  13.487  4.154   0.51 17.13 ? 57  ASN A ND2 1 
ATOM   938  N ND2 B ASN A 1 58  ? 5.450  13.487  4.154   0.49 17.14 ? 57  ASN A ND2 1 
ATOM   939  N N   A ILE A 1 59  ? 6.643  9.641   0.908   0.55 11.11 ? 58  ILE A N   1 
ATOM   940  N N   B ILE A 1 59  ? 6.646  9.641   0.908   0.45 11.12 ? 58  ILE A N   1 
ATOM   941  C CA  A ILE A 1 59  ? 6.681  8.751   -0.200  0.58 11.24 ? 58  ILE A CA  1 
ATOM   942  C CA  B ILE A 1 59  ? 6.681  8.751   -0.200  0.42 11.24 ? 58  ILE A CA  1 
ATOM   943  C C   A ILE A 1 59  ? 5.574  7.702   -0.097  0.46 12.27 ? 58  ILE A C   1 
ATOM   944  C C   B ILE A 1 59  ? 5.574  7.702   -0.097  0.46 12.28 ? 58  ILE A C   1 
ATOM   945  O O   A ILE A 1 59  ? 5.070  7.373   0.990   0.53 15.53 ? 58  ILE A O   1 
ATOM   946  O O   B ILE A 1 59  ? 5.070  7.373   0.990   0.47 15.53 ? 58  ILE A O   1 
ATOM   947  C CB  A ILE A 1 59  ? 7.997  8.011   -0.263  0.53 14.68 ? 58  ILE A CB  1 
ATOM   948  C CB  B ILE A 1 59  ? 7.997  8.011   -0.263  0.47 14.68 ? 58  ILE A CB  1 
ATOM   949  C CG1 A ILE A 1 59  ? 8.224  7.131   0.949   0.57 16.22 ? 58  ILE A CG1 1 
ATOM   950  C CG1 B ILE A 1 59  ? 8.224  7.131   0.949   0.43 16.22 ? 58  ILE A CG1 1 
ATOM   951  C CG2 A ILE A 1 59  ? 9.135  8.993   -0.439  0.47 31.19 ? 58  ILE A CG2 1 
ATOM   952  C CG2 B ILE A 1 59  ? 9.135  8.993   -0.439  0.47 31.19 ? 58  ILE A CG2 1 
ATOM   953  C CD1 A ILE A 1 59  ? 9.042  5.913   0.570   0.57 29.21 ? 58  ILE A CD1 1 
ATOM   954  C CD1 B ILE A 1 59  ? 9.042  5.913   0.570   0.43 29.21 ? 58  ILE A CD1 1 
ATOM   955  N N   A ASP A 1 60  ? 5.212  7.193   -1.256  0.51 11.91 ? 59  ASP A N   1 
ATOM   956  N N   B ASP A 1 60  ? 5.212  7.193   -1.256  0.49 11.91 ? 59  ASP A N   1 
ATOM   957  C CA  A ASP A 1 60  ? 4.211  6.149   -1.294  0.49 11.99 ? 59  ASP A CA  1 
ATOM   958  C CA  B ASP A 1 60  ? 4.211  6.149   -1.294  0.49 11.99 ? 59  ASP A CA  1 
ATOM   959  C C   A ASP A 1 60  ? 4.958  4.859   -1.510  0.52 11.68 ? 59  ASP A C   1 
ATOM   960  C C   B ASP A 1 60  ? 4.958  4.859   -1.510  0.48 11.68 ? 59  ASP A C   1 
ATOM   961  O O   A ASP A 1 60  ? 5.873  4.828   -2.346  0.52 16.89 ? 59  ASP A O   1 
ATOM   962  O O   B ASP A 1 60  ? 5.873  4.828   -2.346  0.48 16.89 ? 59  ASP A O   1 
ATOM   963  C CB  A ASP A 1 60  ? 3.291  6.319   -2.503  0.46 12.78 ? 59  ASP A CB  1 
ATOM   964  C CB  B ASP A 1 60  ? 3.291  6.319   -2.503  0.46 12.78 ? 59  ASP A CB  1 
ATOM   965  C CG  A ASP A 1 60  ? 2.190  7.327   -2.368  0.48 36.68 ? 59  ASP A CG  1 
ATOM   966  C CG  B ASP A 1 60  ? 2.190  7.327   -2.368  0.48 36.68 ? 59  ASP A CG  1 
ATOM   967  O OD1 A ASP A 1 60  ? 2.347  8.165   -1.369  0.50 23.13 ? 59  ASP A OD1 1 
ATOM   968  O OD1 B ASP A 1 60  ? 2.347  8.165   -1.369  0.50 23.13 ? 59  ASP A OD1 1 
ATOM   969  O OD2 A ASP A 1 60  ? 1.255  7.352   -3.142  0.45 37.13 ? 59  ASP A OD2 1 
ATOM   970  O OD2 B ASP A 1 60  ? 1.255  7.352   -3.142  0.45 37.13 ? 59  ASP A OD2 1 
ATOM   971  N N   A VAL A 1 61  ? 4.632  3.825   -0.755  0.54 9.31  ? 60  VAL A N   1 
ATOM   972  N N   B VAL A 1 61  ? 4.632  3.825   -0.755  0.46 9.31  ? 60  VAL A N   1 
ATOM   973  C CA  A VAL A 1 61  ? 5.264  2.545   -0.918  0.54 8.52  ? 60  VAL A CA  1 
ATOM   974  C CA  B VAL A 1 61  ? 5.264  2.545   -0.918  0.46 8.52  ? 60  VAL A CA  1 
ATOM   975  C C   A VAL A 1 61  ? 4.196  1.594   -1.403  0.49 9.27  ? 60  VAL A C   1 
ATOM   976  C C   B VAL A 1 61  ? 4.196  1.594   -1.403  0.49 9.27  ? 60  VAL A C   1 
ATOM   977  O O   A VAL A 1 61  ? 3.185  1.388   -0.714  0.55 11.26 ? 60  VAL A O   1 
ATOM   978  O O   B VAL A 1 61  ? 3.185  1.388   -0.714  0.45 11.26 ? 60  VAL A O   1 
ATOM   979  C CB  A VAL A 1 61  ? 5.890  2.062   0.385   0.51 10.32 ? 60  VAL A CB  1 
ATOM   980  C CB  B VAL A 1 61  ? 5.890  2.062   0.385   0.49 10.32 ? 60  VAL A CB  1 
ATOM   981  C CG1 A VAL A 1 61  ? 6.543  0.704   0.213   0.52 12.44 ? 60  VAL A CG1 1 
ATOM   982  C CG1 B VAL A 1 61  ? 6.543  0.704   0.213   0.48 12.44 ? 60  VAL A CG1 1 
ATOM   983  C CG2 A VAL A 1 61  ? 6.940  3.049   0.858   0.49 13.12 ? 60  VAL A CG2 1 
ATOM   984  C CG2 B VAL A 1 61  ? 6.940  3.049   0.858   0.49 13.12 ? 60  VAL A CG2 1 
ATOM   985  N N   A VAL A 1 62  ? 4.400  0.997   -2.566  0.52 7.90  ? 61  VAL A N   1 
ATOM   986  N N   B VAL A 1 62  ? 4.400  0.997   -2.566  0.48 7.90  ? 61  VAL A N   1 
ATOM   987  C CA  A VAL A 1 62  ? 3.399  0.098   -3.139  0.52 6.69  ? 61  VAL A CA  1 
ATOM   988  C CA  B VAL A 1 62  ? 3.399  0.098   -3.139  0.48 6.69  ? 61  VAL A CA  1 
ATOM   989  C C   A VAL A 1 62  ? 3.961  -1.260  -3.374  0.50 8.41  ? 61  VAL A C   1 
ATOM   990  C C   B VAL A 1 62  ? 3.961  -1.260  -3.374  0.50 8.41  ? 61  VAL A C   1 
ATOM   991  O O   A VAL A 1 62  ? 5.047  -1.373  -3.953  0.47 8.08  ? 61  VAL A O   1 
ATOM   992  O O   B VAL A 1 62  ? 5.047  -1.373  -3.953  0.47 8.08  ? 61  VAL A O   1 
ATOM   993  C CB  A VAL A 1 62  ? 2.923  0.684   -4.464  0.49 8.00  ? 61  VAL A CB  1 
ATOM   994  C CB  B VAL A 1 62  ? 2.923  0.684   -4.464  0.49 8.00  ? 61  VAL A CB  1 
ATOM   995  C CG1 A VAL A 1 62  ? 1.841  -0.211  -5.072  0.51 11.43 ? 61  VAL A CG1 1 
ATOM   996  C CG1 B VAL A 1 62  ? 1.841  -0.211  -5.072  0.49 11.43 ? 61  VAL A CG1 1 
ATOM   997  C CG2 A VAL A 1 62  ? 2.369  2.093   -4.254  0.53 13.47 ? 61  VAL A CG2 1 
ATOM   998  C CG2 B VAL A 1 62  ? 2.369  2.093   -4.254  0.47 13.47 ? 61  VAL A CG2 1 
ATOM   999  N N   A PHE A 1 63  ? 3.294  -2.298  -2.923  0.52 8.46  ? 62  PHE A N   1 
ATOM   1000 N N   B PHE A 1 63  ? 3.294  -2.298  -2.923  0.48 8.46  ? 62  PHE A N   1 
ATOM   1001 C CA  A PHE A 1 63  ? 3.794  -3.635  -3.133  0.53 9.84  ? 62  PHE A CA  1 
ATOM   1002 C CA  B PHE A 1 63  ? 3.794  -3.635  -3.133  0.47 9.84  ? 62  PHE A CA  1 
ATOM   1003 C C   A PHE A 1 63  ? 2.660  -4.633  -3.245  0.48 9.09  ? 62  PHE A C   1 
ATOM   1004 C C   B PHE A 1 63  ? 2.660  -4.633  -3.245  0.48 9.09  ? 62  PHE A C   1 
ATOM   1005 O O   A PHE A 1 63  ? 1.550  -4.412  -2.722  0.52 10.27 ? 62  PHE A O   1 
ATOM   1006 O O   B PHE A 1 63  ? 1.550  -4.412  -2.722  0.48 10.27 ? 62  PHE A O   1 
ATOM   1007 C CB  A PHE A 1 63  ? 4.738  -4.072  -1.999  0.55 9.31  ? 62  PHE A CB  1 
ATOM   1008 C CB  B PHE A 1 63  ? 4.738  -4.072  -1.999  0.45 9.31  ? 62  PHE A CB  1 
ATOM   1009 C CG  A PHE A 1 63  ? 4.151  -3.964  -0.595  0.59 9.36  ? 62  PHE A CG  1 
ATOM   1010 C CG  B PHE A 1 63  ? 4.151  -3.964  -0.595  0.41 9.36  ? 62  PHE A CG  1 
ATOM   1011 C CD1 A PHE A 1 63  ? 3.442  -5.013  -0.025  0.49 9.02  ? 62  PHE A CD1 1 
ATOM   1012 C CD1 B PHE A 1 63  ? 3.442  -5.013  -0.025  0.49 9.02  ? 62  PHE A CD1 1 
ATOM   1013 C CD2 A PHE A 1 63  ? 4.307  -2.802  0.125   0.54 12.36 ? 62  PHE A CD2 1 
ATOM   1014 C CD2 B PHE A 1 63  ? 4.307  -2.802  0.125   0.46 12.36 ? 62  PHE A CD2 1 
ATOM   1015 C CE1 A PHE A 1 63  ? 2.869  -4.895  1.234   0.53 13.72 ? 62  PHE A CE1 1 
ATOM   1016 C CE1 B PHE A 1 63  ? 2.869  -4.895  1.234   0.47 13.72 ? 62  PHE A CE1 1 
ATOM   1017 C CE2 A PHE A 1 63  ? 3.773  -2.663  1.403   0.54 13.69 ? 62  PHE A CE2 1 
ATOM   1018 C CE2 B PHE A 1 63  ? 3.773  -2.663  1.403   0.46 13.69 ? 62  PHE A CE2 1 
ATOM   1019 C CZ  A PHE A 1 63  ? 3.040  -3.712  1.955   0.55 14.76 ? 62  PHE A CZ  1 
ATOM   1020 C CZ  B PHE A 1 63  ? 3.040  -3.712  1.955   0.45 14.76 ? 62  PHE A CZ  1 
ATOM   1021 N N   A GLU A 1 64  ? 2.934  -5.723  -3.925  0.49 7.91  ? 63  GLU A N   1 
ATOM   1022 N N   B GLU A 1 64  ? 2.934  -5.723  -3.925  0.49 7.91  ? 63  GLU A N   1 
ATOM   1023 C CA  A GLU A 1 64  ? 2.002  -6.844  -3.994  0.48 8.09  ? 63  GLU A CA  1 
ATOM   1024 C CA  B GLU A 1 64  ? 2.002  -6.844  -3.994  0.48 8.09  ? 63  GLU A CA  1 
ATOM   1025 C C   A GLU A 1 64  ? 2.524  -7.923  -3.073  0.50 9.80  ? 63  GLU A C   1 
ATOM   1026 C C   B GLU A 1 64  ? 2.524  -7.923  -3.073  0.50 9.80  ? 63  GLU A C   1 
ATOM   1027 O O   A GLU A 1 64  ? 3.736  -8.227  -3.083  0.52 8.66  ? 63  GLU A O   1 
ATOM   1028 O O   B GLU A 1 64  ? 3.736  -8.227  -3.083  0.48 8.66  ? 63  GLU A O   1 
ATOM   1029 C CB  A GLU A 1 64  ? 1.796  -7.409  -5.416  0.45 10.30 ? 63  GLU A CB  1 
ATOM   1030 C CB  B GLU A 1 64  ? 1.796  -7.409  -5.416  0.45 10.30 ? 63  GLU A CB  1 
ATOM   1031 C CG  A GLU A 1 64  ? 0.776  -8.576  -5.382  0.44 16.11 ? 63  GLU A CG  1 
ATOM   1032 C CG  B GLU A 1 64  ? 0.776  -8.576  -5.382  0.44 16.11 ? 63  GLU A CG  1 
ATOM   1033 C CD  A GLU A 1 64  ? 0.442  -9.173  -6.720  0.41 30.93 ? 63  GLU A CD  1 
ATOM   1034 C CD  B GLU A 1 64  ? 0.442  -9.173  -6.720  0.41 30.93 ? 63  GLU A CD  1 
ATOM   1035 O OE1 A GLU A 1 64  ? 0.959  -8.520  -7.732  0.48 22.72 ? 63  GLU A OE1 1 
ATOM   1036 O OE1 B GLU A 1 64  ? 0.959  -8.520  -7.732  0.48 22.72 ? 63  GLU A OE1 1 
ATOM   1037 O OE2 A GLU A 1 64  ? -0.253 -10.170 -6.836  0.47 29.52 ? 63  GLU A OE2 1 
ATOM   1038 O OE2 B GLU A 1 64  ? -0.253 -10.170 -6.836  0.47 29.52 ? 63  GLU A OE2 1 
ATOM   1039 N N   A LEU A 1 65  ? 1.683  -8.540  -2.215  0.52 8.45  ? 64  LEU A N   1 
ATOM   1040 N N   B LEU A 1 65  ? 1.683  -8.540  -2.215  0.48 8.45  ? 64  LEU A N   1 
ATOM   1041 C CA  A LEU A 1 65  ? 2.160  -9.589  -1.344  0.49 7.25  ? 64  LEU A CA  1 
ATOM   1042 C CA  B LEU A 1 65  ? 2.160  -9.589  -1.344  0.49 7.25  ? 64  LEU A CA  1 
ATOM   1043 C C   A LEU A 1 65  ? 2.850  -10.700 -2.143  0.49 8.67  ? 64  LEU A C   1 
ATOM   1044 C C   B LEU A 1 65  ? 2.850  -10.700 -2.143  0.49 8.67  ? 64  LEU A C   1 
ATOM   1045 O O   A LEU A 1 65  ? 2.309  -11.127 -3.167  0.48 10.13 ? 64  LEU A O   1 
ATOM   1046 O O   B LEU A 1 65  ? 2.309  -11.127 -3.167  0.48 10.13 ? 64  LEU A O   1 
ATOM   1047 C CB  A LEU A 1 65  ? 1.035  -10.227 -0.504  0.53 9.10  ? 64  LEU A CB  1 
ATOM   1048 C CB  B LEU A 1 65  ? 1.035  -10.227 -0.504  0.47 9.10  ? 64  LEU A CB  1 
ATOM   1049 C CG  A LEU A 1 65  ? 0.299  -9.239  0.429   0.52 11.55 ? 64  LEU A CG  1 
ATOM   1050 C CG  B LEU A 1 65  ? 0.299  -9.239  0.429   0.48 11.55 ? 64  LEU A CG  1 
ATOM   1051 C CD1 A LEU A 1 65  ? -0.869 -9.954  1.100   0.56 15.10 ? 64  LEU A CD1 1 
ATOM   1052 C CD1 B LEU A 1 65  ? -0.869 -9.954  1.100   0.44 15.10 ? 64  LEU A CD1 1 
ATOM   1053 C CD2 A LEU A 1 65  ? 1.248  -8.725  1.510   0.50 15.32 ? 64  LEU A CD2 1 
ATOM   1054 C CD2 B LEU A 1 65  ? 1.248  -8.725  1.510   0.50 15.32 ? 64  LEU A CD2 1 
ATOM   1055 N N   A GLY A 1 66  ? 4.025  -11.126 -1.685  0.52 10.17 ? 65  GLY A N   1 
ATOM   1056 N N   B GLY A 1 66  ? 4.025  -11.126 -1.685  0.48 10.17 ? 65  GLY A N   1 
ATOM   1057 C CA  A GLY A 1 66  ? 4.768  -12.206 -2.334  0.53 10.81 ? 65  GLY A CA  1 
ATOM   1058 C CA  B GLY A 1 66  ? 4.768  -12.206 -2.334  0.47 10.81 ? 65  GLY A CA  1 
ATOM   1059 C C   A GLY A 1 66  ? 5.565  -11.805 -3.574  0.48 11.78 ? 65  GLY A C   1 
ATOM   1060 C C   B GLY A 1 66  ? 5.565  -11.805 -3.574  0.48 11.78 ? 65  GLY A C   1 
ATOM   1061 O O   A GLY A 1 66  ? 6.218  -12.654 -4.182  0.53 12.94 ? 65  GLY A O   1 
ATOM   1062 O O   B GLY A 1 66  ? 6.218  -12.654 -4.182  0.47 12.94 ? 65  GLY A O   1 
ATOM   1063 N N   A VAL A 1 67  ? 5.518  -10.530 -3.969  0.52 7.96  ? 66  VAL A N   1 
ATOM   1064 N N   B VAL A 1 67  ? 5.518  -10.530 -3.969  0.48 7.96  ? 66  VAL A N   1 
ATOM   1065 C CA  A VAL A 1 67  ? 6.242  -10.093 -5.160  0.55 10.26 ? 66  VAL A CA  1 
ATOM   1066 C CA  B VAL A 1 67  ? 6.242  -10.093 -5.160  0.45 10.26 ? 66  VAL A CA  1 
ATOM   1067 C C   A VAL A 1 67  ? 7.400  -9.193  -4.740  0.48 9.72  ? 66  VAL A C   1 
ATOM   1068 C C   B VAL A 1 67  ? 7.400  -9.193  -4.740  0.48 9.72  ? 66  VAL A C   1 
ATOM   1069 O O   A VAL A 1 67  ? 7.219  -8.191  -4.060  0.49 9.53  ? 66  VAL A O   1 
ATOM   1070 O O   B VAL A 1 67  ? 7.219  -8.191  -4.060  0.49 9.53  ? 66  VAL A O   1 
ATOM   1071 C CB  A VAL A 1 67  ? 5.315  -9.378  -6.121  0.53 11.01 ? 66  VAL A CB  1 
ATOM   1072 C CB  B VAL A 1 67  ? 5.315  -9.378  -6.121  0.47 11.01 ? 66  VAL A CB  1 
ATOM   1073 C CG1 A VAL A 1 67  ? 6.104  -8.875  -7.321  0.53 12.39 ? 66  VAL A CG1 1 
ATOM   1074 C CG1 B VAL A 1 67  ? 6.104  -8.875  -7.321  0.47 12.39 ? 66  VAL A CG1 1 
ATOM   1075 C CG2 A VAL A 1 67  ? 4.191  -10.294 -6.591  0.56 12.64 ? 66  VAL A CG2 1 
ATOM   1076 C CG2 B VAL A 1 67  ? 4.191  -10.294 -6.591  0.44 12.64 ? 66  VAL A CG2 1 
ATOM   1077 N N   A ASP A 1 68  ? 8.611  -9.548  -5.135  0.48 9.66  ? 67  ASP A N   1 
ATOM   1078 N N   B ASP A 1 68  ? 8.611  -9.548  -5.135  0.48 9.66  ? 67  ASP A N   1 
ATOM   1079 C CA  A ASP A 1 68  ? 9.740  -8.761  -4.699  0.52 8.97  ? 67  ASP A CA  1 
ATOM   1080 C CA  B ASP A 1 68  ? 9.740  -8.761  -4.699  0.48 8.98  ? 67  ASP A CA  1 
ATOM   1081 C C   A ASP A 1 68  ? 9.742  -7.373  -5.225  0.53 8.56  ? 67  ASP A C   1 
ATOM   1082 C C   B ASP A 1 68  ? 9.739  -7.373  -5.225  0.47 8.56  ? 67  ASP A C   1 
ATOM   1083 O O   A ASP A 1 68  ? 9.243  -7.090  -6.328  0.51 10.41 ? 67  ASP A O   1 
ATOM   1084 O O   B ASP A 1 68  ? 9.243  -7.090  -6.328  0.49 10.41 ? 67  ASP A O   1 
ATOM   1085 C CB  A ASP A 1 68  ? 11.052 -9.553  -4.890  0.50 20.59 ? 67  ASP A CB  1 
ATOM   1086 C CB  B ASP A 1 68  ? 11.052 -9.553  -4.890  0.50 20.58 ? 67  ASP A CB  1 
ATOM   1087 C CG  A ASP A 1 68  ? 11.476 -9.641  -6.316  0.45 27.46 ? 67  ASP A CG  1 
ATOM   1088 C CG  B ASP A 1 68  ? 11.476 -9.641  -6.316  0.45 27.47 ? 67  ASP A CG  1 
ATOM   1089 O OD1 A ASP A 1 68  ? 10.629 -10.289 -7.077  0.40 31.92 ? 67  ASP A OD1 1 
ATOM   1090 O OD1 B ASP A 1 68  ? 10.629 -10.289 -7.077  0.40 31.92 ? 67  ASP A OD1 1 
ATOM   1091 O OD2 A ASP A 1 68  ? 12.519 -9.168  -6.713  0.44 53.08 ? 67  ASP A OD2 1 
ATOM   1092 O OD2 B ASP A 1 68  ? 12.519 -9.168  -6.713  0.44 53.07 ? 67  ASP A OD2 1 
ATOM   1093 N N   A PHE A 1 69  ? 10.250 -6.443  -4.430  0.50 8.82  ? 68  PHE A N   1 
ATOM   1094 N N   B PHE A 1 69  ? 10.243 -6.443  -4.427  0.50 8.82  ? 68  PHE A N   1 
ATOM   1095 C CA  A PHE A 1 69  ? 10.291 -5.029  -4.815  0.48 8.83  ? 68  PHE A CA  1 
ATOM   1096 C CA  B PHE A 1 69  ? 10.281 -5.029  -4.812  0.48 8.86  ? 68  PHE A CA  1 
ATOM   1097 C C   A PHE A 1 69  ? 11.457 -4.340  -4.141  0.51 9.46  ? 68  PHE A C   1 
ATOM   1098 C C   B PHE A 1 69  ? 11.450 -4.340  -4.141  0.49 9.47  ? 68  PHE A C   1 
ATOM   1099 O O   A PHE A 1 69  ? 12.072 -4.895  -3.227  0.49 11.35 ? 68  PHE A O   1 
ATOM   1100 O O   B PHE A 1 69  ? 12.076 -4.905  -3.239  0.49 11.38 ? 68  PHE A O   1 
ATOM   1101 C CB  A PHE A 1 69  ? 8.956  -4.268  -4.564  0.54 9.26  ? 68  PHE A CB  1 
ATOM   1102 C CB  B PHE A 1 69  ? 8.949  -4.268  -4.561  0.46 9.24  ? 68  PHE A CB  1 
ATOM   1103 C CG  A PHE A 1 69  ? 8.692  -3.954  -3.123  0.49 10.77 ? 68  PHE A CG  1 
ATOM   1104 C CG  B PHE A 1 69  ? 8.689  -3.954  -3.123  0.49 10.77 ? 68  PHE A CG  1 
ATOM   1105 C CD1 A PHE A 1 69  ? 8.459  -4.987  -2.209  0.49 12.13 ? 68  PHE A CD1 1 
ATOM   1106 C CD1 B PHE A 1 69  ? 8.456  -4.987  -2.209  0.49 12.11 ? 68  PHE A CD1 1 
ATOM   1107 C CD2 A PHE A 1 69  ? 8.701  -2.633  -2.631  0.49 14.61 ? 68  PHE A CD2 1 
ATOM   1108 C CD2 B PHE A 1 69  ? 8.698  -2.633  -2.631  0.49 14.62 ? 68  PHE A CD2 1 
ATOM   1109 C CE1 A PHE A 1 69  ? 8.240  -4.735  -0.855  0.50 10.89 ? 68  PHE A CE1 1 
ATOM   1110 C CE1 B PHE A 1 69  ? 8.240  -4.735  -0.855  0.50 10.89 ? 68  PHE A CE1 1 
ATOM   1111 C CE2 A PHE A 1 69  ? 8.482  -2.370  -1.272  0.51 13.12 ? 68  PHE A CE2 1 
ATOM   1112 C CE2 B PHE A 1 69  ? 8.482  -2.370  -1.272  0.49 13.11 ? 68  PHE A CE2 1 
ATOM   1113 C CZ  A PHE A 1 69  ? 8.282  -3.429  -0.401  0.47 14.17 ? 68  PHE A CZ  1 
ATOM   1114 C CZ  B PHE A 1 69  ? 8.286  -3.429  -0.401  0.47 14.17 ? 68  PHE A CZ  1 
ATOM   1115 N N   A ALA A 1 70  ? 11.721 -3.116  -4.568  0.55 10.88 ? 69  ALA A N   1 
ATOM   1116 N N   B ALA A 1 70  ? 11.710 -3.116  -4.552  0.45 10.72 ? 69  ALA A N   1 
ATOM   1117 C CA  A ALA A 1 70  ? 12.794 -2.304  -4.029  0.53 10.31 ? 69  ALA A CA  1 
ATOM   1118 C CA  B ALA A 1 70  ? 12.801 -2.334  -4.004  0.47 10.05 ? 69  ALA A CA  1 
ATOM   1119 C C   A ALA A 1 70  ? 12.268 -1.224  -3.095  0.50 11.88 ? 69  ALA A C   1 
ATOM   1120 C C   B ALA A 1 70  ? 12.283 -1.219  -3.117  0.50 11.75 ? 69  ALA A C   1 
ATOM   1121 O O   A ALA A 1 70  ? 11.310 -0.509  -3.383  0.51 12.61 ? 69  ALA A O   1 
ATOM   1122 O O   B ALA A 1 70  ? 11.384 -0.489  -3.496  0.49 13.21 ? 69  ALA A O   1 
ATOM   1123 C CB  A ALA A 1 70  ? 13.549 -1.645  -5.166  0.51 15.95 ? 69  ALA A CB  1 
ATOM   1124 C CB  B ALA A 1 70  ? 13.545 -1.681  -5.147  0.49 16.06 ? 69  ALA A CB  1 
ATOM   1125 N N   A TYR A 1 71  ? 12.898 -1.105  -1.930  0.51 10.95 ? 70  TYR A N   1 
ATOM   1126 N N   B TYR A 1 71  ? 12.870 -1.085  -1.923  0.49 10.70 ? 70  TYR A N   1 
ATOM   1127 C CA  A TYR A 1 71  ? 12.486 -0.134  -0.955  0.52 13.10 ? 70  TYR A CA  1 
ATOM   1128 C CA  B TYR A 1 71  ? 12.475 -0.072  -0.974  0.48 13.10 ? 70  TYR A CA  1 
ATOM   1129 C C   A TYR A 1 71  ? 13.698 0.452   -0.282  0.49 10.14 ? 70  TYR A C   1 
ATOM   1130 C C   B TYR A 1 71  ? 13.729 0.519   -0.379  0.49 10.03 ? 70  TYR A C   1 
ATOM   1131 O O   A TYR A 1 71  ? 14.580 -0.298  0.063   0.50 13.17 ? 70  TYR A O   1 
ATOM   1132 O O   B TYR A 1 71  ? 14.694 -0.185  -0.229  0.50 13.83 ? 70  TYR A O   1 
ATOM   1133 C CB  A TYR A 1 71  ? 11.638 -0.802  0.160   0.55 13.36 ? 70  TYR A CB  1 
ATOM   1134 C CB  B TYR A 1 71  ? 11.663 -0.740  0.175   0.45 13.11 ? 70  TYR A CB  1 
ATOM   1135 C CG  A TYR A 1 71  ? 11.296 0.165   1.291   0.48 12.69 ? 70  TYR A CG  1 
ATOM   1136 C CG  B TYR A 1 71  ? 11.326 0.113   1.403   0.48 12.39 ? 70  TYR A CG  1 
ATOM   1137 C CD1 A TYR A 1 71  ? 10.454 1.244   1.068   0.44 16.40 ? 70  TYR A CD1 1 
ATOM   1138 C CD1 B TYR A 1 71  ? 10.376 1.131   1.328   0.42 17.59 ? 70  TYR A CD1 1 
ATOM   1139 C CD2 A TYR A 1 71  ? 11.805 0.031   2.588   0.41 16.97 ? 70  TYR A CD2 1 
ATOM   1140 C CD2 B TYR A 1 71  ? 11.875 -0.139  2.663   0.40 19.21 ? 70  TYR A CD2 1 
ATOM   1141 C CE1 A TYR A 1 71  ? 10.101 2.149   2.077   0.48 16.41 ? 70  TYR A CE1 1 
ATOM   1142 C CE1 B TYR A 1 71  ? 10.007 1.887   2.440   0.50 13.70 ? 70  TYR A CE1 1 
ATOM   1143 C CE2 A TYR A 1 71  ? 11.488 0.931   3.615   0.46 20.19 ? 70  TYR A CE2 1 
ATOM   1144 C CE2 B TYR A 1 71  ? 11.551 0.622   3.800   0.48 15.41 ? 70  TYR A CE2 1 
ATOM   1145 C CZ  A TYR A 1 71  ? 10.639 2.010   3.358   0.51 15.28 ? 70  TYR A CZ  1 
ATOM   1146 C CZ  B TYR A 1 71  ? 10.610 1.645   3.678   0.49 19.38 ? 70  TYR A CZ  1 
ATOM   1147 O OH  A TYR A 1 71  ? 10.322 2.900   4.348   0.51 18.17 ? 70  TYR A OH  1 
ATOM   1148 O OH  B TYR A 1 71  ? 10.258 2.406   4.755   0.49 21.02 ? 70  TYR A OH  1 
ATOM   1149 N N   A SER A 1 72  ? 13.695 1.774   -0.047  0.54 13.14 ? 71  SER A N   1 
ATOM   1150 N N   B SER A 1 72  ? 13.681 1.805   -0.019  0.46 13.03 ? 71  SER A N   1 
ATOM   1151 C CA  A SER A 1 72  ? 14.761 2.417   0.667   0.58 14.68 ? 71  SER A CA  1 
ATOM   1152 C CA  B SER A 1 72  ? 14.768 2.442   0.655   0.42 14.61 ? 71  SER A CA  1 
ATOM   1153 C C   A SER A 1 72  ? 14.285 2.931   2.008   0.53 18.20 ? 71  SER A C   1 
ATOM   1154 C C   B SER A 1 72  ? 14.296 2.946   1.999   0.47 18.05 ? 71  SER A C   1 
ATOM   1155 O O   A SER A 1 72  ? 13.242 3.573   2.146   0.53 18.04 ? 71  SER A O   1 
ATOM   1156 O O   B SER A 1 72  ? 13.249 3.579   2.137   0.47 18.07 ? 71  SER A O   1 
ATOM   1157 C CB  A SER A 1 72  ? 15.263 3.661   -0.034  0.55 20.29 ? 71  SER A CB  1 
ATOM   1158 C CB  B SER A 1 72  ? 15.270 3.681   -0.053  0.45 20.39 ? 71  SER A CB  1 
ATOM   1159 O OG  A SER A 1 72  ? 15.924 3.383   -1.247  0.49 29.19 ? 71  SER A OG  1 
ATOM   1160 O OG  B SER A 1 72  ? 15.931 3.393   -1.259  0.49 29.08 ? 71  SER A OG  1 
ATOM   1161 N N   A LEU A 1 73  ? 15.097 2.694   3.011   0.43 17.72 ? 72  LEU A N   1 
ATOM   1162 N N   B LEU A 1 73  ? 15.101 2.699   3.004   0.43 17.82 ? 72  LEU A N   1 
ATOM   1163 C CA  A LEU A 1 73  ? 14.862 3.244   4.317   0.51 15.31 ? 72  LEU A CA  1 
ATOM   1164 C CA  B LEU A 1 73  ? 14.862 3.239   4.314   0.49 15.33 ? 72  LEU A CA  1 
ATOM   1165 C C   A LEU A 1 73  ? 15.096 4.751   4.201   0.46 15.77 ? 72  LEU A C   1 
ATOM   1166 C C   B LEU A 1 73  ? 15.092 4.746   4.201   0.46 15.77 ? 72  LEU A C   1 
ATOM   1167 O O   A LEU A 1 73  ? 15.761 5.260   3.271   0.49 18.58 ? 72  LEU A O   1 
ATOM   1168 O O   B LEU A 1 73  ? 15.761 5.255   3.271   0.49 18.60 ? 72  LEU A O   1 
ATOM   1169 C CB  A LEU A 1 73  ? 15.880 2.679   5.310   0.51 20.62 ? 72  LEU A CB  1 
ATOM   1170 C CB  B LEU A 1 73  ? 15.881 2.679   5.307   0.49 20.66 ? 72  LEU A CB  1 
ATOM   1171 C CG  A LEU A 1 73  ? 15.600 1.229   5.680   0.49 26.12 ? 72  LEU A CG  1 
ATOM   1172 C CG  B LEU A 1 73  ? 15.600 1.229   5.680   0.49 26.12 ? 72  LEU A CG  1 
ATOM   1173 C CD1 A LEU A 1 73  ? 16.659 0.699   6.635   0.53 26.11 ? 72  LEU A CD1 1 
ATOM   1174 C CD1 B LEU A 1 73  ? 16.659 0.699   6.635   0.47 26.12 ? 72  LEU A CD1 1 
ATOM   1175 C CD2 A LEU A 1 73  ? 14.224 1.111   6.306   0.49 33.08 ? 72  LEU A CD2 1 
ATOM   1176 C CD2 B LEU A 1 73  ? 14.220 1.111   6.309   0.49 33.08 ? 72  LEU A CD2 1 
ATOM   1177 N N   A ALA A 1 74  ? 14.523 5.471   5.175   0.47 22.38 ? 73  ALA A N   1 
ATOM   1178 N N   B ALA A 1 74  ? 14.523 5.466   5.175   0.47 22.38 ? 73  ALA A N   1 
ATOM   1179 C CA  A ALA A 1 74  ? 14.610 6.921   5.247   0.50 24.02 ? 73  ALA A CA  1 
ATOM   1180 C CA  B ALA A 1 74  ? 14.610 6.921   5.247   0.50 24.03 ? 73  ALA A CA  1 
ATOM   1181 C C   A ALA A 1 74  ? 16.038 7.409   5.153   0.51 42.75 ? 73  ALA A C   1 
ATOM   1182 C C   B ALA A 1 74  ? 16.038 7.409   5.153   0.49 42.75 ? 73  ALA A C   1 
ATOM   1183 O O   A ALA A 1 74  ? 16.311 8.417   4.499   0.50 31.59 ? 73  ALA A O   1 
ATOM   1184 O O   B ALA A 1 74  ? 16.311 8.417   4.499   0.50 31.59 ? 73  ALA A O   1 
ATOM   1185 C CB  A ALA A 1 74  ? 13.881 7.476   6.475   0.52 21.65 ? 73  ALA A CB  1 
ATOM   1186 C CB  B ALA A 1 74  ? 13.881 7.476   6.475   0.48 21.65 ? 73  ALA A CB  1 
ATOM   1187 N N   A ASP A 1 75  ? 16.941 6.664   5.796   0.35 25.23 ? 74  ASP A N   1 
ATOM   1188 N N   B ASP A 1 75  ? 16.941 6.664   5.796   0.35 25.23 ? 74  ASP A N   1 
ATOM   1189 C CA  A ASP A 1 75  ? 18.365 6.946   5.833   0.49 42.49 ? 74  ASP A CA  1 
ATOM   1190 C CA  B ASP A 1 75  ? 18.365 6.946   5.833   0.49 42.49 ? 74  ASP A CA  1 
ATOM   1191 C C   A ASP A 1 75  ? 19.061 6.869   4.483   0.51 31.38 ? 74  ASP A C   1 
ATOM   1192 C C   B ASP A 1 75  ? 19.061 6.869   4.483   0.49 31.38 ? 74  ASP A C   1 
ATOM   1193 O O   A ASP A 1 75  ? 20.145 7.414   4.295   0.44 42.29 ? 74  ASP A O   1 
ATOM   1194 O O   B ASP A 1 75  ? 20.145 7.414   4.295   0.44 42.29 ? 74  ASP A O   1 
ATOM   1195 C CB  A ASP A 1 75  ? 19.179 6.209   6.845   0.50 0.00  ? 74  ASP A CB  1 
ATOM   1196 C CB  B ASP A 1 75  ? 19.073 5.945   6.747   0.50 0.00  ? 74  ASP A CB  1 
ATOM   1197 C CG  A ASP A 1 75  ? 19.657 4.867   6.288   0.50 0.00  ? 74  ASP A CG  1 
ATOM   1198 C CG  B ASP A 1 75  ? 19.664 4.880   6.275   0.50 0.00  ? 74  ASP A CG  1 
ATOM   1199 O OD1 A ASP A 1 75  ? 18.804 4.030   5.801   0.50 0.00  ? 74  ASP A OD1 1 
ATOM   1200 O OD1 B ASP A 1 75  ? 19.073 4.155   5.387   0.50 0.00  ? 74  ASP A OD1 1 
ATOM   1201 O OD2 A ASP A 1 75  ? 20.912 4.571   6.307   0.50 0.00  ? 74  ASP A OD2 1 
ATOM   1202 O OD2 B ASP A 1 75  ? 20.838 4.552   6.698   0.50 0.00  ? 74  ASP A OD2 1 
ATOM   1203 N N   A GLY A 1 76  ? 18.444 6.165   3.531   0.36 26.25 ? 75  GLY A N   1 
ATOM   1204 N N   B GLY A 1 76  ? 18.444 6.165   3.531   0.36 26.25 ? 75  GLY A N   1 
ATOM   1205 C CA  A GLY A 1 76  ? 18.998 5.995   2.190   0.38 14.97 ? 75  GLY A CA  1 
ATOM   1206 C CA  B GLY A 1 76  ? 18.998 5.995   2.190   0.38 14.97 ? 75  GLY A CA  1 
ATOM   1207 C C   A GLY A 1 76  ? 19.423 4.540   1.861   0.44 13.79 ? 75  GLY A C   1 
ATOM   1208 C C   B GLY A 1 76  ? 19.423 4.540   1.861   0.44 13.79 ? 75  GLY A C   1 
ATOM   1209 O O   A GLY A 1 76  ? 19.711 4.206   0.717   0.48 21.86 ? 75  GLY A O   1 
ATOM   1210 O O   B GLY A 1 76  ? 19.715 4.206   0.717   0.48 21.86 ? 75  GLY A O   1 
ATOM   1211 N N   A THR A 1 77  ? 19.459 3.671   2.841   0.47 16.15 ? 76  THR A N   1 
ATOM   1212 N N   B THR A 1 77  ? 19.459 3.671   2.841   0.47 16.15 ? 76  THR A N   1 
ATOM   1213 C CA  A THR A 1 77  ? 19.832 2.293   2.594   0.50 19.09 ? 76  THR A CA  1 
ATOM   1214 C CA  B THR A 1 77  ? 19.832 2.293   2.594   0.50 19.09 ? 76  THR A CA  1 
ATOM   1215 C C   A THR A 1 77  ? 18.825 1.609   1.676   0.51 14.08 ? 76  THR A C   1 
ATOM   1216 C C   B THR A 1 77  ? 18.825 1.609   1.676   0.49 14.08 ? 76  THR A C   1 
ATOM   1217 O O   A THR A 1 77  ? 17.634 1.579   1.989   0.53 15.00 ? 76  THR A O   1 
ATOM   1218 O O   B THR A 1 77  ? 17.634 1.579   1.989   0.47 14.99 ? 76  THR A O   1 
ATOM   1219 C CB  A THR A 1 77  ? 19.937 1.517   3.919   0.52 26.46 ? 76  THR A CB  1 
ATOM   1220 C CB  B THR A 1 77  ? 19.937 1.517   3.919   0.48 26.46 ? 76  THR A CB  1 
ATOM   1221 O OG1 A THR A 1 77  ? 20.970 2.118   4.646   0.46 36.83 ? 76  THR A OG1 1 
ATOM   1222 O OG1 B THR A 1 77  ? 20.970 2.118   4.646   0.46 36.83 ? 76  THR A OG1 1 
ATOM   1223 C CG2 A THR A 1 77  ? 20.309 0.057   3.731   0.58 18.93 ? 76  THR A CG2 1 
ATOM   1224 C CG2 B THR A 1 77  ? 20.309 0.057   3.731   0.42 18.93 ? 76  THR A CG2 1 
ATOM   1225 N N   A GLU A 1 78  ? 19.315 1.018   0.595   0.46 11.97 ? 77  GLU A N   1 
ATOM   1226 N N   B GLU A 1 78  ? 19.315 1.018   0.595   0.46 11.98 ? 77  GLU A N   1 
ATOM   1227 C CA  A GLU A 1 78  ? 18.427 0.303   -0.338  0.46 10.47 ? 77  GLU A CA  1 
ATOM   1228 C CA  B GLU A 1 78  ? 18.430 0.303   -0.338  0.46 10.46 ? 77  GLU A CA  1 
ATOM   1229 C C   A GLU A 1 78  ? 18.263 -1.162  0.056   0.51 10.23 ? 77  GLU A C   1 
ATOM   1230 C C   B GLU A 1 78  ? 18.264 -1.162  0.053   0.49 10.23 ? 77  GLU A C   1 
ATOM   1231 O O   A GLU A 1 78  ? 19.225 -1.872  0.335   0.49 10.41 ? 77  GLU A O   1 
ATOM   1232 O O   B GLU A 1 78  ? 19.229 -1.877  0.335   0.49 10.41 ? 77  GLU A O   1 
ATOM   1233 C CB  A GLU A 1 78  ? 18.983 0.293   -1.770  0.57 14.96 ? 77  GLU A CB  1 
ATOM   1234 C CB  B GLU A 1 78  ? 18.983 0.314   -1.770  0.43 15.14 ? 77  GLU A CB  1 
ATOM   1235 C CG  A GLU A 1 78  ? 19.100 1.671   -2.456  0.51 26.22 ? 77  GLU A CG  1 
ATOM   1236 C CG  B GLU A 1 78  ? 19.116 1.712   -2.418  0.49 25.16 ? 77  GLU A CG  1 
ATOM   1237 C CD  A GLU A 1 78  ? 20.062 1.625   -3.612  0.50 35.99 ? 77  GLU A CD  1 
ATOM   1238 C CD  B GLU A 1 78  ? 20.089 1.691   -3.565  0.50 38.94 ? 77  GLU A CD  1 
ATOM   1239 O OE1 A GLU A 1 78  ? 21.209 1.290   -3.484  0.49 40.24 ? 77  GLU A OE1 1 
ATOM   1240 O OE1 B GLU A 1 78  ? 21.237 1.352   -3.437  0.49 42.02 ? 77  GLU A OE1 1 
ATOM   1241 O OE2 A GLU A 1 78  ? 19.553 1.969   -4.768  0.43 49.78 ? 77  GLU A OE2 1 
ATOM   1242 O OE2 B GLU A 1 78  ? 19.573 2.010   -4.724  0.43 49.41 ? 77  GLU A OE2 1 
ATOM   1243 N N   A LEU A 1 79  ? 17.021 -1.645  0.028   0.51 9.67  ? 78  LEU A N   1 
ATOM   1244 N N   B LEU A 1 79  ? 17.028 -1.645  0.025   0.49 9.69  ? 78  LEU A N   1 
ATOM   1245 C CA  A LEU A 1 79  ? 16.685 -3.018  0.335   0.49 7.70  ? 78  LEU A CA  1 
ATOM   1246 C CA  B LEU A 1 79  ? 16.700 -3.018  0.329   0.49 7.68  ? 78  LEU A CA  1 
ATOM   1247 C C   A LEU A 1 79  ? 15.892 -3.630  -0.846  0.51 8.08  ? 78  LEU A C   1 
ATOM   1248 C C   B LEU A 1 79  ? 15.910 -3.604  -0.855  0.49 8.17  ? 78  LEU A C   1 
ATOM   1249 O O   A LEU A 1 79  ? 15.318 -2.900  -1.676  0.48 9.60  ? 78  LEU A O   1 
ATOM   1250 O O   B LEU A 1 79  ? 15.285 -2.879  -1.645  0.48 9.53  ? 78  LEU A O   1 
ATOM   1251 C CB  A LEU A 1 79  ? 15.686 -3.059  1.532   0.51 9.31  ? 78  LEU A CB  1 
ATOM   1252 C CB  B LEU A 1 79  ? 15.694 -3.064  1.526   0.49 9.32  ? 78  LEU A CB  1 
ATOM   1253 C CG  A LEU A 1 79  ? 16.125 -2.319  2.794   0.51 12.30 ? 78  LEU A CG  1 
ATOM   1254 C CG  B LEU A 1 79  ? 16.125 -2.319  2.791   0.49 12.26 ? 78  LEU A CG  1 
ATOM   1255 C CD1 A LEU A 1 79  ? 15.033 -2.380  3.853   0.53 14.26 ? 78  LEU A CD1 1 
ATOM   1256 C CD1 B LEU A 1 79  ? 15.033 -2.380  3.850   0.47 14.27 ? 78  LEU A CD1 1 
ATOM   1257 C CD2 A LEU A 1 79  ? 17.357 -2.987  3.380   0.50 13.81 ? 78  LEU A CD2 1 
ATOM   1258 C CD2 B LEU A 1 79  ? 17.357 -2.987  3.380   0.50 13.82 ? 78  LEU A CD2 1 
ATOM   1259 N N   A THR A 1 80  ? 15.832 -4.926  -0.855  0.56 10.91 ? 79  THR A N   1 
ATOM   1260 N N   B THR A 1 80  ? 15.909 -4.879  -0.955  0.44 8.88  ? 79  THR A N   1 
ATOM   1261 C CA  A THR A 1 80  ? 14.989 -5.682  -1.792  0.51 9.37  ? 79  THR A CA  1 
ATOM   1262 C CA  B THR A 1 80  ? 15.010 -5.491  -1.911  0.49 8.74  ? 79  THR A CA  1 
ATOM   1263 C C   A THR A 1 80  ? 14.440 -6.910  -1.053  0.50 8.00  ? 79  THR A C   1 
ATOM   1264 C C   B THR A 1 80  ? 14.330 -6.530  -1.049  0.50 8.54  ? 79  THR A C   1 
ATOM   1265 O O   A THR A 1 80  ? 15.107 -7.532  -0.213  0.51 9.86  ? 79  THR A O   1 
ATOM   1266 O O   B THR A 1 80  ? 14.955 -7.085  -0.150  0.49 9.36  ? 79  THR A O   1 
ATOM   1267 C CB  A THR A 1 80  ? 15.628 -6.196  -3.101  0.48 12.20 ? 79  THR A CB  1 
ATOM   1268 C CB  B THR A 1 80  ? 15.629 -6.185  -3.142  0.48 11.94 ? 79  THR A CB  1 
ATOM   1269 O OG1 A THR A 1 80  ? 16.666 -7.070  -2.747  0.47 16.39 ? 79  THR A OG1 1 
ATOM   1270 O OG1 B THR A 1 80  ? 16.655 -7.065  -2.729  0.47 16.31 ? 79  THR A OG1 1 
ATOM   1271 C CG2 A THR A 1 80  ? 16.083 -5.090  -4.057  0.44 19.51 ? 79  THR A CG2 1 
ATOM   1272 C CG2 B THR A 1 80  ? 16.124 -5.137  -4.126  0.44 19.62 ? 79  THR A CG2 1 
ATOM   1273 N N   A GLY A 1 81  ? 13.234 -7.311  -1.419  0.51 7.45  ? 80  GLY A N   1 
ATOM   1274 N N   B GLY A 1 81  ? 13.075 -6.802  -1.316  0.49 6.05  ? 80  GLY A N   1 
ATOM   1275 C CA  A GLY A 1 81  ? 12.606 -8.463  -0.811  0.55 7.23  ? 80  GLY A CA  1 
ATOM   1276 C CA  B GLY A 1 81  ? 12.456 -7.810  -0.482  0.45 7.91  ? 80  GLY A CA  1 
ATOM   1277 C C   A GLY A 1 81  ? 11.088 -8.329  -0.908  0.50 7.90  ? 80  GLY A C   1 
ATOM   1278 C C   B GLY A 1 81  ? 11.008 -8.093  -0.849  0.50 7.40  ? 80  GLY A C   1 
ATOM   1279 O O   A GLY A 1 81  ? 10.565 -7.512  -1.657  0.51 7.90  ? 80  GLY A O   1 
ATOM   1280 O O   B GLY A 1 81  ? 10.543 -7.769  -1.927  0.49 7.91  ? 80  GLY A O   1 
ATOM   1281 N N   A THR A 1 82  ? 10.418 -9.095  -0.066  0.52 7.91  ? 81  THR A N   1 
ATOM   1282 N N   B THR A 1 82  ? 10.346 -8.715  0.110   0.48 7.00  ? 81  THR A N   1 
ATOM   1283 C CA  A THR A 1 82  ? 8.965  -9.111  -0.081  0.51 8.08  ? 81  THR A CA  1 
ATOM   1284 C CA  B THR A 1 82  ? 8.980  -9.111  -0.110  0.49 7.90  ? 81  THR A CA  1 
ATOM   1285 C C   A THR A 1 82  ? 8.269  -8.905  1.256   0.50 7.19  ? 81  THR A C   1 
ATOM   1286 C C   B THR A 1 82  ? 8.231  -9.178  1.194   0.49 8.36  ? 81  THR A C   1 
ATOM   1287 O O   A THR A 1 82  ? 8.794  -9.090  2.343   0.48 8.84  ? 81  THR A O   1 
ATOM   1288 O O   B THR A 1 82  ? 8.721  -9.779  2.140   0.48 7.97  ? 81  THR A O   1 
ATOM   1289 C CB  A THR A 1 82  ? 8.533  -10.561 -0.470  0.53 12.36 ? 81  THR A CB  1 
ATOM   1290 C CB  B THR A 1 82  ? 8.901  -10.571 -0.648  0.47 10.86 ? 81  THR A CB  1 
ATOM   1291 O OG1 A THR A 1 82  ? 9.051  -11.497 0.464   0.47 10.28 ? 81  THR A OG1 1 
ATOM   1292 O OG1 B THR A 1 82  ? 9.682  -10.772 -1.820  0.51 10.23 ? 81  THR A OG1 1 
ATOM   1293 C CG2 A THR A 1 82  ? 8.950  -10.936 -1.886  0.54 12.15 ? 81  THR A CG2 1 
ATOM   1294 C CG2 B THR A 1 82  ? 7.437  -10.952 -0.811  0.46 10.83 ? 81  THR A CG2 1 
ATOM   1295 N N   A TRP A 1 83  ? 6.993  -8.648  1.122   0.50 8.20  ? 82  TRP A N   1 
ATOM   1296 N N   B TRP A 1 83  ? 7.038  -8.617  1.169   0.50 8.06  ? 82  TRP A N   1 
ATOM   1297 C CA  A TRP A 1 83  ? 6.082  -8.664  2.243   0.51 9.13  ? 82  TRP A CA  1 
ATOM   1298 C CA  B TRP A 1 83  ? 6.127  -8.725  2.290   0.49 9.10  ? 82  TRP A CA  1 
ATOM   1299 C C   A TRP A 1 83  ? 5.109  -9.820  1.955   0.48 9.64  ? 82  TRP A C   1 
ATOM   1300 C C   B TRP A 1 83  ? 5.130  -9.851  1.964   0.48 9.49  ? 82  TRP A C   1 
ATOM   1301 O O   A TRP A 1 83  ? 4.628  -9.975  0.811   0.50 10.73 ? 82  TRP A O   1 
ATOM   1302 O O   B TRP A 1 83  ? 4.617  -9.944  0.824   0.50 10.73 ? 82  TRP A O   1 
ATOM   1303 C CB  A TRP A 1 83  ? 5.223  -7.399  2.390   0.52 9.94  ? 82  TRP A CB  1 
ATOM   1304 C CB  B TRP A 1 83  ? 5.258  -7.460  2.431   0.48 10.23 ? 82  TRP A CB  1 
ATOM   1305 C CG  A TRP A 1 83  ? 5.914  -6.211  2.957   0.49 9.61  ? 82  TRP A CG  1 
ATOM   1306 C CG  B TRP A 1 83  ? 5.935  -6.242  2.967   0.49 9.54  ? 82  TRP A CG  1 
ATOM   1307 C CD1 A TRP A 1 83  ? 6.378  -5.157  2.240   0.54 10.22 ? 82  TRP A CD1 1 
ATOM   1308 C CD1 B TRP A 1 83  ? 6.381  -5.183  2.240   0.46 10.33 ? 82  TRP A CD1 1 
ATOM   1309 C CD2 A TRP A 1 83  ? 6.179  -5.944  4.323   0.49 7.87  ? 82  TRP A CD2 1 
ATOM   1310 C CD2 B TRP A 1 83  ? 6.190  -5.954  4.326   0.49 7.79  ? 82  TRP A CD2 1 
ATOM   1311 N NE1 A TRP A 1 83  ? 6.926  -4.242  3.086   0.51 9.99  ? 82  TRP A NE1 1 
ATOM   1312 N NE1 B TRP A 1 83  ? 6.923  -4.252  3.079   0.49 9.99  ? 82  TRP A NE1 1 
ATOM   1313 C CE2 A TRP A 1 83  ? 6.805  -4.674  4.373   0.48 7.91  ? 82  TRP A CE2 1 
ATOM   1314 C CE2 B TRP A 1 83  ? 6.802  -4.679  4.370   0.48 7.91  ? 82  TRP A CE2 1 
ATOM   1315 C CE3 A TRP A 1 83  ? 5.967  -6.617  5.529   0.48 10.31 ? 82  TRP A CE3 1 
ATOM   1316 C CE3 B TRP A 1 83  ? 5.982  -6.627  5.532   0.48 10.20 ? 82  TRP A CE3 1 
ATOM   1317 C CZ2 A TRP A 1 83  ? 7.231  -4.103  5.567   0.54 11.50 ? 82  TRP A CZ2 1 
ATOM   1318 C CZ2 B TRP A 1 83  ? 7.217  -4.098  5.564   0.46 11.50 ? 82  TRP A CZ2 1 
ATOM   1319 C CZ3 A TRP A 1 83  ? 6.355  -6.026  6.713   0.52 10.74 ? 82  TRP A CZ3 1 
ATOM   1320 C CZ3 B TRP A 1 83  ? 6.358  -6.026  6.713   0.48 10.74 ? 82  TRP A CZ3 1 
ATOM   1321 C CH2 A TRP A 1 83  ? 6.985  -4.782  6.723   0.56 10.39 ? 82  TRP A CH2 1 
ATOM   1322 C CH2 B TRP A 1 83  ? 6.974  -4.776  6.723   0.44 10.39 ? 82  TRP A CH2 1 
ATOM   1323 N N   A THR A 1 84  ? 4.788  -10.597 2.982   0.51 8.95  ? 83  THR A N   1 
ATOM   1324 N N   B THR A 1 84  ? 4.813  -10.638 2.979   0.49 8.86  ? 83  THR A N   1 
ATOM   1325 C CA  A THR A 1 84  ? 3.800  -11.666 2.873   0.53 9.19  ? 83  THR A CA  1 
ATOM   1326 C CA  B THR A 1 84  ? 3.807  -11.687 2.876   0.47 9.27  ? 83  THR A CA  1 
ATOM   1327 C C   A THR A 1 84  ? 2.914  -11.599 4.101   0.49 12.81 ? 83  THR A C   1 
ATOM   1328 C C   B THR A 1 84  ? 2.918  -11.594 4.101   0.49 12.62 ? 83  THR A C   1 
ATOM   1329 O O   A THR A 1 84  ? 3.270  -11.044 5.125   0.48 13.14 ? 83  THR A O   1 
ATOM   1330 O O   B THR A 1 84  ? 3.249  -10.987 5.103   0.48 13.08 ? 83  THR A O   1 
ATOM   1331 C CB  A THR A 1 84  ? 4.394  -13.085 2.776   0.55 15.52 ? 83  THR A CB  1 
ATOM   1332 C CB  B THR A 1 84  ? 4.394  -13.106 2.776   0.45 15.52 ? 83  THR A CB  1 
ATOM   1333 O OG1 A THR A 1 84  ? 5.247  -13.265 3.866   0.47 20.30 ? 83  THR A OG1 1 
ATOM   1334 O OG1 B THR A 1 84  ? 5.250  -13.270 3.866   0.47 20.32 ? 83  THR A OG1 1 
ATOM   1335 C CG2 A THR A 1 84  ? 5.206  -13.291 1.494   0.55 16.30 ? 83  THR A CG2 1 
ATOM   1336 C CG2 B THR A 1 84  ? 5.206  -13.296 1.494   0.45 16.25 ? 83  THR A CG2 1 
ATOM   1337 N N   A MET A 1 85  ? 1.733  -12.180 4.035   0.47 11.28 ? 84  MET A N   1 
ATOM   1338 N N   B MET A 1 85  ? 1.758  -12.216 4.047   0.47 11.50 ? 84  MET A N   1 
ATOM   1339 C CA  A MET A 1 85  ? 0.842  -12.180 5.194   0.54 11.39 ? 84  MET A CA  1 
ATOM   1340 C CA  B MET A 1 85  ? 0.842  -12.191 5.188   0.46 11.78 ? 84  MET A CA  1 
ATOM   1341 C C   A MET A 1 85  ? 0.969  -13.543 5.833   0.51 17.03 ? 84  MET A C   1 
ATOM   1342 C C   B MET A 1 85  ? 0.906  -13.558 5.789   0.49 17.84 ? 84  MET A C   1 
ATOM   1343 O O   A MET A 1 85  ? 0.689  -14.545 5.185   0.47 20.04 ? 84  MET A O   1 
ATOM   1344 O O   B MET A 1 85  ? 0.663  -14.545 5.103   0.47 19.64 ? 84  MET A O   1 
ATOM   1345 C CB  A MET A 1 85  ? -0.565 -11.949 4.630   0.53 19.18 ? 84  MET A CB  1 
ATOM   1346 C CB  B MET A 1 85  ? -0.544 -11.903 4.621   0.47 18.57 ? 84  MET A CB  1 
ATOM   1347 C CG  A MET A 1 85  ? -1.673 -11.599 5.614   0.54 29.90 ? 84  MET A CG  1 
ATOM   1348 C CG  B MET A 1 85  ? -1.648 -11.599 5.617   0.46 31.31 ? 84  MET A CG  1 
ATOM   1349 S SD  A MET A 1 85  ? -1.431 -10.021 6.466   0.48 31.07 ? 84  MET A SD  1 
ATOM   1350 S SD  B MET A 1 85  ? -1.438 -10.021 6.475   0.48 30.98 ? 84  MET A SD  1 
ATOM   1351 C CE  A MET A 1 85  ? -2.351 -8.905  5.391   0.57 35.50 ? 84  MET A CE  1 
ATOM   1352 C CE  B MET A 1 85  ? -2.351 -8.905  5.391   0.43 35.64 ? 84  MET A CE  1 
ATOM   1353 N N   A GLU A 1 86  ? 1.451  -13.604 7.064   0.50 19.85 ? 85  GLU A N   1 
ATOM   1354 N N   B GLU A 1 86  ? 1.277  -13.635 7.042   0.50 16.67 ? 85  GLU A N   1 
ATOM   1355 C CA  A GLU A 1 86  ? 1.622  -14.859 7.779   0.51 24.99 ? 85  GLU A CA  1 
ATOM   1356 C CA  B GLU A 1 86  ? 1.420  -14.905 7.700   0.49 16.65 ? 85  GLU A CA  1 
ATOM   1357 C C   A GLU A 1 86  ? 0.670  -14.854 8.931   0.48 30.29 ? 85  GLU A C   1 
ATOM   1358 C C   B GLU A 1 86  ? 0.704  -14.874 8.988   0.47 29.20 ? 85  GLU A C   1 
ATOM   1359 O O   A GLU A 1 86  ? 0.947  -14.237 9.962   0.47 25.73 ? 85  GLU A O   1 
ATOM   1360 O O   B GLU A 1 86  ? 1.190  -14.299 9.950   0.46 25.36 ? 85  GLU A O   1 
ATOM   1361 C CB  A GLU A 1 86  ? 3.059  -15.018 8.286   0.58 35.38 ? 85  GLU A CB  1 
ATOM   1362 C CB  B GLU A 1 86  ? 2.886  -15.096 8.082   0.42 39.49 ? 85  GLU A CB  1 
ATOM   1363 C CG  A GLU A 1 86  ? 3.829  -16.000 7.390   0.25 89.48 ? 85  GLU A CG  1 
ATOM   1364 C CG  B GLU A 1 86  ? 3.611  -15.892 6.989   0.21 84.29 ? 85  GLU A CG  1 
ATOM   1365 C CD  A GLU A 1 86  ? 5.188  -15.574 6.923   0.40 91.19 ? 85  GLU A CD  1 
ATOM   1366 C CD  B GLU A 1 86  ? 5.063  -15.610 6.760   0.41 88.71 ? 85  GLU A CD  1 
ATOM   1367 O OE1 A GLU A 1 86  ? 6.156  -15.548 7.650   0.34 73.90 ? 85  GLU A OE1 1 
ATOM   1368 O OE1 B GLU A 1 86  ? 5.900  -15.589 7.641   0.37 65.42 ? 85  GLU A OE1 1 
ATOM   1369 O OE2 A GLU A 1 86  ? 5.238  -15.286 5.642   0.33 90.96 ? 85  GLU A OE2 1 
ATOM   1370 O OE2 B GLU A 1 86  ? 5.338  -15.440 5.492   0.40 70.51 ? 85  GLU A OE2 1 
ATOM   1371 N N   A GLY A 1 87  ? -0.465 -15.502 8.728   0.52 41.04 ? 86  GLY A N   1 
ATOM   1372 N N   B GLY A 1 87  ? -0.444 -15.471 9.013   0.48 43.25 ? 86  GLY A N   1 
ATOM   1373 C CA  A GLY A 1 87  ? -1.491 -15.502 9.733   0.57 44.95 ? 86  GLY A CA  1 
ATOM   1374 C CA  B GLY A 1 87  ? -1.102 -15.425 10.266  0.43 41.93 ? 86  GLY A CA  1 
ATOM   1375 C C   A GLY A 1 87  ? -2.048 -14.108 9.630   0.56 21.28 ? 86  GLY A C   1 
ATOM   1376 C C   B GLY A 1 87  ? -1.502 -14.031 10.717  0.44 23.02 ? 86  GLY A C   1 
ATOM   1377 O O   A GLY A 1 87  ? -2.416 -13.697 8.543   0.52 21.26 ? 86  GLY A O   1 
ATOM   1378 O O   B GLY A 1 87  ? -1.317 -13.671 11.870  0.48 22.72 ? 86  GLY A O   1 
ATOM   1379 N N   A ASN A 1 88  ? -2.047 -13.383 10.742  0.48 18.37 ? 87  ASN A N   1 
ATOM   1380 N N   B ASN A 1 88  ? -2.088 -13.280 9.793   0.45 30.45 ? 87  ASN A N   1 
ATOM   1381 C CA  A ASN A 1 88  ? -2.505 -12.031 10.673  0.50 15.55 ? 87  ASN A CA  1 
ATOM   1382 C CA  B ASN A 1 88  ? -2.600 -11.944 10.069  0.38 29.53 ? 87  ASN A CA  1 
ATOM   1383 C C   A ASN A 1 88  ? -1.385 -11.008 10.748  0.47 16.09 ? 87  ASN A C   1 
ATOM   1384 C C   B ASN A 1 88  ? -1.625 -10.828 10.379  0.45 25.54 ? 87  ASN A C   1 
ATOM   1385 O O   A ASN A 1 88  ? -1.605 -9.836  11.002  0.49 19.36 ? 87  ASN A O   1 
ATOM   1386 O O   B ASN A 1 88  ? -2.028 -9.702  10.683  0.49 21.02 ? 87  ASN A O   1 
ATOM   1387 C CB  A ASN A 1 88  ? -3.782 -11.717 11.431  0.59 32.57 ? 87  ASN A CB  1 
ATOM   1388 C CB  B ASN A 1 88  ? -3.806 -11.969 10.990  0.41 55.09 ? 87  ASN A CB  1 
ATOM   1389 C CG  A ASN A 1 88  ? -4.931 -12.329 10.661  0.30 87.23 ? 87  ASN A CG  1 
ATOM   1390 C CG  B ASN A 1 88  ? -4.957 -12.658 10.291  0.25 88.89 ? 87  ASN A CG  1 
ATOM   1391 O OD1 A ASN A 1 88  ? -4.777 -12.705 9.483   0.25 81.89 ? 87  ASN A OD1 1 
ATOM   1392 O OD1 B ASN A 1 88  ? -4.867 -13.023 9.104   0.31 78.68 ? 87  ASN A OD1 1 
ATOM   1393 N ND2 A ASN A 1 88  ? -6.073 -12.453 11.315  0.27 83.58 ? 87  ASN A ND2 1 
ATOM   1394 N ND2 B ASN A 1 88  ? -6.037 -12.838 11.027  0.25 87.45 ? 87  ASN A ND2 1 
ATOM   1395 N N   A LYS A 1 89  ? -0.156 -11.429 10.498  0.52 12.14 ? 88  LYS A N   1 
ATOM   1396 N N   B LYS A 1 89  ? -0.358 -11.172 10.275  0.48 14.95 ? 88  LYS A N   1 
ATOM   1397 C CA  A LYS A 1 89  ? 0.880  -10.427 10.526  0.52 16.48 ? 88  LYS A CA  1 
ATOM   1398 C CA  B LYS A 1 89  ? 0.749  -10.278 10.488  0.48 15.45 ? 88  LYS A CA  1 
ATOM   1399 C C   A LYS A 1 89  ? 1.474  -10.226 9.141   0.51 12.89 ? 88  LYS A C   1 
ATOM   1400 C C   B LYS A 1 89  ? 1.367  -10.088 9.113   0.49 12.93 ? 88  LYS A C   1 
ATOM   1401 O O   A LYS A 1 89  ? 1.461  -11.152 8.352   0.51 16.12 ? 88  LYS A O   1 
ATOM   1402 O O   B LYS A 1 89  ? 1.263  -10.982 8.292   0.49 15.88 ? 88  LYS A O   1 
ATOM   1403 C CB  A LYS A 1 89  ? 2.070  -10.843 11.340  0.50 21.38 ? 88  LYS A CB  1 
ATOM   1404 C CB  B LYS A 1 89  ? 1.888  -10.977 11.218  0.50 19.20 ? 88  LYS A CB  1 
ATOM   1405 C CG  A LYS A 1 89  ? 1.795  -11.543 12.644  0.46 21.33 ? 88  LYS A CG  1 
ATOM   1406 C CG  B LYS A 1 89  ? 1.742  -11.465 12.650  0.46 20.47 ? 88  LYS A CG  1 
ATOM   1407 C CD  A LYS A 1 89  ? 3.082  -12.124 13.179  0.52 21.75 ? 88  LYS A CD  1 
ATOM   1408 C CD  B LYS A 1 89  ? 3.037  -12.093 13.157  0.48 22.13 ? 88  LYS A CD  1 
ATOM   1409 C CE  A LYS A 1 89  ? 2.947  -12.612 14.605  0.55 42.45 ? 88  LYS A CE  1 
ATOM   1410 C CE  B LYS A 1 89  ? 2.940  -12.612 14.586  0.45 43.09 ? 88  LYS A CE  1 
ATOM   1411 N NZ  A LYS A 1 89  ? 4.108  -13.378 15.046  0.49 39.07 ? 88  LYS A NZ  1 
ATOM   1412 N NZ  B LYS A 1 89  ? 4.105  -13.373 15.031  0.49 38.59 ? 88  LYS A NZ  1 
ATOM   1413 N N   A LEU A 1 90  ? 2.053  -9.054  8.913   0.52 9.67  ? 89  LEU A N   1 
ATOM   1414 N N   B LEU A 1 90  ? 2.056  -8.977  8.916   0.48 9.81  ? 89  LEU A N   1 
ATOM   1415 C CA  A LEU A 1 90  ? 2.765  -8.746  7.666   0.51 8.87  ? 89  LEU A CA  1 
ATOM   1416 C CA  B LEU A 1 90  ? 2.779  -8.720  7.666   0.49 8.80  ? 89  LEU A CA  1 
ATOM   1417 C C   A LEU A 1 90  ? 4.231  -9.018  7.982   0.48 10.42 ? 89  LEU A C   1 
ATOM   1418 C C   B LEU A 1 90  ? 4.242  -9.003  7.982   0.48 10.52 ? 89  LEU A C   1 
ATOM   1419 O O   A LEU A 1 90  ? 4.770  -8.458  8.938   0.47 10.60 ? 89  LEU A O   1 
ATOM   1420 O O   B LEU A 1 90  ? 4.785  -8.422  8.922   0.47 10.68 ? 89  LEU A O   1 
ATOM   1421 C CB  A LEU A 1 90  ? 2.586  -7.275  7.246   0.48 13.05 ? 89  LEU A CB  1 
ATOM   1422 C CB  B LEU A 1 90  ? 2.605  -7.265  7.227   0.48 13.21 ? 89  LEU A CB  1 
ATOM   1423 C CG  A LEU A 1 90  ? 1.320  -6.967  6.444   0.48 12.75 ? 89  LEU A CG  1 
ATOM   1424 C CG  B LEU A 1 90  ? 1.324  -6.972  6.444   0.48 12.81 ? 89  LEU A CG  1 
ATOM   1425 C CD1 A LEU A 1 90  ? 1.237  -5.470  6.203   0.51 16.60 ? 89  LEU A CD1 1 
ATOM   1426 C CD1 B LEU A 1 90  ? 1.234  -5.476  6.206   0.49 16.57 ? 89  LEU A CD1 1 
ATOM   1427 C CD2 A LEU A 1 90  ? 1.404  -7.645  5.078   0.50 17.85 ? 89  LEU A CD2 1 
ATOM   1428 C CD2 B LEU A 1 90  ? 1.401  -7.645  5.078   0.50 17.84 ? 89  LEU A CD2 1 
ATOM   1429 N N   A VAL A 1 91  ? 4.873  -9.913  7.246   0.52 8.86  ? 90  VAL A N   1 
ATOM   1430 N N   B VAL A 1 91  ? 4.873  -9.913  7.255   0.48 8.85  ? 90  VAL A N   1 
ATOM   1431 C CA  A VAL A 1 91  ? 6.243  -10.309 7.468   0.54 9.10  ? 90  VAL A CA  1 
ATOM   1432 C CA  B VAL A 1 91  ? 6.243  -10.314 7.472   0.46 9.08  ? 90  VAL A CA  1 
ATOM   1433 C C   A VAL A 1 91  ? 7.068  -9.877  6.256   0.47 9.67  ? 90  VAL A C   1 
ATOM   1434 C C   B VAL A 1 91  ? 7.071  -9.887  6.262   0.47 9.65  ? 90  VAL A C   1 
ATOM   1435 O O   A VAL A 1 91  ? 6.750  -10.273 5.128   0.51 10.51 ? 90  VAL A O   1 
ATOM   1436 O O   B VAL A 1 91  ? 6.750  -10.273 5.131   0.49 10.51 ? 90  VAL A O   1 
ATOM   1437 C CB  A VAL A 1 91  ? 6.312  -11.831 7.688   0.56 14.63 ? 90  VAL A CB  1 
ATOM   1438 C CB  B VAL A 1 91  ? 6.312  -11.831 7.691   0.44 14.64 ? 90  VAL A CB  1 
ATOM   1439 C CG1 A VAL A 1 91  ? 7.729  -12.324 7.854   0.57 17.96 ? 90  VAL A CG1 1 
ATOM   1440 C CG1 B VAL A 1 91  ? 7.729  -12.324 7.857   0.43 17.96 ? 90  VAL A CG1 1 
ATOM   1441 C CG2 A VAL A 1 91  ? 5.561  -12.190 8.963   0.54 17.90 ? 90  VAL A CG2 1 
ATOM   1442 C CG2 B VAL A 1 91  ? 5.564  -12.190 8.963   0.46 17.91 ? 90  VAL A CG2 1 
ATOM   1443 N N   A GLY A 1 92  ? 8.074  -9.018  6.478   0.53 8.40  ? 91  GLY A N   1 
ATOM   1444 N N   B GLY A 1 92  ? 8.088  -9.049  6.482   0.47 8.46  ? 91  GLY A N   1 
ATOM   1445 C CA  A GLY A 1 92  ? 8.898  -8.530  5.420   0.54 9.63  ? 91  GLY A CA  1 
ATOM   1446 C CA  B GLY A 1 92  ? 8.909  -8.581  5.410   0.46 9.95  ? 91  GLY A CA  1 
ATOM   1447 C C   A GLY A 1 92  ? 10.268 -9.183  5.495   0.52 12.60 ? 91  GLY A C   1 
ATOM   1448 C C   B GLY A 1 92  ? 10.290 -9.208  5.492   0.48 12.59 ? 91  GLY A C   1 
ATOM   1449 O O   A GLY A 1 92  ? 10.955 -9.126  6.519   0.51 12.44 ? 91  GLY A O   1 
ATOM   1450 O O   B GLY A 1 92  ? 10.980 -9.095  6.513   0.49 12.39 ? 91  GLY A O   1 
ATOM   1451 N N   A LYS A 1 93  ? 10.662 -9.815  4.414   0.54 8.77  ? 92  LYS A N   1 
ATOM   1452 N N   B LYS A 1 93  ? 10.687 -9.867  4.423   0.46 8.89  ? 92  LYS A N   1 
ATOM   1453 C CA  A LYS A 1 93  ? 11.963 -10.453 4.392   0.52 8.71  ? 92  LYS A CA  1 
ATOM   1454 C CA  B LYS A 1 93  ? 12.003 -10.478 4.342   0.48 8.69  ? 92  LYS A CA  1 
ATOM   1455 C C   A LYS A 1 93  ? 12.770 -9.743  3.321   0.52 7.08  ? 92  LYS A C   1 
ATOM   1456 C C   B LYS A 1 93  ? 12.766 -9.604  3.333   0.48 7.13  ? 92  LYS A C   1 
ATOM   1457 O O   A LYS A 1 93  ? 12.557 -9.975  2.152   0.53 7.71  ? 92  LYS A O   1 
ATOM   1458 O O   B LYS A 1 93  ? 12.403 -9.491  2.187   0.47 7.36  ? 92  LYS A O   1 
ATOM   1459 C CB  A LYS A 1 93  ? 11.887 -11.918 4.007   0.53 12.67 ? 92  LYS A CB  1 
ATOM   1460 C CB  B LYS A 1 93  ? 11.914 -11.944 3.938   0.47 12.52 ? 92  LYS A CB  1 
ATOM   1461 C CG  A LYS A 1 93  ? 11.082 -12.746 4.990   0.49 17.57 ? 92  LYS A CG  1 
ATOM   1462 C CG  B LYS A 1 93  ? 11.105 -12.746 4.947   0.49 17.50 ? 92  LYS A CG  1 
ATOM   1463 C CD  A LYS A 1 93  ? 10.644 -14.067 4.408   0.43 32.13 ? 92  LYS A CD  1 
ATOM   1464 C CD  B LYS A 1 93  ? 10.644 -14.078 4.405   0.43 32.22 ? 92  LYS A CD  1 
ATOM   1465 C CE  A LYS A 1 93  ? 9.471  -14.617 5.175   0.45 35.33 ? 92  LYS A CE  1 
ATOM   1466 C CE  B LYS A 1 93  ? 9.467  -14.612 5.182   0.45 34.46 ? 92  LYS A CE  1 
ATOM   1467 N NZ  A LYS A 1 93  ? 9.921  -15.512 6.244   0.45 45.84 ? 92  LYS A NZ  1 
ATOM   1468 N NZ  B LYS A 1 93  ? 9.921  -15.512 6.247   0.45 45.96 ? 92  LYS A NZ  1 
ATOM   1469 N N   A PHE A 1 94  ? 13.670 -8.890  3.803   0.51 7.57  ? 93  PHE A N   1 
ATOM   1470 N N   B PHE A 1 94  ? 13.779 -8.900  3.844   0.49 7.42  ? 93  PHE A N   1 
ATOM   1471 C CA  A PHE A 1 94  ? 14.542 -8.088  2.979   0.52 8.24  ? 93  PHE A CA  1 
ATOM   1472 C CA  B PHE A 1 94  ? 14.541 -7.959  3.029   0.48 7.67  ? 93  PHE A CA  1 
ATOM   1473 C C   A PHE A 1 94  ? 15.999 -8.494  3.142   0.51 7.27  ? 93  PHE A C   1 
ATOM   1474 C C   B PHE A 1 94  ? 16.018 -8.221  3.083   0.49 9.26  ? 93  PHE A C   1 
ATOM   1475 O O   A PHE A 1 94  ? 16.397 -9.255  4.035   0.52 7.40  ? 93  PHE A O   1 
ATOM   1476 O O   B PHE A 1 94  ? 16.493 -8.807  4.038   0.48 8.06  ? 93  PHE A O   1 
ATOM   1477 C CB  A PHE A 1 94  ? 14.415 -6.602  3.368   0.52 8.75  ? 93  PHE A CB  1 
ATOM   1478 C CB  B PHE A 1 94  ? 14.308 -6.525  3.518   0.48 9.36  ? 93  PHE A CB  1 
ATOM   1479 C CG  A PHE A 1 94  ? 13.000 -6.057  3.374   0.50 9.44  ? 93  PHE A CG  1 
ATOM   1480 C CG  B PHE A 1 94  ? 12.921 -6.113  3.145   0.50 8.07  ? 93  PHE A CG  1 
ATOM   1481 C CD1 A PHE A 1 94  ? 12.178 -6.180  4.483   0.52 9.01  ? 93  PHE A CD1 1 
ATOM   1482 C CD1 B PHE A 1 94  ? 12.626 -5.764  1.823   0.48 9.09  ? 93  PHE A CD1 1 
ATOM   1483 C CD2 A PHE A 1 94  ? 12.534 -5.388  2.240   0.54 11.94 ? 93  PHE A CD2 1 
ATOM   1484 C CD2 B PHE A 1 94  ? 11.920 -6.154  4.107   0.46 11.17 ? 93  PHE A CD2 1 
ATOM   1485 C CE1 A PHE A 1 94  ? 10.874 -5.681  4.477   0.51 13.75 ? 93  PHE A CE1 1 
ATOM   1486 C CE1 B PHE A 1 94  ? 11.316 -5.445  1.497   0.49 13.55 ? 93  PHE A CE1 1 
ATOM   1487 C CE2 A PHE A 1 94  ? 11.248 -4.900  2.212   0.49 15.01 ? 93  PHE A CE2 1 
ATOM   1488 C CE2 B PHE A 1 94  ? 10.603 -5.851  3.781   0.51 11.42 ? 93  PHE A CE2 1 
ATOM   1489 C CZ  A PHE A 1 94  ? 10.401 -5.075  3.321   0.54 7.78  ? 93  PHE A CZ  1 
ATOM   1490 C CZ  B PHE A 1 94  ? 10.326 -5.501  2.475   0.46 7.85  ? 93  PHE A CZ  1 
ATOM   1491 N N   A LYS A 1 95  ? 16.745 -7.867  2.234   0.54 8.62  ? 94  LYS A N   1 
ATOM   1492 N N   B LYS A 1 95  ? 16.699 -7.723  2.061   0.46 9.38  ? 94  LYS A N   1 
ATOM   1493 C CA  A LYS A 1 95  ? 18.183 -7.892  2.127   0.55 8.32  ? 94  LYS A CA  1 
ATOM   1494 C CA  B LYS A 1 95  ? 18.135 -7.825  2.049   0.45 9.24  ? 94  LYS A CA  1 
ATOM   1495 C C   A LYS A 1 95  ? 18.680 -6.540  1.751   0.56 10.15 ? 94  LYS A C   1 
ATOM   1496 C C   B LYS A 1 95  ? 18.685 -6.494  1.723   0.44 10.56 ? 94  LYS A C   1 
ATOM   1497 O O   A LYS A 1 95  ? 18.115 -5.892  0.877   0.53 10.88 ? 94  LYS A O   1 
ATOM   1498 O O   B LYS A 1 95  ? 18.136 -5.810  0.871   0.47 10.90 ? 94  LYS A O   1 
ATOM   1499 C CB  A LYS A 1 95  ? 18.638 -8.833  1.024   0.60 18.26 ? 94  LYS A CB  1 
ATOM   1500 C CB  B LYS A 1 95  ? 18.628 -8.813  1.009   0.40 18.28 ? 94  LYS A CB  1 
ATOM   1501 C CG  A LYS A 1 95  ? 18.728 -10.108 1.826   0.46 36.62 ? 94  LYS A CG  1 
ATOM   1502 C CG  B LYS A 1 95  ? 18.728 -10.077 1.826   0.46 37.38 ? 94  LYS A CG  1 
ATOM   1503 C CD  A LYS A 1 95  ? 19.286 -11.337 1.162   0.43 48.61 ? 94  LYS A CD  1 
ATOM   1504 C CD  B LYS A 1 95  ? 19.279 -11.322 1.175   0.43 48.54 ? 94  LYS A CD  1 
ATOM   1505 C CE  A LYS A 1 95  ? 19.167 -11.332 -0.338  0.45 47.32 ? 94  LYS A CE  1 
ATOM   1506 C CE  B LYS A 1 95  ? 19.174 -11.332 -0.329  0.45 47.26 ? 94  LYS A CE  1 
ATOM   1507 N NZ  A LYS A 1 95  ? 18.641 -12.618 -0.805  0.58 58.94 ? 94  LYS A NZ  1 
ATOM   1508 N NZ  B LYS A 1 95  ? 18.644 -12.618 -0.799  0.42 59.30 ? 94  LYS A NZ  1 
ATOM   1509 N N   A ARG A 1 96  ? 19.766 -6.118  2.375   0.51 8.98  ? 95  ARG A N   1 
ATOM   1510 N N   B ARG A 1 96  ? 19.769 -6.113  2.368   0.49 9.01  ? 95  ARG A N   1 
ATOM   1511 C CA  A ARG A 1 96  ? 20.374 -4.859  1.989   0.54 8.90  ? 95  ARG A CA  1 
ATOM   1512 C CA  B ARG A 1 96  ? 20.384 -4.859  1.992   0.46 8.90  ? 95  ARG A CA  1 
ATOM   1513 C C   A ARG A 1 96  ? 21.049 -5.085  0.639   0.57 10.45 ? 95  ARG A C   1 
ATOM   1514 C C   B ARG A 1 96  ? 21.052 -5.085  0.639   0.43 10.45 ? 95  ARG A C   1 
ATOM   1515 O O   A ARG A 1 96  ? 21.705 -6.093  0.473   0.52 13.49 ? 95  ARG A O   1 
ATOM   1516 O O   B ARG A 1 96  ? 21.705 -6.093  0.473   0.48 13.49 ? 95  ARG A O   1 
ATOM   1517 C CB  A ARG A 1 96  ? 21.471 -4.489  2.985   0.54 11.75 ? 95  ARG A CB  1 
ATOM   1518 C CB  B ARG A 1 96  ? 21.478 -4.489  2.989   0.46 11.67 ? 95  ARG A CB  1 
ATOM   1519 C CG  A ARG A 1 96  ? 20.906 -3.830  4.229   0.53 9.31  ? 95  ARG A CG  1 
ATOM   1520 C CG  B ARG A 1 96  ? 20.909 -3.830  4.229   0.47 9.32  ? 95  ARG A CG  1 
ATOM   1521 C CD  A ARG A 1 96  ? 21.981 -3.434  5.229   0.46 10.74 ? 95  ARG A CD  1 
ATOM   1522 C CD  B ARG A 1 96  ? 21.981 -3.434  5.229   0.46 10.73 ? 95  ARG A CD  1 
ATOM   1523 N NE  A ARG A 1 96  ? 22.899 -2.416  4.727   0.49 11.20 ? 95  ARG A NE  1 
ATOM   1524 N NE  B ARG A 1 96  ? 22.899 -2.416  4.727   0.49 11.19 ? 95  ARG A NE  1 
ATOM   1525 C CZ  A ARG A 1 96  ? 23.358 -1.393  5.473   0.45 12.33 ? 95  ARG A CZ  1 
ATOM   1526 C CZ  B ARG A 1 96  ? 23.358 -1.393  5.473   0.45 12.33 ? 95  ARG A CZ  1 
ATOM   1527 N NH1 A ARG A 1 96  ? 22.987 -1.224  6.745   0.46 14.95 ? 95  ARG A NH1 1 
ATOM   1528 N NH1 B ARG A 1 96  ? 22.987 -1.224  6.745   0.46 14.95 ? 95  ARG A NH1 1 
ATOM   1529 N NH2 A ARG A 1 96  ? 24.208 -0.519  4.928   0.51 13.23 ? 95  ARG A NH2 1 
ATOM   1530 N NH2 B ARG A 1 96  ? 24.208 -0.519  4.928   0.49 13.23 ? 95  ARG A NH2 1 
ATOM   1531 N N   A VAL A 1 97  ? 20.891 -4.206  -0.291  0.52 9.90  ? 96  VAL A N   1 
ATOM   1532 N N   B VAL A 1 97  ? 20.894 -4.206  -0.291  0.48 9.90  ? 96  VAL A N   1 
ATOM   1533 C CA  A VAL A 1 97  ? 21.528 -4.360  -1.579  0.49 11.03 ? 96  VAL A CA  1 
ATOM   1534 C CA  B VAL A 1 97  ? 21.528 -4.365  -1.579  0.49 11.02 ? 96  VAL A CA  1 
ATOM   1535 C C   A VAL A 1 97  ? 23.050 -4.232  -1.457  0.49 14.67 ? 96  VAL A C   1 
ATOM   1536 C C   B VAL A 1 97  ? 23.050 -4.232  -1.457  0.49 14.67 ? 96  VAL A C   1 
ATOM   1537 O O   A VAL A 1 97  ? 23.762 -4.962  -2.140  0.52 16.76 ? 96  VAL A O   1 
ATOM   1538 O O   B VAL A 1 97  ? 23.762 -4.962  -2.140  0.48 16.76 ? 96  VAL A O   1 
ATOM   1539 C CB  A VAL A 1 97  ? 20.997 -3.337  -2.563  0.49 14.07 ? 96  VAL A CB  1 
ATOM   1540 C CB  B VAL A 1 97  ? 20.997 -3.337  -2.563  0.49 14.06 ? 96  VAL A CB  1 
ATOM   1541 C CG1 A VAL A 1 97  ? 21.761 -3.455  -3.888  0.53 16.64 ? 96  VAL A CG1 1 
ATOM   1542 C CG1 B VAL A 1 97  ? 21.761 -3.450  -3.888  0.47 16.64 ? 96  VAL A CG1 1 
ATOM   1543 C CG2 A VAL A 1 97  ? 19.506 -3.548  -2.763  0.53 18.10 ? 96  VAL A CG2 1 
ATOM   1544 C CG2 B VAL A 1 97  ? 19.506 -3.548  -2.763  0.47 18.09 ? 96  VAL A CG2 1 
ATOM   1545 N N   A ASP A 1 98  ? 23.538 -3.332  -0.605  0.52 11.67 ? 97  ASP A N   1 
ATOM   1546 N N   B ASP A 1 98  ? 23.538 -3.332  -0.605  0.48 11.67 ? 97  ASP A N   1 
ATOM   1547 C CA  A ASP A 1 98  ? 25.021 -3.167  -0.489  0.54 10.08 ? 97  ASP A CA  1 
ATOM   1548 C CA  B ASP A 1 98  ? 25.021 -3.167  -0.489  0.46 10.08 ? 97  ASP A CA  1 
ATOM   1549 C C   A ASP A 1 98  ? 25.773 -4.360  0.056   0.51 13.78 ? 97  ASP A C   1 
ATOM   1550 C C   B ASP A 1 98  ? 25.773 -4.360  0.056   0.49 13.78 ? 97  ASP A C   1 
ATOM   1551 O O   A ASP A 1 98  ? 26.743 -4.900  -0.539  0.50 15.91 ? 97  ASP A O   1 
ATOM   1552 O O   B ASP A 1 98  ? 26.743 -4.900  -0.539  0.50 15.91 ? 97  ASP A O   1 
ATOM   1553 C CB  A ASP A 1 98  ? 25.403 -1.908  0.310   0.48 12.89 ? 97  ASP A CB  1 
ATOM   1554 C CB  B ASP A 1 98  ? 25.403 -1.908  0.310   0.48 12.89 ? 97  ASP A CB  1 
ATOM   1555 C CG  A ASP A 1 98  ? 24.813 -1.815  1.707   0.47 12.26 ? 97  ASP A CG  1 
ATOM   1556 C CG  B ASP A 1 98  ? 24.813 -1.815  1.707   0.47 12.26 ? 97  ASP A CG  1 
ATOM   1557 O OD1 A ASP A 1 98  ? 24.186 -2.710  2.259   0.49 13.81 ? 97  ASP A OD1 1 
ATOM   1558 O OD1 B ASP A 1 98  ? 24.186 -2.710  2.259   0.49 13.81 ? 97  ASP A OD1 1 
ATOM   1559 O OD2 A ASP A 1 98  ? 25.037 -0.673  2.277   0.47 14.09 ? 97  ASP A OD2 1 
ATOM   1560 O OD2 B ASP A 1 98  ? 25.037 -0.673  2.277   0.47 14.09 ? 97  ASP A OD2 1 
ATOM   1561 N N   A ASN A 1 99  ? 25.394 -4.797  1.247   0.51 13.06 ? 98  ASN A N   1 
ATOM   1562 N N   B ASN A 1 99  ? 25.394 -4.797  1.247   0.49 13.06 ? 98  ASN A N   1 
ATOM   1563 C CA  A ASN A 1 99  ? 26.089 -5.841  1.958   0.51 14.08 ? 98  ASN A CA  1 
ATOM   1564 C CA  B ASN A 1 99  ? 26.089 -5.841  1.958   0.49 14.08 ? 98  ASN A CA  1 
ATOM   1565 C C   A ASN A 1 99  ? 25.465 -7.219  1.983   0.50 12.42 ? 98  ASN A C   1 
ATOM   1566 C C   B ASN A 1 99  ? 25.465 -7.219  1.983   0.50 12.42 ? 98  ASN A C   1 
ATOM   1567 O O   A ASN A 1 99  ? 26.042 -8.144  2.556   0.46 14.00 ? 98  ASN A O   1 
ATOM   1568 O O   B ASN A 1 99  ? 26.042 -8.144  2.556   0.46 14.00 ? 98  ASN A O   1 
ATOM   1569 C CB  A ASN A 1 99  ? 26.545 -5.342  3.361   0.51 11.68 ? 98  ASN A CB  1 
ATOM   1570 C CB  B ASN A 1 99  ? 26.545 -5.342  3.361   0.49 11.68 ? 98  ASN A CB  1 
ATOM   1571 C CG  A ASN A 1 99  ? 25.423 -5.126  4.367   0.47 12.60 ? 98  ASN A CG  1 
ATOM   1572 C CG  B ASN A 1 99  ? 25.423 -5.126  4.367   0.47 12.60 ? 98  ASN A CG  1 
ATOM   1573 O OD1 A ASN A 1 99  ? 25.582 -4.442  5.423   0.48 16.52 ? 98  ASN A OD1 1 
ATOM   1574 O OD1 B ASN A 1 99  ? 25.582 -4.442  5.423   0.48 16.52 ? 98  ASN A OD1 1 
ATOM   1575 N ND2 A ASN A 1 99  ? 24.294 -5.728  4.069   0.53 9.97  ? 98  ASN A ND2 1 
ATOM   1576 N ND2 B ASN A 1 99  ? 24.294 -5.728  4.069   0.47 9.97  ? 98  ASN A ND2 1 
ATOM   1577 N N   A GLY A 1 100 ? 24.298 -7.363  1.356   0.55 12.08 ? 99  GLY A N   1 
ATOM   1578 N N   B GLY A 1 100 ? 24.298 -7.363  1.356   0.45 12.08 ? 99  GLY A N   1 
ATOM   1579 C CA  A GLY A 1 100 ? 23.598 -8.622  1.281   0.55 11.69 ? 99  GLY A CA  1 
ATOM   1580 C CA  B GLY A 1 100 ? 23.598 -8.622  1.281   0.45 11.69 ? 99  GLY A CA  1 
ATOM   1581 C C   A GLY A 1 100 ? 23.034 -9.183  2.597   0.48 15.37 ? 99  GLY A C   1 
ATOM   1582 C C   B GLY A 1 100 ? 23.034 -9.183  2.597   0.48 15.37 ? 99  GLY A C   1 
ATOM   1583 O O   A GLY A 1 100 ? 22.534 -10.319 2.625   0.53 14.22 ? 99  GLY A O   1 
ATOM   1584 O O   B GLY A 1 100 ? 22.534 -10.319 2.625   0.47 14.22 ? 99  GLY A O   1 
ATOM   1585 N N   A LYS A 1 101 ? 23.089 -8.401  3.687   0.49 9.38  ? 100 LYS A N   1 
ATOM   1586 N N   B LYS A 1 101 ? 23.089 -8.401  3.687   0.49 9.38  ? 100 LYS A N   1 
ATOM   1587 C CA  A LYS A 1 101 ? 22.607 -8.879  4.981   0.47 10.03 ? 100 LYS A CA  1 
ATOM   1588 C CA  B LYS A 1 101 ? 22.607 -8.879  4.981   0.47 10.03 ? 100 LYS A CA  1 
ATOM   1589 C C   A LYS A 1 101 ? 21.082 -8.807  5.135   0.48 7.75  ? 100 LYS A C   1 
ATOM   1590 C C   B LYS A 1 101 ? 21.082 -8.807  5.135   0.48 7.75  ? 100 LYS A C   1 
ATOM   1591 O O   A LYS A 1 101 ? 20.458 -7.918  4.586   0.50 10.00 ? 100 LYS A O   1 
ATOM   1592 O O   B LYS A 1 101 ? 20.458 -7.918  4.586   0.50 10.00 ? 100 LYS A O   1 
ATOM   1593 C CB  A LYS A 1 101 ? 23.299 -8.129  6.090   0.47 10.84 ? 100 LYS A CB  1 
ATOM   1594 C CB  B LYS A 1 101 ? 23.299 -8.129  6.090   0.47 10.84 ? 100 LYS A CB  1 
ATOM   1595 C CG  A LYS A 1 101 ? 24.775 -8.478  6.193   0.47 15.15 ? 100 LYS A CG  1 
ATOM   1596 C CG  B LYS A 1 101 ? 24.775 -8.478  6.193   0.47 15.15 ? 100 LYS A CG  1 
ATOM   1597 C CD  A LYS A 1 101 ? 25.390 -7.579  7.249   0.44 21.41 ? 100 LYS A CD  1 
ATOM   1598 C CD  B LYS A 1 101 ? 25.390 -7.579  7.249   0.44 21.41 ? 100 LYS A CD  1 
ATOM   1599 C CE  A LYS A 1 101 ? 26.861 -7.769  7.531   0.41 38.62 ? 100 LYS A CE  1 
ATOM   1600 C CE  B LYS A 1 101 ? 26.861 -7.769  7.531   0.41 38.62 ? 100 LYS A CE  1 
ATOM   1601 N NZ  A LYS A 1 101 ? 27.193 -9.136  7.932   0.40 35.26 ? 100 LYS A NZ  1 
ATOM   1602 N NZ  B LYS A 1 101 ? 27.193 -9.136  7.932   0.40 35.26 ? 100 LYS A NZ  1 
ATOM   1603 N N   A GLU A 1 102 ? 20.530 -9.764  5.855   0.46 8.96  ? 101 GLU A N   1 
ATOM   1604 N N   B GLU A 1 102 ? 20.530 -9.764  5.855   0.46 8.96  ? 101 GLU A N   1 
ATOM   1605 C CA  A GLU A 1 102 ? 19.086 -9.815  6.018   0.49 9.16  ? 101 GLU A CA  1 
ATOM   1606 C CA  B GLU A 1 102 ? 19.086 -9.815  6.018   0.49 9.16  ? 101 GLU A CA  1 
ATOM   1607 C C   A GLU A 1 102 ? 18.545 -8.792  7.017   0.49 8.45  ? 101 GLU A C   1 
ATOM   1608 C C   B GLU A 1 102 ? 18.545 -8.792  7.017   0.49 8.45  ? 101 GLU A C   1 
ATOM   1609 O O   A GLU A 1 102 ? 19.135 -8.540  8.048   0.50 8.80  ? 101 GLU A O   1 
ATOM   1610 O O   B GLU A 1 102 ? 19.135 -8.540  8.048   0.50 8.80  ? 101 GLU A O   1 
ATOM   1611 C CB  A GLU A 1 102 ? 18.579 -11.234 6.350   0.53 15.60 ? 101 GLU A CB  1 
ATOM   1612 C CB  B GLU A 1 102 ? 18.579 -11.234 6.350   0.47 15.60 ? 101 GLU A CB  1 
ATOM   1613 C CG  A GLU A 1 102 ? 19.085 -11.908 7.634   0.51 35.54 ? 101 GLU A CG  1 
ATOM   1614 C CG  B GLU A 1 102 ? 19.085 -11.908 7.634   0.49 35.54 ? 101 GLU A CG  1 
ATOM   1615 C CD  A GLU A 1 102 ? 18.090 -12.864 8.255   0.42 43.86 ? 101 GLU A CD  1 
ATOM   1616 C CD  B GLU A 1 102 ? 18.090 -12.864 8.255   0.42 43.86 ? 101 GLU A CD  1 
ATOM   1617 O OE1 A GLU A 1 102 ? 17.318 -13.589 7.628   0.51 24.40 ? 101 GLU A OE1 1 
ATOM   1618 O OE1 B GLU A 1 102 ? 17.318 -13.589 7.628   0.49 24.40 ? 101 GLU A OE1 1 
ATOM   1619 O OE2 A GLU A 1 102 ? 18.146 -12.818 9.561   0.45 30.39 ? 101 GLU A OE2 1 
ATOM   1620 O OE2 B GLU A 1 102 ? 18.146 -12.818 9.561   0.45 30.39 ? 101 GLU A OE2 1 
ATOM   1621 N N   A LEU A 1 103 ? 17.371 -8.268  6.676   0.50 6.77  ? 102 LEU A N   1 
ATOM   1622 N N   B LEU A 1 103 ? 17.371 -8.268  6.676   0.50 6.77  ? 102 LEU A N   1 
ATOM   1623 C CA  A LEU A 1 103 ? 16.643 -7.357  7.556   0.48 7.84  ? 102 LEU A CA  1 
ATOM   1624 C CA  B LEU A 1 103 ? 16.643 -7.357  7.556   0.48 7.84  ? 102 LEU A CA  1 
ATOM   1625 C C   A LEU A 1 103 ? 15.214 -7.918  7.578   0.52 7.67  ? 102 LEU A C   1 
ATOM   1626 C C   B LEU A 1 103 ? 15.214 -7.918  7.578   0.48 7.67  ? 102 LEU A C   1 
ATOM   1627 O O   A LEU A 1 103 ? 14.631 -8.108  6.522   0.50 9.67  ? 102 LEU A O   1 
ATOM   1628 O O   B LEU A 1 103 ? 14.631 -8.108  6.522   0.50 9.67  ? 102 LEU A O   1 
ATOM   1629 C CB  A LEU A 1 103 ? 16.670 -5.892  7.074   0.51 10.28 ? 102 LEU A CB  1 
ATOM   1630 C CB  B LEU A 1 103 ? 16.670 -5.892  7.074   0.49 10.28 ? 102 LEU A CB  1 
ATOM   1631 C CG  A LEU A 1 103 ? 16.074 -4.905  8.089   0.54 16.96 ? 102 LEU A CG  1 
ATOM   1632 C CG  B LEU A 1 103 ? 16.074 -4.905  8.089   0.46 16.96 ? 102 LEU A CG  1 
ATOM   1633 C CD1 A LEU A 1 103 ? 16.733 -3.537  7.960   0.58 19.83 ? 102 LEU A CD1 1 
ATOM   1634 C CD1 B LEU A 1 103 ? 16.733 -3.537  7.960   0.42 19.83 ? 102 LEU A CD1 1 
ATOM   1635 C CD2 A LEU A 1 103 ? 14.603 -4.761  7.791   0.56 17.60 ? 102 LEU A CD2 1 
ATOM   1636 C CD2 B LEU A 1 103 ? 14.603 -4.761  7.791   0.44 17.60 ? 102 LEU A CD2 1 
ATOM   1637 N N   A ILE A 1 104 ? 14.707 -8.267  8.753   0.53 7.35  ? 103 ILE A N   1 
ATOM   1638 N N   B ILE A 1 104 ? 14.707 -8.267  8.753   0.47 7.35  ? 103 ILE A N   1 
ATOM   1639 C CA  A ILE A 1 104 ? 13.351 -8.802  8.847   0.51 7.63  ? 103 ILE A CA  1 
ATOM   1640 C CA  B ILE A 1 104 ? 13.351 -8.802  8.847   0.49 7.63  ? 103 ILE A CA  1 
ATOM   1641 C C   A ILE A 1 104 ? 12.498 -7.707  9.492   0.47 9.33  ? 103 ILE A C   1 
ATOM   1642 C C   B ILE A 1 104 ? 12.498 -7.707  9.492   0.47 9.33  ? 103 ILE A C   1 
ATOM   1643 O O   A ILE A 1 104 ? 12.934 -7.054  10.435  0.51 9.83  ? 103 ILE A O   1 
ATOM   1644 O O   B ILE A 1 104 ? 12.934 -7.054  10.435  0.49 9.83  ? 103 ILE A O   1 
ATOM   1645 C CB  A ILE A 1 104 ? 13.286 -10.041 9.746   0.53 11.78 ? 103 ILE A CB  1 
ATOM   1646 C CB  B ILE A 1 104 ? 13.286 -10.041 9.746   0.47 11.78 ? 103 ILE A CB  1 
ATOM   1647 C CG1 A ILE A 1 104 ? 14.137 -11.162 9.185   0.51 15.15 ? 103 ILE A CG1 1 
ATOM   1648 C CG1 B ILE A 1 104 ? 14.137 -11.162 9.185   0.49 15.15 ? 103 ILE A CG1 1 
ATOM   1649 C CG2 A ILE A 1 104 ? 11.870 -10.535 9.931   0.56 15.98 ? 103 ILE A CG2 1 
ATOM   1650 C CG2 B ILE A 1 104 ? 11.870 -10.535 9.931   0.44 15.98 ? 103 ILE A CG2 1 
ATOM   1651 C CD1 A ILE A 1 104 ? 13.708 -11.671 7.829   0.52 14.20 ? 103 ILE A CD1 1 
ATOM   1652 C CD1 B ILE A 1 104 ? 13.708 -11.671 7.829   0.48 14.20 ? 103 ILE A CD1 1 
ATOM   1653 N N   A ALA A 1 105 ? 11.311 -7.501  8.938   0.49 8.82  ? 104 ALA A N   1 
ATOM   1654 N N   B ALA A 1 105 ? 11.311 -7.506  8.938   0.49 8.82  ? 104 ALA A N   1 
ATOM   1655 C CA  A ALA A 1 105 ? 10.379 -6.524  9.476   0.51 8.97  ? 104 ALA A CA  1 
ATOM   1656 C CA  B ALA A 1 105 ? 10.379 -6.524  9.476   0.49 8.97  ? 104 ALA A CA  1 
ATOM   1657 C C   A ALA A 1 105 ? 9.076  -7.249  9.711   0.52 10.28 ? 104 ALA A C   1 
ATOM   1658 C C   B ALA A 1 105 ? 9.076  -7.249  9.708   0.48 10.28 ? 104 ALA A C   1 
ATOM   1659 O O   A ALA A 1 105 ? 8.641  -8.046  8.884   0.52 13.08 ? 104 ALA A O   1 
ATOM   1660 O O   B ALA A 1 105 ? 8.641  -8.046  8.884   0.48 13.08 ? 104 ALA A O   1 
ATOM   1661 C CB  A ALA A 1 105 ? 10.143 -5.368  8.508   0.55 11.32 ? 104 ALA A CB  1 
ATOM   1662 C CB  B ALA A 1 105 ? 10.143 -5.368  8.508   0.45 11.32 ? 104 ALA A CB  1 
ATOM   1663 N N   A VAL A 1 106 ? 8.453  -7.008  10.842  0.49 8.46  ? 105 VAL A N   1 
ATOM   1664 N N   B VAL A 1 106 ? 8.456  -6.997  10.836  0.49 8.46  ? 105 VAL A N   1 
ATOM   1665 C CA  A VAL A 1 106 ? 7.156  -7.614  11.118  0.49 8.66  ? 105 VAL A CA  1 
ATOM   1666 C CA  B VAL A 1 106 ? 7.163  -7.604  11.109  0.49 8.73  ? 105 VAL A CA  1 
ATOM   1667 C C   A VAL A 1 106 ? 6.202  -6.499  11.516  0.50 9.35  ? 105 VAL A C   1 
ATOM   1668 C C   B VAL A 1 106 ? 6.206  -6.478  11.485  0.50 9.39  ? 105 VAL A C   1 
ATOM   1669 O O   A VAL A 1 106 ? 6.564  -5.625  12.293  0.51 10.49 ? 105 VAL A O   1 
ATOM   1670 O O   B VAL A 1 106 ? 6.563  -5.553  12.205  0.49 10.51 ? 105 VAL A O   1 
ATOM   1671 C CB  A VAL A 1 106 ? 7.223  -8.622  12.268  0.49 9.43  ? 105 VAL A CB  1 
ATOM   1672 C CB  B VAL A 1 106 ? 7.220  -8.612  12.261  0.49 9.34  ? 105 VAL A CB  1 
ATOM   1673 C CG1 A VAL A 1 106 ? 5.862  -9.255  12.559  0.55 11.53 ? 105 VAL A CG1 1 
ATOM   1674 C CG1 B VAL A 1 106 ? 5.862  -9.249  12.556  0.45 11.52 ? 105 VAL A CG1 1 
ATOM   1675 C CG2 A VAL A 1 106 ? 8.261  -9.697  11.958  0.56 15.98 ? 105 VAL A CG2 1 
ATOM   1676 C CG2 B VAL A 1 106 ? 8.261  -9.692  11.958  0.44 16.01 ? 105 VAL A CG2 1 
ATOM   1677 N N   A ARG A 1 107 ? 4.986  -6.494  10.983  0.50 7.97  ? 106 ARG A N   1 
ATOM   1678 N N   B ARG A 1 107 ? 4.997  -6.530  10.968  0.50 8.02  ? 106 ARG A N   1 
ATOM   1679 C CA  A ARG A 1 107 ? 3.990  -5.511  11.369  0.50 6.38  ? 106 ARG A CA  1 
ATOM   1680 C CA  B ARG A 1 107 ? 3.987  -5.589  11.356  0.50 6.42  ? 106 ARG A CA  1 
ATOM   1681 C C   A ARG A 1 107 ? 2.774  -6.288  11.848  0.46 9.11  ? 106 ARG A C   1 
ATOM   1682 C C   B ARG A 1 107 ? 2.870  -6.437  11.983  0.46 8.89  ? 106 ARG A C   1 
ATOM   1683 O O   A ARG A 1 107 ? 2.209  -7.039  11.068  0.50 6.95  ? 106 ARG A O   1 
ATOM   1684 O O   B ARG A 1 107 ? 2.429  -7.424  11.403  0.50 7.60  ? 106 ARG A O   1 
ATOM   1685 C CB  A ARG A 1 107 ? 3.528  -4.689  10.203  0.50 7.75  ? 106 ARG A CB  1 
ATOM   1686 C CB  B ARG A 1 107 ? 3.484  -4.715  10.228  0.50 7.63  ? 106 ARG A CB  1 
ATOM   1687 C CG  A ARG A 1 107 ? 4.563  -3.671  9.815   0.50 10.43 ? 106 ARG A CG  1 
ATOM   1688 C CG  B ARG A 1 107 ? 4.531  -3.697  9.818   0.50 10.42 ? 106 ARG A CG  1 
ATOM   1689 C CD  A ARG A 1 107 ? 4.228  -2.905  8.546   0.53 12.56 ? 106 ARG A CD  1 
ATOM   1690 C CD  B ARG A 1 107 ? 4.221  -2.910  8.546   0.47 12.59 ? 106 ARG A CD  1 
ATOM   1691 N NE  A ARG A 1 107 ? 5.119  -1.768  8.418   0.53 13.03 ? 106 ARG A NE  1 
ATOM   1692 N NE  B ARG A 1 107 ? 5.119  -1.774  8.418   0.47 13.00 ? 106 ARG A NE  1 
ATOM   1693 C CZ  A ARG A 1 107 ? 5.354  -1.136  7.268   0.54 15.26 ? 106 ARG A CZ  1 
ATOM   1694 C CZ  B ARG A 1 107 ? 5.354  -1.136  7.271   0.46 15.27 ? 106 ARG A CZ  1 
ATOM   1695 N NH1 A ARG A 1 107 ? 4.736  -1.573  6.181   0.51 14.88 ? 106 ARG A NH1 1 
ATOM   1696 N NH1 B ARG A 1 107 ? 4.736  -1.573  6.181   0.49 14.88 ? 106 ARG A NH1 1 
ATOM   1697 N NH2 A ARG A 1 107 ? 6.164  -0.097  7.202   0.56 16.29 ? 106 ARG A NH2 1 
ATOM   1698 N NH2 B ARG A 1 107 ? 6.168  -0.097  7.202   0.44 16.30 ? 106 ARG A NH2 1 
ATOM   1699 N N   A GLU A 1 108 ? 2.393  -6.077  13.095  0.50 8.31  ? 107 GLU A N   1 
ATOM   1700 N N   B GLU A 1 108 ? 2.483  -6.077  13.198  0.50 8.33  ? 107 GLU A N   1 
ATOM   1701 C CA  A GLU A 1 108 ? 1.282  -6.823  13.649  0.52 9.26  ? 107 GLU A CA  1 
ATOM   1702 C CA  B GLU A 1 108 ? 1.430  -6.823  13.862  0.48 9.46  ? 107 GLU A CA  1 
ATOM   1703 C C   A GLU A 1 108 ? 0.485  -5.933  14.608  0.51 9.18  ? 107 GLU A C   1 
ATOM   1704 C C   B GLU A 1 108 ? 0.524  -5.835  14.605  0.49 8.37  ? 107 GLU A C   1 
ATOM   1705 O O   A GLU A 1 108 ? 1.034  -5.090  15.319  0.50 8.21  ? 107 GLU A O   1 
ATOM   1706 O O   B GLU A 1 108 ? 0.934  -4.720  14.899  0.50 7.30  ? 107 GLU A O   1 
ATOM   1707 C CB  A GLU A 1 108 ? 1.947  -7.985  14.426  0.54 12.14 ? 107 GLU A CB  1 
ATOM   1708 C CB  B GLU A 1 108 ? 2.024  -7.897  14.764  0.46 10.99 ? 107 GLU A CB  1 
ATOM   1709 C CG  A GLU A 1 108 ? 2.544  -7.429  15.748  0.51 10.00 ? 107 GLU A CG  1 
ATOM   1710 C CG  B GLU A 1 108 ? 0.890  -8.704  15.379  0.49 13.88 ? 107 GLU A CG  1 
ATOM   1711 C CD  A GLU A 1 108 ? 3.413  -8.319  16.632  0.54 25.98 ? 107 GLU A CD  1 
ATOM   1712 C CD  B GLU A 1 108 ? 1.396  -9.681  16.362  0.44 19.28 ? 107 GLU A CD  1 
ATOM   1713 O OE1 A GLU A 1 108 ? 4.613  -8.452  16.481  0.54 15.34 ? 107 GLU A OE1 1 
ATOM   1714 O OE1 B GLU A 1 108 ? 2.540  -9.702  16.760  0.46 12.73 ? 107 GLU A OE1 1 
ATOM   1715 O OE2 A GLU A 1 108 ? 2.768  -8.884  17.628  0.54 15.61 ? 107 GLU A OE2 1 
ATOM   1716 O OE2 B GLU A 1 108 ? 0.453  -10.504 16.722  0.35 30.47 ? 107 GLU A OE2 1 
ATOM   1717 N N   A ILE A 1 109 ? -0.837 -6.144  14.639  0.51 9.20  ? 108 ILE A N   1 
ATOM   1718 N N   B ILE A 1 109 ? -0.739 -6.231  14.846  0.49 10.02 ? 108 ILE A N   1 
ATOM   1719 C CA  A ILE A 1 109 ? -1.708 -5.378  15.535  0.51 9.69  ? 108 ILE A CA  1 
ATOM   1720 C CA  B ILE A 1 109 ? -1.683 -5.378  15.570  0.49 9.41  ? 108 ILE A CA  1 
ATOM   1721 C C   A ILE A 1 109 ? -1.729 -5.954  16.951  0.49 10.47 ? 108 ILE A C   1 
ATOM   1722 C C   B ILE A 1 109 ? -1.754 -5.933  16.973  0.49 10.22 ? 108 ILE A C   1 
ATOM   1723 O O   A ILE A 1 109 ? -1.808 -7.162  17.133  0.48 14.34 ? 108 ILE A O   1 
ATOM   1724 O O   B ILE A 1 109 ? -1.847 -7.141  17.136  0.48 14.48 ? 108 ILE A O   1 
ATOM   1725 C CB  A ILE A 1 109 ? -3.133 -5.424  14.990  0.52 13.84 ? 108 ILE A CB  1 
ATOM   1726 C CB  B ILE A 1 109 ? -3.101 -5.434  14.981  0.48 13.41 ? 108 ILE A CB  1 
ATOM   1727 C CG1 A ILE A 1 109 ? -3.107 -5.038  13.533  0.55 15.35 ? 108 ILE A CG1 1 
ATOM   1728 C CG1 B ILE A 1 109 ? -3.086 -5.038  13.524  0.45 15.38 ? 108 ILE A CG1 1 
ATOM   1729 C CG2 A ILE A 1 109 ? -4.054 -4.493  15.786  0.58 16.94 ? 108 ILE A CG2 1 
ATOM   1730 C CG2 B ILE A 1 109 ? -4.054 -4.519  15.764  0.42 17.27 ? 108 ILE A CG2 1 
ATOM   1731 C CD1 A ILE A 1 109 ? -2.473 -3.666  13.377  0.48 21.28 ? 108 ILE A CD1 1 
ATOM   1732 C CD1 B ILE A 1 109 ? -2.473 -3.660  13.370  0.48 21.33 ? 108 ILE A CD1 1 
ATOM   1733 N N   A SER A 1 110 ? -1.665 -5.100  17.954  0.50 11.79 ? 109 SER A N   1 
ATOM   1734 N N   B SER A 1 110 ? -1.658 -5.079  17.969  0.50 11.81 ? 109 SER A N   1 
ATOM   1735 C CA  A SER A 1 110 ? -1.711 -5.496  19.354  0.54 16.75 ? 109 SER A CA  1 
ATOM   1736 C CA  B SER A 1 110 ? -1.718 -5.496  19.360  0.46 16.82 ? 109 SER A CA  1 
ATOM   1737 C C   A SER A 1 110 ? -2.727 -4.565  19.949  0.50 14.72 ? 109 SER A C   1 
ATOM   1738 C C   B SER A 1 110 ? -2.730 -4.565  19.952  0.50 14.74 ? 109 SER A C   1 
ATOM   1739 O O   A SER A 1 110 ? -2.457 -3.388  20.125  0.52 15.65 ? 109 SER A O   1 
ATOM   1740 O O   B SER A 1 110 ? -2.457 -3.388  20.125  0.48 15.65 ? 109 SER A O   1 
ATOM   1741 C CB  A SER A 1 110 ? -0.396 -5.316  20.074  0.52 19.16 ? 109 SER A CB  1 
ATOM   1742 C CB  B SER A 1 110 ? -0.403 -5.316  20.074  0.48 19.20 ? 109 SER A CB  1 
ATOM   1743 O OG  A SER A 1 110 ? -0.599 -5.378  21.475  0.52 29.68 ? 109 SER A OG  1 
ATOM   1744 O OG  B SER A 1 110 ? -0.599 -5.378  21.475  0.48 29.78 ? 109 SER A OG  1 
ATOM   1745 N N   A GLY A 1 111 ? -3.915 -5.100  20.184  0.48 24.09 ? 110 GLY A N   1 
ATOM   1746 N N   B GLY A 1 111 ? -3.915 -5.100  20.184  0.48 24.00 ? 110 GLY A N   1 
ATOM   1747 C CA  A GLY A 1 111 ? -5.000 -4.293  20.685  0.51 24.04 ? 110 GLY A CA  1 
ATOM   1748 C CA  B GLY A 1 111 ? -5.004 -4.293  20.685  0.49 24.00 ? 110 GLY A CA  1 
ATOM   1749 C C   A GLY A 1 111 ? -5.312 -3.254  19.630  0.52 19.44 ? 110 GLY A C   1 
ATOM   1750 C C   B GLY A 1 111 ? -5.312 -3.254  19.630  0.48 19.46 ? 110 GLY A C   1 
ATOM   1751 O O   A GLY A 1 111 ? -5.719 -3.568  18.514  0.53 29.49 ? 110 GLY A O   1 
ATOM   1752 O O   B GLY A 1 111 ? -5.719 -3.568  18.514  0.47 29.43 ? 110 GLY A O   1 
ATOM   1753 N N   A ASN A 1 112 ? -5.089 -1.989  19.952  0.52 19.50 ? 111 ASN A N   1 
ATOM   1754 N N   B ASN A 1 112 ? -5.081 -1.989  19.946  0.48 19.46 ? 111 ASN A N   1 
ATOM   1755 C CA  A ASN A 1 112 ? -5.313 -0.966  18.969  0.51 12.65 ? 111 ASN A CA  1 
ATOM   1756 C CA  B ASN A 1 112 ? -5.306 -0.966  18.953  0.49 12.74 ? 111 ASN A CA  1 
ATOM   1757 C C   A ASN A 1 112 ? -4.012 -0.287  18.511  0.44 15.02 ? 111 ASN A C   1 
ATOM   1758 C C   B ASN A 1 112 ? -4.012 -0.262  18.505  0.44 14.60 ? 111 ASN A C   1 
ATOM   1759 O O   A ASN A 1 112 ? -4.010 0.818   17.991  0.47 15.36 ? 111 ASN A O   1 
ATOM   1760 O O   B ASN A 1 112 ? -4.031 0.849   17.997  0.47 15.47 ? 111 ASN A O   1 
ATOM   1761 C CB  A ASN A 1 112 ? -6.381 0.083   19.341  0.46 20.86 ? 111 ASN A CB  1 
ATOM   1762 C CB  B ASN A 1 112 ? -6.381 0.073   19.338  0.46 20.83 ? 111 ASN A CB  1 
ATOM   1763 C CG  A ASN A 1 112 ? -5.936 1.132   20.347  0.47 24.56 ? 111 ASN A CG  1 
ATOM   1764 C CG  B ASN A 1 112 ? -5.935 1.127   20.344  0.47 24.53 ? 111 ASN A CG  1 
ATOM   1765 O OD1 A ASN A 1 112 ? -6.438 2.268   20.369  0.42 40.73 ? 111 ASN A OD1 1 
ATOM   1766 O OD1 B ASN A 1 112 ? -6.438 2.268   20.366  0.42 40.92 ? 111 ASN A OD1 1 
ATOM   1767 N ND2 A ASN A 1 112 ? -4.988 0.777   21.190  0.47 21.53 ? 111 ASN A ND2 1 
ATOM   1768 N ND2 B ASN A 1 112 ? -4.988 0.772   21.190  0.47 21.52 ? 111 ASN A ND2 1 
ATOM   1769 N N   A GLU A 1 113 ? -2.895 -0.976  18.724  0.51 11.19 ? 112 GLU A N   1 
ATOM   1770 N N   B GLU A 1 113 ? -2.870 -0.904  18.702  0.49 11.28 ? 112 GLU A N   1 
ATOM   1771 C CA  A GLU A 1 113 ? -1.613 -0.426  18.320  0.51 10.23 ? 112 GLU A CA  1 
ATOM   1772 C CA  B GLU A 1 113 ? -1.617 -0.287  18.314  0.49 9.35  ? 112 GLU A CA  1 
ATOM   1773 C C   A GLU A 1 113 ? -1.092 -1.270  17.148  0.49 9.41  ? 112 GLU A C   1 
ATOM   1774 C C   B GLU A 1 113 ? -0.949 -1.136  17.255  0.49 10.82 ? 112 GLU A C   1 
ATOM   1775 O O   A GLU A 1 113 ? -1.574 -2.365  16.888  0.49 10.33 ? 112 GLU A O   1 
ATOM   1776 O O   B GLU A 1 113 ? -1.141 -2.349  17.236  0.49 9.32  ? 112 GLU A O   1 
ATOM   1777 C CB  A GLU A 1 113 ? -0.639 -0.467  19.526  0.50 9.51  ? 112 GLU A CB  1 
ATOM   1778 C CB  B GLU A 1 113 ? -0.667 -0.375  19.523  0.50 9.84  ? 112 GLU A CB  1 
ATOM   1779 C CG  A GLU A 1 113 ? -1.008 0.561   20.610  0.48 12.42 ? 112 GLU A CG  1 
ATOM   1780 C CG  B GLU A 1 113 ? -1.037 0.597   20.638  0.48 12.62 ? 112 GLU A CG  1 
ATOM   1781 C CD  A GLU A 1 113 ? -0.062 0.669   21.794  0.49 12.16 ? 112 GLU A CD  1 
ATOM   1782 C CD  B GLU A 1 113 ? -0.065 0.669   21.797  0.49 12.10 ? 112 GLU A CD  1 
ATOM   1783 O OE1 A GLU A 1 113 ? 0.415  -0.462  22.230  0.54 15.24 ? 112 GLU A OE1 1 
ATOM   1784 O OE1 B GLU A 1 113 ? 0.409  -0.472  22.217  0.46 15.31 ? 112 GLU A OE1 1 
ATOM   1785 O OE2 A GLU A 1 113 ? 0.197  1.744   22.286  0.48 19.50 ? 112 GLU A OE2 1 
ATOM   1786 O OE2 B GLU A 1 113 ? 0.211  1.733   22.296  0.48 19.69 ? 112 GLU A OE2 1 
ATOM   1787 N N   A LEU A 1 114 ? -0.134 -0.709  16.422  0.53 7.66  ? 113 LEU A N   1 
ATOM   1788 N N   B LEU A 1 114 ? -0.126 -0.509  16.419  0.47 7.67  ? 113 LEU A N   1 
ATOM   1789 C CA  A LEU A 1 114 ? 0.528  -1.378  15.313  0.49 6.95  ? 113 LEU A CA  1 
ATOM   1790 C CA  B LEU A 1 114 ? 0.593  -1.295  15.438  0.49 7.94  ? 113 LEU A CA  1 
ATOM   1791 C C   A LEU A 1 114 ? 2.003  -1.429  15.729  0.51 5.83  ? 113 LEU A C   1 
ATOM   1792 C C   B LEU A 1 114 ? 2.037  -1.496  15.958  0.49 5.73  ? 113 LEU A C   1 
ATOM   1793 O O   A LEU A 1 114 ? 2.628  -0.401  15.961  0.54 6.23  ? 113 LEU A O   1 
ATOM   1794 O O   B LEU A 1 114 ? 2.664  -0.534  16.381  0.46 6.54  ? 113 LEU A O   1 
ATOM   1795 C CB  A LEU A 1 114 ? 0.334  -0.627  13.981  0.52 9.63  ? 113 LEU A CB  1 
ATOM   1796 C CB  B LEU A 1 114 ? 0.532  -0.658  14.035  0.48 8.12  ? 113 LEU A CB  1 
ATOM   1797 C CG  A LEU A 1 114 ? 1.322  -1.074  12.910  0.51 10.56 ? 113 LEU A CG  1 
ATOM   1798 C CG  B LEU A 1 114 ? 1.073  -1.558  12.919  0.49 11.68 ? 113 LEU A CG  1 
ATOM   1799 C CD1 A LEU A 1 114 ? 0.974  -2.478  12.459  0.51 17.27 ? 113 LEU A CD1 1 
ATOM   1800 C CD1 B LEU A 1 114 ? 0.315  -1.347  11.616  0.48 19.34 ? 113 LEU A CD1 1 
ATOM   1801 C CD2 A LEU A 1 114 ? 1.217  -0.180  11.694  0.52 19.52 ? 113 LEU A CD2 1 
ATOM   1802 C CD2 B LEU A 1 114 ? 2.556  -1.311  12.716  0.48 11.81 ? 113 LEU A CD2 1 
ATOM   1803 N N   A ILE A 1 115 ? 2.516  -2.617  15.895  0.52 7.64  ? 114 ILE A N   1 
ATOM   1804 N N   B ILE A 1 115 ? 2.506  -2.740  15.986  0.48 7.60  ? 114 ILE A N   1 
ATOM   1805 C CA  A ILE A 1 115 ? 3.887  -2.725  16.331  0.52 6.48  ? 114 ILE A CA  1 
ATOM   1806 C CA  B ILE A 1 115 ? 3.867  -3.018  16.437  0.48 5.33  ? 114 ILE A CA  1 
ATOM   1807 C C   A ILE A 1 115 ? 4.707  -3.270  15.175  0.49 7.03  ? 114 ILE A C   1 
ATOM   1808 C C   B ILE A 1 115 ? 4.693  -3.265  15.172  0.49 7.00  ? 114 ILE A C   1 
ATOM   1809 O O   A ILE A 1 115 ? 4.462  -4.385  14.696  0.52 6.70  ? 114 ILE A O   1 
ATOM   1810 O O   B ILE A 1 115 ? 4.325  -4.087  14.345  0.48 7.00  ? 114 ILE A O   1 
ATOM   1811 C CB  A ILE A 1 115 ? 4.045  -3.763  17.427  0.50 10.05 ? 114 ILE A CB  1 
ATOM   1812 C CB  B ILE A 1 115 ? 4.010  -4.211  17.380  0.50 8.47  ? 114 ILE A CB  1 
ATOM   1813 C CG1 A ILE A 1 115 ? 3.363  -3.480  18.762  0.52 10.46 ? 114 ILE A CG1 1 
ATOM   1814 C CG1 B ILE A 1 115 ? 2.850  -4.236  18.351  0.46 14.79 ? 114 ILE A CG1 1 
ATOM   1815 C CG2 A ILE A 1 115 ? 5.512  -4.139  17.575  0.54 13.41 ? 114 ILE A CG2 1 
ATOM   1816 C CG2 B ILE A 1 115 ? 5.320  -4.108  18.154  0.46 9.24  ? 114 ILE A CG2 1 
ATOM   1817 C CD1 A ILE A 1 115 ? 3.110  -4.745  19.605  0.53 19.19 ? 114 ILE A CD1 1 
ATOM   1818 C CD1 B ILE A 1 115 ? 2.701  -2.889  19.038  0.42 18.38 ? 114 ILE A CD1 1 
ATOM   1819 N N   A GLN A 1 116 ? 5.710  -2.478  14.811  0.50 5.65  ? 115 GLN A N   1 
ATOM   1820 N N   B GLN A 1 116 ? 5.787  -2.524  15.009  0.50 5.99  ? 115 GLN A N   1 
ATOM   1821 C CA  A GLN A 1 116 ? 6.655  -2.838  13.793  0.50 6.22  ? 115 GLN A CA  1 
ATOM   1822 C CA  B GLN A 1 116 ? 6.632  -2.745  13.859  0.50 6.19  ? 115 GLN A CA  1 
ATOM   1823 C C   A GLN A 1 116 ? 7.945  -3.270  14.467  0.48 7.25  ? 115 GLN A C   1 
ATOM   1824 C C   B GLN A 1 116 ? 7.983  -3.146  14.373  0.48 7.48  ? 115 GLN A C   1 
ATOM   1825 O O   A GLN A 1 116 ? 8.513  -2.514  15.256  0.50 7.30  ? 115 GLN A O   1 
ATOM   1826 O O   B GLN A 1 116 ? 8.652  -2.313  14.971  0.50 6.80  ? 115 GLN A O   1 
ATOM   1827 C CB  A GLN A 1 116 ? 6.904  -1.583  12.951  0.51 7.50  ? 115 GLN A CB  1 
ATOM   1828 C CB  B GLN A 1 116 ? 6.779  -1.501  12.969  0.49 7.29  ? 115 GLN A CB  1 
ATOM   1829 C CG  A GLN A 1 116 ? 7.800  -1.830  11.738  0.52 12.20 ? 115 GLN A CG  1 
ATOM   1830 C CG  B GLN A 1 116 ? 7.738  -1.758  11.801  0.48 12.19 ? 115 GLN A CG  1 
ATOM   1831 C CD  A GLN A 1 116 ? 7.778  -0.576  10.889  0.47 17.55 ? 115 GLN A CD  1 
ATOM   1832 C CD  B GLN A 1 116 ? 7.764  -0.545  10.896  0.47 17.56 ? 115 GLN A CD  1 
ATOM   1833 O OE1 A GLN A 1 116 ? 6.806  -0.313  10.188  0.50 18.66 ? 115 GLN A OE1 1 
ATOM   1834 O OE1 B GLN A 1 116 ? 6.810  -0.298  10.163  0.50 18.79 ? 115 GLN A OE1 1 
ATOM   1835 N NE2 A GLN A 1 116 ? 8.837  0.232   10.996  0.48 22.41 ? 115 GLN A NE2 1 
ATOM   1836 N NE2 B GLN A 1 116 ? 8.841  0.237   10.983  0.48 22.35 ? 115 GLN A NE2 1 
ATOM   1837 N N   A THR A 1 117 ? 8.399  -4.473  14.144  0.49 6.15  ? 116 THR A N   1 
ATOM   1838 N N   B THR A 1 117 ? 8.367  -4.391  14.135  0.49 6.35  ? 116 THR A N   1 
ATOM   1839 C CA  A THR A 1 117 ? 9.613  -5.028  14.733  0.50 6.59  ? 116 THR A CA  1 
ATOM   1840 C CA  B THR A 1 117 ? 9.633  -4.864  14.652  0.50 6.92  ? 116 THR A CA  1 
ATOM   1841 C C   A THR A 1 117 ? 10.620 -5.301  13.637  0.48 5.99  ? 116 THR A C   1 
ATOM   1842 C C   B THR A 1 117 ? 10.630 -4.977  13.502  0.48 5.88  ? 116 THR A C   1 
ATOM   1843 O O   A THR A 1 117 ? 10.289 -5.907  12.631  0.49 5.67  ? 116 THR A O   1 
ATOM   1844 O O   B THR A 1 117 ? 10.277 -5.311  12.380  0.49 6.52  ? 116 THR A O   1 
ATOM   1845 C CB  A THR A 1 117 ? 9.350  -6.375  15.419  0.51 8.73  ? 116 THR A CB  1 
ATOM   1846 C CB  B THR A 1 117 ? 9.412  -6.252  15.338  0.49 8.73  ? 116 THR A CB  1 
ATOM   1847 O OG1 A THR A 1 117 ? 8.398  -6.211  16.456  0.50 10.17 ? 116 THR A OG1 1 
ATOM   1848 O OG1 B THR A 1 117 ? 8.414  -6.190  16.356  0.50 10.42 ? 116 THR A OG1 1 
ATOM   1849 C CG2 A THR A 1 117 ? 10.664 -6.864  16.011  0.53 12.74 ? 116 THR A CG2 1 
ATOM   1850 C CG2 B THR A 1 117 ? 10.687 -6.812  15.952  0.47 12.93 ? 116 THR A CG2 1 
ATOM   1851 N N   A TYR A 1 118 ? 11.839 -4.864  13.887  0.52 6.79  ? 117 TYR A N   1 
ATOM   1852 N N   B TYR A 1 118 ? 11.877 -4.632  13.803  0.48 5.29  ? 117 TYR A N   1 
ATOM   1853 C CA  A TYR A 1 118 ? 12.907 -5.110  12.948  0.50 6.56  ? 117 TYR A CA  1 
ATOM   1854 C CA  B TYR A 1 118 ? 12.910 -4.894  12.822  0.50 6.66  ? 117 TYR A CA  1 
ATOM   1855 C C   A TYR A 1 118 ? 13.933 -6.000  13.640  0.50 6.50  ? 117 TYR A C   1 
ATOM   1856 C C   B TYR A 1 118 ? 13.951 -5.753  13.508  0.50 6.96  ? 117 TYR A C   1 
ATOM   1857 O O   A TYR A 1 118 ? 14.120 -5.912  14.865  0.51 7.39  ? 117 TYR A O   1 
ATOM   1858 O O   B TYR A 1 118 ? 14.245 -5.532  14.692  0.49 7.51  ? 117 TYR A O   1 
ATOM   1859 C CB  A TYR A 1 118 ? 13.649 -3.758  12.734  0.50 9.89  ? 117 TYR A CB  1 
ATOM   1860 C CB  B TYR A 1 118 ? 13.744 -3.702  12.377  0.50 8.96  ? 117 TYR A CB  1 
ATOM   1861 C CG  A TYR A 1 118 ? 12.976 -2.606  12.008  0.49 9.74  ? 117 TYR A CG  1 
ATOM   1862 C CG  B TYR A 1 118 ? 13.101 -2.740  11.456  0.49 9.95  ? 117 TYR A CG  1 
ATOM   1863 C CD1 A TYR A 1 118 ? 12.309 -2.786  10.795  0.48 18.58 ? 117 TYR A CD1 1 
ATOM   1864 C CD1 B TYR A 1 118 ? 12.097 -3.116  10.564  0.49 16.11 ? 117 TYR A CD1 1 
ATOM   1865 C CD2 A TYR A 1 118 ? 13.100 -1.295  12.468  0.56 12.10 ? 117 TYR A CD2 1 
ATOM   1866 C CD2 B TYR A 1 118 ? 13.534 -1.414  11.497  0.44 14.75 ? 117 TYR A CD2 1 
ATOM   1867 C CE1 A TYR A 1 118 ? 11.691 -1.727  10.119  0.48 22.18 ? 117 TYR A CE1 1 
ATOM   1868 C CE1 B TYR A 1 118 ? 11.538 -2.149  9.715   0.48 20.61 ? 117 TYR A CE1 1 
ATOM   1869 C CE2 A TYR A 1 118 ? 12.537 -0.216  11.779  0.54 19.51 ? 117 TYR A CE2 1 
ATOM   1870 C CE2 B TYR A 1 118 ? 12.985 -0.457  10.661  0.46 11.56 ? 117 TYR A CE2 1 
ATOM   1871 C CZ  A TYR A 1 118 ? 11.854 -0.421  10.585  0.47 22.32 ? 117 TYR A CZ  1 
ATOM   1872 C CZ  B TYR A 1 118 ? 11.992 -0.833  9.777   0.52 13.13 ? 117 TYR A CZ  1 
ATOM   1873 O OH  A TYR A 1 118 ? 11.283 0.638   9.915   0.49 17.66 ? 117 TYR A OH  1 
ATOM   1874 O OH  B TYR A 1 118 ? 11.454 0.093   8.941   0.51 17.38 ? 117 TYR A OH  1 
ATOM   1875 N N   A THR A 1 119 ? 14.604 -6.823  12.863  0.49 5.66  ? 118 THR A N   1 
ATOM   1876 N N   B THR A 1 119 ? 14.532 -6.684  12.756  0.49 5.90  ? 118 THR A N   1 
ATOM   1877 C CA  A THR A 1 119 ? 15.789 -7.542  13.358  0.49 7.04  ? 118 THR A CA  1 
ATOM   1878 C CA  B THR A 1 119 ? 15.685 -7.455  13.248  0.49 8.37  ? 118 THR A CA  1 
ATOM   1879 C C   A THR A 1 119 ? 16.835 -7.419  12.268  0.48 6.27  ? 118 THR A C   1 
ATOM   1880 C C   B THR A 1 119 ? 16.818 -7.265  12.233  0.48 5.89  ? 118 THR A C   1 
ATOM   1881 O O   A THR A 1 119 ? 16.562 -7.645  11.096  0.50 7.47  ? 118 THR A O   1 
ATOM   1882 O O   B THR A 1 119 ? 16.603 -7.280  11.030  0.50 7.13  ? 118 THR A O   1 
ATOM   1883 C CB  A THR A 1 119 ? 15.710 -8.997  13.818  0.44 10.72 ? 118 THR A CB  1 
ATOM   1884 C CB  B THR A 1 119 ? 15.471 -8.941  13.518  0.47 6.34  ? 118 THR A CB  1 
ATOM   1885 O OG1 A THR A 1 119 ? 17.010 -9.404  14.248  0.43 18.41 ? 118 THR A OG1 1 
ATOM   1886 O OG1 B THR A 1 119 ? 15.295 -9.635  12.302  0.50 8.22  ? 118 THR A OG1 1 
ATOM   1887 C CG2 A THR A 1 119 ? 15.255 -9.836  12.647  0.46 8.69  ? 118 THR A CG2 1 
ATOM   1888 C CG2 B THR A 1 119 ? 14.366 -9.167  14.558  0.50 5.63  ? 118 THR A CG2 1 
ATOM   1889 N N   A TYR A 1 120 ? 18.046 -7.059  12.703  0.51 7.06  ? 119 TYR A N   1 
ATOM   1890 N N   B TYR A 1 120 ? 18.038 -7.069  12.738  0.49 7.02  ? 119 TYR A N   1 
ATOM   1891 C CA  A TYR A 1 120 ? 19.166 -6.910  11.795  0.52 6.61  ? 119 TYR A CA  1 
ATOM   1892 C CA  B TYR A 1 120 ? 19.169 -6.895  11.835  0.48 6.87  ? 119 TYR A CA  1 
ATOM   1893 C C   A TYR A 1 120 ? 20.426 -7.249  12.575  0.48 6.77  ? 119 TYR A C   1 
ATOM   1894 C C   B TYR A 1 120 ? 20.432 -7.244  12.603  0.48 6.66  ? 119 TYR A C   1 
ATOM   1895 O O   A TYR A 1 120 ? 20.663 -6.668  13.618  0.50 7.62  ? 119 TYR A O   1 
ATOM   1896 O O   B TYR A 1 120 ? 20.677 -6.673  13.649  0.50 7.71  ? 119 TYR A O   1 
ATOM   1897 C CB  A TYR A 1 120 ? 19.253 -5.450  11.319  0.53 8.42  ? 119 TYR A CB  1 
ATOM   1898 C CB  B TYR A 1 120 ? 19.249 -5.440  11.334  0.47 8.38  ? 119 TYR A CB  1 
ATOM   1899 C CG  A TYR A 1 120 ? 20.433 -5.193  10.429  0.55 7.42  ? 119 TYR A CG  1 
ATOM   1900 C CG  B TYR A 1 120 ? 20.429 -5.193  10.435  0.45 7.45  ? 119 TYR A CG  1 
ATOM   1901 C CD1 A TYR A 1 120 ? 20.476 -5.681  9.132   0.54 9.35  ? 119 TYR A CD1 1 
ATOM   1902 C CD1 B TYR A 1 120 ? 20.473 -5.681  9.138   0.46 9.34  ? 119 TYR A CD1 1 
ATOM   1903 C CD2 A TYR A 1 120 ? 21.508 -4.432  10.905  0.53 10.21 ? 119 TYR A CD2 1 
ATOM   1904 C CD2 B TYR A 1 120 ? 21.508 -4.432  10.905  0.47 10.21 ? 119 TYR A CD2 1 
ATOM   1905 C CE1 A TYR A 1 120 ? 21.576 -5.414  8.324   0.52 8.97  ? 119 TYR A CE1 1 
ATOM   1906 C CE1 B TYR A 1 120 ? 21.572 -5.414  8.327   0.48 8.97  ? 119 TYR A CE1 1 
ATOM   1907 C CE2 A TYR A 1 120 ? 22.610 -4.159  10.119  0.55 9.96  ? 119 TYR A CE2 1 
ATOM   1908 C CE2 B TYR A 1 120 ? 22.610 -4.164  10.119  0.45 9.96  ? 119 TYR A CE2 1 
ATOM   1909 C CZ  A TYR A 1 120 ? 22.636 -4.668  8.822   0.54 9.93  ? 119 TYR A CZ  1 
ATOM   1910 C CZ  B TYR A 1 120 ? 22.636 -4.673  8.822   0.46 9.91  ? 119 TYR A CZ  1 
ATOM   1911 O OH  A TYR A 1 120 ? 23.732 -4.437  8.023   0.51 13.74 ? 119 TYR A OH  1 
ATOM   1912 O OH  B TYR A 1 120 ? 23.732 -4.442  8.023   0.49 13.74 ? 119 TYR A OH  1 
ATOM   1913 N N   A GLU A 1 121 ? 21.176 -8.231  12.073  0.51 9.05  ? 120 GLU A N   1 
ATOM   1914 N N   B GLU A 1 121 ? 21.175 -8.221  12.086  0.49 9.04  ? 120 GLU A N   1 
ATOM   1915 C CA  A GLU A 1 121 ? 22.432 -8.627  12.684  0.50 9.27  ? 120 GLU A CA  1 
ATOM   1916 C CA  B GLU A 1 121 ? 22.432 -8.627  12.681  0.50 9.28  ? 120 GLU A CA  1 
ATOM   1917 C C   A GLU A 1 121 ? 22.377 -8.823  14.182  0.46 8.10  ? 120 GLU A C   1 
ATOM   1918 C C   B GLU A 1 121 ? 22.380 -8.823  14.179  0.46 8.10  ? 120 GLU A C   1 
ATOM   1919 O O   A GLU A 1 121 ? 23.249 -8.380  14.918  0.49 10.34 ? 120 GLU A O   1 
ATOM   1920 O O   B GLU A 1 121 ? 23.249 -8.380  14.918  0.49 10.35 ? 120 GLU A O   1 
ATOM   1921 C CB  A GLU A 1 121 ? 23.539 -7.620  12.305  0.54 11.26 ? 120 GLU A CB  1 
ATOM   1922 C CB  B GLU A 1 121 ? 23.539 -7.620  12.305  0.46 11.26 ? 120 GLU A CB  1 
ATOM   1923 C CG  A GLU A 1 121 ? 23.819 -7.656  10.783  0.56 13.52 ? 120 GLU A CG  1 
ATOM   1924 C CG  B GLU A 1 121 ? 23.819 -7.656  10.783  0.44 13.52 ? 120 GLU A CG  1 
ATOM   1925 C CD  A GLU A 1 121 ? 24.248 -9.034  10.319  0.47 18.44 ? 120 GLU A CD  1 
ATOM   1926 C CD  B GLU A 1 121 ? 24.248 -9.034  10.319  0.47 18.44 ? 120 GLU A CD  1 
ATOM   1927 O OE1 A GLU A 1 121 ? 25.476 -9.280  10.611  0.44 28.74 ? 120 GLU A OE1 1 
ATOM   1928 O OE1 B GLU A 1 121 ? 25.476 -9.280  10.611  0.44 28.71 ? 120 GLU A OE1 1 
ATOM   1929 O OE2 A GLU A 1 121 ? 23.549 -9.861  9.749   0.47 21.79 ? 120 GLU A OE2 1 
ATOM   1930 O OE2 B GLU A 1 121 ? 23.549 -9.861  9.749   0.47 21.79 ? 120 GLU A OE2 1 
ATOM   1931 N N   A GLY A 1 122 ? 21.321 -9.460  14.661  0.50 7.48  ? 121 GLY A N   1 
ATOM   1932 N N   B GLY A 1 122 ? 21.328 -9.476  14.652  0.50 7.53  ? 121 GLY A N   1 
ATOM   1933 C CA  A GLY A 1 122 ? 21.253 -9.717  16.077  0.53 8.75  ? 121 GLY A CA  1 
ATOM   1934 C CA  B GLY A 1 122 ? 21.254 -9.748  16.065  0.47 8.75  ? 121 GLY A CA  1 
ATOM   1935 C C   A GLY A 1 122 ? 20.700 -8.643  16.986  0.50 8.52  ? 121 GLY A C   1 
ATOM   1936 C C   B GLY A 1 122 ? 20.704 -8.668  16.970  0.50 8.53  ? 121 GLY A C   1 
ATOM   1937 O O   A GLY A 1 122 ? 20.712 -8.822  18.192  0.50 10.75 ? 121 GLY A O   1 
ATOM   1938 O O   B GLY A 1 122 ? 20.723 -8.833  18.179  0.50 10.75 ? 121 GLY A O   1 
ATOM   1939 N N   A VAL A 1 123 ? 20.187 -7.547  16.397  0.50 7.70  ? 122 VAL A N   1 
ATOM   1940 N N   B VAL A 1 123 ? 20.170 -7.583  16.394  0.50 7.82  ? 122 VAL A N   1 
ATOM   1941 C CA  A VAL A 1 123 ? 19.602 -6.463  17.155  0.49 7.68  ? 122 VAL A CA  1 
ATOM   1942 C CA  B VAL A 1 123 ? 19.615 -6.524  17.208  0.49 7.34  ? 122 VAL A CA  1 
ATOM   1943 C C   A VAL A 1 123 ? 18.119 -6.391  16.754  0.51 7.93  ? 122 VAL A C   1 
ATOM   1944 C C   B VAL A 1 123 ? 18.138 -6.334  16.854  0.49 8.18  ? 122 VAL A C   1 
ATOM   1945 O O   A VAL A 1 123 ? 17.767 -6.653  15.613  0.51 7.89  ? 122 VAL A O   1 
ATOM   1946 O O   B VAL A 1 123 ? 17.804 -6.190  15.682  0.49 8.35  ? 122 VAL A O   1 
ATOM   1947 C CB  A VAL A 1 123 ? 20.319 -5.136  16.848  0.51 12.28 ? 122 VAL A CB  1 
ATOM   1948 C CB  B VAL A 1 123 ? 20.328 -5.193  16.907  0.49 12.64 ? 122 VAL A CB  1 
ATOM   1949 C CG1 A VAL A 1 123 ? 19.781 -3.989  17.690  0.55 15.48 ? 122 VAL A CG1 1 
ATOM   1950 C CG1 B VAL A 1 123 ? 19.759 -4.036  17.709  0.45 15.44 ? 122 VAL A CG1 1 
ATOM   1951 C CG2 A VAL A 1 123 ? 21.800 -5.290  17.161  0.50 16.30 ? 122 VAL A CG2 1 
ATOM   1952 C CG2 B VAL A 1 123 ? 21.813 -5.316  17.192  0.50 16.06 ? 122 VAL A CG2 1 
ATOM   1953 N N   A GLU A 1 124 ? 17.287 -6.067  17.703  0.54 9.70  ? 123 GLU A N   1 
ATOM   1954 N N   B GLU A 1 124 ? 17.307 -6.313  17.872  0.46 7.42  ? 123 GLU A N   1 
ATOM   1955 C CA  A GLU A 1 124 ? 15.857 -5.954  17.465  0.52 7.68  ? 123 GLU A CA  1 
ATOM   1956 C CA  B GLU A 1 124 ? 15.892 -6.067  17.631  0.48 8.43  ? 123 GLU A CA  1 
ATOM   1957 C C   A GLU A 1 124 ? 15.422 -4.591  17.919  0.47 10.17 ? 123 GLU A C   1 
ATOM   1958 C C   B GLU A 1 124 ? 15.517 -4.606  17.954  0.47 9.76  ? 123 GLU A C   1 
ATOM   1959 O O   A GLU A 1 124 ? 15.771 -4.185  19.034  0.47 11.63 ? 123 GLU A O   1 
ATOM   1960 O O   B GLU A 1 124 ? 16.080 -3.933  18.818  0.47 11.41 ? 123 GLU A O   1 
ATOM   1961 C CB  A GLU A 1 124 ? 15.159 -6.915  18.467  0.51 12.18 ? 123 GLU A CB  1 
ATOM   1962 C CB  B GLU A 1 124 ? 15.118 -7.074  18.524  0.49 13.70 ? 123 GLU A CB  1 
ATOM   1963 C CG  A GLU A 1 124 ? 13.620 -7.013  18.433  0.48 14.05 ? 123 GLU A CG  1 
ATOM   1964 C CG  B GLU A 1 124 ? 13.607 -6.879  18.674  0.47 13.82 ? 123 GLU A CG  1 
ATOM   1965 C CD  A GLU A 1 124 ? 12.968 -7.938  19.460  0.48 14.87 ? 123 GLU A CD  1 
ATOM   1966 C CD  B GLU A 1 124 ? 13.072 -7.450  19.977  0.47 15.41 ? 123 GLU A CD  1 
ATOM   1967 O OE1 A GLU A 1 124 ? 13.529 -8.524  20.372  0.49 12.10 ? 123 GLU A OE1 1 
ATOM   1968 O OE1 B GLU A 1 124 ? 13.747 -7.794  20.927  0.50 16.58 ? 123 GLU A OE1 1 
ATOM   1969 O OE2 A GLU A 1 124 ? 11.687 -8.041  19.244  0.52 24.83 ? 123 GLU A OE2 1 
ATOM   1970 O OE2 B GLU A 1 124 ? 11.779 -7.516  19.974  0.48 23.22 ? 123 GLU A OE2 1 
ATOM   1971 N N   A ALA A 1 125 ? 14.609 -3.933  17.105  0.49 7.77  ? 124 ALA A N   1 
ATOM   1972 N N   B ALA A 1 125 ? 14.530 -4.077  17.252  0.49 7.94  ? 124 ALA A N   1 
ATOM   1973 C CA  A ALA A 1 125 ? 14.029 -2.653  17.481  0.52 8.13  ? 124 ALA A CA  1 
ATOM   1974 C CA  B ALA A 1 125 ? 14.024 -2.750  17.562  0.48 8.11  ? 124 ALA A CA  1 
ATOM   1975 C C   A ALA A 1 125 ? 12.556 -2.663  17.123  0.50 6.19  ? 124 ALA A C   1 
ATOM   1976 C C   B ALA A 1 125 ? 12.525 -2.843  17.365  0.50 6.05  ? 124 ALA A C   1 
ATOM   1977 O O   A ALA A 1 125 ? 12.116 -3.321  16.209  0.51 6.56  ? 124 ALA A O   1 
ATOM   1978 O O   B ALA A 1 125 ? 12.053 -3.640  16.597  0.49 6.13  ? 124 ALA A O   1 
ATOM   1979 C CB  A ALA A 1 125 ? 14.684 -1.475  16.788  0.56 13.18 ? 124 ALA A CB  1 
ATOM   1980 C CB  B ALA A 1 125 ? 14.601 -1.619  16.707  0.44 13.00 ? 124 ALA A CB  1 
ATOM   1981 N N   A LYS A 1 126 ? 11.801 -1.845  17.850  0.50 6.97  ? 125 LYS A N   1 
ATOM   1982 N N   B LYS A 1 126 ? 11.773 -2.020  18.095  0.50 6.12  ? 125 LYS A N   1 
ATOM   1983 C CA  A LYS A 1 126 ? 10.394 -1.753  17.540  0.54 4.72  ? 125 LYS A CA  1 
ATOM   1984 C CA  B LYS A 1 126 ? 10.343 -1.984  17.860  0.46 6.64  ? 125 LYS A CA  1 
ATOM   1985 C C   A LYS A 1 126 ? 10.018 -0.298  17.468  0.55 7.20  ? 125 LYS A C   1 
ATOM   1986 C C   B LYS A 1 126 ? 9.961  -0.539  17.741  0.45 6.76  ? 125 LYS A C   1 
ATOM   1987 O O   A LYS A 1 126 ? 10.618 0.556   18.145  0.51 7.26  ? 125 LYS A O   1 
ATOM   1988 O O   B LYS A 1 126 ? 10.503 0.319   18.442  0.49 8.20  ? 125 LYS A O   1 
ATOM   1989 C CB  A LYS A 1 126 ? 9.557  -2.406  18.658  0.52 9.97  ? 125 LYS A CB  1 
ATOM   1990 C CB  B LYS A 1 126 ? 9.470  -2.503  19.009  0.48 8.94  ? 125 LYS A CB  1 
ATOM   1991 C CG  A LYS A 1 126 ? 9.818  -3.902  18.912  0.54 6.60  ? 125 LYS A CG  1 
ATOM   1992 C CG  B LYS A 1 126 ? 9.606  -3.933  19.551  0.46 13.49 ? 125 LYS A CG  1 
ATOM   1993 C CD  A LYS A 1 126 ? 8.953  -4.545  20.009  0.55 12.64 ? 125 LYS A CD  1 
ATOM   1994 C CD  B LYS A 1 126 ? 8.671  -4.087  20.776  0.45 15.97 ? 125 LYS A CD  1 
ATOM   1995 C CE  A LYS A 1 126 ? 9.274  -6.005  20.300  0.58 14.93 ? 125 LYS A CE  1 
ATOM   1996 C CE  B LYS A 1 126 ? 8.751  -5.239  21.816  0.42 27.03 ? 125 LYS A CE  1 
ATOM   1997 N NZ  A LYS A 1 126 ? 9.000  -6.838  19.125  0.48 19.16 ? 125 LYS A NZ  1 
ATOM   1998 N NZ  B LYS A 1 126 ? 7.891  -5.033  23.035  0.52 15.69 ? 125 LYS A NZ  1 
ATOM   1999 N N   A ARG A 1 127 ? 9.020  -0.025  16.644  0.54 5.45  ? 126 ARG A N   1 
ATOM   2000 N N   B ARG A 1 127 ? 8.992  -0.246  16.888  0.46 6.32  ? 126 ARG A N   1 
ATOM   2001 C CA  A ARG A 1 127 ? 8.345  1.281   16.550  0.55 5.39  ? 126 ARG A CA  1 
ATOM   2002 C CA  B ARG A 1 127 ? 8.397  1.096   16.751  0.45 5.88  ? 126 ARG A CA  1 
ATOM   2003 C C   A ARG A 1 127 ? 6.882  0.977   16.650  0.52 4.79  ? 126 ARG A C   1 
ATOM   2004 C C   B ARG A 1 127 ? 6.936  0.828   16.932  0.48 4.99  ? 126 ARG A C   1 
ATOM   2005 O O   A ARG A 1 127 ? 6.370  0.144   15.924  0.51 5.55  ? 126 ARG A O   1 
ATOM   2006 O O   B ARG A 1 127 ? 6.421  -0.082  16.303  0.49 5.32  ? 126 ARG A O   1 
ATOM   2007 C CB  A ARG A 1 127 ? 8.696  2.098   15.353  0.53 7.90  ? 126 ARG A CB  1 
ATOM   2008 C CB  B ARG A 1 127 ? 8.659  1.754   15.397  0.47 7.85  ? 126 ARG A CB  1 
ATOM   2009 C CG  A ARG A 1 127 ? 10.192 2.170   15.234  0.53 9.17  ? 126 ARG A CG  1 
ATOM   2010 C CG  B ARG A 1 127 ? 10.133 2.047   15.150  0.47 9.14  ? 126 ARG A CG  1 
ATOM   2011 C CD  A ARG A 1 127 ? 10.464 3.219   14.191  0.53 12.31 ? 126 ARG A CD  1 
ATOM   2012 C CD  B ARG A 1 127 ? 10.386 3.193   14.169  0.47 12.38 ? 126 ARG A CD  1 
ATOM   2013 N NE  A ARG A 1 127 ? 10.252 4.515   14.805  0.52 10.31 ? 126 ARG A NE  1 
ATOM   2014 N NE  B ARG A 1 127 ? 10.227 4.499   14.808  0.48 10.21 ? 126 ARG A NE  1 
ATOM   2015 C CZ  A ARG A 1 127 ? 10.269 5.666   14.160  0.52 9.03  ? 126 ARG A CZ  1 
ATOM   2016 C CZ  B ARG A 1 127 ? 10.265 5.661   14.166  0.48 9.04  ? 126 ARG A CZ  1 
ATOM   2017 N NH1 A ARG A 1 127 ? 10.408 5.692   12.847  0.53 10.86 ? 126 ARG A NH1 1 
ATOM   2018 N NH1 B ARG A 1 127 ? 10.405 5.697   12.850  0.47 10.83 ? 126 ARG A NH1 1 
ATOM   2019 N NH2 A ARG A 1 127 ? 10.099 6.813   14.824  0.52 10.36 ? 126 ARG A NH2 1 
ATOM   2020 N NH2 B ARG A 1 127 ? 10.113 6.813   14.830  0.48 10.38 ? 126 ARG A NH2 1 
ATOM   2021 N N   A ILE A 1 128 ? 6.234  1.564   17.653  0.50 6.49  ? 127 ILE A N   1 
ATOM   2022 N N   B ILE A 1 128 ? 6.286  1.574   17.844  0.50 6.10  ? 127 ILE A N   1 
ATOM   2023 C CA  A ILE A 1 128 ? 4.844  1.240   17.957  0.49 5.50  ? 127 ILE A CA  1 
ATOM   2024 C CA  B ILE A 1 128 ? 4.882  1.342   18.135  0.49 5.56  ? 127 ILE A CA  1 
ATOM   2025 C C   A ILE A 1 128 ? 4.023  2.468   17.725  0.46 5.16  ? 127 ILE A C   1 
ATOM   2026 C C   B ILE A 1 128 ? 4.035  2.504   17.678  0.46 5.39  ? 127 ILE A C   1 
ATOM   2027 O O   A ILE A 1 128 ? 4.349  3.538   18.251  0.48 5.99  ? 127 ILE A O   1 
ATOM   2028 O O   B ILE A 1 128 ? 4.364  3.666   17.925  0.48 6.72  ? 127 ILE A O   1 
ATOM   2029 C CB  A ILE A 1 128 ? 4.722  0.725   19.404  0.51 8.21  ? 127 ILE A CB  1 
ATOM   2030 C CB  B ILE A 1 128 ? 4.667  0.998   19.605  0.49 6.66  ? 127 ILE A CB  1 
ATOM   2031 C CG1 A ILE A 1 128 ? 5.736  -0.370  19.730  0.49 9.62  ? 127 ILE A CG1 1 
ATOM   2032 C CG1 B ILE A 1 128 ? 5.411  -0.293  19.927  0.47 8.26  ? 127 ILE A CG1 1 
ATOM   2033 C CG2 A ILE A 1 128 ? 3.311  0.335   19.839  0.52 8.58  ? 127 ILE A CG2 1 
ATOM   2034 C CG2 B ILE A 1 128 ? 3.172  0.833   19.846  0.47 6.76  ? 127 ILE A CG2 1 
ATOM   2035 C CD1 A ILE A 1 128 ? 5.771  -0.766  21.208  0.52 10.33 ? 127 ILE A CD1 1 
ATOM   2036 C CD1 B ILE A 1 128 ? 6.751  -0.087  20.613  0.43 14.72 ? 127 ILE A CD1 1 
ATOM   2037 N N   A PHE A 1 129 ? 2.979  2.278   16.907  0.50 6.94  ? 128 PHE A N   1 
ATOM   2038 N N   B PHE A 1 129 ? 2.934  2.211   16.967  0.50 6.76  ? 128 PHE A N   1 
ATOM   2039 C CA  A PHE A 1 129 ? 2.092  3.281   16.459  0.55 6.60  ? 128 PHE A CA  1 
ATOM   2040 C CA  B PHE A 1 129 ? 2.110  3.255   16.437  0.45 6.63  ? 128 PHE A CA  1 
ATOM   2041 C C   A PHE A 1 129 ? 0.742  3.199   17.152  0.50 8.26  ? 128 PHE A C   1 
ATOM   2042 C C   B PHE A 1 129 ? 0.728  3.224   17.029  0.50 8.43  ? 128 PHE A C   1 
ATOM   2043 O O   A PHE A 1 129 ? 0.314  2.129   17.600  0.50 9.83  ? 128 PHE A O   1 
ATOM   2044 O O   B PHE A 1 129 ? 0.202  2.139   17.230  0.50 8.28  ? 128 PHE A O   1 
ATOM   2045 C CB  A PHE A 1 129 ? 1.899  3.075   14.940  0.54 8.99  ? 128 PHE A CB  1 
ATOM   2046 C CB  B PHE A 1 129 ? 1.920  3.044   14.924  0.46 9.15  ? 128 PHE A CB  1 
ATOM   2047 C CG  A PHE A 1 129 ? 3.184  3.106   14.116  0.54 7.44  ? 128 PHE A CG  1 
ATOM   2048 C CG  B PHE A 1 129 ? 3.195  3.096   14.103  0.46 7.45  ? 128 PHE A CG  1 
ATOM   2049 C CD1 A PHE A 1 129 ? 4.074  2.047   14.119  0.51 8.78  ? 128 PHE A CD1 1 
ATOM   2050 C CD1 B PHE A 1 129 ? 4.085  2.042   14.113  0.49 8.88  ? 128 PHE A CD1 1 
ATOM   2051 C CD2 A PHE A 1 129 ? 3.499  4.211   13.333  0.54 10.43 ? 128 PHE A CD2 1 
ATOM   2052 C CD2 B PHE A 1 129 ? 3.503  4.211   13.327  0.46 10.47 ? 128 PHE A CD2 1 
ATOM   2053 C CE1 A PHE A 1 129 ? 5.241  2.093   13.361  0.51 8.97  ? 128 PHE A CE1 1 
ATOM   2054 C CE1 B PHE A 1 129 ? 5.251  2.093   13.355  0.49 8.88  ? 128 PHE A CE1 1 
ATOM   2055 C CE2 A PHE A 1 129 ? 4.655  4.288   12.578  0.54 11.47 ? 128 PHE A CE2 1 
ATOM   2056 C CE2 B PHE A 1 129 ? 4.658  4.294   12.575  0.46 11.45 ? 128 PHE A CE2 1 
ATOM   2057 C CZ  A PHE A 1 129 ? 5.538  3.219   12.597  0.52 9.62  ? 128 PHE A CZ  1 
ATOM   2058 C CZ  B PHE A 1 129 ? 5.545  3.224   12.597  0.48 9.63  ? 128 PHE A CZ  1 
ATOM   2059 N N   A LYS A 1 130 ? 0.128  4.366   17.205  0.52 9.14  ? 129 LYS A N   1 
ATOM   2060 N N   B LYS A 1 130 ? 0.174  4.412   17.246  0.48 8.76  ? 129 LYS A N   1 
ATOM   2061 C CA  A LYS A 1 130 ? -1.217 4.494   17.722  0.52 9.68  ? 129 LYS A CA  1 
ATOM   2062 C CA  B LYS A 1 130 ? -1.196 4.494   17.716  0.48 9.85  ? 129 LYS A CA  1 
ATOM   2063 C C   A LYS A 1 130 ? -2.053 4.859   16.528  0.51 8.86  ? 129 LYS A C   1 
ATOM   2064 C C   B LYS A 1 130 ? -2.038 4.854   16.525  0.49 8.80  ? 129 LYS A C   1 
ATOM   2065 O O   A LYS A 1 130 ? -1.642 5.584   15.632  0.50 9.96  ? 129 LYS A O   1 
ATOM   2066 O O   B LYS A 1 130 ? -1.638 5.584   15.626  0.50 9.97  ? 129 LYS A O   1 
ATOM   2067 C CB  A LYS A 1 130 ? -1.362 5.512   18.831  0.52 11.91 ? 129 LYS A CB  1 
ATOM   2068 C CB  B LYS A 1 130 ? -1.380 5.502   18.834  0.48 11.87 ? 129 LYS A CB  1 
ATOM   2069 C CG  A LYS A 1 130 ? -0.843 4.916   20.137  0.48 15.14 ? 129 LYS A CG  1 
ATOM   2070 C CG  B LYS A 1 130 ? -0.843 4.911   20.134  0.48 15.15 ? 129 LYS A CG  1 
ATOM   2071 C CD  A LYS A 1 130 ? -1.037 5.790   21.359  0.45 20.25 ? 129 LYS A CD  1 
ATOM   2072 C CD  B LYS A 1 130 ? -1.037 5.790   21.356  0.45 20.23 ? 129 LYS A CD  1 
ATOM   2073 C CE  A LYS A 1 130 ? -0.396 5.235   22.631  0.50 26.47 ? 129 LYS A CE  1 
ATOM   2074 C CE  B LYS A 1 130 ? -0.400 5.235   22.631  0.50 26.38 ? 129 LYS A CE  1 
ATOM   2075 N NZ  A LYS A 1 130 ? -0.681 3.811   22.903  0.55 28.54 ? 129 LYS A NZ  1 
ATOM   2076 N NZ  B LYS A 1 130 ? -0.681 3.816   22.903  0.45 28.53 ? 129 LYS A NZ  1 
ATOM   2077 N N   A LYS A 1 131 ? -3.251 4.318   16.532  0.50 10.22 ? 130 LYS A N   1 
ATOM   2078 N N   B LYS A 1 131 ? -3.253 4.335   16.528  0.50 10.26 ? 130 LYS A N   1 
ATOM   2079 C CA  A LYS A 1 131 ? -4.269 4.596   15.538  0.50 13.77 ? 130 LYS A CA  1 
ATOM   2080 C CA  B LYS A 1 131 ? -4.192 4.587   15.466  0.50 13.79 ? 130 LYS A CA  1 
ATOM   2081 C C   A LYS A 1 131 ? -4.797 6.049   15.636  0.48 13.04 ? 130 LYS A C   1 
ATOM   2082 C C   B LYS A 1 131 ? -4.727 6.006   15.629  0.48 13.04 ? 130 LYS A C   1 
ATOM   2083 O O   A LYS A 1 131 ? -5.357 6.454   16.670  0.46 17.81 ? 130 LYS A O   1 
ATOM   2084 O O   B LYS A 1 131 ? -5.136 6.381   16.729  0.46 17.81 ? 130 LYS A O   1 
ATOM   2085 C CB  A LYS A 1 131 ? -5.315 3.487   15.569  0.48 16.46 ? 130 LYS A CB  1 
ATOM   2086 C CB  B LYS A 1 131 ? -5.268 3.538   15.751  0.48 16.46 ? 130 LYS A CB  1 
ATOM   2087 C CG  A LYS A 1 131 ? -6.350 3.599   14.442  0.40 35.04 ? 130 LYS A CG  1 
ATOM   2088 C CG  B LYS A 1 131 ? -6.427 3.486   14.811  0.40 35.06 ? 130 LYS A CG  1 
ATOM   2089 C CD  A LYS A 1 131 ? -5.717 3.726   13.053  0.48 28.19 ? 130 LYS A CD  1 
ATOM   2090 C CD  B LYS A 1 131 ? -5.871 3.065   13.489  0.48 28.19 ? 130 LYS A CD  1 
ATOM   2091 C CE  A LYS A 1 131 ? -6.325 2.769   12.021  0.44 52.50 ? 130 LYS A CE  1 
ATOM   2092 C CE  B LYS A 1 131 ? -6.902 2.880   12.427  0.44 52.49 ? 130 LYS A CE  1 
ATOM   2093 N NZ  A LYS A 1 131 ? -5.380 2.383   10.960  0.34 44.64 ? 130 LYS A NZ  1 
ATOM   2094 N NZ  B LYS A 1 131 ? -6.267 2.838   11.118  0.34 44.64 ? 130 LYS A NZ  1 
ATOM   2095 N N   A GLU A 1 132 ? -4.606 6.747   14.511  0.50 14.24 ? 131 GLU A N   1 
ATOM   2096 N N   B GLU A 1 132 ? -4.606 6.747   14.511  0.50 14.23 ? 131 GLU A N   1 
ATOM   2097 C CA  A GLU A 1 132 ? -5.343 7.985   14.132  0.49 17.94 ? 131 GLU A CA  1 
ATOM   2098 C CA  B GLU A 1 132 ? -5.343 7.985   14.132  0.49 17.93 ? 131 GLU A CA  1 
ATOM   2099 C C   A GLU A 1 132 ? -4.385 9.186   14.060  0.51 34.65 ? 131 GLU A C   1 
ATOM   2100 C C   B GLU A 1 132 ? -4.536 9.278   14.340  0.49 34.65 ? 131 GLU A C   1 
ATOM   2101 O O   A GLU A 1 132 ? -4.247 9.942   15.032  0.46 59.26 ? 131 GLU A O   1 
ATOM   2102 O O   B GLU A 1 132 ? -4.554 9.864   15.432  0.46 59.25 ? 131 GLU A O   1 
ATOM   2103 C CB  A GLU A 1 132 ? -6.628 8.132   14.942  0.48 55.49 ? 131 GLU A CB  1 
ATOM   2104 C CB  B GLU A 1 132 ? -6.686 7.848   14.844  0.46 54.00 ? 131 GLU A CB  1 
ATOM   2105 C CG  A GLU A 1 132 ? -7.989 8.648   14.448  0.50 56.89 ? 131 GLU A CG  1 
ATOM   2106 C CG  B GLU A 1 132 ? -8.065 8.290   14.329  0.48 55.70 ? 131 GLU A CG  1 
ATOM   2107 C CD  A GLU A 1 132 ? -7.876 9.661   13.300  0.49 55.23 ? 131 GLU A CD  1 
ATOM   2108 C CD  B GLU A 1 132 ? -8.003 9.493   13.378  0.50 53.80 ? 131 GLU A CD  1 
ATOM   2109 O OE1 A GLU A 1 132 ? -7.336 9.314   12.179  0.48 52.30 ? 131 GLU A OE1 1 
ATOM   2110 O OE1 B GLU A 1 132 ? -7.353 9.407   12.264  0.48 55.00 ? 131 GLU A OE1 1 
ATOM   2111 O OE2 A GLU A 1 132 ? -8.329 10.861  13.449  0.50 55.24 ? 131 GLU A OE2 1 
ATOM   2112 O OE2 B GLU A 1 132 ? -8.607 10.592  13.684  0.48 55.78 ? 131 GLU A OE2 1 
ATOM   2113 O OXT A GLU A 1 132 ? -4.998 9.044   12.647  0.47 33.87 ? 131 GLU A OXT 1 
ATOM   2114 O OXT B GLU A 1 132 ? -5.035 9.317   12.877  0.47 33.87 ? 131 GLU A OXT 1 
HETATM 2115 O O   A HOH B 2 .   ? 8.234  -1.532  3.079   0.51 18.12 ? 133 HOH A O   1 
HETATM 2116 O O   B HOH B 2 .   ? 8.234  -1.532  3.079   0.49 18.12 ? 133 HOH A O   1 
HETATM 2117 O O   A HOH B 2 .   ? 5.925  -0.170  3.969   0.52 19.24 ? 134 HOH A O   1 
HETATM 2118 O O   B HOH B 2 .   ? 5.925  -0.170  3.969   0.48 19.24 ? 134 HOH A O   1 
HETATM 2119 O O   A HOH B 2 .   ? 6.015  -7.759  -1.497  0.50 9.99  ? 135 HOH A O   1 
HETATM 2120 O O   B HOH B 2 .   ? 6.015  -7.759  -1.497  0.50 9.99  ? 135 HOH A O   1 
HETATM 2121 O O   A HOH B 2 .   ? 11.233 3.491   10.918  0.49 22.29 ? 136 HOH A O   1 
HETATM 2122 O O   B HOH B 2 .   ? 11.233 3.491   10.918  0.49 22.29 ? 136 HOH A O   1 
HETATM 2123 O O   A HOH B 2 .   ? 13.579 6.921   11.569  0.55 13.45 ? 137 HOH A O   1 
HETATM 2124 O O   B HOH B 2 .   ? 13.579 6.921   11.569  0.45 13.45 ? 137 HOH A O   1 
HETATM 2125 O O   A HOH B 2 .   ? 10.554 -1.028  13.555  0.45 24.51 ? 138 HOH A O   1 
HETATM 2126 O O   B HOH B 2 .   ? 10.716 -1.013  13.518  0.45 24.04 ? 138 HOH A O   1 
HETATM 2127 O O   A HOH B 2 .   ? 10.790 5.018   8.017   0.43 42.27 ? 139 HOH A O   1 
HETATM 2128 O O   B HOH B 2 .   ? 10.790 5.018   8.017   0.43 42.27 ? 139 HOH A O   1 
HETATM 2129 O O   A HOH B 2 .   ? 8.301  2.746   11.234  0.27 89.48 ? 140 HOH A O   1 
HETATM 2130 O O   B HOH B 2 .   ? 8.301  2.746   11.234  0.27 89.48 ? 140 HOH A O   1 
HETATM 2131 O O   A HOH B 2 .   ? 13.448 4.458   7.559   0.47 19.53 ? 141 HOH A O   1 
HETATM 2132 O O   B HOH B 2 .   ? 12.159 3.898   6.554   0.53 19.54 ? 141 HOH A O   1 
HETATM 2133 O O   A HOH B 2 .   ? 3.551  -3.491  5.128   0.43 55.86 ? 142 HOH A O   1 
HETATM 2134 O O   B HOH B 2 .   ? 3.704  -3.813  4.902   0.43 55.86 ? 142 HOH A O   1 
HETATM 2135 O O   A HOH B 2 .   ? 16.892 4.695   8.862   0.51 40.02 ? 143 HOH A O   1 
HETATM 2136 O O   B HOH B 2 .   ? 16.892 4.695   8.862   0.49 40.02 ? 143 HOH A O   1 
HETATM 2137 O O   A HOH B 2 .   ? 14.057 -1.707  8.850   0.43 52.18 ? 144 HOH A O   1 
HETATM 2138 O O   B HOH B 2 .   ? 13.992 -1.644  9.150   0.43 55.83 ? 144 HOH A O   1 
HETATM 2139 O O   A HOH B 2 .   ? 9.321  8.731   16.863  0.48 15.82 ? 145 HOH A O   1 
HETATM 2140 O O   B HOH B 2 .   ? 9.373  8.248   17.622  0.47 12.16 ? 145 HOH A O   1 
HETATM 2141 O O   A HOH B 2 .   ? 12.885 2.669   8.975   0.35 32.43 ? 146 HOH A O   1 
HETATM 2142 O O   B HOH B 2 .   ? 12.885 2.669   8.975   0.35 32.43 ? 146 HOH A O   1 
HETATM 2143 O O   A HOH B 2 .   ? 6.880  2.011   5.216   0.47 31.46 ? 147 HOH A O   1 
HETATM 2144 O O   B HOH B 2 .   ? 6.880  2.011   5.216   0.47 31.46 ? 147 HOH A O   1 
HETATM 2145 O O   A HOH B 2 .   ? 8.302  2.417   7.904   0.51 29.36 ? 148 HOH A O   1 
HETATM 2146 O O   B HOH B 2 .   ? 8.302  2.417   7.904   0.49 29.36 ? 148 HOH A O   1 
HETATM 2147 O O   A HOH B 2 .   ? 18.149 8.674   10.457  0.49 34.98 ? 149 HOH A O   1 
HETATM 2148 O O   B HOH B 2 .   ? 18.149 8.674   10.457  0.49 34.98 ? 149 HOH A O   1 
HETATM 2149 O O   A HOH B 2 .   ? 15.423 3.096   9.787   0.43 36.26 ? 150 HOH A O   1 
HETATM 2150 O O   B HOH B 2 .   ? 15.423 3.096   9.787   0.43 36.26 ? 150 HOH A O   1 
HETATM 2151 O O   A HOH B 2 .   ? 11.286 -2.396  5.676   0.37 37.63 ? 151 HOH A O   1 
HETATM 2152 O O   B HOH B 2 .   ? 9.663  -1.362  5.332   0.43 28.36 ? 151 HOH A O   1 
HETATM 2153 O O   A HOH B 2 .   ? 8.639  8.859   5.692   0.46 14.30 ? 152 HOH A O   1 
HETATM 2154 O O   B HOH B 2 .   ? 10.303 8.242   6.388   0.47 16.89 ? 152 HOH A O   1 
HETATM 2155 O O   A HOH B 2 .   ? 11.236 7.579   8.696   0.50 25.44 ? 153 HOH A O   1 
HETATM 2156 O O   B HOH B 2 .   ? 11.236 7.579   8.696   0.50 25.44 ? 153 HOH A O   1 
HETATM 2157 O O   A HOH B 2 .   ? 9.527  0.129   7.058   0.47 47.34 ? 154 HOH A O   1 
HETATM 2158 O O   B HOH B 2 .   ? 9.527  0.134   7.067   0.47 46.94 ? 154 HOH A O   1 
HETATM 2159 O O   A HOH B 2 .   ? 16.213 6.890   10.231  0.45 46.81 ? 155 HOH A O   1 
HETATM 2160 O O   B HOH B 2 .   ? 16.213 6.890   10.231  0.45 46.81 ? 155 HOH A O   1 
HETATM 2161 O O   A HOH B 2 .   ? 4.246  -0.936  12.074  0.43 40.39 ? 156 HOH A O   1 
HETATM 2162 O O   B HOH B 2 .   ? 0.601  1.327   11.682  0.46 25.85 ? 156 HOH A O   1 
HETATM 2163 O O   A HOH B 2 .   ? 5.594  -5.877  -5.025  0.51 11.79 ? 170 HOH A O   1 
HETATM 2164 O O   B HOH B 2 .   ? 5.594  -5.877  -5.025  0.49 11.79 ? 170 HOH A O   1 
HETATM 2165 O O   A HOH B 2 .   ? -7.277 -2.293  13.753  0.45 31.20 ? 171 HOH A O   1 
HETATM 2166 O O   B HOH B 2 .   ? -7.277 -2.293  13.753  0.45 31.20 ? 171 HOH A O   1 
HETATM 2167 O O   A HOH B 2 .   ? 16.311 -0.632  -3.073  0.46 23.53 ? 172 HOH A O   1 
HETATM 2168 O O   B HOH B 2 .   ? 16.311 -0.632  -3.073  0.46 23.53 ? 172 HOH A O   1 
HETATM 2169 O O   A HOH B 2 .   ? 4.559  13.888  17.123  0.33 54.91 ? 173 HOH A O   1 
HETATM 2170 O O   B HOH B 2 .   ? 4.559  13.888  17.123  0.33 54.91 ? 173 HOH A O   1 
HETATM 2171 O O   A HOH B 2 .   ? -3.324 -15.178 12.794  0.48 51.43 ? 174 HOH A O   1 
HETATM 2172 O O   B HOH B 2 .   ? -3.324 -15.178 12.794  0.48 51.43 ? 174 HOH A O   1 
HETATM 2173 O O   A HOH B 2 .   ? 8.504  10.988  16.331  0.47 15.61 ? 175 HOH A O   1 
HETATM 2174 O O   B HOH B 2 .   ? 8.504  10.988  16.331  0.47 15.61 ? 175 HOH A O   1 
HETATM 2175 O O   A HOH B 2 .   ? 7.152  0.571   24.670  0.48 26.89 ? 176 HOH A O   1 
HETATM 2176 O O   B HOH B 2 .   ? 7.152  0.571   24.670  0.48 26.89 ? 176 HOH A O   1 
HETATM 2177 O O   A HOH B 2 .   ? 5.450  -1.789  -6.654  0.50 20.03 ? 177 HOH A O   1 
HETATM 2178 O O   B HOH B 2 .   ? 5.450  -1.789  -6.654  0.50 20.03 ? 177 HOH A O   1 
HETATM 2179 O O   A HOH B 2 .   ? -2.310 1.574   24.106  0.49 34.58 ? 178 HOH A O   1 
HETATM 2180 O O   B HOH B 2 .   ? -2.310 1.574   24.106  0.49 34.58 ? 178 HOH A O   1 
HETATM 2181 O O   A HOH B 2 .   ? 4.402  -11.758 17.966  0.48 49.34 ? 179 HOH A O   1 
HETATM 2182 O O   B HOH B 2 .   ? 4.402  -11.758 17.966  0.48 49.34 ? 179 HOH A O   1 
HETATM 2183 O O   A HOH B 2 .   ? 14.822 1.502   24.228  0.43 22.01 ? 180 HOH A O   1 
HETATM 2184 O O   B HOH B 2 .   ? 14.822 1.502   24.228  0.43 22.01 ? 180 HOH A O   1 
HETATM 2185 O O   A HOH B 2 .   ? 21.421 9.553   6.118   0.38 41.50 ? 181 HOH A O   1 
HETATM 2186 O O   B HOH B 2 .   ? 21.421 9.553   6.118   0.38 41.50 ? 181 HOH A O   1 
HETATM 2187 O O   A HOH B 2 .   ? -6.834 -7.321  14.974  0.34 62.89 ? 182 HOH A O   1 
HETATM 2188 O O   B HOH B 2 .   ? -6.834 -7.321  14.974  0.34 62.89 ? 182 HOH A O   1 
HETATM 2189 O O   A HOH B 2 .   ? 19.535 -10.201 -5.326  0.40 47.61 ? 183 HOH A O   1 
HETATM 2190 O O   B HOH B 2 .   ? 19.535 -10.201 -5.326  0.40 47.61 ? 183 HOH A O   1 
HETATM 2191 O O   A HOH B 2 .   ? 21.289 0.083   24.918  0.46 47.49 ? 184 HOH A O   1 
HETATM 2192 O O   B HOH B 2 .   ? 21.289 0.083   24.918  0.46 47.49 ? 184 HOH A O   1 
HETATM 2193 O O   A HOH B 2 .   ? 25.445 -2.463  8.875   0.52 19.84 ? 185 HOH A O   1 
HETATM 2194 O O   B HOH B 2 .   ? 25.445 -2.463  8.875   0.48 19.84 ? 185 HOH A O   1 
HETATM 2195 O O   A HOH B 2 .   ? 9.652  17.626  14.182  0.52 28.75 ? 186 HOH A O   1 
HETATM 2196 O O   B HOH B 2 .   ? 9.467  15.749  15.162  0.48 20.79 ? 186 HOH A O   1 
HETATM 2197 O O   A HOH B 2 .   ? 26.700 -1.470  16.249  0.45 26.76 ? 187 HOH A O   1 
HETATM 2198 O O   B HOH B 2 .   ? 26.266 -1.331  17.631  0.49 29.82 ? 187 HOH A O   1 
HETATM 2199 O O   A HOH B 2 .   ? 27.937 -0.817  10.971  0.55 39.71 ? 188 HOH A O   1 
HETATM 2200 O O   B HOH B 2 .   ? 27.937 -0.817  10.971  0.45 39.71 ? 188 HOH A O   1 
HETATM 2201 O O   A HOH B 2 .   ? 24.983 2.093   6.428   0.52 16.25 ? 189 HOH A O   1 
HETATM 2202 O O   B HOH B 2 .   ? 23.171 2.432   6.397   0.42 26.41 ? 189 HOH A O   1 
HETATM 2203 O O   A HOH B 2 .   ? 13.511 14.135  12.312  0.49 12.61 ? 190 HOH A O   1 
HETATM 2204 O O   B HOH B 2 .   ? 13.511 14.135  12.312  0.49 12.61 ? 190 HOH A O   1 
HETATM 2205 O O   A HOH B 2 .   ? -8.878 9.697   5.987   0.39 70.33 ? 191 HOH A O   1 
HETATM 2206 O O   B HOH B 2 .   ? -8.878 9.697   5.987   0.39 70.33 ? 191 HOH A O   1 
HETATM 2207 O O   A HOH B 2 .   ? 15.728 14.932  17.788  0.50 12.65 ? 192 HOH A O   1 
HETATM 2208 O O   B HOH B 2 .   ? 15.728 14.932  17.788  0.50 12.65 ? 192 HOH A O   1 
HETATM 2209 O O   A HOH B 2 .   ? 17.044 15.235  20.319  0.54 17.99 ? 193 HOH A O   1 
HETATM 2210 O O   B HOH B 2 .   ? 17.044 15.235  20.319  0.46 17.99 ? 193 HOH A O   1 
HETATM 2211 O O   A HOH B 2 .   ? 3.355  10.376  2.046   0.50 22.73 ? 194 HOH A O   1 
HETATM 2212 O O   B HOH B 2 .   ? 3.355  10.376  2.046   0.50 22.73 ? 194 HOH A O   1 
HETATM 2213 O O   A HOH B 2 .   ? 0.837  9.013   5.983   0.48 18.20 ? 195 HOH A O   1 
HETATM 2214 O O   B HOH B 2 .   ? 0.837  9.013   5.983   0.48 18.20 ? 195 HOH A O   1 
HETATM 2215 O O   A HOH B 2 .   ? 5.318  15.219  6.732   0.47 49.48 ? 196 HOH A O   1 
HETATM 2216 O O   B HOH B 2 .   ? 5.318  15.219  6.732   0.47 49.48 ? 196 HOH A O   1 
HETATM 2217 O O   A HOH B 2 .   ? -2.611 4.509   1.557   0.52 15.18 ? 197 HOH A O   1 
HETATM 2218 O O   B HOH B 2 .   ? -2.611 4.509   1.557   0.48 15.18 ? 197 HOH A O   1 
HETATM 2219 O O   A HOH B 2 .   ? 10.195 6.243   22.496  0.41 17.93 ? 198 HOH A O   1 
HETATM 2220 O O   B HOH B 2 .   ? 10.195 6.243   22.496  0.41 17.93 ? 198 HOH A O   1 
HETATM 2221 O O   A HOH B 2 .   ? -3.058 -0.406  -2.938  0.54 17.52 ? 199 HOH A O   1 
HETATM 2222 O O   B HOH B 2 .   ? -3.058 -0.406  -2.938  0.46 17.52 ? 199 HOH A O   1 
HETATM 2223 O O   A HOH B 2 .   ? -4.944 -4.895  -6.854  0.50 22.97 ? 200 HOH A O   1 
HETATM 2224 O O   B HOH B 2 .   ? -4.944 -4.895  -6.854  0.50 22.97 ? 200 HOH A O   1 
HETATM 2225 O O   A HOH B 2 .   ? 7.705  15.682  0.470   0.43 28.52 ? 201 HOH A O   1 
HETATM 2226 O O   B HOH B 2 .   ? 7.705  15.682  0.470   0.43 28.52 ? 201 HOH A O   1 
HETATM 2227 O O   A HOH B 2 .   ? 7.237  3.445   -4.342  0.39 62.41 ? 202 HOH A O   1 
HETATM 2228 O O   B HOH B 2 .   ? 7.237  3.445   -4.342  0.39 62.41 ? 202 HOH A O   1 
HETATM 2229 O O   A HOH B 2 .   ? -5.431 -8.406  7.757   0.33 40.92 ? 203 HOH A O   1 
HETATM 2230 O O   B HOH B 2 .   ? -5.431 -8.406  7.757   0.33 40.92 ? 203 HOH A O   1 
HETATM 2231 O O   A HOH B 2 .   ? -1.352 -17.348 7.180   0.56 34.63 ? 204 HOH A O   1 
HETATM 2232 O O   B HOH B 2 .   ? -1.352 -17.348 7.180   0.44 34.63 ? 204 HOH A O   1 
HETATM 2233 O O   A HOH B 2 .   ? -9.102 -7.311  -1.566  0.45 82.89 ? 205 HOH A O   1 
HETATM 2234 O O   B HOH B 2 .   ? -9.106 -7.311  -1.566  0.45 83.01 ? 205 HOH A O   1 
HETATM 2235 O O   A HOH B 2 .   ? 8.298  -11.975 -7.450  0.47 34.32 ? 206 HOH A O   1 
HETATM 2236 O O   B HOH B 2 .   ? 6.935  -13.337 -6.942  0.53 50.82 ? 206 HOH A O   1 
HETATM 2237 O O   A HOH B 2 .   ? 9.872  13.548  0.144   0.53 24.27 ? 207 HOH A O   1 
HETATM 2238 O O   B HOH B 2 .   ? 9.872  13.548  0.144   0.47 24.27 ? 207 HOH A O   1 
HETATM 2239 O O   A HOH B 2 .   ? 13.251 8.905   -0.764  0.55 33.89 ? 208 HOH A O   1 
HETATM 2240 O O   B HOH B 2 .   ? 13.251 8.905   -0.764  0.45 33.89 ? 208 HOH A O   1 
HETATM 2241 O O   A HOH B 2 .   ? 18.220 9.615   -0.758  0.57 37.71 ? 209 HOH A O   1 
HETATM 2242 O O   B HOH B 2 .   ? 18.164 9.615   1.472   0.43 24.06 ? 209 HOH A O   1 
HETATM 2243 O O   A HOH B 2 .   ? 0.708  10.854  4.304   0.48 43.27 ? 210 HOH A O   1 
HETATM 2244 O O   B HOH B 2 .   ? 0.708  10.854  4.304   0.48 43.27 ? 210 HOH A O   1 
HETATM 2245 O O   A HOH B 2 .   ? 14.275 -9.425  -4.116  0.47 40.33 ? 211 HOH A O   1 
HETATM 2246 O O   B HOH B 2 .   ? 14.275 -9.425  -4.116  0.47 40.33 ? 211 HOH A O   1 
HETATM 2247 O O   A HOH B 2 .   ? 9.262  1.147   -2.381  0.46 16.28 ? 212 HOH A O   1 
HETATM 2248 O O   B HOH B 2 .   ? 9.262  1.147   -2.381  0.46 16.28 ? 212 HOH A O   1 
HETATM 2249 O O   A HOH B 2 .   ? 6.145  0.777   27.186  0.48 17.72 ? 213 HOH A O   1 
HETATM 2250 O O   B HOH B 2 .   ? 6.145  0.777   27.186  0.48 17.72 ? 213 HOH A O   1 
HETATM 2251 O O   A HOH B 2 .   ? 16.108 -13.378 0.780   0.39 54.21 ? 214 HOH A O   1 
HETATM 2252 O O   B HOH B 2 .   ? 16.108 -13.378 0.780   0.39 54.21 ? 214 HOH A O   1 
HETATM 2253 O O   A HOH B 2 .   ? 8.017  -12.119 3.217   0.49 17.46 ? 215 HOH A O   1 
HETATM 2254 O O   B HOH B 2 .   ? 8.017  -12.119 3.217   0.49 17.46 ? 215 HOH A O   1 
HETATM 2255 O O   A HOH B 2 .   ? -3.856 -8.288  20.654  0.52 25.54 ? 216 HOH A O   1 
HETATM 2256 O O   B HOH B 2 .   ? -4.945 -7.532  19.213  0.48 26.93 ? 216 HOH A O   1 
HETATM 2257 O O   A HOH B 2 .   ? 6.064  -6.617  15.341  0.50 11.48 ? 217 HOH A O   1 
HETATM 2258 O O   B HOH B 2 .   ? 6.064  -6.617  15.341  0.50 11.48 ? 217 HOH A O   1 
HETATM 2259 O O   A HOH B 2 .   ? 13.101 -6.324  -6.472  0.34 45.54 ? 218 HOH A O   1 
HETATM 2260 O O   B HOH B 2 .   ? 13.101 -6.324  -6.472  0.34 45.54 ? 218 HOH A O   1 
HETATM 2261 O O   A HOH B 2 .   ? 27.879 -0.350  2.870   0.50 13.55 ? 219 HOH A O   1 
HETATM 2262 O O   B HOH B 2 .   ? 27.879 -0.350  2.870   0.50 13.55 ? 219 HOH A O   1 
HETATM 2263 O O   A HOH B 2 .   ? 22.129 -11.414 7.421   0.52 15.76 ? 220 HOH A O   1 
HETATM 2264 O O   B HOH B 2 .   ? 22.057 -12.453 6.482   0.48 17.05 ? 220 HOH A O   1 
HETATM 2265 O O   A HOH B 2 .   ? -5.572 -4.123  5.254   0.54 23.62 ? 221 HOH A O   1 
HETATM 2266 O O   B HOH B 2 .   ? -5.572 -4.123  5.254   0.46 23.62 ? 221 HOH A O   1 
HETATM 2267 O O   A HOH B 2 .   ? -9.417 8.211   2.917   0.45 58.95 ? 222 HOH A O   1 
HETATM 2268 O O   B HOH B 2 .   ? -9.417 8.211   2.917   0.45 58.95 ? 222 HOH A O   1 
HETATM 2269 O O   A HOH B 2 .   ? 9.874  -18.103 9.834   0.47 44.42 ? 223 HOH A O   1 
HETATM 2270 O O   B HOH B 2 .   ? 9.451  -19.692 9.229   0.39 27.00 ? 223 HOH A O   1 
HETATM 2271 O O   A HOH B 2 .   ? -5.025 10.587  6.911   0.55 50.20 ? 224 HOH A O   1 
HETATM 2272 O O   B HOH B 2 .   ? -5.025 10.587  6.911   0.45 50.20 ? 224 HOH A O   1 
HETATM 2273 O O   A HOH B 2 .   ? -9.567 2.663   -6.316  0.45 70.14 ? 225 HOH A O   1 
HETATM 2274 O O   B HOH B 2 .   ? -9.567 2.663   -6.316  0.45 70.14 ? 225 HOH A O   1 
HETATM 2275 O O   A HOH B 2 .   ? -6.471 4.108   5.185   0.50 32.04 ? 226 HOH A O   1 
HETATM 2276 O O   B HOH B 2 .   ? -6.471 4.108   5.185   0.50 32.04 ? 226 HOH A O   1 
HETATM 2277 O O   A HOH B 2 .   ? 9.467  14.073  19.166  0.45 37.69 ? 227 HOH A O   1 
HETATM 2278 O O   B HOH B 2 .   ? 9.467  14.073  19.166  0.45 37.69 ? 227 HOH A O   1 
HETATM 2279 O O   A HOH B 2 .   ? 13.814 8.798   25.074  0.54 84.98 ? 228 HOH A O   1 
HETATM 2280 O O   B HOH B 2 .   ? 13.814 8.798   25.074  0.46 84.98 ? 228 HOH A O   1 
HETATM 2281 O O   A HOH B 2 .   ? 9.226  2.577   24.789  0.50 17.52 ? 229 HOH A O   1 
HETATM 2282 O O   B HOH B 2 .   ? 9.226  2.577   24.789  0.50 17.52 ? 229 HOH A O   1 
HETATM 2283 O O   A HOH B 2 .   ? 19.610 3.548   24.501  0.46 30.22 ? 230 HOH A O   1 
HETATM 2284 O O   B HOH B 2 .   ? 20.876 3.307   25.879  0.54 37.15 ? 230 HOH A O   1 
HETATM 2285 O O   A HOH B 2 .   ? 4.461  13.091  9.646   0.46 27.24 ? 231 HOH A O   1 
HETATM 2286 O O   B HOH B 2 .   ? 4.461  13.091  9.646   0.46 27.24 ? 231 HOH A O   1 
HETATM 2287 O O   A HOH B 2 .   ? 12.076 9.219   20.939  0.44 33.86 ? 232 HOH A O   1 
HETATM 2288 O O   B HOH B 2 .   ? 10.475 9.996   19.996  0.42 40.41 ? 232 HOH A O   1 
HETATM 2289 O O   A HOH B 2 .   ? 4.421  -19.841 12.083  0.42 25.81 ? 233 HOH A O   1 
HETATM 2290 O O   B HOH B 2 .   ? 3.604  -18.335 9.993   0.29 32.14 ? 233 HOH A O   1 
HETATM 2291 O O   A HOH B 2 .   ? 12.633 -11.461 -2.168  0.48 38.48 ? 234 HOH A O   1 
HETATM 2292 O O   B HOH B 2 .   ? 12.633 -11.461 -2.168  0.48 38.48 ? 234 HOH A O   1 
HETATM 2293 O O   A HOH B 2 .   ? 20.859 -9.758  9.787   0.51 14.52 ? 235 HOH A O   1 
HETATM 2294 O O   B HOH B 2 .   ? 20.859 -9.758  9.787   0.49 14.52 ? 235 HOH A O   1 
HETATM 2295 O O   A HOH B 2 .   ? -7.743 5.595   18.145  0.53 25.59 ? 236 HOH A O   1 
HETATM 2296 O O   B HOH B 2 .   ? -7.743 5.595   18.145  0.47 25.59 ? 236 HOH A O   1 
HETATM 2297 O O   A HOH B 2 .   ? 10.258 -11.749 -10.435 0.32 53.63 ? 237 HOH A O   1 
HETATM 2298 O O   B HOH B 2 .   ? 10.258 -11.749 -10.435 0.32 53.63 ? 237 HOH A O   1 
HETATM 2299 O O   A HOH B 2 .   ? 9.219  -8.654  -8.947  0.43 23.32 ? 238 HOH A O   1 
HETATM 2300 O O   B HOH B 2 .   ? 9.219  -8.654  -8.947  0.43 23.32 ? 238 HOH A O   1 
HETATM 2301 O O   A HOH B 2 .   ? 0.784  -13.358 1.538   0.47 19.12 ? 239 HOH A O   1 
HETATM 2302 O O   B HOH B 2 .   ? 0.784  -13.358 1.538   0.47 19.12 ? 239 HOH A O   1 
HETATM 2303 O O   A HOH B 2 .   ? 8.456  -18.540 4.307   0.41 92.18 ? 240 HOH A O   1 
HETATM 2304 O O   B HOH B 2 .   ? 8.456  -18.540 4.307   0.41 92.18 ? 240 HOH A O   1 
HETATM 2305 O O   A HOH B 2 .   ? 6.596  -3.321  23.483  0.55 27.57 ? 241 HOH A O   1 
HETATM 2306 O O   B HOH B 2 .   ? 8.414  -7.954  18.373  0.45 21.29 ? 241 HOH A O   1 
HETATM 2307 O O   A HOH B 2 .   ? -4.157 3.235   19.044  0.45 30.03 ? 242 HOH A O   1 
HETATM 2308 O O   B HOH B 2 .   ? -4.157 3.235   19.044  0.45 30.03 ? 242 HOH A O   1 
HETATM 2309 O O   A HOH B 2 .   ? 18.406 -6.339  20.516  0.53 19.83 ? 243 HOH A O   1 
HETATM 2310 O O   B HOH B 2 .   ? 18.406 -6.339  20.516  0.47 19.83 ? 243 HOH A O   1 
HETATM 2311 O O   A HOH B 2 .   ? 26.574 4.432   13.173  0.34 37.59 ? 244 HOH A O   1 
HETATM 2312 O O   B HOH B 2 .   ? 26.574 4.432   13.173  0.34 37.59 ? 244 HOH A O   1 
HETATM 2313 O O   A HOH B 2 .   ? 28.074 16.289  13.182  0.53 52.51 ? 245 HOH A O   1 
HETATM 2314 O O   B HOH B 2 .   ? 28.131 16.232  13.170  0.47 50.04 ? 245 HOH A O   1 
HETATM 2315 O O   A HOH B 2 .   ? 0.923  8.186   18.467  0.51 24.01 ? 246 HOH A O   1 
HETATM 2316 O O   B HOH B 2 .   ? 1.287  8.582   19.319  0.49 31.53 ? 246 HOH A O   1 
HETATM 2317 O O   A HOH B 2 .   ? 2.731  5.806   25.240  0.52 33.42 ? 247 HOH A O   1 
HETATM 2318 O O   B HOH B 2 .   ? 2.731  5.806   25.240  0.48 33.42 ? 247 HOH A O   1 
HETATM 2319 O O   A HOH B 2 .   ? -1.790 3.214   26.506  0.47 31.31 ? 248 HOH A O   1 
HETATM 2320 O O   B HOH B 2 .   ? -1.790 3.214   26.506  0.47 31.31 ? 248 HOH A O   1 
HETATM 2321 O O   A HOH B 2 .   ? 8.200  7.677   24.059  0.48 54.51 ? 249 HOH A O   1 
HETATM 2322 O O   B HOH B 2 .   ? 8.200  7.677   24.059  0.48 54.51 ? 249 HOH A O   1 
HETATM 2323 O O   A HOH B 2 .   ? 25.457 16.459  11.704  0.32 43.63 ? 250 HOH A O   1 
HETATM 2324 O O   B HOH B 2 .   ? 25.328 16.335  11.572  0.32 40.28 ? 250 HOH A O   1 
HETATM 2325 O O   A HOH B 2 .   ? 13.135 4.386   23.592  0.48 20.56 ? 251 HOH A O   1 
HETATM 2326 O O   B HOH B 2 .   ? 13.191 5.883   24.648  0.49 29.20 ? 251 HOH A O   1 
HETATM 2327 O O   A HOH B 2 .   ? 20.875 -4.288  21.230  0.46 28.47 ? 252 HOH A O   1 
HETATM 2328 O O   B HOH B 2 .   ? 20.875 -4.288  21.230  0.46 28.47 ? 252 HOH A O   1 
HETATM 2329 O O   A HOH B 2 .   ? 15.317 -18.386 4.724   0.34 49.54 ? 253 HOH A O   1 
HETATM 2330 O O   B HOH B 2 .   ? 15.317 -18.386 4.724   0.34 49.54 ? 253 HOH A O   1 
HETATM 2331 O O   A HOH B 2 .   ? 24.870 8.376   8.960   0.46 25.58 ? 254 HOH A O   1 
HETATM 2332 O O   B HOH B 2 .   ? 24.870 8.376   8.960   0.46 25.58 ? 254 HOH A O   1 
HETATM 2333 O O   A HOH B 2 .   ? 16.876 -20.458 3.506   0.32 56.54 ? 255 HOH A O   1 
HETATM 2334 O O   B HOH B 2 .   ? 16.876 -20.458 3.506   0.32 56.54 ? 255 HOH A O   1 
HETATM 2335 O O   A HOH B 2 .   ? 19.814 9.029   8.411   0.51 31.75 ? 256 HOH A O   1 
HETATM 2336 O O   B HOH B 2 .   ? 22.936 12.047  4.536   0.45 45.07 ? 256 HOH A O   1 
HETATM 2337 O O   A HOH B 2 .   ? 6.317  -7.645  20.588  0.44 32.16 ? 257 HOH A O   1 
HETATM 2338 O O   B HOH B 2 .   ? 6.317  -7.645  20.588  0.44 32.16 ? 257 HOH A O   1 
HETATM 2339 O O   A HOH B 2 .   ? 23.461 18.315  8.490   0.54 35.93 ? 258 HOH A O   1 
HETATM 2340 O O   B HOH B 2 .   ? 23.461 18.315  8.490   0.46 35.93 ? 258 HOH A O   1 
HETATM 2341 O O   A HOH B 2 .   ? 17.195 8.130   23.959  0.47 42.26 ? 259 HOH A O   1 
HETATM 2342 O O   B HOH B 2 .   ? 17.195 8.130   23.959  0.47 42.26 ? 259 HOH A O   1 
HETATM 2343 O O   A HOH B 2 .   ? 12.688 13.594  -0.642  0.63 23.55 ? 260 HOH A O   1 
HETATM 2344 O O   B HOH B 2 .   ? 12.917 14.751  1.338   0.36 29.12 ? 260 HOH A O   1 
HETATM 2345 O O   A HOH B 2 .   ? -4.270 -8.406  17.011  0.53 21.82 ? 261 HOH A O   1 
HETATM 2346 O O   B HOH B 2 .   ? -2.976 -10.170 17.098  0.44 42.74 ? 261 HOH A O   1 
HETATM 2347 O O   A HOH B 2 .   ? 21.895 1.702   0.282   0.52 35.53 ? 262 HOH A O   1 
HETATM 2348 O O   B HOH B 2 .   ? 21.895 1.702   0.282   0.48 35.53 ? 262 HOH A O   1 
HETATM 2349 O O   A HOH B 2 .   ? -5.663 9.939   4.091   0.41 34.05 ? 263 HOH A O   1 
HETATM 2350 O O   B HOH B 2 .   ? -5.663 9.939   4.091   0.41 34.05 ? 263 HOH A O   1 
HETATM 2351 O O   A HOH B 2 .   ? -3.231 -1.203  -8.678  0.38 27.76 ? 264 HOH A O   1 
HETATM 2352 O O   B HOH B 2 .   ? -3.231 -1.203  -8.678  0.38 27.76 ? 264 HOH A O   1 
HETATM 2353 O O   A HOH B 2 .   ? 9.711  14.787  -3.239  0.40 32.75 ? 265 HOH A O   1 
HETATM 2354 O O   B HOH B 2 .   ? 9.711  14.787  -3.239  0.40 32.75 ? 265 HOH A O   1 
HETATM 2355 O O   A HOH B 2 .   ? 2.183  -13.929 -0.968  0.40 31.87 ? 266 HOH A O   1 
HETATM 2356 O O   B HOH B 2 .   ? 2.183  -13.929 -0.968  0.40 31.87 ? 266 HOH A O   1 
HETATM 2357 O O   A HOH B 2 .   ? -7.599 0.484   13.527  0.55 32.37 ? 267 HOH A O   1 
HETATM 2358 O O   B HOH B 2 .   ? -7.599 0.484   13.527  0.45 32.37 ? 267 HOH A O   1 
HETATM 2359 O O   A HOH B 2 .   ? 21.903 -1.368  0.542   0.55 20.05 ? 268 HOH A O   1 
HETATM 2360 O O   B HOH B 2 .   ? 21.903 -1.368  0.542   0.45 20.05 ? 268 HOH A O   1 
HETATM 2361 O O   A HOH B 2 .   ? 21.767 -8.268  -2.014  0.40 45.02 ? 269 HOH A O   1 
HETATM 2362 O O   B HOH B 2 .   ? 21.767 -8.268  -2.014  0.40 45.02 ? 269 HOH A O   1 
HETATM 2363 O O   A HOH B 2 .   ? 11.554 -19.471 6.356   0.37 47.74 ? 270 HOH A O   1 
HETATM 2364 O O   B HOH B 2 .   ? 11.554 -19.471 6.356   0.37 47.74 ? 270 HOH A O   1 
HETATM 2365 O O   A HOH B 2 .   ? 19.725 16.155  6.306   0.56 44.15 ? 271 HOH A O   1 
HETATM 2366 O O   B HOH B 2 .   ? 20.289 17.199  5.971   0.44 28.32 ? 271 HOH A O   1 
HETATM 2367 O O   A HOH B 2 .   ? 11.649 3.728   -1.403  0.51 28.42 ? 272 HOH A O   1 
HETATM 2368 O O   B HOH B 2 .   ? 11.649 3.728   -1.403  0.49 28.42 ? 272 HOH A O   1 
HETATM 2369 O O   A HOH B 2 .   ? 9.412  4.823   -5.269  0.48 39.15 ? 273 HOH A O   1 
HETATM 2370 O O   B HOH B 2 .   ? 9.412  4.823   -5.269  0.48 39.15 ? 273 HOH A O   1 
HETATM 2371 O O   A HOH B 2 .   ? 1.021  5.393   -5.200  0.53 27.84 ? 274 HOH A O   1 
HETATM 2372 O O   B HOH B 2 .   ? 1.021  5.393   -5.200  0.47 27.84 ? 274 HOH A O   1 
HETATM 2373 O O   A HOH B 2 .   ? -8.191 -5.316  20.792  0.48 88.58 ? 275 HOH A O   1 
HETATM 2374 O O   B HOH B 2 .   ? -8.191 -5.316  20.792  0.48 88.58 ? 275 HOH A O   1 
HETATM 2375 O O   A HOH B 2 .   ? -5.891 -5.265  7.481   0.51 27.83 ? 276 HOH A O   1 
HETATM 2376 O O   B HOH B 2 .   ? -6.687 -5.172  7.099   0.49 28.21 ? 276 HOH A O   1 
HETATM 2377 O O   A HOH B 2 .   ? 11.157 13.260  -4.921  0.36 35.44 ? 277 HOH A O   1 
HETATM 2378 O O   B HOH B 2 .   ? 11.157 13.260  -4.921  0.36 35.44 ? 277 HOH A O   1 
HETATM 2379 O O   A HOH B 2 .   ? 8.873  -16.088 2.152   0.52 38.35 ? 278 HOH A O   1 
HETATM 2380 O O   B HOH B 2 .   ? 9.738  -16.684 0.038   0.48 40.40 ? 278 HOH A O   1 
HETATM 2381 O O   A HOH B 2 .   ? -0.469 -12.283 18.831  0.39 55.48 ? 279 HOH A O   1 
HETATM 2382 O O   B HOH B 2 .   ? -0.469 -12.283 18.831  0.39 55.48 ? 279 HOH A O   1 
HETATM 2383 O O   A HOH B 2 .   ? 27.139 2.514   4.405   0.50 45.42 ? 280 HOH A O   1 
HETATM 2384 O O   B HOH B 2 .   ? 27.139 2.514   4.405   0.50 45.42 ? 280 HOH A O   1 
HETATM 2385 O O   A HOH B 2 .   ? -0.451 -11.666 -4.900  0.51 31.93 ? 281 HOH A O   1 
HETATM 2386 O O   B HOH B 2 .   ? 1.295  -12.849 -5.047  0.45 24.90 ? 281 HOH A O   1 
HETATM 2387 O O   A HOH B 2 .   ? 26.682 -2.869  -7.343  0.42 48.11 ? 282 HOH A O   1 
HETATM 2388 O O   B HOH B 2 .   ? 26.682 -2.869  -7.343  0.42 48.11 ? 282 HOH A O   1 
HETATM 2389 O O   A HOH B 2 .   ? 14.572 2.036   -3.590  0.49 38.10 ? 283 HOH A O   1 
HETATM 2390 O O   B HOH B 2 .   ? 14.572 2.036   -3.590  0.49 38.10 ? 283 HOH A O   1 
HETATM 2391 O O   A HOH B 2 .   ? -0.623 9.980   -2.409  0.46 42.30 ? 284 HOH A O   1 
HETATM 2392 O O   B HOH B 2 .   ? -0.623 9.980   -2.409  0.46 42.30 ? 284 HOH A O   1 
HETATM 2393 O O   A HOH B 2 .   ? 21.325 -3.666  -7.262  0.52 45.81 ? 285 HOH A O   1 
HETATM 2394 O O   B HOH B 2 .   ? 21.325 -3.666  -7.262  0.48 45.81 ? 285 HOH A O   1 
HETATM 2395 O O   A HOH B 2 .   ? 3.265  -8.195  20.256  0.38 45.90 ? 286 HOH A O   1 
HETATM 2396 O O   B HOH B 2 .   ? 3.265  -8.195  20.256  0.38 45.90 ? 286 HOH A O   1 
HETATM 2397 O O   A HOH B 2 .   ? 10.216 16.880  3.474   0.52 32.24 ? 287 HOH A O   1 
HETATM 2398 O O   B HOH B 2 .   ? 10.278 17.965  5.285   0.48 32.43 ? 287 HOH A O   1 
HETATM 2399 O O   A HOH B 2 .   ? -8.255 -7.239  23.063  0.39 61.07 ? 288 HOH A O   1 
HETATM 2400 O O   B HOH B 2 .   ? -8.255 -7.239  23.063  0.39 61.07 ? 288 HOH A O   1 
HETATM 2401 O O   A HOH B 2 .   ? -5.854 14.500  10.413  0.46 47.84 ? 289 HOH A O   1 
HETATM 2402 O O   B HOH B 2 .   ? -5.854 14.500  10.413  0.46 47.84 ? 289 HOH A O   1 
HETATM 2403 O O   A HOH B 2 .   ? -4.059 -14.489 6.024   0.39 66.51 ? 290 HOH A O   1 
HETATM 2404 O O   B HOH B 2 .   ? -4.059 -14.489 6.024   0.39 66.51 ? 290 HOH A O   1 
HETATM 2405 O O   A HOH B 2 .   ? 23.799 -15.234 7.030   0.41 61.04 ? 291 HOH A O   1 
HETATM 2406 O O   B HOH B 2 .   ? 23.799 -15.234 7.030   0.41 61.04 ? 291 HOH A O   1 
HETATM 2407 O O   A HOH B 2 .   ? 15.959 -9.872  -1.670  0.46 25.77 ? 292 HOH A O   1 
HETATM 2408 O O   B HOH B 2 .   ? 17.899 -10.633 -2.747  0.40 37.04 ? 292 HOH A O   1 
HETATM 2409 O O   A HOH B 2 .   ? 12.723 5.373   -4.868  0.46 34.70 ? 293 HOH A O   1 
HETATM 2410 O O   B HOH B 2 .   ? 12.708 5.368   -4.843  0.46 35.03 ? 293 HOH A O   1 
HETATM 2411 O O   A HOH B 2 .   ? 5.899  11.317  17.089  0.37 35.91 ? 294 HOH A O   1 
HETATM 2412 O O   B HOH B 2 .   ? 5.899  11.317  17.089  0.37 35.91 ? 294 HOH A O   1 
HETATM 2413 O O   A HOH B 2 .   ? 4.645  -5.666  -7.650  0.44 51.81 ? 295 HOH A O   1 
HETATM 2414 O O   B HOH B 2 .   ? 4.645  -5.666  -7.650  0.44 51.81 ? 295 HOH A O   1 
HETATM 2415 O O   A HOH B 2 .   ? -4.700 1.224   -2.224  0.47 50.95 ? 296 HOH A O   1 
HETATM 2416 O O   B HOH B 2 .   ? -4.700 1.224   -2.224  0.47 50.95 ? 296 HOH A O   1 
HETATM 2417 O O   A HOH B 2 .   ? 30.205 -2.025  24.802  0.43 44.19 ? 297 HOH A O   1 
HETATM 2418 O O   B HOH B 2 .   ? 30.205 -2.025  24.802  0.43 44.19 ? 297 HOH A O   1 
HETATM 2419 O O   A HOH B 2 .   ? 17.164 0.000   -5.379  0.57 30.86 ? 298 HOH A O   1 
HETATM 2420 O O   B HOH B 2 .   ? 18.837 -0.468  -4.649  0.33 55.39 ? 298 HOH A O   1 
HETATM 2421 O O   A HOH B 2 .   ? 19.172 0.695   24.354  0.44 55.15 ? 299 HOH A O   1 
HETATM 2422 O O   B HOH B 2 .   ? 19.172 0.695   24.354  0.44 55.15 ? 299 HOH A O   1 
HETATM 2423 O O   A HOH B 2 .   ? 10.109 19.574  12.017  0.51 46.03 ? 300 HOH A O   1 
HETATM 2424 O O   B HOH B 2 .   ? 10.109 19.574  12.017  0.49 46.03 ? 300 HOH A O   1 
HETATM 2425 O O   A HOH B 2 .   ? 28.774 14.320  15.654  0.40 49.86 ? 301 HOH A O   1 
HETATM 2426 O O   B HOH B 2 .   ? 28.774 14.320  15.654  0.40 49.86 ? 301 HOH A O   1 
HETATM 2427 O O   A HOH B 2 .   ? 26.448 13.872  13.223  0.49 51.73 ? 302 HOH A O   1 
HETATM 2428 O O   B HOH B 2 .   ? 26.448 13.872  13.223  0.49 51.73 ? 302 HOH A O   1 
HETATM 2429 O O   A HOH B 2 .   ? 14.777 15.194  9.414   0.40 31.05 ? 303 HOH A O   1 
HETATM 2430 O O   B HOH B 2 .   ? 14.777 15.194  9.414   0.40 31.05 ? 303 HOH A O   1 
HETATM 2431 O O   A HOH B 2 .   ? -2.667 11.996  7.926   0.43 43.87 ? 304 HOH A O   1 
HETATM 2432 O O   B HOH B 2 .   ? -2.667 11.996  7.926   0.43 43.87 ? 304 HOH A O   1 
HETATM 2433 O O   A HOH B 2 .   ? -4.690 -10.741 7.008   0.42 29.45 ? 305 HOH A O   1 
HETATM 2434 O O   B HOH B 2 .   ? -5.110 -10.818 5.178   0.46 27.71 ? 305 HOH A O   1 
HETATM 2435 O O   A HOH B 2 .   ? -6.551 -6.200  18.038  0.46 37.78 ? 306 HOH A O   1 
HETATM 2436 O O   B HOH B 2 .   ? -6.551 -6.200  18.038  0.46 37.78 ? 306 HOH A O   1 
HETATM 2437 O O   A HOH B 2 .   ? 6.359  8.396   -3.681  0.43 31.66 ? 307 HOH A O   1 
HETATM 2438 O O   B HOH B 2 .   ? 6.359  8.396   -3.681  0.43 31.66 ? 307 HOH A O   1 
HETATM 2439 O O   A HOH B 2 .   ? 8.938  3.851   -2.538  0.49 28.94 ? 308 HOH A O   1 
HETATM 2440 O O   B HOH B 2 .   ? 8.938  3.851   -2.538  0.49 28.94 ? 308 HOH A O   1 
HETATM 2441 O O   A HOH B 2 .   ? -1.601 -12.905 0.316   0.28 96.67 ? 309 HOH A O   1 
HETATM 2442 O O   B HOH B 2 .   ? -1.650 -12.952 0.445   0.26 94.00 ? 309 HOH A O   1 
HETATM 2443 O O   A HOH B 2 .   ? -1.544 -8.566  13.555  0.50 22.31 ? 310 HOH A O   1 
HETATM 2444 O O   B HOH B 2 .   ? -1.544 -8.566  13.555  0.50 22.31 ? 310 HOH A O   1 
HETATM 2445 O O   A HOH B 2 .   ? -1.714 9.492   19.664  0.52 73.30 ? 311 HOH A O   1 
HETATM 2446 O O   B HOH B 2 .   ? -1.879 9.502   19.539  0.48 71.21 ? 311 HOH A O   1 
HETATM 2447 O O   A HOH B 2 .   ? 13.219 12.197  26.929  0.50 58.98 ? 312 HOH A O   1 
HETATM 2448 O O   B HOH B 2 .   ? 13.219 12.197  26.929  0.50 58.98 ? 312 HOH A O   1 
HETATM 2449 O O   A HOH B 2 .   ? -7.327 -10.092 21.703  0.45 25.55 ? 313 HOH A O   1 
HETATM 2450 O O   B HOH B 2 .   ? -7.327 -10.092 21.703  0.45 25.55 ? 313 HOH A O   1 
HETATM 2451 O O   A HOH B 2 .   ? -8.688 -7.928  12.196  0.38 41.30 ? 314 HOH A O   1 
HETATM 2452 O O   B HOH B 2 .   ? -8.688 -7.928  12.196  0.38 41.30 ? 314 HOH A O   1 
HETATM 2453 O O   A HOH B 2 .   ? 24.169 -1.131  17.888  0.51 15.30 ? 315 HOH A O   1 
HETATM 2454 O O   B HOH B 2 .   ? 25.716 0.232   21.384  0.49 36.36 ? 315 HOH A O   1 
HETATM 2455 O O   A HOH B 2 .   ? 13.304 -4.000  21.249  0.50 15.41 ? 316 HOH A O   1 
HETATM 2456 O O   B HOH B 2 .   ? 12.348 -4.015  23.577  0.46 23.37 ? 316 HOH A O   1 
HETATM 2457 O O   A HOH B 2 .   ? -8.492 0.200   -1.757  0.52 34.42 ? 317 HOH A O   1 
HETATM 2458 O O   B HOH B 2 .   ? -8.492 0.200   -1.757  0.48 34.42 ? 317 HOH A O   1 
HETATM 2459 O O   A HOH B 2 .   ? 6.555  5.928   -5.388  0.52 40.15 ? 318 HOH A O   1 
HETATM 2460 O O   B HOH B 2 .   ? 6.555  5.928   -5.388  0.48 40.15 ? 318 HOH A O   1 
HETATM 2461 O O   A HOH B 2 .   ? 15.815 -12.031 3.659   0.39 29.31 ? 319 HOH A O   1 
HETATM 2462 O O   B HOH B 2 .   ? 15.815 -12.031 3.659   0.39 29.31 ? 319 HOH A O   1 
HETATM 2463 O O   A HOH B 2 .   ? 4.245  -16.088 -1.823  0.52 41.26 ? 320 HOH A O   1 
HETATM 2464 O O   B HOH B 2 .   ? 4.245  -16.088 -1.823  0.48 41.26 ? 320 HOH A O   1 
HETATM 2465 O O   A HOH B 2 .   ? 15.879 -8.267  22.264  0.40 52.18 ? 321 HOH A O   1 
HETATM 2466 O O   B HOH B 2 .   ? 15.879 -8.267  22.264  0.40 52.18 ? 321 HOH A O   1 
HETATM 2467 O O   A HOH B 2 .   ? 24.963 -1.111  -3.997  0.58 45.09 ? 322 HOH A O   1 
HETATM 2468 O O   B HOH B 2 .   ? 24.963 -1.111  -3.997  0.42 45.09 ? 322 HOH A O   1 
HETATM 2469 O O   A HOH B 2 .   ? 18.768 -7.234  -6.156  0.55 32.60 ? 323 HOH A O   1 
HETATM 2470 O O   B HOH B 2 .   ? 19.009 -5.867  -5.968  0.45 41.39 ? 323 HOH A O   1 
HETATM 2471 O O   A HOH B 2 .   ? 18.922 -15.368 10.285  0.54 42.56 ? 324 HOH A O   1 
HETATM 2472 O O   B HOH B 2 .   ? 18.922 -15.368 10.285  0.46 42.57 ? 324 HOH A O   1 
HETATM 2473 O O   A HOH B 2 .   ? 18.967 13.538  6.128   0.47 62.46 ? 325 HOH A O   1 
HETATM 2474 O O   B HOH B 2 .   ? 18.967 13.538  6.128   0.47 62.46 ? 325 HOH A O   1 
HETATM 2475 O O   A HOH B 2 .   ? -3.862 -6.565  23.173  0.40 47.09 ? 326 HOH A O   1 
HETATM 2476 O O   B HOH B 2 .   ? -3.862 -6.565  23.173  0.40 47.09 ? 326 HOH A O   1 
HETATM 2477 O O   A HOH B 2 .   ? 10.862 8.058   27.715  0.40 51.45 ? 327 HOH A O   1 
HETATM 2478 O O   B HOH B 2 .   ? 10.862 8.058   27.715  0.40 51.45 ? 327 HOH A O   1 
HETATM 2479 O O   A HOH B 2 .   ? -4.208 3.261   26.904  0.50 49.20 ? 328 HOH A O   1 
HETATM 2480 O O   B HOH B 2 .   ? -4.208 3.261   26.904  0.50 49.20 ? 328 HOH A O   1 
HETATM 2481 O O   A HOH B 2 .   ? 18.750 -6.844  -1.880  0.37 36.31 ? 329 HOH A O   1 
HETATM 2482 O O   B HOH B 2 .   ? 18.754 -6.838  -1.880  0.37 36.37 ? 329 HOH A O   1 
HETATM 2483 O O   A HOH B 2 .   ? -4.213 11.672  11.469  0.43 51.74 ? 330 HOH A O   1 
HETATM 2484 O O   B HOH B 2 .   ? -4.213 11.672  11.469  0.43 51.74 ? 330 HOH A O   1 
HETATM 2485 O O   A HOH B 2 .   ? 12.742 19.718  6.187   0.43 53.63 ? 331 HOH A O   1 
HETATM 2486 O O   B HOH B 2 .   ? 12.742 19.718  6.187   0.43 53.63 ? 331 HOH A O   1 
HETATM 2487 O O   A HOH B 2 .   ? 25.543 3.255   2.146   0.27 76.61 ? 332 HOH A O   1 
HETATM 2488 O O   B HOH B 2 .   ? 25.543 3.255   2.146   0.27 76.61 ? 332 HOH A O   1 
HETATM 2489 O O   A HOH B 2 .   ? 19.941 -14.448 -3.355  0.47 62.33 ? 333 HOH A O   1 
HETATM 2490 O O   B HOH B 2 .   ? 19.941 -14.448 -3.355  0.47 62.33 ? 333 HOH A O   1 
HETATM 2491 O O   A HOH B 2 .   ? 7.023  10.690  25.826  0.39 37.20 ? 334 HOH A O   1 
HETATM 2492 O O   B HOH B 2 .   ? 6.116  11.482  24.658  0.52 32.86 ? 334 HOH A O   1 
HETATM 2493 O O   A HOH B 2 .   ? -4.565 7.003   1.190   0.44 37.21 ? 335 HOH A O   1 
HETATM 2494 O O   B HOH B 2 .   ? -4.565 7.003   1.190   0.44 37.21 ? 335 HOH A O   1 
HETATM 2495 O O   A HOH B 2 .   ? 15.793 -19.991 1.382   0.29 41.71 ? 336 HOH A O   1 
HETATM 2496 O O   B HOH B 2 .   ? 13.376 -19.939 2.425   0.50 34.25 ? 336 HOH A O   1 
HETATM 2497 O O   A HOH B 2 .   ? 10.319 -20.314 2.306   0.54 60.61 ? 337 HOH A O   1 
HETATM 2498 O O   B HOH B 2 .   ? 10.319 -20.314 2.306   0.46 60.61 ? 337 HOH A O   1 
HETATM 2499 O O   A HOH B 2 .   ? 23.511 3.286   3.490   0.50 25.25 ? 338 HOH A O   1 
HETATM 2500 O O   B HOH B 2 .   ? 22.633 5.502   3.255   0.50 40.30 ? 338 HOH A O   1 
HETATM 2501 O O   A HOH B 2 .   ? 6.342  -19.240 -3.183  0.45 37.45 ? 339 HOH A O   1 
HETATM 2502 O O   B HOH B 2 .   ? 6.342  -19.240 -3.183  0.45 37.45 ? 339 HOH A O   1 
HETATM 2503 O O   A HOH B 2 .   ? -6.644 10.160  10.090  0.42 41.37 ? 340 HOH A O   1 
HETATM 2504 O O   B HOH B 2 .   ? -6.644 10.160  10.090  0.42 41.37 ? 340 HOH A O   1 
HETATM 2505 O O   A HOH B 2 .   ? 24.153 9.574   5.733   0.32 59.18 ? 341 HOH A O   1 
HETATM 2506 O O   B HOH B 2 .   ? 24.153 9.574   5.733   0.32 59.18 ? 341 HOH A O   1 
HETATM 2507 O O   A HOH B 2 .   ? 26.168 2.437   -0.633  0.37 42.33 ? 342 HOH A O   1 
HETATM 2508 O O   B HOH B 2 .   ? 26.168 2.437   -0.633  0.37 42.33 ? 342 HOH A O   1 
HETATM 2509 O O   A HOH B 2 .   ? 23.016 -0.375  -2.917  0.50 45.47 ? 343 HOH A O   1 
HETATM 2510 O O   B HOH B 2 .   ? 23.016 -0.375  -2.917  0.50 45.47 ? 343 HOH A O   1 
HETATM 2511 O O   A HOH B 2 .   ? 26.304 5.378   7.315   0.50 29.85 ? 344 HOH A O   1 
HETATM 2512 O O   B HOH B 2 .   ? 25.546 5.594   5.156   0.43 43.33 ? 344 HOH A O   1 
HETATM 2513 O O   A HOH B 2 .   ? 23.400 6.946   6.619   0.41 43.11 ? 345 HOH A O   1 
HETATM 2514 O O   B HOH B 2 .   ? 23.400 6.946   6.619   0.41 43.11 ? 345 HOH A O   1 
HETATM 2515 O O   A HOH B 2 .   ? -9.243 6.288   1.093   0.40 51.99 ? 346 HOH A O   1 
HETATM 2516 O O   B HOH B 2 .   ? -9.243 6.288   1.093   0.40 51.99 ? 346 HOH A O   1 
HETATM 2517 O O   A HOH B 2 .   ? 5.330  15.332  -1.269  0.58 63.81 ? 347 HOH A O   1 
HETATM 2518 O O   B HOH B 2 .   ? 5.330  15.332  -1.269  0.42 63.81 ? 347 HOH A O   1 
HETATM 2519 O O   A HOH B 2 .   ? 14.721 -10.941 0.689   0.50 35.97 ? 348 HOH A O   1 
HETATM 2520 O O   B HOH B 2 .   ? 15.274 -10.345 -0.517  0.50 36.03 ? 348 HOH A O   1 
HETATM 2521 O O   A HOH B 2 .   ? -7.350 -4.133  16.359  0.47 64.07 ? 349 HOH A O   1 
HETATM 2522 O O   B HOH B 2 .   ? -7.350 -4.133  16.359  0.47 64.07 ? 349 HOH A O   1 
HETATM 2523 O O   A HOH B 2 .   ? -3.041 10.386  5.197   0.42 37.69 ? 350 HOH A O   1 
HETATM 2524 O O   B HOH B 2 .   ? -3.041 10.386  5.197   0.42 37.69 ? 350 HOH A O   1 
HETATM 2525 O O   A HOH B 2 .   ? -3.481 5.753   -1.964  0.43 61.18 ? 351 HOH A O   1 
HETATM 2526 O O   B HOH B 2 .   ? -3.481 5.753   -1.964  0.43 61.18 ? 351 HOH A O   1 
HETATM 2527 O O   A HOH B 2 .   ? 13.913 17.950  10.626  0.45 26.99 ? 352 HOH A O   1 
HETATM 2528 O O   B HOH B 2 .   ? 13.913 17.950  10.626  0.45 26.99 ? 352 HOH A O   1 
HETATM 2529 O O   A HOH B 2 .   ? 5.721  -5.552  22.029  0.45 40.25 ? 353 HOH A O   1 
HETATM 2530 O O   B HOH B 2 .   ? 5.721  -5.552  22.029  0.45 40.25 ? 353 HOH A O   1 
HETATM 2531 O O   A HOH B 2 .   ? 0.976  -2.771  22.042  0.47 46.96 ? 354 HOH A O   1 
HETATM 2532 O O   B HOH B 2 .   ? 0.947  -2.755  22.051  0.47 46.50 ? 354 HOH A O   1 
HETATM 2533 O O   A HOH B 2 .   ? 0.825  -9.871  21.086  0.43 57.20 ? 355 HOH A O   1 
HETATM 2534 O O   B HOH B 2 .   ? 0.825  -9.871  21.086  0.43 57.20 ? 355 HOH A O   1 
HETATM 2535 O O   A HOH B 2 .   ? 12.057 -11.990 0.216   0.50 48.27 ? 356 HOH A O   1 
HETATM 2536 O O   B HOH B 2 .   ? 12.057 -11.990 0.216   0.50 48.27 ? 356 HOH A O   1 
HETATM 2537 O O   A HOH B 2 .   ? 12.238 1.933   -4.727  0.48 36.67 ? 357 HOH A O   1 
HETATM 2538 O O   B HOH B 2 .   ? 12.238 1.933   -4.727  0.48 36.67 ? 357 HOH A O   1 
HETATM 2539 O O   A HOH B 2 .   ? 11.592 -15.039 -2.415  0.39 66.58 ? 358 HOH A O   1 
HETATM 2540 O O   B HOH B 2 .   ? 11.592 -15.039 -2.415  0.39 66.58 ? 358 HOH A O   1 
HETATM 2541 O O   A HOH B 2 .   ? 13.341 -13.178 -4.555  0.45 56.61 ? 359 HOH A O   1 
HETATM 2542 O O   B HOH B 2 .   ? 12.572 -13.651 -7.136  0.42 64.43 ? 359 HOH A O   1 
HETATM 2543 O O   A HOH B 2 .   ? 14.023 -17.019 -0.927  0.41 34.48 ? 360 HOH A O   1 
HETATM 2544 O O   B HOH B 2 .   ? 13.043 -15.888 0.107   0.42 38.29 ? 360 HOH A O   1 
HETATM 2545 O O   A HOH B 2 .   ? -5.511 -7.512  5.106   0.49 30.76 ? 361 HOH A O   1 
HETATM 2546 O O   B HOH B 2 .   ? -6.961 -8.561  4.411   0.51 29.12 ? 361 HOH A O   1 
HETATM 2547 O O   A HOH B 2 .   ? 9.028  -13.163 -4.596  0.48 51.33 ? 362 HOH A O   1 
HETATM 2548 O O   B HOH B 2 .   ? 9.028  -13.163 -4.596  0.48 51.33 ? 362 HOH A O   1 
HETATM 2549 O O   A HOH B 2 .   ? 7.830  16.407  5.868   0.45 42.46 ? 363 HOH A O   1 
HETATM 2550 O O   B HOH B 2 .   ? 7.830  16.407  5.868   0.45 42.46 ? 363 HOH A O   1 
HETATM 2551 O O   A HOH B 2 .   ? 15.470 6.324   -3.756  0.46 35.52 ? 364 HOH A O   1 
HETATM 2552 O O   B HOH B 2 .   ? 16.058 4.463   -4.480  0.41 38.05 ? 364 HOH A O   1 
HETATM 2553 O O   A HOH B 2 .   ? 15.590 -3.733  -7.688  0.58 47.99 ? 365 HOH A O   1 
HETATM 2554 O O   B HOH B 2 .   ? 15.590 -3.733  -7.688  0.42 47.99 ? 365 HOH A O   1 
HETATM 2555 O O   A HOH B 2 .   ? 4.306  9.872   21.672  0.43 56.31 ? 366 HOH A O   1 
HETATM 2556 O O   B HOH B 2 .   ? 4.306  9.872   21.672  0.43 56.31 ? 366 HOH A O   1 
HETATM 2557 O O   A HOH B 2 .   ? -4.272 8.694   -2.531  0.28 53.43 ? 367 HOH A O   1 
HETATM 2558 O O   B HOH B 2 .   ? -4.272 8.694   -2.531  0.28 53.43 ? 367 HOH A O   1 
HETATM 2559 O O   A HOH B 2 .   ? -4.998 4.402   21.465  0.47 32.46 ? 368 HOH A O   1 
HETATM 2560 O O   B HOH B 2 .   ? -3.642 3.656   22.067  0.53 31.63 ? 368 HOH A O   1 
HETATM 2561 O O   A HOH B 2 .   ? 3.741  11.435  -3.709  0.43 32.22 ? 369 HOH A O   1 
HETATM 2562 O O   B HOH B 2 .   ? 5.621  12.180  -2.252  0.50 45.66 ? 369 HOH A O   1 
HETATM 2563 O O   A HOH B 2 .   ? 23.081 -3.578  20.184  0.56 35.50 ? 370 HOH A O   1 
HETATM 2564 O O   B HOH B 2 .   ? 23.081 -3.583  20.184  0.44 35.30 ? 370 HOH A O   1 
HETATM 2565 O O   A HOH B 2 .   ? -2.726 -8.186  -5.940  0.47 51.46 ? 371 HOH A O   1 
HETATM 2566 O O   B HOH B 2 .   ? -2.681 -7.995  -6.203  0.47 55.87 ? 371 HOH A O   1 
HETATM 2567 O O   A HOH B 2 .   ? 20.661 -6.252  -8.327  0.48 35.40 ? 372 HOH A O   1 
HETATM 2568 O O   B HOH B 2 .   ? 21.142 -8.330  -7.901  0.51 33.65 ? 372 HOH A O   1 
HETATM 2569 O O   A HOH B 2 .   ? 23.978 -2.622  -6.926  0.43 63.45 ? 373 HOH A O   1 
HETATM 2570 O O   B HOH B 2 .   ? 23.978 -2.622  -6.926  0.43 63.45 ? 373 HOH A O   1 
HETATM 2571 O O   A HOH B 2 .   ? 25.624 -4.715  -4.094  0.39 21.23 ? 374 HOH A O   1 
HETATM 2572 O O   B HOH B 2 .   ? 25.841 -3.676  -4.364  0.41 33.09 ? 374 HOH A O   1 
HETATM 2573 O O   A HOH B 2 .   ? -3.506 -0.288  -5.520  0.52 50.65 ? 375 HOH A O   1 
HETATM 2574 O O   B HOH B 2 .   ? -3.506 -0.288  -5.520  0.48 50.65 ? 375 HOH A O   1 
HETATM 2575 O O   A HOH B 2 .   ? 22.242 6.494   19.702  0.54 21.60 ? 376 HOH A O   1 
HETATM 2576 O O   B HOH B 2 .   ? 22.768 4.607   19.893  0.46 29.97 ? 376 HOH A O   1 
HETATM 2577 O O   A HOH B 2 .   ? 5.344  15.590  11.813  0.48 30.41 ? 377 HOH A O   1 
HETATM 2578 O O   B HOH B 2 .   ? 7.910  14.592  16.751  0.49 49.16 ? 377 HOH A O   1 
HETATM 2579 O O   A HOH B 2 .   ? 16.414 -13.846 5.467   0.39 34.81 ? 378 HOH A O   1 
HETATM 2580 O O   B HOH B 2 .   ? 16.414 -13.846 5.467   0.39 34.81 ? 378 HOH A O   1 
HETATM 2581 O O   A HOH B 2 .   ? 2.536  -7.173  -8.797  0.47 28.60 ? 379 HOH A O   1 
HETATM 2582 O O   B HOH B 2 .   ? 2.536  -7.173  -8.797  0.47 28.60 ? 379 HOH A O   1 
HETATM 2583 O O   A HOH B 2 .   ? -2.167 8.453   17.127  0.39 32.58 ? 380 HOH A O   1 
HETATM 2584 O O   B HOH B 2 .   ? -2.167 8.453   17.127  0.39 32.58 ? 380 HOH A O   1 
HETATM 2585 O O   A HOH B 2 .   ? -0.668 10.546  17.446  0.45 47.68 ? 381 HOH A O   1 
HETATM 2586 O O   B HOH B 2 .   ? -0.668 10.546  17.446  0.45 47.68 ? 381 HOH A O   1 
HETATM 2587 O O   A HOH B 2 .   ? 2.985  14.176  8.267   0.53 47.99 ? 382 HOH A O   1 
HETATM 2588 O O   B HOH B 2 .   ? 2.985  14.176  8.267   0.47 47.99 ? 382 HOH A O   1 
HETATM 2589 O O   A HOH B 2 .   ? 10.320 11.641  -1.262  0.44 59.69 ? 383 HOH A O   1 
HETATM 2590 O O   B HOH B 2 .   ? 10.320 11.641  -1.262  0.44 59.69 ? 383 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   ALA 2   1   1   ALA ALA A . n 
A 1 3   PHE 3   2   2   PHE PHE A . n 
A 1 4   ASP 4   3   3   ASP ASP A . n 
A 1 5   GLY 5   4   4   GLY GLY A . n 
A 1 6   THR 6   5   5   THR THR A . n 
A 1 7   TRP 7   6   6   TRP TRP A . n 
A 1 8   LYS 8   7   7   LYS LYS A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  ASP 10  9   9   ASP ASP A . n 
A 1 11  ARG 11  10  10  ARG ARG A . n 
A 1 12  ASN 12  11  11  ASN ASN A . n 
A 1 13  GLU 13  12  12  GLU GLU A . n 
A 1 14  ASN 14  13  13  ASN ASN A . n 
A 1 15  TYR 15  14  14  TYR TYR A . n 
A 1 16  GLU 16  15  15  GLU GLU A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  PHE 18  17  17  PHE PHE A . n 
A 1 19  MET 19  18  18  MET MET A . n 
A 1 20  GLU 20  19  19  GLU GLU A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  MET 22  21  21  MET MET A . n 
A 1 23  GLY 23  22  22  GLY GLY A . n 
A 1 24  ILE 24  23  23  ILE ILE A . n 
A 1 25  ASN 25  24  24  ASN ASN A . n 
A 1 26  VAL 26  25  25  VAL VAL A . n 
A 1 27  VAL 27  26  26  VAL VAL A . n 
A 1 28  LYS 28  27  27  LYS LYS A . n 
A 1 29  ARG 29  28  28  ARG ARG A . n 
A 1 30  LYS 30  29  29  LYS LYS A . n 
A 1 31  LEU 31  30  30  LEU LEU A . n 
A 1 32  GLY 32  31  31  GLY GLY A . n 
A 1 33  ALA 33  32  32  ALA ALA A . n 
A 1 34  HIS 34  33  33  HIS HIS A . n 
A 1 35  ASP 35  34  34  ASP ASP A . n 
A 1 36  ASN 36  35  35  ASN ASN A . n 
A 1 37  LEU 37  36  36  LEU LEU A . n 
A 1 38  LYS 38  37  37  LYS LYS A . n 
A 1 39  LEU 39  38  38  LEU LEU A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  ILE 41  40  40  ILE ILE A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  GLN 43  42  42  GLN GLN A . n 
A 1 44  GLU 44  43  43  GLU GLU A . n 
A 1 45  GLY 45  44  44  GLY GLY A . n 
A 1 46  ASN 46  45  45  ASN ASN A . n 
A 1 47  LYS 47  46  46  LYS LYS A . n 
A 1 48  PHE 48  47  47  PHE PHE A . n 
A 1 49  THR 49  48  48  THR THR A . n 
A 1 50  VAL 50  49  49  VAL VAL A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  SER 53  52  52  SER SER A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  ASN 55  54  54  ASN ASN A . n 
A 1 56  PHE 56  55  55  PHE PHE A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  ASN 58  57  57  ASN ASN A . n 
A 1 59  ILE 59  58  58  ILE ILE A . n 
A 1 60  ASP 60  59  59  ASP ASP A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  VAL 62  61  61  VAL VAL A . n 
A 1 63  PHE 63  62  62  PHE PHE A . n 
A 1 64  GLU 64  63  63  GLU GLU A . n 
A 1 65  LEU 65  64  64  LEU LEU A . n 
A 1 66  GLY 66  65  65  GLY GLY A . n 
A 1 67  VAL 67  66  66  VAL VAL A . n 
A 1 68  ASP 68  67  67  ASP ASP A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  ALA 70  69  69  ALA ALA A . n 
A 1 71  TYR 71  70  70  TYR TYR A . n 
A 1 72  SER 72  71  71  SER SER A . n 
A 1 73  LEU 73  72  72  LEU LEU A . n 
A 1 74  ALA 74  73  73  ALA ALA A . n 
A 1 75  ASP 75  74  74  ASP ASP A . n 
A 1 76  GLY 76  75  75  GLY GLY A . n 
A 1 77  THR 77  76  76  THR THR A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  THR 80  79  79  THR THR A . n 
A 1 81  GLY 81  80  80  GLY GLY A . n 
A 1 82  THR 82  81  81  THR THR A . n 
A 1 83  TRP 83  82  82  TRP TRP A . n 
A 1 84  THR 84  83  83  THR THR A . n 
A 1 85  MET 85  84  84  MET MET A . n 
A 1 86  GLU 86  85  85  GLU GLU A . n 
A 1 87  GLY 87  86  86  GLY GLY A . n 
A 1 88  ASN 88  87  87  ASN ASN A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  GLY 92  91  91  GLY GLY A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  PHE 94  93  93  PHE PHE A . n 
A 1 95  LYS 95  94  94  LYS LYS A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  ASP 98  97  97  ASP ASP A . n 
A 1 99  ASN 99  98  98  ASN ASN A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 LYS 101 100 100 LYS LYS A . n 
A 1 102 GLU 102 101 101 GLU GLU A . n 
A 1 103 LEU 103 102 102 LEU LEU A . n 
A 1 104 ILE 104 103 103 ILE ILE A . n 
A 1 105 ALA 105 104 104 ALA ALA A . n 
A 1 106 VAL 106 105 105 VAL VAL A . n 
A 1 107 ARG 107 106 106 ARG ARG A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 ILE 109 108 108 ILE ILE A . n 
A 1 110 SER 110 109 109 SER SER A . n 
A 1 111 GLY 111 110 110 GLY GLY A . n 
A 1 112 ASN 112 111 111 ASN ASN A . n 
A 1 113 GLU 113 112 112 GLU GLU A . n 
A 1 114 LEU 114 113 113 LEU LEU A . n 
A 1 115 ILE 115 114 114 ILE ILE A . n 
A 1 116 GLN 116 115 115 GLN GLN A . n 
A 1 117 THR 117 116 116 THR THR A . n 
A 1 118 TYR 118 117 117 TYR TYR A . n 
A 1 119 THR 119 118 118 THR THR A . n 
A 1 120 TYR 120 119 119 TYR TYR A . n 
A 1 121 GLU 121 120 120 GLU GLU A . n 
A 1 122 GLY 122 121 121 GLY GLY A . n 
A 1 123 VAL 123 122 122 VAL VAL A . n 
A 1 124 GLU 124 123 123 GLU GLU A . n 
A 1 125 ALA 125 124 124 ALA ALA A . n 
A 1 126 LYS 126 125 125 LYS LYS A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ILE 128 127 127 ILE ILE A . n 
A 1 129 PHE 129 128 128 PHE PHE A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 LYS 131 130 130 LYS LYS A . n 
A 1 132 GLU 132 131 131 GLU GLU A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   133 133 HOH HOH A . 
B 2 HOH 2   134 134 HOH HOH A . 
B 2 HOH 3   135 135 HOH HOH A . 
B 2 HOH 4   136 136 HOH HOH A . 
B 2 HOH 5   137 137 HOH HOH A . 
B 2 HOH 6   138 138 HOH HOH A . 
B 2 HOH 7   139 139 HOH HOH A . 
B 2 HOH 8   140 140 HOH HOH A . 
B 2 HOH 9   141 141 HOH HOH A . 
B 2 HOH 10  142 142 HOH HOH A . 
B 2 HOH 11  143 143 HOH HOH A . 
B 2 HOH 12  144 144 HOH HOH A . 
B 2 HOH 13  145 145 HOH HOH A . 
B 2 HOH 14  146 146 HOH HOH A . 
B 2 HOH 15  147 147 HOH HOH A . 
B 2 HOH 16  148 148 HOH HOH A . 
B 2 HOH 17  149 149 HOH HOH A . 
B 2 HOH 18  150 150 HOH HOH A . 
B 2 HOH 19  151 151 HOH HOH A . 
B 2 HOH 20  152 152 HOH HOH A . 
B 2 HOH 21  153 153 HOH HOH A . 
B 2 HOH 22  154 154 HOH HOH A . 
B 2 HOH 23  155 155 HOH HOH A . 
B 2 HOH 24  156 156 HOH HOH A . 
B 2 HOH 25  170 170 HOH HOH A . 
B 2 HOH 26  171 171 HOH HOH A . 
B 2 HOH 27  172 172 HOH HOH A . 
B 2 HOH 28  173 173 HOH HOH A . 
B 2 HOH 29  174 174 HOH HOH A . 
B 2 HOH 30  175 175 HOH HOH A . 
B 2 HOH 31  176 176 HOH HOH A . 
B 2 HOH 32  177 177 HOH HOH A . 
B 2 HOH 33  178 178 HOH HOH A . 
B 2 HOH 34  179 179 HOH HOH A . 
B 2 HOH 35  180 180 HOH HOH A . 
B 2 HOH 36  181 181 HOH HOH A . 
B 2 HOH 37  182 182 HOH HOH A . 
B 2 HOH 38  183 183 HOH HOH A . 
B 2 HOH 39  184 184 HOH HOH A . 
B 2 HOH 40  185 185 HOH HOH A . 
B 2 HOH 41  186 186 HOH HOH A . 
B 2 HOH 42  187 187 HOH HOH A . 
B 2 HOH 43  188 188 HOH HOH A . 
B 2 HOH 44  189 189 HOH HOH A . 
B 2 HOH 45  190 190 HOH HOH A . 
B 2 HOH 46  191 191 HOH HOH A . 
B 2 HOH 47  192 192 HOH HOH A . 
B 2 HOH 48  193 193 HOH HOH A . 
B 2 HOH 49  194 194 HOH HOH A . 
B 2 HOH 50  195 195 HOH HOH A . 
B 2 HOH 51  196 196 HOH HOH A . 
B 2 HOH 52  197 197 HOH HOH A . 
B 2 HOH 53  198 198 HOH HOH A . 
B 2 HOH 54  199 199 HOH HOH A . 
B 2 HOH 55  200 200 HOH HOH A . 
B 2 HOH 56  201 201 HOH HOH A . 
B 2 HOH 57  202 202 HOH HOH A . 
B 2 HOH 58  203 203 HOH HOH A . 
B 2 HOH 59  204 204 HOH HOH A . 
B 2 HOH 60  205 205 HOH HOH A . 
B 2 HOH 61  206 206 HOH HOH A . 
B 2 HOH 62  207 207 HOH HOH A . 
B 2 HOH 63  208 208 HOH HOH A . 
B 2 HOH 64  209 209 HOH HOH A . 
B 2 HOH 65  210 210 HOH HOH A . 
B 2 HOH 66  211 211 HOH HOH A . 
B 2 HOH 67  212 212 HOH HOH A . 
B 2 HOH 68  213 213 HOH HOH A . 
B 2 HOH 69  214 214 HOH HOH A . 
B 2 HOH 70  215 215 HOH HOH A . 
B 2 HOH 71  216 216 HOH HOH A . 
B 2 HOH 72  217 217 HOH HOH A . 
B 2 HOH 73  218 218 HOH HOH A . 
B 2 HOH 74  219 219 HOH HOH A . 
B 2 HOH 75  220 220 HOH HOH A . 
B 2 HOH 76  221 221 HOH HOH A . 
B 2 HOH 77  222 222 HOH HOH A . 
B 2 HOH 78  223 223 HOH HOH A . 
B 2 HOH 79  224 224 HOH HOH A . 
B 2 HOH 80  225 225 HOH HOH A . 
B 2 HOH 81  226 226 HOH HOH A . 
B 2 HOH 82  227 227 HOH HOH A . 
B 2 HOH 83  228 228 HOH HOH A . 
B 2 HOH 84  229 229 HOH HOH A . 
B 2 HOH 85  230 230 HOH HOH A . 
B 2 HOH 86  231 231 HOH HOH A . 
B 2 HOH 87  232 232 HOH HOH A . 
B 2 HOH 88  233 233 HOH HOH A . 
B 2 HOH 89  234 234 HOH HOH A . 
B 2 HOH 90  235 235 HOH HOH A . 
B 2 HOH 91  236 236 HOH HOH A . 
B 2 HOH 92  237 237 HOH HOH A . 
B 2 HOH 93  238 238 HOH HOH A . 
B 2 HOH 94  239 239 HOH HOH A . 
B 2 HOH 95  240 240 HOH HOH A . 
B 2 HOH 96  241 241 HOH HOH A . 
B 2 HOH 97  242 242 HOH HOH A . 
B 2 HOH 98  243 243 HOH HOH A . 
B 2 HOH 99  244 244 HOH HOH A . 
B 2 HOH 100 245 245 HOH HOH A . 
B 2 HOH 101 246 246 HOH HOH A . 
B 2 HOH 102 247 247 HOH HOH A . 
B 2 HOH 103 248 248 HOH HOH A . 
B 2 HOH 104 249 249 HOH HOH A . 
B 2 HOH 105 250 250 HOH HOH A . 
B 2 HOH 106 251 251 HOH HOH A . 
B 2 HOH 107 252 252 HOH HOH A . 
B 2 HOH 108 253 253 HOH HOH A . 
B 2 HOH 109 254 254 HOH HOH A . 
B 2 HOH 110 255 255 HOH HOH A . 
B 2 HOH 111 256 256 HOH HOH A . 
B 2 HOH 112 257 257 HOH HOH A . 
B 2 HOH 113 258 258 HOH HOH A . 
B 2 HOH 114 259 259 HOH HOH A . 
B 2 HOH 115 260 260 HOH HOH A . 
B 2 HOH 116 261 261 HOH HOH A . 
B 2 HOH 117 262 262 HOH HOH A . 
B 2 HOH 118 263 263 HOH HOH A . 
B 2 HOH 119 264 264 HOH HOH A . 
B 2 HOH 120 265 265 HOH HOH A . 
B 2 HOH 121 266 266 HOH HOH A . 
B 2 HOH 122 267 267 HOH HOH A . 
B 2 HOH 123 268 268 HOH HOH A . 
B 2 HOH 124 269 269 HOH HOH A . 
B 2 HOH 125 270 270 HOH HOH A . 
B 2 HOH 126 271 271 HOH HOH A . 
B 2 HOH 127 272 272 HOH HOH A . 
B 2 HOH 128 273 273 HOH HOH A . 
B 2 HOH 129 274 274 HOH HOH A . 
B 2 HOH 130 275 275 HOH HOH A . 
B 2 HOH 131 276 276 HOH HOH A . 
B 2 HOH 132 277 277 HOH HOH A . 
B 2 HOH 133 278 278 HOH HOH A . 
B 2 HOH 134 279 279 HOH HOH A . 
B 2 HOH 135 280 280 HOH HOH A . 
B 2 HOH 136 281 281 HOH HOH A . 
B 2 HOH 137 282 282 HOH HOH A . 
B 2 HOH 138 283 283 HOH HOH A . 
B 2 HOH 139 284 284 HOH HOH A . 
B 2 HOH 140 285 285 HOH HOH A . 
B 2 HOH 141 286 286 HOH HOH A . 
B 2 HOH 142 287 287 HOH HOH A . 
B 2 HOH 143 288 288 HOH HOH A . 
B 2 HOH 144 289 289 HOH HOH A . 
B 2 HOH 145 290 290 HOH HOH A . 
B 2 HOH 146 291 291 HOH HOH A . 
B 2 HOH 147 292 292 HOH HOH A . 
B 2 HOH 148 293 293 HOH HOH A . 
B 2 HOH 149 294 294 HOH HOH A . 
B 2 HOH 150 295 295 HOH HOH A . 
B 2 HOH 151 296 296 HOH HOH A . 
B 2 HOH 152 297 297 HOH HOH A . 
B 2 HOH 153 298 298 HOH HOH A . 
B 2 HOH 154 299 299 HOH HOH A . 
B 2 HOH 155 300 300 HOH HOH A . 
B 2 HOH 156 301 301 HOH HOH A . 
B 2 HOH 157 302 302 HOH HOH A . 
B 2 HOH 158 303 303 HOH HOH A . 
B 2 HOH 159 304 304 HOH HOH A . 
B 2 HOH 160 305 305 HOH HOH A . 
B 2 HOH 161 306 306 HOH HOH A . 
B 2 HOH 162 307 307 HOH HOH A . 
B 2 HOH 163 308 308 HOH HOH A . 
B 2 HOH 164 309 309 HOH HOH A . 
B 2 HOH 165 310 310 HOH HOH A . 
B 2 HOH 166 311 311 HOH HOH A . 
B 2 HOH 167 312 312 HOH HOH A . 
B 2 HOH 168 313 313 HOH HOH A . 
B 2 HOH 169 314 314 HOH HOH A . 
B 2 HOH 170 315 315 HOH HOH A . 
B 2 HOH 171 316 316 HOH HOH A . 
B 2 HOH 172 317 317 HOH HOH A . 
B 2 HOH 173 318 318 HOH HOH A . 
B 2 HOH 174 319 319 HOH HOH A . 
B 2 HOH 175 320 320 HOH HOH A . 
B 2 HOH 176 321 321 HOH HOH A . 
B 2 HOH 177 322 322 HOH HOH A . 
B 2 HOH 178 323 323 HOH HOH A . 
B 2 HOH 179 324 324 HOH HOH A . 
B 2 HOH 180 325 325 HOH HOH A . 
B 2 HOH 181 326 326 HOH HOH A . 
B 2 HOH 182 327 327 HOH HOH A . 
B 2 HOH 183 328 328 HOH HOH A . 
B 2 HOH 184 329 329 HOH HOH A . 
B 2 HOH 185 330 330 HOH HOH A . 
B 2 HOH 186 331 331 HOH HOH A . 
B 2 HOH 187 332 332 HOH HOH A . 
B 2 HOH 188 333 333 HOH HOH A . 
B 2 HOH 189 334 334 HOH HOH A . 
B 2 HOH 190 335 335 HOH HOH A . 
B 2 HOH 191 336 336 HOH HOH A . 
B 2 HOH 192 337 337 HOH HOH A . 
B 2 HOH 193 338 338 HOH HOH A . 
B 2 HOH 194 339 339 HOH HOH A . 
B 2 HOH 195 340 340 HOH HOH A . 
B 2 HOH 196 341 341 HOH HOH A . 
B 2 HOH 197 342 342 HOH HOH A . 
B 2 HOH 198 343 343 HOH HOH A . 
B 2 HOH 199 344 344 HOH HOH A . 
B 2 HOH 200 345 345 HOH HOH A . 
B 2 HOH 201 346 346 HOH HOH A . 
B 2 HOH 202 347 347 HOH HOH A . 
B 2 HOH 203 348 348 HOH HOH A . 
B 2 HOH 204 349 349 HOH HOH A . 
B 2 HOH 205 350 350 HOH HOH A . 
B 2 HOH 206 351 351 HOH HOH A . 
B 2 HOH 207 352 352 HOH HOH A . 
B 2 HOH 208 353 353 HOH HOH A . 
B 2 HOH 209 354 354 HOH HOH A . 
B 2 HOH 210 355 355 HOH HOH A . 
B 2 HOH 211 356 356 HOH HOH A . 
B 2 HOH 212 357 357 HOH HOH A . 
B 2 HOH 213 358 358 HOH HOH A . 
B 2 HOH 214 359 359 HOH HOH A . 
B 2 HOH 215 360 360 HOH HOH A . 
B 2 HOH 216 361 361 HOH HOH A . 
B 2 HOH 217 362 362 HOH HOH A . 
B 2 HOH 218 363 363 HOH HOH A . 
B 2 HOH 219 364 364 HOH HOH A . 
B 2 HOH 220 365 365 HOH HOH A . 
B 2 HOH 221 366 366 HOH HOH A . 
B 2 HOH 222 367 367 HOH HOH A . 
B 2 HOH 223 368 368 HOH HOH A . 
B 2 HOH 224 369 369 HOH HOH A . 
B 2 HOH 225 370 370 HOH HOH A . 
B 2 HOH 226 371 371 HOH HOH A . 
B 2 HOH 227 372 372 HOH HOH A . 
B 2 HOH 228 373 373 HOH HOH A . 
B 2 HOH 229 374 374 HOH HOH A . 
B 2 HOH 230 375 375 HOH HOH A . 
B 2 HOH 231 376 376 HOH HOH A . 
B 2 HOH 232 377 377 HOH HOH A . 
B 2 HOH 233 378 378 HOH HOH A . 
B 2 HOH 234 379 379 HOH HOH A . 
B 2 HOH 235 380 380 HOH HOH A . 
B 2 HOH 236 381 381 HOH HOH A . 
B 2 HOH 237 382 382 HOH HOH A . 
B 2 HOH 238 383 383 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 1 4 2019-07-17 
6 'Structure model' 1 5 2019-08-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Atomic model'              
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' 'Derived calculations'      
5  4 'Structure model' Other                       
6  4 'Structure model' 'Structure summary'         
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' 'Refinement description'    
9  6 'Structure model' 'Data collection'           
10 6 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
4 4 'Structure model' struct_keywords      
5 5 'Structure model' software             
6 6 'Structure model' software             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site' 
2 4 'Structure model' '_struct_keywords.text'              
3 5 'Structure model' '_software.classification'           
4 6 'Structure model' '_software.classification'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
TNT    refinement       . ? 2 
X-PLOR refinement       . ? 3 
X-PLOR phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1IFC 
_pdbx_entry_details.compound_details     
;TURN B5 IS TYPE II' IN FIRST STRUCTURE, TYPE III' IN
SECOND STRUCTURE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;SEQUENCE ADVISORY NOTICE:
     DIFFERENCE BETWEEN SWISS-PROT AND PDB SEQUENCE.

     SWISS-PROT ENTRY NAME: FABI_RAT

     SWISS-PROT RESIDUE      PDB SEQRES
       NAME   NUMBER         NAME  CHAIN  SEQ/INSERT CODE
       TYR      9            ASP            9
       LEU     82            TRP           82
;
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD A GLU 51  ? A OE1 A GLU 51  ? A 1.365 1.252 0.113  0.011 N 
2 1 CD A GLU 51  ? B OE1 A GLU 51  ? B 1.359 1.252 0.107  0.011 N 
3 1 CB A ASP 74  ? B CG  A ASP 74  ? B 1.306 1.513 -0.207 0.021 N 
4 1 C  A GLU 131 ? A OXT A GLU 131 ? A 1.547 1.229 0.318  0.019 N 
5 1 C  A GLU 131 ? B OXT A GLU 131 ? B 1.546 1.229 0.317  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 3   ? A CG A ASP 3   ? A OD1 A ASP 3   ? A 112.57 118.30 -5.73  0.90 N 
2 1 CB A ASP 3   ? B CG A ASP 3   ? B OD1 A ASP 3   ? B 112.57 118.30 -5.73  0.90 N 
3 1 CA A LYS 94  ? A CB A LYS 94  ? A CG  A LYS 94  ? A 98.93  113.40 -14.47 2.20 N 
4 1 CB A ASP 97  ? A CG A ASP 97  ? A OD1 A ASP 97  ? A 124.66 118.30 6.36   0.90 N 
5 1 CB A ASP 97  ? B CG A ASP 97  ? B OD1 A ASP 97  ? B 124.66 118.30 6.36   0.90 N 
6 1 CA A GLU 131 ? A CB A GLU 131 ? A CG  A GLU 131 ? A 127.40 113.40 14.00  2.20 N 
7 1 CA A GLU 131 ? B CB A GLU 131 ? B CG  A GLU 131 ? B 127.40 113.40 14.00  2.20 N 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     MET 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      0 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    MET 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#