data_1IG4
# 
_entry.id   1IG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IG4         
RCSB  RCSB013242   
WWPDB D_1000013242 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IG4 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-17 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohki, I.'      1 
'Shimotake, N.' 2 
'Fujita, N.'    3 
'Jee, J.-G.'    4 
'Ikegami, T.'   5 
'Nakao, M.'     6 
'Shirakawa, M.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solution structure of the methyl-CpG binding domain of human MBD1 in complex with methylated DNA.'               
'Cell(Cambridge,Mass.)' 105 487  497  2001 CELLB5 US 0092-8674 0998 ? 11371345 '10.1016/S0092-8674(01)00324-5' 
1       'Solution structure of the methyl-CpG-binding domain of the methylation-dependent transcriptional repressor MBD1' 
'Embo J.'               18  6653 6661 1999 EMJODG UK 0261-4189 0897 ? ?        10.1093/emboj/18.23.6653        
2       'A component of the transcriptional repressor MeCP1 shares a motif with DNA methyltransferase and HRX proteins'   
Nat.Genet.              16  256  259  1997 ?      US 1061-4036 9999 ? ?        ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ohki, I.'      1  
primary 'Shimotake, N.' 2  
primary 'Fujita, N.'    3  
primary 'Jee, J.'       4  
primary 'Ikegami, T.'   5  
primary 'Nakao, M.'     6  
primary 'Shirakawa, M.' 7  
1       'Ohki, I.'      8  
1       'Shimotake, N.' 9  
1       'Fujita, N.'    10 
1       'Nakao, M.'     11 
1       'Shirakawa, M.' 12 
2       'Cross, S.H.'   13 
2       'Meehan, R.R.'  14 
2       'Nan, X.'       15 
2       'Bird, A.'      16 
# 
_cell.entry_id           1IG4 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IG4 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*GP*TP*AP*TP*CP*(5CM)P*GP*GP*AP*TP*AP*C)-3'" 3676.431 2 ? ? ?                           ? 
2 polymer man 'Methyl-CpG Binding Protein'                       8516.751 1 ? ? 'Methyl-CpG-binding domain' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DG)(DT)(DA)(DT)(DC)(5CM)(DG)(DG)(DA)(DT)(DA)(DC)'                         GTATCCGGATAC B,C ? 
2 'polypeptide(L)'        no no  MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK 
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK A   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DT  n 
1 3  DA  n 
1 4  DT  n 
1 5  DC  n 
1 6  5CM n 
1 7  DG  n 
1 8  DG  n 
1 9  DA  n 
1 10 DT  n 
1 11 DA  n 
1 12 DC  n 
2 1  MET n 
2 2  ALA n 
2 3  GLU n 
2 4  ASP n 
2 5  TRP n 
2 6  LEU n 
2 7  ASP n 
2 8  CYS n 
2 9  PRO n 
2 10 ALA n 
2 11 LEU n 
2 12 GLY n 
2 13 PRO n 
2 14 GLY n 
2 15 TRP n 
2 16 LYS n 
2 17 ARG n 
2 18 ARG n 
2 19 GLU n 
2 20 VAL n 
2 21 PHE n 
2 22 ARG n 
2 23 LYS n 
2 24 SER n 
2 25 GLY n 
2 26 ALA n 
2 27 THR n 
2 28 CYS n 
2 29 GLY n 
2 30 ARG n 
2 31 SER n 
2 32 ASP n 
2 33 THR n 
2 34 TYR n 
2 35 TYR n 
2 36 GLN n 
2 37 SER n 
2 38 PRO n 
2 39 THR n 
2 40 GLY n 
2 41 ASP n 
2 42 ARG n 
2 43 ILE n 
2 44 ARG n 
2 45 SER n 
2 46 LYS n 
2 47 VAL n 
2 48 GLU n 
2 49 LEU n 
2 50 THR n 
2 51 ARG n 
2 52 TYR n 
2 53 LEU n 
2 54 GLY n 
2 55 PRO n 
2 56 ALA n 
2 57 CYS n 
2 58 ASP n 
2 59 LEU n 
2 60 THR n 
2 61 LEU n 
2 62 PHE n 
2 63 ASP n 
2 64 PHE n 
2 65 LYS n 
2 66 GLN n 
2 67 GLY n 
2 68 ILE n 
2 69 LEU n 
2 70 CYS n 
2 71 TYR n 
2 72 PRO n 
2 73 ALA n 
2 74 PRO n 
2 75 LYS n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 MBD1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5a 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MBD1_HUMAN 2 MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK 1 Q9UIS9 ? 
2 PDB 1IG4       1 ?                                                                           ? 1IG4   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IG4 A 1 ? 75 ? Q9UIS9 1   ? 75  ? 1   75  
2 2 1IG4 B 1 ? 12 ? 1IG4   101 ? 112 ? 101 112 
3 2 1IG4 C 1 ? 12 ? 1IG4   113 ? 124 ? 113 124 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5CM 'DNA linking'       n "5-METHYL-2'-DEOXY-CYTIDINE-5'-MONOPHOSPHATE" ? 'C10 H16 N3 O7 P' 321.224 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'  175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"           ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"          ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                  ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'      75.067  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 4D_13C/15N-separated_NOESY          
2 2 1 4D_13C-separated_NOESY              
3 3 1 3D_15N-separated_NOESY              
4 2 1 3D_13C-filtered_13C-separated_NOESY 
5 3 1 HNHA                                
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.3mM MBD1(U-15N,13C)-DNA Complex; 20mM phosphate buffer' '90% H2O/10% D2O' 
2 '1.3mM MBD1(U-15N,13C)-DNA Complex; 20mM phosphate buffer' '100% D2O'        
3 '1mM MBD1(U-15N)-DNA Complex; 20mM phosphate buffer'       '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 500 
2 ? Bruker DMX 500 
3 ? Bruker DRX 800 
# 
_pdbx_nmr_refine.entry_id           1IG4 
_pdbx_nmr_refine.method             'Structure calculations were performed following simulated annealing protocols using X-PLOR.' 
_pdbx_nmr_refine.details            
;The structure was determined from a total of 2,022 distance and dihedral angle restraints, including 91 intermolecular NOE restraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1IG4 
_pdbx_nmr_details.text       'The structure was determined using multi-dimensional heteronuclear techniques.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1IG4 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1IG4 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 1.8   processing      Delaglio 1 
Pipp    4.0.4 'data analysis' Garrett  2 
NMRView 4     'data analysis' Johnson  3 
X-PLOR  3.8   refinement      Brunger  4 
# 
_exptl.entry_id          1IG4 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IG4 
_struct.title                     
'Solution Structure of the Methyl-CpG-Binding Domain of Human MBD1 in Complex with Methylated DNA' 
_struct.pdbx_descriptor           'Methyl-CpG Binding Protein/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IG4 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, ALPHA-BETA, DOUBLE HELIX, RECOGNITION VIA BETA-SHEET, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       C 
_struct_conf.beg_label_seq_id        45 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       C 
_struct_conf.end_label_seq_id        54 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         45 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         54 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A DC  5  "O3'" ? ? ? 1_555 A 5CM 6  P  ? ? B DC  105 B 5CM 106 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale2  covale ? ? A 5CM 6  "O3'" ? ? ? 1_555 A DG  7  P  ? ? B 5CM 106 B DG  107 1_555 ? ? ? ? ? ? ?            1.609 ? 
covale3  covale ? ? B DC  5  "O3'" ? ? ? 1_555 B 5CM 6  P  ? ? C DC  117 C 5CM 118 1_555 ? ? ? ? ? ? ?            1.610 ? 
covale4  covale ? ? B 5CM 6  "O3'" ? ? ? 1_555 B DG  7  P  ? ? C 5CM 118 C DG  119 1_555 ? ? ? ? ? ? ?            1.609 ? 
hydrog1  hydrog ? ? A DG  1  N1    ? ? ? 1_555 B DC  12 N3 ? ? B DG  101 C DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG  1  N2    ? ? ? 1_555 B DC  12 O2 ? ? B DG  101 C DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  1  O6    ? ? ? 1_555 B DC  12 N4 ? ? B DG  101 C DC  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT  2  N3    ? ? ? 1_555 B DA  11 N1 ? ? B DT  102 C DA  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT  2  O4    ? ? ? 1_555 B DA  11 N6 ? ? B DT  102 C DA  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DA  3  N1    ? ? ? 1_555 B DT  10 N3 ? ? B DA  103 C DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  3  N6    ? ? ? 1_555 B DT  10 O4 ? ? B DA  103 C DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DT  4  N3    ? ? ? 1_555 B DA  9  N1 ? ? B DT  104 C DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DT  4  O4    ? ? ? 1_555 B DA  9  N6 ? ? B DT  104 C DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DC  5  N3    ? ? ? 1_555 B DG  8  N1 ? ? B DC  105 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DC  5  N4    ? ? ? 1_555 B DG  8  O6 ? ? B DC  105 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC  5  O2    ? ? ? 1_555 B DG  8  N2 ? ? B DC  105 C DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A 5CM 6  N3    ? ? ? 1_555 B DG  7  N1 ? ? B 5CM 106 C DG  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A 5CM 6  N4    ? ? ? 1_555 B DG  7  O6 ? ? B 5CM 106 C DG  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A 5CM 6  O2    ? ? ? 1_555 B DG  7  N2 ? ? B 5CM 106 C DG  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DG  7  N1    ? ? ? 1_555 B 5CM 6  N3 ? ? B DG  107 C 5CM 118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG  7  N2    ? ? ? 1_555 B 5CM 6  O2 ? ? B DG  107 C 5CM 118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG  7  O6    ? ? ? 1_555 B 5CM 6  N4 ? ? B DG  107 C 5CM 118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG  8  N1    ? ? ? 1_555 B DC  5  N3 ? ? B DG  108 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DG  8  N2    ? ? ? 1_555 B DC  5  O2 ? ? B DG  108 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DG  8  O6    ? ? ? 1_555 B DC  5  N4 ? ? B DG  108 C DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  9  N1    ? ? ? 1_555 B DT  4  N3 ? ? B DA  109 C DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DA  9  N6    ? ? ? 1_555 B DT  4  O4 ? ? B DA  109 C DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT  10 N3    ? ? ? 1_555 B DA  3  N1 ? ? B DT  110 C DA  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DT  10 O4    ? ? ? 1_555 B DA  3  N6 ? ? B DT  110 C DA  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA  11 N1    ? ? ? 1_555 B DT  2  N3 ? ? B DA  111 C DT  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA  11 N6    ? ? ? 1_555 B DT  2  O4 ? ? B DA  111 C DT  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DC  12 N3    ? ? ? 1_555 B DG  1  N1 ? ? B DC  112 C DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DC  12 N4    ? ? ? 1_555 B DG  1  O6 ? ? B DC  112 C DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC  12 O2    ? ? ? 1_555 B DG  1  N2 ? ? B DC  112 C DG  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP C 5  ? ASP C 7  ? TRP A 5  ASP A 7  
A 2 LYS C 16 ? VAL C 20 ? LYS A 16 VAL A 20 
A 3 ASP C 32 ? GLN C 36 ? ASP A 32 GLN A 36 
A 4 ARG C 42 ? ILE C 43 ? ARG A 42 ILE A 43 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU C 6  ? O LEU A 6  N ARG C 17 ? N ARG A 17 
A 2 3 O VAL C 20 ? O VAL A 20 N ASP C 32 ? N ASP A 32 
A 3 4 N TYR C 35 ? N TYR A 35 O ILE C 43 ? O ILE A 43 
# 
_database_PDB_matrix.entry_id          1IG4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IG4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O "O5'"  . DG  A 1 1  ? 1.190   20.901  -12.916 1.00 0.00 ? 101 DG  B "O5'"  1  
ATOM   2     C "C5'"  . DG  A 1 1  ? 0.886   21.909  -11.948 1.00 0.00 ? 101 DG  B "C5'"  1  
ATOM   3     C "C4'"  . DG  A 1 1  ? 0.282   21.309  -10.683 1.00 0.00 ? 101 DG  B "C4'"  1  
ATOM   4     O "O4'"  . DG  A 1 1  ? -1.105  20.973  -10.887 1.00 0.00 ? 101 DG  B "O4'"  1  
ATOM   5     C "C3'"  . DG  A 1 1  ? 1.023   20.043  -10.278 1.00 0.00 ? 101 DG  B "C3'"  1  
ATOM   6     O "O3'"  . DG  A 1 1  ? 1.755   20.247  -9.065  1.00 0.00 ? 101 DG  B "O3'"  1  
ATOM   7     C "C2'"  . DG  A 1 1  ? -0.034  18.985  -10.100 1.00 0.00 ? 101 DG  B "C2'"  1  
ATOM   8     C "C1'"  . DG  A 1 1  ? -1.370  19.644  -10.401 1.00 0.00 ? 101 DG  B "C1'"  1  
ATOM   9     N N9     . DG  A 1 1  ? -2.142  18.867  -11.387 1.00 0.00 ? 101 DG  B N9     1  
ATOM   10    C C8     . DG  A 1 1  ? -1.709  18.036  -12.361 1.00 0.00 ? 101 DG  B C8     1  
ATOM   11    N N7     . DG  A 1 1  ? -2.597  17.465  -13.104 1.00 0.00 ? 101 DG  B N7     1  
ATOM   12    C C5     . DG  A 1 1  ? -3.785  17.974  -12.567 1.00 0.00 ? 101 DG  B C5     1  
ATOM   13    C C6     . DG  A 1 1  ? -5.132  17.731  -12.945 1.00 0.00 ? 101 DG  B C6     1  
ATOM   14    O O6     . DG  A 1 1  ? -5.549  17.014  -13.834 1.00 0.00 ? 101 DG  B O6     1  
ATOM   15    N N1     . DG  A 1 1  ? -6.021  18.440  -12.147 1.00 0.00 ? 101 DG  B N1     1  
ATOM   16    C C2     . DG  A 1 1  ? -5.663  19.280  -11.111 1.00 0.00 ? 101 DG  B C2     1  
ATOM   17    N N2     . DG  A 1 1  ? -6.664  19.873  -10.461 1.00 0.00 ? 101 DG  B N2     1  
ATOM   18    N N3     . DG  A 1 1  ? -4.398  19.514  -10.749 1.00 0.00 ? 101 DG  B N3     1  
ATOM   19    C C4     . DG  A 1 1  ? -3.514  18.834  -11.514 1.00 0.00 ? 101 DG  B C4     1  
ATOM   20    H "H5'"  . DG  A 1 1  ? 0.178   22.616  -12.380 1.00 0.00 ? 101 DG  B "H5'"  1  
ATOM   21    H "H5''" . DG  A 1 1  ? 1.803   22.439  -11.687 1.00 0.00 ? 101 DG  B "H5''" 1  
ATOM   22    H "H4'"  . DG  A 1 1  ? 0.351   22.032  -9.874  1.00 0.00 ? 101 DG  B "H4'"  1  
ATOM   23    H "H3'"  . DG  A 1 1  ? 1.704   19.746  -11.080 1.00 0.00 ? 101 DG  B "H3'"  1  
ATOM   24    H "H2'"  . DG  A 1 1  ? 0.142   18.162  -10.790 1.00 0.00 ? 101 DG  B "H2'"  1  
ATOM   25    H "H2''" . DG  A 1 1  ? -0.025  18.618  -9.074  1.00 0.00 ? 101 DG  B "H2''" 1  
ATOM   26    H "H1'"  . DG  A 1 1  ? -1.940  19.714  -9.481  1.00 0.00 ? 101 DG  B "H1'"  1  
ATOM   27    H H8     . DG  A 1 1  ? -0.647  17.854  -12.512 1.00 0.00 ? 101 DG  B H8     1  
ATOM   28    H H1     . DG  A 1 1  ? -6.972  18.320  -12.351 1.00 0.00 ? 101 DG  B H1     1  
ATOM   29    H H21    . DG  A 1 1  ? -7.621  19.695  -10.734 1.00 0.00 ? 101 DG  B H21    1  
ATOM   30    H H22    . DG  A 1 1  ? -6.467  20.499  -9.693  1.00 0.00 ? 101 DG  B H22    1  
ATOM   31    H "HO5'" . DG  A 1 1  ? 0.454   20.865  -13.532 1.00 0.00 ? 101 DG  B "HO5'" 1  
ATOM   32    P P      . DT  A 1 2  ? 2.292   18.992  -8.211  1.00 0.00 ? 102 DT  B P      1  
ATOM   33    O OP1    . DT  A 1 2  ? 3.389   19.464  -7.335  1.00 0.00 ? 102 DT  B OP1    1  
ATOM   34    O OP2    . DT  A 1 2  ? 2.522   17.863  -9.139  1.00 0.00 ? 102 DT  B OP2    1  
ATOM   35    O "O5'"  . DT  A 1 2  ? 1.026   18.633  -7.284  1.00 0.00 ? 102 DT  B "O5'"  1  
ATOM   36    C "C5'"  . DT  A 1 2  ? 0.133   19.660  -6.841  1.00 0.00 ? 102 DT  B "C5'"  1  
ATOM   37    C "C4'"  . DT  A 1 2  ? -0.943  19.106  -5.911  1.00 0.00 ? 102 DT  B "C4'"  1  
ATOM   38    O "O4'"  . DT  A 1 2  ? -2.109  18.705  -6.664  1.00 0.00 ? 102 DT  B "O4'"  1  
ATOM   39    C "C3'"  . DT  A 1 2  ? -0.424  17.895  -5.151  1.00 0.00 ? 102 DT  B "C3'"  1  
ATOM   40    O "O3'"  . DT  A 1 2  ? -0.509  18.113  -3.738  1.00 0.00 ? 102 DT  B "O3'"  1  
ATOM   41    C "C2'"  . DT  A 1 2  ? -1.289  16.735  -5.576  1.00 0.00 ? 102 DT  B "C2'"  1  
ATOM   42    C "C1'"  . DT  A 1 2  ? -2.357  17.292  -6.502  1.00 0.00 ? 102 DT  B "C1'"  1  
ATOM   43    N N1     . DT  A 1 2  ? -2.337  16.611  -7.811  1.00 0.00 ? 102 DT  B N1     1  
ATOM   44    C C2     . DT  A 1 2  ? -3.550  16.203  -8.330  1.00 0.00 ? 102 DT  B C2     1  
ATOM   45    O O2     . DT  A 1 2  ? -4.598  16.367  -7.735  1.00 0.00 ? 102 DT  B O2     1  
ATOM   46    N N3     . DT  A 1 2  ? -3.505  15.592  -9.570  1.00 0.00 ? 102 DT  B N3     1  
ATOM   47    C C4     . DT  A 1 2  ? -2.368  15.358  -10.322 1.00 0.00 ? 102 DT  B C4     1  
ATOM   48    O O4     . DT  A 1 2  ? -2.443  14.812  -11.405 1.00 0.00 ? 102 DT  B O4     1  
ATOM   49    C C5     . DT  A 1 2  ? -1.147  15.817  -9.698  1.00 0.00 ? 102 DT  B C5     1  
ATOM   50    C C7     . DT  A 1 2  ? 0.183   15.621  -10.418 1.00 0.00 ? 102 DT  B C7     1  
ATOM   51    C C6     . DT  A 1 2  ? -1.165  16.416  -8.490  1.00 0.00 ? 102 DT  B C6     1  
ATOM   52    H "H5'"  . DT  A 1 2  ? -0.346  20.112  -7.710  1.00 0.00 ? 102 DT  B "H5'"  1  
ATOM   53    H "H5''" . DT  A 1 2  ? 0.703   20.423  -6.311  1.00 0.00 ? 102 DT  B "H5''" 1  
ATOM   54    H "H4'"  . DT  A 1 2  ? -1.229  19.880  -5.198  1.00 0.00 ? 102 DT  B "H4'"  1  
ATOM   55    H "H3'"  . DT  A 1 2  ? 0.612   17.701  -5.437  1.00 0.00 ? 102 DT  B "H3'"  1  
ATOM   56    H "H2'"  . DT  A 1 2  ? -0.686  15.996  -6.106  1.00 0.00 ? 102 DT  B "H2'"  1  
ATOM   57    H "H2''" . DT  A 1 2  ? -1.754  16.278  -4.704  1.00 0.00 ? 102 DT  B "H2''" 1  
ATOM   58    H "H1'"  . DT  A 1 2  ? -3.334  17.151  -6.042  1.00 0.00 ? 102 DT  B "H1'"  1  
ATOM   59    H H3     . DT  A 1 2  ? -4.358  15.298  -9.951  1.00 0.00 ? 102 DT  B H3     1  
ATOM   60    H H71    . DT  A 1 2  ? 0.937   16.269  -9.972  1.00 0.00 ? 102 DT  B H71    1  
ATOM   61    H H72    . DT  A 1 2  ? 0.497   14.581  -10.325 1.00 0.00 ? 102 DT  B H72    1  
ATOM   62    H H73    . DT  A 1 2  ? 0.066   15.872  -11.472 1.00 0.00 ? 102 DT  B H73    1  
ATOM   63    H H6     . DT  A 1 2  ? -0.228  16.754  -8.047  1.00 0.00 ? 102 DT  B H6     1  
ATOM   64    P P      . DA  A 1 3  ? -0.391  16.884  -2.706  1.00 0.00 ? 103 DA  B P      1  
ATOM   65    O OP1    . DA  A 1 3  ? -0.487  17.423  -1.331  1.00 0.00 ? 103 DA  B OP1    1  
ATOM   66    O OP2    . DA  A 1 3  ? 0.775   16.061  -3.097  1.00 0.00 ? 103 DA  B OP2    1  
ATOM   67    O "O5'"  . DA  A 1 3  ? -1.729  16.041  -3.011  1.00 0.00 ? 103 DA  B "O5'"  1  
ATOM   68    C "C5'"  . DA  A 1 3  ? -3.007  16.524  -2.590  1.00 0.00 ? 103 DA  B "C5'"  1  
ATOM   69    C "C4'"  . DA  A 1 3  ? -4.028  15.395  -2.510  1.00 0.00 ? 103 DA  B "C4'"  1  
ATOM   70    O "O4'"  . DA  A 1 3  ? -4.582  15.116  -3.811  1.00 0.00 ? 103 DA  B "O4'"  1  
ATOM   71    C "C3'"  . DA  A 1 3  ? -3.378  14.125  -1.984  1.00 0.00 ? 103 DA  B "C3'"  1  
ATOM   72    O "O3'"  . DA  A 1 3  ? -3.943  13.755  -0.720  1.00 0.00 ? 103 DA  B "O3'"  1  
ATOM   73    C "C2'"  . DA  A 1 3  ? -3.633  13.070  -3.027  1.00 0.00 ? 103 DA  B "C2'"  1  
ATOM   74    C "C1'"  . DA  A 1 3  ? -4.497  13.709  -4.097  1.00 0.00 ? 103 DA  B "C1'"  1  
ATOM   75    N N9     . DA  A 1 3  ? -3.923  13.479  -5.428  1.00 0.00 ? 103 DA  B N9     1  
ATOM   76    C C8     . DA  A 1 3  ? -2.643  13.593  -5.825  1.00 0.00 ? 103 DA  B C8     1  
ATOM   77    N N7     . DA  A 1 3  ? -2.375  13.352  -7.065  1.00 0.00 ? 103 DA  B N7     1  
ATOM   78    C C5     . DA  A 1 3  ? -3.640  13.031  -7.565  1.00 0.00 ? 103 DA  B C5     1  
ATOM   79    C C6     . DA  A 1 3  ? -4.092  12.664  -8.836  1.00 0.00 ? 103 DA  B C6     1  
ATOM   80    N N6     . DA  A 1 3  ? -3.287  12.554  -9.892  1.00 0.00 ? 103 DA  B N6     1  
ATOM   81    N N1     . DA  A 1 3  ? -5.407  12.417  -8.978  1.00 0.00 ? 103 DA  B N1     1  
ATOM   82    C C2     . DA  A 1 3  ? -6.231  12.522  -7.934  1.00 0.00 ? 103 DA  B C2     1  
ATOM   83    N N3     . DA  A 1 3  ? -5.911  12.862  -6.689  1.00 0.00 ? 103 DA  B N3     1  
ATOM   84    C C4     . DA  A 1 3  ? -4.590  13.105  -6.572  1.00 0.00 ? 103 DA  B C4     1  
ATOM   85    H "H5'"  . DA  A 1 3  ? -3.358  17.272  -3.301  1.00 0.00 ? 103 DA  B "H5'"  1  
ATOM   86    H "H5''" . DA  A 1 3  ? -2.909  16.985  -1.607  1.00 0.00 ? 103 DA  B "H5''" 1  
ATOM   87    H "H4'"  . DA  A 1 3  ? -4.836  15.682  -1.842  1.00 0.00 ? 103 DA  B "H4'"  1  
ATOM   88    H "H3'"  . DA  A 1 3  ? -2.302  14.282  -1.879  1.00 0.00 ? 103 DA  B "H3'"  1  
ATOM   89    H "H2'"  . DA  A 1 3  ? -2.688  12.741  -3.461  1.00 0.00 ? 103 DA  B "H2'"  1  
ATOM   90    H "H2''" . DA  A 1 3  ? -4.153  12.223  -2.589  1.00 0.00 ? 103 DA  B "H2''" 1  
ATOM   91    H "H1'"  . DA  A 1 3  ? -5.488  13.281  -4.056  1.00 0.00 ? 103 DA  B "H1'"  1  
ATOM   92    H H8     . DA  A 1 3  ? -1.865  13.868  -5.116  1.00 0.00 ? 103 DA  B H8     1  
ATOM   93    H H61    . DA  A 1 3  ? -3.664  12.285  -10.790 1.00 0.00 ? 103 DA  B H61    1  
ATOM   94    H H62    . DA  A 1 3  ? -2.298  12.740  -9.795  1.00 0.00 ? 103 DA  B H62    1  
ATOM   95    H H2     . DA  A 1 3  ? -7.283  12.306  -8.124  1.00 0.00 ? 103 DA  B H2     1  
ATOM   96    P P      . DT  A 1 4  ? -3.799  12.252  -0.160  1.00 0.00 ? 104 DT  B P      1  
ATOM   97    O OP1    . DT  A 1 4  ? -3.661  12.317  1.312   1.00 0.00 ? 104 DT  B OP1    1  
ATOM   98    O OP2    . DT  A 1 4  ? -2.774  11.552  -0.967  1.00 0.00 ? 104 DT  B OP2    1  
ATOM   99    O "O5'"  . DT  A 1 4  ? -5.236  11.615  -0.505  1.00 0.00 ? 104 DT  B "O5'"  1  
ATOM   100   C "C5'"  . DT  A 1 4  ? -6.338  12.458  -0.857  1.00 0.00 ? 104 DT  B "C5'"  1  
ATOM   101   C "C4'"  . DT  A 1 4  ? -7.520  11.648  -1.383  1.00 0.00 ? 104 DT  B "C4'"  1  
ATOM   102   O "O4'"  . DT  A 1 4  ? -7.474  11.556  -2.824  1.00 0.00 ? 104 DT  B "O4'"  1  
ATOM   103   C "C3'"  . DT  A 1 4  ? -7.501  10.239  -0.811  1.00 0.00 ? 104 DT  B "C3'"  1  
ATOM   104   O "O3'"  . DT  A 1 4  ? -8.713  9.966   -0.100  1.00 0.00 ? 104 DT  B "O3'"  1  
ATOM   105   C "C2'"  . DT  A 1 4  ? -7.343  9.314   -1.991  1.00 0.00 ? 104 DT  B "C2'"  1  
ATOM   106   C "C1'"  . DT  A 1 4  ? -7.379  10.177  -3.241  1.00 0.00 ? 104 DT  B "C1'"  1  
ATOM   107   N N1     . DT  A 1 4  ? -6.173  9.963   -4.060  1.00 0.00 ? 104 DT  B N1     1  
ATOM   108   C C2     . DT  A 1 4  ? -6.352  9.682   -5.400  1.00 0.00 ? 104 DT  B C2     1  
ATOM   109   O O2     . DT  A 1 4  ? -7.456  9.595   -5.901  1.00 0.00 ? 104 DT  B O2     1  
ATOM   110   N N3     . DT  A 1 4  ? -5.198  9.503   -6.142  1.00 0.00 ? 104 DT  B N3     1  
ATOM   111   C C4     . DT  A 1 4  ? -3.902  9.582   -5.662  1.00 0.00 ? 104 DT  B C4     1  
ATOM   112   O O4     . DT  A 1 4  ? -2.955  9.409   -6.404  1.00 0.00 ? 104 DT  B O4     1  
ATOM   113   C C5     . DT  A 1 4  ? -3.816  9.879   -4.250  1.00 0.00 ? 104 DT  B C5     1  
ATOM   114   C C7     . DT  A 1 4  ? -2.446  9.993   -3.589  1.00 0.00 ? 104 DT  B C7     1  
ATOM   115   C C6     . DT  A 1 4  ? -4.926  10.055  -3.507  1.00 0.00 ? 104 DT  B C6     1  
ATOM   116   H "H5'"  . DT  A 1 4  ? -6.017  13.160  -1.627  1.00 0.00 ? 104 DT  B "H5'"  1  
ATOM   117   H "H5''" . DT  A 1 4  ? -6.654  13.016  0.024   1.00 0.00 ? 104 DT  B "H5''" 1  
ATOM   118   H "H4'"  . DT  A 1 4  ? -8.447  12.140  -1.089  1.00 0.00 ? 104 DT  B "H4'"  1  
ATOM   119   H "H3'"  . DT  A 1 4  ? -6.644  10.127  -0.144  1.00 0.00 ? 104 DT  B "H3'"  1  
ATOM   120   H "H2'"  . DT  A 1 4  ? -6.388  8.792   -1.929  1.00 0.00 ? 104 DT  B "H2'"  1  
ATOM   121   H "H2''" . DT  A 1 4  ? -8.158  8.595   -2.014  1.00 0.00 ? 104 DT  B "H2''" 1  
ATOM   122   H "H1'"  . DT  A 1 4  ? -8.259  9.920   -3.829  1.00 0.00 ? 104 DT  B "H1'"  1  
ATOM   123   H H3     . DT  A 1 4  ? -5.309  9.303   -7.095  1.00 0.00 ? 104 DT  B H3     1  
ATOM   124   H H71    . DT  A 1 4  ? -2.569  10.069  -2.509  1.00 0.00 ? 104 DT  B H71    1  
ATOM   125   H H72    . DT  A 1 4  ? -1.853  9.110   -3.826  1.00 0.00 ? 104 DT  B H72    1  
ATOM   126   H H73    . DT  A 1 4  ? -1.937  10.884  -3.960  1.00 0.00 ? 104 DT  B H73    1  
ATOM   127   H H6     . DT  A 1 4  ? -4.832  10.270  -2.442  1.00 0.00 ? 104 DT  B H6     1  
ATOM   128   P P      . DC  A 1 5  ? -9.110  8.458   0.298   1.00 0.00 ? 105 DC  B P      1  
ATOM   129   O OP1    . DC  A 1 5  ? -10.362 8.503   1.087   1.00 0.00 ? 105 DC  B OP1    1  
ATOM   130   O OP2    . DC  A 1 5  ? -7.911  7.793   0.853   1.00 0.00 ? 105 DC  B OP2    1  
ATOM   131   O "O5'"  . DC  A 1 5  ? -9.440  7.795   -1.131  1.00 0.00 ? 105 DC  B "O5'"  1  
ATOM   132   C "C5'"  . DC  A 1 5  ? -10.577 8.219   -1.887  1.00 0.00 ? 105 DC  B "C5'"  1  
ATOM   133   C "C4'"  . DC  A 1 5  ? -10.875 7.257   -3.032  1.00 0.00 ? 105 DC  B "C4'"  1  
ATOM   134   O "O4'"  . DC  A 1 5  ? -9.914  7.415   -4.097  1.00 0.00 ? 105 DC  B "O4'"  1  
ATOM   135   C "C3'"  . DC  A 1 5  ? -10.826 5.819   -2.551  1.00 0.00 ? 105 DC  B "C3'"  1  
ATOM   136   O "O3'"  . DC  A 1 5  ? -12.122 5.215   -2.695  1.00 0.00 ? 105 DC  B "O3'"  1  
ATOM   137   C "C2'"  . DC  A 1 5  ? -9.776  5.138   -3.398  1.00 0.00 ? 105 DC  B "C2'"  1  
ATOM   138   C "C1'"  . DC  A 1 5  ? -9.359  6.136   -4.458  1.00 0.00 ? 105 DC  B "C1'"  1  
ATOM   139   N N1     . DC  A 1 5  ? -7.891  6.208   -4.560  1.00 0.00 ? 105 DC  B N1     1  
ATOM   140   C C2     . DC  A 1 5  ? -7.322  6.005   -5.808  1.00 0.00 ? 105 DC  B C2     1  
ATOM   141   O O2     . DC  A 1 5  ? -8.028  5.774   -6.770  1.00 0.00 ? 105 DC  B O2     1  
ATOM   142   N N3     . DC  A 1 5  ? -5.966  6.074   -5.916  1.00 0.00 ? 105 DC  B N3     1  
ATOM   143   C C4     . DC  A 1 5  ? -5.203  6.332   -4.845  1.00 0.00 ? 105 DC  B C4     1  
ATOM   144   N N4     . DC  A 1 5  ? -3.878  6.392   -4.985  1.00 0.00 ? 105 DC  B N4     1  
ATOM   145   C C5     . DC  A 1 5  ? -5.789  6.540   -3.556  1.00 0.00 ? 105 DC  B C5     1  
ATOM   146   C C6     . DC  A 1 5  ? -7.130  6.468   -3.462  1.00 0.00 ? 105 DC  B C6     1  
ATOM   147   H "H5'"  . DC  A 1 5  ? -10.383 9.211   -2.296  1.00 0.00 ? 105 DC  B "H5'"  1  
ATOM   148   H "H5''" . DC  A 1 5  ? -11.445 8.270   -1.230  1.00 0.00 ? 105 DC  B "H5''" 1  
ATOM   149   H "H4'"  . DC  A 1 5  ? -11.869 7.457   -3.425  1.00 0.00 ? 105 DC  B "H4'"  1  
ATOM   150   H "H3'"  . DC  A 1 5  ? -10.519 5.795   -1.503  1.00 0.00 ? 105 DC  B "H3'"  1  
ATOM   151   H "H2'"  . DC  A 1 5  ? -8.918  4.871   -2.782  1.00 0.00 ? 105 DC  B "H2'"  1  
ATOM   152   H "H2''" . DC  A 1 5  ? -10.183 4.249   -3.869  1.00 0.00 ? 105 DC  B "H2''" 1  
ATOM   153   H "H1'"  . DC  A 1 5  ? -9.772  5.829   -5.414  1.00 0.00 ? 105 DC  B "H1'"  1  
ATOM   154   H H41    . DC  A 1 5  ? -3.460  6.244   -5.893  1.00 0.00 ? 105 DC  B H41    1  
ATOM   155   H H42    . DC  A 1 5  ? -3.294  6.585   -4.184  1.00 0.00 ? 105 DC  B H42    1  
ATOM   156   H H5     . DC  A 1 5  ? -5.172  6.751   -2.683  1.00 0.00 ? 105 DC  B H5     1  
ATOM   157   H H6     . DC  A 1 5  ? -7.614  6.610   -2.496  1.00 0.00 ? 105 DC  B H6     1  
HETATM 158   N N1     . 5CM A 1 6  ? -9.662  2.123   -6.543  1.00 0.00 ? 106 5CM B N1     1  
HETATM 159   C C2     . 5CM A 1 6  ? -8.435  2.002   -7.180  1.00 0.00 ? 106 5CM B C2     1  
HETATM 160   N N3     . 5CM A 1 6  ? -7.311  1.965   -6.414  1.00 0.00 ? 106 5CM B N3     1  
HETATM 161   C C4     . 5CM A 1 6  ? -7.384  2.042   -5.080  1.00 0.00 ? 106 5CM B C4     1  
HETATM 162   C C5     . 5CM A 1 6  ? -8.646  2.165   -4.418  1.00 0.00 ? 106 5CM B C5     1  
HETATM 163   C C5A    . 5CM A 1 6  ? -8.736  2.264   -2.899  1.00 0.00 ? 106 5CM B C5A    1  
HETATM 164   C C6     . 5CM A 1 6  ? -9.754  2.201   -5.184  1.00 0.00 ? 106 5CM B C6     1  
HETATM 165   O O2     . 5CM A 1 6  ? -8.382  1.933   -8.392  1.00 0.00 ? 106 5CM B O2     1  
HETATM 166   N N4     . 5CM A 1 6  ? -6.260  2.001   -4.364  1.00 0.00 ? 106 5CM B N4     1  
HETATM 167   C "C1'"  . 5CM A 1 6  ? -10.861 2.195   -7.404  1.00 0.00 ? 106 5CM B "C1'"  1  
HETATM 168   C "C2'"  . 5CM A 1 6  ? -12.039 1.435   -6.808  1.00 0.00 ? 106 5CM B "C2'"  1  
HETATM 169   C "C3'"  . 5CM A 1 6  ? -13.236 2.346   -6.938  1.00 0.00 ? 106 5CM B "C3'"  1  
HETATM 170   C "C4'"  . 5CM A 1 6  ? -12.654 3.727   -7.183  1.00 0.00 ? 106 5CM B "C4'"  1  
HETATM 171   O "O4'"  . 5CM A 1 6  ? -11.276 3.565   -7.585  1.00 0.00 ? 106 5CM B "O4'"  1  
HETATM 172   O "O3'"  . 5CM A 1 6  ? -14.083 1.973   -8.038  1.00 0.00 ? 106 5CM B "O3'"  1  
HETATM 173   C "C5'"  . 5CM A 1 6  ? -12.744 4.566   -5.915  1.00 0.00 ? 106 5CM B "C5'"  1  
HETATM 174   O "O5'"  . 5CM A 1 6  ? -11.820 4.105   -4.927  1.00 0.00 ? 106 5CM B "O5'"  1  
HETATM 175   P P      . 5CM A 1 6  ? -12.321 3.798   -3.431  1.00 0.00 ? 106 5CM B P      1  
HETATM 176   O OP1    . 5CM A 1 6  ? -13.768 3.499   -3.490  1.00 0.00 ? 106 5CM B OP1    1  
HETATM 177   O OP2    . 5CM A 1 6  ? -11.386 2.832   -2.816  1.00 0.00 ? 106 5CM B OP2    1  
HETATM 178   H H5A1   . 5CM A 1 6  ? -8.693  1.264   -2.467  1.00 0.00 ? 106 5CM B H5A1   1  
HETATM 179   H H5A2   . 5CM A 1 6  ? -7.902  2.858   -2.524  1.00 0.00 ? 106 5CM B H5A2   1  
HETATM 180   H H5A3   . 5CM A 1 6  ? -9.677  2.740   -2.621  1.00 0.00 ? 106 5CM B H5A3   1  
HETATM 181   H H6     . 5CM A 1 6  ? -10.733 2.289   -4.714  1.00 0.00 ? 106 5CM B H6     1  
HETATM 182   H HN41   . 5CM A 1 6  ? -6.301  2.057   -3.356  1.00 0.00 ? 106 5CM B HN41   1  
HETATM 183   H HN42   . 5CM A 1 6  ? -5.367  1.914   -4.829  1.00 0.00 ? 106 5CM B HN42   1  
HETATM 184   H "H1'"  . 5CM A 1 6  ? -10.623 1.766   -8.378  1.00 0.00 ? 106 5CM B "H1'"  1  
HETATM 185   H "H2'"  . 5CM A 1 6  ? -11.856 1.218   -5.753  1.00 0.00 ? 106 5CM B "H2'"  1  
HETATM 186   H "H2''" . 5CM A 1 6  ? -12.203 0.508   -7.354  1.00 0.00 ? 106 5CM B "H2''" 1  
HETATM 187   H "H3'"  . 5CM A 1 6  ? -13.804 2.343   -6.005  1.00 0.00 ? 106 5CM B "H3'"  1  
HETATM 188   H "H4'"  . 5CM A 1 6  ? -13.209 4.214   -7.983  1.00 0.00 ? 106 5CM B "H4'"  1  
HETATM 189   H "H5'"  . 5CM A 1 6  ? -12.518 5.604   -6.158  1.00 0.00 ? 106 5CM B "H5'"  1  
HETATM 190   H "H5''" . 5CM A 1 6  ? -13.755 4.503   -5.516  1.00 0.00 ? 106 5CM B "H5''" 1  
ATOM   191   P P      . DG  A 1 7  ? -14.200 0.447   -8.536  1.00 0.00 ? 107 DG  B P      1  
ATOM   192   O OP1    . DG  A 1 7  ? -15.079 0.412   -9.727  1.00 0.00 ? 107 DG  B OP1    1  
ATOM   193   O OP2    . DG  A 1 7  ? -14.513 -0.392  -7.365  1.00 0.00 ? 107 DG  B OP2    1  
ATOM   194   O "O5'"  . DG  A 1 7  ? -12.698 0.110   -9.004  1.00 0.00 ? 107 DG  B "O5'"  1  
ATOM   195   C "C5'"  . DG  A 1 7  ? -12.322 0.230   -10.376 1.00 0.00 ? 107 DG  B "C5'"  1  
ATOM   196   C "C4'"  . DG  A 1 7  ? -11.618 -1.028  -10.872 1.00 0.00 ? 107 DG  B "C4'"  1  
ATOM   197   O "O4'"  . DG  A 1 7  ? -10.209 -0.985  -10.559 1.00 0.00 ? 107 DG  B "O4'"  1  
ATOM   198   C "C3'"  . DG  A 1 7  ? -12.217 -2.270  -10.229 1.00 0.00 ? 107 DG  B "C3'"  1  
ATOM   199   O "O3'"  . DG  A 1 7  ? -12.878 -3.082  -11.214 1.00 0.00 ? 107 DG  B "O3'"  1  
ATOM   200   C "C2'"  . DG  A 1 7  ? -11.061 -2.999  -9.585  1.00 0.00 ? 107 DG  B "C2'"  1  
ATOM   201   C "C1'"  . DG  A 1 7  ? -9.813  -2.181  -9.854  1.00 0.00 ? 107 DG  B "C1'"  1  
ATOM   202   N N9     . DG  A 1 7  ? -9.135  -1.853  -8.593  1.00 0.00 ? 107 DG  B N9     1  
ATOM   203   C C8     . DG  A 1 7  ? -9.671  -1.523  -7.401  1.00 0.00 ? 107 DG  B C8     1  
ATOM   204   N N7     . DG  A 1 7  ? -8.864  -1.316  -6.416  1.00 0.00 ? 107 DG  B N7     1  
ATOM   205   C C5     . DG  A 1 7  ? -7.620  -1.533  -7.017  1.00 0.00 ? 107 DG  B C5     1  
ATOM   206   C C6     . DG  A 1 7  ? -6.314  -1.464  -6.462  1.00 0.00 ? 107 DG  B C6     1  
ATOM   207   O O6     . DG  A 1 7  ? -5.994  -1.194  -5.321  1.00 0.00 ? 107 DG  B O6     1  
ATOM   208   N N1     . DG  A 1 7  ? -5.342  -1.756  -7.410  1.00 0.00 ? 107 DG  B N1     1  
ATOM   209   C C2     . DG  A 1 7  ? -5.589  -2.074  -8.731  1.00 0.00 ? 107 DG  B C2     1  
ATOM   210   N N2     . DG  A 1 7  ? -4.520  -2.322  -9.488  1.00 0.00 ? 107 DG  B N2     1  
ATOM   211   N N3     . DG  A 1 7  ? -6.815  -2.141  -9.261  1.00 0.00 ? 107 DG  B N3     1  
ATOM   212   C C4     . DG  A 1 7  ? -7.779  -1.863  -8.354  1.00 0.00 ? 107 DG  B C4     1  
ATOM   213   H "H5'"  . DG  A 1 7  ? -11.650 1.080   -10.488 1.00 0.00 ? 107 DG  B "H5'"  1  
ATOM   214   H "H5''" . DG  A 1 7  ? -13.215 0.400   -10.978 1.00 0.00 ? 107 DG  B "H5''" 1  
ATOM   215   H "H4'"  . DG  A 1 7  ? -11.739 -1.098  -11.951 1.00 0.00 ? 107 DG  B "H4'"  1  
ATOM   216   H "H3'"  . DG  A 1 7  ? -12.929 -1.971  -9.457  1.00 0.00 ? 107 DG  B "H3'"  1  
ATOM   217   H "H2'"  . DG  A 1 7  ? -11.227 -3.080  -8.511  1.00 0.00 ? 107 DG  B "H2'"  1  
ATOM   218   H "H2''" . DG  A 1 7  ? -10.951 -3.990  -10.017 1.00 0.00 ? 107 DG  B "H2''" 1  
ATOM   219   H "H1'"  . DG  A 1 7  ? -9.137  -2.757  -10.478 1.00 0.00 ? 107 DG  B "H1'"  1  
ATOM   220   H H8     . DG  A 1 7  ? -10.750 -1.442  -7.280  1.00 0.00 ? 107 DG  B H8     1  
ATOM   221   H H1     . DG  A 1 7  ? -4.414  -1.728  -7.096  1.00 0.00 ? 107 DG  B H1     1  
ATOM   222   H H21    . DG  A 1 7  ? -3.594  -2.271  -9.087  1.00 0.00 ? 107 DG  B H21    1  
ATOM   223   H H22    . DG  A 1 7  ? -4.636  -2.560  -10.463 1.00 0.00 ? 107 DG  B H22    1  
ATOM   224   P P      . DG  A 1 8  ? -12.880 -4.690  -11.116 1.00 0.00 ? 108 DG  B P      1  
ATOM   225   O OP1    . DG  A 1 8  ? -13.969 -5.207  -11.974 1.00 0.00 ? 108 DG  B OP1    1  
ATOM   226   O OP2    . DG  A 1 8  ? -12.822 -5.069  -9.686  1.00 0.00 ? 108 DG  B OP2    1  
ATOM   227   O "O5'"  . DG  A 1 8  ? -11.473 -5.073  -11.799 1.00 0.00 ? 108 DG  B "O5'"  1  
ATOM   228   C "C5'"  . DG  A 1 8  ? -10.847 -4.167  -12.712 1.00 0.00 ? 108 DG  B "C5'"  1  
ATOM   229   C "C4'"  . DG  A 1 8  ? -9.337  -4.371  -12.769 1.00 0.00 ? 108 DG  B "C4'"  1  
ATOM   230   O "O4'"  . DG  A 1 8  ? -8.725  -4.078  -11.496 1.00 0.00 ? 108 DG  B "O4'"  1  
ATOM   231   C "C3'"  . DG  A 1 8  ? -8.996  -5.805  -13.142 1.00 0.00 ? 108 DG  B "C3'"  1  
ATOM   232   O "O3'"  . DG  A 1 8  ? -8.379  -5.855  -14.436 1.00 0.00 ? 108 DG  B "O3'"  1  
ATOM   233   C "C2'"  . DG  A 1 8  ? -8.060  -6.298  -12.066 1.00 0.00 ? 108 DG  B "C2'"  1  
ATOM   234   C "C1'"  . DG  A 1 8  ? -7.798  -5.123  -11.145 1.00 0.00 ? 108 DG  B "C1'"  1  
ATOM   235   N N9     . DG  A 1 8  ? -7.942  -5.507  -9.732  1.00 0.00 ? 108 DG  B N9     1  
ATOM   236   C C8     . DG  A 1 8  ? -9.062  -5.755  -9.023  1.00 0.00 ? 108 DG  B C8     1  
ATOM   237   N N7     . DG  A 1 8  ? -8.928  -6.051  -7.772  1.00 0.00 ? 108 DG  B N7     1  
ATOM   238   C C5     . DG  A 1 8  ? -7.539  -5.997  -7.616  1.00 0.00 ? 108 DG  B C5     1  
ATOM   239   C C6     . DG  A 1 8  ? -6.740  -6.225  -6.462  1.00 0.00 ? 108 DG  B C6     1  
ATOM   240   O O6     . DG  A 1 8  ? -7.102  -6.521  -5.341  1.00 0.00 ? 108 DG  B O6     1  
ATOM   241   N N1     . DG  A 1 8  ? -5.387  -6.066  -6.740  1.00 0.00 ? 108 DG  B N1     1  
ATOM   242   C C2     . DG  A 1 8  ? -4.862  -5.731  -7.972  1.00 0.00 ? 108 DG  B C2     1  
ATOM   243   N N2     . DG  A 1 8  ? -3.535  -5.623  -8.038  1.00 0.00 ? 108 DG  B N2     1  
ATOM   244   N N3     . DG  A 1 8  ? -5.607  -5.517  -9.062  1.00 0.00 ? 108 DG  B N3     1  
ATOM   245   C C4     . DG  A 1 8  ? -6.928  -5.665  -8.815  1.00 0.00 ? 108 DG  B C4     1  
ATOM   246   H "H5'"  . DG  A 1 8  ? -11.056 -3.145  -12.396 1.00 0.00 ? 108 DG  B "H5'"  1  
ATOM   247   H "H5''" . DG  A 1 8  ? -11.265 -4.323  -13.707 1.00 0.00 ? 108 DG  B "H5''" 1  
ATOM   248   H "H4'"  . DG  A 1 8  ? -8.916  -3.702  -13.520 1.00 0.00 ? 108 DG  B "H4'"  1  
ATOM   249   H "H3'"  . DG  A 1 8  ? -9.906  -6.409  -13.138 1.00 0.00 ? 108 DG  B "H3'"  1  
ATOM   250   H "H2'"  . DG  A 1 8  ? -8.526  -7.112  -11.510 1.00 0.00 ? 108 DG  B "H2'"  1  
ATOM   251   H "H2''" . DG  A 1 8  ? -7.124  -6.637  -12.508 1.00 0.00 ? 108 DG  B "H2''" 1  
ATOM   252   H "H1'"  . DG  A 1 8  ? -6.789  -4.767  -11.310 1.00 0.00 ? 108 DG  B "H1'"  1  
ATOM   253   H H8     . DG  A 1 8  ? -10.040 -5.704  -9.493  1.00 0.00 ? 108 DG  B H8     1  
ATOM   254   H H1     . DG  A 1 8  ? -4.775  -6.207  -5.989  1.00 0.00 ? 108 DG  B H1     1  
ATOM   255   H H21    . DG  A 1 8  ? -2.974  -5.787  -7.215  1.00 0.00 ? 108 DG  B H21    1  
ATOM   256   H H22    . DG  A 1 8  ? -3.090  -5.379  -8.912  1.00 0.00 ? 108 DG  B H22    1  
ATOM   257   P P      . DA  A 1 9  ? -7.442  -7.093  -14.863 1.00 0.00 ? 109 DA  B P      1  
ATOM   258   O OP1    . DA  A 1 9  ? -6.947  -6.850  -16.236 1.00 0.00 ? 109 DA  B OP1    1  
ATOM   259   O OP2    . DA  A 1 9  ? -8.162  -8.348  -14.549 1.00 0.00 ? 109 DA  B OP2    1  
ATOM   260   O "O5'"  . DA  A 1 9  ? -6.198  -6.959  -13.847 1.00 0.00 ? 109 DA  B "O5'"  1  
ATOM   261   C "C5'"  . DA  A 1 9  ? -5.111  -6.074  -14.134 1.00 0.00 ? 109 DA  B "C5'"  1  
ATOM   262   C "C4'"  . DA  A 1 9  ? -3.771  -6.788  -13.998 1.00 0.00 ? 109 DA  B "C4'"  1  
ATOM   263   O "O4'"  . DA  A 1 9  ? -3.400  -6.916  -12.608 1.00 0.00 ? 109 DA  B "O4'"  1  
ATOM   264   C "C3'"  . DA  A 1 9  ? -3.861  -8.182  -14.595 1.00 0.00 ? 109 DA  B "C3'"  1  
ATOM   265   O "O3'"  . DA  A 1 9  ? -2.787  -8.409  -15.516 1.00 0.00 ? 109 DA  B "O3'"  1  
ATOM   266   C "C2'"  . DA  A 1 9  ? -3.787  -9.130  -13.426 1.00 0.00 ? 109 DA  B "C2'"  1  
ATOM   267   C "C1'"  . DA  A 1 9  ? -3.443  -8.302  -12.203 1.00 0.00 ? 109 DA  B "C1'"  1  
ATOM   268   N N9     . DA  A 1 9  ? -4.447  -8.503  -11.153 1.00 0.00 ? 109 DA  B N9     1  
ATOM   269   C C8     . DA  A 1 9  ? -5.786  -8.495  -11.258 1.00 0.00 ? 109 DA  B C8     1  
ATOM   270   N N7     . DA  A 1 9  ? -6.476  -8.670  -10.180 1.00 0.00 ? 109 DA  B N7     1  
ATOM   271   C C5     . DA  A 1 9  ? -5.464  -8.818  -9.225  1.00 0.00 ? 109 DA  B C5     1  
ATOM   272   C C6     . DA  A 1 9  ? -5.487  -9.038  -7.844  1.00 0.00 ? 109 DA  B C6     1  
ATOM   273   N N6     . DA  A 1 9  ? -6.616  -9.153  -7.143  1.00 0.00 ? 109 DA  B N6     1  
ATOM   274   N N1     . DA  A 1 9  ? -4.303  -9.135  -7.213  1.00 0.00 ? 109 DA  B N1     1  
ATOM   275   C C2     . DA  A 1 9  ? -3.162  -9.024  -7.896  1.00 0.00 ? 109 DA  B C2     1  
ATOM   276   N N3     . DA  A 1 9  ? -3.025  -8.815  -9.202  1.00 0.00 ? 109 DA  B N3     1  
ATOM   277   C C4     . DA  A 1 9  ? -4.223  -8.720  -9.812  1.00 0.00 ? 109 DA  B C4     1  
ATOM   278   H "H5'"  . DA  A 1 9  ? -5.140  -5.236  -13.439 1.00 0.00 ? 109 DA  B "H5'"  1  
ATOM   279   H "H5''" . DA  A 1 9  ? -5.215  -5.699  -15.151 1.00 0.00 ? 109 DA  B "H5''" 1  
ATOM   280   H "H4'"  . DA  A 1 9  ? -3.004  -6.220  -14.524 1.00 0.00 ? 109 DA  B "H4'"  1  
ATOM   281   H "H3'"  . DA  A 1 9  ? -4.820  -8.303  -15.102 1.00 0.00 ? 109 DA  B "H3'"  1  
ATOM   282   H "H2'"  . DA  A 1 9  ? -4.751  -9.619  -13.284 1.00 0.00 ? 109 DA  B "H2'"  1  
ATOM   283   H "H2''" . DA  A 1 9  ? -3.019  -9.875  -13.595 1.00 0.00 ? 109 DA  B "H2''" 1  
ATOM   284   H "H1'"  . DA  A 1 9  ? -2.470  -8.599  -11.827 1.00 0.00 ? 109 DA  B "H1'"  1  
ATOM   285   H H8     . DA  A 1 9  ? -6.261  -8.358  -12.225 1.00 0.00 ? 109 DA  B H8     1  
ATOM   286   H H61    . DA  A 1 9  ? -6.577  -9.311  -6.146  1.00 0.00 ? 109 DA  B H61    1  
ATOM   287   H H62    . DA  A 1 9  ? -7.509  -9.082  -7.610  1.00 0.00 ? 109 DA  B H62    1  
ATOM   288   H H2     . DA  A 1 9  ? -2.241  -9.126  -7.320  1.00 0.00 ? 109 DA  B H2     1  
ATOM   289   P P      . DT  A 1 10 ? -2.391  -9.903  -15.965 1.00 0.00 ? 110 DT  B P      1  
ATOM   290   O OP1    . DT  A 1 10 ? -1.579  -9.817  -17.199 1.00 0.00 ? 110 DT  B OP1    1  
ATOM   291   O OP2    . DT  A 1 10 ? -3.616  -10.734 -15.944 1.00 0.00 ? 110 DT  B OP2    1  
ATOM   292   O "O5'"  . DT  A 1 10 ? -1.434  -10.387 -14.763 1.00 0.00 ? 110 DT  B "O5'"  1  
ATOM   293   C "C5'"  . DT  A 1 10 ? -0.630  -9.443  -14.049 1.00 0.00 ? 110 DT  B "C5'"  1  
ATOM   294   C "C4'"  . DT  A 1 10 ? 0.250   -10.129 -13.006 1.00 0.00 ? 110 DT  B "C4'"  1  
ATOM   295   O "O4'"  . DT  A 1 10 ? -0.401  -10.138 -11.716 1.00 0.00 ? 110 DT  B "O4'"  1  
ATOM   296   C "C3'"  . DT  A 1 10 ? 0.536   -11.568 -13.408 1.00 0.00 ? 110 DT  B "C3'"  1  
ATOM   297   O "O3'"  . DT  A 1 10 ? 1.947   -11.795 -13.499 1.00 0.00 ? 110 DT  B "O3'"  1  
ATOM   298   C "C2'"  . DT  A 1 10 ? -0.085  -12.428 -12.337 1.00 0.00 ? 110 DT  B "C2'"  1  
ATOM   299   C "C1'"  . DT  A 1 10 ? -0.589  -11.493 -11.253 1.00 0.00 ? 110 DT  B "C1'"  1  
ATOM   300   N N1     . DT  A 1 10 ? -2.010  -11.751 -10.958 1.00 0.00 ? 110 DT  B N1     1  
ATOM   301   C C2     . DT  A 1 10 ? -2.362  -11.936 -9.636  1.00 0.00 ? 110 DT  B C2     1  
ATOM   302   O O2     . DT  A 1 10 ? -1.545  -11.905 -8.738  1.00 0.00 ? 110 DT  B O2     1  
ATOM   303   N N3     . DT  A 1 10 ? -3.705  -12.158 -9.393  1.00 0.00 ? 110 DT  B N3     1  
ATOM   304   C C4     . DT  A 1 10 ? -4.708  -12.209 -10.345 1.00 0.00 ? 110 DT  B C4     1  
ATOM   305   O O4     . DT  A 1 10 ? -5.861  -12.409 -10.021 1.00 0.00 ? 110 DT  B O4     1  
ATOM   306   C C5     . DT  A 1 10 ? -4.242  -12.006 -11.699 1.00 0.00 ? 110 DT  B C5     1  
ATOM   307   C C7     . DT  A 1 10 ? -5.243  -12.037 -12.849 1.00 0.00 ? 110 DT  B C7     1  
ATOM   308   C C6     . DT  A 1 10 ? -2.938  -11.789 -11.960 1.00 0.00 ? 110 DT  B C6     1  
ATOM   309   H "H5'"  . DT  A 1 10 ? -1.282  -8.727  -13.549 1.00 0.00 ? 110 DT  B "H5'"  1  
ATOM   310   H "H5''" . DT  A 1 10 ? 0.008   -8.911  -14.756 1.00 0.00 ? 110 DT  B "H5''" 1  
ATOM   311   H "H4'"  . DT  A 1 10 ? 1.192   -9.588  -12.923 1.00 0.00 ? 110 DT  B "H4'"  1  
ATOM   312   H "H3'"  . DT  A 1 10 ? 0.061   -11.780 -14.367 1.00 0.00 ? 110 DT  B "H3'"  1  
ATOM   313   H "H2'"  . DT  A 1 10 ? -0.917  -12.996 -12.752 1.00 0.00 ? 110 DT  B "H2'"  1  
ATOM   314   H "H2''" . DT  A 1 10 ? 0.658   -13.106 -11.925 1.00 0.00 ? 110 DT  B "H2''" 1  
ATOM   315   H "H1'"  . DT  A 1 10 ? -0.003  -11.646 -10.347 1.00 0.00 ? 110 DT  B "H1'"  1  
ATOM   316   H H3     . DT  A 1 10 ? -3.970  -12.293 -8.458  1.00 0.00 ? 110 DT  B H3     1  
ATOM   317   H H71    . DT  A 1 10 ? -4.758  -11.691 -13.762 1.00 0.00 ? 110 DT  B H71    1  
ATOM   318   H H72    . DT  A 1 10 ? -5.599  -13.057 -12.992 1.00 0.00 ? 110 DT  B H72    1  
ATOM   319   H H73    . DT  A 1 10 ? -6.086  -11.386 -12.616 1.00 0.00 ? 110 DT  B H73    1  
ATOM   320   H H6     . DT  A 1 10 ? -2.614  -11.652 -12.991 1.00 0.00 ? 110 DT  B H6     1  
ATOM   321   P P      . DA  A 1 11 ? 2.545   -13.290 -13.501 1.00 0.00 ? 111 DA  B P      1  
ATOM   322   O OP1    . DA  A 1 11 ? 4.019   -13.201 -13.595 1.00 0.00 ? 111 DA  B OP1    1  
ATOM   323   O OP2    . DA  A 1 11 ? 1.789   -14.090 -14.491 1.00 0.00 ? 111 DA  B OP2    1  
ATOM   324   O "O5'"  . DA  A 1 11 ? 2.164   -13.822 -12.029 1.00 0.00 ? 111 DA  B "O5'"  1  
ATOM   325   C "C5'"  . DA  A 1 11 ? 2.853   -13.331 -10.875 1.00 0.00 ? 111 DA  B "C5'"  1  
ATOM   326   C "C4'"  . DA  A 1 11 ? 2.928   -14.391 -9.781  1.00 0.00 ? 111 DA  B "C4'"  1  
ATOM   327   O "O4'"  . DA  A 1 11 ? 1.725   -14.384 -8.979  1.00 0.00 ? 111 DA  B "O4'"  1  
ATOM   328   C "C3'"  . DA  A 1 11 ? 3.086   -15.774 -10.394 1.00 0.00 ? 111 DA  B "C3'"  1  
ATOM   329   O "O3'"  . DA  A 1 11 ? 4.294   -16.396 -9.948  1.00 0.00 ? 111 DA  B "O3'"  1  
ATOM   330   C "C2'"  . DA  A 1 11 ? 1.880   -16.563 -9.958  1.00 0.00 ? 111 DA  B "C2'"  1  
ATOM   331   C "C1'"  . DA  A 1 11 ? 1.083   -15.676 -9.021  1.00 0.00 ? 111 DA  B "C1'"  1  
ATOM   332   N N9     . DA  A 1 11 ? -0.304  -15.561 -9.486  1.00 0.00 ? 111 DA  B N9     1  
ATOM   333   C C8     . DA  A 1 11 ? -0.767  -15.384 -10.738 1.00 0.00 ? 111 DA  B C8     1  
ATOM   334   N N7     . DA  A 1 11 ? -2.047  -15.326 -10.901 1.00 0.00 ? 111 DA  B N7     1  
ATOM   335   C C5     . DA  A 1 11 ? -2.503  -15.486 -9.589  1.00 0.00 ? 111 DA  B C5     1  
ATOM   336   C C6     . DA  A 1 11 ? -3.783  -15.529 -9.026  1.00 0.00 ? 111 DA  B C6     1  
ATOM   337   N N6     . DA  A 1 11 ? -4.902  -15.404 -9.741  1.00 0.00 ? 111 DA  B N6     1  
ATOM   338   N N1     . DA  A 1 11 ? -3.867  -15.705 -7.695  1.00 0.00 ? 111 DA  B N1     1  
ATOM   339   C C2     . DA  A 1 11 ? -2.762  -15.831 -6.958  1.00 0.00 ? 111 DA  B C2     1  
ATOM   340   N N3     . DA  A 1 11 ? -1.504  -15.807 -7.386  1.00 0.00 ? 111 DA  B N3     1  
ATOM   341   C C4     . DA  A 1 11 ? -1.445  -15.631 -8.721  1.00 0.00 ? 111 DA  B C4     1  
ATOM   342   H "H5'"  . DA  A 1 11 ? 2.326   -12.459 -10.490 1.00 0.00 ? 111 DA  B "H5'"  1  
ATOM   343   H "H5''" . DA  A 1 11 ? 3.865   -13.040 -11.159 1.00 0.00 ? 111 DA  B "H5''" 1  
ATOM   344   H "H4'"  . DA  A 1 11 ? 3.784   -14.184 -9.140  1.00 0.00 ? 111 DA  B "H4'"  1  
ATOM   345   H "H3'"  . DA  A 1 11 ? 3.091   -15.690 -11.483 1.00 0.00 ? 111 DA  B "H3'"  1  
ATOM   346   H "H2'"  . DA  A 1 11 ? 1.275   -16.825 -10.826 1.00 0.00 ? 111 DA  B "H2'"  1  
ATOM   347   H "H2''" . DA  A 1 11 ? 2.193   -17.464 -9.440  1.00 0.00 ? 111 DA  B "H2''" 1  
ATOM   348   H "H1'"  . DA  A 1 11 ? 1.086   -16.111 -8.027  1.00 0.00 ? 111 DA  B "H1'"  1  
ATOM   349   H H8     . DA  A 1 11 ? -0.080  -15.313 -11.576 1.00 0.00 ? 111 DA  B H8     1  
ATOM   350   H H61    . DA  A 1 11 ? -5.801  -15.443 -9.283  1.00 0.00 ? 111 DA  B H61    1  
ATOM   351   H H62    . DA  A 1 11 ? -4.849  -15.270 -10.740 1.00 0.00 ? 111 DA  B H62    1  
ATOM   352   H H2     . DA  A 1 11 ? -2.906  -15.966 -5.886  1.00 0.00 ? 111 DA  B H2     1  
ATOM   353   P P      . DC  A 1 12 ? 5.077   -17.434 -10.897 1.00 0.00 ? 112 DC  B P      1  
ATOM   354   O OP1    . DC  A 1 12 ? 6.526   -17.150 -10.798 1.00 0.00 ? 112 DC  B OP1    1  
ATOM   355   O OP2    . DC  A 1 12 ? 4.414   -17.441 -12.220 1.00 0.00 ? 112 DC  B OP2    1  
ATOM   356   O "O5'"  . DC  A 1 12 ? 4.790   -18.846 -10.180 1.00 0.00 ? 112 DC  B "O5'"  1  
ATOM   357   C "C5'"  . DC  A 1 12 ? 4.964   -18.991 -8.769  1.00 0.00 ? 112 DC  B "C5'"  1  
ATOM   358   C "C4'"  . DC  A 1 12 ? 4.196   -20.191 -8.226  1.00 0.00 ? 112 DC  B "C4'"  1  
ATOM   359   O "O4'"  . DC  A 1 12 ? 2.808   -19.863 -8.025  1.00 0.00 ? 112 DC  B "O4'"  1  
ATOM   360   C "C3'"  . DC  A 1 12 ? 4.272   -21.364 -9.192  1.00 0.00 ? 112 DC  B "C3'"  1  
ATOM   361   O "O3'"  . DC  A 1 12 ? 5.073   -22.420 -8.652  1.00 0.00 ? 112 DC  B "O3'"  1  
ATOM   362   C "C2'"  . DC  A 1 12 ? 2.850   -21.819 -9.400  1.00 0.00 ? 112 DC  B "C2'"  1  
ATOM   363   C "C1'"  . DC  A 1 12 ? 1.970   -20.901 -8.569  1.00 0.00 ? 112 DC  B "C1'"  1  
ATOM   364   N N1     . DC  A 1 12 ? 0.881   -20.326 -9.386  1.00 0.00 ? 112 DC  B N1     1  
ATOM   365   C C2     . DC  A 1 12 ? -0.404  -20.389 -8.870  1.00 0.00 ? 112 DC  B C2     1  
ATOM   366   O O2     . DC  A 1 12 ? -0.601  -20.901 -7.786  1.00 0.00 ? 112 DC  B O2     1  
ATOM   367   N N3     . DC  A 1 12 ? -1.421  -19.867 -9.609  1.00 0.00 ? 112 DC  B N3     1  
ATOM   368   C C4     . DC  A 1 12 ? -1.188  -19.307 -10.802 1.00 0.00 ? 112 DC  B C4     1  
ATOM   369   N N4     . DC  A 1 12 ? -2.208  -18.806 -11.499 1.00 0.00 ? 112 DC  B N4     1  
ATOM   370   C C5     . DC  A 1 12 ? 0.136   -19.239 -11.338 1.00 0.00 ? 112 DC  B C5     1  
ATOM   371   C C6     . DC  A 1 12 ? 1.136   -19.759 -10.600 1.00 0.00 ? 112 DC  B C6     1  
ATOM   372   H "H5'"  . DC  A 1 12 ? 4.610   -18.088 -8.273  1.00 0.00 ? 112 DC  B "H5'"  1  
ATOM   373   H "H5''" . DC  A 1 12 ? 6.025   -19.121 -8.554  1.00 0.00 ? 112 DC  B "H5''" 1  
ATOM   374   H "H4'"  . DC  A 1 12 ? 4.627   -20.490 -7.274  1.00 0.00 ? 112 DC  B "H4'"  1  
ATOM   375   H "H3'"  . DC  A 1 12 ? 4.689   -21.028 -10.143 1.00 0.00 ? 112 DC  B "H3'"  1  
ATOM   376   H "HO3'" . DC  A 1 12 ? 4.845   -22.505 -7.724  1.00 0.00 ? 112 DC  B "HO3'" 1  
ATOM   377   H "H2'"  . DC  A 1 12 ? 2.584   -21.739 -10.454 1.00 0.00 ? 112 DC  B "H2'"  1  
ATOM   378   H "H2''" . DC  A 1 12 ? 2.736   -22.848 -9.063  1.00 0.00 ? 112 DC  B "H2''" 1  
ATOM   379   H "H1'"  . DC  A 1 12 ? 1.538   -21.470 -7.748  1.00 0.00 ? 112 DC  B "H1'"  1  
ATOM   380   H H41    . DC  A 1 12 ? -3.146  -18.851 -11.126 1.00 0.00 ? 112 DC  B H41    1  
ATOM   381   H H42    . DC  A 1 12 ? -2.044  -18.382 -12.401 1.00 0.00 ? 112 DC  B H42    1  
ATOM   382   H H5     . DC  A 1 12 ? 0.329   -18.783 -12.309 1.00 0.00 ? 112 DC  B H5     1  
ATOM   383   H H6     . DC  A 1 12 ? 2.159   -19.726 -10.977 1.00 0.00 ? 112 DC  B H6     1  
ATOM   384   O "O5'"  . DG  B 1 1  ? -10.384 -22.804 -7.931  1.00 0.00 ? 113 DG  C "O5'"  1  
ATOM   385   C "C5'"  . DG  B 1 1  ? -10.813 -22.947 -6.574  1.00 0.00 ? 113 DG  C "C5'"  1  
ATOM   386   C "C4'"  . DG  B 1 1  ? -9.975  -22.093 -5.629  1.00 0.00 ? 113 DG  C "C4'"  1  
ATOM   387   O "O4'"  . DG  B 1 1  ? -8.671  -21.838 -6.189  1.00 0.00 ? 113 DG  C "O4'"  1  
ATOM   388   C "C3'"  . DG  B 1 1  ? -10.649 -20.755 -5.366  1.00 0.00 ? 113 DG  C "C3'"  1  
ATOM   389   O "O3'"  . DG  B 1 1  ? -11.087 -20.667 -4.005  1.00 0.00 ? 113 DG  C "O3'"  1  
ATOM   390   C "C2'"  . DG  B 1 1  ? -9.615  -19.703 -5.675  1.00 0.00 ? 113 DG  C "C2'"  1  
ATOM   391   C "C1'"  . DG  B 1 1  ? -8.351  -20.439 -6.085  1.00 0.00 ? 113 DG  C "C1'"  1  
ATOM   392   N N9     . DG  B 1 1  ? -7.820  -19.926 -7.361  1.00 0.00 ? 113 DG  C N9     1  
ATOM   393   C C8     . DG  B 1 1  ? -8.468  -19.337 -8.393  1.00 0.00 ? 113 DG  C C8     1  
ATOM   394   N N7     . DG  B 1 1  ? -7.767  -18.973 -9.413  1.00 0.00 ? 113 DG  C N7     1  
ATOM   395   C C5     . DG  B 1 1  ? -6.481  -19.362 -9.027  1.00 0.00 ? 113 DG  C C5     1  
ATOM   396   C C6     . DG  B 1 1  ? -5.245  -19.238 -9.718  1.00 0.00 ? 113 DG  C C6     1  
ATOM   397   O O6     . DG  B 1 1  ? -5.041  -18.758 -10.816 1.00 0.00 ? 113 DG  C O6     1  
ATOM   398   N N1     . DG  B 1 1  ? -4.192  -19.756 -8.976  1.00 0.00 ? 113 DG  C N1     1  
ATOM   399   C C2     . DG  B 1 1  ? -4.305  -20.325 -7.722  1.00 0.00 ? 113 DG  C C2     1  
ATOM   400   N N2     . DG  B 1 1  ? -3.176  -20.766 -7.170  1.00 0.00 ? 113 DG  C N2     1  
ATOM   401   N N3     . DG  B 1 1  ? -5.463  -20.445 -7.066  1.00 0.00 ? 113 DG  C N3     1  
ATOM   402   C C4     . DG  B 1 1  ? -6.505  -19.946 -7.770  1.00 0.00 ? 113 DG  C C4     1  
ATOM   403   H "H5'"  . DG  B 1 1  ? -10.724 -23.992 -6.280  1.00 0.00 ? 113 DG  C "H5'"  1  
ATOM   404   H "H5''" . DG  B 1 1  ? -11.857 -22.643 -6.496  1.00 0.00 ? 113 DG  C "H5''" 1  
ATOM   405   H "H4'"  . DG  B 1 1  ? -9.852  -22.617 -4.684  1.00 0.00 ? 113 DG  C "H4'"  1  
ATOM   406   H "H3'"  . DG  B 1 1  ? -11.501 -20.638 -6.040  1.00 0.00 ? 113 DG  C "H3'"  1  
ATOM   407   H "H2'"  . DG  B 1 1  ? -9.962  -19.068 -6.488  1.00 0.00 ? 113 DG  C "H2'"  1  
ATOM   408   H "H2''" . DG  B 1 1  ? -9.421  -19.098 -4.789  1.00 0.00 ? 113 DG  C "H2''" 1  
ATOM   409   H "H1'"  . DG  B 1 1  ? -7.603  -20.306 -5.313  1.00 0.00 ? 113 DG  C "H1'"  1  
ATOM   410   H H8     . DG  B 1 1  ? -9.543  -19.178 -8.359  1.00 0.00 ? 113 DG  C H8     1  
ATOM   411   H H1     . DG  B 1 1  ? -3.306  -19.704 -9.392  1.00 0.00 ? 113 DG  C H1     1  
ATOM   412   H H21    . DG  B 1 1  ? -2.302  -20.674 -7.666  1.00 0.00 ? 113 DG  C H21    1  
ATOM   413   H H22    . DG  B 1 1  ? -3.195  -21.192 -6.254  1.00 0.00 ? 113 DG  C H22    1  
ATOM   414   H "HO5'" . DG  B 1 1  ? -9.626  -23.380 -8.052  1.00 0.00 ? 113 DG  C "HO5'" 1  
ATOM   415   P P      . DT  B 1 2  ? -11.417 -19.239 -3.336  1.00 0.00 ? 114 DT  C P      1  
ATOM   416   O OP1    . DT  B 1 2  ? -12.301 -19.465 -2.171  1.00 0.00 ? 114 DT  C OP1    1  
ATOM   417   O OP2    . DT  B 1 2  ? -11.836 -18.311 -4.411  1.00 0.00 ? 114 DT  C OP2    1  
ATOM   418   O "O5'"  . DT  B 1 2  ? -9.977  -18.765 -2.794  1.00 0.00 ? 114 DT  C "O5'"  1  
ATOM   419   C "C5'"  . DT  B 1 2  ? -8.973  -19.729 -2.461  1.00 0.00 ? 114 DT  C "C5'"  1  
ATOM   420   C "C4'"  . DT  B 1 2  ? -7.711  -19.062 -1.920  1.00 0.00 ? 114 DT  C "C4'"  1  
ATOM   421   O "O4'"  . DT  B 1 2  ? -6.781  -18.786 -2.989  1.00 0.00 ? 114 DT  C "O4'"  1  
ATOM   422   C "C3'"  . DT  B 1 2  ? -8.052  -17.749 -1.231  1.00 0.00 ? 114 DT  C "C3'"  1  
ATOM   423   O "O3'"  . DT  B 1 2  ? -7.588  -17.759 0.125   1.00 0.00 ? 114 DT  C "O3'"  1  
ATOM   424   C "C2'"  . DT  B 1 2  ? -7.369  -16.670 -2.035  1.00 0.00 ? 114 DT  C "C2'"  1  
ATOM   425   C "C1'"  . DT  B 1 2  ? -6.536  -17.367 -3.096  1.00 0.00 ? 114 DT  C "C1'"  1  
ATOM   426   N N1     . DT  B 1 2  ? -6.878  -16.883 -4.449  1.00 0.00 ? 114 DT  C N1     1  
ATOM   427   C C2     . DT  B 1 2  ? -5.830  -16.555 -5.287  1.00 0.00 ? 114 DT  C C2     1  
ATOM   428   O O2     . DT  B 1 2  ? -4.671  -16.634 -4.934  1.00 0.00 ? 114 DT  C O2     1  
ATOM   429   N N3     . DT  B 1 2  ? -6.179  -16.132 -6.556  1.00 0.00 ? 114 DT  C N3     1  
ATOM   430   C C4     . DT  B 1 2  ? -7.465  -16.008 -7.050  1.00 0.00 ? 114 DT  C C4     1  
ATOM   431   O O4     . DT  B 1 2  ? -7.657  -15.625 -8.187  1.00 0.00 ? 114 DT  C O4     1  
ATOM   432   C C5     . DT  B 1 2  ? -8.495  -16.371 -6.102  1.00 0.00 ? 114 DT  C C5     1  
ATOM   433   C C7     . DT  B 1 2  ? -9.960  -16.284 -6.515  1.00 0.00 ? 114 DT  C C7     1  
ATOM   434   C C6     . DT  B 1 2  ? -8.180  -16.789 -4.858  1.00 0.00 ? 114 DT  C C6     1  
ATOM   435   H "H5'"  . DT  B 1 2  ? -8.718  -20.300 -3.354  1.00 0.00 ? 114 DT  C "H5'"  1  
ATOM   436   H "H5''" . DT  B 1 2  ? -9.368  -20.408 -1.704  1.00 0.00 ? 114 DT  C "H5''" 1  
ATOM   437   H "H4'"  . DT  B 1 2  ? -7.237  -19.729 -1.200  1.00 0.00 ? 114 DT  C "H4'"  1  
ATOM   438   H "H3'"  . DT  B 1 2  ? -9.131  -17.594 -1.255  1.00 0.00 ? 114 DT  C "H3'"  1  
ATOM   439   H "H2'"  . DT  B 1 2  ? -8.115  -16.032 -2.509  1.00 0.00 ? 114 DT  C "H2'"  1  
ATOM   440   H "H2''" . DT  B 1 2  ? -6.725  -16.074 -1.392  1.00 0.00 ? 114 DT  C "H2''" 1  
ATOM   441   H "H1'"  . DT  B 1 2  ? -5.482  -17.171 -2.906  1.00 0.00 ? 114 DT  C "H1'"  1  
ATOM   442   H H3     . DT  B 1 2  ? -5.446  -15.896 -7.162  1.00 0.00 ? 114 DT  C H3     1  
ATOM   443   H H71    . DT  B 1 2  ? -10.078 -16.685 -7.522  1.00 0.00 ? 114 DT  C H71    1  
ATOM   444   H H72    . DT  B 1 2  ? -10.568 -16.861 -5.820  1.00 0.00 ? 114 DT  C H72    1  
ATOM   445   H H73    . DT  B 1 2  ? -10.280 -15.242 -6.499  1.00 0.00 ? 114 DT  C H73    1  
ATOM   446   H H6     . DT  B 1 2  ? -8.979  -17.057 -4.167  1.00 0.00 ? 114 DT  C H6     1  
ATOM   447   P P      . DA  B 1 3  ? -7.386  -16.386 0.941   1.00 0.00 ? 115 DA  C P      1  
ATOM   448   O OP1    . DA  B 1 3  ? -6.951  -16.723 2.314   1.00 0.00 ? 115 DA  C OP1    1  
ATOM   449   O OP2    . DA  B 1 3  ? -8.585  -15.543 0.731   1.00 0.00 ? 115 DA  C OP2    1  
ATOM   450   O "O5'"  . DA  B 1 3  ? -6.148  -15.701 0.173   1.00 0.00 ? 115 DA  C "O5'"  1  
ATOM   451   C "C5'"  . DA  B 1 3  ? -4.852  -16.308 0.189   1.00 0.00 ? 115 DA  C "C5'"  1  
ATOM   452   C "C4'"  . DA  B 1 3  ? -3.760  -15.296 -0.143  1.00 0.00 ? 115 DA  C "C4'"  1  
ATOM   453   O "O4'"  . DA  B 1 3  ? -3.645  -15.118 -1.569  1.00 0.00 ? 115 DA  C "O4'"  1  
ATOM   454   C "C3'"  . DA  B 1 3  ? -4.075  -13.948 0.484   1.00 0.00 ? 115 DA  C "C3'"  1  
ATOM   455   O "O3'"  . DA  B 1 3  ? -3.076  -13.588 1.445   1.00 0.00 ? 115 DA  C "O3'"  1  
ATOM   456   C "C2'"  . DA  B 1 3  ? -4.109  -12.963 -0.654  1.00 0.00 ? 115 DA  C "C2'"  1  
ATOM   457   C "C1'"  . DA  B 1 3  ? -3.692  -13.718 -1.901  1.00 0.00 ? 115 DA  C "C1'"  1  
ATOM   458   N N9     . DA  B 1 3  ? -4.642  -13.471 -2.994  1.00 0.00 ? 115 DA  C N9     1  
ATOM   459   C C8     . DA  B 1 3  ? -5.991  -13.499 -2.969  1.00 0.00 ? 115 DA  C C8     1  
ATOM   460   N N7     . DA  B 1 3  ? -6.616  -13.267 -4.075  1.00 0.00 ? 115 DA  C N7     1  
ATOM   461   C C5     . DA  B 1 3  ? -5.552  -13.051 -4.957  1.00 0.00 ? 115 DA  C C5     1  
ATOM   462   C C6     . DA  B 1 3  ? -5.499  -12.747 -6.321  1.00 0.00 ? 115 DA  C C6     1  
ATOM   463   N N6     . DA  B 1 3  ? -6.586  -12.600 -7.077  1.00 0.00 ? 115 DA  C N6     1  
ATOM   464   N N1     . DA  B 1 3  ? -4.282  -12.600 -6.875  1.00 0.00 ? 115 DA  C N1     1  
ATOM   465   C C2     . DA  B 1 3  ? -3.182  -12.741 -6.136  1.00 0.00 ? 115 DA  C C2     1  
ATOM   466   N N3     . DA  B 1 3  ? -3.115  -13.028 -4.839  1.00 0.00 ? 115 DA  C N3     1  
ATOM   467   C C4     . DA  B 1 3  ? -4.345  -13.172 -4.306  1.00 0.00 ? 115 DA  C C4     1  
ATOM   468   H "H5'"  . DA  B 1 3  ? -4.826  -17.114 -0.545  1.00 0.00 ? 115 DA  C "H5'"  1  
ATOM   469   H "H5''" . DA  B 1 3  ? -4.663  -16.722 1.180   1.00 0.00 ? 115 DA  C "H5''" 1  
ATOM   470   H "H4'"  . DA  B 1 3  ? -2.808  -15.651 0.242   1.00 0.00 ? 115 DA  C "H4'"  1  
ATOM   471   H "H3'"  . DA  B 1 3  ? -5.055  -13.986 0.963   1.00 0.00 ? 115 DA  C "H3'"  1  
ATOM   472   H "H2'"  . DA  B 1 3  ? -5.118  -12.573 -0.777  1.00 0.00 ? 115 DA  C "H2'"  1  
ATOM   473   H "H2''" . DA  B 1 3  ? -3.418  -12.148 -0.465  1.00 0.00 ? 115 DA  C "H2''" 1  
ATOM   474   H "H1'"  . DA  B 1 3  ? -2.700  -13.394 -2.202  1.00 0.00 ? 115 DA  C "H1'"  1  
ATOM   475   H H8     . DA  B 1 3  ? -6.529  -13.702 -2.044  1.00 0.00 ? 115 DA  C H8     1  
ATOM   476   H H61    . DA  B 1 3  ? -6.492  -12.381 -8.060  1.00 0.00 ? 115 DA  C H61    1  
ATOM   477   H H62    . DA  B 1 3  ? -7.503  -12.708 -6.671  1.00 0.00 ? 115 DA  C H62    1  
ATOM   478   H H2     . DA  B 1 3  ? -2.230  -12.603 -6.653  1.00 0.00 ? 115 DA  C H2     1  
ATOM   479   P P      . DT  B 1 4  ? -3.075  -12.125 2.117   1.00 0.00 ? 116 DT  C P      1  
ATOM   480   O OP1    . DT  B 1 4  ? -2.506  -12.242 3.479   1.00 0.00 ? 116 DT  C OP1    1  
ATOM   481   O OP2    . DT  B 1 4  ? -4.415  -11.527 1.925   1.00 0.00 ? 116 DT  C OP2    1  
ATOM   482   O "O5'"  . DT  B 1 4  ? -2.026  -11.319 1.201   1.00 0.00 ? 116 DT  C "O5'"  1  
ATOM   483   C "C5'"  . DT  B 1 4  ? -0.960  -12.006 0.538   1.00 0.00 ? 116 DT  C "C5'"  1  
ATOM   484   C "C4'"  . DT  B 1 4  ? -0.234  -11.095 -0.446  1.00 0.00 ? 116 DT  C "C4'"  1  
ATOM   485   O "O4'"  . DT  B 1 4  ? -0.821  -11.192 -1.759  1.00 0.00 ? 116 DT  C "O4'"  1  
ATOM   486   C "C3'"  . DT  B 1 4  ? -0.309  -9.645  0.006   1.00 0.00 ? 116 DT  C "C3'"  1  
ATOM   487   O "O3'"  . DT  B 1 4  ? 0.989   -9.151  0.354   1.00 0.00 ? 116 DT  C "O3'"  1  
ATOM   488   C "C2'"  . DT  B 1 4  ? -0.884  -8.881  -1.158  1.00 0.00 ? 116 DT  C "C2'"  1  
ATOM   489   C "C1'"  . DT  B 1 4  ? -1.083  -9.877  -2.283  1.00 0.00 ? 116 DT  C "C1'"  1  
ATOM   490   N N1     . DT  B 1 4  ? -2.451  -9.789  -2.820  1.00 0.00 ? 116 DT  C N1     1  
ATOM   491   C C2     . DT  B 1 4  ? -2.596  -9.591  -4.179  1.00 0.00 ? 116 DT  C C2     1  
ATOM   492   O O2     . DT  B 1 4  ? -1.642  -9.484  -4.924  1.00 0.00 ? 116 DT  C O2     1  
ATOM   493   N N3     . DT  B 1 4  ? -3.897  -9.520  -4.645  1.00 0.00 ? 116 DT  C N3     1  
ATOM   494   C C4     . DT  B 1 4  ? -5.044  -9.630  -3.879  1.00 0.00 ? 116 DT  C C4     1  
ATOM   495   O O4     . DT  B 1 4  ? -6.143  -9.554  -4.392  1.00 0.00 ? 116 DT  C O4     1  
ATOM   496   C C5     . DT  B 1 4  ? -4.790  -9.835  -2.470  1.00 0.00 ? 116 DT  C C5     1  
ATOM   497   C C7     . DT  B 1 4  ? -5.965  -9.971  -1.507  1.00 0.00 ? 116 DT  C C7     1  
ATOM   498   C C6     . DT  B 1 4  ? -3.532  -9.906  -1.994  1.00 0.00 ? 116 DT  C C6     1  
ATOM   499   H "H5'"  . DT  B 1 4  ? -1.368  -12.860 -0.003  1.00 0.00 ? 116 DT  C "H5'"  1  
ATOM   500   H "H5''" . DT  B 1 4  ? -0.249  -12.363 1.283   1.00 0.00 ? 116 DT  C "H5''" 1  
ATOM   501   H "H4'"  . DT  B 1 4  ? 0.810   -11.391 -0.509  1.00 0.00 ? 116 DT  C "H4'"  1  
ATOM   502   H "H3'"  . DT  B 1 4  ? -0.981  -9.564  0.862   1.00 0.00 ? 116 DT  C "H3'"  1  
ATOM   503   H "H2'"  . DT  B 1 4  ? -1.841  -8.441  -0.877  1.00 0.00 ? 116 DT  C "H2'"  1  
ATOM   504   H "H2''" . DT  B 1 4  ? -0.195  -8.101  -1.470  1.00 0.00 ? 116 DT  C "H2''" 1  
ATOM   505   H "H1'"  . DT  B 1 4  ? -0.370  -9.667  -3.076  1.00 0.00 ? 116 DT  C "H1'"  1  
ATOM   506   H H3     . DT  B 1 4  ? -4.018  -9.378  -5.607  1.00 0.00 ? 116 DT  C H3     1  
ATOM   507   H H71    . DT  B 1 4  ? -6.516  -10.884 -1.732  1.00 0.00 ? 116 DT  C H71    1  
ATOM   508   H H72    . DT  B 1 4  ? -5.592  -10.014 -0.483  1.00 0.00 ? 116 DT  C H72    1  
ATOM   509   H H73    . DT  B 1 4  ? -6.625  -9.111  -1.617  1.00 0.00 ? 116 DT  C H73    1  
ATOM   510   H H6     . DT  B 1 4  ? -3.368  -10.050 -0.926  1.00 0.00 ? 116 DT  C H6     1  
ATOM   511   P P      . DC  B 1 5  ? 1.259   -7.569  0.476   1.00 0.00 ? 117 DC  C P      1  
ATOM   512   O OP1    . DC  B 1 5  ? 2.555   -7.372  1.166   1.00 0.00 ? 117 DC  C OP1    1  
ATOM   513   O OP2    . DC  B 1 5  ? 0.036   -6.927  1.005   1.00 0.00 ? 117 DC  C OP2    1  
ATOM   514   O "O5'"  . DC  B 1 5  ? 1.436   -7.125  -1.062  1.00 0.00 ? 117 DC  C "O5'"  1  
ATOM   515   C "C5'"  . DC  B 1 5  ? 2.623   -7.464  -1.784  1.00 0.00 ? 117 DC  C "C5'"  1  
ATOM   516   C "C4'"  . DC  B 1 5  ? 2.676   -6.759  -3.135  1.00 0.00 ? 117 DC  C "C4'"  1  
ATOM   517   O "O4'"  . DC  B 1 5  ? 1.542   -7.129  -3.946  1.00 0.00 ? 117 DC  C "O4'"  1  
ATOM   518   C "C3'"  . DC  B 1 5  ? 2.667   -5.255  -2.957  1.00 0.00 ? 117 DC  C "C3'"  1  
ATOM   519   O "O3'"  . DC  B 1 5  ? 3.825   -4.670  -3.567  1.00 0.00 ? 117 DC  C "O3'"  1  
ATOM   520   C "C2'"  . DC  B 1 5  ? 1.401   -4.772  -3.607  1.00 0.00 ? 117 DC  C "C2'"  1  
ATOM   521   C "C1'"  . DC  B 1 5  ? 0.825   -5.950  -4.362  1.00 0.00 ? 117 DC  C "C1'"  1  
ATOM   522   N N1     . DC  B 1 5  ? -0.616  -6.084  -4.092  1.00 0.00 ? 117 DC  C N1     1  
ATOM   523   C C2     . DC  B 1 5  ? -1.480  -6.076  -5.175  1.00 0.00 ? 117 DC  C C2     1  
ATOM   524   O O2     . DC  B 1 5  ? -1.045  -5.957  -6.304  1.00 0.00 ? 117 DC  C O2     1  
ATOM   525   N N3     . DC  B 1 5  ? -2.815  -6.203  -4.935  1.00 0.00 ? 117 DC  C N3     1  
ATOM   526   C C4     . DC  B 1 5  ? -3.279  -6.336  -3.685  1.00 0.00 ? 117 DC  C C4     1  
ATOM   527   N N4     . DC  B 1 5  ? -4.591  -6.462  -3.485  1.00 0.00 ? 117 DC  C N4     1  
ATOM   528   C C5     . DC  B 1 5  ? -2.387  -6.345  -2.566  1.00 0.00 ? 117 DC  C C5     1  
ATOM   529   C C6     . DC  B 1 5  ? -1.069  -6.215  -2.816  1.00 0.00 ? 117 DC  C C6     1  
ATOM   530   H "H5'"  . DC  B 1 5  ? 2.647   -8.542  -1.943  1.00 0.00 ? 117 DC  C "H5'"  1  
ATOM   531   H "H5''" . DC  B 1 5  ? 3.493   -7.171  -1.196  1.00 0.00 ? 117 DC  C "H5''" 1  
ATOM   532   H "H4'"  . DC  B 1 5  ? 3.584   -7.038  -3.649  1.00 0.00 ? 117 DC  C "H4'"  1  
ATOM   533   H "H3'"  . DC  B 1 5  ? 2.648   -5.020  -1.898  1.00 0.00 ? 117 DC  C "H3'"  1  
ATOM   534   H "H2'"  . DC  B 1 5  ? 0.697   -4.437  -2.845  1.00 0.00 ? 117 DC  C "H2'"  1  
ATOM   535   H "H2''" . DC  B 1 5  ? 1.616   -3.960  -4.293  1.00 0.00 ? 117 DC  C "H2''" 1  
ATOM   536   H "H1'"  . DC  B 1 5  ? 0.982   -5.801  -5.424  1.00 0.00 ? 117 DC  C "H1'"  1  
ATOM   537   H H41    . DC  B 1 5  ? -5.226  -6.457  -4.271  1.00 0.00 ? 117 DC  C H41    1  
ATOM   538   H H42    . DC  B 1 5  ? -4.951  -6.562  -2.546  1.00 0.00 ? 117 DC  C H42    1  
ATOM   539   H H5     . DC  B 1 5  ? -2.760  -6.454  -1.548  1.00 0.00 ? 117 DC  C H5     1  
ATOM   540   H H6     . DC  B 1 5  ? -0.358  -6.197  -1.991  1.00 0.00 ? 117 DC  C H6     1  
HETATM 541   N N1     . 5CM B 1 6  ? -0.391  -2.156  -6.989  1.00 0.00 ? 118 5CM C N1     1  
HETATM 542   C C2     . 5CM B 1 6  ? -1.712  -2.097  -7.409  1.00 0.00 ? 118 5CM C C2     1  
HETATM 543   N N3     . 5CM B 1 6  ? -2.675  -1.875  -6.475  1.00 0.00 ? 118 5CM C N3     1  
HETATM 544   C C4     . 5CM B 1 6  ? -2.357  -1.716  -5.184  1.00 0.00 ? 118 5CM C C4     1  
HETATM 545   C C5     . 5CM B 1 6  ? -0.996  -1.777  -4.748  1.00 0.00 ? 118 5CM C C5     1  
HETATM 546   C C5A    . 5CM B 1 6  ? -0.630  -1.596  -3.278  1.00 0.00 ? 118 5CM C C5A    1  
HETATM 547   C C6     . 5CM B 1 6  ? -0.050  -1.998  -5.680  1.00 0.00 ? 118 5CM C C6     1  
HETATM 548   O O2     . 5CM B 1 6  ? -1.984  -2.242  -8.585  1.00 0.00 ? 118 5CM C O2     1  
HETATM 549   N N4     . 5CM B 1 6  ? -3.327  -1.502  -4.295  1.00 0.00 ? 118 5CM C N4     1  
HETATM 550   C "C1'"  . 5CM B 1 6  ? 0.642   -2.387  -8.015  1.00 0.00 ? 118 5CM C "C1'"  1  
HETATM 551   C "C2'"  . 5CM B 1 6  ? 1.731   -1.334  -7.928  1.00 0.00 ? 118 5CM C "C2'"  1  
HETATM 552   C "C3'"  . 5CM B 1 6  ? 3.046   -2.066  -7.838  1.00 0.00 ? 118 5CM C "C3'"  1  
HETATM 553   C "C4'"  . 5CM B 1 6  ? 2.692   -3.537  -7.691  1.00 0.00 ? 118 5CM C "C4'"  1  
HETATM 554   O "O4'"  . 5CM B 1 6  ? 1.261   -3.678  -7.838  1.00 0.00 ? 118 5CM C "O4'"  1  
HETATM 555   O "O3'"  . 5CM B 1 6  ? 3.840   -1.854  -9.012  1.00 0.00 ? 118 5CM C "O3'"  1  
HETATM 556   C "C5'"  . 5CM B 1 6  ? 3.146   -4.059  -6.333  1.00 0.00 ? 118 5CM C "C5'"  1  
HETATM 557   O "O5'"  . 5CM B 1 6  ? 2.943   -3.089  -5.303  1.00 0.00 ? 118 5CM C "O5'"  1  
HETATM 558   P P      . 5CM B 1 6  ? 3.850   -3.112  -3.973  1.00 0.00 ? 118 5CM C P      1  
HETATM 559   O OP1    . 5CM B 1 6  ? 5.235   -2.756  -4.351  1.00 0.00 ? 118 5CM C OP1    1  
HETATM 560   O OP2    . 5CM B 1 6  ? 3.150   -2.345  -2.919  1.00 0.00 ? 118 5CM C OP2    1  
HETATM 561   H H5A1   . 5CM B 1 6  ? 0.455   -1.560  -3.176  1.00 0.00 ? 118 5CM C H5A1   1  
HETATM 562   H H5A2   . 5CM B 1 6  ? -1.061  -0.667  -2.908  1.00 0.00 ? 118 5CM C H5A2   1  
HETATM 563   H H5A3   . 5CM B 1 6  ? -1.022  -2.434  -2.701  1.00 0.00 ? 118 5CM C H5A3   1  
HETATM 564   H H6     . 5CM B 1 6  ? 0.998   -2.056  -5.388  1.00 0.00 ? 118 5CM C H6     1  
HETATM 565   H HN41   . 5CM B 1 6  ? -3.099  -1.382  -3.318  1.00 0.00 ? 118 5CM C HN41   1  
HETATM 566   H HN42   . 5CM B 1 6  ? -4.289  -1.458  -4.598  1.00 0.00 ? 118 5CM C HN42   1  
HETATM 567   H "H1'"  . 5CM B 1 6  ? 0.181   -2.341  -9.000  1.00 0.00 ? 118 5CM C "H1'"  1  
HETATM 568   H "H2'"  . 5CM B 1 6  ? 1.585   -0.722  -7.036  1.00 0.00 ? 118 5CM C "H2'"  1  
HETATM 569   H "H2''" . 5CM B 1 6  ? 1.710   -0.706  -8.815  1.00 0.00 ? 118 5CM C "H2''" 1  
HETATM 570   H "H3'"  . 5CM B 1 6  ? 3.591   -1.730  -6.953  1.00 0.00 ? 118 5CM C "H3'"  1  
HETATM 571   H "H4'"  . 5CM B 1 6  ? 3.188   -4.106  -8.477  1.00 0.00 ? 118 5CM C "H4'"  1  
HETATM 572   H "H5'"  . 5CM B 1 6  ? 2.583   -4.959  -6.090  1.00 0.00 ? 118 5CM C "H5'"  1  
HETATM 573   H "H5''" . 5CM B 1 6  ? 4.208   -4.307  -6.384  1.00 0.00 ? 118 5CM C "H5''" 1  
ATOM   574   P P      . DG  B 1 7  ? 3.987   -0.387  -9.657  1.00 0.00 ? 119 DG  C P      1  
ATOM   575   O OP1    . DG  B 1 7  ? 4.874   -0.486  -10.837 1.00 0.00 ? 119 DG  C OP1    1  
ATOM   576   O OP2    . DG  B 1 7  ? 4.306   0.567   -8.571  1.00 0.00 ? 119 DG  C OP2    1  
ATOM   577   O "O5'"  . DG  B 1 7  ? 2.492   -0.081  -10.171 1.00 0.00 ? 119 DG  C "O5'"  1  
ATOM   578   C "C5'"  . DG  B 1 7  ? 1.921   -0.834  -11.246 1.00 0.00 ? 119 DG  C "C5'"  1  
ATOM   579   C "C4'"  . DG  B 1 7  ? 0.987   0.025   -12.091 1.00 0.00 ? 119 DG  C "C4'"  1  
ATOM   580   O "O4'"  . DG  B 1 7  ? -0.356  0.001   -11.554 1.00 0.00 ? 119 DG  C "O4'"  1  
ATOM   581   C "C3'"  . DG  B 1 7  ? 1.468   1.468   -12.111 1.00 0.00 ? 119 DG  C "C3'"  1  
ATOM   582   O "O3'"  . DG  B 1 7  ? 1.704   1.907   -13.453 1.00 0.00 ? 119 DG  C "O3'"  1  
ATOM   583   C "C2'"  . DG  B 1 7  ? 0.377   2.277   -11.459 1.00 0.00 ? 119 DG  C "C2'"  1  
ATOM   584   C "C1'"  . DG  B 1 7  ? -0.780  1.332   -11.193 1.00 0.00 ? 119 DG  C "C1'"  1  
ATOM   585   N N9     . DG  B 1 7  ? -1.173  1.396   -9.781  1.00 0.00 ? 119 DG  C N9     1  
ATOM   586   C C8     . DG  B 1 7  ? -0.389  1.404   -8.687  1.00 0.00 ? 119 DG  C C8     1  
ATOM   587   N N7     . DG  B 1 7  ? -0.964  1.495   -7.534  1.00 0.00 ? 119 DG  C N7     1  
ATOM   588   C C5     . DG  B 1 7  ? -2.313  1.559   -7.896  1.00 0.00 ? 119 DG  C C5     1  
ATOM   589   C C6     . DG  B 1 7  ? -3.473  1.671   -7.081  1.00 0.00 ? 119 DG  C C6     1  
ATOM   590   O O6     . DG  B 1 7  ? -3.539  1.735   -5.870  1.00 0.00 ? 119 DG  C O6     1  
ATOM   591   N N1     . DG  B 1 7  ? -4.632  1.706   -7.846  1.00 0.00 ? 119 DG  C N1     1  
ATOM   592   C C2     . DG  B 1 7  ? -4.677  1.640   -9.226  1.00 0.00 ? 119 DG  C C2     1  
ATOM   593   N N2     . DG  B 1 7  ? -5.889  1.687   -9.779  1.00 0.00 ? 119 DG  C N2     1  
ATOM   594   N N3     . DG  B 1 7  ? -3.591  1.533   -9.999  1.00 0.00 ? 119 DG  C N3     1  
ATOM   595   C C4     . DG  B 1 7  ? -2.450  1.499   -9.275  1.00 0.00 ? 119 DG  C C4     1  
ATOM   596   H "H5'"  . DG  B 1 7  ? 1.359   -1.672  -10.834 1.00 0.00 ? 119 DG  C "H5'"  1  
ATOM   597   H "H5''" . DG  B 1 7  ? 2.722   -1.218  -11.878 1.00 0.00 ? 119 DG  C "H5''" 1  
ATOM   598   H "H4'"  . DG  B 1 7  ? 0.970   -0.361  -13.110 1.00 0.00 ? 119 DG  C "H4'"  1  
ATOM   599   H "H3'"  . DG  B 1 7  ? 2.385   1.554   -11.525 1.00 0.00 ? 119 DG  C "H3'"  1  
ATOM   600   H "H2'"  . DG  B 1 7  ? 0.738   2.694   -10.519 1.00 0.00 ? 119 DG  C "H2'"  1  
ATOM   601   H "H2''" . DG  B 1 7  ? 0.059   3.077   -12.119 1.00 0.00 ? 119 DG  C "H2''" 1  
ATOM   602   H "H1'"  . DG  B 1 7  ? -1.625  1.620   -11.809 1.00 0.00 ? 119 DG  C "H1'"  1  
ATOM   603   H H8     . DG  B 1 7  ? 0.691   1.346   -8.784  1.00 0.00 ? 119 DG  C H8     1  
ATOM   604   H H1     . DG  B 1 7  ? -5.473  1.784   -7.349  1.00 0.00 ? 119 DG  C H1     1  
ATOM   605   H H21    . DG  B 1 7  ? -6.708  1.768   -9.195  1.00 0.00 ? 119 DG  C H21    1  
ATOM   606   H H22    . DG  B 1 7  ? -5.988  1.642   -10.784 1.00 0.00 ? 119 DG  C H22    1  
ATOM   607   P P      . DG  B 1 8  ? 1.870   3.473   -13.787 1.00 0.00 ? 120 DG  C P      1  
ATOM   608   O OP1    . DG  B 1 8  ? 2.940   3.621   -14.799 1.00 0.00 ? 120 DG  C OP1    1  
ATOM   609   O OP2    . DG  B 1 8  ? 1.954   4.213   -12.509 1.00 0.00 ? 120 DG  C OP2    1  
ATOM   610   O "O5'"  . DG  B 1 8  ? 0.465   3.830   -14.486 1.00 0.00 ? 120 DG  C "O5'"  1  
ATOM   611   C "C5'"  . DG  B 1 8  ? -0.400  2.789   -14.947 1.00 0.00 ? 120 DG  C "C5'"  1  
ATOM   612   C "C4'"  . DG  B 1 8  ? -1.866  3.193   -14.834 1.00 0.00 ? 120 DG  C "C4'"  1  
ATOM   613   O "O4'"  . DG  B 1 8  ? -2.310  3.130   -13.463 1.00 0.00 ? 120 DG  C "O4'"  1  
ATOM   614   C "C3'"  . DG  B 1 8  ? -2.072  4.612   -15.340 1.00 0.00 ? 120 DG  C "C3'"  1  
ATOM   615   O "O3'"  . DG  B 1 8  ? -2.899  4.613   -16.511 1.00 0.00 ? 120 DG  C "O3'"  1  
ATOM   616   C "C2'"  . DG  B 1 8  ? -2.722  5.362   -14.203 1.00 0.00 ? 120 DG  C "C2'"  1  
ATOM   617   C "C1'"  . DG  B 1 8  ? -2.980  4.351   -13.103 1.00 0.00 ? 120 DG  C "C1'"  1  
ATOM   618   N N9     . DG  B 1 8  ? -2.506  4.845   -11.802 1.00 0.00 ? 120 DG  C N9     1  
ATOM   619   C C8     . DG  B 1 8  ? -1.248  5.123   -11.401 1.00 0.00 ? 120 DG  C C8     1  
ATOM   620   N N7     . DG  B 1 8  ? -1.078  5.521   -10.185 1.00 0.00 ? 120 DG  C N7     1  
ATOM   621   C C5     . DG  B 1 8  ? -2.389  5.512   -9.698  1.00 0.00 ? 120 DG  C C5     1  
ATOM   622   C C6     . DG  B 1 8  ? -2.886  5.849   -8.410  1.00 0.00 ? 120 DG  C C6     1  
ATOM   623   O O6     . DG  B 1 8  ? -2.263  6.225   -7.437  1.00 0.00 ? 120 DG  C O6     1  
ATOM   624   N N1     . DG  B 1 8  ? -4.266  5.701   -8.342  1.00 0.00 ? 120 DG  C N1     1  
ATOM   625   C C2     . DG  B 1 8  ? -5.074  5.283   -9.381  1.00 0.00 ? 120 DG  C C2     1  
ATOM   626   N N2     . DG  B 1 8  ? -6.378  5.206   -9.118  1.00 0.00 ? 120 DG  C N2     1  
ATOM   627   N N3     . DG  B 1 8  ? -4.614  4.964   -10.595 1.00 0.00 ? 120 DG  C N3     1  
ATOM   628   C C4     . DG  B 1 8  ? -3.272  5.099   -10.685 1.00 0.00 ? 120 DG  C C4     1  
ATOM   629   H "H5'"  . DG  B 1 8  ? -0.230  1.893   -14.350 1.00 0.00 ? 120 DG  C "H5'"  1  
ATOM   630   H "H5''" . DG  B 1 8  ? -0.171  2.571   -15.990 1.00 0.00 ? 120 DG  C "H5''" 1  
ATOM   631   H "H4'"  . DG  B 1 8  ? -2.473  2.514   -15.430 1.00 0.00 ? 120 DG  C "H4'"  1  
ATOM   632   H "H3'"  . DG  B 1 8  ? -1.103  5.063   -15.566 1.00 0.00 ? 120 DG  C "H3'"  1  
ATOM   633   H "H2'"  . DG  B 1 8  ? -2.053  6.143   -13.842 1.00 0.00 ? 120 DG  C "H2'"  1  
ATOM   634   H "H2''" . DG  B 1 8  ? -3.664  5.801   -14.532 1.00 0.00 ? 120 DG  C "H2''" 1  
ATOM   635   H "H1'"  . DG  B 1 8  ? -4.041  4.163   -13.044 1.00 0.00 ? 120 DG  C "H1'"  1  
ATOM   636   H H8     . DG  B 1 8  ? -0.412  5.013   -12.085 1.00 0.00 ? 120 DG  C H8     1  
ATOM   637   H H1     . DG  B 1 8  ? -4.679  5.917   -7.480  1.00 0.00 ? 120 DG  C H1     1  
ATOM   638   H H21    . DG  B 1 8  ? -6.724  5.447   -8.200  1.00 0.00 ? 120 DG  C H21    1  
ATOM   639   H H22    . DG  B 1 8  ? -7.021  4.907   -9.838  1.00 0.00 ? 120 DG  C H22    1  
ATOM   640   P P      . DA  B 1 9  ? -3.717  5.927   -16.950 1.00 0.00 ? 121 DA  C P      1  
ATOM   641   O OP1    . DA  B 1 9  ? -4.484  5.609   -18.175 1.00 0.00 ? 121 DA  C OP1    1  
ATOM   642   O OP2    . DA  B 1 9  ? -2.787  7.079   -16.939 1.00 0.00 ? 121 DA  C OP2    1  
ATOM   643   O "O5'"  . DA  B 1 9  ? -4.759  6.110   -15.735 1.00 0.00 ? 121 DA  C "O5'"  1  
ATOM   644   C "C5'"  . DA  B 1 9  ? -5.846  5.197   -15.562 1.00 0.00 ? 121 DA  C "C5'"  1  
ATOM   645   C "C4'"  . DA  B 1 9  ? -7.134  5.933   -15.207 1.00 0.00 ? 121 DA  C "C4'"  1  
ATOM   646   O "O4'"  . DA  B 1 9  ? -7.204  6.175   -13.783 1.00 0.00 ? 121 DA  C "O4'"  1  
ATOM   647   C "C3'"  . DA  B 1 9  ? -7.185  7.274   -15.920 1.00 0.00 ? 121 DA  C "C3'"  1  
ATOM   648   O "O3'"  . DA  B 1 9  ? -8.406  7.412   -16.657 1.00 0.00 ? 121 DA  C "O3'"  1  
ATOM   649   C "C2'"  . DA  B 1 9  ? -7.081  8.318   -14.839 1.00 0.00 ? 121 DA  C "C2'"  1  
ATOM   650   C "C1'"  . DA  B 1 9  ? -7.128  7.590   -13.510 1.00 0.00 ? 121 DA  C "C1'"  1  
ATOM   651   N N9     . DA  B 1 9  ? -5.932  7.904   -12.720 1.00 0.00 ? 121 DA  C N9     1  
ATOM   652   C C8     . DA  B 1 9  ? -4.648  7.928   -13.114 1.00 0.00 ? 121 DA  C C8     1  
ATOM   653   N N7     . DA  B 1 9  ? -3.753  8.227   -12.234 1.00 0.00 ? 121 DA  C N7     1  
ATOM   654   C C5     . DA  B 1 9  ? -4.542  8.435   -11.096 1.00 0.00 ? 121 DA  C C5     1  
ATOM   655   C C6     . DA  B 1 9  ? -4.233  8.789   -9.779  1.00 0.00 ? 121 DA  C C6     1  
ATOM   656   N N6     . DA  B 1 9  ? -2.988  9.010   -9.356  1.00 0.00 ? 121 DA  C N6     1  
ATOM   657   N N1     . DA  B 1 9  ? -5.257  8.910   -8.914  1.00 0.00 ? 121 DA  C N1     1  
ATOM   658   C C2     . DA  B 1 9  ? -6.511  8.695   -9.318  1.00 0.00 ? 121 DA  C C2     1  
ATOM   659   N N3     . DA  B 1 9  ? -6.916  8.356   -10.539 1.00 0.00 ? 121 DA  C N3     1  
ATOM   660   C C4     . DA  B 1 9  ? -5.874  8.241   -11.386 1.00 0.00 ? 121 DA  C C4     1  
ATOM   661   H "H5'"  . DA  B 1 9  ? -5.602  4.498   -14.762 1.00 0.00 ? 121 DA  C "H5'"  1  
ATOM   662   H "H5''" . DA  B 1 9  ? -5.997  4.641   -16.488 1.00 0.00 ? 121 DA  C "H5''" 1  
ATOM   663   H "H4'"  . DA  B 1 9  ? -7.989  5.329   -15.510 1.00 0.00 ? 121 DA  C "H4'"  1  
ATOM   664   H "H3'"  . DA  B 1 9  ? -6.331  7.361   -16.594 1.00 0.00 ? 121 DA  C "H3'"  1  
ATOM   665   H "H2'"  . DA  B 1 9  ? -6.138  8.856   -14.934 1.00 0.00 ? 121 DA  C "H2'"  1  
ATOM   666   H "H2''" . DA  B 1 9  ? -7.910  9.012   -14.909 1.00 0.00 ? 121 DA  C "H2''" 1  
ATOM   667   H "H1'"  . DA  B 1 9  ? -8.009  7.901   -12.959 1.00 0.00 ? 121 DA  C "H1'"  1  
ATOM   668   H H8     . DA  B 1 9  ? -4.387  7.714   -14.147 1.00 0.00 ? 121 DA  C H8     1  
ATOM   669   H H61    . DA  B 1 9  ? -2.820  9.264   -8.393  1.00 0.00 ? 121 DA  C H61    1  
ATOM   670   H H62    . DA  B 1 9  ? -2.215  8.923   -9.999  1.00 0.00 ? 121 DA  C H62    1  
ATOM   671   H H2     . DA  B 1 9  ? -7.289  8.816   -8.565  1.00 0.00 ? 121 DA  C H2     1  
ATOM   672   P P      . DT  B 1 10 ? -8.902  8.859   -17.158 1.00 0.00 ? 122 DT  C P      1  
ATOM   673   O OP1    . DT  B 1 10 ? -9.768  8.668   -18.343 1.00 0.00 ? 122 DT  C OP1    1  
ATOM   674   O OP2    . DT  B 1 10 ? -7.723  9.751   -17.240 1.00 0.00 ? 122 DT  C OP2    1  
ATOM   675   O "O5'"  . DT  B 1 10 ? -9.824  9.354   -15.935 1.00 0.00 ? 122 DT  C "O5'"  1  
ATOM   676   C "C5'"  . DT  B 1 10 ? -10.326 8.414   -14.980 1.00 0.00 ? 122 DT  C "C5'"  1  
ATOM   677   C "C4'"  . DT  B 1 10 ? -10.993 9.112   -13.796 1.00 0.00 ? 122 DT  C "C4'"  1  
ATOM   678   O "O4'"  . DT  B 1 10 ? -10.059 9.264   -12.703 1.00 0.00 ? 122 DT  C "O4'"  1  
ATOM   679   C "C3'"  . DT  B 1 10 ? -11.488 10.494  -14.197 1.00 0.00 ? 122 DT  C "C3'"  1  
ATOM   680   O "O3'"  . DT  B 1 10 ? -12.896 10.614  -13.957 1.00 0.00 ? 122 DT  C "O3'"  1  
ATOM   681   C "C2'"  . DT  B 1 10 ? -10.709 11.472  -13.356 1.00 0.00 ? 122 DT  C "C2'"  1  
ATOM   682   C "C1'"  . DT  B 1 10 ? -9.911  10.658  -12.356 1.00 0.00 ? 122 DT  C "C1'"  1  
ATOM   683   N N1     . DT  B 1 10 ? -8.492  11.054  -12.371 1.00 0.00 ? 122 DT  C N1     1  
ATOM   684   C C2     . DT  B 1 10 ? -7.907  11.371  -11.161 1.00 0.00 ? 122 DT  C C2     1  
ATOM   685   O O2     . DT  B 1 10 ? -8.527  11.346  -10.116 1.00 0.00 ? 122 DT  C O2     1  
ATOM   686   N N3     . DT  B 1 10 ? -6.571  11.722  -11.207 1.00 0.00 ? 122 DT  C N3     1  
ATOM   687   C C4     . DT  B 1 10 ? -5.783  11.782  -12.343 1.00 0.00 ? 122 DT  C C4     1  
ATOM   688   O O4     . DT  B 1 10 ? -4.614  12.104  -12.270 1.00 0.00 ? 122 DT  C O4     1  
ATOM   689   C C5     . DT  B 1 10 ? -6.481  11.435  -13.561 1.00 0.00 ? 122 DT  C C5     1  
ATOM   690   C C7     . DT  B 1 10 ? -5.732  11.460  -14.888 1.00 0.00 ? 122 DT  C C7     1  
ATOM   691   C C6     . DT  B 1 10 ? -7.785  11.091  -13.540 1.00 0.00 ? 122 DT  C C6     1  
ATOM   692   H "H5'"  . DT  B 1 10 ? -9.501  7.804   -14.612 1.00 0.00 ? 122 DT  C "H5'"  1  
ATOM   693   H "H5''" . DT  B 1 10 ? -11.056 7.768   -15.467 1.00 0.00 ? 122 DT  C "H5''" 1  
ATOM   694   H "H4'"  . DT  B 1 10 ? -11.838 8.514   -13.460 1.00 0.00 ? 122 DT  C "H4'"  1  
ATOM   695   H "H3'"  . DT  B 1 10 ? -11.273 10.668  -15.253 1.00 0.00 ? 122 DT  C "H3'"  1  
ATOM   696   H "H2'"  . DT  B 1 10 ? -10.034 12.050  -13.987 1.00 0.00 ? 122 DT  C "H2'"  1  
ATOM   697   H "H2''" . DT  B 1 10 ? -11.389 12.140  -12.831 1.00 0.00 ? 122 DT  C "H2''" 1  
ATOM   698   H "H1'"  . DT  B 1 10 ? -10.315 10.822  -11.358 1.00 0.00 ? 122 DT  C "H1'"  1  
ATOM   699   H H3     . DT  B 1 10 ? -6.143  11.952  -10.355 1.00 0.00 ? 122 DT  C H3     1  
ATOM   700   H H71    . DT  B 1 10 ? -5.581  12.494  -15.200 1.00 0.00 ? 122 DT  C H71    1  
ATOM   701   H H72    . DT  B 1 10 ? -4.766  10.971  -14.770 1.00 0.00 ? 122 DT  C H72    1  
ATOM   702   H H73    . DT  B 1 10 ? -6.316  10.934  -15.645 1.00 0.00 ? 122 DT  C H73    1  
ATOM   703   H H6     . DT  B 1 10 ? -8.288  10.846  -14.474 1.00 0.00 ? 122 DT  C H6     1  
ATOM   704   P P      . DA  B 1 11 ? -13.609 12.058  -13.920 1.00 0.00 ? 123 DA  C P      1  
ATOM   705   O OP1    . DA  B 1 11 ? -15.042 11.859  -13.612 1.00 0.00 ? 123 DA  C OP1    1  
ATOM   706   O OP2    . DA  B 1 11 ? -13.212 12.801  -15.138 1.00 0.00 ? 123 DA  C OP2    1  
ATOM   707   O "O5'"  . DA  B 1 11 ? -12.913 12.764  -12.651 1.00 0.00 ? 123 DA  C "O5'"  1  
ATOM   708   C "C5'"  . DA  B 1 11 ? -13.292 12.411  -11.317 1.00 0.00 ? 123 DA  C "C5'"  1  
ATOM   709   C "C4'"  . DA  B 1 11 ? -13.148 13.596  -10.367 1.00 0.00 ? 123 DA  C "C4'"  1  
ATOM   710   O "O4'"  . DA  B 1 11 ? -11.802 13.669  -9.842  1.00 0.00 ? 123 DA  C "O4'"  1  
ATOM   711   C "C3'"  . DA  B 1 11 ? -13.448 14.897  -11.096 1.00 0.00 ? 123 DA  C "C3'"  1  
ATOM   712   O "O3'"  . DA  B 1 11 ? -14.536 15.593  -10.477 1.00 0.00 ? 123 DA  C "O3'"  1  
ATOM   713   C "C2'"  . DA  B 1 11 ? -12.183 15.710  -11.033 1.00 0.00 ? 123 DA  C "C2'"  1  
ATOM   714   C "C1'"  . DA  B 1 11 ? -11.198 14.937  -10.178 1.00 0.00 ? 123 DA  C "C1'"  1  
ATOM   715   N N9     . DA  B 1 11 ? -9.939  14.744  -10.906 1.00 0.00 ? 123 DA  C N9     1  
ATOM   716   C C8     . DA  B 1 11 ? -9.751  14.368  -12.182 1.00 0.00 ? 123 DA  C C8     1  
ATOM   717   N N7     . DA  B 1 11 ? -8.536  14.279  -12.611 1.00 0.00 ? 123 DA  C N7     1  
ATOM   718   C C5     . DA  B 1 11 ? -7.813  14.646  -11.472 1.00 0.00 ? 123 DA  C C5     1  
ATOM   719   C C6     . DA  B 1 11 ? -6.443  14.773  -11.216 1.00 0.00 ? 123 DA  C C6     1  
ATOM   720   N N6     . DA  B 1 11 ? -5.504  14.532  -12.132 1.00 0.00 ? 123 DA  C N6     1  
ATOM   721   N N1     . DA  B 1 11 ? -6.077  15.161  -9.981  1.00 0.00 ? 123 DA  C N1     1  
ATOM   722   C C2     . DA  B 1 11 ? -7.000  15.410  -9.050  1.00 0.00 ? 123 DA  C C2     1  
ATOM   723   N N3     . DA  B 1 11 ? -8.320  15.322  -9.184  1.00 0.00 ? 123 DA  C N3     1  
ATOM   724   C C4     . DA  B 1 11 ? -8.662  14.932  -10.427 1.00 0.00 ? 123 DA  C C4     1  
ATOM   725   H "H5'"  . DA  B 1 11 ? -12.656 11.597  -10.969 1.00 0.00 ? 123 DA  C "H5'"  1  
ATOM   726   H "H5''" . DA  B 1 11 ? -14.329 12.078  -11.318 1.00 0.00 ? 123 DA  C "H5''" 1  
ATOM   727   H "H4'"  . DA  B 1 11 ? -13.848 13.479  -9.540  1.00 0.00 ? 123 DA  C "H4'"  1  
ATOM   728   H "H3'"  . DA  B 1 11 ? -13.691 14.683  -12.140 1.00 0.00 ? 123 DA  C "H3'"  1  
ATOM   729   H "H2'"  . DA  B 1 11 ? -11.777 15.842  -12.036 1.00 0.00 ? 123 DA  C "H2'"  1  
ATOM   730   H "H2''" . DA  B 1 11 ? -12.382 16.679  -10.586 1.00 0.00 ? 123 DA  C "H2''" 1  
ATOM   731   H "H1'"  . DA  B 1 11 ? -10.998 15.492  -9.268  1.00 0.00 ? 123 DA  C "H1'"  1  
ATOM   732   H H8     . DA  B 1 11 ? -10.602 14.168  -12.829 1.00 0.00 ? 123 DA  C H8     1  
ATOM   733   H H61    . DA  B 1 11 ? -4.528  14.639  -11.894 1.00 0.00 ? 123 DA  C H61    1  
ATOM   734   H H62    . DA  B 1 11 ? -5.768  14.241  -13.061 1.00 0.00 ? 123 DA  C H62    1  
ATOM   735   H H2     . DA  B 1 11 ? -6.631  15.718  -8.072  1.00 0.00 ? 123 DA  C H2     1  
ATOM   736   P P      . DC  B 1 12 ? -15.574 16.441  -11.368 1.00 0.00 ? 124 DC  C P      1  
ATOM   737   O OP1    . DC  B 1 12 ? -16.940 16.181  -10.860 1.00 0.00 ? 124 DC  C OP1    1  
ATOM   738   O OP2    . DC  B 1 12 ? -15.261 16.205  -12.795 1.00 0.00 ? 124 DC  C OP2    1  
ATOM   739   O "O5'"  . DC  B 1 12 ? -15.184 17.961  -11.010 1.00 0.00 ? 124 DC  C "O5'"  1  
ATOM   740   C "C5'"  . DC  B 1 12 ? -14.956 18.350  -9.653  1.00 0.00 ? 124 DC  C "C5'"  1  
ATOM   741   C "C4'"  . DC  B 1 12 ? -14.090 19.603  -9.566  1.00 0.00 ? 124 DC  C "C4'"  1  
ATOM   742   O "O4'"  . DC  B 1 12 ? -12.690 19.261  -9.617  1.00 0.00 ? 124 DC  C "O4'"  1  
ATOM   743   C "C3'"  . DC  B 1 12 ? -14.392 20.550  -10.717 1.00 0.00 ? 124 DC  C "C3'"  1  
ATOM   744   O "O3'"  . DC  B 1 12 ? -15.040 21.736  -10.246 1.00 0.00 ? 124 DC  C "O3'"  1  
ATOM   745   C "C2'"  . DC  B 1 12 ? -13.059 20.876  -11.342 1.00 0.00 ? 124 DC  C "C2'"  1  
ATOM   746   C "C1'"  . DC  B 1 12 ? -12.007 20.113  -10.555 1.00 0.00 ? 124 DC  C "C1'"  1  
ATOM   747   N N1     . DC  B 1 12 ? -11.139 19.323  -11.453 1.00 0.00 ? 124 DC  C N1     1  
ATOM   748   C C2     . DC  B 1 12 ? -9.768  19.418  -11.263 1.00 0.00 ? 124 DC  C C2     1  
ATOM   749   O O2     . DC  B 1 12 ? -9.322  20.134  -10.389 1.00 0.00 ? 124 DC  C O2     1  
ATOM   750   N N3     . DC  B 1 12 ? -8.953  18.694  -12.077 1.00 0.00 ? 124 DC  C N3     1  
ATOM   751   C C4     . DC  B 1 12 ? -9.459  17.909  -13.038 1.00 0.00 ? 124 DC  C C4     1  
ATOM   752   N N4     . DC  B 1 12 ? -8.631  17.213  -13.818 1.00 0.00 ? 124 DC  C N4     1  
ATOM   753   C C5     . DC  B 1 12 ? -10.872 17.807  -13.235 1.00 0.00 ? 124 DC  C C5     1  
ATOM   754   C C6     . DC  B 1 12 ? -11.672 18.527  -12.426 1.00 0.00 ? 124 DC  C C6     1  
ATOM   755   H "H5'"  . DC  B 1 12 ? -14.456 17.535  -9.129  1.00 0.00 ? 124 DC  C "H5'"  1  
ATOM   756   H "H5''" . DC  B 1 12 ? -15.914 18.547  -9.174  1.00 0.00 ? 124 DC  C "H5''" 1  
ATOM   757   H "H4'"  . DC  B 1 12 ? -14.292 20.113  -8.627  1.00 0.00 ? 124 DC  C "H4'"  1  
ATOM   758   H "H3'"  . DC  B 1 12 ? -15.024 20.046  -11.450 1.00 0.00 ? 124 DC  C "H3'"  1  
ATOM   759   H "HO3'" . DC  B 1 12 ? -14.801 21.844  -9.323  1.00 0.00 ? 124 DC  C "HO3'" 1  
ATOM   760   H "H2'"  . DC  B 1 12 ? -13.050 20.559  -12.385 1.00 0.00 ? 124 DC  C "H2'"  1  
ATOM   761   H "H2''" . DC  B 1 12 ? -12.870 21.948  -11.276 1.00 0.00 ? 124 DC  C "H2''" 1  
ATOM   762   H "H1'"  . DC  B 1 12 ? -11.395 20.824  -10.002 1.00 0.00 ? 124 DC  C "H1'"  1  
ATOM   763   H H41    . DC  B 1 12 ? -7.632  17.281  -13.681 1.00 0.00 ? 124 DC  C H41    1  
ATOM   764   H H42    . DC  B 1 12 ? -9.002  16.618  -14.544 1.00 0.00 ? 124 DC  C H42    1  
ATOM   765   H H5     . DC  B 1 12 ? -11.288 17.168  -14.016 1.00 0.00 ? 124 DC  C H5     1  
ATOM   766   H H6     . DC  B 1 12 ? -12.754 18.474  -12.548 1.00 0.00 ? 124 DC  C H6     1  
ATOM   767   N N      . MET C 2 1  ? -9.256  16.568  3.047   1.00 0.00 ? 1   MET A N      1  
ATOM   768   C CA     . MET C 2 1  ? -8.104  15.630  2.916   1.00 0.00 ? 1   MET A CA     1  
ATOM   769   C C      . MET C 2 1  ? -7.722  15.069  4.289   1.00 0.00 ? 1   MET A C      1  
ATOM   770   O O      . MET C 2 1  ? -8.458  15.194  5.249   1.00 0.00 ? 1   MET A O      1  
ATOM   771   C CB     . MET C 2 1  ? -6.965  16.477  2.348   1.00 0.00 ? 1   MET A CB     1  
ATOM   772   C CG     . MET C 2 1  ? -7.316  16.915  0.924   1.00 0.00 ? 1   MET A CG     1  
ATOM   773   S SD     . MET C 2 1  ? -8.074  18.559  0.964   1.00 0.00 ? 1   MET A SD     1  
ATOM   774   C CE     . MET C 2 1  ? -6.547  19.517  0.810   1.00 0.00 ? 1   MET A CE     1  
ATOM   775   H H      . MET C 2 1  ? -9.096  17.519  3.225   1.00 0.00 ? 1   MET A H      1  
ATOM   776   H HA     . MET C 2 1  ? -8.345  14.831  2.235   1.00 0.00 ? 1   MET A HA     1  
ATOM   777   H HB2    . MET C 2 1  ? -6.820  17.349  2.970   1.00 0.00 ? 1   MET A HB2    1  
ATOM   778   H HB3    . MET C 2 1  ? -6.057  15.893  2.329   1.00 0.00 ? 1   MET A HB3    1  
ATOM   779   H HG2    . MET C 2 1  ? -6.418  16.948  0.326   1.00 0.00 ? 1   MET A HG2    1  
ATOM   780   H HG3    . MET C 2 1  ? -8.010  16.210  0.491   1.00 0.00 ? 1   MET A HG3    1  
ATOM   781   H HE1    . MET C 2 1  ? -6.791  20.557  0.640   1.00 0.00 ? 1   MET A HE1    1  
ATOM   782   H HE2    . MET C 2 1  ? -5.969  19.145  -0.022  1.00 0.00 ? 1   MET A HE2    1  
ATOM   783   H HE3    . MET C 2 1  ? -5.968  19.421  1.719   1.00 0.00 ? 1   MET A HE3    1  
ATOM   784   N N      . ALA C 2 2  ? -6.574  14.448  4.388   1.00 0.00 ? 2   ALA A N      1  
ATOM   785   C CA     . ALA C 2 2  ? -6.135  13.871  5.696   1.00 0.00 ? 2   ALA A CA     1  
ATOM   786   C C      . ALA C 2 2  ? -7.224  12.960  6.271   1.00 0.00 ? 2   ALA A C      1  
ATOM   787   O O      . ALA C 2 2  ? -7.977  13.350  7.142   1.00 0.00 ? 2   ALA A O      1  
ATOM   788   C CB     . ALA C 2 2  ? -5.905  15.076  6.611   1.00 0.00 ? 2   ALA A CB     1  
ATOM   789   H H      . ALA C 2 2  ? -5.999  14.359  3.600   1.00 0.00 ? 2   ALA A H      1  
ATOM   790   H HA     . ALA C 2 2  ? -5.214  13.324  5.573   1.00 0.00 ? 2   ALA A HA     1  
ATOM   791   H HB1    . ALA C 2 2  ? -6.359  15.953  6.174   1.00 0.00 ? 2   ALA A HB1    1  
ATOM   792   H HB2    . ALA C 2 2  ? -4.843  15.242  6.727   1.00 0.00 ? 2   ALA A HB2    1  
ATOM   793   H HB3    . ALA C 2 2  ? -6.347  14.886  7.578   1.00 0.00 ? 2   ALA A HB3    1  
ATOM   794   N N      . GLU C 2 3  ? -7.310  11.748  5.791   1.00 0.00 ? 3   GLU A N      1  
ATOM   795   C CA     . GLU C 2 3  ? -8.348  10.811  6.309   1.00 0.00 ? 3   GLU A CA     1  
ATOM   796   C C      . GLU C 2 3  ? -7.994  10.363  7.730   1.00 0.00 ? 3   GLU A C      1  
ATOM   797   O O      . GLU C 2 3  ? -8.724  10.613  8.669   1.00 0.00 ? 3   GLU A O      1  
ATOM   798   C CB     . GLU C 2 3  ? -8.322  9.620   5.350   1.00 0.00 ? 3   GLU A CB     1  
ATOM   799   C CG     . GLU C 2 3  ? -9.751  9.133   5.100   1.00 0.00 ? 3   GLU A CG     1  
ATOM   800   C CD     . GLU C 2 3  ? -10.507 10.172  4.271   1.00 0.00 ? 3   GLU A CD     1  
ATOM   801   O OE1    . GLU C 2 3  ? -9.927  10.682  3.325   1.00 0.00 ? 3   GLU A OE1    1  
ATOM   802   O OE2    . GLU C 2 3  ? -11.652 10.441  4.594   1.00 0.00 ? 3   GLU A OE2    1  
ATOM   803   H H      . GLU C 2 3  ? -6.691  11.457  5.089   1.00 0.00 ? 3   GLU A H      1  
ATOM   804   H HA     . GLU C 2 3  ? -9.321  11.277  6.291   1.00 0.00 ? 3   GLU A HA     1  
ATOM   805   H HB2    . GLU C 2 3  ? -7.875  9.922   4.413   1.00 0.00 ? 3   GLU A HB2    1  
ATOM   806   H HB3    . GLU C 2 3  ? -7.742  8.820   5.784   1.00 0.00 ? 3   GLU A HB3    1  
ATOM   807   H HG2    . GLU C 2 3  ? -9.723  8.194   4.566   1.00 0.00 ? 3   GLU A HG2    1  
ATOM   808   H HG3    . GLU C 2 3  ? -10.255 8.994   6.045   1.00 0.00 ? 3   GLU A HG3    1  
ATOM   809   N N      . ASP C 2 4  ? -6.879  9.703   7.892   1.00 0.00 ? 4   ASP A N      1  
ATOM   810   C CA     . ASP C 2 4  ? -6.473  9.237   9.252   1.00 0.00 ? 4   ASP A CA     1  
ATOM   811   C C      . ASP C 2 4  ? -5.028  8.730   9.227   1.00 0.00 ? 4   ASP A C      1  
ATOM   812   O O      . ASP C 2 4  ? -4.772  7.574   8.955   1.00 0.00 ? 4   ASP A O      1  
ATOM   813   C CB     . ASP C 2 4  ? -7.437  8.094   9.584   1.00 0.00 ? 4   ASP A CB     1  
ATOM   814   C CG     . ASP C 2 4  ? -8.119  8.371   10.925  1.00 0.00 ? 4   ASP A CG     1  
ATOM   815   O OD1    . ASP C 2 4  ? -7.412  8.499   11.912  1.00 0.00 ? 4   ASP A OD1    1  
ATOM   816   O OD2    . ASP C 2 4  ? -9.338  8.449   10.944  1.00 0.00 ? 4   ASP A OD2    1  
ATOM   817   H H      . ASP C 2 4  ? -6.305  9.512   7.120   1.00 0.00 ? 4   ASP A H      1  
ATOM   818   H HA     . ASP C 2 4  ? -6.581  10.033  9.970   1.00 0.00 ? 4   ASP A HA     1  
ATOM   819   H HB2    . ASP C 2 4  ? -8.187  8.018   8.808   1.00 0.00 ? 4   ASP A HB2    1  
ATOM   820   H HB3    . ASP C 2 4  ? -6.889  7.166   9.646   1.00 0.00 ? 4   ASP A HB3    1  
ATOM   821   N N      . TRP C 2 5  ? -4.083  9.588   9.511   1.00 0.00 ? 5   TRP A N      1  
ATOM   822   C CA     . TRP C 2 5  ? -2.655  9.153   9.505   1.00 0.00 ? 5   TRP A CA     1  
ATOM   823   C C      . TRP C 2 5  ? -2.217  8.752   10.915  1.00 0.00 ? 5   TRP A C      1  
ATOM   824   O O      . TRP C 2 5  ? -2.134  9.575   11.807  1.00 0.00 ? 5   TRP A O      1  
ATOM   825   C CB     . TRP C 2 5  ? -1.868  10.374  9.028   1.00 0.00 ? 5   TRP A CB     1  
ATOM   826   C CG     . TRP C 2 5  ? -1.775  10.358  7.536   1.00 0.00 ? 5   TRP A CG     1  
ATOM   827   C CD1    . TRP C 2 5  ? -2.236  11.332  6.718   1.00 0.00 ? 5   TRP A CD1    1  
ATOM   828   C CD2    . TRP C 2 5  ? -1.194  9.338   6.671   1.00 0.00 ? 5   TRP A CD2    1  
ATOM   829   N NE1    . TRP C 2 5  ? -1.976  10.975  5.407   1.00 0.00 ? 5   TRP A NE1    1  
ATOM   830   C CE2    . TRP C 2 5  ? -1.335  9.754   5.327   1.00 0.00 ? 5   TRP A CE2    1  
ATOM   831   C CE3    . TRP C 2 5  ? -0.565  8.105   6.922   1.00 0.00 ? 5   TRP A CE3    1  
ATOM   832   C CZ2    . TRP C 2 5  ? -0.868  8.975   4.267   1.00 0.00 ? 5   TRP A CZ2    1  
ATOM   833   C CZ3    . TRP C 2 5  ? -0.094  7.319   5.858   1.00 0.00 ? 5   TRP A CZ3    1  
ATOM   834   C CH2    . TRP C 2 5  ? -0.245  7.753   4.533   1.00 0.00 ? 5   TRP A CH2    1  
ATOM   835   H H      . TRP C 2 5  ? -4.312  10.515  9.728   1.00 0.00 ? 5   TRP A H      1  
ATOM   836   H HA     . TRP C 2 5  ? -2.514  8.333   8.819   1.00 0.00 ? 5   TRP A HA     1  
ATOM   837   H HB2    . TRP C 2 5  ? -2.371  11.275  9.348   1.00 0.00 ? 5   TRP A HB2    1  
ATOM   838   H HB3    . TRP C 2 5  ? -0.873  10.348  9.451   1.00 0.00 ? 5   TRP A HB3    1  
ATOM   839   H HD1    . TRP C 2 5  ? -2.728  12.239  7.036   1.00 0.00 ? 5   TRP A HD1    1  
ATOM   840   H HE1    . TRP C 2 5  ? -2.210  11.508  4.619   1.00 0.00 ? 5   TRP A HE1    1  
ATOM   841   H HE3    . TRP C 2 5  ? -0.442  7.762   7.939   1.00 0.00 ? 5   TRP A HE3    1  
ATOM   842   H HZ2    . TRP C 2 5  ? -0.988  9.315   3.249   1.00 0.00 ? 5   TRP A HZ2    1  
ATOM   843   H HZ3    . TRP C 2 5  ? 0.388   6.373   6.061   1.00 0.00 ? 5   TRP A HZ3    1  
ATOM   844   H HH2    . TRP C 2 5  ? 0.119   7.144   3.720   1.00 0.00 ? 5   TRP A HH2    1  
ATOM   845   N N      . LEU C 2 6  ? -1.937  7.493   11.122  1.00 0.00 ? 6   LEU A N      1  
ATOM   846   C CA     . LEU C 2 6  ? -1.502  7.034   12.473  1.00 0.00 ? 6   LEU A CA     1  
ATOM   847   C C      . LEU C 2 6  ? -0.031  6.610   12.434  1.00 0.00 ? 6   LEU A C      1  
ATOM   848   O O      . LEU C 2 6  ? 0.486   6.228   11.403  1.00 0.00 ? 6   LEU A O      1  
ATOM   849   C CB     . LEU C 2 6  ? -2.398  5.837   12.792  1.00 0.00 ? 6   LEU A CB     1  
ATOM   850   C CG     . LEU C 2 6  ? -3.856  6.294   12.856  1.00 0.00 ? 6   LEU A CG     1  
ATOM   851   C CD1    . LEU C 2 6  ? -4.772  5.143   12.434  1.00 0.00 ? 6   LEU A CD1    1  
ATOM   852   C CD2    . LEU C 2 6  ? -4.194  6.713   14.289  1.00 0.00 ? 6   LEU A CD2    1  
ATOM   853   H H      . LEU C 2 6  ? -2.011  6.850   10.388  1.00 0.00 ? 6   LEU A H      1  
ATOM   854   H HA     . LEU C 2 6  ? -1.651  7.813   13.203  1.00 0.00 ? 6   LEU A HA     1  
ATOM   855   H HB2    . LEU C 2 6  ? -2.287  5.089   12.019  1.00 0.00 ? 6   LEU A HB2    1  
ATOM   856   H HB3    . LEU C 2 6  ? -2.112  5.415   13.744  1.00 0.00 ? 6   LEU A HB3    1  
ATOM   857   H HG     . LEU C 2 6  ? -4.001  7.131   12.189  1.00 0.00 ? 6   LEU A HG     1  
ATOM   858   H HD11   . LEU C 2 6  ? -5.799  5.477   12.442  1.00 0.00 ? 6   LEU A HD11   1  
ATOM   859   H HD12   . LEU C 2 6  ? -4.656  4.319   13.123  1.00 0.00 ? 6   LEU A HD12   1  
ATOM   860   H HD13   . LEU C 2 6  ? -4.507  4.818   11.438  1.00 0.00 ? 6   LEU A HD13   1  
ATOM   861   H HD21   . LEU C 2 6  ? -3.641  6.099   14.983  1.00 0.00 ? 6   LEU A HD21   1  
ATOM   862   H HD22   . LEU C 2 6  ? -5.253  6.587   14.460  1.00 0.00 ? 6   LEU A HD22   1  
ATOM   863   H HD23   . LEU C 2 6  ? -3.927  7.750   14.432  1.00 0.00 ? 6   LEU A HD23   1  
ATOM   864   N N      . ASP C 2 7  ? 0.647   6.677   13.548  1.00 0.00 ? 7   ASP A N      1  
ATOM   865   C CA     . ASP C 2 7  ? 2.086   6.278   13.575  1.00 0.00 ? 7   ASP A CA     1  
ATOM   866   C C      . ASP C 2 7  ? 2.247   4.829   13.109  1.00 0.00 ? 7   ASP A C      1  
ATOM   867   O O      . ASP C 2 7  ? 1.284   4.108   12.945  1.00 0.00 ? 7   ASP A O      1  
ATOM   868   C CB     . ASP C 2 7  ? 2.510   6.419   15.039  1.00 0.00 ? 7   ASP A CB     1  
ATOM   869   C CG     . ASP C 2 7  ? 2.676   7.900   15.382  1.00 0.00 ? 7   ASP A CG     1  
ATOM   870   O OD1    . ASP C 2 7  ? 3.304   8.602   14.606  1.00 0.00 ? 7   ASP A OD1    1  
ATOM   871   O OD2    . ASP C 2 7  ? 2.174   8.307   16.417  1.00 0.00 ? 7   ASP A OD2    1  
ATOM   872   H H      . ASP C 2 7  ? 0.210   6.989   14.366  1.00 0.00 ? 7   ASP A H      1  
ATOM   873   H HA     . ASP C 2 7  ? 2.671   6.940   12.958  1.00 0.00 ? 7   ASP A HA     1  
ATOM   874   H HB2    . ASP C 2 7  ? 1.754   5.983   15.676  1.00 0.00 ? 7   ASP A HB2    1  
ATOM   875   H HB3    . ASP C 2 7  ? 3.449   5.908   15.191  1.00 0.00 ? 7   ASP A HB3    1  
ATOM   876   N N      . CYS C 2 8  ? 3.463   4.401   12.899  1.00 0.00 ? 8   CYS A N      1  
ATOM   877   C CA     . CYS C 2 8  ? 3.700   3.001   12.448  1.00 0.00 ? 8   CYS A CA     1  
ATOM   878   C C      . CYS C 2 8  ? 5.059   2.516   12.965  1.00 0.00 ? 8   CYS A C      1  
ATOM   879   O O      . CYS C 2 8  ? 6.061   2.643   12.292  1.00 0.00 ? 8   CYS A O      1  
ATOM   880   C CB     . CYS C 2 8  ? 3.692   3.070   10.920  1.00 0.00 ? 8   CYS A CB     1  
ATOM   881   S SG     . CYS C 2 8  ? 3.880   1.404   10.238  1.00 0.00 ? 8   CYS A SG     1  
ATOM   882   H H      . CYS C 2 8  ? 4.222   5.000   13.042  1.00 0.00 ? 8   CYS A H      1  
ATOM   883   H HA     . CYS C 2 8  ? 2.910   2.354   12.793  1.00 0.00 ? 8   CYS A HA     1  
ATOM   884   H HB2    . CYS C 2 8  ? 2.757   3.493   10.584  1.00 0.00 ? 8   CYS A HB2    1  
ATOM   885   H HB3    . CYS C 2 8  ? 4.508   3.691   10.584  1.00 0.00 ? 8   CYS A HB3    1  
ATOM   886   H HG     . CYS C 2 8  ? 3.234   1.296   9.535   1.00 0.00 ? 8   CYS A HG     1  
ATOM   887   N N      . PRO C 2 9  ? 5.042   1.976   14.157  1.00 0.00 ? 9   PRO A N      1  
ATOM   888   C CA     . PRO C 2 9  ? 6.289   1.467   14.788  1.00 0.00 ? 9   PRO A CA     1  
ATOM   889   C C      . PRO C 2 9  ? 6.785   0.193   14.105  1.00 0.00 ? 9   PRO A C      1  
ATOM   890   O O      . PRO C 2 9  ? 7.835   -0.322  14.433  1.00 0.00 ? 9   PRO A O      1  
ATOM   891   C CB     . PRO C 2 9  ? 5.868   1.158   16.217  1.00 0.00 ? 9   PRO A CB     1  
ATOM   892   C CG     . PRO C 2 9  ? 4.392   0.934   16.149  1.00 0.00 ? 9   PRO A CG     1  
ATOM   893   C CD     . PRO C 2 9  ? 3.873   1.789   15.024  1.00 0.00 ? 9   PRO A CD     1  
ATOM   894   H HA     . PRO C 2 9  ? 7.054   2.224   14.786  1.00 0.00 ? 9   PRO A HA     1  
ATOM   895   H HB2    . PRO C 2 9  ? 6.368   0.259   16.558  1.00 0.00 ? 9   PRO A HB2    1  
ATOM   896   H HB3    . PRO C 2 9  ? 6.091   1.988   16.867  1.00 0.00 ? 9   PRO A HB3    1  
ATOM   897   H HG2    . PRO C 2 9  ? 4.186   -0.107  15.950  1.00 0.00 ? 9   PRO A HG2    1  
ATOM   898   H HG3    . PRO C 2 9  ? 3.929   1.236   17.075  1.00 0.00 ? 9   PRO A HG3    1  
ATOM   899   H HD2    . PRO C 2 9  ? 3.081   1.276   14.495  1.00 0.00 ? 9   PRO A HD2    1  
ATOM   900   H HD3    . PRO C 2 9  ? 3.529   2.740   15.397  1.00 0.00 ? 9   PRO A HD3    1  
ATOM   901   N N      . ALA C 2 10 ? 6.040   -0.331  13.173  1.00 0.00 ? 10  ALA A N      1  
ATOM   902   C CA     . ALA C 2 10 ? 6.482   -1.583  12.496  1.00 0.00 ? 10  ALA A CA     1  
ATOM   903   C C      . ALA C 2 10 ? 7.847   -1.388  11.821  1.00 0.00 ? 10  ALA A C      1  
ATOM   904   O O      . ALA C 2 10 ? 8.499   -2.341  11.444  1.00 0.00 ? 10  ALA A O      1  
ATOM   905   C CB     . ALA C 2 10 ? 5.406   -1.876  11.451  1.00 0.00 ? 10  ALA A CB     1  
ATOM   906   H H      . ALA C 2 10 ? 5.190   0.085   12.927  1.00 0.00 ? 10  ALA A H      1  
ATOM   907   H HA     . ALA C 2 10 ? 6.529   -2.385  13.213  1.00 0.00 ? 10  ALA A HA     1  
ATOM   908   H HB1    . ALA C 2 10 ? 5.788   -1.642  10.469  1.00 0.00 ? 10  ALA A HB1    1  
ATOM   909   H HB2    . ALA C 2 10 ? 4.535   -1.271  11.652  1.00 0.00 ? 10  ALA A HB2    1  
ATOM   910   H HB3    . ALA C 2 10 ? 5.138   -2.920  11.493  1.00 0.00 ? 10  ALA A HB3    1  
ATOM   911   N N      . LEU C 2 11 ? 8.283   -0.168  11.659  1.00 0.00 ? 11  LEU A N      1  
ATOM   912   C CA     . LEU C 2 11 ? 9.602   0.071   11.004  1.00 0.00 ? 11  LEU A CA     1  
ATOM   913   C C      . LEU C 2 11 ? 10.479  0.965   11.882  1.00 0.00 ? 11  LEU A C      1  
ATOM   914   O O      . LEU C 2 11 ? 11.475  0.531   12.428  1.00 0.00 ? 11  LEU A O      1  
ATOM   915   C CB     . LEU C 2 11 ? 9.270   0.775   9.691   1.00 0.00 ? 11  LEU A CB     1  
ATOM   916   C CG     . LEU C 2 11 ? 8.445   -0.158  8.801   1.00 0.00 ? 11  LEU A CG     1  
ATOM   917   C CD1    . LEU C 2 11 ? 6.975   0.265   8.845   1.00 0.00 ? 11  LEU A CD1    1  
ATOM   918   C CD2    . LEU C 2 11 ? 8.960   -0.076  7.360   1.00 0.00 ? 11  LEU A CD2    1  
ATOM   919   H H      . LEU C 2 11 ? 7.744   0.591   11.961  1.00 0.00 ? 11  LEU A H      1  
ATOM   920   H HA     . LEU C 2 11 ? 10.098  -0.866  10.804  1.00 0.00 ? 11  LEU A HA     1  
ATOM   921   H HB2    . LEU C 2 11 ? 8.702   1.670   9.900   1.00 0.00 ? 11  LEU A HB2    1  
ATOM   922   H HB3    . LEU C 2 11 ? 10.185  1.040   9.183   1.00 0.00 ? 11  LEU A HB3    1  
ATOM   923   H HG     . LEU C 2 11 ? 8.537   -1.174  9.161   1.00 0.00 ? 11  LEU A HG     1  
ATOM   924   H HD11   . LEU C 2 11 ? 6.567   0.046   9.821   1.00 0.00 ? 11  LEU A HD11   1  
ATOM   925   H HD12   . LEU C 2 11 ? 6.421   -0.275  8.092   1.00 0.00 ? 11  LEU A HD12   1  
ATOM   926   H HD13   . LEU C 2 11 ? 6.900   1.325   8.655   1.00 0.00 ? 11  LEU A HD13   1  
ATOM   927   H HD21   . LEU C 2 11 ? 9.657   0.745   7.272   1.00 0.00 ? 11  LEU A HD21   1  
ATOM   928   H HD22   . LEU C 2 11 ? 8.130   0.083   6.688   1.00 0.00 ? 11  LEU A HD22   1  
ATOM   929   H HD23   . LEU C 2 11 ? 9.458   -0.999  7.104   1.00 0.00 ? 11  LEU A HD23   1  
ATOM   930   N N      . GLY C 2 12 ? 10.117  2.211   12.020  1.00 0.00 ? 12  GLY A N      1  
ATOM   931   C CA     . GLY C 2 12 ? 10.928  3.139   12.859  1.00 0.00 ? 12  GLY A CA     1  
ATOM   932   C C      . GLY C 2 12 ? 10.222  4.495   12.955  1.00 0.00 ? 12  GLY A C      1  
ATOM   933   O O      . GLY C 2 12 ? 9.063   4.613   12.610  1.00 0.00 ? 12  GLY A O      1  
ATOM   934   H H      . GLY C 2 12 ? 9.310   2.539   11.570  1.00 0.00 ? 12  GLY A H      1  
ATOM   935   H HA2    . GLY C 2 12 ? 11.043  2.721   13.849  1.00 0.00 ? 12  GLY A HA2    1  
ATOM   936   H HA3    . GLY C 2 12 ? 11.899  3.274   12.410  1.00 0.00 ? 12  GLY A HA3    1  
ATOM   937   N N      . PRO C 2 13 ? 10.947  5.480   13.420  1.00 0.00 ? 13  PRO A N      1  
ATOM   938   C CA     . PRO C 2 13 ? 10.374  6.841   13.560  1.00 0.00 ? 13  PRO A CA     1  
ATOM   939   C C      . PRO C 2 13 ? 10.225  7.505   12.187  1.00 0.00 ? 13  PRO A C      1  
ATOM   940   O O      . PRO C 2 13 ? 11.090  7.399   11.339  1.00 0.00 ? 13  PRO A O      1  
ATOM   941   C CB     . PRO C 2 13 ? 11.404  7.579   14.410  1.00 0.00 ? 13  PRO A CB     1  
ATOM   942   C CG     . PRO C 2 13 ? 12.692  6.856   14.176  1.00 0.00 ? 13  PRO A CG     1  
ATOM   943   C CD     . PRO C 2 13 ? 12.348  5.423   13.858  1.00 0.00 ? 13  PRO A CD     1  
ATOM   944   H HA     . PRO C 2 13 ? 9.427   6.806   14.073  1.00 0.00 ? 13  PRO A HA     1  
ATOM   945   H HB2    . PRO C 2 13 ? 11.484  8.609   14.091  1.00 0.00 ? 13  PRO A HB2    1  
ATOM   946   H HB3    . PRO C 2 13 ? 11.137  7.527   15.454  1.00 0.00 ? 13  PRO A HB3    1  
ATOM   947   H HG2    . PRO C 2 13 ? 13.220  7.304   13.344  1.00 0.00 ? 13  PRO A HG2    1  
ATOM   948   H HG3    . PRO C 2 13 ? 13.303  6.893   15.064  1.00 0.00 ? 13  PRO A HG3    1  
ATOM   949   H HD2    . PRO C 2 13 ? 12.981  5.051   13.064  1.00 0.00 ? 13  PRO A HD2    1  
ATOM   950   H HD3    . PRO C 2 13 ? 12.438  4.807   14.739  1.00 0.00 ? 13  PRO A HD3    1  
ATOM   951   N N      . GLY C 2 14 ? 9.134   8.187   11.964  1.00 0.00 ? 14  GLY A N      1  
ATOM   952   C CA     . GLY C 2 14 ? 8.924   8.860   10.651  1.00 0.00 ? 14  GLY A CA     1  
ATOM   953   C C      . GLY C 2 14 ? 7.827   8.132   9.870   1.00 0.00 ? 14  GLY A C      1  
ATOM   954   O O      . GLY C 2 14 ? 7.071   8.737   9.135   1.00 0.00 ? 14  GLY A O      1  
ATOM   955   H H      . GLY C 2 14 ? 8.451   8.257   12.663  1.00 0.00 ? 14  GLY A H      1  
ATOM   956   H HA2    . GLY C 2 14 ? 8.632   9.886   10.814  1.00 0.00 ? 14  GLY A HA2    1  
ATOM   957   H HA3    . GLY C 2 14 ? 9.846   8.832   10.077  1.00 0.00 ? 14  GLY A HA3    1  
ATOM   958   N N      . TRP C 2 15 ? 7.754   6.833   10.001  1.00 0.00 ? 15  TRP A N      1  
ATOM   959   C CA     . TRP C 2 15 ? 6.730   6.054   9.242   1.00 0.00 ? 15  TRP A CA     1  
ATOM   960   C C      . TRP C 2 15 ? 5.309   6.463   9.639   1.00 0.00 ? 15  TRP A C      1  
ATOM   961   O O      . TRP C 2 15 ? 5.037   6.791   10.778  1.00 0.00 ? 15  TRP A O      1  
ATOM   962   C CB     . TRP C 2 15 ? 6.990   4.593   9.613   1.00 0.00 ? 15  TRP A CB     1  
ATOM   963   C CG     . TRP C 2 15 ? 7.955   4.000   8.640   1.00 0.00 ? 15  TRP A CG     1  
ATOM   964   C CD1    . TRP C 2 15 ? 9.278   3.827   8.863   1.00 0.00 ? 15  TRP A CD1    1  
ATOM   965   C CD2    . TRP C 2 15 ? 7.698   3.504   7.293   1.00 0.00 ? 15  TRP A CD2    1  
ATOM   966   N NE1    . TRP C 2 15 ? 9.849   3.255   7.741   1.00 0.00 ? 15  TRP A NE1    1  
ATOM   967   C CE2    . TRP C 2 15 ? 8.916   3.037   6.747   1.00 0.00 ? 15  TRP A CE2    1  
ATOM   968   C CE3    . TRP C 2 15 ? 6.540   3.414   6.503   1.00 0.00 ? 15  TRP A CE3    1  
ATOM   969   C CZ2    . TRP C 2 15 ? 8.984   2.502   5.461   1.00 0.00 ? 15  TRP A CZ2    1  
ATOM   970   C CZ3    . TRP C 2 15 ? 6.603   2.875   5.207   1.00 0.00 ? 15  TRP A CZ3    1  
ATOM   971   C CH2    . TRP C 2 15 ? 7.824   2.420   4.688   1.00 0.00 ? 15  TRP A CH2    1  
ATOM   972   H H      . TRP C 2 15 ? 8.389   6.366   10.585  1.00 0.00 ? 15  TRP A H      1  
ATOM   973   H HA     . TRP C 2 15 ? 6.871   6.188   8.182   1.00 0.00 ? 15  TRP A HA     1  
ATOM   974   H HB2    . TRP C 2 15 ? 7.405   4.541   10.609  1.00 0.00 ? 15  TRP A HB2    1  
ATOM   975   H HB3    . TRP C 2 15 ? 6.062   4.042   9.580   1.00 0.00 ? 15  TRP A HB3    1  
ATOM   976   H HD1    . TRP C 2 15 ? 9.801   4.091   9.770   1.00 0.00 ? 15  TRP A HD1    1  
ATOM   977   H HE1    . TRP C 2 15 ? 10.796  3.026   7.643   1.00 0.00 ? 15  TRP A HE1    1  
ATOM   978   H HE3    . TRP C 2 15 ? 5.594   3.761   6.893   1.00 0.00 ? 15  TRP A HE3    1  
ATOM   979   H HZ2    . TRP C 2 15 ? 9.927   2.155   5.065   1.00 0.00 ? 15  TRP A HZ2    1  
ATOM   980   H HZ3    . TRP C 2 15 ? 5.707   2.810   4.607   1.00 0.00 ? 15  TRP A HZ3    1  
ATOM   981   H HH2    . TRP C 2 15 ? 7.867   2.007   3.691   1.00 0.00 ? 15  TRP A HH2    1  
ATOM   982   N N      . LYS C 2 16 ? 4.402   6.434   8.698   1.00 0.00 ? 16  LYS A N      1  
ATOM   983   C CA     . LYS C 2 16 ? 2.986   6.807   8.995   1.00 0.00 ? 16  LYS A CA     1  
ATOM   984   C C      . LYS C 2 16 ? 2.038   5.852   8.261   1.00 0.00 ? 16  LYS A C      1  
ATOM   985   O O      . LYS C 2 16 ? 2.206   5.583   7.088   1.00 0.00 ? 16  LYS A O      1  
ATOM   986   C CB     . LYS C 2 16 ? 2.831   8.232   8.463   1.00 0.00 ? 16  LYS A CB     1  
ATOM   987   C CG     . LYS C 2 16 ? 3.010   9.229   9.609   1.00 0.00 ? 16  LYS A CG     1  
ATOM   988   C CD     . LYS C 2 16 ? 1.710   9.328   10.409  1.00 0.00 ? 16  LYS A CD     1  
ATOM   989   C CE     . LYS C 2 16 ? 1.529   10.761  10.918  1.00 0.00 ? 16  LYS A CE     1  
ATOM   990   N NZ     . LYS C 2 16 ? 0.776   10.624  12.194  1.00 0.00 ? 16  LYS A NZ     1  
ATOM   991   H H      . LYS C 2 16 ? 4.652   6.159   7.789   1.00 0.00 ? 16  LYS A H      1  
ATOM   992   H HA     . LYS C 2 16 ? 2.800   6.784   10.058  1.00 0.00 ? 16  LYS A HA     1  
ATOM   993   H HB2    . LYS C 2 16 ? 3.578   8.416   7.704   1.00 0.00 ? 16  LYS A HB2    1  
ATOM   994   H HB3    . LYS C 2 16 ? 1.847   8.352   8.035   1.00 0.00 ? 16  LYS A HB3    1  
ATOM   995   H HG2    . LYS C 2 16 ? 3.808   8.893   10.256  1.00 0.00 ? 16  LYS A HG2    1  
ATOM   996   H HG3    . LYS C 2 16 ? 3.258   10.201  9.207   1.00 0.00 ? 16  LYS A HG3    1  
ATOM   997   H HD2    . LYS C 2 16 ? 0.876   9.063   9.775   1.00 0.00 ? 16  LYS A HD2    1  
ATOM   998   H HD3    . LYS C 2 16 ? 1.753   8.653   11.250  1.00 0.00 ? 16  LYS A HD3    1  
ATOM   999   H HE2    . LYS C 2 16 ? 2.492   11.219  11.093  1.00 0.00 ? 16  LYS A HE2    1  
ATOM   1000  H HE3    . LYS C 2 16 ? 0.957   11.342  10.211  1.00 0.00 ? 16  LYS A HE3    1  
ATOM   1001  H HZ1    . LYS C 2 16 ? 1.368   10.137  12.896  1.00 0.00 ? 16  LYS A HZ1    1  
ATOM   1002  H HZ2    . LYS C 2 16 ? 0.520   11.568  12.549  1.00 0.00 ? 16  LYS A HZ2    1  
ATOM   1003  H HZ3    . LYS C 2 16 ? -0.088  10.069  12.030  1.00 0.00 ? 16  LYS A HZ3    1  
ATOM   1004  N N      . ARG C 2 17 ? 1.052   5.332   8.941   1.00 0.00 ? 17  ARG A N      1  
ATOM   1005  C CA     . ARG C 2 17 ? 0.102   4.388   8.281   1.00 0.00 ? 17  ARG A CA     1  
ATOM   1006  C C      . ARG C 2 17 ? -1.309  4.991   8.232   1.00 0.00 ? 17  ARG A C      1  
ATOM   1007  O O      . ARG C 2 17 ? -1.674  5.807   9.054   1.00 0.00 ? 17  ARG A O      1  
ATOM   1008  C CB     . ARG C 2 17 ? 0.144   3.121   9.147   1.00 0.00 ? 17  ARG A CB     1  
ATOM   1009  C CG     . ARG C 2 17 ? -0.692  3.310   10.420  1.00 0.00 ? 17  ARG A CG     1  
ATOM   1010  C CD     . ARG C 2 17 ? -2.013  2.547   10.278  1.00 0.00 ? 17  ARG A CD     1  
ATOM   1011  N NE     . ARG C 2 17 ? -2.532  2.406   11.668  1.00 0.00 ? 17  ARG A NE     1  
ATOM   1012  C CZ     . ARG C 2 17 ? -3.688  1.836   11.876  1.00 0.00 ? 17  ARG A CZ     1  
ATOM   1013  N NH1    . ARG C 2 17 ? -4.724  2.181   11.161  1.00 0.00 ? 17  ARG A NH1    1  
ATOM   1014  N NH2    . ARG C 2 17 ? -3.806  0.919   12.798  1.00 0.00 ? 17  ARG A NH2    1  
ATOM   1015  H H      . ARG C 2 17 ? 0.938   5.558   9.889   1.00 0.00 ? 17  ARG A H      1  
ATOM   1016  H HA     . ARG C 2 17 ? 0.440   4.157   7.282   1.00 0.00 ? 17  ARG A HA     1  
ATOM   1017  H HB2    . ARG C 2 17 ? -0.248  2.289   8.583   1.00 0.00 ? 17  ARG A HB2    1  
ATOM   1018  H HB3    . ARG C 2 17 ? 1.168   2.914   9.424   1.00 0.00 ? 17  ARG A HB3    1  
ATOM   1019  H HG2    . ARG C 2 17 ? -0.144  2.928   11.270  1.00 0.00 ? 17  ARG A HG2    1  
ATOM   1020  H HG3    . ARG C 2 17 ? -0.898  4.360   10.566  1.00 0.00 ? 17  ARG A HG3    1  
ATOM   1021  H HD2    . ARG C 2 17 ? -2.707  3.110   9.669   1.00 0.00 ? 17  ARG A HD2    1  
ATOM   1022  H HD3    . ARG C 2 17 ? -1.839  1.572   9.848   1.00 0.00 ? 17  ARG A HD3    1  
ATOM   1023  H HE     . ARG C 2 17 ? -2.006  2.740   12.425  1.00 0.00 ? 17  ARG A HE     1  
ATOM   1024  H HH11   . ARG C 2 17 ? -4.631  2.882   10.454  1.00 0.00 ? 17  ARG A HH11   1  
ATOM   1025  H HH12   . ARG C 2 17 ? -5.609  1.744   11.321  1.00 0.00 ? 17  ARG A HH12   1  
ATOM   1026  H HH21   . ARG C 2 17 ? -3.012  0.654   13.344  1.00 0.00 ? 17  ARG A HH21   1  
ATOM   1027  H HH22   . ARG C 2 17 ? -4.691  0.483   12.958  1.00 0.00 ? 17  ARG A HH22   1  
ATOM   1028  N N      . ARG C 2 18 ? -2.099  4.596   7.270   1.00 0.00 ? 18  ARG A N      1  
ATOM   1029  C CA     . ARG C 2 18 ? -3.482  5.143   7.161   1.00 0.00 ? 18  ARG A CA     1  
ATOM   1030  C C      . ARG C 2 18 ? -4.461  4.033   6.767   1.00 0.00 ? 18  ARG A C      1  
ATOM   1031  O O      . ARG C 2 18 ? -4.073  3.007   6.244   1.00 0.00 ? 18  ARG A O      1  
ATOM   1032  C CB     . ARG C 2 18 ? -3.401  6.204   6.060   1.00 0.00 ? 18  ARG A CB     1  
ATOM   1033  C CG     . ARG C 2 18 ? -4.791  6.795   5.809   1.00 0.00 ? 18  ARG A CG     1  
ATOM   1034  C CD     . ARG C 2 18 ? -4.654  8.141   5.093   1.00 0.00 ? 18  ARG A CD     1  
ATOM   1035  N NE     . ARG C 2 18 ? -4.325  7.795   3.682   1.00 0.00 ? 18  ARG A NE     1  
ATOM   1036  C CZ     . ARG C 2 18 ? -4.866  8.467   2.703   1.00 0.00 ? 18  ARG A CZ     1  
ATOM   1037  N NH1    . ARG C 2 18 ? -4.948  9.768   2.773   1.00 0.00 ? 18  ARG A NH1    1  
ATOM   1038  N NH2    . ARG C 2 18 ? -5.323  7.840   1.654   1.00 0.00 ? 18  ARG A NH2    1  
ATOM   1039  H H      . ARG C 2 18 ? -1.781  3.938   6.616   1.00 0.00 ? 18  ARG A H      1  
ATOM   1040  H HA     . ARG C 2 18 ? -3.782  5.599   8.091   1.00 0.00 ? 18  ARG A HA     1  
ATOM   1041  H HB2    . ARG C 2 18 ? -2.725  6.990   6.368   1.00 0.00 ? 18  ARG A HB2    1  
ATOM   1042  H HB3    . ARG C 2 18 ? -3.035  5.751   5.151   1.00 0.00 ? 18  ARG A HB3    1  
ATOM   1043  H HG2    . ARG C 2 18 ? -5.364  6.115   5.194   1.00 0.00 ? 18  ARG A HG2    1  
ATOM   1044  H HG3    . ARG C 2 18 ? -5.296  6.940   6.751   1.00 0.00 ? 18  ARG A HG3    1  
ATOM   1045  H HD2    . ARG C 2 18 ? -5.586  8.686   5.142   1.00 0.00 ? 18  ARG A HD2    1  
ATOM   1046  H HD3    . ARG C 2 18 ? -3.855  8.719   5.528   1.00 0.00 ? 18  ARG A HD3    1  
ATOM   1047  H HE     . ARG C 2 18 ? -3.704  7.062   3.490   1.00 0.00 ? 18  ARG A HE     1  
ATOM   1048  H HH11   . ARG C 2 18 ? -4.598  10.249  3.576   1.00 0.00 ? 18  ARG A HH11   1  
ATOM   1049  H HH12   . ARG C 2 18 ? -5.362  10.283  2.022   1.00 0.00 ? 18  ARG A HH12   1  
ATOM   1050  H HH21   . ARG C 2 18 ? -5.259  6.843   1.601   1.00 0.00 ? 18  ARG A HH21   1  
ATOM   1051  H HH22   . ARG C 2 18 ? -5.736  8.355   0.904   1.00 0.00 ? 18  ARG A HH22   1  
ATOM   1052  N N      . GLU C 2 19 ? -5.729  4.234   7.011   1.00 0.00 ? 19  GLU A N      1  
ATOM   1053  C CA     . GLU C 2 19 ? -6.738  3.196   6.648   1.00 0.00 ? 19  GLU A CA     1  
ATOM   1054  C C      . GLU C 2 19 ? -7.658  3.726   5.544   1.00 0.00 ? 19  GLU A C      1  
ATOM   1055  O O      . GLU C 2 19 ? -8.006  4.891   5.522   1.00 0.00 ? 19  GLU A O      1  
ATOM   1056  C CB     . GLU C 2 19 ? -7.531  2.945   7.934   1.00 0.00 ? 19  GLU A CB     1  
ATOM   1057  C CG     . GLU C 2 19 ? -7.491  1.456   8.280   1.00 0.00 ? 19  GLU A CG     1  
ATOM   1058  C CD     . GLU C 2 19 ? -8.295  1.207   9.558   1.00 0.00 ? 19  GLU A CD     1  
ATOM   1059  O OE1    . GLU C 2 19 ? -7.974  1.816   10.564  1.00 0.00 ? 19  GLU A OE1    1  
ATOM   1060  O OE2    . GLU C 2 19 ? -9.218  0.411   9.508   1.00 0.00 ? 19  GLU A OE2    1  
ATOM   1061  H H      . GLU C 2 19 ? -6.019  5.072   7.431   1.00 0.00 ? 19  GLU A H      1  
ATOM   1062  H HA     . GLU C 2 19 ? -6.249  2.289   6.330   1.00 0.00 ? 19  GLU A HA     1  
ATOM   1063  H HB2    . GLU C 2 19 ? -7.095  3.514   8.743   1.00 0.00 ? 19  GLU A HB2    1  
ATOM   1064  H HB3    . GLU C 2 19 ? -8.556  3.252   7.792   1.00 0.00 ? 19  GLU A HB3    1  
ATOM   1065  H HG2    . GLU C 2 19 ? -7.918  0.886   7.467   1.00 0.00 ? 19  GLU A HG2    1  
ATOM   1066  H HG3    . GLU C 2 19 ? -6.467  1.149   8.436   1.00 0.00 ? 19  GLU A HG3    1  
ATOM   1067  N N      . VAL C 2 20 ? -8.055  2.883   4.627   1.00 0.00 ? 20  VAL A N      1  
ATOM   1068  C CA     . VAL C 2 20 ? -8.952  3.344   3.526   1.00 0.00 ? 20  VAL A CA     1  
ATOM   1069  C C      . VAL C 2 20 ? -10.124 2.374   3.351   1.00 0.00 ? 20  VAL A C      1  
ATOM   1070  O O      . VAL C 2 20 ? -9.985  1.324   2.758   1.00 0.00 ? 20  VAL A O      1  
ATOM   1071  C CB     . VAL C 2 20 ? -8.080  3.354   2.268   1.00 0.00 ? 20  VAL A CB     1  
ATOM   1072  C CG1    . VAL C 2 20 ? -8.861  3.974   1.106   1.00 0.00 ? 20  VAL A CG1    1  
ATOM   1073  C CG2    . VAL C 2 20 ? -6.815  4.175   2.528   1.00 0.00 ? 20  VAL A CG2    1  
ATOM   1074  H H      . VAL C 2 20 ? -7.763  1.948   4.662   1.00 0.00 ? 20  VAL A H      1  
ATOM   1075  H HA     . VAL C 2 20 ? -9.312  4.340   3.728   1.00 0.00 ? 20  VAL A HA     1  
ATOM   1076  H HB     . VAL C 2 20 ? -7.806  2.340   2.014   1.00 0.00 ? 20  VAL A HB     1  
ATOM   1077  H HG11   . VAL C 2 20 ? -9.878  4.166   1.415   1.00 0.00 ? 20  VAL A HG11   1  
ATOM   1078  H HG12   . VAL C 2 20 ? -8.863  3.291   0.270   1.00 0.00 ? 20  VAL A HG12   1  
ATOM   1079  H HG13   . VAL C 2 20 ? -8.394  4.902   0.811   1.00 0.00 ? 20  VAL A HG13   1  
ATOM   1080  H HG21   . VAL C 2 20 ? -6.251  4.268   1.612   1.00 0.00 ? 20  VAL A HG21   1  
ATOM   1081  H HG22   . VAL C 2 20 ? -6.211  3.679   3.274   1.00 0.00 ? 20  VAL A HG22   1  
ATOM   1082  H HG23   . VAL C 2 20 ? -7.089  5.158   2.883   1.00 0.00 ? 20  VAL A HG23   1  
ATOM   1083  N N      . PHE C 2 21 ? -11.278 2.720   3.855   1.00 0.00 ? 21  PHE A N      1  
ATOM   1084  C CA     . PHE C 2 21 ? -12.459 1.817   3.712   1.00 0.00 ? 21  PHE A CA     1  
ATOM   1085  C C      . PHE C 2 21 ? -13.148 2.055   2.362   1.00 0.00 ? 21  PHE A C      1  
ATOM   1086  O O      . PHE C 2 21 ? -14.347 2.231   2.293   1.00 0.00 ? 21  PHE A O      1  
ATOM   1087  C CB     . PHE C 2 21 ? -13.389 2.202   4.863   1.00 0.00 ? 21  PHE A CB     1  
ATOM   1088  C CG     . PHE C 2 21 ? -14.213 1.004   5.270   1.00 0.00 ? 21  PHE A CG     1  
ATOM   1089  C CD1    . PHE C 2 21 ? -13.580 -0.192  5.630   1.00 0.00 ? 21  PHE A CD1    1  
ATOM   1090  C CD2    . PHE C 2 21 ? -15.611 1.090   5.289   1.00 0.00 ? 21  PHE A CD2    1  
ATOM   1091  C CE1    . PHE C 2 21 ? -14.345 -1.302  6.008   1.00 0.00 ? 21  PHE A CE1    1  
ATOM   1092  C CE2    . PHE C 2 21 ? -16.374 -0.020  5.667   1.00 0.00 ? 21  PHE A CE2    1  
ATOM   1093  C CZ     . PHE C 2 21 ? -15.742 -1.216  6.026   1.00 0.00 ? 21  PHE A CZ     1  
ATOM   1094  H H      . PHE C 2 21 ? -11.370 3.576   4.325   1.00 0.00 ? 21  PHE A H      1  
ATOM   1095  H HA     . PHE C 2 21 ? -12.160 0.786   3.808   1.00 0.00 ? 21  PHE A HA     1  
ATOM   1096  H HB2    . PHE C 2 21 ? -12.799 2.536   5.705   1.00 0.00 ? 21  PHE A HB2    1  
ATOM   1097  H HB3    . PHE C 2 21 ? -14.046 2.998   4.545   1.00 0.00 ? 21  PHE A HB3    1  
ATOM   1098  H HD1    . PHE C 2 21 ? -12.502 -0.258  5.616   1.00 0.00 ? 21  PHE A HD1    1  
ATOM   1099  H HD2    . PHE C 2 21 ? -16.098 2.013   5.012   1.00 0.00 ? 21  PHE A HD2    1  
ATOM   1100  H HE1    . PHE C 2 21 ? -13.856 -2.224  6.286   1.00 0.00 ? 21  PHE A HE1    1  
ATOM   1101  H HE2    . PHE C 2 21 ? -17.453 0.045   5.681   1.00 0.00 ? 21  PHE A HE2    1  
ATOM   1102  H HZ     . PHE C 2 21 ? -16.332 -2.073  6.318   1.00 0.00 ? 21  PHE A HZ     1  
ATOM   1103  N N      . ARG C 2 22 ? -12.392 2.052   1.292   1.00 0.00 ? 22  ARG A N      1  
ATOM   1104  C CA     . ARG C 2 22 ? -12.982 2.273   -0.065  1.00 0.00 ? 22  ARG A CA     1  
ATOM   1105  C C      . ARG C 2 22 ? -13.905 3.497   -0.072  1.00 0.00 ? 22  ARG A C      1  
ATOM   1106  O O      . ARG C 2 22 ? -14.088 4.164   0.926   1.00 0.00 ? 22  ARG A O      1  
ATOM   1107  C CB     . ARG C 2 22 ? -13.779 1.007   -0.357  1.00 0.00 ? 22  ARG A CB     1  
ATOM   1108  C CG     . ARG C 2 22 ? -12.927 0.058   -1.199  1.00 0.00 ? 22  ARG A CG     1  
ATOM   1109  C CD     . ARG C 2 22 ? -12.897 0.540   -2.651  1.00 0.00 ? 22  ARG A CD     1  
ATOM   1110  N NE     . ARG C 2 22 ? -11.469 0.456   -3.053  1.00 0.00 ? 22  ARG A NE     1  
ATOM   1111  C CZ     . ARG C 2 22 ? -10.920 -0.701  -3.313  1.00 0.00 ? 22  ARG A CZ     1  
ATOM   1112  N NH1    . ARG C 2 22 ? -10.582 -1.502  -2.339  1.00 0.00 ? 22  ARG A NH1    1  
ATOM   1113  N NH2    . ARG C 2 22 ? -10.700 -1.054  -4.548  1.00 0.00 ? 22  ARG A NH2    1  
ATOM   1114  H H      . ARG C 2 22 ? -11.433 1.896   1.378   1.00 0.00 ? 22  ARG A H      1  
ATOM   1115  H HA     . ARG C 2 22 ? -12.201 2.389   -0.804  1.00 0.00 ? 22  ARG A HA     1  
ATOM   1116  H HB2    . ARG C 2 22 ? -14.046 0.525   0.574   1.00 0.00 ? 22  ARG A HB2    1  
ATOM   1117  H HB3    . ARG C 2 22 ? -14.672 1.266   -0.902  1.00 0.00 ? 22  ARG A HB3    1  
ATOM   1118  H HG2    . ARG C 2 22 ? -11.921 0.040   -0.805  1.00 0.00 ? 22  ARG A HG2    1  
ATOM   1119  H HG3    . ARG C 2 22 ? -13.345 -0.933  -1.161  1.00 0.00 ? 22  ARG A HG3    1  
ATOM   1120  H HD2    . ARG C 2 22 ? -13.503 -0.101  -3.273  1.00 0.00 ? 22  ARG A HD2    1  
ATOM   1121  H HD3    . ARG C 2 22 ? -13.239 1.562   -2.717  1.00 0.00 ? 22  ARG A HD3    1  
ATOM   1122  H HE     . ARG C 2 22 ? -10.941 1.276   -3.126  1.00 0.00 ? 22  ARG A HE     1  
ATOM   1123  H HH11   . ARG C 2 22 ? -10.741 -1.234  -1.390  1.00 0.00 ? 22  ARG A HH11   1  
ATOM   1124  H HH12   . ARG C 2 22 ? -10.164 -2.388  -2.543  1.00 0.00 ? 22  ARG A HH12   1  
ATOM   1125  H HH21   . ARG C 2 22 ? -10.950 -0.440  -5.296  1.00 0.00 ? 22  ARG A HH21   1  
ATOM   1126  H HH22   . ARG C 2 22 ? -10.279 -1.939  -4.747  1.00 0.00 ? 22  ARG A HH22   1  
ATOM   1127  N N      . LYS C 2 23 ? -14.481 3.791   -1.203  1.00 0.00 ? 23  LYS A N      1  
ATOM   1128  C CA     . LYS C 2 23 ? -15.394 4.962   -1.303  1.00 0.00 ? 23  LYS A CA     1  
ATOM   1129  C C      . LYS C 2 23 ? -16.610 4.604   -2.164  1.00 0.00 ? 23  LYS A C      1  
ATOM   1130  O O      . LYS C 2 23 ? -17.719 5.008   -1.876  1.00 0.00 ? 23  LYS A O      1  
ATOM   1131  C CB     . LYS C 2 23 ? -14.558 6.051   -1.976  1.00 0.00 ? 23  LYS A CB     1  
ATOM   1132  C CG     . LYS C 2 23 ? -15.405 7.310   -2.192  1.00 0.00 ? 23  LYS A CG     1  
ATOM   1133  C CD     . LYS C 2 23 ? -15.625 7.535   -3.693  1.00 0.00 ? 23  LYS A CD     1  
ATOM   1134  C CE     . LYS C 2 23 ? -14.274 7.659   -4.403  1.00 0.00 ? 23  LYS A CE     1  
ATOM   1135  N NZ     . LYS C 2 23 ? -14.583 8.308   -5.708  1.00 0.00 ? 23  LYS A NZ     1  
ATOM   1136  H H      . LYS C 2 23 ? -14.308 3.242   -1.993  1.00 0.00 ? 23  LYS A H      1  
ATOM   1137  H HA     . LYS C 2 23 ? -15.705 5.286   -0.323  1.00 0.00 ? 23  LYS A HA     1  
ATOM   1138  H HB2    . LYS C 2 23 ? -13.712 6.291   -1.349  1.00 0.00 ? 23  LYS A HB2    1  
ATOM   1139  H HB3    . LYS C 2 23 ? -14.206 5.688   -2.929  1.00 0.00 ? 23  LYS A HB3    1  
ATOM   1140  H HG2    . LYS C 2 23 ? -16.361 7.188   -1.702  1.00 0.00 ? 23  LYS A HG2    1  
ATOM   1141  H HG3    . LYS C 2 23 ? -14.894 8.164   -1.774  1.00 0.00 ? 23  LYS A HG3    1  
ATOM   1142  H HD2    . LYS C 2 23 ? -16.172 6.701   -4.105  1.00 0.00 ? 23  LYS A HD2    1  
ATOM   1143  H HD3    . LYS C 2 23 ? -16.191 8.443   -3.840  1.00 0.00 ? 23  LYS A HD3    1  
ATOM   1144  H HE2    . LYS C 2 23 ? -13.602 8.276   -3.822  1.00 0.00 ? 23  LYS A HE2    1  
ATOM   1145  H HE3    . LYS C 2 23 ? -13.844 6.682   -4.568  1.00 0.00 ? 23  LYS A HE3    1  
ATOM   1146  H HZ1    . LYS C 2 23 ? -13.698 8.610   -6.163  1.00 0.00 ? 23  LYS A HZ1    1  
ATOM   1147  H HZ2    . LYS C 2 23 ? -15.076 7.630   -6.323  1.00 0.00 ? 23  LYS A HZ2    1  
ATOM   1148  H HZ3    . LYS C 2 23 ? -15.188 9.138   -5.549  1.00 0.00 ? 23  LYS A HZ3    1  
ATOM   1149  N N      . SER C 2 24 ? -16.409 3.844   -3.219  1.00 0.00 ? 24  SER A N      1  
ATOM   1150  C CA     . SER C 2 24 ? -17.558 3.454   -4.107  1.00 0.00 ? 24  SER A CA     1  
ATOM   1151  C C      . SER C 2 24 ? -17.049 2.837   -5.415  1.00 0.00 ? 24  SER A C      1  
ATOM   1152  O O      . SER C 2 24 ? -15.892 2.486   -5.541  1.00 0.00 ? 24  SER A O      1  
ATOM   1153  C CB     . SER C 2 24 ? -18.320 4.749   -4.409  1.00 0.00 ? 24  SER A CB     1  
ATOM   1154  O OG     . SER C 2 24 ? -19.533 4.763   -3.668  1.00 0.00 ? 24  SER A OG     1  
ATOM   1155  H H      . SER C 2 24 ? -15.501 3.523   -3.423  1.00 0.00 ? 24  SER A H      1  
ATOM   1156  H HA     . SER C 2 24 ? -18.205 2.761   -3.596  1.00 0.00 ? 24  SER A HA     1  
ATOM   1157  H HB2    . SER C 2 24 ? -17.722 5.596   -4.125  1.00 0.00 ? 24  SER A HB2    1  
ATOM   1158  H HB3    . SER C 2 24 ? -18.534 4.802   -5.469  1.00 0.00 ? 24  SER A HB3    1  
ATOM   1159  H HG     . SER C 2 24 ? -20.068 4.021   -3.962  1.00 0.00 ? 24  SER A HG     1  
ATOM   1160  N N      . GLY C 2 25 ? -17.914 2.711   -6.390  1.00 0.00 ? 25  GLY A N      1  
ATOM   1161  C CA     . GLY C 2 25 ? -17.499 2.126   -7.698  1.00 0.00 ? 25  GLY A CA     1  
ATOM   1162  C C      . GLY C 2 25 ? -17.921 0.657   -7.761  1.00 0.00 ? 25  GLY A C      1  
ATOM   1163  O O      . GLY C 2 25 ? -19.012 0.327   -8.184  1.00 0.00 ? 25  GLY A O      1  
ATOM   1164  H H      . GLY C 2 25 ? -18.839 3.005   -6.261  1.00 0.00 ? 25  GLY A H      1  
ATOM   1165  H HA2    . GLY C 2 25 ? -17.970 2.672   -8.502  1.00 0.00 ? 25  GLY A HA2    1  
ATOM   1166  H HA3    . GLY C 2 25 ? -16.426 2.191   -7.797  1.00 0.00 ? 25  GLY A HA3    1  
ATOM   1167  N N      . ALA C 2 26 ? -17.056 -0.219  -7.343  1.00 0.00 ? 26  ALA A N      1  
ATOM   1168  C CA     . ALA C 2 26 ? -17.372 -1.678  -7.364  1.00 0.00 ? 26  ALA A CA     1  
ATOM   1169  C C      . ALA C 2 26 ? -16.666 -2.358  -6.193  1.00 0.00 ? 26  ALA A C      1  
ATOM   1170  O O      . ALA C 2 26 ? -17.219 -3.195  -5.507  1.00 0.00 ? 26  ALA A O      1  
ATOM   1171  C CB     . ALA C 2 26 ? -16.812 -2.178  -8.697  1.00 0.00 ? 26  ALA A CB     1  
ATOM   1172  H H      . ALA C 2 26 ? -16.187 0.084   -7.009  1.00 0.00 ? 26  ALA A H      1  
ATOM   1173  H HA     . ALA C 2 26 ? -18.438 -1.841  -7.318  1.00 0.00 ? 26  ALA A HA     1  
ATOM   1174  H HB1    . ALA C 2 26 ? -16.573 -1.334  -9.326  1.00 0.00 ? 26  ALA A HB1    1  
ATOM   1175  H HB2    . ALA C 2 26 ? -17.550 -2.796  -9.188  1.00 0.00 ? 26  ALA A HB2    1  
ATOM   1176  H HB3    . ALA C 2 26 ? -15.919 -2.757  -8.518  1.00 0.00 ? 26  ALA A HB3    1  
ATOM   1177  N N      . THR C 2 27 ? -15.442 -1.977  -5.960  1.00 0.00 ? 27  THR A N      1  
ATOM   1178  C CA     . THR C 2 27 ? -14.654 -2.552  -4.837  1.00 0.00 ? 27  THR A CA     1  
ATOM   1179  C C      . THR C 2 27 ? -15.091 -1.917  -3.508  1.00 0.00 ? 27  THR A C      1  
ATOM   1180  O O      . THR C 2 27 ? -14.565 -2.235  -2.459  1.00 0.00 ? 27  THR A O      1  
ATOM   1181  C CB     . THR C 2 27 ? -13.208 -2.161  -5.167  1.00 0.00 ? 27  THR A CB     1  
ATOM   1182  O OG1    . THR C 2 27 ? -13.122 -0.751  -5.353  1.00 0.00 ? 27  THR A OG1    1  
ATOM   1183  C CG2    . THR C 2 27 ? -12.769 -2.864  -6.455  1.00 0.00 ? 27  THR A CG2    1  
ATOM   1184  H H      . THR C 2 27 ? -15.036 -1.292  -6.531  1.00 0.00 ? 27  THR A H      1  
ATOM   1185  H HA     . THR C 2 27 ? -14.753 -3.625  -4.804  1.00 0.00 ? 27  THR A HA     1  
ATOM   1186  H HB     . THR C 2 27 ? -12.556 -2.454  -4.360  1.00 0.00 ? 27  THR A HB     1  
ATOM   1187  H HG1    . THR C 2 27 ? -13.975 -0.364  -5.144  1.00 0.00 ? 27  THR A HG1    1  
ATOM   1188  H HG21   . THR C 2 27 ? -11.727 -3.134  -6.381  1.00 0.00 ? 27  THR A HG21   1  
ATOM   1189  H HG22   . THR C 2 27 ? -12.910 -2.197  -7.295  1.00 0.00 ? 27  THR A HG22   1  
ATOM   1190  H HG23   . THR C 2 27 ? -13.363 -3.754  -6.599  1.00 0.00 ? 27  THR A HG23   1  
ATOM   1191  N N      . CYS C 2 28 ? -16.038 -1.010  -3.552  1.00 0.00 ? 28  CYS A N      1  
ATOM   1192  C CA     . CYS C 2 28 ? -16.511 -0.330  -2.307  1.00 0.00 ? 28  CYS A CA     1  
ATOM   1193  C C      . CYS C 2 28 ? -16.729 -1.326  -1.165  1.00 0.00 ? 28  CYS A C      1  
ATOM   1194  O O      . CYS C 2 28 ? -17.259 -2.403  -1.358  1.00 0.00 ? 28  CYS A O      1  
ATOM   1195  C CB     . CYS C 2 28 ? -17.838 0.319   -2.697  1.00 0.00 ? 28  CYS A CB     1  
ATOM   1196  S SG     . CYS C 2 28 ? -18.413 1.374   -1.344  1.00 0.00 ? 28  CYS A SG     1  
ATOM   1197  H H      . CYS C 2 28 ? -16.433 -0.765  -4.412  1.00 0.00 ? 28  CYS A H      1  
ATOM   1198  H HA     . CYS C 2 28 ? -15.812 0.432   -2.011  1.00 0.00 ? 28  CYS A HA     1  
ATOM   1199  H HB2    . CYS C 2 28 ? -17.700 0.914   -3.586  1.00 0.00 ? 28  CYS A HB2    1  
ATOM   1200  H HB3    . CYS C 2 28 ? -18.572 -0.450  -2.889  1.00 0.00 ? 28  CYS A HB3    1  
ATOM   1201  H HG     . CYS C 2 28 ? -18.182 2.281   -1.556  1.00 0.00 ? 28  CYS A HG     1  
ATOM   1202  N N      . GLY C 2 29 ? -16.335 -0.961  0.027   1.00 0.00 ? 29  GLY A N      1  
ATOM   1203  C CA     . GLY C 2 29 ? -16.532 -1.876  1.192   1.00 0.00 ? 29  GLY A CA     1  
ATOM   1204  C C      . GLY C 2 29 ? -15.205 -2.527  1.593   1.00 0.00 ? 29  GLY A C      1  
ATOM   1205  O O      . GLY C 2 29 ? -15.088 -3.103  2.657   1.00 0.00 ? 29  GLY A O      1  
ATOM   1206  H H      . GLY C 2 29 ? -15.918 -0.080  0.156   1.00 0.00 ? 29  GLY A H      1  
ATOM   1207  H HA2    . GLY C 2 29 ? -16.920 -1.310  2.027   1.00 0.00 ? 29  GLY A HA2    1  
ATOM   1208  H HA3    . GLY C 2 29 ? -17.238 -2.646  0.924   1.00 0.00 ? 29  GLY A HA3    1  
ATOM   1209  N N      . ARG C 2 30 ? -14.204 -2.447  0.756   1.00 0.00 ? 30  ARG A N      1  
ATOM   1210  C CA     . ARG C 2 30 ? -12.892 -3.068  1.102   1.00 0.00 ? 30  ARG A CA     1  
ATOM   1211  C C      . ARG C 2 30 ? -12.034 -2.082  1.898   1.00 0.00 ? 30  ARG A C      1  
ATOM   1212  O O      . ARG C 2 30 ? -12.139 -0.883  1.736   1.00 0.00 ? 30  ARG A O      1  
ATOM   1213  C CB     . ARG C 2 30 ? -12.237 -3.391  -0.241  1.00 0.00 ? 30  ARG A CB     1  
ATOM   1214  C CG     . ARG C 2 30 ? -13.056 -4.464  -0.962  1.00 0.00 ? 30  ARG A CG     1  
ATOM   1215  C CD     . ARG C 2 30 ? -12.290 -4.950  -2.196  1.00 0.00 ? 30  ARG A CD     1  
ATOM   1216  N NE     . ARG C 2 30 ? -13.123 -6.052  -2.756  1.00 0.00 ? 30  ARG A NE     1  
ATOM   1217  C CZ     . ARG C 2 30 ? -12.714 -6.706  -3.809  1.00 0.00 ? 30  ARG A CZ     1  
ATOM   1218  N NH1    . ARG C 2 30 ? -12.491 -6.072  -4.927  1.00 0.00 ? 30  ARG A NH1    1  
ATOM   1219  N NH2    . ARG C 2 30 ? -12.528 -7.997  -3.743  1.00 0.00 ? 30  ARG A NH2    1  
ATOM   1220  H H      . ARG C 2 30 ? -14.315 -1.980  -0.095  1.00 0.00 ? 30  ARG A H      1  
ATOM   1221  H HA     . ARG C 2 30 ? -13.043 -3.975  1.666   1.00 0.00 ? 30  ARG A HA     1  
ATOM   1222  H HB2    . ARG C 2 30 ? -12.198 -2.498  -0.848  1.00 0.00 ? 30  ARG A HB2    1  
ATOM   1223  H HB3    . ARG C 2 30 ? -11.236 -3.758  -0.075  1.00 0.00 ? 30  ARG A HB3    1  
ATOM   1224  H HG2    . ARG C 2 30 ? -13.227 -5.296  -0.294  1.00 0.00 ? 30  ARG A HG2    1  
ATOM   1225  H HG3    . ARG C 2 30 ? -14.004 -4.049  -1.269  1.00 0.00 ? 30  ARG A HG3    1  
ATOM   1226  H HD2    . ARG C 2 30 ? -12.191 -4.148  -2.914  1.00 0.00 ? 30  ARG A HD2    1  
ATOM   1227  H HD3    . ARG C 2 30 ? -11.321 -5.327  -1.913  1.00 0.00 ? 30  ARG A HD3    1  
ATOM   1228  H HE     . ARG C 2 30 ? -13.977 -6.286  -2.335  1.00 0.00 ? 30  ARG A HE     1  
ATOM   1229  H HH11   . ARG C 2 30 ? -12.633 -5.083  -4.977  1.00 0.00 ? 30  ARG A HH11   1  
ATOM   1230  H HH12   . ARG C 2 30 ? -12.177 -6.573  -5.734  1.00 0.00 ? 30  ARG A HH12   1  
ATOM   1231  H HH21   . ARG C 2 30 ? -12.700 -8.483  -2.886  1.00 0.00 ? 30  ARG A HH21   1  
ATOM   1232  H HH22   . ARG C 2 30 ? -12.215 -8.498  -4.549  1.00 0.00 ? 30  ARG A HH22   1  
ATOM   1233  N N      . SER C 2 31 ? -11.189 -2.581  2.761   1.00 0.00 ? 31  SER A N      1  
ATOM   1234  C CA     . SER C 2 31 ? -10.326 -1.674  3.571   1.00 0.00 ? 31  SER A CA     1  
ATOM   1235  C C      . SER C 2 31 ? -8.862  -1.803  3.142   1.00 0.00 ? 31  SER A C      1  
ATOM   1236  O O      . SER C 2 31 ? -8.263  -2.855  3.250   1.00 0.00 ? 31  SER A O      1  
ATOM   1237  C CB     . SER C 2 31 ? -10.505 -2.142  5.014   1.00 0.00 ? 31  SER A CB     1  
ATOM   1238  O OG     . SER C 2 31 ? -9.798  -3.362  5.203   1.00 0.00 ? 31  SER A OG     1  
ATOM   1239  H H      . SER C 2 31 ? -11.124 -3.552  2.877   1.00 0.00 ? 31  SER A H      1  
ATOM   1240  H HA     . SER C 2 31 ? -10.659 -0.654  3.474   1.00 0.00 ? 31  SER A HA     1  
ATOM   1241  H HB2    . SER C 2 31 ? -10.115 -1.398  5.687   1.00 0.00 ? 31  SER A HB2    1  
ATOM   1242  H HB3    . SER C 2 31 ? -11.558 -2.289  5.215   1.00 0.00 ? 31  SER A HB3    1  
ATOM   1243  H HG     . SER C 2 31 ? -10.343 -4.076  4.864   1.00 0.00 ? 31  SER A HG     1  
ATOM   1244  N N      . ASP C 2 32 ? -8.284  -0.737  2.659   1.00 0.00 ? 32  ASP A N      1  
ATOM   1245  C CA     . ASP C 2 32 ? -6.859  -0.784  2.224   1.00 0.00 ? 32  ASP A CA     1  
ATOM   1246  C C      . ASP C 2 32 ? -6.014  0.146   3.095   1.00 0.00 ? 32  ASP A C      1  
ATOM   1247  O O      . ASP C 2 32 ? -6.328  1.306   3.270   1.00 0.00 ? 32  ASP A O      1  
ATOM   1248  C CB     . ASP C 2 32 ? -6.876  -0.306  0.773   1.00 0.00 ? 32  ASP A CB     1  
ATOM   1249  C CG     . ASP C 2 32 ? -7.512  -1.381  -0.110  1.00 0.00 ? 32  ASP A CG     1  
ATOM   1250  O OD1    . ASP C 2 32 ? -8.563  -1.879  0.261   1.00 0.00 ? 32  ASP A OD1    1  
ATOM   1251  O OD2    . ASP C 2 32 ? -6.940  -1.687  -1.143  1.00 0.00 ? 32  ASP A OD2    1  
ATOM   1252  H H      . ASP C 2 32 ? -8.789  0.099   2.585   1.00 0.00 ? 32  ASP A H      1  
ATOM   1253  H HA     . ASP C 2 32 ? -6.480  -1.788  2.275   1.00 0.00 ? 32  ASP A HA     1  
ATOM   1254  H HB2    . ASP C 2 32 ? -7.449  0.606   0.701   1.00 0.00 ? 32  ASP A HB2    1  
ATOM   1255  H HB3    . ASP C 2 32 ? -5.864  -0.124  0.442   1.00 0.00 ? 32  ASP A HB3    1  
ATOM   1256  N N      . THR C 2 33 ? -4.946  -0.359  3.650   1.00 0.00 ? 33  THR A N      1  
ATOM   1257  C CA     . THR C 2 33 ? -4.083  0.490   4.518   1.00 0.00 ? 33  THR A CA     1  
ATOM   1258  C C      . THR C 2 33 ? -2.862  0.981   3.739   1.00 0.00 ? 33  THR A C      1  
ATOM   1259  O O      . THR C 2 33 ? -2.105  0.200   3.195   1.00 0.00 ? 33  THR A O      1  
ATOM   1260  C CB     . THR C 2 33 ? -3.659  -0.422  5.669   1.00 0.00 ? 33  THR A CB     1  
ATOM   1261  O OG1    . THR C 2 33 ? -4.798  -1.107  6.172   1.00 0.00 ? 33  THR A OG1    1  
ATOM   1262  C CG2    . THR C 2 33 ? -3.031  0.416   6.784   1.00 0.00 ? 33  THR A CG2    1  
ATOM   1263  H H      . THR C 2 33 ? -4.715  -1.300  3.501   1.00 0.00 ? 33  THR A H      1  
ATOM   1264  H HA     . THR C 2 33 ? -4.645  1.327   4.902   1.00 0.00 ? 33  THR A HA     1  
ATOM   1265  H HB     . THR C 2 33 ? -2.936  -1.139  5.313   1.00 0.00 ? 33  THR A HB     1  
ATOM   1266  H HG1    . THR C 2 33 ? -5.409  -0.452  6.518   1.00 0.00 ? 33  THR A HG1    1  
ATOM   1267  H HG21   . THR C 2 33 ? -2.369  1.151   6.353   1.00 0.00 ? 33  THR A HG21   1  
ATOM   1268  H HG22   . THR C 2 33 ? -2.472  -0.229  7.447   1.00 0.00 ? 33  THR A HG22   1  
ATOM   1269  H HG23   . THR C 2 33 ? -3.811  0.915   7.341   1.00 0.00 ? 33  THR A HG23   1  
ATOM   1270  N N      . TYR C 2 34 ? -2.662  2.270   3.689   1.00 0.00 ? 34  TYR A N      1  
ATOM   1271  C CA     . TYR C 2 34 ? -1.489  2.822   2.955   1.00 0.00 ? 34  TYR A CA     1  
ATOM   1272  C C      . TYR C 2 34 ? -0.528  3.474   3.950   1.00 0.00 ? 34  TYR A C      1  
ATOM   1273  O O      . TYR C 2 34 ? -0.947  4.081   4.914   1.00 0.00 ? 34  TYR A O      1  
ATOM   1274  C CB     . TYR C 2 34 ? -2.073  3.867   2.008   1.00 0.00 ? 34  TYR A CB     1  
ATOM   1275  C CG     . TYR C 2 34 ? -2.901  3.178   0.952   1.00 0.00 ? 34  TYR A CG     1  
ATOM   1276  C CD1    . TYR C 2 34 ? -4.231  2.826   1.216   1.00 0.00 ? 34  TYR A CD1    1  
ATOM   1277  C CD2    . TYR C 2 34 ? -2.337  2.891   -0.295  1.00 0.00 ? 34  TYR A CD2    1  
ATOM   1278  C CE1    . TYR C 2 34 ? -4.993  2.191   0.233   1.00 0.00 ? 34  TYR A CE1    1  
ATOM   1279  C CE2    . TYR C 2 34 ? -3.100  2.255   -1.278  1.00 0.00 ? 34  TYR A CE2    1  
ATOM   1280  C CZ     . TYR C 2 34 ? -4.429  1.905   -1.015  1.00 0.00 ? 34  TYR A CZ     1  
ATOM   1281  O OH     . TYR C 2 34 ? -5.182  1.278   -1.986  1.00 0.00 ? 34  TYR A OH     1  
ATOM   1282  H H      . TYR C 2 34 ? -3.283  2.877   4.142   1.00 0.00 ? 34  TYR A H      1  
ATOM   1283  H HA     . TYR C 2 34 ? -0.993  2.046   2.392   1.00 0.00 ? 34  TYR A HA     1  
ATOM   1284  H HB2    . TYR C 2 34 ? -2.696  4.552   2.566   1.00 0.00 ? 34  TYR A HB2    1  
ATOM   1285  H HB3    . TYR C 2 34 ? -1.269  4.412   1.531   1.00 0.00 ? 34  TYR A HB3    1  
ATOM   1286  H HD1    . TYR C 2 34 ? -4.669  3.041   2.181   1.00 0.00 ? 34  TYR A HD1    1  
ATOM   1287  H HD2    . TYR C 2 34 ? -1.311  3.161   -0.498  1.00 0.00 ? 34  TYR A HD2    1  
ATOM   1288  H HE1    . TYR C 2 34 ? -6.018  1.925   0.436   1.00 0.00 ? 34  TYR A HE1    1  
ATOM   1289  H HE2    . TYR C 2 34 ? -2.664  2.032   -2.238  1.00 0.00 ? 34  TYR A HE2    1  
ATOM   1290  H HH     . TYR C 2 34 ? -4.895  0.364   -2.041  1.00 0.00 ? 34  TYR A HH     1  
ATOM   1291  N N      . TYR C 2 35 ? 0.754   3.349   3.738   1.00 0.00 ? 35  TYR A N      1  
ATOM   1292  C CA     . TYR C 2 35 ? 1.721   3.961   4.698   1.00 0.00 ? 35  TYR A CA     1  
ATOM   1293  C C      . TYR C 2 35 ? 2.899   4.592   3.949   1.00 0.00 ? 35  TYR A C      1  
ATOM   1294  O O      . TYR C 2 35 ? 3.408   4.044   2.992   1.00 0.00 ? 35  TYR A O      1  
ATOM   1295  C CB     . TYR C 2 35 ? 2.215   2.815   5.599   1.00 0.00 ? 35  TYR A CB     1  
ATOM   1296  C CG     . TYR C 2 35 ? 1.569   1.503   5.203   1.00 0.00 ? 35  TYR A CG     1  
ATOM   1297  C CD1    . TYR C 2 35 ? 2.007   0.825   4.061   1.00 0.00 ? 35  TYR A CD1    1  
ATOM   1298  C CD2    . TYR C 2 35 ? 0.535   0.969   5.982   1.00 0.00 ? 35  TYR A CD2    1  
ATOM   1299  C CE1    . TYR C 2 35 ? 1.411   -0.389  3.696   1.00 0.00 ? 35  TYR A CE1    1  
ATOM   1300  C CE2    . TYR C 2 35 ? -0.061  -0.243  5.617   1.00 0.00 ? 35  TYR A CE2    1  
ATOM   1301  C CZ     . TYR C 2 35 ? 0.378   -0.922  4.474   1.00 0.00 ? 35  TYR A CZ     1  
ATOM   1302  O OH     . TYR C 2 35 ? -0.211  -2.118  4.115   1.00 0.00 ? 35  TYR A OH     1  
ATOM   1303  H H      . TYR C 2 35 ? 1.079   2.850   2.960   1.00 0.00 ? 35  TYR A H      1  
ATOM   1304  H HA     . TYR C 2 35 ? 1.223   4.706   5.297   1.00 0.00 ? 35  TYR A HA     1  
ATOM   1305  H HB2    . TYR C 2 35 ? 3.286   2.724   5.507   1.00 0.00 ? 35  TYR A HB2    1  
ATOM   1306  H HB3    . TYR C 2 35 ? 1.965   3.038   6.626   1.00 0.00 ? 35  TYR A HB3    1  
ATOM   1307  H HD1    . TYR C 2 35 ? 2.803   1.237   3.461   1.00 0.00 ? 35  TYR A HD1    1  
ATOM   1308  H HD2    . TYR C 2 35 ? 0.197   1.493   6.863   1.00 0.00 ? 35  TYR A HD2    1  
ATOM   1309  H HE1    . TYR C 2 35 ? 1.749   -0.913  2.813   1.00 0.00 ? 35  TYR A HE1    1  
ATOM   1310  H HE2    . TYR C 2 35 ? -0.858  -0.656  6.217   1.00 0.00 ? 35  TYR A HE2    1  
ATOM   1311  H HH     . TYR C 2 35 ? -1.162  -1.998  4.134   1.00 0.00 ? 35  TYR A HH     1  
ATOM   1312  N N      . GLN C 2 36 ? 3.341   5.738   4.394   1.00 0.00 ? 36  GLN A N      1  
ATOM   1313  C CA     . GLN C 2 36 ? 4.494   6.405   3.727   1.00 0.00 ? 36  GLN A CA     1  
ATOM   1314  C C      . GLN C 2 36 ? 5.770   6.132   4.524   1.00 0.00 ? 36  GLN A C      1  
ATOM   1315  O O      . GLN C 2 36 ? 5.731   5.914   5.721   1.00 0.00 ? 36  GLN A O      1  
ATOM   1316  C CB     . GLN C 2 36 ? 4.160   7.900   3.738   1.00 0.00 ? 36  GLN A CB     1  
ATOM   1317  C CG     . GLN C 2 36 ? 5.313   8.696   3.111   1.00 0.00 ? 36  GLN A CG     1  
ATOM   1318  C CD     . GLN C 2 36 ? 5.069   10.192  3.317   1.00 0.00 ? 36  GLN A CD     1  
ATOM   1319  O OE1    . GLN C 2 36 ? 5.145   10.685  4.425   1.00 0.00 ? 36  GLN A OE1    1  
ATOM   1320  N NE2    . GLN C 2 36 ? 4.777   10.940  2.289   1.00 0.00 ? 36  GLN A NE2    1  
ATOM   1321  H H      . GLN C 2 36 ? 2.920   6.156   5.174   1.00 0.00 ? 36  GLN A H      1  
ATOM   1322  H HA     . GLN C 2 36 ? 4.599   6.056   2.712   1.00 0.00 ? 36  GLN A HA     1  
ATOM   1323  H HB2    . GLN C 2 36 ? 3.256   8.070   3.172   1.00 0.00 ? 36  GLN A HB2    1  
ATOM   1324  H HB3    . GLN C 2 36 ? 4.013   8.227   4.757   1.00 0.00 ? 36  GLN A HB3    1  
ATOM   1325  H HG2    . GLN C 2 36 ? 6.245   8.415   3.580   1.00 0.00 ? 36  GLN A HG2    1  
ATOM   1326  H HG3    . GLN C 2 36 ? 5.364   8.485   2.054   1.00 0.00 ? 36  GLN A HG3    1  
ATOM   1327  H HE21   . GLN C 2 36 ? 4.714   10.542  1.395   1.00 0.00 ? 36  GLN A HE21   1  
ATOM   1328  H HE22   . GLN C 2 36 ? 4.619   11.900  2.411   1.00 0.00 ? 36  GLN A HE22   1  
ATOM   1329  N N      . SER C 2 37 ? 6.896   6.136   3.867   1.00 0.00 ? 37  SER A N      1  
ATOM   1330  C CA     . SER C 2 37 ? 8.184   5.873   4.574   1.00 0.00 ? 37  SER A CA     1  
ATOM   1331  C C      . SER C 2 37 ? 8.348   6.824   5.758   1.00 0.00 ? 37  SER A C      1  
ATOM   1332  O O      . SER C 2 37 ? 7.468   7.615   6.039   1.00 0.00 ? 37  SER A O      1  
ATOM   1333  C CB     . SER C 2 37 ? 9.261   6.121   3.526   1.00 0.00 ? 37  SER A CB     1  
ATOM   1334  O OG     . SER C 2 37 ? 9.730   4.870   3.046   1.00 0.00 ? 37  SER A OG     1  
ATOM   1335  H H      . SER C 2 37 ? 6.896   6.311   2.903   1.00 0.00 ? 37  SER A H      1  
ATOM   1336  H HA     . SER C 2 37 ? 8.225   4.848   4.907   1.00 0.00 ? 37  SER A HA     1  
ATOM   1337  H HB2    . SER C 2 37 ? 8.845   6.684   2.709   1.00 0.00 ? 37  SER A HB2    1  
ATOM   1338  H HB3    . SER C 2 37 ? 10.074  6.680   3.967   1.00 0.00 ? 37  SER A HB3    1  
ATOM   1339  H HG     . SER C 2 37 ? 9.870   4.295   3.802   1.00 0.00 ? 37  SER A HG     1  
ATOM   1340  N N      . PRO C 2 38 ? 9.465   6.717   6.432   1.00 0.00 ? 38  PRO A N      1  
ATOM   1341  C CA     . PRO C 2 38 ? 9.704   7.574   7.597   1.00 0.00 ? 38  PRO A CA     1  
ATOM   1342  C C      . PRO C 2 38 ? 10.307  8.914   7.183   1.00 0.00 ? 38  PRO A C      1  
ATOM   1343  O O      . PRO C 2 38 ? 10.429  9.812   7.994   1.00 0.00 ? 38  PRO A O      1  
ATOM   1344  C CB     . PRO C 2 38 ? 10.689  6.770   8.433   1.00 0.00 ? 38  PRO A CB     1  
ATOM   1345  C CG     . PRO C 2 38 ? 11.401  5.871   7.468   1.00 0.00 ? 38  PRO A CG     1  
ATOM   1346  C CD     . PRO C 2 38 ? 10.592  5.810   6.190   1.00 0.00 ? 38  PRO A CD     1  
ATOM   1347  H HA     . PRO C 2 38 ? 8.796   7.721   8.141   1.00 0.00 ? 38  PRO A HA     1  
ATOM   1348  H HB2    . PRO C 2 38 ? 11.393  7.433   8.920   1.00 0.00 ? 38  PRO A HB2    1  
ATOM   1349  H HB3    . PRO C 2 38 ? 10.163  6.179   9.167   1.00 0.00 ? 38  PRO A HB3    1  
ATOM   1350  H HG2    . PRO C 2 38 ? 12.384  6.270   7.262   1.00 0.00 ? 38  PRO A HG2    1  
ATOM   1351  H HG3    . PRO C 2 38 ? 11.488  4.883   7.889   1.00 0.00 ? 38  PRO A HG3    1  
ATOM   1352  H HD2    . PRO C 2 38 ? 11.186  6.155   5.356   1.00 0.00 ? 38  PRO A HD2    1  
ATOM   1353  H HD3    . PRO C 2 38 ? 10.235  4.811   6.012   1.00 0.00 ? 38  PRO A HD3    1  
ATOM   1354  N N      . THR C 2 39 ? 10.699  9.068   5.944   1.00 0.00 ? 39  THR A N      1  
ATOM   1355  C CA     . THR C 2 39 ? 11.297  10.374  5.550   1.00 0.00 ? 39  THR A CA     1  
ATOM   1356  C C      . THR C 2 39 ? 11.286  10.600  4.029   1.00 0.00 ? 39  THR A C      1  
ATOM   1357  O O      . THR C 2 39 ? 11.948  11.494  3.538   1.00 0.00 ? 39  THR A O      1  
ATOM   1358  C CB     . THR C 2 39 ? 12.725  10.307  6.090   1.00 0.00 ? 39  THR A CB     1  
ATOM   1359  O OG1    . THR C 2 39 ? 13.379  11.545  5.849   1.00 0.00 ? 39  THR A OG1    1  
ATOM   1360  C CG2    . THR C 2 39 ? 13.489  9.177   5.397   1.00 0.00 ? 39  THR A CG2    1  
ATOM   1361  H H      . THR C 2 39 ? 10.611  8.338   5.293   1.00 0.00 ? 39  THR A H      1  
ATOM   1362  H HA     . THR C 2 39 ? 10.772  11.177  6.041   1.00 0.00 ? 39  THR A HA     1  
ATOM   1363  H HB     . THR C 2 39 ? 12.692  10.114  7.156   1.00 0.00 ? 39  THR A HB     1  
ATOM   1364  H HG1    . THR C 2 39 ? 14.159  11.582  6.409   1.00 0.00 ? 39  THR A HG1    1  
ATOM   1365  H HG21   . THR C 2 39 ? 14.530  9.218   5.684   1.00 0.00 ? 39  THR A HG21   1  
ATOM   1366  H HG22   . THR C 2 39 ? 13.407  9.291   4.326   1.00 0.00 ? 39  THR A HG22   1  
ATOM   1367  H HG23   . THR C 2 39 ? 13.071  8.226   5.692   1.00 0.00 ? 39  THR A HG23   1  
ATOM   1368  N N      . GLY C 2 40 ? 10.531  9.837   3.273   1.00 0.00 ? 40  GLY A N      1  
ATOM   1369  C CA     . GLY C 2 40 ? 10.501  10.090  1.800   1.00 0.00 ? 40  GLY A CA     1  
ATOM   1370  C C      . GLY C 2 40 ? 10.325  8.798   0.993   1.00 0.00 ? 40  GLY A C      1  
ATOM   1371  O O      . GLY C 2 40 ? 11.270  8.260   0.450   1.00 0.00 ? 40  GLY A O      1  
ATOM   1372  H H      . GLY C 2 40 ? 9.978   9.132   3.669   1.00 0.00 ? 40  GLY A H      1  
ATOM   1373  H HA2    . GLY C 2 40 ? 9.674   10.751  1.579   1.00 0.00 ? 40  GLY A HA2    1  
ATOM   1374  H HA3    . GLY C 2 40 ? 11.422  10.567  1.505   1.00 0.00 ? 40  GLY A HA3    1  
ATOM   1375  N N      . ASP C 2 41 ? 9.111   8.325   0.878   1.00 0.00 ? 41  ASP A N      1  
ATOM   1376  C CA     . ASP C 2 41 ? 8.830   7.093   0.071   1.00 0.00 ? 41  ASP A CA     1  
ATOM   1377  C C      . ASP C 2 41 ? 7.369   6.675   0.262   1.00 0.00 ? 41  ASP A C      1  
ATOM   1378  O O      . ASP C 2 41 ? 6.890   6.553   1.370   1.00 0.00 ? 41  ASP A O      1  
ATOM   1379  C CB     . ASP C 2 41 ? 9.774   6.002   0.586   1.00 0.00 ? 41  ASP A CB     1  
ATOM   1380  C CG     . ASP C 2 41 ? 10.640  5.494   -0.568  1.00 0.00 ? 41  ASP A CG     1  
ATOM   1381  O OD1    . ASP C 2 41 ? 11.370  6.294   -1.130  1.00 0.00 ? 41  ASP A OD1    1  
ATOM   1382  O OD2    . ASP C 2 41 ? 10.555  4.316   -0.872  1.00 0.00 ? 41  ASP A OD2    1  
ATOM   1383  H H      . ASP C 2 41 ? 8.371   8.799   1.305   1.00 0.00 ? 41  ASP A H      1  
ATOM   1384  H HA     . ASP C 2 41 ? 9.025   7.283   -0.974  1.00 0.00 ? 41  ASP A HA     1  
ATOM   1385  H HB2    . ASP C 2 41 ? 10.407  6.404   1.363   1.00 0.00 ? 41  ASP A HB2    1  
ATOM   1386  H HB3    . ASP C 2 41 ? 9.193   5.182   0.982   1.00 0.00 ? 41  ASP A HB3    1  
ATOM   1387  N N      . ARG C 2 42 ? 6.655   6.462   -0.812  1.00 0.00 ? 42  ARG A N      1  
ATOM   1388  C CA     . ARG C 2 42 ? 5.223   6.061   -0.689  1.00 0.00 ? 42  ARG A CA     1  
ATOM   1389  C C      . ARG C 2 42 ? 5.076   4.543   -0.824  1.00 0.00 ? 42  ARG A C      1  
ATOM   1390  O O      . ARG C 2 42 ? 5.173   3.994   -1.905  1.00 0.00 ? 42  ARG A O      1  
ATOM   1391  C CB     . ARG C 2 42 ? 4.513   6.771   -1.844  1.00 0.00 ? 42  ARG A CB     1  
ATOM   1392  C CG     . ARG C 2 42 ? 3.032   6.946   -1.504  1.00 0.00 ? 42  ARG A CG     1  
ATOM   1393  C CD     . ARG C 2 42 ? 2.876   8.024   -0.429  1.00 0.00 ? 42  ARG A CD     1  
ATOM   1394  N NE     . ARG C 2 42 ? 1.520   8.601   -0.652  1.00 0.00 ? 42  ARG A NE     1  
ATOM   1395  C CZ     . ARG C 2 42 ? 1.106   9.597   0.082   1.00 0.00 ? 42  ARG A CZ     1  
ATOM   1396  N NH1    . ARG C 2 42 ? 0.510   9.366   1.221   1.00 0.00 ? 42  ARG A NH1    1  
ATOM   1397  N NH2    . ARG C 2 42 ? 1.288   10.825  -0.321  1.00 0.00 ? 42  ARG A NH2    1  
ATOM   1398  H H      . ARG C 2 42 ? 7.059   6.572   -1.698  1.00 0.00 ? 42  ARG A H      1  
ATOM   1399  H HA     . ARG C 2 42 ? 4.817   6.396   0.252   1.00 0.00 ? 42  ARG A HA     1  
ATOM   1400  H HB2    . ARG C 2 42 ? 4.965   7.741   -2.001  1.00 0.00 ? 42  ARG A HB2    1  
ATOM   1401  H HB3    . ARG C 2 42 ? 4.608   6.180   -2.742  1.00 0.00 ? 42  ARG A HB3    1  
ATOM   1402  H HG2    . ARG C 2 42 ? 2.492   7.240   -2.393  1.00 0.00 ? 42  ARG A HG2    1  
ATOM   1403  H HG3    . ARG C 2 42 ? 2.635   6.012   -1.135  1.00 0.00 ? 42  ARG A HG3    1  
ATOM   1404  H HD2    . ARG C 2 42 ? 2.943   7.583   0.556   1.00 0.00 ? 42  ARG A HD2    1  
ATOM   1405  H HD3    . ARG C 2 42 ? 3.628   8.789   -0.553  1.00 0.00 ? 42  ARG A HD3    1  
ATOM   1406  H HE     . ARG C 2 42 ? 0.939   8.233   -1.350  1.00 0.00 ? 42  ARG A HE     1  
ATOM   1407  H HH11   . ARG C 2 42 ? 0.370   8.425   1.529   1.00 0.00 ? 42  ARG A HH11   1  
ATOM   1408  H HH12   . ARG C 2 42 ? 0.193   10.129  1.783   1.00 0.00 ? 42  ARG A HH12   1  
ATOM   1409  H HH21   . ARG C 2 42 ? 1.745   11.002  -1.193  1.00 0.00 ? 42  ARG A HH21   1  
ATOM   1410  H HH22   . ARG C 2 42 ? 0.970   11.588  0.242   1.00 0.00 ? 42  ARG A HH22   1  
ATOM   1411  N N      . ILE C 2 43 ? 4.840   3.861   0.266   1.00 0.00 ? 43  ILE A N      1  
ATOM   1412  C CA     . ILE C 2 43 ? 4.682   2.379   0.202   1.00 0.00 ? 43  ILE A CA     1  
ATOM   1413  C C      . ILE C 2 43 ? 3.205   2.019   0.380   1.00 0.00 ? 43  ILE A C      1  
ATOM   1414  O O      . ILE C 2 43 ? 2.523   2.555   1.233   1.00 0.00 ? 43  ILE A O      1  
ATOM   1415  C CB     . ILE C 2 43 ? 5.540   1.834   1.359   1.00 0.00 ? 43  ILE A CB     1  
ATOM   1416  C CG1    . ILE C 2 43 ? 7.006   1.725   0.917   1.00 0.00 ? 43  ILE A CG1    1  
ATOM   1417  C CG2    . ILE C 2 43 ? 5.047   0.442   1.766   1.00 0.00 ? 43  ILE A CG2    1  
ATOM   1418  C CD1    . ILE C 2 43 ? 7.454   3.022   0.245   1.00 0.00 ? 43  ILE A CD1    1  
ATOM   1419  H H      . ILE C 2 43 ? 4.762   4.325   1.126   1.00 0.00 ? 43  ILE A H      1  
ATOM   1420  H HA     . ILE C 2 43 ? 5.050   2.003   -0.739  1.00 0.00 ? 43  ILE A HA     1  
ATOM   1421  H HB     . ILE C 2 43 ? 5.467   2.503   2.204   1.00 0.00 ? 43  ILE A HB     1  
ATOM   1422  H HG12   . ILE C 2 43 ? 7.627   1.537   1.779   1.00 0.00 ? 43  ILE A HG12   1  
ATOM   1423  H HG13   . ILE C 2 43 ? 7.109   0.911   0.218   1.00 0.00 ? 43  ILE A HG13   1  
ATOM   1424  H HG21   . ILE C 2 43 ? 4.509   -0.003  0.945   1.00 0.00 ? 43  ILE A HG21   1  
ATOM   1425  H HG22   . ILE C 2 43 ? 4.393   0.528   2.621   1.00 0.00 ? 43  ILE A HG22   1  
ATOM   1426  H HG23   . ILE C 2 43 ? 5.892   -0.180  2.021   1.00 0.00 ? 43  ILE A HG23   1  
ATOM   1427  H HD11   . ILE C 2 43 ? 7.103   3.864   0.819   1.00 0.00 ? 43  ILE A HD11   1  
ATOM   1428  H HD12   . ILE C 2 43 ? 7.039   3.066   -0.751  1.00 0.00 ? 43  ILE A HD12   1  
ATOM   1429  H HD13   . ILE C 2 43 ? 8.531   3.046   0.189   1.00 0.00 ? 43  ILE A HD13   1  
ATOM   1430  N N      . ARG C 2 44 ? 2.703   1.122   -0.423  1.00 0.00 ? 44  ARG A N      1  
ATOM   1431  C CA     . ARG C 2 44 ? 1.268   0.737   -0.305  1.00 0.00 ? 44  ARG A CA     1  
ATOM   1432  C C      . ARG C 2 44 ? 1.129   -0.699  0.207   1.00 0.00 ? 44  ARG A C      1  
ATOM   1433  O O      . ARG C 2 44 ? 0.034   -1.181  0.417   1.00 0.00 ? 44  ARG A O      1  
ATOM   1434  C CB     . ARG C 2 44 ? 0.706   0.850   -1.724  1.00 0.00 ? 44  ARG A CB     1  
ATOM   1435  C CG     . ARG C 2 44 ? 0.995   2.242   -2.288  1.00 0.00 ? 44  ARG A CG     1  
ATOM   1436  C CD     . ARG C 2 44 ? -0.104  2.631   -3.279  1.00 0.00 ? 44  ARG A CD     1  
ATOM   1437  N NE     . ARG C 2 44 ? -0.474  4.025   -2.911  1.00 0.00 ? 44  ARG A NE     1  
ATOM   1438  C CZ     . ARG C 2 44 ? -0.761  4.891   -3.844  1.00 0.00 ? 44  ARG A CZ     1  
ATOM   1439  N NH1    . ARG C 2 44 ? -1.592  4.571   -4.798  1.00 0.00 ? 44  ARG A NH1    1  
ATOM   1440  N NH2    . ARG C 2 44 ? -0.220  6.078   -3.821  1.00 0.00 ? 44  ARG A NH2    1  
ATOM   1441  H H      . ARG C 2 44 ? 3.268   0.707   -1.108  1.00 0.00 ? 44  ARG A H      1  
ATOM   1442  H HA     . ARG C 2 44 ? 0.748   1.421   0.348   1.00 0.00 ? 44  ARG A HA     1  
ATOM   1443  H HB2    . ARG C 2 44 ? 1.168   0.104   -2.353  1.00 0.00 ? 44  ARG A HB2    1  
ATOM   1444  H HB3    . ARG C 2 44 ? -0.361  0.690   -1.701  1.00 0.00 ? 44  ARG A HB3    1  
ATOM   1445  H HG2    . ARG C 2 44 ? 1.023   2.957   -1.480  1.00 0.00 ? 44  ARG A HG2    1  
ATOM   1446  H HG3    . ARG C 2 44 ? 1.948   2.234   -2.796  1.00 0.00 ? 44  ARG A HG3    1  
ATOM   1447  H HD2    . ARG C 2 44 ? 0.274   2.592   -4.292  1.00 0.00 ? 44  ARG A HD2    1  
ATOM   1448  H HD3    . ARG C 2 44 ? -0.957  1.980   -3.168  1.00 0.00 ? 44  ARG A HD3    1  
ATOM   1449  H HE     . ARG C 2 44 ? -0.500  4.290   -1.969  1.00 0.00 ? 44  ARG A HE     1  
ATOM   1450  H HH11   . ARG C 2 44 ? -2.008  3.661   -4.816  1.00 0.00 ? 44  ARG A HH11   1  
ATOM   1451  H HH12   . ARG C 2 44 ? -1.812  5.235   -5.513  1.00 0.00 ? 44  ARG A HH12   1  
ATOM   1452  H HH21   . ARG C 2 44 ? 0.415   6.324   -3.089  1.00 0.00 ? 44  ARG A HH21   1  
ATOM   1453  H HH22   . ARG C 2 44 ? -0.440  6.742   -4.535  1.00 0.00 ? 44  ARG A HH22   1  
ATOM   1454  N N      . SER C 2 45 ? 2.221   -1.396  0.400   1.00 0.00 ? 45  SER A N      1  
ATOM   1455  C CA     . SER C 2 45 ? 2.114   -2.805  0.888   1.00 0.00 ? 45  SER A CA     1  
ATOM   1456  C C      . SER C 2 45 ? 3.392   -3.228  1.620   1.00 0.00 ? 45  SER A C      1  
ATOM   1457  O O      . SER C 2 45 ? 4.222   -2.411  1.969   1.00 0.00 ? 45  SER A O      1  
ATOM   1458  C CB     . SER C 2 45 ? 1.916   -3.638  -0.382  1.00 0.00 ? 45  SER A CB     1  
ATOM   1459  O OG     . SER C 2 45 ? 3.017   -4.522  -0.549  1.00 0.00 ? 45  SER A OG     1  
ATOM   1460  H H      . SER C 2 45 ? 3.105   -1.000  0.218   1.00 0.00 ? 45  SER A H      1  
ATOM   1461  H HA     . SER C 2 45 ? 1.257   -2.914  1.535   1.00 0.00 ? 45  SER A HA     1  
ATOM   1462  H HB2    . SER C 2 45 ? 1.012   -4.217  -0.306  1.00 0.00 ? 45  SER A HB2    1  
ATOM   1463  H HB3    . SER C 2 45 ? 1.843   -2.979  -1.237  1.00 0.00 ? 45  SER A HB3    1  
ATOM   1464  H HG     . SER C 2 45 ? 3.804   -3.992  -0.688  1.00 0.00 ? 45  SER A HG     1  
ATOM   1465  N N      . LYS C 2 46 ? 3.559   -4.508  1.836   1.00 0.00 ? 46  LYS A N      1  
ATOM   1466  C CA     . LYS C 2 46 ? 4.785   -4.997  2.524   1.00 0.00 ? 46  LYS A CA     1  
ATOM   1467  C C      . LYS C 2 46 ? 5.940   -5.027  1.525   1.00 0.00 ? 46  LYS A C      1  
ATOM   1468  O O      . LYS C 2 46 ? 7.043   -4.615  1.829   1.00 0.00 ? 46  LYS A O      1  
ATOM   1469  C CB     . LYS C 2 46 ? 4.446   -6.408  3.005   1.00 0.00 ? 46  LYS A CB     1  
ATOM   1470  C CG     . LYS C 2 46 ? 5.221   -6.704  4.290   1.00 0.00 ? 46  LYS A CG     1  
ATOM   1471  C CD     . LYS C 2 46 ? 5.047   -8.178  4.664   1.00 0.00 ? 46  LYS A CD     1  
ATOM   1472  C CE     . LYS C 2 46 ? 6.207   -8.989  4.083   1.00 0.00 ? 46  LYS A CE     1  
ATOM   1473  N NZ     . LYS C 2 46 ? 5.748   -10.404 4.131   1.00 0.00 ? 46  LYS A NZ     1  
ATOM   1474  H H      . LYS C 2 46 ? 2.882   -5.148  1.530   1.00 0.00 ? 46  LYS A H      1  
ATOM   1475  H HA     . LYS C 2 46 ? 5.026   -4.364  3.364   1.00 0.00 ? 46  LYS A HA     1  
ATOM   1476  H HB2    . LYS C 2 46 ? 3.384   -6.477  3.200   1.00 0.00 ? 46  LYS A HB2    1  
ATOM   1477  H HB3    . LYS C 2 46 ? 4.721   -7.125  2.246   1.00 0.00 ? 46  LYS A HB3    1  
ATOM   1478  H HG2    . LYS C 2 46 ? 6.269   -6.493  4.134   1.00 0.00 ? 46  LYS A HG2    1  
ATOM   1479  H HG3    . LYS C 2 46 ? 4.844   -6.085  5.090   1.00 0.00 ? 46  LYS A HG3    1  
ATOM   1480  H HD2    . LYS C 2 46 ? 5.038   -8.277  5.739   1.00 0.00 ? 46  LYS A HD2    1  
ATOM   1481  H HD3    . LYS C 2 46 ? 4.115   -8.545  4.259   1.00 0.00 ? 46  LYS A HD3    1  
ATOM   1482  H HE2    . LYS C 2 46 ? 6.400   -8.687  3.063   1.00 0.00 ? 46  LYS A HE2    1  
ATOM   1483  H HE3    . LYS C 2 46 ? 7.091   -8.866  4.688   1.00 0.00 ? 46  LYS A HE3    1  
ATOM   1484  H HZ1    . LYS C 2 46 ? 6.516   -11.030 3.815   1.00 0.00 ? 46  LYS A HZ1    1  
ATOM   1485  H HZ2    . LYS C 2 46 ? 5.478   -10.649 5.106   1.00 0.00 ? 46  LYS A HZ2    1  
ATOM   1486  H HZ3    . LYS C 2 46 ? 4.927   -10.524 3.504   1.00 0.00 ? 46  LYS A HZ3    1  
ATOM   1487  N N      . VAL C 2 47 ? 5.693   -5.490  0.324   1.00 0.00 ? 47  VAL A N      1  
ATOM   1488  C CA     . VAL C 2 47 ? 6.779   -5.517  -0.697  1.00 0.00 ? 47  VAL A CA     1  
ATOM   1489  C C      . VAL C 2 47 ? 7.329   -4.099  -0.867  1.00 0.00 ? 47  VAL A C      1  
ATOM   1490  O O      . VAL C 2 47 ? 8.510   -3.859  -0.712  1.00 0.00 ? 47  VAL A O      1  
ATOM   1491  C CB     . VAL C 2 47 ? 6.103   -6.005  -1.976  1.00 0.00 ? 47  VAL A CB     1  
ATOM   1492  C CG1    . VAL C 2 47 ? 6.990   -5.712  -3.185  1.00 0.00 ? 47  VAL A CG1    1  
ATOM   1493  C CG2    . VAL C 2 47 ? 5.859   -7.512  -1.880  1.00 0.00 ? 47  VAL A CG2    1  
ATOM   1494  H H      . VAL C 2 47 ? 4.791   -5.804  0.088   1.00 0.00 ? 47  VAL A H      1  
ATOM   1495  H HA     . VAL C 2 47 ? 7.562   -6.198  -0.403  1.00 0.00 ? 47  VAL A HA     1  
ATOM   1496  H HB     . VAL C 2 47 ? 5.163   -5.496  -2.092  1.00 0.00 ? 47  VAL A HB     1  
ATOM   1497  H HG11   . VAL C 2 47 ? 8.014   -5.965  -2.951  1.00 0.00 ? 47  VAL A HG11   1  
ATOM   1498  H HG12   . VAL C 2 47 ? 6.926   -4.662  -3.430  1.00 0.00 ? 47  VAL A HG12   1  
ATOM   1499  H HG13   . VAL C 2 47 ? 6.655   -6.299  -4.027  1.00 0.00 ? 47  VAL A HG13   1  
ATOM   1500  H HG21   . VAL C 2 47 ? 4.982   -7.771  -2.455  1.00 0.00 ? 47  VAL A HG21   1  
ATOM   1501  H HG22   . VAL C 2 47 ? 5.707   -7.787  -0.847  1.00 0.00 ? 47  VAL A HG22   1  
ATOM   1502  H HG23   . VAL C 2 47 ? 6.715   -8.041  -2.271  1.00 0.00 ? 47  VAL A HG23   1  
ATOM   1503  N N      . GLU C 2 48 ? 6.469   -3.153  -1.158  1.00 0.00 ? 48  GLU A N      1  
ATOM   1504  C CA     . GLU C 2 48 ? 6.930   -1.740  -1.308  1.00 0.00 ? 48  GLU A CA     1  
ATOM   1505  C C      . GLU C 2 48 ? 7.766   -1.365  -0.084  1.00 0.00 ? 48  GLU A C      1  
ATOM   1506  O O      . GLU C 2 48 ? 8.784   -0.701  -0.179  1.00 0.00 ? 48  GLU A O      1  
ATOM   1507  C CB     . GLU C 2 48 ? 5.649   -0.902  -1.367  1.00 0.00 ? 48  GLU A CB     1  
ATOM   1508  C CG     . GLU C 2 48 ? 5.504   -0.286  -2.761  1.00 0.00 ? 48  GLU A CG     1  
ATOM   1509  C CD     . GLU C 2 48 ? 6.138   1.105   -2.774  1.00 0.00 ? 48  GLU A CD     1  
ATOM   1510  O OE1    . GLU C 2 48 ? 7.138   1.285   -2.099  1.00 0.00 ? 48  GLU A OE1    1  
ATOM   1511  O OE2    . GLU C 2 48 ? 5.613   1.967   -3.460  1.00 0.00 ? 48  GLU A OE2    1  
ATOM   1512  H H      . GLU C 2 48 ? 5.520   -3.369  -1.258  1.00 0.00 ? 48  GLU A H      1  
ATOM   1513  H HA     . GLU C 2 48 ? 7.498   -1.617  -2.212  1.00 0.00 ? 48  GLU A HA     1  
ATOM   1514  H HB2    . GLU C 2 48 ? 4.797   -1.533  -1.161  1.00 0.00 ? 48  GLU A HB2    1  
ATOM   1515  H HB3    . GLU C 2 48 ? 5.698   -0.114  -0.632  1.00 0.00 ? 48  GLU A HB3    1  
ATOM   1516  H HG2    . GLU C 2 48 ? 6.001   -0.915  -3.484  1.00 0.00 ? 48  GLU A HG2    1  
ATOM   1517  H HG3    . GLU C 2 48 ? 4.457   -0.206  -3.012  1.00 0.00 ? 48  GLU A HG3    1  
ATOM   1518  N N      . LEU C 2 49 ? 7.347   -1.820  1.064   1.00 0.00 ? 49  LEU A N      1  
ATOM   1519  C CA     . LEU C 2 49 ? 8.106   -1.536  2.310   1.00 0.00 ? 49  LEU A CA     1  
ATOM   1520  C C      . LEU C 2 49 ? 9.438   -2.280  2.253   1.00 0.00 ? 49  LEU A C      1  
ATOM   1521  O O      . LEU C 2 49 ? 10.479  -1.751  2.592   1.00 0.00 ? 49  LEU A O      1  
ATOM   1522  C CB     . LEU C 2 49 ? 7.226   -2.091  3.434   1.00 0.00 ? 49  LEU A CB     1  
ATOM   1523  C CG     . LEU C 2 49 ? 7.314   -1.194  4.670   1.00 0.00 ? 49  LEU A CG     1  
ATOM   1524  C CD1    . LEU C 2 49 ? 6.243   -0.105  4.588   1.00 0.00 ? 49  LEU A CD1    1  
ATOM   1525  C CD2    . LEU C 2 49 ? 7.080   -2.042  5.925   1.00 0.00 ? 49  LEU A CD2    1  
ATOM   1526  H H      . LEU C 2 49 ? 6.536   -2.369  1.102   1.00 0.00 ? 49  LEU A H      1  
ATOM   1527  H HA     . LEU C 2 49 ? 8.260   -0.479  2.430   1.00 0.00 ? 49  LEU A HA     1  
ATOM   1528  H HB2    . LEU C 2 49 ? 6.200   -2.134  3.096   1.00 0.00 ? 49  LEU A HB2    1  
ATOM   1529  H HB3    . LEU C 2 49 ? 7.559   -3.085  3.691   1.00 0.00 ? 49  LEU A HB3    1  
ATOM   1530  H HG     . LEU C 2 49 ? 8.291   -0.737  4.716   1.00 0.00 ? 49  LEU A HG     1  
ATOM   1531  H HD11   . LEU C 2 49 ? 5.281   -0.560  4.403   1.00 0.00 ? 49  LEU A HD11   1  
ATOM   1532  H HD12   . LEU C 2 49 ? 6.481   0.573   3.784   1.00 0.00 ? 49  LEU A HD12   1  
ATOM   1533  H HD13   . LEU C 2 49 ? 6.211   0.438   5.520   1.00 0.00 ? 49  LEU A HD13   1  
ATOM   1534  H HD21   . LEU C 2 49 ? 6.386   -1.535  6.579   1.00 0.00 ? 49  LEU A HD21   1  
ATOM   1535  H HD22   . LEU C 2 49 ? 8.017   -2.188  6.440   1.00 0.00 ? 49  LEU A HD22   1  
ATOM   1536  H HD23   . LEU C 2 49 ? 6.671   -3.002  5.642   1.00 0.00 ? 49  LEU A HD23   1  
ATOM   1537  N N      . THR C 2 50 ? 9.404   -3.506  1.809   1.00 0.00 ? 50  THR A N      1  
ATOM   1538  C CA     . THR C 2 50 ? 10.655  -4.305  1.703   1.00 0.00 ? 50  THR A CA     1  
ATOM   1539  C C      . THR C 2 50 ? 11.581  -3.687  0.647   1.00 0.00 ? 50  THR A C      1  
ATOM   1540  O O      . THR C 2 50 ? 12.757  -3.990  0.588   1.00 0.00 ? 50  THR A O      1  
ATOM   1541  C CB     . THR C 2 50 ? 10.186  -5.699  1.268   1.00 0.00 ? 50  THR A CB     1  
ATOM   1542  O OG1    . THR C 2 50 ? 9.376   -6.260  2.291   1.00 0.00 ? 50  THR A OG1    1  
ATOM   1543  C CG2    . THR C 2 50 ? 11.397  -6.601  1.026   1.00 0.00 ? 50  THR A CG2    1  
ATOM   1544  H H      . THR C 2 50 ? 8.548   -3.899  1.534   1.00 0.00 ? 50  THR A H      1  
ATOM   1545  H HA     . THR C 2 50 ? 11.151  -4.361  2.658   1.00 0.00 ? 50  THR A HA     1  
ATOM   1546  H HB     . THR C 2 50 ? 9.610   -5.619  0.355   1.00 0.00 ? 50  THR A HB     1  
ATOM   1547  H HG1    . THR C 2 50 ? 8.479   -6.327  1.955   1.00 0.00 ? 50  THR A HG1    1  
ATOM   1548  H HG21   . THR C 2 50 ? 11.147  -7.618  1.289   1.00 0.00 ? 50  THR A HG21   1  
ATOM   1549  H HG22   . THR C 2 50 ? 12.224  -6.265  1.634   1.00 0.00 ? 50  THR A HG22   1  
ATOM   1550  H HG23   . THR C 2 50 ? 11.676  -6.557  -0.016  1.00 0.00 ? 50  THR A HG23   1  
ATOM   1551  N N      . ARG C 2 51 ? 11.059  -2.823  -0.185  1.00 0.00 ? 51  ARG A N      1  
ATOM   1552  C CA     . ARG C 2 51 ? 11.907  -2.187  -1.235  1.00 0.00 ? 51  ARG A CA     1  
ATOM   1553  C C      . ARG C 2 51 ? 12.762  -1.077  -0.622  1.00 0.00 ? 51  ARG A C      1  
ATOM   1554  O O      . ARG C 2 51 ? 13.977  -1.137  -0.631  1.00 0.00 ? 51  ARG A O      1  
ATOM   1555  C CB     . ARG C 2 51 ? 10.922  -1.598  -2.243  1.00 0.00 ? 51  ARG A CB     1  
ATOM   1556  C CG     . ARG C 2 51 ? 10.042  -2.712  -2.810  1.00 0.00 ? 51  ARG A CG     1  
ATOM   1557  C CD     . ARG C 2 51 ? 10.527  -3.082  -4.214  1.00 0.00 ? 51  ARG A CD     1  
ATOM   1558  N NE     . ARG C 2 51 ? 9.478   -3.986  -4.763  1.00 0.00 ? 51  ARG A NE     1  
ATOM   1559  C CZ     . ARG C 2 51 ? 9.572   -4.421  -5.990  1.00 0.00 ? 51  ARG A CZ     1  
ATOM   1560  N NH1    . ARG C 2 51 ? 9.374   -3.605  -6.988  1.00 0.00 ? 51  ARG A NH1    1  
ATOM   1561  N NH2    . ARG C 2 51 ? 9.864   -5.672  -6.218  1.00 0.00 ? 51  ARG A NH2    1  
ATOM   1562  H H      . ARG C 2 51 ? 10.109  -2.593  -0.122  1.00 0.00 ? 51  ARG A H      1  
ATOM   1563  H HA     . ARG C 2 51 ? 12.529  -2.925  -1.715  1.00 0.00 ? 51  ARG A HA     1  
ATOM   1564  H HB2    . ARG C 2 51 ? 10.303  -0.862  -1.753  1.00 0.00 ? 51  ARG A HB2    1  
ATOM   1565  H HB3    . ARG C 2 51 ? 11.468  -1.129  -3.048  1.00 0.00 ? 51  ARG A HB3    1  
ATOM   1566  H HG2    . ARG C 2 51 ? 10.101  -3.578  -2.167  1.00 0.00 ? 51  ARG A HG2    1  
ATOM   1567  H HG3    . ARG C 2 51 ? 9.021   -2.371  -2.859  1.00 0.00 ? 51  ARG A HG3    1  
ATOM   1568  H HD2    . ARG C 2 51 ? 10.618  -2.193  -4.825  1.00 0.00 ? 51  ARG A HD2    1  
ATOM   1569  H HD3    . ARG C 2 51 ? 11.471  -3.601  -4.162  1.00 0.00 ? 51  ARG A HD3    1  
ATOM   1570  H HE     . ARG C 2 51 ? 8.719   -4.254  -4.205  1.00 0.00 ? 51  ARG A HE     1  
ATOM   1571  H HH11   . ARG C 2 51 ? 9.151   -2.646  -6.814  1.00 0.00 ? 51  ARG A HH11   1  
ATOM   1572  H HH12   . ARG C 2 51 ? 9.445   -3.938  -7.928  1.00 0.00 ? 51  ARG A HH12   1  
ATOM   1573  H HH21   . ARG C 2 51 ? 10.017  -6.297  -5.453  1.00 0.00 ? 51  ARG A HH21   1  
ATOM   1574  H HH22   . ARG C 2 51 ? 9.936   -6.005  -7.158  1.00 0.00 ? 51  ARG A HH22   1  
ATOM   1575  N N      . TYR C 2 52 ? 12.135  -0.061  -0.089  1.00 0.00 ? 52  TYR A N      1  
ATOM   1576  C CA     . TYR C 2 52 ? 12.910  1.060   0.525   1.00 0.00 ? 52  TYR A CA     1  
ATOM   1577  C C      . TYR C 2 52 ? 13.809  0.531   1.647   1.00 0.00 ? 52  TYR A C      1  
ATOM   1578  O O      . TYR C 2 52 ? 14.788  1.152   2.013   1.00 0.00 ? 52  TYR A O      1  
ATOM   1579  C CB     . TYR C 2 52 ? 11.852  2.013   1.089   1.00 0.00 ? 52  TYR A CB     1  
ATOM   1580  C CG     . TYR C 2 52 ? 12.392  3.428   1.141   1.00 0.00 ? 52  TYR A CG     1  
ATOM   1581  C CD1    . TYR C 2 52 ? 13.098  3.960   0.053   1.00 0.00 ? 52  TYR A CD1    1  
ATOM   1582  C CD2    . TYR C 2 52 ? 12.170  4.215   2.278   1.00 0.00 ? 52  TYR A CD2    1  
ATOM   1583  C CE1    . TYR C 2 52 ? 13.582  5.273   0.106   1.00 0.00 ? 52  TYR A CE1    1  
ATOM   1584  C CE2    . TYR C 2 52 ? 12.650  5.528   2.328   1.00 0.00 ? 52  TYR A CE2    1  
ATOM   1585  C CZ     . TYR C 2 52 ? 13.357  6.057   1.243   1.00 0.00 ? 52  TYR A CZ     1  
ATOM   1586  O OH     . TYR C 2 52 ? 13.830  7.352   1.293   1.00 0.00 ? 52  TYR A OH     1  
ATOM   1587  H H      . TYR C 2 52 ? 11.152  -0.035  -0.096  1.00 0.00 ? 52  TYR A H      1  
ATOM   1588  H HA     . TYR C 2 52 ? 13.499  1.563   -0.223  1.00 0.00 ? 52  TYR A HA     1  
ATOM   1589  H HB2    . TYR C 2 52 ? 10.977  1.988   0.457   1.00 0.00 ? 52  TYR A HB2    1  
ATOM   1590  H HB3    . TYR C 2 52 ? 11.582  1.698   2.086   1.00 0.00 ? 52  TYR A HB3    1  
ATOM   1591  H HD1    . TYR C 2 52 ? 13.272  3.356   -0.826  1.00 0.00 ? 52  TYR A HD1    1  
ATOM   1592  H HD2    . TYR C 2 52 ? 11.629  3.810   3.120   1.00 0.00 ? 52  TYR A HD2    1  
ATOM   1593  H HE1    . TYR C 2 52 ? 14.127  5.681   -0.733  1.00 0.00 ? 52  TYR A HE1    1  
ATOM   1594  H HE2    . TYR C 2 52 ? 12.471  6.134   3.204   1.00 0.00 ? 52  TYR A HE2    1  
ATOM   1595  H HH     . TYR C 2 52 ? 14.783  7.324   1.183   1.00 0.00 ? 52  TYR A HH     1  
ATOM   1596  N N      . LEU C 2 53 ? 13.482  -0.609  2.193   1.00 0.00 ? 53  LEU A N      1  
ATOM   1597  C CA     . LEU C 2 53 ? 14.317  -1.176  3.292   1.00 0.00 ? 53  LEU A CA     1  
ATOM   1598  C C      . LEU C 2 53 ? 15.346  -2.161  2.724   1.00 0.00 ? 53  LEU A C      1  
ATOM   1599  O O      . LEU C 2 53 ? 16.304  -2.518  3.382   1.00 0.00 ? 53  LEU A O      1  
ATOM   1600  C CB     . LEU C 2 53 ? 13.329  -1.900  4.212   1.00 0.00 ? 53  LEU A CB     1  
ATOM   1601  C CG     . LEU C 2 53 ? 12.226  -0.931  4.648   1.00 0.00 ? 53  LEU A CG     1  
ATOM   1602  C CD1    . LEU C 2 53 ? 11.110  -1.707  5.348   1.00 0.00 ? 53  LEU A CD1    1  
ATOM   1603  C CD2    . LEU C 2 53 ? 12.807  0.103   5.614   1.00 0.00 ? 53  LEU A CD2    1  
ATOM   1604  H H      . LEU C 2 53 ? 12.688  -1.092  1.884   1.00 0.00 ? 53  LEU A H      1  
ATOM   1605  H HA     . LEU C 2 53 ? 14.813  -0.388  3.833   1.00 0.00 ? 53  LEU A HA     1  
ATOM   1606  H HB2    . LEU C 2 53 ? 12.888  -2.731  3.680   1.00 0.00 ? 53  LEU A HB2    1  
ATOM   1607  H HB3    . LEU C 2 53 ? 13.850  -2.265  5.084   1.00 0.00 ? 53  LEU A HB3    1  
ATOM   1608  H HG     . LEU C 2 53 ? 11.824  -0.429  3.780   1.00 0.00 ? 53  LEU A HG     1  
ATOM   1609  H HD11   . LEU C 2 53 ? 10.163  -1.224  5.158   1.00 0.00 ? 53  LEU A HD11   1  
ATOM   1610  H HD12   . LEU C 2 53 ? 11.298  -1.728  6.411   1.00 0.00 ? 53  LEU A HD12   1  
ATOM   1611  H HD13   . LEU C 2 53 ? 11.081  -2.717  4.967   1.00 0.00 ? 53  LEU A HD13   1  
ATOM   1612  H HD21   . LEU C 2 53 ? 13.858  0.238   5.409   1.00 0.00 ? 53  LEU A HD21   1  
ATOM   1613  H HD22   . LEU C 2 53 ? 12.680  -0.242  6.630   1.00 0.00 ? 53  LEU A HD22   1  
ATOM   1614  H HD23   . LEU C 2 53 ? 12.291  1.043   5.486   1.00 0.00 ? 53  LEU A HD23   1  
ATOM   1615  N N      . GLY C 2 54 ? 15.158  -2.601  1.506   1.00 0.00 ? 54  GLY A N      1  
ATOM   1616  C CA     . GLY C 2 54 ? 16.126  -3.558  0.899   1.00 0.00 ? 54  GLY A CA     1  
ATOM   1617  C C      . GLY C 2 54 ? 15.489  -4.948  0.821   1.00 0.00 ? 54  GLY A C      1  
ATOM   1618  O O      . GLY C 2 54 ? 14.618  -5.274  1.603   1.00 0.00 ? 54  GLY A O      1  
ATOM   1619  H H      . GLY C 2 54 ? 14.382  -2.302  0.991   1.00 0.00 ? 54  GLY A H      1  
ATOM   1620  H HA2    . GLY C 2 54 ? 16.388  -3.223  -0.095  1.00 0.00 ? 54  GLY A HA2    1  
ATOM   1621  H HA3    . GLY C 2 54 ? 17.014  -3.608  1.509   1.00 0.00 ? 54  GLY A HA3    1  
ATOM   1622  N N      . PRO C 2 55 ? 15.945  -5.729  -0.125  1.00 0.00 ? 55  PRO A N      1  
ATOM   1623  C CA     . PRO C 2 55 ? 15.407  -7.101  -0.299  1.00 0.00 ? 55  PRO A CA     1  
ATOM   1624  C C      . PRO C 2 55 ? 15.856  -7.995  0.858   1.00 0.00 ? 55  PRO A C      1  
ATOM   1625  O O      . PRO C 2 55 ? 15.169  -8.921  1.243   1.00 0.00 ? 55  PRO A O      1  
ATOM   1626  C CB     . PRO C 2 55 ? 16.017  -7.562  -1.621  1.00 0.00 ? 55  PRO A CB     1  
ATOM   1627  C CG     . PRO C 2 55 ? 17.258  -6.744  -1.777  1.00 0.00 ? 55  PRO A CG     1  
ATOM   1628  C CD     . PRO C 2 55 ? 16.993  -5.421  -1.107  1.00 0.00 ? 55  PRO A CD     1  
ATOM   1629  H HA     . PRO C 2 55 ? 14.332  -7.082  -0.373  1.00 0.00 ? 55  PRO A HA     1  
ATOM   1630  H HB2    . PRO C 2 55 ? 16.259  -8.615  -1.576  1.00 0.00 ? 55  PRO A HB2    1  
ATOM   1631  H HB3    . PRO C 2 55 ? 15.340  -7.365  -2.438  1.00 0.00 ? 55  PRO A HB3    1  
ATOM   1632  H HG2    . PRO C 2 55 ? 18.090  -7.243  -1.300  1.00 0.00 ? 55  PRO A HG2    1  
ATOM   1633  H HG3    . PRO C 2 55 ? 17.470  -6.586  -2.823  1.00 0.00 ? 55  PRO A HG3    1  
ATOM   1634  H HD2    . PRO C 2 55 ? 17.886  -5.061  -0.614  1.00 0.00 ? 55  PRO A HD2    1  
ATOM   1635  H HD3    . PRO C 2 55 ? 16.632  -4.698  -1.821  1.00 0.00 ? 55  PRO A HD3    1  
ATOM   1636  N N      . ALA C 2 56 ? 17.001  -7.716  1.422   1.00 0.00 ? 56  ALA A N      1  
ATOM   1637  C CA     . ALA C 2 56 ? 17.494  -8.543  2.563   1.00 0.00 ? 56  ALA A CA     1  
ATOM   1638  C C      . ALA C 2 56 ? 16.718  -8.193  3.837   1.00 0.00 ? 56  ALA A C      1  
ATOM   1639  O O      . ALA C 2 56 ? 16.656  -8.971  4.769   1.00 0.00 ? 56  ALA A O      1  
ATOM   1640  C CB     . ALA C 2 56 ? 18.970  -8.172  2.715   1.00 0.00 ? 56  ALA A CB     1  
ATOM   1641  H H      . ALA C 2 56 ? 17.534  -6.960  1.100   1.00 0.00 ? 56  ALA A H      1  
ATOM   1642  H HA     . ALA C 2 56 ? 17.398  -9.593  2.337   1.00 0.00 ? 56  ALA A HA     1  
ATOM   1643  H HB1    . ALA C 2 56 ? 19.440  -8.160  1.743   1.00 0.00 ? 56  ALA A HB1    1  
ATOM   1644  H HB2    . ALA C 2 56 ? 19.460  -8.901  3.344   1.00 0.00 ? 56  ALA A HB2    1  
ATOM   1645  H HB3    . ALA C 2 56 ? 19.050  -7.195  3.166   1.00 0.00 ? 56  ALA A HB3    1  
ATOM   1646  N N      . CYS C 2 57 ? 16.123  -7.029  3.882   1.00 0.00 ? 57  CYS A N      1  
ATOM   1647  C CA     . CYS C 2 57 ? 15.349  -6.629  5.092   1.00 0.00 ? 57  CYS A CA     1  
ATOM   1648  C C      . CYS C 2 57 ? 13.891  -7.081  4.960   1.00 0.00 ? 57  CYS A C      1  
ATOM   1649  O O      . CYS C 2 57 ? 12.988  -6.273  4.866   1.00 0.00 ? 57  CYS A O      1  
ATOM   1650  C CB     . CYS C 2 57 ? 15.436  -5.102  5.132   1.00 0.00 ? 57  CYS A CB     1  
ATOM   1651  S SG     . CYS C 2 57 ? 16.885  -4.604  6.097   1.00 0.00 ? 57  CYS A SG     1  
ATOM   1652  H H      . CYS C 2 57 ? 16.184  -6.418  3.118   1.00 0.00 ? 57  CYS A H      1  
ATOM   1653  H HA     . CYS C 2 57 ? 15.795  -7.048  5.980   1.00 0.00 ? 57  CYS A HA     1  
ATOM   1654  H HB2    . CYS C 2 57 ? 15.526  -4.719  4.125   1.00 0.00 ? 57  CYS A HB2    1  
ATOM   1655  H HB3    . CYS C 2 57 ? 14.544  -4.702  5.591   1.00 0.00 ? 57  CYS A HB3    1  
ATOM   1656  H HG     . CYS C 2 57 ? 17.449  -4.072  5.532   1.00 0.00 ? 57  CYS A HG     1  
ATOM   1657  N N      . ASP C 2 58 ? 13.657  -8.366  4.953   1.00 0.00 ? 58  ASP A N      1  
ATOM   1658  C CA     . ASP C 2 58 ? 12.257  -8.873  4.827   1.00 0.00 ? 58  ASP A CA     1  
ATOM   1659  C C      . ASP C 2 58 ? 11.402  -8.351  5.984   1.00 0.00 ? 58  ASP A C      1  
ATOM   1660  O O      . ASP C 2 58 ? 11.913  -7.845  6.965   1.00 0.00 ? 58  ASP A O      1  
ATOM   1661  C CB     . ASP C 2 58 ? 12.368  -10.398 4.895   1.00 0.00 ? 58  ASP A CB     1  
ATOM   1662  C CG     . ASP C 2 58 ? 11.677  -11.018 3.678   1.00 0.00 ? 58  ASP A CG     1  
ATOM   1663  O OD1    . ASP C 2 58 ? 10.550  -10.638 3.404   1.00 0.00 ? 58  ASP A OD1    1  
ATOM   1664  O OD2    . ASP C 2 58 ? 12.286  -11.863 3.041   1.00 0.00 ? 58  ASP A OD2    1  
ATOM   1665  H H      . ASP C 2 58 ? 14.402  -9.000  5.030   1.00 0.00 ? 58  ASP A H      1  
ATOM   1666  H HA     . ASP C 2 58 ? 11.833  -8.574  3.880   1.00 0.00 ? 58  ASP A HA     1  
ATOM   1667  H HB2    . ASP C 2 58 ? 13.410  -10.685 4.902   1.00 0.00 ? 58  ASP A HB2    1  
ATOM   1668  H HB3    . ASP C 2 58 ? 11.890  -10.754 5.796   1.00 0.00 ? 58  ASP A HB3    1  
ATOM   1669  N N      . LEU C 2 59 ? 10.105  -8.471  5.878   1.00 0.00 ? 59  LEU A N      1  
ATOM   1670  C CA     . LEU C 2 59 ? 9.219   -7.985  6.974   1.00 0.00 ? 59  LEU A CA     1  
ATOM   1671  C C      . LEU C 2 59 ? 8.074   -8.975  7.201   1.00 0.00 ? 59  LEU A C      1  
ATOM   1672  O O      . LEU C 2 59 ? 6.919   -8.662  6.989   1.00 0.00 ? 59  LEU A O      1  
ATOM   1673  C CB     . LEU C 2 59 ? 8.676   -6.640  6.487   1.00 0.00 ? 59  LEU A CB     1  
ATOM   1674  C CG     . LEU C 2 59 ? 9.836   -5.670  6.246   1.00 0.00 ? 59  LEU A CG     1  
ATOM   1675  C CD1    . LEU C 2 59 ? 9.301   -4.370  5.640   1.00 0.00 ? 59  LEU A CD1    1  
ATOM   1676  C CD2    . LEU C 2 59 ? 10.537  -5.368  7.577   1.00 0.00 ? 59  LEU A CD2    1  
ATOM   1677  H H      . LEU C 2 59 ? 9.716   -8.884  5.080   1.00 0.00 ? 59  LEU A H      1  
ATOM   1678  H HA     . LEU C 2 59 ? 9.785   -7.849  7.881   1.00 0.00 ? 59  LEU A HA     1  
ATOM   1679  H HB2    . LEU C 2 59 ? 8.131   -6.785  5.565   1.00 0.00 ? 59  LEU A HB2    1  
ATOM   1680  H HB3    . LEU C 2 59 ? 8.015   -6.228  7.236   1.00 0.00 ? 59  LEU A HB3    1  
ATOM   1681  H HG     . LEU C 2 59 ? 10.541  -6.117  5.561   1.00 0.00 ? 59  LEU A HG     1  
ATOM   1682  H HD11   . LEU C 2 59 ? 9.659   -3.529  6.215   1.00 0.00 ? 59  LEU A HD11   1  
ATOM   1683  H HD12   . LEU C 2 59 ? 8.221   -4.382  5.655   1.00 0.00 ? 59  LEU A HD12   1  
ATOM   1684  H HD13   . LEU C 2 59 ? 9.645   -4.281  4.620   1.00 0.00 ? 59  LEU A HD13   1  
ATOM   1685  H HD21   . LEU C 2 59 ? 10.084  -5.953  8.365   1.00 0.00 ? 59  LEU A HD21   1  
ATOM   1686  H HD22   . LEU C 2 59 ? 10.437  -4.318  7.809   1.00 0.00 ? 59  LEU A HD22   1  
ATOM   1687  H HD23   . LEU C 2 59 ? 11.583  -5.621  7.498   1.00 0.00 ? 59  LEU A HD23   1  
ATOM   1688  N N      . THR C 2 60 ? 8.387   -10.168 7.628   1.00 0.00 ? 60  THR A N      1  
ATOM   1689  C CA     . THR C 2 60 ? 7.319   -11.182 7.866   1.00 0.00 ? 60  THR A CA     1  
ATOM   1690  C C      . THR C 2 60 ? 6.533   -10.839 9.136   1.00 0.00 ? 60  THR A C      1  
ATOM   1691  O O      . THR C 2 60 ? 5.415   -11.280 9.321   1.00 0.00 ? 60  THR A O      1  
ATOM   1692  C CB     . THR C 2 60 ? 8.055   -12.515 8.034   1.00 0.00 ? 60  THR A CB     1  
ATOM   1693  O OG1    . THR C 2 60 ? 9.304   -12.462 7.356   1.00 0.00 ? 60  THR A OG1    1  
ATOM   1694  C CG2    . THR C 2 60 ? 7.206   -13.644 7.450   1.00 0.00 ? 60  THR A CG2    1  
ATOM   1695  H H      . THR C 2 60 ? 9.326   -10.398 7.789   1.00 0.00 ? 60  THR A H      1  
ATOM   1696  H HA     . THR C 2 60 ? 6.655   -11.234 7.017   1.00 0.00 ? 60  THR A HA     1  
ATOM   1697  H HB     . THR C 2 60 ? 8.223   -12.704 9.084   1.00 0.00 ? 60  THR A HB     1  
ATOM   1698  H HG1    . THR C 2 60 ? 9.138   -12.188 6.452   1.00 0.00 ? 60  THR A HG1    1  
ATOM   1699  H HG21   . THR C 2 60 ? 6.256   -13.681 7.962   1.00 0.00 ? 60  THR A HG21   1  
ATOM   1700  H HG22   . THR C 2 60 ? 7.721   -14.585 7.576   1.00 0.00 ? 60  THR A HG22   1  
ATOM   1701  H HG23   . THR C 2 60 ? 7.040   -13.462 6.398   1.00 0.00 ? 60  THR A HG23   1  
ATOM   1702  N N      . LEU C 2 61 ? 7.107   -10.056 10.012  1.00 0.00 ? 61  LEU A N      1  
ATOM   1703  C CA     . LEU C 2 61 ? 6.391   -9.688  11.268  1.00 0.00 ? 61  LEU A CA     1  
ATOM   1704  C C      . LEU C 2 61 ? 5.672   -8.344  11.107  1.00 0.00 ? 61  LEU A C      1  
ATOM   1705  O O      . LEU C 2 61 ? 5.234   -7.749  12.073  1.00 0.00 ? 61  LEU A O      1  
ATOM   1706  C CB     . LEU C 2 61 ? 7.485   -9.583  12.330  1.00 0.00 ? 61  LEU A CB     1  
ATOM   1707  C CG     . LEU C 2 61 ? 7.943   -10.987 12.729  1.00 0.00 ? 61  LEU A CG     1  
ATOM   1708  C CD1    . LEU C 2 61 ? 9.379   -10.928 13.253  1.00 0.00 ? 61  LEU A CD1    1  
ATOM   1709  C CD2    . LEU C 2 61 ? 7.022   -11.530 13.826  1.00 0.00 ? 61  LEU A CD2    1  
ATOM   1710  H H      . LEU C 2 61 ? 8.009   -9.711  9.844   1.00 0.00 ? 61  LEU A H      1  
ATOM   1711  H HA     . LEU C 2 61 ? 5.689   -10.459 11.541  1.00 0.00 ? 61  LEU A HA     1  
ATOM   1712  H HB2    . LEU C 2 61 ? 8.323   -9.030  11.929  1.00 0.00 ? 61  LEU A HB2    1  
ATOM   1713  H HB3    . LEU C 2 61 ? 7.097   -9.071  13.198  1.00 0.00 ? 61  LEU A HB3    1  
ATOM   1714  H HG     . LEU C 2 61 ? 7.901   -11.638 11.867  1.00 0.00 ? 61  LEU A HG     1  
ATOM   1715  H HD11   . LEU C 2 61 ? 9.553   -11.760 13.921  1.00 0.00 ? 61  LEU A HD11   1  
ATOM   1716  H HD12   . LEU C 2 61 ? 9.529   -10.001 13.786  1.00 0.00 ? 61  LEU A HD12   1  
ATOM   1717  H HD13   . LEU C 2 61 ? 10.067  -10.982 12.423  1.00 0.00 ? 61  LEU A HD13   1  
ATOM   1718  H HD21   . LEU C 2 61 ? 7.566   -12.236 14.436  1.00 0.00 ? 61  LEU A HD21   1  
ATOM   1719  H HD22   . LEU C 2 61 ? 6.175   -12.023 13.373  1.00 0.00 ? 61  LEU A HD22   1  
ATOM   1720  H HD23   . LEU C 2 61 ? 6.676   -10.713 14.442  1.00 0.00 ? 61  LEU A HD23   1  
ATOM   1721  N N      . PHE C 2 62 ? 5.543   -7.862  9.899   1.00 0.00 ? 62  PHE A N      1  
ATOM   1722  C CA     . PHE C 2 62 ? 4.847   -6.559  9.686   1.00 0.00 ? 62  PHE A CA     1  
ATOM   1723  C C      . PHE C 2 62 ? 3.396   -6.802  9.262   1.00 0.00 ? 62  PHE A C      1  
ATOM   1724  O O      . PHE C 2 62 ? 3.125   -7.568  8.358   1.00 0.00 ? 62  PHE A O      1  
ATOM   1725  C CB     . PHE C 2 62 ? 5.628   -5.865  8.566   1.00 0.00 ? 62  PHE A CB     1  
ATOM   1726  C CG     . PHE C 2 62 ? 4.912   -4.597  8.159   1.00 0.00 ? 62  PHE A CG     1  
ATOM   1727  C CD1    . PHE C 2 62 ? 3.901   -4.647  7.192   1.00 0.00 ? 62  PHE A CD1    1  
ATOM   1728  C CD2    . PHE C 2 62 ? 5.258   -3.375  8.747   1.00 0.00 ? 62  PHE A CD2    1  
ATOM   1729  C CE1    . PHE C 2 62 ? 3.235   -3.476  6.814   1.00 0.00 ? 62  PHE A CE1    1  
ATOM   1730  C CE2    . PHE C 2 62 ? 4.591   -2.202  8.369   1.00 0.00 ? 62  PHE A CE2    1  
ATOM   1731  C CZ     . PHE C 2 62 ? 3.580   -2.253  7.401   1.00 0.00 ? 62  PHE A CZ     1  
ATOM   1732  H H      . PHE C 2 62 ? 5.898   -8.356  9.132   1.00 0.00 ? 62  PHE A H      1  
ATOM   1733  H HA     . PHE C 2 62 ? 4.882   -5.962  10.585  1.00 0.00 ? 62  PHE A HA     1  
ATOM   1734  H HB2    . PHE C 2 62 ? 6.620   -5.622  8.918   1.00 0.00 ? 62  PHE A HB2    1  
ATOM   1735  H HB3    . PHE C 2 62 ? 5.699   -6.526  7.716   1.00 0.00 ? 62  PHE A HB3    1  
ATOM   1736  H HD1    . PHE C 2 62 ? 3.634   -5.590  6.739   1.00 0.00 ? 62  PHE A HD1    1  
ATOM   1737  H HD2    . PHE C 2 62 ? 6.036   -3.336  9.495   1.00 0.00 ? 62  PHE A HD2    1  
ATOM   1738  H HE1    . PHE C 2 62 ? 2.454   -3.515  6.068   1.00 0.00 ? 62  PHE A HE1    1  
ATOM   1739  H HE2    . PHE C 2 62 ? 4.856   -1.258  8.821   1.00 0.00 ? 62  PHE A HE2    1  
ATOM   1740  H HZ     . PHE C 2 62 ? 3.066   -1.349  7.109   1.00 0.00 ? 62  PHE A HZ     1  
ATOM   1741  N N      . ASP C 2 63 ? 2.466   -6.155  9.908   1.00 0.00 ? 63  ASP A N      1  
ATOM   1742  C CA     . ASP C 2 63 ? 1.032   -6.346  9.543   1.00 0.00 ? 63  ASP A CA     1  
ATOM   1743  C C      . ASP C 2 63 ? 0.630   -5.364  8.438   1.00 0.00 ? 63  ASP A C      1  
ATOM   1744  O O      . ASP C 2 63 ? 0.712   -4.163  8.602   1.00 0.00 ? 63  ASP A O      1  
ATOM   1745  C CB     . ASP C 2 63 ? 0.255   -6.056  10.826  1.00 0.00 ? 63  ASP A CB     1  
ATOM   1746  C CG     . ASP C 2 63 ? 0.141   -7.337  11.653  1.00 0.00 ? 63  ASP A CG     1  
ATOM   1747  O OD1    . ASP C 2 63 ? -0.246  -8.349  11.092  1.00 0.00 ? 63  ASP A OD1    1  
ATOM   1748  O OD2    . ASP C 2 63 ? 0.444   -7.285  12.834  1.00 0.00 ? 63  ASP A OD2    1  
ATOM   1749  H H      . ASP C 2 63 ? 2.710   -5.542  10.634  1.00 0.00 ? 63  ASP A H      1  
ATOM   1750  H HA     . ASP C 2 63 ? 0.856   -7.361  9.227   1.00 0.00 ? 63  ASP A HA     1  
ATOM   1751  H HB2    . ASP C 2 63 ? 0.774   -5.301  11.399  1.00 0.00 ? 63  ASP A HB2    1  
ATOM   1752  H HB3    . ASP C 2 63 ? -0.734  -5.703  10.576  1.00 0.00 ? 63  ASP A HB3    1  
ATOM   1753  N N      . PHE C 2 64 ? 0.195   -5.869  7.315   1.00 0.00 ? 64  PHE A N      1  
ATOM   1754  C CA     . PHE C 2 64 ? -0.217  -4.969  6.197   1.00 0.00 ? 64  PHE A CA     1  
ATOM   1755  C C      . PHE C 2 64 ? -1.553  -4.292  6.533   1.00 0.00 ? 64  PHE A C      1  
ATOM   1756  O O      . PHE C 2 64 ? -1.854  -3.221  6.044   1.00 0.00 ? 64  PHE A O      1  
ATOM   1757  C CB     . PHE C 2 64 ? -0.359  -5.895  4.981   1.00 0.00 ? 64  PHE A CB     1  
ATOM   1758  C CG     . PHE C 2 64 ? -1.116  -5.195  3.874   1.00 0.00 ? 64  PHE A CG     1  
ATOM   1759  C CD1    . PHE C 2 64 ? -2.516  -5.209  3.868   1.00 0.00 ? 64  PHE A CD1    1  
ATOM   1760  C CD2    . PHE C 2 64 ? -0.419  -4.533  2.855   1.00 0.00 ? 64  PHE A CD2    1  
ATOM   1761  C CE1    . PHE C 2 64 ? -3.219  -4.564  2.845   1.00 0.00 ? 64  PHE A CE1    1  
ATOM   1762  C CE2    . PHE C 2 64 ? -1.123  -3.887  1.831   1.00 0.00 ? 64  PHE A CE2    1  
ATOM   1763  C CZ     . PHE C 2 64 ? -2.523  -3.902  1.827   1.00 0.00 ? 64  PHE A CZ     1  
ATOM   1764  H H      . PHE C 2 64 ? 0.137   -6.842  7.206   1.00 0.00 ? 64  PHE A H      1  
ATOM   1765  H HA     . PHE C 2 64 ? 0.544   -4.229  6.009   1.00 0.00 ? 64  PHE A HA     1  
ATOM   1766  H HB2    . PHE C 2 64 ? 0.622   -6.171  4.625   1.00 0.00 ? 64  PHE A HB2    1  
ATOM   1767  H HB3    . PHE C 2 64 ? -0.896  -6.786  5.273   1.00 0.00 ? 64  PHE A HB3    1  
ATOM   1768  H HD1    . PHE C 2 64 ? -3.054  -5.718  4.654   1.00 0.00 ? 64  PHE A HD1    1  
ATOM   1769  H HD2    . PHE C 2 64 ? 0.661   -4.521  2.858   1.00 0.00 ? 64  PHE A HD2    1  
ATOM   1770  H HE1    . PHE C 2 64 ? -4.299  -4.574  2.841   1.00 0.00 ? 64  PHE A HE1    1  
ATOM   1771  H HE2    . PHE C 2 64 ? -0.587  -3.377  1.046   1.00 0.00 ? 64  PHE A HE2    1  
ATOM   1772  H HZ     . PHE C 2 64 ? -3.066  -3.404  1.037   1.00 0.00 ? 64  PHE A HZ     1  
ATOM   1773  N N      . LYS C 2 65 ? -2.356  -4.913  7.356   1.00 0.00 ? 65  LYS A N      1  
ATOM   1774  C CA     . LYS C 2 65 ? -3.673  -4.308  7.714   1.00 0.00 ? 65  LYS A CA     1  
ATOM   1775  C C      . LYS C 2 65 ? -3.546  -3.413  8.953   1.00 0.00 ? 65  LYS A C      1  
ATOM   1776  O O      . LYS C 2 65 ? -4.449  -2.667  9.279   1.00 0.00 ? 65  LYS A O      1  
ATOM   1777  C CB     . LYS C 2 65 ? -4.587  -5.501  8.006   1.00 0.00 ? 65  LYS A CB     1  
ATOM   1778  C CG     . LYS C 2 65 ? -5.935  -5.297  7.310   1.00 0.00 ? 65  LYS A CG     1  
ATOM   1779  C CD     . LYS C 2 65 ? -5.751  -5.411  5.795   1.00 0.00 ? 65  LYS A CD     1  
ATOM   1780  C CE     . LYS C 2 65 ? -7.122  -5.478  5.118   1.00 0.00 ? 65  LYS A CE     1  
ATOM   1781  N NZ     . LYS C 2 65 ? -6.960  -6.467  4.016   1.00 0.00 ? 65  LYS A NZ     1  
ATOM   1782  H H      . LYS C 2 65 ? -2.096  -5.779  7.734   1.00 0.00 ? 65  LYS A H      1  
ATOM   1783  H HA     . LYS C 2 65 ? -4.064  -3.743  6.883   1.00 0.00 ? 65  LYS A HA     1  
ATOM   1784  H HB2    . LYS C 2 65 ? -4.126  -6.407  7.640   1.00 0.00 ? 65  LYS A HB2    1  
ATOM   1785  H HB3    . LYS C 2 65 ? -4.744  -5.582  9.071   1.00 0.00 ? 65  LYS A HB3    1  
ATOM   1786  H HG2    . LYS C 2 65 ? -6.631  -6.050  7.647   1.00 0.00 ? 65  LYS A HG2    1  
ATOM   1787  H HG3    . LYS C 2 65 ? -6.319  -4.317  7.550   1.00 0.00 ? 65  LYS A HG3    1  
ATOM   1788  H HD2    . LYS C 2 65 ? -5.210  -4.548  5.432   1.00 0.00 ? 65  LYS A HD2    1  
ATOM   1789  H HD3    . LYS C 2 65 ? -5.194  -6.308  5.566   1.00 0.00 ? 65  LYS A HD3    1  
ATOM   1790  H HE2    . LYS C 2 65 ? -7.871  -5.813  5.822   1.00 0.00 ? 65  LYS A HE2    1  
ATOM   1791  H HE3    . LYS C 2 65 ? -7.389  -4.514  4.713   1.00 0.00 ? 65  LYS A HE3    1  
ATOM   1792  H HZ1    . LYS C 2 65 ? -6.511  -7.328  4.386   1.00 0.00 ? 65  LYS A HZ1    1  
ATOM   1793  H HZ2    . LYS C 2 65 ? -7.895  -6.704  3.624   1.00 0.00 ? 65  LYS A HZ2    1  
ATOM   1794  H HZ3    . LYS C 2 65 ? -6.363  -6.061  3.270   1.00 0.00 ? 65  LYS A HZ3    1  
ATOM   1795  N N      . GLN C 2 66 ? -2.441  -3.482  9.650   1.00 0.00 ? 66  GLN A N      1  
ATOM   1796  C CA     . GLN C 2 66 ? -2.276  -2.632  10.867  1.00 0.00 ? 66  GLN A CA     1  
ATOM   1797  C C      . GLN C 2 66 ? -1.025  -1.756  10.748  1.00 0.00 ? 66  GLN A C      1  
ATOM   1798  O O      . GLN C 2 66 ? -1.031  -0.600  11.123  1.00 0.00 ? 66  GLN A O      1  
ATOM   1799  C CB     . GLN C 2 66 ? -2.125  -3.624  12.023  1.00 0.00 ? 66  GLN A CB     1  
ATOM   1800  C CG     . GLN C 2 66 ? -3.393  -4.478  12.137  1.00 0.00 ? 66  GLN A CG     1  
ATOM   1801  C CD     . GLN C 2 66 ? -4.132  -4.131  13.432  1.00 0.00 ? 66  GLN A CD     1  
ATOM   1802  O OE1    . GLN C 2 66 ? -4.123  -4.898  14.374  1.00 0.00 ? 66  GLN A OE1    1  
ATOM   1803  N NE2    . GLN C 2 66 ? -4.774  -2.998  13.518  1.00 0.00 ? 66  GLN A NE2    1  
ATOM   1804  H H      . GLN C 2 66 ? -1.724  -4.091  9.377   1.00 0.00 ? 66  GLN A H      1  
ATOM   1805  H HA     . GLN C 2 66 ? -3.151  -2.020  11.021  1.00 0.00 ? 66  GLN A HA     1  
ATOM   1806  H HB2    . GLN C 2 66 ? -1.275  -4.265  11.837  1.00 0.00 ? 66  GLN A HB2    1  
ATOM   1807  H HB3    . GLN C 2 66 ? -1.973  -3.082  12.944  1.00 0.00 ? 66  GLN A HB3    1  
ATOM   1808  H HG2    . GLN C 2 66 ? -4.038  -4.281  11.292  1.00 0.00 ? 66  GLN A HG2    1  
ATOM   1809  H HG3    . GLN C 2 66 ? -3.123  -5.522  12.149  1.00 0.00 ? 66  GLN A HG3    1  
ATOM   1810  H HE21   . GLN C 2 66 ? -4.782  -2.380  12.758  1.00 0.00 ? 66  GLN A HE21   1  
ATOM   1811  H HE22   . GLN C 2 66 ? -5.250  -2.766  14.343  1.00 0.00 ? 66  GLN A HE22   1  
ATOM   1812  N N      . GLY C 2 67 ? 0.044   -2.298  10.232  1.00 0.00 ? 67  GLY A N      1  
ATOM   1813  C CA     . GLY C 2 67 ? 1.295   -1.499  10.092  1.00 0.00 ? 67  GLY A CA     1  
ATOM   1814  C C      . GLY C 2 67 ? 2.049   -1.500  11.424  1.00 0.00 ? 67  GLY A C      1  
ATOM   1815  O O      . GLY C 2 67 ? 2.340   -0.461  11.984  1.00 0.00 ? 67  GLY A O      1  
ATOM   1816  H H      . GLY C 2 67 ? 0.027   -3.233  9.939   1.00 0.00 ? 67  GLY A H      1  
ATOM   1817  H HA2    . GLY C 2 67 ? 1.917   -1.934  9.323   1.00 0.00 ? 67  GLY A HA2    1  
ATOM   1818  H HA3    . GLY C 2 67 ? 1.046   -0.483  9.825   1.00 0.00 ? 67  GLY A HA3    1  
ATOM   1819  N N      . ILE C 2 68 ? 2.366   -2.661  11.934  1.00 0.00 ? 68  ILE A N      1  
ATOM   1820  C CA     . ILE C 2 68 ? 3.100   -2.733  13.234  1.00 0.00 ? 68  ILE A CA     1  
ATOM   1821  C C      . ILE C 2 68 ? 3.892   -4.037  13.330  1.00 0.00 ? 68  ILE A C      1  
ATOM   1822  O O      . ILE C 2 68 ? 3.512   -5.049  12.776  1.00 0.00 ? 68  ILE A O      1  
ATOM   1823  C CB     . ILE C 2 68 ? 2.026   -2.691  14.327  1.00 0.00 ? 68  ILE A CB     1  
ATOM   1824  C CG1    . ILE C 2 68 ? 0.777   -3.455  13.871  1.00 0.00 ? 68  ILE A CG1    1  
ATOM   1825  C CG2    . ILE C 2 68 ? 1.655   -1.237  14.620  1.00 0.00 ? 68  ILE A CG2    1  
ATOM   1826  C CD1    . ILE C 2 68 ? -0.210  -3.560  15.036  1.00 0.00 ? 68  ILE A CD1    1  
ATOM   1827  H H      . ILE C 2 68 ? 2.119   -3.485  11.467  1.00 0.00 ? 68  ILE A H      1  
ATOM   1828  H HA     . ILE C 2 68 ? 3.759   -1.886  13.339  1.00 0.00 ? 68  ILE A HA     1  
ATOM   1829  H HB     . ILE C 2 68 ? 2.419   -3.150  15.224  1.00 0.00 ? 68  ILE A HB     1  
ATOM   1830  H HG12   . ILE C 2 68 ? 0.312   -2.928  13.050  1.00 0.00 ? 68  ILE A HG12   1  
ATOM   1831  H HG13   . ILE C 2 68 ? 1.058   -4.446  13.550  1.00 0.00 ? 68  ILE A HG13   1  
ATOM   1832  H HG21   . ILE C 2 68 ? 2.554   -0.643  14.691  1.00 0.00 ? 68  ILE A HG21   1  
ATOM   1833  H HG22   . ILE C 2 68 ? 1.114   -1.185  15.554  1.00 0.00 ? 68  ILE A HG22   1  
ATOM   1834  H HG23   . ILE C 2 68 ? 1.033   -0.856  13.823  1.00 0.00 ? 68  ILE A HG23   1  
ATOM   1835  H HD11   . ILE C 2 68 ? -0.362  -2.582  15.468  1.00 0.00 ? 68  ILE A HD11   1  
ATOM   1836  H HD12   . ILE C 2 68 ? 0.187   -4.227  15.785  1.00 0.00 ? 68  ILE A HD12   1  
ATOM   1837  H HD13   . ILE C 2 68 ? -1.153  -3.944  14.674  1.00 0.00 ? 68  ILE A HD13   1  
ATOM   1838  N N      . LEU C 2 69 ? 4.986   -4.019  14.043  1.00 0.00 ? 69  LEU A N      1  
ATOM   1839  C CA     . LEU C 2 69 ? 5.802   -5.257  14.191  1.00 0.00 ? 69  LEU A CA     1  
ATOM   1840  C C      . LEU C 2 69 ? 5.380   -6.001  15.460  1.00 0.00 ? 69  LEU A C      1  
ATOM   1841  O O      . LEU C 2 69 ? 5.981   -5.852  16.506  1.00 0.00 ? 69  LEU A O      1  
ATOM   1842  C CB     . LEU C 2 69 ? 7.249   -4.774  14.310  1.00 0.00 ? 69  LEU A CB     1  
ATOM   1843  C CG     . LEU C 2 69 ? 7.915   -4.757  12.931  1.00 0.00 ? 69  LEU A CG     1  
ATOM   1844  C CD1    . LEU C 2 69 ? 9.363   -4.286  13.076  1.00 0.00 ? 69  LEU A CD1    1  
ATOM   1845  C CD2    . LEU C 2 69 ? 7.899   -6.165  12.323  1.00 0.00 ? 69  LEU A CD2    1  
ATOM   1846  H H      . LEU C 2 69 ? 5.267   -3.192  14.487  1.00 0.00 ? 69  LEU A H      1  
ATOM   1847  H HA     . LEU C 2 69 ? 5.688   -5.889  13.324  1.00 0.00 ? 69  LEU A HA     1  
ATOM   1848  H HB2    . LEU C 2 69 ? 7.259   -3.775  14.724  1.00 0.00 ? 69  LEU A HB2    1  
ATOM   1849  H HB3    . LEU C 2 69 ? 7.797   -5.437  14.963  1.00 0.00 ? 69  LEU A HB3    1  
ATOM   1850  H HG     . LEU C 2 69 ? 7.379   -4.077  12.284  1.00 0.00 ? 69  LEU A HG     1  
ATOM   1851  H HD11   . LEU C 2 69 ? 9.883   -4.928  13.772  1.00 0.00 ? 69  LEU A HD11   1  
ATOM   1852  H HD12   . LEU C 2 69 ? 9.376   -3.270  13.445  1.00 0.00 ? 69  LEU A HD12   1  
ATOM   1853  H HD13   . LEU C 2 69 ? 9.853   -4.325  12.114  1.00 0.00 ? 69  LEU A HD13   1  
ATOM   1854  H HD21   . LEU C 2 69 ? 7.398   -6.845  12.997  1.00 0.00 ? 69  LEU A HD21   1  
ATOM   1855  H HD22   . LEU C 2 69 ? 8.911   -6.501  12.161  1.00 0.00 ? 69  LEU A HD22   1  
ATOM   1856  H HD23   . LEU C 2 69 ? 7.373   -6.141  11.380  1.00 0.00 ? 69  LEU A HD23   1  
ATOM   1857  N N      . CYS C 2 70 ? 4.339   -6.788  15.374  1.00 0.00 ? 70  CYS A N      1  
ATOM   1858  C CA     . CYS C 2 70 ? 3.849   -7.545  16.571  1.00 0.00 ? 70  CYS A CA     1  
ATOM   1859  C C      . CYS C 2 70 ? 5.017   -8.157  17.358  1.00 0.00 ? 70  CYS A C      1  
ATOM   1860  O O      . CYS C 2 70 ? 5.070   -8.071  18.569  1.00 0.00 ? 70  CYS A O      1  
ATOM   1861  C CB     . CYS C 2 70 ? 2.957   -8.649  16.000  1.00 0.00 ? 70  CYS A CB     1  
ATOM   1862  S SG     . CYS C 2 70 ? 1.481   -8.834  17.033  1.00 0.00 ? 70  CYS A SG     1  
ATOM   1863  H H      . CYS C 2 70 ? 3.870   -6.875  14.519  1.00 0.00 ? 70  CYS A H      1  
ATOM   1864  H HA     . CYS C 2 70 ? 3.268   -6.899  17.209  1.00 0.00 ? 70  CYS A HA     1  
ATOM   1865  H HB2    . CYS C 2 70 ? 2.661   -8.388  14.995  1.00 0.00 ? 70  CYS A HB2    1  
ATOM   1866  H HB3    . CYS C 2 70 ? 3.503   -9.581  15.984  1.00 0.00 ? 70  CYS A HB3    1  
ATOM   1867  H HG     . CYS C 2 70 ? 1.768   -8.968  17.939  1.00 0.00 ? 70  CYS A HG     1  
ATOM   1868  N N      . TYR C 2 71 ? 5.951   -8.770  16.680  1.00 0.00 ? 71  TYR A N      1  
ATOM   1869  C CA     . TYR C 2 71 ? 7.110   -9.380  17.394  1.00 0.00 ? 71  TYR A CA     1  
ATOM   1870  C C      . TYR C 2 71 ? 8.428   -8.838  16.825  1.00 0.00 ? 71  TYR A C      1  
ATOM   1871  O O      . TYR C 2 71 ? 8.617   -8.817  15.625  1.00 0.00 ? 71  TYR A O      1  
ATOM   1872  C CB     . TYR C 2 71 ? 6.992   -10.882 17.135  1.00 0.00 ? 71  TYR A CB     1  
ATOM   1873  C CG     . TYR C 2 71 ? 7.549   -11.642 18.316  1.00 0.00 ? 71  TYR A CG     1  
ATOM   1874  C CD1    . TYR C 2 71 ? 8.933   -11.718 18.508  1.00 0.00 ? 71  TYR A CD1    1  
ATOM   1875  C CD2    . TYR C 2 71 ? 6.681   -12.269 19.218  1.00 0.00 ? 71  TYR A CD2    1  
ATOM   1876  C CE1    . TYR C 2 71 ? 9.450   -12.420 19.604  1.00 0.00 ? 71  TYR A CE1    1  
ATOM   1877  C CE2    . TYR C 2 71 ? 7.197   -12.972 20.312  1.00 0.00 ? 71  TYR A CE2    1  
ATOM   1878  C CZ     . TYR C 2 71 ? 8.582   -13.048 20.505  1.00 0.00 ? 71  TYR A CZ     1  
ATOM   1879  O OH     . TYR C 2 71 ? 9.092   -13.741 21.586  1.00 0.00 ? 71  TYR A OH     1  
ATOM   1880  H H      . TYR C 2 71 ? 5.890   -8.828  15.703  1.00 0.00 ? 71  TYR A H      1  
ATOM   1881  H HA     . TYR C 2 71 ? 7.044   -9.184  18.452  1.00 0.00 ? 71  TYR A HA     1  
ATOM   1882  H HB2    . TYR C 2 71 ? 5.953   -11.143 16.995  1.00 0.00 ? 71  TYR A HB2    1  
ATOM   1883  H HB3    . TYR C 2 71 ? 7.550   -11.139 16.247  1.00 0.00 ? 71  TYR A HB3    1  
ATOM   1884  H HD1    . TYR C 2 71 ? 9.603   -11.233 17.813  1.00 0.00 ? 71  TYR A HD1    1  
ATOM   1885  H HD2    . TYR C 2 71 ? 5.613   -12.211 19.069  1.00 0.00 ? 71  TYR A HD2    1  
ATOM   1886  H HE1    . TYR C 2 71 ? 10.518  -12.479 19.753  1.00 0.00 ? 71  TYR A HE1    1  
ATOM   1887  H HE2    . TYR C 2 71 ? 6.528   -13.456 21.008  1.00 0.00 ? 71  TYR A HE2    1  
ATOM   1888  H HH     . TYR C 2 71 ? 9.284   -13.107 22.280  1.00 0.00 ? 71  TYR A HH     1  
ATOM   1889  N N      . PRO C 2 72 ? 9.304   -8.412  17.705  1.00 0.00 ? 72  PRO A N      1  
ATOM   1890  C CA     . PRO C 2 72 ? 10.611  -7.865  17.265  1.00 0.00 ? 72  PRO A CA     1  
ATOM   1891  C C      . PRO C 2 72 ? 11.532  -8.992  16.775  1.00 0.00 ? 72  PRO A C      1  
ATOM   1892  O O      . PRO C 2 72 ? 11.617  -9.259  15.592  1.00 0.00 ? 72  PRO A O      1  
ATOM   1893  C CB     . PRO C 2 72 ? 11.164  -7.196  18.522  1.00 0.00 ? 72  PRO A CB     1  
ATOM   1894  C CG     . PRO C 2 72 ? 10.494  -7.891  19.666  1.00 0.00 ? 72  PRO A CG     1  
ATOM   1895  C CD     . PRO C 2 72 ? 9.164   -8.396  19.169  1.00 0.00 ? 72  PRO A CD     1  
ATOM   1896  H HA     . PRO C 2 72 ? 10.470  -7.130  16.489  1.00 0.00 ? 72  PRO A HA     1  
ATOM   1897  H HB2    . PRO C 2 72 ? 12.236  -7.327  18.573  1.00 0.00 ? 72  PRO A HB2    1  
ATOM   1898  H HB3    . PRO C 2 72 ? 10.912  -6.147  18.529  1.00 0.00 ? 72  PRO A HB3    1  
ATOM   1899  H HG2    . PRO C 2 72 ? 11.103  -8.718  20.003  1.00 0.00 ? 72  PRO A HG2    1  
ATOM   1900  H HG3    . PRO C 2 72 ? 10.337  -7.196  20.476  1.00 0.00 ? 72  PRO A HG3    1  
ATOM   1901  H HD2    . PRO C 2 72 ? 8.975   -9.393  19.544  1.00 0.00 ? 72  PRO A HD2    1  
ATOM   1902  H HD3    . PRO C 2 72 ? 8.372   -7.724  19.458  1.00 0.00 ? 72  PRO A HD3    1  
ATOM   1903  N N      . ALA C 2 73 ? 12.223  -9.654  17.668  1.00 0.00 ? 73  ALA A N      1  
ATOM   1904  C CA     . ALA C 2 73 ? 13.134  -10.756 17.242  1.00 0.00 ? 73  ALA A CA     1  
ATOM   1905  C C      . ALA C 2 73 ? 13.029  -11.937 18.215  1.00 0.00 ? 73  ALA A C      1  
ATOM   1906  O O      . ALA C 2 73 ? 12.681  -11.762 19.365  1.00 0.00 ? 73  ALA A O      1  
ATOM   1907  C CB     . ALA C 2 73 ? 14.536  -10.149 17.288  1.00 0.00 ? 73  ALA A CB     1  
ATOM   1908  H H      . ALA C 2 73 ? 12.144  -9.426  18.616  1.00 0.00 ? 73  ALA A H      1  
ATOM   1909  H HA     . ALA C 2 73 ? 12.900  -11.072 16.238  1.00 0.00 ? 73  ALA A HA     1  
ATOM   1910  H HB1    . ALA C 2 73 ? 14.465  -9.075  17.218  1.00 0.00 ? 73  ALA A HB1    1  
ATOM   1911  H HB2    . ALA C 2 73 ? 15.117  -10.526 16.458  1.00 0.00 ? 73  ALA A HB2    1  
ATOM   1912  H HB3    . ALA C 2 73 ? 15.017  -10.420 18.216  1.00 0.00 ? 73  ALA A HB3    1  
ATOM   1913  N N      . PRO C 2 74 ? 13.336  -13.110 17.719  1.00 0.00 ? 74  PRO A N      1  
ATOM   1914  C CA     . PRO C 2 74 ? 13.274  -14.329 18.561  1.00 0.00 ? 74  PRO A CA     1  
ATOM   1915  C C      . PRO C 2 74 ? 14.438  -14.360 19.560  1.00 0.00 ? 74  PRO A C      1  
ATOM   1916  O O      . PRO C 2 74 ? 14.271  -14.053 20.723  1.00 0.00 ? 74  PRO A O      1  
ATOM   1917  C CB     . PRO C 2 74 ? 13.374  -15.470 17.549  1.00 0.00 ? 74  PRO A CB     1  
ATOM   1918  C CG     . PRO C 2 74 ? 14.068  -14.884 16.358  1.00 0.00 ? 74  PRO A CG     1  
ATOM   1919  C CD     . PRO C 2 74 ? 13.764  -13.407 16.345  1.00 0.00 ? 74  PRO A CD     1  
ATOM   1920  H HA     . PRO C 2 74 ? 12.330  -14.382 19.079  1.00 0.00 ? 74  PRO A HA     1  
ATOM   1921  H HB2    . PRO C 2 74 ? 13.954  -16.284 17.961  1.00 0.00 ? 74  PRO A HB2    1  
ATOM   1922  H HB3    . PRO C 2 74 ? 12.390  -15.813 17.272  1.00 0.00 ? 74  PRO A HB3    1  
ATOM   1923  H HG2    . PRO C 2 74 ? 15.133  -15.044 16.435  1.00 0.00 ? 74  PRO A HG2    1  
ATOM   1924  H HG3    . PRO C 2 74 ? 13.692  -15.339 15.455  1.00 0.00 ? 74  PRO A HG3    1  
ATOM   1925  H HD2    . PRO C 2 74 ? 14.652  -12.843 16.091  1.00 0.00 ? 74  PRO A HD2    1  
ATOM   1926  H HD3    . PRO C 2 74 ? 12.966  -13.190 15.651  1.00 0.00 ? 74  PRO A HD3    1  
ATOM   1927  N N      . LYS C 2 75 ? 15.612  -14.729 19.119  1.00 0.00 ? 75  LYS A N      1  
ATOM   1928  C CA     . LYS C 2 75 ? 16.778  -14.777 20.049  1.00 0.00 ? 75  LYS A CA     1  
ATOM   1929  C C      . LYS C 2 75 ? 17.983  -14.069 19.424  1.00 0.00 ? 75  LYS A C      1  
ATOM   1930  O O      . LYS C 2 75 ? 18.577  -14.638 18.522  1.00 0.00 ? 75  LYS A O      1  
ATOM   1931  C CB     . LYS C 2 75 ? 17.069  -16.266 20.241  1.00 0.00 ? 75  LYS A CB     1  
ATOM   1932  C CG     . LYS C 2 75 ? 17.912  -16.464 21.502  1.00 0.00 ? 75  LYS A CG     1  
ATOM   1933  C CD     . LYS C 2 75 ? 18.424  -17.905 21.554  1.00 0.00 ? 75  LYS A CD     1  
ATOM   1934  C CE     . LYS C 2 75 ? 18.505  -18.367 23.010  1.00 0.00 ? 75  LYS A CE     1  
ATOM   1935  N NZ     . LYS C 2 75 ? 19.302  -19.624 22.972  1.00 0.00 ? 75  LYS A NZ     1  
ATOM   1936  O OXT    . LYS C 2 75 ? 18.291  -12.971 19.857  1.00 0.00 ? 75  LYS A OXT    1  
ATOM   1937  H H      . LYS C 2 75 ? 15.729  -14.973 18.180  1.00 0.00 ? 75  LYS A H      1  
ATOM   1938  H HA     . LYS C 2 75 ? 16.524  -14.325 20.996  1.00 0.00 ? 75  LYS A HA     1  
ATOM   1939  H HB2    . LYS C 2 75 ? 16.138  -16.804 20.341  1.00 0.00 ? 75  LYS A HB2    1  
ATOM   1940  H HB3    . LYS C 2 75 ? 17.611  -16.640 19.386  1.00 0.00 ? 75  LYS A HB3    1  
ATOM   1941  H HG2    . LYS C 2 75 ? 18.751  -15.784 21.484  1.00 0.00 ? 75  LYS A HG2    1  
ATOM   1942  H HG3    . LYS C 2 75 ? 17.307  -16.268 22.375  1.00 0.00 ? 75  LYS A HG3    1  
ATOM   1943  H HD2    . LYS C 2 75 ? 17.748  -18.547 21.007  1.00 0.00 ? 75  LYS A HD2    1  
ATOM   1944  H HD3    . LYS C 2 75 ? 19.406  -17.955 21.108  1.00 0.00 ? 75  LYS A HD3    1  
ATOM   1945  H HE2    . LYS C 2 75 ? 19.003  -17.620 23.613  1.00 0.00 ? 75  LYS A HE2    1  
ATOM   1946  H HE3    . LYS C 2 75 ? 17.517  -18.567 23.396  1.00 0.00 ? 75  LYS A HE3    1  
ATOM   1947  H HZ1    . LYS C 2 75 ? 19.400  -20.003 23.935  1.00 0.00 ? 75  LYS A HZ1    1  
ATOM   1948  H HZ2    . LYS C 2 75 ? 18.818  -20.324 22.372  1.00 0.00 ? 75  LYS A HZ2    1  
ATOM   1949  H HZ3    . LYS C 2 75 ? 20.245  -19.425 22.583  1.00 0.00 ? 75  LYS A HZ3    1  
ATOM   1950  O "O5'"  . DG  A 1 1  ? 0.454   21.985  -12.205 1.00 0.00 ? 101 DG  B "O5'"  2  
ATOM   1951  C "C5'"  . DG  A 1 1  ? 0.839   22.710  -11.034 1.00 0.00 ? 101 DG  B "C5'"  2  
ATOM   1952  C "C4'"  . DG  A 1 1  ? 0.305   22.049  -9.767  1.00 0.00 ? 101 DG  B "C4'"  2  
ATOM   1953  O "O4'"  . DG  A 1 1  ? -1.095  21.738  -9.907  1.00 0.00 ? 101 DG  B "O4'"  2  
ATOM   1954  C "C3'"  . DG  A 1 1  ? 1.056   20.760  -9.471  1.00 0.00 ? 101 DG  B "C3'"  2  
ATOM   1955  O "O3'"  . DG  A 1 1  ? 1.820   20.883  -8.266  1.00 0.00 ? 101 DG  B "O3'"  2  
ATOM   1956  C "C2'"  . DG  A 1 1  ? 0.002   19.690  -9.338  1.00 0.00 ? 101 DG  B "C2'"  2  
ATOM   1957  C "C1'"  . DG  A 1 1  ? -1.341  20.376  -9.516  1.00 0.00 ? 101 DG  B "C1'"  2  
ATOM   1958  N N9     . DG  A 1 1  ? -2.170  19.686  -10.520 1.00 0.00 ? 101 DG  B N9     2  
ATOM   1959  C C8     . DG  A 1 1  ? -1.795  18.939  -11.583 1.00 0.00 ? 101 DG  B C8     2  
ATOM   1960  N N7     . DG  A 1 1  ? -2.727  18.448  -12.330 1.00 0.00 ? 101 DG  B N7     2  
ATOM   1961  C C5     . DG  A 1 1  ? -3.879  18.919  -11.693 1.00 0.00 ? 101 DG  B C5     2  
ATOM   1962  C C6     . DG  A 1 1  ? -5.247  18.727  -12.025 1.00 0.00 ? 101 DG  B C6     2  
ATOM   1963  O O6     . DG  A 1 1  ? -5.716  18.098  -12.953 1.00 0.00 ? 101 DG  B O6     2  
ATOM   1964  N N1     . DG  A 1 1  ? -6.086  19.372  -11.124 1.00 0.00 ? 101 DG  B N1     2  
ATOM   1965  C C2     . DG  A 1 1  ? -5.665  20.113  -10.038 1.00 0.00 ? 101 DG  B C2     2  
ATOM   1966  N N2     . DG  A 1 1  ? -6.624  20.656  -9.287  1.00 0.00 ? 101 DG  B N2     2  
ATOM   1967  N N3     . DG  A 1 1  ? -4.381  20.299  -9.720  1.00 0.00 ? 101 DG  B N3     2  
ATOM   1968  C C4     . DG  A 1 1  ? -3.545  19.679  -10.583 1.00 0.00 ? 101 DG  B C4     2  
ATOM   1969  H "H5'"  . DG  A 1 1  ? 0.447   23.725  -11.098 1.00 0.00 ? 101 DG  B "H5'"  2  
ATOM   1970  H "H5''" . DG  A 1 1  ? 1.927   22.750  -10.982 1.00 0.00 ? 101 DG  B "H5''" 2  
ATOM   1971  H "H4'"  . DG  A 1 1  ? 0.427   22.730  -8.927  1.00 0.00 ? 101 DG  B "H4'"  2  
ATOM   1972  H "H3'"  . DG  A 1 1  ? 1.715   20.521  -10.308 1.00 0.00 ? 101 DG  B "H3'"  2  
ATOM   1973  H "H2'"  . DG  A 1 1  ? 0.142   18.933  -10.108 1.00 0.00 ? 101 DG  B "H2'"  2  
ATOM   1974  H "H2''" . DG  A 1 1  ? 0.057   19.232  -8.351  1.00 0.00 ? 101 DG  B "H2''" 2  
ATOM   1975  H "H1'"  . DG  A 1 1  ? -1.863  20.374  -8.565  1.00 0.00 ? 101 DG  B "H1'"  2  
ATOM   1976  H H8     . DG  A 1 1  ? -0.745  18.760  -11.800 1.00 0.00 ? 101 DG  B H8     2  
ATOM   1977  H H1     . DG  A 1 1  ? -7.047  19.282  -11.292 1.00 0.00 ? 101 DG  B H1     2  
ATOM   1978  H H21    . DG  A 1 1  ? -7.595  20.516  -9.527  1.00 0.00 ? 101 DG  B H21    2  
ATOM   1979  H H22    . DG  A 1 1  ? -6.379  21.209  -8.477  1.00 0.00 ? 101 DG  B H22    2  
ATOM   1980  H "HO5'" . DG  A 1 1  ? -0.414  21.610  -12.036 1.00 0.00 ? 101 DG  B "HO5'" 2  
ATOM   1981  P P      . DT  A 1 2  ? 2.356   19.576  -7.495  1.00 0.00 ? 102 DT  B P      2  
ATOM   1982  O OP1    . DT  A 1 2  ? 3.463   19.986  -6.602  1.00 0.00 ? 102 DT  B OP1    2  
ATOM   1983  O OP2    . DT  A 1 2  ? 2.571   18.505  -8.493  1.00 0.00 ? 102 DT  B OP2    2  
ATOM   1984  O "O5'"  . DT  A 1 2  ? 1.096   19.165  -6.579  1.00 0.00 ? 102 DT  B "O5'"  2  
ATOM   1985  C "C5'"  . DT  A 1 2  ? 0.212   20.169  -6.070  1.00 0.00 ? 102 DT  B "C5'"  2  
ATOM   1986  C "C4'"  . DT  A 1 2  ? -0.898  19.560  -5.217  1.00 0.00 ? 102 DT  B "C4'"  2  
ATOM   1987  O "O4'"  . DT  A 1 2  ? -2.021  19.178  -6.041  1.00 0.00 ? 102 DT  B "O4'"  2  
ATOM   1988  C "C3'"  . DT  A 1 2  ? -0.398  18.323  -4.487  1.00 0.00 ? 102 DT  B "C3'"  2  
ATOM   1989  O "O3'"  . DT  A 1 2  ? -0.549  18.477  -3.071  1.00 0.00 ? 102 DT  B "O3'"  2  
ATOM   1990  C "C2'"  . DT  A 1 2  ? -1.231  17.174  -4.996  1.00 0.00 ? 102 DT  B "C2'"  2  
ATOM   1991  C "C1'"  . DT  A 1 2  ? -2.279  17.763  -5.924  1.00 0.00 ? 102 DT  B "C1'"  2  
ATOM   1992  N N1     . DT  A 1 2  ? -2.238  17.115  -7.250  1.00 0.00 ? 102 DT  B N1     2  
ATOM   1993  C C2     . DT  A 1 2  ? -3.441  16.702  -7.791  1.00 0.00 ? 102 DT  B C2     2  
ATOM   1994  O O2     . DT  A 1 2  ? -4.496  16.845  -7.206  1.00 0.00 ? 102 DT  B O2     2  
ATOM   1995  N N3     . DT  A 1 2  ? -3.374  16.115  -9.040  1.00 0.00 ? 102 DT  B N3     2  
ATOM   1996  C C4     . DT  A 1 2  ? -2.226  15.907  -9.784  1.00 0.00 ? 102 DT  B C4     2  
ATOM   1997  O O4     . DT  A 1 2  ? -2.281  15.379  -10.877 1.00 0.00 ? 102 DT  B O4     2  
ATOM   1998  C C5     . DT  A 1 2  ? -1.018  16.369  -9.137  1.00 0.00 ? 102 DT  B C5     2  
ATOM   1999  C C7     . DT  A 1 2  ? 0.322   16.200  -9.845  1.00 0.00 ? 102 DT  B C7     2  
ATOM   2000  C C6     . DT  A 1 2  ? -1.057  16.946  -7.919  1.00 0.00 ? 102 DT  B C6     2  
ATOM   2001  H "H5'"  . DT  A 1 2  ? -0.236  20.706  -6.906  1.00 0.00 ? 102 DT  B "H5'"  2  
ATOM   2002  H "H5''" . DT  A 1 2  ? 0.783   20.870  -5.460  1.00 0.00 ? 102 DT  B "H5''" 2  
ATOM   2003  H "H4'"  . DT  A 1 2  ? -1.229  20.297  -4.485  1.00 0.00 ? 102 DT  B "H4'"  2  
ATOM   2004  H "H3'"  . DT  A 1 2  ? 0.651   18.150  -4.734  1.00 0.00 ? 102 DT  B "H3'"  2  
ATOM   2005  H "H2'"  . DT  A 1 2  ? -0.602  16.472  -5.543  1.00 0.00 ? 102 DT  B "H2'"  2  
ATOM   2006  H "H2''" . DT  A 1 2  ? -1.718  16.667  -4.164  1.00 0.00 ? 102 DT  B "H2''" 2  
ATOM   2007  H "H1'"  . DT  A 1 2  ? -3.266  17.615  -5.487  1.00 0.00 ? 102 DT  B "H1'"  2  
ATOM   2008  H H3     . DT  A 1 2  ? -4.220  15.818  -9.437  1.00 0.00 ? 102 DT  B H3     2  
ATOM   2009  H H71    . DT  A 1 2  ? 0.883   15.395  -9.372  1.00 0.00 ? 102 DT  B H71    2  
ATOM   2010  H H72    . DT  A 1 2  ? 0.150   15.956  -10.894 1.00 0.00 ? 102 DT  B H72    2  
ATOM   2011  H H73    . DT  A 1 2  ? 0.889   17.128  -9.776  1.00 0.00 ? 102 DT  B H73    2  
ATOM   2012  H H6     . DT  A 1 2  ? -0.129  17.286  -7.458  1.00 0.00 ? 102 DT  B H6     2  
ATOM   2013  P P      . DA  A 1 3  ? -0.476  17.201  -2.090  1.00 0.00 ? 103 DA  B P      2  
ATOM   2014  O OP1    . DA  A 1 3  ? -0.655  17.675  -0.700  1.00 0.00 ? 103 DA  B OP1    2  
ATOM   2015  O OP2    . DA  A 1 3  ? 0.720   16.408  -2.451  1.00 0.00 ? 103 DA  B OP2    2  
ATOM   2016  O "O5'"  . DA  A 1 3  ? -1.785  16.361  -2.509  1.00 0.00 ? 103 DA  B "O5'"  2  
ATOM   2017  C "C5'"  . DA  A 1 3  ? -3.090  16.798  -2.118  1.00 0.00 ? 103 DA  B "C5'"  2  
ATOM   2018  C "C4'"  . DA  A 1 3  ? -4.095  15.652  -2.151  1.00 0.00 ? 103 DA  B "C4'"  2  
ATOM   2019  O "O4'"  . DA  A 1 3  ? -4.571  15.426  -3.496  1.00 0.00 ? 103 DA  B "O4'"  2  
ATOM   2020  C "C3'"  . DA  A 1 3  ? -3.459  14.366  -1.647  1.00 0.00 ? 103 DA  B "C3'"  2  
ATOM   2021  O "O3'"  . DA  A 1 3  ? -4.083  13.934  -0.433  1.00 0.00 ? 103 DA  B "O3'"  2  
ATOM   2022  C "C2'"  . DA  A 1 3  ? -3.648  13.355  -2.747  1.00 0.00 ? 103 DA  B "C2'"  2  
ATOM   2023  C "C1'"  . DA  A 1 3  ? -4.469  14.029  -3.828  1.00 0.00 ? 103 DA  B "C1'"  2  
ATOM   2024  N N9     . DA  A 1 3  ? -3.837  13.846  -5.139  1.00 0.00 ? 103 DA  B N9     2  
ATOM   2025  C C8     . DA  A 1 3  ? -2.546  14.002  -5.481  1.00 0.00 ? 103 DA  B C8     2  
ATOM   2026  N N7     . DA  A 1 3  ? -2.219  13.788  -6.711  1.00 0.00 ? 103 DA  B N7     2  
ATOM   2027  C C5     . DA  A 1 3  ? -3.454  13.440  -7.269  1.00 0.00 ? 103 DA  B C5     2  
ATOM   2028  C C6     . DA  A 1 3  ? -3.841  13.081  -8.564  1.00 0.00 ? 103 DA  B C6     2  
ATOM   2029  N N6     . DA  A 1 3  ? -2.990  13.006  -9.586  1.00 0.00 ? 103 DA  B N6     2  
ATOM   2030  N N1     . DA  A 1 3  ? -5.141  12.800  -8.765  1.00 0.00 ? 103 DA  B N1     2  
ATOM   2031  C C2     . DA  A 1 3  ? -6.011  12.866  -7.755  1.00 0.00 ? 103 DA  B C2     2  
ATOM   2032  N N3     . DA  A 1 3  ? -5.753  13.195  -6.492  1.00 0.00 ? 103 DA  B N3     2  
ATOM   2033  C C4     . DA  A 1 3  ? -4.445  13.472  -6.316  1.00 0.00 ? 103 DA  B C4     2  
ATOM   2034  H "H5'"  . DA  A 1 3  ? -3.421  17.583  -2.799  1.00 0.00 ? 103 DA  B "H5'"  2  
ATOM   2035  H "H5''" . DA  A 1 3  ? -3.043  17.201  -1.106  1.00 0.00 ? 103 DA  B "H5''" 2  
ATOM   2036  H "H4'"  . DA  A 1 3  ? -4.944  15.897  -1.518  1.00 0.00 ? 103 DA  B "H4'"  2  
ATOM   2037  H "H3'"  . DA  A 1 3  ? -2.392  14.528  -1.481  1.00 0.00 ? 103 DA  B "H3'"  2  
ATOM   2038  H "H2'"  . DA  A 1 3  ? -2.679  13.057  -3.148  1.00 0.00 ? 103 DA  B "H2'"  2  
ATOM   2039  H "H2''" . DA  A 1 3  ? -4.175  12.484  -2.371  1.00 0.00 ? 103 DA  B "H2''" 2  
ATOM   2040  H "H1'"  . DA  A 1 3  ? -5.460  13.598  -3.845  1.00 0.00 ? 103 DA  B "H1'"  2  
ATOM   2041  H H8     . DA  A 1 3  ? -1.808  14.284  -4.735  1.00 0.00 ? 103 DA  B H8     2  
ATOM   2042  H H61    . DA  A 1 3  ? -3.322  12.742  -10.502 1.00 0.00 ? 103 DA  B H61    2  
ATOM   2043  H H62    . DA  A 1 3  ? -2.012  13.214  -9.445  1.00 0.00 ? 103 DA  B H62    2  
ATOM   2044  H H2     . DA  A 1 3  ? -7.047  12.623  -7.994  1.00 0.00 ? 103 DA  B H2     2  
ATOM   2045  P P      . DT  A 1 4  ? -3.929  12.415  0.079   1.00 0.00 ? 104 DT  B P      2  
ATOM   2046  O OP1    . DT  A 1 4  ? -3.892  12.425  1.558   1.00 0.00 ? 104 DT  B OP1    2  
ATOM   2047  O OP2    . DT  A 1 4  ? -2.832  11.779  -0.684  1.00 0.00 ? 104 DT  B OP2    2  
ATOM   2048  O "O5'"  . DT  A 1 4  ? -5.319  11.749  -0.386  1.00 0.00 ? 104 DT  B "O5'"  2  
ATOM   2049  C "C5'"  . DT  A 1 4  ? -6.423  12.572  -0.777  1.00 0.00 ? 104 DT  B "C5'"  2  
ATOM   2050  C "C4'"  . DT  A 1 4  ? -7.573  11.743  -1.342  1.00 0.00 ? 104 DT  B "C4'"  2  
ATOM   2051  O "O4'"  . DT  A 1 4  ? -7.491  11.672  -2.783  1.00 0.00 ? 104 DT  B "O4'"  2  
ATOM   2052  C "C3'"  . DT  A 1 4  ? -7.534  10.325  -0.792  1.00 0.00 ? 104 DT  B "C3'"  2  
ATOM   2053  O "O3'"  . DT  A 1 4  ? -8.764  10.005  -0.133  1.00 0.00 ? 104 DT  B "O3'"  2  
ATOM   2054  C "C2'"  . DT  A 1 4  ? -7.303  9.424   -1.978  1.00 0.00 ? 104 DT  B "C2'"  2  
ATOM   2055  C "C1'"  . DT  A 1 4  ? -7.306  10.308  -3.215  1.00 0.00 ? 104 DT  B "C1'"  2  
ATOM   2056  N N1     . DT  A 1 4  ? -6.044  10.167  -3.960  1.00 0.00 ? 104 DT  B N1     2  
ATOM   2057  C C2     . DT  A 1 4  ? -6.125  9.906   -5.314  1.00 0.00 ? 104 DT  B C2     2  
ATOM   2058  O O2     . DT  A 1 4  ? -7.191  9.779   -5.886  1.00 0.00 ? 104 DT  B O2     2  
ATOM   2059  N N3     . DT  A 1 4  ? -4.920  9.799   -5.985  1.00 0.00 ? 104 DT  B N3     2  
ATOM   2060  C C4     . DT  A 1 4  ? -3.662  9.930   -5.422  1.00 0.00 ? 104 DT  B C4     2  
ATOM   2061  O O4     . DT  A 1 4  ? -2.663  9.817   -6.106  1.00 0.00 ? 104 DT  B O4     2  
ATOM   2062  C C5     . DT  A 1 4  ? -3.678  10.200  -4.002  1.00 0.00 ? 104 DT  B C5     2  
ATOM   2063  C C7     . DT  A 1 4  ? -2.360  10.370  -3.254  1.00 0.00 ? 104 DT  B C7     2  
ATOM   2064  C C6     . DT  A 1 4  ? -4.841  10.308  -3.329  1.00 0.00 ? 104 DT  B C6     2  
ATOM   2065  H "H5'"  . DT  A 1 4  ? -6.088  13.278  -1.537  1.00 0.00 ? 104 DT  B "H5'"  2  
ATOM   2066  H "H5''" . DT  A 1 4  ? -6.778  13.126  0.092   1.00 0.00 ? 104 DT  B "H5''" 2  
ATOM   2067  H "H4'"  . DT  A 1 4  ? -8.519  12.208  -1.062  1.00 0.00 ? 104 DT  B "H4'"  2  
ATOM   2068  H "H3'"  . DT  A 1 4  ? -6.701  10.228  -0.093  1.00 0.00 ? 104 DT  B "H3'"  2  
ATOM   2069  H "H2'"  . DT  A 1 4  ? -6.339  8.925   -1.882  1.00 0.00 ? 104 DT  B "H2'"  2  
ATOM   2070  H "H2''" . DT  A 1 4  ? -8.098  8.687   -2.047  1.00 0.00 ? 104 DT  B "H2''" 2  
ATOM   2071  H "H1'"  . DT  A 1 4  ? -8.135  10.019  -3.859  1.00 0.00 ? 104 DT  B "H1'"  2  
ATOM   2072  H H3     . DT  A 1 4  ? -4.961  9.614   -6.946  1.00 0.00 ? 104 DT  B H3     2  
ATOM   2073  H H71    . DT  A 1 4  ? -1.827  11.235  -3.648  1.00 0.00 ? 104 DT  B H71    2  
ATOM   2074  H H72    . DT  A 1 4  ? -2.561  10.520  -2.193  1.00 0.00 ? 104 DT  B H72    2  
ATOM   2075  H H73    . DT  A 1 4  ? -1.750  9.477   -3.386  1.00 0.00 ? 104 DT  B H73    2  
ATOM   2076  H H6     . DT  A 1 4  ? -4.823  10.503  -2.257  1.00 0.00 ? 104 DT  B H6     2  
ATOM   2077  P P      . DC  A 1 5  ? -9.135  8.477   0.214   1.00 0.00 ? 105 DC  B P      2  
ATOM   2078  O OP1    . DC  A 1 5  ? -10.413 8.470   0.961   1.00 0.00 ? 105 DC  B OP1    2  
ATOM   2079  O OP2    . DC  A 1 5  ? -7.938  7.830   0.793   1.00 0.00 ? 105 DC  B OP2    2  
ATOM   2080  O "O5'"  . DC  A 1 5  ? -9.397  7.841   -1.240  1.00 0.00 ? 105 DC  B "O5'"  2  
ATOM   2081  C "C5'"  . DC  A 1 5  ? -10.518 8.255   -2.027  1.00 0.00 ? 105 DC  B "C5'"  2  
ATOM   2082  C "C4'"  . DC  A 1 5  ? -10.763 7.296   -3.186  1.00 0.00 ? 105 DC  B "C4'"  2  
ATOM   2083  O "O4'"  . DC  A 1 5  ? -9.765  7.467   -4.213  1.00 0.00 ? 105 DC  B "O4'"  2  
ATOM   2084  C "C3'"  . DC  A 1 5  ? -10.717 5.856   -2.707  1.00 0.00 ? 105 DC  B "C3'"  2  
ATOM   2085  O "O3'"  . DC  A 1 5  ? -12.003 5.241   -2.887  1.00 0.00 ? 105 DC  B "O3'"  2  
ATOM   2086  C "C2'"  . DC  A 1 5  ? -9.641  5.184   -3.528  1.00 0.00 ? 105 DC  B "C2'"  2  
ATOM   2087  C "C1'"  . DC  A 1 5  ? -9.186  6.195   -4.560  1.00 0.00 ? 105 DC  B "C1'"  2  
ATOM   2088  N N1     . DC  A 1 5  ? -7.714  6.277   -4.601  1.00 0.00 ? 105 DC  B N1     2  
ATOM   2089  C C2     . DC  A 1 5  ? -7.095  6.115   -5.831  1.00 0.00 ? 105 DC  B C2     2  
ATOM   2090  O O2     . DC  A 1 5  ? -7.760  5.912   -6.828  1.00 0.00 ? 105 DC  B O2     2  
ATOM   2091  N N3     . DC  A 1 5  ? -5.737  6.191   -5.883  1.00 0.00 ? 105 DC  B N3     2  
ATOM   2092  C C4     . DC  A 1 5  ? -5.017  6.416   -4.774  1.00 0.00 ? 105 DC  B C4     2  
ATOM   2093  N N4     . DC  A 1 5  ? -3.689  6.486   -4.862  1.00 0.00 ? 105 DC  B N4     2  
ATOM   2094  C C5     . DC  A 1 5  ? -5.655  6.581   -3.504  1.00 0.00 ? 105 DC  B C5     2  
ATOM   2095  C C6     . DC  A 1 5  ? -6.999  6.504   -3.465  1.00 0.00 ? 105 DC  B C6     2  
ATOM   2096  H "H5'"  . DC  A 1 5  ? -10.325 9.252   -2.425  1.00 0.00 ? 105 DC  B "H5'"  2  
ATOM   2097  H "H5''" . DC  A 1 5  ? -11.405 8.287   -1.396  1.00 0.00 ? 105 DC  B "H5''" 2  
ATOM   2098  H "H4'"  . DC  A 1 5  ? -11.745 7.488   -3.614  1.00 0.00 ? 105 DC  B "H4'"  2  
ATOM   2099  H "H3'"  . DC  A 1 5  ? -10.438 5.832   -1.653  1.00 0.00 ? 105 DC  B "H3'"  2  
ATOM   2100  H "H2'"  . DC  A 1 5  ? -8.805  4.906   -2.887  1.00 0.00 ? 105 DC  B "H2'"  2  
ATOM   2101  H "H2''" . DC  A 1 5  ? -10.035 4.302   -4.024  1.00 0.00 ? 105 DC  B "H2''" 2  
ATOM   2102  H "H1'"  . DC  A 1 5  ? -9.558  5.893   -5.536  1.00 0.00 ? 105 DC  B "H1'"  2  
ATOM   2103  H H41    . DC  A 1 5  ? -3.234  6.372   -5.756  1.00 0.00 ? 105 DC  B H41    2  
ATOM   2104  H H42    . DC  A 1 5  ? -3.136  6.658   -4.033  1.00 0.00 ? 105 DC  B H42    2  
ATOM   2105  H H5     . DC  A 1 5  ? -5.073  6.758   -2.600  1.00 0.00 ? 105 DC  B H5     2  
ATOM   2106  H H6     . DC  A 1 5  ? -7.520  6.620   -2.516  1.00 0.00 ? 105 DC  B H6     2  
HETATM 2107  N N1     . 5CM A 1 6  ? -9.396  2.215   -6.730  1.00 0.00 ? 106 5CM B N1     2  
HETATM 2108  C C2     . 5CM A 1 6  ? -8.149  2.098   -7.325  1.00 0.00 ? 106 5CM B C2     2  
HETATM 2109  N N3     . 5CM A 1 6  ? -7.053  2.026   -6.522  1.00 0.00 ? 106 5CM B N3     2  
HETATM 2110  C C4     . 5CM A 1 6  ? -7.173  2.064   -5.189  1.00 0.00 ? 106 5CM B C4     2  
HETATM 2111  C C5     . 5CM A 1 6  ? -8.457  2.184   -4.568  1.00 0.00 ? 106 5CM B C5     2  
HETATM 2112  C C5A    . 5CM A 1 6  ? -8.594  2.253   -3.051  1.00 0.00 ? 106 5CM B C5A    2  
HETATM 2113  C C6     . 5CM A 1 6  ? -9.537  2.253   -5.372  1.00 0.00 ? 106 5CM B C6     2  
HETATM 2114  O O2     . 5CM A 1 6  ? -8.052  2.065   -8.536  1.00 0.00 ? 106 5CM B O2     2  
HETATM 2115  N N4     . 5CM A 1 6  ? -6.078  1.993   -4.434  1.00 0.00 ? 106 5CM B N4     2  
HETATM 2116  C "C1'"  . 5CM A 1 6  ? -10.561 2.340   -7.632  1.00 0.00 ? 106 5CM B "C1'"  2  
HETATM 2117  C "C2'"  . 5CM A 1 6  ? -11.773 1.577   -7.116  1.00 0.00 ? 106 5CM B "C2'"  2  
HETATM 2118  C "C3'"  . 5CM A 1 6  ? -12.944 2.523   -7.232  1.00 0.00 ? 106 5CM B "C3'"  2  
HETATM 2119  C "C4'"  . 5CM A 1 6  ? -12.329 3.899   -7.404  1.00 0.00 ? 106 5CM B "C4'"  2  
HETATM 2120  O "O4'"  . 5CM A 1 6  ? -10.945 3.725   -7.772  1.00 0.00 ? 106 5CM B "O4'"  2  
HETATM 2121  O "O3'"  . 5CM A 1 6  ? -13.764 2.210   -8.366  1.00 0.00 ? 106 5CM B "O3'"  2  
HETATM 2122  C "C5'"  . 5CM A 1 6  ? -12.439 4.692   -6.108  1.00 0.00 ? 106 5CM B "C5'"  2  
HETATM 2123  O "O5'"  . 5CM A 1 6  ? -11.587 4.147   -5.099  1.00 0.00 ? 106 5CM B "O5'"  2  
HETATM 2124  P P      . 5CM A 1 6  ? -12.163 3.826   -3.631  1.00 0.00 ? 106 5CM B P      2  
HETATM 2125  O OP1    . 5CM A 1 6  ? -13.604 3.521   -3.757  1.00 0.00 ? 106 5CM B OP1    2  
HETATM 2126  O OP2    . 5CM A 1 6  ? -11.252 2.864   -2.976  1.00 0.00 ? 106 5CM B OP2    2  
HETATM 2127  H H5A1   . 5CM A 1 6  ? -9.509  2.787   -2.794  1.00 0.00 ? 106 5CM B H5A1   2  
HETATM 2128  H H5A2   . 5CM A 1 6  ? -8.635  1.243   -2.643  1.00 0.00 ? 106 5CM B H5A2   2  
HETATM 2129  H H5A3   . 5CM A 1 6  ? -7.736  2.780   -2.633  1.00 0.00 ? 106 5CM B H5A3   2  
HETATM 2130  H H6     . 5CM A 1 6  ? -10.533 2.327   -4.934  1.00 0.00 ? 106 5CM B H6     2  
HETATM 2131  H HN41   . 5CM A 1 6  ? -6.156  2.022   -3.427  1.00 0.00 ? 106 5CM B HN41   2  
HETATM 2132  H HN42   . 5CM A 1 6  ? -5.170  1.908   -4.868  1.00 0.00 ? 106 5CM B HN42   2  
HETATM 2133  H "H1'"  . 5CM A 1 6  ? -10.290 1.948   -8.613  1.00 0.00 ? 106 5CM B "H1'"  2  
HETATM 2134  H "H2'"  . 5CM A 1 6  ? -11.627 1.298   -6.071  1.00 0.00 ? 106 5CM B "H2'"  2  
HETATM 2135  H "H2''" . 5CM A 1 6  ? -11.942 0.688   -7.719  1.00 0.00 ? 106 5CM B "H2''" 2  
HETATM 2136  H "H3'"  . 5CM A 1 6  ? -13.540 2.492   -6.316  1.00 0.00 ? 106 5CM B "H3'"  2  
HETATM 2137  H "H4'"  . 5CM A 1 6  ? -12.849 4.430   -8.200  1.00 0.00 ? 106 5CM B "H4'"  2  
HETATM 2138  H "H5'"  . 5CM A 1 6  ? -12.154 5.726   -6.296  1.00 0.00 ? 106 5CM B "H5'"  2  
HETATM 2139  H "H5''" . 5CM A 1 6  ? -13.471 4.663   -5.758  1.00 0.00 ? 106 5CM B "H5''" 2  
ATOM   2140  P P      . DG  A 1 7  ? -14.083 0.687   -8.771  1.00 0.00 ? 107 DG  B P      2  
ATOM   2141  O OP1    . DG  A 1 7  ? -14.983 0.697   -9.945  1.00 0.00 ? 107 DG  B OP1    2  
ATOM   2142  O OP2    . DG  A 1 7  ? -14.475 -0.036  -7.548  1.00 0.00 ? 107 DG  B OP2    2  
ATOM   2143  O "O5'"  . DG  A 1 7  ? -12.645 0.136   -9.240  1.00 0.00 ? 107 DG  B "O5'"  2  
ATOM   2144  C "C5'"  . DG  A 1 7  ? -12.228 0.270   -10.599 1.00 0.00 ? 107 DG  B "C5'"  2  
ATOM   2145  C "C4'"  . DG  A 1 7  ? -11.490 -0.972  -11.089 1.00 0.00 ? 107 DG  B "C4'"  2  
ATOM   2146  O "O4'"  . DG  A 1 7  ? -10.096 -0.920  -10.713 1.00 0.00 ? 107 DG  B "O4'"  2  
ATOM   2147  C "C3'"  . DG  A 1 7  ? -12.099 -2.237  -10.501 1.00 0.00 ? 107 DG  B "C3'"  2  
ATOM   2148  O "O3'"  . DG  A 1 7  ? -12.671 -3.051  -11.537 1.00 0.00 ? 107 DG  B "O3'"  2  
ATOM   2149  C "C2'"  . DG  A 1 7  ? -10.970 -2.950  -9.798  1.00 0.00 ? 107 DG  B "C2'"  2  
ATOM   2150  C "C1'"  . DG  A 1 7  ? -9.716  -2.128  -10.026 1.00 0.00 ? 107 DG  B "C1'"  2  
ATOM   2151  N N9     . DG  A 1 7  ? -9.057  -1.828  -8.748  1.00 0.00 ? 107 DG  B N9     2  
ATOM   2152  C C8     . DG  A 1 7  ? -9.609  -1.541  -7.552  1.00 0.00 ? 107 DG  B C8     2  
ATOM   2153  N N7     . DG  A 1 7  ? -8.813  -1.357  -6.553  1.00 0.00 ? 107 DG  B N7     2  
ATOM   2154  C C5     . DG  A 1 7  ? -7.563  -1.544  -7.148  1.00 0.00 ? 107 DG  B C5     2  
ATOM   2155  C C6     . DG  A 1 7  ? -6.263  -1.479  -6.576  1.00 0.00 ? 107 DG  B C6     2  
ATOM   2156  O O6     . DG  A 1 7  ? -5.957  -1.242  -5.425  1.00 0.00 ? 107 DG  B O6     2  
ATOM   2157  N N1     . DG  A 1 7  ? -5.278  -1.730  -7.523  1.00 0.00 ? 107 DG  B N1     2  
ATOM   2158  C C2     . DG  A 1 7  ? -5.509  -2.009  -8.856  1.00 0.00 ? 107 DG  B C2     2  
ATOM   2159  N N2     . DG  A 1 7  ? -4.431  -2.219  -9.609  1.00 0.00 ? 107 DG  B N2     2  
ATOM   2160  N N3     . DG  A 1 7  ? -6.728  -2.071  -9.400  1.00 0.00 ? 107 DG  B N3     2  
ATOM   2161  C C4     . DG  A 1 7  ? -7.704  -1.831  -8.496  1.00 0.00 ? 107 DG  B C4     2  
ATOM   2162  H "H5'"  . DG  A 1 7  ? -11.567 1.132   -10.683 1.00 0.00 ? 107 DG  B "H5'"  2  
ATOM   2163  H "H5''" . DG  A 1 7  ? -13.106 0.433   -11.225 1.00 0.00 ? 107 DG  B "H5''" 2  
ATOM   2164  H "H4'"  . DG  A 1 7  ? -11.560 -1.019  -12.174 1.00 0.00 ? 107 DG  B "H4'"  2  
ATOM   2165  H "H3'"  . DG  A 1 7  ? -12.867 -1.967  -9.774  1.00 0.00 ? 107 DG  B "H3'"  2  
ATOM   2166  H "H2'"  . DG  A 1 7  ? -11.182 -3.015  -8.731  1.00 0.00 ? 107 DG  B "H2'"  2  
ATOM   2167  H "H2''" . DG  A 1 7  ? -10.838 -3.947  -10.209 1.00 0.00 ? 107 DG  B "H2''" 2  
ATOM   2168  H "H1'"  . DG  A 1 7  ? -9.031  -2.693  -10.649 1.00 0.00 ? 107 DG  B "H1'"  2  
ATOM   2169  H H8     . DG  A 1 7  ? -10.689 -1.470  -7.441  1.00 0.00 ? 107 DG  B H8     2  
ATOM   2170  H H1     . DG  A 1 7  ? -4.354  -1.703  -7.199  1.00 0.00 ? 107 DG  B H1     2  
ATOM   2171  H H21    . DG  A 1 7  ? -3.510  -2.171  -9.198  1.00 0.00 ? 107 DG  B H21    2  
ATOM   2172  H H22    . DG  A 1 7  ? -4.535  -2.426  -10.592 1.00 0.00 ? 107 DG  B H22    2  
ATOM   2173  P P      . DG  A 1 8  ? -12.764 -4.654  -11.384 1.00 0.00 ? 108 DG  B P      2  
ATOM   2174  O OP1    . DG  A 1 8  ? -13.728 -5.161  -12.387 1.00 0.00 ? 108 DG  B OP1    2  
ATOM   2175  O OP2    . DG  A 1 8  ? -12.953 -4.974  -9.952  1.00 0.00 ? 108 DG  B OP2    2  
ATOM   2176  O "O5'"  . DG  A 1 8  ? -11.287 -5.129  -11.818 1.00 0.00 ? 108 DG  B "O5'"  2  
ATOM   2177  C "C5'"  . DG  A 1 8  ? -10.455 -4.272  -12.603 1.00 0.00 ? 108 DG  B "C5'"  2  
ATOM   2178  C "C4'"  . DG  A 1 8  ? -8.998  -4.725  -12.590 1.00 0.00 ? 108 DG  B "C4'"  2  
ATOM   2179  O "O4'"  . DG  A 1 8  ? -8.341  -4.321  -11.369 1.00 0.00 ? 108 DG  B "O4'"  2  
ATOM   2180  C "C3'"  . DG  A 1 8  ? -8.896  -6.239  -12.705 1.00 0.00 ? 108 DG  B "C3'"  2  
ATOM   2181  O "O3'"  . DG  A 1 8  ? -8.296  -6.609  -13.953 1.00 0.00 ? 108 DG  B "O3'"  2  
ATOM   2182  C "C2'"  . DG  A 1 8  ? -8.048  -6.684  -11.537 1.00 0.00 ? 108 DG  B "C2'"  2  
ATOM   2183  C "C1'"  . DG  A 1 8  ? -7.592  -5.425  -10.826 1.00 0.00 ? 108 DG  B "C1'"  2  
ATOM   2184  N N9     . DG  A 1 8  ? -7.784  -5.532  -9.370  1.00 0.00 ? 108 DG  B N9     2  
ATOM   2185  C C8     . DG  A 1 8  ? -8.925  -5.506  -8.652  1.00 0.00 ? 108 DG  B C8     2  
ATOM   2186  N N7     . DG  A 1 8  ? -8.830  -5.598  -7.368  1.00 0.00 ? 108 DG  B N7     2  
ATOM   2187  C C5     . DG  A 1 8  ? -7.446  -5.700  -7.193  1.00 0.00 ? 108 DG  B C5     2  
ATOM   2188  C C6     . DG  A 1 8  ? -6.683  -5.827  -6.001  1.00 0.00 ? 108 DG  B C6     2  
ATOM   2189  O O6     . DG  A 1 8  ? -7.078  -5.879  -4.853  1.00 0.00 ? 108 DG  B O6     2  
ATOM   2190  N N1     . DG  A 1 8  ? -5.321  -5.897  -6.272  1.00 0.00 ? 108 DG  B N1     2  
ATOM   2191  C C2     . DG  A 1 8  ? -4.758  -5.852  -7.532  1.00 0.00 ? 108 DG  B C2     2  
ATOM   2192  N N2     . DG  A 1 8  ? -3.428  -5.934  -7.587  1.00 0.00 ? 108 DG  B N2     2  
ATOM   2193  N N3     . DG  A 1 8  ? -5.469  -5.732  -8.658  1.00 0.00 ? 108 DG  B N3     2  
ATOM   2194  C C4     . DG  A 1 8  ? -6.798  -5.661  -8.419  1.00 0.00 ? 108 DG  B C4     2  
ATOM   2195  H "H5'"  . DG  A 1 8  ? -10.515 -3.258  -12.207 1.00 0.00 ? 108 DG  B "H5'"  2  
ATOM   2196  H "H5''" . DG  A 1 8  ? -10.816 -4.272  -13.632 1.00 0.00 ? 108 DG  B "H5''" 2  
ATOM   2197  H "H4'"  . DG  A 1 8  ? -8.477  -4.272  -13.432 1.00 0.00 ? 108 DG  B "H4'"  2  
ATOM   2198  H "H3'"  . DG  A 1 8  ? -9.892  -6.679  -12.622 1.00 0.00 ? 108 DG  B "H3'"  2  
ATOM   2199  H "H2'"  . DG  A 1 8  ? -8.640  -7.300  -10.860 1.00 0.00 ? 108 DG  B "H2'"  2  
ATOM   2200  H "H2''" . DG  A 1 8  ? -7.184  -7.242  -11.892 1.00 0.00 ? 108 DG  B "H2''" 2  
ATOM   2201  H "H1'"  . DG  A 1 8  ? -6.541  -5.269  -11.029 1.00 0.00 ? 108 DG  B "H1'"  2  
ATOM   2202  H H8     . DG  A 1 8  ? -9.889  -5.408  -9.145  1.00 0.00 ? 108 DG  B H8     2  
ATOM   2203  H H1     . DG  A 1 8  ? -4.732  -5.986  -5.495  1.00 0.00 ? 108 DG  B H1     2  
ATOM   2204  H H21    . DG  A 1 8  ? -2.892  -6.026  -6.735  1.00 0.00 ? 108 DG  B H21    2  
ATOM   2205  H H22    . DG  A 1 8  ? -2.957  -5.907  -8.480  1.00 0.00 ? 108 DG  B H22    2  
ATOM   2206  P P      . DA  A 1 9  ? -7.604  -8.050  -14.146 1.00 0.00 ? 109 DA  B P      2  
ATOM   2207  O OP1    . DA  A 1 9  ? -7.079  -8.130  -15.528 1.00 0.00 ? 109 DA  B OP1    2  
ATOM   2208  O OP2    . DA  A 1 9  ? -8.540  -9.084  -13.652 1.00 0.00 ? 109 DA  B OP2    2  
ATOM   2209  O "O5'"  . DA  A 1 9  ? -6.353  -7.977  -13.135 1.00 0.00 ? 109 DA  B "O5'"  2  
ATOM   2210  C "C5'"  . DA  A 1 9  ? -5.083  -7.487  -13.576 1.00 0.00 ? 109 DA  B "C5'"  2  
ATOM   2211  C "C4'"  . DA  A 1 9  ? -3.959  -8.450  -13.205 1.00 0.00 ? 109 DA  B "C4'"  2  
ATOM   2212  O "O4'"  . DA  A 1 9  ? -3.612  -8.313  -11.808 1.00 0.00 ? 109 DA  B "O4'"  2  
ATOM   2213  C "C3'"  . DA  A 1 9  ? -4.397  -9.884  -13.448 1.00 0.00 ? 109 DA  B "C3'"  2  
ATOM   2214  O "O3'"  . DA  A 1 9  ? -3.459  -10.567 -14.289 1.00 0.00 ? 109 DA  B "O3'"  2  
ATOM   2215  C "C2'"  . DA  A 1 9  ? -4.477  -10.527 -12.088 1.00 0.00 ? 109 DA  B "C2'"  2  
ATOM   2216  C "C1'"  . DA  A 1 9  ? -3.933  -9.523  -11.089 1.00 0.00 ? 109 DA  B "C1'"  2  
ATOM   2217  N N9     . DA  A 1 9  ? -4.930  -9.260  -10.046 1.00 0.00 ? 109 DA  B N9     2  
ATOM   2218  C C8     . DA  A 1 9  ? -6.241  -9.003  -10.186 1.00 0.00 ? 109 DA  B C8     2  
ATOM   2219  N N7     . DA  A 1 9  ? -6.930  -8.791  -9.115  1.00 0.00 ? 109 DA  B N7     2  
ATOM   2220  C C5     . DA  A 1 9  ? -5.952  -8.927  -8.125  1.00 0.00 ? 109 DA  B C5     2  
ATOM   2221  C C6     . DA  A 1 9  ? -5.993  -8.830  -6.732  1.00 0.00 ? 109 DA  B C6     2  
ATOM   2222  N N6     . DA  A 1 9  ? -7.108  -8.559  -6.053  1.00 0.00 ? 109 DA  B N6     2  
ATOM   2223  N N1     . DA  A 1 9  ? -4.843  -9.024  -6.064  1.00 0.00 ? 109 DA  B N1     2  
ATOM   2224  C C2     . DA  A 1 9  ? -3.715  -9.298  -6.720  1.00 0.00 ? 109 DA  B C2     2  
ATOM   2225  N N3     . DA  A 1 9  ? -3.561  -9.414  -8.037  1.00 0.00 ? 109 DA  B N3     2  
ATOM   2226  C C4     . DA  A 1 9  ? -4.727  -9.214  -8.686  1.00 0.00 ? 109 DA  B C4     2  
ATOM   2227  H "H5'"  . DA  A 1 9  ? -4.892  -6.520  -13.111 1.00 0.00 ? 109 DA  B "H5'"  2  
ATOM   2228  H "H5''" . DA  A 1 9  ? -5.105  -7.366  -14.659 1.00 0.00 ? 109 DA  B "H5''" 2  
ATOM   2229  H "H4'"  . DA  A 1 9  ? -3.082  -8.232  -13.814 1.00 0.00 ? 109 DA  B "H4'"  2  
ATOM   2230  H "H3'"  . DA  A 1 9  ? -5.386  -9.891  -13.913 1.00 0.00 ? 109 DA  B "H3'"  2  
ATOM   2231  H "H2'"  . DA  A 1 9  ? -5.515  -10.761 -11.849 1.00 0.00 ? 109 DA  B "H2'"  2  
ATOM   2232  H "H2''" . DA  A 1 9  ? -3.882  -11.430 -12.064 1.00 0.00 ? 109 DA  B "H2''" 2  
ATOM   2233  H "H1'"  . DA  A 1 9  ? -3.035  -9.922  -10.630 1.00 0.00 ? 109 DA  B "H1'"  2  
ATOM   2234  H H8     . DA  A 1 9  ? -6.698  -8.996  -11.170 1.00 0.00 ? 109 DA  B H8     2  
ATOM   2235  H H61    . DA  A 1 9  ? -7.083  -8.500  -5.044  1.00 0.00 ? 109 DA  B H61    2  
ATOM   2236  H H62    . DA  A 1 9  ? -7.976  -8.412  -6.546  1.00 0.00 ? 109 DA  B H62    2  
ATOM   2237  H H2     . DA  A 1 9  ? -2.820  -9.439  -6.110  1.00 0.00 ? 109 DA  B H2     2  
ATOM   2238  P P      . DT  A 1 10 ? -3.436  -12.175 -14.361 1.00 0.00 ? 110 DT  B P      2  
ATOM   2239  O OP1    . DT  A 1 10 ? -2.769  -12.574 -15.620 1.00 0.00 ? 110 DT  B OP1    2  
ATOM   2240  O OP2    . DT  A 1 10 ? -4.796  -12.672 -14.056 1.00 0.00 ? 110 DT  B OP2    2  
ATOM   2241  O "O5'"  . DT  A 1 10 ? -2.469  -12.563 -13.133 1.00 0.00 ? 110 DT  B "O5'"  2  
ATOM   2242  C "C5'"  . DT  A 1 10 ? -1.497  -11.631 -12.651 1.00 0.00 ? 110 DT  B "C5'"  2  
ATOM   2243  C "C4'"  . DT  A 1 10 ? -0.706  -12.202 -11.477 1.00 0.00 ? 110 DT  B "C4'"  2  
ATOM   2244  O "O4'"  . DT  A 1 10 ? -1.293  -11.794 -10.221 1.00 0.00 ? 110 DT  B "O4'"  2  
ATOM   2245  C "C3'"  . DT  A 1 10 ? -0.694  -13.722 -11.527 1.00 0.00 ? 110 DT  B "C3'"  2  
ATOM   2246  O "O3'"  . DT  A 1 10 ? 0.651   -14.215 -11.550 1.00 0.00 ? 110 DT  B "O3'"  2  
ATOM   2247  C "C2'"  . DT  A 1 10 ? -1.419  -14.183 -10.289 1.00 0.00 ? 110 DT  B "C2'"  2  
ATOM   2248  C "C1'"  . DT  A 1 10 ? -1.691  -12.947 -9.451  1.00 0.00 ? 110 DT  B "C1'"  2  
ATOM   2249  N N1     . DT  A 1 10 ? -3.115  -12.866 -9.085  1.00 0.00 ? 110 DT  B N1     2  
ATOM   2250  C C2     . DT  A 1 10 ? -3.420  -12.694 -7.748  1.00 0.00 ? 110 DT  B C2     2  
ATOM   2251  O O2     . DT  A 1 10 ? -2.560  -12.622 -6.892  1.00 0.00 ? 110 DT  B O2     2  
ATOM   2252  N N3     . DT  A 1 10 ? -4.765  -12.608 -7.439  1.00 0.00 ? 110 DT  B N3     2  
ATOM   2253  C C4     . DT  A 1 10 ? -5.814  -12.678 -8.340  1.00 0.00 ? 110 DT  B C4     2  
ATOM   2254  O O4     . DT  A 1 10 ? -6.964  -12.589 -7.960  1.00 0.00 ? 110 DT  B O4     2  
ATOM   2255  C C5     . DT  A 1 10 ? -5.397  -12.859 -9.713  1.00 0.00 ? 110 DT  B C5     2  
ATOM   2256  C C7     . DT  A 1 10 ? -6.451  -12.956 -10.812 1.00 0.00 ? 110 DT  B C7     2  
ATOM   2257  C C6     . DT  A 1 10 ? -4.092  -12.947 -10.037 1.00 0.00 ? 110 DT  B C6     2  
ATOM   2258  H "H5'"  . DT  A 1 10 ? -2.006  -10.722 -12.328 1.00 0.00 ? 110 DT  B "H5'"  2  
ATOM   2259  H "H5''" . DT  A 1 10 ? -0.808  -11.386 -13.458 1.00 0.00 ? 110 DT  B "H5''" 2  
ATOM   2260  H "H4'"  . DT  A 1 10 ? 0.319   -11.834 -11.526 1.00 0.00 ? 110 DT  B "H4'"  2  
ATOM   2261  H "H3'"  . DT  A 1 10 ? -1.232  -14.062 -12.414 1.00 0.00 ? 110 DT  B "H3'"  2  
ATOM   2262  H "H2'"  . DT  A 1 10 ? -2.360  -14.658 -10.565 1.00 0.00 ? 110 DT  B "H2'"  2  
ATOM   2263  H "H2''" . DT  A 1 10 ? -0.800  -14.880 -9.732  1.00 0.00 ? 110 DT  B "H2''" 2  
ATOM   2264  H "H1'"  . DT  A 1 10 ? -1.092  -12.994 -8.542  1.00 0.00 ? 110 DT  B "H1'"  2  
ATOM   2265  H H3     . DT  A 1 10 ? -4.997  -12.487 -6.495  1.00 0.00 ? 110 DT  B H3     2  
ATOM   2266  H H71    . DT  A 1 10 ? -7.191  -13.709 -10.540 1.00 0.00 ? 110 DT  B H71    2  
ATOM   2267  H H72    . DT  A 1 10 ? -6.942  -11.991 -10.930 1.00 0.00 ? 110 DT  B H72    2  
ATOM   2268  H H73    . DT  A 1 10 ? -5.973  -13.238 -11.750 1.00 0.00 ? 110 DT  B H73    2  
ATOM   2269  H H6     . DT  A 1 10 ? -3.806  -13.094 -11.079 1.00 0.00 ? 110 DT  B H6     2  
ATOM   2270  P P      . DA  A 1 11 ? 0.965   -15.764 -11.247 1.00 0.00 ? 111 DA  B P      2  
ATOM   2271  O OP1    . DA  A 1 11 ? 2.430   -15.964 -11.320 1.00 0.00 ? 111 DA  B OP1    2  
ATOM   2272  O OP2    . DA  A 1 11 ? 0.066   -16.592 -12.081 1.00 0.00 ? 111 DA  B OP2    2  
ATOM   2273  O "O5'"  . DA  A 1 11 ? 0.513   -15.920 -9.710  1.00 0.00 ? 111 DA  B "O5'"  2  
ATOM   2274  C "C5'"  . DA  A 1 11 ? 1.338   -15.426 -8.652  1.00 0.00 ? 111 DA  B "C5'"  2  
ATOM   2275  C "C4'"  . DA  A 1 11 ? 1.174   -16.257 -7.385  1.00 0.00 ? 111 DA  B "C4'"  2  
ATOM   2276  O "O4'"  . DA  A 1 11 ? 0.055   -15.780 -6.604  1.00 0.00 ? 111 DA  B "O4'"  2  
ATOM   2277  C "C3'"  . DA  A 1 11 ? 0.925   -17.717 -7.736  1.00 0.00 ? 111 DA  B "C3'"  2  
ATOM   2278  O "O3'"  . DA  A 1 11 ? 1.930   -18.559 -7.164  1.00 0.00 ? 111 DA  B "O3'"  2  
ATOM   2279  C "C2'"  . DA  A 1 11 ? -0.436  -18.051 -7.183  1.00 0.00 ? 111 DA  B "C2'"  2  
ATOM   2280  C "C1'"  . DA  A 1 11 ? -0.916  -16.833 -6.419  1.00 0.00 ? 111 DA  B "C1'"  2  
ATOM   2281  N N9     . DA  A 1 11 ? -2.239  -16.420 -6.898  1.00 0.00 ? 111 DA  B N9     2  
ATOM   2282  C C8     . DA  A 1 11 ? -2.691  -16.324 -8.162  1.00 0.00 ? 111 DA  B C8     2  
ATOM   2283  N N7     . DA  A 1 11 ? -3.915  -15.947 -8.335  1.00 0.00 ? 111 DA  B N7     2  
ATOM   2284  C C5     . DA  A 1 11 ? -4.340  -15.771 -7.013  1.00 0.00 ? 111 DA  B C5     2  
ATOM   2285  C C6     . DA  A 1 11 ? -5.559  -15.376 -6.452  1.00 0.00 ? 111 DA  B C6     2  
ATOM   2286  N N6     . DA  A 1 11 ? -6.635  -15.067 -7.179  1.00 0.00 ? 111 DA  B N6     2  
ATOM   2287  N N1     . DA  A 1 11 ? -5.630  -15.313 -5.111  1.00 0.00 ? 111 DA  B N1     2  
ATOM   2288  C C2     . DA  A 1 11 ? -4.568  -15.616 -4.363  1.00 0.00 ? 111 DA  B C2     2  
ATOM   2289  N N3     . DA  A 1 11 ? -3.370  -16.001 -4.788  1.00 0.00 ? 111 DA  B N3     2  
ATOM   2290  C C4     . DA  A 1 11 ? -3.323  -16.058 -6.134  1.00 0.00 ? 111 DA  B C4     2  
ATOM   2291  H "H5'"  . DA  A 1 11 ? 1.064   -14.393 -8.438  1.00 0.00 ? 111 DA  B "H5'"  2  
ATOM   2292  H "H5''" . DA  A 1 11 ? 2.381   -15.460 -8.968  1.00 0.00 ? 111 DA  B "H5''" 2  
ATOM   2293  H "H4'"  . DA  A 1 11 ? 2.083   -16.184 -6.787  1.00 0.00 ? 111 DA  B "H4'"  2  
ATOM   2294  H "H3'"  . DA  A 1 11 ? 0.915   -17.833 -8.822  1.00 0.00 ? 111 DA  B "H3'"  2  
ATOM   2295  H "H2'"  . DA  A 1 11 ? -1.124  -18.270 -8.000  1.00 0.00 ? 111 DA  B "H2'"  2  
ATOM   2296  H "H2''" . DA  A 1 11 ? -0.369  -18.905 -6.517  1.00 0.00 ? 111 DA  B "H2''" 2  
ATOM   2297  H "H1'"  . DA  A 1 11 ? -0.985  -17.076 -5.364  1.00 0.00 ? 111 DA  B "H1'"  2  
ATOM   2298  H H8     . DA  A 1 11 ? -2.046  -16.574 -9.000  1.00 0.00 ? 111 DA  B H8     2  
ATOM   2299  H H61    . DA  A 1 11 ? -7.491  -14.789 -6.720  1.00 0.00 ? 111 DA  B H61    2  
ATOM   2300  H H62    . DA  A 1 11 ? -6.592  -15.113 -8.187  1.00 0.00 ? 111 DA  B H62    2  
ATOM   2301  H H2     . DA  A 1 11 ? -4.697  -15.539 -3.283  1.00 0.00 ? 111 DA  B H2     2  
ATOM   2302  P P      . DC  A 1 12 ? 2.384   -19.912 -7.910  1.00 0.00 ? 112 DC  B P      2  
ATOM   2303  O OP1    . DC  A 1 12 ? 3.859   -19.906 -8.027  1.00 0.00 ? 112 DC  B OP1    2  
ATOM   2304  O OP2    . DC  A 1 12 ? 1.548   -20.076 -9.120  1.00 0.00 ? 112 DC  B OP2    2  
ATOM   2305  O "O5'"  . DC  A 1 12 ? 1.967   -21.052 -6.852  1.00 0.00 ? 112 DC  B "O5'"  2  
ATOM   2306  C "C5'"  . DC  A 1 12 ? 2.123   -20.833 -5.448  1.00 0.00 ? 112 DC  B "C5'"  2  
ATOM   2307  C "C4'"  . DC  A 1 12 ? 1.073   -21.587 -4.641  1.00 0.00 ? 112 DC  B "C4'"  2  
ATOM   2308  O "O4'"  . DC  A 1 12 ? -0.151  -20.830 -4.558  1.00 0.00 ? 112 DC  B "O4'"  2  
ATOM   2309  C "C3'"  . DC  A 1 12 ? 0.759   -22.930 -5.284  1.00 0.00 ? 112 DC  B "C3'"  2  
ATOM   2310  O "O3'"  . DC  A 1 12 ? 1.234   -24.009 -4.471  1.00 0.00 ? 112 DC  B "O3'"  2  
ATOM   2311  C "C2'"  . DC  A 1 12 ? -0.740  -22.980 -5.424  1.00 0.00 ? 112 DC  B "C2'"  2  
ATOM   2312  C "C1'"  . DC  A 1 12 ? -1.278  -21.676 -4.859  1.00 0.00 ? 112 DC  B "C1'"  2  
ATOM   2313  N N1     . DC  A 1 12 ? -2.188  -21.021 -5.819  1.00 0.00 ? 112 DC  B N1     2  
ATOM   2314  C C2     . DC  A 1 12 ? -3.427  -20.612 -5.350  1.00 0.00 ? 112 DC  B C2     2  
ATOM   2315  O O2     . DC  A 1 12 ? -3.732  -20.799 -4.189  1.00 0.00 ? 112 DC  B O2     2  
ATOM   2316  N N3     . DC  A 1 12 ? -4.278  -20.005 -6.223  1.00 0.00 ? 112 DC  B N3     2  
ATOM   2317  C C4     . DC  A 1 12 ? -3.928  -19.807 -7.500  1.00 0.00 ? 112 DC  B C4     2  
ATOM   2318  N N4     . DC  A 1 12 ? -4.786  -19.208 -8.327  1.00 0.00 ? 112 DC  B N4     2  
ATOM   2319  C C5     . DC  A 1 12 ? -2.650  -20.228 -7.987  1.00 0.00 ? 112 DC  B C5     2  
ATOM   2320  C C6     . DC  A 1 12 ? -1.816  -20.828 -7.117  1.00 0.00 ? 112 DC  B C6     2  
ATOM   2321  H "H5'"  . DC  A 1 12 ? 2.032   -19.766 -5.242  1.00 0.00 ? 112 DC  B "H5'"  2  
ATOM   2322  H "H5''" . DC  A 1 12 ? 3.115   -21.169 -5.144  1.00 0.00 ? 112 DC  B "H5''" 2  
ATOM   2323  H "H4'"  . DC  A 1 12 ? 1.448   -21.758 -3.633  1.00 0.00 ? 112 DC  B "H4'"  2  
ATOM   2324  H "H3'"  . DC  A 1 12 ? 1.219   -22.977 -6.273  1.00 0.00 ? 112 DC  B "H3'"  2  
ATOM   2325  H "HO3'" . DC  A 1 12 ? 0.497   -24.305 -3.932  1.00 0.00 ? 112 DC  B "HO3'" 2  
ATOM   2326  H "H2'"  . DC  A 1 12 ? -1.013  -23.073 -6.475  1.00 0.00 ? 112 DC  B "H2'"  2  
ATOM   2327  H "H2''" . DC  A 1 12 ? -1.139  -23.822 -4.859  1.00 0.00 ? 112 DC  B "H2''" 2  
ATOM   2328  H "H1'"  . DC  A 1 12 ? -1.818  -21.884 -3.938  1.00 0.00 ? 112 DC  B "H1'"  2  
ATOM   2329  H H41    . DC  A 1 12 ? -5.688  -18.908 -7.988  1.00 0.00 ? 112 DC  B H41    2  
ATOM   2330  H H42    . DC  A 1 12 ? -4.531  -19.052 -9.292  1.00 0.00 ? 112 DC  B H42    2  
ATOM   2331  H H5     . DC  A 1 12 ? -2.362  -20.069 -9.026  1.00 0.00 ? 112 DC  B H5     2  
ATOM   2332  H H6     . DC  A 1 12 ? -0.836  -21.166 -7.452  1.00 0.00 ? 112 DC  B H6     2  
ATOM   2333  O "O5'"  . DG  B 1 1  ? -14.216 -19.426 -4.460  1.00 0.00 ? 113 DG  C "O5'"  2  
ATOM   2334  C "C5'"  . DG  B 1 1  ? -14.267 -19.807 -3.082  1.00 0.00 ? 113 DG  C "C5'"  2  
ATOM   2335  C "C4'"  . DG  B 1 1  ? -13.168 -19.127 -2.272  1.00 0.00 ? 113 DG  C "C4'"  2  
ATOM   2336  O "O4'"  . DG  B 1 1  ? -11.872 -19.375 -2.855  1.00 0.00 ? 113 DG  C "O4'"  2  
ATOM   2337  C "C3'"  . DG  B 1 1  ? -13.387 -17.623 -2.220  1.00 0.00 ? 113 DG  C "C3'"  2  
ATOM   2338  O "O3'"  . DG  B 1 1  ? -13.732 -17.205 -0.895  1.00 0.00 ? 113 DG  C "O3'"  2  
ATOM   2339  C "C2'"  . DG  B 1 1  ? -12.089 -17.001 -2.663  1.00 0.00 ? 113 DG  C "C2'"  2  
ATOM   2340  C "C1'"  . DG  B 1 1  ? -11.133 -18.144 -2.958  1.00 0.00 ? 113 DG  C "C1'"  2  
ATOM   2341  N N9     . DG  B 1 1  ? -10.532 -18.002 -4.295  1.00 0.00 ? 113 DG  C N9     2  
ATOM   2342  C C8     . DG  B 1 1  ? -11.052 -17.456 -5.417  1.00 0.00 ? 113 DG  C C8     2  
ATOM   2343  N N7     . DG  B 1 1  ? -10.319 -17.452 -6.479  1.00 0.00 ? 113 DG  C N7     2  
ATOM   2344  C C5     . DG  B 1 1  ? -9.152  -18.074 -6.021  1.00 0.00 ? 113 DG  C C5     2  
ATOM   2345  C C6     . DG  B 1 1  ? -7.949  -18.375 -6.712  1.00 0.00 ? 113 DG  C C6     2  
ATOM   2346  O O6     . DG  B 1 1  ? -7.671  -18.152 -7.873  1.00 0.00 ? 113 DG  C O6     2  
ATOM   2347  N N1     . DG  B 1 1  ? -7.027  -19.001 -5.882  1.00 0.00 ? 113 DG  C N1     2  
ATOM   2348  C C2     . DG  B 1 1  ? -7.234  -19.305 -4.551  1.00 0.00 ? 113 DG  C C2     2  
ATOM   2349  N N2     . DG  B 1 1  ? -6.226  -19.909 -3.921  1.00 0.00 ? 113 DG  C N2     2  
ATOM   2350  N N3     . DG  B 1 1  ? -8.363  -19.025 -3.892  1.00 0.00 ? 113 DG  C N3     2  
ATOM   2351  C C4     . DG  B 1 1  ? -9.276  -18.414 -4.681  1.00 0.00 ? 113 DG  C C4     2  
ATOM   2352  H "H5'"  . DG  B 1 1  ? -14.149 -20.887 -3.007  1.00 0.00 ? 113 DG  C "H5'"  2  
ATOM   2353  H "H5''" . DG  B 1 1  ? -15.237 -19.525 -2.672  1.00 0.00 ? 113 DG  C "H5''" 2  
ATOM   2354  H "H4'"  . DG  B 1 1  ? -13.175 -19.521 -1.258  1.00 0.00 ? 113 DG  C "H4'"  2  
ATOM   2355  H "H3'"  . DG  B 1 1  ? -14.180 -17.346 -2.917  1.00 0.00 ? 113 DG  C "H3'"  2  
ATOM   2356  H "H2'"  . DG  B 1 1  ? -12.249 -16.406 -3.562  1.00 0.00 ? 113 DG  C "H2'"  2  
ATOM   2357  H "H2''" . DG  B 1 1  ? -11.685 -16.375 -1.869  1.00 0.00 ? 113 DG  C "H2''" 2  
ATOM   2358  H "H1'"  . DG  B 1 1  ? -10.346 -18.143 -2.213  1.00 0.00 ? 113 DG  C "H1'"  2  
ATOM   2359  H H8     . DG  B 1 1  ? -12.054 -17.033 -5.419  1.00 0.00 ? 113 DG  C H8     2  
ATOM   2360  H H1     . DG  B 1 1  ? -6.170  -19.240 -6.294  1.00 0.00 ? 113 DG  C H1     2  
ATOM   2361  H H21    . DG  B 1 1  ? -5.373  -20.120 -4.419  1.00 0.00 ? 113 DG  C H21    2  
ATOM   2362  H H22    . DG  B 1 1  ? -6.317  -20.157 -2.946  1.00 0.00 ? 113 DG  C H22    2  
ATOM   2363  H "HO5'" . DG  B 1 1  ? -13.597 -18.695 -4.531  1.00 0.00 ? 113 DG  C "HO5'" 2  
ATOM   2364  P P      . DT  B 1 2  ? -13.628 -15.655 -0.473  1.00 0.00 ? 114 DT  C P      2  
ATOM   2365  O OP1    . DT  B 1 2  ? -14.633 -15.393 0.580   1.00 0.00 ? 114 DT  C OP1    2  
ATOM   2366  O OP2    . DT  B 1 2  ? -13.620 -14.838 -1.707  1.00 0.00 ? 114 DT  C OP2    2  
ATOM   2367  O "O5'"  . DT  B 1 2  ? -12.165 -15.572 0.195   1.00 0.00 ? 114 DT  C "O5'"  2  
ATOM   2368  C "C5'"  . DT  B 1 2  ? -11.482 -16.763 0.597   1.00 0.00 ? 114 DT  C "C5'"  2  
ATOM   2369  C "C4'"  . DT  B 1 2  ? -10.044 -16.472 1.018   1.00 0.00 ? 114 DT  C "C4'"  2  
ATOM   2370  O "O4'"  . DT  B 1 2  ? -9.141  -16.657 -0.094  1.00 0.00 ? 114 DT  C "O4'"  2  
ATOM   2371  C "C3'"  . DT  B 1 2  ? -9.908  -15.039 1.511   1.00 0.00 ? 114 DT  C "C3'"  2  
ATOM   2372  O "O3'"  . DT  B 1 2  ? -9.375  -15.015 2.842   1.00 0.00 ? 114 DT  C "O3'"  2  
ATOM   2373  C "C2'"  . DT  B 1 2  ? -8.980  -14.353 0.537   1.00 0.00 ? 114 DT  C "C2'"  2  
ATOM   2374  C "C1'"  . DT  B 1 2  ? -8.473  -15.420 -0.417  1.00 0.00 ? 114 DT  C "C1'"  2  
ATOM   2375  N N1     . DT  B 1 2  ? -8.728  -15.045 -1.821  1.00 0.00 ? 114 DT  C N1     2  
ATOM   2376  C C2     . DT  B 1 2  ? -7.680  -15.176 -2.711  1.00 0.00 ? 114 DT  C C2     2  
ATOM   2377  O O2     . DT  B 1 2  ? -6.579  -15.552 -2.363  1.00 0.00 ? 114 DT  C O2     2  
ATOM   2378  N N3     . DT  B 1 2  ? -7.958  -14.851 -4.026  1.00 0.00 ? 114 DT  C N3     2  
ATOM   2379  C C4     . DT  B 1 2  ? -9.173  -14.413 -4.519  1.00 0.00 ? 114 DT  C C4     2  
ATOM   2380  O O4     . DT  B 1 2  ? -9.306  -14.157 -5.699  1.00 0.00 ? 114 DT  C O4     2  
ATOM   2381  C C5     . DT  B 1 2  ? -10.209 -14.304 -3.514  1.00 0.00 ? 114 DT  C C5     2  
ATOM   2382  C C7     . DT  B 1 2  ? -11.600 -13.828 -3.919  1.00 0.00 ? 114 DT  C C7     2  
ATOM   2383  C C6     . DT  B 1 2  ? -9.963  -14.616 -2.225  1.00 0.00 ? 114 DT  C C6     2  
ATOM   2384  H "H5'"  . DT  B 1 2  ? -11.473 -17.467 -0.234  1.00 0.00 ? 114 DT  C "H5'"  2  
ATOM   2385  H "H5''" . DT  B 1 2  ? -12.013 -17.211 1.436   1.00 0.00 ? 114 DT  C "H5''" 2  
ATOM   2386  H "H4'"  . DT  B 1 2  ? -9.762  -17.153 1.821   1.00 0.00 ? 114 DT  C "H4'"  2  
ATOM   2387  H "H3'"  . DT  B 1 2  ? -10.884 -14.550 1.490   1.00 0.00 ? 114 DT  C "H3'"  2  
ATOM   2388  H "H2'"  . DT  B 1 2  ? -9.522  -13.586 -0.016  1.00 0.00 ? 114 DT  C "H2'"  2  
ATOM   2389  H "H2''" . DT  B 1 2  ? -8.144  -13.905 1.071   1.00 0.00 ? 114 DT  C "H2''" 2  
ATOM   2390  H "H1'"  . DT  B 1 2  ? -7.400  -15.544 -0.273  1.00 0.00 ? 114 DT  C "H1'"  2  
ATOM   2391  H H3     . DT  B 1 2  ? -7.224  -14.939 -4.669  1.00 0.00 ? 114 DT  C H3     2  
ATOM   2392  H H71    . DT  B 1 2  ? -12.089 -14.600 -4.516  1.00 0.00 ? 114 DT  C H71    2  
ATOM   2393  H H72    . DT  B 1 2  ? -12.191 -13.633 -3.025  1.00 0.00 ? 114 DT  C H72    2  
ATOM   2394  H H73    . DT  B 1 2  ? -11.516 -12.914 -4.506  1.00 0.00 ? 114 DT  C H73    2  
ATOM   2395  H H6     . DT  B 1 2  ? -10.763 -14.525 -1.491  1.00 0.00 ? 114 DT  C H6     2  
ATOM   2396  P P      . DA  B 1 3  ? -8.716  -13.676 3.446   1.00 0.00 ? 115 DA  C P      2  
ATOM   2397  O OP1    . DA  B 1 3  ? -8.259  -13.967 4.823   1.00 0.00 ? 115 DA  C OP1    2  
ATOM   2398  O OP2    . DA  B 1 3  ? -9.642  -12.549 3.198   1.00 0.00 ? 115 DA  C OP2    2  
ATOM   2399  O "O5'"  . DA  B 1 3  ? -7.417  -13.475 2.516   1.00 0.00 ? 115 DA  C "O5'"  2  
ATOM   2400  C "C5'"  . DA  B 1 3  ? -6.197  -14.164 2.804   1.00 0.00 ? 115 DA  C "C5'"  2  
ATOM   2401  C "C4'"  . DA  B 1 3  ? -4.991  -13.400 2.268   1.00 0.00 ? 115 DA  C "C4'"  2  
ATOM   2402  O "O4'"  . DA  B 1 3  ? -4.878  -13.566 0.840   1.00 0.00 ? 115 DA  C "O4'"  2  
ATOM   2403  C "C3'"  . DA  B 1 3  ? -5.124  -11.916 2.568   1.00 0.00 ? 115 DA  C "C3'"  2  
ATOM   2404  O "O3'"  . DA  B 1 3  ? -4.084  -11.480 3.448   1.00 0.00 ? 115 DA  C "O3'"  2  
ATOM   2405  C "C2'"  . DA  B 1 3  ? -5.036  -11.217 1.239   1.00 0.00 ? 115 DA  C "C2'"  2  
ATOM   2406  C "C1'"  . DA  B 1 3  ? -4.747  -12.284 0.200   1.00 0.00 ? 115 DA  C "C1'"  2  
ATOM   2407  N N9     . DA  B 1 3  ? -5.677  -12.164 -0.933  1.00 0.00 ? 115 DA  C N9     2  
ATOM   2408  C C8     . DA  B 1 3  ? -7.013  -11.961 -0.921  1.00 0.00 ? 115 DA  C C8     2  
ATOM   2409  N N7     . DA  B 1 3  ? -7.619  -11.905 -2.059  1.00 0.00 ? 115 DA  C N7     2  
ATOM   2410  C C5     . DA  B 1 3  ? -6.558  -12.094 -2.951  1.00 0.00 ? 115 DA  C C5     2  
ATOM   2411  C C6     . DA  B 1 3  ? -6.493  -12.148 -4.346  1.00 0.00 ? 115 DA  C C6     2  
ATOM   2412  N N6     . DA  B 1 3  ? -7.560  -12.009 -5.132  1.00 0.00 ? 115 DA  C N6     2  
ATOM   2413  N N1     . DA  B 1 3  ? -5.286  -12.348 -4.901  1.00 0.00 ? 115 DA  C N1     2  
ATOM   2414  C C2     . DA  B 1 3  ? -4.203  -12.486 -4.135  1.00 0.00 ? 115 DA  C C2     2  
ATOM   2415  N N3     . DA  B 1 3  ? -4.149  -12.452 -2.806  1.00 0.00 ? 115 DA  C N3     2  
ATOM   2416  C C4     . DA  B 1 3  ? -5.372  -12.252 -2.272  1.00 0.00 ? 115 DA  C C4     2  
ATOM   2417  H "H5'"  . DA  B 1 3  ? -6.227  -15.152 2.345   1.00 0.00 ? 115 DA  C "H5'"  2  
ATOM   2418  H "H5''" . DA  B 1 3  ? -6.096  -14.275 3.883   1.00 0.00 ? 115 DA  C "H5''" 2  
ATOM   2419  H "H4'"  . DA  B 1 3  ? -4.085  -13.777 2.737   1.00 0.00 ? 115 DA  C "H4'"  2  
ATOM   2420  H "H3'"  . DA  B 1 3  ? -6.100  -11.720 3.018   1.00 0.00 ? 115 DA  C "H3'"  2  
ATOM   2421  H "H2'"  . DA  B 1 3  ? -5.982  -10.727 1.013   1.00 0.00 ? 115 DA  C "H2'"  2  
ATOM   2422  H "H2''" . DA  B 1 3  ? -4.234  -10.485 1.253   1.00 0.00 ? 115 DA  C "H2''" 2  
ATOM   2423  H "H1'"  . DA  B 1 3  ? -3.727  -12.170 -0.156  1.00 0.00 ? 115 DA  C "H1'"  2  
ATOM   2424  H H8     . DA  B 1 3  ? -7.553  -11.839 0.017   1.00 0.00 ? 115 DA  C H8     2  
ATOM   2425  H H61    . DA  B 1 3  ? -7.458  -12.056 -6.135  1.00 0.00 ? 115 DA  C H61    2  
ATOM   2426  H H62    . DA  B 1 3  ? -8.471  -11.855 -4.724  1.00 0.00 ? 115 DA  C H62    2  
ATOM   2427  H H2     . DA  B 1 3  ? -3.258  -12.644 -4.657  1.00 0.00 ? 115 DA  C H2     2  
ATOM   2428  P P      . DT  B 1 4  ? -3.781  -9.912  3.645   1.00 0.00 ? 116 DT  C P      2  
ATOM   2429  O OP1    . DT  B 1 4  ? -3.304  -9.701  5.029   1.00 0.00 ? 116 DT  C OP1    2  
ATOM   2430  O OP2    . DT  B 1 4  ? -4.946  -9.148  3.141   1.00 0.00 ? 116 DT  C OP2    2  
ATOM   2431  O "O5'"  . DT  B 1 4  ? -2.547  -9.665  2.641   1.00 0.00 ? 116 DT  C "O5'"  2  
ATOM   2432  C "C5'"  . DT  B 1 4  ? -1.812  -10.768 2.105   1.00 0.00 ? 116 DT  C "C5'"  2  
ATOM   2433  C "C4'"  . DT  B 1 4  ? -1.000  -10.358 0.879   1.00 0.00 ? 116 DT  C "C4'"  2  
ATOM   2434  O "O4'"  . DT  B 1 4  ? -1.740  -10.609 -0.333  1.00 0.00 ? 116 DT  C "O4'"  2  
ATOM   2435  C "C3'"  . DT  B 1 4  ? -0.659  -8.874  0.931   1.00 0.00 ? 116 DT  C "C3'"  2  
ATOM   2436  O "O3'"  . DT  B 1 4  ? 0.759   -8.684  0.999   1.00 0.00 ? 116 DT  C "O3'"  2  
ATOM   2437  C "C2'"  . DT  B 1 4  ? -1.229  -8.280  -0.331  1.00 0.00 ? 116 DT  C "C2'"  2  
ATOM   2438  C "C1'"  . DT  B 1 4  ? -1.737  -9.435  -1.166  1.00 0.00 ? 116 DT  C "C1'"  2  
ATOM   2439  N N1     . DT  B 1 4  ? -3.084  -9.149  -1.682  1.00 0.00 ? 116 DT  C N1     2  
ATOM   2440  C C2     . DT  B 1 4  ? -3.268  -9.197  -3.048  1.00 0.00 ? 116 DT  C C2     2  
ATOM   2441  O O2     . DT  B 1 4  ? -2.361  -9.449  -3.816  1.00 0.00 ? 116 DT  C O2     2  
ATOM   2442  N N3     . DT  B 1 4  ? -4.550  -8.939  -3.493  1.00 0.00 ? 116 DT  C N3     2  
ATOM   2443  C C4     . DT  B 1 4  ? -5.645  -8.644  -2.700  1.00 0.00 ? 116 DT  C C4     2  
ATOM   2444  O O4     . DT  B 1 4  ? -6.734  -8.433  -3.198  1.00 0.00 ? 116 DT  C O4     2  
ATOM   2445  C C5     . DT  B 1 4  ? -5.353  -8.617  -1.284  1.00 0.00 ? 116 DT  C C5     2  
ATOM   2446  C C7     . DT  B 1 4  ? -6.468  -8.302  -0.293  1.00 0.00 ? 116 DT  C C7     2  
ATOM   2447  C C6     . DT  B 1 4  ? -4.109  -8.863  -0.828  1.00 0.00 ? 116 DT  C C6     2  
ATOM   2448  H "H5'"  . DT  B 1 4  ? -2.509  -11.556 1.822   1.00 0.00 ? 116 DT  C "H5'"  2  
ATOM   2449  H "H5''" . DT  B 1 4  ? -1.134  -11.151 2.869   1.00 0.00 ? 116 DT  C "H5''" 2  
ATOM   2450  H "H4'"  . DT  B 1 4  ? -0.076  -10.931 0.850   1.00 0.00 ? 116 DT  C "H4'"  2  
ATOM   2451  H "H3'"  . DT  B 1 4  ? -1.141  -8.419  1.799   1.00 0.00 ? 116 DT  C "H3'"  2  
ATOM   2452  H "H2'"  . DT  B 1 4  ? -2.052  -7.608  -0.086  1.00 0.00 ? 116 DT  C "H2'"  2  
ATOM   2453  H "H2''" . DT  B 1 4  ? -0.462  -7.741  -0.875  1.00 0.00 ? 116 DT  C "H2''" 2  
ATOM   2454  H "H1'"  . DT  B 1 4  ? -1.059  -9.597  -2.000  1.00 0.00 ? 116 DT  C "H1'"  2  
ATOM   2455  H H3     . DT  B 1 4  ? -4.697  -8.967  -4.462  1.00 0.00 ? 116 DT  C H3     2  
ATOM   2456  H H71    . DT  B 1 4  ? -6.930  -9.231  0.041   1.00 0.00 ? 116 DT  C H71    2  
ATOM   2457  H H72    . DT  B 1 4  ? -6.053  -7.773  0.565   1.00 0.00 ? 116 DT  C H72    2  
ATOM   2458  H H73    . DT  B 1 4  ? -7.218  -7.676  -0.778  1.00 0.00 ? 116 DT  C H73    2  
ATOM   2459  H H6     . DT  B 1 4  ? -3.910  -8.819  0.242   1.00 0.00 ? 116 DT  C H6     2  
ATOM   2460  P P      . DC  B 1 5  ? 1.431   -7.306  0.507   1.00 0.00 ? 117 DC  C P      2  
ATOM   2461  O OP1    . DC  B 1 5  ? 2.819   -7.267  1.010   1.00 0.00 ? 117 DC  C OP1    2  
ATOM   2462  O OP2    . DC  B 1 5  ? 0.500   -6.198  0.816   1.00 0.00 ? 117 DC  C OP2    2  
ATOM   2463  O "O5'"  . DC  B 1 5  ? 1.484   -7.492  -1.090  1.00 0.00 ? 117 DC  C "O5'"  2  
ATOM   2464  C "C5'"  . DC  B 1 5  ? 2.743   -7.569  -1.766  1.00 0.00 ? 117 DC  C "C5'"  2  
ATOM   2465  C "C4'"  . DC  B 1 5  ? 2.673   -6.943  -3.155  1.00 0.00 ? 117 DC  C "C4'"  2  
ATOM   2466  O "O4'"  . DC  B 1 5  ? 1.429   -7.281  -3.805  1.00 0.00 ? 117 DC  C "O4'"  2  
ATOM   2467  C "C3'"  . DC  B 1 5  ? 2.772   -5.431  -3.065  1.00 0.00 ? 117 DC  C "C3'"  2  
ATOM   2468  O "O3'"  . DC  B 1 5  ? 3.902   -4.954  -3.806  1.00 0.00 ? 117 DC  C "O3'"  2  
ATOM   2469  C "C2'"  . DC  B 1 5  ? 1.489   -4.901  -3.642  1.00 0.00 ? 117 DC  C "C2'"  2  
ATOM   2470  C "C1'"  . DC  B 1 5  ? 0.767   -6.083  -4.257  1.00 0.00 ? 117 DC  C "C1'"  2  
ATOM   2471  N N1     . DC  B 1 5  ? -0.655  -6.080  -3.873  1.00 0.00 ? 117 DC  C N1     2  
ATOM   2472  C C2     . DC  B 1 5  ? -1.596  -6.115  -4.891  1.00 0.00 ? 117 DC  C C2     2  
ATOM   2473  O O2     . DC  B 1 5  ? -1.239  -6.156  -6.052  1.00 0.00 ? 117 DC  C O2     2  
ATOM   2474  N N3     . DC  B 1 5  ? -2.914  -6.099  -4.551  1.00 0.00 ? 117 DC  C N3     2  
ATOM   2475  C C4     . DC  B 1 5  ? -3.293  -6.054  -3.267  1.00 0.00 ? 117 DC  C C4     2  
ATOM   2476  N N4     . DC  B 1 5  ? -4.592  -6.044  -2.969  1.00 0.00 ? 117 DC  C N4     2  
ATOM   2477  C C5     . DC  B 1 5  ? -2.322  -6.019  -2.215  1.00 0.00 ? 117 DC  C C5     2  
ATOM   2478  C C6     . DC  B 1 5  ? -1.021  -6.032  -2.564  1.00 0.00 ? 117 DC  C C6     2  
ATOM   2479  H "H5'"  . DC  B 1 5  ? 3.032   -8.616  -1.861  1.00 0.00 ? 117 DC  C "H5'"  2  
ATOM   2480  H "H5''" . DC  B 1 5  ? 3.494   -7.044  -1.176  1.00 0.00 ? 117 DC  C "H5''" 2  
ATOM   2481  H "H4'"  . DC  B 1 5  ? 3.499   -7.310  -3.757  1.00 0.00 ? 117 DC  C "H4'"  2  
ATOM   2482  H "H3'"  . DC  B 1 5  ? 2.856   -5.132  -2.023  1.00 0.00 ? 117 DC  C "H3'"  2  
ATOM   2483  H "H2'"  . DC  B 1 5  ? 0.879   -4.463  -2.851  1.00 0.00 ? 117 DC  C "H2'"  2  
ATOM   2484  H "H2''" . DC  B 1 5  ? 1.702   -4.157  -4.400  1.00 0.00 ? 117 DC  C "H2''" 2  
ATOM   2485  H "H1'"  . DC  B 1 5  ? 0.847   -6.026  -5.338  1.00 0.00 ? 117 DC  C "H1'"  2  
ATOM   2486  H H41    . DC  B 1 5  ? -5.280  -6.069  -3.708  1.00 0.00 ? 117 DC  C H41    2  
ATOM   2487  H H42    . DC  B 1 5  ? -4.889  -6.011  -2.004  1.00 0.00 ? 117 DC  C H42    2  
ATOM   2488  H H5     . DC  B 1 5  ? -2.625  -5.983  -1.168  1.00 0.00 ? 117 DC  C H5     2  
ATOM   2489  H H6     . DC  B 1 5  ? -0.250  -5.994  -1.793  1.00 0.00 ? 117 DC  C H6     2  
HETATM 2490  N N1     . 5CM B 1 6  ? -0.370  -2.217  -7.108  1.00 0.00 ? 118 5CM C N1     2  
HETATM 2491  C C2     . 5CM B 1 6  ? -1.683  -2.087  -7.527  1.00 0.00 ? 118 5CM C C2     2  
HETATM 2492  N N3     . 5CM B 1 6  ? -2.647  -1.899  -6.583  1.00 0.00 ? 118 5CM C N3     2  
HETATM 2493  C C4     . 5CM B 1 6  ? -2.332  -1.840  -5.283  1.00 0.00 ? 118 5CM C C4     2  
HETATM 2494  C C5     . 5CM B 1 6  ? -0.975  -1.973  -4.847  1.00 0.00 ? 118 5CM C C5     2  
HETATM 2495  C C5A    . 5CM B 1 6  ? -0.611  -1.904  -3.367  1.00 0.00 ? 118 5CM C C5A    2  
HETATM 2496  C C6     . 5CM B 1 6  ? -0.032  -2.162  -5.790  1.00 0.00 ? 118 5CM C C6     2  
HETATM 2497  O O2     . 5CM B 1 6  ? -1.953  -2.140  -8.711  1.00 0.00 ? 118 5CM C O2     2  
HETATM 2498  N N4     . 5CM B 1 6  ? -3.299  -1.653  -4.386  1.00 0.00 ? 118 5CM C N4     2  
HETATM 2499  C "C1'"  . 5CM B 1 6  ? 0.659   -2.409  -8.145  1.00 0.00 ? 118 5CM C "C1'"  2  
HETATM 2500  C "C2'"  . 5CM B 1 6  ? 1.797   -1.419  -7.968  1.00 0.00 ? 118 5CM C "C2'"  2  
HETATM 2501  C "C3'"  . 5CM B 1 6  ? 3.071   -2.222  -7.911  1.00 0.00 ? 118 5CM C "C3'"  2  
HETATM 2502  C "C4'"  . 5CM B 1 6  ? 2.642   -3.680  -7.867  1.00 0.00 ? 118 5CM C "C4'"  2  
HETATM 2503  O "O4'"  . 5CM B 1 6  ? 1.214   -3.739  -8.076  1.00 0.00 ? 118 5CM C "O4'"  2  
HETATM 2504  O "O3'"  . 5CM B 1 6  ? 3.893   -1.973  -9.059  1.00 0.00 ? 118 5CM C "O3'"  2  
HETATM 2505  C "C5'"  . 5CM B 1 6  ? 3.013   -4.302  -6.525  1.00 0.00 ? 118 5CM C "C5'"  2  
HETATM 2506  O "O5'"  . 5CM B 1 6  ? 2.962   -3.338  -5.471  1.00 0.00 ? 118 5CM C "O5'"  2  
HETATM 2507  P P      . 5CM B 1 6  ? 4.006   -3.412  -4.250  1.00 0.00 ? 118 5CM C P      2  
HETATM 2508  O OP1    . 5CM B 1 6  ? 5.365   -3.175  -4.788  1.00 0.00 ? 118 5CM C OP1    2  
HETATM 2509  O OP2    . 5CM B 1 6  ? 3.491   -2.574  -3.145  1.00 0.00 ? 118 5CM C OP2    2  
HETATM 2510  H H5A1   . 5CM B 1 6  ? 0.472   -1.845  -3.262  1.00 0.00 ? 118 5CM C H5A1   2  
HETATM 2511  H H5A2   . 5CM B 1 6  ? -1.068  -1.020  -2.922  1.00 0.00 ? 118 5CM C H5A2   2  
HETATM 2512  H H5A3   . 5CM B 1 6  ? -0.978  -2.797  -2.861  1.00 0.00 ? 118 5CM C H5A3   2  
HETATM 2513  H H6     . 5CM B 1 6  ? 1.011   -2.279  -5.497  1.00 0.00 ? 118 5CM C H6     2  
HETATM 2514  H HN41   . 5CM B 1 6  ? -3.073  -1.607  -3.401  1.00 0.00 ? 118 5CM C HN41   2  
HETATM 2515  H HN42   . 5CM B 1 6  ? -4.258  -1.559  -4.688  1.00 0.00 ? 118 5CM C HN42   2  
HETATM 2516  H "H1'"  . 5CM B 1 6  ? 0.208   -2.260  -9.125  1.00 0.00 ? 118 5CM C "H1'"  2  
HETATM 2517  H "H2'"  . 5CM B 1 6  ? 1.666   -0.865  -7.037  1.00 0.00 ? 118 5CM C "H2'"  2  
HETATM 2518  H "H2''" . 5CM B 1 6  ? 1.823   -0.730  -8.809  1.00 0.00 ? 118 5CM C "H2''" 2  
HETATM 2519  H "H3'"  . 5CM B 1 6  ? 3.619   -1.975  -7.000  1.00 0.00 ? 118 5CM C "H3'"  2  
HETATM 2520  H "H4'"  . 5CM B 1 6  ? 3.142   -4.227  -8.666  1.00 0.00 ? 118 5CM C "H4'"  2  
HETATM 2521  H "H5'"  . 5CM B 1 6  ? 2.316   -5.110  -6.303  1.00 0.00 ? 118 5CM C "H5'"  2  
HETATM 2522  H "H5''" . 5CM B 1 6  ? 4.022   -4.708  -6.588  1.00 0.00 ? 118 5CM C "H5''" 2  
ATOM   2523  P P      . DG  B 1 7  ? 4.114   -0.475  -9.606  1.00 0.00 ? 119 DG  C P      2  
ATOM   2524  O OP1    . DG  B 1 7  ? 5.038   -0.534  -10.760 1.00 0.00 ? 119 DG  C OP1    2  
ATOM   2525  O OP2    . DG  B 1 7  ? 4.429   0.398   -8.452  1.00 0.00 ? 119 DG  C OP2    2  
ATOM   2526  O "O5'"  . DG  B 1 7  ? 2.651   -0.083  -10.150 1.00 0.00 ? 119 DG  C "O5'"  2  
ATOM   2527  C "C5'"  . DG  B 1 7  ? 2.064   -0.796  -11.244 1.00 0.00 ? 119 DG  C "C5'"  2  
ATOM   2528  C "C4'"  . DG  B 1 7  ? 1.187   0.117   -12.098 1.00 0.00 ? 119 DG  C "C4'"  2  
ATOM   2529  O "O4'"  . DG  B 1 7  ? -0.169  0.133   -11.597 1.00 0.00 ? 119 DG  C "O4'"  2  
ATOM   2530  C "C3'"  . DG  B 1 7  ? 1.723   1.541   -12.074 1.00 0.00 ? 119 DG  C "C3'"  2  
ATOM   2531  O "O3'"  . DG  B 1 7  ? 1.986   2.008   -13.401 1.00 0.00 ? 119 DG  C "O3'"  2  
ATOM   2532  C "C2'"  . DG  B 1 7  ? 0.656   2.372   -11.411 1.00 0.00 ? 119 DG  C "C2'"  2  
ATOM   2533  C "C1'"  . DG  B 1 7  ? -0.541  1.466   -11.190 1.00 0.00 ? 119 DG  C "C1'"  2  
ATOM   2534  N N9     . DG  B 1 7  ? -0.945  1.492   -9.780  1.00 0.00 ? 119 DG  C N9     2  
ATOM   2535  C C8     . DG  B 1 7  ? -0.171  1.449   -8.679  1.00 0.00 ? 119 DG  C C8     2  
ATOM   2536  N N7     . DG  B 1 7  ? -0.756  1.509   -7.529  1.00 0.00 ? 119 DG  C N7     2  
ATOM   2537  C C5     . DG  B 1 7  ? -2.101  1.605   -7.902  1.00 0.00 ? 119 DG  C C5     2  
ATOM   2538  C C6     . DG  B 1 7  ? -3.265  1.708   -7.096  1.00 0.00 ? 119 DG  C C6     2  
ATOM   2539  O O6     . DG  B 1 7  ? -3.342  1.728   -5.883  1.00 0.00 ? 119 DG  C O6     2  
ATOM   2540  N N1     . DG  B 1 7  ? -4.416  1.786   -7.870  1.00 0.00 ? 119 DG  C N1     2  
ATOM   2541  C C2     . DG  B 1 7  ? -4.448  1.768   -9.250  1.00 0.00 ? 119 DG  C C2     2  
ATOM   2542  N N2     . DG  B 1 7  ? -5.654  1.856   -9.813  1.00 0.00 ? 119 DG  C N2     2  
ATOM   2543  N N3     . DG  B 1 7  ? -3.357  1.671   -10.017 1.00 0.00 ? 119 DG  C N3     2  
ATOM   2544  C C4     . DG  B 1 7  ? -2.224  1.595   -9.284  1.00 0.00 ? 119 DG  C C4     2  
ATOM   2545  H "H5'"  . DG  B 1 7  ? 1.454   -1.610  -10.854 1.00 0.00 ? 119 DG  C "H5'"  2  
ATOM   2546  H "H5''" . DG  B 1 7  ? 2.858   -1.210  -11.866 1.00 0.00 ? 119 DG  C "H5''" 2  
ATOM   2547  H "H4'"  . DG  B 1 7  ? 1.184   -0.248  -13.124 1.00 0.00 ? 119 DG  C "H4'"  2  
ATOM   2548  H "H3'"  . DG  B 1 7  ? 2.637   1.577   -11.477 1.00 0.00 ? 119 DG  C "H3'"  2  
ATOM   2549  H "H2'"  . DG  B 1 7  ? 1.020   2.744   -10.452 1.00 0.00 ? 119 DG  C "H2'"  2  
ATOM   2550  H "H2''" . DG  B 1 7  ? 0.378   3.205   -12.049 1.00 0.00 ? 119 DG  C "H2''" 2  
ATOM   2551  H "H1'"  . DG  B 1 7  ? -1.367  1.812   -11.800 1.00 0.00 ? 119 DG  C "H1'"  2  
ATOM   2552  H H8     . DG  B 1 7  ? 0.909   1.378   -8.766  1.00 0.00 ? 119 DG  C H8     2  
ATOM   2553  H H1     . DG  B 1 7  ? -5.261  1.859   -7.378  1.00 0.00 ? 119 DG  C H1     2  
ATOM   2554  H H21    . DG  B 1 7  ? -6.478  1.930   -9.235  1.00 0.00 ? 119 DG  C H21    2  
ATOM   2555  H H22    . DG  B 1 7  ? -5.743  1.851   -10.820 1.00 0.00 ? 119 DG  C H22    2  
ATOM   2556  P P      . DG  B 1 8  ? 2.211   3.576   -13.688 1.00 0.00 ? 120 DG  C P      2  
ATOM   2557  O OP1    . DG  B 1 8  ? 3.269   3.712   -14.714 1.00 0.00 ? 120 DG  C OP1    2  
ATOM   2558  O OP2    . DG  B 1 8  ? 2.350   4.269   -12.388 1.00 0.00 ? 120 DG  C OP2    2  
ATOM   2559  O "O5'"  . DG  B 1 8  ? 0.810   4.017   -14.347 1.00 0.00 ? 120 DG  C "O5'"  2  
ATOM   2560  C "C5'"  . DG  B 1 8  ? -0.112  3.032   -14.823 1.00 0.00 ? 120 DG  C "C5'"  2  
ATOM   2561  C "C4'"  . DG  B 1 8  ? -1.556  3.507   -14.700 1.00 0.00 ? 120 DG  C "C4'"  2  
ATOM   2562  O "O4'"  . DG  B 1 8  ? -2.003  3.436   -13.331 1.00 0.00 ? 120 DG  C "O4'"  2  
ATOM   2563  C "C3'"  . DG  B 1 8  ? -1.693  4.946   -15.174 1.00 0.00 ? 120 DG  C "C3'"  2  
ATOM   2564  O "O3'"  . DG  B 1 8  ? -2.524  5.013   -16.342 1.00 0.00 ? 120 DG  C "O3'"  2  
ATOM   2565  C "C2'"  . DG  B 1 8  ? -2.303  5.703   -14.019 1.00 0.00 ? 120 DG  C "C2'"  2  
ATOM   2566  C "C1'"  . DG  B 1 8  ? -2.611  4.681   -12.942 1.00 0.00 ? 120 DG  C "C1'"  2  
ATOM   2567  N N9     . DG  B 1 8  ? -2.112  5.121   -11.631 1.00 0.00 ? 120 DG  C N9     2  
ATOM   2568  C C8     . DG  B 1 8  ? -0.844  5.359   -11.238 1.00 0.00 ? 120 DG  C C8     2  
ATOM   2569  N N7     . DG  B 1 8  ? -0.650  5.714   -10.012 1.00 0.00 ? 120 DG  C N7     2  
ATOM   2570  C C5     . DG  B 1 8  ? -1.956  5.716   -9.509  1.00 0.00 ? 120 DG  C C5     2  
ATOM   2571  C C6     . DG  B 1 8  ? -2.428  6.021   -8.204  1.00 0.00 ? 120 DG  C C6     2  
ATOM   2572  O O6     . DG  B 1 8  ? -1.786  6.353   -7.228  1.00 0.00 ? 120 DG  C O6     2  
ATOM   2573  N N1     . DG  B 1 8  ? -3.811  5.901   -8.123  1.00 0.00 ? 120 DG  C N1     2  
ATOM   2574  C C2     . DG  B 1 8  ? -4.640  5.534   -9.164  1.00 0.00 ? 120 DG  C C2     2  
ATOM   2575  N N2     . DG  B 1 8  ? -5.943  5.477   -8.888  1.00 0.00 ? 120 DG  C N2     2  
ATOM   2576  N N3     . DG  B 1 8  ? -4.203  5.245   -10.394 1.00 0.00 ? 120 DG  C N3     2  
ATOM   2577  C C4     . DG  B 1 8  ? -2.859  5.355   -10.498 1.00 0.00 ? 120 DG  C C4     2  
ATOM   2578  H "H5'"  . DG  B 1 8  ? 0.012   2.118   -14.241 1.00 0.00 ? 120 DG  C "H5'"  2  
ATOM   2579  H "H5''" . DG  B 1 8  ? 0.105   2.818   -15.870 1.00 0.00 ? 120 DG  C "H5''" 2  
ATOM   2580  H "H4'"  . DG  B 1 8  ? -2.197  2.873   -15.308 1.00 0.00 ? 120 DG  C "H4'"  2  
ATOM   2581  H "H3'"  . DG  B 1 8  ? -0.705  5.355   -15.395 1.00 0.00 ? 120 DG  C "H3'"  2  
ATOM   2582  H "H2'"  . DG  B 1 8  ? -1.595  6.441   -13.641 1.00 0.00 ? 120 DG  C "H2'"  2  
ATOM   2583  H "H2''" . DG  B 1 8  ? -3.221  6.197   -14.335 1.00 0.00 ? 120 DG  C "H2''" 2  
ATOM   2584  H "H1'"  . DG  B 1 8  ? -3.682  4.545   -12.884 1.00 0.00 ? 120 DG  C "H1'"  2  
ATOM   2585  H H8     . DG  B 1 8  ? -0.018  5.255   -11.935 1.00 0.00 ? 120 DG  C H8     2  
ATOM   2586  H H1     . DG  B 1 8  ? -4.209  6.097   -7.249  1.00 0.00 ? 120 DG  C H1     2  
ATOM   2587  H H21    . DG  B 1 8  ? -6.273  5.694   -7.959  1.00 0.00 ? 120 DG  C H21    2  
ATOM   2588  H H22    . DG  B 1 8  ? -6.601  5.215   -9.609  1.00 0.00 ? 120 DG  C H22    2  
ATOM   2589  P P      . DA  B 1 9  ? -3.294  6.372   -16.736 1.00 0.00 ? 121 DA  C P      2  
ATOM   2590  O OP1    . DA  B 1 9  ? -4.041  6.134   -17.992 1.00 0.00 ? 121 DA  C OP1    2  
ATOM   2591  O OP2    . DA  B 1 9  ? -2.332  7.492   -16.651 1.00 0.00 ? 121 DA  C OP2    2  
ATOM   2592  O "O5'"  . DA  B 1 9  ? -4.359  6.529   -15.538 1.00 0.00 ? 121 DA  C "O5'"  2  
ATOM   2593  C "C5'"  . DA  B 1 9  ? -5.396  5.561   -15.350 1.00 0.00 ? 121 DA  C "C5'"  2  
ATOM   2594  C "C4'"  . DA  B 1 9  ? -6.718  6.227   -14.987 1.00 0.00 ? 121 DA  C "C4'"  2  
ATOM   2595  O "O4'"  . DA  B 1 9  ? -6.793  6.468   -13.564 1.00 0.00 ? 121 DA  C "O4'"  2  
ATOM   2596  C "C3'"  . DA  B 1 9  ? -6.845  7.563   -15.700 1.00 0.00 ? 121 DA  C "C3'"  2  
ATOM   2597  O "O3'"  . DA  B 1 9  ? -8.092  7.648   -16.402 1.00 0.00 ? 121 DA  C "O3'"  2  
ATOM   2598  C "C2'"  . DA  B 1 9  ? -6.755  8.612   -14.622 1.00 0.00 ? 121 DA  C "C2'"  2  
ATOM   2599  C "C1'"  . DA  B 1 9  ? -6.771  7.885   -13.291 1.00 0.00 ? 121 DA  C "C1'"  2  
ATOM   2600  N N9     . DA  B 1 9  ? -5.588  8.245   -12.505 1.00 0.00 ? 121 DA  C N9     2  
ATOM   2601  C C8     . DA  B 1 9  ? -4.306  8.313   -12.901 1.00 0.00 ? 121 DA  C C8     2  
ATOM   2602  N N7     . DA  B 1 9  ? -3.421  8.644   -12.021 1.00 0.00 ? 121 DA  C N7     2  
ATOM   2603  C C5     . DA  B 1 9  ? -4.216  8.826   -10.884 1.00 0.00 ? 121 DA  C C5     2  
ATOM   2604  C C6     . DA  B 1 9  ? -3.919  9.194   -9.567  1.00 0.00 ? 121 DA  C C6     2  
ATOM   2605  N N6     . DA  B 1 9  ? -2.682  9.457   -9.145  1.00 0.00 ? 121 DA  C N6     2  
ATOM   2606  N N1     . DA  B 1 9  ? -4.945  9.280   -8.702  1.00 0.00 ? 121 DA  C N1     2  
ATOM   2607  C C2     . DA  B 1 9  ? -6.192  9.022   -9.104  1.00 0.00 ? 121 DA  C C2     2  
ATOM   2608  N N3     . DA  B 1 9  ? -6.585  8.666   -10.324 1.00 0.00 ? 121 DA  C N3     2  
ATOM   2609  C C4     . DA  B 1 9  ? -5.541  8.586   -11.171 1.00 0.00 ? 121 DA  C C4     2  
ATOM   2610  H "H5'"  . DA  B 1 9  ? -5.108  4.880   -14.549 1.00 0.00 ? 121 DA  C "H5'"  2  
ATOM   2611  H "H5''" . DA  B 1 9  ? -5.524  4.992   -16.272 1.00 0.00 ? 121 DA  C "H5''" 2  
ATOM   2612  H "H4'"  . DA  B 1 9  ? -7.542  5.580   -15.285 1.00 0.00 ? 121 DA  C "H4'"  2  
ATOM   2613  H "H3'"  . DA  B 1 9  ? -6.014  7.686   -16.399 1.00 0.00 ? 121 DA  C "H3'"  2  
ATOM   2614  H "H2'"  . DA  B 1 9  ? -5.824  9.170   -14.727 1.00 0.00 ? 121 DA  C "H2'"  2  
ATOM   2615  H "H2''" . DA  B 1 9  ? -7.598  9.289   -14.684 1.00 0.00 ? 121 DA  C "H2''" 2  
ATOM   2616  H "H1'"  . DA  B 1 9  ? -7.663  8.162   -12.740 1.00 0.00 ? 121 DA  C "H1'"  2  
ATOM   2617  H H8     . DA  B 1 9  ? -4.038  8.107   -13.933 1.00 0.00 ? 121 DA  C H8     2  
ATOM   2618  H H61    . DA  B 1 9  ? -2.523  9.718   -8.183  1.00 0.00 ? 121 DA  C H61    2  
ATOM   2619  H H62    . DA  B 1 9  ? -1.906  9.395   -9.788  1.00 0.00 ? 121 DA  C H62    2  
ATOM   2620  H H2     . DA  B 1 9  ? -6.974  9.118   -8.351  1.00 0.00 ? 121 DA  C H2     2  
ATOM   2621  P P      . DT  B 1 10 ? -8.677  9.073   -16.871 1.00 0.00 ? 122 DT  C P      2  
ATOM   2622  O OP1    . DT  B 1 10 ? -9.667  8.836   -17.946 1.00 0.00 ? 122 DT  C OP1    2  
ATOM   2623  O OP2    . DT  B 1 10 ? -7.537  9.987   -17.106 1.00 0.00 ? 122 DT  C OP2    2  
ATOM   2624  O "O5'"  . DT  B 1 10 ? -9.465  9.576   -15.560 1.00 0.00 ? 122 DT  C "O5'"  2  
ATOM   2625  C "C5'"  . DT  B 1 10 ? -9.971  8.633   -14.609 1.00 0.00 ? 122 DT  C "C5'"  2  
ATOM   2626  C "C4'"  . DT  B 1 10 ? -10.646 9.329   -13.432 1.00 0.00 ? 122 DT  C "C4'"  2  
ATOM   2627  O "O4'"  . DT  B 1 10 ? -9.706  9.533   -12.352 1.00 0.00 ? 122 DT  C "O4'"  2  
ATOM   2628  C "C3'"  . DT  B 1 10 ? -11.192 10.685  -13.852 1.00 0.00 ? 122 DT  C "C3'"  2  
ATOM   2629  O "O3'"  . DT  B 1 10 ? -12.600 10.763  -13.598 1.00 0.00 ? 122 DT  C "O3'"  2  
ATOM   2630  C "C2'"  . DT  B 1 10 ? -10.435 11.706  -13.040 1.00 0.00 ? 122 DT  C "C2'"  2  
ATOM   2631  C "C1'"  . DT  B 1 10 ? -9.587  10.938  -12.044 1.00 0.00 ? 122 DT  C "C1'"  2  
ATOM   2632  N N1     . DT  B 1 10 ? -8.179  11.370  -12.111 1.00 0.00 ? 122 DT  C N1     2  
ATOM   2633  C C2     . DT  B 1 10 ? -7.566  11.725  -10.926 1.00 0.00 ? 122 DT  C C2     2  
ATOM   2634  O O2     . DT  B 1 10 ? -8.151  11.699  -9.860  1.00 0.00 ? 122 DT  C O2     2  
ATOM   2635  N N3     . DT  B 1 10 ? -6.243  12.112  -11.021 1.00 0.00 ? 122 DT  C N3     2  
ATOM   2636  C C4     . DT  B 1 10 ? -5.493  12.172  -12.183 1.00 0.00 ? 122 DT  C C4     2  
ATOM   2637  O O4     . DT  B 1 10 ? -4.331  12.527  -12.153 1.00 0.00 ? 122 DT  C O4     2  
ATOM   2638  C C5     . DT  B 1 10 ? -6.220  11.784  -13.371 1.00 0.00 ? 122 DT  C C5     2  
ATOM   2639  C C7     . DT  B 1 10 ? -5.514  11.804  -14.722 1.00 0.00 ? 122 DT  C C7     2  
ATOM   2640  C C6     . DT  B 1 10 ? -7.511  11.404  -13.302 1.00 0.00 ? 122 DT  C C6     2  
ATOM   2641  H "H5'"  . DT  B 1 10 ? -9.146  8.024   -14.238 1.00 0.00 ? 122 DT  C "H5'"  2  
ATOM   2642  H "H5''" . DT  B 1 10 ? -10.697 7.986   -15.103 1.00 0.00 ? 122 DT  C "H5''" 2  
ATOM   2643  H "H4'"  . DT  B 1 10 ? -11.467 8.710   -13.073 1.00 0.00 ? 122 DT  C "H4'"  2  
ATOM   2644  H "H3'"  . DT  B 1 10 ? -10.995 10.846  -14.914 1.00 0.00 ? 122 DT  C "H3'"  2  
ATOM   2645  H "H2'"  . DT  B 1 10 ? -9.795  12.300  -13.693 1.00 0.00 ? 122 DT  C "H2'"  2  
ATOM   2646  H "H2''" . DT  B 1 10 ? -11.130 12.355  -12.513 1.00 0.00 ? 122 DT  C "H2''" 2  
ATOM   2647  H "H1'"  . DT  B 1 10 ? -9.966  11.117  -11.039 1.00 0.00 ? 122 DT  C "H1'"  2  
ATOM   2648  H H3     . DT  B 1 10 ? -5.794  12.368  -10.187 1.00 0.00 ? 122 DT  C H3     2  
ATOM   2649  H H71    . DT  B 1 10 ? -5.441  12.832  -15.079 1.00 0.00 ? 122 DT  C H71    2  
ATOM   2650  H H72    . DT  B 1 10 ? -4.514  11.384  -14.617 1.00 0.00 ? 122 DT  C H72    2  
ATOM   2651  H H73    . DT  B 1 10 ? -6.083  11.212  -15.438 1.00 0.00 ? 122 DT  C H73    2  
ATOM   2652  H H6     . DT  B 1 10 ? -8.036  11.125  -14.215 1.00 0.00 ? 122 DT  C H6     2  
ATOM   2653  P P      . DA  B 1 11 ? -13.360 12.183  -13.586 1.00 0.00 ? 123 DA  C P      2  
ATOM   2654  O OP1    . DA  B 1 11 ? -14.783 11.943  -13.259 1.00 0.00 ? 123 DA  C OP1    2  
ATOM   2655  O OP2    . DA  B 1 11 ? -12.999 12.911  -14.824 1.00 0.00 ? 123 DA  C OP2    2  
ATOM   2656  O "O5'"  . DA  B 1 11 ? -12.676 12.938  -12.340 1.00 0.00 ? 123 DA  C "O5'"  2  
ATOM   2657  C "C5'"  . DA  B 1 11 ? -13.022 12.592  -10.995 1.00 0.00 ? 123 DA  C "C5'"  2  
ATOM   2658  C "C4'"  . DA  B 1 11 ? -12.916 13.799  -10.068 1.00 0.00 ? 123 DA  C "C4'"  2  
ATOM   2659  O "O4'"  . DA  B 1 11 ? -11.577 13.919  -9.535  1.00 0.00 ? 123 DA  C "O4'"  2  
ATOM   2660  C "C3'"  . DA  B 1 11 ? -13.246 15.077  -10.826 1.00 0.00 ? 123 DA  C "C3'"  2  
ATOM   2661  O "O3'"  . DA  B 1 11 ? -14.369 15.742  -10.240 1.00 0.00 ? 123 DA  C "O3'"  2  
ATOM   2662  C "C2'"  . DA  B 1 11 ? -12.010 15.935  -10.750 1.00 0.00 ? 123 DA  C "C2'"  2  
ATOM   2663  C "C1'"  . DA  B 1 11 ? -11.010 15.201  -9.878  1.00 0.00 ? 123 DA  C "C1'"  2  
ATOM   2664  N N9     . DA  B 1 11 ? -9.737  15.042  -10.590 1.00 0.00 ? 123 DA  C N9     2  
ATOM   2665  C C8     . DA  B 1 11 ? -9.522  14.680  -11.868 1.00 0.00 ? 123 DA  C C8     2  
ATOM   2666  N N7     . DA  B 1 11 ? -8.299  14.621  -12.279 1.00 0.00 ? 123 DA  C N7     2  
ATOM   2667  C C5     . DA  B 1 11 ? -7.601  14.996  -11.126 1.00 0.00 ? 123 DA  C C5     2  
ATOM   2668  C C6     . DA  B 1 11 ? -6.238  15.152  -10.849 1.00 0.00 ? 123 DA  C C6     2  
ATOM   2669  N N6     . DA  B 1 11 ? -5.281  14.936  -11.753 1.00 0.00 ? 123 DA  C N6     2  
ATOM   2670  N N1     . DA  B 1 11 ? -5.899  15.538  -9.606  1.00 0.00 ? 123 DA  C N1     2  
ATOM   2671  C C2     . DA  B 1 11 ? -6.842  15.757  -8.687  1.00 0.00 ? 123 DA  C C2     2  
ATOM   2672  N N3     . DA  B 1 11 ? -8.157  15.640  -8.840  1.00 0.00 ? 123 DA  C N3     2  
ATOM   2673  C C4     . DA  B 1 11 ? -8.472  15.254  -10.093 1.00 0.00 ? 123 DA  C C4     2  
ATOM   2674  H "H5'"  . DA  B 1 11 ? -12.346 11.813  -10.643 1.00 0.00 ? 123 DA  C "H5'"  2  
ATOM   2675  H "H5''" . DA  B 1 11 ? -14.043 12.215  -10.975 1.00 0.00 ? 123 DA  C "H5''" 2  
ATOM   2676  H "H4'"  . DA  B 1 11 ? -13.618 13.679  -9.244  1.00 0.00 ? 123 DA  C "H4'"  2  
ATOM   2677  H "H3'"  . DA  B 1 11 ? -13.460 14.837  -11.869 1.00 0.00 ? 123 DA  C "H3'"  2  
ATOM   2678  H "H2'"  . DA  B 1 11 ? -11.597 16.075  -11.749 1.00 0.00 ? 123 DA  C "H2'"  2  
ATOM   2679  H "H2''" . DA  B 1 11 ? -12.251 16.898  -10.311 1.00 0.00 ? 123 DA  C "H2''" 2  
ATOM   2680  H "H1'"  . DA  B 1 11 ? -10.838 15.772  -8.973  1.00 0.00 ? 123 DA  C "H1'"  2  
ATOM   2681  H H8     . DA  B 1 11 ? -10.358 14.465  -12.530 1.00 0.00 ? 123 DA  C H8     2  
ATOM   2682  H H61    . DA  B 1 11 ? -4.312  15.063  -11.502 1.00 0.00 ? 123 DA  C H61    2  
ATOM   2683  H H62    . DA  B 1 11 ? -5.527  14.645  -12.688 1.00 0.00 ? 123 DA  C H62    2  
ATOM   2684  H H2     . DA  B 1 11 ? -6.494  16.067  -7.701  1.00 0.00 ? 123 DA  C H2     2  
ATOM   2685  P P      . DC  B 1 12 ? -15.366 16.616  -11.153 1.00 0.00 ? 124 DC  C P      2  
ATOM   2686  O OP1    . DC  B 1 12 ? -16.756 16.257  -10.796 1.00 0.00 ? 124 DC  C OP1    2  
ATOM   2687  O OP2    . DC  B 1 12 ? -14.915 16.513  -12.560 1.00 0.00 ? 124 DC  C OP2    2  
ATOM   2688  O "O5'"  . DC  B 1 12 ? -15.085 18.116  -10.641 1.00 0.00 ? 124 DC  C "O5'"  2  
ATOM   2689  C "C5'"  . DC  B 1 12 ? -14.778 18.365  -9.267  1.00 0.00 ? 124 DC  C "C5'"  2  
ATOM   2690  C "C4'"  . DC  B 1 12 ? -13.888 19.592  -9.105  1.00 0.00 ? 124 DC  C "C4'"  2  
ATOM   2691  O "O4'"  . DC  B 1 12 ? -12.496 19.237  -9.233  1.00 0.00 ? 124 DC  C "O4'"  2  
ATOM   2692  C "C3'"  . DC  B 1 12 ? -14.209 20.639  -10.161 1.00 0.00 ? 124 DC  C "C3'"  2  
ATOM   2693  O "O3'"  . DC  B 1 12 ? -14.829 21.786  -9.571  1.00 0.00 ? 124 DC  C "O3'"  2  
ATOM   2694  C "C2'"  . DC  B 1 12 ? -12.892 21.005  -10.794 1.00 0.00 ? 124 DC  C "C2'"  2  
ATOM   2695  C "C1'"  . DC  B 1 12 ? -11.827 20.161  -10.112 1.00 0.00 ? 124 DC  C "C1'"  2  
ATOM   2696  N N1     . DC  B 1 12 ? -11.004 19.444  -11.106 1.00 0.00 ? 124 DC  C N1     2  
ATOM   2697  C C2     . DC  B 1 12 ? -9.626  19.525  -10.973 1.00 0.00 ? 124 DC  C C2     2  
ATOM   2698  O O2     . DC  B 1 12 ? -9.138  20.168  -10.065 1.00 0.00 ? 124 DC  C O2     2  
ATOM   2699  N N3     . DC  B 1 12 ? -8.851  18.870  -11.880 1.00 0.00 ? 124 DC  C N3     2  
ATOM   2700  C C4     . DC  B 1 12 ? -9.404  18.165  -12.877 1.00 0.00 ? 124 DC  C C4     2  
ATOM   2701  N N4     . DC  B 1 12 ? -8.615  17.536  -13.748 1.00 0.00 ? 124 DC  C N4     2  
ATOM   2702  C C5     . DC  B 1 12 ? -10.824 18.079  -13.017 1.00 0.00 ? 124 DC  C C5     2  
ATOM   2703  C C6     . DC  B 1 12 ? -11.583 18.731  -12.115 1.00 0.00 ? 124 DC  C C6     2  
ATOM   2704  H "H5'"  . DC  B 1 12 ? -14.265 17.497  -8.855  1.00 0.00 ? 124 DC  C "H5'"  2  
ATOM   2705  H "H5''" . DC  B 1 12 ? -15.706 18.525  -8.719  1.00 0.00 ? 124 DC  C "H5''" 2  
ATOM   2706  H "H4'"  . DC  B 1 12 ? -14.048 20.024  -8.119  1.00 0.00 ? 124 DC  C "H4'"  2  
ATOM   2707  H "H3'"  . DC  B 1 12 ? -14.868 20.206  -10.915 1.00 0.00 ? 124 DC  C "H3'"  2  
ATOM   2708  H "HO3'" . DC  B 1 12 ? -14.524 21.840  -8.663  1.00 0.00 ? 124 DC  C "HO3'" 2  
ATOM   2709  H "H2'"  . DC  B 1 12 ? -12.917 20.782  -11.860 1.00 0.00 ? 124 DC  C "H2'"  2  
ATOM   2710  H "H2''" . DC  B 1 12 ? -12.684 22.062  -10.639 1.00 0.00 ? 124 DC  C "H2''" 2  
ATOM   2711  H "H1'"  . DC  B 1 12 ? -11.187 20.810  -9.519  1.00 0.00 ? 124 DC  C "H1'"  2  
ATOM   2712  H H41    . DC  B 1 12 ? -7.611  17.594  -13.654 1.00 0.00 ? 124 DC  C H41    2  
ATOM   2713  H H42    . DC  B 1 12 ? -9.021  17.002  -14.503 1.00 0.00 ? 124 DC  C H42    2  
ATOM   2714  H H5     . DC  B 1 12 ? -11.278 17.506  -13.826 1.00 0.00 ? 124 DC  C H5     2  
ATOM   2715  H H6     . DC  B 1 12 ? -12.670 18.689  -12.190 1.00 0.00 ? 124 DC  C H6     2  
ATOM   2716  N N      . MET C 2 1  ? -15.057 13.324  4.934   1.00 0.00 ? 1   MET A N      2  
ATOM   2717  C CA     . MET C 2 1  ? -14.407 12.748  6.147   1.00 0.00 ? 1   MET A CA     2  
ATOM   2718  C C      . MET C 2 1  ? -12.884 12.810  6.012   1.00 0.00 ? 1   MET A C      2  
ATOM   2719  O O      . MET C 2 1  ? -12.355 13.476  5.144   1.00 0.00 ? 1   MET A O      2  
ATOM   2720  C CB     . MET C 2 1  ? -14.880 11.293  6.205   1.00 0.00 ? 1   MET A CB     2  
ATOM   2721  C CG     . MET C 2 1  ? -14.556 10.592  4.882   1.00 0.00 ? 1   MET A CG     2  
ATOM   2722  S SD     . MET C 2 1  ? -14.101 8.869   5.204   1.00 0.00 ? 1   MET A SD     2  
ATOM   2723  C CE     . MET C 2 1  ? -12.308 9.088   5.111   1.00 0.00 ? 1   MET A CE     2  
ATOM   2724  H H      . MET C 2 1  ? -14.793 13.014  4.043   1.00 0.00 ? 1   MET A H      2  
ATOM   2725  H HA     . MET C 2 1  ? -14.729 13.274  7.032   1.00 0.00 ? 1   MET A HA     2  
ATOM   2726  H HB2    . MET C 2 1  ? -14.377 10.786  7.015   1.00 0.00 ? 1   MET A HB2    2  
ATOM   2727  H HB3    . MET C 2 1  ? -15.946 11.268  6.371   1.00 0.00 ? 1   MET A HB3    2  
ATOM   2728  H HG2    . MET C 2 1  ? -15.424 10.620  4.239   1.00 0.00 ? 1   MET A HG2    2  
ATOM   2729  H HG3    . MET C 2 1  ? -13.733 11.096  4.400   1.00 0.00 ? 1   MET A HG3    2  
ATOM   2730  H HE1    . MET C 2 1  ? -12.039 10.036  5.553   1.00 0.00 ? 1   MET A HE1    2  
ATOM   2731  H HE2    . MET C 2 1  ? -11.996 9.073   4.079   1.00 0.00 ? 1   MET A HE2    2  
ATOM   2732  H HE3    . MET C 2 1  ? -11.820 8.284   5.644   1.00 0.00 ? 1   MET A HE3    2  
ATOM   2733  N N      . ALA C 2 2  ? -12.177 12.120  6.866   1.00 0.00 ? 2   ALA A N      2  
ATOM   2734  C CA     . ALA C 2 2  ? -10.688 12.134  6.790   1.00 0.00 ? 2   ALA A CA     2  
ATOM   2735  C C      . ALA C 2 2  ? -10.119 10.819  7.327   1.00 0.00 ? 2   ALA A C      2  
ATOM   2736  O O      . ALA C 2 2  ? -10.237 10.512  8.496   1.00 0.00 ? 2   ALA A O      2  
ATOM   2737  C CB     . ALA C 2 2  ? -10.255 13.306  7.671   1.00 0.00 ? 2   ALA A CB     2  
ATOM   2738  H H      . ALA C 2 2  ? -12.626 11.590  7.557   1.00 0.00 ? 2   ALA A H      2  
ATOM   2739  H HA     . ALA C 2 2  ? -10.364 12.299  5.774   1.00 0.00 ? 2   ALA A HA     2  
ATOM   2740  H HB1    . ALA C 2 2  ? -9.368  13.033  8.224   1.00 0.00 ? 2   ALA A HB1    2  
ATOM   2741  H HB2    . ALA C 2 2  ? -11.050 13.550  8.362   1.00 0.00 ? 2   ALA A HB2    2  
ATOM   2742  H HB3    . ALA C 2 2  ? -10.043 14.164  7.051   1.00 0.00 ? 2   ALA A HB3    2  
ATOM   2743  N N      . GLU C 2 3  ? -9.502  10.041  6.478   1.00 0.00 ? 3   GLU A N      2  
ATOM   2744  C CA     . GLU C 2 3  ? -8.922  8.740   6.932   1.00 0.00 ? 3   GLU A CA     2  
ATOM   2745  C C      . GLU C 2 3  ? -7.987  8.956   8.125   1.00 0.00 ? 3   GLU A C      2  
ATOM   2746  O O      . GLU C 2 3  ? -7.796  8.076   8.942   1.00 0.00 ? 3   GLU A O      2  
ATOM   2747  C CB     . GLU C 2 3  ? -8.137  8.218   5.730   1.00 0.00 ? 3   GLU A CB     2  
ATOM   2748  C CG     . GLU C 2 3  ? -9.106  7.672   4.679   1.00 0.00 ? 3   GLU A CG     2  
ATOM   2749  C CD     . GLU C 2 3  ? -8.318  7.182   3.464   1.00 0.00 ? 3   GLU A CD     2  
ATOM   2750  O OE1    . GLU C 2 3  ? -7.303  7.787   3.158   1.00 0.00 ? 3   GLU A OE1    2  
ATOM   2751  O OE2    . GLU C 2 3  ? -8.741  6.210   2.861   1.00 0.00 ? 3   GLU A OE2    2  
ATOM   2752  H H      . GLU C 2 3  ? -9.422  10.311  5.540   1.00 0.00 ? 3   GLU A H      2  
ATOM   2753  H HA     . GLU C 2 3  ? -9.708  8.046   7.188   1.00 0.00 ? 3   GLU A HA     2  
ATOM   2754  H HB2    . GLU C 2 3  ? -7.559  9.024   5.302   1.00 0.00 ? 3   GLU A HB2    2  
ATOM   2755  H HB3    . GLU C 2 3  ? -7.473  7.428   6.048   1.00 0.00 ? 3   GLU A HB3    2  
ATOM   2756  H HG2    . GLU C 2 3  ? -9.669  6.851   5.102   1.00 0.00 ? 3   GLU A HG2    2  
ATOM   2757  H HG3    . GLU C 2 3  ? -9.785  8.455   4.375   1.00 0.00 ? 3   GLU A HG3    2  
ATOM   2758  N N      . ASP C 2 4  ? -7.402  10.123  8.232   1.00 0.00 ? 4   ASP A N      2  
ATOM   2759  C CA     . ASP C 2 4  ? -6.472  10.408  9.369   1.00 0.00 ? 4   ASP A CA     2  
ATOM   2760  C C      . ASP C 2 4  ? -5.264  9.468   9.316   1.00 0.00 ? 4   ASP A C      2  
ATOM   2761  O O      . ASP C 2 4  ? -5.401  8.261   9.367   1.00 0.00 ? 4   ASP A O      2  
ATOM   2762  C CB     . ASP C 2 4  ? -7.292  10.161  10.640  1.00 0.00 ? 4   ASP A CB     2  
ATOM   2763  C CG     . ASP C 2 4  ? -6.705  10.976  11.792  1.00 0.00 ? 4   ASP A CG     2  
ATOM   2764  O OD1    . ASP C 2 4  ? -5.726  10.532  12.368  1.00 0.00 ? 4   ASP A OD1    2  
ATOM   2765  O OD2    . ASP C 2 4  ? -7.245  12.032  12.080  1.00 0.00 ? 4   ASP A OD2    2  
ATOM   2766  H H      . ASP C 2 4  ? -7.574  10.815  7.559   1.00 0.00 ? 4   ASP A H      2  
ATOM   2767  H HA     . ASP C 2 4  ? -6.147  11.436  9.337   1.00 0.00 ? 4   ASP A HA     2  
ATOM   2768  H HB2    . ASP C 2 4  ? -8.316  10.460  10.470  1.00 0.00 ? 4   ASP A HB2    2  
ATOM   2769  H HB3    . ASP C 2 4  ? -7.260  9.111   10.890  1.00 0.00 ? 4   ASP A HB3    2  
ATOM   2770  N N      . TRP C 2 5  ? -4.081  10.013  9.216   1.00 0.00 ? 5   TRP A N      2  
ATOM   2771  C CA     . TRP C 2 5  ? -2.862  9.153   9.162   1.00 0.00 ? 5   TRP A CA     2  
ATOM   2772  C C      . TRP C 2 5  ? -2.485  8.686   10.570  1.00 0.00 ? 5   TRP A C      2  
ATOM   2773  O O      . TRP C 2 5  ? -2.420  9.470   11.497  1.00 0.00 ? 5   TRP A O      2  
ATOM   2774  C CB     . TRP C 2 5  ? -1.768  10.050  8.582   1.00 0.00 ? 5   TRP A CB     2  
ATOM   2775  C CG     . TRP C 2 5  ? -1.739  9.903   7.094   1.00 0.00 ? 5   TRP A CG     2  
ATOM   2776  C CD1    . TRP C 2 5  ? -2.273  10.783  6.216   1.00 0.00 ? 5   TRP A CD1    2  
ATOM   2777  C CD2    . TRP C 2 5  ? -1.157  8.831   6.297   1.00 0.00 ? 5   TRP A CD2    2  
ATOM   2778  N NE1    . TRP C 2 5  ? -2.055  10.318  4.931   1.00 0.00 ? 5   TRP A NE1    2  
ATOM   2779  C CE2    . TRP C 2 5  ? -1.371  9.120   4.928   1.00 0.00 ? 5   TRP A CE2    2  
ATOM   2780  C CE3    . TRP C 2 5  ? -0.469  7.649   6.625   1.00 0.00 ? 5   TRP A CE3    2  
ATOM   2781  C CZ2    . TRP C 2 5  ? -0.920  8.266   3.921   1.00 0.00 ? 5   TRP A CZ2    2  
ATOM   2782  C CZ3    . TRP C 2 5  ? -0.013  6.788   5.615   1.00 0.00 ? 5   TRP A CZ3    2  
ATOM   2783  C CH2    . TRP C 2 5  ? -0.238  7.096   4.266   1.00 0.00 ? 5   TRP A CH2    2  
ATOM   2784  H H      . TRP C 2 5  ? -3.993  10.989  9.179   1.00 0.00 ? 5   TRP A H      2  
ATOM   2785  H HA     . TRP C 2 5  ? -3.027  8.304   8.514   1.00 0.00 ? 5   TRP A HA     2  
ATOM   2786  H HB2    . TRP C 2 5  ? -1.972  11.078  8.838   1.00 0.00 ? 5   TRP A HB2    2  
ATOM   2787  H HB3    . TRP C 2 5  ? -0.811  9.759   8.990   1.00 0.00 ? 5   TRP A HB3    2  
ATOM   2788  H HD1    . TRP C 2 5  ? -2.787  11.697  6.476   1.00 0.00 ? 5   TRP A HD1    2  
ATOM   2789  H HE1    . TRP C 2 5  ? -2.344  10.771  4.110   1.00 0.00 ? 5   TRP A HE1    2  
ATOM   2790  H HE3    . TRP C 2 5  ? -0.291  7.403   7.662   1.00 0.00 ? 5   TRP A HE3    2  
ATOM   2791  H HZ2    . TRP C 2 5  ? -1.095  8.508   2.884   1.00 0.00 ? 5   TRP A HZ2    2  
ATOM   2792  H HZ3    . TRP C 2 5  ? 0.513   5.883   5.878   1.00 0.00 ? 5   TRP A HZ3    2  
ATOM   2793  H HH2    . TRP C 2 5  ? 0.115   6.429   3.493   1.00 0.00 ? 5   TRP A HH2    2  
ATOM   2794  N N      . LEU C 2 6  ? -2.239  7.416   10.734  1.00 0.00 ? 6   LEU A N      2  
ATOM   2795  C CA     . LEU C 2 6  ? -1.868  6.888   12.080  1.00 0.00 ? 6   LEU A CA     2  
ATOM   2796  C C      . LEU C 2 6  ? -0.382  6.519   12.111  1.00 0.00 ? 6   LEU A C      2  
ATOM   2797  O O      . LEU C 2 6  ? 0.241   6.335   11.086  1.00 0.00 ? 6   LEU A O      2  
ATOM   2798  C CB     . LEU C 2 6  ? -2.736  5.642   12.270  1.00 0.00 ? 6   LEU A CB     2  
ATOM   2799  C CG     . LEU C 2 6  ? -4.214  6.031   12.185  1.00 0.00 ? 6   LEU A CG     2  
ATOM   2800  C CD1    . LEU C 2 6  ? -5.076  4.766   12.172  1.00 0.00 ? 6   LEU A CD1    2  
ATOM   2801  C CD2    . LEU C 2 6  ? -4.587  6.894   13.394  1.00 0.00 ? 6   LEU A CD2    2  
ATOM   2802  H H      . LEU C 2 6  ? -2.300  6.804   9.971   1.00 0.00 ? 6   LEU A H      2  
ATOM   2803  H HA     . LEU C 2 6  ? -2.092  7.614   12.845  1.00 0.00 ? 6   LEU A HA     2  
ATOM   2804  H HB2    . LEU C 2 6  ? -2.506  4.922   11.499  1.00 0.00 ? 6   LEU A HB2    2  
ATOM   2805  H HB3    . LEU C 2 6  ? -2.535  5.209   13.239  1.00 0.00 ? 6   LEU A HB3    2  
ATOM   2806  H HG     . LEU C 2 6  ? -4.385  6.589   11.275  1.00 0.00 ? 6   LEU A HG     2  
ATOM   2807  H HD11   . LEU C 2 6  ? -5.031  4.308   11.196  1.00 0.00 ? 6   LEU A HD11   2  
ATOM   2808  H HD12   . LEU C 2 6  ? -6.099  5.026   12.401  1.00 0.00 ? 6   LEU A HD12   2  
ATOM   2809  H HD13   . LEU C 2 6  ? -4.707  4.073   12.914  1.00 0.00 ? 6   LEU A HD13   2  
ATOM   2810  H HD21   . LEU C 2 6  ? -3.700  7.116   13.969  1.00 0.00 ? 6   LEU A HD21   2  
ATOM   2811  H HD22   . LEU C 2 6  ? -5.295  6.362   14.014  1.00 0.00 ? 6   LEU A HD22   2  
ATOM   2812  H HD23   . LEU C 2 6  ? -5.033  7.816   13.052  1.00 0.00 ? 6   LEU A HD23   2  
ATOM   2813  N N      . ASP C 2 7  ? 0.188   6.417   13.280  1.00 0.00 ? 7   ASP A N      2  
ATOM   2814  C CA     . ASP C 2 7  ? 1.635   6.065   13.380  1.00 0.00 ? 7   ASP A CA     2  
ATOM   2815  C C      . ASP C 2 7  ? 1.871   4.622   12.920  1.00 0.00 ? 7   ASP A C      2  
ATOM   2816  O O      . ASP C 2 7  ? 0.971   3.806   12.911  1.00 0.00 ? 7   ASP A O      2  
ATOM   2817  C CB     . ASP C 2 7  ? 1.976   6.217   14.864  1.00 0.00 ? 7   ASP A CB     2  
ATOM   2818  C CG     . ASP C 2 7  ? 2.082   7.703   15.216  1.00 0.00 ? 7   ASP A CG     2  
ATOM   2819  O OD1    . ASP C 2 7  ? 1.048   8.317   15.423  1.00 0.00 ? 7   ASP A OD1    2  
ATOM   2820  O OD2    . ASP C 2 7  ? 3.194   8.200   15.272  1.00 0.00 ? 7   ASP A OD2    2  
ATOM   2821  H H      . ASP C 2 7  ? -0.335  6.574   14.092  1.00 0.00 ? 7   ASP A H      2  
ATOM   2822  H HA     . ASP C 2 7  ? 2.229   6.749   12.795  1.00 0.00 ? 7   ASP A HA     2  
ATOM   2823  H HB2    . ASP C 2 7  ? 1.199   5.760   15.460  1.00 0.00 ? 7   ASP A HB2    2  
ATOM   2824  H HB3    . ASP C 2 7  ? 2.919   5.733   15.069  1.00 0.00 ? 7   ASP A HB3    2  
ATOM   2825  N N      . CYS C 2 8  ? 3.082   4.308   12.545  1.00 0.00 ? 8   CYS A N      2  
ATOM   2826  C CA     . CYS C 2 8  ? 3.404   2.925   12.090  1.00 0.00 ? 8   CYS A CA     2  
ATOM   2827  C C      . CYS C 2 8  ? 4.740   2.497   12.710  1.00 0.00 ? 8   CYS A C      2  
ATOM   2828  O O      . CYS C 2 8  ? 5.780   2.615   12.090  1.00 0.00 ? 8   CYS A O      2  
ATOM   2829  C CB     . CYS C 2 8  ? 3.507   3.024   10.567  1.00 0.00 ? 8   CYS A CB     2  
ATOM   2830  S SG     . CYS C 2 8  ? 3.931   1.405   9.875   1.00 0.00 ? 8   CYS A SG     2  
ATOM   2831  H H      . CYS C 2 8  ? 3.787   4.985   12.570  1.00 0.00 ? 8   CYS A H      2  
ATOM   2832  H HA     . CYS C 2 8  ? 2.618   2.241   12.370  1.00 0.00 ? 8   CYS A HA     2  
ATOM   2833  H HB2    . CYS C 2 8  ? 2.559   3.348   10.164  1.00 0.00 ? 8   CYS A HB2    2  
ATOM   2834  H HB3    . CYS C 2 8  ? 4.270   3.740   10.304  1.00 0.00 ? 8   CYS A HB3    2  
ATOM   2835  H HG     . CYS C 2 8  ? 4.078   0.800   10.605  1.00 0.00 ? 8   CYS A HG     2  
ATOM   2836  N N      . PRO C 2 9  ? 4.662   2.032   13.929  1.00 0.00 ? 9   PRO A N      2  
ATOM   2837  C CA     . PRO C 2 9  ? 5.877   1.603   14.671  1.00 0.00 ? 9   PRO A CA     2  
ATOM   2838  C C      . PRO C 2 9  ? 6.474   0.311   14.118  1.00 0.00 ? 9   PRO A C      2  
ATOM   2839  O O      . PRO C 2 9  ? 7.519   -0.126  14.562  1.00 0.00 ? 9   PRO A O      2  
ATOM   2840  C CB     . PRO C 2 9  ? 5.372   1.376   16.089  1.00 0.00 ? 9   PRO A CB     2  
ATOM   2841  C CG     . PRO C 2 9  ? 3.909   1.107   15.943  1.00 0.00 ? 9   PRO A CG     2  
ATOM   2842  C CD     . PRO C 2 9  ? 3.444   1.862   14.729  1.00 0.00 ? 9   PRO A CD     2  
ATOM   2843  H HA     . PRO C 2 9  ? 6.614   2.387   14.671  1.00 0.00 ? 9   PRO A HA     2  
ATOM   2844  H HB2    . PRO C 2 9  ? 5.871   0.517   16.520  1.00 0.00 ? 9   PRO A HB2    2  
ATOM   2845  H HB3    . PRO C 2 9  ? 5.531   2.254   16.695  1.00 0.00 ? 9   PRO A HB3    2  
ATOM   2846  H HG2    . PRO C 2 9  ? 3.741   0.048   15.810  1.00 0.00 ? 9   PRO A HG2    2  
ATOM   2847  H HG3    . PRO C 2 9  ? 3.380   1.460   16.813  1.00 0.00 ? 9   PRO A HG3    2  
ATOM   2848  H HD2    . PRO C 2 9  ? 2.707   1.284   14.185  1.00 0.00 ? 9   PRO A HD2    2  
ATOM   2849  H HD3    . PRO C 2 9  ? 3.044   2.824   15.009  1.00 0.00 ? 9   PRO A HD3    2  
ATOM   2850  N N      . ALA C 2 10 ? 5.836   -0.319  13.173  1.00 0.00 ? 10  ALA A N      2  
ATOM   2851  C CA     . ALA C 2 10 ? 6.402   -1.586  12.637  1.00 0.00 ? 10  ALA A CA     2  
ATOM   2852  C C      . ALA C 2 10 ? 7.834   -1.359  12.147  1.00 0.00 ? 10  ALA A C      2  
ATOM   2853  O O      . ALA C 2 10 ? 8.752   -2.048  12.541  1.00 0.00 ? 10  ALA A O      2  
ATOM   2854  C CB     . ALA C 2 10 ? 5.492   -1.978  11.474  1.00 0.00 ? 10  ALA A CB     2  
ATOM   2855  H H      . ALA C 2 10 ? 4.989   0.029   12.824  1.00 0.00 ? 10  ALA A H      2  
ATOM   2856  H HA     . ALA C 2 10 ? 6.380   -2.346  13.401  1.00 0.00 ? 10  ALA A HA     2  
ATOM   2857  H HB1    . ALA C 2 10 ? 5.949   -1.679  10.542  1.00 0.00 ? 10  ALA A HB1    2  
ATOM   2858  H HB2    . ALA C 2 10 ? 4.538   -1.485  11.581  1.00 0.00 ? 10  ALA A HB2    2  
ATOM   2859  H HB3    . ALA C 2 10 ? 5.347   -3.048  11.475  1.00 0.00 ? 10  ALA A HB3    2  
ATOM   2860  N N      . LEU C 2 11 ? 8.028   -0.395  11.289  1.00 0.00 ? 11  LEU A N      2  
ATOM   2861  C CA     . LEU C 2 11 ? 9.397   -0.121  10.765  1.00 0.00 ? 11  LEU A CA     2  
ATOM   2862  C C      . LEU C 2 11 ? 10.198  0.734   11.756  1.00 0.00 ? 11  LEU A C      2  
ATOM   2863  O O      . LEU C 2 11 ? 11.159  0.276   12.341  1.00 0.00 ? 11  LEU A O      2  
ATOM   2864  C CB     . LEU C 2 11 ? 9.168   0.636   9.460   1.00 0.00 ? 11  LEU A CB     2  
ATOM   2865  C CG     . LEU C 2 11 ? 8.559   -0.311  8.420   1.00 0.00 ? 11  LEU A CG     2  
ATOM   2866  C CD1    . LEU C 2 11 ? 7.191   0.217   7.975   1.00 0.00 ? 11  LEU A CD1    2  
ATOM   2867  C CD2    . LEU C 2 11 ? 9.490   -0.409  7.206   1.00 0.00 ? 11  LEU A CD2    2  
ATOM   2868  H H      . LEU C 2 11 ? 7.270   0.148   10.985  1.00 0.00 ? 11  LEU A H      2  
ATOM   2869  H HA     . LEU C 2 11 ? 9.913   -1.047  10.564  1.00 0.00 ? 11  LEU A HA     2  
ATOM   2870  H HB2    . LEU C 2 11 ? 8.493   1.459   9.641   1.00 0.00 ? 11  LEU A HB2    2  
ATOM   2871  H HB3    . LEU C 2 11 ? 10.110  1.015   9.095   1.00 0.00 ? 11  LEU A HB3    2  
ATOM   2872  H HG     . LEU C 2 11 ? 8.435   -1.293  8.858   1.00 0.00 ? 11  LEU A HG     2  
ATOM   2873  H HD11   . LEU C 2 11 ? 7.250   0.552   6.950   1.00 0.00 ? 11  LEU A HD11   2  
ATOM   2874  H HD12   . LEU C 2 11 ? 6.898   1.042   8.607   1.00 0.00 ? 11  LEU A HD12   2  
ATOM   2875  H HD13   . LEU C 2 11 ? 6.457   -0.572  8.051   1.00 0.00 ? 11  LEU A HD13   2  
ATOM   2876  H HD21   . LEU C 2 11 ? 8.910   -0.315  6.299   1.00 0.00 ? 11  LEU A HD21   2  
ATOM   2877  H HD22   . LEU C 2 11 ? 9.991   -1.365  7.214   1.00 0.00 ? 11  LEU A HD22   2  
ATOM   2878  H HD23   . LEU C 2 11 ? 10.223  0.382   7.248   1.00 0.00 ? 11  LEU A HD23   2  
ATOM   2879  N N      . GLY C 2 12 ? 9.817   1.973   11.945  1.00 0.00 ? 12  GLY A N      2  
ATOM   2880  C CA     . GLY C 2 12 ? 10.572  2.843   12.895  1.00 0.00 ? 12  GLY A CA     2  
ATOM   2881  C C      . GLY C 2 12 ? 9.906   4.223   12.996  1.00 0.00 ? 12  GLY A C      2  
ATOM   2882  O O      . GLY C 2 12 ? 8.744   4.375   12.674  1.00 0.00 ? 12  GLY A O      2  
ATOM   2883  H H      . GLY C 2 12 ? 9.041   2.328   11.463  1.00 0.00 ? 12  GLY A H      2  
ATOM   2884  H HA2    . GLY C 2 12 ? 10.584  2.379   13.871  1.00 0.00 ? 12  GLY A HA2    2  
ATOM   2885  H HA3    . GLY C 2 12 ? 11.585  2.963   12.543  1.00 0.00 ? 12  GLY A HA3    2  
ATOM   2886  N N      . PRO C 2 13 ? 10.672  5.185   13.452  1.00 0.00 ? 13  PRO A N      2  
ATOM   2887  C CA     . PRO C 2 13 ? 10.153  6.569   13.610  1.00 0.00 ? 13  PRO A CA     2  
ATOM   2888  C C      . PRO C 2 13 ? 9.995   7.258   12.250  1.00 0.00 ? 13  PRO A C      2  
ATOM   2889  O O      . PRO C 2 13 ? 10.846  7.159   11.389  1.00 0.00 ? 13  PRO A O      2  
ATOM   2890  C CB     . PRO C 2 13 ? 11.229  7.264   14.440  1.00 0.00 ? 13  PRO A CB     2  
ATOM   2891  C CG     . PRO C 2 13 ? 12.484  6.495   14.172  1.00 0.00 ? 13  PRO A CG     2  
ATOM   2892  C CD     . PRO C 2 13 ? 12.080  5.077   13.861  1.00 0.00 ? 13  PRO A CD     2  
ATOM   2893  H HA     . PRO C 2 13 ? 9.219   6.566   14.147  1.00 0.00 ? 13  PRO A HA     2  
ATOM   2894  H HB2    . PRO C 2 13 ? 11.341  8.292   14.124  1.00 0.00 ? 13  PRO A HB2    2  
ATOM   2895  H HB3    . PRO C 2 13 ? 10.984  7.216   15.490  1.00 0.00 ? 13  PRO A HB3    2  
ATOM   2896  H HG2    . PRO C 2 13 ? 13.005  6.926   13.330  1.00 0.00 ? 13  PRO A HG2    2  
ATOM   2897  H HG3    . PRO C 2 13 ? 13.118  6.508   15.046  1.00 0.00 ? 13  PRO A HG3    2  
ATOM   2898  H HD2    . PRO C 2 13 ? 12.683  4.682   13.055  1.00 0.00 ? 13  PRO A HD2    2  
ATOM   2899  H HD3    . PRO C 2 13 ? 12.165  4.456   14.740  1.00 0.00 ? 13  PRO A HD3    2  
ATOM   2900  N N      . GLY C 2 14 ? 8.905   7.955   12.057  1.00 0.00 ? 14  GLY A N      2  
ATOM   2901  C CA     . GLY C 2 14 ? 8.670   8.657   10.761  1.00 0.00 ? 14  GLY A CA     2  
ATOM   2902  C C      . GLY C 2 14 ? 7.621   7.886   9.961   1.00 0.00 ? 14  GLY A C      2  
ATOM   2903  O O      . GLY C 2 14 ? 6.832   8.460   9.234   1.00 0.00 ? 14  GLY A O      2  
ATOM   2904  H H      . GLY C 2 14 ? 8.239   8.016   12.768  1.00 0.00 ? 14  GLY A H      2  
ATOM   2905  H HA2    . GLY C 2 14 ? 8.317   9.661   10.953  1.00 0.00 ? 14  GLY A HA2    2  
ATOM   2906  H HA3    . GLY C 2 14 ? 9.592   8.702   10.194  1.00 0.00 ? 14  GLY A HA3    2  
ATOM   2907  N N      . TRP C 2 15 ? 7.623   6.586   10.075  1.00 0.00 ? 15  TRP A N      2  
ATOM   2908  C CA     . TRP C 2 15 ? 6.646   5.756   9.312   1.00 0.00 ? 15  TRP A CA     2  
ATOM   2909  C C      . TRP C 2 15 ? 5.207   6.120   9.684   1.00 0.00 ? 15  TRP A C      2  
ATOM   2910  O O      . TRP C 2 15 ? 4.901   6.404   10.826  1.00 0.00 ? 15  TRP A O      2  
ATOM   2911  C CB     . TRP C 2 15 ? 6.952   4.315   9.719   1.00 0.00 ? 15  TRP A CB     2  
ATOM   2912  C CG     . TRP C 2 15 ? 7.986   3.744   8.804   1.00 0.00 ? 15  TRP A CG     2  
ATOM   2913  C CD1    . TRP C 2 15 ? 9.308   3.657   9.080   1.00 0.00 ? 15  TRP A CD1    2  
ATOM   2914  C CD2    . TRP C 2 15 ? 7.807   3.179   7.474   1.00 0.00 ? 15  TRP A CD2    2  
ATOM   2915  N NE1    . TRP C 2 15 ? 9.949   3.067   8.006   1.00 0.00 ? 15  TRP A NE1    2  
ATOM   2916  C CE2    . TRP C 2 15 ? 9.067   2.757   6.989   1.00 0.00 ? 15  TRP A CE2    2  
ATOM   2917  C CE3    . TRP C 2 15 ? 6.683   2.993   6.649   1.00 0.00 ? 15  TRP A CE3    2  
ATOM   2918  C CZ2    . TRP C 2 15 ? 9.209   2.172   5.731   1.00 0.00 ? 15  TRP A CZ2    2  
ATOM   2919  C CZ3    . TRP C 2 15 ? 6.821   2.405   5.381   1.00 0.00 ? 15  TRP A CZ3    2  
ATOM   2920  C CH2    . TRP C 2 15 ? 8.081   1.995   4.924   1.00 0.00 ? 15  TRP A CH2    2  
ATOM   2921  H H      . TRP C 2 15 ? 8.280   6.151   10.658  1.00 0.00 ? 15  TRP A H      2  
ATOM   2922  H HA     . TRP C 2 15 ? 6.800   5.875   8.251   1.00 0.00 ? 15  TRP A HA     2  
ATOM   2923  H HB2    . TRP C 2 15 ? 7.323   4.299   10.734  1.00 0.00 ? 15  TRP A HB2    2  
ATOM   2924  H HB3    . TRP C 2 15 ? 6.052   3.723   9.656   1.00 0.00 ? 15  TRP A HB3    2  
ATOM   2925  H HD1    . TRP C 2 15 ? 9.783   3.987   9.991   1.00 0.00 ? 15  TRP A HD1    2  
ATOM   2926  H HE1    . TRP C 2 15 ? 10.911  2.886   7.950   1.00 0.00 ? 15  TRP A HE1    2  
ATOM   2927  H HE3    . TRP C 2 15 ? 5.707   3.304   6.992   1.00 0.00 ? 15  TRP A HE3    2  
ATOM   2928  H HZ2    . TRP C 2 15 ? 10.182  1.858   5.383   1.00 0.00 ? 15  TRP A HZ2    2  
ATOM   2929  H HZ3    . TRP C 2 15 ? 5.951   2.268   4.756   1.00 0.00 ? 15  TRP A HZ3    2  
ATOM   2930  H HH2    . TRP C 2 15 ? 8.182   1.543   3.949   1.00 0.00 ? 15  TRP A HH2    2  
ATOM   2931  N N      . LYS C 2 16 ? 4.320   6.101   8.725   1.00 0.00 ? 16  LYS A N      2  
ATOM   2932  C CA     . LYS C 2 16 ? 2.892   6.432   9.011   1.00 0.00 ? 16  LYS A CA     2  
ATOM   2933  C C      . LYS C 2 16 ? 1.977   5.491   8.222   1.00 0.00 ? 16  LYS A C      2  
ATOM   2934  O O      . LYS C 2 16 ? 2.313   5.053   7.139   1.00 0.00 ? 16  LYS A O      2  
ATOM   2935  C CB     . LYS C 2 16 ? 2.713   7.878   8.541   1.00 0.00 ? 16  LYS A CB     2  
ATOM   2936  C CG     . LYS C 2 16 ? 2.603   8.800   9.757   1.00 0.00 ? 16  LYS A CG     2  
ATOM   2937  C CD     . LYS C 2 16 ? 3.986   9.353   10.106  1.00 0.00 ? 16  LYS A CD     2  
ATOM   2938  C CE     . LYS C 2 16 ? 3.836   10.724  10.769  1.00 0.00 ? 16  LYS A CE     2  
ATOM   2939  N NZ     . LYS C 2 16 ? 3.923   11.702  9.650   1.00 0.00 ? 16  LYS A NZ     2  
ATOM   2940  H H      . LYS C 2 16 ? 4.594   5.860   7.812   1.00 0.00 ? 16  LYS A H      2  
ATOM   2941  H HA     . LYS C 2 16 ? 2.688   6.355   10.069  1.00 0.00 ? 16  LYS A HA     2  
ATOM   2942  H HB2    . LYS C 2 16 ? 3.564   8.169   7.943   1.00 0.00 ? 16  LYS A HB2    2  
ATOM   2943  H HB3    . LYS C 2 16 ? 1.813   7.955   7.951   1.00 0.00 ? 16  LYS A HB3    2  
ATOM   2944  H HG2    . LYS C 2 16 ? 1.933   9.617   9.529   1.00 0.00 ? 16  LYS A HG2    2  
ATOM   2945  H HG3    . LYS C 2 16 ? 2.217   8.243   10.598  1.00 0.00 ? 16  LYS A HG3    2  
ATOM   2946  H HD2    . LYS C 2 16 ? 4.483   8.675   10.786  1.00 0.00 ? 16  LYS A HD2    2  
ATOM   2947  H HD3    . LYS C 2 16 ? 4.571   9.452   9.205   1.00 0.00 ? 16  LYS A HD3    2  
ATOM   2948  H HE2    . LYS C 2 16 ? 2.876   10.798  11.264  1.00 0.00 ? 16  LYS A HE2    2  
ATOM   2949  H HE3    . LYS C 2 16 ? 4.638   10.892  11.472  1.00 0.00 ? 16  LYS A HE3    2  
ATOM   2950  H HZ1    . LYS C 2 16 ? 4.883   11.687  9.250   1.00 0.00 ? 16  LYS A HZ1    2  
ATOM   2951  H HZ2    . LYS C 2 16 ? 3.234   11.447  8.913   1.00 0.00 ? 16  LYS A HZ2    2  
ATOM   2952  H HZ3    . LYS C 2 16 ? 3.715   12.656  10.006  1.00 0.00 ? 16  LYS A HZ3    2  
ATOM   2953  N N      . ARG C 2 17 ? 0.827   5.171   8.755   1.00 0.00 ? 17  ARG A N      2  
ATOM   2954  C CA     . ARG C 2 17 ? -0.095  4.251   8.031   1.00 0.00 ? 17  ARG A CA     2  
ATOM   2955  C C      . ARG C 2 17 ? -1.516  4.829   7.979   1.00 0.00 ? 17  ARG A C      2  
ATOM   2956  O O      . ARG C 2 17 ? -1.954  5.514   8.880   1.00 0.00 ? 17  ARG A O      2  
ATOM   2957  C CB     . ARG C 2 17 ? -0.062  2.945   8.833   1.00 0.00 ? 17  ARG A CB     2  
ATOM   2958  C CG     . ARG C 2 17 ? -0.643  3.162   10.234  1.00 0.00 ? 17  ARG A CG     2  
ATOM   2959  C CD     . ARG C 2 17 ? -1.732  2.117   10.502  1.00 0.00 ? 17  ARG A CD     2  
ATOM   2960  N NE     . ARG C 2 17 ? -1.568  1.750   11.935  1.00 0.00 ? 17  ARG A NE     2  
ATOM   2961  C CZ     . ARG C 2 17 ? -2.610  1.417   12.646  1.00 0.00 ? 17  ARG A CZ     2  
ATOM   2962  N NH1    . ARG C 2 17 ? -3.025  0.180   12.657  1.00 0.00 ? 17  ARG A NH1    2  
ATOM   2963  N NH2    . ARG C 2 17 ? -3.238  2.323   13.344  1.00 0.00 ? 17  ARG A NH2    2  
ATOM   2964  H H      . ARG C 2 17 ? 0.576   5.530   9.632   1.00 0.00 ? 17  ARG A H      2  
ATOM   2965  H HA     . ARG C 2 17 ? 0.269   4.073   7.031   1.00 0.00 ? 17  ARG A HA     2  
ATOM   2966  H HB2    . ARG C 2 17 ? -0.644  2.196   8.317   1.00 0.00 ? 17  ARG A HB2    2  
ATOM   2967  H HB3    . ARG C 2 17 ? 0.960   2.607   8.921   1.00 0.00 ? 17  ARG A HB3    2  
ATOM   2968  H HG2    . ARG C 2 17 ? 0.144   3.059   10.968  1.00 0.00 ? 17  ARG A HG2    2  
ATOM   2969  H HG3    . ARG C 2 17 ? -1.070  4.149   10.302  1.00 0.00 ? 17  ARG A HG3    2  
ATOM   2970  H HD2    . ARG C 2 17 ? -2.711  2.543   10.330  1.00 0.00 ? 17  ARG A HD2    2  
ATOM   2971  H HD3    . ARG C 2 17 ? -1.583  1.249   9.879   1.00 0.00 ? 17  ARG A HD3    2  
ATOM   2972  H HE     . ARG C 2 17 ? -0.678  1.757   12.344  1.00 0.00 ? 17  ARG A HE     2  
ATOM   2973  H HH11   . ARG C 2 17 ? -2.545  -0.514  12.121  1.00 0.00 ? 17  ARG A HH11   2  
ATOM   2974  H HH12   . ARG C 2 17 ? -3.824  -0.074  13.202  1.00 0.00 ? 17  ARG A HH12   2  
ATOM   2975  H HH21   . ARG C 2 17 ? -2.921  3.270   13.335  1.00 0.00 ? 17  ARG A HH21   2  
ATOM   2976  H HH22   . ARG C 2 17 ? -4.038  2.068   13.889  1.00 0.00 ? 17  ARG A HH22   2  
ATOM   2977  N N      . ARG C 2 18 ? -2.232  4.551   6.925   1.00 0.00 ? 18  ARG A N      2  
ATOM   2978  C CA     . ARG C 2 18 ? -3.624  5.068   6.796   1.00 0.00 ? 18  ARG A CA     2  
ATOM   2979  C C      . ARG C 2 18 ? -4.545  3.948   6.306   1.00 0.00 ? 18  ARG A C      2  
ATOM   2980  O O      . ARG C 2 18 ? -4.137  3.085   5.555   1.00 0.00 ? 18  ARG A O      2  
ATOM   2981  C CB     . ARG C 2 18 ? -3.535  6.189   5.757   1.00 0.00 ? 18  ARG A CB     2  
ATOM   2982  C CG     . ARG C 2 18 ? -4.922  6.795   5.531   1.00 0.00 ? 18  ARG A CG     2  
ATOM   2983  C CD     . ARG C 2 18 ? -4.785  8.114   4.767   1.00 0.00 ? 18  ARG A CD     2  
ATOM   2984  N NE     . ARG C 2 18 ? -4.278  7.730   3.422   1.00 0.00 ? 18  ARG A NE     2  
ATOM   2985  C CZ     . ARG C 2 18 ? -4.550  8.473   2.383   1.00 0.00 ? 18  ARG A CZ     2  
ATOM   2986  N NH1    . ARG C 2 18 ? -4.453  9.773   2.467   1.00 0.00 ? 18  ARG A NH1    2  
ATOM   2987  N NH2    . ARG C 2 18 ? -4.916  7.918   1.261   1.00 0.00 ? 18  ARG A NH2    2  
ATOM   2988  H H      . ARG C 2 18 ? -1.853  3.994   6.214   1.00 0.00 ? 18  ARG A H      2  
ATOM   2989  H HA     . ARG C 2 18 ? -3.971  5.462   7.738   1.00 0.00 ? 18  ARG A HA     2  
ATOM   2990  H HB2    . ARG C 2 18 ? -2.862  6.955   6.112   1.00 0.00 ? 18  ARG A HB2    2  
ATOM   2991  H HB3    . ARG C 2 18 ? -3.164  5.787   4.827   1.00 0.00 ? 18  ARG A HB3    2  
ATOM   2992  H HG2    . ARG C 2 18 ? -5.526  6.106   4.956   1.00 0.00 ? 18  ARG A HG2    2  
ATOM   2993  H HG3    . ARG C 2 18 ? -5.395  6.979   6.484   1.00 0.00 ? 18  ARG A HG3    2  
ATOM   2994  H HD2    . ARG C 2 18 ? -5.748  8.600   4.685   1.00 0.00 ? 18  ARG A HD2    2  
ATOM   2995  H HD3    . ARG C 2 18 ? -4.077  8.762   5.259   1.00 0.00 ? 18  ARG A HD3    2  
ATOM   2996  H HE     . ARG C 2 18 ? -3.740  6.918   3.314   1.00 0.00 ? 18  ARG A HE     2  
ATOM   2997  H HH11   . ARG C 2 18 ? -4.171  10.199  3.327   1.00 0.00 ? 18  ARG A HH11   2  
ATOM   2998  H HH12   . ARG C 2 18 ? -4.661  10.342  1.672   1.00 0.00 ? 18  ARG A HH12   2  
ATOM   2999  H HH21   . ARG C 2 18 ? -4.989  6.923   1.197   1.00 0.00 ? 18  ARG A HH21   2  
ATOM   3000  H HH22   . ARG C 2 18 ? -5.125  8.488   0.466   1.00 0.00 ? 18  ARG A HH22   2  
ATOM   3001  N N      . GLU C 2 19 ? -5.782  3.951   6.726   1.00 0.00 ? 19  GLU A N      2  
ATOM   3002  C CA     . GLU C 2 19 ? -6.722  2.880   6.284   1.00 0.00 ? 19  GLU A CA     2  
ATOM   3003  C C      . GLU C 2 19 ? -7.631  3.397   5.164   1.00 0.00 ? 19  GLU A C      2  
ATOM   3004  O O      . GLU C 2 19 ? -8.001  4.555   5.137   1.00 0.00 ? 19  GLU A O      2  
ATOM   3005  C CB     . GLU C 2 19 ? -7.545  2.532   7.527   1.00 0.00 ? 19  GLU A CB     2  
ATOM   3006  C CG     . GLU C 2 19 ? -7.273  1.081   7.932   1.00 0.00 ? 19  GLU A CG     2  
ATOM   3007  C CD     . GLU C 2 19 ? -8.172  0.703   9.111   1.00 0.00 ? 19  GLU A CD     2  
ATOM   3008  O OE1    . GLU C 2 19 ? -9.369  0.914   9.009   1.00 0.00 ? 19  GLU A OE1    2  
ATOM   3009  O OE2    . GLU C 2 19 ? -7.648  0.210   10.096  1.00 0.00 ? 19  GLU A OE2    2  
ATOM   3010  H H      . GLU C 2 19 ? -6.091  4.655   7.333   1.00 0.00 ? 19  GLU A H      2  
ATOM   3011  H HA     . GLU C 2 19 ? -6.173  2.013   5.950   1.00 0.00 ? 19  GLU A HA     2  
ATOM   3012  H HB2    . GLU C 2 19 ? -7.267  3.191   8.338   1.00 0.00 ? 19  GLU A HB2    2  
ATOM   3013  H HB3    . GLU C 2 19 ? -8.595  2.651   7.311   1.00 0.00 ? 19  GLU A HB3    2  
ATOM   3014  H HG2    . GLU C 2 19 ? -7.481  0.429   7.095   1.00 0.00 ? 19  GLU A HG2    2  
ATOM   3015  H HG3    . GLU C 2 19 ? -6.238  0.976   8.223   1.00 0.00 ? 19  GLU A HG3    2  
ATOM   3016  N N      . VAL C 2 20 ? -7.992  2.546   4.242   1.00 0.00 ? 20  VAL A N      2  
ATOM   3017  C CA     . VAL C 2 20 ? -8.878  2.983   3.123   1.00 0.00 ? 20  VAL A CA     2  
ATOM   3018  C C      . VAL C 2 20 ? -10.020 1.981   2.937   1.00 0.00 ? 20  VAL A C      2  
ATOM   3019  O O      . VAL C 2 20 ? -9.867  0.974   2.275   1.00 0.00 ? 20  VAL A O      2  
ATOM   3020  C CB     . VAL C 2 20 ? -7.985  3.005   1.881   1.00 0.00 ? 20  VAL A CB     2  
ATOM   3021  C CG1    . VAL C 2 20 ? -8.755  3.622   0.712   1.00 0.00 ? 20  VAL A CG1    2  
ATOM   3022  C CG2    . VAL C 2 20 ? -6.734  3.841   2.161   1.00 0.00 ? 20  VAL A CG2    2  
ATOM   3023  H H      . VAL C 2 20 ? -7.681  1.617   4.286   1.00 0.00 ? 20  VAL A H      2  
ATOM   3024  H HA     . VAL C 2 20 ? -9.267  3.969   3.315   1.00 0.00 ? 20  VAL A HA     2  
ATOM   3025  H HB     . VAL C 2 20 ? -7.697  1.996   1.627   1.00 0.00 ? 20  VAL A HB     2  
ATOM   3026  H HG11   . VAL C 2 20 ? -8.061  4.088   0.029   1.00 0.00 ? 20  VAL A HG11   2  
ATOM   3027  H HG12   . VAL C 2 20 ? -9.444  4.365   1.087   1.00 0.00 ? 20  VAL A HG12   2  
ATOM   3028  H HG13   . VAL C 2 20 ? -9.305  2.850   0.195   1.00 0.00 ? 20  VAL A HG13   2  
ATOM   3029  H HG21   . VAL C 2 20 ? -6.154  3.934   1.254   1.00 0.00 ? 20  VAL A HG21   2  
ATOM   3030  H HG22   . VAL C 2 20 ? -6.142  3.355   2.921   1.00 0.00 ? 20  VAL A HG22   2  
ATOM   3031  H HG23   . VAL C 2 20 ? -7.026  4.823   2.504   1.00 0.00 ? 20  VAL A HG23   2  
ATOM   3032  N N      . PHE C 2 21 ? -11.161 2.249   3.513   1.00 0.00 ? 21  PHE A N      2  
ATOM   3033  C CA     . PHE C 2 21 ? -12.313 1.308   3.367   1.00 0.00 ? 21  PHE A CA     2  
ATOM   3034  C C      . PHE C 2 21 ? -13.053 1.566   2.050   1.00 0.00 ? 21  PHE A C      2  
ATOM   3035  O O      . PHE C 2 21 ? -14.266 1.604   2.010   1.00 0.00 ? 21  PHE A O      2  
ATOM   3036  C CB     . PHE C 2 21 ? -13.221 1.608   4.562   1.00 0.00 ? 21  PHE A CB     2  
ATOM   3037  C CG     . PHE C 2 21 ? -13.058 0.526   5.604   1.00 0.00 ? 21  PHE A CG     2  
ATOM   3038  C CD1    . PHE C 2 21 ? -13.669 -0.720  5.420   1.00 0.00 ? 21  PHE A CD1    2  
ATOM   3039  C CD2    . PHE C 2 21 ? -12.295 0.769   6.752   1.00 0.00 ? 21  PHE A CD2    2  
ATOM   3040  C CE1    . PHE C 2 21 ? -13.518 -1.724  6.384   1.00 0.00 ? 21  PHE A CE1    2  
ATOM   3041  C CE2    . PHE C 2 21 ? -12.144 -0.235  7.717   1.00 0.00 ? 21  PHE A CE2    2  
ATOM   3042  C CZ     . PHE C 2 21 ? -12.755 -1.481  7.533   1.00 0.00 ? 21  PHE A CZ     2  
ATOM   3043  H H      . PHE C 2 21 ? -11.262 3.068   4.041   1.00 0.00 ? 21  PHE A H      2  
ATOM   3044  H HA     . PHE C 2 21 ? -11.972 0.287   3.412   1.00 0.00 ? 21  PHE A HA     2  
ATOM   3045  H HB2    . PHE C 2 21 ? -12.950 2.563   4.989   1.00 0.00 ? 21  PHE A HB2    2  
ATOM   3046  H HB3    . PHE C 2 21 ? -14.249 1.639   4.235   1.00 0.00 ? 21  PHE A HB3    2  
ATOM   3047  H HD1    . PHE C 2 21 ? -14.258 -0.907  4.534   1.00 0.00 ? 21  PHE A HD1    2  
ATOM   3048  H HD2    . PHE C 2 21 ? -11.824 1.730   6.894   1.00 0.00 ? 21  PHE A HD2    2  
ATOM   3049  H HE1    . PHE C 2 21 ? -13.989 -2.685  6.242   1.00 0.00 ? 21  PHE A HE1    2  
ATOM   3050  H HE2    . PHE C 2 21 ? -11.555 -0.047  8.603   1.00 0.00 ? 21  PHE A HE2    2  
ATOM   3051  H HZ     . PHE C 2 21 ? -12.638 -2.255  8.277   1.00 0.00 ? 21  PHE A HZ     2  
ATOM   3052  N N      . ARG C 2 22 ? -12.329 1.726   0.969   1.00 0.00 ? 22  ARG A N      2  
ATOM   3053  C CA     . ARG C 2 22 ? -12.975 1.971   -0.357  1.00 0.00 ? 22  ARG A CA     2  
ATOM   3054  C C      . ARG C 2 22 ? -13.977 3.130   -0.277  1.00 0.00 ? 22  ARG A C      2  
ATOM   3055  O O      . ARG C 2 22 ? -14.330 3.593   0.790   1.00 0.00 ? 22  ARG A O      2  
ATOM   3056  C CB     . ARG C 2 22 ? -13.704 0.670   -0.681  1.00 0.00 ? 22  ARG A CB     2  
ATOM   3057  C CG     . ARG C 2 22 ? -12.855 -0.172  -1.631  1.00 0.00 ? 22  ARG A CG     2  
ATOM   3058  C CD     . ARG C 2 22 ? -12.731 0.539   -2.979  1.00 0.00 ? 22  ARG A CD     2  
ATOM   3059  N NE     . ARG C 2 22 ? -11.278 0.503   -3.301  1.00 0.00 ? 22  ARG A NE     2  
ATOM   3060  C CZ     . ARG C 2 22 ? -10.680 -0.633  -3.541  1.00 0.00 ? 22  ARG A CZ     2  
ATOM   3061  N NH1    . ARG C 2 22 ? -10.687 -1.132  -4.744  1.00 0.00 ? 22  ARG A NH1    2  
ATOM   3062  N NH2    . ARG C 2 22 ? -10.068 -1.265  -2.578  1.00 0.00 ? 22  ARG A NH2    2  
ATOM   3063  H H      . ARG C 2 22 ? -11.357 1.672   1.026   1.00 0.00 ? 22  ARG A H      2  
ATOM   3064  H HA     . ARG C 2 22 ? -12.228 2.169   -1.112  1.00 0.00 ? 22  ARG A HA     2  
ATOM   3065  H HB2    . ARG C 2 22 ? -13.879 0.117   0.232   1.00 0.00 ? 22  ARG A HB2    2  
ATOM   3066  H HB3    . ARG C 2 22 ? -14.646 0.899   -1.150  1.00 0.00 ? 22  ARG A HB3    2  
ATOM   3067  H HG2    . ARG C 2 22 ? -11.873 -0.315  -1.205  1.00 0.00 ? 22  ARG A HG2    2  
ATOM   3068  H HG3    . ARG C 2 22 ? -13.324 -1.130  -1.777  1.00 0.00 ? 22  ARG A HG3    2  
ATOM   3069  H HD2    . ARG C 2 22 ? -13.299 0.014   -3.734  1.00 0.00 ? 22  ARG A HD2    2  
ATOM   3070  H HD3    . ARG C 2 22 ? -13.065 1.561   -2.898  1.00 0.00 ? 22  ARG A HD3    2  
ATOM   3071  H HE     . ARG C 2 22 ? -10.771 1.338   -3.332  1.00 0.00 ? 22  ARG A HE     2  
ATOM   3072  H HH11   . ARG C 2 22 ? -11.152 -0.645  -5.483  1.00 0.00 ? 22  ARG A HH11   2  
ATOM   3073  H HH12   . ARG C 2 22 ? -10.229 -2.002  -4.927  1.00 0.00 ? 22  ARG A HH12   2  
ATOM   3074  H HH21   . ARG C 2 22 ? -10.056 -0.880  -1.655  1.00 0.00 ? 22  ARG A HH21   2  
ATOM   3075  H HH22   . ARG C 2 22 ? -9.612  -2.136  -2.762  1.00 0.00 ? 22  ARG A HH22   2  
ATOM   3076  N N      . LYS C 2 23 ? -14.435 3.600   -1.404  1.00 0.00 ? 23  LYS A N      2  
ATOM   3077  C CA     . LYS C 2 23 ? -15.416 4.721   -1.401  1.00 0.00 ? 23  LYS A CA     2  
ATOM   3078  C C      . LYS C 2 23 ? -16.560 4.431   -2.381  1.00 0.00 ? 23  LYS A C      2  
ATOM   3079  O O      . LYS C 2 23 ? -17.681 4.850   -2.167  1.00 0.00 ? 23  LYS A O      2  
ATOM   3080  C CB     . LYS C 2 23 ? -14.621 5.947   -1.849  1.00 0.00 ? 23  LYS A CB     2  
ATOM   3081  C CG     . LYS C 2 23 ? -15.124 7.190   -1.108  1.00 0.00 ? 23  LYS A CG     2  
ATOM   3082  C CD     . LYS C 2 23 ? -14.776 7.087   0.382   1.00 0.00 ? 23  LYS A CD     2  
ATOM   3083  C CE     . LYS C 2 23 ? -13.263 6.919   0.551   1.00 0.00 ? 23  LYS A CE     2  
ATOM   3084  N NZ     . LYS C 2 23 ? -13.013 7.141   2.002   1.00 0.00 ? 23  LYS A NZ     2  
ATOM   3085  H H      . LYS C 2 23 ? -14.134 3.216   -2.251  1.00 0.00 ? 23  LYS A H      2  
ATOM   3086  H HA     . LYS C 2 23 ? -15.806 4.877   -0.409  1.00 0.00 ? 23  LYS A HA     2  
ATOM   3087  H HB2    . LYS C 2 23 ? -13.576 5.795   -1.626  1.00 0.00 ? 23  LYS A HB2    2  
ATOM   3088  H HB3    . LYS C 2 23 ? -14.745 6.089   -2.912  1.00 0.00 ? 23  LYS A HB3    2  
ATOM   3089  H HG2    . LYS C 2 23 ? -14.656 8.070   -1.526  1.00 0.00 ? 23  LYS A HG2    2  
ATOM   3090  H HG3    . LYS C 2 23 ? -16.195 7.265   -1.221  1.00 0.00 ? 23  LYS A HG3    2  
ATOM   3091  H HD2    . LYS C 2 23 ? -15.096 7.988   0.887   1.00 0.00 ? 23  LYS A HD2    2  
ATOM   3092  H HD3    . LYS C 2 23 ? -15.280 6.236   0.813   1.00 0.00 ? 23  LYS A HD3    2  
ATOM   3093  H HE2    . LYS C 2 23 ? -12.962 5.920   0.261   1.00 0.00 ? 23  LYS A HE2    2  
ATOM   3094  H HE3    . LYS C 2 23 ? -12.734 7.656   -0.033  1.00 0.00 ? 23  LYS A HE3    2  
ATOM   3095  H HZ1    . LYS C 2 23 ? -13.147 8.145   2.229   1.00 0.00 ? 23  LYS A HZ1    2  
ATOM   3096  H HZ2    . LYS C 2 23 ? -13.679 6.566   2.559   1.00 0.00 ? 23  LYS A HZ2    2  
ATOM   3097  H HZ3    . LYS C 2 23 ? -12.038 6.863   2.233   1.00 0.00 ? 23  LYS A HZ3    2  
ATOM   3098  N N      . SER C 2 24 ? -16.289 3.711   -3.449  1.00 0.00 ? 24  SER A N      2  
ATOM   3099  C CA     . SER C 2 24 ? -17.367 3.386   -4.449  1.00 0.00 ? 24  SER A CA     2  
ATOM   3100  C C      . SER C 2 24 ? -16.757 2.892   -5.765  1.00 0.00 ? 24  SER A C      2  
ATOM   3101  O O      . SER C 2 24 ? -15.589 2.562   -5.838  1.00 0.00 ? 24  SER A O      2  
ATOM   3102  C CB     . SER C 2 24 ? -18.127 4.696   -4.694  1.00 0.00 ? 24  SER A CB     2  
ATOM   3103  O OG     . SER C 2 24 ? -19.359 4.663   -3.986  1.00 0.00 ? 24  SER A OG     2  
ATOM   3104  H H      . SER C 2 24 ? -15.377 3.373   -3.590  1.00 0.00 ? 24  SER A H      2  
ATOM   3105  H HA     . SER C 2 24 ? -18.036 2.644   -4.047  1.00 0.00 ? 24  SER A HA     2  
ATOM   3106  H HB2    . SER C 2 24 ? -17.539 5.529   -4.346  1.00 0.00 ? 24  SER A HB2    2  
ATOM   3107  H HB3    . SER C 2 24 ? -18.313 4.811   -5.754  1.00 0.00 ? 24  SER A HB3    2  
ATOM   3108  H HG     . SER C 2 24 ? -19.697 5.561   -3.937  1.00 0.00 ? 24  SER A HG     2  
ATOM   3109  N N      . GLY C 2 25 ? -17.548 2.845   -6.809  1.00 0.00 ? 25  GLY A N      2  
ATOM   3110  C CA     . GLY C 2 25 ? -17.030 2.381   -8.130  1.00 0.00 ? 25  GLY A CA     2  
ATOM   3111  C C      . GLY C 2 25 ? -17.462 0.935   -8.376  1.00 0.00 ? 25  GLY A C      2  
ATOM   3112  O O      . GLY C 2 25 ? -18.237 0.644   -9.266  1.00 0.00 ? 25  GLY A O      2  
ATOM   3113  H H      . GLY C 2 25 ? -18.484 3.122   -6.724  1.00 0.00 ? 25  GLY A H      2  
ATOM   3114  H HA2    . GLY C 2 25 ? -17.423 3.014   -8.913  1.00 0.00 ? 25  GLY A HA2    2  
ATOM   3115  H HA3    . GLY C 2 25 ? -15.952 2.433   -8.133  1.00 0.00 ? 25  GLY A HA3    2  
ATOM   3116  N N      . ALA C 2 26 ? -16.954 0.030   -7.590  1.00 0.00 ? 26  ALA A N      2  
ATOM   3117  C CA     . ALA C 2 26 ? -17.302 -1.413  -7.748  1.00 0.00 ? 26  ALA A CA     2  
ATOM   3118  C C      . ALA C 2 26 ? -16.623 -2.202  -6.630  1.00 0.00 ? 26  ALA A C      2  
ATOM   3119  O O      . ALA C 2 26 ? -17.192 -3.099  -6.041  1.00 0.00 ? 26  ALA A O      2  
ATOM   3120  C CB     . ALA C 2 26 ? -16.732 -1.818  -9.110  1.00 0.00 ? 26  ALA A CB     2  
ATOM   3121  H H      . ALA C 2 26 ? -16.328 0.301   -6.886  1.00 0.00 ? 26  ALA A H      2  
ATOM   3122  H HA     . ALA C 2 26 ? -18.371 -1.557  -7.727  1.00 0.00 ? 26  ALA A HA     2  
ATOM   3123  H HB1    . ALA C 2 26 ? -16.461 -2.863  -9.091  1.00 0.00 ? 26  ALA A HB1    2  
ATOM   3124  H HB2    . ALA C 2 26 ? -15.856 -1.224  -9.323  1.00 0.00 ? 26  ALA A HB2    2  
ATOM   3125  H HB3    . ALA C 2 26 ? -17.476 -1.652  -9.875  1.00 0.00 ? 26  ALA A HB3    2  
ATOM   3126  N N      . THR C 2 27 ? -15.409 -1.839  -6.332  1.00 0.00 ? 27  THR A N      2  
ATOM   3127  C CA     . THR C 2 27 ? -14.651 -2.514  -5.244  1.00 0.00 ? 27  THR A CA     2  
ATOM   3128  C C      . THR C 2 27 ? -15.121 -1.989  -3.881  1.00 0.00 ? 27  THR A C      2  
ATOM   3129  O O      . THR C 2 27 ? -14.650 -2.418  -2.848  1.00 0.00 ? 27  THR A O      2  
ATOM   3130  C CB     . THR C 2 27 ? -13.192 -2.117  -5.501  1.00 0.00 ? 27  THR A CB     2  
ATOM   3131  O OG1    . THR C 2 27 ? -13.116 -0.714  -5.727  1.00 0.00 ? 27  THR A OG1    2  
ATOM   3132  C CG2    . THR C 2 27 ? -12.668 -2.867  -6.730  1.00 0.00 ? 27  THR A CG2    2  
ATOM   3133  H H      . THR C 2 27 ? -14.995 -1.100  -6.822  1.00 0.00 ? 27  THR A H      2  
ATOM   3134  H HA     . THR C 2 27 ? -14.764 -3.584  -5.304  1.00 0.00 ? 27  THR A HA     2  
ATOM   3135  H HB     . THR C 2 27 ? -12.589 -2.370  -4.644  1.00 0.00 ? 27  THR A HB     2  
ATOM   3136  H HG1    . THR C 2 27 ? -13.190 -0.556  -6.672  1.00 0.00 ? 27  THR A HG1    2  
ATOM   3137  H HG21   . THR C 2 27 ? -12.884 -2.291  -7.621  1.00 0.00 ? 27  THR A HG21   2  
ATOM   3138  H HG22   . THR C 2 27 ? -13.152 -3.829  -6.799  1.00 0.00 ? 27  THR A HG22   2  
ATOM   3139  H HG23   . THR C 2 27 ? -11.601 -3.005  -6.641  1.00 0.00 ? 27  THR A HG23   2  
ATOM   3140  N N      . CYS C 2 28 ? -16.046 -1.054  -3.882  1.00 0.00 ? 28  CYS A N      2  
ATOM   3141  C CA     . CYS C 2 28 ? -16.563 -0.471  -2.605  1.00 0.00 ? 28  CYS A CA     2  
ATOM   3142  C C      . CYS C 2 28 ? -16.733 -1.539  -1.520  1.00 0.00 ? 28  CYS A C      2  
ATOM   3143  O O      . CYS C 2 28 ? -17.322 -2.580  -1.743  1.00 0.00 ? 28  CYS A O      2  
ATOM   3144  C CB     . CYS C 2 28 ? -17.921 0.126   -2.973  1.00 0.00 ? 28  CYS A CB     2  
ATOM   3145  S SG     . CYS C 2 28 ? -18.432 1.297   -1.691  1.00 0.00 ? 28  CYS A SG     2  
ATOM   3146  H H      . CYS C 2 28 ? -16.398 -0.725  -4.733  1.00 0.00 ? 28  CYS A H      2  
ATOM   3147  H HA     . CYS C 2 28 ? -15.909 0.309   -2.262  1.00 0.00 ? 28  CYS A HA     2  
ATOM   3148  H HB2    . CYS C 2 28 ? -17.843 0.641   -3.920  1.00 0.00 ? 28  CYS A HB2    2  
ATOM   3149  H HB3    . CYS C 2 28 ? -18.653 -0.663  -3.051  1.00 0.00 ? 28  CYS A HB3    2  
ATOM   3150  H HG     . CYS C 2 28 ? -18.836 0.798   -0.978  1.00 0.00 ? 28  CYS A HG     2  
ATOM   3151  N N      . GLY C 2 29 ? -16.232 -1.279  -0.341  1.00 0.00 ? 29  GLY A N      2  
ATOM   3152  C CA     . GLY C 2 29 ? -16.374 -2.269  0.769   1.00 0.00 ? 29  GLY A CA     2  
ATOM   3153  C C      . GLY C 2 29 ? -15.009 -2.855  1.150   1.00 0.00 ? 29  GLY A C      2  
ATOM   3154  O O      . GLY C 2 29 ? -14.859 -3.456  2.196   1.00 0.00 ? 29  GLY A O      2  
ATOM   3155  H H      . GLY C 2 29 ? -15.771 -0.425  -0.185  1.00 0.00 ? 29  GLY A H      2  
ATOM   3156  H HA2    . GLY C 2 29 ? -16.806 -1.779  1.630   1.00 0.00 ? 29  GLY A HA2    2  
ATOM   3157  H HA3    . GLY C 2 29 ? -17.026 -3.069  0.450   1.00 0.00 ? 29  GLY A HA3    2  
ATOM   3158  N N      . ARG C 2 30 ? -14.015 -2.698  0.315   1.00 0.00 ? 30  ARG A N      2  
ATOM   3159  C CA     . ARG C 2 30 ? -12.670 -3.260  0.644   1.00 0.00 ? 30  ARG A CA     2  
ATOM   3160  C C      . ARG C 2 30 ? -11.890 -2.297  1.545   1.00 0.00 ? 30  ARG A C      2  
ATOM   3161  O O      . ARG C 2 30 ? -12.085 -1.098  1.504   1.00 0.00 ? 30  ARG A O      2  
ATOM   3162  C CB     . ARG C 2 30 ? -11.964 -3.425  -0.702  1.00 0.00 ? 30  ARG A CB     2  
ATOM   3163  C CG     . ARG C 2 30 ? -12.325 -4.783  -1.307  1.00 0.00 ? 30  ARG A CG     2  
ATOM   3164  C CD     . ARG C 2 30 ? -11.388 -5.086  -2.478  1.00 0.00 ? 30  ARG A CD     2  
ATOM   3165  N NE     . ARG C 2 30 ? -11.764 -6.456  -2.926  1.00 0.00 ? 30  ARG A NE     2  
ATOM   3166  C CZ     . ARG C 2 30 ? -10.868 -7.405  -2.945  1.00 0.00 ? 30  ARG A CZ     2  
ATOM   3167  N NH1    . ARG C 2 30 ? -10.319 -7.806  -1.831  1.00 0.00 ? 30  ARG A NH1    2  
ATOM   3168  N NH2    . ARG C 2 30 ? -10.520 -7.951  -4.078  1.00 0.00 ? 30  ARG A NH2    2  
ATOM   3169  H H      . ARG C 2 30 ? -14.152 -2.216  -0.525  1.00 0.00 ? 30  ARG A H      2  
ATOM   3170  H HA     . ARG C 2 30 ? -12.772 -4.221  1.124   1.00 0.00 ? 30  ARG A HA     2  
ATOM   3171  H HB2    . ARG C 2 30 ? -12.276 -2.639  -1.372  1.00 0.00 ? 30  ARG A HB2    2  
ATOM   3172  H HB3    . ARG C 2 30 ? -10.895 -3.372  -0.559  1.00 0.00 ? 30  ARG A HB3    2  
ATOM   3173  H HG2    . ARG C 2 30 ? -12.224 -5.550  -0.553  1.00 0.00 ? 30  ARG A HG2    2  
ATOM   3174  H HG3    . ARG C 2 30 ? -13.345 -4.760  -1.661  1.00 0.00 ? 30  ARG A HG3    2  
ATOM   3175  H HD2    . ARG C 2 30 ? -11.541 -4.372  -3.275  1.00 0.00 ? 30  ARG A HD2    2  
ATOM   3176  H HD3    . ARG C 2 30 ? -10.361 -5.074  -2.150  1.00 0.00 ? 30  ARG A HD3    2  
ATOM   3177  H HE     . ARG C 2 30 ? -12.684 -6.645  -3.205  1.00 0.00 ? 30  ARG A HE     2  
ATOM   3178  H HH11   . ARG C 2 30 ? -10.585 -7.386  -0.963  1.00 0.00 ? 30  ARG A HH11   2  
ATOM   3179  H HH12   . ARG C 2 30 ? -9.633  -8.533  -1.845  1.00 0.00 ? 30  ARG A HH12   2  
ATOM   3180  H HH21   . ARG C 2 30 ? -10.939 -7.643  -4.931  1.00 0.00 ? 30  ARG A HH21   2  
ATOM   3181  H HH22   . ARG C 2 30 ? -9.834  -8.679  -4.092  1.00 0.00 ? 30  ARG A HH22   2  
ATOM   3182  N N      . SER C 2 31 ? -11.007 -2.817  2.358   1.00 0.00 ? 31  SER A N      2  
ATOM   3183  C CA     . SER C 2 31 ? -10.211 -1.937  3.262   1.00 0.00 ? 31  SER A CA     2  
ATOM   3184  C C      . SER C 2 31 ? -8.718  -2.076  2.960   1.00 0.00 ? 31  SER A C      2  
ATOM   3185  O O      . SER C 2 31 ? -8.096  -3.067  3.290   1.00 0.00 ? 31  SER A O      2  
ATOM   3186  C CB     . SER C 2 31 ? -10.523 -2.432  4.673   1.00 0.00 ? 31  SER A CB     2  
ATOM   3187  O OG     . SER C 2 31 ? -10.256 -3.826  4.752   1.00 0.00 ? 31  SER A OG     2  
ATOM   3188  H H      . SER C 2 31 ? -10.867 -3.787  2.372   1.00 0.00 ? 31  SER A H      2  
ATOM   3189  H HA     . SER C 2 31 ? -10.521 -0.912  3.157   1.00 0.00 ? 31  SER A HA     2  
ATOM   3190  H HB2    . SER C 2 31 ? -9.905  -1.911  5.384   1.00 0.00 ? 31  SER A HB2    2  
ATOM   3191  H HB3    . SER C 2 31 ? -11.565 -2.239  4.897   1.00 0.00 ? 31  SER A HB3    2  
ATOM   3192  H HG     . SER C 2 31 ? -11.060 -4.295  4.516   1.00 0.00 ? 31  SER A HG     2  
ATOM   3193  N N      . ASP C 2 32 ? -8.141  -1.086  2.335   1.00 0.00 ? 32  ASP A N      2  
ATOM   3194  C CA     . ASP C 2 32 ? -6.688  -1.152  2.005   1.00 0.00 ? 32  ASP A CA     2  
ATOM   3195  C C      . ASP C 2 32 ? -5.904  -0.169  2.875   1.00 0.00 ? 32  ASP A C      2  
ATOM   3196  O O      . ASP C 2 32 ? -6.223  1.000   2.950   1.00 0.00 ? 32  ASP A O      2  
ATOM   3197  C CB     . ASP C 2 32 ? -6.601  -0.763  0.530   1.00 0.00 ? 32  ASP A CB     2  
ATOM   3198  C CG     . ASP C 2 32 ? -7.101  -1.922  -0.333  1.00 0.00 ? 32  ASP A CG     2  
ATOM   3199  O OD1    . ASP C 2 32 ? -6.642  -3.033  -0.122  1.00 0.00 ? 32  ASP A OD1    2  
ATOM   3200  O OD2    . ASP C 2 32 ? -7.935  -1.679  -1.188  1.00 0.00 ? 32  ASP A OD2    2  
ATOM   3201  H H      . ASP C 2 32 ? -8.663  -0.299  2.079   1.00 0.00 ? 32  ASP A H      2  
ATOM   3202  H HA     . ASP C 2 32 ? -6.314  -2.149  2.145   1.00 0.00 ? 32  ASP A HA     2  
ATOM   3203  H HB2    . ASP C 2 32 ? -7.213  0.109   0.352   1.00 0.00 ? 32  ASP A HB2    2  
ATOM   3204  H HB3    . ASP C 2 32 ? -5.574  -0.542  0.274   1.00 0.00 ? 32  ASP A HB3    2  
ATOM   3205  N N      . THR C 2 33 ? -4.881  -0.639  3.535   1.00 0.00 ? 33  THR A N      2  
ATOM   3206  C CA     . THR C 2 33 ? -4.077  0.263   4.404   1.00 0.00 ? 33  THR A CA     2  
ATOM   3207  C C      . THR C 2 33 ? -2.811  0.706   3.670   1.00 0.00 ? 33  THR A C      2  
ATOM   3208  O O      . THR C 2 33 ? -2.010  -0.105  3.251   1.00 0.00 ? 33  THR A O      2  
ATOM   3209  C CB     . THR C 2 33 ? -3.723  -0.578  5.631   1.00 0.00 ? 33  THR A CB     2  
ATOM   3210  O OG1    . THR C 2 33 ? -4.875  -1.288  6.064   1.00 0.00 ? 33  THR A OG1    2  
ATOM   3211  C CG2    . THR C 2 33 ? -3.232  0.336   6.754   1.00 0.00 ? 33  THR A CG2    2  
ATOM   3212  H H      . THR C 2 33 ? -4.645  -1.587  3.460   1.00 0.00 ? 33  THR A H      2  
ATOM   3213  H HA     . THR C 2 33 ? -4.662  1.120   4.700   1.00 0.00 ? 33  THR A HA     2  
ATOM   3214  H HB     . THR C 2 33 ? -2.943  -1.278  5.375   1.00 0.00 ? 33  THR A HB     2  
ATOM   3215  H HG1    . THR C 2 33 ? -4.637  -1.790  6.847   1.00 0.00 ? 33  THR A HG1    2  
ATOM   3216  H HG21   . THR C 2 33 ? -2.526  1.049   6.355   1.00 0.00 ? 33  THR A HG21   2  
ATOM   3217  H HG22   . THR C 2 33 ? -2.750  -0.258  7.516   1.00 0.00 ? 33  THR A HG22   2  
ATOM   3218  H HG23   . THR C 2 33 ? -4.071  0.862   7.184   1.00 0.00 ? 33  THR A HG23   2  
ATOM   3219  N N      . TYR C 2 34 ? -2.631  1.988   3.510   1.00 0.00 ? 34  TYR A N      2  
ATOM   3220  C CA     . TYR C 2 34 ? -1.421  2.491   2.802   1.00 0.00 ? 34  TYR A CA     2  
ATOM   3221  C C      . TYR C 2 34 ? -0.448  3.103   3.814   1.00 0.00 ? 34  TYR A C      2  
ATOM   3222  O O      . TYR C 2 34 ? -0.856  3.697   4.792   1.00 0.00 ? 34  TYR A O      2  
ATOM   3223  C CB     . TYR C 2 34 ? -1.946  3.556   1.843   1.00 0.00 ? 34  TYR A CB     2  
ATOM   3224  C CG     . TYR C 2 34 ? -2.856  2.903   0.834   1.00 0.00 ? 34  TYR A CG     2  
ATOM   3225  C CD1    . TYR C 2 34 ? -4.147  2.506   1.204   1.00 0.00 ? 34  TYR A CD1    2  
ATOM   3226  C CD2    . TYR C 2 34 ? -2.408  2.688   -0.472  1.00 0.00 ? 34  TYR A CD2    2  
ATOM   3227  C CE1    . TYR C 2 34 ? -4.987  1.899   0.268   1.00 0.00 ? 34  TYR A CE1    2  
ATOM   3228  C CE2    . TYR C 2 34 ? -3.248  2.079   -1.409  1.00 0.00 ? 34  TYR A CE2    2  
ATOM   3229  C CZ     . TYR C 2 34 ? -4.539  1.685   -1.041  1.00 0.00 ? 34  TYR A CZ     2  
ATOM   3230  O OH     . TYR C 2 34 ? -5.368  1.084   -1.965  1.00 0.00 ? 34  TYR A OH     2  
ATOM   3231  H H      . TYR C 2 34 ? -3.294  2.620   3.855   1.00 0.00 ? 34  TYR A H      2  
ATOM   3232  H HA     . TYR C 2 34 ? -0.950  1.696   2.246   1.00 0.00 ? 34  TYR A HA     2  
ATOM   3233  H HB2    . TYR C 2 34 ? -2.498  4.304   2.398   1.00 0.00 ? 34  TYR A HB2    2  
ATOM   3234  H HB3    . TYR C 2 34 ? -1.117  4.022   1.329   1.00 0.00 ? 34  TYR A HB3    2  
ATOM   3235  H HD1    . TYR C 2 34 ? -4.497  2.667   2.214   1.00 0.00 ? 34  TYR A HD1    2  
ATOM   3236  H HD2    . TYR C 2 34 ? -1.412  2.993   -0.758  1.00 0.00 ? 34  TYR A HD2    2  
ATOM   3237  H HE1    . TYR C 2 34 ? -5.980  1.597   0.554   1.00 0.00 ? 34  TYR A HE1    2  
ATOM   3238  H HE2    . TYR C 2 34 ? -2.900  1.914   -2.416  1.00 0.00 ? 34  TYR A HE2    2  
ATOM   3239  H HH     . TYR C 2 34 ? -6.255  1.432   -1.838  1.00 0.00 ? 34  TYR A HH     2  
ATOM   3240  N N      . TYR C 2 35 ? 0.831   2.961   3.595   1.00 0.00 ? 35  TYR A N      2  
ATOM   3241  C CA     . TYR C 2 35 ? 1.816   3.535   4.563   1.00 0.00 ? 35  TYR A CA     2  
ATOM   3242  C C      . TYR C 2 35 ? 2.943   4.247   3.819   1.00 0.00 ? 35  TYR A C      2  
ATOM   3243  O O      . TYR C 2 35 ? 3.187   3.999   2.659   1.00 0.00 ? 35  TYR A O      2  
ATOM   3244  C CB     . TYR C 2 35 ? 2.386   2.348   5.356   1.00 0.00 ? 35  TYR A CB     2  
ATOM   3245  C CG     . TYR C 2 35 ? 1.539   1.114   5.154   1.00 0.00 ? 35  TYR A CG     2  
ATOM   3246  C CD1    . TYR C 2 35 ? 1.719   0.319   4.017   1.00 0.00 ? 35  TYR A CD1    2  
ATOM   3247  C CD2    . TYR C 2 35 ? 0.571   0.770   6.104   1.00 0.00 ? 35  TYR A CD2    2  
ATOM   3248  C CE1    . TYR C 2 35 ? 0.932   -0.822  3.830   1.00 0.00 ? 35  TYR A CE1    2  
ATOM   3249  C CE2    . TYR C 2 35 ? -0.216  -0.369  5.917   1.00 0.00 ? 35  TYR A CE2    2  
ATOM   3250  C CZ     . TYR C 2 35 ? -0.036  -1.165  4.781   1.00 0.00 ? 35  TYR A CZ     2  
ATOM   3251  O OH     . TYR C 2 35 ? -0.812  -2.286  4.598   1.00 0.00 ? 35  TYR A OH     2  
ATOM   3252  H H      . TYR C 2 35 ? 1.145   2.475   2.804   1.00 0.00 ? 35  TYR A H      2  
ATOM   3253  H HA     . TYR C 2 35 ? 1.323   4.219   5.235   1.00 0.00 ? 35  TYR A HA     2  
ATOM   3254  H HB2    . TYR C 2 35 ? 3.392   2.144   5.023   1.00 0.00 ? 35  TYR A HB2    2  
ATOM   3255  H HB3    . TYR C 2 35 ? 2.405   2.599   6.406   1.00 0.00 ? 35  TYR A HB3    2  
ATOM   3256  H HD1    . TYR C 2 35 ? 2.468   0.586   3.284   1.00 0.00 ? 35  TYR A HD1    2  
ATOM   3257  H HD2    . TYR C 2 35 ? 0.434   1.384   6.979   1.00 0.00 ? 35  TYR A HD2    2  
ATOM   3258  H HE1    . TYR C 2 35 ? 1.071   -1.437  2.954   1.00 0.00 ? 35  TYR A HE1    2  
ATOM   3259  H HE2    . TYR C 2 35 ? -0.962  -0.636  6.650   1.00 0.00 ? 35  TYR A HE2    2  
ATOM   3260  H HH     . TYR C 2 35 ? -0.379  -3.017  5.041   1.00 0.00 ? 35  TYR A HH     2  
ATOM   3261  N N      . GLN C 2 36 ? 3.640   5.118   4.494   1.00 0.00 ? 36  GLN A N      2  
ATOM   3262  C CA     . GLN C 2 36 ? 4.771   5.843   3.850   1.00 0.00 ? 36  GLN A CA     2  
ATOM   3263  C C      . GLN C 2 36 ? 6.029   5.651   4.694   1.00 0.00 ? 36  GLN A C      2  
ATOM   3264  O O      . GLN C 2 36 ? 5.960   5.525   5.905   1.00 0.00 ? 36  GLN A O      2  
ATOM   3265  C CB     . GLN C 2 36 ? 4.342   7.317   3.831   1.00 0.00 ? 36  GLN A CB     2  
ATOM   3266  C CG     . GLN C 2 36 ? 5.555   8.226   3.560   1.00 0.00 ? 36  GLN A CG     2  
ATOM   3267  C CD     . GLN C 2 36 ? 5.899   9.014   4.826   1.00 0.00 ? 36  GLN A CD     2  
ATOM   3268  O OE1    . GLN C 2 36 ? 5.524   8.630   5.916   1.00 0.00 ? 36  GLN A OE1    2  
ATOM   3269  N NE2    . GLN C 2 36 ? 6.601   10.109  4.726   1.00 0.00 ? 36  GLN A NE2    2  
ATOM   3270  H H      . GLN C 2 36 ? 3.427   5.287   5.435   1.00 0.00 ? 36  GLN A H      2  
ATOM   3271  H HA     . GLN C 2 36 ? 4.931   5.488   2.843   1.00 0.00 ? 36  GLN A HA     2  
ATOM   3272  H HB2    . GLN C 2 36 ? 3.607   7.463   3.053   1.00 0.00 ? 36  GLN A HB2    2  
ATOM   3273  H HB3    . GLN C 2 36 ? 3.909   7.575   4.786   1.00 0.00 ? 36  GLN A HB3    2  
ATOM   3274  H HG2    . GLN C 2 36 ? 6.407   7.625   3.266   1.00 0.00 ? 36  GLN A HG2    2  
ATOM   3275  H HG3    . GLN C 2 36 ? 5.315   8.916   2.765   1.00 0.00 ? 36  GLN A HG3    2  
ATOM   3276  H HE21   . GLN C 2 36 ? 6.902   10.420  3.847   1.00 0.00 ? 36  GLN A HE21   2  
ATOM   3277  H HE22   . GLN C 2 36 ? 6.826   10.622  5.531   1.00 0.00 ? 36  GLN A HE22   2  
ATOM   3278  N N      . SER C 2 37 ? 7.176   5.639   4.068   1.00 0.00 ? 37  SER A N      2  
ATOM   3279  C CA     . SER C 2 37 ? 8.449   5.469   4.831   1.00 0.00 ? 37  SER A CA     2  
ATOM   3280  C C      . SER C 2 37 ? 8.514   6.517   5.949   1.00 0.00 ? 37  SER A C      2  
ATOM   3281  O O      . SER C 2 37 ? 7.573   7.262   6.142   1.00 0.00 ? 37  SER A O      2  
ATOM   3282  C CB     . SER C 2 37 ? 9.557   5.697   3.797   1.00 0.00 ? 37  SER A CB     2  
ATOM   3283  O OG     . SER C 2 37 ? 9.108   5.259   2.520   1.00 0.00 ? 37  SER A OG     2  
ATOM   3284  H H      . SER C 2 37 ? 7.201   5.750   3.095   1.00 0.00 ? 37  SER A H      2  
ATOM   3285  H HA     . SER C 2 37 ? 8.517   4.474   5.238   1.00 0.00 ? 37  SER A HA     2  
ATOM   3286  H HB2    . SER C 2 37 ? 9.796   6.745   3.746   1.00 0.00 ? 37  SER A HB2    2  
ATOM   3287  H HB3    . SER C 2 37 ? 10.437  5.141   4.087   1.00 0.00 ? 37  SER A HB3    2  
ATOM   3288  H HG     . SER C 2 37 ? 9.251   4.311   2.464   1.00 0.00 ? 37  SER A HG     2  
ATOM   3289  N N      . PRO C 2 38 ? 9.611   6.562   6.658   1.00 0.00 ? 38  PRO A N      2  
ATOM   3290  C CA     . PRO C 2 38 ? 9.728   7.546   7.747   1.00 0.00 ? 38  PRO A CA     2  
ATOM   3291  C C      . PRO C 2 38 ? 9.979   8.932   7.158   1.00 0.00 ? 38  PRO A C      2  
ATOM   3292  O O      . PRO C 2 38 ? 9.862   9.937   7.829   1.00 0.00 ? 38  PRO A O      2  
ATOM   3293  C CB     . PRO C 2 38 ? 10.911  7.048   8.566   1.00 0.00 ? 38  PRO A CB     2  
ATOM   3294  C CG     . PRO C 2 38 ? 11.733  6.232   7.621   1.00 0.00 ? 38  PRO A CG     2  
ATOM   3295  C CD     . PRO C 2 38 ? 10.820  5.742   6.520   1.00 0.00 ? 38  PRO A CD     2  
ATOM   3296  H HA     . PRO C 2 38 ? 8.839   7.546   8.342   1.00 0.00 ? 38  PRO A HA     2  
ATOM   3297  H HB2    . PRO C 2 38 ? 11.485  7.885   8.941   1.00 0.00 ? 38  PRO A HB2    2  
ATOM   3298  H HB3    . PRO C 2 38 ? 10.568  6.432   9.380   1.00 0.00 ? 38  PRO A HB3    2  
ATOM   3299  H HG2    . PRO C 2 38 ? 12.522  6.841   7.207   1.00 0.00 ? 38  PRO A HG2    2  
ATOM   3300  H HG3    . PRO C 2 38 ? 12.154  5.389   8.145   1.00 0.00 ? 38  PRO A HG3    2  
ATOM   3301  H HD2    . PRO C 2 38 ? 11.283  5.905   5.557   1.00 0.00 ? 38  PRO A HD2    2  
ATOM   3302  H HD3    . PRO C 2 38 ? 10.585  4.701   6.655   1.00 0.00 ? 38  PRO A HD3    2  
ATOM   3303  N N      . THR C 2 39 ? 10.309  8.980   5.895   1.00 0.00 ? 39  THR A N      2  
ATOM   3304  C CA     . THR C 2 39 ? 10.563  10.279  5.216   1.00 0.00 ? 39  THR A CA     2  
ATOM   3305  C C      . THR C 2 39 ? 10.905  10.000  3.750   1.00 0.00 ? 39  THR A C      2  
ATOM   3306  O O      . THR C 2 39 ? 11.848  10.538  3.205   1.00 0.00 ? 39  THR A O      2  
ATOM   3307  C CB     . THR C 2 39 ? 11.753  10.894  5.964   1.00 0.00 ? 39  THR A CB     2  
ATOM   3308  O OG1    . THR C 2 39 ? 11.987  12.209  5.482   1.00 0.00 ? 39  THR A OG1    2  
ATOM   3309  C CG2    . THR C 2 39 ? 13.004  10.038  5.746   1.00 0.00 ? 39  THR A CG2    2  
ATOM   3310  H H      . THR C 2 39 ? 10.384  8.146   5.381   1.00 0.00 ? 39  THR A H      2  
ATOM   3311  H HA     . THR C 2 39 ? 9.699   10.921  5.292   1.00 0.00 ? 39  THR A HA     2  
ATOM   3312  H HB     . THR C 2 39 ? 11.531  10.931  7.023   1.00 0.00 ? 39  THR A HB     2  
ATOM   3313  H HG1    . THR C 2 39 ? 11.891  12.817  6.219   1.00 0.00 ? 39  THR A HG1    2  
ATOM   3314  H HG21   . THR C 2 39 ? 13.422  10.252  4.774   1.00 0.00 ? 39  THR A HG21   2  
ATOM   3315  H HG22   . THR C 2 39 ? 12.740  8.992   5.802   1.00 0.00 ? 39  THR A HG22   2  
ATOM   3316  H HG23   . THR C 2 39 ? 13.734  10.266  6.509   1.00 0.00 ? 39  THR A HG23   2  
ATOM   3317  N N      . GLY C 2 40 ? 10.154  9.128   3.121   1.00 0.00 ? 40  GLY A N      2  
ATOM   3318  C CA     . GLY C 2 40 ? 10.442  8.773   1.704   1.00 0.00 ? 40  GLY A CA     2  
ATOM   3319  C C      . GLY C 2 40 ? 9.242   9.082   0.805   1.00 0.00 ? 40  GLY A C      2  
ATOM   3320  O O      . GLY C 2 40 ? 8.862   10.222  0.625   1.00 0.00 ? 40  GLY A O      2  
ATOM   3321  H H      . GLY C 2 40 ? 9.414   8.692   3.593   1.00 0.00 ? 40  GLY A H      2  
ATOM   3322  H HA2    . GLY C 2 40 ? 11.298  9.333   1.361   1.00 0.00 ? 40  GLY A HA2    2  
ATOM   3323  H HA3    . GLY C 2 40 ? 10.657  7.717   1.645   1.00 0.00 ? 40  GLY A HA3    2  
ATOM   3324  N N      . ASP C 2 41 ? 8.659   8.065   0.223   1.00 0.00 ? 41  ASP A N      2  
ATOM   3325  C CA     . ASP C 2 41 ? 7.497   8.278   -0.688  1.00 0.00 ? 41  ASP A CA     2  
ATOM   3326  C C      . ASP C 2 41 ? 6.243   7.609   -0.121  1.00 0.00 ? 41  ASP A C      2  
ATOM   3327  O O      . ASP C 2 41 ? 6.109   7.437   1.072   1.00 0.00 ? 41  ASP A O      2  
ATOM   3328  C CB     . ASP C 2 41 ? 7.913   7.617   -2.003  1.00 0.00 ? 41  ASP A CB     2  
ATOM   3329  C CG     . ASP C 2 41 ? 7.618   8.561   -3.171  1.00 0.00 ? 41  ASP A CG     2  
ATOM   3330  O OD1    . ASP C 2 41 ? 6.497   8.543   -3.653  1.00 0.00 ? 41  ASP A OD1    2  
ATOM   3331  O OD2    . ASP C 2 41 ? 8.519   9.285   -3.563  1.00 0.00 ? 41  ASP A OD2    2  
ATOM   3332  H H      . ASP C 2 41 ? 8.995   7.157   0.377   1.00 0.00 ? 41  ASP A H      2  
ATOM   3333  H HA     . ASP C 2 41 ? 7.327   9.333   -0.842  1.00 0.00 ? 41  ASP A HA     2  
ATOM   3334  H HB2    . ASP C 2 41 ? 8.972   7.397   -1.975  1.00 0.00 ? 41  ASP A HB2    2  
ATOM   3335  H HB3    . ASP C 2 41 ? 7.360   6.700   -2.136  1.00 0.00 ? 41  ASP A HB3    2  
ATOM   3336  N N      . ARG C 2 42 ? 5.320   7.232   -0.969  1.00 0.00 ? 42  ARG A N      2  
ATOM   3337  C CA     . ARG C 2 42 ? 4.073   6.582   -0.472  1.00 0.00 ? 42  ARG A CA     2  
ATOM   3338  C C      . ARG C 2 42 ? 4.063   5.086   -0.811  1.00 0.00 ? 42  ARG A C      2  
ATOM   3339  O O      . ARG C 2 42 ? 4.030   4.696   -1.962  1.00 0.00 ? 42  ARG A O      2  
ATOM   3340  C CB     . ARG C 2 42 ? 2.935   7.307   -1.195  1.00 0.00 ? 42  ARG A CB     2  
ATOM   3341  C CG     . ARG C 2 42 ? 2.195   8.218   -0.212  1.00 0.00 ? 42  ARG A CG     2  
ATOM   3342  C CD     . ARG C 2 42 ? 3.152   9.289   0.320   1.00 0.00 ? 42  ARG A CD     2  
ATOM   3343  N NE     . ARG C 2 42 ? 3.183   10.337  -0.737  1.00 0.00 ? 42  ARG A NE     2  
ATOM   3344  C CZ     . ARG C 2 42 ? 3.060   11.595  -0.413  1.00 0.00 ? 42  ARG A CZ     2  
ATOM   3345  N NH1    . ARG C 2 42 ? 2.113   11.970  0.401   1.00 0.00 ? 42  ARG A NH1    2  
ATOM   3346  N NH2    . ARG C 2 42 ? 3.888   12.479  -0.903  1.00 0.00 ? 42  ARG A NH2    2  
ATOM   3347  H H      . ARG C 2 42 ? 5.446   7.382   -1.929  1.00 0.00 ? 42  ARG A H      2  
ATOM   3348  H HA     . ARG C 2 42 ? 3.978   6.723   0.593   1.00 0.00 ? 42  ARG A HA     2  
ATOM   3349  H HB2    . ARG C 2 42 ? 3.342   7.901   -2.001  1.00 0.00 ? 42  ARG A HB2    2  
ATOM   3350  H HB3    . ARG C 2 42 ? 2.246   6.581   -1.598  1.00 0.00 ? 42  ARG A HB3    2  
ATOM   3351  H HG2    . ARG C 2 42 ? 1.366   8.693   -0.716  1.00 0.00 ? 42  ARG A HG2    2  
ATOM   3352  H HG3    . ARG C 2 42 ? 1.823   7.630   0.614   1.00 0.00 ? 42  ARG A HG3    2  
ATOM   3353  H HD2    . ARG C 2 42 ? 2.776   9.699   1.248   1.00 0.00 ? 42  ARG A HD2    2  
ATOM   3354  H HD3    . ARG C 2 42 ? 4.138   8.878   0.463   1.00 0.00 ? 42  ARG A HD3    2  
ATOM   3355  H HE     . ARG C 2 42 ? 3.296   10.082  -1.677  1.00 0.00 ? 42  ARG A HE     2  
ATOM   3356  H HH11   . ARG C 2 42 ? 1.480   11.293  0.777   1.00 0.00 ? 42  ARG A HH11   2  
ATOM   3357  H HH12   . ARG C 2 42 ? 2.018   12.934  0.648   1.00 0.00 ? 42  ARG A HH12   2  
ATOM   3358  H HH21   . ARG C 2 42 ? 4.614   12.192  -1.526  1.00 0.00 ? 42  ARG A HH21   2  
ATOM   3359  H HH22   . ARG C 2 42 ? 3.794   13.443  -0.653  1.00 0.00 ? 42  ARG A HH22   2  
ATOM   3360  N N      . ILE C 2 43 ? 4.072   4.252   0.194   1.00 0.00 ? 43  ILE A N      2  
ATOM   3361  C CA     . ILE C 2 43 ? 4.043   2.777   -0.038  1.00 0.00 ? 43  ILE A CA     2  
ATOM   3362  C C      . ILE C 2 43 ? 2.609   2.271   0.154   1.00 0.00 ? 43  ILE A C      2  
ATOM   3363  O O      . ILE C 2 43 ? 1.815   2.888   0.837   1.00 0.00 ? 43  ILE A O      2  
ATOM   3364  C CB     . ILE C 2 43 ? 4.999   2.204   1.018   1.00 0.00 ? 43  ILE A CB     2  
ATOM   3365  C CG1    . ILE C 2 43 ? 6.439   2.380   0.530   1.00 0.00 ? 43  ILE A CG1    2  
ATOM   3366  C CG2    . ILE C 2 43 ? 4.720   0.714   1.248   1.00 0.00 ? 43  ILE A CG2    2  
ATOM   3367  C CD1    . ILE C 2 43 ? 7.399   2.249   1.712   1.00 0.00 ? 43  ILE A CD1    2  
ATOM   3368  H H      . ILE C 2 43 ? 4.085   4.598   1.111   1.00 0.00 ? 43  ILE A H      2  
ATOM   3369  H HA     . ILE C 2 43 ? 4.397   2.540   -1.028  1.00 0.00 ? 43  ILE A HA     2  
ATOM   3370  H HB     . ILE C 2 43 ? 4.869   2.740   1.947   1.00 0.00 ? 43  ILE A HB     2  
ATOM   3371  H HG12   . ILE C 2 43 ? 6.665   1.619   -0.203  1.00 0.00 ? 43  ILE A HG12   2  
ATOM   3372  H HG13   . ILE C 2 43 ? 6.552   3.356   0.083   1.00 0.00 ? 43  ILE A HG13   2  
ATOM   3373  H HG21   . ILE C 2 43 ? 4.103   0.596   2.127   1.00 0.00 ? 43  ILE A HG21   2  
ATOM   3374  H HG22   . ILE C 2 43 ? 5.652   0.190   1.390   1.00 0.00 ? 43  ILE A HG22   2  
ATOM   3375  H HG23   . ILE C 2 43 ? 4.206   0.308   0.393   1.00 0.00 ? 43  ILE A HG23   2  
ATOM   3376  H HD11   . ILE C 2 43 ? 8.416   2.241   1.351   1.00 0.00 ? 43  ILE A HD11   2  
ATOM   3377  H HD12   . ILE C 2 43 ? 7.196   1.330   2.237   1.00 0.00 ? 43  ILE A HD12   2  
ATOM   3378  H HD13   . ILE C 2 43 ? 7.260   3.085   2.383   1.00 0.00 ? 43  ILE A HD13   2  
ATOM   3379  N N      . ARG C 2 44 ? 2.261   1.169   -0.457  1.00 0.00 ? 44  ARG A N      2  
ATOM   3380  C CA     . ARG C 2 44 ? 0.865   0.656   -0.320  1.00 0.00 ? 44  ARG A CA     2  
ATOM   3381  C C      . ARG C 2 44 ? 0.843   -0.785  0.204   1.00 0.00 ? 44  ARG A C      2  
ATOM   3382  O O      . ARG C 2 44 ? -0.203  -1.302  0.545   1.00 0.00 ? 44  ARG A O      2  
ATOM   3383  C CB     . ARG C 2 44 ? 0.280   0.707   -1.736  1.00 0.00 ? 44  ARG A CB     2  
ATOM   3384  C CG     . ARG C 2 44 ? 0.558   2.071   -2.370  1.00 0.00 ? 44  ARG A CG     2  
ATOM   3385  C CD     . ARG C 2 44 ? -0.434  2.319   -3.508  1.00 0.00 ? 44  ARG A CD     2  
ATOM   3386  N NE     . ARG C 2 44 ? -0.880  3.726   -3.325  1.00 0.00 ? 44  ARG A NE     2  
ATOM   3387  C CZ     . ARG C 2 44 ? -0.841  4.559   -4.329  1.00 0.00 ? 44  ARG A CZ     2  
ATOM   3388  N NH1    . ARG C 2 44 ? -1.481  4.280   -5.432  1.00 0.00 ? 44  ARG A NH1    2  
ATOM   3389  N NH2    . ARG C 2 44 ? -0.162  5.668   -4.230  1.00 0.00 ? 44  ARG A NH2    2  
ATOM   3390  H H      . ARG C 2 44 ? 2.906   0.693   -1.018  1.00 0.00 ? 44  ARG A H      2  
ATOM   3391  H HA     . ARG C 2 44 ? 0.294   1.299   0.330   1.00 0.00 ? 44  ARG A HA     2  
ATOM   3392  H HB2    . ARG C 2 44 ? 0.732   -0.067  -2.338  1.00 0.00 ? 44  ARG A HB2    2  
ATOM   3393  H HB3    . ARG C 2 44 ? -0.787  0.546   -1.688  1.00 0.00 ? 44  ARG A HB3    2  
ATOM   3394  H HG2    . ARG C 2 44 ? 0.451   2.843   -1.623  1.00 0.00 ? 44  ARG A HG2    2  
ATOM   3395  H HG3    . ARG C 2 44 ? 1.563   2.086   -2.764  1.00 0.00 ? 44  ARG A HG3    2  
ATOM   3396  H HD2    . ARG C 2 44 ? 0.055   2.197   -4.465  1.00 0.00 ? 44  ARG A HD2    2  
ATOM   3397  H HD3    . ARG C 2 44 ? -1.276  1.650   -3.426  1.00 0.00 ? 44  ARG A HD3    2  
ATOM   3398  H HE     . ARG C 2 44 ? -1.201  4.027   -2.450  1.00 0.00 ? 44  ARG A HE     2  
ATOM   3399  H HH11   . ARG C 2 44 ? -2.001  3.430   -5.507  1.00 0.00 ? 44  ARG A HH11   2  
ATOM   3400  H HH12   . ARG C 2 44 ? -1.451  4.918   -6.202  1.00 0.00 ? 44  ARG A HH12   2  
ATOM   3401  H HH21   . ARG C 2 44 ? 0.328   5.882   -3.386  1.00 0.00 ? 44  ARG A HH21   2  
ATOM   3402  H HH22   . ARG C 2 44 ? -0.133  6.306   -5.001  1.00 0.00 ? 44  ARG A HH22   2  
ATOM   3403  N N      . SER C 2 45 ? 1.969   -1.449  0.264   1.00 0.00 ? 45  SER A N      2  
ATOM   3404  C CA     . SER C 2 45 ? 1.957   -2.857  0.759   1.00 0.00 ? 45  SER A CA     2  
ATOM   3405  C C      . SER C 2 45 ? 3.303   -3.230  1.387   1.00 0.00 ? 45  SER A C      2  
ATOM   3406  O O      . SER C 2 45 ? 4.121   -2.378  1.673   1.00 0.00 ? 45  SER A O      2  
ATOM   3407  C CB     . SER C 2 45 ? 1.683   -3.700  -0.484  1.00 0.00 ? 45  SER A CB     2  
ATOM   3408  O OG     . SER C 2 45 ? 0.280   -3.896  -0.618  1.00 0.00 ? 45  SER A OG     2  
ATOM   3409  H H      . SER C 2 45 ? 2.812   -1.033  -0.023  1.00 0.00 ? 45  SER A H      2  
ATOM   3410  H HA     . SER C 2 45 ? 1.164   -2.994  1.473   1.00 0.00 ? 45  SER A HA     2  
ATOM   3411  H HB2    . SER C 2 45 ? 2.052   -3.189  -1.357  1.00 0.00 ? 45  SER A HB2    2  
ATOM   3412  H HB3    . SER C 2 45 ? 2.181   -4.654  -0.392  1.00 0.00 ? 45  SER A HB3    2  
ATOM   3413  H HG     . SER C 2 45 ? 0.021   -4.600  -0.018  1.00 0.00 ? 45  SER A HG     2  
ATOM   3414  N N      . LYS C 2 46 ? 3.533   -4.499  1.608   1.00 0.00 ? 46  LYS A N      2  
ATOM   3415  C CA     . LYS C 2 46 ? 4.821   -4.929  2.222   1.00 0.00 ? 46  LYS A CA     2  
ATOM   3416  C C      . LYS C 2 46 ? 5.931   -4.895  1.177   1.00 0.00 ? 46  LYS A C      2  
ATOM   3417  O O      . LYS C 2 46 ? 6.995   -4.359  1.413   1.00 0.00 ? 46  LYS A O      2  
ATOM   3418  C CB     . LYS C 2 46 ? 4.582   -6.356  2.707   1.00 0.00 ? 46  LYS A CB     2  
ATOM   3419  C CG     . LYS C 2 46 ? 5.494   -6.650  3.898   1.00 0.00 ? 46  LYS A CG     2  
ATOM   3420  C CD     . LYS C 2 46 ? 5.330   -8.112  4.313   1.00 0.00 ? 46  LYS A CD     2  
ATOM   3421  C CE     . LYS C 2 46 ? 6.433   -8.950  3.665   1.00 0.00 ? 46  LYS A CE     2  
ATOM   3422  N NZ     . LYS C 2 46 ? 6.136   -10.353 4.069   1.00 0.00 ? 46  LYS A NZ     2  
ATOM   3423  H H      . LYS C 2 46 ? 2.857   -5.168  1.370   1.00 0.00 ? 46  LYS A H      2  
ATOM   3424  H HA     . LYS C 2 46 ? 5.070   -4.293  3.057   1.00 0.00 ? 46  LYS A HA     2  
ATOM   3425  H HB2    . LYS C 2 46 ? 3.550   -6.467  3.007   1.00 0.00 ? 46  LYS A HB2    2  
ATOM   3426  H HB3    . LYS C 2 46 ? 4.802   -7.050  1.909   1.00 0.00 ? 46  LYS A HB3    2  
ATOM   3427  H HG2    . LYS C 2 46 ? 6.521   -6.466  3.618   1.00 0.00 ? 46  LYS A HG2    2  
ATOM   3428  H HG3    . LYS C 2 46 ? 5.225   -6.010  4.724   1.00 0.00 ? 46  LYS A HG3    2  
ATOM   3429  H HD2    . LYS C 2 46 ? 5.399   -8.190  5.388   1.00 0.00 ? 46  LYS A HD2    2  
ATOM   3430  H HD3    . LYS C 2 46 ? 4.366   -8.474  3.988   1.00 0.00 ? 46  LYS A HD3    2  
ATOM   3431  H HE2    . LYS C 2 46 ? 6.395   -8.848  2.589   1.00 0.00 ? 46  LYS A HE2    2  
ATOM   3432  H HE3    . LYS C 2 46 ? 7.399   -8.653  4.040   1.00 0.00 ? 46  LYS A HE3    2  
ATOM   3433  H HZ1    . LYS C 2 46 ? 6.179   -10.431 5.104   1.00 0.00 ? 46  LYS A HZ1    2  
ATOM   3434  H HZ2    . LYS C 2 46 ? 5.184   -10.613 3.740   1.00 0.00 ? 46  LYS A HZ2    2  
ATOM   3435  H HZ3    . LYS C 2 46 ? 6.838   -10.992 3.644   1.00 0.00 ? 46  LYS A HZ3    2  
ATOM   3436  N N      . VAL C 2 47 ? 5.691   -5.446  0.013   1.00 0.00 ? 47  VAL A N      2  
ATOM   3437  C CA     . VAL C 2 47 ? 6.740   -5.420  -1.046  1.00 0.00 ? 47  VAL A CA     2  
ATOM   3438  C C      . VAL C 2 47 ? 7.179   -3.969  -1.270  1.00 0.00 ? 47  VAL A C      2  
ATOM   3439  O O      . VAL C 2 47 ? 8.349   -3.655  -1.196  1.00 0.00 ? 47  VAL A O      2  
ATOM   3440  C CB     . VAL C 2 47 ? 6.057   -5.996  -2.283  1.00 0.00 ? 47  VAL A CB     2  
ATOM   3441  C CG1    . VAL C 2 47 ? 6.800   -5.568  -3.549  1.00 0.00 ? 47  VAL A CG1    2  
ATOM   3442  C CG2    . VAL C 2 47 ? 6.044   -7.523  -2.197  1.00 0.00 ? 47  VAL A CG2    2  
ATOM   3443  H H      . VAL C 2 47 ? 4.821   -5.865  -0.167  1.00 0.00 ? 47  VAL A H      2  
ATOM   3444  H HA     . VAL C 2 47 ? 7.581   -6.033  -0.762  1.00 0.00 ? 47  VAL A HA     2  
ATOM   3445  H HB     . VAL C 2 47 ? 5.049   -5.633  -2.320  1.00 0.00 ? 47  VAL A HB     2  
ATOM   3446  H HG11   . VAL C 2 47 ? 6.722   -4.497  -3.665  1.00 0.00 ? 47  VAL A HG11   2  
ATOM   3447  H HG12   . VAL C 2 47 ? 6.359   -6.057  -4.404  1.00 0.00 ? 47  VAL A HG12   2  
ATOM   3448  H HG13   . VAL C 2 47 ? 7.842   -5.845  -3.468  1.00 0.00 ? 47  VAL A HG13   2  
ATOM   3449  H HG21   . VAL C 2 47 ? 6.984   -7.870  -1.795  1.00 0.00 ? 47  VAL A HG21   2  
ATOM   3450  H HG22   . VAL C 2 47 ? 5.900   -7.936  -3.184  1.00 0.00 ? 47  VAL A HG22   2  
ATOM   3451  H HG23   . VAL C 2 47 ? 5.237   -7.840  -1.553  1.00 0.00 ? 47  VAL A HG23   2  
ATOM   3452  N N      . GLU C 2 48 ? 6.244   -3.077  -1.512  1.00 0.00 ? 48  GLU A N      2  
ATOM   3453  C CA     . GLU C 2 48 ? 6.622   -1.643  -1.700  1.00 0.00 ? 48  GLU A CA     2  
ATOM   3454  C C      . GLU C 2 48 ? 7.458   -1.201  -0.500  1.00 0.00 ? 48  GLU A C      2  
ATOM   3455  O O      . GLU C 2 48 ? 8.374   -0.406  -0.613  1.00 0.00 ? 48  GLU A O      2  
ATOM   3456  C CB     . GLU C 2 48 ? 5.302   -0.869  -1.762  1.00 0.00 ? 48  GLU A CB     2  
ATOM   3457  C CG     . GLU C 2 48 ? 5.086   -0.352  -3.188  1.00 0.00 ? 48  GLU A CG     2  
ATOM   3458  C CD     . GLU C 2 48 ? 3.743   0.373   -3.275  1.00 0.00 ? 48  GLU A CD     2  
ATOM   3459  O OE1    . GLU C 2 48 ? 3.712   1.556   -2.980  1.00 0.00 ? 48  GLU A OE1    2  
ATOM   3460  O OE2    . GLU C 2 48 ? 2.769   -0.266  -3.636  1.00 0.00 ? 48  GLU A OE2    2  
ATOM   3461  H H      . GLU C 2 48 ? 5.303   -3.346  -1.543  1.00 0.00 ? 48  GLU A H      2  
ATOM   3462  H HA     . GLU C 2 48 ? 7.169   -1.513  -2.616  1.00 0.00 ? 48  GLU A HA     2  
ATOM   3463  H HB2    . GLU C 2 48 ? 4.487   -1.520  -1.483  1.00 0.00 ? 48  GLU A HB2    2  
ATOM   3464  H HB3    . GLU C 2 48 ? 5.345   -0.032  -1.084  1.00 0.00 ? 48  GLU A HB3    2  
ATOM   3465  H HG2    . GLU C 2 48 ? 5.881   0.331   -3.446  1.00 0.00 ? 48  GLU A HG2    2  
ATOM   3466  H HG3    . GLU C 2 48 ? 5.089   -1.183  -3.876  1.00 0.00 ? 48  GLU A HG3    2  
ATOM   3467  N N      . LEU C 2 49 ? 7.162   -1.753  0.646   1.00 0.00 ? 49  LEU A N      2  
ATOM   3468  C CA     . LEU C 2 49 ? 7.940   -1.424  1.869   1.00 0.00 ? 49  LEU A CA     2  
ATOM   3469  C C      . LEU C 2 49 ? 9.316   -2.075  1.759   1.00 0.00 ? 49  LEU A C      2  
ATOM   3470  O O      . LEU C 2 49 ? 10.337  -1.448  1.955   1.00 0.00 ? 49  LEU A O      2  
ATOM   3471  C CB     . LEU C 2 49 ? 7.139   -2.044  3.017   1.00 0.00 ? 49  LEU A CB     2  
ATOM   3472  C CG     . LEU C 2 49 ? 7.170   -1.126  4.240   1.00 0.00 ? 49  LEU A CG     2  
ATOM   3473  C CD1    . LEU C 2 49 ? 5.927   -0.235  4.241   1.00 0.00 ? 49  LEU A CD1    2  
ATOM   3474  C CD2    . LEU C 2 49 ? 7.183   -1.980  5.510   1.00 0.00 ? 49  LEU A CD2    2  
ATOM   3475  H H      . LEU C 2 49 ? 6.435   -2.410  0.695   1.00 0.00 ? 49  LEU A H      2  
ATOM   3476  H HA     . LEU C 2 49 ? 8.027   -0.359  1.995   1.00 0.00 ? 49  LEU A HA     2  
ATOM   3477  H HB2    . LEU C 2 49 ? 6.115   -2.186  2.702   1.00 0.00 ? 49  LEU A HB2    2  
ATOM   3478  H HB3    . LEU C 2 49 ? 7.568   -3.000  3.277   1.00 0.00 ? 49  LEU A HB3    2  
ATOM   3479  H HG     . LEU C 2 49 ? 8.056   -0.510  4.206   1.00 0.00 ? 49  LEU A HG     2  
ATOM   3480  H HD11   . LEU C 2 49 ? 6.121   0.654   3.662   1.00 0.00 ? 49  LEU A HD11   2  
ATOM   3481  H HD12   . LEU C 2 49 ? 5.684   0.042   5.256   1.00 0.00 ? 49  LEU A HD12   2  
ATOM   3482  H HD13   . LEU C 2 49 ? 5.098   -0.774  3.806   1.00 0.00 ? 49  LEU A HD13   2  
ATOM   3483  H HD21   . LEU C 2 49 ? 6.597   -1.494  6.277   1.00 0.00 ? 49  LEU A HD21   2  
ATOM   3484  H HD22   . LEU C 2 49 ? 8.198   -2.098  5.854   1.00 0.00 ? 49  LEU A HD22   2  
ATOM   3485  H HD23   . LEU C 2 49 ? 6.760   -2.951  5.296   1.00 0.00 ? 49  LEU A HD23   2  
ATOM   3486  N N      . THR C 2 50 ? 9.338   -3.336  1.420   1.00 0.00 ? 50  THR A N      2  
ATOM   3487  C CA     . THR C 2 50 ? 10.631  -4.057  1.263   1.00 0.00 ? 50  THR A CA     2  
ATOM   3488  C C      . THR C 2 50 ? 11.483  -3.364  0.190   1.00 0.00 ? 50  THR A C      2  
ATOM   3489  O O      . THR C 2 50 ? 12.689  -3.517  0.148   1.00 0.00 ? 50  THR A O      2  
ATOM   3490  C CB     . THR C 2 50 ? 10.233  -5.469  0.818   1.00 0.00 ? 50  THR A CB     2  
ATOM   3491  O OG1    . THR C 2 50 ? 9.484   -6.091  1.852   1.00 0.00 ? 50  THR A OG1    2  
ATOM   3492  C CG2    . THR C 2 50 ? 11.489  -6.295  0.532   1.00 0.00 ? 50  THR A CG2    2  
ATOM   3493  H H      . THR C 2 50 ? 8.496   -3.809  1.255   1.00 0.00 ? 50  THR A H      2  
ATOM   3494  H HA     . THR C 2 50 ? 11.161  -4.097  2.202   1.00 0.00 ? 50  THR A HA     2  
ATOM   3495  H HB     . THR C 2 50 ? 9.629   -5.412  -0.079  1.00 0.00 ? 50  THR A HB     2  
ATOM   3496  H HG1    . THR C 2 50 ? 8.607   -5.701  1.860   1.00 0.00 ? 50  THR A HG1    2  
ATOM   3497  H HG21   . THR C 2 50 ? 11.794  -6.145  -0.492  1.00 0.00 ? 50  THR A HG21   2  
ATOM   3498  H HG22   . THR C 2 50 ? 11.276  -7.341  0.696   1.00 0.00 ? 50  THR A HG22   2  
ATOM   3499  H HG23   . THR C 2 50 ? 12.284  -5.982  1.194   1.00 0.00 ? 50  THR A HG23   2  
ATOM   3500  N N      . ARG C 2 51 ? 10.862  -2.604  -0.674  1.00 0.00 ? 51  ARG A N      2  
ATOM   3501  C CA     . ARG C 2 51 ? 11.627  -1.898  -1.742  1.00 0.00 ? 51  ARG A CA     2  
ATOM   3502  C C      . ARG C 2 51 ? 12.409  -0.727  -1.140  1.00 0.00 ? 51  ARG A C      2  
ATOM   3503  O O      . ARG C 2 51 ? 13.620  -0.669  -1.223  1.00 0.00 ? 51  ARG A O      2  
ATOM   3504  C CB     . ARG C 2 51 ? 10.573  -1.384  -2.722  1.00 0.00 ? 51  ARG A CB     2  
ATOM   3505  C CG     . ARG C 2 51 ? 9.749   -2.558  -3.253  1.00 0.00 ? 51  ARG A CG     2  
ATOM   3506  C CD     . ARG C 2 51 ? 9.849   -2.614  -4.780  1.00 0.00 ? 51  ARG A CD     2  
ATOM   3507  N NE     . ARG C 2 51 ? 8.547   -3.179  -5.230  1.00 0.00 ? 51  ARG A NE     2  
ATOM   3508  C CZ     . ARG C 2 51 ? 8.458   -3.771  -6.389  1.00 0.00 ? 51  ARG A CZ     2  
ATOM   3509  N NH1    . ARG C 2 51 ? 9.345   -4.663  -6.736  1.00 0.00 ? 51  ARG A NH1    2  
ATOM   3510  N NH2    . ARG C 2 51 ? 7.481   -3.471  -7.200  1.00 0.00 ? 51  ARG A NH2    2  
ATOM   3511  H H      . ARG C 2 51 ? 9.889   -2.495  -0.620  1.00 0.00 ? 51  ARG A H      2  
ATOM   3512  H HA     . ARG C 2 51 ? 12.291  -2.584  -2.243  1.00 0.00 ? 51  ARG A HA     2  
ATOM   3513  H HB2    . ARG C 2 51 ? 9.920   -0.687  -2.214  1.00 0.00 ? 51  ARG A HB2    2  
ATOM   3514  H HB3    . ARG C 2 51 ? 11.059  -0.885  -3.546  1.00 0.00 ? 51  ARG A HB3    2  
ATOM   3515  H HG2    . ARG C 2 51 ? 10.124  -3.481  -2.834  1.00 0.00 ? 51  ARG A HG2    2  
ATOM   3516  H HG3    . ARG C 2 51 ? 8.718   -2.430  -2.967  1.00 0.00 ? 51  ARG A HG3    2  
ATOM   3517  H HD2    . ARG C 2 51 ? 9.989   -1.619  -5.182  1.00 0.00 ? 51  ARG A HD2    2  
ATOM   3518  H HD3    . ARG C 2 51 ? 10.657  -3.261  -5.082  1.00 0.00 ? 51  ARG A HD3    2  
ATOM   3519  H HE     . ARG C 2 51 ? 7.757   -3.108  -4.653  1.00 0.00 ? 51  ARG A HE     2  
ATOM   3520  H HH11   . ARG C 2 51 ? 10.093  -4.893  -6.113  1.00 0.00 ? 51  ARG A HH11   2  
ATOM   3521  H HH12   . ARG C 2 51 ? 9.277   -5.116  -7.625  1.00 0.00 ? 51  ARG A HH12   2  
ATOM   3522  H HH21   . ARG C 2 51 ? 6.800   -2.790  -6.933  1.00 0.00 ? 51  ARG A HH21   2  
ATOM   3523  H HH22   . ARG C 2 51 ? 7.413   -3.925  -8.089  1.00 0.00 ? 51  ARG A HH22   2  
ATOM   3524  N N      . TYR C 2 52 ? 11.723  0.206   -0.530  1.00 0.00 ? 52  TYR A N      2  
ATOM   3525  C CA     . TYR C 2 52 ? 12.428  1.373   0.082   1.00 0.00 ? 52  TYR A CA     2  
ATOM   3526  C C      . TYR C 2 52 ? 13.416  0.893   1.148   1.00 0.00 ? 52  TYR A C      2  
ATOM   3527  O O      . TYR C 2 52 ? 14.383  1.560   1.458   1.00 0.00 ? 52  TYR A O      2  
ATOM   3528  C CB     . TYR C 2 52 ? 11.325  2.225   0.718   1.00 0.00 ? 52  TYR A CB     2  
ATOM   3529  C CG     . TYR C 2 52 ? 11.829  3.636   0.914   1.00 0.00 ? 52  TYR A CG     2  
ATOM   3530  C CD1    . TYR C 2 52 ? 12.396  4.331   -0.162  1.00 0.00 ? 52  TYR A CD1    2  
ATOM   3531  C CD2    . TYR C 2 52 ? 11.734  4.251   2.170   1.00 0.00 ? 52  TYR A CD2    2  
ATOM   3532  C CE1    . TYR C 2 52 ? 12.866  5.638   0.017   1.00 0.00 ? 52  TYR A CE1    2  
ATOM   3533  C CE2    . TYR C 2 52 ? 12.204  5.557   2.348   1.00 0.00 ? 52  TYR A CE2    2  
ATOM   3534  C CZ     . TYR C 2 52 ? 12.770  6.251   1.271   1.00 0.00 ? 52  TYR A CZ     2  
ATOM   3535  O OH     . TYR C 2 52 ? 13.232  7.539   1.447   1.00 0.00 ? 52  TYR A OH     2  
ATOM   3536  H H      . TYR C 2 52 ? 10.745  0.137   -0.474  1.00 0.00 ? 52  TYR A H      2  
ATOM   3537  H HA     . TYR C 2 52 ? 12.940  1.943   -0.677  1.00 0.00 ? 52  TYR A HA     2  
ATOM   3538  H HB2    . TYR C 2 52 ? 10.461  2.237   0.070   1.00 0.00 ? 52  TYR A HB2    2  
ATOM   3539  H HB3    . TYR C 2 52 ? 11.053  1.805   1.675   1.00 0.00 ? 52  TYR A HB3    2  
ATOM   3540  H HD1    . TYR C 2 52 ? 12.470  3.859   -1.131  1.00 0.00 ? 52  TYR A HD1    2  
ATOM   3541  H HD2    . TYR C 2 52 ? 11.297  3.718   3.003   1.00 0.00 ? 52  TYR A HD2    2  
ATOM   3542  H HE1    . TYR C 2 52 ? 13.301  6.173   -0.814  1.00 0.00 ? 52  TYR A HE1    2  
ATOM   3543  H HE2    . TYR C 2 52 ? 12.130  6.030   3.316   1.00 0.00 ? 52  TYR A HE2    2  
ATOM   3544  H HH     . TYR C 2 52 ? 14.174  7.493   1.626   1.00 0.00 ? 52  TYR A HH     2  
ATOM   3545  N N      . LEU C 2 53 ? 13.178  -0.262  1.711   1.00 0.00 ? 53  LEU A N      2  
ATOM   3546  C CA     . LEU C 2 53 ? 14.099  -0.792  2.757   1.00 0.00 ? 53  LEU A CA     2  
ATOM   3547  C C      . LEU C 2 53 ? 15.254  -1.560  2.109   1.00 0.00 ? 53  LEU A C      2  
ATOM   3548  O O      . LEU C 2 53 ? 16.298  -1.745  2.704   1.00 0.00 ? 53  LEU A O      2  
ATOM   3549  C CB     . LEU C 2 53 ? 13.239  -1.733  3.599   1.00 0.00 ? 53  LEU A CB     2  
ATOM   3550  C CG     . LEU C 2 53 ? 12.105  -0.943  4.253   1.00 0.00 ? 53  LEU A CG     2  
ATOM   3551  C CD1    . LEU C 2 53 ? 11.082  -1.914  4.842   1.00 0.00 ? 53  LEU A CD1    2  
ATOM   3552  C CD2    . LEU C 2 53 ? 12.676  -0.065  5.369   1.00 0.00 ? 53  LEU A CD2    2  
ATOM   3553  H H      . LEU C 2 53 ? 12.391  -0.783  1.445   1.00 0.00 ? 53  LEU A H      2  
ATOM   3554  H HA     . LEU C 2 53 ? 14.475  0.010   3.370   1.00 0.00 ? 53  LEU A HA     2  
ATOM   3555  H HB2    . LEU C 2 53 ? 12.822  -2.503  2.964   1.00 0.00 ? 53  LEU A HB2    2  
ATOM   3556  H HB3    . LEU C 2 53 ? 13.846  -2.189  4.365   1.00 0.00 ? 53  LEU A HB3    2  
ATOM   3557  H HG     . LEU C 2 53 ? 11.624  -0.320  3.511   1.00 0.00 ? 53  LEU A HG     2  
ATOM   3558  H HD11   . LEU C 2 53 ? 11.018  -2.792  4.218   1.00 0.00 ? 53  LEU A HD11   2  
ATOM   3559  H HD12   . LEU C 2 53 ? 10.115  -1.434  4.888   1.00 0.00 ? 53  LEU A HD12   2  
ATOM   3560  H HD13   . LEU C 2 53 ? 11.390  -2.201  5.837   1.00 0.00 ? 53  LEU A HD13   2  
ATOM   3561  H HD21   . LEU C 2 53 ? 11.894  0.174   6.076   1.00 0.00 ? 53  LEU A HD21   2  
ATOM   3562  H HD22   . LEU C 2 53 ? 13.068  0.848   4.945   1.00 0.00 ? 53  LEU A HD22   2  
ATOM   3563  H HD23   . LEU C 2 53 ? 13.469  -0.596  5.875   1.00 0.00 ? 53  LEU A HD23   2  
ATOM   3564  N N      . GLY C 2 54 ? 15.075  -2.013  0.895   1.00 0.00 ? 54  GLY A N      2  
ATOM   3565  C CA     . GLY C 2 54 ? 16.160  -2.771  0.214   1.00 0.00 ? 54  GLY A CA     2  
ATOM   3566  C C      . GLY C 2 54 ? 15.739  -4.236  0.065   1.00 0.00 ? 54  GLY A C      2  
ATOM   3567  O O      . GLY C 2 54 ? 14.906  -4.717  0.806   1.00 0.00 ? 54  GLY A O      2  
ATOM   3568  H H      . GLY C 2 54 ? 14.227  -1.857  0.433   1.00 0.00 ? 54  GLY A H      2  
ATOM   3569  H HA2    . GLY C 2 54 ? 16.339  -2.344  -0.764  1.00 0.00 ? 54  GLY A HA2    2  
ATOM   3570  H HA3    . GLY C 2 54 ? 17.063  -2.718  0.802   1.00 0.00 ? 54  GLY A HA3    2  
ATOM   3571  N N      . PRO C 2 55 ? 16.332  -4.900  -0.891  1.00 0.00 ? 55  PRO A N      2  
ATOM   3572  C CA     . PRO C 2 55 ? 16.013  -6.328  -1.136  1.00 0.00 ? 55  PRO A CA     2  
ATOM   3573  C C      . PRO C 2 55 ? 16.567  -7.201  -0.005  1.00 0.00 ? 55  PRO A C      2  
ATOM   3574  O O      . PRO C 2 55 ? 16.173  -8.340  0.160   1.00 0.00 ? 55  PRO A O      2  
ATOM   3575  C CB     . PRO C 2 55 ? 16.713  -6.631  -2.458  1.00 0.00 ? 55  PRO A CB     2  
ATOM   3576  C CG     . PRO C 2 55 ? 17.819  -5.630  -2.546  1.00 0.00 ? 55  PRO A CG     2  
ATOM   3577  C CD     . PRO C 2 55 ? 17.346  -4.394  -1.824  1.00 0.00 ? 55  PRO A CD     2  
ATOM   3578  H HA     . PRO C 2 55 ? 14.949  -6.467  -1.240  1.00 0.00 ? 55  PRO A HA     2  
ATOM   3579  H HB2    . PRO C 2 55 ? 17.112  -7.638  -2.448  1.00 0.00 ? 55  PRO A HB2    2  
ATOM   3580  H HB3    . PRO C 2 55 ? 16.032  -6.503  -3.284  1.00 0.00 ? 55  PRO A HB3    2  
ATOM   3581  H HG2    . PRO C 2 55 ? 18.709  -6.021  -2.071  1.00 0.00 ? 55  PRO A HG2    2  
ATOM   3582  H HG3    . PRO C 2 55 ? 18.023  -5.392  -3.578  1.00 0.00 ? 55  PRO A HG3    2  
ATOM   3583  H HD2    . PRO C 2 55 ? 18.164  -3.933  -1.287  1.00 0.00 ? 55  PRO A HD2    2  
ATOM   3584  H HD3    . PRO C 2 55 ? 16.900  -3.695  -2.515  1.00 0.00 ? 55  PRO A HD3    2  
ATOM   3585  N N      . ALA C 2 56 ? 17.472  -6.676  0.778   1.00 0.00 ? 56  ALA A N      2  
ATOM   3586  C CA     . ALA C 2 56 ? 18.045  -7.475  1.900   1.00 0.00 ? 56  ALA A CA     2  
ATOM   3587  C C      . ALA C 2 56 ? 17.307  -7.163  3.206   1.00 0.00 ? 56  ALA A C      2  
ATOM   3588  O O      . ALA C 2 56 ? 17.767  -7.492  4.282   1.00 0.00 ? 56  ALA A O      2  
ATOM   3589  C CB     . ALA C 2 56 ? 19.506  -7.034  1.993   1.00 0.00 ? 56  ALA A CB     2  
ATOM   3590  H H      . ALA C 2 56 ? 17.773  -5.755  0.632   1.00 0.00 ? 56  ALA A H      2  
ATOM   3591  H HA     . ALA C 2 56 ? 17.992  -8.529  1.678   1.00 0.00 ? 56  ALA A HA     2  
ATOM   3592  H HB1    . ALA C 2 56 ? 19.566  -6.097  2.527   1.00 0.00 ? 56  ALA A HB1    2  
ATOM   3593  H HB2    . ALA C 2 56 ? 19.908  -6.909  0.999   1.00 0.00 ? 56  ALA A HB2    2  
ATOM   3594  H HB3    . ALA C 2 56 ? 20.076  -7.785  2.520   1.00 0.00 ? 56  ALA A HB3    2  
ATOM   3595  N N      . CYS C 2 57 ? 16.164  -6.532  3.120   1.00 0.00 ? 57  CYS A N      2  
ATOM   3596  C CA     . CYS C 2 57 ? 15.397  -6.203  4.356   1.00 0.00 ? 57  CYS A CA     2  
ATOM   3597  C C      . CYS C 2 57 ? 13.997  -6.818  4.284   1.00 0.00 ? 57  CYS A C      2  
ATOM   3598  O O      . CYS C 2 57 ? 13.001  -6.121  4.261   1.00 0.00 ? 57  CYS A O      2  
ATOM   3599  C CB     . CYS C 2 57 ? 15.316  -4.676  4.379   1.00 0.00 ? 57  CYS A CB     2  
ATOM   3600  S SG     . CYS C 2 57 ? 16.757  -4.008  5.246   1.00 0.00 ? 57  CYS A SG     2  
ATOM   3601  H H      . CYS C 2 57 ? 15.809  -6.277  2.244   1.00 0.00 ? 57  CYS A H      2  
ATOM   3602  H HA     . CYS C 2 57 ? 15.921  -6.557  5.231   1.00 0.00 ? 57  CYS A HA     2  
ATOM   3603  H HB2    . CYS C 2 57 ? 15.299  -4.300  3.366   1.00 0.00 ? 57  CYS A HB2    2  
ATOM   3604  H HB3    . CYS C 2 57 ? 14.414  -4.370  4.890   1.00 0.00 ? 57  CYS A HB3    2  
ATOM   3605  H HG     . CYS C 2 57 ? 16.482  -3.761  6.133   1.00 0.00 ? 57  CYS A HG     2  
ATOM   3606  N N      . ASP C 2 58 ? 13.918  -8.123  4.246   1.00 0.00 ? 58  ASP A N      2  
ATOM   3607  C CA     . ASP C 2 58 ? 12.583  -8.797  4.173   1.00 0.00 ? 58  ASP A CA     2  
ATOM   3608  C C      . ASP C 2 58 ? 11.653  -8.274  5.264   1.00 0.00 ? 58  ASP A C      2  
ATOM   3609  O O      . ASP C 2 58 ? 12.053  -7.509  6.120   1.00 0.00 ? 58  ASP A O      2  
ATOM   3610  C CB     . ASP C 2 58 ? 12.851  -10.287 4.405   1.00 0.00 ? 58  ASP A CB     2  
ATOM   3611  C CG     . ASP C 2 58 ? 13.804  -10.475 5.589   1.00 0.00 ? 58  ASP A CG     2  
ATOM   3612  O OD1    . ASP C 2 58 ? 14.994  -10.280 5.403   1.00 0.00 ? 58  ASP A OD1    2  
ATOM   3613  O OD2    . ASP C 2 58 ? 13.328  -10.810 6.661   1.00 0.00 ? 58  ASP A OD2    2  
ATOM   3614  H H      . ASP C 2 58 ? 14.736  -8.661  4.264   1.00 0.00 ? 58  ASP A H      2  
ATOM   3615  H HA     . ASP C 2 58 ? 12.141  -8.652  3.202   1.00 0.00 ? 58  ASP A HA     2  
ATOM   3616  H HB2    . ASP C 2 58 ? 11.913  -10.780 4.622   1.00 0.00 ? 58  ASP A HB2    2  
ATOM   3617  H HB3    . ASP C 2 58 ? 13.289  -10.717 3.517   1.00 0.00 ? 58  ASP A HB3    2  
ATOM   3618  N N      . LEU C 2 59 ? 10.418  -8.693  5.246   1.00 0.00 ? 59  LEU A N      2  
ATOM   3619  C CA     . LEU C 2 59 ? 9.456   -8.239  6.287   1.00 0.00 ? 59  LEU A CA     2  
ATOM   3620  C C      . LEU C 2 59 ? 8.384   -9.310  6.500   1.00 0.00 ? 59  LEU A C      2  
ATOM   3621  O O      . LEU C 2 59 ? 7.215   -9.092  6.257   1.00 0.00 ? 59  LEU A O      2  
ATOM   3622  C CB     . LEU C 2 59 ? 8.829   -6.953  5.736   1.00 0.00 ? 59  LEU A CB     2  
ATOM   3623  C CG     . LEU C 2 59 ? 9.826   -5.791  5.831   1.00 0.00 ? 59  LEU A CG     2  
ATOM   3624  C CD1    . LEU C 2 59 ? 9.159   -4.509  5.336   1.00 0.00 ? 59  LEU A CD1    2  
ATOM   3625  C CD2    . LEU C 2 59 ? 10.262  -5.596  7.287   1.00 0.00 ? 59  LEU A CD2    2  
ATOM   3626  H H      . LEU C 2 59 ? 10.125  -9.321  4.551   1.00 0.00 ? 59  LEU A H      2  
ATOM   3627  H HA     . LEU C 2 59 ? 9.975   -8.039  7.207   1.00 0.00 ? 59  LEU A HA     2  
ATOM   3628  H HB2    . LEU C 2 59 ? 8.554   -7.105  4.702   1.00 0.00 ? 59  LEU A HB2    2  
ATOM   3629  H HB3    . LEU C 2 59 ? 7.947   -6.712  6.310   1.00 0.00 ? 59  LEU A HB3    2  
ATOM   3630  H HG     . LEU C 2 59 ? 10.689  -6.005  5.217   1.00 0.00 ? 59  LEU A HG     2  
ATOM   3631  H HD11   . LEU C 2 59 ? 8.106   -4.538  5.574   1.00 0.00 ? 59  LEU A HD11   2  
ATOM   3632  H HD12   . LEU C 2 59 ? 9.285   -4.426  4.267   1.00 0.00 ? 59  LEU A HD12   2  
ATOM   3633  H HD13   . LEU C 2 59 ? 9.614   -3.658  5.820   1.00 0.00 ? 59  LEU A HD13   2  
ATOM   3634  H HD21   . LEU C 2 59 ? 10.945  -6.381  7.570   1.00 0.00 ? 59  LEU A HD21   2  
ATOM   3635  H HD22   . LEU C 2 59 ? 9.395   -5.624  7.929   1.00 0.00 ? 59  LEU A HD22   2  
ATOM   3636  H HD23   . LEU C 2 59 ? 10.753  -4.639  7.388   1.00 0.00 ? 59  LEU A HD23   2  
ATOM   3637  N N      . THR C 2 60 ? 8.780   -10.471 6.945   1.00 0.00 ? 60  THR A N      2  
ATOM   3638  C CA     . THR C 2 60 ? 7.792   -11.569 7.165   1.00 0.00 ? 60  THR A CA     2  
ATOM   3639  C C      . THR C 2 60 ? 6.994   -11.347 8.457   1.00 0.00 ? 60  THR A C      2  
ATOM   3640  O O      . THR C 2 60 ? 6.138   -12.137 8.804   1.00 0.00 ? 60  THR A O      2  
ATOM   3641  C CB     . THR C 2 60 ? 8.635   -12.840 7.270   1.00 0.00 ? 60  THR A CB     2  
ATOM   3642  O OG1    . THR C 2 60 ? 9.714   -12.772 6.347   1.00 0.00 ? 60  THR A OG1    2  
ATOM   3643  C CG2    . THR C 2 60 ? 7.765   -14.054 6.948   1.00 0.00 ? 60  THR A CG2    2  
ATOM   3644  H H      . THR C 2 60 ? 9.731   -10.625 7.127   1.00 0.00 ? 60  THR A H      2  
ATOM   3645  H HA     . THR C 2 60 ? 7.125   -11.644 6.323   1.00 0.00 ? 60  THR A HA     2  
ATOM   3646  H HB     . THR C 2 60 ? 9.021   -12.937 8.272   1.00 0.00 ? 60  THR A HB     2  
ATOM   3647  H HG1    . THR C 2 60 ? 9.347   -12.615 5.474   1.00 0.00 ? 60  THR A HG1    2  
ATOM   3648  H HG21   . THR C 2 60 ? 8.300   -14.957 7.196   1.00 0.00 ? 60  THR A HG21   2  
ATOM   3649  H HG22   . THR C 2 60 ? 7.527   -14.054 5.893   1.00 0.00 ? 60  THR A HG22   2  
ATOM   3650  H HG23   . THR C 2 60 ? 6.852   -14.005 7.522   1.00 0.00 ? 60  THR A HG23   2  
ATOM   3651  N N      . LEU C 2 61 ? 7.260   -10.284 9.172   1.00 0.00 ? 61  LEU A N      2  
ATOM   3652  C CA     . LEU C 2 61 ? 6.507   -10.033 10.436  1.00 0.00 ? 61  LEU A CA     2  
ATOM   3653  C C      . LEU C 2 61 ? 5.493   -8.900  10.241  1.00 0.00 ? 61  LEU A C      2  
ATOM   3654  O O      . LEU C 2 61 ? 4.487   -8.837  10.918  1.00 0.00 ? 61  LEU A O      2  
ATOM   3655  C CB     . LEU C 2 61 ? 7.569   -9.641  11.462  1.00 0.00 ? 61  LEU A CB     2  
ATOM   3656  C CG     . LEU C 2 61 ? 8.169   -10.906 12.079  1.00 0.00 ? 61  LEU A CG     2  
ATOM   3657  C CD1    . LEU C 2 61 ? 9.583   -10.609 12.581  1.00 0.00 ? 61  LEU A CD1    2  
ATOM   3658  C CD2    . LEU C 2 61 ? 7.299   -11.363 13.252  1.00 0.00 ? 61  LEU A CD2    2  
ATOM   3659  H H      . LEU C 2 61 ? 7.952   -9.655  8.884   1.00 0.00 ? 61  LEU A H      2  
ATOM   3660  H HA     . LEU C 2 61 ? 6.003   -10.932 10.756  1.00 0.00 ? 61  LEU A HA     2  
ATOM   3661  H HB2    . LEU C 2 61 ? 8.348   -9.074  10.975  1.00 0.00 ? 61  LEU A HB2    2  
ATOM   3662  H HB3    . LEU C 2 61 ? 7.117   -9.045  12.239  1.00 0.00 ? 61  LEU A HB3    2  
ATOM   3663  H HG     . LEU C 2 61 ? 8.209   -11.687 11.333  1.00 0.00 ? 61  LEU A HG     2  
ATOM   3664  H HD11   . LEU C 2 61 ? 9.545   -10.343 13.628  1.00 0.00 ? 61  LEU A HD11   2  
ATOM   3665  H HD12   . LEU C 2 61 ? 10.000  -9.789  12.017  1.00 0.00 ? 61  LEU A HD12   2  
ATOM   3666  H HD13   . LEU C 2 61 ? 10.201  -11.486 12.454  1.00 0.00 ? 61  LEU A HD13   2  
ATOM   3667  H HD21   . LEU C 2 61 ? 7.634   -12.331 13.594  1.00 0.00 ? 61  LEU A HD21   2  
ATOM   3668  H HD22   . LEU C 2 61 ? 6.269   -11.431 12.932  1.00 0.00 ? 61  LEU A HD22   2  
ATOM   3669  H HD23   . LEU C 2 61 ? 7.378   -10.648 14.058  1.00 0.00 ? 61  LEU A HD23   2  
ATOM   3670  N N      . PHE C 2 62 ? 5.745   -8.007  9.316   1.00 0.00 ? 62  PHE A N      2  
ATOM   3671  C CA     . PHE C 2 62 ? 4.782   -6.887  9.083   1.00 0.00 ? 62  PHE A CA     2  
ATOM   3672  C C      . PHE C 2 62 ? 3.417   -7.460  8.692   1.00 0.00 ? 62  PHE A C      2  
ATOM   3673  O O      . PHE C 2 62 ? 3.298   -8.216  7.747   1.00 0.00 ? 62  PHE A O      2  
ATOM   3674  C CB     . PHE C 2 62 ? 5.382   -6.073  7.934   1.00 0.00 ? 62  PHE A CB     2  
ATOM   3675  C CG     . PHE C 2 62 ? 4.644   -4.759  7.800   1.00 0.00 ? 62  PHE A CG     2  
ATOM   3676  C CD1    . PHE C 2 62 ? 4.715   -3.799  8.820   1.00 0.00 ? 62  PHE A CD1    2  
ATOM   3677  C CD2    . PHE C 2 62 ? 3.890   -4.499  6.649   1.00 0.00 ? 62  PHE A CD2    2  
ATOM   3678  C CE1    . PHE C 2 62 ? 4.032   -2.584  8.685   1.00 0.00 ? 62  PHE A CE1    2  
ATOM   3679  C CE2    . PHE C 2 62 ? 3.208   -3.284  6.516   1.00 0.00 ? 62  PHE A CE2    2  
ATOM   3680  C CZ     . PHE C 2 62 ? 3.279   -2.327  7.534   1.00 0.00 ? 62  PHE A CZ     2  
ATOM   3681  H H      . PHE C 2 62 ? 6.560   -8.076  8.776   1.00 0.00 ? 62  PHE A H      2  
ATOM   3682  H HA     . PHE C 2 62 ? 4.695   -6.274  9.966   1.00 0.00 ? 62  PHE A HA     2  
ATOM   3683  H HB2    . PHE C 2 62 ? 6.425   -5.880  8.138   1.00 0.00 ? 62  PHE A HB2    2  
ATOM   3684  H HB3    . PHE C 2 62 ? 5.293   -6.631  7.014   1.00 0.00 ? 62  PHE A HB3    2  
ATOM   3685  H HD1    . PHE C 2 62 ? 5.295   -3.993  9.711   1.00 0.00 ? 62  PHE A HD1    2  
ATOM   3686  H HD2    . PHE C 2 62 ? 3.834   -5.237  5.863   1.00 0.00 ? 62  PHE A HD2    2  
ATOM   3687  H HE1    . PHE C 2 62 ? 4.085   -1.844  9.469   1.00 0.00 ? 62  PHE A HE1    2  
ATOM   3688  H HE2    . PHE C 2 62 ? 2.627   -3.085  5.628   1.00 0.00 ? 62  PHE A HE2    2  
ATOM   3689  H HZ     . PHE C 2 62 ? 2.752   -1.390  7.431   1.00 0.00 ? 62  PHE A HZ     2  
ATOM   3690  N N      . ASP C 2 63 ? 2.391   -7.125  9.428   1.00 0.00 ? 63  ASP A N      2  
ATOM   3691  C CA     . ASP C 2 63 ? 1.036   -7.671  9.118   1.00 0.00 ? 63  ASP A CA     2  
ATOM   3692  C C      . ASP C 2 63 ? 0.316   -6.832  8.053   1.00 0.00 ? 63  ASP A C      2  
ATOM   3693  O O      . ASP C 2 63 ? -0.847  -7.049  7.781   1.00 0.00 ? 63  ASP A O      2  
ATOM   3694  C CB     . ASP C 2 63 ? 0.282   -7.607  10.446  1.00 0.00 ? 63  ASP A CB     2  
ATOM   3695  C CG     . ASP C 2 63 ? 0.577   -8.866  11.263  1.00 0.00 ? 63  ASP A CG     2  
ATOM   3696  O OD1    . ASP C 2 63 ? 0.340   -9.949  10.752  1.00 0.00 ? 63  ASP A OD1    2  
ATOM   3697  O OD2    . ASP C 2 63 ? 1.036   -8.727  12.384  1.00 0.00 ? 63  ASP A OD2    2  
ATOM   3698  H H      . ASP C 2 63 ? 2.515   -6.528  10.196  1.00 0.00 ? 63  ASP A H      2  
ATOM   3699  H HA     . ASP C 2 63 ? 1.111   -8.697  8.795   1.00 0.00 ? 63  ASP A HA     2  
ATOM   3700  H HB2    . ASP C 2 63 ? 0.603   -6.736  10.998  1.00 0.00 ? 63  ASP A HB2    2  
ATOM   3701  H HB3    . ASP C 2 63 ? -0.779  -7.543  10.256  1.00 0.00 ? 63  ASP A HB3    2  
ATOM   3702  N N      . PHE C 2 64 ? 0.992   -5.886  7.447   1.00 0.00 ? 64  PHE A N      2  
ATOM   3703  C CA     . PHE C 2 64 ? 0.341   -5.038  6.395   1.00 0.00 ? 64  PHE A CA     2  
ATOM   3704  C C      . PHE C 2 64 ? -0.902  -4.329  6.959   1.00 0.00 ? 64  PHE A C      2  
ATOM   3705  O O      . PHE C 2 64 ? -0.871  -3.149  7.248   1.00 0.00 ? 64  PHE A O      2  
ATOM   3706  C CB     . PHE C 2 64 ? -0.033  -6.011  5.262   1.00 0.00 ? 64  PHE A CB     2  
ATOM   3707  C CG     . PHE C 2 64 ? -0.900  -5.316  4.231   1.00 0.00 ? 64  PHE A CG     2  
ATOM   3708  C CD1    . PHE C 2 64 ? -0.315  -4.566  3.197   1.00 0.00 ? 64  PHE A CD1    2  
ATOM   3709  C CD2    . PHE C 2 64 ? -2.295  -5.423  4.310   1.00 0.00 ? 64  PHE A CD2    2  
ATOM   3710  C CE1    . PHE C 2 64 ? -1.128  -3.931  2.249   1.00 0.00 ? 64  PHE A CE1    2  
ATOM   3711  C CE2    . PHE C 2 64 ? -3.104  -4.787  3.361   1.00 0.00 ? 64  PHE A CE2    2  
ATOM   3712  C CZ     . PHE C 2 64 ? -2.520  -4.041  2.332   1.00 0.00 ? 64  PHE A CZ     2  
ATOM   3713  H H      . PHE C 2 64 ? 1.931   -5.733  7.681   1.00 0.00 ? 64  PHE A H      2  
ATOM   3714  H HA     . PHE C 2 64 ? 1.043   -4.308  6.025   1.00 0.00 ? 64  PHE A HA     2  
ATOM   3715  H HB2    . PHE C 2 64 ? 0.868   -6.367  4.786   1.00 0.00 ? 64  PHE A HB2    2  
ATOM   3716  H HB3    . PHE C 2 64 ? -0.573  -6.850  5.673   1.00 0.00 ? 64  PHE A HB3    2  
ATOM   3717  H HD1    . PHE C 2 64 ? 0.761   -4.478  3.130   1.00 0.00 ? 64  PHE A HD1    2  
ATOM   3718  H HD2    . PHE C 2 64 ? -2.748  -5.999  5.103   1.00 0.00 ? 64  PHE A HD2    2  
ATOM   3719  H HE1    . PHE C 2 64 ? -0.681  -3.354  1.453   1.00 0.00 ? 64  PHE A HE1    2  
ATOM   3720  H HE2    . PHE C 2 64 ? -4.178  -4.872  3.423   1.00 0.00 ? 64  PHE A HE2    2  
ATOM   3721  H HZ     . PHE C 2 64 ? -3.145  -3.550  1.601   1.00 0.00 ? 64  PHE A HZ     2  
ATOM   3722  N N      . LYS C 2 65 ? -1.993  -5.032  7.107   1.00 0.00 ? 65  LYS A N      2  
ATOM   3723  C CA     . LYS C 2 65 ? -3.234  -4.392  7.640   1.00 0.00 ? 65  LYS A CA     2  
ATOM   3724  C C      . LYS C 2 65 ? -2.977  -3.766  9.016   1.00 0.00 ? 65  LYS A C      2  
ATOM   3725  O O      . LYS C 2 65 ? -3.248  -2.602  9.238   1.00 0.00 ? 65  LYS A O      2  
ATOM   3726  C CB     . LYS C 2 65 ? -4.252  -5.528  7.751   1.00 0.00 ? 65  LYS A CB     2  
ATOM   3727  C CG     . LYS C 2 65 ? -5.639  -4.947  8.038   1.00 0.00 ? 65  LYS A CG     2  
ATOM   3728  C CD     . LYS C 2 65 ? -6.216  -4.341  6.756   1.00 0.00 ? 65  LYS A CD     2  
ATOM   3729  C CE     . LYS C 2 65 ? -6.699  -5.461  5.829   1.00 0.00 ? 65  LYS A CE     2  
ATOM   3730  N NZ     . LYS C 2 65 ? -8.183  -5.460  5.964   1.00 0.00 ? 65  LYS A NZ     2  
ATOM   3731  H H      . LYS C 2 65 ? -1.999  -5.981  6.862   1.00 0.00 ? 65  LYS A H      2  
ATOM   3732  H HA     . LYS C 2 65 ? -3.595  -3.644  6.952   1.00 0.00 ? 65  LYS A HA     2  
ATOM   3733  H HB2    . LYS C 2 65 ? -4.277  -6.080  6.824   1.00 0.00 ? 65  LYS A HB2    2  
ATOM   3734  H HB3    . LYS C 2 65 ? -3.968  -6.188  8.556   1.00 0.00 ? 65  LYS A HB3    2  
ATOM   3735  H HG2    . LYS C 2 65 ? -6.292  -5.732  8.391   1.00 0.00 ? 65  LYS A HG2    2  
ATOM   3736  H HG3    . LYS C 2 65 ? -5.559  -4.178  8.791   1.00 0.00 ? 65  LYS A HG3    2  
ATOM   3737  H HD2    . LYS C 2 65 ? -7.047  -3.696  7.004   1.00 0.00 ? 65  LYS A HD2    2  
ATOM   3738  H HD3    . LYS C 2 65 ? -5.453  -3.767  6.254   1.00 0.00 ? 65  LYS A HD3    2  
ATOM   3739  H HE2    . LYS C 2 65 ? -6.413  -5.251  4.807   1.00 0.00 ? 65  LYS A HE2    2  
ATOM   3740  H HE3    . LYS C 2 65 ? -6.299  -6.412  6.146   1.00 0.00 ? 65  LYS A HE3    2  
ATOM   3741  H HZ1    . LYS C 2 65 ? -8.577  -6.281  5.465   1.00 0.00 ? 65  LYS A HZ1    2  
ATOM   3742  H HZ2    . LYS C 2 65 ? -8.439  -5.510  6.972   1.00 0.00 ? 65  LYS A HZ2    2  
ATOM   3743  H HZ3    . LYS C 2 65 ? -8.568  -4.588  5.551   1.00 0.00 ? 65  LYS A HZ3    2  
ATOM   3744  N N      . GLN C 2 66 ? -2.463  -4.530  9.943   1.00 0.00 ? 66  GLN A N      2  
ATOM   3745  C CA     . GLN C 2 66 ? -2.199  -3.979  11.306  1.00 0.00 ? 66  GLN A CA     2  
ATOM   3746  C C      . GLN C 2 66 ? -1.148  -2.865  11.241  1.00 0.00 ? 66  GLN A C      2  
ATOM   3747  O O      . GLN C 2 66 ? -1.185  -1.920  12.005  1.00 0.00 ? 66  GLN A O      2  
ATOM   3748  C CB     . GLN C 2 66 ? -1.676  -5.162  12.121  1.00 0.00 ? 66  GLN A CB     2  
ATOM   3749  C CG     . GLN C 2 66 ? -2.756  -6.244  12.202  1.00 0.00 ? 66  GLN A CG     2  
ATOM   3750  C CD     . GLN C 2 66 ? -3.793  -5.855  13.258  1.00 0.00 ? 66  GLN A CD     2  
ATOM   3751  O OE1    . GLN C 2 66 ? -4.975  -5.824  12.982  1.00 0.00 ? 66  GLN A OE1    2  
ATOM   3752  N NE2    . GLN C 2 66 ? -3.396  -5.557  14.465  1.00 0.00 ? 66  GLN A NE2    2  
ATOM   3753  H H      . GLN C 2 66 ? -2.256  -5.468  9.746   1.00 0.00 ? 66  GLN A H      2  
ATOM   3754  H HA     . GLN C 2 66 ? -3.112  -3.607  11.743  1.00 0.00 ? 66  GLN A HA     2  
ATOM   3755  H HB2    . GLN C 2 66 ? -0.796  -5.566  11.643  1.00 0.00 ? 66  GLN A HB2    2  
ATOM   3756  H HB3    . GLN C 2 66 ? -1.426  -4.831  13.117  1.00 0.00 ? 66  GLN A HB3    2  
ATOM   3757  H HG2    . GLN C 2 66 ? -3.240  -6.343  11.241  1.00 0.00 ? 66  GLN A HG2    2  
ATOM   3758  H HG3    . GLN C 2 66 ? -2.303  -7.185  12.474  1.00 0.00 ? 66  GLN A HG3    2  
ATOM   3759  H HE21   . GLN C 2 66 ? -2.443  -5.583  14.688  1.00 0.00 ? 66  GLN A HE21   2  
ATOM   3760  H HE22   . GLN C 2 66 ? -4.053  -5.307  15.148  1.00 0.00 ? 66  GLN A HE22   2  
ATOM   3761  N N      . GLY C 2 67 ? -0.211  -2.969  10.336  1.00 0.00 ? 67  GLY A N      2  
ATOM   3762  C CA     . GLY C 2 67 ? 0.841   -1.918  10.225  1.00 0.00 ? 67  GLY A CA     2  
ATOM   3763  C C      . GLY C 2 67 ? 1.765   -1.985  11.443  1.00 0.00 ? 67  GLY A C      2  
ATOM   3764  O O      . GLY C 2 67 ? 2.093   -0.979  12.041  1.00 0.00 ? 67  GLY A O      2  
ATOM   3765  H H      . GLY C 2 67 ? -0.198  -3.737  9.730   1.00 0.00 ? 67  GLY A H      2  
ATOM   3766  H HA2    . GLY C 2 67 ? 1.417   -2.079  9.324   1.00 0.00 ? 67  GLY A HA2    2  
ATOM   3767  H HA3    . GLY C 2 67 ? 0.375   -0.944  10.185  1.00 0.00 ? 67  GLY A HA3    2  
ATOM   3768  N N      . ILE C 2 68 ? 2.184   -3.166  11.816  1.00 0.00 ? 68  ILE A N      2  
ATOM   3769  C CA     . ILE C 2 68 ? 3.088   -3.300  12.999  1.00 0.00 ? 68  ILE A CA     2  
ATOM   3770  C C      . ILE C 2 68 ? 3.953   -4.555  12.871  1.00 0.00 ? 68  ILE A C      2  
ATOM   3771  O O      . ILE C 2 68 ? 3.613   -5.489  12.173  1.00 0.00 ? 68  ILE A O      2  
ATOM   3772  C CB     . ILE C 2 68 ? 2.171   -3.416  14.222  1.00 0.00 ? 68  ILE A CB     2  
ATOM   3773  C CG1    . ILE C 2 68 ? 0.854   -4.102  13.834  1.00 0.00 ? 68  ILE A CG1    2  
ATOM   3774  C CG2    . ILE C 2 68 ? 1.878   -2.018  14.769  1.00 0.00 ? 68  ILE A CG2    2  
ATOM   3775  C CD1    . ILE C 2 68 ? 0.155   -4.627  15.090  1.00 0.00 ? 68  ILE A CD1    2  
ATOM   3776  H H      . ILE C 2 68 ? 1.906   -3.963  11.319  1.00 0.00 ? 68  ILE A H      2  
ATOM   3777  H HA     . ILE C 2 68 ? 3.711   -2.425  13.095  1.00 0.00 ? 68  ILE A HA     2  
ATOM   3778  H HB     . ILE C 2 68 ? 2.670   -4.002  14.983  1.00 0.00 ? 68  ILE A HB     2  
ATOM   3779  H HG12   . ILE C 2 68 ? 0.213   -3.390  13.334  1.00 0.00 ? 68  ILE A HG12   2  
ATOM   3780  H HG13   . ILE C 2 68 ? 1.062   -4.928  13.169  1.00 0.00 ? 68  ILE A HG13   2  
ATOM   3781  H HG21   . ILE C 2 68 ? 1.117   -1.547  14.165  1.00 0.00 ? 68  ILE A HG21   2  
ATOM   3782  H HG22   . ILE C 2 68 ? 2.780   -1.422  14.740  1.00 0.00 ? 68  ILE A HG22   2  
ATOM   3783  H HG23   . ILE C 2 68 ? 1.531   -2.095  15.789  1.00 0.00 ? 68  ILE A HG23   2  
ATOM   3784  H HD11   . ILE C 2 68 ? 0.768   -4.426  15.957  1.00 0.00 ? 68  ILE A HD11   2  
ATOM   3785  H HD12   . ILE C 2 68 ? 0.000   -5.692  14.998  1.00 0.00 ? 68  ILE A HD12   2  
ATOM   3786  H HD13   . ILE C 2 68 ? -0.800  -4.135  15.202  1.00 0.00 ? 68  ILE A HD13   2  
ATOM   3787  N N      . LEU C 2 69 ? 5.069   -4.581  13.549  1.00 0.00 ? 69  LEU A N      2  
ATOM   3788  C CA     . LEU C 2 69 ? 5.959   -5.774  13.481  1.00 0.00 ? 69  LEU A CA     2  
ATOM   3789  C C      . LEU C 2 69 ? 5.838   -6.579  14.777  1.00 0.00 ? 69  LEU A C      2  
ATOM   3790  O O      . LEU C 2 69 ? 6.592   -6.386  15.710  1.00 0.00 ? 69  LEU A O      2  
ATOM   3791  C CB     . LEU C 2 69 ? 7.376   -5.211  13.330  1.00 0.00 ? 69  LEU A CB     2  
ATOM   3792  C CG     . LEU C 2 69 ? 7.762   -5.164  11.848  1.00 0.00 ? 69  LEU A CG     2  
ATOM   3793  C CD1    . LEU C 2 69 ? 9.159   -4.552  11.700  1.00 0.00 ? 69  LEU A CD1    2  
ATOM   3794  C CD2    . LEU C 2 69 ? 7.773   -6.582  11.275  1.00 0.00 ? 69  LEU A CD2    2  
ATOM   3795  H H      . LEU C 2 69 ? 5.317   -3.817  14.110  1.00 0.00 ? 69  LEU A H      2  
ATOM   3796  H HA     . LEU C 2 69 ? 5.708   -6.385  12.631  1.00 0.00 ? 69  LEU A HA     2  
ATOM   3797  H HB2    . LEU C 2 69 ? 7.410   -4.213  13.743  1.00 0.00 ? 69  LEU A HB2    2  
ATOM   3798  H HB3    . LEU C 2 69 ? 8.072   -5.842  13.861  1.00 0.00 ? 69  LEU A HB3    2  
ATOM   3799  H HG     . LEU C 2 69 ? 7.046   -4.561  11.309  1.00 0.00 ? 69  LEU A HG     2  
ATOM   3800  H HD11   . LEU C 2 69 ? 9.494   -4.181  12.657  1.00 0.00 ? 69  LEU A HD11   2  
ATOM   3801  H HD12   . LEU C 2 69 ? 9.119   -3.736  10.993  1.00 0.00 ? 69  LEU A HD12   2  
ATOM   3802  H HD13   . LEU C 2 69 ? 9.847   -5.303  11.343  1.00 0.00 ? 69  LEU A HD13   2  
ATOM   3803  H HD21   . LEU C 2 69 ? 6.761   -6.894  11.068  1.00 0.00 ? 69  LEU A HD21   2  
ATOM   3804  H HD22   . LEU C 2 69 ? 8.218   -7.256  11.993  1.00 0.00 ? 69  LEU A HD22   2  
ATOM   3805  H HD23   . LEU C 2 69 ? 8.349   -6.597  10.362  1.00 0.00 ? 69  LEU A HD23   2  
ATOM   3806  N N      . CYS C 2 70 ? 4.885   -7.471  14.843  1.00 0.00 ? 70  CYS A N      2  
ATOM   3807  C CA     . CYS C 2 70 ? 4.694   -8.292  16.077  1.00 0.00 ? 70  CYS A CA     2  
ATOM   3808  C C      . CYS C 2 70 ? 5.969   -9.071  16.409  1.00 0.00 ? 70  CYS A C      2  
ATOM   3809  O O      . CYS C 2 70 ? 6.103   -10.236 16.087  1.00 0.00 ? 70  CYS A O      2  
ATOM   3810  C CB     . CYS C 2 70 ? 3.552   -9.253  15.742  1.00 0.00 ? 70  CYS A CB     2  
ATOM   3811  S SG     . CYS C 2 70 ? 2.654   -9.672  17.257  1.00 0.00 ? 70  CYS A SG     2  
ATOM   3812  H H      . CYS C 2 70 ? 4.287   -7.596  14.079  1.00 0.00 ? 70  CYS A H      2  
ATOM   3813  H HA     . CYS C 2 70 ? 4.412   -7.663  16.906  1.00 0.00 ? 70  CYS A HA     2  
ATOM   3814  H HB2    . CYS C 2 70 ? 2.878   -8.781  15.043  1.00 0.00 ? 70  CYS A HB2    2  
ATOM   3815  H HB3    . CYS C 2 70 ? 3.957   -10.153 15.303  1.00 0.00 ? 70  CYS A HB3    2  
ATOM   3816  H HG     . CYS C 2 70 ? 2.114   -10.446 17.077  1.00 0.00 ? 70  CYS A HG     2  
ATOM   3817  N N      . TYR C 2 71 ? 6.904   -8.432  17.056  1.00 0.00 ? 71  TYR A N      2  
ATOM   3818  C CA     . TYR C 2 71 ? 8.177   -9.119  17.421  1.00 0.00 ? 71  TYR A CA     2  
ATOM   3819  C C      . TYR C 2 71 ? 8.479   -8.899  18.910  1.00 0.00 ? 71  TYR A C      2  
ATOM   3820  O O      . TYR C 2 71 ? 9.339   -8.115  19.258  1.00 0.00 ? 71  TYR A O      2  
ATOM   3821  C CB     . TYR C 2 71 ? 9.245   -8.457  16.547  1.00 0.00 ? 71  TYR A CB     2  
ATOM   3822  C CG     . TYR C 2 71 ? 10.597  -9.061  16.848  1.00 0.00 ? 71  TYR A CG     2  
ATOM   3823  C CD1    . TYR C 2 71 ? 10.864  -10.391 16.500  1.00 0.00 ? 71  TYR A CD1    2  
ATOM   3824  C CD2    . TYR C 2 71 ? 11.583  -8.289  17.474  1.00 0.00 ? 71  TYR A CD2    2  
ATOM   3825  C CE1    . TYR C 2 71 ? 12.118  -10.948 16.778  1.00 0.00 ? 71  TYR A CE1    2  
ATOM   3826  C CE2    . TYR C 2 71 ? 12.837  -8.847  17.752  1.00 0.00 ? 71  TYR A CE2    2  
ATOM   3827  C CZ     . TYR C 2 71 ? 13.104  -10.177 17.404  1.00 0.00 ? 71  TYR A CZ     2  
ATOM   3828  O OH     . TYR C 2 71 ? 14.341  -10.727 17.678  1.00 0.00 ? 71  TYR A OH     2  
ATOM   3829  H H      . TYR C 2 71 ? 6.766   -7.494  17.302  1.00 0.00 ? 71  TYR A H      2  
ATOM   3830  H HA     . TYR C 2 71 ? 8.116   -10.172 17.198  1.00 0.00 ? 71  TYR A HA     2  
ATOM   3831  H HB2    . TYR C 2 71 ? 9.004   -8.613  15.506  1.00 0.00 ? 71  TYR A HB2    2  
ATOM   3832  H HB3    . TYR C 2 71 ? 9.271   -7.397  16.754  1.00 0.00 ? 71  TYR A HB3    2  
ATOM   3833  H HD1    . TYR C 2 71 ? 10.103  -10.985 16.017  1.00 0.00 ? 71  TYR A HD1    2  
ATOM   3834  H HD2    . TYR C 2 71 ? 11.376  -7.264  17.743  1.00 0.00 ? 71  TYR A HD2    2  
ATOM   3835  H HE1    . TYR C 2 71 ? 12.324  -11.974 16.509  1.00 0.00 ? 71  TYR A HE1    2  
ATOM   3836  H HE2    . TYR C 2 71 ? 13.597  -8.251  18.235  1.00 0.00 ? 71  TYR A HE2    2  
ATOM   3837  H HH     . TYR C 2 71 ? 14.624  -10.407 18.537  1.00 0.00 ? 71  TYR A HH     2  
ATOM   3838  N N      . PRO C 2 72 ? 7.754   -9.602  19.744  1.00 0.00 ? 72  PRO A N      2  
ATOM   3839  C CA     . PRO C 2 72 ? 7.947   -9.476  21.210  1.00 0.00 ? 72  PRO A CA     2  
ATOM   3840  C C      . PRO C 2 72 ? 9.273   -10.116 21.642  1.00 0.00 ? 72  PRO A C      2  
ATOM   3841  O O      . PRO C 2 72 ? 10.260  -9.436  21.842  1.00 0.00 ? 72  PRO A O      2  
ATOM   3842  C CB     . PRO C 2 72 ? 6.747   -10.215 21.796  1.00 0.00 ? 72  PRO A CB     2  
ATOM   3843  C CG     . PRO C 2 72 ? 6.318   -11.176 20.732  1.00 0.00 ? 72  PRO A CG     2  
ATOM   3844  C CD     . PRO C 2 72 ? 6.700   -10.570 19.407  1.00 0.00 ? 72  PRO A CD     2  
ATOM   3845  H HA     . PRO C 2 72 ? 7.917   -8.439  21.504  1.00 0.00 ? 72  PRO A HA     2  
ATOM   3846  H HB2    . PRO C 2 72 ? 7.036   -10.749 22.692  1.00 0.00 ? 72  PRO A HB2    2  
ATOM   3847  H HB3    . PRO C 2 72 ? 5.947   -9.524  22.012  1.00 0.00 ? 72  PRO A HB3    2  
ATOM   3848  H HG2    . PRO C 2 72 ? 6.819   -12.124 20.865  1.00 0.00 ? 72  PRO A HG2    2  
ATOM   3849  H HG3    . PRO C 2 72 ? 5.249   -11.316 20.771  1.00 0.00 ? 72  PRO A HG3    2  
ATOM   3850  H HD2    . PRO C 2 72 ? 7.081   -11.330 18.738  1.00 0.00 ? 72  PRO A HD2    2  
ATOM   3851  H HD3    . PRO C 2 72 ? 5.857   -10.062 18.964  1.00 0.00 ? 72  PRO A HD3    2  
ATOM   3852  N N      . ALA C 2 73 ? 9.306   -11.415 21.792  1.00 0.00 ? 73  ALA A N      2  
ATOM   3853  C CA     . ALA C 2 73 ? 10.572  -12.085 22.213  1.00 0.00 ? 73  ALA A CA     2  
ATOM   3854  C C      . ALA C 2 73 ? 11.058  -13.040 21.117  1.00 0.00 ? 73  ALA A C      2  
ATOM   3855  O O      . ALA C 2 73 ? 10.273  -13.523 20.325  1.00 0.00 ? 73  ALA A O      2  
ATOM   3856  C CB     . ALA C 2 73 ? 10.206  -12.862 23.477  1.00 0.00 ? 73  ALA A CB     2  
ATOM   3857  H H      . ALA C 2 73 ? 8.503   -11.949 21.629  1.00 0.00 ? 73  ALA A H      2  
ATOM   3858  H HA     . ALA C 2 73 ? 11.330  -11.351 22.438  1.00 0.00 ? 73  ALA A HA     2  
ATOM   3859  H HB1    . ALA C 2 73 ? 9.674   -13.762 23.205  1.00 0.00 ? 73  ALA A HB1    2  
ATOM   3860  H HB2    . ALA C 2 73 ? 9.580   -12.250 24.109  1.00 0.00 ? 73  ALA A HB2    2  
ATOM   3861  H HB3    . ALA C 2 73 ? 11.108  -13.125 24.011  1.00 0.00 ? 73  ALA A HB3    2  
ATOM   3862  N N      . PRO C 2 74 ? 12.345  -13.282 21.107  1.00 0.00 ? 74  PRO A N      2  
ATOM   3863  C CA     . PRO C 2 74 ? 12.938  -14.191 20.095  1.00 0.00 ? 74  PRO A CA     2  
ATOM   3864  C C      . PRO C 2 74 ? 12.579  -15.646 20.410  1.00 0.00 ? 74  PRO A C      2  
ATOM   3865  O O      . PRO C 2 74 ? 12.409  -16.459 19.522  1.00 0.00 ? 74  PRO A O      2  
ATOM   3866  C CB     . PRO C 2 74 ? 14.439  -13.957 20.238  1.00 0.00 ? 74  PRO A CB     2  
ATOM   3867  C CG     . PRO C 2 74 ? 14.623  -13.461 21.637  1.00 0.00 ? 74  PRO A CG     2  
ATOM   3868  C CD     . PRO C 2 74 ? 13.357  -12.741 22.023  1.00 0.00 ? 74  PRO A CD     2  
ATOM   3869  H HA     . PRO C 2 74 ? 12.614  -13.922 19.103  1.00 0.00 ? 74  PRO A HA     2  
ATOM   3870  H HB2    . PRO C 2 74 ? 14.977  -14.883 20.090  1.00 0.00 ? 74  PRO A HB2    2  
ATOM   3871  H HB3    . PRO C 2 74 ? 14.773  -13.210 19.534  1.00 0.00 ? 74  PRO A HB3    2  
ATOM   3872  H HG2    . PRO C 2 74 ? 14.795  -14.295 22.303  1.00 0.00 ? 74  PRO A HG2    2  
ATOM   3873  H HG3    . PRO C 2 74 ? 15.456  -12.777 21.679  1.00 0.00 ? 74  PRO A HG3    2  
ATOM   3874  H HD2    . PRO C 2 74 ? 13.098  -12.959 23.050  1.00 0.00 ? 74  PRO A HD2    2  
ATOM   3875  H HD3    . PRO C 2 74 ? 13.464  -11.678 21.875  1.00 0.00 ? 74  PRO A HD3    2  
ATOM   3876  N N      . LYS C 2 75 ? 12.462  -15.978 21.668  1.00 0.00 ? 75  LYS A N      2  
ATOM   3877  C CA     . LYS C 2 75 ? 12.113  -17.379 22.044  1.00 0.00 ? 75  LYS A CA     2  
ATOM   3878  C C      . LYS C 2 75 ? 10.650  -17.456 22.488  1.00 0.00 ? 75  LYS A C      2  
ATOM   3879  O O      . LYS C 2 75 ? 10.325  -18.360 23.240  1.00 0.00 ? 75  LYS A O      2  
ATOM   3880  C CB     . LYS C 2 75 ? 13.048  -17.724 23.206  1.00 0.00 ? 75  LYS A CB     2  
ATOM   3881  C CG     . LYS C 2 75 ? 14.070  -18.769 22.752  1.00 0.00 ? 75  LYS A CG     2  
ATOM   3882  C CD     . LYS C 2 75 ? 15.388  -18.551 23.496  1.00 0.00 ? 75  LYS A CD     2  
ATOM   3883  C CE     . LYS C 2 75 ? 16.471  -19.450 22.894  1.00 0.00 ? 75  LYS A CE     2  
ATOM   3884  N NZ     . LYS C 2 75 ? 17.035  -18.666 21.760  1.00 0.00 ? 75  LYS A NZ     2  
ATOM   3885  O OXT    . LYS C 2 75 ? 9.879   -16.608 22.068  1.00 0.00 ? 75  LYS A OXT    2  
ATOM   3886  H H      . LYS C 2 75 ? 12.602  -15.305 22.367  1.00 0.00 ? 75  LYS A H      2  
ATOM   3887  H HA     . LYS C 2 75 ? 12.291  -18.047 21.215  1.00 0.00 ? 75  LYS A HA     2  
ATOM   3888  H HB2    . LYS C 2 75 ? 13.565  -16.831 23.528  1.00 0.00 ? 75  LYS A HB2    2  
ATOM   3889  H HB3    . LYS C 2 75 ? 12.471  -18.120 24.027  1.00 0.00 ? 75  LYS A HB3    2  
ATOM   3890  H HG2    . LYS C 2 75 ? 13.692  -19.758 22.970  1.00 0.00 ? 75  LYS A HG2    2  
ATOM   3891  H HG3    . LYS C 2 75 ? 14.237  -18.672 21.691  1.00 0.00 ? 75  LYS A HG3    2  
ATOM   3892  H HD2    . LYS C 2 75 ? 15.686  -17.515 23.403  1.00 0.00 ? 75  LYS A HD2    2  
ATOM   3893  H HD3    . LYS C 2 75 ? 15.259  -18.796 24.540  1.00 0.00 ? 75  LYS A HD3    2  
ATOM   3894  H HE2    . LYS C 2 75 ? 17.236  -19.659 23.628  1.00 0.00 ? 75  LYS A HE2    2  
ATOM   3895  H HE3    . LYS C 2 75 ? 16.036  -20.367 22.528  1.00 0.00 ? 75  LYS A HE3    2  
ATOM   3896  H HZ1    . LYS C 2 75 ? 17.566  -17.853 22.130  1.00 0.00 ? 75  LYS A HZ1    2  
ATOM   3897  H HZ2    . LYS C 2 75 ? 17.672  -19.273 21.204  1.00 0.00 ? 75  LYS A HZ2    2  
ATOM   3898  H HZ3    . LYS C 2 75 ? 16.262  -18.325 21.154  1.00 0.00 ? 75  LYS A HZ3    2  
ATOM   3899  O "O5'"  . DG  A 1 1  ? 2.110   20.088  -12.667 1.00 0.00 ? 101 DG  B "O5'"  3  
ATOM   3900  C "C5'"  . DG  A 1 1  ? 2.211   20.996  -11.566 1.00 0.00 ? 101 DG  B "C5'"  3  
ATOM   3901  C "C4'"  . DG  A 1 1  ? 1.654   20.386  -10.285 1.00 0.00 ? 101 DG  B "C4'"  3  
ATOM   3902  O "O4'"  . DG  A 1 1  ? 0.216   20.297  -10.343 1.00 0.00 ? 101 DG  B "O4'"  3  
ATOM   3903  C "C3'"  . DG  A 1 1  ? 2.210   18.988  -10.064 1.00 0.00 ? 101 DG  B "C3'"  3  
ATOM   3904  O "O3'"  . DG  A 1 1  ? 3.078   18.958  -8.925  1.00 0.00 ? 101 DG  B "O3'"  3  
ATOM   3905  C "C2'"  . DG  A 1 1  ? 1.013   18.096  -9.856  1.00 0.00 ? 101 DG  B "C2'"  3  
ATOM   3906  C "C1'"  . DG  A 1 1  ? -0.216  18.983  -9.945  1.00 0.00 ? 101 DG  B "C1'"  3  
ATOM   3907  N N9     . DG  A 1 1  ? -1.198  18.440  -10.900 1.00 0.00 ? 101 DG  B N9     3  
ATOM   3908  C C8     . DG  A 1 1  ? -0.995  17.709  -12.018 1.00 0.00 ? 101 DG  B C8     3  
ATOM   3909  N N7     . DG  A 1 1  ? -2.033  17.357  -12.701 1.00 0.00 ? 101 DG  B N7     3  
ATOM   3910  C C5     . DG  A 1 1  ? -3.070  17.920  -11.953 1.00 0.00 ? 101 DG  B C5     3  
ATOM   3911  C C6     . DG  A 1 1  ? -4.473  17.893  -12.175 1.00 0.00 ? 101 DG  B C6     3  
ATOM   3912  O O6     . DG  A 1 1  ? -5.082  17.361  -13.082 1.00 0.00 ? 101 DG  B O6     3  
ATOM   3913  N N1     . DG  A 1 1  ? -5.160  18.582  -11.184 1.00 0.00 ? 101 DG  B N1     3  
ATOM   3914  C C2     . DG  A 1 1  ? -4.575  19.221  -10.109 1.00 0.00 ? 101 DG  B C2     3  
ATOM   3915  N N2     . DG  A 1 1  ? -5.404  19.829  -9.261  1.00 0.00 ? 101 DG  B N2     3  
ATOM   3916  N N3     . DG  A 1 1  ? -3.257  19.252  -9.893  1.00 0.00 ? 101 DG  B N3     3  
ATOM   3917  C C4     . DG  A 1 1  ? -2.566  18.586  -10.846 1.00 0.00 ? 101 DG  B C4     3  
ATOM   3918  H "H5'"  . DG  A 1 1  ? 1.653   21.903  -11.801 1.00 0.00 ? 101 DG  B "H5'"  3  
ATOM   3919  H "H5''" . DG  A 1 1  ? 3.259   21.252  -11.413 1.00 0.00 ? 101 DG  B "H5''" 3  
ATOM   3920  H "H4'"  . DG  A 1 1  ? 1.930   21.013  -9.439  1.00 0.00 ? 101 DG  B "H4'"  3  
ATOM   3921  H "H3'"  . DG  A 1 1  ? 2.753   18.666  -10.955 1.00 0.00 ? 101 DG  B "H3'"  3  
ATOM   3922  H "H2'"  . DG  A 1 1  ? 0.980   17.332  -10.631 1.00 0.00 ? 101 DG  B "H2'"  3  
ATOM   3923  H "H2''" . DG  A 1 1  ? 1.064   17.629  -8.874  1.00 0.00 ? 101 DG  B "H2''" 3  
ATOM   3924  H "H1'"  . DG  A 1 1  ? -0.673  19.047  -8.965  1.00 0.00 ? 101 DG  B "H1'"  3  
ATOM   3925  H H8     . DG  A 1 1  ? 0.008   17.426  -12.327 1.00 0.00 ? 101 DG  B H8     3  
ATOM   3926  H H1     . DG  A 1 1  ? -6.136  18.605  -11.273 1.00 0.00 ? 101 DG  B H1     3  
ATOM   3927  H H21    . DG  A 1 1  ? -6.401  19.806  -9.425  1.00 0.00 ? 101 DG  B H21    3  
ATOM   3928  H H22    . DG  A 1 1  ? -5.037  20.313  -8.454  1.00 0.00 ? 101 DG  B H22    3  
ATOM   3929  H "HO5'" . DG  A 1 1  ? 1.569   19.349  -12.379 1.00 0.00 ? 101 DG  B "HO5'" 3  
ATOM   3930  P P      . DT  A 1 2  ? 3.446   17.564  -8.208  1.00 0.00 ? 102 DT  B P      3  
ATOM   3931  O OP1    . DT  A 1 2  ? 4.670   17.766  -7.399  1.00 0.00 ? 102 DT  B OP1    3  
ATOM   3932  O OP2    . DT  A 1 2  ? 3.405   16.492  -9.228  1.00 0.00 ? 102 DT  B OP2    3  
ATOM   3933  O "O5'"  . DT  A 1 2  ? 2.208   17.349  -7.201  1.00 0.00 ? 102 DT  B "O5'"  3  
ATOM   3934  C "C5'"  . DT  A 1 2  ? 1.646   18.458  -6.494  1.00 0.00 ? 102 DT  B "C5'"  3  
ATOM   3935  C "C4'"  . DT  A 1 2  ? 0.595   18.005  -5.484  1.00 0.00 ? 102 DT  B "C4'"  3  
ATOM   3936  O "O4'"  . DT  A 1 2  ? -0.694  17.865  -6.120  1.00 0.00 ? 102 DT  B "O4'"  3  
ATOM   3937  C "C3'"  . DT  A 1 2  ? 0.977   16.663  -4.877  1.00 0.00 ? 102 DT  B "C3'"  3  
ATOM   3938  O "O3'"  . DT  A 1 2  ? 1.068   16.764  -3.450  1.00 0.00 ? 102 DT  B "O3'"  3  
ATOM   3939  C "C2'"  . DT  A 1 2  ? -0.106  15.696  -5.289  1.00 0.00 ? 102 DT  B "C2'"  3  
ATOM   3940  C "C1'"  . DT  A 1 2  ? -1.141  16.493  -6.064  1.00 0.00 ? 102 DT  B "C1'"  3  
ATOM   3941  N N1     . DT  A 1 2  ? -1.320  15.954  -7.425  1.00 0.00 ? 102 DT  B N1     3  
ATOM   3942  C C2     . DT  A 1 2  ? -2.615  15.777  -7.875  1.00 0.00 ? 102 DT  B C2     3  
ATOM   3943  O O2     . DT  A 1 2  ? -3.580  16.026  -7.180  1.00 0.00 ? 102 DT  B O2     3  
ATOM   3944  N N3     . DT  A 1 2  ? -2.749  15.301  -9.165  1.00 0.00 ? 102 DT  B N3     3  
ATOM   3945  C C4     . DT  A 1 2  ? -1.715  14.988  -10.030 1.00 0.00 ? 102 DT  B C4     3  
ATOM   3946  O O4     . DT  A 1 2  ? -1.947  14.574  -11.149 1.00 0.00 ? 102 DT  B O4     3  
ATOM   3947  C C5     . DT  A 1 2  ? -0.398  15.202  -9.473  1.00 0.00 ? 102 DT  B C5     3  
ATOM   3948  C C7     . DT  A 1 2  ? 0.833   14.897  -10.319 1.00 0.00 ? 102 DT  B C7     3  
ATOM   3949  C C6     . DT  A 1 2  ? -0.242  15.667  -8.217  1.00 0.00 ? 102 DT  B C6     3  
ATOM   3950  H "H5'"  . DT  A 1 2  ? 1.182   19.137  -7.208  1.00 0.00 ? 102 DT  B "H5'"  3  
ATOM   3951  H "H5''" . DT  A 1 2  ? 2.441   18.984  -5.965  1.00 0.00 ? 102 DT  B "H5''" 3  
ATOM   3952  H "H4'"  . DT  A 1 2  ? 0.519   18.747  -4.690  1.00 0.00 ? 102 DT  B "H4'"  3  
ATOM   3953  H "H3'"  . DT  A 1 2  ? 1.933   16.335  -5.289  1.00 0.00 ? 102 DT  B "H3'"  3  
ATOM   3954  H "H2'"  . DT  A 1 2  ? 0.314   14.917  -5.925  1.00 0.00 ? 102 DT  B "H2'"  3  
ATOM   3955  H "H2''" . DT  A 1 2  ? -0.565  15.251  -4.409  1.00 0.00 ? 102 DT  B "H2''" 3  
ATOM   3956  H "H1'"  . DT  A 1 2  ? -2.094  16.449  -5.536  1.00 0.00 ? 102 DT  B "H1'"  3  
ATOM   3957  H H3     . DT  A 1 2  ? -3.662  15.171  -9.498  1.00 0.00 ? 102 DT  B H3     3  
ATOM   3958  H H71    . DT  A 1 2  ? 1.655   15.544  -10.011 1.00 0.00 ? 102 DT  B H71    3  
ATOM   3959  H H72    . DT  A 1 2  ? 1.120   13.855  -10.182 1.00 0.00 ? 102 DT  B H72    3  
ATOM   3960  H H73    . DT  A 1 2  ? 0.605   15.076  -11.369 1.00 0.00 ? 102 DT  B H73    3  
ATOM   3961  H H6     . DT  A 1 2  ? 0.764   15.819  -7.825  1.00 0.00 ? 102 DT  B H6     3  
ATOM   3962  P P      . DA  A 1 3  ? 0.972   15.452  -2.521  1.00 0.00 ? 103 DA  B P      3  
ATOM   3963  O OP1    . DA  A 1 3  ? 1.151   15.866  -1.111  1.00 0.00 ? 103 DA  B OP1    3  
ATOM   3964  O OP2    . DA  A 1 3  ? 1.848   14.409  -3.101  1.00 0.00 ? 103 DA  B OP2    3  
ATOM   3965  O "O5'"  . DA  A 1 3  ? -0.559  14.994  -2.722  1.00 0.00 ? 103 DA  B "O5'"  3  
ATOM   3966  C "C5'"  . DA  A 1 3  ? -1.596  15.525  -1.892  1.00 0.00 ? 103 DA  B "C5'"  3  
ATOM   3967  C "C4'"  . DA  A 1 3  ? -2.815  14.609  -1.874  1.00 0.00 ? 103 DA  B "C4'"  3  
ATOM   3968  O "O4'"  . DA  A 1 3  ? -3.414  14.537  -3.183  1.00 0.00 ? 103 DA  B "O4'"  3  
ATOM   3969  C "C3'"  . DA  A 1 3  ? -2.421  13.204  -1.448  1.00 0.00 ? 103 DA  B "C3'"  3  
ATOM   3970  O "O3'"  . DA  A 1 3  ? -3.082  12.841  -0.229  1.00 0.00 ? 103 DA  B "O3'"  3  
ATOM   3971  C "C2'"  . DA  A 1 3  ? -2.832  12.301  -2.581  1.00 0.00 ? 103 DA  B "C2'"  3  
ATOM   3972  C "C1'"  . DA  A 1 3  ? -3.576  13.164  -3.580  1.00 0.00 ? 103 DA  B "C1'"  3  
ATOM   3973  N N9     . DA  A 1 3  ? -3.056  12.947  -4.934  1.00 0.00 ? 103 DA  B N9     3  
ATOM   3974  C C8     . DA  A 1 3  ? -1.777  12.910  -5.348  1.00 0.00 ? 103 DA  B C8     3  
ATOM   3975  N N7     . DA  A 1 3  ? -1.557  12.721  -6.605  1.00 0.00 ? 103 DA  B N7     3  
ATOM   3976  C C5     . DA  A 1 3  ? -2.861  12.615  -7.101  1.00 0.00 ? 103 DA  B C5     3  
ATOM   3977  C C6     . DA  A 1 3  ? -3.371  12.405  -8.386  1.00 0.00 ? 103 DA  B C6     3  
ATOM   3978  N N6     . DA  A 1 3  ? -2.599  12.256  -9.461  1.00 0.00 ? 103 DA  B N6     3  
ATOM   3979  N N1     . DA  A 1 3  ? -4.709  12.352  -8.519  1.00 0.00 ? 103 DA  B N1     3  
ATOM   3980  C C2     . DA  A 1 3  ? -5.501  12.497  -7.455  1.00 0.00 ? 103 DA  B C2     3  
ATOM   3981  N N3     . DA  A 1 3  ? -5.124  12.701  -6.195  1.00 0.00 ? 103 DA  B N3     3  
ATOM   3982  C C4     . DA  A 1 3  ? -3.781  12.750  -6.088  1.00 0.00 ? 103 DA  B C4     3  
ATOM   3983  H "H5'"  . DA  A 1 3  ? -1.890  16.503  -2.270  1.00 0.00 ? 103 DA  B "H5'"  3  
ATOM   3984  H "H5''" . DA  A 1 3  ? -1.217  15.635  -0.875  1.00 0.00 ? 103 DA  B "H5''" 3  
ATOM   3985  H "H4'"  . DA  A 1 3  ? -3.550  14.997  -1.175  1.00 0.00 ? 103 DA  B "H4'"  3  
ATOM   3986  H "H3'"  . DA  A 1 3  ? -1.339  13.151  -1.315  1.00 0.00 ? 103 DA  B "H3'"  3  
ATOM   3987  H "H2'"  . DA  A 1 3  ? -1.948  11.869  -3.050  1.00 0.00 ? 103 DA  B "H2'"  3  
ATOM   3988  H "H2''" . DA  A 1 3  ? -3.481  11.512  -2.217  1.00 0.00 ? 103 DA  B "H2''" 3  
ATOM   3989  H "H1'"  . DA  A 1 3  ? -4.627  12.912  -3.555  1.00 0.00 ? 103 DA  B "H1'"  3  
ATOM   3990  H H8     . DA  A 1 3  ? -0.964  13.022  -4.636  1.00 0.00 ? 103 DA  B H8     3  
ATOM   3991  H H61    . DA  A 1 3  ? -3.018  12.105  -10.368 1.00 0.00 ? 103 DA  B H61    3  
ATOM   3992  H H62    . DA  A 1 3  ? -1.593  12.293  -9.370  1.00 0.00 ? 103 DA  B H62    3  
ATOM   3993  H H2     . DA  A 1 3  ? -6.575  12.441  -7.639  1.00 0.00 ? 103 DA  B H2     3  
ATOM   3994  P P      . DT  A 1 4  ? -3.210  11.297  0.211   1.00 0.00 ? 104 DT  B P      3  
ATOM   3995  O OP1    . DT  A 1 4  ? -3.151  11.230  1.688   1.00 0.00 ? 104 DT  B OP1    3  
ATOM   3996  O OP2    . DT  A 1 4  ? -2.261  10.503  -0.603  1.00 0.00 ? 104 DT  B OP2    3  
ATOM   3997  O "O5'"  . DT  A 1 4  ? -4.706  10.924  -0.252  1.00 0.00 ? 104 DT  B "O5'"  3  
ATOM   3998  C "C5'"  . DT  A 1 4  ? -5.656  11.957  -0.540  1.00 0.00 ? 104 DT  B "C5'"  3  
ATOM   3999  C "C4'"  . DT  A 1 4  ? -6.960  11.386  -1.091  1.00 0.00 ? 104 DT  B "C4'"  3  
ATOM   4000  O "O4'"  . DT  A 1 4  ? -6.935  11.368  -2.535  1.00 0.00 ? 104 DT  B "O4'"  3  
ATOM   4001  C "C3'"  . DT  A 1 4  ? -7.173  9.963   -0.597  1.00 0.00 ? 104 DT  B "C3'"  3  
ATOM   4002  O "O3'"  . DT  A 1 4  ? -8.427  9.846   0.083   1.00 0.00 ? 104 DT  B "O3'"  3  
ATOM   4003  C "C2'"  . DT  A 1 4  ? -7.141  9.089   -1.825  1.00 0.00 ? 104 DT  B "C2'"  3  
ATOM   4004  C "C1'"  . DT  A 1 4  ? -7.021  10.013  -3.026  1.00 0.00 ? 104 DT  B "C1'"  3  
ATOM   4005  N N1     . DT  A 1 4  ? -5.831  9.678   -3.827  1.00 0.00 ? 104 DT  B N1     3  
ATOM   4006  C C2     . DT  A 1 4  ? -6.004  9.510   -5.188  1.00 0.00 ? 104 DT  B C2     3  
ATOM   4007  O O2     . DT  A 1 4  ? -7.092  9.615   -5.719  1.00 0.00 ? 104 DT  B O2     3  
ATOM   4008  N N3     . DT  A 1 4  ? -4.862  9.218   -5.911  1.00 0.00 ? 104 DT  B N3     3  
ATOM   4009  C C4     . DT  A 1 4  ? -3.585  9.080   -5.397  1.00 0.00 ? 104 DT  B C4     3  
ATOM   4010  O O4     . DT  A 1 4  ? -2.648  8.822   -6.127  1.00 0.00 ? 104 DT  B O4     3  
ATOM   4011  C C5     . DT  A 1 4  ? -3.504  9.272   -3.966  1.00 0.00 ? 104 DT  B C5     3  
ATOM   4012  C C7     . DT  A 1 4  ? -2.156  9.148   -3.268  1.00 0.00 ? 104 DT  B C7     3  
ATOM   4013  C C6     . DT  A 1 4  ? -4.603  9.556   -3.241  1.00 0.00 ? 104 DT  B C6     3  
ATOM   4014  H "H5'"  . DT  A 1 4  ? -5.227  12.638  -1.275  1.00 0.00 ? 104 DT  B "H5'"  3  
ATOM   4015  H "H5''" . DT  A 1 4  ? -5.867  12.510  0.375   1.00 0.00 ? 104 DT  B "H5''" 3  
ATOM   4016  H "H4'"  . DT  A 1 4  ? -7.790  12.008  -0.757  1.00 0.00 ? 104 DT  B "H4'"  3  
ATOM   4017  H "H3'"  . DT  A 1 4  ? -6.357  9.682   0.071   1.00 0.00 ? 104 DT  B "H3'"  3  
ATOM   4018  H "H2'"  . DT  A 1 4  ? -6.281  8.422   -1.783  1.00 0.00 ? 104 DT  B "H2'"  3  
ATOM   4019  H "H2''" . DT  A 1 4  ? -8.058  8.509   -1.895  1.00 0.00 ? 104 DT  B "H2''" 3  
ATOM   4020  H "H1'"  . DT  A 1 4  ? -7.909  9.912   -3.647  1.00 0.00 ? 104 DT  B "H1'"  3  
ATOM   4021  H H3     . DT  A 1 4  ? -4.969  9.095   -6.878  1.00 0.00 ? 104 DT  B H3     3  
ATOM   4022  H H71    . DT  A 1 4  ? -2.283  9.316   -2.198  1.00 0.00 ? 104 DT  B H71    3  
ATOM   4023  H H72    . DT  A 1 4  ? -1.749  8.151   -3.433  1.00 0.00 ? 104 DT  B H72    3  
ATOM   4024  H H73    . DT  A 1 4  ? -1.468  9.892   -3.671  1.00 0.00 ? 104 DT  B H73    3  
ATOM   4025  H H6     . DT  A 1 4  ? -4.515  9.688   -2.162  1.00 0.00 ? 104 DT  B H6     3  
ATOM   4026  P P      . DC  A 1 5  ? -9.061  8.399   0.396   1.00 0.00 ? 105 DC  B P      3  
ATOM   4027  O OP1    . DC  A 1 5  ? -10.342 8.598   1.111   1.00 0.00 ? 105 DC  B OP1    3  
ATOM   4028  O OP2    . DC  A 1 5  ? -8.007  7.550   0.994   1.00 0.00 ? 105 DC  B OP2    3  
ATOM   4029  O "O5'"  . DC  A 1 5  ? -9.389  7.832   -1.075  1.00 0.00 ? 105 DC  B "O5'"  3  
ATOM   4030  C "C5'"  . DC  A 1 5  ? -10.594 8.205   -1.748  1.00 0.00 ? 105 DC  B "C5'"  3  
ATOM   4031  C "C4'"  . DC  A 1 5  ? -10.899 7.259   -2.907  1.00 0.00 ? 105 DC  B "C4'"  3  
ATOM   4032  O "O4'"  . DC  A 1 5  ? -9.928  7.417   -3.963  1.00 0.00 ? 105 DC  B "O4'"  3  
ATOM   4033  C "C3'"  . DC  A 1 5  ? -10.873 5.815   -2.442  1.00 0.00 ? 105 DC  B "C3'"  3  
ATOM   4034  O "O3'"  . DC  A 1 5  ? -12.175 5.225   -2.604  1.00 0.00 ? 105 DC  B "O3'"  3  
ATOM   4035  C "C2'"  . DC  A 1 5  ? -9.824  5.131   -3.287  1.00 0.00 ? 105 DC  B "C2'"  3  
ATOM   4036  C "C1'"  . DC  A 1 5  ? -9.384  6.137   -4.331  1.00 0.00 ? 105 DC  B "C1'"  3  
ATOM   4037  N N1     . DC  A 1 5  ? -7.914  6.194   -4.420  1.00 0.00 ? 105 DC  B N1     3  
ATOM   4038  C C2     . DC  A 1 5  ? -7.338  6.031   -5.671  1.00 0.00 ? 105 DC  B C2     3  
ATOM   4039  O O2     . DC  A 1 5  ? -8.040  5.843   -6.645  1.00 0.00 ? 105 DC  B O2     3  
ATOM   4040  N N3     . DC  A 1 5  ? -5.982  6.088   -5.767  1.00 0.00 ? 105 DC  B N3     3  
ATOM   4041  C C4     . DC  A 1 5  ? -5.223  6.297   -4.684  1.00 0.00 ? 105 DC  B C4     3  
ATOM   4042  N N4     . DC  A 1 5  ? -3.897  6.346   -4.814  1.00 0.00 ? 105 DC  B N4     3  
ATOM   4043  C C5     . DC  A 1 5  ? -5.815  6.465   -3.392  1.00 0.00 ? 105 DC  B C5     3  
ATOM   4044  C C6     . DC  A 1 5  ? -7.157  6.406   -3.308  1.00 0.00 ? 105 DC  B C6     3  
ATOM   4045  H "H5'"  . DC  A 1 5  ? -10.488 9.219   -2.134  1.00 0.00 ? 105 DC  B "H5'"  3  
ATOM   4046  H "H5''" . DC  A 1 5  ? -11.422 8.177   -1.039  1.00 0.00 ? 105 DC  B "H5''" 3  
ATOM   4047  H "H4'"  . DC  A 1 5  ? -11.888 7.479   -3.304  1.00 0.00 ? 105 DC  B "H4'"  3  
ATOM   4048  H "H3'"  . DC  A 1 5  ? -10.576 5.776   -1.392  1.00 0.00 ? 105 DC  B "H3'"  3  
ATOM   4049  H "H2'"  . DC  A 1 5  ? -8.976  4.847   -2.665  1.00 0.00 ? 105 DC  B "H2'"  3  
ATOM   4050  H "H2''" . DC  A 1 5  ? -10.238 4.252   -3.772  1.00 0.00 ? 105 DC  B "H2''" 3  
ATOM   4051  H "H1'"  . DC  A 1 5  ? -9.792  5.846   -5.295  1.00 0.00 ? 105 DC  B "H1'"  3  
ATOM   4052  H H41    . DC  A 1 5  ? -3.475  6.229   -5.723  1.00 0.00 ? 105 DC  B H41    3  
ATOM   4053  H H42    . DC  A 1 5  ? -3.316  6.502   -4.003  1.00 0.00 ? 105 DC  B H42    3  
ATOM   4054  H H5     . DC  A 1 5  ? -5.200  6.636   -2.508  1.00 0.00 ? 105 DC  B H5     3  
ATOM   4055  H H6     . DC  A 1 5  ? -7.644  6.522   -2.340  1.00 0.00 ? 105 DC  B H6     3  
HETATM 4056  N N1     . 5CM A 1 6  ? -9.637  2.169   -6.423  1.00 0.00 ? 106 5CM B N1     3  
HETATM 4057  C C2     . 5CM A 1 6  ? -8.384  2.074   -7.012  1.00 0.00 ? 106 5CM B C2     3  
HETATM 4058  N N3     . 5CM A 1 6  ? -7.291  2.043   -6.202  1.00 0.00 ? 106 5CM B N3     3  
HETATM 4059  C C4     . 5CM A 1 6  ? -7.419  2.099   -4.871  1.00 0.00 ? 106 5CM B C4     3  
HETATM 4060  C C5     . 5CM A 1 6  ? -8.708  2.194   -4.259  1.00 0.00 ? 106 5CM B C5     3  
HETATM 4061  C C5A    . 5CM A 1 6  ? -8.859  2.272   -2.743  1.00 0.00 ? 106 5CM B C5A    3  
HETATM 4062  C C6     . 5CM A 1 6  ? -9.785  2.225   -5.069  1.00 0.00 ? 106 5CM B C6     3  
HETATM 4063  O O2     . 5CM A 1 6  ? -8.282  2.022   -8.221  1.00 0.00 ? 106 5CM B O2     3  
HETATM 4064  N N4     . 5CM A 1 6  ? -6.325  2.065   -4.110  1.00 0.00 ? 106 5CM B N4     3  
HETATM 4065  C "C1'"  . 5CM A 1 6  ? -10.803 2.245   -7.329  1.00 0.00 ? 106 5CM B "C1'"  3  
HETATM 4066  C "C2'"  . 5CM A 1 6  ? -11.998 1.471   -6.787  1.00 0.00 ? 106 5CM B "C2'"  3  
HETATM 4067  C "C3'"  . 5CM A 1 6  ? -13.184 2.395   -6.900  1.00 0.00 ? 106 5CM B "C3'"  3  
HETATM 4068  C "C4'"  . 5CM A 1 6  ? -12.599 3.776   -7.120  1.00 0.00 ? 106 5CM B "C4'"  3  
HETATM 4069  O "O4'"  . 5CM A 1 6  ? -11.216 3.618   -7.502  1.00 0.00 ? 106 5CM B "O4'"  3  
HETATM 4070  O "O3'"  . 5CM A 1 6  ? -14.022 2.035   -8.004  1.00 0.00 ? 106 5CM B "O3'"  3  
HETATM 4071  C "C5'"  . 5CM A 1 6  ? -12.710 4.606   -5.846  1.00 0.00 ? 106 5CM B "C5'"  3  
HETATM 4072  O "O5'"  . 5CM A 1 6  ? -11.829 4.117   -4.831  1.00 0.00 ? 106 5CM B "O5'"  3  
HETATM 4073  P P      . 5CM A 1 6  ? -12.382 3.815   -3.351  1.00 0.00 ? 106 5CM B P      3  
HETATM 4074  O OP1    . 5CM A 1 6  ? -13.833 3.545   -3.449  1.00 0.00 ? 106 5CM B OP1    3  
HETATM 4075  O OP2    . 5CM A 1 6  ? -11.486 2.827   -2.714  1.00 0.00 ? 106 5CM B OP2    3  
HETATM 4076  H H5A1   . 5CM A 1 6  ? -8.818  1.268   -2.322  1.00 0.00 ? 106 5CM B H5A1   3  
HETATM 4077  H H5A2   . 5CM A 1 6  ? -8.051  2.874   -2.328  1.00 0.00 ? 106 5CM B H5A2   3  
HETATM 4078  H H5A3   . 5CM A 1 6  ? -9.819  2.731   -2.497  1.00 0.00 ? 106 5CM B H5A3   3  
HETATM 4079  H H6     . 5CM A 1 6  ? -10.783 2.291   -4.637  1.00 0.00 ? 106 5CM B H6     3  
HETATM 4080  H HN41   . 5CM A 1 6  ? -6.408  2.107   -3.104  1.00 0.00 ? 106 5CM B HN41   3  
HETATM 4081  H HN42   . 5CM A 1 6  ? -5.412  1.999   -4.538  1.00 0.00 ? 106 5CM B HN42   3  
HETATM 4082  H "H1'"  . 5CM A 1 6  ? -10.525 1.834   -8.299  1.00 0.00 ? 106 5CM B "H1'"  3  
HETATM 4083  H "H2'"  . 5CM A 1 6  ? -11.835 1.207   -5.742  1.00 0.00 ? 106 5CM B "H2'"  3  
HETATM 4084  H "H2''" . 5CM A 1 6  ? -12.162 0.571   -7.375  1.00 0.00 ? 106 5CM B "H2''" 3  
HETATM 4085  H "H3'"  . 5CM A 1 6  ? -13.756 2.374   -5.969  1.00 0.00 ? 106 5CM B "H3'"  3  
HETATM 4086  H "H4'"  . 5CM A 1 6  ? -13.140 4.272   -7.925  1.00 0.00 ? 106 5CM B "H4'"  3  
HETATM 4087  H "H5'"  . 5CM A 1 6  ? -12.455 5.642   -6.071  1.00 0.00 ? 106 5CM B "H5'"  3  
HETATM 4088  H "H5''" . 5CM A 1 6  ? -13.736 4.563   -5.481  1.00 0.00 ? 106 5CM B "H5''" 3  
ATOM   4089  P P      . DG  A 1 7  ? -14.409 0.501   -8.276  1.00 0.00 ? 107 DG  B P      3  
ATOM   4090  O OP1    . DG  A 1 7  ? -15.364 0.454   -9.404  1.00 0.00 ? 107 DG  B OP1    3  
ATOM   4091  O OP2    . DG  A 1 7  ? -14.760 -0.111  -6.981  1.00 0.00 ? 107 DG  B OP2    3  
ATOM   4092  O "O5'"  . DG  A 1 7  ? -13.016 -0.132  -8.769  1.00 0.00 ? 107 DG  B "O5'"  3  
ATOM   4093  C "C5'"  . DG  A 1 7  ? -12.464 0.239   -10.033 1.00 0.00 ? 107 DG  B "C5'"  3  
ATOM   4094  C "C4'"  . DG  A 1 7  ? -11.667 -0.901  -10.658 1.00 0.00 ? 107 DG  B "C4'"  3  
ATOM   4095  O "O4'"  . DG  A 1 7  ? -10.265 -0.782  -10.333 1.00 0.00 ? 107 DG  B "O4'"  3  
ATOM   4096  C "C3'"  . DG  A 1 7  ? -12.164 -2.251  -10.161 1.00 0.00 ? 107 DG  B "C3'"  3  
ATOM   4097  O "O3'"  . DG  A 1 7  ? -12.697 -3.024  -11.249 1.00 0.00 ? 107 DG  B "O3'"  3  
ATOM   4098  C "C2'"  . DG  A 1 7  ? -10.969 -2.925  -9.537  1.00 0.00 ? 107 DG  B "C2'"  3  
ATOM   4099  C "C1'"  . DG  A 1 7  ? -9.780  -2.007  -9.749  1.00 0.00 ? 107 DG  B "C1'"  3  
ATOM   4100  N N9     . DG  A 1 7  ? -9.098  -1.758  -8.475  1.00 0.00 ? 107 DG  B N9     3  
ATOM   4101  C C8     . DG  A 1 7  ? -9.628  -1.528  -7.258  1.00 0.00 ? 107 DG  B C8     3  
ATOM   4102  N N7     . DG  A 1 7  ? -8.816  -1.388  -6.264  1.00 0.00 ? 107 DG  B N7     3  
ATOM   4103  C C5     . DG  A 1 7  ? -7.575  -1.542  -6.890  1.00 0.00 ? 107 DG  B C5     3  
ATOM   4104  C C6     . DG  A 1 7  ? -6.267  -1.501  -6.341  1.00 0.00 ? 107 DG  B C6     3  
ATOM   4105  O O6     . DG  A 1 7  ? -5.939  -1.317  -5.186  1.00 0.00 ? 107 DG  B O6     3  
ATOM   4106  N N1     . DG  A 1 7  ? -5.298  -1.706  -7.317  1.00 0.00 ? 107 DG  B N1     3  
ATOM   4107  C C2     . DG  A 1 7  ? -5.553  -1.923  -8.656  1.00 0.00 ? 107 DG  B C2     3  
ATOM   4108  N N2     . DG  A 1 7  ? -4.487  -2.098  -9.438  1.00 0.00 ? 107 DG  B N2     3  
ATOM   4109  N N3     . DG  A 1 7  ? -6.782  -1.963  -9.181  1.00 0.00 ? 107 DG  B N3     3  
ATOM   4110  C C4     . DG  A 1 7  ? -7.741  -1.768  -8.248  1.00 0.00 ? 107 DG  B C4     3  
ATOM   4111  H "H5'"  . DG  A 1 7  ? -11.806 1.098   -9.894  1.00 0.00 ? 107 DG  B "H5'"  3  
ATOM   4112  H "H5''" . DG  A 1 7  ? -13.275 0.517   -10.706 1.00 0.00 ? 107 DG  B "H5''" 3  
ATOM   4113  H "H4'"  . DG  A 1 7  ? -11.782 -0.860  -11.738 1.00 0.00 ? 107 DG  B "H4'"  3  
ATOM   4114  H "H3'"  . DG  A 1 7  ? -12.934 -2.098  -9.401  1.00 0.00 ? 107 DG  B "H3'"  3  
ATOM   4115  H "H2'"  . DG  A 1 7  ? -11.139 -3.069  -8.470  1.00 0.00 ? 107 DG  B "H2'"  3  
ATOM   4116  H "H2''" . DG  A 1 7  ? -10.782 -3.882  -10.013 1.00 0.00 ? 107 DG  B "H2''" 3  
ATOM   4117  H "H1'"  . DG  A 1 7  ? -9.085  -2.479  -10.434 1.00 0.00 ? 107 DG  B "H1'"  3  
ATOM   4118  H H8     . DG  A 1 7  ? -10.707 -1.469  -7.125  1.00 0.00 ? 107 DG  B H8     3  
ATOM   4119  H H1     . DG  A 1 7  ? -4.368  -1.692  -7.009  1.00 0.00 ? 107 DG  B H1     3  
ATOM   4120  H H21    . DG  A 1 7  ? -3.559  -2.066  -9.041  1.00 0.00 ? 107 DG  B H21    3  
ATOM   4121  H H22    . DG  A 1 7  ? -4.608  -2.260  -10.428 1.00 0.00 ? 107 DG  B H22    3  
ATOM   4122  P P      . DG  A 1 8  ? -12.651 -4.635  -11.230 1.00 0.00 ? 108 DG  B P      3  
ATOM   4123  O OP1    . DG  A 1 8  ? -13.643 -5.139  -12.206 1.00 0.00 ? 108 DG  B OP1    3  
ATOM   4124  O OP2    . DG  A 1 8  ? -12.706 -5.086  -9.822  1.00 0.00 ? 108 DG  B OP2    3  
ATOM   4125  O "O5'"  . DG  A 1 8  ? -11.176 -4.946  -11.801 1.00 0.00 ? 108 DG  B "O5'"  3  
ATOM   4126  C "C5'"  . DG  A 1 8  ? -10.686 -4.252  -12.953 1.00 0.00 ? 108 DG  B "C5'"  3  
ATOM   4127  C "C4'"  . DG  A 1 8  ? -9.163  -4.154  -12.951 1.00 0.00 ? 108 DG  B "C4'"  3  
ATOM   4128  O "O4'"  . DG  A 1 8  ? -8.665  -3.870  -11.628 1.00 0.00 ? 108 DG  B "O4'"  3  
ATOM   4129  C "C3'"  . DG  A 1 8  ? -8.535  -5.454  -13.427 1.00 0.00 ? 108 DG  B "C3'"  3  
ATOM   4130  O "O3'"  . DG  A 1 8  ? -7.886  -5.266  -14.691 1.00 0.00 ? 108 DG  B "O3'"  3  
ATOM   4131  C "C2'"  . DG  A 1 8  ? -7.545  -5.849  -12.362 1.00 0.00 ? 108 DG  B "C2'"  3  
ATOM   4132  C "C1'"  . DG  A 1 8  ? -7.577  -4.760  -11.309 1.00 0.00 ? 108 DG  B "C1'"  3  
ATOM   4133  N N9     . DG  A 1 8  ? -7.745  -5.323  -9.962  1.00 0.00 ? 108 DG  B N9     3  
ATOM   4134  C C8     . DG  A 1 8  ? -8.872  -5.714  -9.336  1.00 0.00 ? 108 DG  B C8     3  
ATOM   4135  N N7     . DG  A 1 8  ? -8.769  -6.143  -8.121  1.00 0.00 ? 108 DG  B N7     3  
ATOM   4136  C C5     . DG  A 1 8  ? -7.393  -6.028  -7.898  1.00 0.00 ? 108 DG  B C5     3  
ATOM   4137  C C6     . DG  A 1 8  ? -6.626  -6.341  -6.742  1.00 0.00 ? 108 DG  B C6     3  
ATOM   4138  O O6     . DG  A 1 8  ? -7.012  -6.782  -5.677  1.00 0.00 ? 108 DG  B O6     3  
ATOM   4139  N N1     . DG  A 1 8  ? -5.276  -6.077  -6.939  1.00 0.00 ? 108 DG  B N1     3  
ATOM   4140  C C2     . DG  A 1 8  ? -4.725  -5.576  -8.101  1.00 0.00 ? 108 DG  B C2     3  
ATOM   4141  N N2     . DG  A 1 8  ? -3.405  -5.391  -8.095  1.00 0.00 ? 108 DG  B N2     3  
ATOM   4142  N N3     . DG  A 1 8  ? -5.438  -5.280  -9.193  1.00 0.00 ? 108 DG  B N3     3  
ATOM   4143  C C4     . DG  A 1 8  ? -6.757  -5.528  -9.024  1.00 0.00 ? 108 DG  B C4     3  
ATOM   4144  H "H5'"  . DG  A 1 8  ? -11.108 -3.247  -12.967 1.00 0.00 ? 108 DG  B "H5'"  3  
ATOM   4145  H "H5''" . DG  A 1 8  ? -11.006 -4.783  -13.849 1.00 0.00 ? 108 DG  B "H5''" 3  
ATOM   4146  H "H4'"  . DG  A 1 8  ? -8.857  -3.350  -13.618 1.00 0.00 ? 108 DG  B "H4'"  3  
ATOM   4147  H "H3'"  . DG  A 1 8  ? -9.305  -6.221  -13.510 1.00 0.00 ? 108 DG  B "H3'"  3  
ATOM   4148  H "H2'"  . DG  A 1 8  ? -7.831  -6.804  -11.920 1.00 0.00 ? 108 DG  B "H2'"  3  
ATOM   4149  H "H2''" . DG  A 1 8  ? -6.546  -5.918  -12.789 1.00 0.00 ? 108 DG  B "H2''" 3  
ATOM   4150  H "H1'"  . DG  A 1 8  ? -6.648  -4.208  -11.349 1.00 0.00 ? 108 DG  B "H1'"  3  
ATOM   4151  H H8     . DG  A 1 8  ? -9.833  -5.670  -9.843  1.00 0.00 ? 108 DG  B H8     3  
ATOM   4152  H H1     . DG  A 1 8  ? -4.685  -6.269  -6.180  1.00 0.00 ? 108 DG  B H1     3  
ATOM   4153  H H21    . DG  A 1 8  ? -2.867  -5.614  -7.270  1.00 0.00 ? 108 DG  B H21    3  
ATOM   4154  H H22    . DG  A 1 8  ? -2.943  -5.026  -8.916  1.00 0.00 ? 108 DG  B H22    3  
ATOM   4155  P P      . DA  A 1 9  ? -6.777  -6.310  -15.219 1.00 0.00 ? 109 DA  B P      3  
ATOM   4156  O OP1    . DA  A 1 9  ? -6.250  -5.811  -16.509 1.00 0.00 ? 109 DA  B OP1    3  
ATOM   4157  O OP2    . DA  A 1 9  ? -7.347  -7.673  -15.134 1.00 0.00 ? 109 DA  B OP2    3  
ATOM   4158  O "O5'"  . DA  A 1 9  ? -5.609  -6.184  -14.116 1.00 0.00 ? 109 DA  B "O5'"  3  
ATOM   4159  C "C5'"  . DA  A 1 9  ? -4.455  -5.373  -14.359 1.00 0.00 ? 109 DA  B "C5'"  3  
ATOM   4160  C "C4'"  . DA  A 1 9  ? -3.170  -6.149  -14.090 1.00 0.00 ? 109 DA  B "C4'"  3  
ATOM   4161  O "O4'"  . DA  A 1 9  ? -2.985  -6.357  -12.670 1.00 0.00 ? 109 DA  B "O4'"  3  
ATOM   4162  C "C3'"  . DA  A 1 9  ? -3.231  -7.509  -14.764 1.00 0.00 ? 109 DA  B "C3'"  3  
ATOM   4163  O "O3'"  . DA  A 1 9  ? -2.068  -7.727  -15.571 1.00 0.00 ? 109 DA  B "O3'"  3  
ATOM   4164  C "C2'"  . DA  A 1 9  ? -3.315  -8.516  -13.647 1.00 0.00 ? 109 DA  B "C2'"  3  
ATOM   4165  C "C1'"  . DA  A 1 9  ? -3.088  -7.763  -12.350 1.00 0.00 ? 109 DA  B "C1'"  3  
ATOM   4166  N N9     . DA  A 1 9  ? -4.200  -8.004  -11.426 1.00 0.00 ? 109 DA  B N9     3  
ATOM   4167  C C8     . DA  A 1 9  ? -5.517  -7.909  -11.664 1.00 0.00 ? 109 DA  B C8     3  
ATOM   4168  N N7     . DA  A 1 9  ? -6.324  -8.144  -10.685 1.00 0.00 ? 109 DA  B N7     3  
ATOM   4169  C C5     . DA  A 1 9  ? -5.427  -8.442  -9.653  1.00 0.00 ? 109 DA  B C5     3  
ATOM   4170  C C6     . DA  A 1 9  ? -5.607  -8.794  -8.312  1.00 0.00 ? 109 DA  B C6     3  
ATOM   4171  N N6     . DA  A 1 9  ? -6.808  -8.912  -7.744  1.00 0.00 ? 109 DA  B N6     3  
ATOM   4172  N N1     . DA  A 1 9  ? -4.503  -9.020  -7.579  1.00 0.00 ? 109 DA  B N1     3  
ATOM   4173  C C2     . DA  A 1 9  ? -3.292  -8.911  -8.128  1.00 0.00 ? 109 DA  B C2     3  
ATOM   4174  N N3     . DA  A 1 9  ? -3.006  -8.585  -9.385  1.00 0.00 ? 109 DA  B N3     3  
ATOM   4175  C C4     . DA  A 1 9  ? -4.128  -8.360  -10.099 1.00 0.00 ? 109 DA  B C4     3  
ATOM   4176  H "H5'"  . DA  A 1 9  ? -4.489  -4.500  -13.709 1.00 0.00 ? 109 DA  B "H5'"  3  
ATOM   4177  H "H5''" . DA  A 1 9  ? -4.462  -5.045  -15.399 1.00 0.00 ? 109 DA  B "H5''" 3  
ATOM   4178  H "H4'"  . DA  A 1 9  ? -2.321  -5.588  -14.483 1.00 0.00 ? 109 DA  B "H4'"  3  
ATOM   4179  H "H3'"  . DA  A 1 9  ? -4.131  -7.572  -15.379 1.00 0.00 ? 109 DA  B "H3'"  3  
ATOM   4180  H "H2'"  . DA  A 1 9  ? -4.302  -8.977  -13.638 1.00 0.00 ? 109 DA  B "H2'"  3  
ATOM   4181  H "H2''" . DA  A 1 9  ? -2.556  -9.275  -13.769 1.00 0.00 ? 109 DA  B "H2''" 3  
ATOM   4182  H "H1'"  . DA  A 1 9  ? -2.164  -8.100  -11.893 1.00 0.00 ? 109 DA  B "H1'"  3  
ATOM   4183  H H8     . DA  A 1 9  ? -5.876  -7.664  -12.656 1.00 0.00 ? 109 DA  B H8     3  
ATOM   4184  H H61    . DA  A 1 9  ? -6.883  -9.170  -6.771  1.00 0.00 ? 109 DA  B H61    3  
ATOM   4185  H H62    . DA  A 1 9  ? -7.642  -8.746  -8.289  1.00 0.00 ? 109 DA  B H62    3  
ATOM   4186  H H2     . DA  A 1 9  ? -2.443  -9.116  -7.473  1.00 0.00 ? 109 DA  B H2     3  
ATOM   4187  P P      . DT  A 1 10 ? -1.651  -9.213  -16.031 1.00 0.00 ? 110 DT  B P      3  
ATOM   4188  O OP1    . DT  A 1 10 ? -0.792  -9.104  -17.230 1.00 0.00 ? 110 DT  B OP1    3  
ATOM   4189  O OP2    . DT  A 1 10 ? -2.874  -10.046 -16.071 1.00 0.00 ? 110 DT  B OP2    3  
ATOM   4190  O "O5'"  . DT  A 1 10 ? -0.740  -9.716  -14.801 1.00 0.00 ? 110 DT  B "O5'"  3  
ATOM   4191  C "C5'"  . DT  A 1 10 ? -0.110  -8.772  -13.927 1.00 0.00 ? 110 DT  B "C5'"  3  
ATOM   4192  C "C4'"  . DT  A 1 10 ? 0.683   -9.468  -12.824 1.00 0.00 ? 110 DT  B "C4'"  3  
ATOM   4193  O "O4'"  . DT  A 1 10 ? -0.105  -9.573  -11.617 1.00 0.00 ? 110 DT  B "O4'"  3  
ATOM   4194  C "C3'"  . DT  A 1 10 ? 1.083   -10.870 -13.256 1.00 0.00 ? 110 DT  B "C3'"  3  
ATOM   4195  O "O3'"  . DT  A 1 10 ? 2.504   -11.036 -13.177 1.00 0.00 ? 110 DT  B "O3'"  3  
ATOM   4196  C "C2'"  . DT  A 1 10 ? 0.373   -11.811 -12.315 1.00 0.00 ? 110 DT  B "C2'"  3  
ATOM   4197  C "C1'"  . DT  A 1 10 ? -0.285  -10.956 -11.248 1.00 0.00 ? 110 DT  B "C1'"  3  
ATOM   4198  N N1     . DT  A 1 10 ? -1.715  -11.284 -11.127 1.00 0.00 ? 110 DT  B N1     3  
ATOM   4199  C C2     . DT  A 1 10 ? -2.191  -11.620 -9.874  1.00 0.00 ? 110 DT  B C2     3  
ATOM   4200  O O2     . DT  A 1 10 ? -1.470  -11.662 -8.898  1.00 0.00 ? 110 DT  B O2     3  
ATOM   4201  N N3     . DT  A 1 10 ? -3.541  -11.904 -9.797  1.00 0.00 ? 110 DT  B N3     3  
ATOM   4202  C C4     . DT  A 1 10 ? -4.441  -11.882 -10.848 1.00 0.00 ? 110 DT  B C4     3  
ATOM   4203  O O4     . DT  A 1 10 ? -5.613  -12.148 -10.668 1.00 0.00 ? 110 DT  B O4     3  
ATOM   4204  C C5     . DT  A 1 10 ? -3.850  -11.520 -12.118 1.00 0.00 ? 110 DT  B C5     3  
ATOM   4205  C C7     . DT  A 1 10 ? -4.728  -11.455 -13.363 1.00 0.00 ? 110 DT  B C7     3  
ATOM   4206  C C6     . DT  A 1 10 ? -2.536  -11.241 -12.217 1.00 0.00 ? 110 DT  B C6     3  
ATOM   4207  H "H5'"  . DT  A 1 10 ? -0.875  -8.142  -13.473 1.00 0.00 ? 110 DT  B "H5'"  3  
ATOM   4208  H "H5''" . DT  A 1 10 ? 0.566   -8.146  -14.509 1.00 0.00 ? 110 DT  B "H5''" 3  
ATOM   4209  H "H4'"  . DT  A 1 10 ? 1.582   -8.890  -12.612 1.00 0.00 ? 110 DT  B "H4'"  3  
ATOM   4210  H "H3'"  . DT  A 1 10 ? 0.742   -11.049 -14.277 1.00 0.00 ? 110 DT  B "H3'"  3  
ATOM   4211  H "H2'"  . DT  A 1 10 ? -0.386  -12.374 -12.858 1.00 0.00 ? 110 DT  B "H2'"  3  
ATOM   4212  H "H2''" . DT  A 1 10 ? 1.084   -12.492 -11.859 1.00 0.00 ? 110 DT  B "H2''" 3  
ATOM   4213  H "H1'"  . DT  A 1 10 ? 0.205   -11.138 -10.291 1.00 0.00 ? 110 DT  B "H1'"  3  
ATOM   4214  H H3     . DT  A 1 10 ? -3.895  -12.144 -8.915  1.00 0.00 ? 110 DT  B H3     3  
ATOM   4215  H H71    . DT  A 1 10 ? -5.293  -12.381 -13.459 1.00 0.00 ? 110 DT  B H71    3  
ATOM   4216  H H72    . DT  A 1 10 ? -5.418  -10.615 -13.276 1.00 0.00 ? 110 DT  B H72    3  
ATOM   4217  H H73    . DT  A 1 10 ? -4.099  -11.319 -14.243 1.00 0.00 ? 110 DT  B H73    3  
ATOM   4218  H H6     . DT  A 1 10 ? -2.115  -10.985 -13.187 1.00 0.00 ? 110 DT  B H6     3  
ATOM   4219  P P      . DA  A 1 11 ? 3.163   -12.505 -13.183 1.00 0.00 ? 111 DA  B P      3  
ATOM   4220  O OP1    . DA  A 1 11 ? 4.633   -12.353 -13.112 1.00 0.00 ? 111 DA  B OP1    3  
ATOM   4221  O OP2    . DA  A 1 11 ? 2.553   -13.282 -14.285 1.00 0.00 ? 111 DA  B OP2    3  
ATOM   4222  O "O5'"  . DA  A 1 11 ? 2.651   -13.124 -11.787 1.00 0.00 ? 111 DA  B "O5'"  3  
ATOM   4223  C "C5'"  . DA  A 1 11 ? 3.172   -12.646 -10.543 1.00 0.00 ? 111 DA  B "C5'"  3  
ATOM   4224  C "C4'"  . DA  A 1 11 ? 3.266   -13.766 -9.514  1.00 0.00 ? 111 DA  B "C4'"  3  
ATOM   4225  O "O4'"  . DA  A 1 11 ? 2.004   -13.941 -8.832  1.00 0.00 ? 111 DA  B "O4'"  3  
ATOM   4226  C "C3'"  . DA  A 1 11 ? 3.630   -15.079 -10.190 1.00 0.00 ? 111 DA  B "C3'"  3  
ATOM   4227  O "O3'"  . DA  A 1 11 ? 4.845   -15.612 -9.652  1.00 0.00 ? 111 DA  B "O3'"  3  
ATOM   4228  C "C2'"  . DA  A 1 11 ? 2.476   -16.012 -9.936  1.00 0.00 ? 111 DA  B "C2'"  3  
ATOM   4229  C "C1'"  . DA  A 1 11 ? 1.494   -15.275 -9.043  1.00 0.00 ? 111 DA  B "C1'"  3  
ATOM   4230  N N9     . DA  A 1 11 ? 0.165   -15.236 -9.668  1.00 0.00 ? 111 DA  B N9     3  
ATOM   4231  C C8     . DA  A 1 11 ? -0.160  -15.011 -10.954 1.00 0.00 ? 111 DA  B C8     3  
ATOM   4232  N N7     . DA  A 1 11 ? -1.412  -15.028 -11.269 1.00 0.00 ? 111 DA  B N7     3  
ATOM   4233  C C5     . DA  A 1 11 ? -2.005  -15.304 -10.032 1.00 0.00 ? 111 DA  B C5     3  
ATOM   4234  C C6     . DA  A 1 11 ? -3.336  -15.467 -9.632  1.00 0.00 ? 111 DA  B C6     3  
ATOM   4235  N N6     . DA  A 1 11 ? -4.367  -15.371 -10.471 1.00 0.00 ? 111 DA  B N6     3  
ATOM   4236  N N1     . DA  A 1 11 ? -3.564  -15.734 -8.333  1.00 0.00 ? 111 DA  B N1     3  
ATOM   4237  C C2     . DA  A 1 11 ? -2.547  -15.834 -7.476  1.00 0.00 ? 111 DA  B C2     3  
ATOM   4238  N N3     . DA  A 1 11 ? -1.252  -15.698 -7.746  1.00 0.00 ? 111 DA  B N3     3  
ATOM   4239  C C4     . DA  A 1 11 ? -1.049  -15.432 -9.051  1.00 0.00 ? 111 DA  B C4     3  
ATOM   4240  H "H5'"  . DA  A 1 11 ? 2.518   -11.863 -10.159 1.00 0.00 ? 111 DA  B "H5'"  3  
ATOM   4241  H "H5''" . DA  A 1 11 ? 4.165   -12.230 -10.709 1.00 0.00 ? 111 DA  B "H5''" 3  
ATOM   4242  H "H4'"  . DA  A 1 11 ? 4.035   -13.516 -8.782  1.00 0.00 ? 111 DA  B "H4'"  3  
ATOM   4243  H "H3'"  . DA  A 1 11 ? 3.738   -14.918 -11.265 1.00 0.00 ? 111 DA  B "H3'"  3  
ATOM   4244  H "H2'"  . DA  A 1 11 ? 1.995   -16.272 -10.880 1.00 0.00 ? 111 DA  B "H2'"  3  
ATOM   4245  H "H2''" . DA  A 1 11 ? 2.825   -16.913 -9.440  1.00 0.00 ? 111 DA  B "H2''" 3  
ATOM   4246  H "H1'"  . DA  A 1 11 ? 1.421   -15.787 -8.091  1.00 0.00 ? 111 DA  B "H1'"  3  
ATOM   4247  H H8     . DA  A 1 11 ? 0.613   -14.839 -11.699 1.00 0.00 ? 111 DA  B H8     3  
ATOM   4248  H H61    . DA  A 1 11 ? -5.309  -15.499 -10.130 1.00 0.00 ? 111 DA  B H61    3  
ATOM   4249  H H62    . DA  A 1 11 ? -4.206  -15.173 -11.449 1.00 0.00 ? 111 DA  B H62    3  
ATOM   4250  H H2     . DA  A 1 11 ? -2.806  -16.050 -6.439  1.00 0.00 ? 111 DA  B H2     3  
ATOM   4251  P P      . DC  A 1 12 ? 5.804   -16.536 -10.559 1.00 0.00 ? 112 DC  B P      3  
ATOM   4252  O OP1    . DC  A 1 12 ? 7.209   -16.177 -10.262 1.00 0.00 ? 112 DC  B OP1    3  
ATOM   4253  O OP2    . DC  A 1 12 ? 5.310   -16.489 -11.953 1.00 0.00 ? 112 DC  B OP2    3  
ATOM   4254  O "O5'"  . DC  A 1 12 ? 5.526   -18.010 -9.974  1.00 0.00 ? 112 DC  B "O5'"  3  
ATOM   4255  C "C5'"  . DC  A 1 12 ? 5.648   -18.270 -8.573  1.00 0.00 ? 112 DC  B "C5'"  3  
ATOM   4256  C "C4'"  . DC  A 1 12 ? 4.845   -19.497 -8.158  1.00 0.00 ? 112 DC  B "C4'"  3  
ATOM   4257  O "O4'"  . DC  A 1 12 ? 3.434   -19.199 -8.127  1.00 0.00 ? 112 DC  B "O4'"  3  
ATOM   4258  C "C3'"  . DC  A 1 12 ? 5.068   -20.644 -9.131  1.00 0.00 ? 112 DC  B "C3'"  3  
ATOM   4259  O "O3'"  . DC  A 1 12 ? 5.799   -21.707 -8.511  1.00 0.00 ? 112 DC  B "O3'"  3  
ATOM   4260  C "C2'"  . DC  A 1 12 ? 3.695   -21.106 -9.546  1.00 0.00 ? 112 DC  B "C2'"  3  
ATOM   4261  C "C1'"  . DC  A 1 12 ? 2.696   -20.228 -8.813  1.00 0.00 ? 112 DC  B "C1'"  3  
ATOM   4262  N N1     . DC  A 1 12 ? 1.721   -19.639 -9.752  1.00 0.00 ? 112 DC  B N1     3  
ATOM   4263  C C2     . DC  A 1 12 ? 0.376   -19.747 -9.430  1.00 0.00 ? 112 DC  B C2     3  
ATOM   4264  O O2     . DC  A 1 12 ? 0.037   -20.313 -8.410  1.00 0.00 ? 112 DC  B O2     3  
ATOM   4265  N N3     . DC  A 1 12 ? -0.537  -19.208 -10.285 1.00 0.00 ? 112 DC  B N3     3  
ATOM   4266  C C4     . DC  A 1 12 ? -0.147  -18.588 -11.407 1.00 0.00 ? 112 DC  B C4     3  
ATOM   4267  N N4     . DC  A 1 12 ? -1.067  -18.070 -12.220 1.00 0.00 ? 112 DC  B N4     3  
ATOM   4268  C C5     . DC  A 1 12 ? 1.239   -18.474 -11.741 1.00 0.00 ? 112 DC  B C5     3  
ATOM   4269  C C6     . DC  A 1 12 ? 2.134   -19.012 -10.891 1.00 0.00 ? 112 DC  B C6     3  
ATOM   4270  H "H5'"  . DC  A 1 12 ? 5.287   -17.404 -8.018  1.00 0.00 ? 112 DC  B "H5'"  3  
ATOM   4271  H "H5''" . DC  A 1 12 ? 6.699   -18.434 -8.332  1.00 0.00 ? 112 DC  B "H5''" 3  
ATOM   4272  H "H4'"  . DC  A 1 12 ? 5.157   -19.812 -7.163  1.00 0.00 ? 112 DC  B "H4'"  3  
ATOM   4273  H "H3'"  . DC  A 1 12 ? 5.610   -20.280 -10.006 1.00 0.00 ? 112 DC  B "H3'"  3  
ATOM   4274  H "HO3'" . DC  A 1 12 ? 5.702   -22.483 -9.068  1.00 0.00 ? 112 DC  B "HO3'" 3  
ATOM   4275  H "H2'"  . DC  A 1 12 ? 3.574   -20.991 -10.623 1.00 0.00 ? 112 DC  B "H2'"  3  
ATOM   4276  H "H2''" . DC  A 1 12 ? 3.552   -22.149 -9.264  1.00 0.00 ? 112 DC  B "H2''" 3  
ATOM   4277  H "H1'"  . DC  A 1 12 ? 2.167   -20.830 -8.079  1.00 0.00 ? 112 DC  B "H1'"  3  
ATOM   4278  H H41    . DC  A 1 12 ? -2.047  -18.146 -11.988 1.00 0.00 ? 112 DC  B H41    3  
ATOM   4279  H H42    . DC  A 1 12 ? -0.784  -17.600 -13.068 1.00 0.00 ? 112 DC  B H42    3  
ATOM   4280  H H5     . DC  A 1 12 ? 1.559   -17.969 -12.652 1.00 0.00 ? 112 DC  B H5     3  
ATOM   4281  H H6     . DC  A 1 12 ? 3.199   -18.946 -11.114 1.00 0.00 ? 112 DC  B H6     3  
ATOM   4282  O "O5'"  . DG  B 1 1  ? -9.354  -22.679 -9.953  1.00 0.00 ? 113 DG  C "O5'"  3  
ATOM   4283  C "C5'"  . DG  B 1 1  ? -10.110 -22.878 -8.756  1.00 0.00 ? 113 DG  C "C5'"  3  
ATOM   4284  C "C4'"  . DG  B 1 1  ? -9.517  -22.104 -7.584  1.00 0.00 ? 113 DG  C "C4'"  3  
ATOM   4285  O "O4'"  . DG  B 1 1  ? -8.122  -21.819 -7.812  1.00 0.00 ? 113 DG  C "O4'"  3  
ATOM   4286  C "C3'"  . DG  B 1 1  ? -10.247 -20.784 -7.382  1.00 0.00 ? 113 DG  C "C3'"  3  
ATOM   4287  O "O3'"  . DG  B 1 1  ? -10.989 -20.794 -6.157  1.00 0.00 ? 113 DG  C "O3'"  3  
ATOM   4288  C "C2'"  . DG  B 1 1  ? -9.180  -19.722 -7.360  1.00 0.00 ? 113 DG  C "C2'"  3  
ATOM   4289  C "C1'"  . DG  B 1 1  ? -7.849  -20.432 -7.539  1.00 0.00 ? 113 DG  C "C1'"  3  
ATOM   4290  N N9     . DG  B 1 1  ? -7.058  -19.828 -8.627  1.00 0.00 ? 113 DG  C N9     3  
ATOM   4291  C C8     . DG  B 1 1  ? -7.473  -19.163 -9.728  1.00 0.00 ? 113 DG  C C8     3  
ATOM   4292  N N7     . DG  B 1 1  ? -6.572  -18.729 -10.543 1.00 0.00 ? 113 DG  C N7     3  
ATOM   4293  C C5     . DG  B 1 1  ? -5.396  -19.154 -9.919  1.00 0.00 ? 113 DG  C C5     3  
ATOM   4294  C C6     . DG  B 1 1  ? -4.042  -18.988 -10.316 1.00 0.00 ? 113 DG  C C6     3  
ATOM   4295  O O6     . DG  B 1 1  ? -3.611  -18.430 -11.305 1.00 0.00 ? 113 DG  C O6     3  
ATOM   4296  N N1     . DG  B 1 1  ? -3.168  -19.566 -9.404  1.00 0.00 ? 113 DG  C N1     3  
ATOM   4297  C C2     . DG  B 1 1  ? -3.544  -20.223 -8.250  1.00 0.00 ? 113 DG  C C2     3  
ATOM   4298  N N2     . DG  B 1 1  ? -2.555  -20.711 -7.500  1.00 0.00 ? 113 DG  C N2     3  
ATOM   4299  N N3     . DG  B 1 1  ? -4.815  -20.384 -7.868  1.00 0.00 ? 113 DG  C N3     3  
ATOM   4300  C C4     . DG  B 1 1  ? -5.685  -19.828 -8.743  1.00 0.00 ? 113 DG  C C4     3  
ATOM   4301  H "H5'"  . DG  B 1 1  ? -10.119 -23.940 -8.513  1.00 0.00 ? 113 DG  C "H5'"  3  
ATOM   4302  H "H5''" . DG  B 1 1  ? -11.134 -22.543 -8.922  1.00 0.00 ? 113 DG  C "H5''" 3  
ATOM   4303  H "H4'"  . DG  B 1 1  ? -9.608  -22.698 -6.678  1.00 0.00 ? 113 DG  C "H4'"  3  
ATOM   4304  H "H3'"  . DG  B 1 1  ? -10.920 -20.608 -8.224  1.00 0.00 ? 113 DG  C "H3'"  3  
ATOM   4305  H "H2'"  . DG  B 1 1  ? -9.340  -19.015 -8.174  1.00 0.00 ? 113 DG  C "H2'"  3  
ATOM   4306  H "H2''" . DG  B 1 1  ? -9.195  -19.200 -6.406  1.00 0.00 ? 113 DG  C "H2''" 3  
ATOM   4307  H "H1'"  . DG  B 1 1  ? -7.289  -20.361 -6.613  1.00 0.00 ? 113 DG  C "H1'"  3  
ATOM   4308  H H8     . DG  B 1 1  ? -8.532  -18.999 -9.917  1.00 0.00 ? 113 DG  C H8     3  
ATOM   4309  H H1     . DG  B 1 1  ? -2.214  -19.490 -9.615  1.00 0.00 ? 113 DG  C H1     3  
ATOM   4310  H H21    . DG  B 1 1  ? -1.596  -20.591 -7.790  1.00 0.00 ? 113 DG  C H21    3  
ATOM   4311  H H22    . DG  B 1 1  ? -2.766  -21.203 -6.644  1.00 0.00 ? 113 DG  C H22    3  
ATOM   4312  H "HO5'" . DG  B 1 1  ? -8.493  -22.341 -9.695  1.00 0.00 ? 113 DG  C "HO5'" 3  
ATOM   4313  P P      . DT  B 1 2  ? -11.492 -19.417 -5.491  1.00 0.00 ? 114 DT  C P      3  
ATOM   4314  O OP1    . DT  B 1 2  ? -12.658 -19.717 -4.630  1.00 0.00 ? 114 DT  C OP1    3  
ATOM   4315  O OP2    . DT  B 1 2  ? -11.606 -18.401 -6.561  1.00 0.00 ? 114 DT  C OP2    3  
ATOM   4316  O "O5'"  . DT  B 1 2  ? -10.255 -19.014 -4.543  1.00 0.00 ? 114 DT  C "O5'"  3  
ATOM   4317  C "C5'"  . DT  B 1 2  ? -9.336  -20.009 -4.081  1.00 0.00 ? 114 DT  C "C5'"  3  
ATOM   4318  C "C4'"  . DT  B 1 2  ? -8.158  -19.385 -3.339  1.00 0.00 ? 114 DT  C "C4'"  3  
ATOM   4319  O "O4'"  . DT  B 1 2  ? -7.089  -19.061 -4.255  1.00 0.00 ? 114 DT  C "O4'"  3  
ATOM   4320  C "C3'"  . DT  B 1 2  ? -8.586  -18.107 -2.634  1.00 0.00 ? 114 DT  C "C3'"  3  
ATOM   4321  O "O3'"  . DT  B 1 2  ? -8.319  -18.197 -1.229  1.00 0.00 ? 114 DT  C "O3'"  3  
ATOM   4322  C "C2'"  . DT  B 1 2  ? -7.794  -16.994 -3.274  1.00 0.00 ? 114 DT  C "C2'"  3  
ATOM   4323  C "C1'"  . DT  B 1 2  ? -6.830  -17.642 -4.253  1.00 0.00 ? 114 DT  C "C1'"  3  
ATOM   4324  N N1     . DT  B 1 2  ? -6.994  -17.084 -5.608  1.00 0.00 ? 114 DT  C N1     3  
ATOM   4325  C C2     . DT  B 1 2  ? -5.848  -16.705 -6.283  1.00 0.00 ? 114 DT  C C2     3  
ATOM   4326  O O2     . DT  B 1 2  ? -4.744  -16.798 -5.785  1.00 0.00 ? 114 DT  C O2     3  
ATOM   4327  N N3     . DT  B 1 2  ? -6.032  -16.212 -7.562  1.00 0.00 ? 114 DT  C N3     3  
ATOM   4328  C C4     . DT  B 1 2  ? -7.245  -16.068 -8.213  1.00 0.00 ? 114 DT  C C4     3  
ATOM   4329  O O4     . DT  B 1 2  ? -7.293  -15.622 -9.342  1.00 0.00 ? 114 DT  C O4     3  
ATOM   4330  C C5     . DT  B 1 2  ? -8.385  -16.487 -7.429  1.00 0.00 ? 114 DT  C C5     3  
ATOM   4331  C C7     . DT  B 1 2  ? -9.784  -16.380 -8.024  1.00 0.00 ? 114 DT  C C7     3  
ATOM   4332  C C6     . DT  B 1 2  ? -8.231  -16.971 -6.180  1.00 0.00 ? 114 DT  C C6     3  
ATOM   4333  H "H5'"  . DT  B 1 2  ? -8.961  -20.570 -4.937  1.00 0.00 ? 114 DT  C "H5'"  3  
ATOM   4334  H "H5''" . DT  B 1 2  ? -9.859  -20.691 -3.410  1.00 0.00 ? 114 DT  C "H5''" 3  
ATOM   4335  H "H4'"  . DT  B 1 2  ? -7.788  -20.093 -2.598  1.00 0.00 ? 114 DT  C "H4'"  3  
ATOM   4336  H "H3'"  . DT  B 1 2  ? -9.652  -17.939 -2.800  1.00 0.00 ? 114 DT  C "H3'"  3  
ATOM   4337  H "H2'"  . DT  B 1 2  ? -8.464  -16.319 -3.806  1.00 0.00 ? 114 DT  C "H2'"  3  
ATOM   4338  H "H2''" . DT  B 1 2  ? -7.239  -16.445 -2.516  1.00 0.00 ? 114 DT  C "H2''" 3  
ATOM   4339  H "H1'"  . DT  B 1 2  ? -5.809  -17.465 -3.916  1.00 0.00 ? 114 DT  C "H1'"  3  
ATOM   4340  H H3     . DT  B 1 2  ? -5.229  -15.942 -8.054  1.00 0.00 ? 114 DT  C H3     3  
ATOM   4341  H H71    . DT  B 1 2  ? -9.716  -16.355 -9.111  1.00 0.00 ? 114 DT  C H71    3  
ATOM   4342  H H72    . DT  B 1 2  ? -10.376 -17.243 -7.718  1.00 0.00 ? 114 DT  C H72    3  
ATOM   4343  H H73    . DT  B 1 2  ? -10.262 -15.467 -7.669  1.00 0.00 ? 114 DT  C H73    3  
ATOM   4344  H H6     . DT  B 1 2  ? -9.110  -17.281 -5.614  1.00 0.00 ? 114 DT  C H6     3  
ATOM   4345  P P      . DA  B 1 3  ? -8.222  -16.872 -0.318  1.00 0.00 ? 115 DA  C P      3  
ATOM   4346  O OP1    . DA  B 1 3  ? -7.992  -17.288 1.083   1.00 0.00 ? 115 DA  C OP1    3  
ATOM   4347  O OP2    . DA  B 1 3  ? -9.368  -15.997 -0.651  1.00 0.00 ? 115 DA  C OP2    3  
ATOM   4348  O "O5'"  . DA  B 1 3  ? -6.878  -16.173 -0.864  1.00 0.00 ? 115 DA  C "O5'"  3  
ATOM   4349  C "C5'"  . DA  B 1 3  ? -5.609  -16.822 -0.732  1.00 0.00 ? 115 DA  C "C5'"  3  
ATOM   4350  C "C4'"  . DA  B 1 3  ? -4.463  -15.831 -0.893  1.00 0.00 ? 115 DA  C "C4'"  3  
ATOM   4351  O "O4'"  . DA  B 1 3  ? -4.219  -15.555 -2.286  1.00 0.00 ? 115 DA  C "O4'"  3  
ATOM   4352  C "C3'"  . DA  B 1 3  ? -4.792  -14.522 -0.195  1.00 0.00 ? 115 DA  C "C3'"  3  
ATOM   4353  O "O3'"  . DA  B 1 3  ? -3.851  -14.256 0.850   1.00 0.00 ? 115 DA  C "O3'"  3  
ATOM   4354  C "C2'"  . DA  B 1 3  ? -4.733  -13.462 -1.262  1.00 0.00 ? 115 DA  C "C2'"  3  
ATOM   4355  C "C1'"  . DA  B 1 3  ? -4.216  -14.134 -2.518  1.00 0.00 ? 115 DA  C "C1'"  3  
ATOM   4356  N N9     . DA  B 1 3  ? -5.062  -13.790 -3.670  1.00 0.00 ? 115 DA  C N9     3  
ATOM   4357  C C8     . DA  B 1 3  ? -6.408  -13.818 -3.773  1.00 0.00 ? 115 DA  C C8     3  
ATOM   4358  N N7     . DA  B 1 3  ? -6.929  -13.493 -4.909  1.00 0.00 ? 115 DA  C N7     3  
ATOM   4359  C C5     . DA  B 1 3  ? -5.788  -13.206 -5.667  1.00 0.00 ? 115 DA  C C5     3  
ATOM   4360  C C6     . DA  B 1 3  ? -5.610  -12.788 -6.989  1.00 0.00 ? 115 DA  C C6     3  
ATOM   4361  N N6     . DA  B 1 3  ? -6.623  -12.578 -7.831  1.00 0.00 ? 115 DA  C N6     3  
ATOM   4362  N N1     . DA  B 1 3  ? -4.349  -12.597 -7.413  1.00 0.00 ? 115 DA  C N1     3  
ATOM   4363  C C2     . DA  B 1 3  ? -3.320  -12.800 -6.588  1.00 0.00 ? 115 DA  C C2     3  
ATOM   4364  N N3     . DA  B 1 3  ? -3.373  -13.196 -5.319  1.00 0.00 ? 115 DA  C N3     3  
ATOM   4365  C C4     . DA  B 1 3  ? -4.647  -13.383 -4.918  1.00 0.00 ? 115 DA  C C4     3  
ATOM   4366  H "H5'"  . DA  B 1 3  ? -5.523  -17.595 -1.497  1.00 0.00 ? 115 DA  C "H5'"  3  
ATOM   4367  H "H5''" . DA  B 1 3  ? -5.546  -17.286 0.252   1.00 0.00 ? 115 DA  C "H5''" 3  
ATOM   4368  H "H4'"  . DA  B 1 3  ? -3.559  -16.247 -0.456  1.00 0.00 ? 115 DA  C "H4'"  3  
ATOM   4369  H "H3'"  . DA  B 1 3  ? -5.802  -14.570 0.216   1.00 0.00 ? 115 DA  C "H3'"  3  
ATOM   4370  H "H2'"  . DA  B 1 3  ? -5.730  -13.060 -1.439  1.00 0.00 ? 115 DA  C "H2'"  3  
ATOM   4371  H "H2''" . DA  B 1 3  ? -4.061  -12.665 -0.964  1.00 0.00 ? 115 DA  C "H2''" 3  
ATOM   4372  H "H1'"  . DA  B 1 3  ? -3.197  -13.808 -2.706  1.00 0.00 ? 115 DA  C "H1'"  3  
ATOM   4373  H H8     . DA  B 1 3  ? -7.027  -14.094 -2.921  1.00 0.00 ? 115 DA  C H8     3  
ATOM   4374  H H61    . DA  B 1 3  ? -6.440  -12.276 -8.777  1.00 0.00 ? 115 DA  C H61    3  
ATOM   4375  H H62    . DA  B 1 3  ? -7.574  -12.720 -7.521  1.00 0.00 ? 115 DA  C H62    3  
ATOM   4376  H H2     . DA  B 1 3  ? -2.325  -12.621 -7.000  1.00 0.00 ? 115 DA  C H2     3  
ATOM   4377  P P      . DT  B 1 4  ? -3.751  -12.793 1.512   1.00 0.00 ? 116 DT  C P      3  
ATOM   4378  O OP1    . DT  B 1 4  ? -3.146  -12.932 2.856   1.00 0.00 ? 116 DT  C OP1    3  
ATOM   4379  O OP2    . DT  B 1 4  ? -5.064  -12.126 1.359   1.00 0.00 ? 116 DT  C OP2    3  
ATOM   4380  O "O5'"  . DT  B 1 4  ? -2.693  -12.049 0.557   1.00 0.00 ? 116 DT  C "O5'"  3  
ATOM   4381  C "C5'"  . DT  B 1 4  ? -1.672  -12.791 -0.119  1.00 0.00 ? 116 DT  C "C5'"  3  
ATOM   4382  C "C4'"  . DT  B 1 4  ? -0.847  -11.895 -1.035  1.00 0.00 ? 116 DT  C "C4'"  3  
ATOM   4383  O "O4'"  . DT  B 1 4  ? -1.441  -11.823 -2.346  1.00 0.00 ? 116 DT  C "O4'"  3  
ATOM   4384  C "C3'"  . DT  B 1 4  ? -0.760  -10.485 -0.471  1.00 0.00 ? 116 DT  C "C3'"  3  
ATOM   4385  O "O3'"  . DT  B 1 4  ? 0.601   -10.143 -0.181  1.00 0.00 ? 116 DT  C "O3'"  3  
ATOM   4386  C "C2'"  . DT  B 1 4  ? -1.337  -9.583  -1.530  1.00 0.00 ? 116 DT  C "C2'"  3  
ATOM   4387  C "C1'"  . DT  B 1 4  ? -1.604  -10.450 -2.743  1.00 0.00 ? 116 DT  C "C1'"  3  
ATOM   4388  N N1     . DT  B 1 4  ? -2.959  -10.217 -3.267  1.00 0.00 ? 116 DT  C N1     3  
ATOM   4389  C C2     . DT  B 1 4  ? -3.080  -9.864  -4.598  1.00 0.00 ? 116 DT  C C2     3  
ATOM   4390  O O2     . DT  B 1 4  ? -2.114  -9.721  -5.319  1.00 0.00 ? 116 DT  C O2     3  
ATOM   4391  N N3     . DT  B 1 4  ? -4.369  -9.685  -5.061  1.00 0.00 ? 116 DT  C N3     3  
ATOM   4392  C C4     . DT  B 1 4  ? -5.530  -9.827  -4.318  1.00 0.00 ? 116 DT  C C4     3  
ATOM   4393  O O4     . DT  B 1 4  ? -6.618  -9.647  -4.828  1.00 0.00 ? 116 DT  C O4     3  
ATOM   4394  C C5     . DT  B 1 4  ? -5.302  -10.196 -2.939  1.00 0.00 ? 116 DT  C C5     3  
ATOM   4395  C C7     . DT  B 1 4  ? -6.492  -10.384 -2.005  1.00 0.00 ? 116 DT  C C7     3  
ATOM   4396  C C6     . DT  B 1 4  ? -4.052  -10.373 -2.465  1.00 0.00 ? 116 DT  C C6     3  
ATOM   4397  H "H5'"  . DT  B 1 4  ? -2.138  -13.577 -0.713  1.00 0.00 ? 116 DT  C "H5'"  3  
ATOM   4398  H "H5''" . DT  B 1 4  ? -1.014  -13.246 0.621   1.00 0.00 ? 116 DT  C "H5''" 3  
ATOM   4399  H "H4'"  . DT  B 1 4  ? 0.157   -12.300 -1.130  1.00 0.00 ? 116 DT  C "H4'"  3  
ATOM   4400  H "H3'"  . DT  B 1 4  ? -1.364  -10.417 0.436   1.00 0.00 ? 116 DT  C "H3'"  3  
ATOM   4401  H "H2'"  . DT  B 1 4  ? -2.268  -9.141  -1.176  1.00 0.00 ? 116 DT  C "H2'"  3  
ATOM   4402  H "H2''" . DT  B 1 4  ? -0.628  -8.802  -1.783  1.00 0.00 ? 116 DT  C "H2''" 3  
ATOM   4403  H "H1'"  . DT  B 1 4  ? -0.875  -10.218 -3.513  1.00 0.00 ? 116 DT  C "H1'"  3  
ATOM   4404  H H3     . DT  B 1 4  ? -4.472  -9.434  -6.003  1.00 0.00 ? 116 DT  C H3     3  
ATOM   4405  H H71    . DT  B 1 4  ? -6.135  -10.577 -0.994  1.00 0.00 ? 116 DT  C H71    3  
ATOM   4406  H H72    . DT  B 1 4  ? -7.105  -9.483  -2.009  1.00 0.00 ? 116 DT  C H72    3  
ATOM   4407  H H73    . DT  B 1 4  ? -7.091  -11.230 -2.346  1.00 0.00 ? 116 DT  C H73    3  
ATOM   4408  H H6     . DT  B 1 4  ? -3.907  -10.636 -1.418  1.00 0.00 ? 116 DT  C H6     3  
ATOM   4409  P P      . DC  B 1 5  ? 1.054   -8.604  -0.044  1.00 0.00 ? 117 DC  C P      3  
ATOM   4410  O OP1    . DC  B 1 5  ? 2.341   -8.565  0.683   1.00 0.00 ? 117 DC  C OP1    3  
ATOM   4411  O OP2    . DC  B 1 5  ? -0.100  -7.822  0.453   1.00 0.00 ? 117 DC  C OP2    3  
ATOM   4412  O "O5'"  . DC  B 1 5  ? 1.328   -8.181  -1.574  1.00 0.00 ? 117 DC  C "O5'"  3  
ATOM   4413  C "C5'"  . DC  B 1 5  ? 2.663   -7.975  -2.045  1.00 0.00 ? 117 DC  C "C5'"  3  
ATOM   4414  C "C4'"  . DC  B 1 5  ? 2.682   -7.145  -3.326  1.00 0.00 ? 117 DC  C "C4'"  3  
ATOM   4415  O "O4'"  . DC  B 1 5  ? 1.544   -7.460  -4.154  1.00 0.00 ? 117 DC  C "O4'"  3  
ATOM   4416  C "C3'"  . DC  B 1 5  ? 2.644   -5.661  -3.006  1.00 0.00 ? 117 DC  C "C3'"  3  
ATOM   4417  O "O3'"  . DC  B 1 5  ? 3.786   -5.000  -3.574  1.00 0.00 ? 117 DC  C "O3'"  3  
ATOM   4418  C "C2'"  . DC  B 1 5  ? 1.358   -5.150  -3.593  1.00 0.00 ? 117 DC  C "C2'"  3  
ATOM   4419  C "C1'"  . DC  B 1 5  ? 0.812   -6.260  -4.465  1.00 0.00 ? 117 DC  C "C1'"  3  
ATOM   4420  N N1     . DC  B 1 5  ? -0.628  -6.440  -4.225  1.00 0.00 ? 117 DC  C N1     3  
ATOM   4421  C C2     . DC  B 1 5  ? -1.486  -6.315  -5.306  1.00 0.00 ? 117 DC  C C2     3  
ATOM   4422  O O2     . DC  B 1 5  ? -1.045  -6.062  -6.411  1.00 0.00 ? 117 DC  C O2     3  
ATOM   4423  N N3     . DC  B 1 5  ? -2.819  -6.482  -5.091  1.00 0.00 ? 117 DC  C N3     3  
ATOM   4424  C C4     . DC  B 1 5  ? -3.290  -6.763  -3.868  1.00 0.00 ? 117 DC  C C4     3  
ATOM   4425  N N4     . DC  B 1 5  ? -4.603  -6.922  -3.692  1.00 0.00 ? 117 DC  C N4     3  
ATOM   4426  C C5     . DC  B 1 5  ? -2.403  -6.893  -2.751  1.00 0.00 ? 117 DC  C C5     3  
ATOM   4427  C C6     . DC  B 1 5  ? -1.086  -6.721  -2.977  1.00 0.00 ? 117 DC  C C6     3  
ATOM   4428  H "H5'"  . DC  B 1 5  ? 3.125   -8.943  -2.242  1.00 0.00 ? 117 DC  C "H5'"  3  
ATOM   4429  H "H5''" . DC  B 1 5  ? 3.236   -7.457  -1.276  1.00 0.00 ? 117 DC  C "H5''" 3  
ATOM   4430  H "H4'"  . DC  B 1 5  ? 3.591   -7.357  -3.878  1.00 0.00 ? 117 DC  C "H4'"  3  
ATOM   4431  H "H3'"  . DC  B 1 5  ? 2.630   -5.525  -1.927  1.00 0.00 ? 117 DC  C "H3'"  3  
ATOM   4432  H "H2'"  . DC  B 1 5  ? 0.651   -4.923  -2.795  1.00 0.00 ? 117 DC  C "H2'"  3  
ATOM   4433  H "H2''" . DC  B 1 5  ? 1.540   -4.265  -4.187  1.00 0.00 ? 117 DC  C "H2''" 3  
ATOM   4434  H "H1'"  . DC  B 1 5  ? 0.976   -6.008  -5.509  1.00 0.00 ? 117 DC  C "H1'"  3  
ATOM   4435  H H41    . DC  B 1 5  ? -5.231  -6.832  -4.477  1.00 0.00 ? 117 DC  C H41    3  
ATOM   4436  H H42    . DC  B 1 5  ? -4.967  -7.133  -2.775  1.00 0.00 ? 117 DC  C H42    3  
ATOM   4437  H H5     . DC  B 1 5  ? -2.780  -7.122  -1.755  1.00 0.00 ? 117 DC  C H5     3  
ATOM   4438  H H6     . DC  B 1 5  ? -0.376  -6.794  -2.151  1.00 0.00 ? 117 DC  C H6     3  
HETATM 4439  N N1     . 5CM B 1 6  ? -0.441  -2.175  -6.903  1.00 0.00 ? 118 5CM C N1     3  
HETATM 4440  C C2     . 5CM B 1 6  ? -1.751  -2.056  -7.340  1.00 0.00 ? 118 5CM C C2     3  
HETATM 4441  N N3     . 5CM B 1 6  ? -2.736  -1.960  -6.407  1.00 0.00 ? 118 5CM C N3     3  
HETATM 4442  C C4     . 5CM B 1 6  ? -2.450  -1.979  -5.099  1.00 0.00 ? 118 5CM C C4     3  
HETATM 4443  C C5     . 5CM B 1 6  ? -1.098  -2.102  -4.645  1.00 0.00 ? 118 5CM C C5     3  
HETATM 4444  C C5A    . 5CM B 1 6  ? -0.769  -2.135  -3.158  1.00 0.00 ? 118 5CM C C5A    3  
HETATM 4445  C C6     . 5CM B 1 6  ? -0.131  -2.196  -5.576  1.00 0.00 ? 118 5CM C C6     3  
HETATM 4446  O O2     . 5CM B 1 6  ? -1.997  -2.040  -8.530  1.00 0.00 ? 118 5CM C O2     3  
HETATM 4447  N N4     . 5CM B 1 6  ? -3.439  -1.883  -4.211  1.00 0.00 ? 118 5CM C N4     3  
HETATM 4448  C "C1'"  . 5CM B 1 6  ? 0.614   -2.272  -7.929  1.00 0.00 ? 118 5CM C "C1'"  3  
HETATM 4449  C "C2'"  . 5CM B 1 6  ? 1.727   -1.276  -7.659  1.00 0.00 ? 118 5CM C "C2'"  3  
HETATM 4450  C "C3'"  . 5CM B 1 6  ? 3.020   -2.055  -7.648  1.00 0.00 ? 118 5CM C "C3'"  3  
HETATM 4451  C "C4'"  . 5CM B 1 6  ? 2.624   -3.521  -7.753  1.00 0.00 ? 118 5CM C "C4'"  3  
HETATM 4452  O "O4'"  . 5CM B 1 6  ? 1.194   -3.593  -7.947  1.00 0.00 ? 118 5CM C "O4'"  3  
HETATM 4453  O "O3'"  . 5CM B 1 6  ? 3.862   -1.683  -8.748  1.00 0.00 ? 118 5CM C "O3'"  3  
HETATM 4454  C "C5'"  . 5CM B 1 6  ? 3.033   -4.278  -6.494  1.00 0.00 ? 118 5CM C "C5'"  3  
HETATM 4455  O "O5'"  . 5CM B 1 6  ? 2.687   -3.553  -5.310  1.00 0.00 ? 118 5CM C "O5'"  3  
HETATM 4456  P P      . 5CM B 1 6  ? 3.717   -3.470  -4.074  1.00 0.00 ? 118 5CM C P      3  
HETATM 4457  O OP1    . 5CM B 1 6  ? 5.046   -3.098  -4.607  1.00 0.00 ? 118 5CM C OP1    3  
HETATM 4458  O OP2    . 5CM B 1 6  ? 3.094   -2.659  -3.004  1.00 0.00 ? 118 5CM C OP2    3  
HETATM 4459  H H5A1   . 5CM B 1 6  ? 0.314   -2.150  -3.026  1.00 0.00 ? 118 5CM C H5A1   3  
HETATM 4460  H H5A2   . 5CM B 1 6  ? -1.181  -1.250  -2.674  1.00 0.00 ? 118 5CM C H5A2   3  
HETATM 4461  H H5A3   . 5CM B 1 6  ? -1.202  -3.029  -2.709  1.00 0.00 ? 118 5CM C H5A3   3  
HETATM 4462  H H6     . 5CM B 1 6  ? 0.910   -2.290  -5.268  1.00 0.00 ? 118 5CM C H6     3  
HETATM 4463  H HN41   . 5CM B 1 6  ? -3.233  -1.897  -3.222  1.00 0.00 ? 118 5CM C HN41   3  
HETATM 4464  H HN42   . 5CM B 1 6  ? -4.395  -1.793  -4.527  1.00 0.00 ? 118 5CM C HN42   3  
HETATM 4465  H "H1'"  . 5CM B 1 6  ? 0.179   -2.060  -8.905  1.00 0.00 ? 118 5CM C "H1'"  3  
HETATM 4466  H "H2'"  . 5CM B 1 6  ? 1.572   -0.800  -6.690  1.00 0.00 ? 118 5CM C "H2'"  3  
HETATM 4467  H "H2''" . 5CM B 1 6  ? 1.748   -0.523  -8.442  1.00 0.00 ? 118 5CM C "H2''" 3  
HETATM 4468  H "H3'"  . 5CM B 1 6  ? 3.541   -1.883  -6.704  1.00 0.00 ? 118 5CM C "H3'"  3  
HETATM 4469  H "H4'"  . 5CM B 1 6  ? 3.123   -3.965  -8.613  1.00 0.00 ? 118 5CM C "H4'"  3  
HETATM 4470  H "H5'"  . 5CM B 1 6  ? 2.529   -5.244  -6.480  1.00 0.00 ? 118 5CM C "H5'"  3  
HETATM 4471  H "H5''" . 5CM B 1 6  ? 4.111   -4.440  -6.510  1.00 0.00 ? 118 5CM C "H5''" 3  
ATOM   4472  P P      . DG  B 1 7  ? 4.004   -0.144  -9.201  1.00 0.00 ? 119 DG  C P      3  
ATOM   4473  O OP1    . DG  B 1 7  ? 4.967   -0.078  -10.324 1.00 0.00 ? 119 DG  C OP1    3  
ATOM   4474  O OP2    . DG  B 1 7  ? 4.224   0.678   -7.990  1.00 0.00 ? 119 DG  C OP2    3  
ATOM   4475  O "O5'"  . DG  B 1 7  ? 2.536   0.188   -9.776  1.00 0.00 ? 119 DG  C "O5'"  3  
ATOM   4476  C "C5'"  . DG  B 1 7  ? 1.999   -0.553  -10.877 1.00 0.00 ? 119 DG  C "C5'"  3  
ATOM   4477  C "C4'"  . DG  B 1 7  ? 1.069   0.307   -11.728 1.00 0.00 ? 119 DG  C "C4'"  3  
ATOM   4478  O "O4'"  . DG  B 1 7  ? -0.280  0.266   -11.211 1.00 0.00 ? 119 DG  C "O4'"  3  
ATOM   4479  C "C3'"  . DG  B 1 7  ? 1.537   1.754   -11.727 1.00 0.00 ? 119 DG  C "C3'"  3  
ATOM   4480  O "O3'"  . DG  B 1 7  ? 1.778   2.213   -13.061 1.00 0.00 ? 119 DG  C "O3'"  3  
ATOM   4481  C "C2'"  . DG  B 1 7  ? 0.434   2.546   -11.076 1.00 0.00 ? 119 DG  C "C2'"  3  
ATOM   4482  C "C1'"  . DG  B 1 7  ? -0.720  1.590   -10.840 1.00 0.00 ? 119 DG  C "C1'"  3  
ATOM   4483  N N9     . DG  B 1 7  ? -1.134  1.632   -9.432  1.00 0.00 ? 119 DG  C N9     3  
ATOM   4484  C C8     . DG  B 1 7  ? -0.367  1.634   -8.328  1.00 0.00 ? 119 DG  C C8     3  
ATOM   4485  N N7     . DG  B 1 7  ? -0.959  1.698   -7.182  1.00 0.00 ? 119 DG  C N7     3  
ATOM   4486  C C5     . DG  B 1 7  ? -2.305  1.747   -7.563  1.00 0.00 ? 119 DG  C C5     3  
ATOM   4487  C C6     . DG  B 1 7  ? -3.477  1.829   -6.763  1.00 0.00 ? 119 DG  C C6     3  
ATOM   4488  O O6     . DG  B 1 7  ? -3.562  1.873   -5.552  1.00 0.00 ? 119 DG  C O6     3  
ATOM   4489  N N1     . DG  B 1 7  ? -4.626  1.857   -7.544  1.00 0.00 ? 119 DG  C N1     3  
ATOM   4490  C C2     . DG  B 1 7  ? -4.650  1.811   -8.925  1.00 0.00 ? 119 DG  C C2     3  
ATOM   4491  N N2     . DG  B 1 7  ? -5.856  1.845   -9.494  1.00 0.00 ? 119 DG  C N2     3  
ATOM   4492  N N3     . DG  B 1 7  ? -3.552  1.733   -9.684  1.00 0.00 ? 119 DG  C N3     3  
ATOM   4493  C C4     . DG  B 1 7  ? -2.421  1.706   -8.944  1.00 0.00 ? 119 DG  C C4     3  
ATOM   4494  H "H5'"  . DG  B 1 7  ? 1.441   -1.408  -10.494 1.00 0.00 ? 119 DG  C "H5'"  3  
ATOM   4495  H "H5''" . DG  B 1 7  ? 2.819   -0.913  -11.498 1.00 0.00 ? 119 DG  C "H5''" 3  
ATOM   4496  H "H4'"  . DG  B 1 7  ? 1.070   -0.069  -12.750 1.00 0.00 ? 119 DG  C "H4'"  3  
ATOM   4497  H "H3'"  . DG  B 1 7  ? 2.449   1.843   -11.132 1.00 0.00 ? 119 DG  C "H3'"  3  
ATOM   4498  H "H2'"  . DG  B 1 7  ? 0.780   2.951   -10.126 1.00 0.00 ? 119 DG  C "H2'"  3  
ATOM   4499  H "H2''" . DG  B 1 7  ? 0.119   3.354   -11.729 1.00 0.00 ? 119 DG  C "H2''" 3  
ATOM   4500  H "H1'"  . DG  B 1 7  ? -1.558  1.880   -11.464 1.00 0.00 ? 119 DG  C "H1'"  3  
ATOM   4501  H H8     . DG  B 1 7  ? 0.715   1.595   -8.408  1.00 0.00 ? 119 DG  C H8     3  
ATOM   4502  H H1     . DG  B 1 7  ? -5.475  1.914   -7.057  1.00 0.00 ? 119 DG  C H1     3  
ATOM   4503  H H21    . DG  B 1 7  ? -6.684  1.903   -8.920  1.00 0.00 ? 119 DG  C H21    3  
ATOM   4504  H H22    . DG  B 1 7  ? -5.939  1.813   -10.500 1.00 0.00 ? 119 DG  C H22    3  
ATOM   4505  P P      . DG  B 1 8  ? 2.026   3.775   -13.358 1.00 0.00 ? 120 DG  C P      3  
ATOM   4506  O OP1    . DG  B 1 8  ? 2.935   3.888   -14.520 1.00 0.00 ? 120 DG  C OP1    3  
ATOM   4507  O OP2    . DG  B 1 8  ? 2.374   4.440   -12.082 1.00 0.00 ? 120 DG  C OP2    3  
ATOM   4508  O "O5'"  . DG  B 1 8  ? 0.567   4.285   -13.808 1.00 0.00 ? 120 DG  C "O5'"  3  
ATOM   4509  C "C5'"  . DG  B 1 8  ? -0.214  3.526   -14.736 1.00 0.00 ? 120 DG  C "C5'"  3  
ATOM   4510  C "C4'"  . DG  B 1 8  ? -1.699  3.851   -14.616 1.00 0.00 ? 120 DG  C "C4'"  3  
ATOM   4511  O "O4'"  . DG  B 1 8  ? -2.159  3.648   -13.265 1.00 0.00 ? 120 DG  C "O4'"  3  
ATOM   4512  C "C3'"  . DG  B 1 8  ? -1.968  5.299   -15.000 1.00 0.00 ? 120 DG  C "C3'"  3  
ATOM   4513  O "O3'"  . DG  B 1 8  ? -2.783  5.363   -16.180 1.00 0.00 ? 120 DG  C "O3'"  3  
ATOM   4514  C "C2'"  . DG  B 1 8  ? -2.668  5.915   -13.814 1.00 0.00 ? 120 DG  C "C2'"  3  
ATOM   4515  C "C1'"  . DG  B 1 8  ? -2.886  4.802   -12.808 1.00 0.00 ? 120 DG  C "C1'"  3  
ATOM   4516  N N9     . DG  B 1 8  ? -2.443  5.201   -11.464 1.00 0.00 ? 120 DG  C N9     3  
ATOM   4517  C C8     . DG  B 1 8  ? -1.195  5.434   -11.012 1.00 0.00 ? 120 DG  C C8     3  
ATOM   4518  N N7     . DG  B 1 8  ? -1.053  5.748   -9.768  1.00 0.00 ? 120 DG  C N7     3  
ATOM   4519  C C5     . DG  B 1 8  ? -2.378  5.725   -9.319  1.00 0.00 ? 120 DG  C C5     3  
ATOM   4520  C C6     . DG  B 1 8  ? -2.907  5.984   -8.026  1.00 0.00 ? 120 DG  C C6     3  
ATOM   4521  O O6     . DG  B 1 8  ? -2.308  6.287   -7.013  1.00 0.00 ? 120 DG  C O6     3  
ATOM   4522  N N1     . DG  B 1 8  ? -4.290  5.852   -8.006  1.00 0.00 ? 120 DG  C N1     3  
ATOM   4523  C C2     . DG  B 1 8  ? -5.072  5.513   -9.092  1.00 0.00 ? 120 DG  C C2     3  
ATOM   4524  N N2     . DG  B 1 8  ? -6.385  5.437   -8.872  1.00 0.00 ? 120 DG  C N2     3  
ATOM   4525  N N3     . DG  B 1 8  ? -4.583  5.270   -10.312 1.00 0.00 ? 120 DG  C N3     3  
ATOM   4526  C C4     . DG  B 1 8  ? -3.236  5.392   -10.355 1.00 0.00 ? 120 DG  C C4     3  
ATOM   4527  H "H5'"  . DG  B 1 8  ? -0.065  2.464   -14.540 1.00 0.00 ? 120 DG  C "H5'"  3  
ATOM   4528  H "H5''" . DG  B 1 8  ? 0.119   3.751   -15.750 1.00 0.00 ? 120 DG  C "H5''" 3  
ATOM   4529  H "H4'"  . DG  B 1 8  ? -2.265  3.199   -15.278 1.00 0.00 ? 120 DG  C "H4'"  3  
ATOM   4530  H "H3'"  . DG  B 1 8  ? -1.020  5.813   -15.171 1.00 0.00 ? 120 DG  C "H3'"  3  
ATOM   4531  H "H2'"  . DG  B 1 8  ? -2.046  6.695   -13.378 1.00 0.00 ? 120 DG  C "H2'"  3  
ATOM   4532  H "H2''" . DG  B 1 8  ? -3.627  6.330   -14.119 1.00 0.00 ? 120 DG  C "H2''" 3  
ATOM   4533  H "H1'"  . DG  B 1 8  ? -3.939  4.561   -12.776 1.00 0.00 ? 120 DG  C "H1'"  3  
ATOM   4534  H H8     . DG  B 1 8  ? -0.339  5.356   -11.677 1.00 0.00 ? 120 DG  C H8     3  
ATOM   4535  H H1     . DG  B 1 8  ? -4.725  6.015   -7.143  1.00 0.00 ? 120 DG  C H1     3  
ATOM   4536  H H21    . DG  B 1 8  ? -6.754  5.622   -7.951  1.00 0.00 ? 120 DG  C H21    3  
ATOM   4537  H H22    . DG  B 1 8  ? -7.010  5.194   -9.628  1.00 0.00 ? 120 DG  C H22    3  
ATOM   4538  P P      . DA  B 1 9  ? -3.665  6.669   -16.510 1.00 0.00 ? 121 DA  C P      3  
ATOM   4539  O OP1    . DA  B 1 9  ? -4.388  6.431   -17.781 1.00 0.00 ? 121 DA  C OP1    3  
ATOM   4540  O OP2    . DA  B 1 9  ? -2.801  7.861   -16.365 1.00 0.00 ? 121 DA  C OP2    3  
ATOM   4541  O "O5'"  . DA  B 1 9  ? -4.740  6.676   -15.312 1.00 0.00 ? 121 DA  C "O5'"  3  
ATOM   4542  C "C5'"  . DA  B 1 9  ? -5.925  5.877   -15.387 1.00 0.00 ? 121 DA  C "C5'"  3  
ATOM   4543  C "C4'"  . DA  B 1 9  ? -7.163  6.685   -15.014 1.00 0.00 ? 121 DA  C "C4'"  3  
ATOM   4544  O "O4'"  . DA  B 1 9  ? -7.260  6.832   -13.579 1.00 0.00 ? 121 DA  C "O4'"  3  
ATOM   4545  C "C3'"  . DA  B 1 9  ? -7.089  8.073   -15.628 1.00 0.00 ? 121 DA  C "C3'"  3  
ATOM   4546  O "O3'"  . DA  B 1 9  ? -8.281  8.366   -16.365 1.00 0.00 ? 121 DA  C "O3'"  3  
ATOM   4547  C "C2'"  . DA  B 1 9  ? -6.916  9.024   -14.472 1.00 0.00 ? 121 DA  C "C2'"  3  
ATOM   4548  C "C1'"  . DA  B 1 9  ? -7.048  8.208   -13.199 1.00 0.00 ? 121 DA  C "C1'"  3  
ATOM   4549  N N9     . DA  B 1 9  ? -5.835  8.340   -12.386 1.00 0.00 ? 121 DA  C N9     3  
ATOM   4550  C C8     . DA  B 1 9  ? -4.551  8.275   -12.776 1.00 0.00 ? 121 DA  C C8     3  
ATOM   4551  N N7     . DA  B 1 9  ? -3.639  8.402   -11.872 1.00 0.00 ? 121 DA  C N7     3  
ATOM   4552  C C5     . DA  B 1 9  ? -4.414  8.579   -10.720 1.00 0.00 ? 121 DA  C C5     3  
ATOM   4553  C C6     . DA  B 1 9  ? -4.085  8.778   -9.376  1.00 0.00 ? 121 DA  C C6     3  
ATOM   4554  N N6     . DA  B 1 9  ? -2.828  8.835   -8.935  1.00 0.00 ? 121 DA  C N6     3  
ATOM   4555  N N1     . DA  B 1 9  ? -5.098  8.917   -8.504  1.00 0.00 ? 121 DA  C N1     3  
ATOM   4556  C C2     . DA  B 1 9  ? -6.364  8.865   -8.925  1.00 0.00 ? 121 DA  C C2     3  
ATOM   4557  N N3     . DA  B 1 9  ? -6.789  8.680   -10.172 1.00 0.00 ? 121 DA  C N3     3  
ATOM   4558  C C4     . DA  B 1 9  ? -5.755  8.544   -11.027 1.00 0.00 ? 121 DA  C C4     3  
ATOM   4559  H "H5'"  . DA  B 1 9  ? -5.830  5.034   -14.702 1.00 0.00 ? 121 DA  C "H5'"  3  
ATOM   4560  H "H5''" . DA  B 1 9  ? -6.037  5.501   -16.403 1.00 0.00 ? 121 DA  C "H5''" 3  
ATOM   4561  H "H4'"  . DA  B 1 9  ? -8.051  6.174   -15.383 1.00 0.00 ? 121 DA  C "H4'"  3  
ATOM   4562  H "H3'"  . DA  B 1 9  ? -6.218  8.136   -16.285 1.00 0.00 ? 121 DA  C "H3'"  3  
ATOM   4563  H "H2'"  . DA  B 1 9  ? -5.930  9.485   -14.516 1.00 0.00 ? 121 DA  C "H2'"  3  
ATOM   4564  H "H2''" . DA  B 1 9  ? -7.681  9.788   -14.502 1.00 0.00 ? 121 DA  C "H2''" 3  
ATOM   4565  H "H1'"  . DA  B 1 9  ? -7.900  8.564   -12.630 1.00 0.00 ? 121 DA  C "H1'"  3  
ATOM   4566  H H8     . DA  B 1 9  ? -4.302  8.136   -13.824 1.00 0.00 ? 121 DA  C H8     3  
ATOM   4567  H H61    . DA  B 1 9  ? -2.644  8.981   -7.953  1.00 0.00 ? 121 DA  C H61    3  
ATOM   4568  H H62    . DA  B 1 9  ? -2.060  8.733   -9.584  1.00 0.00 ? 121 DA  C H62    3  
ATOM   4569  H H2     . DA  B 1 9  ? -7.133  8.991   -8.162  1.00 0.00 ? 121 DA  C H2     3  
ATOM   4570  P P      . DT  B 1 10 ? -8.654  9.884   -16.757 1.00 0.00 ? 122 DT  C P      3  
ATOM   4571  O OP1    . DT  B 1 10 ? -9.582  9.851   -17.909 1.00 0.00 ? 122 DT  C OP1    3  
ATOM   4572  O OP2    . DT  B 1 10 ? -7.398  10.661  -16.842 1.00 0.00 ? 122 DT  C OP2    3  
ATOM   4573  O "O5'"  . DT  B 1 10 ? -9.472  10.387  -15.464 1.00 0.00 ? 122 DT  C "O5'"  3  
ATOM   4574  C "C5'"  . DT  B 1 10 ? -10.120 9.446   -14.602 1.00 0.00 ? 122 DT  C "C5'"  3  
ATOM   4575  C "C4'"  . DT  B 1 10 ? -10.716 10.125  -13.371 1.00 0.00 ? 122 DT  C "C4'"  3  
ATOM   4576  O "O4'"  . DT  B 1 10 ? -9.774  10.112  -12.276 1.00 0.00 ? 122 DT  C "O4'"  3  
ATOM   4577  C "C3'"  . DT  B 1 10 ? -11.075 11.571  -13.677 1.00 0.00 ? 122 DT  C "C3'"  3  
ATOM   4578  O "O3'"  . DT  B 1 10 ? -12.465 11.808  -13.424 1.00 0.00 ? 122 DT  C "O3'"  3  
ATOM   4579  C "C2'"  . DT  B 1 10 ? -10.207 12.412  -12.774 1.00 0.00 ? 122 DT  C "C2'"  3  
ATOM   4580  C "C1'"  . DT  B 1 10 ? -9.470  11.458  -11.853 1.00 0.00 ? 122 DT  C "C1'"  3  
ATOM   4581  N N1     . DT  B 1 10 ? -8.018  11.703  -11.895 1.00 0.00 ? 122 DT  C N1     3  
ATOM   4582  C C2     . DT  B 1 10 ? -7.364  11.863  -10.689 1.00 0.00 ? 122 DT  C C2     3  
ATOM   4583  O O2     . DT  B 1 10 ? -7.949  11.823  -9.626  1.00 0.00 ? 122 DT  C O2     3  
ATOM   4584  N N3     . DT  B 1 10 ? -5.999  12.069  -10.763 1.00 0.00 ? 122 DT  C N3     3  
ATOM   4585  C C4     . DT  B 1 10 ? -5.245  12.129  -11.923 1.00 0.00 ? 122 DT  C C4     3  
ATOM   4586  O O4     . DT  B 1 10 ? -4.046  12.314  -11.874 1.00 0.00 ? 122 DT  C O4     3  
ATOM   4587  C C5     . DT  B 1 10 ? -6.016  11.952  -13.133 1.00 0.00 ? 122 DT  C C5     3  
ATOM   4588  C C7     . DT  B 1 10 ? -5.311  11.993  -14.484 1.00 0.00 ? 122 DT  C C7     3  
ATOM   4589  C C6     . DT  B 1 10 ? -7.347  11.752  -13.085 1.00 0.00 ? 122 DT  C C6     3  
ATOM   4590  H "H5'"  . DT  B 1 10 ? -9.394  8.701   -14.280 1.00 0.00 ? 122 DT  C "H5'"  3  
ATOM   4591  H "H5''" . DT  B 1 10 ? -10.917 8.949   -15.155 1.00 0.00 ? 122 DT  C "H5''" 3  
ATOM   4592  H "H4'"  . DT  B 1 10 ? -11.616 9.590   -13.071 1.00 0.00 ? 122 DT  C "H4'"  3  
ATOM   4593  H "H3'"  . DT  B 1 10 ? -10.841 11.794  -14.720 1.00 0.00 ? 122 DT  C "H3'"  3  
ATOM   4594  H "H2'"  . DT  B 1 10 ? -9.491  12.979  -13.372 1.00 0.00 ? 122 DT  C "H2'"  3  
ATOM   4595  H "H2''" . DT  B 1 10 ? -10.821 13.092  -12.189 1.00 0.00 ? 122 DT  C "H2''" 3  
ATOM   4596  H "H1'"  . DT  B 1 10 ? -9.826  11.601  -10.833 1.00 0.00 ? 122 DT  C "H1'"  3  
ATOM   4597  H H3     . DT  B 1 10 ? -5.522  12.184  -9.916  1.00 0.00 ? 122 DT  C H3     3  
ATOM   4598  H H71    . DT  B 1 10 ? -4.544  11.220  -14.517 1.00 0.00 ? 122 DT  C H71    3  
ATOM   4599  H H72    . DT  B 1 10 ? -6.037  11.818  -15.278 1.00 0.00 ? 122 DT  C H72    3  
ATOM   4600  H H73    . DT  B 1 10 ? -4.848  12.971  -14.624 1.00 0.00 ? 122 DT  C H73    3  
ATOM   4601  H H6     . DT  B 1 10 ? -7.904  11.632  -14.015 1.00 0.00 ? 122 DT  C H6     3  
ATOM   4602  P P      . DA  B 1 11 ? -13.029 13.306  -13.246 1.00 0.00 ? 123 DA  C P      3  
ATOM   4603  O OP1    . DA  B 1 11 ? -14.486 13.226  -12.996 1.00 0.00 ? 123 DA  C OP1    3  
ATOM   4604  O OP2    . DA  B 1 11 ? -12.515 14.130  -14.363 1.00 0.00 ? 123 DA  C OP2    3  
ATOM   4605  O "O5'"  . DA  B 1 11 ? -12.311 13.793  -11.890 1.00 0.00 ? 123 DA  C "O5'"  3  
ATOM   4606  C "C5'"  . DA  B 1 11 ? -12.720 13.277  -10.620 1.00 0.00 ? 123 DA  C "C5'"  3  
ATOM   4607  C "C4'"  . DA  B 1 11 ? -12.504 14.300  -9.510  1.00 0.00 ? 123 DA  C "C4'"  3  
ATOM   4608  O "O4'"  . DA  B 1 11 ? -11.143 14.241  -9.022  1.00 0.00 ? 123 DA  C "O4'"  3  
ATOM   4609  C "C3'"  . DA  B 1 11 ? -12.765 15.705  -10.029 1.00 0.00 ? 123 DA  C "C3'"  3  
ATOM   4610  O "O3'"  . DA  B 1 11 ? -13.778 16.357  -9.256  1.00 0.00 ? 123 DA  C "O3'"  3  
ATOM   4611  C "C2'"  . DA  B 1 11 ? -11.453 16.437  -9.923  1.00 0.00 ? 123 DA  C "C2'"  3  
ATOM   4612  C "C1'"  . DA  B 1 11 ? -10.468 15.496  -9.256  1.00 0.00 ? 123 DA  C "C1'"  3  
ATOM   4613  N N9     . DA  B 1 11 ? -9.292  15.307  -10.111 1.00 0.00 ? 123 DA  C N9     3  
ATOM   4614  C C8     . DA  B 1 11 ? -9.239  15.099  -11.439 1.00 0.00 ? 123 DA  C C8     3  
ATOM   4615  N N7     . DA  B 1 11 ? -8.074  14.966  -11.980 1.00 0.00 ? 123 DA  C N7     3  
ATOM   4616  C C5     . DA  B 1 11 ? -7.234  15.106  -10.869 1.00 0.00 ? 123 DA  C C5     3  
ATOM   4617  C C6     . DA  B 1 11 ? -5.844  15.076  -10.720 1.00 0.00 ? 123 DA  C C6     3  
ATOM   4618  N N6     . DA  B 1 11 ? -5.006  14.887  -11.739 1.00 0.00 ? 123 DA  C N6     3  
ATOM   4619  N N1     . DA  B 1 11 ? -5.350  15.252  -9.481  1.00 0.00 ? 123 DA  C N1     3  
ATOM   4620  C C2     . DA  B 1 11 ? -6.172  15.447  -8.448  1.00 0.00 ? 123 DA  C C2     3  
ATOM   4621  N N3     . DA  B 1 11 ? -7.501  15.495  -8.475  1.00 0.00 ? 123 DA  C N3     3  
ATOM   4622  C C4     . DA  B 1 11 ? -7.971  15.315  -9.726  1.00 0.00 ? 123 DA  C C4     3  
ATOM   4623  H "H5'"  . DA  B 1 11 ? -12.142 12.380  -10.397 1.00 0.00 ? 123 DA  C "H5'"  3  
ATOM   4624  H "H5''" . DA  B 1 11 ? -13.778 13.017  -10.664 1.00 0.00 ? 123 DA  C "H5''" 3  
ATOM   4625  H "H4'"  . DA  B 1 11 ? -13.187 14.088  -8.687  1.00 0.00 ? 123 DA  C "H4'"  3  
ATOM   4626  H "H3'"  . DA  B 1 11 ? -13.071 15.656  -11.076 1.00 0.00 ? 123 DA  C "H3'"  3  
ATOM   4627  H "H2'"  . DA  B 1 11 ? -11.095 16.700  -10.918 1.00 0.00 ? 123 DA  C "H2'"  3  
ATOM   4628  H "H2''" . DA  B 1 11 ? -11.573 17.334  -9.325  1.00 0.00 ? 123 DA  C "H2''" 3  
ATOM   4629  H "H1'"  . DA  B 1 11 ? -10.152 15.916  -8.308  1.00 0.00 ? 123 DA  C "H1'"  3  
ATOM   4630  H H8     . DA  B 1 11 ? -10.150 15.066  -12.030 1.00 0.00 ? 123 DA  C H8     3  
ATOM   4631  H H61    . DA  B 1 11 ? -4.009  14.874  -11.577 1.00 0.00 ? 123 DA  C H61    3  
ATOM   4632  H H62    . DA  B 1 11 ? -5.367  14.757  -12.673 1.00 0.00 ? 123 DA  C H62    3  
ATOM   4633  H H2     . DA  B 1 11 ? -5.702  15.582  -7.474  1.00 0.00 ? 123 DA  C H2     3  
ATOM   4634  P P      . DC  B 1 12 ? -14.731 17.465  -9.930  1.00 0.00 ? 124 DC  C P      3  
ATOM   4635  O OP1    . DC  B 1 12 ? -16.051 17.410  -9.262  1.00 0.00 ? 124 DC  C OP1    3  
ATOM   4636  O OP2    . DC  B 1 12 ? -14.642 17.322  -11.401 1.00 0.00 ? 124 DC  C OP2    3  
ATOM   4637  O "O5'"  . DC  B 1 12 ? -14.013 18.846  -9.514  1.00 0.00 ? 124 DC  C "O5'"  3  
ATOM   4638  C "C5'"  . DC  B 1 12 ? -13.939 19.240  -8.142  1.00 0.00 ? 124 DC  C "C5'"  3  
ATOM   4639  C "C4'"  . DC  B 1 12 ? -12.880 20.315  -7.923  1.00 0.00 ? 124 DC  C "C4'"  3  
ATOM   4640  O "O4'"  . DC  B 1 12 ? -11.556 19.779  -8.122  1.00 0.00 ? 124 DC  C "O4'"  3  
ATOM   4641  C "C3'"  . DC  B 1 12 ? -13.074 21.473  -8.890  1.00 0.00 ? 124 DC  C "C3'"  3  
ATOM   4642  O "O3'"  . DC  B 1 12 ? -13.505 22.650  -8.200  1.00 0.00 ? 124 DC  C "O3'"  3  
ATOM   4643  C "C2'"  . DC  B 1 12 ? -11.734 21.692  -9.544  1.00 0.00 ? 124 DC  C "C2'"  3  
ATOM   4644  C "C1'"  . DC  B 1 12 ? -10.783 20.664  -8.954  1.00 0.00 ? 124 DC  C "C1'"  3  
ATOM   4645  N N1     . DC  B 1 12 ? -10.085 19.915  -10.017 1.00 0.00 ? 124 DC  C N1     3  
ATOM   4646  C C2     . DC  B 1 12 ? -8.707  19.800  -9.922  1.00 0.00 ? 124 DC  C C2     3  
ATOM   4647  O O2     . DC  B 1 12 ? -8.117  20.307  -8.988  1.00 0.00 ? 124 DC  C O2     3  
ATOM   4648  N N3     . DC  B 1 12 ? -8.048  19.113  -10.893 1.00 0.00 ? 124 DC  C N3     3  
ATOM   4649  C C4     . DC  B 1 12 ? -8.712  18.560  -11.917 1.00 0.00 ? 124 DC  C C4     3  
ATOM   4650  N N4     . DC  B 1 12 ? -8.036  17.891  -12.851 1.00 0.00 ? 124 DC  C N4     3  
ATOM   4651  C C5     . DC  B 1 12 ? -10.134 18.676  -12.020 1.00 0.00 ? 124 DC  C C5     3  
ATOM   4652  C C6     . DC  B 1 12 ? -10.777 19.358  -11.054 1.00 0.00 ? 124 DC  C C6     3  
ATOM   4653  H "H5'"  . DC  B 1 12 ? -13.694 18.370  -7.534  1.00 0.00 ? 124 DC  C "H5'"  3  
ATOM   4654  H "H5''" . DC  B 1 12 ? -14.909 19.630  -7.832  1.00 0.00 ? 124 DC  C "H5''" 3  
ATOM   4655  H "H4'"  . DC  B 1 12 ? -12.955 20.691  -6.904  1.00 0.00 ? 124 DC  C "H4'"  3  
ATOM   4656  H "H3'"  . DC  B 1 12 ? -13.807 21.194  -9.650  1.00 0.00 ? 124 DC  C "H3'"  3  
ATOM   4657  H "HO3'" . DC  B 1 12 ? -13.312 23.400  -8.767  1.00 0.00 ? 124 DC  C "HO3'" 3  
ATOM   4658  H "H2'"  . DC  B 1 12 ? -11.816 21.549  -10.621 1.00 0.00 ? 124 DC  C "H2'"  3  
ATOM   4659  H "H2''" . DC  B 1 12 ? -11.375 22.698  -9.329  1.00 0.00 ? 124 DC  C "H2''" 3  
ATOM   4660  H "H1'"  . DC  B 1 12 ? -10.048 21.175  -8.336  1.00 0.00 ? 124 DC  C "H1'"  3  
ATOM   4661  H H41    . DC  B 1 12 ? -7.031  17.806  -12.783 1.00 0.00 ? 124 DC  C H41    3  
ATOM   4662  H H42    . DC  B 1 12 ? -8.526  17.469  -13.626 1.00 0.00 ? 124 DC  C H42    3  
ATOM   4663  H H5     . DC  B 1 12 ? -10.678 18.227  -12.851 1.00 0.00 ? 124 DC  C H5     3  
ATOM   4664  H H6     . DC  B 1 12 ? -11.861 19.469  -11.099 1.00 0.00 ? 124 DC  C H6     3  
ATOM   4665  N N      . MET C 2 1  ? -5.784  17.825  3.927   1.00 0.00 ? 1   MET A N      3  
ATOM   4666  C CA     . MET C 2 1  ? -6.463  16.618  4.485   1.00 0.00 ? 1   MET A CA     3  
ATOM   4667  C C      . MET C 2 1  ? -6.013  15.363  3.730   1.00 0.00 ? 1   MET A C      3  
ATOM   4668  O O      . MET C 2 1  ? -5.825  15.383  2.530   1.00 0.00 ? 1   MET A O      3  
ATOM   4669  C CB     . MET C 2 1  ? -7.956  16.868  4.269   1.00 0.00 ? 1   MET A CB     3  
ATOM   4670  C CG     . MET C 2 1  ? -8.582  17.393  5.564   1.00 0.00 ? 1   MET A CG     3  
ATOM   4671  S SD     . MET C 2 1  ? -9.344  16.023  6.469   1.00 0.00 ? 1   MET A SD     3  
ATOM   4672  C CE     . MET C 2 1  ? -7.993  15.742  7.639   1.00 0.00 ? 1   MET A CE     3  
ATOM   4673  H H      . MET C 2 1  ? -6.021  18.149  3.032   1.00 0.00 ? 1   MET A H      3  
ATOM   4674  H HA     . MET C 2 1  ? -6.253  16.520  5.538   1.00 0.00 ? 1   MET A HA     3  
ATOM   4675  H HB2    . MET C 2 1  ? -8.086  17.599  3.483   1.00 0.00 ? 1   MET A HB2    3  
ATOM   4676  H HB3    . MET C 2 1  ? -8.439  15.946  3.984   1.00 0.00 ? 1   MET A HB3    3  
ATOM   4677  H HG2    . MET C 2 1  ? -7.815  17.846  6.176   1.00 0.00 ? 1   MET A HG2    3  
ATOM   4678  H HG3    . MET C 2 1  ? -9.334  18.131  5.327   1.00 0.00 ? 1   MET A HG3    3  
ATOM   4679  H HE1    . MET C 2 1  ? -7.624  14.731  7.525   1.00 0.00 ? 1   MET A HE1    3  
ATOM   4680  H HE2    . MET C 2 1  ? -8.352  15.878  8.647   1.00 0.00 ? 1   MET A HE2    3  
ATOM   4681  H HE3    . MET C 2 1  ? -7.196  16.446  7.444   1.00 0.00 ? 1   MET A HE3    3  
ATOM   4682  N N      . ALA C 2 2  ? -5.840  14.269  4.426   1.00 0.00 ? 2   ALA A N      3  
ATOM   4683  C CA     . ALA C 2 2  ? -5.403  13.011  3.751   1.00 0.00 ? 2   ALA A CA     3  
ATOM   4684  C C      . ALA C 2 2  ? -6.026  11.794  4.438   1.00 0.00 ? 2   ALA A C      3  
ATOM   4685  O O      . ALA C 2 2  ? -5.336  10.889  4.865   1.00 0.00 ? 2   ALA A O      3  
ATOM   4686  C CB     . ALA C 2 2  ? -3.886  12.986  3.905   1.00 0.00 ? 2   ALA A CB     3  
ATOM   4687  H H      . ALA C 2 2  ? -5.998  14.275  5.394   1.00 0.00 ? 2   ALA A H      3  
ATOM   4688  H HA     . ALA C 2 2  ? -5.667  13.032  2.705   1.00 0.00 ? 2   ALA A HA     3  
ATOM   4689  H HB1    . ALA C 2 2  ? -3.537  11.967  3.834   1.00 0.00 ? 2   ALA A HB1    3  
ATOM   4690  H HB2    . ALA C 2 2  ? -3.616  13.393  4.868   1.00 0.00 ? 2   ALA A HB2    3  
ATOM   4691  H HB3    . ALA C 2 2  ? -3.433  13.577  3.123   1.00 0.00 ? 2   ALA A HB3    3  
ATOM   4692  N N      . GLU C 2 3  ? -7.326  11.768  4.546   1.00 0.00 ? 3   GLU A N      3  
ATOM   4693  C CA     . GLU C 2 3  ? -8.009  10.614  5.204   1.00 0.00 ? 3   GLU A CA     3  
ATOM   4694  C C      . GLU C 2 3  ? -7.471  10.402  6.626   1.00 0.00 ? 3   GLU A C      3  
ATOM   4695  O O      . GLU C 2 3  ? -7.613  9.338   7.196   1.00 0.00 ? 3   GLU A O      3  
ATOM   4696  C CB     . GLU C 2 3  ? -7.698  9.398   4.322   1.00 0.00 ? 3   GLU A CB     3  
ATOM   4697  C CG     . GLU C 2 3  ? -9.003  8.697   3.939   1.00 0.00 ? 3   GLU A CG     3  
ATOM   4698  C CD     . GLU C 2 3  ? -9.428  7.754   5.067   1.00 0.00 ? 3   GLU A CD     3  
ATOM   4699  O OE1    . GLU C 2 3  ? -9.645  8.237   6.166   1.00 0.00 ? 3   GLU A OE1    3  
ATOM   4700  O OE2    . GLU C 2 3  ? -9.527  6.566   4.811   1.00 0.00 ? 3   GLU A OE2    3  
ATOM   4701  H H      . GLU C 2 3  ? -7.859  12.511  4.193   1.00 0.00 ? 3   GLU A H      3  
ATOM   4702  H HA     . GLU C 2 3  ? -9.070  10.783  5.231   1.00 0.00 ? 3   GLU A HA     3  
ATOM   4703  H HB2    . GLU C 2 3  ? -7.188  9.724   3.428   1.00 0.00 ? 3   GLU A HB2    3  
ATOM   4704  H HB3    . GLU C 2 3  ? -7.069  8.709   4.865   1.00 0.00 ? 3   GLU A HB3    3  
ATOM   4705  H HG2    . GLU C 2 3  ? -9.775  9.437   3.777   1.00 0.00 ? 3   GLU A HG2    3  
ATOM   4706  H HG3    . GLU C 2 3  ? -8.853  8.128   3.033   1.00 0.00 ? 3   GLU A HG3    3  
ATOM   4707  N N      . ASP C 2 4  ? -6.870  11.410  7.209   1.00 0.00 ? 4   ASP A N      3  
ATOM   4708  C CA     . ASP C 2 4  ? -6.333  11.271  8.600   1.00 0.00 ? 4   ASP A CA     3  
ATOM   4709  C C      . ASP C 2 4  ? -5.244  10.194  8.662   1.00 0.00 ? 4   ASP A C      3  
ATOM   4710  O O      . ASP C 2 4  ? -5.526  9.029   8.857   1.00 0.00 ? 4   ASP A O      3  
ATOM   4711  C CB     . ASP C 2 4  ? -7.533  10.859  9.455   1.00 0.00 ? 4   ASP A CB     3  
ATOM   4712  C CG     . ASP C 2 4  ? -7.369  11.410  10.872  1.00 0.00 ? 4   ASP A CG     3  
ATOM   4713  O OD1    . ASP C 2 4  ? -6.253  11.395  11.366  1.00 0.00 ? 4   ASP A OD1    3  
ATOM   4714  O OD2    . ASP C 2 4  ? -8.361  11.837  11.440  1.00 0.00 ? 4   ASP A OD2    3  
ATOM   4715  H H      . ASP C 2 4  ? -6.776  12.262  6.735   1.00 0.00 ? 4   ASP A H      3  
ATOM   4716  H HA     . ASP C 2 4  ? -5.945  12.216  8.948   1.00 0.00 ? 4   ASP A HA     3  
ATOM   4717  H HB2    . ASP C 2 4  ? -8.438  11.254  9.016   1.00 0.00 ? 4   ASP A HB2    3  
ATOM   4718  H HB3    . ASP C 2 4  ? -7.592  9.780   9.492   1.00 0.00 ? 4   ASP A HB3    3  
ATOM   4719  N N      . TRP C 2 5  ? -4.003  10.577  8.512   1.00 0.00 ? 5   TRP A N      3  
ATOM   4720  C CA     . TRP C 2 5  ? -2.896  9.575   8.572   1.00 0.00 ? 5   TRP A CA     3  
ATOM   4721  C C      . TRP C 2 5  ? -2.578  9.234   10.030  1.00 0.00 ? 5   TRP A C      3  
ATOM   4722  O O      . TRP C 2 5  ? -3.032  9.896   10.943  1.00 0.00 ? 5   TRP A O      3  
ATOM   4723  C CB     . TRP C 2 5  ? -1.699  10.266  7.920   1.00 0.00 ? 5   TRP A CB     3  
ATOM   4724  C CG     . TRP C 2 5  ? -1.660  9.938   6.462   1.00 0.00 ? 5   TRP A CG     3  
ATOM   4725  C CD1    . TRP C 2 5  ? -2.151  10.723  5.477   1.00 0.00 ? 5   TRP A CD1    3  
ATOM   4726  C CD2    . TRP C 2 5  ? -1.111  8.757   5.810   1.00 0.00 ? 5   TRP A CD2    3  
ATOM   4727  N NE1    . TRP C 2 5  ? -1.939  10.100  4.261   1.00 0.00 ? 5   TRP A NE1    3  
ATOM   4728  C CE2    . TRP C 2 5  ? -1.301  8.884   4.414   1.00 0.00 ? 5   TRP A CE2    3  
ATOM   4729  C CE3    . TRP C 2 5  ? -0.474  7.598   6.288   1.00 0.00 ? 5   TRP A CE3    3  
ATOM   4730  C CZ2    . TRP C 2 5  ? -0.873  7.899   3.524   1.00 0.00 ? 5   TRP A CZ2    3  
ATOM   4731  C CZ3    . TRP C 2 5  ? -0.042  6.604   5.396   1.00 0.00 ? 5   TRP A CZ3    3  
ATOM   4732  C CH2    . TRP C 2 5  ? -0.241  6.754   4.016   1.00 0.00 ? 5   TRP A CH2    3  
ATOM   4733  H H      . TRP C 2 5  ? -3.798  11.524  8.366   1.00 0.00 ? 5   TRP A H      3  
ATOM   4734  H HA     . TRP C 2 5  ? -3.155  8.683   8.020   1.00 0.00 ? 5   TRP A HA     3  
ATOM   4735  H HB2    . TRP C 2 5  ? -1.789  11.335  8.044   1.00 0.00 ? 5   TRP A HB2    3  
ATOM   4736  H HB3    . TRP C 2 5  ? -0.787  9.927   8.389   1.00 0.00 ? 5   TRP A HB3    3  
ATOM   4737  H HD1    . TRP C 2 5  ? -2.630  11.681  5.618   1.00 0.00 ? 5   TRP A HD1    3  
ATOM   4738  H HE1    . TRP C 2 5  ? -2.201  10.459  3.388   1.00 0.00 ? 5   TRP A HE1    3  
ATOM   4739  H HE3    . TRP C 2 5  ? -0.315  7.472   7.349   1.00 0.00 ? 5   TRP A HE3    3  
ATOM   4740  H HZ2    . TRP C 2 5  ? -1.029  8.019   2.462   1.00 0.00 ? 5   TRP A HZ2    3  
ATOM   4741  H HZ3    . TRP C 2 5  ? 0.445   5.717   5.774   1.00 0.00 ? 5   TRP A HZ3    3  
ATOM   4742  H HH2    . TRP C 2 5  ? 0.093   5.985   3.335   1.00 0.00 ? 5   TRP A HH2    3  
ATOM   4743  N N      . LEU C 2 6  ? -1.802  8.208   10.255  1.00 0.00 ? 6   LEU A N      3  
ATOM   4744  C CA     . LEU C 2 6  ? -1.455  7.823   11.655  1.00 0.00 ? 6   LEU A CA     3  
ATOM   4745  C C      . LEU C 2 6  ? 0.031   7.462   11.752  1.00 0.00 ? 6   LEU A C      3  
ATOM   4746  O O      . LEU C 2 6  ? 0.670   7.159   10.766  1.00 0.00 ? 6   LEU A O      3  
ATOM   4747  C CB     . LEU C 2 6  ? -2.324  6.601   11.957  1.00 0.00 ? 6   LEU A CB     3  
ATOM   4748  C CG     . LEU C 2 6  ? -3.803  6.994   11.902  1.00 0.00 ? 6   LEU A CG     3  
ATOM   4749  C CD1    . LEU C 2 6  ? -4.670  5.741   12.035  1.00 0.00 ? 6   LEU A CD1    3  
ATOM   4750  C CD2    . LEU C 2 6  ? -4.119  7.955   13.051  1.00 0.00 ? 6   LEU A CD2    3  
ATOM   4751  H H      . LEU C 2 6  ? -1.446  7.688   9.503   1.00 0.00 ? 6   LEU A H      3  
ATOM   4752  H HA     . LEU C 2 6  ? -1.695  8.624   12.336  1.00 0.00 ? 6   LEU A HA     3  
ATOM   4753  H HB2    . LEU C 2 6  ? -2.129  5.831   11.224  1.00 0.00 ? 6   LEU A HB2    3  
ATOM   4754  H HB3    . LEU C 2 6  ? -2.090  6.227   12.943  1.00 0.00 ? 6   LEU A HB3    3  
ATOM   4755  H HG     . LEU C 2 6  ? -4.012  7.476   10.958  1.00 0.00 ? 6   LEU A HG     3  
ATOM   4756  H HD11   . LEU C 2 6  ? -5.649  6.018   12.397  1.00 0.00 ? 6   LEU A HD11   3  
ATOM   4757  H HD12   . LEU C 2 6  ? -4.209  5.056   12.730  1.00 0.00 ? 6   LEU A HD12   3  
ATOM   4758  H HD13   . LEU C 2 6  ? -4.765  5.265   11.070  1.00 0.00 ? 6   LEU A HD13   3  
ATOM   4759  H HD21   . LEU C 2 6  ? -5.184  7.960   13.233  1.00 0.00 ? 6   LEU A HD21   3  
ATOM   4760  H HD22   . LEU C 2 6  ? -3.793  8.950   12.788  1.00 0.00 ? 6   LEU A HD22   3  
ATOM   4761  H HD23   . LEU C 2 6  ? -3.603  7.631   13.943  1.00 0.00 ? 6   LEU A HD23   3  
ATOM   4762  N N      . ASP C 2 7  ? 0.583   7.491   12.936  1.00 0.00 ? 7   ASP A N      3  
ATOM   4763  C CA     . ASP C 2 7  ? 2.027   7.147   13.097  1.00 0.00 ? 7   ASP A CA     3  
ATOM   4764  C C      . ASP C 2 7  ? 2.266   5.692   12.684  1.00 0.00 ? 7   ASP A C      3  
ATOM   4765  O O      . ASP C 2 7  ? 1.340   4.916   12.551  1.00 0.00 ? 7   ASP A O      3  
ATOM   4766  C CB     . ASP C 2 7  ? 2.321   7.334   14.586  1.00 0.00 ? 7   ASP A CB     3  
ATOM   4767  C CG     . ASP C 2 7  ? 2.734   8.783   14.847  1.00 0.00 ? 7   ASP A CG     3  
ATOM   4768  O OD1    . ASP C 2 7  ? 1.854   9.602   15.056  1.00 0.00 ? 7   ASP A OD1    3  
ATOM   4769  O OD2    . ASP C 2 7  ? 3.925   9.050   14.832  1.00 0.00 ? 7   ASP A OD2    3  
ATOM   4770  H H      . ASP C 2 7  ? 0.048   7.737   13.718  1.00 0.00 ? 7   ASP A H      3  
ATOM   4771  H HA     . ASP C 2 7  ? 2.642   7.812   12.511  1.00 0.00 ? 7   ASP A HA     3  
ATOM   4772  H HB2    . ASP C 2 7  ? 1.433   7.103   15.159  1.00 0.00 ? 7   ASP A HB2    3  
ATOM   4773  H HB3    . ASP C 2 7  ? 3.122   6.675   14.882  1.00 0.00 ? 7   ASP A HB3    3  
ATOM   4774  N N      . CYS C 2 8  ? 3.500   5.316   12.477  1.00 0.00 ? 8   CYS A N      3  
ATOM   4775  C CA     . CYS C 2 8  ? 3.791   3.911   12.071  1.00 0.00 ? 8   CYS A CA     3  
ATOM   4776  C C      . CYS C 2 8  ? 5.152   3.465   12.622  1.00 0.00 ? 8   CYS A C      3  
ATOM   4777  O O      . CYS C 2 8  ? 6.153   3.541   11.938  1.00 0.00 ? 8   CYS A O      3  
ATOM   4778  C CB     . CYS C 2 8  ? 3.812   3.940   10.543  1.00 0.00 ? 8   CYS A CB     3  
ATOM   4779  S SG     . CYS C 2 8  ? 4.080   2.267   9.906   1.00 0.00 ? 8   CYS A SG     3  
ATOM   4780  H H      . CYS C 2 8  ? 4.233   5.956   12.587  1.00 0.00 ? 8   CYS A H      3  
ATOM   4781  H HA     . CYS C 2 8  ? 3.012   3.251   12.415  1.00 0.00 ? 8   CYS A HA     3  
ATOM   4782  H HB2    . CYS C 2 8  ? 2.868   4.317   10.179  1.00 0.00 ? 8   CYS A HB2    3  
ATOM   4783  H HB3    . CYS C 2 8  ? 4.609   4.585   10.209  1.00 0.00 ? 8   CYS A HB3    3  
ATOM   4784  H HG     . CYS C 2 8  ? 5.007   2.184   9.672   1.00 0.00 ? 8   CYS A HG     3  
ATOM   4785  N N      . PRO C 2 9  ? 5.141   3.006   13.848  1.00 0.00 ? 9   PRO A N      3  
ATOM   4786  C CA     . PRO C 2 9  ? 6.391   2.535   14.498  1.00 0.00 ? 9   PRO A CA     3  
ATOM   4787  C C      . PRO C 2 9  ? 6.826   1.183   13.937  1.00 0.00 ? 9   PRO A C      3  
ATOM   4788  O O      . PRO C 2 9  ? 7.881   0.678   14.266  1.00 0.00 ? 9   PRO A O      3  
ATOM   4789  C CB     . PRO C 2 9  ? 6.001   2.380   15.962  1.00 0.00 ? 9   PRO A CB     3  
ATOM   4790  C CG     . PRO C 2 9  ? 4.520   2.173   15.952  1.00 0.00 ? 9   PRO A CG     3  
ATOM   4791  C CD     . PRO C 2 9  ? 3.978   2.883   14.739  1.00 0.00 ? 9   PRO A CD     3  
ATOM   4792  H HA     . PRO C 2 9  ? 7.175   3.265   14.399  1.00 0.00 ? 9   PRO A HA     3  
ATOM   4793  H HB2    . PRO C 2 9  ? 6.498   1.513   16.382  1.00 0.00 ? 9   PRO A HB2    3  
ATOM   4794  H HB3    . PRO C 2 9  ? 6.250   3.270   16.518  1.00 0.00 ? 9   PRO A HB3    3  
ATOM   4795  H HG2    . PRO C 2 9  ? 4.298   1.116   15.893  1.00 0.00 ? 9   PRO A HG2    3  
ATOM   4796  H HG3    . PRO C 2 9  ? 4.082   2.594   16.844  1.00 0.00 ? 9   PRO A HG3    3  
ATOM   4797  H HD2    . PRO C 2 9  ? 3.200   2.295   14.273  1.00 0.00 ? 9   PRO A HD2    3  
ATOM   4798  H HD3    . PRO C 2 9  ? 3.610   3.861   15.005  1.00 0.00 ? 9   PRO A HD3    3  
ATOM   4799  N N      . ALA C 2 10 ? 6.015   0.579   13.114  1.00 0.00 ? 10  ALA A N      3  
ATOM   4800  C CA     . ALA C 2 10 ? 6.378   -0.754  12.560  1.00 0.00 ? 10  ALA A CA     3  
ATOM   4801  C C      . ALA C 2 10 ? 7.737   -0.709  11.852  1.00 0.00 ? 10  ALA A C      3  
ATOM   4802  O O      . ALA C 2 10 ? 8.364   -1.727  11.640  1.00 0.00 ? 10  ALA A O      3  
ATOM   4803  C CB     . ALA C 2 10 ? 5.267   -1.091  11.564  1.00 0.00 ? 10  ALA A CB     3  
ATOM   4804  H H      . ALA C 2 10 ? 5.161   0.993   12.875  1.00 0.00 ? 10  ALA A H      3  
ATOM   4805  H HA     . ALA C 2 10 ? 6.393   -1.484  13.353  1.00 0.00 ? 10  ALA A HA     3  
ATOM   4806  H HB1    . ALA C 2 10 ? 4.928   -2.102  11.732  1.00 0.00 ? 10  ALA A HB1    3  
ATOM   4807  H HB2    . ALA C 2 10 ? 5.647   -1.001  10.557  1.00 0.00 ? 10  ALA A HB2    3  
ATOM   4808  H HB3    . ALA C 2 10 ? 4.442   -0.407  11.698  1.00 0.00 ? 10  ALA A HB3    3  
ATOM   4809  N N      . LEU C 2 11 ? 8.196   0.453   11.474  1.00 0.00 ? 11  LEU A N      3  
ATOM   4810  C CA     . LEU C 2 11 ? 9.511   0.537   10.775  1.00 0.00 ? 11  LEU A CA     3  
ATOM   4811  C C      . LEU C 2 11 ? 10.436  1.535   11.480  1.00 0.00 ? 11  LEU A C      3  
ATOM   4812  O O      . LEU C 2 11 ? 11.447  1.162   12.042  1.00 0.00 ? 11  LEU A O      3  
ATOM   4813  C CB     . LEU C 2 11 ? 9.171   1.016   9.366   1.00 0.00 ? 11  LEU A CB     3  
ATOM   4814  C CG     . LEU C 2 11 ? 8.309   -0.041  8.670   1.00 0.00 ? 11  LEU A CG     3  
ATOM   4815  C CD1    . LEU C 2 11 ? 6.853   0.429   8.628   1.00 0.00 ? 11  LEU A CD1    3  
ATOM   4816  C CD2    . LEU C 2 11 ? 8.817   -0.252  7.243   1.00 0.00 ? 11  LEU A CD2    3  
ATOM   4817  H H      . LEU C 2 11 ? 7.675   1.265   11.643  1.00 0.00 ? 11  LEU A H      3  
ATOM   4818  H HA     . LEU C 2 11 ? 9.974   -0.436  10.727  1.00 0.00 ? 11  LEU A HA     3  
ATOM   4819  H HB2    . LEU C 2 11 ? 8.627   1.949   9.424   1.00 0.00 ? 11  LEU A HB2    3  
ATOM   4820  H HB3    . LEU C 2 11 ? 10.082  1.162   8.806   1.00 0.00 ? 11  LEU A HB3    3  
ATOM   4821  H HG     . LEU C 2 11 ? 8.368   -0.973  9.217   1.00 0.00 ? 11  LEU A HG     3  
ATOM   4822  H HD11   . LEU C 2 11 ? 6.735   1.167   7.847   1.00 0.00 ? 11  LEU A HD11   3  
ATOM   4823  H HD12   . LEU C 2 11 ? 6.589   0.868   9.579   1.00 0.00 ? 11  LEU A HD12   3  
ATOM   4824  H HD13   . LEU C 2 11 ? 6.208   -0.413  8.427   1.00 0.00 ? 11  LEU A HD13   3  
ATOM   4825  H HD21   . LEU C 2 11 ? 9.863   0.014   7.190   1.00 0.00 ? 11  LEU A HD21   3  
ATOM   4826  H HD22   . LEU C 2 11 ? 8.253   0.368   6.565   1.00 0.00 ? 11  LEU A HD22   3  
ATOM   4827  H HD23   . LEU C 2 11 ? 8.695   -1.289  6.969   1.00 0.00 ? 11  LEU A HD23   3  
ATOM   4828  N N      . GLY C 2 12 ? 10.102  2.799   11.453  1.00 0.00 ? 12  GLY A N      3  
ATOM   4829  C CA     . GLY C 2 12 ? 10.970  3.812   12.121  1.00 0.00 ? 12  GLY A CA     3  
ATOM   4830  C C      . GLY C 2 12 ? 10.282  5.181   12.101  1.00 0.00 ? 12  GLY A C      3  
ATOM   4831  O O      . GLY C 2 12 ? 9.099   5.276   11.838  1.00 0.00 ? 12  GLY A O      3  
ATOM   4832  H H      . GLY C 2 12 ? 9.283   3.080   10.994  1.00 0.00 ? 12  GLY A H      3  
ATOM   4833  H HA2    . GLY C 2 12 ? 11.147  3.513   13.145  1.00 0.00 ? 12  GLY A HA2    3  
ATOM   4834  H HA3    . GLY C 2 12 ? 11.911  3.879   11.599  1.00 0.00 ? 12  GLY A HA3    3  
ATOM   4835  N N      . PRO C 2 13 ? 11.051  6.203   12.383  1.00 0.00 ? 13  PRO A N      3  
ATOM   4836  C CA     . PRO C 2 13 ? 10.507  7.584   12.399  1.00 0.00 ? 13  PRO A CA     3  
ATOM   4837  C C      . PRO C 2 13 ? 10.250  8.081   10.974  1.00 0.00 ? 13  PRO A C      3  
ATOM   4838  O O      . PRO C 2 13 ? 11.078  7.935   10.096  1.00 0.00 ? 13  PRO A O      3  
ATOM   4839  C CB     . PRO C 2 13 ? 11.611  8.398   13.067  1.00 0.00 ? 13  PRO A CB     3  
ATOM   4840  C CG     . PRO C 2 13 ? 12.868  7.625   12.821  1.00 0.00 ? 13  PRO A CG     3  
ATOM   4841  C CD     . PRO C 2 13 ? 12.484  6.172   12.711  1.00 0.00 ? 13  PRO A CD     3  
ATOM   4842  H HA     . PRO C 2 13 ? 9.605   7.631   12.989  1.00 0.00 ? 13  PRO A HA     3  
ATOM   4843  H HB2    . PRO C 2 13 ? 11.676  9.380   12.618  1.00 0.00 ? 13  PRO A HB2    3  
ATOM   4844  H HB3    . PRO C 2 13 ? 11.430  8.480   14.128  1.00 0.00 ? 13  PRO A HB3    3  
ATOM   4845  H HG2    . PRO C 2 13 ? 13.330  7.958   11.902  1.00 0.00 ? 13  PRO A HG2    3  
ATOM   4846  H HG3    . PRO C 2 13 ? 13.550  7.757   13.647  1.00 0.00 ? 13  PRO A HG3    3  
ATOM   4847  H HD2    . PRO C 2 13 ? 13.046  5.693   11.921  1.00 0.00 ? 13  PRO A HD2    3  
ATOM   4848  H HD3    . PRO C 2 13 ? 12.639  5.665   13.650  1.00 0.00 ? 13  PRO A HD3    3  
ATOM   4849  N N      . GLY C 2 14 ? 9.107   8.668   10.740  1.00 0.00 ? 14  GLY A N      3  
ATOM   4850  C CA     . GLY C 2 14 ? 8.787   9.179   9.377   1.00 0.00 ? 14  GLY A CA     3  
ATOM   4851  C C      . GLY C 2 14 ? 7.656   8.341   8.773   1.00 0.00 ? 14  GLY A C      3  
ATOM   4852  O O      . GLY C 2 14 ? 6.852   8.826   8.000   1.00 0.00 ? 14  GLY A O      3  
ATOM   4853  H H      . GLY C 2 14 ? 8.458   8.773   11.463  1.00 0.00 ? 14  GLY A H      3  
ATOM   4854  H HA2    . GLY C 2 14 ? 8.478   10.213  9.441   1.00 0.00 ? 14  GLY A HA2    3  
ATOM   4855  H HA3    . GLY C 2 14 ? 9.665   9.101   8.743   1.00 0.00 ? 14  GLY A HA3    3  
ATOM   4856  N N      . TRP C 2 15 ? 7.606   7.077   9.104   1.00 0.00 ? 15  TRP A N      3  
ATOM   4857  C CA     . TRP C 2 15 ? 6.549   6.186   8.536   1.00 0.00 ? 15  TRP A CA     3  
ATOM   4858  C C      . TRP C 2 15 ? 5.149   6.638   8.960   1.00 0.00 ? 15  TRP A C      3  
ATOM   4859  O O      . TRP C 2 15 ? 4.945   7.139   10.048  1.00 0.00 ? 15  TRP A O      3  
ATOM   4860  C CB     . TRP C 2 15 ? 6.852   4.800   9.107   1.00 0.00 ? 15  TRP A CB     3  
ATOM   4861  C CG     . TRP C 2 15 ? 8.025   4.214   8.392   1.00 0.00 ? 15  TRP A CG     3  
ATOM   4862  C CD1    . TRP C 2 15 ? 9.307   4.279   8.816   1.00 0.00 ? 15  TRP A CD1    3  
ATOM   4863  C CD2    . TRP C 2 15 ? 8.044   3.476   7.137   1.00 0.00 ? 15  TRP A CD2    3  
ATOM   4864  N NE1    . TRP C 2 15 ? 10.114  3.628   7.901   1.00 0.00 ? 15  TRP A NE1    3  
ATOM   4865  C CE2    . TRP C 2 15 ? 9.382   3.116   6.848   1.00 0.00 ? 15  TRP A CE2    3  
ATOM   4866  C CE3    . TRP C 2 15 ? 7.042   3.087   6.228   1.00 0.00 ? 15  TRP A CE3    3  
ATOM   4867  C CZ2    . TRP C 2 15 ? 9.716   2.397   5.702   1.00 0.00 ? 15  TRP A CZ2    3  
ATOM   4868  C CZ3    . TRP C 2 15 ? 7.375   2.364   5.072   1.00 0.00 ? 15  TRP A CZ3    3  
ATOM   4869  C CH2    . TRP C 2 15 ? 8.709   2.020   4.810   1.00 0.00 ? 15  TRP A CH2    3  
ATOM   4870  H H      . TRP C 2 15 ? 8.276   6.709   9.716   1.00 0.00 ? 15  TRP A H      3  
ATOM   4871  H HA     . TRP C 2 15 ? 6.623   6.159   7.461   1.00 0.00 ? 15  TRP A HA     3  
ATOM   4872  H HB2    . TRP C 2 15 ? 7.078   4.885   10.159  1.00 0.00 ? 15  TRP A HB2    3  
ATOM   4873  H HB3    . TRP C 2 15 ? 5.994   4.160   8.972   1.00 0.00 ? 15  TRP A HB3    3  
ATOM   4874  H HD1    . TRP C 2 15 ? 9.646   4.762   9.721   1.00 0.00 ? 15  TRP A HD1    3  
ATOM   4875  H HE1    . TRP C 2 15 ? 11.086  3.532   7.971   1.00 0.00 ? 15  TRP A HE1    3  
ATOM   4876  H HE3    . TRP C 2 15 ? 6.010   3.345   6.421   1.00 0.00 ? 15  TRP A HE3    3  
ATOM   4877  H HZ2    . TRP C 2 15 ? 10.744  2.134   5.503   1.00 0.00 ? 15  TRP A HZ2    3  
ATOM   4878  H HZ3    . TRP C 2 15 ? 6.599   2.072   4.381   1.00 0.00 ? 15  TRP A HZ3    3  
ATOM   4879  H HH2    . TRP C 2 15 ? 8.959   1.462   3.920   1.00 0.00 ? 15  TRP A HH2    3  
ATOM   4880  N N      . LYS C 2 16 ? 4.182   6.442   8.102   1.00 0.00 ? 16  LYS A N      3  
ATOM   4881  C CA     . LYS C 2 16 ? 2.780   6.833   8.433   1.00 0.00 ? 16  LYS A CA     3  
ATOM   4882  C C      . LYS C 2 16 ? 1.820   5.733   7.964   1.00 0.00 ? 16  LYS A C      3  
ATOM   4883  O O      . LYS C 2 16 ? 2.121   4.991   7.049   1.00 0.00 ? 16  LYS A O      3  
ATOM   4884  C CB     . LYS C 2 16 ? 2.532   8.130   7.657   1.00 0.00 ? 16  LYS A CB     3  
ATOM   4885  C CG     . LYS C 2 16 ? 3.303   9.280   8.315   1.00 0.00 ? 16  LYS A CG     3  
ATOM   4886  C CD     . LYS C 2 16 ? 2.322   10.212  9.033   1.00 0.00 ? 16  LYS A CD     3  
ATOM   4887  C CE     . LYS C 2 16 ? 2.870   11.642  9.017   1.00 0.00 ? 16  LYS A CE     3  
ATOM   4888  N NZ     . LYS C 2 16 ? 2.629   12.163  10.392  1.00 0.00 ? 16  LYS A NZ     3  
ATOM   4889  H H      . LYS C 2 16 ? 4.378   6.024   7.236   1.00 0.00 ? 16  LYS A H      3  
ATOM   4890  H HA     . LYS C 2 16 ? 2.671   7.006   9.494   1.00 0.00 ? 16  LYS A HA     3  
ATOM   4891  H HB2    . LYS C 2 16 ? 2.870   8.007   6.639   1.00 0.00 ? 16  LYS A HB2    3  
ATOM   4892  H HB3    . LYS C 2 16 ? 1.477   8.356   7.662   1.00 0.00 ? 16  LYS A HB3    3  
ATOM   4893  H HG2    . LYS C 2 16 ? 4.008   8.881   9.029   1.00 0.00 ? 16  LYS A HG2    3  
ATOM   4894  H HG3    . LYS C 2 16 ? 3.834   9.836   7.558   1.00 0.00 ? 16  LYS A HG3    3  
ATOM   4895  H HD2    . LYS C 2 16 ? 1.367   10.187  8.528   1.00 0.00 ? 16  LYS A HD2    3  
ATOM   4896  H HD3    . LYS C 2 16 ? 2.200   9.887   10.055  1.00 0.00 ? 16  LYS A HD3    3  
ATOM   4897  H HE2    . LYS C 2 16 ? 3.930   11.635  8.795   1.00 0.00 ? 16  LYS A HE2    3  
ATOM   4898  H HE3    . LYS C 2 16 ? 2.337   12.241  8.296   1.00 0.00 ? 16  LYS A HE3    3  
ATOM   4899  H HZ1    . LYS C 2 16 ? 3.295   11.718  11.054  1.00 0.00 ? 16  LYS A HZ1    3  
ATOM   4900  H HZ2    . LYS C 2 16 ? 2.769   13.195  10.400  1.00 0.00 ? 16  LYS A HZ2    3  
ATOM   4901  H HZ3    . LYS C 2 16 ? 1.655   11.944  10.681  1.00 0.00 ? 16  LYS A HZ3    3  
ATOM   4902  N N      . ARG C 2 17 ? 0.673   5.615   8.580   1.00 0.00 ? 17  ARG A N      3  
ATOM   4903  C CA     . ARG C 2 17 ? -0.290  4.553   8.159   1.00 0.00 ? 17  ARG A CA     3  
ATOM   4904  C C      . ARG C 2 17 ? -1.694  5.138   7.967   1.00 0.00 ? 17  ARG A C      3  
ATOM   4905  O O      . ARG C 2 17 ? -2.167  5.928   8.762   1.00 0.00 ? 17  ARG A O      3  
ATOM   4906  C CB     . ARG C 2 17 ? -0.286  3.528   9.301   1.00 0.00 ? 17  ARG A CB     3  
ATOM   4907  C CG     . ARG C 2 17 ? -1.514  2.615   9.181   1.00 0.00 ? 17  ARG A CG     3  
ATOM   4908  C CD     . ARG C 2 17 ? -1.203  1.241   9.779   1.00 0.00 ? 17  ARG A CD     3  
ATOM   4909  N NE     . ARG C 2 17 ? -1.492  1.379   11.234  1.00 0.00 ? 17  ARG A NE     3  
ATOM   4910  C CZ     . ARG C 2 17 ? -0.692  2.072   11.997  1.00 0.00 ? 17  ARG A CZ     3  
ATOM   4911  N NH1    . ARG C 2 17 ? 0.598   1.878   11.937  1.00 0.00 ? 17  ARG A NH1    3  
ATOM   4912  N NH2    . ARG C 2 17 ? -1.180  2.958   12.822  1.00 0.00 ? 17  ARG A NH2    3  
ATOM   4913  H H      . ARG C 2 17 ? 0.448   6.219   9.318   1.00 0.00 ? 17  ARG A H      3  
ATOM   4914  H HA     . ARG C 2 17 ? 0.047   4.085   7.247   1.00 0.00 ? 17  ARG A HA     3  
ATOM   4915  H HB2    . ARG C 2 17 ? 0.614   2.931   9.244   1.00 0.00 ? 17  ARG A HB2    3  
ATOM   4916  H HB3    . ARG C 2 17 ? -0.315  4.044   10.248  1.00 0.00 ? 17  ARG A HB3    3  
ATOM   4917  H HG2    . ARG C 2 17 ? -2.343  3.058   9.713   1.00 0.00 ? 17  ARG A HG2    3  
ATOM   4918  H HG3    . ARG C 2 17 ? -1.775  2.500   8.140   1.00 0.00 ? 17  ARG A HG3    3  
ATOM   4919  H HD2    . ARG C 2 17 ? -1.846  0.489   9.336   1.00 0.00 ? 17  ARG A HD2    3  
ATOM   4920  H HD3    . ARG C 2 17 ? -0.165  0.989   9.630   1.00 0.00 ? 17  ARG A HD3    3  
ATOM   4921  H HE     . ARG C 2 17 ? -2.285  0.949   11.619  1.00 0.00 ? 17  ARG A HE     3  
ATOM   4922  H HH11   . ARG C 2 17 ? 0.972   1.199   11.306  1.00 0.00 ? 17  ARG A HH11   3  
ATOM   4923  H HH12   . ARG C 2 17 ? 1.211   2.408   12.523  1.00 0.00 ? 17  ARG A HH12   3  
ATOM   4924  H HH21   . ARG C 2 17 ? -2.169  3.106   12.868  1.00 0.00 ? 17  ARG A HH21   3  
ATOM   4925  H HH22   . ARG C 2 17 ? -0.567  3.489   13.407  1.00 0.00 ? 17  ARG A HH22   3  
ATOM   4926  N N      . ARG C 2 18 ? -2.366  4.731   6.925   1.00 0.00 ? 18  ARG A N      3  
ATOM   4927  C CA     . ARG C 2 18 ? -3.746  5.228   6.672   1.00 0.00 ? 18  ARG A CA     3  
ATOM   4928  C C      . ARG C 2 18 ? -4.618  4.077   6.165   1.00 0.00 ? 18  ARG A C      3  
ATOM   4929  O O      . ARG C 2 18 ? -4.222  3.326   5.295   1.00 0.00 ? 18  ARG A O      3  
ATOM   4930  C CB     . ARG C 2 18 ? -3.601  6.306   5.598   1.00 0.00 ? 18  ARG A CB     3  
ATOM   4931  C CG     . ARG C 2 18 ? -4.968  6.938   5.323   1.00 0.00 ? 18  ARG A CG     3  
ATOM   4932  C CD     . ARG C 2 18 ? -5.486  7.615   6.595   1.00 0.00 ? 18  ARG A CD     3  
ATOM   4933  N NE     . ARG C 2 18 ? -6.732  6.878   6.946   1.00 0.00 ? 18  ARG A NE     3  
ATOM   4934  C CZ     . ARG C 2 18 ? -7.148  6.848   8.184   1.00 0.00 ? 18  ARG A CZ     3  
ATOM   4935  N NH1    . ARG C 2 18 ? -6.310  6.584   9.149   1.00 0.00 ? 18  ARG A NH1    3  
ATOM   4936  N NH2    . ARG C 2 18 ? -8.403  7.081   8.456   1.00 0.00 ? 18  ARG A NH2    3  
ATOM   4937  H H      . ARG C 2 18 ? -1.963  4.084   6.312   1.00 0.00 ? 18  ARG A H      3  
ATOM   4938  H HA     . ARG C 2 18 ? -4.165  5.652   7.570   1.00 0.00 ? 18  ARG A HA     3  
ATOM   4939  H HB2    . ARG C 2 18 ? -2.914  7.066   5.942   1.00 0.00 ? 18  ARG A HB2    3  
ATOM   4940  H HB3    . ARG C 2 18 ? -3.223  5.863   4.690   1.00 0.00 ? 18  ARG A HB3    3  
ATOM   4941  H HG2    . ARG C 2 18 ? -4.874  7.675   4.538   1.00 0.00 ? 18  ARG A HG2    3  
ATOM   4942  H HG3    . ARG C 2 18 ? -5.665  6.173   5.017   1.00 0.00 ? 18  ARG A HG3    3  
ATOM   4943  H HD2    . ARG C 2 18 ? -4.757  7.529   7.389   1.00 0.00 ? 18  ARG A HD2    3  
ATOM   4944  H HD3    . ARG C 2 18 ? -5.711  8.652   6.402   1.00 0.00 ? 18  ARG A HD3    3  
ATOM   4945  H HE     . ARG C 2 18 ? -7.240  6.415   6.248   1.00 0.00 ? 18  ARG A HE     3  
ATOM   4946  H HH11   . ARG C 2 18 ? -5.348  6.407   8.942   1.00 0.00 ? 18  ARG A HH11   3  
ATOM   4947  H HH12   . ARG C 2 18 ? -6.629  6.562   10.096  1.00 0.00 ? 18  ARG A HH12   3  
ATOM   4948  H HH21   . ARG C 2 18 ? -9.046  7.283   7.717   1.00 0.00 ? 18  ARG A HH21   3  
ATOM   4949  H HH22   . ARG C 2 18 ? -8.722  7.057   9.404   1.00 0.00 ? 18  ARG A HH22   3  
ATOM   4950  N N      . GLU C 2 19 ? -5.798  3.928   6.703   1.00 0.00 ? 19  GLU A N      3  
ATOM   4951  C CA     . GLU C 2 19 ? -6.687  2.818   6.251   1.00 0.00 ? 19  GLU A CA     3  
ATOM   4952  C C      . GLU C 2 19 ? -7.727  3.343   5.259   1.00 0.00 ? 19  GLU A C      3  
ATOM   4953  O O      . GLU C 2 19 ? -8.301  4.399   5.442   1.00 0.00 ? 19  GLU A O      3  
ATOM   4954  C CB     . GLU C 2 19 ? -7.361  2.301   7.525   1.00 0.00 ? 19  GLU A CB     3  
ATOM   4955  C CG     . GLU C 2 19 ? -6.912  0.862   7.794   1.00 0.00 ? 19  GLU A CG     3  
ATOM   4956  C CD     . GLU C 2 19 ? -7.609  0.336   9.050   1.00 0.00 ? 19  GLU A CD     3  
ATOM   4957  O OE1    . GLU C 2 19 ? -8.819  0.469   9.133   1.00 0.00 ? 19  GLU A OE1    3  
ATOM   4958  O OE2    . GLU C 2 19 ? -6.920  -0.190  9.910   1.00 0.00 ? 19  GLU A OE2    3  
ATOM   4959  H H      . GLU C 2 19 ? -6.098  4.541   7.407   1.00 0.00 ? 19  GLU A H      3  
ATOM   4960  H HA     . GLU C 2 19 ? -6.103  2.032   5.799   1.00 0.00 ? 19  GLU A HA     3  
ATOM   4961  H HB2    . GLU C 2 19 ? -7.080  2.927   8.360   1.00 0.00 ? 19  GLU A HB2    3  
ATOM   4962  H HB3    . GLU C 2 19 ? -8.433  2.325   7.402   1.00 0.00 ? 19  GLU A HB3    3  
ATOM   4963  H HG2    . GLU C 2 19 ? -7.174  0.240   6.949   1.00 0.00 ? 19  GLU A HG2    3  
ATOM   4964  H HG3    . GLU C 2 19 ? -5.841  0.839   7.942   1.00 0.00 ? 19  GLU A HG3    3  
ATOM   4965  N N      . VAL C 2 20 ? -7.963  2.612   4.204   1.00 0.00 ? 20  VAL A N      3  
ATOM   4966  C CA     . VAL C 2 20 ? -8.956  3.055   3.183   1.00 0.00 ? 20  VAL A CA     3  
ATOM   4967  C C      . VAL C 2 20 ? -10.124 2.067   3.128   1.00 0.00 ? 20  VAL A C      3  
ATOM   4968  O O      . VAL C 2 20 ? -10.000 0.984   2.593   1.00 0.00 ? 20  VAL A O      3  
ATOM   4969  C CB     . VAL C 2 20 ? -8.198  3.043   1.851   1.00 0.00 ? 20  VAL A CB     3  
ATOM   4970  C CG1    . VAL C 2 20 ? -9.018  3.775   0.788   1.00 0.00 ? 20  VAL A CG1    3  
ATOM   4971  C CG2    . VAL C 2 20 ? -6.844  3.742   2.016   1.00 0.00 ? 20  VAL A CG2    3  
ATOM   4972  H H      . VAL C 2 20 ? -7.482  1.768   4.079   1.00 0.00 ? 20  VAL A H      3  
ATOM   4973  H HA     . VAL C 2 20 ? -9.304  4.052   3.401   1.00 0.00 ? 20  VAL A HA     3  
ATOM   4974  H HB     . VAL C 2 20 ? -8.040  2.021   1.539   1.00 0.00 ? 20  VAL A HB     3  
ATOM   4975  H HG11   . VAL C 2 20 ? -9.686  3.076   0.305   1.00 0.00 ? 20  VAL A HG11   3  
ATOM   4976  H HG12   . VAL C 2 20 ? -8.355  4.206   0.054   1.00 0.00 ? 20  VAL A HG12   3  
ATOM   4977  H HG13   . VAL C 2 20 ? -9.596  4.559   1.256   1.00 0.00 ? 20  VAL A HG13   3  
ATOM   4978  H HG21   . VAL C 2 20 ? -6.310  3.716   1.077   1.00 0.00 ? 20  VAL A HG21   3  
ATOM   4979  H HG22   . VAL C 2 20 ? -6.267  3.232   2.772   1.00 0.00 ? 20  VAL A HG22   3  
ATOM   4980  H HG23   . VAL C 2 20 ? -7.002  4.769   2.313   1.00 0.00 ? 20  VAL A HG23   3  
ATOM   4981  N N      . PHE C 2 21 ? -11.258 2.426   3.671   1.00 0.00 ? 21  PHE A N      3  
ATOM   4982  C CA     . PHE C 2 21 ? -12.429 1.496   3.646   1.00 0.00 ? 21  PHE A CA     3  
ATOM   4983  C C      . PHE C 2 21 ? -13.216 1.658   2.340   1.00 0.00 ? 21  PHE A C      3  
ATOM   4984  O O      . PHE C 2 21 ? -14.429 1.580   2.327   1.00 0.00 ? 21  PHE A O      3  
ATOM   4985  C CB     . PHE C 2 21 ? -13.290 1.910   4.844   1.00 0.00 ? 21  PHE A CB     3  
ATOM   4986  C CG     . PHE C 2 21 ? -13.416 0.750   5.804   1.00 0.00 ? 21  PHE A CG     3  
ATOM   4987  C CD1    . PHE C 2 21 ? -13.996 -0.451  5.378   1.00 0.00 ? 21  PHE A CD1    3  
ATOM   4988  C CD2    . PHE C 2 21 ? -12.954 0.877   7.119   1.00 0.00 ? 21  PHE A CD2    3  
ATOM   4989  C CE1    . PHE C 2 21 ? -14.114 -1.525  6.267   1.00 0.00 ? 21  PHE A CE1    3  
ATOM   4990  C CE2    . PHE C 2 21 ? -13.071 -0.196  8.008   1.00 0.00 ? 21  PHE A CE2    3  
ATOM   4991  C CZ     . PHE C 2 21 ? -13.652 -1.397  7.582   1.00 0.00 ? 21  PHE A CZ     3  
ATOM   4992  H H      . PHE C 2 21 ? -11.340 3.306   4.097   1.00 0.00 ? 21  PHE A H      3  
ATOM   4993  H HA     . PHE C 2 21 ? -12.101 0.476   3.764   1.00 0.00 ? 21  PHE A HA     3  
ATOM   4994  H HB2    . PHE C 2 21 ? -12.826 2.745   5.349   1.00 0.00 ? 21  PHE A HB2    3  
ATOM   4995  H HB3    . PHE C 2 21 ? -14.272 2.199   4.500   1.00 0.00 ? 21  PHE A HB3    3  
ATOM   4996  H HD1    . PHE C 2 21 ? -14.352 -0.548  4.362   1.00 0.00 ? 21  PHE A HD1    3  
ATOM   4997  H HD2    . PHE C 2 21 ? -12.507 1.805   7.447   1.00 0.00 ? 21  PHE A HD2    3  
ATOM   4998  H HE1    . PHE C 2 21 ? -14.561 -2.452  5.939   1.00 0.00 ? 21  PHE A HE1    3  
ATOM   4999  H HE2    . PHE C 2 21 ? -12.716 -0.099  9.023   1.00 0.00 ? 21  PHE A HE2    3  
ATOM   5000  H HZ     . PHE C 2 21 ? -13.742 -2.227  8.270   1.00 0.00 ? 21  PHE A HZ     3  
ATOM   5001  N N      . ARG C 2 22 ? -12.532 1.865   1.244   1.00 0.00 ? 22  ARG A N      3  
ATOM   5002  C CA     . ARG C 2 22 ? -13.216 2.024   -0.075  1.00 0.00 ? 22  ARG A CA     3  
ATOM   5003  C C      . ARG C 2 22 ? -14.326 3.080   -0.006  1.00 0.00 ? 22  ARG A C      3  
ATOM   5004  O O      . ARG C 2 22 ? -14.790 3.452   1.055   1.00 0.00 ? 22  ARG A O      3  
ATOM   5005  C CB     . ARG C 2 22 ? -13.803 0.652   -0.379  1.00 0.00 ? 22  ARG A CB     3  
ATOM   5006  C CG     . ARG C 2 22 ? -12.784 -0.165  -1.171  1.00 0.00 ? 22  ARG A CG     3  
ATOM   5007  C CD     . ARG C 2 22 ? -12.825 0.250   -2.642  1.00 0.00 ? 22  ARG A CD     3  
ATOM   5008  N NE     . ARG C 2 22 ? -11.403 0.417   -3.026  1.00 0.00 ? 22  ARG A NE     3  
ATOM   5009  C CZ     . ARG C 2 22 ? -10.647 -0.632  -3.204  1.00 0.00 ? 22  ARG A CZ     3  
ATOM   5010  N NH1    . ARG C 2 22 ? -10.628 -1.232  -4.359  1.00 0.00 ? 22  ARG A NH1    3  
ATOM   5011  N NH2    . ARG C 2 22 ? -9.910  -1.079  -2.223  1.00 0.00 ? 22  ARG A NH2    3  
ATOM   5012  H H      . ARG C 2 22 ? -11.561 1.902   1.284   1.00 0.00 ? 22  ARG A H      3  
ATOM   5013  H HA     . ARG C 2 22 ? -12.500 2.288   -0.839  1.00 0.00 ? 22  ARG A HA     3  
ATOM   5014  H HB2    . ARG C 2 22 ? -14.034 0.144   0.547   1.00 0.00 ? 22  ARG A HB2    3  
ATOM   5015  H HB3    . ARG C 2 22 ? -14.701 0.768   -0.963  1.00 0.00 ? 22  ARG A HB3    3  
ATOM   5016  H HG2    . ARG C 2 22 ? -11.796 0.013   -0.773  1.00 0.00 ? 22  ARG A HG2    3  
ATOM   5017  H HG3    . ARG C 2 22 ? -13.021 -1.209  -1.089  1.00 0.00 ? 22  ARG A HG3    3  
ATOM   5018  H HD2    . ARG C 2 22 ? -13.288 -0.520  -3.236  1.00 0.00 ? 22  ARG A HD2    3  
ATOM   5019  H HD3    . ARG C 2 22 ? -13.351 1.185   -2.759  1.00 0.00 ? 22  ARG A HD3    3  
ATOM   5020  H HE     . ARG C 2 22 ? -11.035 1.314   -3.141  1.00 0.00 ? 22  ARG A HE     3  
ATOM   5021  H HH11   . ARG C 2 22 ? -11.191 -0.890  -5.110  1.00 0.00 ? 22  ARG A HH11   3  
ATOM   5022  H HH12   . ARG C 2 22 ? -10.049 -2.037  -4.496  1.00 0.00 ? 22  ARG A HH12   3  
ATOM   5023  H HH21   . ARG C 2 22 ? -9.925  -0.618  -1.336  1.00 0.00 ? 22  ARG A HH21   3  
ATOM   5024  H HH22   . ARG C 2 22 ? -9.330  -1.882  -2.359  1.00 0.00 ? 22  ARG A HH22   3  
ATOM   5025  N N      . LYS C 2 23 ? -14.755 3.567   -1.137  1.00 0.00 ? 23  LYS A N      3  
ATOM   5026  C CA     . LYS C 2 23 ? -15.834 4.593   -1.149  1.00 0.00 ? 23  LYS A CA     3  
ATOM   5027  C C      . LYS C 2 23 ? -16.960 4.172   -2.099  1.00 0.00 ? 23  LYS A C      3  
ATOM   5028  O O      . LYS C 2 23 ? -18.118 4.435   -1.843  1.00 0.00 ? 23  LYS A O      3  
ATOM   5029  C CB     . LYS C 2 23 ? -15.164 5.877   -1.648  1.00 0.00 ? 23  LYS A CB     3  
ATOM   5030  C CG     . LYS C 2 23 ? -15.298 6.977   -0.590  1.00 0.00 ? 23  LYS A CG     3  
ATOM   5031  C CD     . LYS C 2 23 ? -13.938 7.224   0.068   1.00 0.00 ? 23  LYS A CD     3  
ATOM   5032  C CE     . LYS C 2 23 ? -13.647 6.109   1.073   1.00 0.00 ? 23  LYS A CE     3  
ATOM   5033  N NZ     . LYS C 2 23 ? -12.641 6.688   2.007   1.00 0.00 ? 23  LYS A NZ     3  
ATOM   5034  H H      . LYS C 2 23 ? -14.365 3.259   -1.981  1.00 0.00 ? 23  LYS A H      3  
ATOM   5035  H HA     . LYS C 2 23 ? -16.219 4.741   -0.153  1.00 0.00 ? 23  LYS A HA     3  
ATOM   5036  H HB2    . LYS C 2 23 ? -14.119 5.685   -1.839  1.00 0.00 ? 23  LYS A HB2    3  
ATOM   5037  H HB3    . LYS C 2 23 ? -15.641 6.199   -2.561  1.00 0.00 ? 23  LYS A HB3    3  
ATOM   5038  H HG2    . LYS C 2 23 ? -15.642 7.887   -1.061  1.00 0.00 ? 23  LYS A HG2    3  
ATOM   5039  H HG3    . LYS C 2 23 ? -16.008 6.671   0.163   1.00 0.00 ? 23  LYS A HG3    3  
ATOM   5040  H HD2    . LYS C 2 23 ? -13.169 7.237   -0.690  1.00 0.00 ? 23  LYS A HD2    3  
ATOM   5041  H HD3    . LYS C 2 23 ? -13.954 8.174   0.580   1.00 0.00 ? 23  LYS A HD3    3  
ATOM   5042  H HE2    . LYS C 2 23 ? -14.548 5.841   1.607   1.00 0.00 ? 23  LYS A HE2    3  
ATOM   5043  H HE3    . LYS C 2 23 ? -13.233 5.248   0.572   1.00 0.00 ? 23  LYS A HE3    3  
ATOM   5044  H HZ1    . LYS C 2 23 ? -11.767 6.900   1.486   1.00 0.00 ? 23  LYS A HZ1    3  
ATOM   5045  H HZ2    . LYS C 2 23 ? -13.019 7.562   2.424   1.00 0.00 ? 23  LYS A HZ2    3  
ATOM   5046  H HZ3    . LYS C 2 23 ? -12.434 6.004   2.761   1.00 0.00 ? 23  LYS A HZ3    3  
ATOM   5047  N N      . SER C 2 24 ? -16.632 3.514   -3.191  1.00 0.00 ? 24  SER A N      3  
ATOM   5048  C CA     . SER C 2 24 ? -17.694 3.074   -4.164  1.00 0.00 ? 24  SER A CA     3  
ATOM   5049  C C      . SER C 2 24 ? -17.072 2.637   -5.496  1.00 0.00 ? 24  SER A C      3  
ATOM   5050  O O      . SER C 2 24 ? -15.871 2.509   -5.623  1.00 0.00 ? 24  SER A O      3  
ATOM   5051  C CB     . SER C 2 24 ? -18.590 4.298   -4.397  1.00 0.00 ? 24  SER A CB     3  
ATOM   5052  O OG     . SER C 2 24 ? -17.802 5.481   -4.336  1.00 0.00 ? 24  SER A OG     3  
ATOM   5053  H H      . SER C 2 24 ? -15.687 3.304   -3.368  1.00 0.00 ? 24  SER A H      3  
ATOM   5054  H HA     . SER C 2 24 ? -18.275 2.273   -3.743  1.00 0.00 ? 24  SER A HA     3  
ATOM   5055  H HB2    . SER C 2 24 ? -19.047 4.229   -5.370  1.00 0.00 ? 24  SER A HB2    3  
ATOM   5056  H HB3    . SER C 2 24 ? -19.363 4.327   -3.641  1.00 0.00 ? 24  SER A HB3    3  
ATOM   5057  H HG     . SER C 2 24 ? -18.393 6.222   -4.186  1.00 0.00 ? 24  SER A HG     3  
ATOM   5058  N N      . GLY C 2 25 ? -17.895 2.418   -6.492  1.00 0.00 ? 25  GLY A N      3  
ATOM   5059  C CA     . GLY C 2 25 ? -17.375 1.999   -7.827  1.00 0.00 ? 25  GLY A CA     3  
ATOM   5060  C C      . GLY C 2 25 ? -17.670 0.515   -8.059  1.00 0.00 ? 25  GLY A C      3  
ATOM   5061  O O      . GLY C 2 25 ? -18.309 0.138   -9.021  1.00 0.00 ? 25  GLY A O      3  
ATOM   5062  H H      . GLY C 2 25 ? -18.859 2.535   -6.362  1.00 0.00 ? 25  GLY A H      3  
ATOM   5063  H HA2    . GLY C 2 25 ? -17.850 2.586   -8.599  1.00 0.00 ? 25  GLY A HA2    3  
ATOM   5064  H HA3    . GLY C 2 25 ? -16.308 2.158   -7.861  1.00 0.00 ? 25  GLY A HA3    3  
ATOM   5065  N N      . ALA C 2 26 ? -17.190 -0.326  -7.186  1.00 0.00 ? 26  ALA A N      3  
ATOM   5066  C CA     . ALA C 2 26 ? -17.407 -1.798  -7.330  1.00 0.00 ? 26  ALA A CA     3  
ATOM   5067  C C      . ALA C 2 26 ? -16.684 -2.507  -6.188  1.00 0.00 ? 26  ALA A C      3  
ATOM   5068  O O      . ALA C 2 26 ? -17.170 -3.460  -5.611  1.00 0.00 ? 26  ALA A O      3  
ATOM   5069  C CB     . ALA C 2 26 ? -16.775 -2.168  -8.674  1.00 0.00 ? 26  ALA A CB     3  
ATOM   5070  H H      . ALA C 2 26 ? -16.670 0.013   -6.428  1.00 0.00 ? 26  ALA A H      3  
ATOM   5071  H HA     . ALA C 2 26 ? -18.460 -2.035  -7.328  1.00 0.00 ? 26  ALA A HA     3  
ATOM   5072  H HB1    . ALA C 2 26 ? -16.590 -3.232  -8.705  1.00 0.00 ? 26  ALA A HB1    3  
ATOM   5073  H HB2    . ALA C 2 26 ? -15.840 -1.637  -8.789  1.00 0.00 ? 26  ALA A HB2    3  
ATOM   5074  H HB3    . ALA C 2 26 ? -17.445 -1.895  -9.475  1.00 0.00 ? 26  ALA A HB3    3  
ATOM   5075  N N      . THR C 2 27 ? -15.525 -2.014  -5.853  1.00 0.00 ? 27  THR A N      3  
ATOM   5076  C CA     . THR C 2 27 ? -14.731 -2.596  -4.738  1.00 0.00 ? 27  THR A CA     3  
ATOM   5077  C C      . THR C 2 27 ? -15.191 -1.979  -3.407  1.00 0.00 ? 27  THR A C      3  
ATOM   5078  O O      . THR C 2 27 ? -14.573 -2.167  -2.378  1.00 0.00 ? 27  THR A O      3  
ATOM   5079  C CB     . THR C 2 27 ? -13.284 -2.191  -5.058  1.00 0.00 ? 27  THR A CB     3  
ATOM   5080  O OG1    . THR C 2 27 ? -13.225 -0.786  -5.285  1.00 0.00 ? 27  THR A OG1    3  
ATOM   5081  C CG2    . THR C 2 27 ? -12.807 -2.935  -6.312  1.00 0.00 ? 27  THR A CG2    3  
ATOM   5082  H H      . THR C 2 27 ? -15.179 -1.234  -6.333  1.00 0.00 ? 27  THR A H      3  
ATOM   5083  H HA     . THR C 2 27 ? -14.824 -3.670  -4.717  1.00 0.00 ? 27  THR A HA     3  
ATOM   5084  H HB     . THR C 2 27 ? -12.642 -2.441  -4.228  1.00 0.00 ? 27  THR A HB     3  
ATOM   5085  H HG1    . THR C 2 27 ? -13.366 -0.625  -6.221  1.00 0.00 ? 27  THR A HG1    3  
ATOM   5086  H HG21   . THR C 2 27 ? -11.781 -3.241  -6.180  1.00 0.00 ? 27  THR A HG21   3  
ATOM   5087  H HG22   . THR C 2 27 ? -12.879 -2.279  -7.170  1.00 0.00 ? 27  THR A HG22   3  
ATOM   5088  H HG23   . THR C 2 27 ? -13.425 -3.805  -6.471  1.00 0.00 ? 27  THR A HG23   3  
ATOM   5089  N N      . CYS C 2 28 ? -16.268 -1.230  -3.431  1.00 0.00 ? 28  CYS A N      3  
ATOM   5090  C CA     . CYS C 2 28 ? -16.779 -0.579  -2.187  1.00 0.00 ? 28  CYS A CA     3  
ATOM   5091  C C      . CYS C 2 28 ? -16.878 -1.578  -1.033  1.00 0.00 ? 28  CYS A C      3  
ATOM   5092  O O      . CYS C 2 28 ? -17.407 -2.662  -1.180  1.00 0.00 ? 28  CYS A O      3  
ATOM   5093  C CB     . CYS C 2 28 ? -18.172 -0.068  -2.554  1.00 0.00 ? 28  CYS A CB     3  
ATOM   5094  S SG     . CYS C 2 28 ? -18.694 1.181   -1.351  1.00 0.00 ? 28  CYS A SG     3  
ATOM   5095  H H      . CYS C 2 28 ? -16.741 -1.086  -4.275  1.00 0.00 ? 28  CYS A H      3  
ATOM   5096  H HA     . CYS C 2 28 ? -16.151 0.251   -1.914  1.00 0.00 ? 28  CYS A HA     3  
ATOM   5097  H HB2    . CYS C 2 28 ? -18.147 0.369   -3.541  1.00 0.00 ? 28  CYS A HB2    3  
ATOM   5098  H HB3    . CYS C 2 28 ? -18.872 -0.892  -2.544  1.00 0.00 ? 28  CYS A HB3    3  
ATOM   5099  H HG     . CYS C 2 28 ? -19.562 0.934   -1.026  1.00 0.00 ? 28  CYS A HG     3  
ATOM   5100  N N      . GLY C 2 29 ? -16.388 -1.208  0.120   1.00 0.00 ? 29  GLY A N      3  
ATOM   5101  C CA     . GLY C 2 29 ? -16.471 -2.127  1.294   1.00 0.00 ? 29  GLY A CA     3  
ATOM   5102  C C      . GLY C 2 29 ? -15.125 -2.818  1.536   1.00 0.00 ? 29  GLY A C      3  
ATOM   5103  O O      . GLY C 2 29 ? -14.946 -3.505  2.523   1.00 0.00 ? 29  GLY A O      3  
ATOM   5104  H H      . GLY C 2 29 ? -15.977 -0.319  0.215   1.00 0.00 ? 29  GLY A H      3  
ATOM   5105  H HA2    . GLY C 2 29 ? -16.743 -1.559  2.171   1.00 0.00 ? 29  GLY A HA2    3  
ATOM   5106  H HA3    . GLY C 2 29 ? -17.226 -2.877  1.106   1.00 0.00 ? 29  GLY A HA3    3  
ATOM   5107  N N      . ARG C 2 30 ? -14.176 -2.646  0.654   1.00 0.00 ? 30  ARG A N      3  
ATOM   5108  C CA     . ARG C 2 30 ? -12.849 -3.298  0.856   1.00 0.00 ? 30  ARG A CA     3  
ATOM   5109  C C      . ARG C 2 30 ? -11.921 -2.346  1.616   1.00 0.00 ? 30  ARG A C      3  
ATOM   5110  O O      . ARG C 2 30 ? -11.767 -1.196  1.251   1.00 0.00 ? 30  ARG A O      3  
ATOM   5111  C CB     . ARG C 2 30 ? -12.318 -3.579  -0.553  1.00 0.00 ? 30  ARG A CB     3  
ATOM   5112  C CG     . ARG C 2 30 ? -12.628 -5.027  -0.942  1.00 0.00 ? 30  ARG A CG     3  
ATOM   5113  C CD     . ARG C 2 30 ? -14.145 -5.240  -0.972  1.00 0.00 ? 30  ARG A CD     3  
ATOM   5114  N NE     . ARG C 2 30 ? -14.351 -6.438  -1.833  1.00 0.00 ? 30  ARG A NE     3  
ATOM   5115  C CZ     . ARG C 2 30 ? -15.548 -6.940  -1.974  1.00 0.00 ? 30  ARG A CZ     3  
ATOM   5116  N NH1    . ARG C 2 30 ? -16.140 -7.511  -0.961  1.00 0.00 ? 30  ARG A NH1    3  
ATOM   5117  N NH2    . ARG C 2 30 ? -16.153 -6.872  -3.128  1.00 0.00 ? 30  ARG A NH2    3  
ATOM   5118  H H      . ARG C 2 30 ? -14.333 -2.086  -0.133  1.00 0.00 ? 30  ARG A H      3  
ATOM   5119  H HA     . ARG C 2 30 ? -12.964 -4.223  1.399   1.00 0.00 ? 30  ARG A HA     3  
ATOM   5120  H HB2    . ARG C 2 30 ? -12.791 -2.912  -1.256  1.00 0.00 ? 30  ARG A HB2    3  
ATOM   5121  H HB3    . ARG C 2 30 ? -11.250 -3.424  -0.572  1.00 0.00 ? 30  ARG A HB3    3  
ATOM   5122  H HG2    . ARG C 2 30 ? -12.217 -5.230  -1.922  1.00 0.00 ? 30  ARG A HG2    3  
ATOM   5123  H HG3    . ARG C 2 30 ? -12.186 -5.697  -0.220  1.00 0.00 ? 30  ARG A HG3    3  
ATOM   5124  H HD2    . ARG C 2 30 ? -14.516 -5.422  0.026   1.00 0.00 ? 30  ARG A HD2    3  
ATOM   5125  H HD3    . ARG C 2 30 ? -14.635 -4.383  -1.407  1.00 0.00 ? 30  ARG A HD3    3  
ATOM   5126  H HE     . ARG C 2 30 ? -13.591 -6.849  -2.294  1.00 0.00 ? 30  ARG A HE     3  
ATOM   5127  H HH11   . ARG C 2 30 ? -15.677 -7.564  -0.076  1.00 0.00 ? 30  ARG A HH11   3  
ATOM   5128  H HH12   . ARG C 2 30 ? -17.057 -7.895  -1.069  1.00 0.00 ? 30  ARG A HH12   3  
ATOM   5129  H HH21   . ARG C 2 30 ? -15.700 -6.435  -3.905  1.00 0.00 ? 30  ARG A HH21   3  
ATOM   5130  H HH22   . ARG C 2 30 ? -17.069 -7.257  -3.236  1.00 0.00 ? 30  ARG A HH22   3  
ATOM   5131  N N      . SER C 2 31 ? -11.316 -2.809  2.677   1.00 0.00 ? 31  SER A N      3  
ATOM   5132  C CA     . SER C 2 31 ? -10.415 -1.922  3.469   1.00 0.00 ? 31  SER A CA     3  
ATOM   5133  C C      . SER C 2 31 ? -8.947  -2.174  3.115   1.00 0.00 ? 31  SER A C      3  
ATOM   5134  O O      . SER C 2 31 ? -8.452  -3.280  3.212   1.00 0.00 ? 31  SER A O      3  
ATOM   5135  C CB     . SER C 2 31 ? -10.685 -2.290  4.927   1.00 0.00 ? 31  SER A CB     3  
ATOM   5136  O OG     . SER C 2 31 ? -10.707 -3.705  5.059   1.00 0.00 ? 31  SER A OG     3  
ATOM   5137  H H      . SER C 2 31 ? -11.466 -3.735  2.961   1.00 0.00 ? 31  SER A H      3  
ATOM   5138  H HA     . SER C 2 31 ? -10.668 -0.889  3.305   1.00 0.00 ? 31  SER A HA     3  
ATOM   5139  H HB2    . SER C 2 31 ? -9.905  -1.886  5.552   1.00 0.00 ? 31  SER A HB2    3  
ATOM   5140  H HB3    . SER C 2 31 ? -11.636 -1.873  5.229   1.00 0.00 ? 31  SER A HB3    3  
ATOM   5141  H HG     . SER C 2 31 ? -11.223 -3.922  5.839   1.00 0.00 ? 31  SER A HG     3  
ATOM   5142  N N      . ASP C 2 32 ? -8.248  -1.145  2.715   1.00 0.00 ? 32  ASP A N      3  
ATOM   5143  C CA     . ASP C 2 32 ? -6.807  -1.300  2.362   1.00 0.00 ? 32  ASP A CA     3  
ATOM   5144  C C      . ASP C 2 32 ? -5.967  -0.335  3.196   1.00 0.00 ? 32  ASP A C      3  
ATOM   5145  O O      . ASP C 2 32 ? -6.252  0.841   3.270   1.00 0.00 ? 32  ASP A O      3  
ATOM   5146  C CB     . ASP C 2 32 ? -6.719  -0.952  0.875   1.00 0.00 ? 32  ASP A CB     3  
ATOM   5147  C CG     . ASP C 2 32 ? -7.130  -2.167  0.040   1.00 0.00 ? 32  ASP A CG     3  
ATOM   5148  O OD1    . ASP C 2 32 ? -8.112  -2.799  0.393   1.00 0.00 ? 32  ASP A OD1    3  
ATOM   5149  O OD2    . ASP C 2 32 ? -6.456  -2.443  -0.939  1.00 0.00 ? 32  ASP A OD2    3  
ATOM   5150  H H      . ASP C 2 32 ? -8.671  -0.263  2.654   1.00 0.00 ? 32  ASP A H      3  
ATOM   5151  H HA     . ASP C 2 32 ? -6.485  -2.313  2.524   1.00 0.00 ? 32  ASP A HA     3  
ATOM   5152  H HB2    . ASP C 2 32 ? -7.380  -0.125  0.660   1.00 0.00 ? 32  ASP A HB2    3  
ATOM   5153  H HB3    . ASP C 2 32 ? -5.705  -0.676  0.630   1.00 0.00 ? 32  ASP A HB3    3  
ATOM   5154  N N      . THR C 2 33 ? -4.934  -0.822  3.827   1.00 0.00 ? 33  THR A N      3  
ATOM   5155  C CA     . THR C 2 33 ? -4.087  0.074   4.664   1.00 0.00 ? 33  THR A CA     3  
ATOM   5156  C C      . THR C 2 33 ? -2.843  0.506   3.885   1.00 0.00 ? 33  THR A C      3  
ATOM   5157  O O      . THR C 2 33 ? -2.033  -0.306  3.485   1.00 0.00 ? 33  THR A O      3  
ATOM   5158  C CB     . THR C 2 33 ? -3.699  -0.770  5.881   1.00 0.00 ? 33  THR A CB     3  
ATOM   5159  O OG1    . THR C 2 33 ? -4.874  -1.307  6.473   1.00 0.00 ? 33  THR A OG1    3  
ATOM   5160  C CG2    . THR C 2 33 ? -2.967  0.104   6.900   1.00 0.00 ? 33  THR A CG2    3  
ATOM   5161  H H      . THR C 2 33 ? -4.721  -1.776  3.758   1.00 0.00 ? 33  THR A H      3  
ATOM   5162  H HA     . THR C 2 33 ? -4.650  0.938   4.980   1.00 0.00 ? 33  THR A HA     3  
ATOM   5163  H HB     . THR C 2 33 ? -3.051  -1.575  5.571   1.00 0.00 ? 33  THR A HB     3  
ATOM   5164  H HG1    . THR C 2 33 ? -4.899  -2.247  6.281   1.00 0.00 ? 33  THR A HG1    3  
ATOM   5165  H HG21   . THR C 2 33 ? -2.487  -0.526  7.635   1.00 0.00 ? 33  THR A HG21   3  
ATOM   5166  H HG22   . THR C 2 33 ? -3.676  0.755   7.391   1.00 0.00 ? 33  THR A HG22   3  
ATOM   5167  H HG23   . THR C 2 33 ? -2.222  0.700   6.394   1.00 0.00 ? 33  THR A HG23   3  
ATOM   5168  N N      . TYR C 2 34 ? -2.697  1.785   3.664   1.00 0.00 ? 34  TYR A N      3  
ATOM   5169  C CA     . TYR C 2 34 ? -1.515  2.289   2.909   1.00 0.00 ? 34  TYR A CA     3  
ATOM   5170  C C      . TYR C 2 34 ? -0.483  2.869   3.878   1.00 0.00 ? 34  TYR A C      3  
ATOM   5171  O O      . TYR C 2 34 ? -0.821  3.324   4.954   1.00 0.00 ? 34  TYR A O      3  
ATOM   5172  C CB     . TYR C 2 34 ? -2.074  3.382   2.001   1.00 0.00 ? 34  TYR A CB     3  
ATOM   5173  C CG     . TYR C 2 34 ? -2.947  2.751   0.945   1.00 0.00 ? 34  TYR A CG     3  
ATOM   5174  C CD1    . TYR C 2 34 ? -4.239  2.314   1.268   1.00 0.00 ? 34  TYR A CD1    3  
ATOM   5175  C CD2    . TYR C 2 34 ? -2.463  2.601   -0.358  1.00 0.00 ? 34  TYR A CD2    3  
ATOM   5176  C CE1    . TYR C 2 34 ? -5.042  1.726   0.284   1.00 0.00 ? 34  TYR A CE1    3  
ATOM   5177  C CE2    . TYR C 2 34 ? -3.267  2.014   -1.340  1.00 0.00 ? 34  TYR A CE2    3  
ATOM   5178  C CZ     . TYR C 2 34 ? -4.556  1.576   -1.019  1.00 0.00 ? 34  TYR A CZ     3  
ATOM   5179  O OH     . TYR C 2 34 ? -5.349  0.996   -1.989  1.00 0.00 ? 34  TYR A OH     3  
ATOM   5180  H H      . TYR C 2 34 ? -3.369  2.416   3.995   1.00 0.00 ? 34  TYR A H      3  
ATOM   5181  H HA     . TYR C 2 34 ? -1.082  1.500   2.313   1.00 0.00 ? 34  TYR A HA     3  
ATOM   5182  H HB2    . TYR C 2 34 ? -2.661  4.074   2.591   1.00 0.00 ? 34  TYR A HB2    3  
ATOM   5183  H HB3    . TYR C 2 34 ? -1.259  3.909   1.527   1.00 0.00 ? 34  TYR A HB3    3  
ATOM   5184  H HD1    . TYR C 2 34 ? -4.615  2.427   2.274   1.00 0.00 ? 34  TYR A HD1    3  
ATOM   5185  H HD2    . TYR C 2 34 ? -1.468  2.940   -0.606  1.00 0.00 ? 34  TYR A HD2    3  
ATOM   5186  H HE1    . TYR C 2 34 ? -6.036  1.390   0.532   1.00 0.00 ? 34  TYR A HE1    3  
ATOM   5187  H HE2    . TYR C 2 34 ? -2.890  1.898   -2.344  1.00 0.00 ? 34  TYR A HE2    3  
ATOM   5188  H HH     . TYR C 2 34 ? -5.676  0.162   -1.645  1.00 0.00 ? 34  TYR A HH     3  
ATOM   5189  N N      . TYR C 2 35 ? 0.771   2.861   3.509   1.00 0.00 ? 35  TYR A N      3  
ATOM   5190  C CA     . TYR C 2 35 ? 1.817   3.417   4.421   1.00 0.00 ? 35  TYR A CA     3  
ATOM   5191  C C      . TYR C 2 35 ? 2.849   4.209   3.621   1.00 0.00 ? 35  TYR A C      3  
ATOM   5192  O O      . TYR C 2 35 ? 3.208   3.844   2.518   1.00 0.00 ? 35  TYR A O      3  
ATOM   5193  C CB     . TYR C 2 35 ? 2.503   2.214   5.090   1.00 0.00 ? 35  TYR A CB     3  
ATOM   5194  C CG     . TYR C 2 35 ? 1.583   1.017   5.122   1.00 0.00 ? 35  TYR A CG     3  
ATOM   5195  C CD1    . TYR C 2 35 ? 1.453   0.206   3.989   1.00 0.00 ? 35  TYR A CD1    3  
ATOM   5196  C CD2    . TYR C 2 35 ? 0.864   0.718   6.283   1.00 0.00 ? 35  TYR A CD2    3  
ATOM   5197  C CE1    . TYR C 2 35 ? 0.603   -0.904  4.017   1.00 0.00 ? 35  TYR A CE1    3  
ATOM   5198  C CE2    . TYR C 2 35 ? 0.014   -0.393  6.313   1.00 0.00 ? 35  TYR A CE2    3  
ATOM   5199  C CZ     . TYR C 2 35 ? -0.117  -1.204  5.179   1.00 0.00 ? 35  TYR A CZ     3  
ATOM   5200  O OH     . TYR C 2 35 ? -0.956  -2.297  5.204   1.00 0.00 ? 35  TYR A OH     3  
ATOM   5201  H H      . TYR C 2 35 ? 1.024   2.490   2.639   1.00 0.00 ? 35  TYR A H      3  
ATOM   5202  H HA     . TYR C 2 35 ? 1.364   4.044   5.172   1.00 0.00 ? 35  TYR A HA     3  
ATOM   5203  H HB2    . TYR C 2 35 ? 3.394   1.960   4.537   1.00 0.00 ? 35  TYR A HB2    3  
ATOM   5204  H HB3    . TYR C 2 35 ? 2.777   2.479   6.101   1.00 0.00 ? 35  TYR A HB3    3  
ATOM   5205  H HD1    . TYR C 2 35 ? 2.010   0.437   3.093   1.00 0.00 ? 35  TYR A HD1    3  
ATOM   5206  H HD2    . TYR C 2 35 ? 0.968   1.346   7.157   1.00 0.00 ? 35  TYR A HD2    3  
ATOM   5207  H HE1    . TYR C 2 35 ? 0.502   -1.530  3.142   1.00 0.00 ? 35  TYR A HE1    3  
ATOM   5208  H HE2    . TYR C 2 35 ? -0.541  -0.624  7.209   1.00 0.00 ? 35  TYR A HE2    3  
ATOM   5209  H HH     . TYR C 2 35 ? -0.544  -2.974  5.745   1.00 0.00 ? 35  TYR A HH     3  
ATOM   5210  N N      . GLN C 2 36 ? 3.347   5.276   4.180   1.00 0.00 ? 36  GLN A N      3  
ATOM   5211  C CA     . GLN C 2 36 ? 4.379   6.077   3.468   1.00 0.00 ? 36  GLN A CA     3  
ATOM   5212  C C      . GLN C 2 36 ? 5.721   5.889   4.172   1.00 0.00 ? 36  GLN A C      3  
ATOM   5213  O O      . GLN C 2 36 ? 5.785   5.802   5.383   1.00 0.00 ? 36  GLN A O      3  
ATOM   5214  C CB     . GLN C 2 36 ? 3.915   7.531   3.572   1.00 0.00 ? 36  GLN A CB     3  
ATOM   5215  C CG     . GLN C 2 36 ? 4.901   8.438   2.828   1.00 0.00 ? 36  GLN A CG     3  
ATOM   5216  C CD     . GLN C 2 36 ? 4.591   9.902   3.148   1.00 0.00 ? 36  GLN A CD     3  
ATOM   5217  O OE1    . GLN C 2 36 ? 3.696   10.485  2.569   1.00 0.00 ? 36  GLN A OE1    3  
ATOM   5218  N NE2    . GLN C 2 36 ? 5.298   10.524  4.052   1.00 0.00 ? 36  GLN A NE2    3  
ATOM   5219  H H      . GLN C 2 36 ? 3.055   5.539   5.077   1.00 0.00 ? 36  GLN A H      3  
ATOM   5220  H HA     . GLN C 2 36 ? 4.446   5.779   2.433   1.00 0.00 ? 36  GLN A HA     3  
ATOM   5221  H HB2    . GLN C 2 36 ? 2.933   7.627   3.131   1.00 0.00 ? 36  GLN A HB2    3  
ATOM   5222  H HB3    . GLN C 2 36 ? 3.874   7.823   4.610   1.00 0.00 ? 36  GLN A HB3    3  
ATOM   5223  H HG2    . GLN C 2 36 ? 5.911   8.208   3.138   1.00 0.00 ? 36  GLN A HG2    3  
ATOM   5224  H HG3    . GLN C 2 36 ? 4.808   8.278   1.763   1.00 0.00 ? 36  GLN A HG3    3  
ATOM   5225  H HE21   . GLN C 2 36 ? 6.020   10.054  4.518   1.00 0.00 ? 36  GLN A HE21   3  
ATOM   5226  H HE22   . GLN C 2 36 ? 5.106   11.461  4.263   1.00 0.00 ? 36  GLN A HE22   3  
ATOM   5227  N N      . SER C 2 37 ? 6.791   5.818   3.427   1.00 0.00 ? 37  SER A N      3  
ATOM   5228  C CA     . SER C 2 37 ? 8.130   5.629   4.061   1.00 0.00 ? 37  SER A CA     3  
ATOM   5229  C C      . SER C 2 37 ? 8.377   6.722   5.104   1.00 0.00 ? 37  SER A C      3  
ATOM   5230  O O      . SER C 2 37 ? 7.499   7.516   5.381   1.00 0.00 ? 37  SER A O      3  
ATOM   5231  C CB     . SER C 2 37 ? 9.125   5.729   2.913   1.00 0.00 ? 37  SER A CB     3  
ATOM   5232  O OG     . SER C 2 37 ? 9.428   7.097   2.665   1.00 0.00 ? 37  SER A OG     3  
ATOM   5233  H H      . SER C 2 37 ? 6.715   5.885   2.452   1.00 0.00 ? 37  SER A H      3  
ATOM   5234  H HA     . SER C 2 37 ? 8.193   4.654   4.517   1.00 0.00 ? 37  SER A HA     3  
ATOM   5235  H HB2    . SER C 2 37 ? 10.027  5.206   3.173   1.00 0.00 ? 37  SER A HB2    3  
ATOM   5236  H HB3    . SER C 2 37 ? 8.693   5.280   2.033   1.00 0.00 ? 37  SER A HB3    3  
ATOM   5237  H HG     . SER C 2 37 ? 8.605   7.554   2.475   1.00 0.00 ? 37  SER A HG     3  
ATOM   5238  N N      . PRO C 2 38 ? 9.555   6.726   5.670   1.00 0.00 ? 38  PRO A N      3  
ATOM   5239  C CA     . PRO C 2 38 ? 9.869   7.724   6.699   1.00 0.00 ? 38  PRO A CA     3  
ATOM   5240  C C      . PRO C 2 38 ? 10.321  9.046   6.084   1.00 0.00 ? 38  PRO A C      3  
ATOM   5241  O O      . PRO C 2 38 ? 10.485  10.025  6.786   1.00 0.00 ? 38  PRO A O      3  
ATOM   5242  C CB     . PRO C 2 38 ? 10.993  7.078   7.496   1.00 0.00 ? 38  PRO A CB     3  
ATOM   5243  C CG     . PRO C 2 38 ? 11.642  6.106   6.563   1.00 0.00 ? 38  PRO A CG     3  
ATOM   5244  C CD     . PRO C 2 38 ? 10.687  5.829   5.423   1.00 0.00 ? 38  PRO A CD     3  
ATOM   5245  H HA     . PRO C 2 38 ? 9.022   7.878   7.330   1.00 0.00 ? 38  PRO A HA     3  
ATOM   5246  H HB2    . PRO C 2 38 ? 11.703  7.828   7.814   1.00 0.00 ? 38  PRO A HB2    3  
ATOM   5247  H HB3    . PRO C 2 38 ? 10.591  6.555   8.351   1.00 0.00 ? 38  PRO A HB3    3  
ATOM   5248  H HG2    . PRO C 2 38 ? 12.559  6.530   6.182   1.00 0.00 ? 38  PRO A HG2    3  
ATOM   5249  H HG3    . PRO C 2 38 ? 11.854  5.189   7.089   1.00 0.00 ? 38  PRO A HG3    3  
ATOM   5250  H HD2    . PRO C 2 38 ? 11.157  6.062   4.478   1.00 0.00 ? 38  PRO A HD2    3  
ATOM   5251  H HD3    . PRO C 2 38 ? 10.360  4.802   5.441   1.00 0.00 ? 38  PRO A HD3    3  
ATOM   5252  N N      . THR C 2 39 ? 10.529  9.108   4.791   1.00 0.00 ? 39  THR A N      3  
ATOM   5253  C CA     . THR C 2 39 ? 10.972  10.411  4.213   1.00 0.00 ? 39  THR A CA     3  
ATOM   5254  C C      . THR C 2 39 ? 10.902  10.436  2.678   1.00 0.00 ? 39  THR A C      3  
ATOM   5255  O O      . THR C 2 39 ? 11.816  10.894  2.022   1.00 0.00 ? 39  THR A O      3  
ATOM   5256  C CB     . THR C 2 39 ? 12.413  10.570  4.701   1.00 0.00 ? 39  THR A CB     3  
ATOM   5257  O OG1    . THR C 2 39 ? 12.921  11.826  4.275   1.00 0.00 ? 39  THR A OG1    3  
ATOM   5258  C CG2    . THR C 2 39 ? 13.280  9.444   4.133   1.00 0.00 ? 39  THR A CG2    3  
ATOM   5259  H H      . THR C 2 39 ? 10.401  8.319   4.217   1.00 0.00 ? 39  THR A H      3  
ATOM   5260  H HA     . THR C 2 39 ? 10.373  11.210  4.617   1.00 0.00 ? 39  THR A HA     3  
ATOM   5261  H HB     . THR C 2 39 ? 12.427  10.519  5.783   1.00 0.00 ? 39  THR A HB     3  
ATOM   5262  H HG1    . THR C 2 39 ? 13.026  11.796  3.321   1.00 0.00 ? 39  THR A HG1    3  
ATOM   5263  H HG21   . THR C 2 39 ? 13.218  9.451   3.055   1.00 0.00 ? 39  THR A HG21   3  
ATOM   5264  H HG22   . THR C 2 39 ? 12.929  8.496   4.509   1.00 0.00 ? 39  THR A HG22   3  
ATOM   5265  H HG23   . THR C 2 39 ? 14.306  9.594   4.436   1.00 0.00 ? 39  THR A HG23   3  
ATOM   5266  N N      . GLY C 2 40 ? 9.811   9.997   2.101   1.00 0.00 ? 40  GLY A N      3  
ATOM   5267  C CA     . GLY C 2 40 ? 9.688   10.060  0.612   1.00 0.00 ? 40  GLY A CA     3  
ATOM   5268  C C      . GLY C 2 40 ? 9.649   8.664   -0.019  1.00 0.00 ? 40  GLY A C      3  
ATOM   5269  O O      . GLY C 2 40 ? 10.663  8.117   -0.403  1.00 0.00 ? 40  GLY A O      3  
ATOM   5270  H H      . GLY C 2 40 ? 9.066   9.663   2.644   1.00 0.00 ? 40  GLY A H      3  
ATOM   5271  H HA2    . GLY C 2 40 ? 8.774   10.580  0.361   1.00 0.00 ? 40  GLY A HA2    3  
ATOM   5272  H HA3    . GLY C 2 40 ? 10.528  10.606  0.210   1.00 0.00 ? 40  GLY A HA3    3  
ATOM   5273  N N      . ASP C 2 41 ? 8.470   8.110   -0.158  1.00 0.00 ? 41  ASP A N      3  
ATOM   5274  C CA     . ASP C 2 41 ? 8.303   6.761   -0.798  1.00 0.00 ? 41  ASP A CA     3  
ATOM   5275  C C      . ASP C 2 41 ? 6.903   6.228   -0.486  1.00 0.00 ? 41  ASP A C      3  
ATOM   5276  O O      . ASP C 2 41 ? 6.602   5.868   0.636   1.00 0.00 ? 41  ASP A O      3  
ATOM   5277  C CB     . ASP C 2 41 ? 9.373   5.843   -0.195  1.00 0.00 ? 41  ASP A CB     3  
ATOM   5278  C CG     . ASP C 2 41 ? 10.437  5.532   -1.251  1.00 0.00 ? 41  ASP A CG     3  
ATOM   5279  O OD1    . ASP C 2 41 ? 10.059  5.219   -2.368  1.00 0.00 ? 41  ASP A OD1    3  
ATOM   5280  O OD2    . ASP C 2 41 ? 11.609  5.613   -0.925  1.00 0.00 ? 41  ASP A OD2    3  
ATOM   5281  H H      . ASP C 2 41 ? 7.676   8.597   0.141   1.00 0.00 ? 41  ASP A H      3  
ATOM   5282  H HA     . ASP C 2 41 ? 8.441   6.838   -1.866  1.00 0.00 ? 41  ASP A HA     3  
ATOM   5283  H HB2    . ASP C 2 41 ? 9.837   6.334   0.647   1.00 0.00 ? 41  ASP A HB2    3  
ATOM   5284  H HB3    . ASP C 2 41 ? 8.915   4.922   0.130   1.00 0.00 ? 41  ASP A HB3    3  
ATOM   5285  N N      . ARG C 2 42 ? 6.040   6.188   -1.466  1.00 0.00 ? 42  ARG A N      3  
ATOM   5286  C CA     . ARG C 2 42 ? 4.651   5.696   -1.222  1.00 0.00 ? 42  ARG A CA     3  
ATOM   5287  C C      . ARG C 2 42 ? 4.611   4.167   -1.194  1.00 0.00 ? 42  ARG A C      3  
ATOM   5288  O O      . ARG C 2 42 ? 4.874   3.508   -2.180  1.00 0.00 ? 42  ARG A O      3  
ATOM   5289  C CB     . ARG C 2 42 ? 3.829   6.235   -2.393  1.00 0.00 ? 42  ARG A CB     3  
ATOM   5290  C CG     . ARG C 2 42 ? 3.576   7.730   -2.193  1.00 0.00 ? 42  ARG A CG     3  
ATOM   5291  C CD     . ARG C 2 42 ? 2.646   7.936   -0.994  1.00 0.00 ? 42  ARG A CD     3  
ATOM   5292  N NE     . ARG C 2 42 ? 1.416   8.553   -1.564  1.00 0.00 ? 42  ARG A NE     3  
ATOM   5293  C CZ     . ARG C 2 42 ? 0.553   7.816   -2.205  1.00 0.00 ? 42  ARG A CZ     3  
ATOM   5294  N NH1    . ARG C 2 42 ? -0.347  7.140   -1.544  1.00 0.00 ? 42  ARG A NH1    3  
ATOM   5295  N NH2    . ARG C 2 42 ? 0.588   7.754   -3.507  1.00 0.00 ? 42  ARG A NH2    3  
ATOM   5296  H H      . ARG C 2 42 ? 6.301   6.495   -2.360  1.00 0.00 ? 42  ARG A H      3  
ATOM   5297  H HA     . ARG C 2 42 ? 4.272   6.097   -0.296  1.00 0.00 ? 42  ARG A HA     3  
ATOM   5298  H HB2    . ARG C 2 42 ? 4.371   6.079   -3.315  1.00 0.00 ? 42  ARG A HB2    3  
ATOM   5299  H HB3    . ARG C 2 42 ? 2.883   5.715   -2.438  1.00 0.00 ? 42  ARG A HB3    3  
ATOM   5300  H HG2    . ARG C 2 42 ? 4.515   8.232   -2.011  1.00 0.00 ? 42  ARG A HG2    3  
ATOM   5301  H HG3    . ARG C 2 42 ? 3.115   8.138   -3.079  1.00 0.00 ? 42  ARG A HG3    3  
ATOM   5302  H HD2    . ARG C 2 42 ? 2.413   6.988   -0.530  1.00 0.00 ? 42  ARG A HD2    3  
ATOM   5303  H HD3    . ARG C 2 42 ? 3.097   8.605   -0.278  1.00 0.00 ? 42  ARG A HD3    3  
ATOM   5304  H HE     . ARG C 2 42 ? 1.258   9.514   -1.458  1.00 0.00 ? 42  ARG A HE     3  
ATOM   5305  H HH11   . ARG C 2 42 ? -0.374  7.188   -0.545  1.00 0.00 ? 42  ARG A HH11   3  
ATOM   5306  H HH12   . ARG C 2 42 ? -1.009  6.575   -2.035  1.00 0.00 ? 42  ARG A HH12   3  
ATOM   5307  H HH21   . ARG C 2 42 ? 1.278   8.272   -4.014  1.00 0.00 ? 42  ARG A HH21   3  
ATOM   5308  H HH22   . ARG C 2 42 ? -0.074  7.189   -4.000  1.00 0.00 ? 42  ARG A HH22   3  
ATOM   5309  N N      . ILE C 2 43 ? 4.269   3.602   -0.067  1.00 0.00 ? 43  ILE A N      3  
ATOM   5310  C CA     . ILE C 2 43 ? 4.190   2.117   0.044   1.00 0.00 ? 43  ILE A CA     3  
ATOM   5311  C C      . ILE C 2 43 ? 2.728   1.706   0.254   1.00 0.00 ? 43  ILE A C      3  
ATOM   5312  O O      . ILE C 2 43 ? 1.948   2.443   0.825   1.00 0.00 ? 43  ILE A O      3  
ATOM   5313  C CB     . ILE C 2 43 ? 5.062   1.776   1.258   1.00 0.00 ? 43  ILE A CB     3  
ATOM   5314  C CG1    . ILE C 2 43 ? 6.530   1.791   0.827   1.00 0.00 ? 43  ILE A CG1    3  
ATOM   5315  C CG2    . ILE C 2 43 ? 4.705   0.389   1.810   1.00 0.00 ? 43  ILE A CG2    3  
ATOM   5316  C CD1    . ILE C 2 43 ? 7.427   1.766   2.063   1.00 0.00 ? 43  ILE A CD1    3  
ATOM   5317  H H      . ILE C 2 43 ? 4.052   4.160   0.710   1.00 0.00 ? 43  ILE A H      3  
ATOM   5318  H HA     . ILE C 2 43 ? 4.590   1.653   -0.844  1.00 0.00 ? 43  ILE A HA     3  
ATOM   5319  H HB     . ILE C 2 43 ? 4.909   2.516   2.029   1.00 0.00 ? 43  ILE A HB     3  
ATOM   5320  H HG12   . ILE C 2 43 ? 6.736   0.925   0.216   1.00 0.00 ? 43  ILE A HG12   3  
ATOM   5321  H HG13   . ILE C 2 43 ? 6.731   2.687   0.259   1.00 0.00 ? 43  ILE A HG13   3  
ATOM   5322  H HG21   . ILE C 2 43 ? 5.612   -0.154  2.034   1.00 0.00 ? 43  ILE A HG21   3  
ATOM   5323  H HG22   . ILE C 2 43 ? 4.132   -0.156  1.075   1.00 0.00 ? 43  ILE A HG22   3  
ATOM   5324  H HG23   . ILE C 2 43 ? 4.120   0.500   2.710   1.00 0.00 ? 43  ILE A HG23   3  
ATOM   5325  H HD11   . ILE C 2 43 ? 7.107   0.972   2.719   1.00 0.00 ? 43  ILE A HD11   3  
ATOM   5326  H HD12   . ILE C 2 43 ? 7.354   2.712   2.579   1.00 0.00 ? 43  ILE A HD12   3  
ATOM   5327  H HD13   . ILE C 2 43 ? 8.449   1.595   1.763   1.00 0.00 ? 43  ILE A HD13   3  
ATOM   5328  N N      . ARG C 2 44 ? 2.344   0.550   -0.221  1.00 0.00 ? 44  ARG A N      3  
ATOM   5329  C CA     . ARG C 2 44 ? 0.923   0.125   -0.059  1.00 0.00 ? 44  ARG A CA     3  
ATOM   5330  C C      . ARG C 2 44 ? 0.819   -1.342  0.378   1.00 0.00 ? 44  ARG A C      3  
ATOM   5331  O O      . ARG C 2 44 ? -0.266  -1.880  0.482   1.00 0.00 ? 44  ARG A O      3  
ATOM   5332  C CB     . ARG C 2 44 ? 0.298   0.304   -1.445  1.00 0.00 ? 44  ARG A CB     3  
ATOM   5333  C CG     . ARG C 2 44 ? 0.631   1.692   -1.995  1.00 0.00 ? 44  ARG A CG     3  
ATOM   5334  C CD     . ARG C 2 44 ? -0.075  1.891   -3.337  1.00 0.00 ? 44  ARG A CD     3  
ATOM   5335  N NE     . ARG C 2 44 ? 0.278   3.275   -3.749  1.00 0.00 ? 44  ARG A NE     3  
ATOM   5336  C CZ     . ARG C 2 44 ? 0.445   3.559   -5.012  1.00 0.00 ? 44  ARG A CZ     3  
ATOM   5337  N NH1    . ARG C 2 44 ? 1.526   3.165   -5.630  1.00 0.00 ? 44  ARG A NH1    3  
ATOM   5338  N NH2    . ARG C 2 44 ? -0.465  4.235   -5.656  1.00 0.00 ? 44  ARG A NH2    3  
ATOM   5339  H H      . ARG C 2 44 ? 2.981   -0.025  -0.694  1.00 0.00 ? 44  ARG A H      3  
ATOM   5340  H HA     . ARG C 2 44 ? 0.419   0.763   0.649   1.00 0.00 ? 44  ARG A HA     3  
ATOM   5341  H HB2    . ARG C 2 44 ? 0.691   -0.446  -2.115  1.00 0.00 ? 44  ARG A HB2    3  
ATOM   5342  H HB3    . ARG C 2 44 ? -0.773  0.195   -1.374  1.00 0.00 ? 44  ARG A HB3    3  
ATOM   5343  H HG2    . ARG C 2 44 ? 0.299   2.445   -1.296  1.00 0.00 ? 44  ARG A HG2    3  
ATOM   5344  H HG3    . ARG C 2 44 ? 1.698   1.777   -2.137  1.00 0.00 ? 44  ARG A HG3    3  
ATOM   5345  H HD2    . ARG C 2 44 ? 0.288   1.174   -4.061  1.00 0.00 ? 44  ARG A HD2    3  
ATOM   5346  H HD3    . ARG C 2 44 ? -1.143  1.799   -3.219  1.00 0.00 ? 44  ARG A HD3    3  
ATOM   5347  H HE     . ARG C 2 44 ? 0.386   3.973   -3.071  1.00 0.00 ? 44  ARG A HE     3  
ATOM   5348  H HH11   . ARG C 2 44 ? 2.224   2.648   -5.135  1.00 0.00 ? 44  ARG A HH11   3  
ATOM   5349  H HH12   . ARG C 2 44 ? 1.656   3.382   -6.597  1.00 0.00 ? 44  ARG A HH12   3  
ATOM   5350  H HH21   . ARG C 2 44 ? -1.293  4.538   -5.182  1.00 0.00 ? 44  ARG A HH21   3  
ATOM   5351  H HH22   . ARG C 2 44 ? -0.336  4.452   -6.623  1.00 0.00 ? 44  ARG A HH22   3  
ATOM   5352  N N      . SER C 2 45 ? 1.921   -2.000  0.633   1.00 0.00 ? 45  SER A N      3  
ATOM   5353  C CA     . SER C 2 45 ? 1.831   -3.430  1.056   1.00 0.00 ? 45  SER A CA     3  
ATOM   5354  C C      . SER C 2 45 ? 3.143   -3.899  1.694   1.00 0.00 ? 45  SER A C      3  
ATOM   5355  O O      . SER C 2 45 ? 3.969   -3.104  2.095   1.00 0.00 ? 45  SER A O      3  
ATOM   5356  C CB     . SER C 2 45 ? 1.546   -4.201  -0.232  1.00 0.00 ? 45  SER A CB     3  
ATOM   5357  O OG     . SER C 2 45 ? 0.165   -4.535  -0.283  1.00 0.00 ? 45  SER A OG     3  
ATOM   5358  H H      . SER C 2 45 ? 2.795   -1.564  0.545   1.00 0.00 ? 45  SER A H      3  
ATOM   5359  H HA     . SER C 2 45 ? 1.015   -3.563  1.747   1.00 0.00 ? 45  SER A HA     3  
ATOM   5360  H HB2    . SER C 2 45 ? 1.795   -3.592  -1.084  1.00 0.00 ? 45  SER A HB2    3  
ATOM   5361  H HB3    . SER C 2 45 ? 2.144   -5.101  -0.253  1.00 0.00 ? 45  SER A HB3    3  
ATOM   5362  H HG     . SER C 2 45 ? -0.258  -3.951  -0.917  1.00 0.00 ? 45  SER A HG     3  
ATOM   5363  N N      . LYS C 2 46 ? 3.334   -5.191  1.792   1.00 0.00 ? 46  LYS A N      3  
ATOM   5364  C CA     . LYS C 2 46 ? 4.585   -5.722  2.405   1.00 0.00 ? 46  LYS A CA     3  
ATOM   5365  C C      . LYS C 2 46 ? 5.747   -5.554  1.429   1.00 0.00 ? 46  LYS A C      3  
ATOM   5366  O O      . LYS C 2 46 ? 6.804   -5.069  1.784   1.00 0.00 ? 46  LYS A O      3  
ATOM   5367  C CB     . LYS C 2 46 ? 4.301   -7.203  2.666   1.00 0.00 ? 46  LYS A CB     3  
ATOM   5368  C CG     . LYS C 2 46 ? 5.571   -7.899  3.168   1.00 0.00 ? 46  LYS A CG     3  
ATOM   5369  C CD     . LYS C 2 46 ? 5.256   -8.698  4.436   1.00 0.00 ? 46  LYS A CD     3  
ATOM   5370  C CE     . LYS C 2 46 ? 5.816   -7.962  5.655   1.00 0.00 ? 46  LYS A CE     3  
ATOM   5371  N NZ     . LYS C 2 46 ? 4.956   -8.392  6.794   1.00 0.00 ? 46  LYS A NZ     3  
ATOM   5372  H H      . LYS C 2 46 ? 2.654   -5.811  1.460   1.00 0.00 ? 46  LYS A H      3  
ATOM   5373  H HA     . LYS C 2 46 ? 4.795   -5.215  3.334   1.00 0.00 ? 46  LYS A HA     3  
ATOM   5374  H HB2    . LYS C 2 46 ? 3.522   -7.293  3.411   1.00 0.00 ? 46  LYS A HB2    3  
ATOM   5375  H HB3    . LYS C 2 46 ? 3.977   -7.672  1.750   1.00 0.00 ? 46  LYS A HB3    3  
ATOM   5376  H HG2    . LYS C 2 46 ? 5.939   -8.569  2.403   1.00 0.00 ? 46  LYS A HG2    3  
ATOM   5377  H HG3    . LYS C 2 46 ? 6.325   -7.159  3.389   1.00 0.00 ? 46  LYS A HG3    3  
ATOM   5378  H HD2    . LYS C 2 46 ? 4.186   -8.805  4.539   1.00 0.00 ? 46  LYS A HD2    3  
ATOM   5379  H HD3    . LYS C 2 46 ? 5.711   -9.675  4.368   1.00 0.00 ? 46  LYS A HD3    3  
ATOM   5380  H HE2    . LYS C 2 46 ? 6.844   -8.250  5.825   1.00 0.00 ? 46  LYS A HE2    3  
ATOM   5381  H HE3    . LYS C 2 46 ? 5.740   -6.895  5.516   1.00 0.00 ? 46  LYS A HE3    3  
ATOM   5382  H HZ1    . LYS C 2 46 ? 4.807   -9.420  6.750   1.00 0.00 ? 46  LYS A HZ1    3  
ATOM   5383  H HZ2    . LYS C 2 46 ? 5.425   -8.147  7.692   1.00 0.00 ? 46  LYS A HZ2    3  
ATOM   5384  H HZ3    . LYS C 2 46 ? 4.039   -7.908  6.739   1.00 0.00 ? 46  LYS A HZ3    3  
ATOM   5385  N N      . VAL C 2 47 ? 5.556   -5.941  0.195   1.00 0.00 ? 47  VAL A N      3  
ATOM   5386  C CA     . VAL C 2 47 ? 6.647   -5.790  -0.807  1.00 0.00 ? 47  VAL A CA     3  
ATOM   5387  C C      . VAL C 2 47 ? 7.115   -4.330  -0.837  1.00 0.00 ? 47  VAL A C      3  
ATOM   5388  O O      . VAL C 2 47 ? 8.283   -4.046  -0.664  1.00 0.00 ? 47  VAL A O      3  
ATOM   5389  C CB     . VAL C 2 47 ? 6.007   -6.198  -2.130  1.00 0.00 ? 47  VAL A CB     3  
ATOM   5390  C CG1    . VAL C 2 47 ? 6.837   -5.677  -3.303  1.00 0.00 ? 47  VAL A CG1    3  
ATOM   5391  C CG2    . VAL C 2 47 ? 5.919   -7.723  -2.207  1.00 0.00 ? 47  VAL A CG2    3  
ATOM   5392  H H      . VAL C 2 47 ? 4.692   -6.322  -0.075  1.00 0.00 ? 47  VAL A H      3  
ATOM   5393  H HA     . VAL C 2 47 ? 7.469   -6.448  -0.574  1.00 0.00 ? 47  VAL A HA     3  
ATOM   5394  H HB     . VAL C 2 47 ? 5.018   -5.781  -2.180  1.00 0.00 ? 47  VAL A HB     3  
ATOM   5395  H HG11   . VAL C 2 47 ? 6.503   -6.146  -4.215  1.00 0.00 ? 47  VAL A HG11   3  
ATOM   5396  H HG12   . VAL C 2 47 ? 7.880   -5.909  -3.136  1.00 0.00 ? 47  VAL A HG12   3  
ATOM   5397  H HG13   . VAL C 2 47 ? 6.715   -4.608  -3.380  1.00 0.00 ? 47  VAL A HG13   3  
ATOM   5398  H HG21   . VAL C 2 47 ? 5.675   -8.019  -3.216  1.00 0.00 ? 47  VAL A HG21   3  
ATOM   5399  H HG22   . VAL C 2 47 ? 5.150   -8.073  -1.533  1.00 0.00 ? 47  VAL A HG22   3  
ATOM   5400  H HG23   . VAL C 2 47 ? 6.868   -8.153  -1.924  1.00 0.00 ? 47  VAL A HG23   3  
ATOM   5401  N N      . GLU C 2 48 ? 6.208   -3.402  -1.036  1.00 0.00 ? 48  GLU A N      3  
ATOM   5402  C CA     . GLU C 2 48 ? 6.607   -1.960  -1.056  1.00 0.00 ? 48  GLU A CA     3  
ATOM   5403  C C      . GLU C 2 48 ? 7.414   -1.643  0.204   1.00 0.00 ? 48  GLU A C      3  
ATOM   5404  O O      . GLU C 2 48 ? 8.430   -0.973  0.158   1.00 0.00 ? 48  GLU A O      3  
ATOM   5405  C CB     . GLU C 2 48 ? 5.293   -1.175  -1.070  1.00 0.00 ? 48  GLU A CB     3  
ATOM   5406  C CG     . GLU C 2 48 ? 5.011   -0.665  -2.485  1.00 0.00 ? 48  GLU A CG     3  
ATOM   5407  C CD     . GLU C 2 48 ? 6.126   0.290   -2.919  1.00 0.00 ? 48  GLU A CD     3  
ATOM   5408  O OE1    . GLU C 2 48 ? 6.178   1.388   -2.389  1.00 0.00 ? 48  GLU A OE1    3  
ATOM   5409  O OE2    . GLU C 2 48 ? 6.909   -0.094  -3.773  1.00 0.00 ? 48  GLU A OE2    3  
ATOM   5410  H H      . GLU C 2 48 ? 5.269   -3.654  -1.160  1.00 0.00 ? 48  GLU A H      3  
ATOM   5411  H HA     . GLU C 2 48 ? 7.178   -1.737  -1.940  1.00 0.00 ? 48  GLU A HA     3  
ATOM   5412  H HB2    . GLU C 2 48 ? 4.485   -1.817  -0.749  1.00 0.00 ? 48  GLU A HB2    3  
ATOM   5413  H HB3    . GLU C 2 48 ? 5.372   -0.335  -0.399  1.00 0.00 ? 48  GLU A HB3    3  
ATOM   5414  H HG2    . GLU C 2 48 ? 4.970   -1.501  -3.165  1.00 0.00 ? 48  GLU A HG2    3  
ATOM   5415  H HG3    . GLU C 2 48 ? 4.068   -0.143  -2.498  1.00 0.00 ? 48  GLU A HG3    3  
ATOM   5416  N N      . LEU C 2 49 ? 6.977   -2.147  1.327   1.00 0.00 ? 49  LEU A N      3  
ATOM   5417  C CA     . LEU C 2 49 ? 7.723   -1.910  2.592   1.00 0.00 ? 49  LEU A CA     3  
ATOM   5418  C C      . LEU C 2 49 ? 9.075   -2.612  2.504   1.00 0.00 ? 49  LEU A C      3  
ATOM   5419  O O      . LEU C 2 49 ? 10.107  -2.051  2.813   1.00 0.00 ? 49  LEU A O      3  
ATOM   5420  C CB     . LEU C 2 49 ? 6.857   -2.540  3.686   1.00 0.00 ? 49  LEU A CB     3  
ATOM   5421  C CG     . LEU C 2 49 ? 7.128   -1.853  5.026   1.00 0.00 ? 49  LEU A CG     3  
ATOM   5422  C CD1    . LEU C 2 49 ? 6.329   -0.552  5.096   1.00 0.00 ? 49  LEU A CD1    3  
ATOM   5423  C CD2    . LEU C 2 49 ? 6.701   -2.775  6.173   1.00 0.00 ? 49  LEU A CD2    3  
ATOM   5424  H H      . LEU C 2 49 ? 6.167   -2.698  1.332   1.00 0.00 ? 49  LEU A H      3  
ATOM   5425  H HA     . LEU C 2 49 ? 7.850   -0.855  2.767   1.00 0.00 ? 49  LEU A HA     3  
ATOM   5426  H HB2    . LEU C 2 49 ? 5.814   -2.426  3.430   1.00 0.00 ? 49  LEU A HB2    3  
ATOM   5427  H HB3    . LEU C 2 49 ? 7.093   -3.590  3.770   1.00 0.00 ? 49  LEU A HB3    3  
ATOM   5428  H HG     . LEU C 2 49 ? 8.183   -1.633  5.109   1.00 0.00 ? 49  LEU A HG     3  
ATOM   5429  H HD11   . LEU C 2 49 ? 5.287   -0.759  4.908   1.00 0.00 ? 49  LEU A HD11   3  
ATOM   5430  H HD12   . LEU C 2 49 ? 6.700   0.135   4.354   1.00 0.00 ? 49  LEU A HD12   3  
ATOM   5431  H HD13   . LEU C 2 49 ? 6.438   -0.116  6.078   1.00 0.00 ? 49  LEU A HD13   3  
ATOM   5432  H HD21   . LEU C 2 49 ? 5.833   -2.362  6.664   1.00 0.00 ? 49  LEU A HD21   3  
ATOM   5433  H HD22   . LEU C 2 49 ? 7.508   -2.861  6.885   1.00 0.00 ? 49  LEU A HD22   3  
ATOM   5434  H HD23   . LEU C 2 49 ? 6.461   -3.753  5.781   1.00 0.00 ? 49  LEU A HD23   3  
ATOM   5435  N N      . THR C 2 50 ? 9.065   -3.839  2.062   1.00 0.00 ? 50  THR A N      3  
ATOM   5436  C CA     . THR C 2 50 ? 10.334  -4.604  1.922   1.00 0.00 ? 50  THR A CA     3  
ATOM   5437  C C      . THR C 2 50 ? 11.269  -3.903  0.926   1.00 0.00 ? 50  THR A C      3  
ATOM   5438  O O      . THR C 2 50 ? 12.453  -4.173  0.881   1.00 0.00 ? 50  THR A O      3  
ATOM   5439  C CB     . THR C 2 50 ? 9.898   -5.974  1.385   1.00 0.00 ? 50  THR A CB     3  
ATOM   5440  O OG1    . THR C 2 50 ? 9.043   -6.596  2.334   1.00 0.00 ? 50  THR A OG1    3  
ATOM   5441  C CG2    . THR C 2 50 ? 11.126  -6.856  1.150   1.00 0.00 ? 50  THR A CG2    3  
ATOM   5442  H H      . THR C 2 50 ? 8.215   -4.257  1.811   1.00 0.00 ? 50  THR A H      3  
ATOM   5443  H HA     . THR C 2 50 ? 10.815  -4.719  2.880   1.00 0.00 ? 50  THR A HA     3  
ATOM   5444  H HB     . THR C 2 50 ? 9.365   -5.844  0.453   1.00 0.00 ? 50  THR A HB     3  
ATOM   5445  H HG1    . THR C 2 50 ? 9.558   -6.781  3.122   1.00 0.00 ? 50  THR A HG1    3  
ATOM   5446  H HG21   . THR C 2 50 ? 11.193  -7.106  0.102   1.00 0.00 ? 50  THR A HG21   3  
ATOM   5447  H HG22   . THR C 2 50 ? 11.033  -7.762  1.731   1.00 0.00 ? 50  THR A HG22   3  
ATOM   5448  H HG23   . THR C 2 50 ? 12.017  -6.325  1.451   1.00 0.00 ? 50  THR A HG23   3  
ATOM   5449  N N      . ARG C 2 51 ? 10.746  -3.006  0.127   1.00 0.00 ? 51  ARG A N      3  
ATOM   5450  C CA     . ARG C 2 51 ? 11.604  -2.295  -0.866  1.00 0.00 ? 51  ARG A CA     3  
ATOM   5451  C C      . ARG C 2 51 ? 12.408  -1.184  -0.182  1.00 0.00 ? 51  ARG A C      3  
ATOM   5452  O O      . ARG C 2 51 ? 13.624  -1.209  -0.168  1.00 0.00 ? 51  ARG A O      3  
ATOM   5453  C CB     . ARG C 2 51 ? 10.634  -1.697  -1.885  1.00 0.00 ? 51  ARG A CB     3  
ATOM   5454  C CG     . ARG C 2 51 ? 9.793   -2.812  -2.509  1.00 0.00 ? 51  ARG A CG     3  
ATOM   5455  C CD     . ARG C 2 51 ? 10.078  -2.893  -4.012  1.00 0.00 ? 51  ARG A CD     3  
ATOM   5456  N NE     . ARG C 2 51 ? 8.764   -3.209  -4.640  1.00 0.00 ? 51  ARG A NE     3  
ATOM   5457  C CZ     . ARG C 2 51 ? 8.705   -3.532  -5.904  1.00 0.00 ? 51  ARG A CZ     3  
ATOM   5458  N NH1    . ARG C 2 51 ? 9.469   -2.924  -6.771  1.00 0.00 ? 51  ARG A NH1    3  
ATOM   5459  N NH2    . ARG C 2 51 ? 7.879   -4.462  -6.302  1.00 0.00 ? 51  ARG A NH2    3  
ATOM   5460  H H      . ARG C 2 51 ? 9.788   -2.806  0.175   1.00 0.00 ? 51  ARG A H      3  
ATOM   5461  H HA     . ARG C 2 51 ? 12.265  -2.992  -1.356  1.00 0.00 ? 51  ARG A HA     3  
ATOM   5462  H HB2    . ARG C 2 51 ? 9.986   -0.988  -1.390  1.00 0.00 ? 51  ARG A HB2    3  
ATOM   5463  H HB3    . ARG C 2 51 ? 11.194  -1.192  -2.659  1.00 0.00 ? 51  ARG A HB3    3  
ATOM   5464  H HG2    . ARG C 2 51 ? 10.042  -3.755  -2.043  1.00 0.00 ? 51  ARG A HG2    3  
ATOM   5465  H HG3    . ARG C 2 51 ? 8.747   -2.601  -2.353  1.00 0.00 ? 51  ARG A HG3    3  
ATOM   5466  H HD2    . ARG C 2 51 ? 10.451  -1.944  -4.373  1.00 0.00 ? 51  ARG A HD2    3  
ATOM   5467  H HD3    . ARG C 2 51 ? 10.786  -3.681  -4.220  1.00 0.00 ? 51  ARG A HD3    3  
ATOM   5468  H HE     . ARG C 2 51 ? 7.943   -3.175  -4.105  1.00 0.00 ? 51  ARG A HE     3  
ATOM   5469  H HH11   . ARG C 2 51 ? 10.101  -2.211  -6.466  1.00 0.00 ? 51  ARG A HH11   3  
ATOM   5470  H HH12   . ARG C 2 51 ? 9.423   -3.172  -7.738  1.00 0.00 ? 51  ARG A HH12   3  
ATOM   5471  H HH21   . ARG C 2 51 ? 7.293   -4.927  -5.639  1.00 0.00 ? 51  ARG A HH21   3  
ATOM   5472  H HH22   . ARG C 2 51 ? 7.834   -4.710  -7.269  1.00 0.00 ? 51  ARG A HH22   3  
ATOM   5473  N N      . TYR C 2 52 ? 11.743  -0.207  0.384   1.00 0.00 ? 52  TYR A N      3  
ATOM   5474  C CA     . TYR C 2 52 ? 12.483  0.905   1.062   1.00 0.00 ? 52  TYR A CA     3  
ATOM   5475  C C      . TYR C 2 52 ? 13.470  0.334   2.083   1.00 0.00 ? 52  TYR A C      3  
ATOM   5476  O O      . TYR C 2 52 ? 14.493  0.925   2.371   1.00 0.00 ? 52  TYR A O      3  
ATOM   5477  C CB     . TYR C 2 52 ? 11.410  1.747   1.764   1.00 0.00 ? 52  TYR A CB     3  
ATOM   5478  C CG     . TYR C 2 52 ? 12.024  3.039   2.259   1.00 0.00 ? 52  TYR A CG     3  
ATOM   5479  C CD1    . TYR C 2 52 ? 12.952  3.020   3.309   1.00 0.00 ? 52  TYR A CD1    3  
ATOM   5480  C CD2    . TYR C 2 52 ? 11.669  4.260   1.666   1.00 0.00 ? 52  TYR A CD2    3  
ATOM   5481  C CE1    . TYR C 2 52 ? 13.522  4.216   3.763   1.00 0.00 ? 52  TYR A CE1    3  
ATOM   5482  C CE2    . TYR C 2 52 ? 12.241  5.454   2.120   1.00 0.00 ? 52  TYR A CE2    3  
ATOM   5483  C CZ     . TYR C 2 52 ? 13.167  5.432   3.168   1.00 0.00 ? 52  TYR A CZ     3  
ATOM   5484  O OH     . TYR C 2 52 ? 13.731  6.610   3.615   1.00 0.00 ? 52  TYR A OH     3  
ATOM   5485  H H      . TYR C 2 52 ? 10.760  -0.203  0.359   1.00 0.00 ? 52  TYR A H      3  
ATOM   5486  H HA     . TYR C 2 52 ? 13.003  1.507   0.333   1.00 0.00 ? 52  TYR A HA     3  
ATOM   5487  H HB2    . TYR C 2 52 ? 10.615  1.968   1.067   1.00 0.00 ? 52  TYR A HB2    3  
ATOM   5488  H HB3    . TYR C 2 52 ? 11.012  1.194   2.602   1.00 0.00 ? 52  TYR A HB3    3  
ATOM   5489  H HD1    . TYR C 2 52 ? 13.226  2.084   3.771   1.00 0.00 ? 52  TYR A HD1    3  
ATOM   5490  H HD2    . TYR C 2 52 ? 10.954  4.281   0.862   1.00 0.00 ? 52  TYR A HD2    3  
ATOM   5491  H HE1    . TYR C 2 52 ? 14.237  4.199   4.572   1.00 0.00 ? 52  TYR A HE1    3  
ATOM   5492  H HE2    . TYR C 2 52 ? 11.964  6.393   1.662   1.00 0.00 ? 52  TYR A HE2    3  
ATOM   5493  H HH     . TYR C 2 52 ? 13.951  7.143   2.847   1.00 0.00 ? 52  TYR A HH     3  
ATOM   5494  N N      . LEU C 2 53 ? 13.172  -0.814  2.630   1.00 0.00 ? 53  LEU A N      3  
ATOM   5495  C CA     . LEU C 2 53 ? 14.089  -1.430  3.632   1.00 0.00 ? 53  LEU A CA     3  
ATOM   5496  C C      . LEU C 2 53 ? 15.079  -2.373  2.940   1.00 0.00 ? 53  LEU A C      3  
ATOM   5497  O O      . LEU C 2 53 ? 16.142  -2.656  3.457   1.00 0.00 ? 53  LEU A O      3  
ATOM   5498  C CB     . LEU C 2 53 ? 13.174  -2.209  4.576   1.00 0.00 ? 53  LEU A CB     3  
ATOM   5499  C CG     . LEU C 2 53 ? 12.297  -1.230  5.363   1.00 0.00 ? 53  LEU A CG     3  
ATOM   5500  C CD1    . LEU C 2 53 ? 10.870  -1.777  5.457   1.00 0.00 ? 53  LEU A CD1    3  
ATOM   5501  C CD2    . LEU C 2 53 ? 12.870  -1.054  6.772   1.00 0.00 ? 53  LEU A CD2    3  
ATOM   5502  H H      . LEU C 2 53 ? 12.342  -1.272  2.381   1.00 0.00 ? 53  LEU A H      3  
ATOM   5503  H HA     . LEU C 2 53 ? 14.618  -0.666  4.179   1.00 0.00 ? 53  LEU A HA     3  
ATOM   5504  H HB2    . LEU C 2 53 ? 12.547  -2.874  3.999   1.00 0.00 ? 53  LEU A HB2    3  
ATOM   5505  H HB3    . LEU C 2 53 ? 13.774  -2.786  5.263   1.00 0.00 ? 53  LEU A HB3    3  
ATOM   5506  H HG     . LEU C 2 53 ? 12.281  -0.275  4.858   1.00 0.00 ? 53  LEU A HG     3  
ATOM   5507  H HD11   . LEU C 2 53 ? 10.175  -1.025  5.116   1.00 0.00 ? 53  LEU A HD11   3  
ATOM   5508  H HD12   . LEU C 2 53 ? 10.649  -2.034  6.482   1.00 0.00 ? 53  LEU A HD12   3  
ATOM   5509  H HD13   . LEU C 2 53 ? 10.780  -2.657  4.838   1.00 0.00 ? 53  LEU A HD13   3  
ATOM   5510  H HD21   . LEU C 2 53 ? 12.471  -0.153  7.214   1.00 0.00 ? 53  LEU A HD21   3  
ATOM   5511  H HD22   . LEU C 2 53 ? 13.946  -0.982  6.716   1.00 0.00 ? 53  LEU A HD22   3  
ATOM   5512  H HD23   . LEU C 2 53 ? 12.598  -1.904  7.380   1.00 0.00 ? 53  LEU A HD23   3  
ATOM   5513  N N      . GLY C 2 54 ? 14.739  -2.861  1.775   1.00 0.00 ? 54  GLY A N      3  
ATOM   5514  C CA     . GLY C 2 54 ? 15.661  -3.784  1.055   1.00 0.00 ? 54  GLY A CA     3  
ATOM   5515  C C      . GLY C 2 54 ? 15.078  -5.200  1.062   1.00 0.00 ? 54  GLY A C      3  
ATOM   5516  O O      . GLY C 2 54 ? 14.298  -5.542  1.928   1.00 0.00 ? 54  GLY A O      3  
ATOM   5517  H H      . GLY C 2 54 ? 13.878  -2.621  1.374   1.00 0.00 ? 54  GLY A H      3  
ATOM   5518  H HA2    . GLY C 2 54 ? 15.782  -3.447  0.035   1.00 0.00 ? 54  GLY A HA2    3  
ATOM   5519  H HA3    . GLY C 2 54 ? 16.621  -3.791  1.548   1.00 0.00 ? 54  GLY A HA3    3  
ATOM   5520  N N      . PRO C 2 55 ? 15.478  -5.980  0.091   1.00 0.00 ? 55  PRO A N      3  
ATOM   5521  C CA     . PRO C 2 55 ? 14.987  -7.376  -0.010  1.00 0.00 ? 55  PRO A CA     3  
ATOM   5522  C C      . PRO C 2 55 ? 15.599  -8.238  1.098   1.00 0.00 ? 55  PRO A C      3  
ATOM   5523  O O      . PRO C 2 55 ? 15.019  -9.217  1.526   1.00 0.00 ? 55  PRO A O      3  
ATOM   5524  C CB     . PRO C 2 55 ? 15.471  -7.827  -1.387  1.00 0.00 ? 55  PRO A CB     3  
ATOM   5525  C CG     . PRO C 2 55 ? 16.652  -6.959  -1.684  1.00 0.00 ? 55  PRO A CG     3  
ATOM   5526  C CD     . PRO C 2 55 ? 16.415  -5.644  -0.989  1.00 0.00 ? 55  PRO A CD     3  
ATOM   5527  H HA     . PRO C 2 55 ? 13.911  -7.406  0.031   1.00 0.00 ? 55  PRO A HA     3  
ATOM   5528  H HB2    . PRO C 2 55 ? 15.763  -8.869  -1.359  1.00 0.00 ? 55  PRO A HB2    3  
ATOM   5529  H HB3    . PRO C 2 55 ? 14.702  -7.670  -2.126  1.00 0.00 ? 55  PRO A HB3    3  
ATOM   5530  H HG2    . PRO C 2 55 ? 17.553  -7.423  -1.307  1.00 0.00 ? 55  PRO A HG2    3  
ATOM   5531  H HG3    . PRO C 2 55 ? 16.735  -6.799  -2.748  1.00 0.00 ? 55  PRO A HG3    3  
ATOM   5532  H HD2    . PRO C 2 55 ? 17.341  -5.257  -0.585  1.00 0.00 ? 55  PRO A HD2    3  
ATOM   5533  H HD3    . PRO C 2 55 ? 15.964  -4.932  -1.662  1.00 0.00 ? 55  PRO A HD3    3  
ATOM   5534  N N      . ALA C 2 56 ? 16.763  -7.877  1.567   1.00 0.00 ? 56  ALA A N      3  
ATOM   5535  C CA     . ALA C 2 56 ? 17.410  -8.672  2.651   1.00 0.00 ? 56  ALA A CA     3  
ATOM   5536  C C      . ALA C 2 56 ? 16.752  -8.360  3.999   1.00 0.00 ? 56  ALA A C      3  
ATOM   5537  O O      . ALA C 2 56 ? 16.840  -9.131  4.936   1.00 0.00 ? 56  ALA A O      3  
ATOM   5538  C CB     . ALA C 2 56 ? 18.873  -8.225  2.653   1.00 0.00 ? 56  ALA A CB     3  
ATOM   5539  H H      . ALA C 2 56 ? 17.211  -7.083  1.208   1.00 0.00 ? 56  ALA A H      3  
ATOM   5540  H HA     . ALA C 2 56 ? 17.348  -9.727  2.435   1.00 0.00 ? 56  ALA A HA     3  
ATOM   5541  H HB1    . ALA C 2 56 ? 18.941  -7.219  3.039   1.00 0.00 ? 56  ALA A HB1    3  
ATOM   5542  H HB2    . ALA C 2 56 ? 19.258  -8.250  1.644   1.00 0.00 ? 56  ALA A HB2    3  
ATOM   5543  H HB3    . ALA C 2 56 ? 19.452  -8.890  3.277   1.00 0.00 ? 56  ALA A HB3    3  
ATOM   5544  N N      . CYS C 2 57 ? 16.095  -7.234  4.104   1.00 0.00 ? 57  CYS A N      3  
ATOM   5545  C CA     . CYS C 2 57 ? 15.432  -6.872  5.391   1.00 0.00 ? 57  CYS A CA     3  
ATOM   5546  C C      . CYS C 2 57 ? 13.967  -7.319  5.375   1.00 0.00 ? 57  CYS A C      3  
ATOM   5547  O O      . CYS C 2 57 ? 13.064  -6.516  5.242   1.00 0.00 ? 57  CYS A O      3  
ATOM   5548  C CB     . CYS C 2 57 ? 15.525  -5.347  5.467   1.00 0.00 ? 57  CYS A CB     3  
ATOM   5549  S SG     . CYS C 2 57 ? 15.716  -4.839  7.194   1.00 0.00 ? 57  CYS A SG     3  
ATOM   5550  H H      . CYS C 2 57 ? 16.037  -6.628  3.337   1.00 0.00 ? 57  CYS A H      3  
ATOM   5551  H HA     . CYS C 2 57 ? 15.954  -7.316  6.222   1.00 0.00 ? 57  CYS A HA     3  
ATOM   5552  H HB2    . CYS C 2 57 ? 16.379  -5.010  4.897   1.00 0.00 ? 57  CYS A HB2    3  
ATOM   5553  H HB3    . CYS C 2 57 ? 14.626  -4.909  5.061   1.00 0.00 ? 57  CYS A HB3    3  
ATOM   5554  H HG     . CYS C 2 57 ? 16.334  -5.440  7.614   1.00 0.00 ? 57  CYS A HG     3  
ATOM   5555  N N      . ASP C 2 58 ? 13.726  -8.596  5.511   1.00 0.00 ? 58  ASP A N      3  
ATOM   5556  C CA     . ASP C 2 58 ? 12.319  -9.098  5.505   1.00 0.00 ? 58  ASP A CA     3  
ATOM   5557  C C      . ASP C 2 58 ? 11.525  -8.456  6.643   1.00 0.00 ? 58  ASP A C      3  
ATOM   5558  O O      . ASP C 2 58 ? 12.086  -7.962  7.601   1.00 0.00 ? 58  ASP A O      3  
ATOM   5559  C CB     . ASP C 2 58 ? 12.432  -10.607 5.731   1.00 0.00 ? 58  ASP A CB     3  
ATOM   5560  C CG     . ASP C 2 58 ? 12.265  -11.339 4.398   1.00 0.00 ? 58  ASP A CG     3  
ATOM   5561  O OD1    . ASP C 2 58 ? 12.789  -10.854 3.408   1.00 0.00 ? 58  ASP A OD1    3  
ATOM   5562  O OD2    . ASP C 2 58 ? 11.619  -12.374 4.390   1.00 0.00 ? 58  ASP A OD2    3  
ATOM   5563  H H      . ASP C 2 58 ? 14.470  -9.225  5.617   1.00 0.00 ? 58  ASP A H      3  
ATOM   5564  H HA     . ASP C 2 58 ? 11.850  -8.900  4.556   1.00 0.00 ? 58  ASP A HA     3  
ATOM   5565  H HB2    . ASP C 2 58 ? 13.400  -10.836 6.151   1.00 0.00 ? 58  ASP A HB2    3  
ATOM   5566  H HB3    . ASP C 2 58 ? 11.658  -10.924 6.413   1.00 0.00 ? 58  ASP A HB3    3  
ATOM   5567  N N      . LEU C 2 59 ? 10.223  -8.468  6.549   1.00 0.00 ? 59  LEU A N      3  
ATOM   5568  C CA     . LEU C 2 59 ? 9.394   -7.864  7.631   1.00 0.00 ? 59  LEU A CA     3  
ATOM   5569  C C      . LEU C 2 59 ? 8.268   -8.823  8.026   1.00 0.00 ? 59  LEU A C      3  
ATOM   5570  O O      . LEU C 2 59 ? 7.134   -8.422  8.205   1.00 0.00 ? 59  LEU A O      3  
ATOM   5571  C CB     . LEU C 2 59 ? 8.815   -6.578  7.035   1.00 0.00 ? 59  LEU A CB     3  
ATOM   5572  C CG     . LEU C 2 59 ? 9.944   -5.688  6.510   1.00 0.00 ? 59  LEU A CG     3  
ATOM   5573  C CD1    . LEU C 2 59 ? 9.345   -4.469  5.804   1.00 0.00 ? 59  LEU A CD1    3  
ATOM   5574  C CD2    . LEU C 2 59 ? 10.815  -5.221  7.680   1.00 0.00 ? 59  LEU A CD2    3  
ATOM   5575  H H      . LEU C 2 59 ? 9.791   -8.878  5.770   1.00 0.00 ? 59  LEU A H      3  
ATOM   5576  H HA     . LEU C 2 59 ? 10.008  -7.633  8.486   1.00 0.00 ? 59  LEU A HA     3  
ATOM   5577  H HB2    . LEU C 2 59 ? 8.149   -6.828  6.222   1.00 0.00 ? 59  LEU A HB2    3  
ATOM   5578  H HB3    . LEU C 2 59 ? 8.266   -6.045  7.798   1.00 0.00 ? 59  LEU A HB3    3  
ATOM   5579  H HG     . LEU C 2 59 ? 10.545  -6.246  5.807   1.00 0.00 ? 59  LEU A HG     3  
ATOM   5580  H HD11   . LEU C 2 59 ? 8.296   -4.641  5.616   1.00 0.00 ? 59  LEU A HD11   3  
ATOM   5581  H HD12   . LEU C 2 59 ? 9.857   -4.309  4.867   1.00 0.00 ? 59  LEU A HD12   3  
ATOM   5582  H HD13   . LEU C 2 59 ? 9.459   -3.595  6.433   1.00 0.00 ? 59  LEU A HD13   3  
ATOM   5583  H HD21   . LEU C 2 59 ? 10.239  -4.569  8.319   1.00 0.00 ? 59  LEU A HD21   3  
ATOM   5584  H HD22   . LEU C 2 59 ? 11.672  -4.686  7.299   1.00 0.00 ? 59  LEU A HD22   3  
ATOM   5585  H HD23   . LEU C 2 59 ? 11.149  -6.077  8.245   1.00 0.00 ? 59  LEU A HD23   3  
ATOM   5586  N N      . THR C 2 60 ? 8.572   -10.086 8.162   1.00 0.00 ? 60  THR A N      3  
ATOM   5587  C CA     . THR C 2 60 ? 7.518   -11.075 8.544   1.00 0.00 ? 60  THR A CA     3  
ATOM   5588  C C      . THR C 2 60 ? 6.830   -10.641 9.842   1.00 0.00 ? 60  THR A C      3  
ATOM   5589  O O      . THR C 2 60 ? 5.693   -10.987 10.098  1.00 0.00 ? 60  THR A O      3  
ATOM   5590  C CB     . THR C 2 60 ? 8.261   -12.401 8.749   1.00 0.00 ? 60  THR A CB     3  
ATOM   5591  O OG1    . THR C 2 60 ? 9.466   -12.397 7.995   1.00 0.00 ? 60  THR A OG1    3  
ATOM   5592  C CG2    . THR C 2 60 ? 7.374   -13.558 8.286   1.00 0.00 ? 60  THR A CG2    3  
ATOM   5593  H H      . THR C 2 60 ? 9.493   -10.385 8.011   1.00 0.00 ? 60  THR A H      3  
ATOM   5594  H HA     . THR C 2 60 ? 6.795   -11.178 7.752   1.00 0.00 ? 60  THR A HA     3  
ATOM   5595  H HB     . THR C 2 60 ? 8.490   -12.527 9.795   1.00 0.00 ? 60  THR A HB     3  
ATOM   5596  H HG1    . THR C 2 60 ? 10.192  -12.575 8.597   1.00 0.00 ? 60  THR A HG1    3  
ATOM   5597  H HG21   . THR C 2 60 ? 7.005   -13.351 7.292   1.00 0.00 ? 60  THR A HG21   3  
ATOM   5598  H HG22   . THR C 2 60 ? 6.541   -13.666 8.964   1.00 0.00 ? 60  THR A HG22   3  
ATOM   5599  H HG23   . THR C 2 60 ? 7.951   -14.470 8.274   1.00 0.00 ? 60  THR A HG23   3  
ATOM   5600  N N      . LEU C 2 61 ? 7.512   -9.885  10.660  1.00 0.00 ? 61  LEU A N      3  
ATOM   5601  C CA     . LEU C 2 61 ? 6.899   -9.423  11.941  1.00 0.00 ? 61  LEU A CA     3  
ATOM   5602  C C      . LEU C 2 61 ? 6.001   -8.209  11.690  1.00 0.00 ? 61  LEU A C      3  
ATOM   5603  O O      . LEU C 2 61 ? 5.085   -7.939  12.442  1.00 0.00 ? 61  LEU A O      3  
ATOM   5604  C CB     . LEU C 2 61 ? 8.084   -9.043  12.831  1.00 0.00 ? 61  LEU A CB     3  
ATOM   5605  C CG     . LEU C 2 61 ? 8.869   -10.302 13.204  1.00 0.00 ? 61  LEU A CG     3  
ATOM   5606  C CD1    . LEU C 2 61 ? 10.365  -9.981  13.256  1.00 0.00 ? 61  LEU A CD1    3  
ATOM   5607  C CD2    . LEU C 2 61 ? 8.403   -10.804 14.573  1.00 0.00 ? 61  LEU A CD2    3  
ATOM   5608  H H      . LEU C 2 61 ? 8.427   -9.618  10.433  1.00 0.00 ? 61  LEU A H      3  
ATOM   5609  H HA     . LEU C 2 61 ? 6.336   -10.220 12.400  1.00 0.00 ? 61  LEU A HA     3  
ATOM   5610  H HB2    . LEU C 2 61 ? 8.728   -8.359  12.298  1.00 0.00 ? 61  LEU A HB2    3  
ATOM   5611  H HB3    . LEU C 2 61 ? 7.720   -8.568  13.730  1.00 0.00 ? 61  LEU A HB3    3  
ATOM   5612  H HG     . LEU C 2 61 ? 8.693   -11.067 12.461  1.00 0.00 ? 61  LEU A HG     3  
ATOM   5613  H HD11   . LEU C 2 61 ? 10.890  -10.597 12.540  1.00 0.00 ? 61  LEU A HD11   3  
ATOM   5614  H HD12   . LEU C 2 61 ? 10.744  -10.181 14.248  1.00 0.00 ? 61  LEU A HD12   3  
ATOM   5615  H HD13   . LEU C 2 61 ? 10.520  -8.940  13.015  1.00 0.00 ? 61  LEU A HD13   3  
ATOM   5616  H HD21   . LEU C 2 61 ? 8.231   -9.962  15.227  1.00 0.00 ? 61  LEU A HD21   3  
ATOM   5617  H HD22   . LEU C 2 61 ? 9.163   -11.442 15.001  1.00 0.00 ? 61  LEU A HD22   3  
ATOM   5618  H HD23   . LEU C 2 61 ? 7.487   -11.364 14.460  1.00 0.00 ? 61  LEU A HD23   3  
ATOM   5619  N N      . PHE C 2 62 ? 6.254   -7.478  10.637  1.00 0.00 ? 62  PHE A N      3  
ATOM   5620  C CA     . PHE C 2 62 ? 5.412   -6.282  10.338  1.00 0.00 ? 62  PHE A CA     3  
ATOM   5621  C C      . PHE C 2 62 ? 3.999   -6.721  9.942   1.00 0.00 ? 62  PHE A C      3  
ATOM   5622  O O      . PHE C 2 62 ? 3.805   -7.404  8.955   1.00 0.00 ? 62  PHE A O      3  
ATOM   5623  C CB     . PHE C 2 62 ? 6.109   -5.581  9.166   1.00 0.00 ? 62  PHE A CB     3  
ATOM   5624  C CG     . PHE C 2 62 ? 5.211   -4.494  8.615   1.00 0.00 ? 62  PHE A CG     3  
ATOM   5625  C CD1    . PHE C 2 62 ? 5.079   -3.281  9.300   1.00 0.00 ? 62  PHE A CD1    3  
ATOM   5626  C CD2    . PHE C 2 62 ? 4.511   -4.703  7.422   1.00 0.00 ? 62  PHE A CD2    3  
ATOM   5627  C CE1    . PHE C 2 62 ? 4.245   -2.276  8.791   1.00 0.00 ? 62  PHE A CE1    3  
ATOM   5628  C CE2    . PHE C 2 62 ? 3.678   -3.700  6.913   1.00 0.00 ? 62  PHE A CE2    3  
ATOM   5629  C CZ     . PHE C 2 62 ? 3.545   -2.487  7.598   1.00 0.00 ? 62  PHE A CZ     3  
ATOM   5630  H H      . PHE C 2 62 ? 6.997   -7.714  10.043  1.00 0.00 ? 62  PHE A H      3  
ATOM   5631  H HA     . PHE C 2 62 ? 5.376   -5.624  11.192  1.00 0.00 ? 62  PHE A HA     3  
ATOM   5632  H HB2    . PHE C 2 62 ? 7.035   -5.145  9.508   1.00 0.00 ? 62  PHE A HB2    3  
ATOM   5633  H HB3    . PHE C 2 62 ? 6.316   -6.302  8.389   1.00 0.00 ? 62  PHE A HB3    3  
ATOM   5634  H HD1    . PHE C 2 62 ? 5.619   -3.119  10.221  1.00 0.00 ? 62  PHE A HD1    3  
ATOM   5635  H HD2    . PHE C 2 62 ? 4.612   -5.639  6.893   1.00 0.00 ? 62  PHE A HD2    3  
ATOM   5636  H HE1    . PHE C 2 62 ? 4.143   -1.341  9.320   1.00 0.00 ? 62  PHE A HE1    3  
ATOM   5637  H HE2    . PHE C 2 62 ? 3.137   -3.862  5.992   1.00 0.00 ? 62  PHE A HE2    3  
ATOM   5638  H HZ     . PHE C 2 62 ? 2.901   -1.713  7.207   1.00 0.00 ? 62  PHE A HZ     3  
ATOM   5639  N N      . ASP C 2 63 ? 3.012   -6.324  10.699  1.00 0.00 ? 63  ASP A N      3  
ATOM   5640  C CA     . ASP C 2 63 ? 1.613   -6.711  10.360  1.00 0.00 ? 63  ASP A CA     3  
ATOM   5641  C C      . ASP C 2 63 ? 1.028   -5.719  9.352   1.00 0.00 ? 63  ASP A C      3  
ATOM   5642  O O      . ASP C 2 63 ? 0.795   -4.567  9.663   1.00 0.00 ? 63  ASP A O      3  
ATOM   5643  C CB     . ASP C 2 63 ? 0.850   -6.649  11.683  1.00 0.00 ? 63  ASP A CB     3  
ATOM   5644  C CG     . ASP C 2 63 ? 0.823   -8.039  12.323  1.00 0.00 ? 63  ASP A CG     3  
ATOM   5645  O OD1    . ASP C 2 63 ? 0.341   -8.956  11.679  1.00 0.00 ? 63  ASP A OD1    3  
ATOM   5646  O OD2    . ASP C 2 63 ? 1.285   -8.162  13.445  1.00 0.00 ? 63  ASP A OD2    3  
ATOM   5647  H H      . ASP C 2 63 ? 3.192   -5.769  11.487  1.00 0.00 ? 63  ASP A H      3  
ATOM   5648  H HA     . ASP C 2 63 ? 1.584   -7.714  9.964   1.00 0.00 ? 63  ASP A HA     3  
ATOM   5649  H HB2    . ASP C 2 63 ? 1.341   -5.955  12.350  1.00 0.00 ? 63  ASP A HB2    3  
ATOM   5650  H HB3    . ASP C 2 63 ? -0.161  -6.319  11.501  1.00 0.00 ? 63  ASP A HB3    3  
ATOM   5651  N N      . PHE C 2 64 ? 0.797   -6.157  8.142   1.00 0.00 ? 64  PHE A N      3  
ATOM   5652  C CA     . PHE C 2 64 ? 0.233   -5.244  7.099   1.00 0.00 ? 64  PHE A CA     3  
ATOM   5653  C C      . PHE C 2 64 ? -1.007  -4.508  7.628   1.00 0.00 ? 64  PHE A C      3  
ATOM   5654  O O      . PHE C 2 64 ? -1.175  -3.324  7.408   1.00 0.00 ? 64  PHE A O      3  
ATOM   5655  C CB     . PHE C 2 64 ? -0.135  -6.171  5.932   1.00 0.00 ? 64  PHE A CB     3  
ATOM   5656  C CG     . PHE C 2 64 ? -1.028  -5.444  4.951   1.00 0.00 ? 64  PHE A CG     3  
ATOM   5657  C CD1    . PHE C 2 64 ? -0.465  -4.670  3.929   1.00 0.00 ? 64  PHE A CD1    3  
ATOM   5658  C CD2    . PHE C 2 64 ? -2.419  -5.547  5.066   1.00 0.00 ? 64  PHE A CD2    3  
ATOM   5659  C CE1    . PHE C 2 64 ? -1.296  -3.999  3.022   1.00 0.00 ? 64  PHE A CE1    3  
ATOM   5660  C CE2    . PHE C 2 64 ? -3.248  -4.876  4.160   1.00 0.00 ? 64  PHE A CE2    3  
ATOM   5661  C CZ     . PHE C 2 64 ? -2.687  -4.102  3.138   1.00 0.00 ? 64  PHE A CZ     3  
ATOM   5662  H H      . PHE C 2 64 ? 1.000   -7.089  7.915   1.00 0.00 ? 64  PHE A H      3  
ATOM   5663  H HA     . PHE C 2 64 ? 0.981   -4.535  6.780   1.00 0.00 ? 64  PHE A HA     3  
ATOM   5664  H HB2    . PHE C 2 64 ? 0.766   -6.488  5.429   1.00 0.00 ? 64  PHE A HB2    3  
ATOM   5665  H HB3    . PHE C 2 64 ? -0.655  -7.037  6.315   1.00 0.00 ? 64  PHE A HB3    3  
ATOM   5666  H HD1    . PHE C 2 64 ? 0.608   -4.590  3.840   1.00 0.00 ? 64  PHE A HD1    3  
ATOM   5667  H HD2    . PHE C 2 64 ? -2.853  -6.145  5.854   1.00 0.00 ? 64  PHE A HD2    3  
ATOM   5668  H HE1    . PHE C 2 64 ? -0.863  -3.402  2.235   1.00 0.00 ? 64  PHE A HE1    3  
ATOM   5669  H HE2    . PHE C 2 64 ? -4.322  -4.956  4.248   1.00 0.00 ? 64  PHE A HE2    3  
ATOM   5670  H HZ     . PHE C 2 64 ? -3.327  -3.585  2.439   1.00 0.00 ? 64  PHE A HZ     3  
ATOM   5671  N N      . LYS C 2 65 ? -1.881  -5.198  8.310   1.00 0.00 ? 65  LYS A N      3  
ATOM   5672  C CA     . LYS C 2 65 ? -3.111  -4.531  8.833   1.00 0.00 ? 65  LYS A CA     3  
ATOM   5673  C C      . LYS C 2 65 ? -2.788  -3.656  10.049  1.00 0.00 ? 65  LYS A C      3  
ATOM   5674  O O      . LYS C 2 65 ? -3.097  -2.481  10.073  1.00 0.00 ? 65  LYS A O      3  
ATOM   5675  C CB     . LYS C 2 65 ? -4.047  -5.675  9.224   1.00 0.00 ? 65  LYS A CB     3  
ATOM   5676  C CG     . LYS C 2 65 ? -5.477  -5.329  8.803   1.00 0.00 ? 65  LYS A CG     3  
ATOM   5677  C CD     . LYS C 2 65 ? -5.605  -5.439  7.281   1.00 0.00 ? 65  LYS A CD     3  
ATOM   5678  C CE     . LYS C 2 65 ? -6.923  -4.804  6.828   1.00 0.00 ? 65  LYS A CE     3  
ATOM   5679  N NZ     . LYS C 2 65 ? -7.593  -5.847  6.003   1.00 0.00 ? 65  LYS A NZ     3  
ATOM   5680  H H      . LYS C 2 65 ? -1.734  -6.153  8.470   1.00 0.00 ? 65  LYS A H      3  
ATOM   5681  H HA     . LYS C 2 65 ? -3.568  -3.936  8.058   1.00 0.00 ? 65  LYS A HA     3  
ATOM   5682  H HB2    . LYS C 2 65 ? -3.735  -6.582  8.727   1.00 0.00 ? 65  LYS A HB2    3  
ATOM   5683  H HB3    . LYS C 2 65 ? -4.014  -5.819  10.293  1.00 0.00 ? 65  LYS A HB3    3  
ATOM   5684  H HG2    . LYS C 2 65 ? -6.168  -6.013  9.274   1.00 0.00 ? 65  LYS A HG2    3  
ATOM   5685  H HG3    . LYS C 2 65 ? -5.707  -4.318  9.107   1.00 0.00 ? 65  LYS A HG3    3  
ATOM   5686  H HD2    . LYS C 2 65 ? -4.778  -4.924  6.812   1.00 0.00 ? 65  LYS A HD2    3  
ATOM   5687  H HD3    . LYS C 2 65 ? -5.591  -6.479  6.993   1.00 0.00 ? 65  LYS A HD3    3  
ATOM   5688  H HE2    . LYS C 2 65 ? -7.534  -4.551  7.685   1.00 0.00 ? 65  LYS A HE2    3  
ATOM   5689  H HE3    . LYS C 2 65 ? -6.733  -3.927  6.229   1.00 0.00 ? 65  LYS A HE3    3  
ATOM   5690  H HZ1    . LYS C 2 65 ? -8.506  -5.487  5.660   1.00 0.00 ? 65  LYS A HZ1    3  
ATOM   5691  H HZ2    . LYS C 2 65 ? -6.987  -6.087  5.190   1.00 0.00 ? 65  LYS A HZ2    3  
ATOM   5692  H HZ3    . LYS C 2 65 ? -7.752  -6.697  6.579   1.00 0.00 ? 65  LYS A HZ3    3  
ATOM   5693  N N      . GLN C 2 66 ? -2.179  -4.216  11.061  1.00 0.00 ? 66  GLN A N      3  
ATOM   5694  C CA     . GLN C 2 66 ? -1.851  -3.408  12.274  1.00 0.00 ? 66  GLN A CA     3  
ATOM   5695  C C      . GLN C 2 66 ? -0.837  -2.312  11.934  1.00 0.00 ? 66  GLN A C      3  
ATOM   5696  O O      . GLN C 2 66 ? -1.034  -1.154  12.253  1.00 0.00 ? 66  GLN A O      3  
ATOM   5697  C CB     . GLN C 2 66 ? -1.249  -4.401  13.269  1.00 0.00 ? 66  GLN A CB     3  
ATOM   5698  C CG     . GLN C 2 66 ? -2.278  -5.484  13.598  1.00 0.00 ? 66  GLN A CG     3  
ATOM   5699  C CD     . GLN C 2 66 ? -2.074  -5.960  15.038  1.00 0.00 ? 66  GLN A CD     3  
ATOM   5700  O OE1    . GLN C 2 66 ? -2.797  -5.563  15.930  1.00 0.00 ? 66  GLN A OE1    3  
ATOM   5701  N NE2    . GLN C 2 66 ? -1.110  -6.799  15.304  1.00 0.00 ? 66  GLN A NE2    3  
ATOM   5702  H H      . GLN C 2 66 ? -1.944  -5.167  11.027  1.00 0.00 ? 66  GLN A H      3  
ATOM   5703  H HA     . GLN C 2 66 ? -2.747  -2.973  12.689  1.00 0.00 ? 66  GLN A HA     3  
ATOM   5704  H HB2    . GLN C 2 66 ? -0.372  -4.855  12.836  1.00 0.00 ? 66  GLN A HB2    3  
ATOM   5705  H HB3    . GLN C 2 66 ? -0.975  -3.880  14.175  1.00 0.00 ? 66  GLN A HB3    3  
ATOM   5706  H HG2    . GLN C 2 66 ? -3.274  -5.080  13.489  1.00 0.00 ? 66  GLN A HG2    3  
ATOM   5707  H HG3    . GLN C 2 66 ? -2.151  -6.318  12.925  1.00 0.00 ? 66  GLN A HG3    3  
ATOM   5708  H HE21   . GLN C 2 66 ? -0.526  -7.119  14.585  1.00 0.00 ? 66  GLN A HE21   3  
ATOM   5709  H HE22   . GLN C 2 66 ? -0.971  -7.110  16.223  1.00 0.00 ? 66  GLN A HE22   3  
ATOM   5710  N N      . GLY C 2 67 ? 0.249   -2.664  11.299  1.00 0.00 ? 67  GLY A N      3  
ATOM   5711  C CA     . GLY C 2 67 ? 1.275   -1.640  10.953  1.00 0.00 ? 67  GLY A CA     3  
ATOM   5712  C C      . GLY C 2 67 ? 2.208   -1.449  12.148  1.00 0.00 ? 67  GLY A C      3  
ATOM   5713  O O      . GLY C 2 67 ? 2.427   -0.346  12.611  1.00 0.00 ? 67  GLY A O      3  
ATOM   5714  H H      . GLY C 2 67 ? 0.394   -3.602  11.058  1.00 0.00 ? 67  GLY A H      3  
ATOM   5715  H HA2    . GLY C 2 67 ? 1.842   -1.972  10.097  1.00 0.00 ? 67  GLY A HA2    3  
ATOM   5716  H HA3    . GLY C 2 67 ? 0.789   -0.702  10.726  1.00 0.00 ? 67  GLY A HA3    3  
ATOM   5717  N N      . ILE C 2 68 ? 2.753   -2.524  12.654  1.00 0.00 ? 68  ILE A N      3  
ATOM   5718  C CA     . ILE C 2 68 ? 3.672   -2.423  13.828  1.00 0.00 ? 68  ILE A CA     3  
ATOM   5719  C C      . ILE C 2 68 ? 4.598   -3.638  13.876  1.00 0.00 ? 68  ILE A C      3  
ATOM   5720  O O      . ILE C 2 68 ? 4.278   -4.695  13.367  1.00 0.00 ? 68  ILE A O      3  
ATOM   5721  C CB     . ILE C 2 68 ? 2.768   -2.399  15.068  1.00 0.00 ? 68  ILE A CB     3  
ATOM   5722  C CG1    . ILE C 2 68 ? 1.465   -3.162  14.790  1.00 0.00 ? 68  ILE A CG1    3  
ATOM   5723  C CG2    . ILE C 2 68 ? 2.440   -0.951  15.432  1.00 0.00 ? 68  ILE A CG2    3  
ATOM   5724  C CD1    . ILE C 2 68 ? 0.902   -3.715  16.101  1.00 0.00 ? 68  ILE A CD1    3  
ATOM   5725  H H      . ILE C 2 68 ? 2.553   -3.400  12.266  1.00 0.00 ? 68  ILE A H      3  
ATOM   5726  H HA     . ILE C 2 68 ? 4.248   -1.512  13.777  1.00 0.00 ? 68  ILE A HA     3  
ATOM   5727  H HB     . ILE C 2 68 ? 3.290   -2.867  15.894  1.00 0.00 ? 68  ILE A HB     3  
ATOM   5728  H HG12   . ILE C 2 68 ? 0.746   -2.492  14.343  1.00 0.00 ? 68  ILE A HG12   3  
ATOM   5729  H HG13   . ILE C 2 68 ? 1.665   -3.980  14.114  1.00 0.00 ? 68  ILE A HG13   3  
ATOM   5730  H HG21   . ILE C 2 68 ? 1.475   -0.686  15.026  1.00 0.00 ? 68  ILE A HG21   3  
ATOM   5731  H HG22   . ILE C 2 68 ? 3.195   -0.295  15.022  1.00 0.00 ? 68  ILE A HG22   3  
ATOM   5732  H HG23   . ILE C 2 68 ? 2.419   -0.845  16.508  1.00 0.00 ? 68  ILE A HG23   3  
ATOM   5733  H HD11   . ILE C 2 68 ? 0.504   -4.704  15.932  1.00 0.00 ? 68  ILE A HD11   3  
ATOM   5734  H HD12   . ILE C 2 68 ? 0.116   -3.066  16.455  1.00 0.00 ? 68  ILE A HD12   3  
ATOM   5735  H HD13   . ILE C 2 68 ? 1.689   -3.764  16.839  1.00 0.00 ? 68  ILE A HD13   3  
ATOM   5736  N N      . LEU C 2 69 ? 5.742   -3.499  14.490  1.00 0.00 ? 69  LEU A N      3  
ATOM   5737  C CA     . LEU C 2 69 ? 6.684   -4.649  14.578  1.00 0.00 ? 69  LEU A CA     3  
ATOM   5738  C C      . LEU C 2 69 ? 6.626   -5.260  15.980  1.00 0.00 ? 69  LEU A C      3  
ATOM   5739  O O      . LEU C 2 69 ? 7.387   -4.895  16.855  1.00 0.00 ? 69  LEU A O      3  
ATOM   5740  C CB     . LEU C 2 69 ? 8.072   -4.058  14.314  1.00 0.00 ? 69  LEU A CB     3  
ATOM   5741  C CG     . LEU C 2 69 ? 8.473   -4.286  12.852  1.00 0.00 ? 69  LEU A CG     3  
ATOM   5742  C CD1    . LEU C 2 69 ? 9.874   -3.718  12.617  1.00 0.00 ? 69  LEU A CD1    3  
ATOM   5743  C CD2    . LEU C 2 69 ? 8.483   -5.785  12.543  1.00 0.00 ? 69  LEU A CD2    3  
ATOM   5744  H H      . LEU C 2 69 ? 5.978   -2.640  14.898  1.00 0.00 ? 69  LEU A H      3  
ATOM   5745  H HA     . LEU C 2 69 ? 6.446   -5.391  13.831  1.00 0.00 ? 69  LEU A HA     3  
ATOM   5746  H HB2    . LEU C 2 69 ? 8.053   -2.997  14.519  1.00 0.00 ? 69  LEU A HB2    3  
ATOM   5747  H HB3    . LEU C 2 69 ? 8.794   -4.535  14.959  1.00 0.00 ? 69  LEU A HB3    3  
ATOM   5748  H HG     . LEU C 2 69 ? 7.768   -3.786  12.203  1.00 0.00 ? 69  LEU A HG     3  
ATOM   5749  H HD11   . LEU C 2 69 ? 10.603  -4.348  13.105  1.00 0.00 ? 69  LEU A HD11   3  
ATOM   5750  H HD12   . LEU C 2 69 ? 9.930   -2.719  13.024  1.00 0.00 ? 69  LEU A HD12   3  
ATOM   5751  H HD13   . LEU C 2 69 ? 10.076  -3.687  11.557  1.00 0.00 ? 69  LEU A HD13   3  
ATOM   5752  H HD21   . LEU C 2 69 ? 8.830   -6.330  13.408  1.00 0.00 ? 69  LEU A HD21   3  
ATOM   5753  H HD22   . LEU C 2 69 ? 9.141   -5.976  11.708  1.00 0.00 ? 69  LEU A HD22   3  
ATOM   5754  H HD23   . LEU C 2 69 ? 7.483   -6.107  12.292  1.00 0.00 ? 69  LEU A HD23   3  
ATOM   5755  N N      . CYS C 2 70 ? 5.725   -6.182  16.200  1.00 0.00 ? 70  CYS A N      3  
ATOM   5756  C CA     . CYS C 2 70 ? 5.606   -6.821  17.548  1.00 0.00 ? 70  CYS A CA     3  
ATOM   5757  C C      . CYS C 2 70 ? 6.986   -7.239  18.070  1.00 0.00 ? 70  CYS A C      3  
ATOM   5758  O O      . CYS C 2 70 ? 7.445   -6.757  19.088  1.00 0.00 ? 70  CYS A O      3  
ATOM   5759  C CB     . CYS C 2 70 ? 4.725   -8.050  17.328  1.00 0.00 ? 70  CYS A CB     3  
ATOM   5760  S SG     . CYS C 2 70 ? 3.910   -8.495  18.881  1.00 0.00 ? 70  CYS A SG     3  
ATOM   5761  H H      . CYS C 2 70 ? 5.119   -6.452  15.477  1.00 0.00 ? 70  CYS A H      3  
ATOM   5762  H HA     . CYS C 2 70 ? 5.129   -6.147  18.242  1.00 0.00 ? 70  CYS A HA     3  
ATOM   5763  H HB2    . CYS C 2 70 ? 3.978   -7.830  16.579  1.00 0.00 ? 70  CYS A HB2    3  
ATOM   5764  H HB3    . CYS C 2 70 ? 5.337   -8.875  16.993  1.00 0.00 ? 70  CYS A HB3    3  
ATOM   5765  H HG     . CYS C 2 70 ? 3.738   -9.439  18.866  1.00 0.00 ? 70  CYS A HG     3  
ATOM   5766  N N      . TYR C 2 71 ? 7.652   -8.127  17.378  1.00 0.00 ? 71  TYR A N      3  
ATOM   5767  C CA     . TYR C 2 71 ? 9.007   -8.575  17.826  1.00 0.00 ? 71  TYR A CA     3  
ATOM   5768  C C      . TYR C 2 71 ? 8.972   -9.013  19.296  1.00 0.00 ? 71  TYR A C      3  
ATOM   5769  O O      . TYR C 2 71 ? 9.204   -8.217  20.183  1.00 0.00 ? 71  TYR A O      3  
ATOM   5770  C CB     . TYR C 2 71 ? 9.907   -7.349  17.654  1.00 0.00 ? 71  TYR A CB     3  
ATOM   5771  C CG     . TYR C 2 71 ? 11.347  -7.741  17.886  1.00 0.00 ? 71  TYR A CG     3  
ATOM   5772  C CD1    . TYR C 2 71 ? 12.038  -8.473  16.914  1.00 0.00 ? 71  TYR A CD1    3  
ATOM   5773  C CD2    . TYR C 2 71 ? 11.990  -7.371  19.073  1.00 0.00 ? 71  TYR A CD2    3  
ATOM   5774  C CE1    . TYR C 2 71 ? 13.373  -8.836  17.129  1.00 0.00 ? 71  TYR A CE1    3  
ATOM   5775  C CE2    . TYR C 2 71 ? 13.326  -7.734  19.288  1.00 0.00 ? 71  TYR A CE2    3  
ATOM   5776  C CZ     . TYR C 2 71 ? 14.017  -8.467  18.316  1.00 0.00 ? 71  TYR A CZ     3  
ATOM   5777  O OH     . TYR C 2 71 ? 15.333  -8.824  18.527  1.00 0.00 ? 71  TYR A OH     3  
ATOM   5778  H H      . TYR C 2 71 ? 7.262   -8.498  16.559  1.00 0.00 ? 71  TYR A H      3  
ATOM   5779  H HA     . TYR C 2 71 ? 9.361   -9.379  17.203  1.00 0.00 ? 71  TYR A HA     3  
ATOM   5780  H HB2    . TYR C 2 71 ? 9.796   -6.960  16.653  1.00 0.00 ? 71  TYR A HB2    3  
ATOM   5781  H HB3    . TYR C 2 71 ? 9.622   -6.591  18.368  1.00 0.00 ? 71  TYR A HB3    3  
ATOM   5782  H HD1    . TYR C 2 71 ? 11.542  -8.758  15.998  1.00 0.00 ? 71  TYR A HD1    3  
ATOM   5783  H HD2    . TYR C 2 71 ? 11.457  -6.806  19.823  1.00 0.00 ? 71  TYR A HD2    3  
ATOM   5784  H HE1    . TYR C 2 71 ? 13.907  -9.401  16.379  1.00 0.00 ? 71  TYR A HE1    3  
ATOM   5785  H HE2    . TYR C 2 71 ? 13.821  -7.449  20.204  1.00 0.00 ? 71  TYR A HE2    3  
ATOM   5786  H HH     . TYR C 2 71 ? 15.879  -8.321  17.918  1.00 0.00 ? 71  TYR A HH     3  
ATOM   5787  N N      . PRO C 2 72 ? 8.681   -10.272 19.507  1.00 0.00 ? 72  PRO A N      3  
ATOM   5788  C CA     . PRO C 2 72 ? 8.617   -10.815 20.885  1.00 0.00 ? 72  PRO A CA     3  
ATOM   5789  C C      . PRO C 2 72 ? 10.025  -10.949 21.470  1.00 0.00 ? 72  PRO A C      3  
ATOM   5790  O O      . PRO C 2 72 ? 10.921  -11.475 20.839  1.00 0.00 ? 72  PRO A O      3  
ATOM   5791  C CB     . PRO C 2 72 ? 7.971   -12.186 20.703  1.00 0.00 ? 72  PRO A CB     3  
ATOM   5792  C CG     . PRO C 2 72 ? 8.276   -12.573 19.291  1.00 0.00 ? 72  PRO A CG     3  
ATOM   5793  C CD     . PRO C 2 72 ? 8.388   -11.298 18.496  1.00 0.00 ? 72  PRO A CD     3  
ATOM   5794  H HA     . PRO C 2 72 ? 7.998   -10.194 21.513  1.00 0.00 ? 72  PRO A HA     3  
ATOM   5795  H HB2    . PRO C 2 72 ? 8.403   -12.897 21.394  1.00 0.00 ? 72  PRO A HB2    3  
ATOM   5796  H HB3    . PRO C 2 72 ? 6.904   -12.120 20.845  1.00 0.00 ? 72  PRO A HB3    3  
ATOM   5797  H HG2    . PRO C 2 72 ? 9.211   -13.117 19.254  1.00 0.00 ? 72  PRO A HG2    3  
ATOM   5798  H HG3    . PRO C 2 72 ? 7.479   -13.181 18.895  1.00 0.00 ? 72  PRO A HG3    3  
ATOM   5799  H HD2    . PRO C 2 72 ? 9.194   -11.369 17.778  1.00 0.00 ? 72  PRO A HD2    3  
ATOM   5800  H HD3    . PRO C 2 72 ? 7.455   -11.077 18.001  1.00 0.00 ? 72  PRO A HD3    3  
ATOM   5801  N N      . ALA C 2 73 ? 10.226  -10.476 22.672  1.00 0.00 ? 73  ALA A N      3  
ATOM   5802  C CA     . ALA C 2 73 ? 11.576  -10.574 23.299  1.00 0.00 ? 73  ALA A CA     3  
ATOM   5803  C C      . ALA C 2 73 ? 11.466  -11.191 24.699  1.00 0.00 ? 73  ALA A C      3  
ATOM   5804  O O      . ALA C 2 73 ? 11.880  -10.595 25.672  1.00 0.00 ? 73  ALA A O      3  
ATOM   5805  C CB     . ALA C 2 73 ? 12.079  -9.133  23.383  1.00 0.00 ? 73  ALA A CB     3  
ATOM   5806  H H      . ALA C 2 73 ? 9.489   -10.055 23.161  1.00 0.00 ? 73  ALA A H      3  
ATOM   5807  H HA     . ALA C 2 73 ? 12.238  -11.160 22.679  1.00 0.00 ? 73  ALA A HA     3  
ATOM   5808  H HB1    . ALA C 2 73 ? 11.963  -8.653  22.422  1.00 0.00 ? 73  ALA A HB1    3  
ATOM   5809  H HB2    . ALA C 2 73 ? 13.122  -9.131  23.662  1.00 0.00 ? 73  ALA A HB2    3  
ATOM   5810  H HB3    . ALA C 2 73 ? 11.508  -8.594  24.125  1.00 0.00 ? 73  ALA A HB3    3  
ATOM   5811  N N      . PRO C 2 74 ? 10.907  -12.374 24.752  1.00 0.00 ? 74  PRO A N      3  
ATOM   5812  C CA     . PRO C 2 74 ? 10.740  -13.077 26.049  1.00 0.00 ? 74  PRO A CA     3  
ATOM   5813  C C      . PRO C 2 74 ? 12.091  -13.593 26.554  1.00 0.00 ? 74  PRO A C      3  
ATOM   5814  O O      . PRO C 2 74 ? 12.913  -14.057 25.789  1.00 0.00 ? 74  PRO A O      3  
ATOM   5815  C CB     . PRO C 2 74 ? 9.806   -14.235 25.713  1.00 0.00 ? 74  PRO A CB     3  
ATOM   5816  C CG     . PRO C 2 74 ? 10.000  -14.479 24.250  1.00 0.00 ? 74  PRO A CG     3  
ATOM   5817  C CD     . PRO C 2 74 ? 10.382  -13.160 23.628  1.00 0.00 ? 74  PRO A CD     3  
ATOM   5818  H HA     . PRO C 2 74 ? 10.281  -12.429 26.778  1.00 0.00 ? 74  PRO A HA     3  
ATOM   5819  H HB2    . PRO C 2 74 ? 10.079  -15.112 26.283  1.00 0.00 ? 74  PRO A HB2    3  
ATOM   5820  H HB3    . PRO C 2 74 ? 8.781   -13.961 25.908  1.00 0.00 ? 74  PRO A HB3    3  
ATOM   5821  H HG2    . PRO C 2 74 ? 10.788  -15.203 24.100  1.00 0.00 ? 74  PRO A HG2    3  
ATOM   5822  H HG3    . PRO C 2 74 ? 9.081   -14.835 23.810  1.00 0.00 ? 74  PRO A HG3    3  
ATOM   5823  H HD2    . PRO C 2 74 ? 11.144  -13.306 22.874  1.00 0.00 ? 74  PRO A HD2    3  
ATOM   5824  H HD3    . PRO C 2 74 ? 9.515   -12.674 23.206  1.00 0.00 ? 74  PRO A HD3    3  
ATOM   5825  N N      . LYS C 2 75 ? 12.323  -13.515 27.839  1.00 0.00 ? 75  LYS A N      3  
ATOM   5826  C CA     . LYS C 2 75 ? 13.620  -14.000 28.407  1.00 0.00 ? 75  LYS A CA     3  
ATOM   5827  C C      . LYS C 2 75 ? 14.801  -13.384 27.650  1.00 0.00 ? 75  LYS A C      3  
ATOM   5828  O O      . LYS C 2 75 ? 14.587  -12.405 26.954  1.00 0.00 ? 75  LYS A O      3  
ATOM   5829  C CB     . LYS C 2 75 ? 13.595  -15.519 28.222  1.00 0.00 ? 75  LYS A CB     3  
ATOM   5830  C CG     . LYS C 2 75 ? 13.002  -16.182 29.470  1.00 0.00 ? 75  LYS A CG     3  
ATOM   5831  C CD     . LYS C 2 75 ? 14.014  -17.165 30.063  1.00 0.00 ? 75  LYS A CD     3  
ATOM   5832  C CE     . LYS C 2 75 ? 15.188  -16.389 30.667  1.00 0.00 ? 75  LYS A CE     3  
ATOM   5833  N NZ     . LYS C 2 75 ? 14.873  -16.288 32.119  1.00 0.00 ? 75  LYS A NZ     3  
ATOM   5834  O OXT    . LYS C 2 75 ? 15.897  -13.902 27.780  1.00 0.00 ? 75  LYS A OXT    3  
ATOM   5835  H H      . LYS C 2 75 ? 11.643  -13.136 28.435  1.00 0.00 ? 75  LYS A H      3  
ATOM   5836  H HA     . LYS C 2 75 ? 13.681  -13.760 29.457  1.00 0.00 ? 75  LYS A HA     3  
ATOM   5837  H HB2    . LYS C 2 75 ? 12.992  -15.767 27.361  1.00 0.00 ? 75  LYS A HB2    3  
ATOM   5838  H HB3    . LYS C 2 75 ? 14.603  -15.879 28.069  1.00 0.00 ? 75  LYS A HB3    3  
ATOM   5839  H HG2    . LYS C 2 75 ? 12.764  -15.424 30.202  1.00 0.00 ? 75  LYS A HG2    3  
ATOM   5840  H HG3    . LYS C 2 75 ? 12.103  -16.715 29.201  1.00 0.00 ? 75  LYS A HG3    3  
ATOM   5841  H HD2    . LYS C 2 75 ? 13.536  -17.754 30.833  1.00 0.00 ? 75  LYS A HD2    3  
ATOM   5842  H HD3    . LYS C 2 75 ? 14.381  -17.817 29.285  1.00 0.00 ? 75  LYS A HD3    3  
ATOM   5843  H HE2    . LYS C 2 75 ? 16.112  -16.928 30.515  1.00 0.00 ? 75  LYS A HE2    3  
ATOM   5844  H HE3    . LYS C 2 75 ? 15.250  -15.403 30.233  1.00 0.00 ? 75  LYS A HE3    3  
ATOM   5845  H HZ1    . LYS C 2 75 ? 15.644  -15.789 32.608  1.00 0.00 ? 75  LYS A HZ1    3  
ATOM   5846  H HZ2    . LYS C 2 75 ? 13.984  -15.763 32.247  1.00 0.00 ? 75  LYS A HZ2    3  
ATOM   5847  H HZ3    . LYS C 2 75 ? 14.773  -17.241 32.520  1.00 0.00 ? 75  LYS A HZ3    3  
ATOM   5848  O "O5'"  . DG  A 1 1  ? 1.547   21.307  -12.219 1.00 0.00 ? 101 DG  B "O5'"  4  
ATOM   5849  C "C5'"  . DG  A 1 1  ? 2.510   21.235  -11.163 1.00 0.00 ? 101 DG  B "C5'"  4  
ATOM   5850  C "C4'"  . DG  A 1 1  ? 1.926   20.580  -9.917  1.00 0.00 ? 101 DG  B "C4'"  4  
ATOM   5851  O "O4'"  . DG  A 1 1  ? 0.486   20.575  -9.967  1.00 0.00 ? 101 DG  B "O4'"  4  
ATOM   5852  C "C3'"  . DG  A 1 1  ? 2.404   19.141  -9.786  1.00 0.00 ? 101 DG  B "C3'"  4  
ATOM   5853  O "O3'"  . DG  A 1 1  ? 3.263   18.995  -8.649  1.00 0.00 ? 101 DG  B "O3'"  4  
ATOM   5854  C "C2'"  . DG  A 1 1  ? 1.157   18.304  -9.642  1.00 0.00 ? 101 DG  B "C2'"  4  
ATOM   5855  C "C1'"  . DG  A 1 1  ? -0.017  19.266  -9.642  1.00 0.00 ? 101 DG  B "C1'"  4  
ATOM   5856  N N9     . DG  A 1 1  ? -1.055  18.848  -10.600 1.00 0.00 ? 101 DG  B N9     4  
ATOM   5857  C C8     . DG  A 1 1  ? -0.937  18.146  -11.750 1.00 0.00 ? 101 DG  B C8     4  
ATOM   5858  N N7     . DG  A 1 1  ? -2.013  17.911  -12.423 1.00 0.00 ? 101 DG  B N7     4  
ATOM   5859  C C5     . DG  A 1 1  ? -2.984  18.533  -11.632 1.00 0.00 ? 101 DG  B C5     4  
ATOM   5860  C C6     . DG  A 1 1  ? -4.387  18.636  -11.825 1.00 0.00 ? 101 DG  B C6     4  
ATOM   5861  O O6     . DG  A 1 1  ? -5.055  18.197  -12.739 1.00 0.00 ? 101 DG  B O6     4  
ATOM   5862  N N1     . DG  A 1 1  ? -4.994  19.344  -10.795 1.00 0.00 ? 101 DG  B N1     4  
ATOM   5863  C C2     . DG  A 1 1  ? -4.336  19.886  -9.709  1.00 0.00 ? 101 DG  B C2     4  
ATOM   5864  N N2     . DG  A 1 1  ? -5.093  20.530  -8.821  1.00 0.00 ? 101 DG  B N2     4  
ATOM   5865  N N3     . DG  A 1 1  ? -3.015  19.794  -9.520  1.00 0.00 ? 101 DG  B N3     4  
ATOM   5866  C C4     . DG  A 1 1  ? -2.403  19.109  -10.513 1.00 0.00 ? 101 DG  B C4     4  
ATOM   5867  H "H5'"  . DG  A 1 1  ? 2.841   22.242  -10.913 1.00 0.00 ? 101 DG  B "H5'"  4  
ATOM   5868  H "H5''" . DG  A 1 1  ? 3.366   20.652  -11.504 1.00 0.00 ? 101 DG  B "H5''" 4  
ATOM   5869  H "H4'"  . DG  A 1 1  ? 2.243   21.138  -9.038  1.00 0.00 ? 101 DG  B "H4'"  4  
ATOM   5870  H "H3'"  . DG  A 1 1  ? 2.936   18.850  -10.694 1.00 0.00 ? 101 DG  B "H3'"  4  
ATOM   5871  H "H2'"  . DG  A 1 1  ? 1.077   17.612  -10.478 1.00 0.00 ? 101 DG  B "H2'"  4  
ATOM   5872  H "H2''" . DG  A 1 1  ? 1.185   17.751  -8.704  1.00 0.00 ? 101 DG  B "H2''" 4  
ATOM   5873  H "H1'"  . DG  A 1 1  ? -0.446  19.293  -8.647  1.00 0.00 ? 101 DG  B "H1'"  4  
ATOM   5874  H H8     . DG  A 1 1  ? 0.033   17.791  -12.092 1.00 0.00 ? 101 DG  B H8     4  
ATOM   5875  H H1     . DG  A 1 1  ? -5.964  19.455  -10.863 1.00 0.00 ? 101 DG  B H1     4  
ATOM   5876  H H21    . DG  A 1 1  ? -6.089  20.600  -8.964  1.00 0.00 ? 101 DG  B H21    4  
ATOM   5877  H H22    . DG  A 1 1  ? -4.669  20.948  -8.005  1.00 0.00 ? 101 DG  B H22    4  
ATOM   5878  H "HO5'" . DG  A 1 1  ? 0.697   21.501  -11.817 1.00 0.00 ? 101 DG  B "HO5'" 4  
ATOM   5879  P P      . DT  A 1 2  ? 3.512   17.551  -7.980  1.00 0.00 ? 102 DT  B P      4  
ATOM   5880  O OP1    . DT  A 1 2  ? 4.813   17.582  -7.278  1.00 0.00 ? 102 DT  B OP1    4  
ATOM   5881  O OP2    . DT  A 1 2  ? 3.251   16.515  -9.005  1.00 0.00 ? 102 DT  B OP2    4  
ATOM   5882  O "O5'"  . DT  A 1 2  ? 2.342   17.472  -6.875  1.00 0.00 ? 102 DT  B "O5'"  4  
ATOM   5883  C "C5'"  . DT  A 1 2  ? 1.644   18.653  -6.467  1.00 0.00 ? 102 DT  B "C5'"  4  
ATOM   5884  C "C4'"  . DT  A 1 2  ? 0.427   18.315  -5.610  1.00 0.00 ? 102 DT  B "C4'"  4  
ATOM   5885  O "O4'"  . DT  A 1 2  ? -0.752  18.165  -6.431  1.00 0.00 ? 102 DT  B "O4'"  4  
ATOM   5886  C "C3'"  . DT  A 1 2  ? 0.654   17.014  -4.855  1.00 0.00 ? 102 DT  B "C3'"  4  
ATOM   5887  O "O3'"  . DT  A 1 2  ? 0.569   17.227  -3.443  1.00 0.00 ? 102 DT  B "O3'"  4  
ATOM   5888  C "C2'"  . DT  A 1 2  ? -0.418  16.064  -5.330  1.00 0.00 ? 102 DT  B "C2'"  4  
ATOM   5889  C "C1'"  . DT  A 1 2  ? -1.295  16.834  -6.302  1.00 0.00 ? 102 DT  B "C1'"  4  
ATOM   5890  N N1     . DT  A 1 2  ? -1.344  16.166  -7.618  1.00 0.00 ? 102 DT  B N1     4  
ATOM   5891  C C2     . DT  A 1 2  ? -2.587  15.994  -8.198  1.00 0.00 ? 102 DT  B C2     4  
ATOM   5892  O O2     . DT  A 1 2  ? -3.611  16.353  -7.650  1.00 0.00 ? 102 DT  B O2     4  
ATOM   5893  N N3     . DT  A 1 2  ? -2.597  15.393  -9.442  1.00 0.00 ? 102 DT  B N3     4  
ATOM   5894  C C4     . DT  A 1 2  ? -1.489  14.952  -10.144 1.00 0.00 ? 102 DT  B C4     4  
ATOM   5895  O O4     . DT  A 1 2  ? -1.614  14.435  -11.237 1.00 0.00 ? 102 DT  B O4     4  
ATOM   5896  C C5     . DT  A 1 2  ? -0.235  15.172  -9.459  1.00 0.00 ? 102 DT  B C5     4  
ATOM   5897  C C7     . DT  A 1 2  ? 1.068   14.733  -10.122 1.00 0.00 ? 102 DT  B C7     4  
ATOM   5898  C C6     . DT  A 1 2  ? -0.199  15.757  -8.245  1.00 0.00 ? 102 DT  B C6     4  
ATOM   5899  H "H5'"  . DT  A 1 2  ? 1.315   19.198  -7.352  1.00 0.00 ? 102 DT  B "H5'"  4  
ATOM   5900  H "H5''" . DT  A 1 2  ? 2.320   19.285  -5.891  1.00 0.00 ? 102 DT  B "H5''" 4  
ATOM   5901  H "H4'"  . DT  A 1 2  ? 0.261   19.119  -4.893  1.00 0.00 ? 102 DT  B "H4'"  4  
ATOM   5902  H "H3'"  . DT  A 1 2  ? 1.635   16.610  -5.112  1.00 0.00 ? 102 DT  B "H3'"  4  
ATOM   5903  H "H2'"  . DT  A 1 2  ? 0.036   15.212  -5.833  1.00 0.00 ? 102 DT  B "H2'"  4  
ATOM   5904  H "H2''" . DT  A 1 2  ? -1.013  15.722  -4.484  1.00 0.00 ? 102 DT  B "H2''" 4  
ATOM   5905  H "H1'"  . DT  A 1 2  ? -2.305  16.897  -5.898  1.00 0.00 ? 102 DT  B "H1'"  4  
ATOM   5906  H H3     . DT  A 1 2  ? -3.472  15.265  -9.866  1.00 0.00 ? 102 DT  B H3     4  
ATOM   5907  H H71    . DT  A 1 2  ? 1.746   15.583  -10.188 1.00 0.00 ? 102 DT  B H71    4  
ATOM   5908  H H72    . DT  A 1 2  ? 1.530   13.944  -9.528  1.00 0.00 ? 102 DT  B H72    4  
ATOM   5909  H H73    . DT  A 1 2  ? 0.857   14.359  -11.124 1.00 0.00 ? 102 DT  B H73    4  
ATOM   5910  H H6     . DT  A 1 2  ? 0.761   15.907  -7.751  1.00 0.00 ? 102 DT  B H6     4  
ATOM   5911  P P      . DA  A 1 3  ? 0.390   15.985  -2.437  1.00 0.00 ? 103 DA  B P      4  
ATOM   5912  O OP1    . DA  A 1 3  ? 0.414   16.503  -1.051  1.00 0.00 ? 103 DA  B OP1    4  
ATOM   5913  O OP2    . DA  A 1 3  ? 1.333   14.919  -2.843  1.00 0.00 ? 103 DA  B OP2    4  
ATOM   5914  O "O5'"  . DA  A 1 3  ? -1.105  15.487  -2.763  1.00 0.00 ? 103 DA  B "O5'"  4  
ATOM   5915  C "C5'"  . DA  A 1 3  ? -2.237  16.212  -2.275  1.00 0.00 ? 103 DA  B "C5'"  4  
ATOM   5916  C "C4'"  . DA  A 1 3  ? -3.491  15.345  -2.281  1.00 0.00 ? 103 DA  B "C4'"  4  
ATOM   5917  O "O4'"  . DA  A 1 3  ? -3.981  15.168  -3.625  1.00 0.00 ? 103 DA  B "O4'"  4  
ATOM   5918  C "C3'"  . DA  A 1 3  ? -3.191  13.974  -1.694  1.00 0.00 ? 103 DA  B "C3'"  4  
ATOM   5919  O "O3'"  . DA  A 1 3  ? -3.973  13.747  -0.516  1.00 0.00 ? 103 DA  B "O3'"  4  
ATOM   5920  C "C2'"  . DA  A 1 3  ? -3.532  12.983  -2.775  1.00 0.00 ? 103 DA  B "C2'"  4  
ATOM   5921  C "C1'"  . DA  A 1 3  ? -4.163  13.769  -3.906  1.00 0.00 ? 103 DA  B "C1'"  4  
ATOM   5922  N N9     . DA  A 1 3  ? -3.550  13.408  -5.188  1.00 0.00 ? 103 DA  B N9     4  
ATOM   5923  C C8     . DA  A 1 3  ? -2.246  13.296  -5.495  1.00 0.00 ? 103 DA  B C8     4  
ATOM   5924  N N7     . DA  A 1 3  ? -1.938  12.976  -6.708  1.00 0.00 ? 103 DA  B N7     4  
ATOM   5925  C C5     . DA  A 1 3  ? -3.204  12.855  -7.291  1.00 0.00 ? 103 DA  B C5     4  
ATOM   5926  C C6     . DA  A 1 3  ? -3.625  12.528  -8.584  1.00 0.00 ? 103 DA  B C6     4  
ATOM   5927  N N6     . DA  A 1 3  ? -2.781  12.254  -9.579  1.00 0.00 ? 103 DA  B N6     4  
ATOM   5928  N N1     . DA  A 1 3  ? -4.950  12.498  -8.814  1.00 0.00 ? 103 DA  B N1     4  
ATOM   5929  C C2     . DA  A 1 3  ? -5.813  12.770  -7.834  1.00 0.00 ? 103 DA  B C2     4  
ATOM   5930  N N3     . DA  A 1 3  ? -5.525  13.090  -6.576  1.00 0.00 ? 103 DA  B N3     4  
ATOM   5931  C C4     . DA  A 1 3  ? -4.192  13.114  -6.370  1.00 0.00 ? 103 DA  B C4     4  
ATOM   5932  H "H5'"  . DA  A 1 3  ? -2.403  17.084  -2.908  1.00 0.00 ? 103 DA  B "H5'"  4  
ATOM   5933  H "H5''" . DA  A 1 3  ? -2.038  16.543  -1.256  1.00 0.00 ? 103 DA  B "H5''" 4  
ATOM   5934  H "H4'"  . DA  A 1 3  ? -4.266  15.822  -1.687  1.00 0.00 ? 103 DA  B "H4'"  4  
ATOM   5935  H "H3'"  . DA  A 1 3  ? -2.128  13.903  -1.456  1.00 0.00 ? 103 DA  B "H3'"  4  
ATOM   5936  H "H2'"  . DA  A 1 3  ? -2.625  12.491  -3.126  1.00 0.00 ? 103 DA  B "H2'"  4  
ATOM   5937  H "H2''" . DA  A 1 3  ? -4.232  12.244  -2.401  1.00 0.00 ? 103 DA  B "H2''" 4  
ATOM   5938  H "H1'"  . DA  A 1 3  ? -5.221  13.554  -3.941  1.00 0.00 ? 103 DA  B "H1'"  4  
ATOM   5939  H H8     . DA  A 1 3  ? -1.484  13.459  -4.738  1.00 0.00 ? 103 DA  B H8     4  
ATOM   5940  H H61    . DA  A 1 3  ? -3.138  12.023  -10.495 1.00 0.00 ? 103 DA  B H61    4  
ATOM   5941  H H62    . DA  A 1 3  ? -1.784  12.275  -9.416  1.00 0.00 ? 103 DA  B H62    4  
ATOM   5942  H H2     . DA  A 1 3  ? -6.871  12.724  -8.094  1.00 0.00 ? 103 DA  B H2     4  
ATOM   5943  P P      . DT  A 1 4  ? -4.181  12.260  0.063   1.00 0.00 ? 104 DT  B P      4  
ATOM   5944  O OP1    . DT  A 1 4  ? -4.505  12.366  1.503   1.00 0.00 ? 104 DT  B OP1    4  
ATOM   5945  O OP2    . DT  A 1 4  ? -3.040  11.427  -0.379  1.00 0.00 ? 104 DT  B OP2    4  
ATOM   5946  O "O5'"  . DT  A 1 4  ? -5.499  11.764  -0.715  1.00 0.00 ? 104 DT  B "O5'"  4  
ATOM   5947  C "C5'"  . DT  A 1 4  ? -6.519  12.698  -1.085  1.00 0.00 ? 104 DT  B "C5'"  4  
ATOM   5948  C "C4'"  . DT  A 1 4  ? -7.715  11.998  -1.722  1.00 0.00 ? 104 DT  B "C4'"  4  
ATOM   5949  O "O4'"  . DT  A 1 4  ? -7.529  11.870  -3.150  1.00 0.00 ? 104 DT  B "O4'"  4  
ATOM   5950  C "C3'"  . DT  A 1 4  ? -7.892  10.605  -1.137  1.00 0.00 ? 104 DT  B "C3'"  4  
ATOM   5951  O "O3'"  . DT  A 1 4  ? -9.207  10.446  -0.592  1.00 0.00 ? 104 DT  B "O3'"  4  
ATOM   5952  C "C2'"  . DT  A 1 4  ? -7.658  9.645   -2.275  1.00 0.00 ? 104 DT  B "C2'"  4  
ATOM   5953  C "C1'"  . DT  A 1 4  ? -7.482  10.480  -3.532  1.00 0.00 ? 104 DT  B "C1'"  4  
ATOM   5954  N N1     . DT  A 1 4  ? -6.204  10.165  -4.195  1.00 0.00 ? 104 DT  B N1     4  
ATOM   5955  C C2     . DT  A 1 4  ? -6.239  9.866   -5.544  1.00 0.00 ? 104 DT  B C2     4  
ATOM   5956  O O2     . DT  A 1 4  ? -7.278  9.845   -6.174  1.00 0.00 ? 104 DT  B O2     4  
ATOM   5957  N N3     . DT  A 1 4  ? -5.020  9.592   -6.136  1.00 0.00 ? 104 DT  B N3     4  
ATOM   5958  C C4     . DT  A 1 4  ? -3.789  9.592   -5.502  1.00 0.00 ? 104 DT  B C4     4  
ATOM   5959  O O4     . DT  A 1 4  ? -2.775  9.336   -6.121  1.00 0.00 ? 104 DT  B O4     4  
ATOM   5960  C C5     . DT  A 1 4  ? -3.853  9.915   -4.095  1.00 0.00 ? 104 DT  B C5     4  
ATOM   5961  C C7     . DT  A 1 4  ? -2.567  9.953   -3.275  1.00 0.00 ? 104 DT  B C7     4  
ATOM   5962  C C6     . DT  A 1 4  ? -5.030  10.184  -3.496  1.00 0.00 ? 104 DT  B C6     4  
ATOM   5963  H "H5'"  . DT  A 1 4  ? -6.105  13.413  -1.795  1.00 0.00 ? 104 DT  B "H5'"  4  
ATOM   5964  H "H5''" . DT  A 1 4  ? -6.852  13.231  -0.195  1.00 0.00 ? 104 DT  B "H5''" 4  
ATOM   5965  H "H4'"  . DT  A 1 4  ? -8.615  12.582  -1.531  1.00 0.00 ? 104 DT  B "H4'"  4  
ATOM   5966  H "H3'"  . DT  A 1 4  ? -7.143  10.438  -0.360  1.00 0.00 ? 104 DT  B "H3'"  4  
ATOM   5967  H "H2'"  . DT  A 1 4  ? -6.756  9.061   -2.089  1.00 0.00 ? 104 DT  B "H2'"  4  
ATOM   5968  H "H2''" . DT  A 1 4  ? -8.513  8.982   -2.386  1.00 0.00 ? 104 DT  B "H2''" 4  
ATOM   5969  H "H1'"  . DT  A 1 4  ? -8.301  10.268  -4.219  1.00 0.00 ? 104 DT  B "H1'"  4  
ATOM   5970  H H3     . DT  A 1 4  ? -5.028  9.378   -7.092  1.00 0.00 ? 104 DT  B H3     4  
ATOM   5971  H H71    . DT  A 1 4  ? -2.800  10.219  -2.245  1.00 0.00 ? 104 DT  B H71    4  
ATOM   5972  H H72    . DT  A 1 4  ? -2.092  8.973   -3.300  1.00 0.00 ? 104 DT  B H72    4  
ATOM   5973  H H73    . DT  A 1 4  ? -1.890  10.696  -3.698  1.00 0.00 ? 104 DT  B H73    4  
ATOM   5974  H H6     . DT  A 1 4  ? -5.050  10.416  -2.431  1.00 0.00 ? 104 DT  B H6     4  
ATOM   5975  P P      . DC  A 1 5  ? -9.775  8.985   -0.226  1.00 0.00 ? 105 DC  B P      4  
ATOM   5976  O OP1    . DC  A 1 5  ? -11.140 9.143   0.323   1.00 0.00 ? 105 DC  B OP1    4  
ATOM   5977  O OP2    . DC  A 1 5  ? -8.742  8.270   0.555   1.00 0.00 ? 105 DC  B OP2    4  
ATOM   5978  O "O5'"  . DC  A 1 5  ? -9.891  8.283   -1.670  1.00 0.00 ? 105 DC  B "O5'"  4  
ATOM   5979  C "C5'"  . DC  A 1 5  ? -10.944 8.639   -2.570  1.00 0.00 ? 105 DC  B "C5'"  4  
ATOM   5980  C "C4'"  . DC  A 1 5  ? -11.127 7.583   -3.656  1.00 0.00 ? 105 DC  B "C4'"  4  
ATOM   5981  O "O4'"  . DC  A 1 5  ? -10.071 7.665   -4.635  1.00 0.00 ? 105 DC  B "O4'"  4  
ATOM   5982  C "C3'"  . DC  A 1 5  ? -11.118 6.189   -3.056  1.00 0.00 ? 105 DC  B "C3'"  4  
ATOM   5983  O "O3'"  . DC  A 1 5  ? -12.396 5.564   -3.258  1.00 0.00 ? 105 DC  B "O3'"  4  
ATOM   5984  C "C2'"  . DC  A 1 5  ? -10.001 5.448   -3.754  1.00 0.00 ? 105 DC  B "C2'"  4  
ATOM   5985  C "C1'"  . DC  A 1 5  ? -9.485  6.366   -4.844  1.00 0.00 ? 105 DC  B "C1'"  4  
ATOM   5986  N N1     . DC  A 1 5  ? -8.014  6.439   -4.822  1.00 0.00 ? 105 DC  B N1     4  
ATOM   5987  C C2     . DC  A 1 5  ? -7.340  6.197   -6.009  1.00 0.00 ? 105 DC  B C2     4  
ATOM   5988  O O2     . DC  A 1 5  ? -7.962  5.930   -7.019  1.00 0.00 ? 105 DC  B O2     4  
ATOM   5989  N N3     . DC  A 1 5  ? -5.981  6.269   -6.007  1.00 0.00 ? 105 DC  B N3     4  
ATOM   5990  C C4     . DC  A 1 5  ? -5.310  6.565   -4.885  1.00 0.00 ? 105 DC  B C4     4  
ATOM   5991  N N4     . DC  A 1 5  ? -3.979  6.628   -4.916  1.00 0.00 ? 105 DC  B N4     4  
ATOM   5992  C C5     . DC  A 1 5  ? -6.001  6.813   -3.658  1.00 0.00 ? 105 DC  B C5     4  
ATOM   5993  C C6     . DC  A 1 5  ? -7.346  6.741   -3.672  1.00 0.00 ? 105 DC  B C6     4  
ATOM   5994  H "H5'"  . DC  A 1 5  ? -10.705 9.594   -3.038  1.00 0.00 ? 105 DC  B "H5'"  4  
ATOM   5995  H "H5''" . DC  A 1 5  ? -11.873 8.738   -2.010  1.00 0.00 ? 105 DC  B "H5''" 4  
ATOM   5996  H "H4'"  . DC  A 1 5  ? -12.082 7.739   -4.155  1.00 0.00 ? 105 DC  B "H4'"  4  
ATOM   5997  H "H3'"  . DC  A 1 5  ? -10.900 6.254   -1.988  1.00 0.00 ? 105 DC  B "H3'"  4  
ATOM   5998  H "H2'"  . DC  A 1 5  ? -9.203  5.226   -3.046  1.00 0.00 ? 105 DC  B "H2'"  4  
ATOM   5999  H "H2''" . DC  A 1 5  ? -10.371 4.526   -4.192  1.00 0.00 ? 105 DC  B "H2''" 4  
ATOM   6000  H "H1'"  . DC  A 1 5  ? -9.813  5.984   -5.807  1.00 0.00 ? 105 DC  B "H1'"  4  
ATOM   6001  H H41    . DC  A 1 5  ? -3.485  6.455   -5.780  1.00 0.00 ? 105 DC  B H41    4  
ATOM   6002  H H42    . DC  A 1 5  ? -3.464  6.850   -4.076  1.00 0.00 ? 105 DC  B H42    4  
ATOM   6003  H H5     . DC  A 1 5  ? -5.459  7.049   -2.742  1.00 0.00 ? 105 DC  B H5     4  
ATOM   6004  H H6     . DC  A 1 5  ? -7.907  6.920   -2.756  1.00 0.00 ? 105 DC  B H6     4  
HETATM 6005  N N1     . 5CM A 1 6  ? -9.616  2.253   -6.683  1.00 0.00 ? 106 5CM B N1     4  
HETATM 6006  C C2     . 5CM A 1 6  ? -8.338  2.139   -7.214  1.00 0.00 ? 106 5CM B C2     4  
HETATM 6007  N N3     . 5CM A 1 6  ? -7.278  2.183   -6.363  1.00 0.00 ? 106 5CM B N3     4  
HETATM 6008  C C4     . 5CM A 1 6  ? -7.458  2.331   -5.045  1.00 0.00 ? 106 5CM B C4     4  
HETATM 6009  C C5     . 5CM A 1 6  ? -8.771  2.446   -4.489  1.00 0.00 ? 106 5CM B C5     4  
HETATM 6010  C C5A    . 5CM A 1 6  ? -8.978  2.617   -2.987  1.00 0.00 ? 106 5CM B C5A    4  
HETATM 6011  C C6     . 5CM A 1 6  ? -9.817  2.402   -5.340  1.00 0.00 ? 106 5CM B C6     4  
HETATM 6012  O O2     . 5CM A 1 6  ? -8.186  2.004   -8.412  1.00 0.00 ? 106 5CM B O2     4  
HETATM 6013  N N4     . 5CM A 1 6  ? -6.393  2.373   -4.244  1.00 0.00 ? 106 5CM B N4     4  
HETATM 6014  C "C1'"  . 5CM A 1 6  ? -10.743 2.258   -7.643  1.00 0.00 ? 106 5CM B "C1'"  4  
HETATM 6015  C "C2'"  . 5CM A 1 6  ? -11.971 1.541   -7.097  1.00 0.00 ? 106 5CM B "C2'"  4  
HETATM 6016  C "C3'"  . 5CM A 1 6  ? -13.139 2.461   -7.345  1.00 0.00 ? 106 5CM B "C3'"  4  
HETATM 6017  C "C4'"  . 5CM A 1 6  ? -12.528 3.816   -7.645  1.00 0.00 ? 106 5CM B "C4'"  4  
HETATM 6018  O "O4'"  . 5CM A 1 6  ? -11.132 3.613   -7.955  1.00 0.00 ? 106 5CM B "O4'"  4  
HETATM 6019  O "O3'"  . 5CM A 1 6  ? -13.920 2.019   -8.460  1.00 0.00 ? 106 5CM B "O3'"  4  
HETATM 6020  C "C5'"  . 5CM A 1 6  ? -12.679 4.734   -6.442  1.00 0.00 ? 106 5CM B "C5'"  4  
HETATM 6021  O "O5'"  . 5CM A 1 6  ? -11.877 4.282   -5.350  1.00 0.00 ? 106 5CM B "O5'"  4  
HETATM 6022  P P      . 5CM A 1 6  ? -12.518 4.091   -3.888  1.00 0.00 ? 106 5CM B P      4  
HETATM 6023  O OP1    . 5CM A 1 6  ? -13.952 3.766   -4.052  1.00 0.00 ? 106 5CM B OP1    4  
HETATM 6024  O OP2    . 5CM A 1 6  ? -11.636 3.194   -3.114  1.00 0.00 ? 106 5CM B OP2    4  
HETATM 6025  H H5A1   . 5CM A 1 6  ? -8.141  3.177   -2.565  1.00 0.00 ? 106 5CM B H5A1   4  
HETATM 6026  H H5A2   . 5CM A 1 6  ? -9.905  3.159   -2.807  1.00 0.00 ? 106 5CM B H5A2   4  
HETATM 6027  H H5A3   . 5CM A 1 6  ? -9.033  1.637   -2.514  1.00 0.00 ? 106 5CM B H5A3   4  
HETATM 6028  H H6     . 5CM A 1 6  ? -10.833 2.480   -4.952  1.00 0.00 ? 106 5CM B H6     4  
HETATM 6029  H HN41   . 5CM A 1 6  ? -6.516  2.484   -3.247  1.00 0.00 ? 106 5CM B HN41   4  
HETATM 6030  H HN42   . 5CM A 1 6  ? -5.465  2.291   -4.633  1.00 0.00 ? 106 5CM B HN42   4  
HETATM 6031  H "H1'"  . 5CM A 1 6  ? -10.425 1.763   -8.560  1.00 0.00 ? 106 5CM B "H1'"  4  
HETATM 6032  H "H2'"  . 5CM A 1 6  ? -11.861 1.363   -6.026  1.00 0.00 ? 106 5CM B "H2'"  4  
HETATM 6033  H "H2''" . 5CM A 1 6  ? -12.120 0.596   -7.616  1.00 0.00 ? 106 5CM B "H2''" 4  
HETATM 6034  H "H3'"  . 5CM A 1 6  ? -13.760 2.521   -6.449  1.00 0.00 ? 106 5CM B "H3'"  4  
HETATM 6035  H "H4'"  . 5CM A 1 6  ? -13.029 4.255   -8.506  1.00 0.00 ? 106 5CM B "H4'"  4  
HETATM 6036  H "H5'"  . 5CM A 1 6  ? -12.371 5.742   -6.720  1.00 0.00 ? 106 5CM B "H5'"  4  
HETATM 6037  H "H5''" . 5CM A 1 6  ? -13.725 4.752   -6.135  1.00 0.00 ? 106 5CM B "H5''" 4  
ATOM   6038  P P      . DG  A 1 7  ? -14.428 0.501   -8.542  1.00 0.00 ? 107 DG  B P      4  
ATOM   6039  O OP1    . DG  A 1 7  ? -15.413 0.397   -9.642  1.00 0.00 ? 107 DG  B OP1    4  
ATOM   6040  O OP2    . DG  A 1 7  ? -14.795 0.080   -7.178  1.00 0.00 ? 107 DG  B OP2    4  
ATOM   6041  O "O5'"  . DG  A 1 7  ? -13.098 -0.292  -8.975  1.00 0.00 ? 107 DG  B "O5'"  4  
ATOM   6042  C "C5'"  . DG  A 1 7  ? -12.355 0.121   -10.122 1.00 0.00 ? 107 DG  B "C5'"  4  
ATOM   6043  C "C4'"  . DG  A 1 7  ? -11.554 -1.032  -10.719 1.00 0.00 ? 107 DG  B "C4'"  4  
ATOM   6044  O "O4'"  . DG  A 1 7  ? -10.162 -0.930  -10.347 1.00 0.00 ? 107 DG  B "O4'"  4  
ATOM   6045  C "C3'"  . DG  A 1 7  ? -12.085 -2.374  -10.235 1.00 0.00 ? 107 DG  B "C3'"  4  
ATOM   6046  O "O3'"  . DG  A 1 7  ? -12.557 -3.158  -11.340 1.00 0.00 ? 107 DG  B "O3'"  4  
ATOM   6047  C "C2'"  . DG  A 1 7  ? -10.931 -3.046  -9.537  1.00 0.00 ? 107 DG  B "C2'"  4  
ATOM   6048  C "C1'"  . DG  A 1 7  ? -9.725  -2.140  -9.696  1.00 0.00 ? 107 DG  B "C1'"  4  
ATOM   6049  N N9     . DG  A 1 7  ? -9.130  -1.851  -8.386  1.00 0.00 ? 107 DG  B N9     4  
ATOM   6050  C C8     . DG  A 1 7  ? -9.740  -1.597  -7.212  1.00 0.00 ? 107 DG  B C8     4  
ATOM   6051  N N7     . DG  A 1 7  ? -8.994  -1.426  -6.173  1.00 0.00 ? 107 DG  B N7     4  
ATOM   6052  C C5     . DG  A 1 7  ? -7.714  -1.580  -6.714  1.00 0.00 ? 107 DG  B C5     4  
ATOM   6053  C C6     . DG  A 1 7  ? -6.442  -1.509  -6.084  1.00 0.00 ? 107 DG  B C6     4  
ATOM   6054  O O6     . DG  A 1 7  ? -6.192  -1.292  -4.915  1.00 0.00 ? 107 DG  B O6     4  
ATOM   6055  N N1     . DG  A 1 7  ? -5.412  -1.725  -6.991  1.00 0.00 ? 107 DG  B N1     4  
ATOM   6056  C C2     . DG  A 1 7  ? -5.577  -1.976  -8.338  1.00 0.00 ? 107 DG  B C2     4  
ATOM   6057  N N2     . DG  A 1 7  ? -4.462  -2.156  -9.046  1.00 0.00 ? 107 DG  B N2     4  
ATOM   6058  N N3     . DG  A 1 7  ? -6.770  -2.044  -8.938  1.00 0.00 ? 107 DG  B N3     4  
ATOM   6059  C C4     . DG  A 1 7  ? -7.789  -1.839  -8.074  1.00 0.00 ? 107 DG  B C4     4  
ATOM   6060  H "H5'"  . DG  A 1 7  ? -11.670 0.917   -9.835  1.00 0.00 ? 107 DG  B "H5'"  4  
ATOM   6061  H "H5''" . DG  A 1 7  ? -13.046 0.500   -10.875 1.00 0.00 ? 107 DG  B "H5''" 4  
ATOM   6062  H "H4'"  . DG  A 1 7  ? -11.633 -0.993  -11.802 1.00 0.00 ? 107 DG  B "H4'"  4  
ATOM   6063  H "H3'"  . DG  A 1 7  ? -12.895 -2.208  -9.522  1.00 0.00 ? 107 DG  B "H3'"  4  
ATOM   6064  H "H2'"  . DG  A 1 7  ? -11.161 -3.173  -8.478  1.00 0.00 ? 107 DG  B "H2'"  4  
ATOM   6065  H "H2''" . DG  A 1 7  ? -10.727 -4.012  -9.989  1.00 0.00 ? 107 DG  B "H2''" 4  
ATOM   6066  H "H1'"  . DG  A 1 7  ? -8.987  -2.635  -10.317 1.00 0.00 ? 107 DG  B "H1'"  4  
ATOM   6067  H H8     . DG  A 1 7  ? -10.826 -1.540  -7.152  1.00 0.00 ? 107 DG  B H8     4  
ATOM   6068  H H1     . DG  A 1 7  ? -4.503  -1.694  -6.624  1.00 0.00 ? 107 DG  B H1     4  
ATOM   6069  H H21    . DG  A 1 7  ? -3.562  -2.104  -8.593  1.00 0.00 ? 107 DG  B H21    4  
ATOM   6070  H H22    . DG  A 1 7  ? -4.518  -2.342  -10.038 1.00 0.00 ? 107 DG  B H22    4  
ATOM   6071  P P      . DG  A 1 8  ? -12.616 -4.766  -11.253 1.00 0.00 ? 108 DG  B P      4  
ATOM   6072  O OP1    . DG  A 1 8  ? -13.641 -5.246  -12.207 1.00 0.00 ? 108 DG  B OP1    4  
ATOM   6073  O OP2    . DG  A 1 8  ? -12.696 -5.152  -9.826  1.00 0.00 ? 108 DG  B OP2    4  
ATOM   6074  O "O5'"  . DG  A 1 8  ? -11.166 -5.196  -11.812 1.00 0.00 ? 108 DG  B "O5'"  4  
ATOM   6075  C "C5'"  . DG  A 1 8  ? -10.499 -4.390  -12.786 1.00 0.00 ? 108 DG  B "C5'"  4  
ATOM   6076  C "C4'"  . DG  A 1 8  ? -8.998  -4.662  -12.815 1.00 0.00 ? 108 DG  B "C4'"  4  
ATOM   6077  O "O4'"  . DG  A 1 8  ? -8.406  -4.427  -11.520 1.00 0.00 ? 108 DG  B "O4'"  4  
ATOM   6078  C "C3'"  . DG  A 1 8  ? -8.715  -6.103  -13.215 1.00 0.00 ? 108 DG  B "C3'"  4  
ATOM   6079  O "O3'"  . DG  A 1 8  ? -8.052  -6.148  -14.486 1.00 0.00 ? 108 DG  B "O3'"  4  
ATOM   6080  C "C2'"  . DG  A 1 8  ? -7.846  -6.671  -12.118 1.00 0.00 ? 108 DG  B "C2'"  4  
ATOM   6081  C "C1'"  . DG  A 1 8  ? -7.560  -5.533  -11.158 1.00 0.00 ? 108 DG  B "C1'"  4  
ATOM   6082  N N9     . DG  A 1 8  ? -7.792  -5.937  -9.764  1.00 0.00 ? 108 DG  B N9     4  
ATOM   6083  C C8     . DG  A 1 8  ? -8.953  -6.213  -9.136  1.00 0.00 ? 108 DG  B C8     4  
ATOM   6084  N N7     . DG  A 1 8  ? -8.900  -6.522  -7.883  1.00 0.00 ? 108 DG  B N7     4  
ATOM   6085  C C5     . DG  A 1 8  ? -7.525  -6.445  -7.631  1.00 0.00 ? 108 DG  B C5     4  
ATOM   6086  C C6     . DG  A 1 8  ? -6.804  -6.671  -6.428  1.00 0.00 ? 108 DG  B C6     4  
ATOM   6087  O O6     . DG  A 1 8  ? -7.236  -6.987  -5.337  1.00 0.00 ? 108 DG  B O6     4  
ATOM   6088  N N1     . DG  A 1 8  ? -5.439  -6.486  -6.611  1.00 0.00 ? 108 DG  B N1     4  
ATOM   6089  C C2     . DG  A 1 8  ? -4.837  -6.129  -7.799  1.00 0.00 ? 108 DG  B C2     4  
ATOM   6090  N N2     . DG  A 1 8  ? -3.511  -6.001  -7.772  1.00 0.00 ? 108 DG  B N2     4  
ATOM   6091  N N3     . DG  A 1 8  ? -5.508  -5.914  -8.935  1.00 0.00 ? 108 DG  B N3     4  
ATOM   6092  C C4     . DG  A 1 8  ? -6.840  -6.088  -8.782  1.00 0.00 ? 108 DG  B C4     4  
ATOM   6093  H "H5'"  . DG  A 1 8  ? -10.664 -3.339  -12.551 1.00 0.00 ? 108 DG  B "H5'"  4  
ATOM   6094  H "H5''" . DG  A 1 8  ? -10.916 -4.604  -13.770 1.00 0.00 ? 108 DG  B "H5''" 4  
ATOM   6095  H "H4'"  . DG  A 1 8  ? -8.528  -3.997  -13.538 1.00 0.00 ? 108 DG  B "H4'"  4  
ATOM   6096  H "H3'"  . DG  A 1 8  ? -9.653  -6.659  -13.263 1.00 0.00 ? 108 DG  B "H3'"  4  
ATOM   6097  H "H2'"  . DG  A 1 8  ? -8.376  -7.471  -11.600 1.00 0.00 ? 108 DG  B "H2'"  4  
ATOM   6098  H "H2''" . DG  A 1 8  ? -6.914  -7.050  -12.533 1.00 0.00 ? 108 DG  B "H2''" 4  
ATOM   6099  H "H1'"  . DG  A 1 8  ? -6.526  -5.235  -11.269 1.00 0.00 ? 108 DG  B "H1'"  4  
ATOM   6100  H H8     . DG  A 1 8  ? -9.896  -6.172  -9.671  1.00 0.00 ? 108 DG  B H8     4  
ATOM   6101  H H1     . DG  A 1 8  ? -4.877  -6.623  -5.822  1.00 0.00 ? 108 DG  B H1     4  
ATOM   6102  H H21    . DG  A 1 8  ? -3.005  -6.164  -6.913  1.00 0.00 ? 108 DG  B H21    4  
ATOM   6103  H H22    . DG  A 1 8  ? -3.011  -5.743  -8.611  1.00 0.00 ? 108 DG  B H22    4  
ATOM   6104  P P      . DA  A 1 9  ? -7.118  -7.395  -14.896 1.00 0.00 ? 109 DA  B P      4  
ATOM   6105  O OP1    . DA  A 1 9  ? -6.602  -7.158  -16.262 1.00 0.00 ? 109 DA  B OP1    4  
ATOM   6106  O OP2    . DA  A 1 9  ? -7.849  -8.644  -14.587 1.00 0.00 ? 109 DA  B OP2    4  
ATOM   6107  O "O5'"  . DA  A 1 9  ? -5.888  -7.263  -13.863 1.00 0.00 ? 109 DA  B "O5'"  4  
ATOM   6108  C "C5'"  . DA  A 1 9  ? -4.823  -6.341  -14.111 1.00 0.00 ? 109 DA  B "C5'"  4  
ATOM   6109  C "C4'"  . DA  A 1 9  ? -3.464  -7.020  -13.983 1.00 0.00 ? 109 DA  B "C4'"  4  
ATOM   6110  O "O4'"  . DA  A 1 9  ? -3.102  -7.177  -12.592 1.00 0.00 ? 109 DA  B "O4'"  4  
ATOM   6111  C "C3'"  . DA  A 1 9  ? -3.506  -8.398  -14.621 1.00 0.00 ? 109 DA  B "C3'"  4  
ATOM   6112  O "O3'"  . DA  A 1 9  ? -2.439  -8.549  -15.567 1.00 0.00 ? 109 DA  B "O3'"  4  
ATOM   6113  C "C2'"  . DA  A 1 9  ? -3.374  -9.379  -13.485 1.00 0.00 ? 109 DA  B "C2'"  4  
ATOM   6114  C "C1'"  . DA  A 1 9  ? -3.080  -8.575  -12.233 1.00 0.00 ? 109 DA  B "C1'"  4  
ATOM   6115  N N9     . DA  A 1 9  ? -4.081  -8.859  -11.201 1.00 0.00 ? 109 DA  B N9     4  
ATOM   6116  C C8     . DA  A 1 9  ? -5.418  -8.923  -11.323 1.00 0.00 ? 109 DA  B C8     4  
ATOM   6117  N N7     . DA  A 1 9  ? -6.107  -9.173  -10.260 1.00 0.00 ? 109 DA  B N7     4  
ATOM   6118  C C5     . DA  A 1 9  ? -5.099  -9.299  -9.298  1.00 0.00 ? 109 DA  B C5     4  
ATOM   6119  C C6     . DA  A 1 9  ? -5.123  -9.569  -7.926  1.00 0.00 ? 109 DA  B C6     4  
ATOM   6120  N N6     . DA  A 1 9  ? -6.250  -9.774  -7.243  1.00 0.00 ? 109 DA  B N6     4  
ATOM   6121  N N1     . DA  A 1 9  ? -3.942  -9.623  -7.284  1.00 0.00 ? 109 DA  B N1     4  
ATOM   6122  C C2     . DA  A 1 9  ? -2.802  -9.423  -7.950  1.00 0.00 ? 109 DA  B C2     4  
ATOM   6123  N N3     . DA  A 1 9  ? -2.664  -9.159  -9.246  1.00 0.00 ? 109 DA  B N3     4  
ATOM   6124  C C4     . DA  A 1 9  ? -3.860  -9.111  -9.866  1.00 0.00 ? 109 DA  B C4     4  
ATOM   6125  H "H5'"  . DA  A 1 9  ? -4.883  -5.524  -13.390 1.00 0.00 ? 109 DA  B "H5'"  4  
ATOM   6126  H "H5''" . DA  A 1 9  ? -4.926  -5.937  -15.117 1.00 0.00 ? 109 DA  B "H5''" 4  
ATOM   6127  H "H4'"  . DA  A 1 9  ? -2.710  -6.414  -14.484 1.00 0.00 ? 109 DA  B "H4'"  4  
ATOM   6128  H "H3'"  . DA  A 1 9  ? -4.467  -8.542  -15.118 1.00 0.00 ? 109 DA  B "H3'"  4  
ATOM   6129  H "H2'"  . DA  A 1 9  ? -4.308  -9.929  -13.361 1.00 0.00 ? 109 DA  B "H2'"  4  
ATOM   6130  H "H2''" . DA  A 1 9  ? -2.565  -10.070 -13.677 1.00 0.00 ? 109 DA  B "H2''" 4  
ATOM   6131  H "H1'"  . DA  A 1 9  ? -2.098  -8.838  -11.858 1.00 0.00 ? 109 DA  B "H1'"  4  
ATOM   6132  H H8     . DA  A 1 9  ? -5.889  -8.778  -12.290 1.00 0.00 ? 109 DA  B H8     4  
ATOM   6133  H H61    . DA  A 1 9  ? -6.212  -9.966  -6.253  1.00 0.00 ? 109 DA  B H61    4  
ATOM   6134  H H62    . DA  A 1 9  ? -7.141  -9.737  -7.718  1.00 0.00 ? 109 DA  B H62    4  
ATOM   6135  H H2     . DA  A 1 9  ? -1.883  -9.491  -7.366  1.00 0.00 ? 109 DA  B H2     4  
ATOM   6136  P P      . DT  A 1 10 ? -1.922  -10.010 -16.006 1.00 0.00 ? 110 DT  B P      4  
ATOM   6137  O OP1    . DT  A 1 10 ? -1.206  -9.881  -17.295 1.00 0.00 ? 110 DT  B OP1    4  
ATOM   6138  O OP2    . DT  A 1 10 ? -3.051  -10.958 -15.879 1.00 0.00 ? 110 DT  B OP2    4  
ATOM   6139  O "O5'"  . DT  A 1 10 ? -0.844  -10.354 -14.860 1.00 0.00 ? 110 DT  B "O5'"  4  
ATOM   6140  C "C5'"  . DT  A 1 10 ? -0.230  -9.306  -14.103 1.00 0.00 ? 110 DT  B "C5'"  4  
ATOM   6141  C "C4'"  . DT  A 1 10 ? 0.710   -9.857  -13.034 1.00 0.00 ? 110 DT  B "C4'"  4  
ATOM   6142  O "O4'"  . DT  A 1 10 ? 0.027   -9.977  -11.766 1.00 0.00 ? 110 DT  B "O4'"  4  
ATOM   6143  C "C3'"  . DT  A 1 10 ? 1.227   -11.232 -13.431 1.00 0.00 ? 110 DT  B "C3'"  4  
ATOM   6144  O "O3'"  . DT  A 1 10 ? 2.659   -11.235 -13.486 1.00 0.00 ? 110 DT  B "O3'"  4  
ATOM   6145  C "C2'"  . DT  A 1 10 ? 0.719   -12.184 -12.378 1.00 0.00 ? 110 DT  B "C2'"  4  
ATOM   6146  C "C1'"  . DT  A 1 10 ? 0.043   -11.347 -11.310 1.00 0.00 ? 110 DT  B "C1'"  4  
ATOM   6147  N N1     . DT  A 1 10 ? -1.325  -11.829 -11.058 1.00 0.00 ? 110 DT  B N1     4  
ATOM   6148  C C2     . DT  A 1 10 ? -1.669  -12.124 -9.753  1.00 0.00 ? 110 DT  B C2     4  
ATOM   6149  O O2     . DT  A 1 10 ? -0.881  -12.011 -8.835  1.00 0.00 ? 110 DT  B O2     4  
ATOM   6150  N N3     . DT  A 1 10 ? -2.965  -12.558 -9.552  1.00 0.00 ? 110 DT  B N3     4  
ATOM   6151  C C4     . DT  A 1 10 ? -3.932  -12.719 -10.530 1.00 0.00 ? 110 DT  B C4     4  
ATOM   6152  O O4     . DT  A 1 10 ? -5.047  -13.106 -10.243 1.00 0.00 ? 110 DT  B O4     4  
ATOM   6153  C C5     . DT  A 1 10 ? -3.478  -12.387 -11.862 1.00 0.00 ? 110 DT  B C5     4  
ATOM   6154  C C7     . DT  A 1 10 ? -4.441  -12.518 -13.038 1.00 0.00 ? 110 DT  B C7     4  
ATOM   6155  C C6     . DT  A 1 10 ? -2.218  -11.964 -12.082 1.00 0.00 ? 110 DT  B C6     4  
ATOM   6156  H "H5'"  . DT  A 1 10 ? -1.006  -8.713  -13.622 1.00 0.00 ? 110 DT  B "H5'"  4  
ATOM   6157  H "H5''" . DT  A 1 10 ? 0.338   -8.665  -14.779 1.00 0.00 ? 110 DT  B "H5''" 4  
ATOM   6158  H "H4'"  . DT  A 1 10 ? 1.555   -9.178  -12.919 1.00 0.00 ? 110 DT  B "H4'"  4  
ATOM   6159  H "H3'"  . DT  A 1 10 ? 0.816   -11.510 -14.403 1.00 0.00 ? 110 DT  B "H3'"  4  
ATOM   6160  H "H2'"  . DT  A 1 10 ? 0.000   -12.874 -12.819 1.00 0.00 ? 110 DT  B "H2'"  4  
ATOM   6161  H "H2''" . DT  A 1 10 ? 1.547   -12.740 -11.945 1.00 0.00 ? 110 DT  B "H2''" 4  
ATOM   6162  H "H1'"  . DT  A 1 10 ? 0.620   -11.409 -10.387 1.00 0.00 ? 110 DT  B "H1'"  4  
ATOM   6163  H H3     . DT  A 1 10 ? -3.224  -12.773 -8.632  1.00 0.00 ? 110 DT  B H3     4  
ATOM   6164  H H71    . DT  A 1 10 ? -5.367  -11.989 -12.810 1.00 0.00 ? 110 DT  B H71    4  
ATOM   6165  H H72    . DT  A 1 10 ? -3.986  -12.087 -13.930 1.00 0.00 ? 110 DT  B H72    4  
ATOM   6166  H H73    . DT  A 1 10 ? -4.658  -13.572 -13.213 1.00 0.00 ? 110 DT  B H73    4  
ATOM   6167  H H6     . DT  A 1 10 ? -1.899  -11.736 -13.097 1.00 0.00 ? 110 DT  B H6     4  
ATOM   6168  P P      . DA  A 1 11 ? 3.485   -12.616 -13.444 1.00 0.00 ? 111 DA  B P      4  
ATOM   6169  O OP1    . DA  A 1 11 ? 4.928   -12.296 -13.534 1.00 0.00 ? 111 DA  B OP1    4  
ATOM   6170  O OP2    . DA  A 1 11 ? 2.875   -13.551 -14.416 1.00 0.00 ? 111 DA  B OP2    4  
ATOM   6171  O "O5'"  . DA  A 1 11 ? 3.180   -13.162 -11.961 1.00 0.00 ? 111 DA  B "O5'"  4  
ATOM   6172  C "C5'"  . DA  A 1 11 ? 3.741   -12.514 -10.815 1.00 0.00 ? 111 DA  B "C5'"  4  
ATOM   6173  C "C4'"  . DA  A 1 11 ? 4.053   -13.516 -9.707  1.00 0.00 ? 111 DA  B "C4'"  4  
ATOM   6174  O "O4'"  . DA  A 1 11 ? 2.875   -13.776 -8.910  1.00 0.00 ? 111 DA  B "O4'"  4  
ATOM   6175  C "C3'"  . DA  A 1 11 ? 4.526   -14.831 -10.304 1.00 0.00 ? 111 DA  B "C3'"  4  
ATOM   6176  O "O3'"  . DA  A 1 11 ? 5.801   -15.202 -9.771  1.00 0.00 ? 111 DA  B "O3'"  4  
ATOM   6177  C "C2'"  . DA  A 1 11 ? 3.475   -15.849 -9.946  1.00 0.00 ? 111 DA  B "C2'"  4  
ATOM   6178  C "C1'"  . DA  A 1 11 ? 2.481   -15.160 -9.030  1.00 0.00 ? 111 DA  B "C1'"  4  
ATOM   6179  N N9     . DA  A 1 11 ? 1.124   -15.269 -9.578  1.00 0.00 ? 111 DA  B N9     4  
ATOM   6180  C C8     . DA  A 1 11 ? 0.707   -15.098 -10.846 1.00 0.00 ? 111 DA  B C8     4  
ATOM   6181  N N7     . DA  A 1 11 ? -0.554  -15.238 -11.087 1.00 0.00 ? 111 DA  B N7     4  
ATOM   6182  C C5     . DA  A 1 11 ? -1.049  -15.544 -9.814  1.00 0.00 ? 111 DA  B C5     4  
ATOM   6183  C C6     . DA  A 1 11 ? -2.334  -15.824 -9.336  1.00 0.00 ? 111 DA  B C6     4  
ATOM   6184  N N6     . DA  A 1 11 ? -3.416  -15.836 -10.115 1.00 0.00 ? 111 DA  B N6     4  
ATOM   6185  N N1     . DA  A 1 11 ? -2.461  -16.088 -8.024  1.00 0.00 ? 111 DA  B N1     4  
ATOM   6186  C C2     . DA  A 1 11 ? -1.392  -16.079 -7.225  1.00 0.00 ? 111 DA  B C2     4  
ATOM   6187  N N3     . DA  A 1 11 ? -0.132  -15.829 -7.572  1.00 0.00 ? 111 DA  B N3     4  
ATOM   6188  C C4     . DA  A 1 11 ? -0.030  -15.566 -8.890  1.00 0.00 ? 111 DA  B C4     4  
ATOM   6189  H "H5'"  . DA  A 1 11 ? 3.031   -11.777 -10.439 1.00 0.00 ? 111 DA  B "H5'"  4  
ATOM   6190  H "H5''" . DA  A 1 11 ? 4.661   -12.007 -11.106 1.00 0.00 ? 111 DA  B "H5''" 4  
ATOM   6191  H "H4'"  . DA  A 1 11 ? 4.835   -13.110 -9.067  1.00 0.00 ? 111 DA  B "H4'"  4  
ATOM   6192  H "H3'"  . DA  A 1 11 ? 4.588   -14.739 -11.390 1.00 0.00 ? 111 DA  B "H3'"  4  
ATOM   6193  H "H2'"  . DA  A 1 11 ? 2.969   -16.194 -10.848 1.00 0.00 ? 111 DA  B "H2'"  4  
ATOM   6194  H "H2''" . DA  A 1 11 ? 3.929   -16.691 -9.433  1.00 0.00 ? 111 DA  B "H2''" 4  
ATOM   6195  H "H1'"  . DA  A 1 11 ? 2.506   -15.627 -8.053  1.00 0.00 ? 111 DA  B "H1'"  4  
ATOM   6196  H H8     . DA  A 1 11 ? 1.419   -14.873 -11.634 1.00 0.00 ? 111 DA  B H8     4  
ATOM   6197  H H61    . DA  A 1 11 ? -4.321  -16.045 -9.718  1.00 0.00 ? 111 DA  B H61    4  
ATOM   6198  H H62    . DA  A 1 11 ? -3.330  -15.637 -11.101 1.00 0.00 ? 111 DA  B H62    4  
ATOM   6199  H H2     . DA  A 1 11 ? -1.569  -16.302 -6.174  1.00 0.00 ? 111 DA  B H2     4  
ATOM   6200  P P      . DC  A 1 12 ? 6.534   -16.550 -10.260 1.00 0.00 ? 112 DC  B P      4  
ATOM   6201  O OP1    . DC  A 1 12 ? 7.957   -16.476 -9.860  1.00 0.00 ? 112 DC  B OP1    4  
ATOM   6202  O OP2    . DC  A 1 12 ? 6.176   -16.783 -11.677 1.00 0.00 ? 112 DC  B OP2    4  
ATOM   6203  O "O5'"  . DC  A 1 12 ? 5.817   -17.682 -9.367  1.00 0.00 ? 112 DC  B "O5'"  4  
ATOM   6204  C "C5'"  . DC  A 1 12 ? 6.504   -18.279 -8.264  1.00 0.00 ? 112 DC  B "C5'"  4  
ATOM   6205  C "C4'"  . DC  A 1 12 ? 5.792   -19.539 -7.782  1.00 0.00 ? 112 DC  B "C4'"  4  
ATOM   6206  O "O4'"  . DC  A 1 12 ? 4.372   -19.314 -7.678  1.00 0.00 ? 112 DC  B "O4'"  4  
ATOM   6207  C "C3'"  . DC  A 1 12 ? 6.023   -20.692 -8.748  1.00 0.00 ? 112 DC  B "C3'"  4  
ATOM   6208  O "O3'"  . DC  A 1 12 ? 6.818   -21.715 -8.140  1.00 0.00 ? 112 DC  B "O3'"  4  
ATOM   6209  C "C2'"  . DC  A 1 12 ? 4.655   -21.212 -9.102  1.00 0.00 ? 112 DC  B "C2'"  4  
ATOM   6210  C "C1'"  . DC  A 1 12 ? 3.652   -20.381 -8.321  1.00 0.00 ? 112 DC  B "C1'"  4  
ATOM   6211  N N1     . DC  A 1 12 ? 2.604   -19.847 -9.211  1.00 0.00 ? 112 DC  B N1     4  
ATOM   6212  C C2     . DC  A 1 12 ? 1.284   -20.042 -8.836  1.00 0.00 ? 112 DC  B C2     4  
ATOM   6213  O O2     . DC  A 1 12 ? 1.023   -20.635 -7.808  1.00 0.00 ? 112 DC  B O2     4  
ATOM   6214  N N3     . DC  A 1 12 ? 0.304   -19.554 -9.646  1.00 0.00 ? 112 DC  B N3     4  
ATOM   6215  C C4     . DC  A 1 12 ? 0.607   -18.901 -10.776 1.00 0.00 ? 112 DC  B C4     4  
ATOM   6216  N N4     . DC  A 1 12 ? -0.376  -18.435 -11.545 1.00 0.00 ? 112 DC  B N4     4  
ATOM   6217  C C5     . DC  A 1 12 ? 1.968   -18.698 -11.166 1.00 0.00 ? 112 DC  B C5     4  
ATOM   6218  C C6     . DC  A 1 12 ? 2.929   -19.186 -10.358 1.00 0.00 ? 112 DC  B C6     4  
ATOM   6219  H "H5'"  . DC  A 1 12 ? 6.553   -17.563 -7.445  1.00 0.00 ? 112 DC  B "H5'"  4  
ATOM   6220  H "H5''" . DC  A 1 12 ? 7.516   -18.539 -8.573  1.00 0.00 ? 112 DC  B "H5''" 4  
ATOM   6221  H "H4'"  . DC  A 1 12 ? 6.175   -19.816 -6.803  1.00 0.00 ? 112 DC  B "H4'"  4  
ATOM   6222  H "H3'"  . DC  A 1 12 ? 6.517   -20.320 -9.648  1.00 0.00 ? 112 DC  B "H3'"  4  
ATOM   6223  H "HO3'" . DC  A 1 12 ? 7.020   -21.428 -7.247  1.00 0.00 ? 112 DC  B "HO3'" 4  
ATOM   6224  H "H2'"  . DC  A 1 12 ? 4.480   -21.099 -10.172 1.00 0.00 ? 112 DC  B "H2'"  4  
ATOM   6225  H "H2''" . DC  A 1 12 ? 4.570   -22.260 -8.820  1.00 0.00 ? 112 DC  B "H2''" 4  
ATOM   6226  H "H1'"  . DC  A 1 12 ? 3.193   -21.005 -7.559  1.00 0.00 ? 112 DC  B "H1'"  4  
ATOM   6227  H H41    . DC  A 1 12 ? -1.339  -18.574 -11.275 1.00 0.00 ? 112 DC  B H41    4  
ATOM   6228  H H42    . DC  A 1 12 ? -0.158  -17.941 -12.399 1.00 0.00 ? 112 DC  B H42    4  
ATOM   6229  H H5     . DC  A 1 12 ? 2.219   -18.167 -12.084 1.00 0.00 ? 112 DC  B H5     4  
ATOM   6230  H H6     . DC  A 1 12 ? 3.978   -19.053 -10.625 1.00 0.00 ? 112 DC  B H6     4  
ATOM   6231  O "O5'"  . DG  B 1 1  ? -9.592  -22.527 -9.366  1.00 0.00 ? 113 DG  C "O5'"  4  
ATOM   6232  C "C5'"  . DG  B 1 1  ? -9.284  -23.425 -8.296  1.00 0.00 ? 113 DG  C "C5'"  4  
ATOM   6233  C "C4'"  . DG  B 1 1  ? -8.542  -22.717 -7.166  1.00 0.00 ? 113 DG  C "C4'"  4  
ATOM   6234  O "O4'"  . DG  B 1 1  ? -7.191  -22.403 -7.558  1.00 0.00 ? 113 DG  C "O4'"  4  
ATOM   6235  C "C3'"  . DG  B 1 1  ? -9.243  -21.421 -6.787  1.00 0.00 ? 113 DG  C "C3'"  4  
ATOM   6236  O "O3'"  . DG  B 1 1  ? -9.787  -21.505 -5.465  1.00 0.00 ? 113 DG  C "O3'"  4  
ATOM   6237  C "C2'"  . DG  B 1 1  ? -8.191  -20.344 -6.873  1.00 0.00 ? 113 DG  C "C2'"  4  
ATOM   6238  C "C1'"  . DG  B 1 1  ? -6.888  -21.033 -7.237  1.00 0.00 ? 113 DG  C "C1'"  4  
ATOM   6239  N N9     . DG  B 1 1  ? -6.229  -20.360 -8.367  1.00 0.00 ? 113 DG  C N9     4  
ATOM   6240  C C8     . DG  B 1 1  ? -6.775  -19.727 -9.427  1.00 0.00 ? 113 DG  C C8     4  
ATOM   6241  N N7     . DG  B 1 1  ? -5.973  -19.208 -10.297 1.00 0.00 ? 113 DG  C N7     4  
ATOM   6242  C C5     . DG  B 1 1  ? -4.724  -19.531 -9.757  1.00 0.00 ? 113 DG  C C5     4  
ATOM   6243  C C6     . DG  B 1 1  ? -3.420  -19.242 -10.240 1.00 0.00 ? 113 DG  C C6     4  
ATOM   6244  O O6     . DG  B 1 1  ? -3.105  -18.640 -11.247 1.00 0.00 ? 113 DG  C O6     4  
ATOM   6245  N N1     . DG  B 1 1  ? -2.439  -19.747 -9.394  1.00 0.00 ? 113 DG  C N1     4  
ATOM   6246  C C2     . DG  B 1 1  ? -2.679  -20.443 -8.227  1.00 0.00 ? 113 DG  C C2     4  
ATOM   6247  N N2     . DG  B 1 1  ? -1.605  -20.846 -7.548  1.00 0.00 ? 113 DG  C N2     4  
ATOM   6248  N N3     . DG  B 1 1  ? -3.903  -20.719 -7.765  1.00 0.00 ? 113 DG  C N3     4  
ATOM   6249  C C4     . DG  B 1 1  ? -4.873  -20.237 -8.573  1.00 0.00 ? 113 DG  C C4     4  
ATOM   6250  H "H5'"  . DG  B 1 1  ? -8.660  -24.234 -8.677  1.00 0.00 ? 113 DG  C "H5'"  4  
ATOM   6251  H "H5''" . DG  B 1 1  ? -10.211 -23.844 -7.905  1.00 0.00 ? 113 DG  C "H5''" 4  
ATOM   6252  H "H4'"  . DG  B 1 1  ? -8.511  -23.369 -6.294  1.00 0.00 ? 113 DG  C "H4'"  4  
ATOM   6253  H "H3'"  . DG  B 1 1  ? -10.038 -21.212 -7.505  1.00 0.00 ? 113 DG  C "H3'"  4  
ATOM   6254  H "H2'"  . DG  B 1 1  ? -8.460  -19.622 -7.644  1.00 0.00 ? 113 DG  C "H2'"  4  
ATOM   6255  H "H2''" . DG  B 1 1  ? -8.089  -19.841 -5.912  1.00 0.00 ? 113 DG  C "H2''" 4  
ATOM   6256  H "H1'"  . DG  B 1 1  ? -6.228  -21.012 -6.379  1.00 0.00 ? 113 DG  C "H1'"  4  
ATOM   6257  H H8     . DG  B 1 1  ? -7.854  -19.655 -9.541  1.00 0.00 ? 113 DG  C H8     4  
ATOM   6258  H H1     . DG  B 1 1  ? -1.512  -19.587 -9.667  1.00 0.00 ? 113 DG  C H1     4  
ATOM   6259  H H21    . DG  B 1 1  ? -0.679  -20.639 -7.898  1.00 0.00 ? 113 DG  C H21    4  
ATOM   6260  H H22    . DG  B 1 1  ? -1.715  -21.360 -6.686  1.00 0.00 ? 113 DG  C H22    4  
ATOM   6261  H "HO5'" . DG  B 1 1  ? -9.233  -21.668 -9.130  1.00 0.00 ? 113 DG  C "HO5'" 4  
ATOM   6262  P P      . DT  B 1 2  ? -10.192 -20.173 -4.655  1.00 0.00 ? 114 DT  C P      4  
ATOM   6263  O OP1    . DT  B 1 2  ? -11.091 -20.561 -3.546  1.00 0.00 ? 114 DT  C OP1    4  
ATOM   6264  O OP2    . DT  B 1 2  ? -10.624 -19.151 -5.634  1.00 0.00 ? 114 DT  C OP2    4  
ATOM   6265  O "O5'"  . DT  B 1 2  ? -8.786  -19.703 -4.025  1.00 0.00 ? 114 DT  C "O5'"  4  
ATOM   6266  C "C5'"  . DT  B 1 2  ? -7.817  -20.670 -3.607  1.00 0.00 ? 114 DT  C "C5'"  4  
ATOM   6267  C "C4'"  . DT  B 1 2  ? -6.637  -20.010 -2.898  1.00 0.00 ? 114 DT  C "C4'"  4  
ATOM   6268  O "O4'"  . DT  B 1 2  ? -5.618  -19.631 -3.850  1.00 0.00 ? 114 DT  C "O4'"  4  
ATOM   6269  C "C3'"  . DT  B 1 2  ? -7.087  -18.761 -2.158  1.00 0.00 ? 114 DT  C "C3'"  4  
ATOM   6270  O "O3'"  . DT  B 1 2  ? -6.745  -18.850 -0.768  1.00 0.00 ? 114 DT  C "O3'"  4  
ATOM   6271  C "C2'"  . DT  B 1 2  ? -6.381  -17.605 -2.824  1.00 0.00 ? 114 DT  C "C2'"  4  
ATOM   6272  C "C1'"  . DT  B 1 2  ? -5.439  -18.199 -3.858  1.00 0.00 ? 114 DT  C "C1'"  4  
ATOM   6273  N N1     . DT  B 1 2  ? -5.713  -17.652 -5.202  1.00 0.00 ? 114 DT  C N1     4  
ATOM   6274  C C2     . DT  B 1 2  ? -4.634  -17.207 -5.940  1.00 0.00 ? 114 DT  C C2     4  
ATOM   6275  O O2     . DT  B 1 2  ? -3.500  -17.228 -5.504  1.00 0.00 ? 114 DT  C O2     4  
ATOM   6276  N N3     . DT  B 1 2  ? -4.919  -16.734 -7.207  1.00 0.00 ? 114 DT  C N3     4  
ATOM   6277  C C4     . DT  B 1 2  ? -6.173  -16.669 -7.790  1.00 0.00 ? 114 DT  C C4     4  
ATOM   6278  O O4     . DT  B 1 2  ? -6.311  -16.234 -8.916  1.00 0.00 ? 114 DT  C O4     4  
ATOM   6279  C C5     . DT  B 1 2  ? -7.240  -17.153 -6.942  1.00 0.00 ? 114 DT  C C5     4  
ATOM   6280  C C7     . DT  B 1 2  ? -8.674  -17.138 -7.460  1.00 0.00 ? 114 DT  C C7     4  
ATOM   6281  C C6     . DT  B 1 2  ? -6.987  -17.620 -5.703  1.00 0.00 ? 114 DT  C C6     4  
ATOM   6282  H "H5'"  . DT  B 1 2  ? -7.451  -21.208 -4.482  1.00 0.00 ? 114 DT  C "H5'"  4  
ATOM   6283  H "H5''" . DT  B 1 2  ? -8.290  -21.377 -2.926  1.00 0.00 ? 114 DT  C "H5''" 4  
ATOM   6284  H "H4'"  . DT  B 1 2  ? -6.211  -20.715 -2.185  1.00 0.00 ? 114 DT  C "H4'"  4  
ATOM   6285  H "H3'"  . DT  B 1 2  ? -8.168  -18.640 -2.268  1.00 0.00 ? 114 DT  C "H3'"  4  
ATOM   6286  H "H2'"  . DT  B 1 2  ? -7.108  -16.957 -3.312  1.00 0.00 ? 114 DT  C "H2'"  4  
ATOM   6287  H "H2''" . DT  B 1 2  ? -5.813  -17.040 -2.088  1.00 0.00 ? 114 DT  C "H2''" 4  
ATOM   6288  H "H1'"  . DT  B 1 2  ? -4.413  -17.963 -3.581  1.00 0.00 ? 114 DT  C "H1'"  4  
ATOM   6289  H H3     . DT  B 1 2  ? -4.163  -16.414 -7.743  1.00 0.00 ? 114 DT  C H3     4  
ATOM   6290  H H71    . DT  B 1 2  ? -9.316  -17.680 -6.767  1.00 0.00 ? 114 DT  C H71    4  
ATOM   6291  H H72    . DT  B 1 2  ? -9.018  -16.108 -7.546  1.00 0.00 ? 114 DT  C H72    4  
ATOM   6292  H H73    . DT  B 1 2  ? -8.711  -17.616 -8.439  1.00 0.00 ? 114 DT  C H73    4  
ATOM   6293  H H6     . DT  B 1 2  ? -7.812  -17.974 -5.085  1.00 0.00 ? 114 DT  C H6     4  
ATOM   6294  P P      . DA  B 1 3  ? -6.669  -17.533 0.152   1.00 0.00 ? 115 DA  C P      4  
ATOM   6295  O OP1    . DA  B 1 3  ? -6.320  -17.948 1.529   1.00 0.00 ? 115 DA  C OP1    4  
ATOM   6296  O OP2    . DA  B 1 3  ? -7.888  -16.728 -0.090  1.00 0.00 ? 115 DA  C OP2    4  
ATOM   6297  O "O5'"  . DA  B 1 3  ? -5.412  -16.743 -0.470  1.00 0.00 ? 115 DA  C "O5'"  4  
ATOM   6298  C "C5'"  . DA  B 1 3  ? -4.073  -17.181 -0.216  1.00 0.00 ? 115 DA  C "C5'"  4  
ATOM   6299  C "C4'"  . DA  B 1 3  ? -3.072  -16.052 -0.436  1.00 0.00 ? 115 DA  C "C4'"  4  
ATOM   6300  O "O4'"  . DA  B 1 3  ? -2.887  -15.804 -1.844  1.00 0.00 ? 115 DA  C "O4'"  4  
ATOM   6301  C "C3'"  . DA  B 1 3  ? -3.562  -14.772 0.218   1.00 0.00 ? 115 DA  C "C3'"  4  
ATOM   6302  O "O3'"  . DA  B 1 3  ? -2.647  -14.335 1.228   1.00 0.00 ? 115 DA  C "O3'"  4  
ATOM   6303  C "C2'"  . DA  B 1 3  ? -3.669  -13.759 -0.890  1.00 0.00 ? 115 DA  C "C2'"  4  
ATOM   6304  C "C1'"  . DA  B 1 3  ? -3.094  -14.410 -2.134  1.00 0.00 ? 115 DA  C "C1'"  4  
ATOM   6305  N N9     . DA  B 1 3  ? -4.011  -14.245 -3.271  1.00 0.00 ? 115 DA  C N9     4  
ATOM   6306  C C8     . DA  B 1 3  ? -5.345  -14.448 -3.323  1.00 0.00 ? 115 DA  C C8     4  
ATOM   6307  N N7     . DA  B 1 3  ? -5.934  -14.260 -4.456  1.00 0.00 ? 115 DA  C N7     4  
ATOM   6308  C C5     . DA  B 1 3  ? -4.863  -13.879 -5.269  1.00 0.00 ? 115 DA  C C5     4  
ATOM   6309  C C6     . DA  B 1 3  ? -4.776  -13.524 -6.618  1.00 0.00 ? 115 DA  C C6     4  
ATOM   6310  N N6     . DA  B 1 3  ? -5.831  -13.493 -7.433  1.00 0.00 ? 115 DA  C N6     4  
ATOM   6311  N N1     . DA  B 1 3  ? -3.563  -13.202 -7.098  1.00 0.00 ? 115 DA  C N1     4  
ATOM   6312  C C2     . DA  B 1 3  ? -2.492  -13.226 -6.301  1.00 0.00 ? 115 DA  C C2     4  
ATOM   6313  N N3     . DA  B 1 3  ? -2.459  -13.546 -5.010  1.00 0.00 ? 115 DA  C N3     4  
ATOM   6314  C C4     . DA  B 1 3  ? -3.687  -13.865 -4.553  1.00 0.00 ? 115 DA  C C4     4  
ATOM   6315  H "H5'"  . DA  B 1 3  ? -3.834  -18.006 -0.889  1.00 0.00 ? 115 DA  C "H5'"  4  
ATOM   6316  H "H5''" . DA  B 1 3  ? -4.000  -17.527 0.815   1.00 0.00 ? 115 DA  C "H5''" 4  
ATOM   6317  H "H4'"  . DA  B 1 3  ? -2.114  -16.327 -0.002  1.00 0.00 ? 115 DA  C "H4'"  4  
ATOM   6318  H "H3'"  . DA  B 1 3  ? -4.549  -14.939 0.656   1.00 0.00 ? 115 DA  C "H3'"  4  
ATOM   6319  H "H2'"  . DA  B 1 3  ? -4.714  -13.500 -1.056  1.00 0.00 ? 115 DA  C "H2'"  4  
ATOM   6320  H "H2''" . DA  B 1 3  ? -3.103  -12.869 -0.641  1.00 0.00 ? 115 DA  C "H2''" 4  
ATOM   6321  H "H1'"  . DA  B 1 3  ? -2.138  -13.954 -2.368  1.00 0.00 ? 115 DA  C "H1'"  4  
ATOM   6322  H H8     . DA  B 1 3  ? -5.899  -14.748 -2.434  1.00 0.00 ? 115 DA  C H8     4  
ATOM   6323  H H61    . DA  B 1 3  ? -5.715  -13.230 -8.401  1.00 0.00 ? 115 DA  C H61    4  
ATOM   6324  H H62    . DA  B 1 3  ? -6.748  -13.734 -7.083  1.00 0.00 ? 115 DA  C H62    4  
ATOM   6325  H H2     . DA  B 1 3  ? -1.542  -12.950 -6.759  1.00 0.00 ? 115 DA  C H2     4  
ATOM   6326  P P      . DT  B 1 4  ? -2.811  -12.886 1.911   1.00 0.00 ? 116 DT  C P      4  
ATOM   6327  O OP1    . DT  B 1 4  ? -2.426  -13.001 3.335   1.00 0.00 ? 116 DT  C OP1    4  
ATOM   6328  O OP2    . DT  B 1 4  ? -4.140  -12.350 1.546   1.00 0.00 ? 116 DT  C OP2    4  
ATOM   6329  O "O5'"  . DT  B 1 4  ? -1.689  -12.013 1.155   1.00 0.00 ? 116 DT  C "O5'"  4  
ATOM   6330  C "C5'"  . DT  B 1 4  ? -0.642  -12.653 0.418   1.00 0.00 ? 116 DT  C "C5'"  4  
ATOM   6331  C "C4'"  . DT  B 1 4  ? 0.065   -11.673 -0.516  1.00 0.00 ? 116 DT  C "C4'"  4  
ATOM   6332  O "O4'"  . DT  B 1 4  ? -0.500  -11.732 -1.840  1.00 0.00 ? 116 DT  C "O4'"  4  
ATOM   6333  C "C3'"  . DT  B 1 4  ? -0.068  -10.248 -0.002  1.00 0.00 ? 116 DT  C "C3'"  4  
ATOM   6334  O "O3'"  . DT  B 1 4  ? 1.210   -9.718  0.363   1.00 0.00 ? 116 DT  C "O3'"  4  
ATOM   6335  C "C2'"  . DT  B 1 4  ? -0.681  -9.459  -1.128  1.00 0.00 ? 116 DT  C "C2'"  4  
ATOM   6336  C "C1'"  . DT  B 1 4  ? -0.812  -10.407 -2.307  1.00 0.00 ? 116 DT  C "C1'"  4  
ATOM   6337  N N1     . DT  B 1 4  ? -2.171  -10.357 -2.871  1.00 0.00 ? 116 DT  C N1     4  
ATOM   6338  C C2     . DT  B 1 4  ? -2.295  -10.108 -4.225  1.00 0.00 ? 116 DT  C C2     4  
ATOM   6339  O O2     . DT  B 1 4  ? -1.329  -9.919  -4.939  1.00 0.00 ? 116 DT  C O2     4  
ATOM   6340  N N3     . DT  B 1 4  ? -3.585  -10.086 -4.721  1.00 0.00 ? 116 DT  C N3     4  
ATOM   6341  C C4     . DT  B 1 4  ? -4.744  -10.289 -3.989  1.00 0.00 ? 116 DT  C C4     4  
ATOM   6342  O O4     . DT  B 1 4  ? -5.832  -10.250 -4.526  1.00 0.00 ? 116 DT  C O4     4  
ATOM   6343  C C5     . DT  B 1 4  ? -4.512  -10.540 -2.584  1.00 0.00 ? 116 DT  C C5     4  
ATOM   6344  C C7     . DT  B 1 4  ? -5.701  -10.780 -1.659  1.00 0.00 ? 116 DT  C C7     4  
ATOM   6345  C C6     . DT  B 1 4  ? -3.263  -10.564 -2.078  1.00 0.00 ? 116 DT  C C6     4  
ATOM   6346  H "H5'"  . DT  B 1 4  ? -1.066  -13.464 -0.173  1.00 0.00 ? 116 DT  C "H5'"  4  
ATOM   6347  H "H5''" . DT  B 1 4  ? 0.085   -13.065 1.117   1.00 0.00 ? 116 DT  C "H5''" 4  
ATOM   6348  H "H4'"  . DT  B 1 4  ? 1.120   -11.930 -0.575  1.00 0.00 ? 116 DT  C "H4'"  4  
ATOM   6349  H "H3'"  . DT  B 1 4  ? -0.738  -10.233 0.861   1.00 0.00 ? 116 DT  C "H3'"  4  
ATOM   6350  H "H2'"  . DT  B 1 4  ? -1.665  -9.094  -0.834  1.00 0.00 ? 116 DT  C "H2'"  4  
ATOM   6351  H "H2''" . DT  B 1 4  ? -0.038  -8.623  -1.392  1.00 0.00 ? 116 DT  C "H2''" 4  
ATOM   6352  H "H1'"  . DT  B 1 4  ? -0.093  -10.124 -3.071  1.00 0.00 ? 116 DT  C "H1'"  4  
ATOM   6353  H H3     . DT  B 1 4  ? -3.691  -9.911  -5.679  1.00 0.00 ? 116 DT  C H3     4  
ATOM   6354  H H71    . DT  B 1 4  ? -5.380  -10.684 -0.621  1.00 0.00 ? 116 DT  C H71    4  
ATOM   6355  H H72    . DT  B 1 4  ? -6.478  -10.045 -1.868  1.00 0.00 ? 116 DT  C H72    4  
ATOM   6356  H H73    . DT  B 1 4  ? -6.095  -11.783 -1.825  1.00 0.00 ? 116 DT  C H73    4  
ATOM   6357  H H6     . DT  B 1 4  ? -3.118  -10.745 -1.013  1.00 0.00 ? 116 DT  C H6     4  
ATOM   6358  P P      . DC  B 1 5  ? 1.385   -8.151  0.689   1.00 0.00 ? 117 DC  C P      4  
ATOM   6359  O OP1    . DC  B 1 5  ? 2.690   -7.960  1.361   1.00 0.00 ? 117 DC  C OP1    4  
ATOM   6360  O OP2    . DC  B 1 5  ? 0.143   -7.672  1.336   1.00 0.00 ? 117 DC  C OP2    4  
ATOM   6361  O "O5'"  . DC  B 1 5  ? 1.473   -7.497  -0.780  1.00 0.00 ? 117 DC  C "O5'"  4  
ATOM   6362  C "C5'"  . DC  B 1 5  ? 2.513   -7.880  -1.686  1.00 0.00 ? 117 DC  C "C5'"  4  
ATOM   6363  C "C4'"  . DC  B 1 5  ? 2.495   -7.022  -2.947  1.00 0.00 ? 117 DC  C "C4'"  4  
ATOM   6364  O "O4'"  . DC  B 1 5  ? 1.371   -7.369  -3.783  1.00 0.00 ? 117 DC  C "O4'"  4  
ATOM   6365  C "C3'"  . DC  B 1 5  ? 2.393   -5.550  -2.592  1.00 0.00 ? 117 DC  C "C3'"  4  
ATOM   6366  O "O3'"  . DC  B 1 5  ? 3.526   -4.834  -3.102  1.00 0.00 ? 117 DC  C "O3'"  4  
ATOM   6367  C "C2'"  . DC  B 1 5  ? 1.112   -5.066  -3.214  1.00 0.00 ? 117 DC  C "C2'"  4  
ATOM   6368  C "C1'"  . DC  B 1 5  ? 0.603   -6.190  -4.094  1.00 0.00 ? 117 DC  C "C1'"  4  
ATOM   6369  N N1     . DC  B 1 5  ? -0.835  -6.419  -3.869  1.00 0.00 ? 117 DC  C N1     4  
ATOM   6370  C C2     . DC  B 1 5  ? -1.679  -6.366  -4.968  1.00 0.00 ? 117 DC  C C2     4  
ATOM   6371  O O2     . DC  B 1 5  ? -1.227  -6.143  -6.075  1.00 0.00 ? 117 DC  C O2     4  
ATOM   6372  N N3     . DC  B 1 5  ? -3.011  -6.570  -4.769  1.00 0.00 ? 117 DC  C N3     4  
ATOM   6373  C C4     . DC  B 1 5  ? -3.492  -6.817  -3.543  1.00 0.00 ? 117 DC  C C4     4  
ATOM   6374  N N4     . DC  B 1 5  ? -4.802  -7.011  -3.378  1.00 0.00 ? 117 DC  C N4     4  
ATOM   6375  C C5     . DC  B 1 5  ? -2.623  -6.871  -2.408  1.00 0.00 ? 117 DC  C C5     4  
ATOM   6376  C C6     . DC  B 1 5  ? -1.308  -6.666  -2.617  1.00 0.00 ? 117 DC  C C6     4  
ATOM   6377  H "H5'"  . DC  B 1 5  ? 2.375   -8.925  -1.964  1.00 0.00 ? 117 DC  C "H5'"  4  
ATOM   6378  H "H5''" . DC  B 1 5  ? 3.476   -7.765  -1.190  1.00 0.00 ? 117 DC  C "H5''" 4  
ATOM   6379  H "H4'"  . DC  B 1 5  ? 3.412   -7.183  -3.504  1.00 0.00 ? 117 DC  C "H4'"  4  
ATOM   6380  H "H3'"  . DC  B 1 5  ? 2.338   -5.442  -1.512  1.00 0.00 ? 117 DC  C "H3'"  4  
ATOM   6381  H "H2'"  . DC  B 1 5  ? 0.382   -4.844  -2.436  1.00 0.00 ? 117 DC  C "H2'"  4  
ATOM   6382  H "H2''" . DC  B 1 5  ? 1.297   -4.180  -3.813  1.00 0.00 ? 117 DC  C "H2''" 4  
ATOM   6383  H "H1'"  . DC  B 1 5  ? 0.769   -5.929  -5.135  1.00 0.00 ? 117 DC  C "H1'"  4  
ATOM   6384  H H41    . DC  B 1 5  ? -5.422  -6.975  -4.173  1.00 0.00 ? 117 DC  C H41    4  
ATOM   6385  H H42    . DC  B 1 5  ? -5.173  -7.196  -2.457  1.00 0.00 ? 117 DC  C H42    4  
ATOM   6386  H H5     . DC  B 1 5  ? -3.010  -7.072  -1.409  1.00 0.00 ? 117 DC  C H5     4  
ATOM   6387  H H6     . DC  B 1 5  ? -0.614  -6.689  -1.777  1.00 0.00 ? 117 DC  C H6     4  
HETATM 6388  N N1     . 5CM B 1 6  ? -0.466  -2.087  -6.582  1.00 0.00 ? 118 5CM C N1     4  
HETATM 6389  C C2     . 5CM B 1 6  ? -1.747  -1.985  -7.101  1.00 0.00 ? 118 5CM C C2     4  
HETATM 6390  N N3     . 5CM B 1 6  ? -2.791  -1.912  -6.232  1.00 0.00 ? 118 5CM C N3     4  
HETATM 6391  C C4     . 5CM B 1 6  ? -2.588  -1.936  -4.909  1.00 0.00 ? 118 5CM C C4     4  
HETATM 6392  C C5     . 5CM B 1 6  ? -1.267  -2.041  -4.370  1.00 0.00 ? 118 5CM C C5     4  
HETATM 6393  C C5A    . 5CM B 1 6  ? -1.031  -2.076  -2.865  1.00 0.00 ? 118 5CM C C5A    4  
HETATM 6394  C C6     . 5CM B 1 6  ? -0.241  -2.115  -5.238  1.00 0.00 ? 118 5CM C C6     4  
HETATM 6395  O O2     . 5CM B 1 6  ? -1.918  -1.962  -8.305  1.00 0.00 ? 118 5CM C O2     4  
HETATM 6396  N N4     . 5CM B 1 6  ? -3.633  -1.863  -4.085  1.00 0.00 ? 118 5CM C N4     4  
HETATM 6397  C "C1'"  . 5CM B 1 6  ? 0.654   -2.157  -7.539  1.00 0.00 ? 118 5CM C "C1'"  4  
HETATM 6398  C "C2'"  . 5CM B 1 6  ? 1.729   -1.142  -7.189  1.00 0.00 ? 118 5CM C "C2'"  4  
HETATM 6399  C "C3'"  . 5CM B 1 6  ? 3.030   -1.899  -7.093  1.00 0.00 ? 118 5CM C "C3'"  4  
HETATM 6400  C "C4'"  . 5CM B 1 6  ? 2.658   -3.369  -7.174  1.00 0.00 ? 118 5CM C "C4'"  4  
HETATM 6401  O "O4'"  . 5CM B 1 6  ? 1.260   -3.465  -7.524  1.00 0.00 ? 118 5CM C "O4'"  4  
HETATM 6402  O "O3'"  . 5CM B 1 6  ? 3.919   -1.545  -8.160  1.00 0.00 ? 118 5CM C "O3'"  4  
HETATM 6403  C "C5'"  . 5CM B 1 6  ? 2.921   -4.052  -5.838  1.00 0.00 ? 118 5CM C "C5'"  4  
HETATM 6404  O "O5'"  . 5CM B 1 6  ? 2.607   -3.185  -4.744  1.00 0.00 ? 118 5CM C "O5'"  4  
HETATM 6405  P P      . 5CM B 1 6  ? 3.456   -3.252  -3.381  1.00 0.00 ? 118 5CM C P      4  
HETATM 6406  O OP1    . 5CM B 1 6  ? 4.827   -2.773  -3.665  1.00 0.00 ? 118 5CM C OP1    4  
HETATM 6407  O OP2    . 5CM B 1 6  ? 2.661   -2.622  -2.305  1.00 0.00 ? 118 5CM C OP2    4  
HETATM 6408  H H5A1   . 5CM B 1 6  ? -1.314  -3.052  -2.474  1.00 0.00 ? 118 5CM C H5A1   4  
HETATM 6409  H H5A2   . 5CM B 1 6  ? 0.024   -1.894  -2.659  1.00 0.00 ? 118 5CM C H5A2   4  
HETATM 6410  H H5A3   . 5CM B 1 6  ? -1.632  -1.303  -2.385  1.00 0.00 ? 118 5CM C H5A3   4  
HETATM 6411  H H6     . 5CM B 1 6  ? 0.780   -2.202  -4.866  1.00 0.00 ? 118 5CM C H6     4  
HETATM 6412  H HN41   . 5CM B 1 6  ? -3.490  -1.882  -3.085  1.00 0.00 ? 118 5CM C HN41   4  
HETATM 6413  H HN42   . 5CM B 1 6  ? -4.568  -1.788  -4.460  1.00 0.00 ? 118 5CM C HN42   4  
HETATM 6414  H "H1'"  . 5CM B 1 6  ? 0.279   -1.947  -8.540  1.00 0.00 ? 118 5CM C "H1'"  4  
HETATM 6415  H "H2'"  . 5CM B 1 6  ? 1.501   -0.676  -6.230  1.00 0.00 ? 118 5CM C "H2'"  4  
HETATM 6416  H "H2''" . 5CM B 1 6  ? 1.792   -0.382  -7.962  1.00 0.00 ? 118 5CM C "H2''" 4  
HETATM 6417  H "H3'"  . 5CM B 1 6  ? 3.501   -1.694  -6.130  1.00 0.00 ? 118 5CM C "H3'"  4  
HETATM 6418  H "H4'"  . 5CM B 1 6  ? 3.255   -3.851  -7.948  1.00 0.00 ? 118 5CM C "H4'"  4  
HETATM 6419  H "H5'"  . 5CM B 1 6  ? 2.308   -4.950  -5.769  1.00 0.00 ? 118 5CM C "H5'"  4  
HETATM 6420  H "H5''" . 5CM B 1 6  ? 3.972   -4.331  -5.781  1.00 0.00 ? 118 5CM C "H5''" 4  
ATOM   6421  P P      . DG  B 1 7  ? 4.095   -0.012  -8.617  1.00 0.00 ? 119 DG  C P      4  
ATOM   6422  O OP1    . DG  B 1 7  ? 5.182   0.051   -9.618  1.00 0.00 ? 119 DG  C OP1    4  
ATOM   6423  O OP2    . DG  B 1 7  ? 4.160   0.830   -7.402  1.00 0.00 ? 119 DG  C OP2    4  
ATOM   6424  O "O5'"  . DG  B 1 7  ? 2.701   0.289   -9.366  1.00 0.00 ? 119 DG  C "O5'"  4  
ATOM   6425  C "C5'"  . DG  B 1 7  ? 2.206   -0.601  -10.372 1.00 0.00 ? 119 DG  C "C5'"  4  
ATOM   6426  C "C4'"  . DG  B 1 7  ? 1.302   0.125   -11.365 1.00 0.00 ? 119 DG  C "C4'"  4  
ATOM   6427  O "O4'"  . DG  B 1 7  ? -0.069  0.116   -10.906 1.00 0.00 ? 119 DG  C "O4'"  4  
ATOM   6428  C "C3'"  . DG  B 1 7  ? 1.744   1.572   -11.522 1.00 0.00 ? 119 DG  C "C3'"  4  
ATOM   6429  O "O3'"  . DG  B 1 7  ? 1.992   1.881   -12.898 1.00 0.00 ? 119 DG  C "O3'"  4  
ATOM   6430  C "C2'"  . DG  B 1 7  ? 0.617   2.409   -10.975 1.00 0.00 ? 119 DG  C "C2'"  4  
ATOM   6431  C "C1'"  . DG  B 1 7  ? -0.534  1.465   -10.678 1.00 0.00 ? 119 DG  C "C1'"  4  
ATOM   6432  N N9     . DG  B 1 7  ? -0.990  1.634   -9.292  1.00 0.00 ? 119 DG  C N9     4  
ATOM   6433  C C8     . DG  B 1 7  ? -0.257  1.736   -8.169  1.00 0.00 ? 119 DG  C C8     4  
ATOM   6434  N N7     . DG  B 1 7  ? -0.885  1.879   -7.050  1.00 0.00 ? 119 DG  C N7     4  
ATOM   6435  C C5     . DG  B 1 7  ? -2.218  1.876   -7.473  1.00 0.00 ? 119 DG  C C5     4  
ATOM   6436  C C6     . DG  B 1 7  ? -3.417  2.000   -6.718  1.00 0.00 ? 119 DG  C C6     4  
ATOM   6437  O O6     . DG  B 1 7  ? -3.542  2.136   -5.517  1.00 0.00 ? 119 DG  C O6     4  
ATOM   6438  N N1     . DG  B 1 7  ? -4.539  1.949   -7.534  1.00 0.00 ? 119 DG  C N1     4  
ATOM   6439  C C2     . DG  B 1 7  ? -4.520  1.796   -8.906  1.00 0.00 ? 119 DG  C C2     4  
ATOM   6440  N N2     . DG  B 1 7  ? -5.707  1.769   -9.513  1.00 0.00 ? 119 DG  C N2     4  
ATOM   6441  N N3     . DG  B 1 7  ? -3.398  1.679   -9.624  1.00 0.00 ? 119 DG  C N3     4  
ATOM   6442  C C4     . DG  B 1 7  ? -2.290  1.726   -8.850  1.00 0.00 ? 119 DG  C C4     4  
ATOM   6443  H "H5'"  . DG  B 1 7  ? 1.641   -1.400  -9.894  1.00 0.00 ? 119 DG  C "H5'"  4  
ATOM   6444  H "H5''" . DG  B 1 7  ? 3.049   -1.034  -10.910 1.00 0.00 ? 119 DG  C "H5''" 4  
ATOM   6445  H "H4'"  . DG  B 1 7  ? 1.359   -0.374  -12.331 1.00 0.00 ? 119 DG  C "H4'"  4  
ATOM   6446  H "H3'"  . DG  B 1 7  ? 2.646   1.746   -10.932 1.00 0.00 ? 119 DG  C "H3'"  4  
ATOM   6447  H "H2'"  . DG  B 1 7  ? 0.935   2.905   -10.059 1.00 0.00 ? 119 DG  C "H2'"  4  
ATOM   6448  H "H2''" . DG  B 1 7  ? 0.310   3.148   -11.707 1.00 0.00 ? 119 DG  C "H2''" 4  
ATOM   6449  H "H1'"  . DG  B 1 7  ? -1.356  1.681   -11.349 1.00 0.00 ? 119 DG  C "H1'"  4  
ATOM   6450  H H8     . DG  B 1 7  ? 0.828   1.713   -8.217  1.00 0.00 ? 119 DG  C H8     4  
ATOM   6451  H H1     . DG  B 1 7  ? -5.404  2.029   -7.080  1.00 0.00 ? 119 DG  C H1     4  
ATOM   6452  H H21    . DG  B 1 7  ? -6.553  1.857   -8.969  1.00 0.00 ? 119 DG  C H21    4  
ATOM   6453  H H22    . DG  B 1 7  ? -5.759  1.659   -10.515 1.00 0.00 ? 119 DG  C H22    4  
ATOM   6454  P P      . DG  B 1 8  ? 2.168   3.408   -13.378 1.00 0.00 ? 120 DG  C P      4  
ATOM   6455  O OP1    . DG  B 1 8  ? 2.968   3.412   -14.623 1.00 0.00 ? 120 DG  C OP1    4  
ATOM   6456  O OP2    . DG  B 1 8  ? 2.608   4.211   -12.215 1.00 0.00 ? 120 DG  C OP2    4  
ATOM   6457  O "O5'"  . DG  B 1 8  ? 0.661   3.838   -13.745 1.00 0.00 ? 120 DG  C "O5'"  4  
ATOM   6458  C "C5'"  . DG  B 1 8  ? -0.076  3.127   -14.745 1.00 0.00 ? 120 DG  C "C5'"  4  
ATOM   6459  C "C4'"  . DG  B 1 8  ? -1.576  3.352   -14.597 1.00 0.00 ? 120 DG  C "C4'"  4  
ATOM   6460  O "O4'"  . DG  B 1 8  ? -1.973  3.248   -13.215 1.00 0.00 ? 120 DG  C "O4'"  4  
ATOM   6461  C "C3'"  . DG  B 1 8  ? -1.968  4.731   -15.105 1.00 0.00 ? 120 DG  C "C3'"  4  
ATOM   6462  O "O3'"  . DG  B 1 8  ? -2.858  4.620   -16.224 1.00 0.00 ? 120 DG  C "O3'"  4  
ATOM   6463  C "C2'"  . DG  B 1 8  ? -2.635  5.424   -13.942 1.00 0.00 ? 120 DG  C "C2'"  4  
ATOM   6464  C "C1'"  . DG  B 1 8  ? -2.750  4.396   -12.834 1.00 0.00 ? 120 DG  C "C1'"  4  
ATOM   6465  N N9     . DG  B 1 8  ? -2.283  4.938   -11.549 1.00 0.00 ? 120 DG  C N9     4  
ATOM   6466  C C8     . DG  B 1 8  ? -1.027  5.219   -11.148 1.00 0.00 ? 120 DG  C C8     4  
ATOM   6467  N N7     . DG  B 1 8  ? -0.862  5.655   -9.944  1.00 0.00 ? 120 DG  C N7     4  
ATOM   6468  C C5     . DG  B 1 8  ? -2.177  5.671   -9.468  1.00 0.00 ? 120 DG  C C5     4  
ATOM   6469  C C6     . DG  B 1 8  ? -2.681  6.054   -8.196  1.00 0.00 ? 120 DG  C C6     4  
ATOM   6470  O O6     . DG  B 1 8  ? -2.063  6.458   -7.231  1.00 0.00 ? 120 DG  C O6     4  
ATOM   6471  N N1     . DG  B 1 8  ? -4.063  5.919   -8.134  1.00 0.00 ? 120 DG  C N1     4  
ATOM   6472  C C2     . DG  B 1 8  ? -4.865  5.473   -9.164  1.00 0.00 ? 120 DG  C C2     4  
ATOM   6473  N N2     . DG  B 1 8  ? -6.172  5.414   -8.911  1.00 0.00 ? 120 DG  C N2     4  
ATOM   6474  N N3     . DG  B 1 8  ? -4.399  5.112   -10.365 1.00 0.00 ? 120 DG  C N3     4  
ATOM   6475  C C4     . DG  B 1 8  ? -3.055  5.233   -10.448 1.00 0.00 ? 120 DG  C C4     4  
ATOM   6476  H "H5'"  . DG  B 1 8  ? 0.136   2.062   -14.653 1.00 0.00 ? 120 DG  C "H5'"  4  
ATOM   6477  H "H5''" . DG  B 1 8  ? 0.241   3.469   -15.730 1.00 0.00 ? 120 DG  C "H5''" 4  
ATOM   6478  H "H4'"  . DG  B 1 8  ? -2.112  2.599   -15.171 1.00 0.00 ? 120 DG  C "H4'"  4  
ATOM   6479  H "H3'"  . DG  B 1 8  ? -1.071  5.284   -15.394 1.00 0.00 ? 120 DG  C "H3'"  4  
ATOM   6480  H "H2'"  . DG  B 1 8  ? -2.027  6.265   -13.610 1.00 0.00 ? 120 DG  C "H2'"  4  
ATOM   6481  H "H2''" . DG  B 1 8  ? -3.626  5.771   -14.229 1.00 0.00 ? 120 DG  C "H2''" 4  
ATOM   6482  H "H1'"  . DG  B 1 8  ? -3.784  4.101   -12.737 1.00 0.00 ? 120 DG  C "H1'"  4  
ATOM   6483  H H8     . DG  B 1 8  ? -0.185  5.079   -11.819 1.00 0.00 ? 120 DG  C H8     4  
ATOM   6484  H H1     . DG  B 1 8  ? -4.481  6.165   -7.282  1.00 0.00 ? 120 DG  C H1     4  
ATOM   6485  H H21    . DG  B 1 8  ? -6.523  5.687   -8.004  1.00 0.00 ? 120 DG  C H21    4  
ATOM   6486  H H22    . DG  B 1 8  ? -6.811  5.096   -9.625  1.00 0.00 ? 120 DG  C H22    4  
ATOM   6487  P P      . DA  B 1 9  ? -3.820  5.841   -16.649 1.00 0.00 ? 121 DA  C P      4  
ATOM   6488  O OP1    . DA  B 1 9  ? -4.624  5.413   -17.816 1.00 0.00 ? 121 DA  C OP1    4  
ATOM   6489  O OP2    . DA  B 1 9  ? -2.999  7.069   -16.730 1.00 0.00 ? 121 DA  C OP2    4  
ATOM   6490  O "O5'"  . DA  B 1 9  ? -4.801  5.972   -15.380 1.00 0.00 ? 121 DA  C "O5'"  4  
ATOM   6491  C "C5'"  . DA  B 1 9  ? -6.016  5.219   -15.313 1.00 0.00 ? 121 DA  C "C5'"  4  
ATOM   6492  C "C4'"  . DA  B 1 9  ? -7.204  6.112   -14.975 1.00 0.00 ? 121 DA  C "C4'"  4  
ATOM   6493  O "O4'"  . DA  B 1 9  ? -7.238  6.403   -13.559 1.00 0.00 ? 121 DA  C "O4'"  4  
ATOM   6494  C "C3'"  . DA  B 1 9  ? -7.101  7.427   -15.730 1.00 0.00 ? 121 DA  C "C3'"  4  
ATOM   6495  O "O3'"  . DA  B 1 9  ? -8.300  7.683   -16.472 1.00 0.00 ? 121 DA  C "O3'"  4  
ATOM   6496  C "C2'"  . DA  B 1 9  ? -6.875  8.486   -14.681 1.00 0.00 ? 121 DA  C "C2'"  4  
ATOM   6497  C "C1'"  . DA  B 1 9  ? -7.016  7.813   -13.330 1.00 0.00 ? 121 DA  C "C1'"  4  
ATOM   6498  N N9     . DA  B 1 9  ? -5.805  8.025   -12.529 1.00 0.00 ? 121 DA  C N9     4  
ATOM   6499  C C8     . DA  B 1 9  ? -4.521  7.896   -12.900 1.00 0.00 ? 121 DA  C C8     4  
ATOM   6500  N N7     . DA  B 1 9  ? -3.612  8.127   -12.013 1.00 0.00 ? 121 DA  C N7     4  
ATOM   6501  C C5     . DA  B 1 9  ? -4.391  8.456   -10.898 1.00 0.00 ? 121 DA  C C5     4  
ATOM   6502  C C6     . DA  B 1 9  ? -4.067  8.820   -9.586  1.00 0.00 ? 121 DA  C C6     4  
ATOM   6503  N N6     . DA  B 1 9  ? -2.813  8.915   -9.146  1.00 0.00 ? 121 DA  C N6     4  
ATOM   6504  N N1     . DA  B 1 9  ? -5.084  9.079   -8.746  1.00 0.00 ? 121 DA  C N1     4  
ATOM   6505  C C2     . DA  B 1 9  ? -6.348  8.989   -9.166  1.00 0.00 ? 121 DA  C C2     4  
ATOM   6506  N N3     . DA  B 1 9  ? -6.768  8.653   -10.384 1.00 0.00 ? 121 DA  C N3     4  
ATOM   6507  C C4     . DA  B 1 9  ? -5.731  8.398   -11.206 1.00 0.00 ? 121 DA  C C4     4  
ATOM   6508  H "H5'"  . DA  B 1 9  ? -5.917  4.450   -14.545 1.00 0.00 ? 121 DA  C "H5'"  4  
ATOM   6509  H "H5''" . DA  B 1 9  ? -6.192  4.739   -16.276 1.00 0.00 ? 121 DA  C "H5''" 4  
ATOM   6510  H "H4'"  . DA  B 1 9  ? -8.127  5.606   -15.259 1.00 0.00 ? 121 DA  C "H4'"  4  
ATOM   6511  H "H3'"  . DA  B 1 9  ? -6.244  7.395   -16.405 1.00 0.00 ? 121 DA  C "H3'"  4  
ATOM   6512  H "H2'"  . DA  B 1 9  ? -5.873  8.900   -14.785 1.00 0.00 ? 121 DA  C "H2'"  4  
ATOM   6513  H "H2''" . DA  B 1 9  ? -7.612  9.274   -14.780 1.00 0.00 ? 121 DA  C "H2''" 4  
ATOM   6514  H "H1'"  . DA  B 1 9  ? -7.867  8.232   -12.806 1.00 0.00 ? 121 DA  C "H1'"  4  
ATOM   6515  H H8     . DA  B 1 9  ? -4.267  7.621   -13.920 1.00 0.00 ? 121 DA  C H8     4  
ATOM   6516  H H61    . DA  B 1 9  ? -2.632  9.182   -8.190  1.00 0.00 ? 121 DA  C H61    4  
ATOM   6517  H H62    . DA  B 1 9  ? -2.042  8.722   -9.771  1.00 0.00 ? 121 DA  C H62    4  
ATOM   6518  H H2     . DA  B 1 9  ? -7.120  9.220   -8.433  1.00 0.00 ? 121 DA  C H2     4  
ATOM   6519  P P      . DT  B 1 10 ? -8.623  9.159   -17.027 1.00 0.00 ? 122 DT  C P      4  
ATOM   6520  O OP1    . DT  B 1 10 ? -9.603  9.036   -18.128 1.00 0.00 ? 122 DT  C OP1    4  
ATOM   6521  O OP2    . DT  B 1 10 ? -7.340  9.861   -17.254 1.00 0.00 ? 122 DT  C OP2    4  
ATOM   6522  O "O5'"  . DT  B 1 10 ? -9.359  9.849   -15.771 1.00 0.00 ? 122 DT  C "O5'"  4  
ATOM   6523  C "C5'"  . DT  B 1 10 ? -10.106 9.057   -14.843 1.00 0.00 ? 122 DT  C "C5'"  4  
ATOM   6524  C "C4'"  . DT  B 1 10 ? -10.745 9.917   -13.755 1.00 0.00 ? 122 DT  C "C4'"  4  
ATOM   6525  O "O4'"  . DT  B 1 10 ? -9.886  9.995   -12.597 1.00 0.00 ? 122 DT  C "O4'"  4  
ATOM   6526  C "C3'"  . DT  B 1 10 ? -10.990 11.330  -14.265 1.00 0.00 ? 122 DT  C "C3'"  4  
ATOM   6527  O "O3'"  . DT  B 1 10 ? -12.375 11.678  -14.144 1.00 0.00 ? 122 DT  C "O3'"  4  
ATOM   6528  C "C2'"  . DT  B 1 10 ? -10.128 12.231  -13.418 1.00 0.00 ? 122 DT  C "C2'"  4  
ATOM   6529  C "C1'"  . DT  B 1 10 ? -9.519  11.366  -12.331 1.00 0.00 ? 122 DT  C "C1'"  4  
ATOM   6530  N N1     . DT  B 1 10 ? -8.054  11.518  -12.300 1.00 0.00 ? 122 DT  C N1     4  
ATOM   6531  C C2     . DT  B 1 10 ? -7.470  11.809  -11.083 1.00 0.00 ? 122 DT  C C2     4  
ATOM   6532  O O2     . DT  B 1 10 ? -8.123  11.948  -10.069 1.00 0.00 ? 122 DT  C O2     4  
ATOM   6533  N N3     . DT  B 1 10 ? -6.092  11.930  -11.086 1.00 0.00 ? 122 DT  C N3     4  
ATOM   6534  C C4     . DT  B 1 10 ? -5.264  11.789  -12.186 1.00 0.00 ? 122 DT  C C4     4  
ATOM   6535  O O4     . DT  B 1 10 ? -4.061  11.916  -12.077 1.00 0.00 ? 122 DT  C O4     4  
ATOM   6536  C C5     . DT  B 1 10 ? -5.965  11.488  -13.413 1.00 0.00 ? 122 DT  C C5     4  
ATOM   6537  C C7     . DT  B 1 10 ? -5.175  11.305  -14.704 1.00 0.00 ? 122 DT  C C7     4  
ATOM   6538  C C6     . DT  B 1 10 ? -7.308  11.365  -13.436 1.00 0.00 ? 122 DT  C C6     4  
ATOM   6539  H "H5'"  . DT  B 1 10 ? -9.438  8.333   -14.375 1.00 0.00 ? 122 DT  C "H5'"  4  
ATOM   6540  H "H5''" . DT  B 1 10 ? -10.890 8.523   -15.379 1.00 0.00 ? 122 DT  C "H5''" 4  
ATOM   6541  H "H4'"  . DT  B 1 10 ? -11.697 9.474   -13.463 1.00 0.00 ? 122 DT  C "H4'"  4  
ATOM   6542  H "H3'"  . DT  B 1 10 ? -10.677 11.402  -15.309 1.00 0.00 ? 122 DT  C "H3'"  4  
ATOM   6543  H "H2'"  . DT  B 1 10 ? -9.339  12.670  -14.028 1.00 0.00 ? 122 DT  C "H2'"  4  
ATOM   6544  H "H2''" . DT  B 1 10 ? -10.732 13.016  -12.972 1.00 0.00 ? 122 DT  C "H2''" 4  
ATOM   6545  H "H1'"  . DT  B 1 10 ? -9.928  11.664  -11.365 1.00 0.00 ? 122 DT  C "H1'"  4  
ATOM   6546  H H3     . DT  B 1 10 ? -5.663  12.138  -10.230 1.00 0.00 ? 122 DT  C H3     4  
ATOM   6547  H H71    . DT  B 1 10 ? -5.859  11.080  -15.522 1.00 0.00 ? 122 DT  C H71    4  
ATOM   6548  H H72    . DT  B 1 10 ? -4.629  12.222  -14.928 1.00 0.00 ? 122 DT  C H72    4  
ATOM   6549  H H73    . DT  B 1 10 ? -4.469  10.483  -14.584 1.00 0.00 ? 122 DT  C H73    4  
ATOM   6550  H H6     . DT  B 1 10 ? -7.811  11.148  -14.377 1.00 0.00 ? 122 DT  C H6     4  
ATOM   6551  P P      . DA  B 1 11 ? -12.847 13.216  -14.219 1.00 0.00 ? 123 DA  C P      4  
ATOM   6552  O OP1    . DA  B 1 11 ? -14.319 13.256  -14.064 1.00 0.00 ? 123 DA  C OP1    4  
ATOM   6553  O OP2    . DA  B 1 11 ? -12.211 13.840  -15.401 1.00 0.00 ? 123 DA  C OP2    4  
ATOM   6554  O "O5'"  . DA  B 1 11 ? -12.184 13.853  -12.896 1.00 0.00 ? 123 DA  C "O5'"  4  
ATOM   6555  C "C5'"  . DA  B 1 11 ? -12.693 13.534  -11.597 1.00 0.00 ? 123 DA  C "C5'"  4  
ATOM   6556  C "C4'"  . DA  B 1 11 ? -12.458 14.675  -10.613 1.00 0.00 ? 123 DA  C "C4'"  4  
ATOM   6557  O "O4'"  . DA  B 1 11 ? -11.138 14.585  -10.029 1.00 0.00 ? 123 DA  C "O4'"  4  
ATOM   6558  C "C3'"  . DA  B 1 11 ? -12.576 16.016  -11.321 1.00 0.00 ? 123 DA  C "C3'"  4  
ATOM   6559  O "O3'"  . DA  B 1 11 ? -13.594 16.824  -10.718 1.00 0.00 ? 123 DA  C "O3'"  4  
ATOM   6560  C "C2'"  . DA  B 1 11 ? -11.226 16.671  -11.196 1.00 0.00 ? 123 DA  C "C2'"  4  
ATOM   6561  C "C1'"  . DA  B 1 11 ? -10.379 15.780  -10.308 1.00 0.00 ? 123 DA  C "C1'"  4  
ATOM   6562  N N9     . DA  B 1 11 ? -9.112  15.458  -10.973 1.00 0.00 ? 123 DA  C N9     4  
ATOM   6563  C C8     . DA  B 1 11 ? -8.897  15.078  -12.246 1.00 0.00 ? 123 DA  C C8     4  
ATOM   6564  N N7     . DA  B 1 11 ? -7.678  14.851  -12.607 1.00 0.00 ? 123 DA  C N7     4  
ATOM   6565  C C5     . DA  B 1 11 ? -6.983  15.117  -11.422 1.00 0.00 ? 123 DA  C C5     4  
ATOM   6566  C C6     . DA  B 1 11 ? -5.626  15.078  -11.089 1.00 0.00 ? 123 DA  C C6     4  
ATOM   6567  N N6     . DA  B 1 11 ? -4.670  14.736  -11.954 1.00 0.00 ? 123 DA  C N6     4  
ATOM   6568  N N1     . DA  B 1 11 ? -5.288  15.406  -9.828  1.00 0.00 ? 123 DA  C N1     4  
ATOM   6569  C C2     . DA  B 1 11 ? -6.228  15.751  -8.946  1.00 0.00 ? 123 DA  C C2     4  
ATOM   6570  N N3     . DA  B 1 11 ? -7.538  15.821  -9.154  1.00 0.00 ? 123 DA  C N3     4  
ATOM   6571  C C4     . DA  B 1 11 ? -7.851  15.489  -10.422 1.00 0.00 ? 123 DA  C C4     4  
ATOM   6572  H "H5'"  . DA  B 1 11 ? -12.195 12.637  -11.229 1.00 0.00 ? 123 DA  C "H5'"  4  
ATOM   6573  H "H5''" . DA  B 1 11 ? -13.764 13.341  -11.671 1.00 0.00 ? 123 DA  C "H5''" 4  
ATOM   6574  H "H4'"  . DA  B 1 11 ? -13.203 14.623  -9.819  1.00 0.00 ? 123 DA  C "H4'"  4  
ATOM   6575  H "H3'"  . DA  B 1 11 ? -12.807 15.853  -12.376 1.00 0.00 ? 123 DA  C "H3'"  4  
ATOM   6576  H "H2'"  . DA  B 1 11 ? -10.765 16.758  -12.181 1.00 0.00 ? 123 DA  C "H2'"  4  
ATOM   6577  H "H2''" . DA  B 1 11 ? -11.327 17.654  -10.749 1.00 0.00 ? 123 DA  C "H2''" 4  
ATOM   6578  H "H1'"  . DA  B 1 11 ? -10.168 16.297  -9.378  1.00 0.00 ? 123 DA  C "H1'"  4  
ATOM   6579  H H8     . DA  B 1 11 ? -9.727  14.987  -12.942 1.00 0.00 ? 123 DA  C H8     4  
ATOM   6580  H H61    . DA  B 1 11 ? -3.704  14.725  -11.661 1.00 0.00 ? 123 DA  C H61    4  
ATOM   6581  H H62    . DA  B 1 11 ? -4.913  14.490  -12.903 1.00 0.00 ? 123 DA  C H62    4  
ATOM   6582  H H2     . DA  B 1 11 ? -5.882  16.003  -7.943  1.00 0.00 ? 123 DA  C H2     4  
ATOM   6583  P P      . DC  B 1 12 ? -14.439 17.868  -11.603 1.00 0.00 ? 124 DC  C P      4  
ATOM   6584  O OP1    . DC  B 1 12 ? -15.877 17.559  -11.438 1.00 0.00 ? 124 DC  C OP1    4  
ATOM   6585  O OP2    . DC  B 1 12 ? -13.845 17.916  -12.958 1.00 0.00 ? 124 DC  C OP2    4  
ATOM   6586  O "O5'"  . DC  B 1 12 ? -14.138 19.270  -10.873 1.00 0.00 ? 124 DC  C "O5'"  4  
ATOM   6587  C "C5'"  . DC  B 1 12 ? -13.798 19.306  -9.484  1.00 0.00 ? 124 DC  C "C5'"  4  
ATOM   6588  C "C4'"  . DC  B 1 12 ? -12.777 20.398  -9.181  1.00 0.00 ? 124 DC  C "C4'"  4  
ATOM   6589  O "O4'"  . DC  B 1 12 ? -11.434 19.884  -9.276  1.00 0.00 ? 124 DC  C "O4'"  4  
ATOM   6590  C "C3'"  . DC  B 1 12 ? -12.914 21.555  -10.160 1.00 0.00 ? 124 DC  C "C3'"  4  
ATOM   6591  O "O3'"  . DC  B 1 12 ? -13.413 22.724  -9.502  1.00 0.00 ? 124 DC  C "O3'"  4  
ATOM   6592  C "C2'"  . DC  B 1 12 ? -11.533 21.795  -10.711 1.00 0.00 ? 124 DC  C "C2'"  4  
ATOM   6593  C "C1'"  . DC  B 1 12 ? -10.615 20.779  -10.052 1.00 0.00 ? 124 DC  C "C1'"  4  
ATOM   6594  N N1     . DC  B 1 12 ? -9.833  20.037  -11.061 1.00 0.00 ? 124 DC  C N1     4  
ATOM   6595  C C2     . DC  B 1 12 ? -8.466  19.922  -10.854 1.00 0.00 ? 124 DC  C C2     4  
ATOM   6596  O O2     . DC  B 1 12 ? -7.954  20.425  -9.872  1.00 0.00 ? 124 DC  C O2     4  
ATOM   6597  N N3     . DC  B 1 12 ? -7.729  19.239  -11.772 1.00 0.00 ? 124 DC  C N3     4  
ATOM   6598  C C4     . DC  B 1 12 ? -8.308  18.691  -12.849 1.00 0.00 ? 124 DC  C C4     4  
ATOM   6599  N N4     . DC  B 1 12 ? -7.557  18.025  -13.727 1.00 0.00 ? 124 DC  C N4     4  
ATOM   6600  C C5     . DC  B 1 12 ? -9.716  18.807  -13.066 1.00 0.00 ? 124 DC  C C5     4  
ATOM   6601  C C6     . DC  B 1 12 ? -10.438 19.485  -12.152 1.00 0.00 ? 124 DC  C C6     4  
ATOM   6602  H "H5'"  . DC  B 1 12 ? -13.382 18.341  -9.195  1.00 0.00 ? 124 DC  C "H5'"  4  
ATOM   6603  H "H5''" . DC  B 1 12 ? -14.701 19.492  -8.901  1.00 0.00 ? 124 DC  C "H5''" 4  
ATOM   6604  H "H4'"  . DC  B 1 12 ? -12.938 20.769  -8.172  1.00 0.00 ? 124 DC  C "H4'"  4  
ATOM   6605  H "H3'"  . DC  B 1 12 ? -13.586 21.268  -10.972 1.00 0.00 ? 124 DC  C "H3'"  4  
ATOM   6606  H "HO3'" . DC  B 1 12 ? -14.360 22.610  -9.396  1.00 0.00 ? 124 DC  C "HO3'" 4  
ATOM   6607  H "H2'"  . DC  B 1 12 ? -11.533 21.652  -11.791 1.00 0.00 ? 124 DC  C "H2'"  4  
ATOM   6608  H "H2''" . DC  B 1 12 ? -11.206 22.806  -10.468 1.00 0.00 ? 124 DC  C "H2''" 4  
ATOM   6609  H "H1'"  . DC  B 1 12 ? -9.933  21.299  -9.382  1.00 0.00 ? 124 DC  C "H1'"  4  
ATOM   6610  H H41    . DC  B 1 12 ? -6.563  17.940  -13.578 1.00 0.00 ? 124 DC  C H41    4  
ATOM   6611  H H42    . DC  B 1 12 ? -7.985  17.607  -14.541 1.00 0.00 ? 124 DC  C H42    4  
ATOM   6612  H H5     . DC  B 1 12 ? -10.190 18.364  -13.943 1.00 0.00 ? 124 DC  C H5     4  
ATOM   6613  H H6     . DC  B 1 12 ? -11.514 19.593  -12.286 1.00 0.00 ? 124 DC  C H6     4  
ATOM   6614  N N      . MET C 2 1  ? -14.240 13.718  7.625   1.00 0.00 ? 1   MET A N      4  
ATOM   6615  C CA     . MET C 2 1  ? -12.958 13.077  8.042   1.00 0.00 ? 1   MET A CA     4  
ATOM   6616  C C      . MET C 2 1  ? -11.900 13.254  6.950   1.00 0.00 ? 1   MET A C      4  
ATOM   6617  O O      . MET C 2 1  ? -12.215 13.399  5.785   1.00 0.00 ? 1   MET A O      4  
ATOM   6618  C CB     . MET C 2 1  ? -13.297 11.596  8.230   1.00 0.00 ? 1   MET A CB     4  
ATOM   6619  C CG     . MET C 2 1  ? -13.252 11.244  9.718   1.00 0.00 ? 1   MET A CG     4  
ATOM   6620  S SD     . MET C 2 1  ? -13.107 9.451   9.911   1.00 0.00 ? 1   MET A SD     4  
ATOM   6621  C CE     . MET C 2 1  ? -13.199 9.407   11.717  1.00 0.00 ? 1   MET A CE     4  
ATOM   6622  H H      . MET C 2 1  ? -14.761 13.337  6.889   1.00 0.00 ? 1   MET A H      4  
ATOM   6623  H HA     . MET C 2 1  ? -12.613 13.498  8.973   1.00 0.00 ? 1   MET A HA     4  
ATOM   6624  H HB2    . MET C 2 1  ? -14.287 11.401  7.844   1.00 0.00 ? 1   MET A HB2    4  
ATOM   6625  H HB3    . MET C 2 1  ? -12.578 10.992  7.698   1.00 0.00 ? 1   MET A HB3    4  
ATOM   6626  H HG2    . MET C 2 1  ? -12.400 11.726  10.176  1.00 0.00 ? 1   MET A HG2    4  
ATOM   6627  H HG3    . MET C 2 1  ? -14.158 11.586  10.196  1.00 0.00 ? 1   MET A HG3    4  
ATOM   6628  H HE1    . MET C 2 1  ? -12.910 10.371  12.115  1.00 0.00 ? 1   MET A HE1    4  
ATOM   6629  H HE2    . MET C 2 1  ? -12.532 8.651   12.096  1.00 0.00 ? 1   MET A HE2    4  
ATOM   6630  H HE3    . MET C 2 1  ? -14.212 9.176   12.020  1.00 0.00 ? 1   MET A HE3    4  
ATOM   6631  N N      . ALA C 2 2  ? -10.648 13.242  7.321   1.00 0.00 ? 2   ALA A N      4  
ATOM   6632  C CA     . ALA C 2 2  ? -9.564  13.410  6.308   1.00 0.00 ? 2   ALA A CA     4  
ATOM   6633  C C      . ALA C 2 2  ? -8.589  12.234  6.377   1.00 0.00 ? 2   ALA A C      4  
ATOM   6634  O O      . ALA C 2 2  ? -7.398  12.401  6.208   1.00 0.00 ? 2   ALA A O      4  
ATOM   6635  C CB     . ALA C 2 2  ? -8.860  14.709  6.696   1.00 0.00 ? 2   ALA A CB     4  
ATOM   6636  H H      . ALA C 2 2  ? -10.418 13.124  8.266   1.00 0.00 ? 2   ALA A H      4  
ATOM   6637  H HA     . ALA C 2 2  ? -9.983  13.499  5.318   1.00 0.00 ? 2   ALA A HA     4  
ATOM   6638  H HB1    . ALA C 2 2  ? -8.470  15.185  5.809   1.00 0.00 ? 2   ALA A HB1    4  
ATOM   6639  H HB2    . ALA C 2 2  ? -8.048  14.486  7.373   1.00 0.00 ? 2   ALA A HB2    4  
ATOM   6640  H HB3    . ALA C 2 2  ? -9.563  15.369  7.181   1.00 0.00 ? 2   ALA A HB3    4  
ATOM   6641  N N      . GLU C 2 3  ? -9.091  11.049  6.623   1.00 0.00 ? 3   GLU A N      4  
ATOM   6642  C CA     . GLU C 2 3  ? -8.213  9.836   6.710   1.00 0.00 ? 3   GLU A CA     4  
ATOM   6643  C C      . GLU C 2 3  ? -7.226  9.952   7.881   1.00 0.00 ? 3   GLU A C      4  
ATOM   6644  O O      . GLU C 2 3  ? -7.242  9.144   8.787   1.00 0.00 ? 3   GLU A O      4  
ATOM   6645  C CB     . GLU C 2 3  ? -7.471  9.753   5.370   1.00 0.00 ? 3   GLU A CB     4  
ATOM   6646  C CG     . GLU C 2 3  ? -8.472  9.465   4.245   1.00 0.00 ? 3   GLU A CG     4  
ATOM   6647  C CD     . GLU C 2 3  ? -8.510  10.643  3.269   1.00 0.00 ? 3   GLU A CD     4  
ATOM   6648  O OE1    . GLU C 2 3  ? -8.263  11.757  3.701   1.00 0.00 ? 3   GLU A OE1    4  
ATOM   6649  O OE2    . GLU C 2 3  ? -8.787  10.411  2.103   1.00 0.00 ? 3   GLU A OE2    4  
ATOM   6650  H H      . GLU C 2 3  ? -10.058 10.955  6.753   1.00 0.00 ? 3   GLU A H      4  
ATOM   6651  H HA     . GLU C 2 3  ? -8.823  8.957   6.836   1.00 0.00 ? 3   GLU A HA     4  
ATOM   6652  H HB2    . GLU C 2 3  ? -6.965  10.687  5.175   1.00 0.00 ? 3   GLU A HB2    4  
ATOM   6653  H HB3    . GLU C 2 3  ? -6.745  8.955   5.413   1.00 0.00 ? 3   GLU A HB3    4  
ATOM   6654  H HG2    . GLU C 2 3  ? -8.171  8.571   3.718   1.00 0.00 ? 3   GLU A HG2    4  
ATOM   6655  H HG3    . GLU C 2 3  ? -9.455  9.319   4.667   1.00 0.00 ? 3   GLU A HG3    4  
ATOM   6656  N N      . ASP C 2 4  ? -6.371  10.944  7.868   1.00 0.00 ? 4   ASP A N      4  
ATOM   6657  C CA     . ASP C 2 4  ? -5.379  11.116  8.977   1.00 0.00 ? 4   ASP A CA     4  
ATOM   6658  C C      . ASP C 2 4  ? -4.430  9.917   9.034   1.00 0.00 ? 4   ASP A C      4  
ATOM   6659  O O      . ASP C 2 4  ? -4.850  8.776   9.073   1.00 0.00 ? 4   ASP A O      4  
ATOM   6660  C CB     . ASP C 2 4  ? -6.199  11.221  10.269  1.00 0.00 ? 4   ASP A CB     4  
ATOM   6661  C CG     . ASP C 2 4  ? -7.217  12.358  10.141  1.00 0.00 ? 4   ASP A CG     4  
ATOM   6662  O OD1    . ASP C 2 4  ? -6.806  13.459  9.813   1.00 0.00 ? 4   ASP A OD1    4  
ATOM   6663  O OD2    . ASP C 2 4  ? -8.387  12.106  10.373  1.00 0.00 ? 4   ASP A OD2    4  
ATOM   6664  H H      . ASP C 2 4  ? -6.375  11.579  7.123   1.00 0.00 ? 4   ASP A H      4  
ATOM   6665  H HA     . ASP C 2 4  ? -4.814  12.023  8.831   1.00 0.00 ? 4   ASP A HA     4  
ATOM   6666  H HB2    . ASP C 2 4  ? -6.717  10.292  10.448  1.00 0.00 ? 4   ASP A HB2    4  
ATOM   6667  H HB3    . ASP C 2 4  ? -5.538  11.427  11.097  1.00 0.00 ? 4   ASP A HB3    4  
ATOM   6668  N N      . TRP C 2 5  ? -3.150  10.172  9.035   1.00 0.00 ? 5   TRP A N      4  
ATOM   6669  C CA     . TRP C 2 5  ? -2.162  9.054   9.086   1.00 0.00 ? 5   TRP A CA     4  
ATOM   6670  C C      . TRP C 2 5  ? -2.018  8.539   10.520  1.00 0.00 ? 5   TRP A C      4  
ATOM   6671  O O      . TRP C 2 5  ? -2.552  9.109   11.452  1.00 0.00 ? 5   TRP A O      4  
ATOM   6672  C CB     . TRP C 2 5  ? -0.848  9.667   8.602   1.00 0.00 ? 5   TRP A CB     4  
ATOM   6673  C CG     . TRP C 2 5  ? -0.902  9.867   7.121   1.00 0.00 ? 5   TRP A CG     4  
ATOM   6674  C CD1    . TRP C 2 5  ? -1.359  10.981  6.504   1.00 0.00 ? 5   TRP A CD1    4  
ATOM   6675  C CD2    . TRP C 2 5  ? -0.491  8.953   6.064   1.00 0.00 ? 5   TRP A CD2    4  
ATOM   6676  N NE1    . TRP C 2 5  ? -1.255  10.807  5.135   1.00 0.00 ? 5   TRP A NE1    4  
ATOM   6677  C CE2    . TRP C 2 5  ? -0.726  9.573   4.815   1.00 0.00 ? 5   TRP A CE2    4  
ATOM   6678  C CE3    . TRP C 2 5  ? 0.057   7.657   6.068   1.00 0.00 ? 5   TRP A CE3    4  
ATOM   6679  C CZ2    . TRP C 2 5  ? -0.427  8.933   3.611   1.00 0.00 ? 5   TRP A CZ2    4  
ATOM   6680  C CZ3    . TRP C 2 5  ? 0.359   7.009   4.859   1.00 0.00 ? 5   TRP A CZ3    4  
ATOM   6681  C CH2    . TRP C 2 5  ? 0.118   7.646   3.633   1.00 0.00 ? 5   TRP A CH2    4  
ATOM   6682  H H      . TRP C 2 5  ? -2.839  11.100  9.000   1.00 0.00 ? 5   TRP A H      4  
ATOM   6683  H HA     . TRP C 2 5  ? -2.461  8.257   8.426   1.00 0.00 ? 5   TRP A HA     4  
ATOM   6684  H HB2    . TRP C 2 5  ? -0.695  10.620  9.089   1.00 0.00 ? 5   TRP A HB2    4  
ATOM   6685  H HB3    . TRP C 2 5  ? -0.032  9.004   8.846   1.00 0.00 ? 5   TRP A HB3    4  
ATOM   6686  H HD1    . TRP C 2 5  ? -1.743  11.861  6.998   1.00 0.00 ? 5   TRP A HD1    4  
ATOM   6687  H HE1    . TRP C 2 5  ? -1.520  11.467  4.460   1.00 0.00 ? 5   TRP A HE1    4  
ATOM   6688  H HE3    . TRP C 2 5  ? 0.246   7.158   7.006   1.00 0.00 ? 5   TRP A HE3    4  
ATOM   6689  H HZ2    . TRP C 2 5  ? -0.615  9.427   2.670   1.00 0.00 ? 5   TRP A HZ2    4  
ATOM   6690  H HZ3    . TRP C 2 5  ? 0.780   6.015   4.874   1.00 0.00 ? 5   TRP A HZ3    4  
ATOM   6691  H HH2    . TRP C 2 5  ? 0.353   7.142   2.707   1.00 0.00 ? 5   TRP A HH2    4  
ATOM   6692  N N      . LEU C 2 6  ? -1.302  7.462   10.702  1.00 0.00 ? 6   LEU A N      4  
ATOM   6693  C CA     . LEU C 2 6  ? -1.123  6.901   12.075  1.00 0.00 ? 6   LEU A CA     4  
ATOM   6694  C C      . LEU C 2 6  ? 0.343   6.523   12.302  1.00 0.00 ? 6   LEU A C      4  
ATOM   6695  O O      . LEU C 2 6  ? 1.100   6.357   11.368  1.00 0.00 ? 6   LEU A O      4  
ATOM   6696  C CB     . LEU C 2 6  ? -2.012  5.654   12.120  1.00 0.00 ? 6   LEU A CB     4  
ATOM   6697  C CG     . LEU C 2 6  ? -3.438  6.015   11.696  1.00 0.00 ? 6   LEU A CG     4  
ATOM   6698  C CD1    . LEU C 2 6  ? -4.293  4.747   11.651  1.00 0.00 ? 6   LEU A CD1    4  
ATOM   6699  C CD2    . LEU C 2 6  ? -4.040  7.004   12.701  1.00 0.00 ? 6   LEU A CD2    4  
ATOM   6700  H H      . LEU C 2 6  ? -0.884  7.019   9.936   1.00 0.00 ? 6   LEU A H      4  
ATOM   6701  H HA     . LEU C 2 6  ? -1.449  7.611   12.817  1.00 0.00 ? 6   LEU A HA     4  
ATOM   6702  H HB2    . LEU C 2 6  ? -1.615  4.907   11.447  1.00 0.00 ? 6   LEU A HB2    4  
ATOM   6703  H HB3    . LEU C 2 6  ? -2.026  5.260   13.125  1.00 0.00 ? 6   LEU A HB3    4  
ATOM   6704  H HG     . LEU C 2 6  ? -3.416  6.466   10.715  1.00 0.00 ? 6   LEU A HG     4  
ATOM   6705  H HD11   . LEU C 2 6  ? -3.899  4.074   10.903  1.00 0.00 ? 6   LEU A HD11   4  
ATOM   6706  H HD12   . LEU C 2 6  ? -5.311  5.008   11.400  1.00 0.00 ? 6   LEU A HD12   4  
ATOM   6707  H HD13   . LEU C 2 6  ? -4.272  4.264   12.616  1.00 0.00 ? 6   LEU A HD13   4  
ATOM   6708  H HD21   . LEU C 2 6  ? -4.288  7.926   12.193  1.00 0.00 ? 6   LEU A HD21   4  
ATOM   6709  H HD22   . LEU C 2 6  ? -3.324  7.205   13.485  1.00 0.00 ? 6   LEU A HD22   4  
ATOM   6710  H HD23   . LEU C 2 6  ? -4.935  6.580   13.134  1.00 0.00 ? 6   LEU A HD23   4  
ATOM   6711  N N      . ASP C 2 7  ? 0.748   6.389   13.534  1.00 0.00 ? 7   ASP A N      4  
ATOM   6712  C CA     . ASP C 2 7  ? 2.167   6.024   13.821  1.00 0.00 ? 7   ASP A CA     4  
ATOM   6713  C C      . ASP C 2 7  ? 2.462   4.601   13.335  1.00 0.00 ? 7   ASP A C      4  
ATOM   6714  O O      . ASP C 2 7  ? 1.581   3.765   13.261  1.00 0.00 ? 7   ASP A O      4  
ATOM   6715  C CB     . ASP C 2 7  ? 2.302   6.108   15.342  1.00 0.00 ? 7   ASP A CB     4  
ATOM   6716  C CG     . ASP C 2 7  ? 2.314   7.576   15.771  1.00 0.00 ? 7   ASP A CG     4  
ATOM   6717  O OD1    . ASP C 2 7  ? 1.241   8.141   15.910  1.00 0.00 ? 7   ASP A OD1    4  
ATOM   6718  O OD2    . ASP C 2 7  ? 3.395   8.111   15.953  1.00 0.00 ? 7   ASP A OD2    4  
ATOM   6719  H H      . ASP C 2 7  ? 0.119   6.530   14.272  1.00 0.00 ? 7   ASP A H      4  
ATOM   6720  H HA     . ASP C 2 7  ? 2.839   6.727   13.354  1.00 0.00 ? 7   ASP A HA     4  
ATOM   6721  H HB2    . ASP C 2 7  ? 1.465   5.604   15.804  1.00 0.00 ? 7   ASP A HB2    4  
ATOM   6722  H HB3    . ASP C 2 7  ? 3.222   5.637   15.650  1.00 0.00 ? 7   ASP A HB3    4  
ATOM   6723  N N      . CYS C 2 8  ? 3.696   4.320   13.008  1.00 0.00 ? 8   CYS A N      4  
ATOM   6724  C CA     . CYS C 2 8  ? 4.058   2.954   12.531  1.00 0.00 ? 8   CYS A CA     4  
ATOM   6725  C C      . CYS C 2 8  ? 5.441   2.569   13.073  1.00 0.00 ? 8   CYS A C      4  
ATOM   6726  O O      . CYS C 2 8  ? 6.441   2.749   12.407  1.00 0.00 ? 8   CYS A O      4  
ATOM   6727  C CB     . CYS C 2 8  ? 4.081   3.062   11.006  1.00 0.00 ? 8   CYS A CB     4  
ATOM   6728  S SG     . CYS C 2 8  ? 4.486   1.450   10.288  1.00 0.00 ? 8   CYS A SG     4  
ATOM   6729  H H      . CYS C 2 8  ? 4.388   5.009   13.078  1.00 0.00 ? 8   CYS A H      4  
ATOM   6730  H HA     . CYS C 2 8  ? 3.316   2.236   12.840  1.00 0.00 ? 8   CYS A HA     4  
ATOM   6731  H HB2    . CYS C 2 8  ? 3.111   3.380   10.653  1.00 0.00 ? 8   CYS A HB2    4  
ATOM   6732  H HB3    . CYS C 2 8  ? 4.825   3.786   10.710  1.00 0.00 ? 8   CYS A HB3    4  
ATOM   6733  H HG     . CYS C 2 8  ? 3.860   1.274   9.582   1.00 0.00 ? 8   CYS A HG     4  
ATOM   6734  N N      . PRO C 2 9  ? 5.446   2.058   14.277  1.00 0.00 ? 9   PRO A N      4  
ATOM   6735  C CA     . PRO C 2 9  ? 6.716   1.652   14.933  1.00 0.00 ? 9   PRO A CA     4  
ATOM   6736  C C      . PRO C 2 9  ? 7.302   0.388   14.306  1.00 0.00 ? 9   PRO A C      4  
ATOM   6737  O O      . PRO C 2 9  ? 8.404   -0.013  14.629  1.00 0.00 ? 9   PRO A O      4  
ATOM   6738  C CB     . PRO C 2 9  ? 6.303   1.371   16.372  1.00 0.00 ? 9   PRO A CB     4  
ATOM   6739  C CG     . PRO C 2 9  ? 4.845   1.052   16.304  1.00 0.00 ? 9   PRO A CG     4  
ATOM   6740  C CD     . PRO C 2 9  ? 4.281   1.812   15.136  1.00 0.00 ? 9   PRO A CD     4  
ATOM   6741  H HA     . PRO C 2 9  ? 7.431   2.455   14.908  1.00 0.00 ? 9   PRO A HA     4  
ATOM   6742  H HB2    . PRO C 2 9  ? 6.857   0.521   16.751  1.00 0.00 ? 9   PRO A HB2    4  
ATOM   6743  H HB3    . PRO C 2 9  ? 6.467   2.240   16.990  1.00 0.00 ? 9   PRO A HB3    4  
ATOM   6744  H HG2    . PRO C 2 9  ? 4.707   -0.009  16.159  1.00 0.00 ? 9   PRO A HG2    4  
ATOM   6745  H HG3    . PRO C 2 9  ? 4.356   1.370   17.212  1.00 0.00 ? 9   PRO A HG3    4  
ATOM   6746  H HD2    . PRO C 2 9  ? 3.543   1.215   14.617  1.00 0.00 ? 9   PRO A HD2    4  
ATOM   6747  H HD3    . PRO C 2 9  ? 3.854   2.748   15.460  1.00 0.00 ? 9   PRO A HD3    4  
ATOM   6748  N N      . ALA C 2 10 ? 6.583   -0.256  13.431  1.00 0.00 ? 10  ALA A N      4  
ATOM   6749  C CA     . ALA C 2 10 ? 7.117   -1.503  12.817  1.00 0.00 ? 10  ALA A CA     4  
ATOM   6750  C C      . ALA C 2 10 ? 8.492   -1.251  12.191  1.00 0.00 ? 10  ALA A C      4  
ATOM   6751  O O      . ALA C 2 10 ? 9.478   -1.856  12.564  1.00 0.00 ? 10  ALA A O      4  
ATOM   6752  C CB     . ALA C 2 10 ? 6.106   -1.889  11.738  1.00 0.00 ? 10  ALA A CB     4  
ATOM   6753  H H      . ALA C 2 10 ? 5.691   0.068   13.188  1.00 0.00 ? 10  ALA A H      4  
ATOM   6754  H HA     . ALA C 2 10 ? 7.179   -2.280  13.562  1.00 0.00 ? 10  ALA A HA     4  
ATOM   6755  H HB1    . ALA C 2 10 ? 5.173   -1.374  11.918  1.00 0.00 ? 10  ALA A HB1    4  
ATOM   6756  H HB2    . ALA C 2 10 ? 5.939   -2.954  11.764  1.00 0.00 ? 10  ALA A HB2    4  
ATOM   6757  H HB3    . ALA C 2 10 ? 6.489   -1.608  10.768  1.00 0.00 ? 10  ALA A HB3    4  
ATOM   6758  N N      . LEU C 2 11 ? 8.558   -0.367  11.235  1.00 0.00 ? 11  LEU A N      4  
ATOM   6759  C CA     . LEU C 2 11 ? 9.861   -0.077  10.569  1.00 0.00 ? 11  LEU A CA     4  
ATOM   6760  C C      . LEU C 2 11 ? 10.710  0.865   11.428  1.00 0.00 ? 11  LEU A C      4  
ATOM   6761  O O      . LEU C 2 11 ? 11.807  0.527   11.831  1.00 0.00 ? 11  LEU A O      4  
ATOM   6762  C CB     . LEU C 2 11 ? 9.482   0.594   9.248   1.00 0.00 ? 11  LEU A CB     4  
ATOM   6763  C CG     . LEU C 2 11 ? 8.615   -0.362  8.420   1.00 0.00 ? 11  LEU A CG     4  
ATOM   6764  C CD1    . LEU C 2 11 ? 7.183   0.175   8.349   1.00 0.00 ? 11  LEU A CD1    4  
ATOM   6765  C CD2    . LEU C 2 11 ? 9.184   -0.475  7.003   1.00 0.00 ? 11  LEU A CD2    4  
ATOM   6766  H H      . LEU C 2 11 ? 7.748   0.102   10.950  1.00 0.00 ? 11  LEU A H      4  
ATOM   6767  H HA     . LEU C 2 11 ? 10.395  -0.993  10.373  1.00 0.00 ? 11  LEU A HA     4  
ATOM   6768  H HB2    . LEU C 2 11 ? 8.928   1.498   9.453   1.00 0.00 ? 11  LEU A HB2    4  
ATOM   6769  H HB3    . LEU C 2 11 ? 10.377  0.837   8.697   1.00 0.00 ? 11  LEU A HB3    4  
ATOM   6770  H HG     . LEU C 2 11 ? 8.608   -1.336  8.885   1.00 0.00 ? 11  LEU A HG     4  
ATOM   6771  H HD11   . LEU C 2 11 ? 6.951   0.702   9.263   1.00 0.00 ? 11  LEU A HD11   4  
ATOM   6772  H HD12   . LEU C 2 11 ? 6.496   -0.647  8.224   1.00 0.00 ? 11  LEU A HD12   4  
ATOM   6773  H HD13   . LEU C 2 11 ? 7.093   0.851   7.513   1.00 0.00 ? 11  LEU A HD13   4  
ATOM   6774  H HD21   . LEU C 2 11 ? 8.622   0.162   6.337   1.00 0.00 ? 11  LEU A HD21   4  
ATOM   6775  H HD22   . LEU C 2 11 ? 9.110   -1.499  6.669   1.00 0.00 ? 11  LEU A HD22   4  
ATOM   6776  H HD23   . LEU C 2 11 ? 10.220  -0.170  7.005   1.00 0.00 ? 11  LEU A HD23   4  
ATOM   6777  N N      . GLY C 2 12 ? 10.218  2.043   11.710  1.00 0.00 ? 12  GLY A N      4  
ATOM   6778  C CA     . GLY C 2 12 ? 11.006  2.998   12.542  1.00 0.00 ? 12  GLY A CA     4  
ATOM   6779  C C      . GLY C 2 12 ? 10.298  4.356   12.588  1.00 0.00 ? 12  GLY A C      4  
ATOM   6780  O O      . GLY C 2 12 ? 9.118   4.448   12.309  1.00 0.00 ? 12  GLY A O      4  
ATOM   6781  H H      . GLY C 2 12 ? 9.333   2.299   11.376  1.00 0.00 ? 12  GLY A H      4  
ATOM   6782  H HA2    . GLY C 2 12 ? 11.102  2.607   13.545  1.00 0.00 ? 12  GLY A HA2    4  
ATOM   6783  H HA3    . GLY C 2 12 ? 11.988  3.124   12.111  1.00 0.00 ? 12  GLY A HA3    4  
ATOM   6784  N N      . PRO C 2 13 ? 11.045  5.372   12.946  1.00 0.00 ? 13  PRO A N      4  
ATOM   6785  C CA     . PRO C 2 13 ? 10.477  6.739   13.036  1.00 0.00 ? 13  PRO A CA     4  
ATOM   6786  C C      . PRO C 2 13 ? 10.250  7.329   11.640  1.00 0.00 ? 13  PRO A C      4  
ATOM   6787  O O      . PRO C 2 13 ? 10.976  7.046   10.707  1.00 0.00 ? 13  PRO A O      4  
ATOM   6788  C CB     . PRO C 2 13 ? 11.548  7.524   13.787  1.00 0.00 ? 13  PRO A CB     4  
ATOM   6789  C CG     . PRO C 2 13 ? 12.826  6.789   13.527  1.00 0.00 ? 13  PRO A CG     4  
ATOM   6790  C CD     . PRO C 2 13 ? 12.470  5.342   13.298  1.00 0.00 ? 13  PRO A CD     4  
ATOM   6791  H HA     . PRO C 2 13 ? 9.559   6.734   13.603  1.00 0.00 ? 13  PRO A HA     4  
ATOM   6792  H HB2    . PRO C 2 13 ? 11.608  8.534   13.405  1.00 0.00 ? 13  PRO A HB2    4  
ATOM   6793  H HB3    . PRO C 2 13 ? 11.336  7.532   14.845  1.00 0.00 ? 13  PRO A HB3    4  
ATOM   6794  H HG2    . PRO C 2 13 ? 13.311  7.195   12.651  1.00 0.00 ? 13  PRO A HG2    4  
ATOM   6795  H HG3    . PRO C 2 13 ? 13.478  6.871   14.383  1.00 0.00 ? 13  PRO A HG3    4  
ATOM   6796  H HD2    . PRO C 2 13 ? 13.056  4.934   12.485  1.00 0.00 ? 13  PRO A HD2    4  
ATOM   6797  H HD3    . PRO C 2 13 ? 12.619  4.767   14.199  1.00 0.00 ? 13  PRO A HD3    4  
ATOM   6798  N N      . GLY C 2 14 ? 9.243   8.149   11.497  1.00 0.00 ? 14  GLY A N      4  
ATOM   6799  C CA     . GLY C 2 14 ? 8.953   8.769   10.173  1.00 0.00 ? 14  GLY A CA     4  
ATOM   6800  C C      . GLY C 2 14 ? 7.836   7.987   9.478   1.00 0.00 ? 14  GLY A C      4  
ATOM   6801  O O      . GLY C 2 14 ? 7.058   8.536   8.721   1.00 0.00 ? 14  GLY A O      4  
ATOM   6802  H H      . GLY C 2 14 ? 8.676   8.358   12.263  1.00 0.00 ? 14  GLY A H      4  
ATOM   6803  H HA2    . GLY C 2 14 ? 8.644   9.795   10.314  1.00 0.00 ? 14  GLY A HA2    4  
ATOM   6804  H HA3    . GLY C 2 14 ? 9.844   8.742   9.554   1.00 0.00 ? 14  GLY A HA3    4  
ATOM   6805  N N      . TRP C 2 15 ? 7.768   6.704   9.711   1.00 0.00 ? 15  TRP A N      4  
ATOM   6806  C CA     . TRP C 2 15 ? 6.723   5.871   9.044   1.00 0.00 ? 15  TRP A CA     4  
ATOM   6807  C C      . TRP C 2 15 ? 5.317   6.264   9.503   1.00 0.00 ? 15  TRP A C      4  
ATOM   6808  O O      . TRP C 2 15 ? 5.101   6.642   10.638  1.00 0.00 ? 15  TRP A O      4  
ATOM   6809  C CB     . TRP C 2 15 ? 7.041   4.436   9.459   1.00 0.00 ? 15  TRP A CB     4  
ATOM   6810  C CG     . TRP C 2 15 ? 8.095   3.879   8.557   1.00 0.00 ? 15  TRP A CG     4  
ATOM   6811  C CD1    . TRP C 2 15 ? 9.411   3.790   8.858   1.00 0.00 ? 15  TRP A CD1    4  
ATOM   6812  C CD2    . TRP C 2 15 ? 7.944   3.338   7.215   1.00 0.00 ? 15  TRP A CD2    4  
ATOM   6813  N NE1    . TRP C 2 15 ? 10.076  3.219   7.787   1.00 0.00 ? 15  TRP A NE1    4  
ATOM   6814  C CE2    . TRP C 2 15 ? 9.214   2.926   6.749   1.00 0.00 ? 15  TRP A CE2    4  
ATOM   6815  C CE3    . TRP C 2 15 ? 6.838   3.166   6.365   1.00 0.00 ? 15  TRP A CE3    4  
ATOM   6816  C CZ2    . TRP C 2 15 ? 9.382   2.363   5.484   1.00 0.00 ? 15  TRP A CZ2    4  
ATOM   6817  C CZ3    . TRP C 2 15 ? 7.002   2.600   5.092   1.00 0.00 ? 15  TRP A CZ3    4  
ATOM   6818  C CH2    . TRP C 2 15 ? 8.272   2.198   4.653   1.00 0.00 ? 15  TRP A CH2    4  
ATOM   6819  H H      . TRP C 2 15 ? 8.416   6.282   10.313  1.00 0.00 ? 15  TRP A H      4  
ATOM   6820  H HA     . TRP C 2 15 ? 6.803   5.963   7.972   1.00 0.00 ? 15  TRP A HA     4  
ATOM   6821  H HB2    . TRP C 2 15 ? 7.396   4.425   10.479  1.00 0.00 ? 15  TRP A HB2    4  
ATOM   6822  H HB3    . TRP C 2 15 ? 6.150   3.833   9.381   1.00 0.00 ? 15  TRP A HB3    4  
ATOM   6823  H HD1    . TRP C 2 15 ? 9.868   4.105   9.785   1.00 0.00 ? 15  TRP A HD1    4  
ATOM   6824  H HE1    . TRP C 2 15 ? 11.038  3.040   7.747   1.00 0.00 ? 15  TRP A HE1    4  
ATOM   6825  H HE3    . TRP C 2 15 ? 5.855   3.471   6.694   1.00 0.00 ? 15  TRP A HE3    4  
ATOM   6826  H HZ2    . TRP C 2 15 ? 10.362  2.055   5.151   1.00 0.00 ? 15  TRP A HZ2    4  
ATOM   6827  H HZ3    . TRP C 2 15 ? 6.145   2.471   4.447   1.00 0.00 ? 15  TRP A HZ3    4  
ATOM   6828  H HH2    . TRP C 2 15 ? 8.393   1.762   3.672   1.00 0.00 ? 15  TRP A HH2    4  
ATOM   6829  N N      . LYS C 2 16 ? 4.359   6.167   8.618   1.00 0.00 ? 16  LYS A N      4  
ATOM   6830  C CA     . LYS C 2 16 ? 2.955   6.519   8.978   1.00 0.00 ? 16  LYS A CA     4  
ATOM   6831  C C      . LYS C 2 16 ? 1.991   5.516   8.331   1.00 0.00 ? 16  LYS A C      4  
ATOM   6832  O O      . LYS C 2 16 ? 2.269   4.966   7.282   1.00 0.00 ? 16  LYS A O      4  
ATOM   6833  C CB     . LYS C 2 16 ? 2.739   7.926   8.410   1.00 0.00 ? 16  LYS A CB     4  
ATOM   6834  C CG     . LYS C 2 16 ? 2.335   8.879   9.538   1.00 0.00 ? 16  LYS A CG     4  
ATOM   6835  C CD     . LYS C 2 16 ? 3.507   9.053   10.507  1.00 0.00 ? 16  LYS A CD     4  
ATOM   6836  C CE     . LYS C 2 16 ? 3.524   10.489  11.036  1.00 0.00 ? 16  LYS A CE     4  
ATOM   6837  N NZ     . LYS C 2 16 ? 4.605   11.168  10.268  1.00 0.00 ? 16  LYS A NZ     4  
ATOM   6838  H H      . LYS C 2 16 ? 4.564   5.854   7.713   1.00 0.00 ? 16  LYS A H      4  
ATOM   6839  H HA     . LYS C 2 16 ? 2.830   6.527   10.049  1.00 0.00 ? 16  LYS A HA     4  
ATOM   6840  H HB2    . LYS C 2 16 ? 3.655   8.275   7.956   1.00 0.00 ? 16  LYS A HB2    4  
ATOM   6841  H HB3    . LYS C 2 16 ? 1.956   7.899   7.668   1.00 0.00 ? 16  LYS A HB3    4  
ATOM   6842  H HG2    . LYS C 2 16 ? 2.067   9.838   9.119   1.00 0.00 ? 16  LYS A HG2    4  
ATOM   6843  H HG3    . LYS C 2 16 ? 1.489   8.470   10.069  1.00 0.00 ? 16  LYS A HG3    4  
ATOM   6844  H HD2    . LYS C 2 16 ? 3.395   8.365   11.334  1.00 0.00 ? 16  LYS A HD2    4  
ATOM   6845  H HD3    . LYS C 2 16 ? 4.434   8.849   9.994   1.00 0.00 ? 16  LYS A HD3    4  
ATOM   6846  H HE2    . LYS C 2 16 ? 2.572   10.969  10.853  1.00 0.00 ? 16  LYS A HE2    4  
ATOM   6847  H HE3    . LYS C 2 16 ? 3.757   10.500  12.089  1.00 0.00 ? 16  LYS A HE3    4  
ATOM   6848  H HZ1    . LYS C 2 16 ? 4.574   12.190  10.455  1.00 0.00 ? 16  LYS A HZ1    4  
ATOM   6849  H HZ2    . LYS C 2 16 ? 5.529   10.788  10.561  1.00 0.00 ? 16  LYS A HZ2    4  
ATOM   6850  H HZ3    . LYS C 2 16 ? 4.467   10.999  9.252   1.00 0.00 ? 16  LYS A HZ3    4  
ATOM   6851  N N      . ARG C 2 17 ? 0.868   5.264   8.950   1.00 0.00 ? 17  ARG A N      4  
ATOM   6852  C CA     . ARG C 2 17 ? -0.104  4.286   8.373   1.00 0.00 ? 17  ARG A CA     4  
ATOM   6853  C C      . ARG C 2 17 ? -1.492  4.919   8.237   1.00 0.00 ? 17  ARG A C      4  
ATOM   6854  O O      . ARG C 2 17 ? -2.070  5.385   9.199   1.00 0.00 ? 17  ARG A O      4  
ATOM   6855  C CB     . ARG C 2 17 ? -0.134  3.132   9.377   1.00 0.00 ? 17  ARG A CB     4  
ATOM   6856  C CG     . ARG C 2 17 ? -0.991  1.988   8.823   1.00 0.00 ? 17  ARG A CG     4  
ATOM   6857  C CD     . ARG C 2 17 ? -2.111  1.654   9.814   1.00 0.00 ? 17  ARG A CD     4  
ATOM   6858  N NE     . ARG C 2 17 ? -1.411  1.282   11.075  1.00 0.00 ? 17  ARG A NE     4  
ATOM   6859  C CZ     . ARG C 2 17 ? -2.003  1.456   12.225  1.00 0.00 ? 17  ARG A CZ     4  
ATOM   6860  N NH1    . ARG C 2 17 ? -3.034  0.725   12.546  1.00 0.00 ? 17  ARG A NH1    4  
ATOM   6861  N NH2    . ARG C 2 17 ? -1.561  2.362   13.055  1.00 0.00 ? 17  ARG A NH2    4  
ATOM   6862  H H      . ARG C 2 17 ? 0.667   5.711   9.799   1.00 0.00 ? 17  ARG A H      4  
ATOM   6863  H HA     . ARG C 2 17 ? 0.242   3.931   7.415   1.00 0.00 ? 17  ARG A HA     4  
ATOM   6864  H HB2    . ARG C 2 17 ? 0.873   2.779   9.547   1.00 0.00 ? 17  ARG A HB2    4  
ATOM   6865  H HB3    . ARG C 2 17 ? -0.555  3.479   10.309  1.00 0.00 ? 17  ARG A HB3    4  
ATOM   6866  H HG2    . ARG C 2 17 ? -1.424  2.284   7.878   1.00 0.00 ? 17  ARG A HG2    4  
ATOM   6867  H HG3    . ARG C 2 17 ? -0.373  1.116   8.677   1.00 0.00 ? 17  ARG A HG3    4  
ATOM   6868  H HD2    . ARG C 2 17 ? -2.742  2.518   9.972   1.00 0.00 ? 17  ARG A HD2    4  
ATOM   6869  H HD3    . ARG C 2 17 ? -2.694  0.820   9.455   1.00 0.00 ? 17  ARG A HD3    4  
ATOM   6870  H HE     . ARG C 2 17 ? -0.507  0.907   11.041  1.00 0.00 ? 17  ARG A HE     4  
ATOM   6871  H HH11   . ARG C 2 17 ? -3.372  0.031   11.910  1.00 0.00 ? 17  ARG A HH11   4  
ATOM   6872  H HH12   . ARG C 2 17 ? -3.488  0.859   13.427  1.00 0.00 ? 17  ARG A HH12   4  
ATOM   6873  H HH21   . ARG C 2 17 ? -0.770  2.923   12.809  1.00 0.00 ? 17  ARG A HH21   4  
ATOM   6874  H HH22   . ARG C 2 17 ? -2.014  2.496   13.936  1.00 0.00 ? 17  ARG A HH22   4  
ATOM   6875  N N      . ARG C 2 18 ? -2.031  4.932   7.048   1.00 0.00 ? 18  ARG A N      4  
ATOM   6876  C CA     . ARG C 2 18 ? -3.383  5.530   6.839   1.00 0.00 ? 18  ARG A CA     4  
ATOM   6877  C C      . ARG C 2 18 ? -4.384  4.441   6.440   1.00 0.00 ? 18  ARG A C      4  
ATOM   6878  O O      . ARG C 2 18 ? -4.081  3.568   5.650   1.00 0.00 ? 18  ARG A O      4  
ATOM   6879  C CB     . ARG C 2 18 ? -3.196  6.531   5.698   1.00 0.00 ? 18  ARG A CB     4  
ATOM   6880  C CG     . ARG C 2 18 ? -4.523  7.239   5.410   1.00 0.00 ? 18  ARG A CG     4  
ATOM   6881  C CD     . ARG C 2 18 ? -4.246  8.643   4.866   1.00 0.00 ? 18  ARG A CD     4  
ATOM   6882  N NE     . ARG C 2 18 ? -5.007  8.720   3.589   1.00 0.00 ? 18  ARG A NE     4  
ATOM   6883  C CZ     . ARG C 2 18 ? -4.414  9.122   2.497   1.00 0.00 ? 18  ARG A CZ     4  
ATOM   6884  N NH1    . ARG C 2 18 ? -3.647  10.179  2.523   1.00 0.00 ? 18  ARG A NH1    4  
ATOM   6885  N NH2    . ARG C 2 18 ? -4.587  8.468   1.382   1.00 0.00 ? 18  ARG A NH2    4  
ATOM   6886  H H      . ARG C 2 18 ? -1.546  4.547   6.288   1.00 0.00 ? 18  ARG A H      4  
ATOM   6887  H HA     . ARG C 2 18 ? -3.713  6.040   7.730   1.00 0.00 ? 18  ARG A HA     4  
ATOM   6888  H HB2    . ARG C 2 18 ? -2.452  7.262   5.980   1.00 0.00 ? 18  ARG A HB2    4  
ATOM   6889  H HB3    . ARG C 2 18 ? -2.870  6.009   4.811   1.00 0.00 ? 18  ARG A HB3    4  
ATOM   6890  H HG2    . ARG C 2 18 ? -5.081  6.670   4.679   1.00 0.00 ? 18  ARG A HG2    4  
ATOM   6891  H HG3    . ARG C 2 18 ? -5.095  7.315   6.323   1.00 0.00 ? 18  ARG A HG3    4  
ATOM   6892  H HD2    . ARG C 2 18 ? -4.599  9.391   5.563   1.00 0.00 ? 18  ARG A HD2    4  
ATOM   6893  H HD3    . ARG C 2 18 ? -3.192  8.774   4.676   1.00 0.00 ? 18  ARG A HD3    4  
ATOM   6894  H HE     . ARG C 2 18 ? -5.954  8.468   3.567   1.00 0.00 ? 18  ARG A HE     4  
ATOM   6895  H HH11   . ARG C 2 18 ? -3.514  10.680  3.378   1.00 0.00 ? 18  ARG A HH11   4  
ATOM   6896  H HH12   . ARG C 2 18 ? -3.193  10.487  1.687   1.00 0.00 ? 18  ARG A HH12   4  
ATOM   6897  H HH21   . ARG C 2 18 ? -5.174  7.659   1.363   1.00 0.00 ? 18  ARG A HH21   4  
ATOM   6898  H HH22   . ARG C 2 18 ? -4.132  8.778   0.546   1.00 0.00 ? 18  ARG A HH22   4  
ATOM   6899  N N      . GLU C 2 19 ? -5.574  4.486   6.978   1.00 0.00 ? 19  GLU A N      4  
ATOM   6900  C CA     . GLU C 2 19 ? -6.591  3.452   6.625   1.00 0.00 ? 19  GLU A CA     4  
ATOM   6901  C C      . GLU C 2 19 ? -7.586  4.013   5.605   1.00 0.00 ? 19  GLU A C      4  
ATOM   6902  O O      . GLU C 2 19 ? -7.891  5.190   5.604   1.00 0.00 ? 19  GLU A O      4  
ATOM   6903  C CB     . GLU C 2 19 ? -7.300  3.120   7.939   1.00 0.00 ? 19  GLU A CB     4  
ATOM   6904  C CG     . GLU C 2 19 ? -7.570  1.616   8.009   1.00 0.00 ? 19  GLU A CG     4  
ATOM   6905  C CD     . GLU C 2 19 ? -8.302  1.288   9.310   1.00 0.00 ? 19  GLU A CD     4  
ATOM   6906  O OE1    . GLU C 2 19 ? -7.869  1.763   10.348  1.00 0.00 ? 19  GLU A OE1    4  
ATOM   6907  O OE2    . GLU C 2 19 ? -9.285  0.568   9.248   1.00 0.00 ? 19  GLU A OE2    4  
ATOM   6908  H H      . GLU C 2 19 ? -5.799  5.198   7.613   1.00 0.00 ? 19  GLU A H      4  
ATOM   6909  H HA     . GLU C 2 19 ? -6.110  2.570   6.234   1.00 0.00 ? 19  GLU A HA     4  
ATOM   6910  H HB2    . GLU C 2 19 ? -6.675  3.415   8.769   1.00 0.00 ? 19  GLU A HB2    4  
ATOM   6911  H HB3    . GLU C 2 19 ? -8.238  3.653   7.987   1.00 0.00 ? 19  GLU A HB3    4  
ATOM   6912  H HG2    . GLU C 2 19 ? -8.178  1.320   7.166   1.00 0.00 ? 19  GLU A HG2    4  
ATOM   6913  H HG3    . GLU C 2 19 ? -6.632  1.080   7.981   1.00 0.00 ? 19  GLU A HG3    4  
ATOM   6914  N N      . VAL C 2 20 ? -8.092  3.179   4.739   1.00 0.00 ? 20  VAL A N      4  
ATOM   6915  C CA     . VAL C 2 20 ? -9.067  3.655   3.713   1.00 0.00 ? 20  VAL A CA     4  
ATOM   6916  C C      . VAL C 2 20 ? -10.337 2.799   3.766   1.00 0.00 ? 20  VAL A C      4  
ATOM   6917  O O      . VAL C 2 20 ? -10.319 1.682   4.242   1.00 0.00 ? 20  VAL A O      4  
ATOM   6918  C CB     . VAL C 2 20 ? -8.348  3.475   2.372   1.00 0.00 ? 20  VAL A CB     4  
ATOM   6919  C CG1    . VAL C 2 20 ? -9.212  4.038   1.242   1.00 0.00 ? 20  VAL A CG1    4  
ATOM   6920  C CG2    . VAL C 2 20 ? -7.011  4.222   2.402   1.00 0.00 ? 20  VAL A CG2    4  
ATOM   6921  H H      . VAL C 2 20 ? -7.830  2.235   4.760   1.00 0.00 ? 20  VAL A H      4  
ATOM   6922  H HA     . VAL C 2 20 ? -9.302  4.696   3.870   1.00 0.00 ? 20  VAL A HA     4  
ATOM   6923  H HB     . VAL C 2 20 ? -8.169  2.424   2.199   1.00 0.00 ? 20  VAL A HB     4  
ATOM   6924  H HG11   . VAL C 2 20 ? -8.867  3.645   0.297   1.00 0.00 ? 20  VAL A HG11   4  
ATOM   6925  H HG12   . VAL C 2 20 ? -9.138  5.115   1.233   1.00 0.00 ? 20  VAL A HG12   4  
ATOM   6926  H HG13   . VAL C 2 20 ? -10.240 3.750   1.396   1.00 0.00 ? 20  VAL A HG13   4  
ATOM   6927  H HG21   . VAL C 2 20 ? -6.380  3.800   3.170   1.00 0.00 ? 20  VAL A HG21   4  
ATOM   6928  H HG22   . VAL C 2 20 ? -7.187  5.266   2.616   1.00 0.00 ? 20  VAL A HG22   4  
ATOM   6929  H HG23   . VAL C 2 20 ? -6.523  4.128   1.443   1.00 0.00 ? 20  VAL A HG23   4  
ATOM   6930  N N      . PHE C 2 21 ? -11.439 3.312   3.283   1.00 0.00 ? 21  PHE A N      4  
ATOM   6931  C CA     . PHE C 2 21 ? -12.707 2.523   3.306   1.00 0.00 ? 21  PHE A CA     4  
ATOM   6932  C C      . PHE C 2 21 ? -13.426 2.642   1.958   1.00 0.00 ? 21  PHE A C      4  
ATOM   6933  O O      . PHE C 2 21 ? -14.635 2.751   1.896   1.00 0.00 ? 21  PHE A O      4  
ATOM   6934  C CB     . PHE C 2 21 ? -13.545 3.153   4.422   1.00 0.00 ? 21  PHE A CB     4  
ATOM   6935  C CG     . PHE C 2 21 ? -13.592 2.218   5.607   1.00 0.00 ? 21  PHE A CG     4  
ATOM   6936  C CD1    . PHE C 2 21 ? -14.365 1.052   5.550   1.00 0.00 ? 21  PHE A CD1    4  
ATOM   6937  C CD2    . PHE C 2 21 ? -12.862 2.518   6.765   1.00 0.00 ? 21  PHE A CD2    4  
ATOM   6938  C CE1    . PHE C 2 21 ? -14.409 0.186   6.650   1.00 0.00 ? 21  PHE A CE1    4  
ATOM   6939  C CE2    . PHE C 2 21 ? -12.906 1.652   7.863   1.00 0.00 ? 21  PHE A CE2    4  
ATOM   6940  C CZ     . PHE C 2 21 ? -13.679 0.487   7.806   1.00 0.00 ? 21  PHE A CZ     4  
ATOM   6941  H H      . PHE C 2 21 ? -11.431 4.216   2.905   1.00 0.00 ? 21  PHE A H      4  
ATOM   6942  H HA     . PHE C 2 21 ? -12.503 1.489   3.536   1.00 0.00 ? 21  PHE A HA     4  
ATOM   6943  H HB2    . PHE C 2 21 ? -13.102 4.092   4.720   1.00 0.00 ? 21  PHE A HB2    4  
ATOM   6944  H HB3    . PHE C 2 21 ? -14.549 3.327   4.064   1.00 0.00 ? 21  PHE A HB3    4  
ATOM   6945  H HD1    . PHE C 2 21 ? -14.927 0.821   4.657   1.00 0.00 ? 21  PHE A HD1    4  
ATOM   6946  H HD2    . PHE C 2 21 ? -12.265 3.417   6.809   1.00 0.00 ? 21  PHE A HD2    4  
ATOM   6947  H HE1    . PHE C 2 21 ? -15.005 -0.713  6.604   1.00 0.00 ? 21  PHE A HE1    4  
ATOM   6948  H HE2    . PHE C 2 21 ? -12.343 1.884   8.756   1.00 0.00 ? 21  PHE A HE2    4  
ATOM   6949  H HZ     . PHE C 2 21 ? -13.713 -0.182  8.654   1.00 0.00 ? 21  PHE A HZ     4  
ATOM   6950  N N      . ARG C 2 22 ? -12.684 2.611   0.881   1.00 0.00 ? 22  ARG A N      4  
ATOM   6951  C CA     . ARG C 2 22 ? -13.295 2.715   -0.478  1.00 0.00 ? 22  ARG A CA     4  
ATOM   6952  C C      . ARG C 2 22 ? -14.252 3.910   -0.569  1.00 0.00 ? 22  ARG A C      4  
ATOM   6953  O O      . ARG C 2 22 ? -14.511 4.593   0.401   1.00 0.00 ? 22  ARG A O      4  
ATOM   6954  C CB     . ARG C 2 22 ? -14.055 1.408   -0.670  1.00 0.00 ? 22  ARG A CB     4  
ATOM   6955  C CG     . ARG C 2 22 ? -13.184 0.426   -1.452  1.00 0.00 ? 22  ARG A CG     4  
ATOM   6956  C CD     . ARG C 2 22 ? -13.096 0.866   -2.916  1.00 0.00 ? 22  ARG A CD     4  
ATOM   6957  N NE     . ARG C 2 22 ? -11.645 0.841   -3.232  1.00 0.00 ? 22  ARG A NE     4  
ATOM   6958  C CZ     . ARG C 2 22 ? -11.016 -0.296  -3.359  1.00 0.00 ? 22  ARG A CZ     4  
ATOM   6959  N NH1    . ARG C 2 22 ? -10.969 -0.888  -4.519  1.00 0.00 ? 22  ARG A NH1    4  
ATOM   6960  N NH2    . ARG C 2 22 ? -10.427 -0.838  -2.328  1.00 0.00 ? 22  ARG A NH2    4  
ATOM   6961  H H      . ARG C 2 22 ? -11.719 2.510   0.966   1.00 0.00 ? 22  ARG A H      4  
ATOM   6962  H HA     . ARG C 2 22 ? -12.524 2.799   -1.228  1.00 0.00 ? 22  ARG A HA     4  
ATOM   6963  H HB2    . ARG C 2 22 ? -14.299 0.988   0.297   1.00 0.00 ? 22  ARG A HB2    4  
ATOM   6964  H HB3    . ARG C 2 22 ? -14.961 1.602   -1.220  1.00 0.00 ? 22  ARG A HB3    4  
ATOM   6965  H HG2    . ARG C 2 22 ? -12.195 0.405   -1.022  1.00 0.00 ? 22  ARG A HG2    4  
ATOM   6966  H HG3    . ARG C 2 22 ? -13.617 -0.555  -1.402  1.00 0.00 ? 22  ARG A HG3    4  
ATOM   6967  H HD2    . ARG C 2 22 ? -13.634 0.174   -3.549  1.00 0.00 ? 22  ARG A HD2    4  
ATOM   6968  H HD3    . ARG C 2 22 ? -13.484 1.866   -3.037  1.00 0.00 ? 22  ARG A HD3    4  
ATOM   6969  H HE     . ARG C 2 22 ? -11.161 1.683   -3.344  1.00 0.00 ? 22  ARG A HE     4  
ATOM   6970  H HH11   . ARG C 2 22 ? -11.416 -0.471  -5.312  1.00 0.00 ? 22  ARG A HH11   4  
ATOM   6971  H HH12   . ARG C 2 22 ? -10.487 -1.758  -4.617  1.00 0.00 ? 22  ARG A HH12   4  
ATOM   6972  H HH21   . ARG C 2 22 ? -10.458 -0.382  -1.438  1.00 0.00 ? 22  ARG A HH21   4  
ATOM   6973  H HH22   . ARG C 2 22 ? -9.946  -1.708  -2.427  1.00 0.00 ? 22  ARG A HH22   4  
ATOM   6974  N N      . LYS C 2 23 ? -14.773 4.164   -1.739  1.00 0.00 ? 23  LYS A N      4  
ATOM   6975  C CA     . LYS C 2 23 ? -15.710 5.308   -1.912  1.00 0.00 ? 23  LYS A CA     4  
ATOM   6976  C C      . LYS C 2 23 ? -16.855 4.921   -2.854  1.00 0.00 ? 23  LYS A C      4  
ATOM   6977  O O      . LYS C 2 23 ? -17.998 5.255   -2.613  1.00 0.00 ? 23  LYS A O      4  
ATOM   6978  C CB     . LYS C 2 23 ? -14.859 6.418   -2.528  1.00 0.00 ? 23  LYS A CB     4  
ATOM   6979  C CG     . LYS C 2 23 ? -15.707 7.680   -2.722  1.00 0.00 ? 23  LYS A CG     4  
ATOM   6980  C CD     . LYS C 2 23 ? -16.257 7.729   -4.152  1.00 0.00 ? 23  LYS A CD     4  
ATOM   6981  C CE     . LYS C 2 23 ? -15.103 7.700   -5.159  1.00 0.00 ? 23  LYS A CE     4  
ATOM   6982  N NZ     . LYS C 2 23 ? -15.680 8.237   -6.423  1.00 0.00 ? 23  LYS A NZ     4  
ATOM   6983  H H      . LYS C 2 23 ? -14.541 3.605   -2.508  1.00 0.00 ? 23  LYS A H      4  
ATOM   6984  H HA     . LYS C 2 23 ? -16.097 5.628   -0.958  1.00 0.00 ? 23  LYS A HA     4  
ATOM   6985  H HB2    . LYS C 2 23 ? -14.030 6.640   -1.872  1.00 0.00 ? 23  LYS A HB2    4  
ATOM   6986  H HB3    . LYS C 2 23 ? -14.482 6.089   -3.483  1.00 0.00 ? 23  LYS A HB3    4  
ATOM   6987  H HG2    . LYS C 2 23 ? -16.529 7.670   -2.022  1.00 0.00 ? 23  LYS A HG2    4  
ATOM   6988  H HG3    . LYS C 2 23 ? -15.097 8.552   -2.546  1.00 0.00 ? 23  LYS A HG3    4  
ATOM   6989  H HD2    . LYS C 2 23 ? -16.900 6.878   -4.319  1.00 0.00 ? 23  LYS A HD2    4  
ATOM   6990  H HD3    . LYS C 2 23 ? -16.825 8.637   -4.286  1.00 0.00 ? 23  LYS A HD3    4  
ATOM   6991  H HE2    . LYS C 2 23 ? -14.291 8.327   -4.815  1.00 0.00 ? 23  LYS A HE2    4  
ATOM   6992  H HE3    . LYS C 2 23 ? -14.760 6.688   -5.311  1.00 0.00 ? 23  LYS A HE3    4  
ATOM   6993  H HZ1    . LYS C 2 23 ? -15.821 9.263   -6.333  1.00 0.00 ? 23  LYS A HZ1    4  
ATOM   6994  H HZ2    . LYS C 2 23 ? -15.027 8.044   -7.211  1.00 0.00 ? 23  LYS A HZ2    4  
ATOM   6995  H HZ3    . LYS C 2 23 ? -16.595 7.779   -6.611  1.00 0.00 ? 23  LYS A HZ3    4  
ATOM   6996  N N      . SER C 2 24 ? -16.559 4.215   -3.923  1.00 0.00 ? 24  SER A N      4  
ATOM   6997  C CA     . SER C 2 24 ? -17.639 3.806   -4.887  1.00 0.00 ? 24  SER A CA     4  
ATOM   6998  C C      . SER C 2 24 ? -17.042 3.113   -6.118  1.00 0.00 ? 24  SER A C      4  
ATOM   6999  O O      . SER C 2 24 ? -15.884 2.745   -6.139  1.00 0.00 ? 24  SER A O      4  
ATOM   7000  C CB     . SER C 2 24 ? -18.332 5.104   -5.314  1.00 0.00 ? 24  SER A CB     4  
ATOM   7001  O OG     . SER C 2 24 ? -19.355 4.804   -6.255  1.00 0.00 ? 24  SER A OG     4  
ATOM   7002  H H      . SER C 2 24 ? -15.628 3.948   -4.088  1.00 0.00 ? 24  SER A H      4  
ATOM   7003  H HA     . SER C 2 24 ? -18.346 3.157   -4.402  1.00 0.00 ? 24  SER A HA     4  
ATOM   7004  H HB2    . SER C 2 24 ? -18.773 5.583   -4.459  1.00 0.00 ? 24  SER A HB2    4  
ATOM   7005  H HB3    . SER C 2 24 ? -17.603 5.768   -5.761  1.00 0.00 ? 24  SER A HB3    4  
ATOM   7006  H HG     . SER C 2 24 ? -19.739 5.633   -6.549  1.00 0.00 ? 24  SER A HG     4  
ATOM   7007  N N      . GLY C 2 25 ? -17.835 2.943   -7.148  1.00 0.00 ? 25  GLY A N      4  
ATOM   7008  C CA     . GLY C 2 25 ? -17.335 2.286   -8.391  1.00 0.00 ? 25  GLY A CA     4  
ATOM   7009  C C      . GLY C 2 25 ? -17.790 0.825   -8.427  1.00 0.00 ? 25  GLY A C      4  
ATOM   7010  O O      . GLY C 2 25 ? -18.671 0.452   -9.176  1.00 0.00 ? 25  GLY A O      4  
ATOM   7011  H H      . GLY C 2 25 ? -18.763 3.255   -7.103  1.00 0.00 ? 25  GLY A H      4  
ATOM   7012  H HA2    . GLY C 2 25 ? -17.722 2.806   -9.254  1.00 0.00 ? 25  GLY A HA2    4  
ATOM   7013  H HA3    . GLY C 2 25 ? -16.255 2.320   -8.406  1.00 0.00 ? 25  GLY A HA3    4  
ATOM   7014  N N      . ALA C 2 26 ? -17.180 0.002   -7.625  1.00 0.00 ? 26  ALA A N      4  
ATOM   7015  C CA     . ALA C 2 26 ? -17.538 -1.446  -7.589  1.00 0.00 ? 26  ALA A CA     4  
ATOM   7016  C C      . ALA C 2 26 ? -16.913 -2.069  -6.343  1.00 0.00 ? 26  ALA A C      4  
ATOM   7017  O O      . ALA C 2 26 ? -17.536 -2.817  -5.616  1.00 0.00 ? 26  ALA A O      4  
ATOM   7018  C CB     . ALA C 2 26 ? -16.917 -2.033  -8.856  1.00 0.00 ? 26  ALA A CB     4  
ATOM   7019  H H      . ALA C 2 26 ? -16.469 0.339   -7.041  1.00 0.00 ? 26  ALA A H      4  
ATOM   7020  H HA     . ALA C 2 26 ? -18.608 -1.579  -7.594  1.00 0.00 ? 26  ALA A HA     4  
ATOM   7021  H HB1    . ALA C 2 26 ? -17.487 -1.716  -9.717  1.00 0.00 ? 26  ALA A HB1    4  
ATOM   7022  H HB2    . ALA C 2 26 ? -16.923 -3.110  -8.795  1.00 0.00 ? 26  ALA A HB2    4  
ATOM   7023  H HB3    . ALA C 2 26 ? -15.898 -1.683  -8.951  1.00 0.00 ? 26  ALA A HB3    4  
ATOM   7024  N N      . THR C 2 27 ? -15.679 -1.730  -6.090  1.00 0.00 ? 27  THR A N      4  
ATOM   7025  C CA     . THR C 2 27 ? -14.968 -2.247  -4.890  1.00 0.00 ? 27  THR A CA     4  
ATOM   7026  C C      . THR C 2 27 ? -15.454 -1.501  -3.637  1.00 0.00 ? 27  THR A C      4  
ATOM   7027  O O      . THR C 2 27 ? -15.025 -1.776  -2.535  1.00 0.00 ? 27  THR A O      4  
ATOM   7028  C CB     . THR C 2 27 ? -13.489 -1.935  -5.161  1.00 0.00 ? 27  THR A CB     4  
ATOM   7029  O OG1    . THR C 2 27 ? -13.343 -0.553  -5.462  1.00 0.00 ? 27  THR A OG1    4  
ATOM   7030  C CG2    . THR C 2 27 ? -12.994 -2.774  -6.345  1.00 0.00 ? 27  THR A CG2    4  
ATOM   7031  H H      . THR C 2 27 ? -15.220 -1.109  -6.692  1.00 0.00 ? 27  THR A H      4  
ATOM   7032  H HA     . THR C 2 27 ? -15.113 -3.310  -4.785  1.00 0.00 ? 27  THR A HA     4  
ATOM   7033  H HB     . THR C 2 27 ? -12.901 -2.169  -4.287  1.00 0.00 ? 27  THR A HB     4  
ATOM   7034  H HG1    . THR C 2 27 ? -13.445 -0.436  -6.409  1.00 0.00 ? 27  THR A HG1    4  
ATOM   7035  H HG21   . THR C 2 27 ? -13.636 -3.632  -6.472  1.00 0.00 ? 27  THR A HG21   4  
ATOM   7036  H HG22   . THR C 2 27 ? -11.984 -3.105  -6.155  1.00 0.00 ? 27  THR A HG22   4  
ATOM   7037  H HG23   . THR C 2 27 ? -13.013 -2.174  -7.246  1.00 0.00 ? 27  THR A HG23   4  
ATOM   7038  N N      . CYS C 2 28 ? -16.342 -0.546  -3.811  1.00 0.00 ? 28  CYS A N      4  
ATOM   7039  C CA     . CYS C 2 28 ? -16.866 0.247   -2.656  1.00 0.00 ? 28  CYS A CA     4  
ATOM   7040  C C      . CYS C 2 28 ? -17.142 -0.636  -1.436  1.00 0.00 ? 28  CYS A C      4  
ATOM   7041  O O      . CYS C 2 28 ? -17.697 -1.711  -1.545  1.00 0.00 ? 28  CYS A O      4  
ATOM   7042  C CB     . CYS C 2 28 ? -18.173 0.856   -3.165  1.00 0.00 ? 28  CYS A CB     4  
ATOM   7043  S SG     . CYS C 2 28 ? -18.743 2.117   -1.998  1.00 0.00 ? 28  CYS A SG     4  
ATOM   7044  H H      . CYS C 2 28 ? -16.660 -0.341  -4.712  1.00 0.00 ? 28  CYS A H      4  
ATOM   7045  H HA     . CYS C 2 28 ? -16.179 1.034   -2.402  1.00 0.00 ? 28  CYS A HA     4  
ATOM   7046  H HB2    . CYS C 2 28 ? -18.006 1.305   -4.131  1.00 0.00 ? 28  CYS A HB2    4  
ATOM   7047  H HB3    . CYS C 2 28 ? -18.920 0.081   -3.252  1.00 0.00 ? 28  CYS A HB3    4  
ATOM   7048  H HG     . CYS C 2 28 ? -18.938 2.914   -2.496  1.00 0.00 ? 28  CYS A HG     4  
ATOM   7049  N N      . GLY C 2 29 ? -16.767 -0.177  -0.270  1.00 0.00 ? 29  GLY A N      4  
ATOM   7050  C CA     . GLY C 2 29 ? -17.018 -0.979  0.965   1.00 0.00 ? 29  GLY A CA     4  
ATOM   7051  C C      . GLY C 2 29 ? -15.748 -1.730  1.380   1.00 0.00 ? 29  GLY A C      4  
ATOM   7052  O O      . GLY C 2 29 ? -15.682 -2.299  2.451   1.00 0.00 ? 29  GLY A O      4  
ATOM   7053  H H      . GLY C 2 29 ? -16.328 0.701   -0.208  1.00 0.00 ? 29  GLY A H      4  
ATOM   7054  H HA2    . GLY C 2 29 ? -17.319 -0.317  1.764   1.00 0.00 ? 29  GLY A HA2    4  
ATOM   7055  H HA3    . GLY C 2 29 ? -17.804 -1.692  0.773   1.00 0.00 ? 29  GLY A HA3    4  
ATOM   7056  N N      . ARG C 2 30 ? -14.741 -1.738  0.548   1.00 0.00 ? 30  ARG A N      4  
ATOM   7057  C CA     . ARG C 2 30 ? -13.482 -2.455  0.907   1.00 0.00 ? 30  ARG A CA     4  
ATOM   7058  C C      . ARG C 2 30 ? -12.516 -1.495  1.605   1.00 0.00 ? 30  ARG A C      4  
ATOM   7059  O O      . ARG C 2 30 ? -12.322 -0.375  1.173   1.00 0.00 ? 30  ARG A O      4  
ATOM   7060  C CB     . ARG C 2 30 ? -12.899 -2.934  -0.424  1.00 0.00 ? 30  ARG A CB     4  
ATOM   7061  C CG     . ARG C 2 30 ? -13.273 -4.400  -0.653  1.00 0.00 ? 30  ARG A CG     4  
ATOM   7062  C CD     . ARG C 2 30 ? -12.259 -5.046  -1.599  1.00 0.00 ? 30  ARG A CD     4  
ATOM   7063  N NE     . ARG C 2 30 ? -10.948 -4.928  -0.902  1.00 0.00 ? 30  ARG A NE     4  
ATOM   7064  C CZ     . ARG C 2 30 ? -10.594 -5.826  -0.024  1.00 0.00 ? 30  ARG A CZ     4  
ATOM   7065  N NH1    . ARG C 2 30 ? -10.504 -7.081  -0.372  1.00 0.00 ? 30  ARG A NH1    4  
ATOM   7066  N NH2    . ARG C 2 30 ? -10.327 -5.470  1.203   1.00 0.00 ? 30  ARG A NH2    4  
ATOM   7067  H H      . ARG C 2 30 ? -14.811 -1.273  -0.309  1.00 0.00 ? 30  ARG A H      4  
ATOM   7068  H HA     . ARG C 2 30 ? -13.699 -3.300  1.542   1.00 0.00 ? 30  ARG A HA     4  
ATOM   7069  H HB2    . ARG C 2 30 ? -13.298 -2.334  -1.228  1.00 0.00 ? 30  ARG A HB2    4  
ATOM   7070  H HB3    . ARG C 2 30 ? -11.824 -2.838  -0.401  1.00 0.00 ? 30  ARG A HB3    4  
ATOM   7071  H HG2    . ARG C 2 30 ? -13.271 -4.923  0.292   1.00 0.00 ? 30  ARG A HG2    4  
ATOM   7072  H HG3    . ARG C 2 30 ? -14.257 -4.455  -1.092  1.00 0.00 ? 30  ARG A HG3    4  
ATOM   7073  H HD2    . ARG C 2 30 ? -12.509 -6.085  -1.763  1.00 0.00 ? 30  ARG A HD2    4  
ATOM   7074  H HD3    . ARG C 2 30 ? -12.227 -4.513  -2.537  1.00 0.00 ? 30  ARG A HD3    4  
ATOM   7075  H HE     . ARG C 2 30 ? -10.353 -4.177  -1.101  1.00 0.00 ? 30  ARG A HE     4  
ATOM   7076  H HH11   . ARG C 2 30 ? -10.709 -7.355  -1.312  1.00 0.00 ? 30  ARG A HH11   4  
ATOM   7077  H HH12   . ARG C 2 30 ? -10.231 -7.768  0.301   1.00 0.00 ? 30  ARG A HH12   4  
ATOM   7078  H HH21   . ARG C 2 30 ? -10.396 -4.508  1.470   1.00 0.00 ? 30  ARG A HH21   4  
ATOM   7079  H HH22   . ARG C 2 30 ? -10.055 -6.157  1.875   1.00 0.00 ? 30  ARG A HH22   4  
ATOM   7080  N N      . SER C 2 31 ? -11.911 -1.922  2.681   1.00 0.00 ? 31  SER A N      4  
ATOM   7081  C CA     . SER C 2 31 ? -10.961 -1.028  3.405   1.00 0.00 ? 31  SER A CA     4  
ATOM   7082  C C      . SER C 2 31 ? -9.516  -1.372  3.037   1.00 0.00 ? 31  SER A C      4  
ATOM   7083  O O      . SER C 2 31 ? -9.112  -2.519  3.069   1.00 0.00 ? 31  SER A O      4  
ATOM   7084  C CB     . SER C 2 31 ? -11.214 -1.294  4.890   1.00 0.00 ? 31  SER A CB     4  
ATOM   7085  O OG     . SER C 2 31 ? -10.885 -2.644  5.187   1.00 0.00 ? 31  SER A OG     4  
ATOM   7086  H H      . SER C 2 31 ? -12.084 -2.827  3.015   1.00 0.00 ? 31  SER A H      4  
ATOM   7087  H HA     . SER C 2 31 ? -11.172 0.004   3.176   1.00 0.00 ? 31  SER A HA     4  
ATOM   7088  H HB2    . SER C 2 31 ? -10.598 -0.639  5.485   1.00 0.00 ? 31  SER A HB2    4  
ATOM   7089  H HB3    . SER C 2 31 ? -12.256 -1.108  5.116   1.00 0.00 ? 31  SER A HB3    4  
ATOM   7090  H HG     . SER C 2 31 ? -11.627 -3.194  4.929   1.00 0.00 ? 31  SER A HG     4  
ATOM   7091  N N      . ASP C 2 32 ? -8.735  -0.383  2.689   1.00 0.00 ? 32  ASP A N      4  
ATOM   7092  C CA     . ASP C 2 32 ? -7.313  -0.641  2.319   1.00 0.00 ? 32  ASP A CA     4  
ATOM   7093  C C      . ASP C 2 32 ? -6.383  0.190   3.205   1.00 0.00 ? 32  ASP A C      4  
ATOM   7094  O O      . ASP C 2 32 ? -6.609  1.362   3.429   1.00 0.00 ? 32  ASP A O      4  
ATOM   7095  C CB     . ASP C 2 32 ? -7.198  -0.206  0.858   1.00 0.00 ? 32  ASP A CB     4  
ATOM   7096  C CG     . ASP C 2 32 ? -7.686  -1.333  -0.055  1.00 0.00 ? 32  ASP A CG     4  
ATOM   7097  O OD1    . ASP C 2 32 ? -7.623  -2.479  0.359   1.00 0.00 ? 32  ASP A OD1    4  
ATOM   7098  O OD2    . ASP C 2 32 ? -8.118  -1.031  -1.156  1.00 0.00 ? 32  ASP A OD2    4  
ATOM   7099  H H      . ASP C 2 32 ? -9.085  0.532   2.673   1.00 0.00 ? 32  ASP A H      4  
ATOM   7100  H HA     . ASP C 2 32 ? -7.081  -1.688  2.412   1.00 0.00 ? 32  ASP A HA     4  
ATOM   7101  H HB2    . ASP C 2 32 ? -7.801  0.675   0.697   1.00 0.00 ? 32  ASP A HB2    4  
ATOM   7102  H HB3    . ASP C 2 32 ? -6.166  0.016   0.629   1.00 0.00 ? 32  ASP A HB3    4  
ATOM   7103  N N      . THR C 2 33 ? -5.338  -0.409  3.711   1.00 0.00 ? 33  THR A N      4  
ATOM   7104  C CA     . THR C 2 33 ? -4.397  0.347   4.585   1.00 0.00 ? 33  THR A CA     4  
ATOM   7105  C C      . THR C 2 33 ? -3.168  0.785   3.786   1.00 0.00 ? 33  THR A C      4  
ATOM   7106  O O      . THR C 2 33 ? -2.476  -0.022  3.196   1.00 0.00 ? 33  THR A O      4  
ATOM   7107  C CB     . THR C 2 33 ? -4.000  -0.638  5.686   1.00 0.00 ? 33  THR A CB     4  
ATOM   7108  O OG1    . THR C 2 33 ? -5.173  -1.194  6.265   1.00 0.00 ? 33  THR A OG1    4  
ATOM   7109  C CG2    . THR C 2 33 ? -3.195  0.093   6.760   1.00 0.00 ? 33  THR A CG2    4  
ATOM   7110  H H      . THR C 2 33 ? -5.175  -1.357  3.520   1.00 0.00 ? 33  THR A H      4  
ATOM   7111  H HA     . THR C 2 33 ? -4.890  1.203   5.018   1.00 0.00 ? 33  THR A HA     4  
ATOM   7112  H HB     . THR C 2 33 ? -3.398  -1.426  5.263   1.00 0.00 ? 33  THR A HB     4  
ATOM   7113  H HG1    . THR C 2 33 ? -5.748  -0.470  6.524   1.00 0.00 ? 33  THR A HG1    4  
ATOM   7114  H HG21   . THR C 2 33 ? -2.437  0.702   6.291   1.00 0.00 ? 33  THR A HG21   4  
ATOM   7115  H HG22   . THR C 2 33 ? -2.724  -0.629  7.412   1.00 0.00 ? 33  THR A HG22   4  
ATOM   7116  H HG23   . THR C 2 33 ? -3.854  0.723   7.339   1.00 0.00 ? 33  THR A HG23   4  
ATOM   7117  N N      . TYR C 2 34 ? -2.894  2.062   3.765   1.00 0.00 ? 34  TYR A N      4  
ATOM   7118  C CA     . TYR C 2 34 ? -1.712  2.566   3.011   1.00 0.00 ? 34  TYR A CA     4  
ATOM   7119  C C      . TYR C 2 34 ? -0.651  3.065   3.995   1.00 0.00 ? 34  TYR A C      4  
ATOM   7120  O O      . TYR C 2 34 ? -0.952  3.386   5.127   1.00 0.00 ? 34  TYR A O      4  
ATOM   7121  C CB     . TYR C 2 34 ? -2.252  3.716   2.163   1.00 0.00 ? 34  TYR A CB     4  
ATOM   7122  C CG     . TYR C 2 34 ? -3.085  3.156   1.035   1.00 0.00 ? 34  TYR A CG     4  
ATOM   7123  C CD1    . TYR C 2 34 ? -4.422  2.796   1.256   1.00 0.00 ? 34  TYR A CD1    4  
ATOM   7124  C CD2    . TYR C 2 34 ? -2.519  2.998   -0.234  1.00 0.00 ? 34  TYR A CD2    4  
ATOM   7125  C CE1    . TYR C 2 34 ? -5.188  2.278   0.207   1.00 0.00 ? 34  TYR A CE1    4  
ATOM   7126  C CE2    . TYR C 2 34 ? -3.286  2.479   -1.283  1.00 0.00 ? 34  TYR A CE2    4  
ATOM   7127  C CZ     . TYR C 2 34 ? -4.620  2.118   -1.062  1.00 0.00 ? 34  TYR A CZ     4  
ATOM   7128  O OH     . TYR C 2 34 ? -5.375  1.605   -2.097  1.00 0.00 ? 34  TYR A OH     4  
ATOM   7129  H H      . TYR C 2 34 ? -3.466  2.691   4.251   1.00 0.00 ? 34  TYR A H      4  
ATOM   7130  H HA     . TYR C 2 34 ? -1.310  1.792   2.374   1.00 0.00 ? 34  TYR A HA     4  
ATOM   7131  H HB2    . TYR C 2 34 ? -2.863  4.363   2.778   1.00 0.00 ? 34  TYR A HB2    4  
ATOM   7132  H HB3    . TYR C 2 34 ? -1.425  4.279   1.752   1.00 0.00 ? 34  TYR A HB3    4  
ATOM   7133  H HD1    . TYR C 2 34 ? -4.863  2.915   2.235   1.00 0.00 ? 34  TYR A HD1    4  
ATOM   7134  H HD2    . TYR C 2 34 ? -1.490  3.276   -0.405  1.00 0.00 ? 34  TYR A HD2    4  
ATOM   7135  H HE1    . TYR C 2 34 ? -6.216  2.001   0.375   1.00 0.00 ? 34  TYR A HE1    4  
ATOM   7136  H HE2    . TYR C 2 34 ? -2.848  2.357   -2.262  1.00 0.00 ? 34  TYR A HE2    4  
ATOM   7137  H HH     . TYR C 2 34 ? -5.711  0.749   -1.822  1.00 0.00 ? 34  TYR A HH     4  
ATOM   7138  N N      . TYR C 2 35 ? 0.587   3.125   3.582   1.00 0.00 ? 35  TYR A N      4  
ATOM   7139  C CA     . TYR C 2 35 ? 1.652   3.597   4.518   1.00 0.00 ? 35  TYR A CA     4  
ATOM   7140  C C      . TYR C 2 35 ? 2.659   4.490   3.788   1.00 0.00 ? 35  TYR A C      4  
ATOM   7141  O O      . TYR C 2 35 ? 2.983   4.268   2.639   1.00 0.00 ? 35  TYR A O      4  
ATOM   7142  C CB     . TYR C 2 35 ? 2.362   2.334   5.026   1.00 0.00 ? 35  TYR A CB     4  
ATOM   7143  C CG     . TYR C 2 35 ? 1.391   1.180   5.142   1.00 0.00 ? 35  TYR A CG     4  
ATOM   7144  C CD1    . TYR C 2 35 ? 1.107   0.390   4.022   1.00 0.00 ? 35  TYR A CD1    4  
ATOM   7145  C CD2    . TYR C 2 35 ? 0.783   0.897   6.370   1.00 0.00 ? 35  TYR A CD2    4  
ATOM   7146  C CE1    . TYR C 2 35 ? 0.216   -0.684  4.129   1.00 0.00 ? 35  TYR A CE1    4  
ATOM   7147  C CE2    . TYR C 2 35 ? -0.110  -0.177  6.478   1.00 0.00 ? 35  TYR A CE2    4  
ATOM   7148  C CZ     . TYR C 2 35 ? -0.393  -0.968  5.357   1.00 0.00 ? 35  TYR A CZ     4  
ATOM   7149  O OH     . TYR C 2 35 ? -1.271  -2.030  5.460   1.00 0.00 ? 35  TYR A OH     4  
ATOM   7150  H H      . TYR C 2 35 ? 0.817   2.856   2.669   1.00 0.00 ? 35  TYR A H      4  
ATOM   7151  H HA     . TYR C 2 35 ? 1.214   4.128   5.348   1.00 0.00 ? 35  TYR A HA     4  
ATOM   7152  H HB2    . TYR C 2 35 ? 3.148   2.067   4.335   1.00 0.00 ? 35  TYR A HB2    4  
ATOM   7153  H HB3    . TYR C 2 35 ? 2.795   2.534   5.994   1.00 0.00 ? 35  TYR A HB3    4  
ATOM   7154  H HD1    . TYR C 2 35 ? 1.576   0.610   3.074   1.00 0.00 ? 35  TYR A HD1    4  
ATOM   7155  H HD2    . TYR C 2 35 ? 1.001   1.506   7.235   1.00 0.00 ? 35  TYR A HD2    4  
ATOM   7156  H HE1    . TYR C 2 35 ? -0.001  -1.293  3.264   1.00 0.00 ? 35  TYR A HE1    4  
ATOM   7157  H HE2    . TYR C 2 35 ? -0.579  -0.395  7.425   1.00 0.00 ? 35  TYR A HE2    4  
ATOM   7158  H HH     . TYR C 2 35 ? -1.759  -1.936  6.282   1.00 0.00 ? 35  TYR A HH     4  
ATOM   7159  N N      . GLN C 2 36 ? 3.173   5.482   4.464   1.00 0.00 ? 36  GLN A N      4  
ATOM   7160  C CA     . GLN C 2 36 ? 4.186   6.374   3.832   1.00 0.00 ? 36  GLN A CA     4  
ATOM   7161  C C      . GLN C 2 36 ? 5.542   6.114   4.488   1.00 0.00 ? 36  GLN A C      4  
ATOM   7162  O O      . GLN C 2 36 ? 5.628   5.898   5.681   1.00 0.00 ? 36  GLN A O      4  
ATOM   7163  C CB     . GLN C 2 36 ? 3.712   7.801   4.119   1.00 0.00 ? 36  GLN A CB     4  
ATOM   7164  C CG     . GLN C 2 36 ? 4.696   8.807   3.506   1.00 0.00 ? 36  GLN A CG     4  
ATOM   7165  C CD     . GLN C 2 36 ? 4.599   10.137  4.257   1.00 0.00 ? 36  GLN A CD     4  
ATOM   7166  O OE1    . GLN C 2 36 ? 5.600   10.767  4.532   1.00 0.00 ? 36  GLN A OE1    4  
ATOM   7167  N NE2    . GLN C 2 36 ? 3.426   10.594  4.602   1.00 0.00 ? 36  GLN A NE2    4  
ATOM   7168  H H      . GLN C 2 36 ? 2.909   5.626   5.396   1.00 0.00 ? 36  GLN A H      4  
ATOM   7169  H HA     . GLN C 2 36 ? 4.237   6.201   2.769   1.00 0.00 ? 36  GLN A HA     4  
ATOM   7170  H HB2    . GLN C 2 36 ? 2.733   7.948   3.688   1.00 0.00 ? 36  GLN A HB2    4  
ATOM   7171  H HB3    . GLN C 2 36 ? 3.662   7.956   5.186   1.00 0.00 ? 36  GLN A HB3    4  
ATOM   7172  H HG2    . GLN C 2 36 ? 5.704   8.423   3.582   1.00 0.00 ? 36  GLN A HG2    4  
ATOM   7173  H HG3    . GLN C 2 36 ? 4.451   8.966   2.466   1.00 0.00 ? 36  GLN A HG3    4  
ATOM   7174  H HE21   . GLN C 2 36 ? 2.618   10.086  4.380   1.00 0.00 ? 36  GLN A HE21   4  
ATOM   7175  H HE22   . GLN C 2 36 ? 3.354   11.444  5.083   1.00 0.00 ? 36  GLN A HE22   4  
ATOM   7176  N N      . SER C 2 37 ? 6.600   6.122   3.724   1.00 0.00 ? 37  SER A N      4  
ATOM   7177  C CA     . SER C 2 37 ? 7.946   5.865   4.316   1.00 0.00 ? 37  SER A CA     4  
ATOM   7178  C C      . SER C 2 37 ? 8.210   6.833   5.474   1.00 0.00 ? 37  SER A C      4  
ATOM   7179  O O      . SER C 2 37 ? 7.355   7.622   5.824   1.00 0.00 ? 37  SER A O      4  
ATOM   7180  C CB     . SER C 2 37 ? 8.927   6.096   3.176   1.00 0.00 ? 37  SER A CB     4  
ATOM   7181  O OG     . SER C 2 37 ? 9.233   7.482   3.083   1.00 0.00 ? 37  SER A OG     4  
ATOM   7182  H H      . SER C 2 37 ? 6.509   6.291   2.763   1.00 0.00 ? 37  SER A H      4  
ATOM   7183  H HA     . SER C 2 37 ? 8.015   4.844   4.659   1.00 0.00 ? 37  SER A HA     4  
ATOM   7184  H HB2    . SER C 2 37 ? 9.831   5.544   3.360   1.00 0.00 ? 37  SER A HB2    4  
ATOM   7185  H HB3    . SER C 2 37 ? 8.480   5.752   2.256   1.00 0.00 ? 37  SER A HB3    4  
ATOM   7186  H HG     . SER C 2 37 ? 8.424   7.950   2.861   1.00 0.00 ? 37  SER A HG     4  
ATOM   7187  N N      . PRO C 2 38 ? 9.382   6.737   6.048   1.00 0.00 ? 38  PRO A N      4  
ATOM   7188  C CA     . PRO C 2 38 ? 9.722   7.608   7.180   1.00 0.00 ? 38  PRO A CA     4  
ATOM   7189  C C      . PRO C 2 38 ? 10.258  8.959   6.711   1.00 0.00 ? 38  PRO A C      4  
ATOM   7190  O O      . PRO C 2 38 ? 10.460  9.852   7.512   1.00 0.00 ? 38  PRO A O      4  
ATOM   7191  C CB     . PRO C 2 38 ? 10.794  6.825   7.923   1.00 0.00 ? 38  PRO A CB     4  
ATOM   7192  C CG     . PRO C 2 38 ? 11.418  5.922   6.903   1.00 0.00 ? 38  PRO A CG     4  
ATOM   7193  C CD     . PRO C 2 38 ? 10.484  5.831   5.714   1.00 0.00 ? 38  PRO A CD     4  
ATOM   7194  H HA     . PRO C 2 38 ? 8.871   7.743   7.809   1.00 0.00 ? 38  PRO A HA     4  
ATOM   7195  H HB2    . PRO C 2 38 ? 11.534  7.500   8.330   1.00 0.00 ? 38  PRO A HB2    4  
ATOM   7196  H HB3    . PRO C 2 38 ? 10.350  6.236   8.710   1.00 0.00 ? 38  PRO A HB3    4  
ATOM   7197  H HG2    . PRO C 2 38 ? 12.369  6.330   6.594   1.00 0.00 ? 38  PRO A HG2    4  
ATOM   7198  H HG3    . PRO C 2 38 ? 11.560  4.942   7.328   1.00 0.00 ? 38  PRO A HG3    4  
ATOM   7199  H HD2    . PRO C 2 38 ? 10.987  6.160   4.816   1.00 0.00 ? 38  PRO A HD2    4  
ATOM   7200  H HD3    . PRO C 2 38 ? 10.116  4.826   5.595   1.00 0.00 ? 38  PRO A HD3    4  
ATOM   7201  N N      . THR C 2 39 ? 10.500  9.135   5.437   1.00 0.00 ? 39  THR A N      4  
ATOM   7202  C CA     . THR C 2 39 ? 11.029  10.455  4.993   1.00 0.00 ? 39  THR A CA     4  
ATOM   7203  C C      . THR C 2 39 ? 10.938  10.637  3.471   1.00 0.00 ? 39  THR A C      4  
ATOM   7204  O O      . THR C 2 39 ? 11.870  11.094  2.838   1.00 0.00 ? 39  THR A O      4  
ATOM   7205  C CB     . THR C 2 39 ? 12.482  10.458  5.472   1.00 0.00 ? 39  THR A CB     4  
ATOM   7206  O OG1    . THR C 2 39 ? 13.066  11.725  5.201   1.00 0.00 ? 39  THR A OG1    4  
ATOM   7207  C CG2    . THR C 2 39 ? 13.273  9.363   4.752   1.00 0.00 ? 39  THR A CG2    4  
ATOM   7208  H H      . THR C 2 39 ? 10.343  8.412   4.788   1.00 0.00 ? 39  THR A H      4  
ATOM   7209  H HA     . THR C 2 39 ? 10.491  11.249  5.486   1.00 0.00 ? 39  THR A HA     4  
ATOM   7210  H HB     . THR C 2 39 ? 12.501  10.270  6.539   1.00 0.00 ? 39  THR A HB     4  
ATOM   7211  H HG1    . THR C 2 39 ? 12.971  11.901  4.263   1.00 0.00 ? 39  THR A HG1    4  
ATOM   7212  H HG21   . THR C 2 39 ? 13.630  8.645   5.475   1.00 0.00 ? 39  THR A HG21   4  
ATOM   7213  H HG22   . THR C 2 39 ? 14.114  9.805   4.239   1.00 0.00 ? 39  THR A HG22   4  
ATOM   7214  H HG23   . THR C 2 39 ? 12.635  8.866   4.036   1.00 0.00 ? 39  THR A HG23   4  
ATOM   7215  N N      . GLY C 2 40 ? 9.811   10.326  2.883   1.00 0.00 ? 40  GLY A N      4  
ATOM   7216  C CA     . GLY C 2 40 ? 9.655   10.531  1.411   1.00 0.00 ? 40  GLY A CA     4  
ATOM   7217  C C      . GLY C 2 40 ? 9.687   9.203   0.649   1.00 0.00 ? 40  GLY A C      4  
ATOM   7218  O O      . GLY C 2 40 ? 10.729  8.742   0.225   1.00 0.00 ? 40  GLY A O      4  
ATOM   7219  H H      . GLY C 2 40 ? 9.058   9.988   3.413   1.00 0.00 ? 40  GLY A H      4  
ATOM   7220  H HA2    . GLY C 2 40 ? 8.707   11.016  1.227   1.00 0.00 ? 40  GLY A HA2    4  
ATOM   7221  H HA3    . GLY C 2 40 ? 10.455  11.164  1.055   1.00 0.00 ? 40  GLY A HA3    4  
ATOM   7222  N N      . ASP C 2 41 ? 8.538   8.612   0.449   1.00 0.00 ? 41  ASP A N      4  
ATOM   7223  C CA     . ASP C 2 41 ? 8.433   7.324   -0.313  1.00 0.00 ? 41  ASP A CA     4  
ATOM   7224  C C      . ASP C 2 41 ? 7.047   6.720   -0.067  1.00 0.00 ? 41  ASP A C      4  
ATOM   7225  O O      . ASP C 2 41 ? 6.713   6.347   1.041   1.00 0.00 ? 41  ASP A O      4  
ATOM   7226  C CB     . ASP C 2 41 ? 9.534   6.396   0.218   1.00 0.00 ? 41  ASP A CB     4  
ATOM   7227  C CG     . ASP C 2 41 ? 10.608  6.209   -0.857  1.00 0.00 ? 41  ASP A CG     4  
ATOM   7228  O OD1    . ASP C 2 41 ? 10.292  5.635   -1.887  1.00 0.00 ? 41  ASP A OD1    4  
ATOM   7229  O OD2    . ASP C 2 41 ? 11.726  6.642   -0.632  1.00 0.00 ? 41  ASP A OD2    4  
ATOM   7230  H H      . ASP C 2 41 ? 7.721   9.033   0.788   1.00 0.00 ? 41  ASP A H      4  
ATOM   7231  H HA     . ASP C 2 41 ? 8.576   7.505   -1.368  1.00 0.00 ? 41  ASP A HA     4  
ATOM   7232  H HB2    . ASP C 2 41 ? 9.981   6.830   1.099   1.00 0.00 ? 41  ASP A HB2    4  
ATOM   7233  H HB3    . ASP C 2 41 ? 9.108   5.435   0.464   1.00 0.00 ? 41  ASP A HB3    4  
ATOM   7234  N N      . ARG C 2 42 ? 6.230   6.648   -1.082  1.00 0.00 ? 42  ARG A N      4  
ATOM   7235  C CA     . ARG C 2 42 ? 4.855   6.098   -0.900  1.00 0.00 ? 42  ARG A CA     4  
ATOM   7236  C C      . ARG C 2 42 ? 4.866   4.568   -0.873  1.00 0.00 ? 42  ARG A C      4  
ATOM   7237  O O      . ARG C 2 42 ? 5.369   3.921   -1.770  1.00 0.00 ? 42  ARG A O      4  
ATOM   7238  C CB     . ARG C 2 42 ? 4.065   6.603   -2.108  1.00 0.00 ? 42  ARG A CB     4  
ATOM   7239  C CG     . ARG C 2 42 ? 2.620   6.889   -1.693  1.00 0.00 ? 42  ARG A CG     4  
ATOM   7240  C CD     . ARG C 2 42 ? 2.583   8.121   -0.786  1.00 0.00 ? 42  ARG A CD     4  
ATOM   7241  N NE     . ARG C 2 42 ? 1.421   8.919   -1.267  1.00 0.00 ? 42  ARG A NE     4  
ATOM   7242  C CZ     . ARG C 2 42 ? 1.411   10.214  -1.111  1.00 0.00 ? 42  ARG A CZ     4  
ATOM   7243  N NH1    . ARG C 2 42 ? 1.042   10.732  0.028   1.00 0.00 ? 42  ARG A NH1    4  
ATOM   7244  N NH2    . ARG C 2 42 ? 1.767   10.992  -2.097  1.00 0.00 ? 42  ARG A NH2    4  
ATOM   7245  H H      . ARG C 2 42 ? 6.515   6.975   -1.962  1.00 0.00 ? 42  ARG A H      4  
ATOM   7246  H HA     . ARG C 2 42 ? 4.417   6.484   0.007   1.00 0.00 ? 42  ARG A HA     4  
ATOM   7247  H HB2    . ARG C 2 42 ? 4.520   7.511   -2.480  1.00 0.00 ? 42  ARG A HB2    4  
ATOM   7248  H HB3    . ARG C 2 42 ? 4.073   5.853   -2.883  1.00 0.00 ? 42  ARG A HB3    4  
ATOM   7249  H HG2    . ARG C 2 42 ? 2.022   7.071   -2.573  1.00 0.00 ? 42  ARG A HG2    4  
ATOM   7250  H HG3    . ARG C 2 42 ? 2.225   6.039   -1.157  1.00 0.00 ? 42  ARG A HG3    4  
ATOM   7251  H HD2    . ARG C 2 42 ? 2.438   7.824   0.244   1.00 0.00 ? 42  ARG A HD2    4  
ATOM   7252  H HD3    . ARG C 2 42 ? 3.493   8.693   -0.889  1.00 0.00 ? 42  ARG A HD3    4  
ATOM   7253  H HE     . ARG C 2 42 ? 0.666   8.471   -1.701  1.00 0.00 ? 42  ARG A HE     4  
ATOM   7254  H HH11   . ARG C 2 42 ? 0.767   10.136  0.782   1.00 0.00 ? 42  ARG A HH11   4  
ATOM   7255  H HH12   . ARG C 2 42 ? 1.035   11.725  0.148   1.00 0.00 ? 42  ARG A HH12   4  
ATOM   7256  H HH21   . ARG C 2 42 ? 2.047   10.595  -2.971  1.00 0.00 ? 42  ARG A HH21   4  
ATOM   7257  H HH22   . ARG C 2 42 ? 1.760   11.985  -1.978  1.00 0.00 ? 42  ARG A HH22   4  
ATOM   7258  N N      . ILE C 2 43 ? 4.294   3.990   0.151   1.00 0.00 ? 43  ILE A N      4  
ATOM   7259  C CA     . ILE C 2 43 ? 4.241   2.502   0.253   1.00 0.00 ? 43  ILE A CA     4  
ATOM   7260  C C      . ILE C 2 43 ? 2.777   2.055   0.249   1.00 0.00 ? 43  ILE A C      4  
ATOM   7261  O O      . ILE C 2 43 ? 1.905   2.771   0.702   1.00 0.00 ? 43  ILE A O      4  
ATOM   7262  C CB     . ILE C 2 43 ? 4.906   2.161   1.590   1.00 0.00 ? 43  ILE A CB     4  
ATOM   7263  C CG1    . ILE C 2 43 ? 6.279   2.848   1.687   1.00 0.00 ? 43  ILE A CG1    4  
ATOM   7264  C CG2    . ILE C 2 43 ? 5.082   0.647   1.698   1.00 0.00 ? 43  ILE A CG2    4  
ATOM   7265  C CD1    . ILE C 2 43 ? 7.159   2.443   0.500   1.00 0.00 ? 43  ILE A CD1    4  
ATOM   7266  H H      . ILE C 2 43 ? 3.887   4.540   0.852   1.00 0.00 ? 43  ILE A H      4  
ATOM   7267  H HA     . ILE C 2 43 ? 4.779   2.043   -0.561  1.00 0.00 ? 43  ILE A HA     4  
ATOM   7268  H HB     . ILE C 2 43 ? 4.276   2.503   2.398   1.00 0.00 ? 43  ILE A HB     4  
ATOM   7269  H HG12   . ILE C 2 43 ? 6.143   3.920   1.682   1.00 0.00 ? 43  ILE A HG12   4  
ATOM   7270  H HG13   . ILE C 2 43 ? 6.762   2.553   2.605   1.00 0.00 ? 43  ILE A HG13   4  
ATOM   7271  H HG21   . ILE C 2 43 ? 5.095   0.359   2.738   1.00 0.00 ? 43  ILE A HG21   4  
ATOM   7272  H HG22   . ILE C 2 43 ? 6.012   0.356   1.231   1.00 0.00 ? 43  ILE A HG22   4  
ATOM   7273  H HG23   . ILE C 2 43 ? 4.260   0.153   1.200   1.00 0.00 ? 43  ILE A HG23   4  
ATOM   7274  H HD11   . ILE C 2 43 ? 8.086   2.999   0.535   1.00 0.00 ? 43  ILE A HD11   4  
ATOM   7275  H HD12   . ILE C 2 43 ? 6.644   2.663   -0.423  1.00 0.00 ? 43  ILE A HD12   4  
ATOM   7276  H HD13   . ILE C 2 43 ? 7.371   1.386   0.552   1.00 0.00 ? 43  ILE A HD13   4  
ATOM   7277  N N      . ARG C 2 44 ? 2.490   0.889   -0.269  1.00 0.00 ? 44  ARG A N      4  
ATOM   7278  C CA     . ARG C 2 44 ? 1.068   0.431   -0.307  1.00 0.00 ? 44  ARG A CA     4  
ATOM   7279  C C      . ARG C 2 44 ? 0.894   -0.914  0.408   1.00 0.00 ? 44  ARG A C      4  
ATOM   7280  O O      . ARG C 2 44 ? -0.195  -1.262  0.819   1.00 0.00 ? 44  ARG A O      4  
ATOM   7281  C CB     . ARG C 2 44 ? 0.733   0.289   -1.794  1.00 0.00 ? 44  ARG A CB     4  
ATOM   7282  C CG     . ARG C 2 44 ? 1.027   1.604   -2.523  1.00 0.00 ? 44  ARG A CG     4  
ATOM   7283  C CD     . ARG C 2 44 ? -0.270  2.178   -3.102  1.00 0.00 ? 44  ARG A CD     4  
ATOM   7284  N NE     . ARG C 2 44 ? -0.327  3.579   -2.598  1.00 0.00 ? 44  ARG A NE     4  
ATOM   7285  C CZ     . ARG C 2 44 ? -0.866  4.514   -3.329  1.00 0.00 ? 44  ARG A CZ     4  
ATOM   7286  N NH1    . ARG C 2 44 ? -0.571  4.605   -4.597  1.00 0.00 ? 44  ARG A NH1    4  
ATOM   7287  N NH2    . ARG C 2 44 ? -1.703  5.361   -2.793  1.00 0.00 ? 44  ARG A NH2    4  
ATOM   7288  H H      . ARG C 2 44 ? 3.200   0.326   -0.643  1.00 0.00 ? 44  ARG A H      4  
ATOM   7289  H HA     . ARG C 2 44 ? 0.427   1.174   0.139   1.00 0.00 ? 44  ARG A HA     4  
ATOM   7290  H HB2    . ARG C 2 44 ? 1.331   -0.500  -2.223  1.00 0.00 ? 44  ARG A HB2    4  
ATOM   7291  H HB3    . ARG C 2 44 ? -0.312  0.047   -1.901  1.00 0.00 ? 44  ARG A HB3    4  
ATOM   7292  H HG2    . ARG C 2 44 ? 1.455   2.309   -1.830  1.00 0.00 ? 44  ARG A HG2    4  
ATOM   7293  H HG3    . ARG C 2 44 ? 1.725   1.421   -3.326  1.00 0.00 ? 44  ARG A HG3    4  
ATOM   7294  H HD2    . ARG C 2 44 ? -0.236  2.165   -4.182  1.00 0.00 ? 44  ARG A HD2    4  
ATOM   7295  H HD3    . ARG C 2 44 ? -1.122  1.622   -2.744  1.00 0.00 ? 44  ARG A HD3    4  
ATOM   7296  H HE     . ARG C 2 44 ? 0.043   3.796   -1.717  1.00 0.00 ? 44  ARG A HE     4  
ATOM   7297  H HH11   . ARG C 2 44 ? 0.069   3.957   -5.009  1.00 0.00 ? 44  ARG A HH11   4  
ATOM   7298  H HH12   . ARG C 2 44 ? -0.985  5.323   -5.156  1.00 0.00 ? 44  ARG A HH12   4  
ATOM   7299  H HH21   . ARG C 2 44 ? -1.929  5.291   -1.821  1.00 0.00 ? 44  ARG A HH21   4  
ATOM   7300  H HH22   . ARG C 2 44 ? -2.116  6.079   -3.353  1.00 0.00 ? 44  ARG A HH22   4  
ATOM   7301  N N      . SER C 2 45 ? 1.946   -1.677  0.559   1.00 0.00 ? 45  SER A N      4  
ATOM   7302  C CA     . SER C 2 45 ? 1.809   -2.996  1.248   1.00 0.00 ? 45  SER A CA     4  
ATOM   7303  C C      . SER C 2 45 ? 3.149   -3.431  1.852   1.00 0.00 ? 45  SER A C      4  
ATOM   7304  O O      . SER C 2 45 ? 3.995   -2.615  2.146   1.00 0.00 ? 45  SER A O      4  
ATOM   7305  C CB     . SER C 2 45 ? 1.359   -3.968  0.157   1.00 0.00 ? 45  SER A CB     4  
ATOM   7306  O OG     . SER C 2 45 ? 0.044   -4.424  0.450   1.00 0.00 ? 45  SER A OG     4  
ATOM   7307  H H      . SER C 2 45 ? 2.818   -1.385  0.221   1.00 0.00 ? 45  SER A H      4  
ATOM   7308  H HA     . SER C 2 45 ? 1.057   -2.938  2.017   1.00 0.00 ? 45  SER A HA     4  
ATOM   7309  H HB2    . SER C 2 45 ? 1.355   -3.469  -0.798  1.00 0.00 ? 45  SER A HB2    4  
ATOM   7310  H HB3    . SER C 2 45 ? 2.039   -4.804  0.118   1.00 0.00 ? 45  SER A HB3    4  
ATOM   7311  H HG     . SER C 2 45 ? 0.118   -5.198  1.014   1.00 0.00 ? 45  SER A HG     4  
ATOM   7312  N N      . LYS C 2 46 ? 3.342   -4.712  2.047   1.00 0.00 ? 46  LYS A N      4  
ATOM   7313  C CA     . LYS C 2 46 ? 4.623   -5.194  2.641   1.00 0.00 ? 46  LYS A CA     4  
ATOM   7314  C C      . LYS C 2 46 ? 5.743   -5.131  1.605   1.00 0.00 ? 46  LYS A C      4  
ATOM   7315  O O      . LYS C 2 46 ? 6.827   -4.658  1.885   1.00 0.00 ? 46  LYS A O      4  
ATOM   7316  C CB     . LYS C 2 46 ? 4.358   -6.639  3.059   1.00 0.00 ? 46  LYS A CB     4  
ATOM   7317  C CG     . LYS C 2 46 ? 5.190   -6.966  4.300   1.00 0.00 ? 46  LYS A CG     4  
ATOM   7318  C CD     . LYS C 2 46 ? 4.938   -8.416  4.718   1.00 0.00 ? 46  LYS A CD     4  
ATOM   7319  C CE     . LYS C 2 46 ? 6.018   -9.313  4.110   1.00 0.00 ? 46  LYS A CE     4  
ATOM   7320  N NZ     . LYS C 2 46 ? 5.773   -10.660 4.695   1.00 0.00 ? 46  LYS A NZ     4  
ATOM   7321  H H      . LYS C 2 46 ? 2.644   -5.356  1.805   1.00 0.00 ? 46  LYS A H      4  
ATOM   7322  H HA     . LYS C 2 46 ? 4.879   -4.603  3.506   1.00 0.00 ? 46  LYS A HA     4  
ATOM   7323  H HB2    . LYS C 2 46 ? 3.307   -6.763  3.282   1.00 0.00 ? 46  LYS A HB2    4  
ATOM   7324  H HB3    . LYS C 2 46 ? 4.637   -7.305  2.255   1.00 0.00 ? 46  LYS A HB3    4  
ATOM   7325  H HG2    . LYS C 2 46 ? 6.239   -6.831  4.075   1.00 0.00 ? 46  LYS A HG2    4  
ATOM   7326  H HG3    . LYS C 2 46 ? 4.907   -6.307  5.107   1.00 0.00 ? 46  LYS A HG3    4  
ATOM   7327  H HD2    . LYS C 2 46 ? 4.970   -8.490  5.796   1.00 0.00 ? 46  LYS A HD2    4  
ATOM   7328  H HD3    . LYS C 2 46 ? 3.969   -8.731  4.363   1.00 0.00 ? 46  LYS A HD3    4  
ATOM   7329  H HE2    . LYS C 2 46 ? 5.917   -9.341  3.033   1.00 0.00 ? 46  LYS A HE2    4  
ATOM   7330  H HE3    . LYS C 2 46 ? 6.999   -8.960  4.388   1.00 0.00 ? 46  LYS A HE3    4  
ATOM   7331  H HZ1    . LYS C 2 46 ? 4.882   -11.044 4.320   1.00 0.00 ? 46  LYS A HZ1    4  
ATOM   7332  H HZ2    . LYS C 2 46 ? 6.559   -11.294 4.443   1.00 0.00 ? 46  LYS A HZ2    4  
ATOM   7333  H HZ3    . LYS C 2 46 ? 5.707   -10.583 5.729   1.00 0.00 ? 46  LYS A HZ3    4  
ATOM   7334  N N      . VAL C 2 47 ? 5.495   -5.595  0.408   1.00 0.00 ? 47  VAL A N      4  
ATOM   7335  C CA     . VAL C 2 47 ? 6.557   -5.543  -0.638  1.00 0.00 ? 47  VAL A CA     4  
ATOM   7336  C C      . VAL C 2 47 ? 7.056   -4.101  -0.773  1.00 0.00 ? 47  VAL A C      4  
ATOM   7337  O O      . VAL C 2 47 ? 8.209   -3.817  -0.529  1.00 0.00 ? 47  VAL A O      4  
ATOM   7338  C CB     . VAL C 2 47 ? 5.871   -6.018  -1.918  1.00 0.00 ? 47  VAL A CB     4  
ATOM   7339  C CG1    . VAL C 2 47 ? 6.598   -5.467  -3.146  1.00 0.00 ? 47  VAL A CG1    4  
ATOM   7340  C CG2    . VAL C 2 47 ? 5.879   -7.547  -1.965  1.00 0.00 ? 47  VAL A CG2    4  
ATOM   7341  H H      . VAL C 2 47 ? 4.611   -5.968  0.193   1.00 0.00 ? 47  VAL A H      4  
ATOM   7342  H HA     . VAL C 2 47 ? 7.371   -6.203  -0.384  1.00 0.00 ? 47  VAL A HA     4  
ATOM   7343  H HB     . VAL C 2 47 ? 4.856   -5.667  -1.917  1.00 0.00 ? 47  VAL A HB     4  
ATOM   7344  H HG11   . VAL C 2 47 ? 7.664   -5.459  -2.961  1.00 0.00 ? 47  VAL A HG11   4  
ATOM   7345  H HG12   . VAL C 2 47 ? 6.260   -4.459  -3.340  1.00 0.00 ? 47  VAL A HG12   4  
ATOM   7346  H HG13   . VAL C 2 47 ? 6.383   -6.090  -4.000  1.00 0.00 ? 47  VAL A HG13   4  
ATOM   7347  H HG21   . VAL C 2 47 ? 6.826   -7.890  -2.357  1.00 0.00 ? 47  VAL A HG21   4  
ATOM   7348  H HG22   . VAL C 2 47 ? 5.079   -7.891  -2.603  1.00 0.00 ? 47  VAL A HG22   4  
ATOM   7349  H HG23   . VAL C 2 47 ? 5.739   -7.938  -0.969  1.00 0.00 ? 47  VAL A HG23   4  
ATOM   7350  N N      . GLU C 2 48 ? 6.188   -3.185  -1.136  1.00 0.00 ? 48  GLU A N      4  
ATOM   7351  C CA     . GLU C 2 48 ? 6.615   -1.756  -1.257  1.00 0.00 ? 48  GLU A CA     4  
ATOM   7352  C C      . GLU C 2 48 ? 7.365   -1.356  0.016   1.00 0.00 ? 48  GLU A C      4  
ATOM   7353  O O      . GLU C 2 48 ? 8.344   -0.631  -0.019  1.00 0.00 ? 48  GLU A O      4  
ATOM   7354  C CB     . GLU C 2 48 ? 5.317   -0.958  -1.407  1.00 0.00 ? 48  GLU A CB     4  
ATOM   7355  C CG     . GLU C 2 48 ? 5.538   0.226   -2.356  1.00 0.00 ? 48  GLU A CG     4  
ATOM   7356  C CD     . GLU C 2 48 ? 5.906   -0.286  -3.750  1.00 0.00 ? 48  GLU A CD     4  
ATOM   7357  O OE1    . GLU C 2 48 ? 7.086   -0.457  -4.005  1.00 0.00 ? 48  GLU A OE1    4  
ATOM   7358  O OE2    . GLU C 2 48 ? 5.001   -0.495  -4.541  1.00 0.00 ? 48  GLU A OE2    4  
ATOM   7359  H H      . GLU C 2 48 ? 5.256   -3.435  -1.310  1.00 0.00 ? 48  GLU A H      4  
ATOM   7360  H HA     . GLU C 2 48 ? 7.240   -1.622  -2.125  1.00 0.00 ? 48  GLU A HA     4  
ATOM   7361  H HB2    . GLU C 2 48 ? 4.546   -1.600  -1.809  1.00 0.00 ? 48  GLU A HB2    4  
ATOM   7362  H HB3    . GLU C 2 48 ? 5.009   -0.590  -0.443  1.00 0.00 ? 48  GLU A HB3    4  
ATOM   7363  H HG2    . GLU C 2 48 ? 4.631   0.810   -2.418  1.00 0.00 ? 48  GLU A HG2    4  
ATOM   7364  H HG3    . GLU C 2 48 ? 6.339   0.844   -1.979  1.00 0.00 ? 48  GLU A HG3    4  
ATOM   7365  N N      . LEU C 2 49 ? 6.933   -1.868  1.139   1.00 0.00 ? 49  LEU A N      4  
ATOM   7366  C CA     . LEU C 2 49 ? 7.638   -1.570  2.416   1.00 0.00 ? 49  LEU A CA     4  
ATOM   7367  C C      . LEU C 2 49 ? 9.028   -2.191  2.340   1.00 0.00 ? 49  LEU A C      4  
ATOM   7368  O O      . LEU C 2 49 ? 10.019  -1.594  2.712   1.00 0.00 ? 49  LEU A O      4  
ATOM   7369  C CB     . LEU C 2 49 ? 6.802   -2.253  3.502   1.00 0.00 ? 49  LEU A CB     4  
ATOM   7370  C CG     . LEU C 2 49 ? 7.012   -1.550  4.842   1.00 0.00 ? 49  LEU A CG     4  
ATOM   7371  C CD1    . LEU C 2 49 ? 6.228   -0.240  4.855   1.00 0.00 ? 49  LEU A CD1    4  
ATOM   7372  C CD2    . LEU C 2 49 ? 6.513   -2.453  5.975   1.00 0.00 ? 49  LEU A CD2    4  
ATOM   7373  H H      . LEU C 2 49 ? 6.164   -2.475  1.135   1.00 0.00 ? 49  LEU A H      4  
ATOM   7374  H HA     . LEU C 2 49 ? 7.695   -0.507  2.587   1.00 0.00 ? 49  LEU A HA     4  
ATOM   7375  H HB2    . LEU C 2 49 ? 5.758   -2.205  3.234   1.00 0.00 ? 49  LEU A HB2    4  
ATOM   7376  H HB3    . LEU C 2 49 ? 7.104   -3.286  3.590   1.00 0.00 ? 49  LEU A HB3    4  
ATOM   7377  H HG     . LEU C 2 49 ? 8.063   -1.344  4.979   1.00 0.00 ? 49  LEU A HG     4  
ATOM   7378  H HD11   . LEU C 2 49 ? 6.579   0.397   4.058   1.00 0.00 ? 49  LEU A HD11   4  
ATOM   7379  H HD12   . LEU C 2 49 ? 6.371   0.257   5.802   1.00 0.00 ? 49  LEU A HD12   4  
ATOM   7380  H HD13   . LEU C 2 49 ? 5.177   -0.448  4.714   1.00 0.00 ? 49  LEU A HD13   4  
ATOM   7381  H HD21   . LEU C 2 49 ? 5.872   -3.223  5.567   1.00 0.00 ? 49  LEU A HD21   4  
ATOM   7382  H HD22   . LEU C 2 49 ? 5.957   -1.863  6.688   1.00 0.00 ? 49  LEU A HD22   4  
ATOM   7383  H HD23   . LEU C 2 49 ? 7.357   -2.913  6.467   1.00 0.00 ? 49  LEU A HD23   4  
ATOM   7384  N N      . THR C 2 50 ? 9.094   -3.390  1.829   1.00 0.00 ? 50  THR A N      4  
ATOM   7385  C CA     . THR C 2 50 ? 10.402  -4.082  1.683   1.00 0.00 ? 50  THR A CA     4  
ATOM   7386  C C      . THR C 2 50 ? 11.271  -3.333  0.662   1.00 0.00 ? 50  THR A C      4  
ATOM   7387  O O      . THR C 2 50 ? 12.479  -3.461  0.653   1.00 0.00 ? 50  THR A O      4  
ATOM   7388  C CB     . THR C 2 50 ? 10.043  -5.485  1.178   1.00 0.00 ? 50  THR A CB     4  
ATOM   7389  O OG1    . THR C 2 50 ? 9.293   -6.163  2.177   1.00 0.00 ? 50  THR A OG1    4  
ATOM   7390  C CG2    . THR C 2 50 ? 11.319  -6.273  0.879   1.00 0.00 ? 50  THR A CG2    4  
ATOM   7391  H H      . THR C 2 50 ? 8.275   -3.833  1.526   1.00 0.00 ? 50  THR A H      4  
ATOM   7392  H HA     . THR C 2 50 ? 10.905  -4.146  2.634   1.00 0.00 ? 50  THR A HA     4  
ATOM   7393  H HB     . THR C 2 50 ? 9.450   -5.408  0.276   1.00 0.00 ? 50  THR A HB     4  
ATOM   7394  H HG1    . THR C 2 50 ? 8.965   -6.981  1.798   1.00 0.00 ? 50  THR A HG1    4  
ATOM   7395  H HG21   . THR C 2 50 ? 11.568  -6.173  -0.166  1.00 0.00 ? 50  THR A HG21   4  
ATOM   7396  H HG22   . THR C 2 50 ? 11.158  -7.316  1.113   1.00 0.00 ? 50  THR A HG22   4  
ATOM   7397  H HG23   . THR C 2 50 ? 12.128  -5.890  1.482   1.00 0.00 ? 50  THR A HG23   4  
ATOM   7398  N N      . ARG C 2 51 ? 10.663  -2.543  -0.192  1.00 0.00 ? 51  ARG A N      4  
ATOM   7399  C CA     . ARG C 2 51 ? 11.462  -1.783  -1.199  1.00 0.00 ? 51  ARG A CA     4  
ATOM   7400  C C      . ARG C 2 51 ? 12.292  -0.711  -0.491  1.00 0.00 ? 51  ARG A C      4  
ATOM   7401  O O      . ARG C 2 51 ? 13.501  -0.666  -0.617  1.00 0.00 ? 51  ARG A O      4  
ATOM   7402  C CB     . ARG C 2 51 ? 10.444  -1.129  -2.136  1.00 0.00 ? 51  ARG A CB     4  
ATOM   7403  C CG     . ARG C 2 51 ? 9.573   -2.202  -2.789  1.00 0.00 ? 51  ARG A CG     4  
ATOM   7404  C CD     . ARG C 2 51 ? 10.441  -3.106  -3.668  1.00 0.00 ? 51  ARG A CD     4  
ATOM   7405  N NE     . ARG C 2 51 ? 9.481   -3.803  -4.568  1.00 0.00 ? 51  ARG A NE     4  
ATOM   7406  C CZ     . ARG C 2 51 ? 8.934   -3.158  -5.562  1.00 0.00 ? 51  ARG A CZ     4  
ATOM   7407  N NH1    . ARG C 2 51 ? 9.686   -2.551  -6.440  1.00 0.00 ? 51  ARG A NH1    4  
ATOM   7408  N NH2    . ARG C 2 51 ? 7.634   -3.119  -5.678  1.00 0.00 ? 51  ARG A NH2    4  
ATOM   7409  H H      . ARG C 2 51 ? 9.689   -2.448  -0.165  1.00 0.00 ? 51  ARG A H      4  
ATOM   7410  H HA     . ARG C 2 51 ? 12.098  -2.454  -1.756  1.00 0.00 ? 51  ARG A HA     4  
ATOM   7411  H HB2    . ARG C 2 51 ? 9.820   -0.452  -1.572  1.00 0.00 ? 51  ARG A HB2    4  
ATOM   7412  H HB3    . ARG C 2 51 ? 10.966  -0.579  -2.904  1.00 0.00 ? 51  ARG A HB3    4  
ATOM   7413  H HG2    . ARG C 2 51 ? 9.098   -2.792  -2.023  1.00 0.00 ? 51  ARG A HG2    4  
ATOM   7414  H HG3    . ARG C 2 51 ? 8.818   -1.730  -3.398  1.00 0.00 ? 51  ARG A HG3    4  
ATOM   7415  H HD2    . ARG C 2 51 ? 11.138  -2.512  -4.243  1.00 0.00 ? 51  ARG A HD2    4  
ATOM   7416  H HD3    . ARG C 2 51 ? 10.969  -3.826  -3.062  1.00 0.00 ? 51  ARG A HD3    4  
ATOM   7417  H HE     . ARG C 2 51 ? 9.261   -4.745  -4.414  1.00 0.00 ? 51  ARG A HE     4  
ATOM   7418  H HH11   . ARG C 2 51 ? 10.681  -2.582  -6.351  1.00 0.00 ? 51  ARG A HH11   4  
ATOM   7419  H HH12   . ARG C 2 51 ? 9.266   -2.058  -7.201  1.00 0.00 ? 51  ARG A HH12   4  
ATOM   7420  H HH21   . ARG C 2 51 ? 7.058   -3.583  -5.005  1.00 0.00 ? 51  ARG A HH21   4  
ATOM   7421  H HH22   . ARG C 2 51 ? 7.215   -2.625  -6.440  1.00 0.00 ? 51  ARG A HH22   4  
ATOM   7422  N N      . TYR C 2 52 ? 11.651  0.149   0.260   1.00 0.00 ? 52  TYR A N      4  
ATOM   7423  C CA     . TYR C 2 52 ? 12.409  1.217   0.985   1.00 0.00 ? 52  TYR A CA     4  
ATOM   7424  C C      . TYR C 2 52 ? 13.473  0.578   1.881   1.00 0.00 ? 52  TYR A C      4  
ATOM   7425  O O      . TYR C 2 52 ? 14.549  1.113   2.062   1.00 0.00 ? 52  TYR A O      4  
ATOM   7426  C CB     . TYR C 2 52 ? 11.364  1.952   1.833   1.00 0.00 ? 52  TYR A CB     4  
ATOM   7427  C CG     . TYR C 2 52 ? 11.987  3.182   2.459   1.00 0.00 ? 52  TYR A CG     4  
ATOM   7428  C CD1    . TYR C 2 52 ? 12.961  3.049   3.457   1.00 0.00 ? 52  TYR A CD1    4  
ATOM   7429  C CD2    . TYR C 2 52 ? 11.589  4.460   2.041   1.00 0.00 ? 52  TYR A CD2    4  
ATOM   7430  C CE1    . TYR C 2 52 ? 13.537  4.188   4.033   1.00 0.00 ? 52  TYR A CE1    4  
ATOM   7431  C CE2    . TYR C 2 52 ? 12.165  5.597   2.618   1.00 0.00 ? 52  TYR A CE2    4  
ATOM   7432  C CZ     . TYR C 2 52 ? 13.138  5.463   3.612   1.00 0.00 ? 52  TYR A CZ     4  
ATOM   7433  O OH     . TYR C 2 52 ? 13.705  6.585   4.181   1.00 0.00 ? 52  TYR A OH     4  
ATOM   7434  H H      . TYR C 2 52 ? 10.674  0.089   0.350   1.00 0.00 ? 52  TYR A H      4  
ATOM   7435  H HA     . TYR C 2 52 ? 12.863  1.899   0.285   1.00 0.00 ? 52  TYR A HA     4  
ATOM   7436  H HB2    . TYR C 2 52 ? 10.536  2.247   1.206   1.00 0.00 ? 52  TYR A HB2    4  
ATOM   7437  H HB3    . TYR C 2 52 ? 11.007  1.295   2.612   1.00 0.00 ? 52  TYR A HB3    4  
ATOM   7438  H HD1    . TYR C 2 52 ? 13.269  2.068   3.784   1.00 0.00 ? 52  TYR A HD1    4  
ATOM   7439  H HD2    . TYR C 2 52 ? 10.837  4.569   1.276   1.00 0.00 ? 52  TYR A HD2    4  
ATOM   7440  H HE1    . TYR C 2 52 ? 14.288  4.084   4.802   1.00 0.00 ? 52  TYR A HE1    4  
ATOM   7441  H HE2    . TYR C 2 52 ? 11.855  6.580   2.293   1.00 0.00 ? 52  TYR A HE2    4  
ATOM   7442  H HH     . TYR C 2 52 ? 13.963  7.178   3.471   1.00 0.00 ? 52  TYR A HH     4  
ATOM   7443  N N      . LEU C 2 53 ? 13.175  -0.564  2.439   1.00 0.00 ? 53  LEU A N      4  
ATOM   7444  C CA     . LEU C 2 53 ? 14.163  -1.248  3.324   1.00 0.00 ? 53  LEU A CA     4  
ATOM   7445  C C      . LEU C 2 53 ? 15.197  -1.997  2.481   1.00 0.00 ? 53  LEU A C      4  
ATOM   7446  O O      . LEU C 2 53 ? 16.295  -2.268  2.927   1.00 0.00 ? 53  LEU A O      4  
ATOM   7447  C CB     . LEU C 2 53 ? 13.336  -2.228  4.159   1.00 0.00 ? 53  LEU A CB     4  
ATOM   7448  C CG     . LEU C 2 53 ? 12.275  -1.459  4.953   1.00 0.00 ? 53  LEU A CG     4  
ATOM   7449  C CD1    . LEU C 2 53 ? 11.038  -2.339  5.142   1.00 0.00 ? 53  LEU A CD1    4  
ATOM   7450  C CD2    . LEU C 2 53 ? 12.841  -1.075  6.322   1.00 0.00 ? 53  LEU A CD2    4  
ATOM   7451  H H      . LEU C 2 53 ? 12.300  -0.974  2.275   1.00 0.00 ? 53  LEU A H      4  
ATOM   7452  H HA     . LEU C 2 53 ? 14.649  -0.534  3.970   1.00 0.00 ? 53  LEU A HA     4  
ATOM   7453  H HB2    . LEU C 2 53 ? 12.851  -2.937  3.504   1.00 0.00 ? 53  LEU A HB2    4  
ATOM   7454  H HB3    . LEU C 2 53 ? 13.983  -2.753  4.843   1.00 0.00 ? 53  LEU A HB3    4  
ATOM   7455  H HG     . LEU C 2 53 ? 11.999  -0.565  4.413   1.00 0.00 ? 53  LEU A HG     4  
ATOM   7456  H HD11   . LEU C 2 53 ? 11.057  -3.147  4.425   1.00 0.00 ? 53  LEU A HD11   4  
ATOM   7457  H HD12   . LEU C 2 53 ? 10.149  -1.745  4.991   1.00 0.00 ? 53  LEU A HD12   4  
ATOM   7458  H HD13   . LEU C 2 53 ? 11.033  -2.746  6.142   1.00 0.00 ? 53  LEU A HD13   4  
ATOM   7459  H HD21   . LEU C 2 53 ? 13.291  -0.094  6.263   1.00 0.00 ? 53  LEU A HD21   4  
ATOM   7460  H HD22   . LEU C 2 53 ? 13.587  -1.796  6.619   1.00 0.00 ? 53  LEU A HD22   4  
ATOM   7461  H HD23   . LEU C 2 53 ? 12.043  -1.060  7.050   1.00 0.00 ? 53  LEU A HD23   4  
ATOM   7462  N N      . GLY C 2 54 ? 14.857  -2.331  1.264   1.00 0.00 ? 54  GLY A N      4  
ATOM   7463  C CA     . GLY C 2 54 ? 15.820  -3.060  0.392   1.00 0.00 ? 54  GLY A CA     4  
ATOM   7464  C C      . GLY C 2 54 ? 15.284  -4.463  0.097   1.00 0.00 ? 54  GLY A C      4  
ATOM   7465  O O      . GLY C 2 54 ? 14.511  -5.003  0.862   1.00 0.00 ? 54  GLY A O      4  
ATOM   7466  H H      . GLY C 2 54 ? 13.968  -2.103  0.922   1.00 0.00 ? 54  GLY A H      4  
ATOM   7467  H HA2    . GLY C 2 54 ? 15.946  -2.518  -0.534  1.00 0.00 ? 54  GLY A HA2    4  
ATOM   7468  H HA3    . GLY C 2 54 ? 16.772  -3.141  0.895   1.00 0.00 ? 54  GLY A HA3    4  
ATOM   7469  N N      . PRO C 2 55 ? 15.718  -5.011  -1.009  1.00 0.00 ? 55  PRO A N      4  
ATOM   7470  C CA     . PRO C 2 55 ? 15.276  -6.371  -1.406  1.00 0.00 ? 55  PRO A CA     4  
ATOM   7471  C C      . PRO C 2 55 ? 15.884  -7.422  -0.471  1.00 0.00 ? 55  PRO A C      4  
ATOM   7472  O O      . PRO C 2 55 ? 15.375  -8.518  -0.340  1.00 0.00 ? 55  PRO A O      4  
ATOM   7473  C CB     . PRO C 2 55 ? 15.811  -6.521  -2.828  1.00 0.00 ? 55  PRO A CB     4  
ATOM   7474  C CG     . PRO C 2 55 ? 16.967  -5.576  -2.904  1.00 0.00 ? 55  PRO A CG     4  
ATOM   7475  C CD     . PRO C 2 55 ? 16.649  -4.428  -1.982  1.00 0.00 ? 55  PRO A CD     4  
ATOM   7476  H HA     . PRO C 2 55 ? 14.201  -6.438  -1.405  1.00 0.00 ? 55  PRO A HA     4  
ATOM   7477  H HB2    . PRO C 2 55 ? 16.140  -7.537  -2.999  1.00 0.00 ? 55  PRO A HB2    4  
ATOM   7478  H HB3    . PRO C 2 55 ? 15.058  -6.241  -3.547  1.00 0.00 ? 55  PRO A HB3    4  
ATOM   7479  H HG2    . PRO C 2 55 ? 17.873  -6.073  -2.583  1.00 0.00 ? 55  PRO A HG2    4  
ATOM   7480  H HG3    . PRO C 2 55 ? 17.081  -5.211  -3.914  1.00 0.00 ? 55  PRO A HG3    4  
ATOM   7481  H HD2    . PRO C 2 55 ? 17.546  -4.077  -1.491  1.00 0.00 ? 55  PRO A HD2    4  
ATOM   7482  H HD3    . PRO C 2 55 ? 16.170  -3.626  -2.520  1.00 0.00 ? 55  PRO A HD3    4  
ATOM   7483  N N      . ALA C 2 56 ? 16.966  -7.091  0.183   1.00 0.00 ? 56  ALA A N      4  
ATOM   7484  C CA     . ALA C 2 56 ? 17.604  -8.064  1.115   1.00 0.00 ? 56  ALA A CA     4  
ATOM   7485  C C      . ALA C 2 56 ? 16.908  -8.021  2.479   1.00 0.00 ? 56  ALA A C      4  
ATOM   7486  O O      . ALA C 2 56 ? 17.012  -8.940  3.268   1.00 0.00 ? 56  ALA A O      4  
ATOM   7487  C CB     . ALA C 2 56 ? 19.055  -7.602  1.237   1.00 0.00 ? 56  ALA A CB     4  
ATOM   7488  H H      . ALA C 2 56 ? 17.357  -6.201  0.065   1.00 0.00 ? 56  ALA A H      4  
ATOM   7489  H HA     . ALA C 2 56 ? 17.567  -9.061  0.703   1.00 0.00 ? 56  ALA A HA     4  
ATOM   7490  H HB1    . ALA C 2 56 ? 19.679  -8.199  0.585   1.00 0.00 ? 56  ALA A HB1    4  
ATOM   7491  H HB2    . ALA C 2 56 ? 19.386  -7.720  2.257   1.00 0.00 ? 56  ALA A HB2    4  
ATOM   7492  H HB3    . ALA C 2 56 ? 19.127  -6.564  0.952   1.00 0.00 ? 56  ALA A HB3    4  
ATOM   7493  N N      . CYS C 2 57 ? 16.197  -6.959  2.763   1.00 0.00 ? 57  CYS A N      4  
ATOM   7494  C CA     . CYS C 2 57 ? 15.493  -6.859  4.076   1.00 0.00 ? 57  CYS A CA     4  
ATOM   7495  C C      . CYS C 2 57 ? 14.096  -7.479  3.972   1.00 0.00 ? 57  CYS A C      4  
ATOM   7496  O O      . CYS C 2 57 ? 13.353  -7.204  3.051   1.00 0.00 ? 57  CYS A O      4  
ATOM   7497  C CB     . CYS C 2 57 ? 15.396  -5.359  4.360   1.00 0.00 ? 57  CYS A CB     4  
ATOM   7498  S SG     . CYS C 2 57 ? 15.041  -5.102  6.117   1.00 0.00 ? 57  CYS A SG     4  
ATOM   7499  H H      . CYS C 2 57 ? 16.124  -6.230  2.113   1.00 0.00 ? 57  CYS A H      4  
ATOM   7500  H HA     . CYS C 2 57 ? 16.066  -7.345  4.848   1.00 0.00 ? 57  CYS A HA     4  
ATOM   7501  H HB2    . CYS C 2 57 ? 16.332  -4.883  4.110   1.00 0.00 ? 57  CYS A HB2    4  
ATOM   7502  H HB3    . CYS C 2 57 ? 14.603  -4.929  3.766   1.00 0.00 ? 57  CYS A HB3    4  
ATOM   7503  H HG     . CYS C 2 57 ? 15.433  -5.828  6.608   1.00 0.00 ? 57  CYS A HG     4  
ATOM   7504  N N      . ASP C 2 58 ? 13.737  -8.314  4.910   1.00 0.00 ? 58  ASP A N      4  
ATOM   7505  C CA     . ASP C 2 58 ? 12.389  -8.956  4.866   1.00 0.00 ? 58  ASP A CA     4  
ATOM   7506  C C      . ASP C 2 58 ? 11.458  -8.310  5.897   1.00 0.00 ? 58  ASP A C      4  
ATOM   7507  O O      . ASP C 2 58 ? 11.871  -7.490  6.693   1.00 0.00 ? 58  ASP A O      4  
ATOM   7508  C CB     . ASP C 2 58 ? 12.638  -10.426 5.215   1.00 0.00 ? 58  ASP A CB     4  
ATOM   7509  C CG     . ASP C 2 58 ? 12.379  -11.298 3.985   1.00 0.00 ? 58  ASP A CG     4  
ATOM   7510  O OD1    . ASP C 2 58 ? 13.271  -11.401 3.158   1.00 0.00 ? 58  ASP A OD1    4  
ATOM   7511  O OD2    . ASP C 2 58 ? 11.295  -11.849 3.890   1.00 0.00 ? 58  ASP A OD2    4  
ATOM   7512  H H      . ASP C 2 58 ? 14.354  -8.523  5.643   1.00 0.00 ? 58  ASP A H      4  
ATOM   7513  H HA     . ASP C 2 58 ? 11.966  -8.877  3.877   1.00 0.00 ? 58  ASP A HA     4  
ATOM   7514  H HB2    . ASP C 2 58 ? 13.661  -10.551 5.536   1.00 0.00 ? 58  ASP A HB2    4  
ATOM   7515  H HB3    . ASP C 2 58 ? 11.972  -10.725 6.011   1.00 0.00 ? 58  ASP A HB3    4  
ATOM   7516  N N      . LEU C 2 59 ? 10.205  -8.681  5.889   1.00 0.00 ? 59  LEU A N      4  
ATOM   7517  C CA     . LEU C 2 59 ? 9.239   -8.101  6.869   1.00 0.00 ? 59  LEU A CA     4  
ATOM   7518  C C      . LEU C 2 59 ? 8.173   -9.144  7.207   1.00 0.00 ? 59  LEU A C      4  
ATOM   7519  O O      . LEU C 2 59 ? 6.989   -8.877  7.165   1.00 0.00 ? 59  LEU A O      4  
ATOM   7520  C CB     . LEU C 2 59 ? 8.607   -6.899  6.161   1.00 0.00 ? 59  LEU A CB     4  
ATOM   7521  C CG     . LEU C 2 59 ? 9.625   -5.757  6.046   1.00 0.00 ? 59  LEU A CG     4  
ATOM   7522  C CD1    . LEU C 2 59 ? 8.972   -4.557  5.354   1.00 0.00 ? 59  LEU A CD1    4  
ATOM   7523  C CD2    . LEU C 2 59 ? 10.100  -5.343  7.445   1.00 0.00 ? 59  LEU A CD2    4  
ATOM   7524  H H      . LEU C 2 59 ? 9.896   -9.351  5.243   1.00 0.00 ? 59  LEU A H      4  
ATOM   7525  H HA     . LEU C 2 59 ? 9.753   -7.781  7.762   1.00 0.00 ? 59  LEU A HA     4  
ATOM   7526  H HB2    . LEU C 2 59 ? 8.287   -7.194  5.172   1.00 0.00 ? 59  LEU A HB2    4  
ATOM   7527  H HB3    . LEU C 2 59 ? 7.754   -6.559  6.728   1.00 0.00 ? 59  LEU A HB3    4  
ATOM   7528  H HG     . LEU C 2 59 ? 10.469  -6.088  5.459   1.00 0.00 ? 59  LEU A HG     4  
ATOM   7529  H HD11   . LEU C 2 59 ? 9.432   -4.403  4.389   1.00 0.00 ? 59  LEU A HD11   4  
ATOM   7530  H HD12   . LEU C 2 59 ? 9.106   -3.674  5.961   1.00 0.00 ? 59  LEU A HD12   4  
ATOM   7531  H HD13   . LEU C 2 59 ? 7.916   -4.745  5.222   1.00 0.00 ? 59  LEU A HD13   4  
ATOM   7532  H HD21   . LEU C 2 59 ? 9.519   -5.862  8.193   1.00 0.00 ? 59  LEU A HD21   4  
ATOM   7533  H HD22   . LEU C 2 59 ? 9.973   -4.277  7.569   1.00 0.00 ? 59  LEU A HD22   4  
ATOM   7534  H HD23   . LEU C 2 59 ? 11.143  -5.596  7.561   1.00 0.00 ? 59  LEU A HD23   4  
ATOM   7535  N N      . THR C 2 60 ? 8.594   -10.335 7.528   1.00 0.00 ? 60  THR A N      4  
ATOM   7536  C CA     . THR C 2 60 ? 7.622   -11.418 7.859   1.00 0.00 ? 60  THR A CA     4  
ATOM   7537  C C      . THR C 2 60 ? 6.848   -11.092 9.142   1.00 0.00 ? 60  THR A C      4  
ATOM   7538  O O      . THR C 2 60 ? 5.859   -11.726 9.453   1.00 0.00 ? 60  THR A O      4  
ATOM   7539  C CB     . THR C 2 60 ? 8.485   -12.663 8.061   1.00 0.00 ? 60  THR A CB     4  
ATOM   7540  O OG1    . THR C 2 60 ? 9.486   -12.714 7.054   1.00 0.00 ? 60  THR A OG1    4  
ATOM   7541  C CG2    . THR C 2 60 ? 7.608   -13.908 7.974   1.00 0.00 ? 60  THR A CG2    4  
ATOM   7542  H H      . THR C 2 60 ? 9.557   -10.522 7.544   1.00 0.00 ? 60  THR A H      4  
ATOM   7543  H HA     . THR C 2 60 ? 6.942   -11.575 7.039   1.00 0.00 ? 60  THR A HA     4  
ATOM   7544  H HB     . THR C 2 60 ? 8.952   -12.623 9.032   1.00 0.00 ? 60  THR A HB     4  
ATOM   7545  H HG1    . THR C 2 60 ? 9.051   -12.867 6.211   1.00 0.00 ? 60  THR A HG1    4  
ATOM   7546  H HG21   . THR C 2 60 ? 6.854   -13.763 7.216   1.00 0.00 ? 60  THR A HG21   4  
ATOM   7547  H HG22   . THR C 2 60 ? 7.133   -14.079 8.929   1.00 0.00 ? 60  THR A HG22   4  
ATOM   7548  H HG23   . THR C 2 60 ? 8.219   -14.760 7.717   1.00 0.00 ? 60  THR A HG23   4  
ATOM   7549  N N      . LEU C 2 61 ? 7.290   -10.119 9.892   1.00 0.00 ? 61  LEU A N      4  
ATOM   7550  C CA     . LEU C 2 61 ? 6.580   -9.769  11.157  1.00 0.00 ? 61  LEU A CA     4  
ATOM   7551  C C      . LEU C 2 61 ? 5.627   -8.587  10.937  1.00 0.00 ? 61  LEU A C      4  
ATOM   7552  O O      . LEU C 2 61 ? 4.811   -8.277  11.782  1.00 0.00 ? 61  LEU A O      4  
ATOM   7553  C CB     . LEU C 2 61 ? 7.699   -9.411  12.137  1.00 0.00 ? 61  LEU A CB     4  
ATOM   7554  C CG     . LEU C 2 61 ? 8.630   -10.618 12.317  1.00 0.00 ? 61  LEU A CG     4  
ATOM   7555  C CD1    . LEU C 2 61 ? 9.650   -10.318 13.411  1.00 0.00 ? 61  LEU A CD1    4  
ATOM   7556  C CD2    . LEU C 2 61 ? 7.820   -11.856 12.718  1.00 0.00 ? 61  LEU A CD2    4  
ATOM   7557  H H      . LEU C 2 61 ? 8.093   -9.624  9.630   1.00 0.00 ? 61  LEU A H      4  
ATOM   7558  H HA     . LEU C 2 61 ? 6.030   -10.618 11.528  1.00 0.00 ? 61  LEU A HA     4  
ATOM   7559  H HB2    . LEU C 2 61 ? 8.264   -8.576  11.746  1.00 0.00 ? 61  LEU A HB2    4  
ATOM   7560  H HB3    . LEU C 2 61 ? 7.274   -9.140  13.091  1.00 0.00 ? 61  LEU A HB3    4  
ATOM   7561  H HG     . LEU C 2 61 ? 9.149   -10.811 11.388  1.00 0.00 ? 61  LEU A HG     4  
ATOM   7562  H HD11   . LEU C 2 61 ? 10.106  -11.242 13.737  1.00 0.00 ? 61  LEU A HD11   4  
ATOM   7563  H HD12   . LEU C 2 61 ? 9.153   -9.848  14.246  1.00 0.00 ? 61  LEU A HD12   4  
ATOM   7564  H HD13   . LEU C 2 61 ? 10.411  -9.658  13.024  1.00 0.00 ? 61  LEU A HD13   4  
ATOM   7565  H HD21   . LEU C 2 61 ? 8.494   -12.674 12.923  1.00 0.00 ? 61  LEU A HD21   4  
ATOM   7566  H HD22   . LEU C 2 61 ? 7.158   -12.132 11.909  1.00 0.00 ? 61  LEU A HD22   4  
ATOM   7567  H HD23   . LEU C 2 61 ? 7.240   -11.638 13.600  1.00 0.00 ? 61  LEU A HD23   4  
ATOM   7568  N N      . PHE C 2 62 ? 5.710   -7.935  9.805   1.00 0.00 ? 62  PHE A N      4  
ATOM   7569  C CA     . PHE C 2 62 ? 4.789   -6.791  9.539   1.00 0.00 ? 62  PHE A CA     4  
ATOM   7570  C C      . PHE C 2 62 ? 3.405   -7.332  9.167   1.00 0.00 ? 62  PHE A C      4  
ATOM   7571  O O      . PHE C 2 62 ? 3.260   -8.093  8.230   1.00 0.00 ? 62  PHE A O      4  
ATOM   7572  C CB     . PHE C 2 62 ? 5.413   -6.036  8.363   1.00 0.00 ? 62  PHE A CB     4  
ATOM   7573  C CG     . PHE C 2 62 ? 4.761   -4.681  8.228   1.00 0.00 ? 62  PHE A CG     4  
ATOM   7574  C CD1    . PHE C 2 62 ? 4.987   -3.692  9.196   1.00 0.00 ? 62  PHE A CD1    4  
ATOM   7575  C CD2    . PHE C 2 62 ? 3.931   -4.411  7.134   1.00 0.00 ? 62  PHE A CD2    4  
ATOM   7576  C CE1    . PHE C 2 62 ? 4.382   -2.436  9.066   1.00 0.00 ? 62  PHE A CE1    4  
ATOM   7577  C CE2    . PHE C 2 62 ? 3.326   -3.156  7.005   1.00 0.00 ? 62  PHE A CE2    4  
ATOM   7578  C CZ     . PHE C 2 62 ? 3.552   -2.168  7.971   1.00 0.00 ? 62  PHE A CZ     4  
ATOM   7579  H H      . PHE C 2 62 ? 6.365   -8.204  9.129   1.00 0.00 ? 62  PHE A H      4  
ATOM   7580  H HA     . PHE C 2 62 ? 4.725   -6.148  10.404  1.00 0.00 ? 62  PHE A HA     4  
ATOM   7581  H HB2    . PHE C 2 62 ? 6.472   -5.912  8.538   1.00 0.00 ? 62  PHE A HB2    4  
ATOM   7582  H HB3    . PHE C 2 62 ? 5.262   -6.599  7.454   1.00 0.00 ? 62  PHE A HB3    4  
ATOM   7583  H HD1    . PHE C 2 62 ? 5.627   -3.897  10.041  1.00 0.00 ? 62  PHE A HD1    4  
ATOM   7584  H HD2    . PHE C 2 62 ? 3.757   -5.174  6.388   1.00 0.00 ? 62  PHE A HD2    4  
ATOM   7585  H HE1    . PHE C 2 62 ? 4.555   -1.673  9.810   1.00 0.00 ? 62  PHE A HE1    4  
ATOM   7586  H HE2    . PHE C 2 62 ? 2.687   -2.948  6.161   1.00 0.00 ? 62  PHE A HE2    4  
ATOM   7587  H HZ     . PHE C 2 62 ? 3.085   -1.199  7.871   1.00 0.00 ? 62  PHE A HZ     4  
ATOM   7588  N N      . ASP C 2 63 ? 2.390   -6.962  9.902   1.00 0.00 ? 63  ASP A N      4  
ATOM   7589  C CA     . ASP C 2 63 ? 1.021   -7.477  9.598   1.00 0.00 ? 63  ASP A CA     4  
ATOM   7590  C C      . ASP C 2 63 ? 0.283   -6.552  8.621   1.00 0.00 ? 63  ASP A C      4  
ATOM   7591  O O      . ASP C 2 63 ? -0.924  -6.611  8.505   1.00 0.00 ? 63  ASP A O      4  
ATOM   7592  C CB     . ASP C 2 63 ? 0.304   -7.508  10.951  1.00 0.00 ? 63  ASP A CB     4  
ATOM   7593  C CG     . ASP C 2 63 ? 0.165   -8.957  11.423  1.00 0.00 ? 63  ASP A CG     4  
ATOM   7594  O OD1    . ASP C 2 63 ? 1.159   -9.516  11.856  1.00 0.00 ? 63  ASP A OD1    4  
ATOM   7595  O OD2    . ASP C 2 63 ? -0.934  -9.482  11.346  1.00 0.00 ? 63  ASP A OD2    4  
ATOM   7596  H H      . ASP C 2 63 ? 2.530   -6.359  10.661  1.00 0.00 ? 63  ASP A H      4  
ATOM   7597  H HA     . ASP C 2 63 ? 1.079   -8.474  9.194   1.00 0.00 ? 63  ASP A HA     4  
ATOM   7598  H HB2    . ASP C 2 63 ? 0.876   -6.946  11.674  1.00 0.00 ? 63  ASP A HB2    4  
ATOM   7599  H HB3    . ASP C 2 63 ? -0.677  -7.070  10.849  1.00 0.00 ? 63  ASP A HB3    4  
ATOM   7600  N N      . PHE C 2 64 ? 0.996   -5.710  7.914   1.00 0.00 ? 64  PHE A N      4  
ATOM   7601  C CA     . PHE C 2 64 ? 0.334   -4.788  6.935   1.00 0.00 ? 64  PHE A CA     4  
ATOM   7602  C C      . PHE C 2 64 ? -0.752  -3.945  7.625   1.00 0.00 ? 64  PHE A C      4  
ATOM   7603  O O      . PHE C 2 64 ? -0.527  -2.805  7.981   1.00 0.00 ? 64  PHE A O      4  
ATOM   7604  C CB     . PHE C 2 64 ? -0.272  -5.710  5.866   1.00 0.00 ? 64  PHE A CB     4  
ATOM   7605  C CG     . PHE C 2 64 ? -1.126  -4.909  4.908   1.00 0.00 ? 64  PHE A CG     4  
ATOM   7606  C CD1    . PHE C 2 64 ? -0.525  -4.134  3.907   1.00 0.00 ? 64  PHE A CD1    4  
ATOM   7607  C CD2    . PHE C 2 64 ? -2.523  -4.943  5.020   1.00 0.00 ? 64  PHE A CD2    4  
ATOM   7608  C CE1    . PHE C 2 64 ? -1.320  -3.396  3.022   1.00 0.00 ? 64  PHE A CE1    4  
ATOM   7609  C CE2    . PHE C 2 64 ? -3.316  -4.205  4.134   1.00 0.00 ? 64  PHE A CE2    4  
ATOM   7610  C CZ     . PHE C 2 64 ? -2.714  -3.432  3.135   1.00 0.00 ? 64  PHE A CZ     4  
ATOM   7611  H H      . PHE C 2 64 ? 1.969   -5.687  8.020   1.00 0.00 ? 64  PHE A H      4  
ATOM   7612  H HA     . PHE C 2 64 ? 1.070   -4.142  6.482   1.00 0.00 ? 64  PHE A HA     4  
ATOM   7613  H HB2    . PHE C 2 64 ? 0.524   -6.191  5.316   1.00 0.00 ? 64  PHE A HB2    4  
ATOM   7614  H HB3    . PHE C 2 64 ? -0.881  -6.463  6.342   1.00 0.00 ? 64  PHE A HB3    4  
ATOM   7615  H HD1    . PHE C 2 64 ? 0.551   -4.105  3.819   1.00 0.00 ? 64  PHE A HD1    4  
ATOM   7616  H HD2    . PHE C 2 64 ? -2.988  -5.541  5.790   1.00 0.00 ? 64  PHE A HD2    4  
ATOM   7617  H HE1    . PHE C 2 64 ? -0.858  -2.799  2.251   1.00 0.00 ? 64  PHE A HE1    4  
ATOM   7618  H HE2    . PHE C 2 64 ? -4.392  -4.233  4.221   1.00 0.00 ? 64  PHE A HE2    4  
ATOM   7619  H HZ     . PHE C 2 64 ? -3.326  -2.862  2.451   1.00 0.00 ? 64  PHE A HZ     4  
ATOM   7620  N N      . LYS C 2 65 ? -1.923  -4.495  7.813   1.00 0.00 ? 65  LYS A N      4  
ATOM   7621  C CA     . LYS C 2 65 ? -3.020  -3.724  8.474   1.00 0.00 ? 65  LYS A CA     4  
ATOM   7622  C C      . LYS C 2 65 ? -2.582  -3.241  9.860   1.00 0.00 ? 65  LYS A C      4  
ATOM   7623  O O      . LYS C 2 65 ? -2.675  -2.072  10.177  1.00 0.00 ? 65  LYS A O      4  
ATOM   7624  C CB     . LYS C 2 65 ? -4.185  -4.711  8.595   1.00 0.00 ? 65  LYS A CB     4  
ATOM   7625  C CG     . LYS C 2 65 ? -5.475  -4.045  8.112   1.00 0.00 ? 65  LYS A CG     4  
ATOM   7626  C CD     . LYS C 2 65 ? -5.649  -4.292  6.611   1.00 0.00 ? 65  LYS A CD     4  
ATOM   7627  C CE     . LYS C 2 65 ? -7.127  -4.537  6.300   1.00 0.00 ? 65  LYS A CE     4  
ATOM   7628  N NZ     . LYS C 2 65 ? -7.256  -6.016  6.189   1.00 0.00 ? 65  LYS A NZ     4  
ATOM   7629  H H      . LYS C 2 65 ? -2.083  -5.415  7.516   1.00 0.00 ? 65  LYS A H      4  
ATOM   7630  H HA     . LYS C 2 65 ? -3.312  -2.886  7.860   1.00 0.00 ? 65  LYS A HA     4  
ATOM   7631  H HB2    . LYS C 2 65 ? -3.983  -5.584  7.990   1.00 0.00 ? 65  LYS A HB2    4  
ATOM   7632  H HB3    . LYS C 2 65 ? -4.301  -5.008  9.626   1.00 0.00 ? 65  LYS A HB3    4  
ATOM   7633  H HG2    . LYS C 2 65 ? -6.317  -4.462  8.646   1.00 0.00 ? 65  LYS A HG2    4  
ATOM   7634  H HG3    . LYS C 2 65 ? -5.422  -2.982  8.296   1.00 0.00 ? 65  LYS A HG3    4  
ATOM   7635  H HD2    . LYS C 2 65 ? -5.303  -3.426  6.062   1.00 0.00 ? 65  LYS A HD2    4  
ATOM   7636  H HD3    . LYS C 2 65 ? -5.073  -5.157  6.318   1.00 0.00 ? 65  LYS A HD3    4  
ATOM   7637  H HE2    . LYS C 2 65 ? -7.747  -4.160  7.102   1.00 0.00 ? 65  LYS A HE2    4  
ATOM   7638  H HE3    . LYS C 2 65 ? -7.398  -4.072  5.365   1.00 0.00 ? 65  LYS A HE3    4  
ATOM   7639  H HZ1    . LYS C 2 65 ? -6.857  -6.463  7.038   1.00 0.00 ? 65  LYS A HZ1    4  
ATOM   7640  H HZ2    . LYS C 2 65 ? -8.261  -6.271  6.102   1.00 0.00 ? 65  LYS A HZ2    4  
ATOM   7641  H HZ3    . LYS C 2 65 ? -6.741  -6.348  5.349   1.00 0.00 ? 65  LYS A HZ3    4  
ATOM   7642  N N      . GLN C 2 66 ? -2.106  -4.132  10.690  1.00 0.00 ? 66  GLN A N      4  
ATOM   7643  C CA     . GLN C 2 66 ? -1.664  -3.725  12.060  1.00 0.00 ? 66  GLN A CA     4  
ATOM   7644  C C      . GLN C 2 66 ? -0.650  -2.580  11.976  1.00 0.00 ? 66  GLN A C      4  
ATOM   7645  O O      . GLN C 2 66 ? -0.664  -1.666  12.775  1.00 0.00 ? 66  GLN A O      4  
ATOM   7646  C CB     . GLN C 2 66 ? -1.017  -4.974  12.658  1.00 0.00 ? 66  GLN A CB     4  
ATOM   7647  C CG     . GLN C 2 66 ? -2.072  -6.070  12.823  1.00 0.00 ? 66  GLN A CG     4  
ATOM   7648  C CD     . GLN C 2 66 ? -2.652  -6.014  14.238  1.00 0.00 ? 66  GLN A CD     4  
ATOM   7649  O OE1    . GLN C 2 66 ? -3.015  -4.958  14.717  1.00 0.00 ? 66  GLN A OE1    4  
ATOM   7650  N NE2    . GLN C 2 66 ? -2.754  -7.114  14.932  1.00 0.00 ? 66  GLN A NE2    4  
ATOM   7651  H H      . GLN C 2 66 ? -2.042  -5.072  10.415  1.00 0.00 ? 66  GLN A H      4  
ATOM   7652  H HA     . GLN C 2 66 ? -2.515  -3.431  12.656  1.00 0.00 ? 66  GLN A HA     4  
ATOM   7653  H HB2    . GLN C 2 66 ? -0.233  -5.322  12.001  1.00 0.00 ? 66  GLN A HB2    4  
ATOM   7654  H HB3    . GLN C 2 66 ? -0.597  -4.734  13.624  1.00 0.00 ? 66  GLN A HB3    4  
ATOM   7655  H HG2    . GLN C 2 66 ? -2.863  -5.918  12.102  1.00 0.00 ? 66  GLN A HG2    4  
ATOM   7656  H HG3    . GLN C 2 66 ? -1.617  -7.035  12.661  1.00 0.00 ? 66  GLN A HG3    4  
ATOM   7657  H HE21   . GLN C 2 66 ? -2.462  -7.965  14.547  1.00 0.00 ? 66  GLN A HE21   4  
ATOM   7658  H HE22   . GLN C 2 66 ? -3.125  -7.088  15.839  1.00 0.00 ? 66  GLN A HE22   4  
ATOM   7659  N N      . GLY C 2 67 ? 0.229   -2.624  11.010  1.00 0.00 ? 67  GLY A N      4  
ATOM   7660  C CA     . GLY C 2 67 ? 1.242   -1.539  10.870  1.00 0.00 ? 67  GLY A CA     4  
ATOM   7661  C C      . GLY C 2 67 ? 2.363   -1.737  11.894  1.00 0.00 ? 67  GLY A C      4  
ATOM   7662  O O      . GLY C 2 67 ? 3.045   -0.803  12.266  1.00 0.00 ? 67  GLY A O      4  
ATOM   7663  H H      . GLY C 2 67 ? 0.220   -3.370  10.375  1.00 0.00 ? 67  GLY A H      4  
ATOM   7664  H HA2    . GLY C 2 67 ? 1.658   -1.563  9.873   1.00 0.00 ? 67  GLY A HA2    4  
ATOM   7665  H HA3    . GLY C 2 67 ? 0.772   -0.583  11.040  1.00 0.00 ? 67  GLY A HA3    4  
ATOM   7666  N N      . ILE C 2 68 ? 2.564   -2.946  12.348  1.00 0.00 ? 68  ILE A N      4  
ATOM   7667  C CA     . ILE C 2 68 ? 3.648   -3.200  13.344  1.00 0.00 ? 68  ILE A CA     4  
ATOM   7668  C C      . ILE C 2 68 ? 4.413   -4.475  12.977  1.00 0.00 ? 68  ILE A C      4  
ATOM   7669  O O      . ILE C 2 68 ? 3.894   -5.354  12.316  1.00 0.00 ? 68  ILE A O      4  
ATOM   7670  C CB     . ILE C 2 68 ? 2.957   -3.353  14.706  1.00 0.00 ? 68  ILE A CB     4  
ATOM   7671  C CG1    . ILE C 2 68 ? 1.596   -4.047  14.552  1.00 0.00 ? 68  ILE A CG1    4  
ATOM   7672  C CG2    . ILE C 2 68 ? 2.749   -1.969  15.324  1.00 0.00 ? 68  ILE A CG2    4  
ATOM   7673  C CD1    . ILE C 2 68 ? 1.799   -5.469  14.025  1.00 0.00 ? 68  ILE A CD1    4  
ATOM   7674  H H      . ILE C 2 68 ? 2.006   -3.688  12.032  1.00 0.00 ? 68  ILE A H      4  
ATOM   7675  H HA     . ILE C 2 68 ? 4.325   -2.360  13.374  1.00 0.00 ? 68  ILE A HA     4  
ATOM   7676  H HB     . ILE C 2 68 ? 3.588   -3.941  15.359  1.00 0.00 ? 68  ILE A HB     4  
ATOM   7677  H HG12   . ILE C 2 68 ? 1.105   -4.088  15.513  1.00 0.00 ? 68  ILE A HG12   4  
ATOM   7678  H HG13   . ILE C 2 68 ? 0.983   -3.492  13.859  1.00 0.00 ? 68  ILE A HG13   4  
ATOM   7679  H HG21   . ILE C 2 68 ? 1.911   -1.483  14.845  1.00 0.00 ? 68  ILE A HG21   4  
ATOM   7680  H HG22   . ILE C 2 68 ? 3.639   -1.373  15.183  1.00 0.00 ? 68  ILE A HG22   4  
ATOM   7681  H HG23   . ILE C 2 68 ? 2.548   -2.072  16.380  1.00 0.00 ? 68  ILE A HG23   4  
ATOM   7682  H HD11   . ILE C 2 68 ? 2.768   -5.832  14.334  1.00 0.00 ? 68  ILE A HD11   4  
ATOM   7683  H HD12   . ILE C 2 68 ? 1.743   -5.464  12.947  1.00 0.00 ? 68  ILE A HD12   4  
ATOM   7684  H HD13   . ILE C 2 68 ? 1.030   -6.113  14.424  1.00 0.00 ? 68  ILE A HD13   4  
ATOM   7685  N N      . LEU C 2 69 ? 5.646   -4.577  13.394  1.00 0.00 ? 69  LEU A N      4  
ATOM   7686  C CA     . LEU C 2 69 ? 6.448   -5.791  13.065  1.00 0.00 ? 69  LEU A CA     4  
ATOM   7687  C C      . LEU C 2 69 ? 6.329   -6.823  14.189  1.00 0.00 ? 69  LEU A C      4  
ATOM   7688  O O      . LEU C 2 69 ? 7.214   -6.968  15.009  1.00 0.00 ? 69  LEU A O      4  
ATOM   7689  C CB     . LEU C 2 69 ? 7.890   -5.294  12.942  1.00 0.00 ? 69  LEU A CB     4  
ATOM   7690  C CG     . LEU C 2 69 ? 8.214   -4.999  11.474  1.00 0.00 ? 69  LEU A CG     4  
ATOM   7691  C CD1    . LEU C 2 69 ? 9.565   -4.284  11.379  1.00 0.00 ? 69  LEU A CD1    4  
ATOM   7692  C CD2    . LEU C 2 69 ? 8.277   -6.312  10.691  1.00 0.00 ? 69  LEU A CD2    4  
ATOM   7693  H H      . LEU C 2 69 ? 6.046   -3.855  13.920  1.00 0.00 ? 69  LEU A H      4  
ATOM   7694  H HA     . LEU C 2 69 ? 6.122   -6.215  12.129  1.00 0.00 ? 69  LEU A HA     4  
ATOM   7695  H HB2    . LEU C 2 69 ? 8.010   -4.392  13.525  1.00 0.00 ? 69  LEU A HB2    4  
ATOM   7696  H HB3    . LEU C 2 69 ? 8.565   -6.052  13.311  1.00 0.00 ? 69  LEU A HB3    4  
ATOM   7697  H HG     . LEU C 2 69 ? 7.442   -4.367  11.058  1.00 0.00 ? 69  LEU A HG     4  
ATOM   7698  H HD11   . LEU C 2 69 ? 10.274  -4.919  10.869  1.00 0.00 ? 69  LEU A HD11   4  
ATOM   7699  H HD12   . LEU C 2 69 ? 9.927   -4.064  12.373  1.00 0.00 ? 69  LEU A HD12   4  
ATOM   7700  H HD13   . LEU C 2 69 ? 9.445   -3.363  10.829  1.00 0.00 ? 69  LEU A HD13   4  
ATOM   7701  H HD21   . LEU C 2 69 ? 9.221   -6.801  10.883  1.00 0.00 ? 69  LEU A HD21   4  
ATOM   7702  H HD22   . LEU C 2 69 ? 8.188   -6.106  9.635   1.00 0.00 ? 69  LEU A HD22   4  
ATOM   7703  H HD23   . LEU C 2 69 ? 7.469   -6.956  11.000  1.00 0.00 ? 69  LEU A HD23   4  
ATOM   7704  N N      . CYS C 2 70 ? 5.237   -7.538  14.234  1.00 0.00 ? 70  CYS A N      4  
ATOM   7705  C CA     . CYS C 2 70 ? 5.053   -8.556  15.301  1.00 0.00 ? 70  CYS A CA     4  
ATOM   7706  C C      . CYS C 2 70 ? 4.934   -9.950  14.676  1.00 0.00 ? 70  CYS A C      4  
ATOM   7707  O O      . CYS C 2 70 ? 5.552   -10.246 13.674  1.00 0.00 ? 70  CYS A O      4  
ATOM   7708  C CB     . CYS C 2 70 ? 3.748   -8.158  15.989  1.00 0.00 ? 70  CYS A CB     4  
ATOM   7709  S SG     . CYS C 2 70 ? 3.872   -8.489  17.765  1.00 0.00 ? 70  CYS A SG     4  
ATOM   7710  H H      . CYS C 2 70 ? 4.534   -7.406  13.566  1.00 0.00 ? 70  CYS A H      4  
ATOM   7711  H HA     . CYS C 2 70 ? 5.870   -8.522  16.003  1.00 0.00 ? 70  CYS A HA     4  
ATOM   7712  H HB2    . CYS C 2 70 ? 3.566   -7.106  15.831  1.00 0.00 ? 70  CYS A HB2    4  
ATOM   7713  H HB3    . CYS C 2 70 ? 2.935   -8.731  15.571  1.00 0.00 ? 70  CYS A HB3    4  
ATOM   7714  H HG     . CYS C 2 70 ? 4.780   -8.736  17.959  1.00 0.00 ? 70  CYS A HG     4  
ATOM   7715  N N      . TYR C 2 71 ? 4.141   -10.806 15.257  1.00 0.00 ? 71  TYR A N      4  
ATOM   7716  C CA     . TYR C 2 71 ? 3.981   -12.177 14.695  1.00 0.00 ? 71  TYR A CA     4  
ATOM   7717  C C      . TYR C 2 71 ? 2.715   -12.251 13.836  1.00 0.00 ? 71  TYR A C      4  
ATOM   7718  O O      . TYR C 2 71 ? 1.810   -11.457 13.998  1.00 0.00 ? 71  TYR A O      4  
ATOM   7719  C CB     . TYR C 2 71 ? 3.857   -13.093 15.913  1.00 0.00 ? 71  TYR A CB     4  
ATOM   7720  C CG     . TYR C 2 71 ? 5.155   -13.834 16.124  1.00 0.00 ? 71  TYR A CG     4  
ATOM   7721  C CD1    . TYR C 2 71 ? 6.320   -13.128 16.448  1.00 0.00 ? 71  TYR A CD1    4  
ATOM   7722  C CD2    . TYR C 2 71 ? 5.194   -15.228 15.996  1.00 0.00 ? 71  TYR A CD2    4  
ATOM   7723  C CE1    . TYR C 2 71 ? 7.524   -13.816 16.643  1.00 0.00 ? 71  TYR A CE1    4  
ATOM   7724  C CE2    . TYR C 2 71 ? 6.398   -15.915 16.191  1.00 0.00 ? 71  TYR A CE2    4  
ATOM   7725  C CZ     . TYR C 2 71 ? 7.563   -15.210 16.515  1.00 0.00 ? 71  TYR A CZ     4  
ATOM   7726  O OH     . TYR C 2 71 ? 8.750   -15.887 16.707  1.00 0.00 ? 71  TYR A OH     4  
ATOM   7727  H H      . TYR C 2 71 ? 3.648   -10.545 16.059  1.00 0.00 ? 71  TYR A H      4  
ATOM   7728  H HA     . TYR C 2 71 ? 4.848   -12.449 14.114  1.00 0.00 ? 71  TYR A HA     4  
ATOM   7729  H HB2    . TYR C 2 71 ? 3.636   -12.499 16.788  1.00 0.00 ? 71  TYR A HB2    4  
ATOM   7730  H HB3    . TYR C 2 71 ? 3.060   -13.803 15.750  1.00 0.00 ? 71  TYR A HB3    4  
ATOM   7731  H HD1    . TYR C 2 71 ? 6.290   -12.053 16.547  1.00 0.00 ? 71  TYR A HD1    4  
ATOM   7732  H HD2    . TYR C 2 71 ? 4.295   -15.772 15.746  1.00 0.00 ? 71  TYR A HD2    4  
ATOM   7733  H HE1    . TYR C 2 71 ? 8.422   -13.271 16.893  1.00 0.00 ? 71  TYR A HE1    4  
ATOM   7734  H HE2    . TYR C 2 71 ? 6.427   -16.991 16.093  1.00 0.00 ? 71  TYR A HE2    4  
ATOM   7735  H HH     . TYR C 2 71 ? 9.366   -15.607 16.027  1.00 0.00 ? 71  TYR A HH     4  
ATOM   7736  N N      . PRO C 2 72 ? 2.691   -13.210 12.947  1.00 0.00 ? 72  PRO A N      4  
ATOM   7737  C CA     . PRO C 2 72 ? 1.517   -13.391 12.057  1.00 0.00 ? 72  PRO A CA     4  
ATOM   7738  C C      . PRO C 2 72 ? 0.313   -13.893 12.861  1.00 0.00 ? 72  PRO A C      4  
ATOM   7739  O O      . PRO C 2 72 ? -0.824  -13.687 12.484  1.00 0.00 ? 72  PRO A O      4  
ATOM   7740  C CB     . PRO C 2 72 ? 1.987   -14.439 11.051  1.00 0.00 ? 72  PRO A CB     4  
ATOM   7741  C CG     . PRO C 2 72 ? 3.074   -15.187 11.756  1.00 0.00 ? 72  PRO A CG     4  
ATOM   7742  C CD     . PRO C 2 72 ? 3.738   -14.208 12.688  1.00 0.00 ? 72  PRO A CD     4  
ATOM   7743  H HA     . PRO C 2 72 ? 1.279   -12.470 11.549  1.00 0.00 ? 72  PRO A HA     4  
ATOM   7744  H HB2    . PRO C 2 72 ? 1.173   -15.103 10.794  1.00 0.00 ? 72  PRO A HB2    4  
ATOM   7745  H HB3    . PRO C 2 72 ? 2.381   -13.964 10.166  1.00 0.00 ? 72  PRO A HB3    4  
ATOM   7746  H HG2    . PRO C 2 72 ? 2.650   -16.009 12.318  1.00 0.00 ? 72  PRO A HG2    4  
ATOM   7747  H HG3    . PRO C 2 72 ? 3.793   -15.556 11.042  1.00 0.00 ? 72  PRO A HG3    4  
ATOM   7748  H HD2    . PRO C 2 72 ? 4.035   -14.700 13.605  1.00 0.00 ? 72  PRO A HD2    4  
ATOM   7749  H HD3    . PRO C 2 72 ? 4.587   -13.743 12.212  1.00 0.00 ? 72  PRO A HD3    4  
ATOM   7750  N N      . ALA C 2 73 ? 0.557   -14.543 13.970  1.00 0.00 ? 73  ALA A N      4  
ATOM   7751  C CA     . ALA C 2 73 ? -0.569  -15.057 14.813  1.00 0.00 ? 73  ALA A CA     4  
ATOM   7752  C C      . ALA C 2 73 ? -1.528  -15.915 13.976  1.00 0.00 ? 73  ALA A C      4  
ATOM   7753  O O      . ALA C 2 73 ? -2.397  -15.393 13.306  1.00 0.00 ? 73  ALA A O      4  
ATOM   7754  C CB     . ALA C 2 73 ? -1.283  -13.805 15.331  1.00 0.00 ? 73  ALA A CB     4  
ATOM   7755  H H      . ALA C 2 73 ? 1.482   -14.691 14.255  1.00 0.00 ? 73  ALA A H      4  
ATOM   7756  H HA     . ALA C 2 73 ? -0.183  -15.626 15.643  1.00 0.00 ? 73  ALA A HA     4  
ATOM   7757  H HB1    . ALA C 2 73 ? -1.091  -13.694 16.389  1.00 0.00 ? 73  ALA A HB1    4  
ATOM   7758  H HB2    . ALA C 2 73 ? -2.346  -13.902 15.167  1.00 0.00 ? 73  ALA A HB2    4  
ATOM   7759  H HB3    . ALA C 2 73 ? -0.916  -12.936 14.806  1.00 0.00 ? 73  ALA A HB3    4  
ATOM   7760  N N      . PRO C 2 74 ? -1.343  -17.210 14.045  1.00 0.00 ? 74  PRO A N      4  
ATOM   7761  C CA     . PRO C 2 74 ? -2.215  -18.140 13.285  1.00 0.00 ? 74  PRO A CA     4  
ATOM   7762  C C      . PRO C 2 74 ? -3.605  -18.207 13.923  1.00 0.00 ? 74  PRO A C      4  
ATOM   7763  O O      . PRO C 2 74 ? -4.587  -18.496 13.266  1.00 0.00 ? 74  PRO A O      4  
ATOM   7764  C CB     . PRO C 2 74 ? -1.497  -19.481 13.402  1.00 0.00 ? 74  PRO A CB     4  
ATOM   7765  C CG     . PRO C 2 74 ? -0.682  -19.377 14.652  1.00 0.00 ? 74  PRO A CG     4  
ATOM   7766  C CD     . PRO C 2 74 ? -0.323  -17.924 14.824  1.00 0.00 ? 74  PRO A CD     4  
ATOM   7767  H HA     . PRO C 2 74 ? -2.281  -17.843 12.250  1.00 0.00 ? 74  PRO A HA     4  
ATOM   7768  H HB2    . PRO C 2 74 ? -2.217  -20.285 13.486  1.00 0.00 ? 74  PRO A HB2    4  
ATOM   7769  H HB3    . PRO C 2 74 ? -0.852  -19.640 12.553  1.00 0.00 ? 74  PRO A HB3    4  
ATOM   7770  H HG2    . PRO C 2 74 ? -1.260  -19.721 15.498  1.00 0.00 ? 74  PRO A HG2    4  
ATOM   7771  H HG3    . PRO C 2 74 ? 0.219   -19.964 14.555  1.00 0.00 ? 74  PRO A HG3    4  
ATOM   7772  H HD2    . PRO C 2 74 ? -0.374  -17.644 15.869  1.00 0.00 ? 74  PRO A HD2    4  
ATOM   7773  H HD3    . PRO C 2 74 ? 0.658   -17.724 14.423  1.00 0.00 ? 74  PRO A HD3    4  
ATOM   7774  N N      . LYS C 2 75 ? -3.696  -17.942 15.200  1.00 0.00 ? 75  LYS A N      4  
ATOM   7775  C CA     . LYS C 2 75 ? -5.022  -17.990 15.884  1.00 0.00 ? 75  LYS A CA     4  
ATOM   7776  C C      . LYS C 2 75 ? -5.944  -16.900 15.331  1.00 0.00 ? 75  LYS A C      4  
ATOM   7777  O O      . LYS C 2 75 ? -6.894  -16.552 16.013  1.00 0.00 ? 75  LYS A O      4  
ATOM   7778  C CB     . LYS C 2 75 ? -4.717  -17.733 17.361  1.00 0.00 ? 75  LYS A CB     4  
ATOM   7779  C CG     . LYS C 2 75 ? -4.196  -19.019 18.007  1.00 0.00 ? 75  LYS A CG     4  
ATOM   7780  C CD     . LYS C 2 75 ? -3.573  -18.691 19.365  1.00 0.00 ? 75  LYS A CD     4  
ATOM   7781  C CE     . LYS C 2 75 ? -2.098  -18.327 19.177  1.00 0.00 ? 75  LYS A CE     4  
ATOM   7782  N NZ     . LYS C 2 75 ? -1.361  -19.613 19.331  1.00 0.00 ? 75  LYS A NZ     4  
ATOM   7783  O OXT    . LYS C 2 75 ? -5.683  -16.432 14.234  1.00 0.00 ? 75  LYS A OXT    4  
ATOM   7784  H H      . LYS C 2 75 ? -2.891  -17.711 15.709  1.00 0.00 ? 75  LYS A H      4  
ATOM   7785  H HA     . LYS C 2 75 ? -5.473  -18.963 15.765  1.00 0.00 ? 75  LYS A HA     4  
ATOM   7786  H HB2    . LYS C 2 75 ? -3.969  -16.959 17.444  1.00 0.00 ? 75  LYS A HB2    4  
ATOM   7787  H HB3    . LYS C 2 75 ? -5.619  -17.420 17.865  1.00 0.00 ? 75  LYS A HB3    4  
ATOM   7788  H HG2    . LYS C 2 75 ? -5.015  -19.710 18.143  1.00 0.00 ? 75  LYS A HG2    4  
ATOM   7789  H HG3    . LYS C 2 75 ? -3.448  -19.466 17.369  1.00 0.00 ? 75  LYS A HG3    4  
ATOM   7790  H HD2    . LYS C 2 75 ? -4.097  -17.856 19.809  1.00 0.00 ? 75  LYS A HD2    4  
ATOM   7791  H HD3    . LYS C 2 75 ? -3.650  -19.551 20.014  1.00 0.00 ? 75  LYS A HD3    4  
ATOM   7792  H HE2    . LYS C 2 75 ? -1.938  -17.914 18.190  1.00 0.00 ? 75  LYS A HE2    4  
ATOM   7793  H HE3    . LYS C 2 75 ? -1.784  -17.626 19.934  1.00 0.00 ? 75  LYS A HE3    4  
ATOM   7794  H HZ1    . LYS C 2 75 ? -1.732  -20.130 20.154  1.00 0.00 ? 75  LYS A HZ1    4  
ATOM   7795  H HZ2    . LYS C 2 75 ? -1.486  -20.188 18.473  1.00 0.00 ? 75  LYS A HZ2    4  
ATOM   7796  H HZ3    . LYS C 2 75 ? -0.350  -19.418 19.474  1.00 0.00 ? 75  LYS A HZ3    4  
ATOM   7797  O "O5'"  . DG  A 1 1  ? 1.995   20.466  -12.436 1.00 0.00 ? 101 DG  B "O5'"  5  
ATOM   7798  C "C5'"  . DG  A 1 1  ? 2.069   21.327  -11.297 1.00 0.00 ? 101 DG  B "C5'"  5  
ATOM   7799  C "C4'"  . DG  A 1 1  ? 1.550   20.637  -10.039 1.00 0.00 ? 101 DG  B "C4'"  5  
ATOM   7800  O "O4'"  . DG  A 1 1  ? 0.120   20.470  -10.098 1.00 0.00 ? 101 DG  B "O4'"  5  
ATOM   7801  C "C3'"  . DG  A 1 1  ? 2.185   19.265  -9.876  1.00 0.00 ? 101 DG  B "C3'"  5  
ATOM   7802  O "O3'"  . DG  A 1 1  ? 3.067   19.243  -8.748  1.00 0.00 ? 101 DG  B "O3'"  5  
ATOM   7803  C "C2'"  . DG  A 1 1  ? 1.042   18.302  -9.686  1.00 0.00 ? 101 DG  B "C2'"  5  
ATOM   7804  C "C1'"  . DG  A 1 1  ? -0.237  19.121  -9.745  1.00 0.00 ? 101 DG  B "C1'"  5  
ATOM   7805  N N9     . DG  A 1 1  ? -1.190  18.559  -10.719 1.00 0.00 ? 101 DG  B N9     5  
ATOM   7806  C C8     . DG  A 1 1  ? -0.954  17.840  -11.841 1.00 0.00 ? 101 DG  B C8     5  
ATOM   7807  N N7     . DG  A 1 1  ? -1.973  17.466  -12.539 1.00 0.00 ? 101 DG  B N7     5  
ATOM   7808  C C5     . DG  A 1 1  ? -3.034  17.998  -11.801 1.00 0.00 ? 101 DG  B C5     5  
ATOM   7809  C C6     . DG  A 1 1  ? -4.434  17.936  -12.044 1.00 0.00 ? 101 DG  B C6     5  
ATOM   7810  O O6     . DG  A 1 1  ? -5.016  17.396  -12.964 1.00 0.00 ? 101 DG  B O6     5  
ATOM   7811  N N1     . DG  A 1 1  ? -5.152  18.601  -11.057 1.00 0.00 ? 101 DG  B N1     5  
ATOM   7812  C C2     . DG  A 1 1  ? -4.598  19.247  -9.970  1.00 0.00 ? 101 DG  B C2     5  
ATOM   7813  N N2     . DG  A 1 1  ? -5.456  19.828  -9.130  1.00 0.00 ? 101 DG  B N2     5  
ATOM   7814  N N3     . DG  A 1 1  ? -3.283  19.310  -9.735  1.00 0.00 ? 101 DG  B N3     5  
ATOM   7815  C C4     . DG  A 1 1  ? -2.563  18.669  -10.684 1.00 0.00 ? 101 DG  B C4     5  
ATOM   7816  H "H5'"  . DG  A 1 1  ? 1.470   22.219  -11.486 1.00 0.00 ? 101 DG  B "H5'"  5  
ATOM   7817  H "H5''" . DG  A 1 1  ? 3.106   21.621  -11.139 1.00 0.00 ? 101 DG  B "H5''" 5  
ATOM   7818  H "H4'"  . DG  A 1 1  ? 1.794   21.245  -9.169  1.00 0.00 ? 101 DG  B "H4'"  5  
ATOM   7819  H "H3'"  . DG  A 1 1  ? 2.733   19.006  -10.783 1.00 0.00 ? 101 DG  B "H3'"  5  
ATOM   7820  H "H2'"  . DG  A 1 1  ? 1.048   17.556  -10.480 1.00 0.00 ? 101 DG  B "H2'"  5  
ATOM   7821  H "H2''" . DG  A 1 1  ? 1.124   17.812  -8.716  1.00 0.00 ? 101 DG  B "H2''" 5  
ATOM   7822  H "H1'"  . DG  A 1 1  ? -0.695  19.124  -8.764  1.00 0.00 ? 101 DG  B "H1'"  5  
ATOM   7823  H H8     . DG  A 1 1  ? 0.059   17.587  -12.140 1.00 0.00 ? 101 DG  B H8     5  
ATOM   7824  H H1     . DG  A 1 1  ? -6.127  18.599  -11.161 1.00 0.00 ? 101 DG  B H1     5  
ATOM   7825  H H21    . DG  A 1 1  ? -6.449  19.779  -9.309  1.00 0.00 ? 101 DG  B H21    5  
ATOM   7826  H H22    . DG  A 1 1  ? -5.112  20.316  -8.315  1.00 0.00 ? 101 DG  B H22    5  
ATOM   7827  H "HO5'" . DG  A 1 1  ? 2.862   20.465  -12.849 1.00 0.00 ? 101 DG  B "HO5'" 5  
ATOM   7828  P P      . DT  A 1 2  ? 3.552   17.845  -8.114  1.00 0.00 ? 102 DT  B P      5  
ATOM   7829  O OP1    . DT  A 1 2  ? 4.851   18.066  -7.441  1.00 0.00 ? 102 DT  B OP1    5  
ATOM   7830  O OP2    . DT  A 1 2  ? 3.427   16.797  -9.152  1.00 0.00 ? 102 DT  B OP2    5  
ATOM   7831  O "O5'"  . DT  A 1 2  ? 2.439   17.568  -6.983  1.00 0.00 ? 102 DT  B "O5'"  5  
ATOM   7832  C "C5'"  . DT  A 1 2  ? 1.709   18.653  -6.402  1.00 0.00 ? 102 DT  B "C5'"  5  
ATOM   7833  C "C4'"  . DT  A 1 2  ? 0.663   18.159  -5.407  1.00 0.00 ? 102 DT  B "C4'"  5  
ATOM   7834  O "O4'"  . DT  A 1 2  ? -0.605  17.947  -6.066  1.00 0.00 ? 102 DT  B "O4'"  5  
ATOM   7835  C "C3'"  . DT  A 1 2  ? 1.100   16.846  -4.777  1.00 0.00 ? 102 DT  B "C3'"  5  
ATOM   7836  O "O3'"  . DT  A 1 2  ? 1.170   16.968  -3.351  1.00 0.00 ? 102 DT  B "O3'"  5  
ATOM   7837  C "C2'"  . DT  A 1 2  ? 0.069   15.823  -5.185  1.00 0.00 ? 102 DT  B "C2'"  5  
ATOM   7838  C "C1'"  . DT  A 1 2  ? -0.996  16.560  -5.978  1.00 0.00 ? 102 DT  B "C1'"  5  
ATOM   7839  N N1     . DT  A 1 2  ? -1.150  15.980  -7.326  1.00 0.00 ? 102 DT  B N1     5  
ATOM   7840  C C2     . DT  A 1 2  ? -2.434  15.721  -7.766  1.00 0.00 ? 102 DT  B C2     5  
ATOM   7841  O O2     . DT  A 1 2  ? -3.409  15.938  -7.075  1.00 0.00 ? 102 DT  B O2     5  
ATOM   7842  N N3     . DT  A 1 2  ? -2.545  15.198  -9.041  1.00 0.00 ? 102 DT  B N3     5  
ATOM   7843  C C4     . DT  A 1 2  ? -1.497  14.916  -9.900  1.00 0.00 ? 102 DT  B C4     5  
ATOM   7844  O O4     . DT  A 1 2  ? -1.709  14.455  -11.004 1.00 0.00 ? 102 DT  B O4     5  
ATOM   7845  C C5     . DT  A 1 2  ? -0.193  15.218  -9.354  1.00 0.00 ? 102 DT  B C5     5  
ATOM   7846  C C7     . DT  A 1 2  ? 1.052   14.953  -10.194 1.00 0.00 ? 102 DT  B C7     5  
ATOM   7847  C C6     . DT  A 1 2  ? -0.059  15.728  -8.113  1.00 0.00 ? 102 DT  B C6     5  
ATOM   7848  H "H5'"  . DT  A 1 2  ? 1.210   19.212  -7.195  1.00 0.00 ? 102 DT  B "H5'"  5  
ATOM   7849  H "H5''" . DT  A 1 2  ? 2.405   19.314  -5.886  1.00 0.00 ? 102 DT  B "H5''" 5  
ATOM   7850  H "H4'"  . DT  A 1 2  ? 0.534   18.906  -4.624  1.00 0.00 ? 102 DT  B "H4'"  5  
ATOM   7851  H "H3'"  . DT  A 1 2  ? 2.076   16.557  -5.174  1.00 0.00 ? 102 DT  B "H3'"  5  
ATOM   7852  H "H2'"  . DT  A 1 2  ? 0.531   15.057  -5.806  1.00 0.00 ? 102 DT  B "H2'"  5  
ATOM   7853  H "H2''" . DT  A 1 2  ? -0.375  15.368  -4.302  1.00 0.00 ? 102 DT  B "H2''" 5  
ATOM   7854  H "H1'"  . DT  A 1 2  ? -1.947  16.490  -5.451  1.00 0.00 ? 102 DT  B "H1'"  5  
ATOM   7855  H H3     . DT  A 1 2  ? -3.450  15.009  -9.366  1.00 0.00 ? 102 DT  B H3     5  
ATOM   7856  H H71    . DT  A 1 2  ? 1.374   13.922  -10.052 1.00 0.00 ? 102 DT  B H71    5  
ATOM   7857  H H72    . DT  A 1 2  ? 0.822   15.120  -11.246 1.00 0.00 ? 102 DT  B H72    5  
ATOM   7858  H H73    . DT  A 1 2  ? 1.849   15.629  -9.885  1.00 0.00 ? 102 DT  B H73    5  
ATOM   7859  H H6     . DT  A 1 2  ? 0.937   15.948  -7.730  1.00 0.00 ? 102 DT  B H6     5  
ATOM   7860  P P      . DA  A 1 3  ? 1.206   15.660  -2.414  1.00 0.00 ? 103 DA  B P      5  
ATOM   7861  O OP1    . DA  A 1 3  ? 1.332   16.102  -1.007  1.00 0.00 ? 103 DA  B OP1    5  
ATOM   7862  O OP2    . DA  A 1 3  ? 2.190   14.710  -2.980  1.00 0.00 ? 103 DA  B OP2    5  
ATOM   7863  O "O5'"  . DA  A 1 3  ? -0.267  15.042  -2.619  1.00 0.00 ? 103 DA  B "O5'"  5  
ATOM   7864  C "C5'"  . DA  A 1 3  ? -1.421  15.716  -2.105  1.00 0.00 ? 103 DA  B "C5'"  5  
ATOM   7865  C "C4'"  . DA  A 1 3  ? -2.641  14.800  -2.100  1.00 0.00 ? 103 DA  B "C4'"  5  
ATOM   7866  O "O4'"  . DA  A 1 3  ? -3.186  14.670  -3.429  1.00 0.00 ? 103 DA  B "O4'"  5  
ATOM   7867  C "C3'"  . DA  A 1 3  ? -2.266  13.415  -1.598  1.00 0.00 ? 103 DA  B "C3'"  5  
ATOM   7868  O "O3'"  . DA  A 1 3  ? -2.982  13.101  -0.398  1.00 0.00 ? 103 DA  B "O3'"  5  
ATOM   7869  C "C2'"  . DA  A 1 3  ? -2.626  12.466  -2.709  1.00 0.00 ? 103 DA  B "C2'"  5  
ATOM   7870  C "C1'"  . DA  A 1 3  ? -3.346  13.280  -3.764  1.00 0.00 ? 103 DA  B "C1'"  5  
ATOM   7871  N N9     . DA  A 1 3  ? -2.803  12.995  -5.097  1.00 0.00 ? 103 DA  B N9     5  
ATOM   7872  C C8     . DA  A 1 3  ? -1.517  12.924  -5.487  1.00 0.00 ? 103 DA  B C8     5  
ATOM   7873  N N7     . DA  A 1 3  ? -1.280  12.674  -6.732  1.00 0.00 ? 103 DA  B N7     5  
ATOM   7874  C C5     . DA  A 1 3  ? -2.578  12.558  -7.244  1.00 0.00 ? 103 DA  B C5     5  
ATOM   7875  C C6     . DA  A 1 3  ? -3.072  12.291  -8.524  1.00 0.00 ? 103 DA  B C6     5  
ATOM   7876  N N6     . DA  A 1 3  ? -2.286  12.083  -9.580  1.00 0.00 ? 103 DA  B N6     5  
ATOM   7877  N N1     . DA  A 1 3  ? -4.408  12.246  -8.675  1.00 0.00 ? 103 DA  B N1     5  
ATOM   7878  C C2     . DA  A 1 3  ? -5.213  12.450  -7.631  1.00 0.00 ? 103 DA  B C2     5  
ATOM   7879  N N3     . DA  A 1 3  ? -4.852  12.710  -6.377  1.00 0.00 ? 103 DA  B N3     5  
ATOM   7880  C C4     . DA  A 1 3  ? -3.511  12.750  -6.252  1.00 0.00 ? 103 DA  B C4     5  
ATOM   7881  H "H5'"  . DA  A 1 3  ? -1.631  16.586  -2.726  1.00 0.00 ? 103 DA  B "H5'"  5  
ATOM   7882  H "H5''" . DA  A 1 3  ? -1.218  16.045  -1.086  1.00 0.00 ? 103 DA  B "H5''" 5  
ATOM   7883  H "H4'"  . DA  A 1 3  ? -3.405  15.219  -1.449  1.00 0.00 ? 103 DA  B "H4'"  5  
ATOM   7884  H "H3'"  . DA  A 1 3  ? -1.191  13.371  -1.414  1.00 0.00 ? 103 DA  B "H3'"  5  
ATOM   7885  H "H2'"  . DA  A 1 3  ? -1.722  12.028  -3.131  1.00 0.00 ? 103 DA  B "H2'"  5  
ATOM   7886  H "H2''" . DA  A 1 3  ? -3.278  11.681  -2.338  1.00 0.00 ? 103 DA  B "H2''" 5  
ATOM   7887  H "H1'"  . DA  A 1 3  ? -4.399  13.033  -3.747  1.00 0.00 ? 103 DA  B "H1'"  5  
ATOM   7888  H H8     . DA  A 1 3  ? -0.714  13.060  -4.770  1.00 0.00 ? 103 DA  B H8     5  
ATOM   7889  H H61    . DA  A 1 3  ? -2.694  11.894  -10.484 1.00 0.00 ? 103 DA  B H61    5  
ATOM   7890  H H62    . DA  A 1 3  ? -1.282  12.116  -9.476  1.00 0.00 ? 103 DA  B H62    5  
ATOM   7891  H H2     . DA  A 1 3  ? -6.285  12.398  -7.827  1.00 0.00 ? 103 DA  B H2     5  
ATOM   7892  P P      . DT  A 1 4  ? -3.112  11.578  0.109   1.00 0.00 ? 104 DT  B P      5  
ATOM   7893  O OP1    . DT  A 1 4  ? -3.113  11.582  1.588   1.00 0.00 ? 104 DT  B OP1    5  
ATOM   7894  O OP2    . DT  A 1 4  ? -2.121  10.760  -0.626  1.00 0.00 ? 104 DT  B OP2    5  
ATOM   7895  O "O5'"  . DT  A 1 4  ? -4.584  11.163  -0.398  1.00 0.00 ? 104 DT  B "O5'"  5  
ATOM   7896  C "C5'"  . DT  A 1 4  ? -5.539  12.166  -0.760  1.00 0.00 ? 104 DT  B "C5'"  5  
ATOM   7897  C "C4'"  . DT  A 1 4  ? -6.785  11.556  -1.395  1.00 0.00 ? 104 DT  B "C4'"  5  
ATOM   7898  O "O4'"  . DT  A 1 4  ? -6.648  11.496  -2.832  1.00 0.00 ? 104 DT  B "O4'"  5  
ATOM   7899  C "C3'"  . DT  A 1 4  ? -7.015  10.144  -0.877  1.00 0.00 ? 104 DT  B "C3'"  5  
ATOM   7900  O "O3'"  . DT  A 1 4  ? -8.308  10.033  -0.269  1.00 0.00 ? 104 DT  B "O3'"  5  
ATOM   7901  C "C2'"  . DT  A 1 4  ? -6.900  9.238   -2.077  1.00 0.00 ? 104 DT  B "C2'"  5  
ATOM   7902  C "C1'"  . DT  A 1 4  ? -6.708  10.129  -3.291  1.00 0.00 ? 104 DT  B "C1'"  5  
ATOM   7903  N N1     . DT  A 1 4  ? -5.474  9.770   -4.011  1.00 0.00 ? 104 DT  B N1     5  
ATOM   7904  C C2     . DT  A 1 4  ? -5.570  9.537   -5.370  1.00 0.00 ? 104 DT  B C2     5  
ATOM   7905  O O2     . DT  A 1 4  ? -6.627  9.604   -5.965  1.00 0.00 ? 104 DT  B O2     5  
ATOM   7906  N N3     . DT  A 1 4  ? -4.387  9.222   -6.015  1.00 0.00 ? 104 DT  B N3     5  
ATOM   7907  C C4     . DT  A 1 4  ? -3.139  9.124   -5.426  1.00 0.00 ? 104 DT  B C4     5  
ATOM   7908  O O4     . DT  A 1 4  ? -2.161  8.841   -6.090  1.00 0.00 ? 104 DT  B O4     5  
ATOM   7909  C C5     . DT  A 1 4  ? -3.140  9.383   -4.003  1.00 0.00 ? 104 DT  B C5     5  
ATOM   7910  C C7     . DT  A 1 4  ? -1.829  9.311   -3.227  1.00 0.00 ? 104 DT  B C7     5  
ATOM   7911  C C6     . DT  A 1 4  ? -4.280  9.690   -3.353  1.00 0.00 ? 104 DT  B C6     5  
ATOM   7912  H "H5'"  . DT  A 1 4  ? -5.080  12.855  -1.468  1.00 0.00 ? 104 DT  B "H5'"  5  
ATOM   7913  H "H5''" . DT  A 1 4  ? -5.830  12.718  0.135   1.00 0.00 ? 104 DT  B "H5''" 5  
ATOM   7914  H "H4'"  . DT  A 1 4  ? -7.650  12.172  -1.146  1.00 0.00 ? 104 DT  B "H4'"  5  
ATOM   7915  H "H3'"  . DT  A 1 4  ? -6.239  9.890   -0.152  1.00 0.00 ? 104 DT  B "H3'"  5  
ATOM   7916  H "H2'"  . DT  A 1 4  ? -6.041  8.577   -1.961  1.00 0.00 ? 104 DT  B "H2'"  5  
ATOM   7917  H "H2''" . DT  A 1 4  ? -7.808  8.650   -2.190  1.00 0.00 ? 104 DT  B "H2''" 5  
ATOM   7918  H "H1'"  . DT  A 1 4  ? -7.558  10.011  -3.961  1.00 0.00 ? 104 DT  B "H1'"  5  
ATOM   7919  H H3     . DT  A 1 4  ? -4.439  9.054   -6.979  1.00 0.00 ? 104 DT  B H3     5  
ATOM   7920  H H71    . DT  A 1 4  ? -1.032  9.762   -3.818  1.00 0.00 ? 104 DT  B H71    5  
ATOM   7921  H H72    . DT  A 1 4  ? -1.934  9.851   -2.287  1.00 0.00 ? 104 DT  B H72    5  
ATOM   7922  H H73    . DT  A 1 4  ? -1.585  8.269   -3.022  1.00 0.00 ? 104 DT  B H73    5  
ATOM   7923  H H6     . DT  A 1 4  ? -4.253  9.870   -2.279  1.00 0.00 ? 104 DT  B H6     5  
ATOM   7924  P P      . DC  A 1 5  ? -8.974  8.590   -0.009  1.00 0.00 ? 105 DC  B P      5  
ATOM   7925  O OP1    . DC  A 1 5  ? -10.278 8.797   0.662   1.00 0.00 ? 105 DC  B OP1    5  
ATOM   7926  O OP2    . DC  A 1 5  ? -7.955  7.714   0.611   1.00 0.00 ? 105 DC  B OP2    5  
ATOM   7927  O "O5'"  . DC  A 1 5  ? -9.256  8.060   -1.503  1.00 0.00 ? 105 DC  B "O5'"  5  
ATOM   7928  C "C5'"  . DC  A 1 5  ? -10.492 8.351   -2.160  1.00 0.00 ? 105 DC  B "C5'"  5  
ATOM   7929  C "C4'"  . DC  A 1 5  ? -10.784 7.344   -3.267  1.00 0.00 ? 105 DC  B "C4'"  5  
ATOM   7930  O "O4'"  . DC  A 1 5  ? -9.791  7.427   -4.308  1.00 0.00 ? 105 DC  B "O4'"  5  
ATOM   7931  C "C3'"  . DC  A 1 5  ? -10.790 5.929   -2.719  1.00 0.00 ? 105 DC  B "C3'"  5  
ATOM   7932  O "O3'"  . DC  A 1 5  ? -12.096 5.352   -2.878  1.00 0.00 ? 105 DC  B "O3'"  5  
ATOM   7933  C "C2'"  . DC  A 1 5  ? -9.733  5.182   -3.499  1.00 0.00 ? 105 DC  B "C2'"  5  
ATOM   7934  C "C1'"  . DC  A 1 5  ? -9.246  6.123   -4.581  1.00 0.00 ? 105 DC  B "C1'"  5  
ATOM   7935  N N1     . DC  A 1 5  ? -7.774  6.169   -4.618  1.00 0.00 ? 105 DC  B N1     5  
ATOM   7936  C C2     . DC  A 1 5  ? -7.151  5.938   -5.835  1.00 0.00 ? 105 DC  B C2     5  
ATOM   7937  O O2     . DC  A 1 5  ? -7.816  5.687   -6.823  1.00 0.00 ? 105 DC  B O2     5  
ATOM   7938  N N3     . DC  A 1 5  ? -5.792  5.998   -5.885  1.00 0.00 ? 105 DC  B N3     5  
ATOM   7939  C C4     . DC  A 1 5  ? -5.076  6.274   -4.787  1.00 0.00 ? 105 DC  B C4     5  
ATOM   7940  N N4     . DC  A 1 5  ? -3.747  6.329   -4.871  1.00 0.00 ? 105 DC  B N4     5  
ATOM   7941  C C5     . DC  A 1 5  ? -5.715  6.511   -3.530  1.00 0.00 ? 105 DC  B C5     5  
ATOM   7942  C C6     . DC  A 1 5  ? -7.060  6.449   -3.492  1.00 0.00 ? 105 DC  B C6     5  
ATOM   7943  H "H5'"  . DC  A 1 5  ? -10.439 9.350   -2.591  1.00 0.00 ? 105 DC  B "H5'"  5  
ATOM   7944  H "H5''" . DC  A 1 5  ? -11.300 8.321   -1.428  1.00 0.00 ? 105 DC  B "H5''" 5  
ATOM   7945  H "H4'"  . DC  A 1 5  ? -11.760 7.553   -3.699  1.00 0.00 ? 105 DC  B "H4'"  5  
ATOM   7946  H "H3'"  . DC  A 1 5  ? -10.518 5.946   -1.662  1.00 0.00 ? 105 DC  B "H3'"  5  
ATOM   7947  H "H2'"  . DC  A 1 5  ? -8.907  4.914   -2.840  1.00 0.00 ? 105 DC  B "H2'"  5  
ATOM   7948  H "H2''" . DC  A 1 5  ? -10.151 4.287   -3.948  1.00 0.00 ? 105 DC  B "H2''" 5  
ATOM   7949  H "H1'"  . DC  A 1 5  ? -9.621  5.778   -5.541  1.00 0.00 ? 105 DC  B "H1'"  5  
ATOM   7950  H H41    . DC  A 1 5  ? -3.288  6.161   -5.755  1.00 0.00 ? 105 DC  B H41    5  
ATOM   7951  H H42    . DC  A 1 5  ? -3.197  6.536   -4.049  1.00 0.00 ? 105 DC  B H42    5  
ATOM   7952  H H5     . DC  A 1 5  ? -5.136  6.736   -2.635  1.00 0.00 ? 105 DC  B H5     5  
ATOM   7953  H H6     . DC  A 1 5  ? -7.584  6.616   -2.552  1.00 0.00 ? 105 DC  B H6     5  
HETATM 7954  N N1     . 5CM A 1 6  ? -9.626  2.089   -6.553  1.00 0.00 ? 106 5CM B N1     5  
HETATM 7955  C C2     . 5CM A 1 6  ? -8.389  1.968   -7.169  1.00 0.00 ? 106 5CM B C2     5  
HETATM 7956  N N3     . 5CM A 1 6  ? -7.275  1.958   -6.388  1.00 0.00 ? 106 5CM B N3     5  
HETATM 7957  C C4     . 5CM A 1 6  ? -7.367  2.059   -5.057  1.00 0.00 ? 106 5CM B C4     5  
HETATM 7958  C C5     . 5CM A 1 6  ? -8.640  2.183   -4.414  1.00 0.00 ? 106 5CM B C5     5  
HETATM 7959  C C5A    . 5CM A 1 6  ? -8.750  2.308   -2.898  1.00 0.00 ? 106 5CM B C5A    5  
HETATM 7960  C C6     . 5CM A 1 6  ? -9.738  2.192   -5.195  1.00 0.00 ? 106 5CM B C6     5  
HETATM 7961  O O2     . 5CM A 1 6  ? -8.317  1.875   -8.380  1.00 0.00 ? 106 5CM B O2     5  
HETATM 7962  N N4     . 5CM A 1 6  ? -6.253  2.048   -4.323  1.00 0.00 ? 106 5CM B N4     5  
HETATM 7963  C "C1'"  . 5CM A 1 6  ? -10.813 2.131   -7.435  1.00 0.00 ? 106 5CM B "C1'"  5  
HETATM 7964  C "C2'"  . 5CM A 1 6  ? -12.003 1.396   -6.833  1.00 0.00 ? 106 5CM B "C2'"  5  
HETATM 7965  C "C3'"  . 5CM A 1 6  ? -13.193 2.311   -7.004  1.00 0.00 ? 106 5CM B "C3'"  5  
HETATM 7966  C "C4'"  . 5CM A 1 6  ? -12.603 3.677   -7.302  1.00 0.00 ? 106 5CM B "C4'"  5  
HETATM 7967  O "O4'"  . 5CM A 1 6  ? -11.220 3.494   -7.677  1.00 0.00 ? 106 5CM B "O4'"  5  
HETATM 7968  O "O3'"  . 5CM A 1 6  ? -14.039 1.897   -8.090  1.00 0.00 ? 106 5CM B "O3'"  5  
HETATM 7969  C "C5'"  . 5CM A 1 6  ? -12.705 4.571   -6.076  1.00 0.00 ? 106 5CM B "C5'"  5  
HETATM 7970  O "O5'"  . 5CM A 1 6  ? -11.791 4.154   -5.059  1.00 0.00 ? 106 5CM B "O5'"  5  
HETATM 7971  P P      . 5CM A 1 6  ? -12.306 3.909   -3.557  1.00 0.00 ? 106 5CM B P      5  
HETATM 7972  O OP1    . 5CM A 1 6  ? -13.755 3.621   -3.615  1.00 0.00 ? 106 5CM B OP1    5  
HETATM 7973  O OP2    . 5CM A 1 6  ? -11.384 2.962   -2.900  1.00 0.00 ? 106 5CM B OP2    5  
HETATM 7974  H H5A1   . 5CM A 1 6  ? -7.887  2.852   -2.514  1.00 0.00 ? 106 5CM B H5A1   5  
HETATM 7975  H H5A2   . 5CM A 1 6  ? -9.662  2.850   -2.643  1.00 0.00 ? 106 5CM B H5A2   5  
HETATM 7976  H H5A3   . 5CM A 1 6  ? -8.781  1.314   -2.453  1.00 0.00 ? 106 5CM B H5A3   5  
HETATM 7977  H H6     . 5CM A 1 6  ? -10.723 2.281   -4.740  1.00 0.00 ? 106 5CM B H6     5  
HETATM 7978  H HN41   . 5CM A 1 6  ? -6.309  2.126   -3.318  1.00 0.00 ? 106 5CM B HN41   5  
HETATM 7979  H HN42   . 5CM A 1 6  ? -5.354  1.961   -4.774  1.00 0.00 ? 106 5CM B HN42   5  
HETATM 7980  H "H1'"  . 5CM A 1 6  ? -10.560 1.666   -8.388  1.00 0.00 ? 106 5CM B "H1'"  5  
HETATM 7981  H "H2'"  . 5CM A 1 6  ? -11.834 1.208   -5.771  1.00 0.00 ? 106 5CM B "H2'"  5  
HETATM 7982  H "H2''" . 5CM A 1 6  ? -12.168 0.456   -7.354  1.00 0.00 ? 106 5CM B "H2''" 5  
HETATM 7983  H "H3'"  . 5CM A 1 6  ? -13.766 2.351   -6.073  1.00 0.00 ? 106 5CM B "H3'"  5  
HETATM 7984  H "H4'"  . 5CM A 1 6  ? -13.144 4.131   -8.132  1.00 0.00 ? 106 5CM B "H4'"  5  
HETATM 7985  H "H5'"  . 5CM A 1 6  ? -12.478 5.599   -6.361  1.00 0.00 ? 106 5CM B "H5'"  5  
HETATM 7986  H "H5''" . 5CM A 1 6  ? -13.721 4.525   -5.683  1.00 0.00 ? 106 5CM B "H5''" 5  
ATOM   7987  P P      . DG  A 1 7  ? -14.201 0.346   -8.487  1.00 0.00 ? 107 DG  B P      5  
ATOM   7988  O OP1    . DG  A 1 7  ? -15.104 0.258   -9.657  1.00 0.00 ? 107 DG  B OP1    5  
ATOM   7989  O OP2    . DG  A 1 7  ? -14.509 -0.410  -7.259  1.00 0.00 ? 107 DG  B OP2    5  
ATOM   7990  O "O5'"  . DG  A 1 7  ? -12.718 -0.054  -8.962  1.00 0.00 ? 107 DG  B "O5'"  5  
ATOM   7991  C "C5'"  . DG  A 1 7  ? -12.377 -0.064  -10.348 1.00 0.00 ? 107 DG  B "C5'"  5  
ATOM   7992  C "C4'"  . DG  A 1 7  ? -11.640 -1.340  -10.736 1.00 0.00 ? 107 DG  B "C4'"  5  
ATOM   7993  O "O4'"  . DG  A 1 7  ? -10.247 -1.262  -10.356 1.00 0.00 ? 107 DG  B "O4'"  5  
ATOM   7994  C "C3'"  . DG  A 1 7  ? -12.257 -2.553  -10.055 1.00 0.00 ? 107 DG  B "C3'"  5  
ATOM   7995  O "O3'"  . DG  A 1 7  ? -12.866 -3.420  -11.028 1.00 0.00 ? 107 DG  B "O3'"  5  
ATOM   7996  C "C2'"  . DG  A 1 7  ? -11.125 -3.232  -9.319  1.00 0.00 ? 107 DG  B "C2'"  5  
ATOM   7997  C "C1'"  . DG  A 1 7  ? -9.870  -2.427  -9.595  1.00 0.00 ? 107 DG  B "C1'"  5  
ATOM   7998  N N9     . DG  A 1 7  ? -9.210  -2.050  -8.337  1.00 0.00 ? 107 DG  B N9     5  
ATOM   7999  C C8     . DG  A 1 7  ? -9.760  -1.685  -7.159  1.00 0.00 ? 107 DG  B C8     5  
ATOM   8000  N N7     . DG  A 1 7  ? -8.962  -1.436  -6.175  1.00 0.00 ? 107 DG  B N7     5  
ATOM   8001  C C5     . DG  A 1 7  ? -7.712  -1.659  -6.762  1.00 0.00 ? 107 DG  B C5     5  
ATOM   8002  C C6     . DG  A 1 7  ? -6.411  -1.555  -6.200  1.00 0.00 ? 107 DG  B C6     5  
ATOM   8003  O O6     . DG  A 1 7  ? -6.101  -1.241  -5.068  1.00 0.00 ? 107 DG  B O6     5  
ATOM   8004  N N1     . DG  A 1 7  ? -5.428  -1.867  -7.132  1.00 0.00 ? 107 DG  B N1     5  
ATOM   8005  C C2     . DG  A 1 7  ? -5.662  -2.233  -8.442  1.00 0.00 ? 107 DG  B C2     5  
ATOM   8006  N N2     . DG  A 1 7  ? -4.585  -2.497  -9.183  1.00 0.00 ? 107 DG  B N2     5  
ATOM   8007  N N3     . DG  A 1 7  ? -6.882  -2.333  -8.978  1.00 0.00 ? 107 DG  B N3     5  
ATOM   8008  C C4     . DG  A 1 7  ? -7.856  -2.034  -8.088  1.00 0.00 ? 107 DG  B C4     5  
ATOM   8009  H "H5'"  . DG  A 1 7  ? -11.742 0.795   -10.565 1.00 0.00 ? 107 DG  B "H5'"  5  
ATOM   8010  H "H5''" . DG  A 1 7  ? -13.291 0.011   -10.939 1.00 0.00 ? 107 DG  B "H5''" 5  
ATOM   8011  H "H4'"  . DG  A 1 7  ? -11.703 -1.472  -11.814 1.00 0.00 ? 107 DG  B "H4'"  5  
ATOM   8012  H "H3'"  . DG  A 1 7  ? -13.007 -2.220  -9.336  1.00 0.00 ? 107 DG  B "H3'"  5  
ATOM   8013  H "H2'"  . DG  A 1 7  ? -11.332 -3.240  -8.249  1.00 0.00 ? 107 DG  B "H2'"  5  
ATOM   8014  H "H2''" . DG  A 1 7  ? -10.995 -4.249  -9.679  1.00 0.00 ? 107 DG  B "H2''" 5  
ATOM   8015  H "H1'"  . DG  A 1 7  ? -9.185  -3.030  -10.181 1.00 0.00 ? 107 DG  B "H1'"  5  
ATOM   8016  H H8     . DG  A 1 7  ? -10.840 -1.609  -7.049  1.00 0.00 ? 107 DG  B H8     5  
ATOM   8017  H H1     . DG  A 1 7  ? -4.502  -1.817  -6.813  1.00 0.00 ? 107 DG  B H1     5  
ATOM   8018  H H21    . DG  A 1 7  ? -3.663  -2.421  -8.778  1.00 0.00 ? 107 DG  B H21    5  
ATOM   8019  H H22    . DG  A 1 7  ? -4.692  -2.770  -10.149 1.00 0.00 ? 107 DG  B H22    5  
ATOM   8020  P P      . DG  A 1 8  ? -12.751 -5.026  -10.924 1.00 0.00 ? 108 DG  B P      5  
ATOM   8021  O OP1    . DG  A 1 8  ? -13.768 -5.623  -11.817 1.00 0.00 ? 108 DG  B OP1    5  
ATOM   8022  O OP2    . DG  A 1 8  ? -12.716 -5.397  -9.491  1.00 0.00 ? 108 DG  B OP2    5  
ATOM   8023  O "O5'"  . DG  A 1 8  ? -11.296 -5.308  -11.553 1.00 0.00 ? 108 DG  B "O5'"  5  
ATOM   8024  C "C5'"  . DG  A 1 8  ? -10.737 -4.401  -12.509 1.00 0.00 ? 108 DG  B "C5'"  5  
ATOM   8025  C "C4'"  . DG  A 1 8  ? -9.220  -4.544  -12.608 1.00 0.00 ? 108 DG  B "C4'"  5  
ATOM   8026  O "O4'"  . DG  A 1 8  ? -8.589  -4.245  -11.347 1.00 0.00 ? 108 DG  B "O4'"  5  
ATOM   8027  C "C3'"  . DG  A 1 8  ? -8.834  -5.960  -13.010 1.00 0.00 ? 108 DG  B "C3'"  5  
ATOM   8028  O "O3'"  . DG  A 1 8  ? -8.241  -5.967  -14.315 1.00 0.00 ? 108 DG  B "O3'"  5  
ATOM   8029  C "C2'"  . DG  A 1 8  ? -7.856  -6.432  -11.962 1.00 0.00 ? 108 DG  B "C2'"  5  
ATOM   8030  C "C1'"  . DG  A 1 8  ? -7.624  -5.264  -11.023 1.00 0.00 ? 108 DG  B "C1'"  5  
ATOM   8031  N N9     . DG  A 1 8  ? -7.747  -5.673  -9.615  1.00 0.00 ? 108 DG  B N9     5  
ATOM   8032  C C8     . DG  A 1 8  ? -8.855  -5.951  -8.899  1.00 0.00 ? 108 DG  B C8     5  
ATOM   8033  N N7     . DG  A 1 8  ? -8.706  -6.254  -7.652  1.00 0.00 ? 108 DG  B N7     5  
ATOM   8034  C C5     . DG  A 1 8  ? -7.317  -6.172  -7.506  1.00 0.00 ? 108 DG  B C5     5  
ATOM   8035  C C6     . DG  A 1 8  ? -6.505  -6.391  -6.359  1.00 0.00 ? 108 DG  B C6     5  
ATOM   8036  O O6     . DG  A 1 8  ? -6.853  -6.702  -5.237  1.00 0.00 ? 108 DG  B O6     5  
ATOM   8037  N N1     . DG  A 1 8  ? -5.159  -6.202  -6.645  1.00 0.00 ? 108 DG  B N1     5  
ATOM   8038  C C2     . DG  A 1 8  ? -4.650  -5.849  -7.878  1.00 0.00 ? 108 DG  B C2     5  
ATOM   8039  N N2     . DG  A 1 8  ? -3.325  -5.716  -7.953  1.00 0.00 ? 108 DG  B N2     5  
ATOM   8040  N N3     . DG  A 1 8  ? -5.406  -5.641  -8.961  1.00 0.00 ? 108 DG  B N3     5  
ATOM   8041  C C4     . DG  A 1 8  ? -6.722  -5.818  -8.706  1.00 0.00 ? 108 DG  B C4     5  
ATOM   8042  H "H5'"  . DG  A 1 8  ? -10.977 -3.381  -12.211 1.00 0.00 ? 108 DG  B "H5'"  5  
ATOM   8043  H "H5''" . DG  A 1 8  ? -11.176 -4.598  -13.485 1.00 0.00 ? 108 DG  B "H5''" 5  
ATOM   8044  H "H4'"  . DG  A 1 8  ? -8.847  -3.851  -13.360 1.00 0.00 ? 108 DG  B "H4'"  5  
ATOM   8045  H "H3'"  . DG  A 1 8  ? -9.719  -6.599  -12.997 1.00 0.00 ? 108 DG  B "H3'"  5  
ATOM   8046  H "H2'"  . DG  A 1 8  ? -8.273  -7.276  -11.414 1.00 0.00 ? 108 DG  B "H2'"  5  
ATOM   8047  H "H2''" . DG  A 1 8  ? -6.916  -6.720  -12.431 1.00 0.00 ? 108 DG  B "H2''" 5  
ATOM   8048  H "H1'"  . DG  A 1 8  ? -6.631  -4.872  -11.189 1.00 0.00 ? 108 DG  B "H1'"  5  
ATOM   8049  H H8     . DG  A 1 8  ? -9.838  -5.914  -9.360  1.00 0.00 ? 108 DG  B H8     5  
ATOM   8050  H H1     . DG  A 1 8  ? -4.539  -6.335  -5.898  1.00 0.00 ? 108 DG  B H1     5  
ATOM   8051  H H21    . DG  A 1 8  ? -2.755  -5.873  -7.134  1.00 0.00 ? 108 DG  B H21    5  
ATOM   8052  H H22    . DG  A 1 8  ? -2.892  -5.460  -8.828  1.00 0.00 ? 108 DG  B H22    5  
ATOM   8053  P P      . DA  A 1 9  ? -7.304  -7.186  -14.794 1.00 0.00 ? 109 DA  B P      5  
ATOM   8054  O OP1    . DA  A 1 9  ? -6.861  -6.912  -16.179 1.00 0.00 ? 109 DA  B OP1    5  
ATOM   8055  O OP2    . DA  A 1 9  ? -7.997  -8.455  -14.478 1.00 0.00 ? 109 DA  B OP2    5  
ATOM   8056  O "O5'"  . DA  A 1 9  ? -6.027  -7.053  -13.820 1.00 0.00 ? 109 DA  B "O5'"  5  
ATOM   8057  C "C5'"  . DA  A 1 9  ? -4.918  -6.223  -14.179 1.00 0.00 ? 109 DA  B "C5'"  5  
ATOM   8058  C "C4'"  . DA  A 1 9  ? -3.598  -6.977  -14.047 1.00 0.00 ? 109 DA  B "C4'"  5  
ATOM   8059  O "O4'"  . DA  A 1 9  ? -3.201  -7.075  -12.661 1.00 0.00 ? 109 DA  B "O4'"  5  
ATOM   8060  C "C3'"  . DA  A 1 9  ? -3.744  -8.385  -14.601 1.00 0.00 ? 109 DA  B "C3'"  5  
ATOM   8061  O "O3'"  . DA  A 1 9  ? -2.722  -8.660  -15.564 1.00 0.00 ? 109 DA  B "O3'"  5  
ATOM   8062  C "C2'"  . DA  A 1 9  ? -3.634  -9.305  -13.412 1.00 0.00 ? 109 DA  B "C2'"  5  
ATOM   8063  C "C1'"  . DA  A 1 9  ? -3.258  -8.448  -12.218 1.00 0.00 ? 109 DA  B "C1'"  5  
ATOM   8064  N N9     . DA  A 1 9  ? -4.250  -8.606  -11.151 1.00 0.00 ? 109 DA  B N9     5  
ATOM   8065  C C8     . DA  A 1 9  ? -5.589  -8.566  -11.242 1.00 0.00 ? 109 DA  B C8     5  
ATOM   8066  N N7     . DA  A 1 9  ? -6.270  -8.708  -10.155 1.00 0.00 ? 109 DA  B N7     5  
ATOM   8067  C C5     . DA  A 1 9  ? -5.253  -8.867  -9.208  1.00 0.00 ? 109 DA  B C5     5  
ATOM   8068  C C6     . DA  A 1 9  ? -5.268  -9.069  -7.824  1.00 0.00 ? 109 DA  B C6     5  
ATOM   8069  N N6     . DA  A 1 9  ? -6.391  -9.144  -7.111  1.00 0.00 ? 109 DA  B N6     5  
ATOM   8070  N N1     . DA  A 1 9  ? -4.080  -9.188  -7.205  1.00 0.00 ? 109 DA  B N1     5  
ATOM   8071  C C2     . DA  A 1 9  ? -2.943  -9.114  -7.900  1.00 0.00 ? 109 DA  B C2     5  
ATOM   8072  N N3     . DA  A 1 9  ? -2.814  -8.926  -9.211  1.00 0.00 ? 109 DA  B N3     5  
ATOM   8073  C C4     . DA  A 1 9  ? -4.016  -8.809  -9.810  1.00 0.00 ? 109 DA  B C4     5  
ATOM   8074  H "H5'"  . DA  A 1 9  ? -4.898  -5.352  -13.523 1.00 0.00 ? 109 DA  B "H5'"  5  
ATOM   8075  H "H5''" . DA  A 1 9  ? -5.039  -5.891  -15.210 1.00 0.00 ? 109 DA  B "H5''" 5  
ATOM   8076  H "H4'"  . DA  A 1 9  ? -2.826  -6.450  -14.606 1.00 0.00 ? 109 DA  B "H4'"  5  
ATOM   8077  H "H3'"  . DA  A 1 9  ? -4.730  -8.498  -15.058 1.00 0.00 ? 109 DA  B "H3'"  5  
ATOM   8078  H "H2'"  . DA  A 1 9  ? -4.592  -9.792  -13.230 1.00 0.00 ? 109 DA  B "H2'"  5  
ATOM   8079  H "H2''" . DA  A 1 9  ? -2.870  -10.051 -13.586 1.00 0.00 ? 109 DA  B "H2''" 5  
ATOM   8080  H "H1'"  . DA  A 1 9  ? -2.285  -8.751  -11.848 1.00 0.00 ? 109 DA  B "H1'"  5  
ATOM   8081  H H8     . DA  A 1 9  ? -6.070  -8.438  -12.206 1.00 0.00 ? 109 DA  B H8     5  
ATOM   8082  H H61    . DA  A 1 9  ? -6.346  -9.292  -6.113  1.00 0.00 ? 109 DA  B H61    5  
ATOM   8083  H H62    . DA  A 1 9  ? -7.286  -9.054  -7.569  1.00 0.00 ? 109 DA  B H62    5  
ATOM   8084  H H2     . DA  A 1 9  ? -2.019  -9.224  -7.330  1.00 0.00 ? 109 DA  B H2     5  
ATOM   8085  P P      . DT  A 1 10 ? -2.386  -10.174 -15.998 1.00 0.00 ? 110 DT  B P      5  
ATOM   8086  O OP1    . DT  A 1 10 ? -1.730  -10.141 -17.324 1.00 0.00 ? 110 DT  B OP1    5  
ATOM   8087  O OP2    . DT  A 1 10 ? -3.601  -10.995 -15.795 1.00 0.00 ? 110 DT  B OP2    5  
ATOM   8088  O "O5'"  . DT  A 1 10 ? -1.291  -10.614 -14.903 1.00 0.00 ? 110 DT  B "O5'"  5  
ATOM   8089  C "C5'"  . DT  A 1 10 ? -0.518  -9.628  -14.212 1.00 0.00 ? 110 DT  B "C5'"  5  
ATOM   8090  C "C4'"  . DT  A 1 10 ? 0.399   -10.261 -13.168 1.00 0.00 ? 110 DT  B "C4'"  5  
ATOM   8091  O "O4'"  . DT  A 1 10 ? -0.230  -10.253 -11.866 1.00 0.00 ? 110 DT  B "O4'"  5  
ATOM   8092  C "C3'"  . DT  A 1 10 ? 0.718   -11.701 -13.536 1.00 0.00 ? 110 DT  B "C3'"  5  
ATOM   8093  O "O3'"  . DT  A 1 10 ? 2.134   -11.893 -13.642 1.00 0.00 ? 110 DT  B "O3'"  5  
ATOM   8094  C "C2'"  . DT  A 1 10 ? 0.135   -12.549 -12.436 1.00 0.00 ? 110 DT  B "C2'"  5  
ATOM   8095  C "C1'"  . DT  A 1 10 ? -0.359  -11.600 -11.360 1.00 0.00 ? 110 DT  B "C1'"  5  
ATOM   8096  N N1     . DT  A 1 10 ? -1.758  -11.894 -11.005 1.00 0.00 ? 110 DT  B N1     5  
ATOM   8097  C C2     . DT  A 1 10 ? -2.051  -12.083 -9.668  1.00 0.00 ? 110 DT  B C2     5  
ATOM   8098  O O2     . DT  A 1 10 ? -1.199  -12.020 -8.804  1.00 0.00 ? 110 DT  B O2     5  
ATOM   8099  N N3     . DT  A 1 10 ? -3.374  -12.348 -9.369  1.00 0.00 ? 110 DT  B N3     5  
ATOM   8100  C C4     . DT  A 1 10 ? -4.413  -12.436 -10.279 1.00 0.00 ? 110 DT  B C4     5  
ATOM   8101  O O4     . DT  A 1 10 ? -5.546  -12.673 -9.907  1.00 0.00 ? 110 DT  B O4     5  
ATOM   8102  C C5     . DT  A 1 10 ? -4.010  -12.225 -11.652 1.00 0.00 ? 110 DT  B C5     5  
ATOM   8103  C C7     . DT  A 1 10 ? -5.056  -12.294 -12.759 1.00 0.00 ? 110 DT  B C7     5  
ATOM   8104  C C6     . DT  A 1 10 ? -2.726  -11.968 -11.967 1.00 0.00 ? 110 DT  B C6     5  
ATOM   8105  H "H5'"  . DT  A 1 10 ? -1.195  -8.931  -13.716 1.00 0.00 ? 110 DT  B "H5'"  5  
ATOM   8106  H "H5''" . DT  A 1 10 ? 0.089   -9.081  -14.933 1.00 0.00 ? 110 DT  B "H5''" 5  
ATOM   8107  H "H4'"  . DT  A 1 10 ? 1.326   -9.691  -13.117 1.00 0.00 ? 110 DT  B "H4'"  5  
ATOM   8108  H "H3'"  . DT  A 1 10 ? 0.236   -11.952 -14.484 1.00 0.00 ? 110 DT  B "H3'"  5  
ATOM   8109  H "H2'"  . DT  A 1 10 ? -0.697  -13.138 -12.821 1.00 0.00 ? 110 DT  B "H2'"  5  
ATOM   8110  H "H2''" . DT  A 1 10 ? 0.897   -13.207 -12.027 1.00 0.00 ? 110 DT  B "H2''" 5  
ATOM   8111  H "H1'"  . DT  A 1 10 ? 0.264   -11.709 -10.473 1.00 0.00 ? 110 DT  B "H1'"  5  
ATOM   8112  H H3     . DT  A 1 10 ? -3.597  -12.485 -8.425  1.00 0.00 ? 110 DT  B H3     5  
ATOM   8113  H H71    . DT  A 1 10 ? -5.711  -11.425 -12.696 1.00 0.00 ? 110 DT  B H71    5  
ATOM   8114  H H72    . DT  A 1 10 ? -4.558  -12.303 -13.730 1.00 0.00 ? 110 DT  B H72    5  
ATOM   8115  H H73    . DT  A 1 10 ? -5.647  -13.203 -12.646 1.00 0.00 ? 110 DT  B H73    5  
ATOM   8116  H H6     . DT  A 1 10 ? -2.449  -11.825 -13.010 1.00 0.00 ? 110 DT  B H6     5  
ATOM   8117  P P      . DA  A 1 11 ? 2.766   -13.374 -13.653 1.00 0.00 ? 111 DA  B P      5  
ATOM   8118  O OP1    . DA  A 1 11 ? 4.238   -13.248 -13.748 1.00 0.00 ? 111 DA  B OP1    5  
ATOM   8119  O OP2    . DA  A 1 11 ? 2.030   -14.185 -14.649 1.00 0.00 ? 111 DA  B OP2    5  
ATOM   8120  O "O5'"  . DA  A 1 11 ? 2.401   -13.926 -12.184 1.00 0.00 ? 111 DA  B "O5'"  5  
ATOM   8121  C "C5'"  . DA  A 1 11 ? 3.127   -13.479 -11.035 1.00 0.00 ? 111 DA  B "C5'"  5  
ATOM   8122  C "C4'"  . DA  A 1 11 ? 3.168   -14.553 -9.953  1.00 0.00 ? 111 DA  B "C4'"  5  
ATOM   8123  O "O4'"  . DA  A 1 11 ? 1.967   -14.514 -9.150  1.00 0.00 ? 111 DA  B "O4'"  5  
ATOM   8124  C "C3'"  . DA  A 1 11 ? 3.278   -15.933 -10.583 1.00 0.00 ? 111 DA  B "C3'"  5  
ATOM   8125  O "O3'"  . DA  A 1 11 ? 4.443   -16.617 -10.110 1.00 0.00 ? 111 DA  B "O3'"  5  
ATOM   8126  C "C2'"  . DA  A 1 11 ? 2.025   -16.669 -10.189 1.00 0.00 ? 111 DA  B "C2'"  5  
ATOM   8127  C "C1'"  . DA  A 1 11 ? 1.263   -15.771 -9.233  1.00 0.00 ? 111 DA  B "C1'"  5  
ATOM   8128  N N9     . DA  A 1 11 ? -0.112  -15.574 -9.708  1.00 0.00 ? 111 DA  B N9     5  
ATOM   8129  C C8     . DA  A 1 11 ? -0.547  -15.311 -10.953 1.00 0.00 ? 111 DA  B C8     5  
ATOM   8130  N N7     . DA  A 1 11 ? -1.820  -15.183 -11.130 1.00 0.00 ? 111 DA  B N7     5  
ATOM   8131  C C5     . DA  A 1 11 ? -2.302  -15.390 -9.832  1.00 0.00 ? 111 DA  B C5     5  
ATOM   8132  C C6     . DA  A 1 11 ? -3.591  -15.401 -9.288  1.00 0.00 ? 111 DA  B C6     5  
ATOM   8133  N N6     . DA  A 1 11 ? -4.691  -15.185 -10.010 1.00 0.00 ? 111 DA  B N6     5  
ATOM   8134  N N1     . DA  A 1 11 ? -3.703  -15.644 -7.970  1.00 0.00 ? 111 DA  B N1     5  
ATOM   8135  C C2     . DA  A 1 11 ? -2.616  -15.862 -7.228  1.00 0.00 ? 111 DA  B C2     5  
ATOM   8136  N N3     . DA  A 1 11 ? -1.352  -15.875 -7.639  1.00 0.00 ? 111 DA  B N3     5  
ATOM   8137  C C4     . DA  A 1 11 ? -1.265  -15.631 -8.961  1.00 0.00 ? 111 DA  B C4     5  
ATOM   8138  H "H5'"  . DA  A 1 11 ? 2.645   -12.587 -10.634 1.00 0.00 ? 111 DA  B "H5'"  5  
ATOM   8139  H "H5''" . DA  A 1 11 ? 4.146   -13.230 -11.331 1.00 0.00 ? 111 DA  B "H5''" 5  
ATOM   8140  H "H4'"  . DA  A 1 11 ? 4.032   -14.381 -9.312  1.00 0.00 ? 111 DA  B "H4'"  5  
ATOM   8141  H "H3'"  . DA  A 1 11 ? 3.318   -15.836 -11.670 1.00 0.00 ? 111 DA  B "H3'"  5  
ATOM   8142  H "H2'"  . DA  A 1 11 ? 1.419   -16.867 -11.074 1.00 0.00 ? 111 DA  B "H2'"  5  
ATOM   8143  H "H2''" . DA  A 1 11 ? 2.278   -17.603 -9.699  1.00 0.00 ? 111 DA  B "H2''" 5  
ATOM   8144  H "H1'"  . DA  A 1 11 ? 1.234   -16.232 -8.252  1.00 0.00 ? 111 DA  B "H1'"  5  
ATOM   8145  H H8     . DA  A 1 11 ? 0.155   -15.230 -11.778 1.00 0.00 ? 111 DA  B H8     5  
ATOM   8146  H H61    . DA  A 1 11 ? -5.598  -15.204 -9.566  1.00 0.00 ? 111 DA  B H61    5  
ATOM   8147  H H62    . DA  A 1 11 ? -4.617  -15.002 -11.000 1.00 0.00 ? 111 DA  B H62    5  
ATOM   8148  H H2     . DA  A 1 11 ? -2.782  -16.048 -6.167  1.00 0.00 ? 111 DA  B H2     5  
ATOM   8149  P P      . DC  A 1 12 ? 5.129   -17.771 -10.999 1.00 0.00 ? 112 DC  B P      5  
ATOM   8150  O OP1    . DC  A 1 12 ? 6.580   -17.491 -11.082 1.00 0.00 ? 112 DC  B OP1    5  
ATOM   8151  O OP2    . DC  A 1 12 ? 4.337   -17.933 -12.239 1.00 0.00 ? 112 DC  B OP2    5  
ATOM   8152  O "O5'"  . DC  A 1 12 ? 4.921   -19.084 -10.093 1.00 0.00 ? 112 DC  B "O5'"  5  
ATOM   8153  C "C5'"  . DC  A 1 12 ? 4.820   -18.976 -8.670  1.00 0.00 ? 112 DC  B "C5'"  5  
ATOM   8154  C "C4'"  . DC  A 1 12 ? 3.970   -20.098 -8.082  1.00 0.00 ? 112 DC  B "C4'"  5  
ATOM   8155  O "O4'"  . DC  A 1 12 ? 2.587   -19.699 -7.992  1.00 0.00 ? 112 DC  B "O4'"  5  
ATOM   8156  C "C3'"  . DC  A 1 12 ? 4.050   -21.348 -8.946  1.00 0.00 ? 112 DC  B "C3'"  5  
ATOM   8157  O "O3'"  . DC  A 1 12 ? 4.746   -22.396 -8.265  1.00 0.00 ? 112 DC  B "O3'"  5  
ATOM   8158  C "C2'"  . DC  A 1 12 ? 2.625   -21.743 -9.230  1.00 0.00 ? 112 DC  B "C2'"  5  
ATOM   8159  C "C1'"  . DC  A 1 12 ? 1.738   -20.732 -8.524  1.00 0.00 ? 112 DC  B "C1'"  5  
ATOM   8160  N N1     . DC  A 1 12 ? 0.740   -20.167 -9.452  1.00 0.00 ? 112 DC  B N1     5  
ATOM   8161  C C2     . DC  A 1 12 ? -0.585  -20.156 -9.041  1.00 0.00 ? 112 DC  B C2     5  
ATOM   8162  O O2     . DC  A 1 12 ? -0.889  -20.605 -7.953  1.00 0.00 ? 112 DC  B O2     5  
ATOM   8163  N N3     . DC  A 1 12 ? -1.518  -19.634 -9.883  1.00 0.00 ? 112 DC  B N3     5  
ATOM   8164  C C4     . DC  A 1 12 ? -1.168  -19.142 -11.079 1.00 0.00 ? 112 DC  B C4     5  
ATOM   8165  N N4     . DC  A 1 12 ? -2.106  -18.637 -11.878 1.00 0.00 ? 112 DC  B N4     5  
ATOM   8166  C C5     . DC  A 1 12 ? 0.198   -19.152 -11.506 1.00 0.00 ? 112 DC  B C5     5  
ATOM   8167  C C6     . DC  A 1 12 ? 1.113   -19.671 -10.666 1.00 0.00 ? 112 DC  B C6     5  
ATOM   8168  H "H5'"  . DC  A 1 12 ? 4.367   -18.017 -8.418  1.00 0.00 ? 112 DC  B "H5'"  5  
ATOM   8169  H "H5''" . DC  A 1 12 ? 5.818   -19.022 -8.238  1.00 0.00 ? 112 DC  B "H5''" 5  
ATOM   8170  H "H4'"  . DC  A 1 12 ? 4.331   -20.336 -7.083  1.00 0.00 ? 112 DC  B "H4'"  5  
ATOM   8171  H "H3'"  . DC  A 1 12 ? 4.556   -21.111 -9.883  1.00 0.00 ? 112 DC  B "H3'"  5  
ATOM   8172  H "HO3'" . DC  A 1 12 ? 4.137   -22.778 -7.628  1.00 0.00 ? 112 DC  B "HO3'" 5  
ATOM   8173  H "H2'"  . DC  A 1 12 ? 2.438   -21.718 -10.304 1.00 0.00 ? 112 DC  B "H2'"  5  
ATOM   8174  H "H2''" . DC  A 1 12 ? 2.431   -22.743 -8.842  1.00 0.00 ? 112 DC  B "H2''" 5  
ATOM   8175  H "H1'"  . DC  A 1 12 ? 1.225   -21.224 -7.701  1.00 0.00 ? 112 DC  B "H1'"  5  
ATOM   8176  H H41    . DC  A 1 12 ? -3.071  -18.628 -11.583 1.00 0.00 ? 112 DC  B H41    5  
ATOM   8177  H H42    . DC  A 1 12 ? -1.852  -18.264 -12.782 1.00 0.00 ? 112 DC  B H42    5  
ATOM   8178  H H5     . DC  A 1 12 ? 0.487   -18.752 -12.479 1.00 0.00 ? 112 DC  B H5     5  
ATOM   8179  H H6     . DC  A 1 12 ? 2.162   -19.698 -10.960 1.00 0.00 ? 112 DC  B H6     5  
ATOM   8180  O "O5'"  . DG  B 1 1  ? -11.743 -21.318 -8.426  1.00 0.00 ? 113 DG  C "O5'"  5  
ATOM   8181  C "C5'"  . DG  B 1 1  ? -11.520 -22.101 -7.250  1.00 0.00 ? 113 DG  C "C5'"  5  
ATOM   8182  C "C4'"  . DG  B 1 1  ? -10.588 -21.392 -6.273  1.00 0.00 ? 113 DG  C "C4'"  5  
ATOM   8183  O "O4'"  . DG  B 1 1  ? -9.249  -21.321 -6.800  1.00 0.00 ? 113 DG  C "O4'"  5  
ATOM   8184  C "C3'"  . DG  B 1 1  ? -11.070 -19.975 -5.999  1.00 0.00 ? 113 DG  C "C3'"  5  
ATOM   8185  O "O3'"  . DG  B 1 1  ? -11.532 -19.845 -4.650  1.00 0.00 ? 113 DG  C "O3'"  5  
ATOM   8186  C "C2'"  . DG  B 1 1  ? -9.882  -19.082 -6.254  1.00 0.00 ? 113 DG  C "C2'"  5  
ATOM   8187  C "C1'"  . DG  B 1 1  ? -8.732  -19.985 -6.661  1.00 0.00 ? 113 DG  C "C1'"  5  
ATOM   8188  N N9     . DG  B 1 1  ? -8.117  -19.524 -7.916  1.00 0.00 ? 113 DG  C N9     5  
ATOM   8189  C C8     . DG  B 1 1  ? -8.694  -18.938 -8.988  1.00 0.00 ? 113 DG  C C8     5  
ATOM   8190  N N7     . DG  B 1 1  ? -7.933  -18.619 -9.980  1.00 0.00 ? 113 DG  C N7     5  
ATOM   8191  C C5     . DG  B 1 1  ? -6.680  -19.039 -9.523  1.00 0.00 ? 113 DG  C C5     5  
ATOM   8192  C C6     . DG  B 1 1  ? -5.410  -18.969 -10.155 1.00 0.00 ? 113 DG  C C6     5  
ATOM   8193  O O6     . DG  B 1 1  ? -5.135  -18.519 -11.249 1.00 0.00 ? 113 DG  C O6     5  
ATOM   8194  N N1     . DG  B 1 1  ? -4.410  -19.504 -9.350  1.00 0.00 ? 113 DG  C N1     5  
ATOM   8195  C C2     . DG  B 1 1  ? -4.605  -20.042 -8.093  1.00 0.00 ? 113 DG  C C2     5  
ATOM   8196  N N2     . DG  B 1 1  ? -3.518  -20.507 -7.477  1.00 0.00 ? 113 DG  C N2     5  
ATOM   8197  N N3     . DG  B 1 1  ? -5.797  -20.112 -7.492  1.00 0.00 ? 113 DG  C N3     5  
ATOM   8198  C C4     . DG  B 1 1  ? -6.785  -19.596 -8.257  1.00 0.00 ? 113 DG  C C4     5  
ATOM   8199  H "H5'"  . DG  B 1 1  ? -11.075 -23.054 -7.537  1.00 0.00 ? 113 DG  C "H5'"  5  
ATOM   8200  H "H5''" . DG  B 1 1  ? -12.475 -22.287 -6.761  1.00 0.00 ? 113 DG  C "H5''" 5  
ATOM   8201  H "H4'"  . DG  B 1 1  ? -10.565 -21.944 -5.335  1.00 0.00 ? 113 DG  C "H4'"  5  
ATOM   8202  H "H3'"  . DG  B 1 1  ? -11.872 -19.721 -6.695  1.00 0.00 ? 113 DG  C "H3'"  5  
ATOM   8203  H "H2'"  . DG  B 1 1  ? -10.109 -18.381 -7.057  1.00 0.00 ? 113 DG  C "H2'"  5  
ATOM   8204  H "H2''" . DG  B 1 1  ? -9.624  -18.536 -5.346  1.00 0.00 ? 113 DG  C "H2''" 5  
ATOM   8205  H "H1'"  . DG  B 1 1  ? -7.985  -19.978 -5.876  1.00 0.00 ? 113 DG  C "H1'"  5  
ATOM   8206  H H8     . DG  B 1 1  ? -9.763  -18.741 -9.007  1.00 0.00 ? 113 DG  C H8     5  
ATOM   8207  H H1     . DG  B 1 1  ? -3.504  -19.490 -9.722  1.00 0.00 ? 113 DG  C H1     5  
ATOM   8208  H H21    . DG  B 1 1  ? -2.618  -20.454 -7.932  1.00 0.00 ? 113 DG  C H21    5  
ATOM   8209  H H22    . DG  B 1 1  ? -3.594  -20.912 -6.556  1.00 0.00 ? 113 DG  C H22    5  
ATOM   8210  H "HO5'" . DG  B 1 1  ? -11.270 -20.490 -8.311  1.00 0.00 ? 113 DG  C "HO5'" 5  
ATOM   8211  P P      . DT  B 1 2  ? -11.690 -18.393 -3.974  1.00 0.00 ? 114 DT  C P      5  
ATOM   8212  O OP1    . DT  B 1 2  ? -12.712 -18.486 -2.907  1.00 0.00 ? 114 DT  C OP1    5  
ATOM   8213  O OP2    . DT  B 1 2  ? -11.841 -17.391 -5.053  1.00 0.00 ? 114 DT  C OP2    5  
ATOM   8214  O "O5'"  . DT  B 1 2  ? -10.254 -18.173 -3.279  1.00 0.00 ? 114 DT  C "O5'"  5  
ATOM   8215  C "C5'"  . DT  B 1 2  ? -9.406  -19.290 -2.997  1.00 0.00 ? 114 DT  C "C5'"  5  
ATOM   8216  C "C4'"  . DT  B 1 2  ? -8.047  -18.845 -2.463  1.00 0.00 ? 114 DT  C "C4'"  5  
ATOM   8217  O "O4'"  . DT  B 1 2  ? -7.107  -18.671 -3.545  1.00 0.00 ? 114 DT  C "O4'"  5  
ATOM   8218  C "C3'"  . DT  B 1 2  ? -8.168  -17.526 -1.716  1.00 0.00 ? 114 DT  C "C3'"  5  
ATOM   8219  O "O3'"  . DT  B 1 2  ? -7.702  -17.673 -0.365  1.00 0.00 ? 114 DT  C "O3'"  5  
ATOM   8220  C "C2'"  . DT  B 1 2  ? -7.333  -16.533 -2.493  1.00 0.00 ? 114 DT  C "C2'"  5  
ATOM   8221  C "C1'"  . DT  B 1 2  ? -6.634  -17.309 -3.595  1.00 0.00 ? 114 DT  C "C1'"  5  
ATOM   8222  N N1     . DT  B 1 2  ? -6.905  -16.712 -4.915  1.00 0.00 ? 114 DT  C N1     5  
ATOM   8223  C C2     . DT  B 1 2  ? -5.822  -16.465 -5.737  1.00 0.00 ? 114 DT  C C2     5  
ATOM   8224  O O2     . DT  B 1 2  ? -4.681  -16.702 -5.391  1.00 0.00 ? 114 DT  C O2     5  
ATOM   8225  N N3     . DT  B 1 2  ? -6.111  -15.933 -6.978  1.00 0.00 ? 114 DT  C N3     5  
ATOM   8226  C C4     . DT  B 1 2  ? -7.372  -15.630 -7.461  1.00 0.00 ? 114 DT  C C4     5  
ATOM   8227  O O4     . DT  B 1 2  ? -7.512  -15.164 -8.575  1.00 0.00 ? 114 DT  C O4     5  
ATOM   8228  C C5     . DT  B 1 2  ? -8.442  -15.920 -6.533  1.00 0.00 ? 114 DT  C C5     5  
ATOM   8229  C C7     . DT  B 1 2  ? -9.884  -15.632 -6.937  1.00 0.00 ? 114 DT  C C7     5  
ATOM   8230  C C6     . DT  B 1 2  ? -8.184  -16.439 -5.315  1.00 0.00 ? 114 DT  C C6     5  
ATOM   8231  H "H5'"  . DT  B 1 2  ? -9.258  -19.864 -3.912  1.00 0.00 ? 114 DT  C "H5'"  5  
ATOM   8232  H "H5''" . DT  B 1 2  ? -9.889  -19.924 -2.254  1.00 0.00 ? 114 DT  C "H5''" 5  
ATOM   8233  H "H4'"  . DT  B 1 2  ? -7.666  -19.606 -1.782  1.00 0.00 ? 114 DT  C "H4'"  5  
ATOM   8234  H "H3'"  . DT  B 1 2  ? -9.211  -17.202 -1.717  1.00 0.00 ? 114 DT  C "H3'"  5  
ATOM   8235  H "H2'"  . DT  B 1 2  ? -7.976  -15.769 -2.928  1.00 0.00 ? 114 DT  C "H2'"  5  
ATOM   8236  H "H2''" . DT  B 1 2  ? -6.595  -16.071 -1.843  1.00 0.00 ? 114 DT  C "H2''" 5  
ATOM   8237  H "H1'"  . DT  B 1 2  ? -5.560  -17.294 -3.411  1.00 0.00 ? 114 DT  C "H1'"  5  
ATOM   8238  H H3     . DT  B 1 2  ? -5.353  -15.754 -7.572  1.00 0.00 ? 114 DT  C H3     5  
ATOM   8239  H H71    . DT  B 1 2  ? -10.561 -16.087 -6.214  1.00 0.00 ? 114 DT  C H71    5  
ATOM   8240  H H72    . DT  B 1 2  ? -10.047 -14.554 -6.960  1.00 0.00 ? 114 DT  C H72    5  
ATOM   8241  H H73    . DT  B 1 2  ? -10.074 -16.050 -7.925  1.00 0.00 ? 114 DT  C H73    5  
ATOM   8242  H H6     . DT  B 1 2  ? -9.010  -16.642 -4.634  1.00 0.00 ? 114 DT  C H6     5  
ATOM   8243  P P      . DA  B 1 3  ? -7.025  -16.447 0.430   1.00 0.00 ? 115 DA  C P      5  
ATOM   8244  O OP1    . DA  B 1 3  ? -6.653  -16.919 1.782   1.00 0.00 ? 115 DA  C OP1    5  
ATOM   8245  O OP2    . DA  B 1 3  ? -7.894  -15.258 0.276   1.00 0.00 ? 115 DA  C OP2    5  
ATOM   8246  O "O5'"  . DA  B 1 3  ? -5.673  -16.197 -0.408  1.00 0.00 ? 115 DA  C "O5'"  5  
ATOM   8247  C "C5'"  . DA  B 1 3  ? -4.393  -16.447 0.178   1.00 0.00 ? 115 DA  C "C5'"  5  
ATOM   8248  C "C4'"  . DA  B 1 3  ? -3.431  -15.293 -0.081  1.00 0.00 ? 115 DA  C "C4'"  5  
ATOM   8249  O "O4'"  . DA  B 1 3  ? -3.257  -15.086 -1.496  1.00 0.00 ? 115 DA  C "O4'"  5  
ATOM   8250  C "C3'"  . DA  B 1 3  ? -3.963  -14.007 0.531   1.00 0.00 ? 115 DA  C "C3'"  5  
ATOM   8251  O "O3'"  . DA  B 1 3  ? -3.101  -13.551 1.580   1.00 0.00 ? 115 DA  C "O3'"  5  
ATOM   8252  C "C2'"  . DA  B 1 3  ? -4.025  -13.010 -0.596  1.00 0.00 ? 115 DA  C "C2'"  5  
ATOM   8253  C "C1'"  . DA  B 1 3  ? -3.464  -13.699 -1.825  1.00 0.00 ? 115 DA  C "C1'"  5  
ATOM   8254  N N9     . DA  B 1 3  ? -4.388  -13.564 -2.962  1.00 0.00 ? 115 DA  C N9     5  
ATOM   8255  C C8     . DA  B 1 3  ? -5.735  -13.683 -2.985  1.00 0.00 ? 115 DA  C C8     5  
ATOM   8256  N N7     . DA  B 1 3  ? -6.328  -13.529 -4.121  1.00 0.00 ? 115 DA  C N7     5  
ATOM   8257  C C5     . DA  B 1 3  ? -5.247  -13.274 -4.971  1.00 0.00 ? 115 DA  C C5     5  
ATOM   8258  C C6     . DA  B 1 3  ? -5.162  -13.013 -6.342  1.00 0.00 ? 115 DA  C C6     5  
ATOM   8259  N N6     . DA  B 1 3  ? -6.226  -12.961 -7.142  1.00 0.00 ? 115 DA  C N6     5  
ATOM   8260  N N1     . DA  B 1 3  ? -3.937  -12.806 -6.857  1.00 0.00 ? 115 DA  C N1     5  
ATOM   8261  C C2     . DA  B 1 3  ? -2.858  -12.850 -6.074  1.00 0.00 ? 115 DA  C C2     5  
ATOM   8262  N N3     . DA  B 1 3  ? -2.823  -13.086 -4.765  1.00 0.00 ? 115 DA  C N3     5  
ATOM   8263  C C4     . DA  B 1 3  ? -4.061  -13.292 -4.272  1.00 0.00 ? 115 DA  C C4     5  
ATOM   8264  H "H5'"  . DA  B 1 3  ? -3.977  -17.360 -0.247  1.00 0.00 ? 115 DA  C "H5'"  5  
ATOM   8265  H "H5''" . DA  B 1 3  ? -4.512  -16.577 1.254   1.00 0.00 ? 115 DA  C "H5''" 5  
ATOM   8266  H "H4'"  . DA  B 1 3  ? -2.465  -15.521 0.360   1.00 0.00 ? 115 DA  C "H4'"  5  
ATOM   8267  H "H3'"  . DA  B 1 3  ? -4.967  -14.178 0.923   1.00 0.00 ? 115 DA  C "H3'"  5  
ATOM   8268  H "H2'"  . DA  B 1 3  ? -5.060  -12.717 -0.775  1.00 0.00 ? 115 DA  C "H2'"  5  
ATOM   8269  H "H2''" . DA  B 1 3  ? -3.429  -12.135 -0.356  1.00 0.00 ? 115 DA  C "H2''" 5  
ATOM   8270  H "H1'"  . DA  B 1 3  ? -2.507  -13.253 -2.081  1.00 0.00 ? 115 DA  C "H1'"  5  
ATOM   8271  H H8     . DA  B 1 3  ? -6.294  -13.896 -2.076  1.00 0.00 ? 115 DA  C H8     5  
ATOM   8272  H H61    . DA  B 1 3  ? -6.110  -12.770 -8.127  1.00 0.00 ? 115 DA  C H61    5  
ATOM   8273  H H62    . DA  B 1 3  ? -7.150  -13.114 -6.763  1.00 0.00 ? 115 DA  C H62    5  
ATOM   8274  H H2     . DA  B 1 3  ? -1.899  -12.672 -6.562  1.00 0.00 ? 115 DA  C H2     5  
ATOM   8275  P P      . DT  B 1 4  ? -3.178  -12.033 2.107   1.00 0.00 ? 116 DT  C P      5  
ATOM   8276  O OP1    . DT  B 1 4  ? -2.822  -12.021 3.543   1.00 0.00 ? 116 DT  C OP1    5  
ATOM   8277  O OP2    . DT  B 1 4  ? -4.464  -11.452 1.660   1.00 0.00 ? 116 DT  C OP2    5  
ATOM   8278  O "O5'"  . DT  B 1 4  ? -1.990  -11.321 1.287   1.00 0.00 ? 116 DT  C "O5'"  5  
ATOM   8279  C "C5'"  . DT  B 1 4  ? -0.998  -12.106 0.617   1.00 0.00 ? 116 DT  C "C5'"  5  
ATOM   8280  C "C4'"  . DT  B 1 4  ? -0.209  -11.270 -0.386  1.00 0.00 ? 116 DT  C "C4'"  5  
ATOM   8281  O "O4'"  . DT  B 1 4  ? -0.803  -11.350 -1.698  1.00 0.00 ? 116 DT  C "O4'"  5  
ATOM   8282  C "C3'"  . DT  B 1 4  ? -0.179  -9.809  0.037   1.00 0.00 ? 116 DT  C "C3'"  5  
ATOM   8283  O "O3'"  . DT  B 1 4  ? 1.162   -9.398  0.324   1.00 0.00 ? 116 DT  C "O3'"  5  
ATOM   8284  C "C2'"  . DT  B 1 4  ? -0.752  -9.033  -1.121  1.00 0.00 ? 116 DT  C "C2'"  5  
ATOM   8285  C "C1'"  . DT  B 1 4  ? -0.992  -10.029 -2.238  1.00 0.00 ? 116 DT  C "C1'"  5  
ATOM   8286  N N1     . DT  B 1 4  ? -2.347  -9.880  -2.792  1.00 0.00 ? 116 DT  C N1     5  
ATOM   8287  C C2     . DT  B 1 4  ? -2.464  -9.683  -4.155  1.00 0.00 ? 116 DT  C C2     5  
ATOM   8288  O O2     . DT  B 1 4  ? -1.494  -9.616  -4.884  1.00 0.00 ? 116 DT  C O2     5  
ATOM   8289  N N3     . DT  B 1 4  ? -3.753  -9.568  -4.641  1.00 0.00 ? 116 DT  C N3     5  
ATOM   8290  C C4     . DT  B 1 4  ? -4.915  -9.634  -3.891  1.00 0.00 ? 116 DT  C C4     5  
ATOM   8291  O O4     . DT  B 1 4  ? -6.002  -9.522  -4.422  1.00 0.00 ? 116 DT  C O4     5  
ATOM   8292  C C5     . DT  B 1 4  ? -4.691  -9.840  -2.478  1.00 0.00 ? 116 DT  C C5     5  
ATOM   8293  C C7     . DT  B 1 4  ? -5.885  -9.931  -1.533  1.00 0.00 ? 116 DT  C C7     5  
ATOM   8294  C C6     . DT  B 1 4  ? -3.442  -9.953  -1.982  1.00 0.00 ? 116 DT  C C6     5  
ATOM   8295  H "H5'"  . DT  B 1 4  ? -1.488  -12.925 0.091   1.00 0.00 ? 116 DT  C "H5'"  5  
ATOM   8296  H "H5''" . DT  B 1 4  ? -0.311  -12.517 1.356   1.00 0.00 ? 116 DT  C "H5''" 5  
ATOM   8297  H "H4'"  . DT  B 1 4  ? 0.811   -11.643 -0.443  1.00 0.00 ? 116 DT  C "H4'"  5  
ATOM   8298  H "H3'"  . DT  B 1 4  ? -0.809  -9.670  0.917   1.00 0.00 ? 116 DT  C "H3'"  5  
ATOM   8299  H "H2'"  . DT  B 1 4  ? -1.695  -8.571  -0.827  1.00 0.00 ? 116 DT  C "H2'"  5  
ATOM   8300  H "H2''" . DT  B 1 4  ? -0.051  -8.272  -1.447  1.00 0.00 ? 116 DT  C "H2''" 5  
ATOM   8301  H "H1'"  . DT  B 1 4  ? -0.260  -9.863  -3.024  1.00 0.00 ? 116 DT  C "H1'"  5  
ATOM   8302  H H3     . DT  B 1 4  ? -3.852  -9.429  -5.606  1.00 0.00 ? 116 DT  C H3     5  
ATOM   8303  H H71    . DT  B 1 4  ? -6.805  -9.761  -2.094  1.00 0.00 ? 116 DT  C H71    5  
ATOM   8304  H H72    . DT  B 1 4  ? -5.914  -10.920 -1.078  1.00 0.00 ? 116 DT  C H72    5  
ATOM   8305  H H73    . DT  B 1 4  ? -5.790  -9.174  -0.754  1.00 0.00 ? 116 DT  C H73    5  
ATOM   8306  H H6     . DT  B 1 4  ? -3.301  -10.097 -0.911  1.00 0.00 ? 116 DT  C H6     5  
ATOM   8307  P P      . DC  B 1 5  ? 1.564   -7.839  0.332   1.00 0.00 ? 117 DC  C P      5  
ATOM   8308  O OP1    . DC  B 1 5  ? 2.907   -7.712  0.937   1.00 0.00 ? 117 DC  C OP1    5  
ATOM   8309  O OP2    . DC  B 1 5  ? 0.427   -7.068  0.886   1.00 0.00 ? 117 DC  C OP2    5  
ATOM   8310  O "O5'"  . DC  B 1 5  ? 1.686   -7.501  -1.237  1.00 0.00 ? 117 DC  C "O5'"  5  
ATOM   8311  C "C5'"  . DC  B 1 5  ? 2.960   -7.524  -1.889  1.00 0.00 ? 117 DC  C "C5'"  5  
ATOM   8312  C "C4'"  . DC  B 1 5  ? 2.920   -6.772  -3.214  1.00 0.00 ? 117 DC  C "C4'"  5  
ATOM   8313  O "O4'"  . DC  B 1 5  ? 1.755   -7.151  -3.977  1.00 0.00 ? 117 DC  C "O4'"  5  
ATOM   8314  C "C3'"  . DC  B 1 5  ? 2.874   -5.273  -2.980  1.00 0.00 ? 117 DC  C "C3'"  5  
ATOM   8315  O "O3'"  . DC  B 1 5  ? 3.997   -4.635  -3.604  1.00 0.00 ? 117 DC  C "O3'"  5  
ATOM   8316  C "C2'"  . DC  B 1 5  ? 1.573   -4.806  -3.578  1.00 0.00 ? 117 DC  C "C2'"  5  
ATOM   8317  C "C1'"  . DC  B 1 5  ? 1.001   -5.981  -4.344  1.00 0.00 ? 117 DC  C "C1'"  5  
ATOM   8318  N N1     . DC  B 1 5  ? -0.428  -6.154  -4.037  1.00 0.00 ? 117 DC  C N1     5  
ATOM   8319  C C2     . DC  B 1 5  ? -1.323  -6.138  -5.095  1.00 0.00 ? 117 DC  C C2     5  
ATOM   8320  O O2     . DC  B 1 5  ? -0.921  -5.989  -6.232  1.00 0.00 ? 117 DC  C O2     5  
ATOM   8321  N N3     . DC  B 1 5  ? -2.647  -6.296  -4.821  1.00 0.00 ? 117 DC  C N3     5  
ATOM   8322  C C4     . DC  B 1 5  ? -3.074  -6.461  -3.562  1.00 0.00 ? 117 DC  C C4     5  
ATOM   8323  N N4     . DC  B 1 5  ? -4.378  -6.614  -3.329  1.00 0.00 ? 117 DC  C N4     5  
ATOM   8324  C C5     . DC  B 1 5  ? -2.150  -6.477  -2.468  1.00 0.00 ? 117 DC  C C5     5  
ATOM   8325  C C6     . DC  B 1 5  ? -0.843  -6.317  -2.752  1.00 0.00 ? 117 DC  C C6     5  
ATOM   8326  H "H5'"  . DC  B 1 5  ? 3.246   -8.559  -2.075  1.00 0.00 ? 117 DC  C "H5'"  5  
ATOM   8327  H "H5''" . DC  B 1 5  ? 3.701   -7.061  -1.238  1.00 0.00 ? 117 DC  C "H5''" 5  
ATOM   8328  H "H4'"  . DC  B 1 5  ? 3.810   -7.008  -3.790  1.00 0.00 ? 117 DC  C "H4'"  5  
ATOM   8329  H "H3'"  . DC  B 1 5  ? 2.877   -5.072  -1.909  1.00 0.00 ? 117 DC  C "H3'"  5  
ATOM   8330  H "H2'"  . DC  B 1 5  ? 0.886   -4.510  -2.785  1.00 0.00 ? 117 DC  C "H2'"  5  
ATOM   8331  H "H2''" . DC  B 1 5  ? 1.744   -3.972  -4.249  1.00 0.00 ? 117 DC  C "H2''" 5  
ATOM   8332  H "H1'"  . DC  B 1 5  ? 1.123   -5.806  -5.408  1.00 0.00 ? 117 DC  C "H1'"  5  
ATOM   8333  H H41    . DC  B 1 5  ? -5.033  -6.604  -4.097  1.00 0.00 ? 117 DC  C H41    5  
ATOM   8334  H H42    . DC  B 1 5  ? -4.711  -6.739  -2.383  1.00 0.00 ? 117 DC  C H42    5  
ATOM   8335  H H5     . DC  B 1 5  ? -2.492  -6.611  -1.441  1.00 0.00 ? 117 DC  C H5     5  
ATOM   8336  H H6     . DC  B 1 5  ? -0.107  -6.309  -1.947  1.00 0.00 ? 117 DC  C H6     5  
HETATM 8337  N N1     . 5CM B 1 6  ? -0.405  -2.198  -6.924  1.00 0.00 ? 118 5CM C N1     5  
HETATM 8338  C C2     . 5CM B 1 6  ? -1.733  -2.169  -7.317  1.00 0.00 ? 118 5CM C C2     5  
HETATM 8339  N N3     . 5CM B 1 6  ? -2.685  -1.986  -6.361  1.00 0.00 ? 118 5CM C N3     5  
HETATM 8340  C C4     . 5CM B 1 6  ? -2.346  -1.838  -5.073  1.00 0.00 ? 118 5CM C C4     5  
HETATM 8341  C C5     . 5CM B 1 6  ? -0.976  -1.868  -4.665  1.00 0.00 ? 118 5CM C C5     5  
HETATM 8342  C C5A    . 5CM B 1 6  ? -0.586  -1.708  -3.200  1.00 0.00 ? 118 5CM C C5A    5  
HETATM 8343  C C6     . 5CM B 1 6  ? -0.043  -2.050  -5.619  1.00 0.00 ? 118 5CM C C6     5  
HETATM 8344  O O2     . 5CM B 1 6  ? -2.026  -2.305  -8.489  1.00 0.00 ? 118 5CM C O2     5  
HETATM 8345  N N4     . 5CM B 1 6  ? -3.303  -1.661  -4.162  1.00 0.00 ? 118 5CM C N4     5  
HETATM 8346  C "C1'"  . 5CM B 1 6  ? 0.613   -2.387  -7.973  1.00 0.00 ? 118 5CM C "C1'"  5  
HETATM 8347  C "C2'"  . 5CM B 1 6  ? 1.682   -1.312  -7.888  1.00 0.00 ? 118 5CM C "C2'"  5  
HETATM 8348  C "C3'"  . 5CM B 1 6  ? 3.014   -2.017  -7.834  1.00 0.00 ? 118 5CM C "C3'"  5  
HETATM 8349  C "C4'"  . 5CM B 1 6  ? 2.694   -3.499  -7.721  1.00 0.00 ? 118 5CM C "C4'"  5  
HETATM 8350  O "O4'"  . 5CM B 1 6  ? 1.263   -3.668  -7.835  1.00 0.00 ? 118 5CM C "O4'"  5  
HETATM 8351  O "O3'"  . 5CM B 1 6  ? 3.790   -1.760  -9.011  1.00 0.00 ? 118 5CM C "O3'"  5  
HETATM 8352  C "C5'"  . 5CM B 1 6  ? 3.197   -4.052  -6.393  1.00 0.00 ? 118 5CM C "C5'"  5  
HETATM 8353  O "O5'"  . 5CM B 1 6  ? 2.954   -3.136  -5.321  1.00 0.00 ? 118 5CM C "O5'"  5  
HETATM 8354  P P      . 5CM B 1 6  ? 3.942   -3.091  -4.053  1.00 0.00 ? 118 5CM C P      5  
HETATM 8355  O OP1    . 5CM B 1 6  ? 5.288   -2.700  -4.529  1.00 0.00 ? 118 5CM C OP1    5  
HETATM 8356  O OP2    . 5CM B 1 6  ? 3.284   -2.316  -2.977  1.00 0.00 ? 118 5CM C OP2    5  
HETATM 8357  H H5A1   . 5CM B 1 6  ? -0.991  -2.539  -2.623  1.00 0.00 ? 118 5CM C H5A1   5  
HETATM 8358  H H5A2   . 5CM B 1 6  ? 0.500   -1.700  -3.112  1.00 0.00 ? 118 5CM C H5A2   5  
HETATM 8359  H H5A3   . 5CM B 1 6  ? -0.988  -0.769  -2.818  1.00 0.00 ? 118 5CM C H5A3   5  
HETATM 8360  H H6     . 5CM B 1 6  ? 1.012   -2.081  -5.348  1.00 0.00 ? 118 5CM C H6     5  
HETATM 8361  H HN41   . 5CM B 1 6  ? -3.059  -1.549  -3.188  1.00 0.00 ? 118 5CM C HN41   5  
HETATM 8362  H HN42   . 5CM B 1 6  ? -4.272  -1.639  -4.445  1.00 0.00 ? 118 5CM C HN42   5  
HETATM 8363  H "H1'"  . 5CM B 1 6  ? 0.132   -2.331  -8.949  1.00 0.00 ? 118 5CM C "H1'"  5  
HETATM 8364  H "H2'"  . 5CM B 1 6  ? 1.540   -0.718  -6.983  1.00 0.00 ? 118 5CM C "H2'"  5  
HETATM 8365  H "H2''" . 5CM B 1 6  ? 1.632   -0.670  -8.764  1.00 0.00 ? 118 5CM C "H2''" 5  
HETATM 8366  H "H3'"  . 5CM B 1 6  ? 3.561   -1.693  -6.947  1.00 0.00 ? 118 5CM C "H3'"  5  
HETATM 8367  H "H4'"  . 5CM B 1 6  ? 3.180   -4.033  -8.537  1.00 0.00 ? 118 5CM C "H4'"  5  
HETATM 8368  H "H5'"  . 5CM B 1 6  ? 2.688   -4.991  -6.183  1.00 0.00 ? 118 5CM C "H5'"  5  
HETATM 8369  H "H5''" . 5CM B 1 6  ? 4.268   -4.235  -6.468  1.00 0.00 ? 118 5CM C "H5''" 5  
ATOM   8370  P P      . DG  B 1 7  ? 3.864   -0.283  -9.648  1.00 0.00 ? 119 DG  C P      5  
ATOM   8371  O OP1    . DG  B 1 7  ? 4.744   -0.333  -10.835 1.00 0.00 ? 119 DG  C OP1    5  
ATOM   8372  O OP2    . DG  B 1 7  ? 4.145   0.680   -8.559  1.00 0.00 ? 119 DG  C OP2    5  
ATOM   8373  O "O5'"  . DG  B 1 7  ? 2.352   -0.047  -10.151 1.00 0.00 ? 119 DG  C "O5'"  5  
ATOM   8374  C "C5'"  . DG  B 1 7  ? 1.808   -0.831  -11.217 1.00 0.00 ? 119 DG  C "C5'"  5  
ATOM   8375  C "C4'"  . DG  B 1 7  ? 0.883   0.000   -12.099 1.00 0.00 ? 119 DG  C "C4'"  5  
ATOM   8376  O "O4'"  . DG  B 1 7  ? -0.467  -0.020  -11.581 1.00 0.00 ? 119 DG  C "O4'"  5  
ATOM   8377  C "C3'"  . DG  B 1 7  ? 1.356   1.445   -12.144 1.00 0.00 ? 119 DG  C "C3'"  5  
ATOM   8378  O "O3'"  . DG  B 1 7  ? 1.603   1.861   -13.491 1.00 0.00 ? 119 DG  C "O3'"  5  
ATOM   8379  C "C2'"  . DG  B 1 7  ? 0.256   2.261   -11.522 1.00 0.00 ? 119 DG  C "C2'"  5  
ATOM   8380  C "C1'"  . DG  B 1 7  ? -0.892  1.314   -11.227 1.00 0.00 ? 119 DG  C "C1'"  5  
ATOM   8381  N N9     . DG  B 1 7  ? -1.256  1.390   -9.806  1.00 0.00 ? 119 DG  C N9     5  
ATOM   8382  C C8     . DG  B 1 7  ? -0.449  1.419   -8.732  1.00 0.00 ? 119 DG  C C8     5  
ATOM   8383  N N7     . DG  B 1 7  ? -0.998  1.524   -7.568  1.00 0.00 ? 119 DG  C N7     5  
ATOM   8384  C C5     . DG  B 1 7  ? -2.355  1.573   -7.900  1.00 0.00 ? 119 DG  C C5     5  
ATOM   8385  C C6     . DG  B 1 7  ? -3.496  1.690   -7.061  1.00 0.00 ? 119 DG  C C6     5  
ATOM   8386  O O6     . DG  B 1 7  ? -3.538  1.771   -5.849  1.00 0.00 ? 119 DG  C O6     5  
ATOM   8387  N N1     . DG  B 1 7  ? -4.673  1.704   -7.800  1.00 0.00 ? 119 DG  C N1     5  
ATOM   8388  C C2     . DG  B 1 7  ? -4.749  1.617   -9.177  1.00 0.00 ? 119 DG  C C2     5  
ATOM   8389  N N2     . DG  B 1 7  ? -5.973  1.646   -9.703  1.00 0.00 ? 119 DG  C N2     5  
ATOM   8390  N N3     . DG  B 1 7  ? -3.680  1.505   -9.973  1.00 0.00 ? 119 DG  C N3     5  
ATOM   8391  C C4     . DG  B 1 7  ? -2.522  1.490   -9.275  1.00 0.00 ? 119 DG  C C4     5  
ATOM   8392  H "H5'"  . DG  B 1 7  ? 1.246   -1.665  -10.796 1.00 0.00 ? 119 DG  C "H5'"  5  
ATOM   8393  H "H5''" . DG  B 1 7  ? 2.624   -1.221  -11.824 1.00 0.00 ? 119 DG  C "H5''" 5  
ATOM   8394  H "H4'"  . DG  B 1 7  ? 0.884   -0.411  -13.108 1.00 0.00 ? 119 DG  C "H4'"  5  
ATOM   8395  H "H3'"  . DG  B 1 7  ? 2.266   1.549   -11.549 1.00 0.00 ? 119 DG  C "H3'"  5  
ATOM   8396  H "H2'"  . DG  B 1 7  ? 0.609   2.715   -10.596 1.00 0.00 ? 119 DG  C "H2'"  5  
ATOM   8397  H "H2''" . DG  B 1 7  ? -0.070  3.032   -12.210 1.00 0.00 ? 119 DG  C "H2''" 5  
ATOM   8398  H "H1'"  . DG  B 1 7  ? -1.750  1.591   -11.828 1.00 0.00 ? 119 DG  C "H1'"  5  
ATOM   8399  H H8     . DG  B 1 7  ? 0.629   1.367   -8.852  1.00 0.00 ? 119 DG  C H8     5  
ATOM   8400  H H1     . DG  B 1 7  ? -5.503  1.785   -7.286  1.00 0.00 ? 119 DG  C H1     5  
ATOM   8401  H H21    . DG  B 1 7  ? -6.779  1.730   -9.101  1.00 0.00 ? 119 DG  C H21    5  
ATOM   8402  H H22    . DG  B 1 7  ? -6.093  1.585   -10.704 1.00 0.00 ? 119 DG  C H22    5  
ATOM   8403  P P      . DG  B 1 8  ? 1.836   3.418   -13.833 1.00 0.00 ? 120 DG  C P      5  
ATOM   8404  O OP1    . DG  B 1 8  ? 2.861   3.509   -14.896 1.00 0.00 ? 120 DG  C OP1    5  
ATOM   8405  O OP2    . DG  B 1 8  ? 2.025   4.149   -12.561 1.00 0.00 ? 120 DG  C OP2    5  
ATOM   8406  O "O5'"  . DG  B 1 8  ? 0.420   3.854   -14.460 1.00 0.00 ? 120 DG  C "O5'"  5  
ATOM   8407  C "C5'"  . DG  B 1 8  ? -0.452  2.876   -15.032 1.00 0.00 ? 120 DG  C "C5'"  5  
ATOM   8408  C "C4'"  . DG  B 1 8  ? -1.918  3.209   -14.771 1.00 0.00 ? 120 DG  C "C4'"  5  
ATOM   8409  O "O4'"  . DG  B 1 8  ? -2.220  3.120   -13.364 1.00 0.00 ? 120 DG  C "O4'"  5  
ATOM   8410  C "C3'"  . DG  B 1 8  ? -2.243  4.620   -15.242 1.00 0.00 ? 120 DG  C "C3'"  5  
ATOM   8411  O "O3'"  . DG  B 1 8  ? -3.191  4.584   -16.318 1.00 0.00 ? 120 DG  C "O3'"  5  
ATOM   8412  C "C2'"  . DG  B 1 8  ? -2.806  5.334   -14.038 1.00 0.00 ? 120 DG  C "C2'"  5  
ATOM   8413  C "C1'"  . DG  B 1 8  ? -2.918  4.303   -12.933 1.00 0.00 ? 120 DG  C "C1'"  5  
ATOM   8414  N N9     . DG  B 1 8  ? -2.365  4.809   -11.668 1.00 0.00 ? 120 DG  C N9     5  
ATOM   8415  C C8     . DG  B 1 8  ? -1.086  5.099   -11.351 1.00 0.00 ? 120 DG  C C8     5  
ATOM   8416  N N7     . DG  B 1 8  ? -0.843  5.508   -10.150 1.00 0.00 ? 120 DG  C N7     5  
ATOM   8417  C C5     . DG  B 1 8  ? -2.121  5.492   -9.582  1.00 0.00 ? 120 DG  C C5     5  
ATOM   8418  C C6     . DG  B 1 8  ? -2.540  5.836   -8.269  1.00 0.00 ? 120 DG  C C6     5  
ATOM   8419  O O6     . DG  B 1 8  ? -1.861  6.226   -7.340  1.00 0.00 ? 120 DG  C O6     5  
ATOM   8420  N N1     . DG  B 1 8  ? -3.912  5.680   -8.114  1.00 0.00 ? 120 DG  C N1     5  
ATOM   8421  C C2     . DG  B 1 8  ? -4.779  5.246   -9.098  1.00 0.00 ? 120 DG  C C2     5  
ATOM   8422  N N2     . DG  B 1 8  ? -6.065  5.160   -8.755  1.00 0.00 ? 120 DG  C N2     5  
ATOM   8423  N N3     . DG  B 1 8  ? -4.393  4.922   -10.336 1.00 0.00 ? 120 DG  C N3     5  
ATOM   8424  C C4     . DG  B 1 8  ? -3.060  5.066   -10.510 1.00 0.00 ? 120 DG  C C4     5  
ATOM   8425  H "H5'"  . DG  B 1 8  ? -0.227  1.901   -14.599 1.00 0.00 ? 120 DG  C "H5'"  5  
ATOM   8426  H "H5''" . DG  B 1 8  ? -0.283  2.834   -16.108 1.00 0.00 ? 120 DG  C "H5''" 5  
ATOM   8427  H "H4'"  . DG  B 1 8  ? -2.547  2.503   -15.309 1.00 0.00 ? 120 DG  C "H4'"  5  
ATOM   8428  H "H3'"  . DG  B 1 8  ? -1.326  5.117   -15.567 1.00 0.00 ? 120 DG  C "H3'"  5  
ATOM   8429  H "H2'"  . DG  B 1 8  ? -2.134  6.137   -13.733 1.00 0.00 ? 120 DG  C "H2'"  5  
ATOM   8430  H "H2''" . DG  B 1 8  ? -3.791  5.740   -14.268 1.00 0.00 ? 120 DG  C "H2''" 5  
ATOM   8431  H "H1'"  . DG  B 1 8  ? -3.961  4.059   -12.788 1.00 0.00 ? 120 DG  C "H1'"  5  
ATOM   8432  H H8     . DG  B 1 8  ? -0.294  4.990   -12.085 1.00 0.00 ? 120 DG  C H8     5  
ATOM   8433  H H1     . DG  B 1 8  ? -4.273  5.899   -7.230  1.00 0.00 ? 120 DG  C H1     5  
ATOM   8434  H H21    . DG  B 1 8  ? -6.355  5.406   -7.820  1.00 0.00 ? 120 DG  C H21    5  
ATOM   8435  H H22    . DG  B 1 8  ? -6.747  4.849   -9.431  1.00 0.00 ? 120 DG  C H22    5  
ATOM   8436  P P      . DA  B 1 9  ? -4.093  5.870   -16.673 1.00 0.00 ? 121 DA  C P      5  
ATOM   8437  O OP1    . DA  B 1 9  ? -4.987  5.512   -17.797 1.00 0.00 ? 121 DA  C OP1    5  
ATOM   8438  O OP2    . DA  B 1 9  ? -3.202  7.045   -16.784 1.00 0.00 ? 121 DA  C OP2    5  
ATOM   8439  O "O5'"  . DA  B 1 9  ? -4.992  6.043   -15.348 1.00 0.00 ? 121 DA  C "O5'"  5  
ATOM   8440  C "C5'"  . DA  B 1 9  ? -6.166  5.250   -15.151 1.00 0.00 ? 121 DA  C "C5'"  5  
ATOM   8441  C "C4'"  . DA  B 1 9  ? -7.346  6.111   -14.711 1.00 0.00 ? 121 DA  C "C4'"  5  
ATOM   8442  O "O4'"  . DA  B 1 9  ? -7.289  6.365   -13.290 1.00 0.00 ? 121 DA  C "O4'"  5  
ATOM   8443  C "C3'"  . DA  B 1 9  ? -7.317  7.447   -15.433 1.00 0.00 ? 121 DA  C "C3'"  5  
ATOM   8444  O "O3'"  . DA  B 1 9  ? -8.578  7.710   -16.061 1.00 0.00 ? 121 DA  C "O3'"  5  
ATOM   8445  C "C2'"  . DA  B 1 9  ? -7.006  8.478   -14.377 1.00 0.00 ? 121 DA  C "C2'"  5  
ATOM   8446  C "C1'"  . DA  B 1 9  ? -7.034  7.764   -13.038 1.00 0.00 ? 121 DA  C "C1'"  5  
ATOM   8447  N N9     . DA  B 1 9  ? -5.755  7.940   -12.342 1.00 0.00 ? 121 DA  C N9     5  
ATOM   8448  C C8     . DA  B 1 9  ? -4.508  7.830   -12.832 1.00 0.00 ? 121 DA  C C8     5  
ATOM   8449  N N7     . DA  B 1 9  ? -3.523  8.010   -12.017 1.00 0.00 ? 121 DA  C N7     5  
ATOM   8450  C C5     . DA  B 1 9  ? -4.198  8.280   -10.822 1.00 0.00 ? 121 DA  C C5     5  
ATOM   8451  C C6     . DA  B 1 9  ? -3.756  8.571   -9.527  1.00 0.00 ? 121 DA  C C6     5  
ATOM   8452  N N6     . DA  B 1 9  ? -2.467  8.641   -9.195  1.00 0.00 ? 121 DA  C N6     5  
ATOM   8453  N N1     . DA  B 1 9  ? -4.694  8.787   -8.587  1.00 0.00 ? 121 DA  C N1     5  
ATOM   8454  C C2     . DA  B 1 9  ? -5.990  8.722   -8.899  1.00 0.00 ? 121 DA  C C2     5  
ATOM   8455  N N3     . DA  B 1 9  ? -6.519  8.455   -10.089 1.00 0.00 ? 121 DA  C N3     5  
ATOM   8456  C C4     . DA  B 1 9  ? -5.561  8.241   -11.013 1.00 0.00 ? 121 DA  C C4     5  
ATOM   8457  H "H5'"  . DA  B 1 9  ? -5.967  4.500   -14.386 1.00 0.00 ? 121 DA  C "H5'"  5  
ATOM   8458  H "H5''" . DA  B 1 9  ? -6.419  4.749   -16.085 1.00 0.00 ? 121 DA  C "H5''" 5  
ATOM   8459  H "H4'"  . DA  B 1 9  ? -8.276  5.594   -14.946 1.00 0.00 ? 121 DA  C "H4'"  5  
ATOM   8460  H "H3'"  . DA  B 1 9  ? -6.522  7.442   -16.181 1.00 0.00 ? 121 DA  C "H3'"  5  
ATOM   8461  H "H2'"  . DA  B 1 9  ? -6.016  8.899   -14.551 1.00 0.00 ? 121 DA  C "H2'"  5  
ATOM   8462  H "H2''" . DA  B 1 9  ? -7.749  9.265   -14.390 1.00 0.00 ? 121 DA  C "H2''" 5  
ATOM   8463  H "H1'"  . DA  B 1 9  ? -7.831  8.173   -12.428 1.00 0.00 ? 121 DA  C "H1'"  5  
ATOM   8464  H H8     . DA  B 1 9  ? -4.348  7.610   -13.883 1.00 0.00 ? 121 DA  C H8     5  
ATOM   8465  H H61    . DA  B 1 9  ? -2.202  8.856   -8.245  1.00 0.00 ? 121 DA  C H61    5  
ATOM   8466  H H62    . DA  B 1 9  ? -1.756  8.481   -9.894  1.00 0.00 ? 121 DA  C H62    5  
ATOM   8467  H H2     . DA  B 1 9  ? -6.693  8.914   -8.087  1.00 0.00 ? 121 DA  C H2     5  
ATOM   8468  P P      . DT  B 1 10 ? -8.997  9.207   -16.483 1.00 0.00 ? 122 DT  C P      5  
ATOM   8469  O OP1    . DT  B 1 10 ? -10.081 9.120   -17.486 1.00 0.00 ? 122 DT  C OP1    5  
ATOM   8470  O OP2    . DT  B 1 10 ? -7.764  9.964   -16.790 1.00 0.00 ? 122 DT  C OP2    5  
ATOM   8471  O "O5'"  . DT  B 1 10 ? -9.621  9.789   -15.117 1.00 0.00 ? 122 DT  C "O5'"  5  
ATOM   8472  C "C5'"  . DT  B 1 10 ? -10.172 8.905   -14.135 1.00 0.00 ? 122 DT  C "C5'"  5  
ATOM   8473  C "C4'"  . DT  B 1 10 ? -10.680 9.665   -12.913 1.00 0.00 ? 122 DT  C "C4'"  5  
ATOM   8474  O "O4'"  . DT  B 1 10 ? -9.664  9.719   -11.888 1.00 0.00 ? 122 DT  C "O4'"  5  
ATOM   8475  C "C3'"  . DT  B 1 10 ? -11.060 11.089  -13.286 1.00 0.00 ? 122 DT  C "C3'"  5  
ATOM   8476  O "O3'"  . DT  B 1 10 ? -12.434 11.345  -12.969 1.00 0.00 ? 122 DT  C "O3'"  5  
ATOM   8477  C "C2'"  . DT  B 1 10 ? -10.142 11.985  -12.493 1.00 0.00 ? 122 DT  C "C2'"  5  
ATOM   8478  C "C1'"  . DT  B 1 10 ? -9.326  11.089  -11.580 1.00 0.00 ? 122 DT  C "C1'"  5  
ATOM   8479  N N1     . DT  B 1 10 ? -7.883  11.325  -11.768 1.00 0.00 ? 122 DT  C N1     5  
ATOM   8480  C C2     . DT  B 1 10 ? -7.124  11.567  -10.640 1.00 0.00 ? 122 DT  C C2     5  
ATOM   8481  O O2     . DT  B 1 10 ? -7.612  11.603  -9.527  1.00 0.00 ? 122 DT  C O2     5  
ATOM   8482  N N3     . DT  B 1 10 ? -5.773  11.767  -10.851 1.00 0.00 ? 122 DT  C N3     5  
ATOM   8483  C C4     . DT  B 1 10 ? -5.127  11.744  -12.075 1.00 0.00 ? 122 DT  C C4     5  
ATOM   8484  O O4     . DT  B 1 10 ? -3.929  11.932  -12.148 1.00 0.00 ? 122 DT  C O4     5  
ATOM   8485  C C5     . DT  B 1 10 ? -6.003  11.485  -13.196 1.00 0.00 ? 122 DT  C C5     5  
ATOM   8486  C C7     . DT  B 1 10 ? -5.424  11.433  -14.605 1.00 0.00 ? 122 DT  C C7     5  
ATOM   8487  C C6     . DT  B 1 10 ? -7.324  11.289  -13.014 1.00 0.00 ? 122 DT  C C6     5  
ATOM   8488  H "H5'"  . DT  B 1 10 ? -9.403  8.200   -13.821 1.00 0.00 ? 122 DT  C "H5'"  5  
ATOM   8489  H "H5''" . DT  B 1 10 ? -11.000 8.353   -14.581 1.00 0.00 ? 122 DT  C "H5''" 5  
ATOM   8490  H "H4'"  . DT  B 1 10 ? -11.557 9.154   -12.516 1.00 0.00 ? 122 DT  C "H4'"  5  
ATOM   8491  H "H3'"  . DT  B 1 10 ? -10.889 11.247  -14.353 1.00 0.00 ? 122 DT  C "H3'"  5  
ATOM   8492  H "H2'"  . DT  B 1 10 ? -9.480  12.529  -13.167 1.00 0.00 ? 122 DT  C "H2'"  5  
ATOM   8493  H "H2''" . DT  B 1 10 ? -10.724 12.686  -11.899 1.00 0.00 ? 122 DT  C "H2''" 5  
ATOM   8494  H "H1'"  . DT  B 1 10 ? -9.590  11.297  -10.544 1.00 0.00 ? 122 DT  C "H1'"  5  
ATOM   8495  H H3     . DT  B 1 10 ? -5.221  11.940  -10.060 1.00 0.00 ? 122 DT  C H3     5  
ATOM   8496  H H71    . DT  B 1 10 ? -4.973  12.396  -14.848 1.00 0.00 ? 122 DT  C H71    5  
ATOM   8497  H H72    . DT  B 1 10 ? -4.664  10.653  -14.658 1.00 0.00 ? 122 DT  C H72    5  
ATOM   8498  H H73    . DT  B 1 10 ? -6.219  11.215  -15.317 1.00 0.00 ? 122 DT  C H73    5  
ATOM   8499  H H6     . DT  B 1 10 ? -7.961  11.103  -13.877 1.00 0.00 ? 122 DT  C H6     5  
ATOM   8500  P P      . DA  B 1 11 ? -12.988 12.853  -12.852 1.00 0.00 ? 123 DA  C P      5  
ATOM   8501  O OP1    . DA  B 1 11 ? -14.430 12.793  -12.528 1.00 0.00 ? 123 DA  C OP1    5  
ATOM   8502  O OP2    . DA  B 1 11 ? -12.529 13.609  -14.038 1.00 0.00 ? 123 DA  C OP2    5  
ATOM   8503  O "O5'"  . DA  B 1 11 ? -12.205 13.414  -11.562 1.00 0.00 ? 123 DA  C "O5'"  5  
ATOM   8504  C "C5'"  . DA  B 1 11 ? -12.558 12.977  -10.246 1.00 0.00 ? 123 DA  C "C5'"  5  
ATOM   8505  C "C4'"  . DA  B 1 11 ? -12.323 14.076  -9.215  1.00 0.00 ? 123 DA  C "C4'"  5  
ATOM   8506  O "O4'"  . DA  B 1 11 ? -10.955 14.053  -8.747  1.00 0.00 ? 123 DA  C "O4'"  5  
ATOM   8507  C "C3'"  . DA  B 1 11 ? -12.595 15.443  -9.825  1.00 0.00 ? 123 DA  C "C3'"  5  
ATOM   8508  O "O3'"  . DA  B 1 11 ? -13.582 16.153  -9.070  1.00 0.00 ? 123 DA  C "O3'"  5  
ATOM   8509  C "C2'"  . DA  B 1 11 ? -11.279 16.173  -9.811  1.00 0.00 ? 123 DA  C "C2'"  5  
ATOM   8510  C "C1'"  . DA  B 1 11 ? -10.287 15.289  -9.078  1.00 0.00 ? 123 DA  C "C1'"  5  
ATOM   8511  N N9     . DA  B 1 11 ? -9.109  15.042  -9.917  1.00 0.00 ? 123 DA  C N9     5  
ATOM   8512  C C8     . DA  B 1 11 ? -9.053  14.744  -11.228 1.00 0.00 ? 123 DA  C C8     5  
ATOM   8513  N N7     . DA  B 1 11 ? -7.888  14.574  -11.756 1.00 0.00 ? 123 DA  C N7     5  
ATOM   8514  C C5     . DA  B 1 11 ? -7.050  14.789  -10.656 1.00 0.00 ? 123 DA  C C5     5  
ATOM   8515  C C6     . DA  B 1 11 ? -5.660  14.770  -10.504 1.00 0.00 ? 123 DA  C C6     5  
ATOM   8516  N N6     . DA  B 1 11 ? -4.819  14.508  -11.505 1.00 0.00 ? 123 DA  C N6     5  
ATOM   8517  N N1     . DA  B 1 11 ? -5.168  15.030  -9.279  1.00 0.00 ? 123 DA  C N1     5  
ATOM   8518  C C2     . DA  B 1 11 ? -5.991  15.294  -8.263  1.00 0.00 ? 123 DA  C C2     5  
ATOM   8519  N N3     . DA  B 1 11 ? -7.320  15.338  -8.295  1.00 0.00 ? 123 DA  C N3     5  
ATOM   8520  C C4     . DA  B 1 11 ? -7.788  15.076  -9.531  1.00 0.00 ? 123 DA  C C4     5  
ATOM   8521  H "H5'"  . DA  B 1 11 ? -11.954 12.109  -9.985  1.00 0.00 ? 123 DA  C "H5'"  5  
ATOM   8522  H "H5''" . DA  B 1 11 ? -13.611 12.696  -10.235 1.00 0.00 ? 123 DA  C "H5''" 5  
ATOM   8523  H "H4'"  . DA  B 1 11 ? -12.992 13.923  -8.369  1.00 0.00 ? 123 DA  C "H4'"  5  
ATOM   8524  H "H3'"  . DA  B 1 11 ? -12.933 15.320  -10.857 1.00 0.00 ? 123 DA  C "H3'"  5  
ATOM   8525  H "H2'"  . DA  B 1 11 ? -10.938 16.340  -10.833 1.00 0.00 ? 123 DA  C "H2'"  5  
ATOM   8526  H "H2''" . DA  B 1 11 ? -11.383 17.122  -9.296  1.00 0.00 ? 123 DA  C "H2''" 5  
ATOM   8527  H "H1'"  . DA  B 1 11 ? -9.973  15.783  -8.165  1.00 0.00 ? 123 DA  C "H1'"  5  
ATOM   8528  H H8     . DA  B 1 11 ? -9.964  14.669  -11.817 1.00 0.00 ? 123 DA  C H8     5  
ATOM   8529  H H61    . DA  B 1 11 ? -3.823  14.506  -11.341 1.00 0.00 ? 123 DA  C H61    5  
ATOM   8530  H H62    . DA  B 1 11 ? -5.180  14.310  -12.428 1.00 0.00 ? 123 DA  C H62    5  
ATOM   8531  H H2     . DA  B 1 11 ? -5.523  15.495  -7.299  1.00 0.00 ? 123 DA  C H2     5  
ATOM   8532  P P      . DC  B 1 12 ? -14.650 17.103  -9.812  1.00 0.00 ? 124 DC  C P      5  
ATOM   8533  O OP1    . DC  B 1 12 ? -16.004 16.737  -9.340  1.00 0.00 ? 124 DC  C OP1    5  
ATOM   8534  O OP2    . DC  B 1 12 ? -14.346 17.098  -11.260 1.00 0.00 ? 124 DC  C OP2    5  
ATOM   8535  O "O5'"  . DC  B 1 12 ? -14.289 18.560  -9.227  1.00 0.00 ? 124 DC  C "O5'"  5  
ATOM   8536  C "C5'"  . DC  B 1 12 ? -13.923 18.720  -7.853  1.00 0.00 ? 124 DC  C "C5'"  5  
ATOM   8537  C "C4'"  . DC  B 1 12 ? -12.954 19.882  -7.663  1.00 0.00 ? 124 DC  C "C4'"  5  
ATOM   8538  O "O4'"  . DC  B 1 12 ? -11.596 19.459  -7.894  1.00 0.00 ? 124 DC  C "O4'"  5  
ATOM   8539  C "C3'"  . DC  B 1 12 ? -13.271 21.015  -8.628  1.00 0.00 ? 124 DC  C "C3'"  5  
ATOM   8540  O "O3'"  . DC  B 1 12 ? -13.784 22.154  -7.929  1.00 0.00 ? 124 DC  C "O3'"  5  
ATOM   8541  C "C2'"  . DC  B 1 12 ? -11.970 21.346  -9.314  1.00 0.00 ? 124 DC  C "C2'"  5  
ATOM   8542  C "C1'"  . DC  B 1 12 ? -10.923 20.398  -8.753  1.00 0.00 ? 124 DC  C "C1'"  5  
ATOM   8543  N N1     . DC  B 1 12 ? -10.203 19.700  -9.836  1.00 0.00 ? 124 DC  C N1     5  
ATOM   8544  C C2     . DC  B 1 12 ? -8.817  19.667  -9.765  1.00 0.00 ? 124 DC  C C2     5  
ATOM   8545  O O2     . DC  B 1 12 ? -8.242  20.207  -8.841  1.00 0.00 ? 124 DC  C O2     5  
ATOM   8546  N N3     . DC  B 1 12 ? -8.135  19.022  -10.750 1.00 0.00 ? 124 DC  C N3     5  
ATOM   8547  C C4     . DC  B 1 12 ? -8.783  18.432  -11.763 1.00 0.00 ? 124 DC  C C4     5  
ATOM   8548  N N4     . DC  B 1 12 ? -8.084  17.806  -12.710 1.00 0.00 ? 124 DC  C N4     5  
ATOM   8549  C C5     . DC  B 1 12 ? -10.212 18.463  -11.842 1.00 0.00 ? 124 DC  C C5     5  
ATOM   8550  C C6     . DC  B 1 12 ? -10.878 19.104  -10.862 1.00 0.00 ? 124 DC  C C6     5  
ATOM   8551  H "H5'"  . DC  B 1 12 ? -13.452 17.803  -7.501  1.00 0.00 ? 124 DC  C "H5'"  5  
ATOM   8552  H "H5''" . DC  B 1 12 ? -14.822 18.907  -7.265  1.00 0.00 ? 124 DC  C "H5''" 5  
ATOM   8553  H "H4'"  . DC  B 1 12 ? -13.036 20.254  -6.644  1.00 0.00 ? 124 DC  C "H4'"  5  
ATOM   8554  H "H3'"  . DC  B 1 12 ? -13.997 20.672  -9.368  1.00 0.00 ? 124 DC  C "H3'"  5  
ATOM   8555  H "HO3'" . DC  B 1 12 ? -13.042 22.732  -7.739  1.00 0.00 ? 124 DC  C "HO3'" 5  
ATOM   8556  H "H2'"  . DC  B 1 12 ? -12.069 21.200  -10.390 1.00 0.00 ? 124 DC  C "H2'"  5  
ATOM   8557  H "H2''" . DC  B 1 12 ? -11.690 22.378  -9.103  1.00 0.00 ? 124 DC  C "H2''" 5  
ATOM   8558  H "H1'"  . DC  B 1 12 ? -10.211 20.968  -8.160  1.00 0.00 ? 124 DC  C "H1'"  5  
ATOM   8559  H H41    . DC  B 1 12 ? -7.075  17.781  -12.660 1.00 0.00 ? 124 DC  C H41    5  
ATOM   8560  H H42    . DC  B 1 12 ? -8.563  17.356  -13.477 1.00 0.00 ? 124 DC  C H42    5  
ATOM   8561  H H5     . DC  B 1 12 ? -10.741 17.984  -12.665 1.00 0.00 ? 124 DC  C H5     5  
ATOM   8562  H H6     . DC  B 1 12 ? -11.967 19.148  -10.889 1.00 0.00 ? 124 DC  C H6     5  
ATOM   8563  N N      . MET C 2 1  ? -6.348  15.948  3.391   1.00 0.00 ? 1   MET A N      5  
ATOM   8564  C CA     . MET C 2 1  ? -6.601  14.524  3.757   1.00 0.00 ? 1   MET A CA     5  
ATOM   8565  C C      . MET C 2 1  ? -7.896  14.407  4.567   1.00 0.00 ? 1   MET A C      5  
ATOM   8566  O O      . MET C 2 1  ? -8.299  15.332  5.246   1.00 0.00 ? 1   MET A O      5  
ATOM   8567  C CB     . MET C 2 1  ? -5.395  14.108  4.605   1.00 0.00 ? 1   MET A CB     5  
ATOM   8568  C CG     . MET C 2 1  ? -5.274  15.033  5.818   1.00 0.00 ? 1   MET A CG     5  
ATOM   8569  S SD     . MET C 2 1  ? -3.885  14.499  6.850   1.00 0.00 ? 1   MET A SD     5  
ATOM   8570  C CE     . MET C 2 1  ? -2.569  14.852  5.659   1.00 0.00 ? 1   MET A CE     5  
ATOM   8571  H H      . MET C 2 1  ? -6.849  16.664  3.836   1.00 0.00 ? 1   MET A H      5  
ATOM   8572  H HA     . MET C 2 1  ? -6.655  13.912  2.871   1.00 0.00 ? 1   MET A HA     5  
ATOM   8573  H HB2    . MET C 2 1  ? -5.525  13.090  4.940   1.00 0.00 ? 1   MET A HB2    5  
ATOM   8574  H HB3    . MET C 2 1  ? -4.496  14.179  4.011   1.00 0.00 ? 1   MET A HB3    5  
ATOM   8575  H HG2    . MET C 2 1  ? -5.105  16.047  5.484   1.00 0.00 ? 1   MET A HG2    5  
ATOM   8576  H HG3    . MET C 2 1  ? -6.187  14.992  6.395   1.00 0.00 ? 1   MET A HG3    5  
ATOM   8577  H HE1    . MET C 2 1  ? -2.805  15.760  5.120   1.00 0.00 ? 1   MET A HE1    5  
ATOM   8578  H HE2    . MET C 2 1  ? -2.483  14.034  4.962   1.00 0.00 ? 1   MET A HE2    5  
ATOM   8579  H HE3    . MET C 2 1  ? -1.632  14.973  6.186   1.00 0.00 ? 1   MET A HE3    5  
ATOM   8580  N N      . ALA C 2 2  ? -8.549  13.278  4.501   1.00 0.00 ? 2   ALA A N      5  
ATOM   8581  C CA     . ALA C 2 2  ? -9.819  13.102  5.265   1.00 0.00 ? 2   ALA A CA     5  
ATOM   8582  C C      . ALA C 2 2  ? -9.857  11.721  5.928   1.00 0.00 ? 2   ALA A C      5  
ATOM   8583  O O      . ALA C 2 2  ? -10.911 11.211  6.255   1.00 0.00 ? 2   ALA A O      5  
ATOM   8584  C CB     . ALA C 2 2  ? -10.929 13.226  4.221   1.00 0.00 ? 2   ALA A CB     5  
ATOM   8585  H H      . ALA C 2 2  ? -8.206  12.545  3.947   1.00 0.00 ? 2   ALA A H      5  
ATOM   8586  H HA     . ALA C 2 2  ? -9.922  13.878  6.006   1.00 0.00 ? 2   ALA A HA     5  
ATOM   8587  H HB1    . ALA C 2 2  ? -10.605 13.884  3.428   1.00 0.00 ? 2   ALA A HB1    5  
ATOM   8588  H HB2    . ALA C 2 2  ? -11.816 13.630  4.686   1.00 0.00 ? 2   ALA A HB2    5  
ATOM   8589  H HB3    . ALA C 2 2  ? -11.149 12.251  3.813   1.00 0.00 ? 2   ALA A HB3    5  
ATOM   8590  N N      . GLU C 2 3  ? -8.717  11.115  6.130   1.00 0.00 ? 3   GLU A N      5  
ATOM   8591  C CA     . GLU C 2 3  ? -8.690  9.769   6.774   1.00 0.00 ? 3   GLU A CA     5  
ATOM   8592  C C      . GLU C 2 3  ? -7.822  9.795   8.039   1.00 0.00 ? 3   GLU A C      5  
ATOM   8593  O O      . GLU C 2 3  ? -7.663  8.794   8.709   1.00 0.00 ? 3   GLU A O      5  
ATOM   8594  C CB     . GLU C 2 3  ? -8.078  8.840   5.722   1.00 0.00 ? 3   GLU A CB     5  
ATOM   8595  C CG     . GLU C 2 3  ? -9.189  8.050   5.026   1.00 0.00 ? 3   GLU A CG     5  
ATOM   8596  C CD     . GLU C 2 3  ? -10.091 9.011   4.246   1.00 0.00 ? 3   GLU A CD     5  
ATOM   8597  O OE1    . GLU C 2 3  ? -9.592  10.029  3.795   1.00 0.00 ? 3   GLU A OE1    5  
ATOM   8598  O OE2    . GLU C 2 3  ? -11.266 8.710   4.114   1.00 0.00 ? 3   GLU A OE2    5  
ATOM   8599  H H      . GLU C 2 3  ? -7.879  11.544  5.860   1.00 0.00 ? 3   GLU A H      5  
ATOM   8600  H HA     . GLU C 2 3  ? -9.691  9.445   7.011   1.00 0.00 ? 3   GLU A HA     5  
ATOM   8601  H HB2    . GLU C 2 3  ? -7.541  9.429   4.993   1.00 0.00 ? 3   GLU A HB2    5  
ATOM   8602  H HB3    . GLU C 2 3  ? -7.398  8.153   6.203   1.00 0.00 ? 3   GLU A HB3    5  
ATOM   8603  H HG2    . GLU C 2 3  ? -8.749  7.337   4.345   1.00 0.00 ? 3   GLU A HG2    5  
ATOM   8604  H HG3    . GLU C 2 3  ? -9.776  7.528   5.765   1.00 0.00 ? 3   GLU A HG3    5  
ATOM   8605  N N      . ASP C 2 4  ? -7.262  10.931  8.373   1.00 0.00 ? 4   ASP A N      5  
ATOM   8606  C CA     . ASP C 2 4  ? -6.406  11.024  9.597   1.00 0.00 ? 4   ASP A CA     5  
ATOM   8607  C C      . ASP C 2 4  ? -5.228  10.049  9.504   1.00 0.00 ? 4   ASP A C      5  
ATOM   8608  O O      . ASP C 2 4  ? -5.388  8.850   9.622   1.00 0.00 ? 4   ASP A O      5  
ATOM   8609  C CB     . ASP C 2 4  ? -7.325  10.649  10.763  1.00 0.00 ? 4   ASP A CB     5  
ATOM   8610  C CG     . ASP C 2 4  ? -7.007  11.535  11.970  1.00 0.00 ? 4   ASP A CG     5  
ATOM   8611  O OD1    . ASP C 2 4  ? -5.837  11.784  12.205  1.00 0.00 ? 4   ASP A OD1    5  
ATOM   8612  O OD2    . ASP C 2 4  ? -7.941  11.950  12.636  1.00 0.00 ? 4   ASP A OD2    5  
ATOM   8613  H H      . ASP C 2 4  ? -7.404  11.727  7.821   1.00 0.00 ? 4   ASP A H      5  
ATOM   8614  H HA     . ASP C 2 4  ? -6.046  12.032  9.726   1.00 0.00 ? 4   ASP A HA     5  
ATOM   8615  H HB2    . ASP C 2 4  ? -8.355  10.794  10.471  1.00 0.00 ? 4   ASP A HB2    5  
ATOM   8616  H HB3    . ASP C 2 4  ? -7.168  9.614   11.028  1.00 0.00 ? 4   ASP A HB3    5  
ATOM   8617  N N      . TRP C 2 5  ? -4.043  10.559  9.298   1.00 0.00 ? 5   TRP A N      5  
ATOM   8618  C CA     . TRP C 2 5  ? -2.848  9.670   9.200   1.00 0.00 ? 5   TRP A CA     5  
ATOM   8619  C C      . TRP C 2 5  ? -2.382  9.262   10.601  1.00 0.00 ? 5   TRP A C      5  
ATOM   8620  O O      . TRP C 2 5  ? -2.241  10.088  11.482  1.00 0.00 ? 5   TRP A O      5  
ATOM   8621  C CB     . TRP C 2 5  ? -1.779  10.518  8.510   1.00 0.00 ? 5   TRP A CB     5  
ATOM   8622  C CG     . TRP C 2 5  ? -1.845  10.302  7.032   1.00 0.00 ? 5   TRP A CG     5  
ATOM   8623  C CD1    . TRP C 2 5  ? -2.487  11.107  6.155   1.00 0.00 ? 5   TRP A CD1    5  
ATOM   8624  C CD2    . TRP C 2 5  ? -1.254  9.228   6.243   1.00 0.00 ? 5   TRP A CD2    5  
ATOM   8625  N NE1    . TRP C 2 5  ? -2.330  10.596  4.880   1.00 0.00 ? 5   TRP A NE1    5  
ATOM   8626  C CE2    . TRP C 2 5  ? -1.577  9.439   4.883   1.00 0.00 ? 5   TRP A CE2    5  
ATOM   8627  C CE3    . TRP C 2 5  ? -0.477  8.103   6.573   1.00 0.00 ? 5   TRP A CE3    5  
ATOM   8628  C CZ2    . TRP C 2 5  ? -1.145  8.565   3.884   1.00 0.00 ? 5   TRP A CZ2    5  
ATOM   8629  C CZ3    . TRP C 2 5  ? -0.041  7.221   5.572   1.00 0.00 ? 5   TRP A CZ3    5  
ATOM   8630  C CH2    . TRP C 2 5  ? -0.374  7.451   4.230   1.00 0.00 ? 5   TRP A CH2    5  
ATOM   8631  H H      . TRP C 2 5  ? -3.938  11.530  9.210   1.00 0.00 ? 5   TRP A H      5  
ATOM   8632  H HA     . TRP C 2 5  ? -3.071  8.796   8.605   1.00 0.00 ? 5   TRP A HA     5  
ATOM   8633  H HB2    . TRP C 2 5  ? -1.953  11.561  8.727   1.00 0.00 ? 5   TRP A HB2    5  
ATOM   8634  H HB3    . TRP C 2 5  ? -0.804  10.232  8.873   1.00 0.00 ? 5   TRP A HB3    5  
ATOM   8635  H HD1    . TRP C 2 5  ? -3.034  12.002  6.410   1.00 0.00 ? 5   TRP A HD1    5  
ATOM   8636  H HE1    . TRP C 2 5  ? -2.698  10.992  4.063   1.00 0.00 ? 5   TRP A HE1    5  
ATOM   8637  H HE3    . TRP C 2 5  ? -0.215  7.916   7.604   1.00 0.00 ? 5   TRP A HE3    5  
ATOM   8638  H HZ2    . TRP C 2 5  ? -1.404  8.747   2.851   1.00 0.00 ? 5   TRP A HZ2    5  
ATOM   8639  H HZ3    . TRP C 2 5  ? 0.555   6.360   5.838   1.00 0.00 ? 5   TRP A HZ3    5  
ATOM   8640  H HH2    . TRP C 2 5  ? -0.036  6.769   3.464   1.00 0.00 ? 5   TRP A HH2    5  
ATOM   8641  N N      . LEU C 2 6  ? -2.142  7.996   10.813  1.00 0.00 ? 6   LEU A N      5  
ATOM   8642  C CA     . LEU C 2 6  ? -1.686  7.534   12.157  1.00 0.00 ? 6   LEU A CA     5  
ATOM   8643  C C      . LEU C 2 6  ? -0.212  7.122   12.100  1.00 0.00 ? 6   LEU A C      5  
ATOM   8644  O O      . LEU C 2 6  ? 0.324   6.851   11.046  1.00 0.00 ? 6   LEU A O      5  
ATOM   8645  C CB     . LEU C 2 6  ? -2.569  6.328   12.483  1.00 0.00 ? 6   LEU A CB     5  
ATOM   8646  C CG     . LEU C 2 6  ? -4.034  6.767   12.546  1.00 0.00 ? 6   LEU A CG     5  
ATOM   8647  C CD1    . LEU C 2 6  ? -4.936  5.532   12.607  1.00 0.00 ? 6   LEU A CD1    5  
ATOM   8648  C CD2    . LEU C 2 6  ? -4.260  7.624   13.796  1.00 0.00 ? 6   LEU A CD2    5  
ATOM   8649  H H      . LEU C 2 6  ? -2.264  7.348   10.088  1.00 0.00 ? 6   LEU A H      5  
ATOM   8650  H HA     . LEU C 2 6  ? -1.833  8.310   12.892  1.00 0.00 ? 6   LEU A HA     5  
ATOM   8651  H HB2    . LEU C 2 6  ? -2.451  5.578   11.714  1.00 0.00 ? 6   LEU A HB2    5  
ATOM   8652  H HB3    . LEU C 2 6  ? -2.278  5.917   13.437  1.00 0.00 ? 6   LEU A HB3    5  
ATOM   8653  H HG     . LEU C 2 6  ? -4.274  7.344   11.664  1.00 0.00 ? 6   LEU A HG     5  
ATOM   8654  H HD11   . LEU C 2 6  ? -5.042  5.115   11.616  1.00 0.00 ? 6   LEU A HD11   5  
ATOM   8655  H HD12   . LEU C 2 6  ? -5.907  5.814   12.985  1.00 0.00 ? 6   LEU A HD12   5  
ATOM   8656  H HD13   . LEU C 2 6  ? -4.494  4.796   13.262  1.00 0.00 ? 6   LEU A HD13   5  
ATOM   8657  H HD21   . LEU C 2 6  ? -4.917  8.447   13.553  1.00 0.00 ? 6   LEU A HD21   5  
ATOM   8658  H HD22   . LEU C 2 6  ? -3.314  8.012   14.144  1.00 0.00 ? 6   LEU A HD22   5  
ATOM   8659  H HD23   . LEU C 2 6  ? -4.709  7.022   14.571  1.00 0.00 ? 6   LEU A HD23   5  
ATOM   8660  N N      . ASP C 2 7  ? 0.446   7.074   13.227  1.00 0.00 ? 7   ASP A N      5  
ATOM   8661  C CA     . ASP C 2 7  ? 1.885   6.679   13.237  1.00 0.00 ? 7   ASP A CA     5  
ATOM   8662  C C      . ASP C 2 7  ? 2.039   5.234   12.752  1.00 0.00 ? 7   ASP A C      5  
ATOM   8663  O O      . ASP C 2 7  ? 1.070   4.567   12.448  1.00 0.00 ? 7   ASP A O      5  
ATOM   8664  C CB     . ASP C 2 7  ? 2.325   6.802   14.697  1.00 0.00 ? 7   ASP A CB     5  
ATOM   8665  C CG     . ASP C 2 7  ? 2.707   8.253   14.995  1.00 0.00 ? 7   ASP A CG     5  
ATOM   8666  O OD1    . ASP C 2 7  ? 1.979   9.136   14.570  1.00 0.00 ? 7   ASP A OD1    5  
ATOM   8667  O OD2    . ASP C 2 7  ? 3.722   8.458   15.640  1.00 0.00 ? 7   ASP A OD2    5  
ATOM   8668  H H      . ASP C 2 7  ? -0.006  7.298   14.066  1.00 0.00 ? 7   ASP A H      5  
ATOM   8669  H HA     . ASP C 2 7  ? 2.464   7.348   12.620  1.00 0.00 ? 7   ASP A HA     5  
ATOM   8670  H HB2    . ASP C 2 7  ? 1.512   6.504   15.343  1.00 0.00 ? 7   ASP A HB2    5  
ATOM   8671  H HB3    . ASP C 2 7  ? 3.178   6.165   14.872  1.00 0.00 ? 7   ASP A HB3    5  
ATOM   8672  N N      . CYS C 2 8  ? 3.249   4.749   12.679  1.00 0.00 ? 8   CYS A N      5  
ATOM   8673  C CA     . CYS C 2 8  ? 3.469   3.350   12.215  1.00 0.00 ? 8   CYS A CA     5  
ATOM   8674  C C      . CYS C 2 8  ? 4.756   2.789   12.835  1.00 0.00 ? 8   CYS A C      5  
ATOM   8675  O O      . CYS C 2 8  ? 5.820   2.900   12.261  1.00 0.00 ? 8   CYS A O      5  
ATOM   8676  C CB     . CYS C 2 8  ? 3.595   3.455   10.696  1.00 0.00 ? 8   CYS A CB     5  
ATOM   8677  S SG     . CYS C 2 8  ? 3.836   1.807   9.988   1.00 0.00 ? 8   CYS A SG     5  
ATOM   8678  H H      . CYS C 2 8  ? 4.016   5.306   12.930  1.00 0.00 ? 8   CYS A H      5  
ATOM   8679  H HA     . CYS C 2 8  ? 2.624   2.730   12.473  1.00 0.00 ? 8   CYS A HA     5  
ATOM   8680  H HB2    . CYS C 2 8  ? 2.695   3.893   10.290  1.00 0.00 ? 8   CYS A HB2    5  
ATOM   8681  H HB3    . CYS C 2 8  ? 4.440   4.080   10.450  1.00 0.00 ? 8   CYS A HB3    5  
ATOM   8682  H HG     . CYS C 2 8  ? 4.663   1.810   9.501   1.00 0.00 ? 8   CYS A HG     5  
ATOM   8683  N N      . PRO C 2 9  ? 4.609   2.206   13.998  1.00 0.00 ? 9   PRO A N      5  
ATOM   8684  C CA     . PRO C 2 9  ? 5.772   1.622   14.715  1.00 0.00 ? 9   PRO A CA     5  
ATOM   8685  C C      . PRO C 2 9  ? 6.253   0.333   14.052  1.00 0.00 ? 9   PRO A C      5  
ATOM   8686  O O      . PRO C 2 9  ? 7.257   -0.231  14.444  1.00 0.00 ? 9   PRO A O      5  
ATOM   8687  C CB     . PRO C 2 9  ? 5.222   1.313   16.100  1.00 0.00 ? 9   PRO A CB     5  
ATOM   8688  C CG     . PRO C 2 9  ? 3.747   1.165   15.911  1.00 0.00 ? 9   PRO A CG     5  
ATOM   8689  C CD     . PRO C 2 9  ? 3.359   2.036   14.748  1.00 0.00 ? 9   PRO A CD     5  
ATOM   8690  H HA     . PRO C 2 9  ? 6.573   2.336   14.789  1.00 0.00 ? 9   PRO A HA     5  
ATOM   8691  H HB2    . PRO C 2 9  ? 5.649   0.386   16.463  1.00 0.00 ? 9   PRO A HB2    5  
ATOM   8692  H HB3    . PRO C 2 9  ? 5.431   2.122   16.782  1.00 0.00 ? 9   PRO A HB3    5  
ATOM   8693  H HG2    . PRO C 2 9  ? 3.505   0.133   15.700  1.00 0.00 ? 9   PRO A HG2    5  
ATOM   8694  H HG3    . PRO C 2 9  ? 3.227   1.493   16.797  1.00 0.00 ? 9   PRO A HG3    5  
ATOM   8695  H HD2    . PRO C 2 9  ? 2.612   1.543   14.139  1.00 0.00 ? 9   PRO A HD2    5  
ATOM   8696  H HD3    . PRO C 2 9  ? 2.999   2.992   15.092  1.00 0.00 ? 9   PRO A HD3    5  
ATOM   8697  N N      . ALA C 2 10 ? 5.545   -0.152  13.074  1.00 0.00 ? 10  ALA A N      5  
ATOM   8698  C CA     . ALA C 2 10 ? 5.966   -1.421  12.418  1.00 0.00 ? 10  ALA A CA     5  
ATOM   8699  C C      . ALA C 2 10 ? 7.426   -1.344  11.964  1.00 0.00 ? 10  ALA A C      5  
ATOM   8700  O O      . ALA C 2 10 ? 8.158   -2.311  12.035  1.00 0.00 ? 10  ALA A O      5  
ATOM   8701  C CB     . ALA C 2 10 ? 5.036   -1.583  11.214  1.00 0.00 ? 10  ALA A CB     5  
ATOM   8702  H H      . ALA C 2 10 ? 4.729   0.305   12.783  1.00 0.00 ? 10  ALA A H      5  
ATOM   8703  H HA     . ALA C 2 10 ? 5.831   -2.242  13.101  1.00 0.00 ? 10  ALA A HA     5  
ATOM   8704  H HB1    . ALA C 2 10 ? 5.618   -1.563  10.304  1.00 0.00 ? 10  ALA A HB1    5  
ATOM   8705  H HB2    . ALA C 2 10 ? 4.320   -0.775  11.199  1.00 0.00 ? 10  ALA A HB2    5  
ATOM   8706  H HB3    . ALA C 2 10 ? 4.514   -2.525  11.285  1.00 0.00 ? 10  ALA A HB3    5  
ATOM   8707  N N      . LEU C 2 11 ? 7.852   -0.204  11.495  1.00 0.00 ? 11  LEU A N      5  
ATOM   8708  C CA     . LEU C 2 11 ? 9.264   -0.071  11.029  1.00 0.00 ? 11  LEU A CA     5  
ATOM   8709  C C      . LEU C 2 11 ? 10.058  0.854   11.957  1.00 0.00 ? 11  LEU A C      5  
ATOM   8710  O O      . LEU C 2 11 ? 11.010  0.437   12.590  1.00 0.00 ? 11  LEU A O      5  
ATOM   8711  C CB     . LEU C 2 11 ? 9.156   0.530   9.629   1.00 0.00 ? 11  LEU A CB     5  
ATOM   8712  C CG     . LEU C 2 11 ? 8.423   -0.452  8.711   1.00 0.00 ? 11  LEU A CG     5  
ATOM   8713  C CD1    . LEU C 2 11 ? 6.951   -0.048  8.601   1.00 0.00 ? 11  LEU A CD1    5  
ATOM   8714  C CD2    . LEU C 2 11 ? 9.064   -0.429  7.320   1.00 0.00 ? 11  LEU A CD2    5  
ATOM   8715  H H      . LEU C 2 11 ? 7.244   0.560   11.443  1.00 0.00 ? 11  LEU A H      5  
ATOM   8716  H HA     . LEU C 2 11 ? 9.733   -1.041  10.974  1.00 0.00 ? 11  LEU A HA     5  
ATOM   8717  H HB2    . LEU C 2 11 ? 8.607   1.459   9.677   1.00 0.00 ? 11  LEU A HB2    5  
ATOM   8718  H HB3    . LEU C 2 11 ? 10.146  0.715   9.239   1.00 0.00 ? 11  LEU A HB3    5  
ATOM   8719  H HG     . LEU C 2 11 ? 8.491   -1.449  9.124   1.00 0.00 ? 11  LEU A HG     5  
ATOM   8720  H HD11   . LEU C 2 11 ? 6.845   0.722   7.850   1.00 0.00 ? 11  LEU A HD11   5  
ATOM   8721  H HD12   . LEU C 2 11 ? 6.609   0.329   9.553   1.00 0.00 ? 11  LEU A HD12   5  
ATOM   8722  H HD13   . LEU C 2 11 ? 6.362   -0.909  8.320   1.00 0.00 ? 11  LEU A HD13   5  
ATOM   8723  H HD21   . LEU C 2 11 ? 10.031  0.048   7.375   1.00 0.00 ? 11  LEU A HD21   5  
ATOM   8724  H HD22   . LEU C 2 11 ? 8.430   0.119   6.640   1.00 0.00 ? 11  LEU A HD22   5  
ATOM   8725  H HD23   . LEU C 2 11 ? 9.183   -1.442  6.964   1.00 0.00 ? 11  LEU A HD23   5  
ATOM   8726  N N      . GLY C 2 12 ? 9.685   2.105   12.043  1.00 0.00 ? 12  GLY A N      5  
ATOM   8727  C CA     . GLY C 2 12 ? 10.432  3.043   12.931  1.00 0.00 ? 12  GLY A CA     5  
ATOM   8728  C C      . GLY C 2 12 ? 9.783   4.431   12.896  1.00 0.00 ? 12  GLY A C      5  
ATOM   8729  O O      . GLY C 2 12 ? 8.632   4.567   12.528  1.00 0.00 ? 12  GLY A O      5  
ATOM   8730  H H      . GLY C 2 12 ? 8.917   2.425   11.525  1.00 0.00 ? 12  GLY A H      5  
ATOM   8731  H HA2    . GLY C 2 12 ? 10.419  2.665   13.943  1.00 0.00 ? 12  GLY A HA2    5  
ATOM   8732  H HA3    . GLY C 2 12 ? 11.454  3.121   12.591  1.00 0.00 ? 12  GLY A HA3    5  
ATOM   8733  N N      . PRO C 2 13 ? 10.546  5.421   13.290  1.00 0.00 ? 13  PRO A N      5  
ATOM   8734  C CA     . PRO C 2 13 ? 10.035  6.815   13.311  1.00 0.00 ? 13  PRO A CA     5  
ATOM   8735  C C      . PRO C 2 13 ? 9.929   7.375   11.889  1.00 0.00 ? 13  PRO A C      5  
ATOM   8736  O O      . PRO C 2 13 ? 10.725  7.062   11.026  1.00 0.00 ? 13  PRO A O      5  
ATOM   8737  C CB     . PRO C 2 13 ? 11.091  7.572   14.112  1.00 0.00 ? 13  PRO A CB     5  
ATOM   8738  C CG     . PRO C 2 13 ? 12.346  6.776   13.953  1.00 0.00 ? 13  PRO A CG     5  
ATOM   8739  C CD     . PRO C 2 13 ? 11.939  5.339   13.749  1.00 0.00 ? 13  PRO A CD     5  
ATOM   8740  H HA     . PRO C 2 13 ? 9.084   6.866   13.813  1.00 0.00 ? 13  PRO A HA     5  
ATOM   8741  H HB2    . PRO C 2 13 ? 11.221  8.569   13.711  1.00 0.00 ? 13  PRO A HB2    5  
ATOM   8742  H HB3    . PRO C 2 13 ? 10.811  7.619   15.153  1.00 0.00 ? 13  PRO A HB3    5  
ATOM   8743  H HG2    . PRO C 2 13 ? 12.901  7.131   13.095  1.00 0.00 ? 13  PRO A HG2    5  
ATOM   8744  H HG3    . PRO C 2 13 ? 12.950  6.859   14.843  1.00 0.00 ? 13  PRO A HG3    5  
ATOM   8745  H HD2    . PRO C 2 13 ? 12.563  4.875   12.995  1.00 0.00 ? 13  PRO A HD2    5  
ATOM   8746  H HD3    . PRO C 2 13 ? 11.994  4.793   14.677  1.00 0.00 ? 13  PRO A HD3    5  
ATOM   8747  N N      . GLY C 2 14 ? 8.949   8.204   11.646  1.00 0.00 ? 14  GLY A N      5  
ATOM   8748  C CA     . GLY C 2 14 ? 8.777   8.793   10.287  1.00 0.00 ? 14  GLY A CA     5  
ATOM   8749  C C      . GLY C 2 14 ? 7.672   8.038   9.546   1.00 0.00 ? 14  GLY A C      5  
ATOM   8750  O O      . GLY C 2 14 ? 6.912   8.614   8.791   1.00 0.00 ? 14  GLY A O      5  
ATOM   8751  H H      . GLY C 2 14 ? 8.324   8.439   12.359  1.00 0.00 ? 14  GLY A H      5  
ATOM   8752  H HA2    . GLY C 2 14 ? 8.507   9.835   10.378  1.00 0.00 ? 14  GLY A HA2    5  
ATOM   8753  H HA3    . GLY C 2 14 ? 9.705   8.706   9.731   1.00 0.00 ? 14  GLY A HA3    5  
ATOM   8754  N N      . TRP C 2 15 ? 7.591   6.748   9.741   1.00 0.00 ? 15  TRP A N      5  
ATOM   8755  C CA     . TRP C 2 15 ? 6.552   5.942   9.033   1.00 0.00 ? 15  TRP A CA     5  
ATOM   8756  C C      . TRP C 2 15 ? 5.147   6.418   9.404   1.00 0.00 ? 15  TRP A C      5  
ATOM   8757  O O      . TRP C 2 15 ? 4.899   6.863   10.508  1.00 0.00 ? 15  TRP A O      5  
ATOM   8758  C CB     . TRP C 2 15 ? 6.771   4.505   9.508   1.00 0.00 ? 15  TRP A CB     5  
ATOM   8759  C CG     . TRP C 2 15 ? 7.921   3.901   8.771   1.00 0.00 ? 15  TRP A CG     5  
ATOM   8760  C CD1    . TRP C 2 15 ? 9.189   3.827   9.236   1.00 0.00 ? 15  TRP A CD1    5  
ATOM   8761  C CD2    . TRP C 2 15 ? 7.930   3.283   7.453   1.00 0.00 ? 15  TRP A CD2    5  
ATOM   8762  N NE1    . TRP C 2 15 ? 9.976   3.202   8.285   1.00 0.00 ? 15  TRP A NE1    5  
ATOM   8763  C CE2    . TRP C 2 15 ? 9.245   2.848   7.169   1.00 0.00 ? 15  TRP A CE2    5  
ATOM   8764  C CE3    . TRP C 2 15 ? 6.934   3.059   6.486   1.00 0.00 ? 15  TRP A CE3    5  
ATOM   8765  C CZ2    . TRP C 2 15 ? 9.563   2.213   5.969   1.00 0.00 ? 15  TRP A CZ2    5  
ATOM   8766  C CZ3    . TRP C 2 15 ? 7.250   2.421   5.277   1.00 0.00 ? 15  TRP A CZ3    5  
ATOM   8767  C CH2    . TRP C 2 15 ? 8.563   1.998   5.018   1.00 0.00 ? 15  TRP A CH2    5  
ATOM   8768  H H      . TRP C 2 15 ? 8.225   6.305   10.345  1.00 0.00 ? 15  TRP A H      5  
ATOM   8769  H HA     . TRP C 2 15 ? 6.698   6.000   7.967   1.00 0.00 ? 15  TRP A HA     5  
ATOM   8770  H HB2    . TRP C 2 15 ? 6.979   4.503   10.568  1.00 0.00 ? 15  TRP A HB2    5  
ATOM   8771  H HB3    . TRP C 2 15 ? 5.881   3.926   9.316   1.00 0.00 ? 15  TRP A HB3    5  
ATOM   8772  H HD1    . TRP C 2 15 ? 9.532   4.196   10.191  1.00 0.00 ? 15  TRP A HD1    5  
ATOM   8773  H HE1    . TRP C 2 15 ? 10.935  3.023   8.371   1.00 0.00 ? 15  TRP A HE1    5  
ATOM   8774  H HE3    . TRP C 2 15 ? 5.920   3.379   6.674   1.00 0.00 ? 15  TRP A HE3    5  
ATOM   8775  H HZ2    . TRP C 2 15 ? 10.575  1.890   5.775   1.00 0.00 ? 15  TRP A HZ2    5  
ATOM   8776  H HZ3    . TRP C 2 15 ? 6.478   2.254   4.540   1.00 0.00 ? 15  TRP A HZ3    5  
ATOM   8777  H HH2    . TRP C 2 15 ? 8.799   1.508   4.086   1.00 0.00 ? 15  TRP A HH2    5  
ATOM   8778  N N      . LYS C 2 16 ? 4.225   6.319   8.484   1.00 0.00 ? 16  LYS A N      5  
ATOM   8779  C CA     . LYS C 2 16 ? 2.825   6.755   8.766   1.00 0.00 ? 16  LYS A CA     5  
ATOM   8780  C C      . LYS C 2 16 ? 1.838   5.770   8.134   1.00 0.00 ? 16  LYS A C      5  
ATOM   8781  O O      . LYS C 2 16 ? 2.135   5.135   7.142   1.00 0.00 ? 16  LYS A O      5  
ATOM   8782  C CB     . LYS C 2 16 ? 2.702   8.135   8.117   1.00 0.00 ? 16  LYS A CB     5  
ATOM   8783  C CG     . LYS C 2 16 ? 2.619   9.212   9.202   1.00 0.00 ? 16  LYS A CG     5  
ATOM   8784  C CD     . LYS C 2 16 ? 4.008   9.809   9.436   1.00 0.00 ? 16  LYS A CD     5  
ATOM   8785  C CE     . LYS C 2 16 ? 3.868   11.185  10.093  1.00 0.00 ? 16  LYS A CE     5  
ATOM   8786  N NZ     . LYS C 2 16 ? 3.964   12.161  8.971   1.00 0.00 ? 16  LYS A NZ     5  
ATOM   8787  H H      . LYS C 2 16 ? 4.454   5.952   7.603   1.00 0.00 ? 16  LYS A H      5  
ATOM   8788  H HA     . LYS C 2 16 ? 2.658   6.828   9.831   1.00 0.00 ? 16  LYS A HA     5  
ATOM   8789  H HB2    . LYS C 2 16 ? 3.565   8.318   7.493   1.00 0.00 ? 16  LYS A HB2    5  
ATOM   8790  H HB3    . LYS C 2 16 ? 1.808   8.170   7.511   1.00 0.00 ? 16  LYS A HB3    5  
ATOM   8791  H HG2    . LYS C 2 16 ? 1.939   9.989   8.886   1.00 0.00 ? 16  LYS A HG2    5  
ATOM   8792  H HG3    . LYS C 2 16 ? 2.260   8.770   10.120  1.00 0.00 ? 16  LYS A HG3    5  
ATOM   8793  H HD2    . LYS C 2 16 ? 4.576   9.156   10.083  1.00 0.00 ? 16  LYS A HD2    5  
ATOM   8794  H HD3    . LYS C 2 16 ? 4.518   9.914   8.491   1.00 0.00 ? 16  LYS A HD3    5  
ATOM   8795  H HE2    . LYS C 2 16 ? 2.910   11.268  10.588  1.00 0.00 ? 16  LYS A HE2    5  
ATOM   8796  H HE3    . LYS C 2 16 ? 4.671   11.349  10.795  1.00 0.00 ? 16  LYS A HE3    5  
ATOM   8797  H HZ1    . LYS C 2 16 ? 3.074   12.159  8.433   1.00 0.00 ? 16  LYS A HZ1    5  
ATOM   8798  H HZ2    . LYS C 2 16 ? 4.137   13.113  9.356   1.00 0.00 ? 16  LYS A HZ2    5  
ATOM   8799  H HZ3    . LYS C 2 16 ? 4.747   11.892  8.342   1.00 0.00 ? 16  LYS A HZ3    5  
ATOM   8800  N N      . ARG C 2 17 ? 0.668   5.634   8.700   1.00 0.00 ? 17  ARG A N      5  
ATOM   8801  C CA     . ARG C 2 17 ? -0.332  4.686   8.129   1.00 0.00 ? 17  ARG A CA     5  
ATOM   8802  C C      . ARG C 2 17 ? -1.707  5.353   8.022   1.00 0.00 ? 17  ARG A C      5  
ATOM   8803  O O      . ARG C 2 17 ? -2.109  6.120   8.874   1.00 0.00 ? 17  ARG A O      5  
ATOM   8804  C CB     . ARG C 2 17 ? -0.380  3.513   9.114   1.00 0.00 ? 17  ARG A CB     5  
ATOM   8805  C CG     . ARG C 2 17 ? -1.540  2.578   8.747   1.00 0.00 ? 17  ARG A CG     5  
ATOM   8806  C CD     . ARG C 2 17 ? -1.550  1.369   9.687   1.00 0.00 ? 17  ARG A CD     5  
ATOM   8807  N NE     . ARG C 2 17 ? -1.668  1.943   11.056  1.00 0.00 ? 17  ARG A NE     5  
ATOM   8808  C CZ     . ARG C 2 17 ? -2.787  1.828   11.717  1.00 0.00 ? 17  ARG A CZ     5  
ATOM   8809  N NH1    . ARG C 2 17 ? -3.924  2.069   11.123  1.00 0.00 ? 17  ARG A NH1    5  
ATOM   8810  N NH2    . ARG C 2 17 ? -2.769  1.473   12.972  1.00 0.00 ? 17  ARG A NH2    5  
ATOM   8811  H H      . ARG C 2 17 ? 0.449   6.153   9.503   1.00 0.00 ? 17  ARG A H      5  
ATOM   8812  H HA     . ARG C 2 17 ? -0.009  4.337   7.160   1.00 0.00 ? 17  ARG A HA     5  
ATOM   8813  H HB2    . ARG C 2 17 ? 0.551   2.967   9.068   1.00 0.00 ? 17  ARG A HB2    5  
ATOM   8814  H HB3    . ARG C 2 17 ? -0.528  3.889   10.115  1.00 0.00 ? 17  ARG A HB3    5  
ATOM   8815  H HG2    . ARG C 2 17 ? -2.474  3.112   8.839   1.00 0.00 ? 17  ARG A HG2    5  
ATOM   8816  H HG3    . ARG C 2 17 ? -1.420  2.238   7.729   1.00 0.00 ? 17  ARG A HG3    5  
ATOM   8817  H HD2    . ARG C 2 17 ? -2.399  0.734   9.468   1.00 0.00 ? 17  ARG A HD2    5  
ATOM   8818  H HD3    . ARG C 2 17 ? -0.630  0.814   9.596   1.00 0.00 ? 17  ARG A HD3    5  
ATOM   8819  H HE     . ARG C 2 17 ? -0.905  2.407   11.460  1.00 0.00 ? 17  ARG A HE     5  
ATOM   8820  H HH11   . ARG C 2 17 ? -3.937  2.341   10.161  1.00 0.00 ? 17  ARG A HH11   5  
ATOM   8821  H HH12   . ARG C 2 17 ? -4.781  1.981   11.629  1.00 0.00 ? 17  ARG A HH12   5  
ATOM   8822  H HH21   . ARG C 2 17 ? -1.898  1.288   13.427  1.00 0.00 ? 17  ARG A HH21   5  
ATOM   8823  H HH22   . ARG C 2 17 ? -3.627  1.384   13.479  1.00 0.00 ? 17  ARG A HH22   5  
ATOM   8824  N N      . ARG C 2 18 ? -2.431  5.049   6.979   1.00 0.00 ? 18  ARG A N      5  
ATOM   8825  C CA     . ARG C 2 18 ? -3.787  5.638   6.799   1.00 0.00 ? 18  ARG A CA     5  
ATOM   8826  C C      . ARG C 2 18 ? -4.774  4.533   6.415   1.00 0.00 ? 18  ARG A C      5  
ATOM   8827  O O      . ARG C 2 18 ? -4.446  3.633   5.666   1.00 0.00 ? 18  ARG A O      5  
ATOM   8828  C CB     . ARG C 2 18 ? -3.633  6.648   5.659   1.00 0.00 ? 18  ARG A CB     5  
ATOM   8829  C CG     . ARG C 2 18 ? -4.999  7.241   5.308   1.00 0.00 ? 18  ARG A CG     5  
ATOM   8830  C CD     . ARG C 2 18 ? -4.807  8.556   4.549   1.00 0.00 ? 18  ARG A CD     5  
ATOM   8831  N NE     . ARG C 2 18 ? -5.812  8.516   3.449   1.00 0.00 ? 18  ARG A NE     5  
ATOM   8832  C CZ     . ARG C 2 18 ? -6.182  9.622   2.859   1.00 0.00 ? 18  ARG A CZ     5  
ATOM   8833  N NH1    . ARG C 2 18 ? -5.327  10.594  2.694   1.00 0.00 ? 18  ARG A NH1    5  
ATOM   8834  N NH2    . ARG C 2 18 ? -7.408  9.754   2.434   1.00 0.00 ? 18  ARG A NH2    5  
ATOM   8835  H H      . ARG C 2 18 ? -2.083  4.422   6.315   1.00 0.00 ? 18  ARG A H      5  
ATOM   8836  H HA     . ARG C 2 18 ? -4.107  6.138   7.699   1.00 0.00 ? 18  ARG A HA     5  
ATOM   8837  H HB2    . ARG C 2 18 ? -2.965  7.438   5.968   1.00 0.00 ? 18  ARG A HB2    5  
ATOM   8838  H HB3    . ARG C 2 18 ? -3.225  6.150   4.792   1.00 0.00 ? 18  ARG A HB3    5  
ATOM   8839  H HG2    . ARG C 2 18 ? -5.546  6.544   4.689   1.00 0.00 ? 18  ARG A HG2    5  
ATOM   8840  H HG3    . ARG C 2 18 ? -5.554  7.430   6.215   1.00 0.00 ? 18  ARG A HG3    5  
ATOM   8841  H HD2    . ARG C 2 18 ? -4.994  9.398   5.203   1.00 0.00 ? 18  ARG A HD2    5  
ATOM   8842  H HD3    . ARG C 2 18 ? -3.811  8.612   4.137   1.00 0.00 ? 18  ARG A HD3    5  
ATOM   8843  H HE     . ARG C 2 18 ? -6.195  7.661   3.167   1.00 0.00 ? 18  ARG A HE     5  
ATOM   8844  H HH11   . ARG C 2 18 ? -4.387  10.493  3.020   1.00 0.00 ? 18  ARG A HH11   5  
ATOM   8845  H HH12   . ARG C 2 18 ? -5.612  11.440  2.243   1.00 0.00 ? 18  ARG A HH12   5  
ATOM   8846  H HH21   . ARG C 2 18 ? -8.064  9.009   2.558   1.00 0.00 ? 18  ARG A HH21   5  
ATOM   8847  H HH22   . ARG C 2 18 ? -7.693  10.600  1.983   1.00 0.00 ? 18  ARG A HH22   5  
ATOM   8848  N N      . GLU C 2 19 ? -5.978  4.589   6.918   1.00 0.00 ? 19  GLU A N      5  
ATOM   8849  C CA     . GLU C 2 19 ? -6.977  3.535   6.576   1.00 0.00 ? 19  GLU A CA     5  
ATOM   8850  C C      . GLU C 2 19 ? -7.918  4.041   5.481   1.00 0.00 ? 19  GLU A C      5  
ATOM   8851  O O      . GLU C 2 19 ? -8.481  5.113   5.579   1.00 0.00 ? 19  GLU A O      5  
ATOM   8852  C CB     . GLU C 2 19 ? -7.744  3.272   7.875   1.00 0.00 ? 19  GLU A CB     5  
ATOM   8853  C CG     . GLU C 2 19 ? -7.458  1.848   8.359   1.00 0.00 ? 19  GLU A CG     5  
ATOM   8854  C CD     . GLU C 2 19 ? -8.246  1.576   9.641   1.00 0.00 ? 19  GLU A CD     5  
ATOM   8855  O OE1    . GLU C 2 19 ? -7.783  1.981   10.695  1.00 0.00 ? 19  GLU A OE1    5  
ATOM   8856  O OE2    . GLU C 2 19 ? -9.298  0.966   9.548   1.00 0.00 ? 19  GLU A OE2    5  
ATOM   8857  H H      . GLU C 2 19 ? -6.224  5.322   7.521   1.00 0.00 ? 19  GLU A H      5  
ATOM   8858  H HA     . GLU C 2 19 ? -6.477  2.635   6.254   1.00 0.00 ? 19  GLU A HA     5  
ATOM   8859  H HB2    . GLU C 2 19 ? -7.430  3.979   8.628   1.00 0.00 ? 19  GLU A HB2    5  
ATOM   8860  H HB3    . GLU C 2 19 ? -8.803  3.383   7.697   1.00 0.00 ? 19  GLU A HB3    5  
ATOM   8861  H HG2    . GLU C 2 19 ? -7.755  1.142   7.595   1.00 0.00 ? 19  GLU A HG2    5  
ATOM   8862  H HG3    . GLU C 2 19 ? -6.401  1.740   8.557   1.00 0.00 ? 19  GLU A HG3    5  
ATOM   8863  N N      . VAL C 2 20 ? -8.085  3.276   4.435   1.00 0.00 ? 20  VAL A N      5  
ATOM   8864  C CA     . VAL C 2 20 ? -8.982  3.710   3.325   1.00 0.00 ? 20  VAL A CA     5  
ATOM   8865  C C      . VAL C 2 20 ? -10.175 2.759   3.202   1.00 0.00 ? 20  VAL A C      5  
ATOM   8866  O O      . VAL C 2 20 ? -10.071 1.696   2.625   1.00 0.00 ? 20  VAL A O      5  
ATOM   8867  C CB     . VAL C 2 20 ? -8.121  3.641   2.061   1.00 0.00 ? 20  VAL A CB     5  
ATOM   8868  C CG1    . VAL C 2 20 ? -8.888  4.254   0.888   1.00 0.00 ? 20  VAL A CG1    5  
ATOM   8869  C CG2    . VAL C 2 20 ? -6.822  4.419   2.278   1.00 0.00 ? 20  VAL A CG2    5  
ATOM   8870  H H      . VAL C 2 20 ? -7.615  2.418   4.377   1.00 0.00 ? 20  VAL A H      5  
ATOM   8871  H HA     . VAL C 2 20 ? -9.317  4.721   3.485   1.00 0.00 ? 20  VAL A HA     5  
ATOM   8872  H HB     . VAL C 2 20 ? -7.892  2.609   1.839   1.00 0.00 ? 20  VAL A HB     5  
ATOM   8873  H HG11   . VAL C 2 20 ? -9.881  3.831   0.846   1.00 0.00 ? 20  VAL A HG11   5  
ATOM   8874  H HG12   . VAL C 2 20 ? -8.367  4.039   -0.033  1.00 0.00 ? 20  VAL A HG12   5  
ATOM   8875  H HG13   . VAL C 2 20 ? -8.956  5.323   1.022   1.00 0.00 ? 20  VAL A HG13   5  
ATOM   8876  H HG21   . VAL C 2 20 ? -6.227  3.922   3.030   1.00 0.00 ? 20  VAL A HG21   5  
ATOM   8877  H HG22   . VAL C 2 20 ? -7.052  5.422   2.605   1.00 0.00 ? 20  VAL A HG22   5  
ATOM   8878  H HG23   . VAL C 2 20 ? -6.268  4.460   1.351   1.00 0.00 ? 20  VAL A HG23   5  
ATOM   8879  N N      . PHE C 2 21 ? -11.308 3.134   3.731   1.00 0.00 ? 21  PHE A N      5  
ATOM   8880  C CA     . PHE C 2 21 ? -12.508 2.250   3.633   1.00 0.00 ? 21  PHE A CA     5  
ATOM   8881  C C      . PHE C 2 21 ? -13.189 2.442   2.275   1.00 0.00 ? 21  PHE A C      5  
ATOM   8882  O O      . PHE C 2 21 ? -14.385 2.643   2.194   1.00 0.00 ? 21  PHE A O      5  
ATOM   8883  C CB     . PHE C 2 21 ? -13.429 2.706   4.766   1.00 0.00 ? 21  PHE A CB     5  
ATOM   8884  C CG     . PHE C 2 21 ? -13.988 1.500   5.483   1.00 0.00 ? 21  PHE A CG     5  
ATOM   8885  C CD1    . PHE C 2 21 ? -14.674 0.513   4.764   1.00 0.00 ? 21  PHE A CD1    5  
ATOM   8886  C CD2    . PHE C 2 21 ? -13.822 1.370   6.867   1.00 0.00 ? 21  PHE A CD2    5  
ATOM   8887  C CE1    . PHE C 2 21 ? -15.193 -0.604  5.429   1.00 0.00 ? 21  PHE A CE1    5  
ATOM   8888  C CE2    . PHE C 2 21 ? -14.341 0.252   7.532   1.00 0.00 ? 21  PHE A CE2    5  
ATOM   8889  C CZ     . PHE C 2 21 ? -15.027 -0.734  6.814   1.00 0.00 ? 21  PHE A CZ     5  
ATOM   8890  H H      . PHE C 2 21 ? -11.374 4.000   4.186   1.00 0.00 ? 21  PHE A H      5  
ATOM   8891  H HA     . PHE C 2 21 ? -12.228 1.218   3.774   1.00 0.00 ? 21  PHE A HA     5  
ATOM   8892  H HB2    . PHE C 2 21 ? -12.869 3.311   5.464   1.00 0.00 ? 21  PHE A HB2    5  
ATOM   8893  H HB3    . PHE C 2 21 ? -14.241 3.289   4.357   1.00 0.00 ? 21  PHE A HB3    5  
ATOM   8894  H HD1    . PHE C 2 21 ? -14.803 0.614   3.696   1.00 0.00 ? 21  PHE A HD1    5  
ATOM   8895  H HD2    . PHE C 2 21 ? -13.293 2.131   7.421   1.00 0.00 ? 21  PHE A HD2    5  
ATOM   8896  H HE1    . PHE C 2 21 ? -15.722 -1.364  4.875   1.00 0.00 ? 21  PHE A HE1    5  
ATOM   8897  H HE2    . PHE C 2 21 ? -14.212 0.152   8.600   1.00 0.00 ? 21  PHE A HE2    5  
ATOM   8898  H HZ     . PHE C 2 21 ? -15.427 -1.595  7.327   1.00 0.00 ? 21  PHE A HZ     5  
ATOM   8899  N N      . ARG C 2 22 ? -12.434 2.376   1.205   1.00 0.00 ? 22  ARG A N      5  
ATOM   8900  C CA     . ARG C 2 22 ? -13.019 2.553   -0.158  1.00 0.00 ? 22  ARG A CA     5  
ATOM   8901  C C      . ARG C 2 22 ? -13.901 3.806   -0.217  1.00 0.00 ? 22  ARG A C      5  
ATOM   8902  O O      . ARG C 2 22 ? -14.060 4.522   0.752   1.00 0.00 ? 22  ARG A O      5  
ATOM   8903  C CB     . ARG C 2 22 ? -13.863 1.306   -0.386  1.00 0.00 ? 22  ARG A CB     5  
ATOM   8904  C CG     . ARG C 2 22 ? -13.045 0.269   -1.156  1.00 0.00 ? 22  ARG A CG     5  
ATOM   8905  C CD     . ARG C 2 22 ? -12.945 0.672   -2.629  1.00 0.00 ? 22  ARG A CD     5  
ATOM   8906  N NE     . ARG C 2 22 ? -11.495 0.596   -2.949  1.00 0.00 ? 22  ARG A NE     5  
ATOM   8907  C CZ     . ARG C 2 22 ? -10.906 -0.563  -3.079  1.00 0.00 ? 22  ARG A CZ     5  
ATOM   8908  N NH1    . ARG C 2 22 ? -10.433 -1.180  -2.031  1.00 0.00 ? 22  ARG A NH1    5  
ATOM   8909  N NH2    . ARG C 2 22 ? -10.780 -1.099  -4.261  1.00 0.00 ? 22  ARG A NH2    5  
ATOM   8910  H H      . ARG C 2 22 ? -11.478 2.204   1.298   1.00 0.00 ? 22  ARG A H      5  
ATOM   8911  H HA     . ARG C 2 22 ? -12.238 2.607   -0.903  1.00 0.00 ? 22  ARG A HA     5  
ATOM   8912  H HB2    . ARG C 2 22 ? -14.162 0.894   0.569   1.00 0.00 ? 22  ARG A HB2    5  
ATOM   8913  H HB3    . ARG C 2 22 ? -14.738 1.569   -0.957  1.00 0.00 ? 22  ARG A HB3    5  
ATOM   8914  H HG2    . ARG C 2 22 ? -12.055 0.209   -0.730  1.00 0.00 ? 22  ARG A HG2    5  
ATOM   8915  H HG3    . ARG C 2 22 ? -13.524 -0.691  -1.084  1.00 0.00 ? 22  ARG A HG3    5  
ATOM   8916  H HD2    . ARG C 2 22 ? -13.504 -0.015  -3.246  1.00 0.00 ? 22  ARG A HD2    5  
ATOM   8917  H HD3    . ARG C 2 22 ? -13.301 1.681   -2.770  1.00 0.00 ? 22  ARG A HD3    5  
ATOM   8918  H HE     . ARG C 2 22 ? -10.982 1.420   -3.065  1.00 0.00 ? 22  ARG A HE     5  
ATOM   8919  H HH11   . ARG C 2 22 ? -10.519 -0.767  -1.125  1.00 0.00 ? 22  ARG A HH11   5  
ATOM   8920  H HH12   . ARG C 2 22 ? -9.984  -2.067  -2.135  1.00 0.00 ? 22  ARG A HH12   5  
ATOM   8921  H HH21   . ARG C 2 22 ? -11.135 -0.624  -5.066  1.00 0.00 ? 22  ARG A HH21   5  
ATOM   8922  H HH22   . ARG C 2 22 ? -10.330 -1.986  -4.362  1.00 0.00 ? 22  ARG A HH22   5  
ATOM   8923  N N      . LYS C 2 23 ? -14.473 4.069   -1.357  1.00 0.00 ? 23  LYS A N      5  
ATOM   8924  C CA     . LYS C 2 23 ? -15.352 5.261   -1.506  1.00 0.00 ? 23  LYS A CA     5  
ATOM   8925  C C      . LYS C 2 23 ? -16.558 4.912   -2.383  1.00 0.00 ? 23  LYS A C      5  
ATOM   8926  O O      . LYS C 2 23 ? -17.656 5.377   -2.147  1.00 0.00 ? 23  LYS A O      5  
ATOM   8927  C CB     . LYS C 2 23 ? -14.477 6.315   -2.187  1.00 0.00 ? 23  LYS A CB     5  
ATOM   8928  C CG     . LYS C 2 23 ? -15.278 7.605   -2.389  1.00 0.00 ? 23  LYS A CG     5  
ATOM   8929  C CD     . LYS C 2 23 ? -14.756 8.338   -3.627  1.00 0.00 ? 23  LYS A CD     5  
ATOM   8930  C CE     . LYS C 2 23 ? -15.016 7.487   -4.873  1.00 0.00 ? 23  LYS A CE     5  
ATOM   8931  N NZ     . LYS C 2 23 ? -14.941 8.442   -6.014  1.00 0.00 ? 23  LYS A NZ     5  
ATOM   8932  H H      . LYS C 2 23 ? -14.323 3.478   -2.122  1.00 0.00 ? 23  LYS A H      5  
ATOM   8933  H HA     . LYS C 2 23 ? -15.675 5.617   -0.540  1.00 0.00 ? 23  LYS A HA     5  
ATOM   8934  H HB2    . LYS C 2 23 ? -13.614 6.520   -1.569  1.00 0.00 ? 23  LYS A HB2    5  
ATOM   8935  H HB3    . LYS C 2 23 ? -14.153 5.943   -3.147  1.00 0.00 ? 23  LYS A HB3    5  
ATOM   8936  H HG2    . LYS C 2 23 ? -16.322 7.364   -2.524  1.00 0.00 ? 23  LYS A HG2    5  
ATOM   8937  H HG3    . LYS C 2 23 ? -15.162 8.239   -1.523  1.00 0.00 ? 23  LYS A HG3    5  
ATOM   8938  H HD2    . LYS C 2 23 ? -15.266 9.286   -3.724  1.00 0.00 ? 23  LYS A HD2    5  
ATOM   8939  H HD3    . LYS C 2 23 ? -13.695 8.509   -3.524  1.00 0.00 ? 23  LYS A HD3    5  
ATOM   8940  H HE2    . LYS C 2 23 ? -14.257 6.722   -4.969  1.00 0.00 ? 23  LYS A HE2    5  
ATOM   8941  H HE3    . LYS C 2 23 ? -15.997 7.043   -4.828  1.00 0.00 ? 23  LYS A HE3    5  
ATOM   8942  H HZ1    . LYS C 2 23 ? -15.228 7.961   -6.889  1.00 0.00 ? 23  LYS A HZ1    5  
ATOM   8943  H HZ2    . LYS C 2 23 ? -15.576 9.247   -5.834  1.00 0.00 ? 23  LYS A HZ2    5  
ATOM   8944  H HZ3    . LYS C 2 23 ? -13.965 8.786   -6.115  1.00 0.00 ? 23  LYS A HZ3    5  
ATOM   8945  N N      . SER C 2 24 ? -16.363 4.090   -3.391  1.00 0.00 ? 24  SER A N      5  
ATOM   8946  C CA     . SER C 2 24 ? -17.503 3.701   -4.290  1.00 0.00 ? 24  SER A CA     5  
ATOM   8947  C C      . SER C 2 24 ? -16.987 2.990   -5.545  1.00 0.00 ? 24  SER A C      5  
ATOM   8948  O O      . SER C 2 24 ? -15.834 2.614   -5.633  1.00 0.00 ? 24  SER A O      5  
ATOM   8949  C CB     . SER C 2 24 ? -18.191 5.012   -4.684  1.00 0.00 ? 24  SER A CB     5  
ATOM   8950  O OG     . SER C 2 24 ? -19.382 5.164   -3.923  1.00 0.00 ? 24  SER A OG     5  
ATOM   8951  H H      . SER C 2 24 ? -15.466 3.719   -3.552  1.00 0.00 ? 24  SER A H      5  
ATOM   8952  H HA     . SER C 2 24 ? -18.195 3.068   -3.761  1.00 0.00 ? 24  SER A HA     5  
ATOM   8953  H HB2    . SER C 2 24 ? -17.534 5.841   -4.482  1.00 0.00 ? 24  SER A HB2    5  
ATOM   8954  H HB3    . SER C 2 24 ? -18.426 4.990   -5.740  1.00 0.00 ? 24  SER A HB3    5  
ATOM   8955  H HG     . SER C 2 24 ? -19.135 5.262   -3.000  1.00 0.00 ? 24  SER A HG     5  
ATOM   8956  N N      . GLY C 2 25 ? -17.841 2.809   -6.521  1.00 0.00 ? 25  GLY A N      5  
ATOM   8957  C CA     . GLY C 2 25 ? -17.421 2.130   -7.780  1.00 0.00 ? 25  GLY A CA     5  
ATOM   8958  C C      . GLY C 2 25 ? -17.894 0.677   -7.764  1.00 0.00 ? 25  GLY A C      5  
ATOM   8959  O O      . GLY C 2 25 ? -18.993 0.360   -8.177  1.00 0.00 ? 25  GLY A O      5  
ATOM   8960  H H      . GLY C 2 25 ? -18.764 3.125   -6.424  1.00 0.00 ? 25  GLY A H      5  
ATOM   8961  H HA2    . GLY C 2 25 ? -17.854 2.642   -8.627  1.00 0.00 ? 25  GLY A HA2    5  
ATOM   8962  H HA3    . GLY C 2 25 ? -16.344 2.152   -7.858  1.00 0.00 ? 25  GLY A HA3    5  
ATOM   8963  N N      . ALA C 2 26 ? -17.064 -0.205  -7.288  1.00 0.00 ? 26  ALA A N      5  
ATOM   8964  C CA     . ALA C 2 26 ? -17.433 -1.651  -7.231  1.00 0.00 ? 26  ALA A CA     5  
ATOM   8965  C C      . ALA C 2 26 ? -16.747 -2.292  -6.024  1.00 0.00 ? 26  ALA A C      5  
ATOM   8966  O O      . ALA C 2 26 ? -17.336 -3.050  -5.280  1.00 0.00 ? 26  ALA A O      5  
ATOM   8967  C CB     . ALA C 2 26 ? -16.894 -2.243  -8.533  1.00 0.00 ? 26  ALA A CB     5  
ATOM   8968  H H      . ALA C 2 26 ? -16.187 0.085   -6.964  1.00 0.00 ? 26  ALA A H      5  
ATOM   8969  H HA     . ALA C 2 26 ? -18.503 -1.772  -7.175  1.00 0.00 ? 26  ALA A HA     5  
ATOM   8970  H HB1    . ALA C 2 26 ? -16.673 -3.290  -8.388  1.00 0.00 ? 26  ALA A HB1    5  
ATOM   8971  H HB2    . ALA C 2 26 ? -15.992 -1.720  -8.819  1.00 0.00 ? 26  ALA A HB2    5  
ATOM   8972  H HB3    . ALA C 2 26 ? -17.635 -2.135  -9.311  1.00 0.00 ? 26  ALA A HB3    5  
ATOM   8973  N N      . THR C 2 27 ? -15.503 -1.962  -5.826  1.00 0.00 ? 27  THR A N      5  
ATOM   8974  C CA     . THR C 2 27 ? -14.734 -2.503  -4.673  1.00 0.00 ? 27  THR A CA     5  
ATOM   8975  C C      . THR C 2 27 ? -15.169 -1.801  -3.377  1.00 0.00 ? 27  THR A C      5  
ATOM   8976  O O      . THR C 2 27 ? -14.675 -2.098  -2.308  1.00 0.00 ? 27  THR A O      5  
ATOM   8977  C CB     . THR C 2 27 ? -13.276 -2.163  -5.002  1.00 0.00 ? 27  THR A CB     5  
ATOM   8978  O OG1    . THR C 2 27 ? -13.161 -0.764  -5.239  1.00 0.00 ? 27  THR A OG1    5  
ATOM   8979  C CG2    . THR C 2 27 ? -12.837 -2.933  -6.251  1.00 0.00 ? 27  THR A CG2    5  
ATOM   8980  H H      . THR C 2 27 ? -15.069 -1.338  -6.443  1.00 0.00 ? 27  THR A H      5  
ATOM   8981  H HA     . THR C 2 27 ? -14.859 -3.571  -4.591  1.00 0.00 ? 27  THR A HA     5  
ATOM   8982  H HB     . THR C 2 27 ? -12.641 -2.434  -4.173  1.00 0.00 ? 27  THR A HB     5  
ATOM   8983  H HG1    . THR C 2 27 ? -13.335 -0.600  -6.169  1.00 0.00 ? 27  THR A HG1    5  
ATOM   8984  H HG21   . THR C 2 27 ? -13.427 -3.833  -6.345  1.00 0.00 ? 27  THR A HG21   5  
ATOM   8985  H HG22   . THR C 2 27 ? -11.793 -3.194  -6.166  1.00 0.00 ? 27  THR A HG22   5  
ATOM   8986  H HG23   . THR C 2 27 ? -12.984 -2.314  -7.126  1.00 0.00 ? 27  THR A HG23   5  
ATOM   8987  N N      . CYS C 2 28 ? -16.079 -0.860  -3.475  1.00 0.00 ? 28  CYS A N      5  
ATOM   8988  C CA     . CYS C 2 28 ? -16.550 -0.110  -2.270  1.00 0.00 ? 28  CYS A CA     5  
ATOM   8989  C C      . CYS C 2 28 ? -16.778 -1.039  -1.072  1.00 0.00 ? 28  CYS A C      5  
ATOM   8990  O O      . CYS C 2 28 ? -17.285 -2.135  -1.209  1.00 0.00 ? 28  CYS A O      5  
ATOM   8991  C CB     . CYS C 2 28 ? -17.869 0.538   -2.700  1.00 0.00 ? 28  CYS A CB     5  
ATOM   8992  S SG     . CYS C 2 28 ? -19.056 -0.743  -3.186  1.00 0.00 ? 28  CYS A SG     5  
ATOM   8993  H H      . CYS C 2 28 ? -16.448 -0.633  -4.352  1.00 0.00 ? 28  CYS A H      5  
ATOM   8994  H HA     . CYS C 2 28 ? -15.841 0.658   -2.014  1.00 0.00 ? 28  CYS A HA     5  
ATOM   8995  H HB2    . CYS C 2 28 ? -18.274 1.108   -1.877  1.00 0.00 ? 28  CYS A HB2    5  
ATOM   8996  H HB3    . CYS C 2 28 ? -17.688 1.196   -3.537  1.00 0.00 ? 28  CYS A HB3    5  
ATOM   8997  H HG     . CYS C 2 28 ? -19.783 -0.726  -2.559  1.00 0.00 ? 28  CYS A HG     5  
ATOM   8998  N N      . GLY C 2 29 ? -16.413 -0.596  0.103   1.00 0.00 ? 29  GLY A N      5  
ATOM   8999  C CA     . GLY C 2 29 ? -16.616 -1.439  1.318   1.00 0.00 ? 29  GLY A CA     5  
ATOM   9000  C C      . GLY C 2 29 ? -15.288 -2.055  1.771   1.00 0.00 ? 29  GLY A C      5  
ATOM   9001  O O      . GLY C 2 29 ? -15.163 -2.518  2.888   1.00 0.00 ? 29  GLY A O      5  
ATOM   9002  H H      . GLY C 2 29 ? -16.013 0.298   0.184   1.00 0.00 ? 29  GLY A H      5  
ATOM   9003  H HA2    . GLY C 2 29 ? -17.017 -0.826  2.114   1.00 0.00 ? 29  GLY A HA2    5  
ATOM   9004  H HA3    . GLY C 2 29 ? -17.315 -2.231  1.091   1.00 0.00 ? 29  GLY A HA3    5  
ATOM   9005  N N      . ARG C 2 30 ? -14.299 -2.070  0.918   1.00 0.00 ? 30  ARG A N      5  
ATOM   9006  C CA     . ARG C 2 30 ? -12.985 -2.663  1.308   1.00 0.00 ? 30  ARG A CA     5  
ATOM   9007  C C      . ARG C 2 30 ? -12.158 -1.647  2.101   1.00 0.00 ? 30  ARG A C      5  
ATOM   9008  O O      . ARG C 2 30 ? -12.269 -0.452  1.903   1.00 0.00 ? 30  ARG A O      5  
ATOM   9009  C CB     . ARG C 2 30 ? -12.293 -3.005  -0.009  1.00 0.00 ? 30  ARG A CB     5  
ATOM   9010  C CG     . ARG C 2 30 ? -12.795 -4.362  -0.504  1.00 0.00 ? 30  ARG A CG     5  
ATOM   9011  C CD     . ARG C 2 30 ? -12.107 -4.706  -1.824  1.00 0.00 ? 30  ARG A CD     5  
ATOM   9012  N NE     . ARG C 2 30 ? -10.659 -4.810  -1.492  1.00 0.00 ? 30  ARG A NE     5  
ATOM   9013  C CZ     . ARG C 2 30 ? -10.211 -5.840  -0.826  1.00 0.00 ? 30  ARG A CZ     5  
ATOM   9014  N NH1    . ARG C 2 30 ? -10.635 -7.040  -1.116  1.00 0.00 ? 30  ARG A NH1    5  
ATOM   9015  N NH2    . ARG C 2 30 ? -9.338  -5.671  0.128   1.00 0.00 ? 30  ARG A NH2    5  
ATOM   9016  H H      . ARG C 2 30 ? -14.419 -1.695  0.024   1.00 0.00 ? 30  ARG A H      5  
ATOM   9017  H HA     . ARG C 2 30 ? -13.135 -3.561  1.885   1.00 0.00 ? 30  ARG A HA     5  
ATOM   9018  H HB2    . ARG C 2 30 ? -12.517 -2.247  -0.744  1.00 0.00 ? 30  ARG A HB2    5  
ATOM   9019  H HB3    . ARG C 2 30 ? -11.226 -3.054  0.146   1.00 0.00 ? 30  ARG A HB3    5  
ATOM   9020  H HG2    . ARG C 2 30 ? -12.567 -5.121  0.231   1.00 0.00 ? 30  ARG A HG2    5  
ATOM   9021  H HG3    . ARG C 2 30 ? -13.862 -4.316  -0.659  1.00 0.00 ? 30  ARG A HG3    5  
ATOM   9022  H HD2    . ARG C 2 30 ? -12.479 -5.647  -2.203  1.00 0.00 ? 30  ARG A HD2    5  
ATOM   9023  H HD3    . ARG C 2 30 ? -12.265 -3.920  -2.544  1.00 0.00 ? 30  ARG A HD3    5  
ATOM   9024  H HE     . ARG C 2 30 ? -10.040 -4.103  -1.771  1.00 0.00 ? 30  ARG A HE     5  
ATOM   9025  H HH11   . ARG C 2 30 ? -11.303 -7.171  -1.849  1.00 0.00 ? 30  ARG A HH11   5  
ATOM   9026  H HH12   . ARG C 2 30 ? -10.291 -7.829  -0.606  1.00 0.00 ? 30  ARG A HH12   5  
ATOM   9027  H HH21   . ARG C 2 30 ? -9.012  -4.752  0.350   1.00 0.00 ? 30  ARG A HH21   5  
ATOM   9028  H HH22   . ARG C 2 30 ? -8.994  -6.460  0.638   1.00 0.00 ? 30  ARG A HH22   5  
ATOM   9029  N N      . SER C 2 31 ? -11.329 -2.114  2.997   1.00 0.00 ? 31  SER A N      5  
ATOM   9030  C CA     . SER C 2 31 ? -10.493 -1.178  3.802   1.00 0.00 ? 31  SER A CA     5  
ATOM   9031  C C      . SER C 2 31 ? -9.013  -1.355  3.451   1.00 0.00 ? 31  SER A C      5  
ATOM   9032  O O      . SER C 2 31 ? -8.374  -2.298  3.874   1.00 0.00 ? 31  SER A O      5  
ATOM   9033  C CB     . SER C 2 31 ? -10.753 -1.566  5.256   1.00 0.00 ? 31  SER A CB     5  
ATOM   9034  O OG     . SER C 2 31 ? -10.563 -2.966  5.410   1.00 0.00 ? 31  SER A OG     5  
ATOM   9035  H H      . SER C 2 31 ? -11.257 -3.081  3.138   1.00 0.00 ? 31  SER A H      5  
ATOM   9036  H HA     . SER C 2 31 ? -10.800 -0.158  3.634   1.00 0.00 ? 31  SER A HA     5  
ATOM   9037  H HB2    . SER C 2 31 ? -10.065 -1.042  5.899   1.00 0.00 ? 31  SER A HB2    5  
ATOM   9038  H HB3    . SER C 2 31 ? -11.767 -1.297  5.522   1.00 0.00 ? 31  SER A HB3    5  
ATOM   9039  H HG     . SER C 2 31 ? -11.408 -3.397  5.261   1.00 0.00 ? 31  SER A HG     5  
ATOM   9040  N N      . ASP C 2 32 ? -8.467  -0.452  2.682   1.00 0.00 ? 32  ASP A N      5  
ATOM   9041  C CA     . ASP C 2 32 ? -7.031  -0.560  2.300   1.00 0.00 ? 32  ASP A CA     5  
ATOM   9042  C C      . ASP C 2 32 ? -6.185  0.364   3.175   1.00 0.00 ? 32  ASP A C      5  
ATOM   9043  O O      . ASP C 2 32 ? -6.422  1.553   3.252   1.00 0.00 ? 32  ASP A O      5  
ATOM   9044  C CB     . ASP C 2 32 ? -6.976  -0.120  0.837   1.00 0.00 ? 32  ASP A CB     5  
ATOM   9045  C CG     . ASP C 2 32 ? -7.656  -1.171  -0.044  1.00 0.00 ? 32  ASP A CG     5  
ATOM   9046  O OD1    . ASP C 2 32 ? -7.777  -2.302  0.397   1.00 0.00 ? 32  ASP A OD1    5  
ATOM   9047  O OD2    . ASP C 2 32 ? -8.042  -0.826  -1.149  1.00 0.00 ? 32  ASP A OD2    5  
ATOM   9048  H H      . ASP C 2 32 ? -9.005  0.300   2.355   1.00 0.00 ? 32  ASP A H      5  
ATOM   9049  H HA     . ASP C 2 32 ? -6.690  -1.575  2.390   1.00 0.00 ? 32  ASP A HA     5  
ATOM   9050  H HB2    . ASP C 2 32 ? -7.485  0.826   0.727   1.00 0.00 ? 32  ASP A HB2    5  
ATOM   9051  H HB3    . ASP C 2 32 ? -5.946  -0.011  0.533   1.00 0.00 ? 32  ASP A HB3    5  
ATOM   9052  N N      . THR C 2 33 ? -5.198  -0.177  3.836   1.00 0.00 ? 33  THR A N      5  
ATOM   9053  C CA     . THR C 2 33 ? -4.336  0.666   4.710   1.00 0.00 ? 33  THR A CA     5  
ATOM   9054  C C      . THR C 2 33 ? -3.039  1.024   3.980   1.00 0.00 ? 33  THR A C      5  
ATOM   9055  O O      . THR C 2 33 ? -2.211  0.176   3.714   1.00 0.00 ? 33  THR A O      5  
ATOM   9056  C CB     . THR C 2 33 ? -4.048  -0.206  5.935   1.00 0.00 ? 33  THR A CB     5  
ATOM   9057  O OG1    . THR C 2 33 ? -5.273  -0.543  6.570   1.00 0.00 ? 33  THR A OG1    5  
ATOM   9058  C CG2    . THR C 2 33 ? -3.159  0.561   6.916   1.00 0.00 ? 33  THR A CG2    5  
ATOM   9059  H H      . THR C 2 33 ? -5.026  -1.138  3.759   1.00 0.00 ? 33  THR A H      5  
ATOM   9060  H HA     . THR C 2 33 ? -4.860  1.560   5.008   1.00 0.00 ? 33  THR A HA     5  
ATOM   9061  H HB     . THR C 2 33 ? -3.542  -1.108  5.626   1.00 0.00 ? 33  THR A HB     5  
ATOM   9062  H HG1    . THR C 2 33 ? -5.114  -1.295  7.145   1.00 0.00 ? 33  THR A HG1    5  
ATOM   9063  H HG21   . THR C 2 33 ? -3.739  1.333   7.400   1.00 0.00 ? 33  THR A HG21   5  
ATOM   9064  H HG22   . THR C 2 33 ? -2.337  1.011   6.380   1.00 0.00 ? 33  THR A HG22   5  
ATOM   9065  H HG23   . THR C 2 33 ? -2.774  -0.120  7.661   1.00 0.00 ? 33  THR A HG23   5  
ATOM   9066  N N      . TYR C 2 34 ? -2.862  2.276   3.655   1.00 0.00 ? 34  TYR A N      5  
ATOM   9067  C CA     . TYR C 2 34 ? -1.622  2.698   2.943   1.00 0.00 ? 34  TYR A CA     5  
ATOM   9068  C C      . TYR C 2 34 ? -0.644  3.324   3.938   1.00 0.00 ? 34  TYR A C      5  
ATOM   9069  O O      . TYR C 2 34 ? -1.042  3.886   4.939   1.00 0.00 ? 34  TYR A O      5  
ATOM   9070  C CB     . TYR C 2 34 ? -2.085  3.736   1.924   1.00 0.00 ? 34  TYR A CB     5  
ATOM   9071  C CG     . TYR C 2 34 ? -2.899  3.060   0.848   1.00 0.00 ? 34  TYR A CG     5  
ATOM   9072  C CD1    . TYR C 2 34 ? -4.270  2.850   1.032   1.00 0.00 ? 34  TYR A CD1    5  
ATOM   9073  C CD2    . TYR C 2 34 ? -2.280  2.646   -0.336  1.00 0.00 ? 34  TYR A CD2    5  
ATOM   9074  C CE1    . TYR C 2 34 ? -5.022  2.228   0.031   1.00 0.00 ? 34  TYR A CE1    5  
ATOM   9075  C CE2    . TYR C 2 34 ? -3.032  2.024   -1.337  1.00 0.00 ? 34  TYR A CE2    5  
ATOM   9076  C CZ     . TYR C 2 34 ? -4.404  1.816   -1.155  1.00 0.00 ? 34  TYR A CZ     5  
ATOM   9077  O OH     . TYR C 2 34 ? -5.147  1.203   -2.144  1.00 0.00 ? 34  TYR A OH     5  
ATOM   9078  H H      . TYR C 2 34 ? -3.545  2.941   3.883   1.00 0.00 ? 34  TYR A H      5  
ATOM   9079  H HA     . TYR C 2 34 ? -1.170  1.858   2.438   1.00 0.00 ? 34  TYR A HA     5  
ATOM   9080  H HB2    . TYR C 2 34 ? -2.690  4.483   2.418   1.00 0.00 ? 34  TYR A HB2    5  
ATOM   9081  H HB3    . TYR C 2 34 ? -1.221  4.208   1.474   1.00 0.00 ? 34  TYR A HB3    5  
ATOM   9082  H HD1    . TYR C 2 34 ? -4.749  3.164   1.948   1.00 0.00 ? 34  TYR A HD1    5  
ATOM   9083  H HD2    . TYR C 2 34 ? -1.222  2.808   -0.478  1.00 0.00 ? 34  TYR A HD2    5  
ATOM   9084  H HE1    . TYR C 2 34 ? -6.080  2.070   0.172   1.00 0.00 ? 34  TYR A HE1    5  
ATOM   9085  H HE2    . TYR C 2 34 ? -2.554  1.705   -2.250  1.00 0.00 ? 34  TYR A HE2    5  
ATOM   9086  H HH     . TYR C 2 34 ? -4.863  0.288   -2.203  1.00 0.00 ? 34  TYR A HH     5  
ATOM   9087  N N      . TYR C 2 35 ? 0.632   3.236   3.674   1.00 0.00 ? 35  TYR A N      5  
ATOM   9088  C CA     . TYR C 2 35 ? 1.625   3.833   4.615   1.00 0.00 ? 35  TYR A CA     5  
ATOM   9089  C C      . TYR C 2 35 ? 2.758   4.505   3.835   1.00 0.00 ? 35  TYR A C      5  
ATOM   9090  O O      . TYR C 2 35 ? 3.060   4.139   2.715   1.00 0.00 ? 35  TYR A O      5  
ATOM   9091  C CB     . TYR C 2 35 ? 2.182   2.674   5.462   1.00 0.00 ? 35  TYR A CB     5  
ATOM   9092  C CG     . TYR C 2 35 ? 1.422   1.391   5.198   1.00 0.00 ? 35  TYR A CG     5  
ATOM   9093  C CD1    . TYR C 2 35 ? 1.681   0.650   4.038   1.00 0.00 ? 35  TYR A CD1    5  
ATOM   9094  C CD2    . TYR C 2 35 ? 0.466   0.943   6.115   1.00 0.00 ? 35  TYR A CD2    5  
ATOM   9095  C CE1    . TYR C 2 35 ? 0.983   -0.538  3.797   1.00 0.00 ? 35  TYR A CE1    5  
ATOM   9096  C CE2    . TYR C 2 35 ? -0.233  -0.246  5.873   1.00 0.00 ? 35  TYR A CE2    5  
ATOM   9097  C CZ     . TYR C 2 35 ? 0.026   -0.988  4.714   1.00 0.00 ? 35  TYR A CZ     5  
ATOM   9098  O OH     . TYR C 2 35 ? -0.663  -2.159  4.475   1.00 0.00 ? 35  TYR A OH     5  
ATOM   9099  H H      . TYR C 2 35 ? 0.936   2.779   2.861   1.00 0.00 ? 35  TYR A H      5  
ATOM   9100  H HA     . TYR C 2 35 ? 1.140   4.551   5.256   1.00 0.00 ? 35  TYR A HA     5  
ATOM   9101  H HB2    . TYR C 2 35 ? 3.224   2.523   5.219   1.00 0.00 ? 35  TYR A HB2    5  
ATOM   9102  H HB3    . TYR C 2 35 ? 2.097   2.927   6.509   1.00 0.00 ? 35  TYR A HB3    5  
ATOM   9103  H HD1    . TYR C 2 35 ? 2.419   0.996   3.331   1.00 0.00 ? 35  TYR A HD1    5  
ATOM   9104  H HD2    . TYR C 2 35 ? 0.267   1.514   7.009   1.00 0.00 ? 35  TYR A HD2    5  
ATOM   9105  H HE1    . TYR C 2 35 ? 1.184   -1.110  2.903   1.00 0.00 ? 35  TYR A HE1    5  
ATOM   9106  H HE2    . TYR C 2 35 ? -0.972  -0.592  6.582   1.00 0.00 ? 35  TYR A HE2    5  
ATOM   9107  H HH     . TYR C 2 35 ? -0.528  -2.740  5.228   1.00 0.00 ? 35  TYR A HH     5  
ATOM   9108  N N      . GLN C 2 36 ? 3.392   5.479   4.428   1.00 0.00 ? 36  GLN A N      5  
ATOM   9109  C CA     . GLN C 2 36 ? 4.516   6.173   3.739   1.00 0.00 ? 36  GLN A CA     5  
ATOM   9110  C C      . GLN C 2 36 ? 5.813   5.917   4.505   1.00 0.00 ? 36  GLN A C      5  
ATOM   9111  O O      . GLN C 2 36 ? 5.806   5.739   5.710   1.00 0.00 ? 36  GLN A O      5  
ATOM   9112  C CB     . GLN C 2 36 ? 4.152   7.659   3.775   1.00 0.00 ? 36  GLN A CB     5  
ATOM   9113  C CG     . GLN C 2 36 ? 5.260   8.480   3.105   1.00 0.00 ? 36  GLN A CG     5  
ATOM   9114  C CD     . GLN C 2 36 ? 4.836   9.949   3.025   1.00 0.00 ? 36  GLN A CD     5  
ATOM   9115  O OE1    . GLN C 2 36 ? 3.815   10.331  3.563   1.00 0.00 ? 36  GLN A OE1    5  
ATOM   9116  N NE2    . GLN C 2 36 ? 5.584   10.795  2.372   1.00 0.00 ? 36  GLN A NE2    5  
ATOM   9117  H H      . GLN C 2 36 ? 3.132   5.749   5.333   1.00 0.00 ? 36  GLN A H      5  
ATOM   9118  H HA     . GLN C 2 36 ? 4.603   5.836   2.718   1.00 0.00 ? 36  GLN A HA     5  
ATOM   9119  H HB2    . GLN C 2 36 ? 3.221   7.814   3.249   1.00 0.00 ? 36  GLN A HB2    5  
ATOM   9120  H HB3    . GLN C 2 36 ? 4.043   7.978   4.802   1.00 0.00 ? 36  GLN A HB3    5  
ATOM   9121  H HG2    . GLN C 2 36 ? 6.170   8.400   3.684   1.00 0.00 ? 36  GLN A HG2    5  
ATOM   9122  H HG3    . GLN C 2 36 ? 5.435   8.104   2.108   1.00 0.00 ? 36  GLN A HG3    5  
ATOM   9123  H HE21   . GLN C 2 36 ? 6.408   10.488  1.938   1.00 0.00 ? 36  GLN A HE21   5  
ATOM   9124  H HE22   . GLN C 2 36 ? 5.322   11.738  2.314   1.00 0.00 ? 36  GLN A HE22   5  
ATOM   9125  N N      . SER C 2 37 ? 6.926   5.895   3.820   1.00 0.00 ? 37  SER A N      5  
ATOM   9126  C CA     . SER C 2 37 ? 8.225   5.649   4.514   1.00 0.00 ? 37  SER A CA     5  
ATOM   9127  C C      . SER C 2 37 ? 8.416   6.667   5.645   1.00 0.00 ? 37  SER A C      5  
ATOM   9128  O O      . SER C 2 37 ? 7.538   7.467   5.902   1.00 0.00 ? 37  SER A O      5  
ATOM   9129  C CB     . SER C 2 37 ? 9.282   5.808   3.429   1.00 0.00 ? 37  SER A CB     5  
ATOM   9130  O OG     . SER C 2 37 ? 8.864   5.084   2.280   1.00 0.00 ? 37  SER A OG     5  
ATOM   9131  H H      . SER C 2 37 ? 6.906   6.040   2.850   1.00 0.00 ? 37  SER A H      5  
ATOM   9132  H HA     . SER C 2 37 ? 8.252   4.646   4.908   1.00 0.00 ? 37  SER A HA     5  
ATOM   9133  H HB2    . SER C 2 37 ? 9.393   6.849   3.176   1.00 0.00 ? 37  SER A HB2    5  
ATOM   9134  H HB3    . SER C 2 37 ? 10.224  5.420   3.785   1.00 0.00 ? 37  SER A HB3    5  
ATOM   9135  H HG     . SER C 2 37 ? 9.281   4.220   2.307   1.00 0.00 ? 37  SER A HG     5  
ATOM   9136  N N      . PRO C 2 38 ? 9.536   6.589   6.317   1.00 0.00 ? 38  PRO A N      5  
ATOM   9137  C CA     . PRO C 2 38 ? 9.781   7.494   7.450   1.00 0.00 ? 38  PRO A CA     5  
ATOM   9138  C C      . PRO C 2 38 ? 10.379  8.835   7.021   1.00 0.00 ? 38  PRO A C      5  
ATOM   9139  O O      . PRO C 2 38 ? 10.670  9.665   7.862   1.00 0.00 ? 38  PRO A O      5  
ATOM   9140  C CB     . PRO C 2 38 ? 10.768  6.720   8.310   1.00 0.00 ? 38  PRO A CB     5  
ATOM   9141  C CG     . PRO C 2 38 ? 11.475  5.784   7.377   1.00 0.00 ? 38  PRO A CG     5  
ATOM   9142  C CD     . PRO C 2 38 ? 10.661  5.676   6.106   1.00 0.00 ? 38  PRO A CD     5  
ATOM   9143  H HA     . PRO C 2 38 ? 8.876   7.650   7.996   1.00 0.00 ? 38  PRO A HA     5  
ATOM   9144  H HB2    . PRO C 2 38 ? 11.474  7.398   8.770   1.00 0.00 ? 38  PRO A HB2    5  
ATOM   9145  H HB3    . PRO C 2 38 ? 10.243  6.156   9.065   1.00 0.00 ? 38  PRO A HB3    5  
ATOM   9146  H HG2    . PRO C 2 38 ? 12.457  6.173   7.152   1.00 0.00 ? 38  PRO A HG2    5  
ATOM   9147  H HG3    . PRO C 2 38 ? 11.563  4.813   7.835   1.00 0.00 ? 38  PRO A HG3    5  
ATOM   9148  H HD2    . PRO C 2 38 ? 11.253  5.992   5.257   1.00 0.00 ? 38  PRO A HD2    5  
ATOM   9149  H HD3    . PRO C 2 38 ? 10.304  4.669   5.967   1.00 0.00 ? 38  PRO A HD3    5  
ATOM   9150  N N      . THR C 2 39 ? 10.582  9.080   5.751   1.00 0.00 ? 39  THR A N      5  
ATOM   9151  C CA     . THR C 2 39 ? 11.178  10.400  5.386   1.00 0.00 ? 39  THR A CA     5  
ATOM   9152  C C      . THR C 2 39 ? 11.088  10.723  3.885   1.00 0.00 ? 39  THR A C      5  
ATOM   9153  O O      . THR C 2 39 ? 11.760  11.619  3.414   1.00 0.00 ? 39  THR A O      5  
ATOM   9154  C CB     . THR C 2 39 ? 12.633  10.291  5.841   1.00 0.00 ? 39  THR A CB     5  
ATOM   9155  O OG1    . THR C 2 39 ? 13.285  11.538  5.647   1.00 0.00 ? 39  THR A OG1    5  
ATOM   9156  C CG2    . THR C 2 39 ? 13.348  9.205   5.034   1.00 0.00 ? 39  THR A CG2    5  
ATOM   9157  H H      . THR C 2 39 ? 10.359  8.414   5.064   1.00 0.00 ? 39  THR A H      5  
ATOM   9158  H HA     . THR C 2 39 ? 10.695  11.181  5.951   1.00 0.00 ? 39  THR A HA     5  
ATOM   9159  H HB     . THR C 2 39 ? 12.655  10.027  6.891   1.00 0.00 ? 39  THR A HB     5  
ATOM   9160  H HG1    . THR C 2 39 ? 13.986  11.612  6.299   1.00 0.00 ? 39  THR A HG1    5  
ATOM   9161  H HG21   . THR C 2 39 ? 13.812  9.649   4.166   1.00 0.00 ? 39  THR A HG21   5  
ATOM   9162  H HG22   . THR C 2 39 ? 12.632  8.461   4.718   1.00 0.00 ? 39  THR A HG22   5  
ATOM   9163  H HG23   . THR C 2 39 ? 14.103  8.739   5.648   1.00 0.00 ? 39  THR A HG23   5  
ATOM   9164  N N      . GLY C 2 40 ? 10.255  10.051  3.129   1.00 0.00 ? 40  GLY A N      5  
ATOM   9165  C CA     . GLY C 2 40 ? 10.152  10.412  1.680   1.00 0.00 ? 40  GLY A CA     5  
ATOM   9166  C C      . GLY C 2 40 ? 10.079  9.175   0.779   1.00 0.00 ? 40  GLY A C      5  
ATOM   9167  O O      . GLY C 2 40 ? 11.065  8.754   0.209   1.00 0.00 ? 40  GLY A O      5  
ATOM   9168  H H      . GLY C 2 40 ? 9.690   9.348   3.510   1.00 0.00 ? 40  GLY A H      5  
ATOM   9169  H HA2    . GLY C 2 40 ? 9.259   11.002  1.532   1.00 0.00 ? 40  GLY A HA2    5  
ATOM   9170  H HA3    . GLY C 2 40 ? 11.013  11.000  1.401   1.00 0.00 ? 40  GLY A HA3    5  
ATOM   9171  N N      . ASP C 2 41 ? 8.903   8.625   0.618   1.00 0.00 ? 41  ASP A N      5  
ATOM   9172  C CA     . ASP C 2 41 ? 8.707   7.437   -0.276  1.00 0.00 ? 41  ASP A CA     5  
ATOM   9173  C C      . ASP C 2 41 ? 7.304   6.866   -0.044  1.00 0.00 ? 41  ASP A C      5  
ATOM   9174  O O      . ASP C 2 41 ? 6.950   6.497   1.059   1.00 0.00 ? 41  ASP A O      5  
ATOM   9175  C CB     . ASP C 2 41 ? 9.795   6.417   0.096   1.00 0.00 ? 41  ASP A CB     5  
ATOM   9176  C CG     . ASP C 2 41 ? 9.406   5.028   -0.426  1.00 0.00 ? 41  ASP A CG     5  
ATOM   9177  O OD1    . ASP C 2 41 ? 8.777   4.966   -1.470  1.00 0.00 ? 41  ASP A OD1    5  
ATOM   9178  O OD2    . ASP C 2 41 ? 9.740   4.054   0.225   1.00 0.00 ? 41  ASP A OD2    5  
ATOM   9179  H H      . ASP C 2 41 ? 8.128   9.013   1.073   1.00 0.00 ? 41  ASP A H      5  
ATOM   9180  H HA     . ASP C 2 41 ? 8.819   7.733   -1.309  1.00 0.00 ? 41  ASP A HA     5  
ATOM   9181  H HB2    . ASP C 2 41 ? 10.731  6.715   -0.355  1.00 0.00 ? 41  ASP A HB2    5  
ATOM   9182  H HB3    . ASP C 2 41 ? 9.910   6.384   1.164   1.00 0.00 ? 41  ASP A HB3    5  
ATOM   9183  N N      . ARG C 2 42 ? 6.500   6.809   -1.071  1.00 0.00 ? 42  ARG A N      5  
ATOM   9184  C CA     . ARG C 2 42 ? 5.113   6.283   -0.910  1.00 0.00 ? 42  ARG A CA     5  
ATOM   9185  C C      . ARG C 2 42 ? 5.109   4.752   -0.890  1.00 0.00 ? 42  ARG A C      5  
ATOM   9186  O O      . ARG C 2 42 ? 5.787   4.105   -1.663  1.00 0.00 ? 42  ARG A O      5  
ATOM   9187  C CB     . ARG C 2 42 ? 4.347   6.806   -2.128  1.00 0.00 ? 42  ARG A CB     5  
ATOM   9188  C CG     . ARG C 2 42 ? 3.025   7.431   -1.675  1.00 0.00 ? 42  ARG A CG     5  
ATOM   9189  C CD     . ARG C 2 42 ? 3.313   8.678   -0.834  1.00 0.00 ? 42  ARG A CD     5  
ATOM   9190  N NE     . ARG C 2 42 ? 3.169   9.821   -1.778  1.00 0.00 ? 42  ARG A NE     5  
ATOM   9191  C CZ     . ARG C 2 42 ? 2.074   10.531  -1.778  1.00 0.00 ? 42  ARG A CZ     5  
ATOM   9192  N NH1    . ARG C 2 42 ? 1.689   11.136  -0.688  1.00 0.00 ? 42  ARG A NH1    5  
ATOM   9193  N NH2    . ARG C 2 42 ? 1.366   10.636  -2.869  1.00 0.00 ? 42  ARG A NH2    5  
ATOM   9194  H H      . ARG C 2 42 ? 6.804   7.125   -1.948  1.00 0.00 ? 42  ARG A H      5  
ATOM   9195  H HA     . ARG C 2 42 ? 4.670   6.670   -0.006  1.00 0.00 ? 42  ARG A HA     5  
ATOM   9196  H HB2    . ARG C 2 42 ? 4.943   7.551   -2.635  1.00 0.00 ? 42  ARG A HB2    5  
ATOM   9197  H HB3    . ARG C 2 42 ? 4.142   5.988   -2.803  1.00 0.00 ? 42  ARG A HB3    5  
ATOM   9198  H HG2    . ARG C 2 42 ? 2.443   7.707   -2.541  1.00 0.00 ? 42  ARG A HG2    5  
ATOM   9199  H HG3    . ARG C 2 42 ? 2.474   6.718   -1.080  1.00 0.00 ? 42  ARG A HG3    5  
ATOM   9200  H HD2    . ARG C 2 42 ? 2.596   8.758   -0.028  1.00 0.00 ? 42  ARG A HD2    5  
ATOM   9201  H HD3    . ARG C 2 42 ? 4.318   8.646   -0.443  1.00 0.00 ? 42  ARG A HD3    5  
ATOM   9202  H HE     . ARG C 2 42 ? 3.895   10.038  -2.399  1.00 0.00 ? 42  ARG A HE     5  
ATOM   9203  H HH11   . ARG C 2 42 ? 2.232   11.055  0.147   1.00 0.00 ? 42  ARG A HH11   5  
ATOM   9204  H HH12   . ARG C 2 42 ? 0.850   11.682  -0.689  1.00 0.00 ? 42  ARG A HH12   5  
ATOM   9205  H HH21   . ARG C 2 42 ? 1.660   10.172  -3.705  1.00 0.00 ? 42  ARG A HH21   5  
ATOM   9206  H HH22   . ARG C 2 42 ? 0.527   11.181  -2.871  1.00 0.00 ? 42  ARG A HH22   5  
ATOM   9207  N N      . ILE C 2 43 ? 4.336   4.173   -0.009  1.00 0.00 ? 43  ILE A N      5  
ATOM   9208  C CA     . ILE C 2 43 ? 4.261   2.687   0.075   1.00 0.00 ? 43  ILE A CA     5  
ATOM   9209  C C      . ILE C 2 43 ? 2.797   2.265   0.225   1.00 0.00 ? 43  ILE A C      5  
ATOM   9210  O O      . ILE C 2 43 ? 2.000   2.966   0.820   1.00 0.00 ? 43  ILE A O      5  
ATOM   9211  C CB     . ILE C 2 43 ? 5.090   2.325   1.313   1.00 0.00 ? 43  ILE A CB     5  
ATOM   9212  C CG1    . ILE C 2 43 ? 6.575   2.450   0.966   1.00 0.00 ? 43  ILE A CG1    5  
ATOM   9213  C CG2    . ILE C 2 43 ? 4.790   0.888   1.760   1.00 0.00 ? 43  ILE A CG2    5  
ATOM   9214  C CD1    . ILE C 2 43 ? 7.409   2.338   2.240   1.00 0.00 ? 43  ILE A CD1    5  
ATOM   9215  H H      . ILE C 2 43 ? 3.795   4.721   0.598   1.00 0.00 ? 43  ILE A H      5  
ATOM   9216  H HA     . ILE C 2 43 ? 4.695   2.238   -0.806  1.00 0.00 ? 43  ILE A HA     5  
ATOM   9217  H HB     . ILE C 2 43 ? 4.851   3.007   2.115   1.00 0.00 ? 43  ILE A HB     5  
ATOM   9218  H HG12   . ILE C 2 43 ? 6.852   1.659   0.283   1.00 0.00 ? 43  ILE A HG12   5  
ATOM   9219  H HG13   . ILE C 2 43 ? 6.758   3.407   0.501   1.00 0.00 ? 43  ILE A HG13   5  
ATOM   9220  H HG21   . ILE C 2 43 ? 4.196   0.392   1.007   1.00 0.00 ? 43  ILE A HG21   5  
ATOM   9221  H HG22   . ILE C 2 43 ? 4.246   0.909   2.692   1.00 0.00 ? 43  ILE A HG22   5  
ATOM   9222  H HG23   . ILE C 2 43 ? 5.718   0.352   1.898   1.00 0.00 ? 43  ILE A HG23   5  
ATOM   9223  H HD11   . ILE C 2 43 ? 7.180   1.408   2.739   1.00 0.00 ? 43  ILE A HD11   5  
ATOM   9224  H HD12   . ILE C 2 43 ? 7.178   3.165   2.895   1.00 0.00 ? 43  ILE A HD12   5  
ATOM   9225  H HD13   . ILE C 2 43 ? 8.459   2.361   1.988   1.00 0.00 ? 43  ILE A HD13   5  
ATOM   9226  N N      . ARG C 2 44 ? 2.426   1.140   -0.328  1.00 0.00 ? 44  ARG A N      5  
ATOM   9227  C CA     . ARG C 2 44 ? 1.001   0.704   -0.229  1.00 0.00 ? 44  ARG A CA     5  
ATOM   9228  C C      . ARG C 2 44 ? 0.894   -0.760  0.209   1.00 0.00 ? 44  ARG A C      5  
ATOM   9229  O O      . ARG C 2 44 ? -0.191  -1.299  0.309   1.00 0.00 ? 44  ARG A O      5  
ATOM   9230  C CB     . ARG C 2 44 ? 0.435   0.874   -1.642  1.00 0.00 ? 44  ARG A CB     5  
ATOM   9231  C CG     . ARG C 2 44 ? 0.884   2.213   -2.230  1.00 0.00 ? 44  ARG A CG     5  
ATOM   9232  C CD     . ARG C 2 44 ? -0.088  2.645   -3.329  1.00 0.00 ? 44  ARG A CD     5  
ATOM   9233  N NE     . ARG C 2 44 ? -0.509  4.020   -2.947  1.00 0.00 ? 44  ARG A NE     5  
ATOM   9234  C CZ     . ARG C 2 44 ? 0.069   5.054   -3.492  1.00 0.00 ? 44  ARG A CZ     5  
ATOM   9235  N NH1    . ARG C 2 44 ? 1.366   5.184   -3.430  1.00 0.00 ? 44  ARG A NH1    5  
ATOM   9236  N NH2    . ARG C 2 44 ? -0.649  5.958   -4.100  1.00 0.00 ? 44  ARG A NH2    5  
ATOM   9237  H H      . ARG C 2 44 ? 3.076   0.596   -0.819  1.00 0.00 ? 44  ARG A H      5  
ATOM   9238  H HA     . ARG C 2 44 ? 0.463   1.339   0.456   1.00 0.00 ? 44  ARG A HA     5  
ATOM   9239  H HB2    . ARG C 2 44 ? 0.793   0.074   -2.269  1.00 0.00 ? 44  ARG A HB2    5  
ATOM   9240  H HB3    . ARG C 2 44 ? -0.644  0.844   -1.603  1.00 0.00 ? 44  ARG A HB3    5  
ATOM   9241  H HG2    . ARG C 2 44 ? 0.901   2.958   -1.449  1.00 0.00 ? 44  ARG A HG2    5  
ATOM   9242  H HG3    . ARG C 2 44 ? 1.874   2.108   -2.649  1.00 0.00 ? 44  ARG A HG3    5  
ATOM   9243  H HD2    . ARG C 2 44 ? 0.410   2.654   -4.288  1.00 0.00 ? 44  ARG A HD2    5  
ATOM   9244  H HD3    . ARG C 2 44 ? -0.945  1.990   -3.354  1.00 0.00 ? 44  ARG A HD3    5  
ATOM   9245  H HE     . ARG C 2 44 ? -1.218  4.146   -2.283  1.00 0.00 ? 44  ARG A HE     5  
ATOM   9246  H HH11   . ARG C 2 44 ? 1.916   4.491   -2.964  1.00 0.00 ? 44  ARG A HH11   5  
ATOM   9247  H HH12   . ARG C 2 44 ? 1.809   5.977   -3.848  1.00 0.00 ? 44  ARG A HH12   5  
ATOM   9248  H HH21   . ARG C 2 44 ? -1.642  5.859   -4.148  1.00 0.00 ? 44  ARG A HH21   5  
ATOM   9249  H HH22   . ARG C 2 44 ? -0.205  6.751   -4.517  1.00 0.00 ? 44  ARG A HH22   5  
ATOM   9250  N N      . SER C 2 45 ? 1.996   -1.417  0.467   1.00 0.00 ? 45  SER A N      5  
ATOM   9251  C CA     . SER C 2 45 ? 1.918   -2.846  0.890   1.00 0.00 ? 45  SER A CA     5  
ATOM   9252  C C      . SER C 2 45 ? 3.219   -3.275  1.573   1.00 0.00 ? 45  SER A C      5  
ATOM   9253  O O      . SER C 2 45 ? 4.033   -2.452  1.946   1.00 0.00 ? 45  SER A O      5  
ATOM   9254  C CB     . SER C 2 45 ? 1.698   -3.620  -0.408  1.00 0.00 ? 45  SER A CB     5  
ATOM   9255  O OG     . SER C 2 45 ? 0.327   -3.542  -0.773  1.00 0.00 ? 45  SER A OG     5  
ATOM   9256  H H      . SER C 2 45 ? 2.870   -0.976  0.380   1.00 0.00 ? 45  SER A H      5  
ATOM   9257  H HA     . SER C 2 45 ? 1.080   -2.994  1.552   1.00 0.00 ? 45  SER A HA     5  
ATOM   9258  H HB2    . SER C 2 45 ? 2.297   -3.190  -1.192  1.00 0.00 ? 45  SER A HB2    5  
ATOM   9259  H HB3    . SER C 2 45 ? 1.984   -4.652  -0.265  1.00 0.00 ? 45  SER A HB3    5  
ATOM   9260  H HG     . SER C 2 45 ? -0.069  -4.404  -0.625  1.00 0.00 ? 45  SER A HG     5  
ATOM   9261  N N      . LYS C 2 46 ? 3.422   -4.555  1.747   1.00 0.00 ? 46  LYS A N      5  
ATOM   9262  C CA     . LYS C 2 46 ? 4.671   -5.027  2.412   1.00 0.00 ? 46  LYS A CA     5  
ATOM   9263  C C      . LYS C 2 46 ? 5.850   -4.910  1.449   1.00 0.00 ? 46  LYS A C      5  
ATOM   9264  O O      . LYS C 2 46 ? 6.895   -4.400  1.801   1.00 0.00 ? 46  LYS A O      5  
ATOM   9265  C CB     . LYS C 2 46 ? 4.416   -6.488  2.772   1.00 0.00 ? 46  LYS A CB     5  
ATOM   9266  C CG     . LYS C 2 46 ? 5.197   -6.839  4.039   1.00 0.00 ? 46  LYS A CG     5  
ATOM   9267  C CD     . LYS C 2 46 ? 4.808   -8.242  4.504   1.00 0.00 ? 46  LYS A CD     5  
ATOM   9268  C CE     . LYS C 2 46 ? 5.805   -9.254  3.940   1.00 0.00 ? 46  LYS A CE     5  
ATOM   9269  N NZ     . LYS C 2 46 ? 5.127   -10.574 4.071   1.00 0.00 ? 46  LYS A NZ     5  
ATOM   9270  H H      . LYS C 2 46 ? 2.755   -5.204  1.441   1.00 0.00 ? 46  LYS A H      5  
ATOM   9271  H HA     . LYS C 2 46 ? 4.858   -4.454  3.306   1.00 0.00 ? 46  LYS A HA     5  
ATOM   9272  H HB2    . LYS C 2 46 ? 3.359   -6.637  2.944   1.00 0.00 ? 46  LYS A HB2    5  
ATOM   9273  H HB3    . LYS C 2 46 ? 4.745   -7.122  1.963   1.00 0.00 ? 46  LYS A HB3    5  
ATOM   9274  H HG2    . LYS C 2 46 ? 6.257   -6.809  3.827   1.00 0.00 ? 46  LYS A HG2    5  
ATOM   9275  H HG3    . LYS C 2 46 ? 4.964   -6.126  4.815   1.00 0.00 ? 46  LYS A HG3    5  
ATOM   9276  H HD2    . LYS C 2 46 ? 4.823   -8.280  5.583   1.00 0.00 ? 46  LYS A HD2    5  
ATOM   9277  H HD3    . LYS C 2 46 ? 3.816   -8.479  4.148   1.00 0.00 ? 46  LYS A HD3    5  
ATOM   9278  H HE2    . LYS C 2 46 ? 6.012   -9.035  2.902   1.00 0.00 ? 46  LYS A HE2    5  
ATOM   9279  H HE3    . LYS C 2 46 ? 6.715   -9.246  4.518   1.00 0.00 ? 46  LYS A HE3    5  
ATOM   9280  H HZ1    . LYS C 2 46 ? 4.858   -10.729 5.062   1.00 0.00 ? 46  LYS A HZ1    5  
ATOM   9281  H HZ2    . LYS C 2 46 ? 4.276   -10.586 3.473   1.00 0.00 ? 46  LYS A HZ2    5  
ATOM   9282  H HZ3    . LYS C 2 46 ? 5.775   -11.329 3.768   1.00 0.00 ? 46  LYS A HZ3    5  
ATOM   9283  N N      . VAL C 2 47 ? 5.689   -5.366  0.231   1.00 0.00 ? 47  VAL A N      5  
ATOM   9284  C CA     . VAL C 2 47 ? 6.805   -5.260  -0.751  1.00 0.00 ? 47  VAL A CA     5  
ATOM   9285  C C      . VAL C 2 47 ? 7.281   -3.805  -0.808  1.00 0.00 ? 47  VAL A C      5  
ATOM   9286  O O      . VAL C 2 47 ? 8.449   -3.526  -0.636  1.00 0.00 ? 47  VAL A O      5  
ATOM   9287  C CB     . VAL C 2 47 ? 6.195   -5.712  -2.078  1.00 0.00 ? 47  VAL A CB     5  
ATOM   9288  C CG1    . VAL C 2 47 ? 6.976   -5.120  -3.254  1.00 0.00 ? 47  VAL A CG1    5  
ATOM   9289  C CG2    . VAL C 2 47 ? 6.239   -7.239  -2.161  1.00 0.00 ? 47  VAL A CG2    5  
ATOM   9290  H H      . VAL C 2 47 ? 4.832   -5.766  -0.038  1.00 0.00 ? 47  VAL A H      5  
ATOM   9291  H HA     . VAL C 2 47 ? 7.616   -5.914  -0.472  1.00 0.00 ? 47  VAL A HA     5  
ATOM   9292  H HB     . VAL C 2 47 ? 5.174   -5.380  -2.124  1.00 0.00 ? 47  VAL A HB     5  
ATOM   9293  H HG11   . VAL C 2 47 ? 8.022   -5.366  -3.153  1.00 0.00 ? 47  VAL A HG11   5  
ATOM   9294  H HG12   . VAL C 2 47 ? 6.857   -4.046  -3.258  1.00 0.00 ? 47  VAL A HG12   5  
ATOM   9295  H HG13   . VAL C 2 47 ? 6.594   -5.527  -4.178  1.00 0.00 ? 47  VAL A HG13   5  
ATOM   9296  H HG21   . VAL C 2 47 ? 7.174   -7.549  -2.603  1.00 0.00 ? 47  VAL A HG21   5  
ATOM   9297  H HG22   . VAL C 2 47 ? 5.419   -7.590  -2.771  1.00 0.00 ? 47  VAL A HG22   5  
ATOM   9298  H HG23   . VAL C 2 47 ? 6.152   -7.656  -1.169  1.00 0.00 ? 47  VAL A HG23   5  
ATOM   9299  N N      . GLU C 2 48 ? 6.377   -2.874  -1.013  1.00 0.00 ? 48  GLU A N      5  
ATOM   9300  C CA     . GLU C 2 48 ? 6.781   -1.435  -1.040  1.00 0.00 ? 48  GLU A CA     5  
ATOM   9301  C C      . GLU C 2 48 ? 7.577   -1.130  0.231   1.00 0.00 ? 48  GLU A C      5  
ATOM   9302  O O      . GLU C 2 48 ? 8.583   -0.442  0.213   1.00 0.00 ? 48  GLU A O      5  
ATOM   9303  C CB     . GLU C 2 48 ? 5.472   -0.644  -1.060  1.00 0.00 ? 48  GLU A CB     5  
ATOM   9304  C CG     . GLU C 2 48 ? 5.172   -0.185  -2.488  1.00 0.00 ? 48  GLU A CG     5  
ATOM   9305  C CD     . GLU C 2 48 ? 6.144   0.929   -2.883  1.00 0.00 ? 48  GLU A CD     5  
ATOM   9306  O OE1    . GLU C 2 48 ? 6.519   1.698   -2.013  1.00 0.00 ? 48  GLU A OE1    5  
ATOM   9307  O OE2    . GLU C 2 48 ? 6.494   0.996   -4.050  1.00 0.00 ? 48  GLU A OE2    5  
ATOM   9308  H H      . GLU C 2 48 ? 5.435   -3.121  -1.123  1.00 0.00 ? 48  GLU A H      5  
ATOM   9309  H HA     . GLU C 2 48 ? 7.363   -1.217  -1.918  1.00 0.00 ? 48  GLU A HA     5  
ATOM   9310  H HB2    . GLU C 2 48 ? 4.667   -1.270  -0.704  1.00 0.00 ? 48  GLU A HB2    5  
ATOM   9311  H HB3    . GLU C 2 48 ? 5.567   0.220   -0.421  1.00 0.00 ? 48  GLU A HB3    5  
ATOM   9312  H HG2    . GLU C 2 48 ? 5.285   -1.018  -3.164  1.00 0.00 ? 48  GLU A HG2    5  
ATOM   9313  H HG3    . GLU C 2 48 ? 4.160   0.187   -2.541  1.00 0.00 ? 48  GLU A HG3    5  
ATOM   9314  N N      . LEU C 2 49 ? 7.137   -1.681  1.331   1.00 0.00 ? 49  LEU A N      5  
ATOM   9315  C CA     . LEU C 2 49 ? 7.859   -1.480  2.616   1.00 0.00 ? 49  LEU A CA     5  
ATOM   9316  C C      . LEU C 2 49 ? 9.239   -2.122  2.503   1.00 0.00 ? 49  LEU A C      5  
ATOM   9317  O O      . LEU C 2 49 ? 10.232  -1.585  2.951   1.00 0.00 ? 49  LEU A O      5  
ATOM   9318  C CB     . LEU C 2 49 ? 7.008   -2.213  3.658   1.00 0.00 ? 49  LEU A CB     5  
ATOM   9319  C CG     . LEU C 2 49 ? 7.106   -1.500  5.005   1.00 0.00 ? 49  LEU A CG     5  
ATOM   9320  C CD1    . LEU C 2 49 ? 6.141   -0.315  5.024   1.00 0.00 ? 49  LEU A CD1    5  
ATOM   9321  C CD2    . LEU C 2 49 ? 6.736   -2.476  6.128   1.00 0.00 ? 49  LEU A CD2    5  
ATOM   9322  H H      . LEU C 2 49 ? 6.339   -2.250  1.304   1.00 0.00 ? 49  LEU A H      5  
ATOM   9323  H HA     . LEU C 2 49 ? 7.936   -0.433  2.854   1.00 0.00 ? 49  LEU A HA     5  
ATOM   9324  H HB2    . LEU C 2 49 ? 5.977   -2.225  3.333   1.00 0.00 ? 49  LEU A HB2    5  
ATOM   9325  H HB3    . LEU C 2 49 ? 7.364   -3.226  3.764   1.00 0.00 ? 49  LEU A HB3    5  
ATOM   9326  H HG     . LEU C 2 49 ? 8.115   -1.145  5.151   1.00 0.00 ? 49  LEU A HG     5  
ATOM   9327  H HD11   . LEU C 2 49 ? 6.273   0.242   5.940   1.00 0.00 ? 49  LEU A HD11   5  
ATOM   9328  H HD12   . LEU C 2 49 ? 5.125   -0.677  4.966   1.00 0.00 ? 49  LEU A HD12   5  
ATOM   9329  H HD13   . LEU C 2 49 ? 6.344   0.327   4.180   1.00 0.00 ? 49  LEU A HD13   5  
ATOM   9330  H HD21   . LEU C 2 49 ? 7.600   -2.653  6.751   1.00 0.00 ? 49  LEU A HD21   5  
ATOM   9331  H HD22   . LEU C 2 49 ? 6.402   -3.411  5.701   1.00 0.00 ? 49  LEU A HD22   5  
ATOM   9332  H HD23   . LEU C 2 49 ? 5.943   -2.054  6.728   1.00 0.00 ? 49  LEU A HD23   5  
ATOM   9333  N N      . THR C 2 50 ? 9.295   -3.270  1.886   1.00 0.00 ? 50  THR A N      5  
ATOM   9334  C CA     . THR C 2 50 ? 10.594  -3.971  1.709   1.00 0.00 ? 50  THR A CA     5  
ATOM   9335  C C      . THR C 2 50 ? 11.489  -3.174  0.753   1.00 0.00 ? 50  THR A C      5  
ATOM   9336  O O      . THR C 2 50 ? 12.697  -3.305  0.766   1.00 0.00 ? 50  THR A O      5  
ATOM   9337  C CB     . THR C 2 50 ? 10.222  -5.331  1.108   1.00 0.00 ? 50  THR A CB     5  
ATOM   9338  O OG1    . THR C 2 50 ? 9.395   -6.037  2.023   1.00 0.00 ? 50  THR A OG1    5  
ATOM   9339  C CG2    . THR C 2 50 ? 11.489  -6.143  0.837   1.00 0.00 ? 50  THR A CG2    5  
ATOM   9340  H H      . THR C 2 50 ? 8.474   -3.670  1.530   1.00 0.00 ? 50  THR A H      5  
ATOM   9341  H HA     . THR C 2 50 ? 11.083  -4.108  2.660   1.00 0.00 ? 50  THR A HA     5  
ATOM   9342  H HB     . THR C 2 50 ? 9.685   -5.183  0.181   1.00 0.00 ? 50  THR A HB     5  
ATOM   9343  H HG1    . THR C 2 50 ? 9.844   -6.060  2.871   1.00 0.00 ? 50  THR A HG1    5  
ATOM   9344  H HG21   . THR C 2 50 ? 11.750  -6.064  -0.209  1.00 0.00 ? 50  THR A HG21   5  
ATOM   9345  H HG22   . THR C 2 50 ? 11.312  -7.178  1.088   1.00 0.00 ? 50  THR A HG22   5  
ATOM   9346  H HG23   . THR C 2 50 ? 12.298  -5.759  1.439   1.00 0.00 ? 50  THR A HG23   5  
ATOM   9347  N N      . ARG C 2 51 ? 10.905  -2.345  -0.075  1.00 0.00 ? 51  ARG A N      5  
ATOM   9348  C CA     . ARG C 2 51 ? 11.726  -1.539  -1.027  1.00 0.00 ? 51  ARG A CA     5  
ATOM   9349  C C      . ARG C 2 51 ? 12.548  -0.505  -0.257  1.00 0.00 ? 51  ARG A C      5  
ATOM   9350  O O      . ARG C 2 51 ? 13.762  -0.486  -0.326  1.00 0.00 ? 51  ARG A O      5  
ATOM   9351  C CB     . ARG C 2 51 ? 10.724  -0.839  -1.946  1.00 0.00 ? 51  ARG A CB     5  
ATOM   9352  C CG     . ARG C 2 51 ? 9.849   -1.881  -2.640  1.00 0.00 ? 51  ARG A CG     5  
ATOM   9353  C CD     . ARG C 2 51 ? 9.414   -1.356  -4.010  1.00 0.00 ? 51  ARG A CD     5  
ATOM   9354  N NE     . ARG C 2 51 ? 10.445  -1.859  -4.959  1.00 0.00 ? 51  ARG A NE     5  
ATOM   9355  C CZ     . ARG C 2 51 ? 10.093  -2.602  -5.972  1.00 0.00 ? 51  ARG A CZ     5  
ATOM   9356  N NH1    . ARG C 2 51 ? 9.264   -3.594  -5.795  1.00 0.00 ? 51  ARG A NH1    5  
ATOM   9357  N NH2    . ARG C 2 51 ? 10.569  -2.354  -7.161  1.00 0.00 ? 51  ARG A NH2    5  
ATOM   9358  H H      . ARG C 2 51 ? 9.930   -2.252  -0.070  1.00 0.00 ? 51  ARG A H      5  
ATOM   9359  H HA     . ARG C 2 51 ? 12.370  -2.182  -1.607  1.00 0.00 ? 51  ARG A HA     5  
ATOM   9360  H HB2    . ARG C 2 51 ? 10.103  -0.177  -1.362  1.00 0.00 ? 51  ARG A HB2    5  
ATOM   9361  H HB3    . ARG C 2 51 ? 11.258  -0.267  -2.690  1.00 0.00 ? 51  ARG A HB3    5  
ATOM   9362  H HG2    . ARG C 2 51 ? 10.409  -2.797  -2.765  1.00 0.00 ? 51  ARG A HG2    5  
ATOM   9363  H HG3    . ARG C 2 51 ? 8.976   -2.072  -2.037  1.00 0.00 ? 51  ARG A HG3    5  
ATOM   9364  H HD2    . ARG C 2 51 ? 8.438   -1.746  -4.269  1.00 0.00 ? 51  ARG A HD2    5  
ATOM   9365  H HD3    . ARG C 2 51 ? 9.402   -0.277  -4.014  1.00 0.00 ? 51  ARG A HD3    5  
ATOM   9366  H HE     . ARG C 2 51 ? 11.388  -1.630  -4.825  1.00 0.00 ? 51  ARG A HE     5  
ATOM   9367  H HH11   . ARG C 2 51 ? 8.899   -3.784  -4.883  1.00 0.00 ? 51  ARG A HH11   5  
ATOM   9368  H HH12   . ARG C 2 51 ? 8.993   -4.164  -6.571  1.00 0.00 ? 51  ARG A HH12   5  
ATOM   9369  H HH21   . ARG C 2 51 ? 11.204  -1.594  -7.297  1.00 0.00 ? 51  ARG A HH21   5  
ATOM   9370  H HH22   . ARG C 2 51 ? 10.299  -2.924  -7.937  1.00 0.00 ? 51  ARG A HH22   5  
ATOM   9371  N N      . TYR C 2 52 ? 11.895  0.357   0.482   1.00 0.00 ? 52  TYR A N      5  
ATOM   9372  C CA     . TYR C 2 52 ? 12.646  1.389   1.261   1.00 0.00 ? 52  TYR A CA     5  
ATOM   9373  C C      . TYR C 2 52 ? 13.635  0.710   2.211   1.00 0.00 ? 52  TYR A C      5  
ATOM   9374  O O      . TYR C 2 52 ? 14.676  1.249   2.531   1.00 0.00 ? 52  TYR A O      5  
ATOM   9375  C CB     . TYR C 2 52 ? 11.583  2.154   2.054   1.00 0.00 ? 52  TYR A CB     5  
ATOM   9376  C CG     . TYR C 2 52 ? 12.223  3.330   2.760   1.00 0.00 ? 52  TYR A CG     5  
ATOM   9377  C CD1    . TYR C 2 52 ? 13.062  3.114   3.861   1.00 0.00 ? 52  TYR A CD1    5  
ATOM   9378  C CD2    . TYR C 2 52 ? 11.976  4.637   2.316   1.00 0.00 ? 52  TYR A CD2    5  
ATOM   9379  C CE1    . TYR C 2 52 ? 13.652  4.202   4.515   1.00 0.00 ? 52  TYR A CE1    5  
ATOM   9380  C CE2    . TYR C 2 52 ? 12.567  5.722   2.970   1.00 0.00 ? 52  TYR A CE2    5  
ATOM   9381  C CZ     . TYR C 2 52 ? 13.406  5.506   4.070   1.00 0.00 ? 52  TYR A CZ     5  
ATOM   9382  O OH     . TYR C 2 52 ? 13.990  6.576   4.715   1.00 0.00 ? 52  TYR A OH     5  
ATOM   9383  H H      . TYR C 2 52 ? 10.914  0.322   0.526   1.00 0.00 ? 52  TYR A H      5  
ATOM   9384  H HA     . TYR C 2 52 ? 13.165  2.061   0.596   1.00 0.00 ? 52  TYR A HA     5  
ATOM   9385  H HB2    . TYR C 2 52 ? 10.819  2.512   1.379   1.00 0.00 ? 52  TYR A HB2    5  
ATOM   9386  H HB3    . TYR C 2 52 ? 11.137  1.496   2.785   1.00 0.00 ? 52  TYR A HB3    5  
ATOM   9387  H HD1    . TYR C 2 52 ? 13.252  2.110   4.206   1.00 0.00 ? 52  TYR A HD1    5  
ATOM   9388  H HD2    . TYR C 2 52 ? 11.329  4.807   1.470   1.00 0.00 ? 52  TYR A HD2    5  
ATOM   9389  H HE1    . TYR C 2 52 ? 14.300  4.035   5.364   1.00 0.00 ? 52  TYR A HE1    5  
ATOM   9390  H HE2    . TYR C 2 52 ? 12.373  6.729   2.626   1.00 0.00 ? 52  TYR A HE2    5  
ATOM   9391  H HH     . TYR C 2 52 ? 14.903  6.635   4.425   1.00 0.00 ? 52  TYR A HH     5  
ATOM   9392  N N      . LEU C 2 53 ? 13.313  -0.473  2.664   1.00 0.00 ? 53  LEU A N      5  
ATOM   9393  C CA     . LEU C 2 53 ? 14.228  -1.196  3.595   1.00 0.00 ? 53  LEU A CA     5  
ATOM   9394  C C      . LEU C 2 53 ? 15.286  -1.977  2.807   1.00 0.00 ? 53  LEU A C      5  
ATOM   9395  O O      . LEU C 2 53 ? 16.277  -2.417  3.356   1.00 0.00 ? 53  LEU A O      5  
ATOM   9396  C CB     . LEU C 2 53 ? 13.322  -2.151  4.372   1.00 0.00 ? 53  LEU A CB     5  
ATOM   9397  C CG     . LEU C 2 53 ? 12.291  -1.344  5.165   1.00 0.00 ? 53  LEU A CG     5  
ATOM   9398  C CD1    . LEU C 2 53 ? 11.085  -2.230  5.490   1.00 0.00 ? 53  LEU A CD1    5  
ATOM   9399  C CD2    . LEU C 2 53 ? 12.926  -0.846  6.465   1.00 0.00 ? 53  LEU A CD2    5  
ATOM   9400  H H      . LEU C 2 53 ? 12.467  -0.886  2.391   1.00 0.00 ? 53  LEU A H      5  
ATOM   9401  H HA     . LEU C 2 53 ? 14.699  -0.504  4.273   1.00 0.00 ? 53  LEU A HA     5  
ATOM   9402  H HB2    . LEU C 2 53 ? 12.813  -2.807  3.681   1.00 0.00 ? 53  LEU A HB2    5  
ATOM   9403  H HB3    . LEU C 2 53 ? 13.919  -2.738  5.054   1.00 0.00 ? 53  LEU A HB3    5  
ATOM   9404  H HG     . LEU C 2 53 ? 11.964  -0.499  4.575   1.00 0.00 ? 53  LEU A HG     5  
ATOM   9405  H HD11   . LEU C 2 53 ? 10.178  -1.725  5.194   1.00 0.00 ? 53  LEU A HD11   5  
ATOM   9406  H HD12   . LEU C 2 53 ? 11.058  -2.427  6.552   1.00 0.00 ? 53  LEU A HD12   5  
ATOM   9407  H HD13   . LEU C 2 53 ? 11.168  -3.164  4.954   1.00 0.00 ? 53  LEU A HD13   5  
ATOM   9408  H HD21   . LEU C 2 53 ? 12.880  -1.627  7.211   1.00 0.00 ? 53  LEU A HD21   5  
ATOM   9409  H HD22   . LEU C 2 53 ? 12.389  0.021   6.820   1.00 0.00 ? 53  LEU A HD22   5  
ATOM   9410  H HD23   . LEU C 2 53 ? 13.958  -0.582  6.284   1.00 0.00 ? 53  LEU A HD23   5  
ATOM   9411  N N      . GLY C 2 54 ? 15.086  -2.154  1.527   1.00 0.00 ? 54  GLY A N      5  
ATOM   9412  C CA     . GLY C 2 54 ? 16.081  -2.906  0.712   1.00 0.00 ? 54  GLY A CA     5  
ATOM   9413  C C      . GLY C 2 54 ? 15.498  -4.268  0.326   1.00 0.00 ? 54  GLY A C      5  
ATOM   9414  O O      . GLY C 2 54 ? 14.649  -4.794  1.015   1.00 0.00 ? 54  GLY A O      5  
ATOM   9415  H H      . GLY C 2 54 ? 14.282  -1.791  1.102   1.00 0.00 ? 54  GLY A H      5  
ATOM   9416  H HA2    . GLY C 2 54 ? 16.312  -2.343  -0.182  1.00 0.00 ? 54  GLY A HA2    5  
ATOM   9417  H HA3    . GLY C 2 54 ? 16.982  -3.054  1.288   1.00 0.00 ? 54  GLY A HA3    5  
ATOM   9418  N N      . PRO C 2 55 ? 15.977  -4.799  -0.771  1.00 0.00 ? 55  PRO A N      5  
ATOM   9419  C CA     . PRO C 2 55 ? 15.490  -6.117  -1.249  1.00 0.00 ? 55  PRO A CA     5  
ATOM   9420  C C      . PRO C 2 55 ? 15.992  -7.239  -0.334  1.00 0.00 ? 55  PRO A C      5  
ATOM   9421  O O      . PRO C 2 55 ? 15.494  -8.347  -0.368  1.00 0.00 ? 55  PRO A O      5  
ATOM   9422  C CB     . PRO C 2 55 ? 16.090  -6.236  -2.647  1.00 0.00 ? 55  PRO A CB     5  
ATOM   9423  C CG     . PRO C 2 55 ? 17.295  -5.352  -2.626  1.00 0.00 ? 55  PRO A CG     5  
ATOM   9424  C CD     . PRO C 2 55 ? 17.003  -4.236  -1.658  1.00 0.00 ? 55  PRO A CD     5  
ATOM   9425  H HA     . PRO C 2 55 ? 14.414  -6.127  -1.307  1.00 0.00 ? 55  PRO A HA     5  
ATOM   9426  H HB2    . PRO C 2 55 ? 16.374  -7.261  -2.846  1.00 0.00 ? 55  PRO A HB2    5  
ATOM   9427  H HB3    . PRO C 2 55 ? 15.389  -5.887  -3.390  1.00 0.00 ? 55  PRO A HB3    5  
ATOM   9428  H HG2    . PRO C 2 55 ? 18.159  -5.914  -2.297  1.00 0.00 ? 55  PRO A HG2    5  
ATOM   9429  H HG3    . PRO C 2 55 ? 17.471  -4.944  -3.609  1.00 0.00 ? 55  PRO A HG3    5  
ATOM   9430  H HD2    . PRO C 2 55 ? 17.892  -3.978  -1.099  1.00 0.00 ? 55  PRO A HD2    5  
ATOM   9431  H HD3    . PRO C 2 55 ? 16.614  -3.373  -2.176  1.00 0.00 ? 55  PRO A HD3    5  
ATOM   9432  N N      . ALA C 2 56 ? 16.970  -6.960  0.487   1.00 0.00 ? 56  ALA A N      5  
ATOM   9433  C CA     . ALA C 2 56 ? 17.497  -8.009  1.406   1.00 0.00 ? 56  ALA A CA     5  
ATOM   9434  C C      . ALA C 2 56 ? 16.720  -7.994  2.728   1.00 0.00 ? 56  ALA A C      5  
ATOM   9435  O O      . ALA C 2 56 ? 16.760  -8.940  3.490   1.00 0.00 ? 56  ALA A O      5  
ATOM   9436  C CB     . ALA C 2 56 ? 18.961  -7.632  1.639   1.00 0.00 ? 56  ALA A CB     5  
ATOM   9437  H H      . ALA C 2 56 ? 17.355  -6.059  0.502   1.00 0.00 ? 56  ALA A H      5  
ATOM   9438  H HA     . ALA C 2 56 ? 17.436  -8.981  0.944   1.00 0.00 ? 56  ALA A HA     5  
ATOM   9439  H HB1    . ALA C 2 56 ? 19.430  -8.378  2.262   1.00 0.00 ? 56  ALA A HB1    5  
ATOM   9440  H HB2    . ALA C 2 56 ? 19.011  -6.670  2.128   1.00 0.00 ? 56  ALA A HB2    5  
ATOM   9441  H HB3    . ALA C 2 56 ? 19.475  -7.580  0.690   1.00 0.00 ? 56  ALA A HB3    5  
ATOM   9442  N N      . CYS C 2 57 ? 16.014  -6.927  3.005   1.00 0.00 ? 57  CYS A N      5  
ATOM   9443  C CA     . CYS C 2 57 ? 15.237  -6.854  4.276   1.00 0.00 ? 57  CYS A CA     5  
ATOM   9444  C C      . CYS C 2 57 ? 13.824  -7.407  4.063   1.00 0.00 ? 57  CYS A C      5  
ATOM   9445  O O      . CYS C 2 57 ? 13.077  -6.921  3.237   1.00 0.00 ? 57  CYS A O      5  
ATOM   9446  C CB     . CYS C 2 57 ? 15.185  -5.365  4.625   1.00 0.00 ? 57  CYS A CB     5  
ATOM   9447  S SG     . CYS C 2 57 ? 16.639  -4.925  5.608   1.00 0.00 ? 57  CYS A SG     5  
ATOM   9448  H H      . CYS C 2 57 ? 15.996  -6.175  2.377   1.00 0.00 ? 57  CYS A H      5  
ATOM   9449  H HA     . CYS C 2 57 ? 15.741  -7.398  5.059   1.00 0.00 ? 57  CYS A HA     5  
ATOM   9450  H HB2    . CYS C 2 57 ? 15.176  -4.781  3.716   1.00 0.00 ? 57  CYS A HB2    5  
ATOM   9451  H HB3    . CYS C 2 57 ? 14.290  -5.159  5.194   1.00 0.00 ? 57  CYS A HB3    5  
ATOM   9452  H HG     . CYS C 2 57 ? 16.649  -5.483  6.390   1.00 0.00 ? 57  CYS A HG     5  
ATOM   9453  N N      . ASP C 2 58 ? 13.454  -8.418  4.802   1.00 0.00 ? 58  ASP A N      5  
ATOM   9454  C CA     . ASP C 2 58 ? 12.091  -9.003  4.642   1.00 0.00 ? 58  ASP A CA     5  
ATOM   9455  C C      . ASP C 2 58 ? 11.190  -8.570  5.802   1.00 0.00 ? 58  ASP A C      5  
ATOM   9456  O O      . ASP C 2 58 ? 11.661  -8.164  6.846   1.00 0.00 ? 58  ASP A O      5  
ATOM   9457  C CB     . ASP C 2 58 ? 12.299  -10.517 4.670   1.00 0.00 ? 58  ASP A CB     5  
ATOM   9458  C CG     . ASP C 2 58 ? 12.219  -11.071 3.245   1.00 0.00 ? 58  ASP A CG     5  
ATOM   9459  O OD1    . ASP C 2 58 ? 13.230  -11.051 2.563   1.00 0.00 ? 58  ASP A OD1    5  
ATOM   9460  O OD2    . ASP C 2 58 ? 11.145  -11.507 2.860   1.00 0.00 ? 58  ASP A OD2    5  
ATOM   9461  H H      . ASP C 2 58 ? 14.074  -8.794  5.462   1.00 0.00 ? 58  ASP A H      5  
ATOM   9462  H HA     . ASP C 2 58 ? 11.661  -8.705  3.699   1.00 0.00 ? 58  ASP A HA     5  
ATOM   9463  H HB2    . ASP C 2 58 ? 13.270  -10.739 5.088   1.00 0.00 ? 58  ASP A HB2    5  
ATOM   9464  H HB3    . ASP C 2 58 ? 11.533  -10.975 5.276   1.00 0.00 ? 58  ASP A HB3    5  
ATOM   9465  N N      . LEU C 2 59 ? 9.898   -8.656  5.625   1.00 0.00 ? 59  LEU A N      5  
ATOM   9466  C CA     . LEU C 2 59 ? 8.967   -8.252  6.718   1.00 0.00 ? 59  LEU A CA     5  
ATOM   9467  C C      . LEU C 2 59 ? 7.801   -9.240  6.805   1.00 0.00 ? 59  LEU A C      5  
ATOM   9468  O O      . LEU C 2 59 ? 6.648   -8.863  6.730   1.00 0.00 ? 59  LEU A O      5  
ATOM   9469  C CB     . LEU C 2 59 ? 8.459   -6.861  6.325   1.00 0.00 ? 59  LEU A CB     5  
ATOM   9470  C CG     . LEU C 2 59 ? 9.640   -5.902  6.146   1.00 0.00 ? 59  LEU A CG     5  
ATOM   9471  C CD1    . LEU C 2 59 ? 9.123   -4.538  5.681   1.00 0.00 ? 59  LEU A CD1    5  
ATOM   9472  C CD2    . LEU C 2 59 ? 10.383  -5.742  7.480   1.00 0.00 ? 59  LEU A CD2    5  
ATOM   9473  H H      . LEU C 2 59 ? 9.542   -8.989  4.775   1.00 0.00 ? 59  LEU A H      5  
ATOM   9474  H HA     . LEU C 2 59 ? 9.491   -8.203  7.658   1.00 0.00 ? 59  LEU A HA     5  
ATOM   9475  H HB2    . LEU C 2 59 ? 7.909   -6.930  5.398   1.00 0.00 ? 59  LEU A HB2    5  
ATOM   9476  H HB3    . LEU C 2 59 ? 7.808   -6.485  7.100   1.00 0.00 ? 59  LEU A HB3    5  
ATOM   9477  H HG     . LEU C 2 59 ? 10.314  -6.298  5.401   1.00 0.00 ? 59  LEU A HG     5  
ATOM   9478  H HD11   . LEU C 2 59 ? 9.572   -4.287  4.732   1.00 0.00 ? 59  LEU A HD11   5  
ATOM   9479  H HD12   . LEU C 2 59 ? 9.383   -3.785  6.412   1.00 0.00 ? 59  LEU A HD12   5  
ATOM   9480  H HD13   . LEU C 2 59 ? 8.051   -4.577  5.572   1.00 0.00 ? 59  LEU A HD13   5  
ATOM   9481  H HD21   . LEU C 2 59 ? 11.421  -6.004  7.347   1.00 0.00 ? 59  LEU A HD21   5  
ATOM   9482  H HD22   . LEU C 2 59 ? 9.941   -6.391  8.220   1.00 0.00 ? 59  LEU A HD22   5  
ATOM   9483  H HD23   . LEU C 2 59 ? 10.311  -4.717  7.812   1.00 0.00 ? 59  LEU A HD23   5  
ATOM   9484  N N      . THR C 2 60 ? 8.095   -10.502 6.960   1.00 0.00 ? 60  THR A N      5  
ATOM   9485  C CA     . THR C 2 60 ? 7.004   -11.518 7.049   1.00 0.00 ? 60  THR A CA     5  
ATOM   9486  C C      . THR C 2 60 ? 6.220   -11.353 8.356   1.00 0.00 ? 60  THR A C      5  
ATOM   9487  O O      . THR C 2 60 ? 5.165   -11.930 8.531   1.00 0.00 ? 60  THR A O      5  
ATOM   9488  C CB     . THR C 2 60 ? 7.714   -12.876 7.022   1.00 0.00 ? 60  THR A CB     5  
ATOM   9489  O OG1    . THR C 2 60 ? 8.936   -12.761 6.304   1.00 0.00 ? 60  THR A OG1    5  
ATOM   9490  C CG2    . THR C 2 60 ? 6.816   -13.905 6.336   1.00 0.00 ? 60  THR A CG2    5  
ATOM   9491  H H      . THR C 2 60 ? 9.032   -10.783 7.016   1.00 0.00 ? 60  THR A H      5  
ATOM   9492  H HA     . THR C 2 60 ? 6.342   -11.433 6.202   1.00 0.00 ? 60  THR A HA     5  
ATOM   9493  H HB     . THR C 2 60 ? 7.917   -13.197 8.031   1.00 0.00 ? 60  THR A HB     5  
ATOM   9494  H HG1    . THR C 2 60 ? 9.476   -13.527 6.514   1.00 0.00 ? 60  THR A HG1    5  
ATOM   9495  H HG21   . THR C 2 60 ? 6.353   -13.458 5.469   1.00 0.00 ? 60  THR A HG21   5  
ATOM   9496  H HG22   . THR C 2 60 ? 6.051   -14.232 7.025   1.00 0.00 ? 60  THR A HG22   5  
ATOM   9497  H HG23   . THR C 2 60 ? 7.410   -14.753 6.030   1.00 0.00 ? 60  THR A HG23   5  
ATOM   9498  N N      . LEU C 2 61 ? 6.724   -10.572 9.277   1.00 0.00 ? 61  LEU A N      5  
ATOM   9499  C CA     . LEU C 2 61 ? 6.006   -10.377 10.570  1.00 0.00 ? 61  LEU A CA     5  
ATOM   9500  C C      . LEU C 2 61 ? 5.157   -9.101  10.529  1.00 0.00 ? 61  LEU A C      5  
ATOM   9501  O O      . LEU C 2 61 ? 4.195   -8.964  11.259  1.00 0.00 ? 61  LEU A O      5  
ATOM   9502  C CB     . LEU C 2 61 ? 7.112   -10.253 11.619  1.00 0.00 ? 61  LEU A CB     5  
ATOM   9503  C CG     . LEU C 2 61 ? 7.837   -11.593 11.754  1.00 0.00 ? 61  LEU A CG     5  
ATOM   9504  C CD1    . LEU C 2 61 ? 9.308   -11.347 12.089  1.00 0.00 ? 61  LEU A CD1    5  
ATOM   9505  C CD2    . LEU C 2 61 ? 7.189   -12.411 12.874  1.00 0.00 ? 61  LEU A CD2    5  
ATOM   9506  H H      . LEU C 2 61 ? 7.578   -10.117 9.120   1.00 0.00 ? 61  LEU A H      5  
ATOM   9507  H HA     . LEU C 2 61 ? 5.387   -11.233 10.789  1.00 0.00 ? 61  LEU A HA     5  
ATOM   9508  H HB2    . LEU C 2 61 ? 7.814   -9.491  11.312  1.00 0.00 ? 61  LEU A HB2    5  
ATOM   9509  H HB3    . LEU C 2 61 ? 6.678   -9.982  12.570  1.00 0.00 ? 61  LEU A HB3    5  
ATOM   9510  H HG     . LEU C 2 61 ? 7.766   -12.135 10.822  1.00 0.00 ? 61  LEU A HG     5  
ATOM   9511  H HD11   . LEU C 2 61 ? 9.683   -12.164 12.687  1.00 0.00 ? 61  LEU A HD11   5  
ATOM   9512  H HD12   . LEU C 2 61 ? 9.402   -10.424 12.641  1.00 0.00 ? 61  LEU A HD12   5  
ATOM   9513  H HD13   . LEU C 2 61 ? 9.879   -11.278 11.174  1.00 0.00 ? 61  LEU A HD13   5  
ATOM   9514  H HD21   . LEU C 2 61 ? 7.751   -12.283 13.787  1.00 0.00 ? 61  LEU A HD21   5  
ATOM   9515  H HD22   . LEU C 2 61 ? 7.183   -13.456 12.599  1.00 0.00 ? 61  LEU A HD22   5  
ATOM   9516  H HD23   . LEU C 2 61 ? 6.174   -12.075 13.027  1.00 0.00 ? 61  LEU A HD23   5  
ATOM   9517  N N      . PHE C 2 62 ? 5.504   -8.167  9.683   1.00 0.00 ? 62  PHE A N      5  
ATOM   9518  C CA     . PHE C 2 62 ? 4.714   -6.901  9.599   1.00 0.00 ? 62  PHE A CA     5  
ATOM   9519  C C      . PHE C 2 62 ? 3.257   -7.210  9.236   1.00 0.00 ? 62  PHE A C      5  
ATOM   9520  O O      . PHE C 2 62 ? 2.976   -8.117  8.476   1.00 0.00 ? 62  PHE A O      5  
ATOM   9521  C CB     . PHE C 2 62 ? 5.388   -6.082  8.492   1.00 0.00 ? 62  PHE A CB     5  
ATOM   9522  C CG     . PHE C 2 62 ? 4.515   -4.905  8.114   1.00 0.00 ? 62  PHE A CG     5  
ATOM   9523  C CD1    . PHE C 2 62 ? 4.497   -3.755  8.914   1.00 0.00 ? 62  PHE A CD1    5  
ATOM   9524  C CD2    . PHE C 2 62 ? 3.722   -4.967  6.961   1.00 0.00 ? 62  PHE A CD2    5  
ATOM   9525  C CE1    . PHE C 2 62 ? 3.688   -2.668  8.559   1.00 0.00 ? 62  PHE A CE1    5  
ATOM   9526  C CE2    . PHE C 2 62 ? 2.914   -3.881  6.607   1.00 0.00 ? 62  PHE A CE2    5  
ATOM   9527  C CZ     . PHE C 2 62 ? 2.896   -2.731  7.405   1.00 0.00 ? 62  PHE A CZ     5  
ATOM   9528  H H      . PHE C 2 62 ? 6.284   -8.296  9.102   1.00 0.00 ? 62  PHE A H      5  
ATOM   9529  H HA     . PHE C 2 62 ? 4.763   -6.366  10.533  1.00 0.00 ? 62  PHE A HA     5  
ATOM   9530  H HB2    . PHE C 2 62 ? 6.343   -5.721  8.845   1.00 0.00 ? 62  PHE A HB2    5  
ATOM   9531  H HB3    . PHE C 2 62 ? 5.540   -6.708  7.626   1.00 0.00 ? 62  PHE A HB3    5  
ATOM   9532  H HD1    . PHE C 2 62 ? 5.107   -3.705  9.803   1.00 0.00 ? 62  PHE A HD1    5  
ATOM   9533  H HD2    . PHE C 2 62 ? 3.735   -5.853  6.344   1.00 0.00 ? 62  PHE A HD2    5  
ATOM   9534  H HE1    . PHE C 2 62 ? 3.673   -1.782  9.174   1.00 0.00 ? 62  PHE A HE1    5  
ATOM   9535  H HE2    . PHE C 2 62 ? 2.303   -3.929  5.718   1.00 0.00 ? 62  PHE A HE2    5  
ATOM   9536  H HZ     . PHE C 2 62 ? 2.272   -1.893  7.133   1.00 0.00 ? 62  PHE A HZ     5  
ATOM   9537  N N      . ASP C 2 63 ? 2.332   -6.457  9.770   1.00 0.00 ? 63  ASP A N      5  
ATOM   9538  C CA     . ASP C 2 63 ? 0.895   -6.701  9.455   1.00 0.00 ? 63  ASP A CA     5  
ATOM   9539  C C      . ASP C 2 63 ? 0.383   -5.637  8.479   1.00 0.00 ? 63  ASP A C      5  
ATOM   9540  O O      . ASP C 2 63 ? 0.240   -4.481  8.825   1.00 0.00 ? 63  ASP A O      5  
ATOM   9541  C CB     . ASP C 2 63 ? 0.170   -6.591  10.796  1.00 0.00 ? 63  ASP A CB     5  
ATOM   9542  C CG     . ASP C 2 63 ? -0.079  -7.992  11.360  1.00 0.00 ? 63  ASP A CG     5  
ATOM   9543  O OD1    . ASP C 2 63 ? 0.805   -8.509  12.022  1.00 0.00 ? 63  ASP A OD1    5  
ATOM   9544  O OD2    . ASP C 2 63 ? -1.151  -8.524  11.119  1.00 0.00 ? 63  ASP A OD2    5  
ATOM   9545  H H      . ASP C 2 63 ? 2.583   -5.730  10.378  1.00 0.00 ? 63  ASP A H      5  
ATOM   9546  H HA     . ASP C 2 63 ? 0.761   -7.687  9.041   1.00 0.00 ? 63  ASP A HA     5  
ATOM   9547  H HB2    . ASP C 2 63 ? 0.778   -6.027  11.488  1.00 0.00 ? 63  ASP A HB2    5  
ATOM   9548  H HB3    . ASP C 2 63 ? -0.775  -6.090  10.655  1.00 0.00 ? 63  ASP A HB3    5  
ATOM   9549  N N      . PHE C 2 64 ? 0.106   -6.022  7.261   1.00 0.00 ? 64  PHE A N      5  
ATOM   9550  C CA     . PHE C 2 64 ? -0.399  -5.038  6.256   1.00 0.00 ? 64  PHE A CA     5  
ATOM   9551  C C      . PHE C 2 64 ? -1.663  -4.345  6.781   1.00 0.00 ? 64  PHE A C      5  
ATOM   9552  O O      . PHE C 2 64 ? -2.000  -3.252  6.367   1.00 0.00 ? 64  PHE A O      5  
ATOM   9553  C CB     . PHE C 2 64 ? -0.709  -5.877  5.011   1.00 0.00 ? 64  PHE A CB     5  
ATOM   9554  C CG     . PHE C 2 64 ? -1.432  -5.038  3.981   1.00 0.00 ? 64  PHE A CG     5  
ATOM   9555  C CD1    . PHE C 2 64 ? -2.818  -4.857  4.075   1.00 0.00 ? 64  PHE A CD1    5  
ATOM   9556  C CD2    . PHE C 2 64 ? -0.720  -4.446  2.931   1.00 0.00 ? 64  PHE A CD2    5  
ATOM   9557  C CE1    . PHE C 2 64 ? -3.490  -4.085  3.121   1.00 0.00 ? 64  PHE A CE1    5  
ATOM   9558  C CE2    . PHE C 2 64 ? -1.393  -3.674  1.977   1.00 0.00 ? 64  PHE A CE2    5  
ATOM   9559  C CZ     . PHE C 2 64 ? -2.779  -3.493  2.072   1.00 0.00 ? 64  PHE A CZ     5  
ATOM   9560  H H      . PHE C 2 64 ? 0.229   -6.961  7.007   1.00 0.00 ? 64  PHE A H      5  
ATOM   9561  H HA     . PHE C 2 64 ? 0.363   -4.310  6.029   1.00 0.00 ? 64  PHE A HA     5  
ATOM   9562  H HB2    . PHE C 2 64 ? 0.215   -6.244  4.588   1.00 0.00 ? 64  PHE A HB2    5  
ATOM   9563  H HB3    . PHE C 2 64 ? -1.331  -6.715  5.290   1.00 0.00 ? 64  PHE A HB3    5  
ATOM   9564  H HD1    . PHE C 2 64 ? -3.367  -5.314  4.885   1.00 0.00 ? 64  PHE A HD1    5  
ATOM   9565  H HD2    . PHE C 2 64 ? 0.349   -4.583  2.856   1.00 0.00 ? 64  PHE A HD2    5  
ATOM   9566  H HE1    . PHE C 2 64 ? -4.559  -3.946  3.195   1.00 0.00 ? 64  PHE A HE1    5  
ATOM   9567  H HE2    . PHE C 2 64 ? -0.845  -3.219  1.166   1.00 0.00 ? 64  PHE A HE2    5  
ATOM   9568  H HZ     . PHE C 2 64 ? -3.298  -2.898  1.335   1.00 0.00 ? 64  PHE A HZ     5  
ATOM   9569  N N      . LYS C 2 65 ? -2.367  -4.973  7.685   1.00 0.00 ? 65  LYS A N      5  
ATOM   9570  C CA     . LYS C 2 65 ? -3.610  -4.354  8.231   1.00 0.00 ? 65  LYS A CA     5  
ATOM   9571  C C      . LYS C 2 65 ? -3.292  -3.508  9.469   1.00 0.00 ? 65  LYS A C      5  
ATOM   9572  O O      . LYS C 2 65 ? -3.518  -2.314  9.490   1.00 0.00 ? 65  LYS A O      5  
ATOM   9573  C CB     . LYS C 2 65 ? -4.508  -5.533  8.602   1.00 0.00 ? 65  LYS A CB     5  
ATOM   9574  C CG     . LYS C 2 65 ? -5.966  -5.179  8.303   1.00 0.00 ? 65  LYS A CG     5  
ATOM   9575  C CD     . LYS C 2 65 ? -6.189  -5.169  6.788   1.00 0.00 ? 65  LYS A CD     5  
ATOM   9576  C CE     . LYS C 2 65 ? -7.440  -4.350  6.459   1.00 0.00 ? 65  LYS A CE     5  
ATOM   9577  N NZ     . LYS C 2 65 ? -8.218  -5.198  5.513   1.00 0.00 ? 65  LYS A NZ     5  
ATOM   9578  H H      . LYS C 2 65 ? -2.080  -5.855  8.003   1.00 0.00 ? 65  LYS A H      5  
ATOM   9579  H HA     . LYS C 2 65 ? -4.090  -3.750  7.478   1.00 0.00 ? 65  LYS A HA     5  
ATOM   9580  H HB2    . LYS C 2 65 ? -4.222  -6.400  8.026   1.00 0.00 ? 65  LYS A HB2    5  
ATOM   9581  H HB3    . LYS C 2 65 ? -4.403  -5.748  9.655   1.00 0.00 ? 65  LYS A HB3    5  
ATOM   9582  H HG2    . LYS C 2 65 ? -6.616  -5.913  8.758   1.00 0.00 ? 65  LYS A HG2    5  
ATOM   9583  H HG3    . LYS C 2 65 ? -6.189  -4.202  8.703   1.00 0.00 ? 65  LYS A HG3    5  
ATOM   9584  H HD2    . LYS C 2 65 ? -5.330  -4.727  6.302   1.00 0.00 ? 65  LYS A HD2    5  
ATOM   9585  H HD3    . LYS C 2 65 ? -6.320  -6.181  6.438   1.00 0.00 ? 65  LYS A HD3    5  
ATOM   9586  H HE2    . LYS C 2 65 ? -8.013  -4.161  7.357   1.00 0.00 ? 65  LYS A HE2    5  
ATOM   9587  H HE3    . LYS C 2 65 ? -7.167  -3.421  5.983   1.00 0.00 ? 65  LYS A HE3    5  
ATOM   9588  H HZ1    . LYS C 2 65 ? -8.542  -6.056  6.003   1.00 0.00 ? 65  LYS A HZ1    5  
ATOM   9589  H HZ2    . LYS C 2 65 ? -9.042  -4.664  5.166   1.00 0.00 ? 65  LYS A HZ2    5  
ATOM   9590  H HZ3    . LYS C 2 65 ? -7.615  -5.467  4.711   1.00 0.00 ? 65  LYS A HZ3    5  
ATOM   9591  N N      . GLN C 2 66 ? -2.777  -4.120  10.503  1.00 0.00 ? 66  GLN A N      5  
ATOM   9592  C CA     . GLN C 2 66 ? -2.454  -3.354  11.744  1.00 0.00 ? 66  GLN A CA     5  
ATOM   9593  C C      . GLN C 2 66 ? -1.320  -2.359  11.482  1.00 0.00 ? 66  GLN A C      5  
ATOM   9594  O O      . GLN C 2 66 ? -1.437  -1.184  11.773  1.00 0.00 ? 66  GLN A O      5  
ATOM   9595  C CB     . GLN C 2 66 ? -2.020  -4.408  12.762  1.00 0.00 ? 66  GLN A CB     5  
ATOM   9596  C CG     . GLN C 2 66 ? -3.259  -5.079  13.363  1.00 0.00 ? 66  GLN A CG     5  
ATOM   9597  C CD     . GLN C 2 66 ? -2.917  -6.509  13.789  1.00 0.00 ? 66  GLN A CD     5  
ATOM   9598  O OE1    . GLN C 2 66 ? -1.793  -6.949  13.642  1.00 0.00 ? 66  GLN A OE1    5  
ATOM   9599  N NE2    . GLN C 2 66 ? -3.847  -7.259  14.315  1.00 0.00 ? 66  GLN A NE2    5  
ATOM   9600  H H      . GLN C 2 66 ? -2.609  -5.086  10.466  1.00 0.00 ? 66  GLN A H      5  
ATOM   9601  H HA     . GLN C 2 66 ? -3.331  -2.837  12.102  1.00 0.00 ? 66  GLN A HA     5  
ATOM   9602  H HB2    . GLN C 2 66 ? -1.409  -5.152  12.273  1.00 0.00 ? 66  GLN A HB2    5  
ATOM   9603  H HB3    . GLN C 2 66 ? -1.452  -3.937  13.550  1.00 0.00 ? 66  GLN A HB3    5  
ATOM   9604  H HG2    . GLN C 2 66 ? -3.590  -4.515  14.224  1.00 0.00 ? 66  GLN A HG2    5  
ATOM   9605  H HG3    . GLN C 2 66 ? -4.047  -5.104  12.625  1.00 0.00 ? 66  GLN A HG3    5  
ATOM   9606  H HE21   . GLN C 2 66 ? -4.753  -6.905  14.433  1.00 0.00 ? 66  GLN A HE21   5  
ATOM   9607  H HE22   . GLN C 2 66 ? -3.639  -8.176  14.591  1.00 0.00 ? 66  GLN A HE22   5  
ATOM   9608  N N      . GLY C 2 67 ? -0.222  -2.816  10.939  1.00 0.00 ? 67  GLY A N      5  
ATOM   9609  C CA     . GLY C 2 67 ? 0.915   -1.893  10.667  1.00 0.00 ? 67  GLY A CA     5  
ATOM   9610  C C      . GLY C 2 67 ? 1.951   -2.021  11.786  1.00 0.00 ? 67  GLY A C      5  
ATOM   9611  O O      . GLY C 2 67 ? 2.422   -1.038  12.325  1.00 0.00 ? 67  GLY A O      5  
ATOM   9612  H H      . GLY C 2 67 ? -0.145  -3.768  10.714  1.00 0.00 ? 67  GLY A H      5  
ATOM   9613  H HA2    . GLY C 2 67 ? 1.370   -2.150  9.720   1.00 0.00 ? 67  GLY A HA2    5  
ATOM   9614  H HA3    . GLY C 2 67 ? 0.554   -0.876  10.631  1.00 0.00 ? 67  GLY A HA3    5  
ATOM   9615  N N      . ILE C 2 68 ? 2.305   -3.227  12.138  1.00 0.00 ? 68  ILE A N      5  
ATOM   9616  C CA     . ILE C 2 68 ? 3.311   -3.428  13.223  1.00 0.00 ? 68  ILE A CA     5  
ATOM   9617  C C      . ILE C 2 68 ? 4.144   -4.681  12.941  1.00 0.00 ? 68  ILE A C      5  
ATOM   9618  O O      . ILE C 2 68 ? 3.679   -5.620  12.324  1.00 0.00 ? 68  ILE A O      5  
ATOM   9619  C CB     . ILE C 2 68 ? 2.500   -3.597  14.510  1.00 0.00 ? 68  ILE A CB     5  
ATOM   9620  C CG1    . ILE C 2 68 ? 1.310   -4.531  14.256  1.00 0.00 ? 68  ILE A CG1    5  
ATOM   9621  C CG2    . ILE C 2 68 ? 1.992   -2.229  14.972  1.00 0.00 ? 68  ILE A CG2    5  
ATOM   9622  C CD1    . ILE C 2 68 ? 0.569   -4.791  15.569  1.00 0.00 ? 68  ILE A CD1    5  
ATOM   9623  H H      . ILE C 2 68 ? 1.911   -4.003  11.688  1.00 0.00 ? 68  ILE A H      5  
ATOM   9624  H HA     . ILE C 2 68 ? 3.951   -2.564  13.304  1.00 0.00 ? 68  ILE A HA     5  
ATOM   9625  H HB     . ILE C 2 68 ? 3.133   -4.021  15.278  1.00 0.00 ? 68  ILE A HB     5  
ATOM   9626  H HG12   . ILE C 2 68 ? 0.636   -4.068  13.549  1.00 0.00 ? 68  ILE A HG12   5  
ATOM   9627  H HG13   . ILE C 2 68 ? 1.666   -5.466  13.854  1.00 0.00 ? 68  ILE A HG13   5  
ATOM   9628  H HG21   . ILE C 2 68 ? 2.768   -1.490  14.827  1.00 0.00 ? 68  ILE A HG21   5  
ATOM   9629  H HG22   . ILE C 2 68 ? 1.731   -2.277  16.018  1.00 0.00 ? 68  ILE A HG22   5  
ATOM   9630  H HG23   . ILE C 2 68 ? 1.121   -1.955  14.395  1.00 0.00 ? 68  ILE A HG23   5  
ATOM   9631  H HD11   . ILE C 2 68 ? -0.287  -5.422  15.379  1.00 0.00 ? 68  ILE A HD11   5  
ATOM   9632  H HD12   . ILE C 2 68 ? 0.241   -3.852  15.989  1.00 0.00 ? 68  ILE A HD12   5  
ATOM   9633  H HD13   . ILE C 2 68 ? 1.233   -5.285  16.263  1.00 0.00 ? 68  ILE A HD13   5  
ATOM   9634  N N      . LEU C 2 69 ? 5.371   -4.701  13.387  1.00 0.00 ? 69  LEU A N      5  
ATOM   9635  C CA     . LEU C 2 69 ? 6.238   -5.891  13.144  1.00 0.00 ? 69  LEU A CA     5  
ATOM   9636  C C      . LEU C 2 69 ? 6.219   -6.809  14.369  1.00 0.00 ? 69  LEU A C      5  
ATOM   9637  O O      . LEU C 2 69 ? 7.143   -6.828  15.158  1.00 0.00 ? 69  LEU A O      5  
ATOM   9638  C CB     . LEU C 2 69 ? 7.640   -5.318  12.914  1.00 0.00 ? 69  LEU A CB     5  
ATOM   9639  C CG     . LEU C 2 69 ? 7.994   -5.406  11.427  1.00 0.00 ? 69  LEU A CG     5  
ATOM   9640  C CD1    . LEU C 2 69 ? 9.294   -4.640  11.160  1.00 0.00 ? 69  LEU A CD1    5  
ATOM   9641  C CD2    . LEU C 2 69 ? 8.177   -6.873  11.033  1.00 0.00 ? 69  LEU A CD2    5  
ATOM   9642  H H      . LEU C 2 69 ? 5.724   -3.934  13.882  1.00 0.00 ? 69  LEU A H      5  
ATOM   9643  H HA     . LEU C 2 69 ? 5.908   -6.425  12.267  1.00 0.00 ? 69  LEU A HA     5  
ATOM   9644  H HB2    . LEU C 2 69 ? 7.661   -4.283  13.229  1.00 0.00 ? 69  LEU A HB2    5  
ATOM   9645  H HB3    . LEU C 2 69 ? 8.358   -5.884  13.487  1.00 0.00 ? 69  LEU A HB3    5  
ATOM   9646  H HG     . LEU C 2 69 ? 7.195   -4.972  10.842  1.00 0.00 ? 69  LEU A HG     5  
ATOM   9647  H HD11   . LEU C 2 69 ? 9.757   -4.377  12.100  1.00 0.00 ? 69  LEU A HD11   5  
ATOM   9648  H HD12   . LEU C 2 69 ? 9.073   -3.741  10.604  1.00 0.00 ? 69  LEU A HD12   5  
ATOM   9649  H HD13   . LEU C 2 69 ? 9.967   -5.260  10.588  1.00 0.00 ? 69  LEU A HD13   5  
ATOM   9650  H HD21   . LEU C 2 69 ? 8.922   -7.328  11.671  1.00 0.00 ? 69  LEU A HD21   5  
ATOM   9651  H HD22   . LEU C 2 69 ? 8.500   -6.932  10.004  1.00 0.00 ? 69  LEU A HD22   5  
ATOM   9652  H HD23   . LEU C 2 69 ? 7.239   -7.397  11.146  1.00 0.00 ? 69  LEU A HD23   5  
ATOM   9653  N N      . CYS C 2 70 ? 5.167   -7.567  14.532  1.00 0.00 ? 70  CYS A N      5  
ATOM   9654  C CA     . CYS C 2 70 ? 5.075   -8.484  15.706  1.00 0.00 ? 70  CYS A CA     5  
ATOM   9655  C C      . CYS C 2 70 ? 6.128   -9.592  15.599  1.00 0.00 ? 70  CYS A C      5  
ATOM   9656  O O      . CYS C 2 70 ? 5.836   -10.706 15.213  1.00 0.00 ? 70  CYS A O      5  
ATOM   9657  C CB     . CYS C 2 70 ? 3.663   -9.072  15.639  1.00 0.00 ? 70  CYS A CB     5  
ATOM   9658  S SG     . CYS C 2 70 ? 2.941   -9.108  17.299  1.00 0.00 ? 70  CYS A SG     5  
ATOM   9659  H H      . CYS C 2 70 ? 4.434   -7.530  13.883  1.00 0.00 ? 70  CYS A H      5  
ATOM   9660  H HA     . CYS C 2 70 ? 5.203   -7.932  16.624  1.00 0.00 ? 70  CYS A HA     5  
ATOM   9661  H HB2    . CYS C 2 70 ? 3.050   -8.460  14.995  1.00 0.00 ? 70  CYS A HB2    5  
ATOM   9662  H HB3    . CYS C 2 70 ? 3.708   -10.076 15.244  1.00 0.00 ? 70  CYS A HB3    5  
ATOM   9663  H HG     . CYS C 2 70 ? 3.576   -9.517  17.891  1.00 0.00 ? 70  CYS A HG     5  
ATOM   9664  N N      . TYR C 2 71 ? 7.351   -9.290  15.941  1.00 0.00 ? 71  TYR A N      5  
ATOM   9665  C CA     . TYR C 2 71 ? 8.428   -10.321 15.863  1.00 0.00 ? 71  TYR A CA     5  
ATOM   9666  C C      . TYR C 2 71 ? 8.229   -11.398 16.938  1.00 0.00 ? 71  TYR A C      5  
ATOM   9667  O O      . TYR C 2 71 ? 8.168   -12.572 16.631  1.00 0.00 ? 71  TYR A O      5  
ATOM   9668  C CB     . TYR C 2 71 ? 9.738   -9.558  16.097  1.00 0.00 ? 71  TYR A CB     5  
ATOM   9669  C CG     . TYR C 2 71 ? 10.602  -9.642  14.862  1.00 0.00 ? 71  TYR A CG     5  
ATOM   9670  C CD1    . TYR C 2 71 ? 11.195  -10.858 14.502  1.00 0.00 ? 71  TYR A CD1    5  
ATOM   9671  C CD2    . TYR C 2 71 ? 10.812  -8.502  14.077  1.00 0.00 ? 71  TYR A CD2    5  
ATOM   9672  C CE1    . TYR C 2 71 ? 11.997  -10.934 13.358  1.00 0.00 ? 71  TYR A CE1    5  
ATOM   9673  C CE2    . TYR C 2 71 ? 11.614  -8.578  12.932  1.00 0.00 ? 71  TYR A CE2    5  
ATOM   9674  C CZ     . TYR C 2 71 ? 12.207  -9.794  12.573  1.00 0.00 ? 71  TYR A CZ     5  
ATOM   9675  O OH     . TYR C 2 71 ? 12.998  -9.869  11.444  1.00 0.00 ? 71  TYR A OH     5  
ATOM   9676  H H      . TYR C 2 71 ? 7.561   -8.384  16.248  1.00 0.00 ? 71  TYR A H      5  
ATOM   9677  H HA     . TYR C 2 71 ? 8.437   -10.771 14.892  1.00 0.00 ? 71  TYR A HA     5  
ATOM   9678  H HB2    . TYR C 2 71 ? 9.518   -8.523  16.313  1.00 0.00 ? 71  TYR A HB2    5  
ATOM   9679  H HB3    . TYR C 2 71 ? 10.264  -9.995  16.933  1.00 0.00 ? 71  TYR A HB3    5  
ATOM   9680  H HD1    . TYR C 2 71 ? 11.033  -11.737 15.108  1.00 0.00 ? 71  TYR A HD1    5  
ATOM   9681  H HD2    . TYR C 2 71 ? 10.355  -7.563  14.354  1.00 0.00 ? 71  TYR A HD2    5  
ATOM   9682  H HE1    . TYR C 2 71 ? 12.454  -11.872 13.080  1.00 0.00 ? 71  TYR A HE1    5  
ATOM   9683  H HE2    . TYR C 2 71 ? 11.776  -7.698  12.326  1.00 0.00 ? 71  TYR A HE2    5  
ATOM   9684  H HH     . TYR C 2 71 ? 12.420  -9.911  10.679  1.00 0.00 ? 71  TYR A HH     5  
ATOM   9685  N N      . PRO C 2 72 ? 8.139   -10.964 18.167  1.00 0.00 ? 72  PRO A N      5  
ATOM   9686  C CA     . PRO C 2 72 ? 7.951   -11.910 19.300  1.00 0.00 ? 72  PRO A CA     5  
ATOM   9687  C C      . PRO C 2 72 ? 6.540   -12.519 19.293  1.00 0.00 ? 72  PRO A C      5  
ATOM   9688  O O      . PRO C 2 72 ? 6.221   -13.357 20.113  1.00 0.00 ? 72  PRO A O      5  
ATOM   9689  C CB     . PRO C 2 72 ? 8.151   -11.031 20.531  1.00 0.00 ? 72  PRO A CB     5  
ATOM   9690  C CG     . PRO C 2 72 ? 7.822   -9.649  20.069  1.00 0.00 ? 72  PRO A CG     5  
ATOM   9691  C CD     . PRO C 2 72 ? 8.206   -9.570  18.624  1.00 0.00 ? 72  PRO A CD     5  
ATOM   9692  H HA     . PRO C 2 72 ? 8.699   -12.684 19.277  1.00 0.00 ? 72  PRO A HA     5  
ATOM   9693  H HB2    . PRO C 2 72 ? 7.480   -11.337 21.323  1.00 0.00 ? 72  PRO A HB2    5  
ATOM   9694  H HB3    . PRO C 2 72 ? 9.175   -11.076 20.864  1.00 0.00 ? 72  PRO A HB3    5  
ATOM   9695  H HG2    . PRO C 2 72 ? 6.764   -9.467  20.176  1.00 0.00 ? 72  PRO A HG2    5  
ATOM   9696  H HG3    . PRO C 2 72 ? 8.386   -8.925  20.632  1.00 0.00 ? 72  PRO A HG3    5  
ATOM   9697  H HD2    . PRO C 2 72 ? 7.501   -8.953  18.086  1.00 0.00 ? 72  PRO A HD2    5  
ATOM   9698  H HD3    . PRO C 2 72 ? 9.209   -9.189  18.515  1.00 0.00 ? 72  PRO A HD3    5  
ATOM   9699  N N      . ALA C 2 73 ? 5.693   -12.109 18.382  1.00 0.00 ? 73  ALA A N      5  
ATOM   9700  C CA     . ALA C 2 73 ? 4.306   -12.670 18.334  1.00 0.00 ? 73  ALA A CA     5  
ATOM   9701  C C      . ALA C 2 73 ? 4.344   -14.206 18.359  1.00 0.00 ? 73  ALA A C      5  
ATOM   9702  O O      . ALA C 2 73 ? 4.876   -14.823 17.457  1.00 0.00 ? 73  ALA A O      5  
ATOM   9703  C CB     . ALA C 2 73 ? 3.725   -12.174 17.009  1.00 0.00 ? 73  ALA A CB     5  
ATOM   9704  H H      . ALA C 2 73 ? 5.965   -11.429 17.731  1.00 0.00 ? 73  ALA A H      5  
ATOM   9705  H HA     . ALA C 2 73 ? 3.721   -12.289 19.155  1.00 0.00 ? 73  ALA A HA     5  
ATOM   9706  H HB1    . ALA C 2 73 ? 4.290   -11.321 16.667  1.00 0.00 ? 73  ALA A HB1    5  
ATOM   9707  H HB2    . ALA C 2 73 ? 2.694   -11.890 17.153  1.00 0.00 ? 73  ALA A HB2    5  
ATOM   9708  H HB3    . ALA C 2 73 ? 3.783   -12.963 16.274  1.00 0.00 ? 73  ALA A HB3    5  
ATOM   9709  N N      . PRO C 2 74 ? 3.775   -14.778 19.395  1.00 0.00 ? 74  PRO A N      5  
ATOM   9710  C CA     . PRO C 2 74 ? 3.753   -16.257 19.524  1.00 0.00 ? 74  PRO A CA     5  
ATOM   9711  C C      . PRO C 2 74 ? 2.768   -16.868 18.521  1.00 0.00 ? 74  PRO A C      5  
ATOM   9712  O O      . PRO C 2 74 ? 1.847   -16.218 18.066  1.00 0.00 ? 74  PRO A O      5  
ATOM   9713  C CB     . PRO C 2 74 ? 3.281   -16.487 20.956  1.00 0.00 ? 74  PRO A CB     5  
ATOM   9714  C CG     . PRO C 2 74 ? 2.512   -15.256 21.313  1.00 0.00 ? 74  PRO A CG     5  
ATOM   9715  C CD     . PRO C 2 74 ? 3.111   -14.119 20.527  1.00 0.00 ? 74  PRO A CD     5  
ATOM   9716  H HA     . PRO C 2 74 ? 4.740   -16.668 19.388  1.00 0.00 ? 74  PRO A HA     5  
ATOM   9717  H HB2    . PRO C 2 74 ? 2.644   -17.359 21.006  1.00 0.00 ? 74  PRO A HB2    5  
ATOM   9718  H HB3    . PRO C 2 74 ? 4.126   -16.598 21.618  1.00 0.00 ? 74  PRO A HB3    5  
ATOM   9719  H HG2    . PRO C 2 74 ? 1.471   -15.383 21.047  1.00 0.00 ? 74  PRO A HG2    5  
ATOM   9720  H HG3    . PRO C 2 74 ? 2.602   -15.055 22.369  1.00 0.00 ? 74  PRO A HG3    5  
ATOM   9721  H HD2    . PRO C 2 74 ? 2.335   -13.450 20.179  1.00 0.00 ? 74  PRO A HD2    5  
ATOM   9722  H HD3    . PRO C 2 74 ? 3.834   -13.586 21.124  1.00 0.00 ? 74  PRO A HD3    5  
ATOM   9723  N N      . LYS C 2 75 ? 2.958   -18.116 18.177  1.00 0.00 ? 75  LYS A N      5  
ATOM   9724  C CA     . LYS C 2 75 ? 2.036   -18.782 17.203  1.00 0.00 ? 75  LYS A CA     5  
ATOM   9725  C C      . LYS C 2 75 ? 1.897   -17.937 15.933  1.00 0.00 ? 75  LYS A C      5  
ATOM   9726  O O      . LYS C 2 75 ? 0.890   -18.080 15.257  1.00 0.00 ? 75  LYS A O      5  
ATOM   9727  C CB     . LYS C 2 75 ? 0.692   -18.886 17.929  1.00 0.00 ? 75  LYS A CB     5  
ATOM   9728  C CG     . LYS C 2 75 ? 0.677   -20.145 18.801  1.00 0.00 ? 75  LYS A CG     5  
ATOM   9729  C CD     . LYS C 2 75 ? -0.689  -20.827 18.693  1.00 0.00 ? 75  LYS A CD     5  
ATOM   9730  C CE     . LYS C 2 75 ? -1.016  -21.529 20.013  1.00 0.00 ? 75  LYS A CE     5  
ATOM   9731  N NZ     . LYS C 2 75 ? -2.344  -22.165 19.791  1.00 0.00 ? 75  LYS A NZ     5  
ATOM   9732  O OXT    . LYS C 2 75 ? 2.799   -17.162 15.658  1.00 0.00 ? 75  LYS A OXT    5  
ATOM   9733  H H      . LYS C 2 75 ? 3.707   -18.618 18.559  1.00 0.00 ? 75  LYS A H      5  
ATOM   9734  H HA     . LYS C 2 75 ? 2.399   -19.767 16.960  1.00 0.00 ? 75  LYS A HA     5  
ATOM   9735  H HB2    . LYS C 2 75 ? 0.551   -18.014 18.552  1.00 0.00 ? 75  LYS A HB2    5  
ATOM   9736  H HB3    . LYS C 2 75 ? -0.104  -18.943 17.204  1.00 0.00 ? 75  LYS A HB3    5  
ATOM   9737  H HG2    . LYS C 2 75 ? 1.447   -20.825 18.466  1.00 0.00 ? 75  LYS A HG2    5  
ATOM   9738  H HG3    . LYS C 2 75 ? 0.860   -19.873 19.830  1.00 0.00 ? 75  LYS A HG3    5  
ATOM   9739  H HD2    . LYS C 2 75 ? -1.445  -20.086 18.481  1.00 0.00 ? 75  LYS A HD2    5  
ATOM   9740  H HD3    . LYS C 2 75 ? -0.665  -21.556 17.898  1.00 0.00 ? 75  LYS A HD3    5  
ATOM   9741  H HE2    . LYS C 2 75 ? -0.268  -22.279 20.235  1.00 0.00 ? 75  LYS A HE2    5  
ATOM   9742  H HE3    . LYS C 2 75 ? -1.081  -20.810 20.816  1.00 0.00 ? 75  LYS A HE3    5  
ATOM   9743  H HZ1    . LYS C 2 75 ? -2.251  -22.926 19.088  1.00 0.00 ? 75  LYS A HZ1    5  
ATOM   9744  H HZ2    . LYS C 2 75 ? -2.692  -22.562 20.688  1.00 0.00 ? 75  LYS A HZ2    5  
ATOM   9745  H HZ3    . LYS C 2 75 ? -3.016  -21.454 19.442  1.00 0.00 ? 75  LYS A HZ3    5  
ATOM   9746  O "O5'"  . DG  A 1 1  ? 2.531   20.870  -11.830 1.00 0.00 ? 101 DG  B "O5'"  6  
ATOM   9747  C "C5'"  . DG  A 1 1  ? 2.710   21.692  -10.674 1.00 0.00 ? 101 DG  B "C5'"  6  
ATOM   9748  C "C4'"  . DG  A 1 1  ? 2.089   21.058  -9.434  1.00 0.00 ? 101 DG  B "C4'"  6  
ATOM   9749  O "O4'"  . DG  A 1 1  ? 0.659   20.942  -9.580  1.00 0.00 ? 101 DG  B "O4'"  6  
ATOM   9750  C "C3'"  . DG  A 1 1  ? 2.658   19.667  -9.195  1.00 0.00 ? 101 DG  B "C3'"  6  
ATOM   9751  O "O3'"  . DG  A 1 1  ? 3.460   19.640  -8.010  1.00 0.00 ? 101 DG  B "O3'"  6  
ATOM   9752  C "C2'"  . DG  A 1 1  ? 1.468   18.751  -9.064  1.00 0.00 ? 101 DG  B "C2'"  6  
ATOM   9753  C "C1'"  . DG  A 1 1  ? 0.229   19.617  -9.219  1.00 0.00 ? 101 DG  B "C1'"  6  
ATOM   9754  N N9     . DG  A 1 1  ? -0.686  19.067  -10.237 1.00 0.00 ? 101 DG  B N9     6  
ATOM   9755  C C8     . DG  A 1 1  ? -0.412  18.311  -11.324 1.00 0.00 ? 101 DG  B C8     6  
ATOM   9756  N N7     . DG  A 1 1  ? -1.401  17.955  -12.073 1.00 0.00 ? 101 DG  B N7     6  
ATOM   9757  C C5     . DG  A 1 1  ? -2.483  18.542  -11.411 1.00 0.00 ? 101 DG  B C5     6  
ATOM   9758  C C6     . DG  A 1 1  ? -3.867  18.523  -11.733 1.00 0.00 ? 101 DG  B C6     6  
ATOM   9759  O O6     . DG  A 1 1  ? -4.415  17.980  -12.672 1.00 0.00 ? 101 DG  B O6     6  
ATOM   9760  N N1     . DG  A 1 1  ? -4.616  19.239  -10.807 1.00 0.00 ? 101 DG  B N1     6  
ATOM   9761  C C2     . DG  A 1 1  ? -4.103  19.894  -9.706  1.00 0.00 ? 101 DG  B C2     6  
ATOM   9762  N N2     . DG  A 1 1  ? -4.984  20.528  -8.933  1.00 0.00 ? 101 DG  B N2     6  
ATOM   9763  N N3     . DG  A 1 1  ? -2.802  19.918  -9.397  1.00 0.00 ? 101 DG  B N3     6  
ATOM   9764  C C4     . DG  A 1 1  ? -2.052  19.227  -10.285 1.00 0.00 ? 101 DG  B C4     6  
ATOM   9765  H "H5'"  . DG  A 1 1  ? 2.242   22.660  -10.850 1.00 0.00 ? 101 DG  B "H5'"  6  
ATOM   9766  H "H5''" . DG  A 1 1  ? 3.776   21.838  -10.502 1.00 0.00 ? 101 DG  B "H5''" 6  
ATOM   9767  H "H4'"  . DG  A 1 1  ? 2.303   21.679  -8.568  1.00 0.00 ? 101 DG  B "H4'"  6  
ATOM   9768  H "H3'"  . DG  A 1 1  ? 3.257   19.364  -10.058 1.00 0.00 ? 101 DG  B "H3'"  6  
ATOM   9769  H "H2'"  . DG  A 1 1  ? 1.495   17.991  -9.844  1.00 0.00 ? 101 DG  B "H2'"  6  
ATOM   9770  H "H2''" . DG  A 1 1  ? 1.469   18.278  -8.082  1.00 0.00 ? 101 DG  B "H2''" 6  
ATOM   9771  H "H1'"  . DG  A 1 1  ? -0.287  19.663  -8.268  1.00 0.00 ? 101 DG  B "H1'"  6  
ATOM   9772  H H8     . DG  A 1 1  ? 0.608   18.014  -11.557 1.00 0.00 ? 101 DG  B H8     6  
ATOM   9773  H H1     . DG  A 1 1  ? -5.582  19.268  -10.967 1.00 0.00 ? 101 DG  B H1     6  
ATOM   9774  H H21    . DG  A 1 1  ? -5.967  20.511  -9.169  1.00 0.00 ? 101 DG  B H21    6  
ATOM   9775  H H22    . DG  A 1 1  ? -4.670  21.027  -8.113  1.00 0.00 ? 101 DG  B H22    6  
ATOM   9776  H "HO5'" . DG  A 1 1  ? 3.046   21.261  -12.541 1.00 0.00 ? 101 DG  B "HO5'" 6  
ATOM   9777  P P      . DT  A 1 2  ? 3.842   18.241  -7.309  1.00 0.00 ? 102 DT  B P      6  
ATOM   9778  O OP1    . DT  A 1 2  ? 5.038   18.457  -6.465  1.00 0.00 ? 102 DT  B OP1    6  
ATOM   9779  O OP2    . DT  A 1 2  ? 3.852   17.189  -8.350  1.00 0.00 ? 102 DT  B OP2    6  
ATOM   9780  O "O5'"  . DT  A 1 2  ? 2.583   17.979  -6.340  1.00 0.00 ? 102 DT  B "O5'"  6  
ATOM   9781  C "C5'"  . DT  A 1 2  ? 1.857   19.075  -5.776  1.00 0.00 ? 102 DT  B "C5'"  6  
ATOM   9782  C "C4'"  . DT  A 1 2  ? 0.705   18.593  -4.899  1.00 0.00 ? 102 DT  B "C4'"  6  
ATOM   9783  O "O4'"  . DT  A 1 2  ? -0.493  18.413  -5.686  1.00 0.00 ? 102 DT  B "O4'"  6  
ATOM   9784  C "C3'"  . DT  A 1 2  ? 1.051   17.265  -4.243  1.00 0.00 ? 102 DT  B "C3'"  6  
ATOM   9785  O "O3'"  . DT  A 1 2  ? 0.967   17.370  -2.816  1.00 0.00 ? 102 DT  B "O3'"  6  
ATOM   9786  C "C2'"  . DT  A 1 2  ? 0.054   16.267  -4.775  1.00 0.00 ? 102 DT  B "C2'"  6  
ATOM   9787  C "C1'"  . DT  A 1 2  ? -0.921  17.035  -5.650  1.00 0.00 ? 102 DT  B "C1'"  6  
ATOM   9788  N N1     . DT  A 1 2  ? -0.973  16.471  -7.012  1.00 0.00 ? 102 DT  B N1     6  
ATOM   9789  C C2     . DT  A 1 2  ? -2.221  16.245  -7.559  1.00 0.00 ? 102 DT  B C2     6  
ATOM   9790  O O2     . DT  A 1 2  ? -3.245  16.478  -6.949  1.00 0.00 ? 102 DT  B O2     6  
ATOM   9791  N N3     . DT  A 1 2  ? -2.238  15.739  -8.844  1.00 0.00 ? 102 DT  B N3     6  
ATOM   9792  C C4     . DT  A 1 2  ? -1.130  15.440  -9.619  1.00 0.00 ? 102 DT  B C4     6  
ATOM   9793  O O4     . DT  A 1 2  ? -1.261  14.999  -10.743 1.00 0.00 ? 102 DT  B O4     6  
ATOM   9794  C C5     . DT  A 1 2  ? 0.132   15.706  -8.963  1.00 0.00 ? 102 DT  B C5     6  
ATOM   9795  C C7     . DT  A 1 2  ? 1.435   15.421  -9.702  1.00 0.00 ? 102 DT  B C7     6  
ATOM   9796  C C6     . DT  A 1 2  ? 0.174   16.202  -7.710  1.00 0.00 ? 102 DT  B C6     6  
ATOM   9797  H "H5'"  . DT  A 1 2  ? 1.457   19.690  -6.582  1.00 0.00 ? 102 DT  B "H5'"  6  
ATOM   9798  H "H5''" . DT  A 1 2  ? 2.536   19.678  -5.172  1.00 0.00 ? 102 DT  B "H5''" 6  
ATOM   9799  H "H4'"  . DT  A 1 2  ? 0.513   19.334  -4.125  1.00 0.00 ? 102 DT  B "H4'"  6  
ATOM   9800  H "H3'"  . DT  A 1 2  ? 2.059   16.964  -4.536  1.00 0.00 ? 102 DT  B "H3'"  6  
ATOM   9801  H "H2'"  . DT  A 1 2  ? 0.566   15.508  -5.367  1.00 0.00 ? 102 DT  B "H2'"  6  
ATOM   9802  H "H2''" . DT  A 1 2  ? -0.480  15.795  -3.952  1.00 0.00 ? 102 DT  B "H2''" 6  
ATOM   9803  H "H1'"  . DT  A 1 2  ? -1.915  16.982  -5.206  1.00 0.00 ? 102 DT  B "H1'"  6  
ATOM   9804  H H3     . DT  A 1 2  ? -3.116  15.574  -9.246  1.00 0.00 ? 102 DT  B H3     6  
ATOM   9805  H H71    . DT  A 1 2  ? 1.260   15.461  -10.777 1.00 0.00 ? 102 DT  B H71    6  
ATOM   9806  H H72    . DT  A 1 2  ? 2.180   16.166  -9.425  1.00 0.00 ? 102 DT  B H72    6  
ATOM   9807  H H73    . DT  A 1 2  ? 1.796   14.428  -9.430  1.00 0.00 ? 102 DT  B H73    6  
ATOM   9808  H H6     . DT  A 1 2  ? 1.139   16.393  -7.242  1.00 0.00 ? 102 DT  B H6     6  
ATOM   9809  P P      . DA  A 1 3  ? 0.844   16.053  -1.899  1.00 0.00 ? 103 DA  B P      6  
ATOM   9810  O OP1    . DA  A 1 3  ? 0.824   16.476  -0.481  1.00 0.00 ? 103 DA  B OP1    6  
ATOM   9811  O OP2    . DA  A 1 3  ? 1.847   15.069  -2.362  1.00 0.00 ? 103 DA  B OP2    6  
ATOM   9812  O "O5'"  . DA  A 1 3  ? -0.620  15.498  -2.279  1.00 0.00 ? 103 DA  B "O5'"  6  
ATOM   9813  C "C5'"  . DA  A 1 3  ? -1.793  16.076  -1.700  1.00 0.00 ? 103 DA  B "C5'"  6  
ATOM   9814  C "C4'"  . DA  A 1 3  ? -2.980  15.121  -1.776  1.00 0.00 ? 103 DA  B "C4'"  6  
ATOM   9815  O "O4'"  . DA  A 1 3  ? -3.459  15.013  -3.131  1.00 0.00 ? 103 DA  B "O4'"  6  
ATOM   9816  C "C3'"  . DA  A 1 3  ? -2.581  13.733  -1.296  1.00 0.00 ? 103 DA  B "C3'"  6  
ATOM   9817  O "O3'"  . DA  A 1 3  ? -3.329  13.368  -0.128  1.00 0.00 ? 103 DA  B "O3'"  6  
ATOM   9818  C "C2'"  . DA  A 1 3  ? -2.873  12.803  -2.443  1.00 0.00 ? 103 DA  B "C2'"  6  
ATOM   9819  C "C1'"  . DA  A 1 3  ? -3.559  13.629  -3.512  1.00 0.00 ? 103 DA  B "C1'"  6  
ATOM   9820  N N9     . DA  A 1 3  ? -2.932  13.399  -4.819  1.00 0.00 ? 103 DA  B N9     6  
ATOM   9821  C C8     . DA  A 1 3  ? -1.625  13.379  -5.134  1.00 0.00 ? 103 DA  B C8     6  
ATOM   9822  N N7     . DA  A 1 3  ? -1.308  13.172  -6.368  1.00 0.00 ? 103 DA  B N7     6  
ATOM   9823  C C5     . DA  A 1 3  ? -2.569  13.030  -6.958  1.00 0.00 ? 103 DA  B C5     6  
ATOM   9824  C C6     . DA  A 1 3  ? -2.979  12.785  -8.272  1.00 0.00 ? 103 DA  B C6     6  
ATOM   9825  N N6     . DA  A 1 3  ? -2.127  12.633  -9.285  1.00 0.00 ? 103 DA  B N6     6  
ATOM   9826  N N1     . DA  A 1 3  ? -4.302  12.703  -8.502  1.00 0.00 ? 103 DA  B N1     6  
ATOM   9827  C C2     . DA  A 1 3  ? -5.173  12.853  -7.502  1.00 0.00 ? 103 DA  B C2     6  
ATOM   9828  N N3     . DA  A 1 3  ? -4.895  13.089  -6.223  1.00 0.00 ? 103 DA  B N3     6  
ATOM   9829  C C4     . DA  A 1 3  ? -3.565  13.167  -6.018  1.00 0.00 ? 103 DA  B C4     6  
ATOM   9830  H "H5'"  . DA  A 1 3  ? -2.040  16.993  -2.236  1.00 0.00 ? 103 DA  B "H5'"  6  
ATOM   9831  H "H5''" . DA  A 1 3  ? -1.595  16.317  -0.656  1.00 0.00 ? 103 DA  B "H5''" 6  
ATOM   9832  H "H4'"  . DA  A 1 3  ? -3.785  15.493  -1.149  1.00 0.00 ? 103 DA  B "H4'"  6  
ATOM   9833  H "H3'"  . DA  A 1 3  ? -1.511  13.716  -1.074  1.00 0.00 ? 103 DA  B "H3'"  6  
ATOM   9834  H "H2'"  . DA  A 1 3  ? -1.942  12.390  -2.832  1.00 0.00 ? 103 DA  B "H2'"  6  
ATOM   9835  H "H2''" . DA  A 1 3  ? -3.526  11.999  -2.120  1.00 0.00 ? 103 DA  B "H2''" 6  
ATOM   9836  H "H1'"  . DA  A 1 3  ? -4.602  13.352  -3.562  1.00 0.00 ? 103 DA  B "H1'"  6  
ATOM   9837  H H8     . DA  A 1 3  ? -0.870  13.521  -4.367  1.00 0.00 ? 103 DA  B H8     6  
ATOM   9838  H H61    . DA  A 1 3  ? -2.476  12.457  -10.217 1.00 0.00 ? 103 DA  B H61    6  
ATOM   9839  H H62    . DA  A 1 3  ? -1.132  12.694  -9.122  1.00 0.00 ? 103 DA  B H62    6  
ATOM   9840  H H2     . DA  A 1 3  ? -6.229  12.772  -7.763  1.00 0.00 ? 103 DA  B H2     6  
ATOM   9841  P P      . DT  A 1 4  ? -3.457  11.826  0.319   1.00 0.00 ? 104 DT  B P      6  
ATOM   9842  O OP1    . DT  A 1 4  ? -3.554  11.779  1.794   1.00 0.00 ? 104 DT  B OP1    6  
ATOM   9843  O OP2    . DT  A 1 4  ? -2.404  11.052  -0.377  1.00 0.00 ? 104 DT  B OP2    6  
ATOM   9844  O "O5'"  . DT  A 1 4  ? -4.883  11.400  -0.296  1.00 0.00 ? 104 DT  B "O5'"  6  
ATOM   9845  C "C5'"  . DT  A 1 4  ? -5.866  12.393  -0.609  1.00 0.00 ? 104 DT  B "C5'"  6  
ATOM   9846  C "C4'"  . DT  A 1 4  ? -7.094  11.777  -1.273  1.00 0.00 ? 104 DT  B "C4'"  6  
ATOM   9847  O "O4'"  . DT  A 1 4  ? -6.930  11.734  -2.708  1.00 0.00 ? 104 DT  B "O4'"  6  
ATOM   9848  C "C3'"  . DT  A 1 4  ? -7.316  10.356  -0.775  1.00 0.00 ? 104 DT  B "C3'"  6  
ATOM   9849  O "O3'"  . DT  A 1 4  ? -8.622  10.218  -0.206  1.00 0.00 ? 104 DT  B "O3'"  6  
ATOM   9850  C "C2'"  . DT  A 1 4  ? -7.153  9.464   -1.980  1.00 0.00 ? 104 DT  B "C2'"  6  
ATOM   9851  C "C1'"  . DT  A 1 4  ? -6.942  10.370  -3.180  1.00 0.00 ? 104 DT  B "C1'"  6  
ATOM   9852  N N1     . DT  A 1 4  ? -5.679  10.046  -3.864  1.00 0.00 ? 104 DT  B N1     6  
ATOM   9853  C C2     . DT  A 1 4  ? -5.724  9.834   -5.228  1.00 0.00 ? 104 DT  B C2     6  
ATOM   9854  O O2     . DT  A 1 4  ? -6.761  9.893   -5.858  1.00 0.00 ? 104 DT  B O2     6  
ATOM   9855  N N3     . DT  A 1 4  ? -4.516  9.548   -5.837  1.00 0.00 ? 104 DT  B N3     6  
ATOM   9856  C C4     . DT  A 1 4  ? -3.286  9.460   -5.206  1.00 0.00 ? 104 DT  B C4     6  
ATOM   9857  O O4     . DT  A 1 4  ? -2.282  9.203   -5.840  1.00 0.00 ? 104 DT  B O4     6  
ATOM   9858  C C5     . DT  A 1 4  ? -3.339  9.697   -3.781  1.00 0.00 ? 104 DT  B C5     6  
ATOM   9859  C C7     . DT  A 1 4  ? -2.055  9.633   -2.962  1.00 0.00 ? 104 DT  B C7     6  
ATOM   9860  C C6     . DT  A 1 4  ? -4.506  9.975   -3.166  1.00 0.00 ? 104 DT  B C6     6  
ATOM   9861  H "H5'"  . DT  A 1 4  ? -5.426  13.126  -1.286  1.00 0.00 ? 104 DT  B "H5'"  6  
ATOM   9862  H "H5''" . DT  A 1 4  ? -6.172  12.894  0.309   1.00 0.00 ? 104 DT  B "H5''" 6  
ATOM   9863  H "H4'"  . DT  A 1 4  ? -7.970  12.379  -1.033  1.00 0.00 ? 104 DT  B "H4'"  6  
ATOM   9864  H "H3'"  . DT  A 1 4  ? -6.555  10.107  -0.032  1.00 0.00 ? 104 DT  B "H3'"  6  
ATOM   9865  H "H2'"  . DT  A 1 4  ? -6.286  8.816   -1.848  1.00 0.00 ? 104 DT  B "H2'"  6  
ATOM   9866  H "H2''" . DT  A 1 4  ? -8.047  8.862   -2.122  1.00 0.00 ? 104 DT  B "H2''" 6  
ATOM   9867  H "H1'"  . DT  A 1 4  ? -7.769  10.239  -3.878  1.00 0.00 ? 104 DT  B "H1'"  6  
ATOM   9868  H H3     . DT  A 1 4  ? -4.532  9.393   -6.805  1.00 0.00 ? 104 DT  B H3     6  
ATOM   9869  H H71    . DT  A 1 4  ? -2.299  9.673   -1.900  1.00 0.00 ? 104 DT  B H71    6  
ATOM   9870  H H72    . DT  A 1 4  ? -1.532  8.702   -3.179  1.00 0.00 ? 104 DT  B H72    6  
ATOM   9871  H H73    . DT  A 1 4  ? -1.416  10.477  -3.220  1.00 0.00 ? 104 DT  B H73    6  
ATOM   9872  H H6     . DT  A 1 4  ? -4.518  10.140  -2.089  1.00 0.00 ? 104 DT  B H6     6  
ATOM   9873  P P      . DC  A 1 5  ? -9.251  8.759   0.065   1.00 0.00 ? 105 DC  B P      6  
ATOM   9874  O OP1    . DC  A 1 5  ? -10.584 8.937   0.680   1.00 0.00 ? 105 DC  B OP1    6  
ATOM   9875  O OP2    . DC  A 1 5  ? -8.228  7.933   0.744   1.00 0.00 ? 105 DC  B OP2    6  
ATOM   9876  O "O5'"  . DC  A 1 5  ? -9.456  8.184   -1.426  1.00 0.00 ? 105 DC  B "O5'"  6  
ATOM   9877  C "C5'"  . DC  A 1 5  ? -10.648 8.475   -2.161  1.00 0.00 ? 105 DC  B "C5'"  6  
ATOM   9878  C "C4'"  . DC  A 1 5  ? -10.854 7.483   -3.302  1.00 0.00 ? 105 DC  B "C4'"  6  
ATOM   9879  O "O4'"  . DC  A 1 5  ? -9.825  7.635   -4.301  1.00 0.00 ? 105 DC  B "O4'"  6  
ATOM   9880  C "C3'"  . DC  A 1 5  ? -10.818 6.054   -2.790  1.00 0.00 ? 105 DC  B "C3'"  6  
ATOM   9881  O "O3'"  . DC  A 1 5  ? -12.097 5.428   -2.988  1.00 0.00 ? 105 DC  B "O3'"  6  
ATOM   9882  C "C2'"  . DC  A 1 5  ? -9.720  5.367   -3.569  1.00 0.00 ? 105 DC  B "C2'"  6  
ATOM   9883  C "C1'"  . DC  A 1 5  ? -9.235  6.358   -4.606  1.00 0.00 ? 105 DC  B "C1'"  6  
ATOM   9884  N N1     . DC  A 1 5  ? -7.764  6.441   -4.605  1.00 0.00 ? 105 DC  B N1     6  
ATOM   9885  C C2     . DC  A 1 5  ? -7.111  6.260   -5.815  1.00 0.00 ? 105 DC  B C2     6  
ATOM   9886  O O2     . DC  A 1 5  ? -7.749  6.043   -6.826  1.00 0.00 ? 105 DC  B O2     6  
ATOM   9887  N N3     . DC  A 1 5  ? -5.751  6.333   -5.831  1.00 0.00 ? 105 DC  B N3     6  
ATOM   9888  C C4     . DC  A 1 5  ? -5.063  6.575   -4.706  1.00 0.00 ? 105 DC  B C4     6  
ATOM   9889  N N4     . DC  A 1 5  ? -3.733  6.646   -4.756  1.00 0.00 ? 105 DC  B N4     6  
ATOM   9890  C C5     . DC  A 1 5  ? -5.736  6.762   -3.458  1.00 0.00 ? 105 DC  B C5     6  
ATOM   9891  C C6     . DC  A 1 5  ? -7.080  6.686   -3.454  1.00 0.00 ? 105 DC  B C6     6  
ATOM   9892  H "H5'"  . DC  A 1 5  ? -10.577 9.481   -2.572  1.00 0.00 ? 105 DC  B "H5'"  6  
ATOM   9893  H "H5''" . DC  A 1 5  ? -11.503 8.425   -1.486  1.00 0.00 ? 105 DC  B "H5''" 6  
ATOM   9894  H "H4'"  . DC  A 1 5  ? -11.822 7.662   -3.766  1.00 0.00 ? 105 DC  B "H4'"  6  
ATOM   9895  H "H3'"  . DC  A 1 5  ? -10.564 6.053   -1.728  1.00 0.00 ? 105 DC  B "H3'"  6  
ATOM   9896  H "H2'"  . DC  A 1 5  ? -8.903  5.098   -2.901  1.00 0.00 ? 105 DC  B "H2'"  6  
ATOM   9897  H "H2''" . DC  A 1 5  ? -10.100 4.477   -4.061  1.00 0.00 ? 105 DC  B "H2''" 6  
ATOM   9898  H "H1'"  . DC  A 1 5  ? -9.578  6.039   -5.587  1.00 0.00 ? 105 DC  B "H1'"  6  
ATOM   9899  H H41    . DC  A 1 5  ? -3.253  6.515   -5.635  1.00 0.00 ? 105 DC  B H41    6  
ATOM   9900  H H42    . DC  A 1 5  ? -3.205  6.830   -3.915  1.00 0.00 ? 105 DC  B H42    6  
ATOM   9901  H H5     . DC  A 1 5  ? -5.179  6.956   -2.541  1.00 0.00 ? 105 DC  B H5     6  
ATOM   9902  H H6     . DC  A 1 5  ? -7.628  6.817   -2.522  1.00 0.00 ? 105 DC  B H6     6  
HETATM 9903  N N1     . 5CM A 1 6  ? -9.473  2.301   -6.756  1.00 0.00 ? 106 5CM B N1     6  
HETATM 9904  C C2     . 5CM A 1 6  ? -8.229  2.138   -7.348  1.00 0.00 ? 106 5CM B C2     6  
HETATM 9905  N N3     . 5CM A 1 6  ? -7.135  2.064   -6.545  1.00 0.00 ? 106 5CM B N3     6  
HETATM 9906  C C4     . 5CM A 1 6  ? -7.251  2.146   -5.214  1.00 0.00 ? 106 5CM B C4     6  
HETATM 9907  C C5     . 5CM A 1 6  ? -8.531  2.312   -4.596  1.00 0.00 ? 106 5CM B C5     6  
HETATM 9908  C C5A    . 5CM A 1 6  ? -8.663  2.424   -3.081  1.00 0.00 ? 106 5CM B C5A    6  
HETATM 9909  C C6     . 5CM A 1 6  ? -9.610  2.384   -5.399  1.00 0.00 ? 106 5CM B C6     6  
HETATM 9910  O O2     . 5CM A 1 6  ? -8.135  2.067   -8.558  1.00 0.00 ? 106 5CM B O2     6  
HETATM 9911  N N4     . 5CM A 1 6  ? -6.157  2.070   -4.458  1.00 0.00 ? 106 5CM B N4     6  
HETATM 9912  C "C1'"  . 5CM A 1 6  ? -10.639 2.410   -7.659  1.00 0.00 ? 106 5CM B "C1'"  6  
HETATM 9913  C "C2'"  . 5CM A 1 6  ? -11.847 1.653   -7.126  1.00 0.00 ? 106 5CM B "C2'"  6  
HETATM 9914  C "C3'"  . 5CM A 1 6  ? -13.026 2.583   -7.274  1.00 0.00 ? 106 5CM B "C3'"  6  
HETATM 9915  C "C4'"  . 5CM A 1 6  ? -12.419 3.960   -7.474  1.00 0.00 ? 106 5CM B "C4'"  6  
HETATM 9916  O "O4'"  . 5CM A 1 6  ? -11.029 3.790   -7.824  1.00 0.00 ? 106 5CM B "O4'"  6  
HETATM 9917  O "O3'"  . 5CM A 1 6  ? -13.845 2.242   -8.405  1.00 0.00 ? 106 5CM B "O3'"  6  
HETATM 9918  C "C5'"  . 5CM A 1 6  ? -12.548 4.784   -6.200  1.00 0.00 ? 106 5CM B "C5'"  6  
HETATM 9919  O "O5'"  . 5CM A 1 6  ? -11.672 4.296   -5.181  1.00 0.00 ? 106 5CM B "O5'"  6  
HETATM 9920  P P      . 5CM A 1 6  ? -12.228 3.993   -3.704  1.00 0.00 ? 106 5CM B P      6  
HETATM 9921  O OP1    . 5CM A 1 6  ? -13.663 3.650   -3.812  1.00 0.00 ? 106 5CM B OP1    6  
HETATM 9922  O OP2    . 5CM A 1 6  ? -11.291 3.064   -3.036  1.00 0.00 ? 106 5CM B OP2    6  
HETATM 9923  H H5A1   . 5CM A 1 6  ? -7.805  2.964   -2.680  1.00 0.00 ? 106 5CM B H5A1   6  
HETATM 9924  H H5A2   . 5CM A 1 6  ? -9.580  2.963   -2.836  1.00 0.00 ? 106 5CM B H5A2   6  
HETATM 9925  H H5A3   . 5CM A 1 6  ? -8.700  1.426   -2.644  1.00 0.00 ? 106 5CM B H5A3   6  
HETATM 9926  H H6     . 5CM A 1 6  ? -10.602 2.500   -4.963  1.00 0.00 ? 106 5CM B H6     6  
HETATM 9927  H HN41   . 5CM A 1 6  ? -6.233  2.129   -3.452  1.00 0.00 ? 106 5CM B HN41   6  
HETATM 9928  H HN42   . 5CM A 1 6  ? -5.253  1.952   -4.890  1.00 0.00 ? 106 5CM B HN42   6  
HETATM 9929  H "H1'"  . 5CM A 1 6  ? -10.369 2.001   -8.632  1.00 0.00 ? 106 5CM B "H1'"  6  
HETATM 9930  H "H2'"  . 5CM A 1 6  ? -11.703 1.407   -6.072  1.00 0.00 ? 106 5CM B "H2'"  6  
HETATM 9931  H "H2''" . 5CM A 1 6  ? -12.004 0.743   -7.701  1.00 0.00 ? 106 5CM B "H2''" 6  
HETATM 9932  H "H3'"  . 5CM A 1 6  ? -13.624 2.570   -6.359  1.00 0.00 ? 106 5CM B "H3'"  6  
HETATM 9933  H "H4'"  . 5CM A 1 6  ? -12.937 4.467   -8.288  1.00 0.00 ? 106 5CM B "H4'"  6  
HETATM 9934  H "H5'"  . 5CM A 1 6  ? -12.298 5.822   -6.419  1.00 0.00 ? 106 5CM B "H5'"  6  
HETATM 9935  H "H5''" . 5CM A 1 6  ? -13.577 4.732   -5.843  1.00 0.00 ? 106 5CM B "H5''" 6  
ATOM   9936  P P      . DG  A 1 7  ? -14.012 0.721   -8.907  1.00 0.00 ? 107 DG  B P      6  
ATOM   9937  O OP1    . DG  A 1 7  ? -14.847 0.724   -10.128 1.00 0.00 ? 107 DG  B OP1    6  
ATOM   9938  O OP2    . DG  A 1 7  ? -14.406 -0.103  -7.748  1.00 0.00 ? 107 DG  B OP2    6  
ATOM   9939  O "O5'"  . DG  A 1 7  ? -12.511 0.316   -9.323  1.00 0.00 ? 107 DG  B "O5'"  6  
ATOM   9940  C "C5'"  . DG  A 1 7  ? -12.093 0.382   -10.688 1.00 0.00 ? 107 DG  B "C5'"  6  
ATOM   9941  C "C4'"  . DG  A 1 7  ? -11.417 -0.910  -11.130 1.00 0.00 ? 107 DG  B "C4'"  6  
ATOM   9942  O "O4'"  . DG  A 1 7  ? -10.013 -0.896  -10.788 1.00 0.00 ? 107 DG  B "O4'"  6  
ATOM   9943  C "C3'"  . DG  A 1 7  ? -12.062 -2.116  -10.460 1.00 0.00 ? 107 DG  B "C3'"  6  
ATOM   9944  O "O3'"  . DG  A 1 7  ? -12.722 -2.945  -11.428 1.00 0.00 ? 107 DG  B "O3'"  6  
ATOM   9945  C "C2'"  . DG  A 1 7  ? -10.939 -2.857  -9.775  1.00 0.00 ? 107 DG  B "C2'"  6  
ATOM   9946  C "C1'"  . DG  A 1 7  ? -9.664  -2.085  -10.050 1.00 0.00 ? 107 DG  B "C1'"  6  
ATOM   9947  N N9     . DG  A 1 7  ? -8.988  -1.752  -8.790  1.00 0.00 ? 107 DG  B N9     6  
ATOM   9948  C C8     . DG  A 1 7  ? -9.522  -1.387  -7.607  1.00 0.00 ? 107 DG  B C8     6  
ATOM   9949  N N7     . DG  A 1 7  ? -8.715  -1.190  -6.619  1.00 0.00 ? 107 DG  B N7     6  
ATOM   9950  C C5     . DG  A 1 7  ? -7.476  -1.456  -7.209  1.00 0.00 ? 107 DG  B C5     6  
ATOM   9951  C C6     . DG  A 1 7  ? -6.172  -1.419  -6.647  1.00 0.00 ? 107 DG  B C6     6  
ATOM   9952  O O6     . DG  A 1 7  ? -5.849  -1.143  -5.510  1.00 0.00 ? 107 DG  B O6     6  
ATOM   9953  N N1     . DG  A 1 7  ? -5.205  -1.755  -7.587  1.00 0.00 ? 107 DG  B N1     6  
ATOM   9954  C C2     . DG  A 1 7  ? -5.455  -2.085  -8.904  1.00 0.00 ? 107 DG  B C2     6  
ATOM   9955  N N2     . DG  A 1 7  ? -4.392  -2.377  -9.652  1.00 0.00 ? 107 DG  B N2     6  
ATOM   9956  N N3     . DG  A 1 7  ? -6.678  -2.121  -9.439  1.00 0.00 ? 107 DG  B N3     6  
ATOM   9957  C C4     . DG  A 1 7  ? -7.636  -1.799  -8.542  1.00 0.00 ? 107 DG  B C4     6  
ATOM   9958  H "H5'"  . DG  A 1 7  ? -11.393 1.209   -10.805 1.00 0.00 ? 107 DG  B "H5'"  6  
ATOM   9959  H "H5''" . DG  A 1 7  ? -12.964 0.563   -11.318 1.00 0.00 ? 107 DG  B "H5''" 6  
ATOM   9960  H "H4'"  . DG  A 1 7  ? -11.516 -1.011  -12.209 1.00 0.00 ? 107 DG  B "H4'"  6  
ATOM   9961  H "H3'"  . DG  A 1 7  ? -12.779 -1.775  -9.712  1.00 0.00 ? 107 DG  B "H3'"  6  
ATOM   9962  H "H2'"  . DG  A 1 7  ? -11.123 -2.899  -8.702  1.00 0.00 ? 107 DG  B "H2'"  6  
ATOM   9963  H "H2''" . DG  A 1 7  ? -10.852 -3.864  -10.175 1.00 0.00 ? 107 DG  B "H2''" 6  
ATOM   9964  H "H1'"  . DG  A 1 7  ? -9.001  -2.697  -10.652 1.00 0.00 ? 107 DG  B "H1'"  6  
ATOM   9965  H H8     . DG  A 1 7  ? -10.598 -1.272  -7.494  1.00 0.00 ? 107 DG  B H8     6  
ATOM   9966  H H1     . DG  A 1 7  ? -4.278  -1.753  -7.268  1.00 0.00 ? 107 DG  B H1     6  
ATOM   9967  H H21    . DG  A 1 7  ? -3.467  -2.350  -9.248  1.00 0.00 ? 107 DG  B H21    6  
ATOM   9968  H H22    . DG  A 1 7  ? -4.511  -2.626  -10.624 1.00 0.00 ? 107 DG  B H22    6  
ATOM   9969  P P      . DG  A 1 8  ? -12.871 -4.534  -11.198 1.00 0.00 ? 108 DG  B P      6  
ATOM   9970  O OP1    . DG  A 1 8  ? -13.833 -5.059  -12.192 1.00 0.00 ? 108 DG  B OP1    6  
ATOM   9971  O OP2    . DG  A 1 8  ? -13.091 -4.776  -9.755  1.00 0.00 ? 108 DG  B OP2    6  
ATOM   9972  O "O5'"  . DG  A 1 8  ? -11.401 -5.075  -11.582 1.00 0.00 ? 108 DG  B "O5'"  6  
ATOM   9973  C "C5'"  . DG  A 1 8  ? -10.740 -4.584  -12.751 1.00 0.00 ? 108 DG  B "C5'"  6  
ATOM   9974  C "C4'"  . DG  A 1 8  ? -9.228  -4.793  -12.685 1.00 0.00 ? 108 DG  B "C4'"  6  
ATOM   9975  O "O4'"  . DG  A 1 8  ? -8.702  -4.393  -11.402 1.00 0.00 ? 108 DG  B "O4'"  6  
ATOM   9976  C "C3'"  . DG  A 1 8  ? -8.870  -6.254  -12.910 1.00 0.00 ? 108 DG  B "C3'"  6  
ATOM   9977  O "O3'"  . DG  A 1 8  ? -8.193  -6.419  -14.163 1.00 0.00 ? 108 DG  B "O3'"  6  
ATOM   9978  C "C2'"  . DG  A 1 8  ? -7.982  -6.642  -11.755 1.00 0.00 ? 108 DG  B "C2'"  6  
ATOM   9979  C "C1'"  . DG  A 1 8  ? -7.787  -5.395  -10.915 1.00 0.00 ? 108 DG  B "C1'"  6  
ATOM   9980  N N9     . DG  A 1 8  ? -8.013  -5.669  -9.487  1.00 0.00 ? 108 DG  B N9     6  
ATOM   9981  C C8     . DG  A 1 8  ? -9.175  -5.829  -8.821  1.00 0.00 ? 108 DG  B C8     6  
ATOM   9982  N N7     . DG  A 1 8  ? -9.114  -6.036  -7.546  1.00 0.00 ? 108 DG  B N7     6  
ATOM   9983  C C5     . DG  A 1 8  ? -7.733  -6.016  -7.323  1.00 0.00 ? 108 DG  B C5     6  
ATOM   9984  C C6     . DG  A 1 8  ? -7.000  -6.185  -6.115  1.00 0.00 ? 108 DG  B C6     6  
ATOM   9985  O O6     . DG  A 1 8  ? -7.426  -6.385  -4.994  1.00 0.00 ? 108 DG  B O6     6  
ATOM   9986  N N1     . DG  A 1 8  ? -5.631  -6.093  -6.333  1.00 0.00 ? 108 DG  B N1     6  
ATOM   9987  C C2     . DG  A 1 8  ? -5.034  -5.868  -7.558  1.00 0.00 ? 108 DG  B C2     6  
ATOM   9988  N N2     . DG  A 1 8  ? -3.702  -5.814  -7.563  1.00 0.00 ? 108 DG  B N2     6  
ATOM   9989  N N3     . DG  A 1 8  ? -5.716  -5.708  -8.696  1.00 0.00 ? 108 DG  B N3     6  
ATOM   9990  C C4     . DG  A 1 8  ? -7.052  -5.793  -8.510  1.00 0.00 ? 108 DG  B C4     6  
ATOM   9991  H "H5'"  . DG  A 1 8  ? -10.947 -3.519  -12.853 1.00 0.00 ? 108 DG  B "H5'"  6  
ATOM   9992  H "H5''" . DG  A 1 8  ? -11.131 -5.106  -13.624 1.00 0.00 ? 108 DG  B "H5''" 6  
ATOM   9993  H "H4'"  . DG  A 1 8  ? -8.755  -4.192  -13.460 1.00 0.00 ? 108 DG  B "H4'"  6  
ATOM   9994  H "H3'"  . DG  A 1 8  ? -9.778  -6.859  -12.891 1.00 0.00 ? 108 DG  B "H3'"  6  
ATOM   9995  H "H2'"  . DG  A 1 8  ? -8.459  -7.422  -11.162 1.00 0.00 ? 108 DG  B "H2'"  6  
ATOM   9996  H "H2''" . DG  A 1 8  ? -7.019  -6.993  -12.125 1.00 0.00 ? 108 DG  B "H2''" 6  
ATOM   9997  H "H1'"  . DG  A 1 8  ? -6.773  -5.040  -11.047 1.00 0.00 ? 108 DG  B "H1'"  6  
ATOM   9998  H H8     . DG  A 1 8  ? -10.126 -5.781  -9.344  1.00 0.00 ? 108 DG  B H8     6  
ATOM   9999  H H1     . DG  A 1 8  ? -5.062  -6.200  -5.543  1.00 0.00 ? 108 DG  B H1     6  
ATOM   10000 H H21    . DG  A 1 8  ? -3.189  -5.933  -6.701  1.00 0.00 ? 108 DG  B H21    6  
ATOM   10001 H H22    . DG  A 1 8  ? -3.207  -5.652  -8.428  1.00 0.00 ? 108 DG  B H22    6  
ATOM   10002 P P      . DA  A 1 9  ? -7.296  -7.725  -14.453 1.00 0.00 ? 109 DA  B P      6  
ATOM   10003 O OP1    . DA  A 1 9  ? -6.736  -7.607  -15.818 1.00 0.00 ? 109 DA  B OP1    6  
ATOM   10004 O OP2    . DA  A 1 9  ? -8.085  -8.920  -14.081 1.00 0.00 ? 109 DA  B OP2    6  
ATOM   10005 O "O5'"  . DA  A 1 9  ? -6.089  -7.569  -13.398 1.00 0.00 ? 109 DA  B "O5'"  6  
ATOM   10006 C "C5'"  . DA  A 1 9  ? -4.862  -6.938  -13.778 1.00 0.00 ? 109 DA  B "C5'"  6  
ATOM   10007 C "C4'"  . DA  A 1 9  ? -3.657  -7.800  -13.409 1.00 0.00 ? 109 DA  B "C4'"  6  
ATOM   10008 O "O4'"  . DA  A 1 9  ? -3.419  -7.760  -11.983 1.00 0.00 ? 109 DA  B "O4'"  6  
ATOM   10009 C "C3'"  . DA  A 1 9  ? -3.904  -9.244  -13.809 1.00 0.00 ? 109 DA  B "C3'"  6  
ATOM   10010 O "O3'"  . DA  A 1 9  ? -2.819  -9.741  -14.602 1.00 0.00 ? 109 DA  B "O3'"  6  
ATOM   10011 C "C2'"  . DA  A 1 9  ? -4.032  -10.010 -12.518 1.00 0.00 ? 109 DA  B "C2'"  6  
ATOM   10012 C "C1'"  . DA  A 1 9  ? -3.645  -9.063  -11.399 1.00 0.00 ? 109 DA  B "C1'"  6  
ATOM   10013 N N9     . DA  A 1 9  ? -4.711  -9.004  -10.395 1.00 0.00 ? 109 DA  B N9     6  
ATOM   10014 C C8     . DA  A 1 9  ? -6.029  -8.826  -10.583 1.00 0.00 ? 109 DA  B C8     6  
ATOM   10015 N N7     . DA  A 1 9  ? -6.786  -8.785  -9.538  1.00 0.00 ? 109 DA  B N7     6  
ATOM   10016 C C5     . DA  A 1 9  ? -5.851  -8.963  -8.513  1.00 0.00 ? 109 DA  B C5     6  
ATOM   10017 C C6     . DA  A 1 9  ? -5.971  -9.028  -7.122  1.00 0.00 ? 109 DA  B C6     6  
ATOM   10018 N N6     . DA  A 1 9  ? -7.137  -8.920  -6.484  1.00 0.00 ? 109 DA  B N6     6  
ATOM   10019 N N1     . DA  A 1 9  ? -4.844  -9.214  -6.412  1.00 0.00 ? 109 DA  B N1     6  
ATOM   10020 C C2     . DA  A 1 9  ? -3.667  -9.333  -7.029  1.00 0.00 ? 109 DA  B C2     6  
ATOM   10021 N N3     . DA  A 1 9  ? -3.439  -9.289  -8.338  1.00 0.00 ? 109 DA  B N3     6  
ATOM   10022 C C4     . DA  A 1 9  ? -4.582  -9.099  -9.028  1.00 0.00 ? 109 DA  B C4     6  
ATOM   10023 H "H5'"  . DA  A 1 9  ? -4.782  -5.977  -13.271 1.00 0.00 ? 109 DA  B "H5'"  6  
ATOM   10024 H "H5''" . DA  A 1 9  ? -4.865  -6.775  -14.856 1.00 0.00 ? 109 DA  B "H5''" 6  
ATOM   10025 H "H4'"  . DA  A 1 9  ? -2.776  -7.427  -13.930 1.00 0.00 ? 109 DA  B "H4'"  6  
ATOM   10026 H "H3'"  . DA  A 1 9  ? -4.838  -9.315  -14.369 1.00 0.00 ? 109 DA  B "H3'"  6  
ATOM   10027 H "H2'"  . DA  A 1 9  ? -5.062  -10.339 -12.385 1.00 0.00 ? 109 DA  B "H2'"  6  
ATOM   10028 H "H2''" . DA  A 1 9  ? -3.371  -10.867 -12.522 1.00 0.00 ? 109 DA  B "H2''" 6  
ATOM   10029 H "H1'"  . DA  A 1 9  ? -2.733  -9.413  -10.929 1.00 0.00 ? 109 DA  B "H1'"  6  
ATOM   10030 H H8     . DA  A 1 9  ? -6.433  -8.740  -11.586 1.00 0.00 ? 109 DA  B H8     6  
ATOM   10031 H H61    . DA  A 1 9  ? -7.169  -8.973  -5.476  1.00 0.00 ? 109 DA  B H61    6  
ATOM   10032 H H62    . DA  A 1 9  ? -7.988  -8.784  -7.010  1.00 0.00 ? 109 DA  B H62    6  
ATOM   10033 H H2     . DA  A 1 9  ? -2.797  -9.485  -6.387  1.00 0.00 ? 109 DA  B H2     6  
ATOM   10034 P P      . DT  A 1 10 ? -2.605  -11.324 -14.805 1.00 0.00 ? 110 DT  B P      6  
ATOM   10035 O OP1    . DT  A 1 10 ? -1.741  -11.526 -15.990 1.00 0.00 ? 110 DT  B OP1    6  
ATOM   10036 O OP2    . DT  A 1 10 ? -3.927  -11.984 -14.734 1.00 0.00 ? 110 DT  B OP2    6  
ATOM   10037 O "O5'"  . DT  A 1 10 ? -1.765  -11.733 -13.493 1.00 0.00 ? 110 DT  B "O5'"  6  
ATOM   10038 C "C5'"  . DT  A 1 10 ? -0.935  -10.773 -12.831 1.00 0.00 ? 110 DT  B "C5'"  6  
ATOM   10039 C "C4'"  . DT  A 1 10 ? -0.177  -11.397 -11.662 1.00 0.00 ? 110 DT  B "C4'"  6  
ATOM   10040 O "O4'"  . DT  A 1 10 ? -0.885  -11.182 -10.421 1.00 0.00 ? 110 DT  B "O4'"  6  
ATOM   10041 C "C3'"  . DT  A 1 10 ? -0.015  -12.895 -11.867 1.00 0.00 ? 110 DT  B "C3'"  6  
ATOM   10042 O "O3'"  . DT  A 1 10 ? 1.369   -13.263 -11.838 1.00 0.00 ? 110 DT  B "O3'"  6  
ATOM   10043 C "C2'"  . DT  A 1 10 ? -0.773  -13.550 -10.741 1.00 0.00 ? 110 DT  B "C2'"  6  
ATOM   10044 C "C1'"  . DT  A 1 10 ? -1.224  -12.444 -9.808  1.00 0.00 ? 110 DT  B "C1'"  6  
ATOM   10045 N N1     . DT  A 1 10 ? -2.673  -12.531 -9.556  1.00 0.00 ? 110 DT  B N1     6  
ATOM   10046 C C2     . DT  A 1 10 ? -3.093  -12.551 -8.239  1.00 0.00 ? 110 DT  B C2     6  
ATOM   10047 O O2     . DT  A 1 10 ? -2.311  -12.510 -7.310  1.00 0.00 ? 110 DT  B O2     6  
ATOM   10048 N N3     . DT  A 1 10 ? -4.459  -12.621 -8.042  1.00 0.00 ? 110 DT  B N3     6  
ATOM   10049 C C4     . DT  A 1 10 ? -5.425  -12.671 -9.031  1.00 0.00 ? 110 DT  B C4     6  
ATOM   10050 O O4     . DT  A 1 10 ? -6.604  -12.730 -8.744  1.00 0.00 ? 110 DT  B O4     6  
ATOM   10051 C C5     . DT  A 1 10 ? -4.890  -12.648 -10.373 1.00 0.00 ? 110 DT  B C5     6  
ATOM   10052 C C7     . DT  A 1 10 ? -5.844  -12.701 -11.562 1.00 0.00 ? 110 DT  B C7     6  
ATOM   10053 C C6     . DT  A 1 10 ? -3.562  -12.581 -10.592 1.00 0.00 ? 110 DT  B C6     6  
ATOM   10054 H "H5'"  . DT  A 1 10 ? -1.561  -9.962  -12.456 1.00 0.00 ? 110 DT  B "H5'"  6  
ATOM   10055 H "H5''" . DT  A 1 10 ? -0.219  -10.369 -13.545 1.00 0.00 ? 110 DT  B "H5''" 6  
ATOM   10056 H "H4'"  . DT  A 1 10 ? 0.809   -10.937 -11.591 1.00 0.00 ? 110 DT  B "H4'"  6  
ATOM   10057 H "H3'"  . DT  A 1 10 ? -0.459  -13.183 -12.822 1.00 0.00 ? 110 DT  B "H3'"  6  
ATOM   10058 H "H2'"  . DT  A 1 10 ? -1.640  -14.079 -11.137 1.00 0.00 ? 110 DT  B "H2'"  6  
ATOM   10059 H "H2''" . DT  A 1 10 ? -0.127  -14.244 -10.211 1.00 0.00 ? 110 DT  B "H2''" 6  
ATOM   10060 H "H1'"  . DT  A 1 10 ? -0.692  -12.536 -8.861  1.00 0.00 ? 110 DT  B "H1'"  6  
ATOM   10061 H H3     . DT  A 1 10 ? -4.772  -12.636 -7.113  1.00 0.00 ? 110 DT  B H3     6  
ATOM   10062 H H71    . DT  A 1 10 ? -5.275  -12.631 -12.489 1.00 0.00 ? 110 DT  B H71    6  
ATOM   10063 H H72    . DT  A 1 10 ? -6.395  -13.640 -11.544 1.00 0.00 ? 110 DT  B H72    6  
ATOM   10064 H H73    . DT  A 1 10 ? -6.546  -11.868 -11.503 1.00 0.00 ? 110 DT  B H73    6  
ATOM   10065 H H6     . DT  A 1 10 ? -3.186  -12.574 -11.615 1.00 0.00 ? 110 DT  B H6     6  
ATOM   10066 P P      . DA  A 1 11 ? 1.807   -14.805 -11.680 1.00 0.00 ? 111 DA  B P      6  
ATOM   10067 O OP1    . DA  A 1 11 ? 3.285   -14.869 -11.679 1.00 0.00 ? 111 DA  B OP1    6  
ATOM   10068 O OP2    . DA  A 1 11 ? 1.035   -15.608 -12.654 1.00 0.00 ? 111 DA  B OP2    6  
ATOM   10069 O "O5'"  . DA  A 1 11 ? 1.285   -15.169 -10.200 1.00 0.00 ? 111 DA  B "O5'"  6  
ATOM   10070 C "C5'"  . DA  A 1 11 ? 1.987   -14.704 -9.045  1.00 0.00 ? 111 DA  B "C5'"  6  
ATOM   10071 C "C4'"  . DA  A 1 11 ? 1.850   -15.680 -7.881  1.00 0.00 ? 111 DA  B "C4'"  6  
ATOM   10072 O "O4'"  . DA  A 1 11 ? 0.631   -15.429 -7.145  1.00 0.00 ? 111 DA  B "O4'"  6  
ATOM   10073 C "C3'"  . DA  A 1 11 ? 1.813   -17.113 -8.393  1.00 0.00 ? 111 DA  B "C3'"  6  
ATOM   10074 O "O3'"  . DA  A 1 11 ? 2.870   -17.886 -7.815  1.00 0.00 ? 111 DA  B "O3'"  6  
ATOM   10075 C "C2'"  . DA  A 1 11 ? 0.467   -17.661 -7.997  1.00 0.00 ? 111 DA  B "C2'"  6  
ATOM   10076 C "C1'"  . DA  A 1 11 ? -0.217  -16.598 -7.158  1.00 0.00 ? 111 DA  B "C1'"  6  
ATOM   10077 N N9     . DA  A 1 11 ? -1.541  -16.280 -7.707  1.00 0.00 ? 111 DA  B N9     6  
ATOM   10078 C C8     . DA  A 1 11 ? -1.909  -16.112 -8.991  1.00 0.00 ? 111 DA  B C8     6  
ATOM   10079 N N7     . DA  A 1 11 ? -3.149  -15.832 -9.228  1.00 0.00 ? 111 DA  B N7     6  
ATOM   10080 C C5     . DA  A 1 11 ? -3.682  -15.814 -7.934  1.00 0.00 ? 111 DA  B C5     6  
ATOM   10081 C C6     . DA  A 1 11 ? -4.971  -15.581 -7.439  1.00 0.00 ? 111 DA  B C6     6  
ATOM   10082 N N6     . DA  A 1 11 ? -6.017  -15.305 -8.218  1.00 0.00 ? 111 DA  B N6     6  
ATOM   10083 N N1     . DA  A 1 11 ? -5.140  -15.644 -6.107  1.00 0.00 ? 111 DA  B N1     6  
ATOM   10084 C C2     . DA  A 1 11 ? -4.109  -15.919 -5.305  1.00 0.00 ? 111 DA  B C2     6  
ATOM   10085 N N3     . DA  A 1 11 ? -2.852  -16.156 -5.665  1.00 0.00 ? 111 DA  B N3     6  
ATOM   10086 C C4     . DA  A 1 11 ? -2.706  -16.087 -7.003  1.00 0.00 ? 111 DA  B C4     6  
ATOM   10087 H "H5'"  . DA  A 1 11 ? 1.583   -13.736 -8.747  1.00 0.00 ? 111 DA  B "H5'"  6  
ATOM   10088 H "H5''" . DA  A 1 11 ? 3.043   -14.589 -9.291  1.00 0.00 ? 111 DA  B "H5''" 6  
ATOM   10089 H "H4'"  . DA  A 1 11 ? 2.701   -15.561 -7.212  1.00 0.00 ? 111 DA  B "H4'"  6  
ATOM   10090 H "H3'"  . DA  A 1 11 ? 1.903   -17.114 -9.480  1.00 0.00 ? 111 DA  B "H3'"  6  
ATOM   10091 H "H2'"  . DA  A 1 11 ? -0.126  -17.866 -8.889  1.00 0.00 ? 111 DA  B "H2'"  6  
ATOM   10092 H "H2''" . DA  A 1 11 ? 0.590   -18.570 -7.417  1.00 0.00 ? 111 DA  B "H2''" 6  
ATOM   10093 H "H1'"  . DA  A 1 11 ? -0.335  -16.965 -6.144  1.00 0.00 ? 111 DA  B "H1'"  6  
ATOM   10094 H H8     . DA  A 1 11 ? -1.187  -16.225 -9.794  1.00 0.00 ? 111 DA  B H8     6  
ATOM   10095 H H61    . DA  A 1 11 ? -6.925  -15.145 -7.807  1.00 0.00 ? 111 DA  B H61    6  
ATOM   10096 H H62    . DA  A 1 11 ? -5.901  -15.255 -9.220  1.00 0.00 ? 111 DA  B H62    6  
ATOM   10097 H H2     . DA  A 1 11 ? -4.321  -15.950 -4.237  1.00 0.00 ? 111 DA  B H2     6  
ATOM   10098 P P      . DC  A 1 12 ? 3.468   -19.163 -8.591  1.00 0.00 ? 112 DC  B P      6  
ATOM   10099 O OP1    . DC  A 1 12 ? 4.940   -19.025 -8.645  1.00 0.00 ? 112 DC  B OP1    6  
ATOM   10100 O OP2    . DC  A 1 12 ? 2.698   -19.348 -9.842  1.00 0.00 ? 112 DC  B OP2    6  
ATOM   10101 O "O5'"  . DC  A 1 12 ? 3.111   -20.377 -7.596  1.00 0.00 ? 112 DC  B "O5'"  6  
ATOM   10102 C "C5'"  . DC  A 1 12 ? 3.050   -20.163 -6.183  1.00 0.00 ? 112 DC  B "C5'"  6  
ATOM   10103 C "C4'"  . DC  A 1 12 ? 2.058   -21.109 -5.514  1.00 0.00 ? 112 DC  B "C4'"  6  
ATOM   10104 O "O4'"  . DC  A 1 12 ? 0.743   -20.520 -5.464  1.00 0.00 ? 112 DC  B "O4'"  6  
ATOM   10105 C "C3'"  . DC  A 1 12 ? 1.964   -22.422 -6.275  1.00 0.00 ? 112 DC  B "C3'"  6  
ATOM   10106 O "O3'"  . DC  A 1 12 ? 2.520   -23.496 -5.512  1.00 0.00 ? 112 DC  B "O3'"  6  
ATOM   10107 C "C2'"  . DC  A 1 12 ? 0.495   -22.646 -6.529  1.00 0.00 ? 112 DC  B "C2'"  6  
ATOM   10108 C "C1'"  . DC  A 1 12 ? -0.242  -21.470 -5.912  1.00 0.00 ? 112 DC  B "C1'"  6  
ATOM   10109 N N1     . DC  A 1 12 ? -1.164  -20.852 -6.885  1.00 0.00 ? 112 DC  B N1     6  
ATOM   10110 C C2     . DC  A 1 12 ? -2.467  -20.618 -6.473  1.00 0.00 ? 112 DC  B C2     6  
ATOM   10111 O O2     . DC  A 1 12 ? -2.814  -20.925 -5.350  1.00 0.00 ? 112 DC  B O2     6  
ATOM   10112 N N3     . DC  A 1 12 ? -3.330  -20.043 -7.355  1.00 0.00 ? 112 DC  B N3     6  
ATOM   10113 C C4     . DC  A 1 12 ? -2.931  -19.711 -8.590  1.00 0.00 ? 112 DC  B C4     6  
ATOM   10114 N N4     . DC  A 1 12 ? -3.802  -19.147 -9.428  1.00 0.00 ? 112 DC  B N4     6  
ATOM   10115 C C5     . DC  A 1 12 ? -1.588  -19.951 -9.019  1.00 0.00 ? 112 DC  B C5     6  
ATOM   10116 C C6     . DC  A 1 12 ? -0.742  -20.521 -8.140  1.00 0.00 ? 112 DC  B C6     6  
ATOM   10117 H "H5'"  . DC  A 1 12 ? 2.745   -19.134 -5.992  1.00 0.00 ? 112 DC  B "H5'"  6  
ATOM   10118 H "H5''" . DC  A 1 12 ? 4.040   -20.325 -5.756  1.00 0.00 ? 112 DC  B "H5''" 6  
ATOM   10119 H "H4'"  . DC  A 1 12 ? 2.387   -21.312 -4.497  1.00 0.00 ? 112 DC  B "H4'"  6  
ATOM   10120 H "H3'"  . DC  A 1 12 ? 2.487   -22.329 -7.228  1.00 0.00 ? 112 DC  B "H3'"  6  
ATOM   10121 H "HO3'" . DC  A 1 12 ? 3.155   -23.947 -6.074  1.00 0.00 ? 112 DC  B "HO3'" 6  
ATOM   10122 H "H2'"  . DC  A 1 12 ? 0.304   -22.685 -7.602  1.00 0.00 ? 112 DC  B "H2'"  6  
ATOM   10123 H "H2''" . DC  A 1 12 ? 0.173   -23.574 -6.060  1.00 0.00 ? 112 DC  B "H2''" 6  
ATOM   10124 H "H1'"  . DC  A 1 12 ? -0.810  -21.819 -5.053  1.00 0.00 ? 112 DC  B "H1'"  6  
ATOM   10125 H H41    . DC  A 1 12 ? -4.751  -18.975 -9.130  1.00 0.00 ? 112 DC  B H41    6  
ATOM   10126 H H42    . DC  A 1 12 ? -3.511  -18.892 -10.362 1.00 0.00 ? 112 DC  B H42    6  
ATOM   10127 H H5     . DC  A 1 12 ? -1.261  -19.682 -10.024 1.00 0.00 ? 112 DC  B H5     6  
ATOM   10128 H H6     . DC  A 1 12 ? 0.288   -20.721 -8.432  1.00 0.00 ? 112 DC  B H6     6  
ATOM   10129 O "O5'"  . DG  B 1 1  ? -13.496 -20.219 -6.015  1.00 0.00 ? 113 DG  C "O5'"  6  
ATOM   10130 C "C5'"  . DG  B 1 1  ? -13.391 -20.920 -4.772  1.00 0.00 ? 113 DG  C "C5'"  6  
ATOM   10131 C "C4'"  . DG  B 1 1  ? -12.447 -20.211 -3.807  1.00 0.00 ? 113 DG  C "C4'"  6  
ATOM   10132 O "O4'"  . DG  B 1 1  ? -11.078 -20.351 -4.237  1.00 0.00 ? 113 DG  C "O4'"  6  
ATOM   10133 C "C3'"  . DG  B 1 1  ? -12.771 -18.727 -3.723  1.00 0.00 ? 113 DG  C "C3'"  6  
ATOM   10134 O "O3'"  . DG  B 1 1  ? -13.295 -18.391 -2.433  1.00 0.00 ? 113 DG  C "O3'"  6  
ATOM   10135 C "C2'"  . DG  B 1 1  ? -11.474 -18.006 -3.988  1.00 0.00 ? 113 DG  C "C2'"  6  
ATOM   10136 C "C1'"  . DG  B 1 1  ? -10.417 -19.073 -4.207  1.00 0.00 ? 113 DG  C "C1'"  6  
ATOM   10137 N N9     . DG  B 1 1  ? -9.673  -18.835 -5.456  1.00 0.00 ? 113 DG  C N9     6  
ATOM   10138 C C8     . DG  B 1 1  ? -10.091 -18.275 -6.613  1.00 0.00 ? 113 DG  C C8     6  
ATOM   10139 N N7     . DG  B 1 1  ? -9.237  -18.178 -7.576  1.00 0.00 ? 113 DG  C N7     6  
ATOM   10140 C C5     . DG  B 1 1  ? -8.095  -18.743 -7.001  1.00 0.00 ? 113 DG  C C5     6  
ATOM   10141 C C6     . DG  B 1 1  ? -6.799  -18.935 -7.549  1.00 0.00 ? 113 DG  C C6     6  
ATOM   10142 O O6     . DG  B 1 1  ? -6.400  -18.645 -8.659  1.00 0.00 ? 113 DG  C O6     6  
ATOM   10143 N N1     . DG  B 1 1  ? -5.943  -19.538 -6.636  1.00 0.00 ? 113 DG  C N1     6  
ATOM   10144 C C2     . DG  B 1 1  ? -6.286  -19.911 -5.351  1.00 0.00 ? 113 DG  C C2     6  
ATOM   10145 N N2     . DG  B 1 1  ? -5.323  -20.476 -4.624  1.00 0.00 ? 113 DG  C N2     6  
ATOM   10146 N N3     . DG  B 1 1  ? -7.503  -19.734 -4.827  1.00 0.00 ? 113 DG  C N3     6  
ATOM   10147 C C4     . DG  B 1 1  ? -8.354  -19.148 -5.700  1.00 0.00 ? 113 DG  C C4     6  
ATOM   10148 H "H5'"  . DG  B 1 1  ? -13.018 -21.926 -4.962  1.00 0.00 ? 113 DG  C "H5'"  6  
ATOM   10149 H "H5''" . DG  B 1 1  ? -14.380 -20.987 -4.317  1.00 0.00 ? 113 DG  C "H5''" 6  
ATOM   10150 H "H4'"  . DG  B 1 1  ? -12.548 -20.651 -2.818  1.00 0.00 ? 113 DG  C "H4'"  6  
ATOM   10151 H "H3'"  . DG  B 1 1  ? -13.497 -18.469 -4.499  1.00 0.00 ? 113 DG  C "H3'"  6  
ATOM   10152 H "H2'"  . DG  B 1 1  ? -11.569 -17.384 -4.878  1.00 0.00 ? 113 DG  C "H2'"  6  
ATOM   10153 H "H2''" . DG  B 1 1  ? -11.209 -17.390 -3.129  1.00 0.00 ? 113 DG  C "H2''" 6  
ATOM   10154 H "H1'"  . DG  B 1 1  ? -9.724  -19.056 -3.374  1.00 0.00 ? 113 DG  C "H1'"  6  
ATOM   10155 H H8     . DG  B 1 1  ? -11.111 -17.917 -6.722  1.00 0.00 ? 113 DG  C H8     6  
ATOM   10156 H H1     . DG  B 1 1  ? -5.029  -19.703 -6.947  1.00 0.00 ? 113 DG  C H1     6  
ATOM   10157 H H21    . DG  B 1 1  ? -4.404  -20.610 -5.020  1.00 0.00 ? 113 DG  C H21    6  
ATOM   10158 H H22    . DG  B 1 1  ? -5.512  -20.771 -3.677  1.00 0.00 ? 113 DG  C H22    6  
ATOM   10159 H "HO5'" . DG  B 1 1  ? -12.846 -19.512 -5.999  1.00 0.00 ? 113 DG  C "HO5'" 6  
ATOM   10160 P P      . DT  B 1 2  ? -13.304 -16.864 -1.922  1.00 0.00 ? 114 DT  C P      6  
ATOM   10161 O OP1    . DT  B 1 2  ? -14.389 -16.715 -0.927  1.00 0.00 ? 114 DT  C OP1    6  
ATOM   10162 O OP2    . DT  B 1 2  ? -13.264 -15.978 -3.108  1.00 0.00 ? 114 DT  C OP2    6  
ATOM   10163 O "O5'"  . DT  B 1 2  ? -11.894 -16.743 -1.154  1.00 0.00 ? 114 DT  C "O5'"  6  
ATOM   10164 C "C5'"  . DT  B 1 2  ? -11.209 -17.916 -0.706  1.00 0.00 ? 114 DT  C "C5'"  6  
ATOM   10165 C "C4'"  . DT  B 1 2  ? -9.790  -17.599 -0.244  1.00 0.00 ? 114 DT  C "C4'"  6  
ATOM   10166 O "O4'"  . DT  B 1 2  ? -8.866  -17.668 -1.353  1.00 0.00 ? 114 DT  C "O4'"  6  
ATOM   10167 C "C3'"  . DT  B 1 2  ? -9.719  -16.201 0.352   1.00 0.00 ? 114 DT  C "C3'"  6  
ATOM   10168 O "O3'"  . DT  B 1 2  ? -9.232  -16.256 1.701   1.00 0.00 ? 114 DT  C "O3'"  6  
ATOM   10169 C "C2'"  . DT  B 1 2  ? -8.784  -15.418 -0.538  1.00 0.00 ? 114 DT  C "C2'"  6  
ATOM   10170 C "C1'"  . DT  B 1 2  ? -8.208  -16.398 -1.544  1.00 0.00 ? 114 DT  C "C1'"  6  
ATOM   10171 N N1     . DT  B 1 2  ? -8.399  -15.915 -2.924  1.00 0.00 ? 114 DT  C N1     6  
ATOM   10172 C C2     . DT  B 1 2  ? -7.297  -15.928 -3.758  1.00 0.00 ? 114 DT  C C2     6  
ATOM   10173 O O2     . DT  B 1 2  ? -6.203  -16.294 -3.377  1.00 0.00 ? 114 DT  C O2     6  
ATOM   10174 N N3     . DT  B 1 2  ? -7.511  -15.498 -5.054  1.00 0.00 ? 114 DT  C N3     6  
ATOM   10175 C C4     . DT  B 1 2  ? -8.713  -15.064 -5.581  1.00 0.00 ? 114 DT  C C4     6  
ATOM   10176 O O4     . DT  B 1 2  ? -8.787  -14.709 -6.741  1.00 0.00 ? 114 DT  C O4     6  
ATOM   10177 C C5     . DT  B 1 2  ? -9.809  -15.083 -4.636  1.00 0.00 ? 114 DT  C C5     6  
ATOM   10178 C C7     . DT  B 1 2  ? -11.193 -14.624 -5.083  1.00 0.00 ? 114 DT  C C7     6  
ATOM   10179 C C6     . DT  B 1 2  ? -9.625  -15.498 -3.365  1.00 0.00 ? 114 DT  C C6     6  
ATOM   10180 H "H5'"  . DT  B 1 2  ? -11.164 -18.636 -1.524  1.00 0.00 ? 114 DT  C "H5'"  6  
ATOM   10181 H "H5''" . DT  B 1 2  ? -11.763 -18.355 0.124   1.00 0.00 ? 114 DT  C "H5''" 6  
ATOM   10182 H "H4'"  . DT  B 1 2  ? -9.491  -18.324 0.511   1.00 0.00 ? 114 DT  C "H4'"  6  
ATOM   10183 H "H3'"  . DT  B 1 2  ? -10.710 -15.743 0.331   1.00 0.00 ? 114 DT  C "H3'"  6  
ATOM   10184 H "H2'"  . DT  B 1 2  ? -9.334  -14.633 -1.057  1.00 0.00 ? 114 DT  C "H2'"  6  
ATOM   10185 H "H2''" . DT  B 1 2  ? -7.981  -14.981 0.052   1.00 0.00 ? 114 DT  C "H2''" 6  
ATOM   10186 H "H1'"  . DT  B 1 2  ? -7.141  -16.516 -1.354  1.00 0.00 ? 114 DT  C "H1'"  6  
ATOM   10187 H H3     . DT  B 1 2  ? -6.738  -15.503 -5.656  1.00 0.00 ? 114 DT  C H3     6  
ATOM   10188 H H71    . DT  B 1 2  ? -11.484 -13.741 -4.514  1.00 0.00 ? 114 DT  C H71    6  
ATOM   10189 H H72    . DT  B 1 2  ? -11.169 -14.380 -6.145  1.00 0.00 ? 114 DT  C H72    6  
ATOM   10190 H H73    . DT  B 1 2  ? -11.914 -15.422 -4.909  1.00 0.00 ? 114 DT  C H73    6  
ATOM   10191 H H6     . DT  B 1 2  ? -10.467 -15.498 -2.674  1.00 0.00 ? 114 DT  C H6     6  
ATOM   10192 P P      . DA  B 1 3  ? -8.576  -14.962 2.401   1.00 0.00 ? 115 DA  C P      6  
ATOM   10193 O OP1    . DA  B 1 3  ? -8.187  -15.328 3.781   1.00 0.00 ? 115 DA  C OP1    6  
ATOM   10194 O OP2    . DA  B 1 3  ? -9.469  -13.805 2.168   1.00 0.00 ? 115 DA  C OP2    6  
ATOM   10195 O "O5'"  . DA  B 1 3  ? -7.234  -14.743 1.540   1.00 0.00 ? 115 DA  C "O5'"  6  
ATOM   10196 C "C5'"  . DA  B 1 3  ? -5.996  -15.332 1.950   1.00 0.00 ? 115 DA  C "C5'"  6  
ATOM   10197 C "C4'"  . DA  B 1 3  ? -4.806  -14.486 1.512   1.00 0.00 ? 115 DA  C "C4'"  6  
ATOM   10198 O "O4'"  . DA  B 1 3  ? -4.670  -14.503 0.078   1.00 0.00 ? 115 DA  C "O4'"  6  
ATOM   10199 C "C3'"  . DA  B 1 3  ? -4.987  -13.044 1.959   1.00 0.00 ? 115 DA  C "C3'"  6  
ATOM   10200 O "O3'"  . DA  B 1 3  ? -3.953  -12.661 2.872   1.00 0.00 ? 115 DA  C "O3'"  6  
ATOM   10201 C "C2'"  . DA  B 1 3  ? -4.936  -12.216 0.703   1.00 0.00 ? 115 DA  C "C2'"  6  
ATOM   10202 C "C1'"  . DA  B 1 3  ? -4.594  -13.160 -0.432  1.00 0.00 ? 115 DA  C "C1'"  6  
ATOM   10203 N N9     . DA  B 1 3  ? -5.523  -12.973 -1.554  1.00 0.00 ? 115 DA  C N9     6  
ATOM   10204 C C8     . DA  B 1 3  ? -6.870  -12.868 -1.536  1.00 0.00 ? 115 DA  C C8     6  
ATOM   10205 N N7     . DA  B 1 3  ? -7.475  -12.728 -2.667  1.00 0.00 ? 115 DA  C N7     6  
ATOM   10206 C C5     . DA  B 1 3  ? -6.401  -12.735 -3.562  1.00 0.00 ? 115 DA  C C5     6  
ATOM   10207 C C6     . DA  B 1 3  ? -6.326  -12.623 -4.954  1.00 0.00 ? 115 DA  C C6     6  
ATOM   10208 N N6     . DA  B 1 3  ? -7.399  -12.475 -5.731  1.00 0.00 ? 115 DA  C N6     6  
ATOM   10209 N N1     . DA  B 1 3  ? -5.105  -12.669 -5.514  1.00 0.00 ? 115 DA  C N1     6  
ATOM   10210 C C2     . DA  B 1 3  ? -4.017  -12.814 -4.754  1.00 0.00 ? 115 DA  C C2     6  
ATOM   10211 N N3     . DA  B 1 3  ? -3.972  -12.930 -3.429  1.00 0.00 ? 115 DA  C N3     6  
ATOM   10212 C C4     . DA  B 1 3  ? -5.207  -12.883 -2.892  1.00 0.00 ? 115 DA  C C4     6  
ATOM   10213 H "H5'"  . DA  B 1 3  ? -5.909  -16.325 1.507   1.00 0.00 ? 115 DA  C "H5'"  6  
ATOM   10214 H "H5''" . DA  B 1 3  ? -5.988  -15.426 3.037   1.00 0.00 ? 115 DA  C "H5''" 6  
ATOM   10215 H "H4'"  . DA  B 1 3  ? -3.895  -14.882 1.955   1.00 0.00 ? 115 DA  C "H4'"  6  
ATOM   10216 H "H3'"  . DA  B 1 3  ? -5.964  -12.927 2.433   1.00 0.00 ? 115 DA  C "H3'"  6  
ATOM   10217 H "H2'"  . DA  B 1 3  ? -5.907  -11.755 0.523   1.00 0.00 ? 115 DA  C "H2'"  6  
ATOM   10218 H "H2''" . DA  B 1 3  ? -4.174  -11.448 0.789   1.00 0.00 ? 115 DA  C "H2''" 6  
ATOM   10219 H "H1'"  . DA  B 1 3  ? -3.578  -12.967 -0.766  1.00 0.00 ? 115 DA  C "H1'"  6  
ATOM   10220 H H8     . DA  B 1 3  ? -7.419  -12.890 -0.595  1.00 0.00 ? 115 DA  C H8     6  
ATOM   10221 H H61    . DA  B 1 3  ? -7.290  -12.398 -6.732  1.00 0.00 ? 115 DA  C H61    6  
ATOM   10222 H H62    . DA  B 1 3  ? -8.320  -12.437 -5.318  1.00 0.00 ? 115 DA  C H62    6  
ATOM   10223 H H2     . DA  B 1 3  ? -3.061  -12.839 -5.277  1.00 0.00 ? 115 DA  C H2     6  
ATOM   10224 P P      . DT  B 1 4  ? -3.688  -11.111 3.208   1.00 0.00 ? 116 DT  C P      6  
ATOM   10225 O OP1    . DT  B 1 4  ? -3.111  -11.023 4.569   1.00 0.00 ? 116 DT  C OP1    6  
ATOM   10226 O OP2    . DT  B 1 4  ? -4.912  -10.348 2.876   1.00 0.00 ? 116 DT  C OP2    6  
ATOM   10227 O "O5'"  . DT  B 1 4  ? -2.543  -10.713 2.149   1.00 0.00 ? 116 DT  C "O5'"  6  
ATOM   10228 C "C5'"  . DT  B 1 4  ? -1.799  -11.725 1.464   1.00 0.00 ? 116 DT  C "C5'"  6  
ATOM   10229 C "C4'"  . DT  B 1 4  ? -0.971  -11.137 0.324   1.00 0.00 ? 116 DT  C "C4'"  6  
ATOM   10230 O "O4'"  . DT  B 1 4  ? -1.671  -11.254 -0.928  1.00 0.00 ? 116 DT  C "O4'"  6  
ATOM   10231 C "C3'"  . DT  B 1 4  ? -0.680  -9.665  0.575   1.00 0.00 ? 116 DT  C "C3'"  6  
ATOM   10232 O "O3'"  . DT  B 1 4  ? 0.731   -9.444  0.659   1.00 0.00 ? 116 DT  C "O3'"  6  
ATOM   10233 C "C2'"  . DT  B 1 4  ? -1.278  -8.924  -0.590  1.00 0.00 ? 116 DT  C "C2'"  6  
ATOM   10234 C "C1'"  . DT  B 1 4  ? -1.732  -9.974  -1.585  1.00 0.00 ? 116 DT  C "C1'"  6  
ATOM   10235 N N1     . DT  B 1 4  ? -3.098  -9.700  -2.059  1.00 0.00 ? 116 DT  C N1     6  
ATOM   10236 C C2     . DT  B 1 4  ? -3.294  -9.599  -3.421  1.00 0.00 ? 116 DT  C C2     6  
ATOM   10237 O O2     . DT  B 1 4  ? -2.381  -9.695  -4.216  1.00 0.00 ? 116 DT  C O2     6  
ATOM   10238 N N3     . DT  B 1 4  ? -4.596  -9.382  -3.829  1.00 0.00 ? 116 DT  C N3     6  
ATOM   10239 C C4     . DT  B 1 4  ? -5.700  -9.259  -3.002  1.00 0.00 ? 116 DT  C C4     6  
ATOM   10240 O O4     . DT  B 1 4  ? -6.806  -9.070  -3.468  1.00 0.00 ? 116 DT  C O4     6  
ATOM   10241 C C5     . DT  B 1 4  ? -5.394  -9.376  -1.594  1.00 0.00 ? 116 DT  C C5     6  
ATOM   10242 C C7     . DT  B 1 4  ? -6.517  -9.259  -0.568  1.00 0.00 ? 116 DT  C C7     6  
ATOM   10243 C C6     . DT  B 1 4  ? -4.131  -9.586  -1.174  1.00 0.00 ? 116 DT  C C6     6  
ATOM   10244 H "H5'"  . DT  B 1 4  ? -2.491  -12.462 1.056   1.00 0.00 ? 116 DT  C "H5'"  6  
ATOM   10245 H "H5''" . DT  B 1 4  ? -1.131  -12.217 2.171   1.00 0.00 ? 116 DT  C "H5''" 6  
ATOM   10246 H "H4'"  . DT  B 1 4  ? -0.028  -11.674 0.248   1.00 0.00 ? 116 DT  C "H4'"  6  
ATOM   10247 H "H3'"  . DT  B 1 4  ? -1.166  -9.348  1.499   1.00 0.00 ? 116 DT  C "H3'"  6  
ATOM   10248 H "H2'"  . DT  B 1 4  ? -2.131  -8.333  -0.258  1.00 0.00 ? 116 DT  C "H2'"  6  
ATOM   10249 H "H2''" . DT  B 1 4  ? -0.535  -8.278  -1.047  1.00 0.00 ? 116 DT  C "H2''" 6  
ATOM   10250 H "H1'"  . DT  B 1 4  ? -1.051  -9.980  -2.430  1.00 0.00 ? 116 DT  C "H1'"  6  
ATOM   10251 H H3     . DT  B 1 4  ? -4.753  -9.307  -4.794  1.00 0.00 ? 116 DT  C H3     6  
ATOM   10252 H H71    . DT  B 1 4  ? -7.063  -10.201 -0.519  1.00 0.00 ? 116 DT  C H71    6  
ATOM   10253 H H72    . DT  B 1 4  ? -6.092  -9.033  0.410   1.00 0.00 ? 116 DT  C H72    6  
ATOM   10254 H H73    . DT  B 1 4  ? -7.196  -8.459  -0.864  1.00 0.00 ? 116 DT  C H73    6  
ATOM   10255 H H6     . DT  B 1 4  ? -3.923  -9.656  -0.106  1.00 0.00 ? 116 DT  C H6     6  
ATOM   10256 P P      . DC  B 1 5  ? 1.345   -7.961  0.546   1.00 0.00 ? 117 DC  C P      6  
ATOM   10257 O OP1    . DC  B 1 5  ? 2.757   -8.019  0.979   1.00 0.00 ? 117 DC  C OP1    6  
ATOM   10258 O OP2    . DC  B 1 5  ? 0.408   -7.018  1.198   1.00 0.00 ? 117 DC  C OP2    6  
ATOM   10259 O "O5'"  . DC  B 1 5  ? 1.322   -7.685  -1.038  1.00 0.00 ? 117 DC  C "O5'"  6  
ATOM   10260 C "C5'"  . DC  B 1 5  ? 2.546   -7.659  -1.777  1.00 0.00 ? 117 DC  C "C5'"  6  
ATOM   10261 C "C4'"  . DC  B 1 5  ? 2.405   -6.885  -3.083  1.00 0.00 ? 117 DC  C "C4'"  6  
ATOM   10262 O "O4'"  . DC  B 1 5  ? 1.198   -7.261  -3.779  1.00 0.00 ? 117 DC  C "O4'"  6  
ATOM   10263 C "C3'"  . DC  B 1 5  ? 2.361   -5.388  -2.823  1.00 0.00 ? 117 DC  C "C3'"  6  
ATOM   10264 O "O3'"  . DC  B 1 5  ? 3.478   -4.738  -3.444  1.00 0.00 ? 117 DC  C "O3'"  6  
ATOM   10265 C "C2'"  . DC  B 1 5  ? 1.059   -4.910  -3.404  1.00 0.00 ? 117 DC  C "C2'"  6  
ATOM   10266 C "C1'"  . DC  B 1 5  ? 0.457   -6.083  -4.152  1.00 0.00 ? 117 DC  C "C1'"  6  
ATOM   10267 N N1     . DC  B 1 5  ? -0.974  -6.226  -3.833  1.00 0.00 ? 117 DC  C N1     6  
ATOM   10268 C C2     . DC  B 1 5  ? -1.874  -6.211  -4.886  1.00 0.00 ? 117 DC  C C2     6  
ATOM   10269 O O2     . DC  B 1 5  ? -1.475  -6.094  -6.028  1.00 0.00 ? 117 DC  C O2     6  
ATOM   10270 N N3     . DC  B 1 5  ? -3.201  -6.330  -4.604  1.00 0.00 ? 117 DC  C N3     6  
ATOM   10271 C C4     . DC  B 1 5  ? -3.626  -6.460  -3.339  1.00 0.00 ? 117 DC  C C4     6  
ATOM   10272 N N4     . DC  B 1 5  ? -4.933  -6.573  -3.097  1.00 0.00 ? 117 DC  C N4     6  
ATOM   10273 C C5     . DC  B 1 5  ? -2.697  -6.477  -2.250  1.00 0.00 ? 117 DC  C C5     6  
ATOM   10274 C C6     . DC  B 1 5  ? -1.387  -6.356  -2.542  1.00 0.00 ? 117 DC  C C6     6  
ATOM   10275 H "H5'"  . DC  B 1 5  ? 2.845   -8.682  -2.002  1.00 0.00 ? 117 DC  C "H5'"  6  
ATOM   10276 H "H5''" . DC  B 1 5  ? 3.317   -7.190  -1.167  1.00 0.00 ? 117 DC  C "H5''" 6  
ATOM   10277 H "H4'"  . DC  B 1 5  ? 3.259   -7.099  -3.716  1.00 0.00 ? 117 DC  C "H4'"  6  
ATOM   10278 H "H3'"  . DC  B 1 5  ? 2.372   -5.206  -1.751  1.00 0.00 ? 117 DC  C "H3'"  6  
ATOM   10279 H "H2'"  . DC  B 1 5  ? 0.388   -4.594  -2.605  1.00 0.00 ? 117 DC  C "H2'"  6  
ATOM   10280 H "H2''" . DC  B 1 5  ? 1.235   -4.084  -4.083  1.00 0.00 ? 117 DC  C "H2''" 6  
ATOM   10281 H "H1'"  . DC  B 1 5  ? 0.571   -5.920  -5.222  1.00 0.00 ? 117 DC  C "H1'"  6  
ATOM   10282 H H41    . DC  B 1 5  ? -5.591  -6.562  -3.863  1.00 0.00 ? 117 DC  C H41    6  
ATOM   10283 H H42    . DC  B 1 5  ? -5.263  -6.669  -2.148  1.00 0.00 ? 117 DC  C H42    6  
ATOM   10284 H H5     . DC  B 1 5  ? -3.037  -6.583  -1.220  1.00 0.00 ? 117 DC  C H5     6  
ATOM   10285 H H6     . DC  B 1 5  ? -0.648  -6.350  -1.742  1.00 0.00 ? 117 DC  C H6     6  
HETATM 10286 N N1     . 5CM B 1 6  ? -0.387  -2.290  -7.048  1.00 0.00 ? 118 5CM C N1     6  
HETATM 10287 C C2     . 5CM B 1 6  ? -1.692  -2.196  -7.503  1.00 0.00 ? 118 5CM C C2     6  
HETATM 10288 N N3     . 5CM B 1 6  ? -2.675  -1.953  -6.595  1.00 0.00 ? 118 5CM C N3     6  
HETATM 10289 C C4     . 5CM B 1 6  ? -2.389  -1.808  -5.295  1.00 0.00 ? 118 5CM C C4     6  
HETATM 10290 C C5     . 5CM B 1 6  ? -1.043  -1.904  -4.822  1.00 0.00 ? 118 5CM C C5     6  
HETATM 10291 C C5A    . 5CM B 1 6  ? -0.714  -1.749  -3.342  1.00 0.00 ? 118 5CM C C5A    6  
HETATM 10292 C C6     . 5CM B 1 6  ? -0.078  -2.145  -5.730  1.00 0.00 ? 118 5CM C C6     6  
HETATM 10293 O O2     . 5CM B 1 6  ? -1.935  -2.331  -8.686  1.00 0.00 ? 118 5CM C O2     6  
HETATM 10294 N N4     . 5CM B 1 6  ? -3.378  -1.570  -4.433  1.00 0.00 ? 118 5CM C N4     6  
HETATM 10295 C "C1'"  . 5CM B 1 6  ? 0.665   -2.551  -8.045  1.00 0.00 ? 118 5CM C "C1'"  6  
HETATM 10296 C "C2'"  . 5CM B 1 6  ? 1.767   -1.513  -7.950  1.00 0.00 ? 118 5CM C "C2'"  6  
HETATM 10297 C "C3'"  . 5CM B 1 6  ? 3.067   -2.266  -7.834  1.00 0.00 ? 118 5CM C "C3'"  6  
HETATM 10298 C "C4'"  . 5CM B 1 6  ? 2.684   -3.721  -7.621  1.00 0.00 ? 118 5CM C "C4'"  6  
HETATM 10299 O "O4'"  . 5CM B 1 6  ? 1.260   -3.849  -7.834  1.00 0.00 ? 118 5CM C "O4'"  6  
HETATM 10300 O "O3'"  . 5CM B 1 6  ? 3.856   -2.123  -9.022  1.00 0.00 ? 118 5CM C "O3'"  6  
HETATM 10301 C "C5'"  . 5CM B 1 6  ? 3.055   -4.165  -6.211  1.00 0.00 ? 118 5CM C "C5'"  6  
HETATM 10302 O "O5'"  . 5CM B 1 6  ? 2.745   -3.154  -5.247  1.00 0.00 ? 118 5CM C "O5'"  6  
HETATM 10303 P P      . 5CM B 1 6  ? 3.440   -3.167  -3.796  1.00 0.00 ? 118 5CM C P      6  
HETATM 10304 O OP1    . 5CM B 1 6  ? 4.833   -2.692  -3.945  1.00 0.00 ? 118 5CM C OP1    6  
HETATM 10305 O OP2    . 5CM B 1 6  ? 2.530   -2.497  -2.842  1.00 0.00 ? 118 5CM C OP2    6  
HETATM 10306 H H5A1   . 5CM B 1 6  ? -1.043  -2.637  -2.802  1.00 0.00 ? 118 5CM C H5A1   6  
HETATM 10307 H H5A2   . 5CM B 1 6  ? 0.362   -1.627  -3.219  1.00 0.00 ? 118 5CM C H5A2   6  
HETATM 10308 H H5A3   . 5CM B 1 6  ? -1.227  -0.873  -2.946  1.00 0.00 ? 118 5CM C H5A3   6  
HETATM 10309 H H6     . 5CM B 1 6  ? 0.961   -2.225  -5.411  1.00 0.00 ? 118 5CM C H6     6  
HETATM 10310 H HN41   . 5CM B 1 6  ? -3.174  -1.460  -3.449  1.00 0.00 ? 118 5CM C HN41   6  
HETATM 10311 H HN42   . 5CM B 1 6  ? -4.329  -1.501  -4.763  1.00 0.00 ? 118 5CM C HN42   6  
HETATM 10312 H "H1'"  . 5CM B 1 6  ? 0.227   -2.514  -9.041  1.00 0.00 ? 118 5CM C "H1'"  6  
HETATM 10313 H "H2'"  . 5CM B 1 6  ? 1.617   -0.893  -7.065  1.00 0.00 ? 118 5CM C "H2'"  6  
HETATM 10314 H "H2''" . 5CM B 1 6  ? 1.769   -0.892  -8.841  1.00 0.00 ? 118 5CM C "H2''" 6  
HETATM 10315 H "H3'"  . 5CM B 1 6  ? 3.625   -1.903  -6.969  1.00 0.00 ? 118 5CM C "H3'"  6  
HETATM 10316 H "H4'"  . 5CM B 1 6  ? 3.212   -4.342  -8.344  1.00 0.00 ? 118 5CM C "H4'"  6  
HETATM 10317 H "H5'"  . 5CM B 1 6  ? 2.504   -5.072  -5.965  1.00 0.00 ? 118 5CM C "H5'"  6  
HETATM 10318 H "H5''" . 5CM B 1 6  ? 4.125   -4.376  -6.174  1.00 0.00 ? 118 5CM C "H5''" 6  
ATOM   10319 P P      . DG  B 1 7  ? 4.038   -0.686  -9.728  1.00 0.00 ? 119 DG  C P      6  
ATOM   10320 O OP1    . DG  B 1 7  ? 4.882   -0.865  -10.931 1.00 0.00 ? 119 DG  C OP1    6  
ATOM   10321 O OP2    . DG  B 1 7  ? 4.432   0.293   -8.690  1.00 0.00 ? 119 DG  C OP2    6  
ATOM   10322 O "O5'"  . DG  B 1 7  ? 2.543   -0.337  -10.209 1.00 0.00 ? 119 DG  C "O5'"  6  
ATOM   10323 C "C5'"  . DG  B 1 7  ? 1.939   -1.050  -11.293 1.00 0.00 ? 119 DG  C "C5'"  6  
ATOM   10324 C "C4'"  . DG  B 1 7  ? 1.048   -0.140  -12.133 1.00 0.00 ? 119 DG  C "C4'"  6  
ATOM   10325 O "O4'"  . DG  B 1 7  ? -0.297  -0.109  -11.602 1.00 0.00 ? 119 DG  C "O4'"  6  
ATOM   10326 C "C3'"  . DG  B 1 7  ? 1.594   1.280   -12.134 1.00 0.00 ? 119 DG  C "C3'"  6  
ATOM   10327 O "O3'"  . DG  B 1 7  ? 1.848   1.729   -13.471 1.00 0.00 ? 119 DG  C "O3'"  6  
ATOM   10328 C "C2'"  . DG  B 1 7  ? 0.542   2.130   -11.472 1.00 0.00 ? 119 DG  C "C2'"  6  
ATOM   10329 C "C1'"  . DG  B 1 7  ? -0.659  1.237   -11.225 1.00 0.00 ? 119 DG  C "C1'"  6  
ATOM   10330 N N9     . DG  B 1 7  ? -1.057  1.301   -9.813  1.00 0.00 ? 119 DG  C N9     6  
ATOM   10331 C C8     . DG  B 1 7  ? -0.280  1.271   -8.716  1.00 0.00 ? 119 DG  C C8     6  
ATOM   10332 N N7     . DG  B 1 7  ? -0.855  1.377   -7.566  1.00 0.00 ? 119 DG  C N7     6  
ATOM   10333 C C5     . DG  B 1 7  ? -2.200  1.494   -7.934  1.00 0.00 ? 119 DG  C C5     6  
ATOM   10334 C C6     . DG  B 1 7  ? -3.357  1.644   -7.123  1.00 0.00 ? 119 DG  C C6     6  
ATOM   10335 O O6     . DG  B 1 7  ? -3.427  1.703   -5.912  1.00 0.00 ? 119 DG  C O6     6  
ATOM   10336 N N1     . DG  B 1 7  ? -4.511  1.726   -7.895  1.00 0.00 ? 119 DG  C N1     6  
ATOM   10337 C C2     . DG  B 1 7  ? -4.553  1.669   -9.274  1.00 0.00 ? 119 DG  C C2     6  
ATOM   10338 N N2     . DG  B 1 7  ? -5.759  1.765   -9.833  1.00 0.00 ? 119 DG  C N2     6  
ATOM   10339 N N3     . DG  B 1 7  ? -3.467  1.526   -10.043 1.00 0.00 ? 119 DG  C N3     6  
ATOM   10340 C C4     . DG  B 1 7  ? -2.331  1.446   -9.314  1.00 0.00 ? 119 DG  C C4     6  
ATOM   10341 H "H5'"  . DG  B 1 7  ? 1.336   -1.864  -10.891 1.00 0.00 ? 119 DG  C "H5'"  6  
ATOM   10342 H "H5''" . DG  B 1 7  ? 2.722   -1.465  -11.927 1.00 0.00 ? 119 DG  C "H5''" 6  
ATOM   10343 H "H4'"  . DG  B 1 7  ? 1.019   -0.513  -13.156 1.00 0.00 ? 119 DG  C "H4'"  6  
ATOM   10344 H "H3'"  . DG  B 1 7  ? 2.515   1.319   -11.549 1.00 0.00 ? 119 DG  C "H3'"  6  
ATOM   10345 H "H2'"  . DG  B 1 7  ? 0.919   2.515   -10.524 1.00 0.00 ? 119 DG  C "H2'"  6  
ATOM   10346 H "H2''" . DG  B 1 7  ? 0.264   2.955   -12.119 1.00 0.00 ? 119 DG  C "H2''" 6  
ATOM   10347 H "H1'"  . DG  B 1 7  ? -1.486  1.573   -11.841 1.00 0.00 ? 119 DG  C "H1'"  6  
ATOM   10348 H H8     . DG  B 1 7  ? 0.798   1.170   -8.808  1.00 0.00 ? 119 DG  C H8     6  
ATOM   10349 H H1     . DG  B 1 7  ? -5.352  1.832   -7.400  1.00 0.00 ? 119 DG  C H1     6  
ATOM   10350 H H21    . DG  B 1 7  ? -6.578  1.873   -9.251  1.00 0.00 ? 119 DG  C H21    6  
ATOM   10351 H H22    . DG  B 1 7  ? -5.854  1.732   -10.837 1.00 0.00 ? 119 DG  C H22    6  
ATOM   10352 P P      . DG  B 1 8  ? 2.098   3.290   -13.776 1.00 0.00 ? 120 DG  C P      6  
ATOM   10353 O OP1    . DG  B 1 8  ? 2.958   3.395   -14.976 1.00 0.00 ? 120 DG  C OP1    6  
ATOM   10354 O OP2    . DG  B 1 8  ? 2.505   3.949   -12.515 1.00 0.00 ? 120 DG  C OP2    6  
ATOM   10355 O "O5'"  . DG  B 1 8  ? 0.625   3.812   -14.165 1.00 0.00 ? 120 DG  C "O5'"  6  
ATOM   10356 C "C5'"  . DG  B 1 8  ? -0.309  2.940   -14.806 1.00 0.00 ? 120 DG  C "C5'"  6  
ATOM   10357 C "C4'"  . DG  B 1 8  ? -1.747  3.413   -14.612 1.00 0.00 ? 120 DG  C "C4'"  6  
ATOM   10358 O "O4'"  . DG  B 1 8  ? -2.129  3.331   -13.225 1.00 0.00 ? 120 DG  C "O4'"  6  
ATOM   10359 C "C3'"  . DG  B 1 8  ? -1.907  4.857   -15.068 1.00 0.00 ? 120 DG  C "C3'"  6  
ATOM   10360 O "O3'"  . DG  B 1 8  ? -2.797  4.932   -16.190 1.00 0.00 ? 120 DG  C "O3'"  6  
ATOM   10361 C "C2'"  . DG  B 1 8  ? -2.459  5.603   -13.880 1.00 0.00 ? 120 DG  C "C2'"  6  
ATOM   10362 C "C1'"  . DG  B 1 8  ? -2.726  4.570   -12.802 1.00 0.00 ? 120 DG  C "C1'"  6  
ATOM   10363 N N9     . DG  B 1 8  ? -2.185  4.999   -11.505 1.00 0.00 ? 120 DG  C N9     6  
ATOM   10364 C C8     . DG  B 1 8  ? -0.902  5.179   -11.132 1.00 0.00 ? 120 DG  C C8     6  
ATOM   10365 N N7     . DG  B 1 8  ? -0.676  5.546   -9.914  1.00 0.00 ? 120 DG  C N7     6  
ATOM   10366 C C5     . DG  B 1 8  ? -1.974  5.624   -9.398  1.00 0.00 ? 120 DG  C C5     6  
ATOM   10367 C C6     . DG  B 1 8  ? -2.417  5.978   -8.095  1.00 0.00 ? 120 DG  C C6     6  
ATOM   10368 O O6     . DG  B 1 8  ? -1.749  6.295   -7.131  1.00 0.00 ? 120 DG  C O6     6  
ATOM   10369 N N1     . DG  B 1 8  ? -3.803  5.929   -7.998  1.00 0.00 ? 120 DG  C N1     6  
ATOM   10370 C C2     . DG  B 1 8  ? -4.660  5.583   -9.023  1.00 0.00 ? 120 DG  C C2     6  
ATOM   10371 N N2     . DG  B 1 8  ? -5.960  5.593   -8.733  1.00 0.00 ? 120 DG  C N2     6  
ATOM   10372 N N3     . DG  B 1 8  ? -4.250  5.251   -10.251 1.00 0.00 ? 120 DG  C N3     6  
ATOM   10373 C C4     . DG  B 1 8  ? -2.904  5.291   -10.369 1.00 0.00 ? 120 DG  C C4     6  
ATOM   10374 H "H5'"  . DG  B 1 8  ? -0.206  1.938   -14.387 1.00 0.00 ? 120 DG  C "H5'"  6  
ATOM   10375 H "H5''" . DG  B 1 8  ? -0.088  2.903   -15.872 1.00 0.00 ? 120 DG  C "H5''" 6  
ATOM   10376 H "H4'"  . DG  B 1 8  ? -2.413  2.782   -15.196 1.00 0.00 ? 120 DG  C "H4'"  6  
ATOM   10377 H "H3'"  . DG  B 1 8  ? -0.932  5.267   -15.337 1.00 0.00 ? 120 DG  C "H3'"  6  
ATOM   10378 H "H2'"  . DG  B 1 8  ? -1.727  6.330   -13.525 1.00 0.00 ? 120 DG  C "H2'"  6  
ATOM   10379 H "H2''" . DG  B 1 8  ? -3.386  6.108   -14.148 1.00 0.00 ? 120 DG  C "H2''" 6  
ATOM   10380 H "H1'"  . DG  B 1 8  ? -3.794  4.431   -12.710 1.00 0.00 ? 120 DG  C "H1'"  6  
ATOM   10381 H H8     . DG  B 1 8  ? -0.092  5.014   -11.834 1.00 0.00 ? 120 DG  C H8     6  
ATOM   10382 H H1     . DG  B 1 8  ? -4.181  6.160   -7.124  1.00 0.00 ? 120 DG  C H1     6  
ATOM   10383 H H21    . DG  B 1 8  ? -6.269  5.845   -7.806  1.00 0.00 ? 120 DG  C H21    6  
ATOM   10384 H H22    . DG  B 1 8  ? -6.638  5.349   -9.442  1.00 0.00 ? 120 DG  C H22    6  
ATOM   10385 P P      . DA  B 1 9  ? -3.558  6.304   -16.557 1.00 0.00 ? 121 DA  C P      6  
ATOM   10386 O OP1    . DA  B 1 9  ? -4.392  6.066   -17.756 1.00 0.00 ? 121 DA  C OP1    6  
ATOM   10387 O OP2    . DA  B 1 9  ? -2.561  7.399   -16.557 1.00 0.00 ? 121 DA  C OP2    6  
ATOM   10388 O "O5'"  . DA  B 1 9  ? -4.536  6.511   -15.294 1.00 0.00 ? 121 DA  C "O5'"  6  
ATOM   10389 C "C5'"  . DA  B 1 9  ? -5.740  5.747   -15.169 1.00 0.00 ? 121 DA  C "C5'"  6  
ATOM   10390 C "C4'"  . DA  B 1 9  ? -6.922  6.634   -14.796 1.00 0.00 ? 121 DA  C "C4'"  6  
ATOM   10391 O "O4'"  . DA  B 1 9  ? -6.965  6.851   -13.368 1.00 0.00 ? 121 DA  C "O4'"  6  
ATOM   10392 C "C3'"  . DA  B 1 9  ? -6.802  7.986   -15.479 1.00 0.00 ? 121 DA  C "C3'"  6  
ATOM   10393 O "O3'"  . DA  B 1 9  ? -7.998  8.297   -16.203 1.00 0.00 ? 121 DA  C "O3'"  6  
ATOM   10394 C "C2'"  . DA  B 1 9  ? -6.557  8.982   -14.375 1.00 0.00 ? 121 DA  C "C2'"  6  
ATOM   10395 C "C1'"  . DA  B 1 9  ? -6.699  8.236   -13.062 1.00 0.00 ? 121 DA  C "C1'"  6  
ATOM   10396 N N9     . DA  B 1 9  ? -5.472  8.366   -12.269 1.00 0.00 ? 121 DA  C N9     6  
ATOM   10397 C C8     . DA  B 1 9  ? -4.197  8.236   -12.670 1.00 0.00 ? 121 DA  C C8     6  
ATOM   10398 N N7     . DA  B 1 9  ? -3.269  8.381   -11.783 1.00 0.00 ? 121 DA  C N7     6  
ATOM   10399 C C5     . DA  B 1 9  ? -4.023  8.647   -10.636 1.00 0.00 ? 121 DA  C C5     6  
ATOM   10400 C C6     . DA  B 1 9  ? -3.671  8.908   -9.307  1.00 0.00 ? 121 DA  C C6     6  
ATOM   10401 N N6     . DA  B 1 9  ? -2.408  8.945   -8.882  1.00 0.00 ? 121 DA  C N6     6  
ATOM   10402 N N1     . DA  B 1 9  ? -4.669  9.128   -8.434  1.00 0.00 ? 121 DA  C N1     6  
ATOM   10403 C C2     . DA  B 1 9  ? -5.941  9.097   -8.838  1.00 0.00 ? 121 DA  C C2     6  
ATOM   10404 N N3     . DA  B 1 9  ? -6.387  8.859   -10.068 1.00 0.00 ? 121 DA  C N3     6  
ATOM   10405 C C4     . DA  B 1 9  ? -5.368  8.641   -10.925 1.00 0.00 ? 121 DA  C C4     6  
ATOM   10406 H "H5'"  . DA  B 1 9  ? -5.602  4.992   -14.395 1.00 0.00 ? 121 DA  C "H5'"  6  
ATOM   10407 H "H5''" . DA  B 1 9  ? -5.948  5.253   -16.118 1.00 0.00 ? 121 DA  C "H5''" 6  
ATOM   10408 H "H4'"  . DA  B 1 9  ? -7.847  6.151   -15.113 1.00 0.00 ? 121 DA  C "H4'"  6  
ATOM   10409 H "H3'"  . DA  B 1 9  ? -5.946  7.978   -16.158 1.00 0.00 ? 121 DA  C "H3'"  6  
ATOM   10410 H "H2'"  . DA  B 1 9  ? -5.550  9.390   -14.462 1.00 0.00 ? 121 DA  C "H2'"  6  
ATOM   10411 H "H2''" . DA  B 1 9  ? -7.284  9.783   -14.425 1.00 0.00 ? 121 DA  C "H2''" 6  
ATOM   10412 H "H1'"  . DA  B 1 9  ? -7.531  8.649   -12.500 1.00 0.00 ? 121 DA  C "H1'"  6  
ATOM   10413 H H8     . DA  B 1 9  ? -3.965  8.029   -13.711 1.00 0.00 ? 121 DA  C H8     6  
ATOM   10414 H H61    . DA  B 1 9  ? -2.207  9.137   -7.911  1.00 0.00 ? 121 DA  C H61    6  
ATOM   10415 H H62    . DA  B 1 9  ? -1.652  8.781   -9.531  1.00 0.00 ? 121 DA  C H62    6  
ATOM   10416 H H2     . DA  B 1 9  ? -6.697  9.291   -8.076  1.00 0.00 ? 121 DA  C H2     6  
ATOM   10417 P P      . DT  B 1 10 ? -8.336  9.814   -16.627 1.00 0.00 ? 122 DT  C P      6  
ATOM   10418 O OP1    . DT  B 1 10 ? -9.316  9.779   -17.735 1.00 0.00 ? 122 DT  C OP1    6  
ATOM   10419 O OP2    . DT  B 1 10 ? -7.059  10.544  -16.792 1.00 0.00 ? 122 DT  C OP2    6  
ATOM   10420 O "O5'"  . DT  B 1 10 ? -9.076  10.384  -15.316 1.00 0.00 ? 122 DT  C "O5'"  6  
ATOM   10421 C "C5'"  . DT  B 1 10 ? -9.729  9.492   -14.405 1.00 0.00 ? 122 DT  C "C5'"  6  
ATOM   10422 C "C4'"  . DT  B 1 10 ? -10.290 10.236  -13.196 1.00 0.00 ? 122 DT  C "C4'"  6  
ATOM   10423 O "O4'"  . DT  B 1 10 ? -9.327  10.261  -12.120 1.00 0.00 ? 122 DT  C "O4'"  6  
ATOM   10424 C "C3'"  . DT  B 1 10 ? -10.635 11.672  -13.563 1.00 0.00 ? 122 DT  C "C3'"  6  
ATOM   10425 O "O3'"  . DT  B 1 10 ? -12.016 11.943  -13.294 1.00 0.00 ? 122 DT  C "O3'"  6  
ATOM   10426 C "C2'"  . DT  B 1 10 ? -9.736  12.541  -12.720 1.00 0.00 ? 122 DT  C "C2'"  6  
ATOM   10427 C "C1'"  . DT  B 1 10 ? -8.997  11.621  -11.766 1.00 0.00 ? 122 DT  C "C1'"  6  
ATOM   10428 N N1     . DT  B 1 10 ? -7.542  11.844  -11.845 1.00 0.00 ? 122 DT  C N1     6  
ATOM   10429 C C2     . DT  B 1 10 ? -6.868  12.074  -10.662 1.00 0.00 ? 122 DT  C C2     6  
ATOM   10430 O O2     . DT  B 1 10 ? -7.438  12.114  -9.590  1.00 0.00 ? 122 DT  C O2     6  
ATOM   10431 N N3     . DT  B 1 10 ? -5.502  12.260  -10.769 1.00 0.00 ? 122 DT  C N3     6  
ATOM   10432 C C4     . DT  B 1 10 ? -4.766  12.233  -11.940 1.00 0.00 ? 122 DT  C C4     6  
ATOM   10433 O O4     . DT  B 1 10 ? -3.564  12.408  -11.921 1.00 0.00 ? 122 DT  C O4     6  
ATOM   10434 C C5     . DT  B 1 10 ? -5.557  11.986  -13.125 1.00 0.00 ? 122 DT  C C5     6  
ATOM   10435 C C7     . DT  B 1 10 ? -4.871  11.928  -14.485 1.00 0.00 ? 122 DT  C C7     6  
ATOM   10436 C C6     . DT  B 1 10 ? -6.890  11.804  -13.045 1.00 0.00 ? 122 DT  C C6     6  
ATOM   10437 H "H5'"  . DT  B 1 10 ? -9.011  8.748   -14.062 1.00 0.00 ? 122 DT  C "H5'"  6  
ATOM   10438 H "H5''" . DT  B 1 10 ? -10.545 8.989   -14.923 1.00 0.00 ? 122 DT  C "H5''" 6  
ATOM   10439 H "H4'"  . DT  B 1 10 ? -11.192 9.729   -12.854 1.00 0.00 ? 122 DT  C "H4'"  6  
ATOM   10440 H "H3'"  . DT  B 1 10 ? -10.420 11.842  -14.620 1.00 0.00 ? 122 DT  C "H3'"  6  
ATOM   10441 H "H2'"  . DT  B 1 10 ? -9.023  13.066  -13.357 1.00 0.00 ? 122 DT  C "H2'"  6  
ATOM   10442 H "H2''" . DT  B 1 10 ? -10.328 13.258  -12.158 1.00 0.00 ? 122 DT  C "H2''" 6  
ATOM   10443 H "H1'"  . DT  B 1 10 ? -9.332  11.817  -10.748 1.00 0.00 ? 122 DT  C "H1'"  6  
ATOM   10444 H H3     . DT  B 1 10 ? -5.011  12.426  -9.938  1.00 0.00 ? 122 DT  C H3     6  
ATOM   10445 H H71    . DT  B 1 10 ? -5.569  11.538  -15.228 1.00 0.00 ? 122 DT  C H71    6  
ATOM   10446 H H72    . DT  B 1 10 ? -4.553  12.929  -14.775 1.00 0.00 ? 122 DT  C H72    6  
ATOM   10447 H H73    . DT  B 1 10 ? -4.003  11.272  -14.427 1.00 0.00 ? 122 DT  C H73    6  
ATOM   10448 H H6     . DT  B 1 10 ? -7.462  11.631  -13.955 1.00 0.00 ? 122 DT  C H6     6  
ATOM   10449 P P      . DA  B 1 11 ? -12.558 13.457  -13.207 1.00 0.00 ? 123 DA  C P      6  
ATOM   10450 O OP1    . DA  B 1 11 ? -14.009 13.414  -12.920 1.00 0.00 ? 123 DA  C OP1    6  
ATOM   10451 O OP2    . DA  B 1 11 ? -12.061 14.195  -14.389 1.00 0.00 ? 123 DA  C OP2    6  
ATOM   10452 O "O5'"  . DA  B 1 11 ? -11.802 14.025  -11.904 1.00 0.00 ? 123 DA  C "O5'"  6  
ATOM   10453 C "C5'"  . DA  B 1 11 ? -12.199 13.615  -10.592 1.00 0.00 ? 123 DA  C "C5'"  6  
ATOM   10454 C "C4'"  . DA  B 1 11 ? -11.970 14.724  -9.571  1.00 0.00 ? 123 DA  C "C4'"  6  
ATOM   10455 O "O4'"  . DA  B 1 11 ? -10.618 14.674  -9.060  1.00 0.00 ? 123 DA  C "O4'"  6  
ATOM   10456 C "C3'"  . DA  B 1 11 ? -12.189 16.085  -10.212 1.00 0.00 ? 123 DA  C "C3'"  6  
ATOM   10457 O "O3'"  . DA  B 1 11 ? -13.198 16.822  -9.513  1.00 0.00 ? 123 DA  C "O3'"  6  
ATOM   10458 C "C2'"  . DA  B 1 11 ? -10.862 16.794  -10.146 1.00 0.00 ? 123 DA  C "C2'"  6  
ATOM   10459 C "C1'"  . DA  B 1 11 ? -9.919  15.901  -9.361  1.00 0.00 ? 123 DA  C "C1'"  6  
ATOM   10460 N N9     . DA  B 1 11 ? -8.703  15.636  -10.139 1.00 0.00 ? 123 DA  C N9     6  
ATOM   10461 C C8     . DA  B 1 11 ? -8.583  15.331  -11.445 1.00 0.00 ? 123 DA  C C8     6  
ATOM   10462 N N7     . DA  B 1 11 ? -7.394  15.142  -11.910 1.00 0.00 ? 123 DA  C N7     6  
ATOM   10463 C C5     . DA  B 1 11 ? -6.613  15.350  -10.768 1.00 0.00 ? 123 DA  C C5     6  
ATOM   10464 C C6     . DA  B 1 11 ? -5.232  15.312  -10.541 1.00 0.00 ? 123 DA  C C6     6  
ATOM   10465 N N6     . DA  B 1 11 ? -4.342  15.032  -11.494 1.00 0.00 ? 123 DA  C N6     6  
ATOM   10466 N N1     . DA  B 1 11 ? -4.804  15.571  -9.293  1.00 0.00 ? 123 DA  C N1     6  
ATOM   10467 C C2     . DA  B 1 11 ? -5.677  15.851  -8.323  1.00 0.00 ? 123 DA  C C2     6  
ATOM   10468 N N3     . DA  B 1 11 ? -7.000  15.915  -8.427  1.00 0.00 ? 123 DA  C N3     6  
ATOM   10469 C C4     . DA  B 1 11 ? -7.405  15.652  -9.685  1.00 0.00 ? 123 DA  C C4     6  
ATOM   10470 H "H5'"  . DA  B 1 11 ? -11.619 12.738  -10.303 1.00 0.00 ? 123 DA  C "H5'"  6  
ATOM   10471 H "H5''" . DA  B 1 11 ? -13.257 13.355  -10.605 1.00 0.00 ? 123 DA  C "H5''" 6  
ATOM   10472 H "H4'"  . DA  B 1 11 ? -12.669 14.600  -8.744  1.00 0.00 ? 123 DA  C "H4'"  6  
ATOM   10473 H "H3'"  . DA  B 1 11 ? -12.479 15.954  -11.256 1.00 0.00 ? 123 DA  C "H3'"  6  
ATOM   10474 H "H2'"  . DA  B 1 11 ? -10.475 16.948  -11.153 1.00 0.00 ? 123 DA  C "H2'"  6  
ATOM   10475 H "H2''" . DA  B 1 11 ? -10.974 17.750  -9.643  1.00 0.00 ? 123 DA  C "H2''" 6  
ATOM   10476 H "H1'"  . DA  B 1 11 ? -9.645  16.394  -8.435  1.00 0.00 ? 123 DA  C "H1'"  6  
ATOM   10477 H H8     . DA  B 1 11 ? -9.462  15.265  -12.080 1.00 0.00 ? 123 DA  C H8     6  
ATOM   10478 H H61    . DA  B 1 11 ? -3.356  15.017  -11.276 1.00 0.00 ? 123 DA  C H61    6  
ATOM   10479 H H62    . DA  B 1 11 ? -4.654  14.837  -12.434 1.00 0.00 ? 123 DA  C H62    6  
ATOM   10480 H H2     . DA  B 1 11 ? -5.258  16.049  -7.337  1.00 0.00 ? 123 DA  C H2     6  
ATOM   10481 P P      . DC  B 1 12 ? -14.187 17.810  -10.311 1.00 0.00 ? 124 DC  C P      6  
ATOM   10482 O OP1    . DC  B 1 12 ? -15.564 17.583  -9.820  1.00 0.00 ? 124 DC  C OP1    6  
ATOM   10483 O OP2    . DC  B 1 12 ? -13.891 17.694  -11.758 1.00 0.00 ? 124 DC  C OP2    6  
ATOM   10484 O "O5'"  . DC  B 1 12 ? -13.706 19.263  -9.813  1.00 0.00 ? 124 DC  C "O5'"  6  
ATOM   10485 C "C5'"  . DC  B 1 12 ? -13.396 19.490  -8.435  1.00 0.00 ? 124 DC  C "C5'"  6  
ATOM   10486 C "C4'"  . DC  B 1 12 ? -12.365 20.602  -8.268  1.00 0.00 ? 124 DC  C "C4'"  6  
ATOM   10487 O "O4'"  . DC  B 1 12 ? -11.029 20.094  -8.455  1.00 0.00 ? 124 DC  C "O4'"  6  
ATOM   10488 C "C3'"  . DC  B 1 12 ? -12.597 21.714  -9.279  1.00 0.00 ? 124 DC  C "C3'"  6  
ATOM   10489 O "O3'"  . DC  B 1 12 ? -13.072 22.901  -8.636  1.00 0.00 ? 124 DC  C "O3'"  6  
ATOM   10490 C "C2'"  . DC  B 1 12 ? -11.264 21.956  -9.938  1.00 0.00 ? 124 DC  C "C2'"  6  
ATOM   10491 C "C1'"  . DC  B 1 12 ? -10.284 20.970  -9.323  1.00 0.00 ? 124 DC  C "C1'"  6  
ATOM   10492 N N1     . DC  B 1 12 ? -9.574  20.201  -10.366 1.00 0.00 ? 124 DC  C N1     6  
ATOM   10493 C C2     . DC  B 1 12 ? -8.197  20.094  -10.254 1.00 0.00 ? 124 DC  C C2     6  
ATOM   10494 O O2     . DC  B 1 12 ? -7.617  20.624  -9.326  1.00 0.00 ? 124 DC  C O2     6  
ATOM   10495 N N3     . DC  B 1 12 ? -7.525  19.387  -11.203 1.00 0.00 ? 124 DC  C N3     6  
ATOM   10496 C C4     . DC  B 1 12 ? -8.177  18.809  -12.221 1.00 0.00 ? 124 DC  C C4     6  
ATOM   10497 N N4     . DC  B 1 12 ? -7.488  18.120  -13.131 1.00 0.00 ? 124 DC  C N4     6  
ATOM   10498 C C5     . DC  B 1 12 ? -9.598  18.918  -12.341 1.00 0.00 ? 124 DC  C C5     6  
ATOM   10499 C C6     . DC  B 1 12 ? -10.254 19.619  -11.396 1.00 0.00 ? 124 DC  C C6     6  
ATOM   10500 H "H5'"  . DC  B 1 12 ? -13.001 18.571  -8.004  1.00 0.00 ? 124 DC  C "H5'"  6  
ATOM   10501 H "H5''" . DC  B 1 12 ? -14.308 19.769  -7.908  1.00 0.00 ? 124 DC  C "H5''" 6  
ATOM   10502 H "H4'"  . DC  B 1 12 ? -12.445 21.015  -7.264  1.00 0.00 ? 124 DC  C "H4'"  6  
ATOM   10503 H "H3'"  . DC  B 1 12 ? -13.318 21.381  -10.028 1.00 0.00 ? 124 DC  C "H3'"  6  
ATOM   10504 H "HO3'" . DC  B 1 12 ? -13.838 23.205  -9.129  1.00 0.00 ? 124 DC  C "HO3'" 6  
ATOM   10505 H "H2'"  . DC  B 1 12 ? -11.341 21.784  -11.012 1.00 0.00 ? 124 DC  C "H2'"  6  
ATOM   10506 H "H2''" . DC  B 1 12 ? -10.934 22.977  -9.747  1.00 0.00 ? 124 DC  C "H2''" 6  
ATOM   10507 H "H1'"  . DC  B 1 12 ? -9.557  21.519  -8.728  1.00 0.00 ? 124 DC  C "H1'"  6  
ATOM   10508 H H41    . DC  B 1 12 ? -6.485  18.041  -13.052 1.00 0.00 ? 124 DC  C H41    6  
ATOM   10509 H H42    . DC  B 1 12 ? -7.971  17.679  -13.900 1.00 0.00 ? 124 DC  C H42    6  
ATOM   10510 H H5     . DC  B 1 12 ? -10.132 18.448  -13.167 1.00 0.00 ? 124 DC  C H5     6  
ATOM   10511 H H6     . DC  B 1 12 ? -11.337 19.723  -11.456 1.00 0.00 ? 124 DC  C H6     6  
ATOM   10512 N N      . MET C 2 1  ? -4.850  14.916  3.917   1.00 0.00 ? 1   MET A N      6  
ATOM   10513 C CA     . MET C 2 1  ? -4.160  13.818  4.664   1.00 0.00 ? 1   MET A CA     6  
ATOM   10514 C C      . MET C 2 1  ? -4.712  13.709  6.089   1.00 0.00 ? 1   MET A C      6  
ATOM   10515 O O      . MET C 2 1  ? -3.982  13.812  7.057   1.00 0.00 ? 1   MET A O      6  
ATOM   10516 C CB     . MET C 2 1  ? -2.683  14.219  4.688   1.00 0.00 ? 1   MET A CB     6  
ATOM   10517 C CG     . MET C 2 1  ? -2.158  14.349  3.253   1.00 0.00 ? 1   MET A CG     6  
ATOM   10518 S SD     . MET C 2 1  ? -1.112  12.925  2.855   1.00 0.00 ? 1   MET A SD     6  
ATOM   10519 C CE     . MET C 2 1  ? 0.482   13.724  3.155   1.00 0.00 ? 1   MET A CE     6  
ATOM   10520 H H      . MET C 2 1  ? -5.232  14.737  3.033   1.00 0.00 ? 1   MET A H      6  
ATOM   10521 H HA     . MET C 2 1  ? -4.277  12.880  4.143   1.00 0.00 ? 1   MET A HA     6  
ATOM   10522 H HB2    . MET C 2 1  ? -2.577  15.166  5.196   1.00 0.00 ? 1   MET A HB2    6  
ATOM   10523 H HB3    . MET C 2 1  ? -2.115  13.464  5.212   1.00 0.00 ? 1   MET A HB3    6  
ATOM   10524 H HG2    . MET C 2 1  ? -2.990  14.386  2.567   1.00 0.00 ? 1   MET A HG2    6  
ATOM   10525 H HG3    . MET C 2 1  ? -1.579  15.256  3.165   1.00 0.00 ? 1   MET A HG3    6  
ATOM   10526 H HE1    . MET C 2 1  ? 0.680   13.740  4.219   1.00 0.00 ? 1   MET A HE1    6  
ATOM   10527 H HE2    . MET C 2 1  ? 0.457   14.735  2.782   1.00 0.00 ? 1   MET A HE2    6  
ATOM   10528 H HE3    . MET C 2 1  ? 1.261   13.173  2.647   1.00 0.00 ? 1   MET A HE3    6  
ATOM   10529 N N      . ALA C 2 2  ? -5.994  13.502  6.225   1.00 0.00 ? 2   ALA A N      6  
ATOM   10530 C CA     . ALA C 2 2  ? -6.592  13.387  7.587   1.00 0.00 ? 2   ALA A CA     6  
ATOM   10531 C C      . ALA C 2 2  ? -7.547  12.192  7.657   1.00 0.00 ? 2   ALA A C      6  
ATOM   10532 O O      . ALA C 2 2  ? -8.349  12.083  8.564   1.00 0.00 ? 2   ALA A O      6  
ATOM   10533 C CB     . ALA C 2 2  ? -7.356  14.694  7.796   1.00 0.00 ? 2   ALA A CB     6  
ATOM   10534 H H      . ALA C 2 2  ? -6.565  13.423  5.432   1.00 0.00 ? 2   ALA A H      6  
ATOM   10535 H HA     . ALA C 2 2  ? -5.817  13.293  8.331   1.00 0.00 ? 2   ALA A HA     6  
ATOM   10536 H HB1    . ALA C 2 2  ? -7.736  15.044  6.848   1.00 0.00 ? 2   ALA A HB1    6  
ATOM   10537 H HB2    . ALA C 2 2  ? -6.693  15.436  8.215   1.00 0.00 ? 2   ALA A HB2    6  
ATOM   10538 H HB3    . ALA C 2 2  ? -8.180  14.524  8.473   1.00 0.00 ? 2   ALA A HB3    6  
ATOM   10539 N N      . GLU C 2 3  ? -7.470  11.294  6.710   1.00 0.00 ? 3   GLU A N      6  
ATOM   10540 C CA     . GLU C 2 3  ? -8.377  10.109  6.734   1.00 0.00 ? 3   GLU A CA     6  
ATOM   10541 C C      . GLU C 2 3  ? -8.094  9.263   7.977   1.00 0.00 ? 3   GLU A C      6  
ATOM   10542 O O      . GLU C 2 3  ? -8.987  8.938   8.734   1.00 0.00 ? 3   GLU A O      6  
ATOM   10543 C CB     . GLU C 2 3  ? -8.048  9.325   5.460   1.00 0.00 ? 3   GLU A CB     6  
ATOM   10544 C CG     . GLU C 2 3  ? -9.345  8.894   4.773   1.00 0.00 ? 3   GLU A CG     6  
ATOM   10545 C CD     . GLU C 2 3  ? -9.972  10.096  4.064   1.00 0.00 ? 3   GLU A CD     6  
ATOM   10546 O OE1    . GLU C 2 3  ? -9.240  10.820  3.410   1.00 0.00 ? 3   GLU A OE1    6  
ATOM   10547 O OE2    . GLU C 2 3  ? -11.172 10.271  4.187   1.00 0.00 ? 3   GLU A OE2    6  
ATOM   10548 H H      . GLU C 2 3  ? -6.815  11.397  5.988   1.00 0.00 ? 3   GLU A H      6  
ATOM   10549 H HA     . GLU C 2 3  ? -9.408  10.424  6.718   1.00 0.00 ? 3   GLU A HA     6  
ATOM   10550 H HB2    . GLU C 2 3  ? -7.476  9.950   4.790   1.00 0.00 ? 3   GLU A HB2    6  
ATOM   10551 H HB3    . GLU C 2 3  ? -7.470  8.448   5.715   1.00 0.00 ? 3   GLU A HB3    6  
ATOM   10552 H HG2    . GLU C 2 3  ? -9.130  8.120   4.051   1.00 0.00 ? 3   GLU A HG2    6  
ATOM   10553 H HG3    . GLU C 2 3  ? -10.035 8.515   5.512   1.00 0.00 ? 3   GLU A HG3    6  
ATOM   10554 N N      . ASP C 2 4  ? -6.854  8.910   8.193   1.00 0.00 ? 4   ASP A N      6  
ATOM   10555 C CA     . ASP C 2 4  ? -6.497  8.086   9.389   1.00 0.00 ? 4   ASP A CA     6  
ATOM   10556 C C      . ASP C 2 4  ? -4.990  7.803   9.401   1.00 0.00 ? 4   ASP A C      6  
ATOM   10557 O O      . ASP C 2 4  ? -4.562  6.667   9.360   1.00 0.00 ? 4   ASP A O      6  
ATOM   10558 C CB     . ASP C 2 4  ? -7.288  6.781   9.236   1.00 0.00 ? 4   ASP A CB     6  
ATOM   10559 C CG     . ASP C 2 4  ? -8.434  6.751   10.249  1.00 0.00 ? 4   ASP A CG     6  
ATOM   10560 O OD1    . ASP C 2 4  ? -8.151  6.769   11.435  1.00 0.00 ? 4   ASP A OD1    6  
ATOM   10561 O OD2    . ASP C 2 4  ? -9.576  6.711   9.821   1.00 0.00 ? 4   ASP A OD2    6  
ATOM   10562 H H      . ASP C 2 4  ? -6.152  9.190   7.568   1.00 0.00 ? 4   ASP A H      6  
ATOM   10563 H HA     . ASP C 2 4  ? -6.791  8.592   10.295  1.00 0.00 ? 4   ASP A HA     6  
ATOM   10564 H HB2    . ASP C 2 4  ? -7.689  6.720   8.235   1.00 0.00 ? 4   ASP A HB2    6  
ATOM   10565 H HB3    . ASP C 2 4  ? -6.635  5.939   9.412   1.00 0.00 ? 4   ASP A HB3    6  
ATOM   10566 N N      . TRP C 2 5  ? -4.182  8.830   9.456   1.00 0.00 ? 5   TRP A N      6  
ATOM   10567 C CA     . TRP C 2 5  ? -2.705  8.613   9.470   1.00 0.00 ? 5   TRP A CA     6  
ATOM   10568 C C      . TRP C 2 5  ? -2.241  8.228   10.875  1.00 0.00 ? 5   TRP A C      6  
ATOM   10569 O O      . TRP C 2 5  ? -1.989  9.076   11.710  1.00 0.00 ? 5   TRP A O      6  
ATOM   10570 C CB     . TRP C 2 5  ? -2.097  9.954   9.056   1.00 0.00 ? 5   TRP A CB     6  
ATOM   10571 C CG     . TRP C 2 5  ? -1.921  9.989   7.572   1.00 0.00 ? 5   TRP A CG     6  
ATOM   10572 C CD1    . TRP C 2 5  ? -2.331  10.993  6.764   1.00 0.00 ? 5   TRP A CD1    6  
ATOM   10573 C CD2    . TRP C 2 5  ? -1.296  8.997   6.706   1.00 0.00 ? 5   TRP A CD2    6  
ATOM   10574 N NE1    . TRP C 2 5  ? -1.999  10.682  5.459   1.00 0.00 ? 5   TRP A NE1    6  
ATOM   10575 C CE2    . TRP C 2 5  ? -1.359  9.462   5.370   1.00 0.00 ? 5   TRP A CE2    6  
ATOM   10576 C CE3    . TRP C 2 5  ? -0.687  7.752   6.946   1.00 0.00 ? 5   TRP A CE3    6  
ATOM   10577 C CZ2    . TRP C 2 5  ? -0.837  8.717   4.312   1.00 0.00 ? 5   TRP A CZ2    6  
ATOM   10578 C CZ3    . TRP C 2 5  ? -0.160  7.000   5.883   1.00 0.00 ? 5   TRP A CZ3    6  
ATOM   10579 C CH2    . TRP C 2 5  ? -0.235  7.483   4.568   1.00 0.00 ? 5   TRP A CH2    6  
ATOM   10580 H H      . TRP C 2 5  ? -4.545  9.739   9.488   1.00 0.00 ? 5   TRP A H      6  
ATOM   10581 H HA     . TRP C 2 5  ? -2.430  7.851   8.760   1.00 0.00 ? 5   TRP A HA     6  
ATOM   10582 H HB2    . TRP C 2 5  ? -2.751  10.757  9.361   1.00 0.00 ? 5   TRP A HB2    6  
ATOM   10583 H HB3    . TRP C 2 5  ? -1.134  10.072  9.534   1.00 0.00 ? 5   TRP A HB3    6  
ATOM   10584 H HD1    . TRP C 2 5  ? -2.836  11.891  7.087   1.00 0.00 ? 5   TRP A HD1    6  
ATOM   10585 H HE1    . TRP C 2 5  ? -2.185  11.245  4.678   1.00 0.00 ? 5   TRP A HE1    6  
ATOM   10586 H HE3    . TRP C 2 5  ? -0.624  7.372   7.955   1.00 0.00 ? 5   TRP A HE3    6  
ATOM   10587 H HZ2    . TRP C 2 5  ? -0.897  9.093   3.301   1.00 0.00 ? 5   TRP A HZ2    6  
ATOM   10588 H HZ3    . TRP C 2 5  ? 0.305   6.046   6.079   1.00 0.00 ? 5   TRP A HZ3    6  
ATOM   10589 H HH2    . TRP C 2 5  ? 0.172   6.901   3.756   1.00 0.00 ? 5   TRP A HH2    6  
ATOM   10590 N N      . LEU C 2 6  ? -2.122  6.957   11.141  1.00 0.00 ? 6   LEU A N      6  
ATOM   10591 C CA     . LEU C 2 6  ? -1.670  6.512   12.490  1.00 0.00 ? 6   LEU A CA     6  
ATOM   10592 C C      . LEU C 2 6  ? -0.181  6.163   12.449  1.00 0.00 ? 6   LEU A C      6  
ATOM   10593 O O      . LEU C 2 6  ? 0.326   5.694   11.451  1.00 0.00 ? 6   LEU A O      6  
ATOM   10594 C CB     . LEU C 2 6  ? -2.505  5.270   12.800  1.00 0.00 ? 6   LEU A CB     6  
ATOM   10595 C CG     . LEU C 2 6  ? -3.949  5.681   13.094  1.00 0.00 ? 6   LEU A CG     6  
ATOM   10596 C CD1    . LEU C 2 6  ? -4.814  4.430   13.252  1.00 0.00 ? 6   LEU A CD1    6  
ATOM   10597 C CD2    . LEU C 2 6  ? -3.994  6.498   14.387  1.00 0.00 ? 6   LEU A CD2    6  
ATOM   10598 H H      . LEU C 2 6  ? -2.328  6.291   10.451  1.00 0.00 ? 6   LEU A H      6  
ATOM   10599 H HA     . LEU C 2 6  ? -1.859  7.279   13.224  1.00 0.00 ? 6   LEU A HA     6  
ATOM   10600 H HB2    . LEU C 2 6  ? -2.486  4.602   11.951  1.00 0.00 ? 6   LEU A HB2    6  
ATOM   10601 H HB3    . LEU C 2 6  ? -2.095  4.767   13.664  1.00 0.00 ? 6   LEU A HB3    6  
ATOM   10602 H HG     . LEU C 2 6  ? -4.325  6.278   12.275  1.00 0.00 ? 6   LEU A HG     6  
ATOM   10603 H HD11   . LEU C 2 6  ? -5.855  4.716   13.308  1.00 0.00 ? 6   LEU A HD11   6  
ATOM   10604 H HD12   . LEU C 2 6  ? -4.534  3.911   14.156  1.00 0.00 ? 6   LEU A HD12   6  
ATOM   10605 H HD13   . LEU C 2 6  ? -4.666  3.780   12.402  1.00 0.00 ? 6   LEU A HD13   6  
ATOM   10606 H HD21   . LEU C 2 6  ? -3.690  7.513   14.184  1.00 0.00 ? 6   LEU A HD21   6  
ATOM   10607 H HD22   . LEU C 2 6  ? -3.325  6.059   15.113  1.00 0.00 ? 6   LEU A HD22   6  
ATOM   10608 H HD23   . LEU C 2 6  ? -5.001  6.495   14.780  1.00 0.00 ? 6   LEU A HD23   6  
ATOM   10609 N N      . ASP C 2 7  ? 0.522   6.392   13.526  1.00 0.00 ? 7   ASP A N      6  
ATOM   10610 C CA     . ASP C 2 7  ? 1.984   6.079   13.553  1.00 0.00 ? 7   ASP A CA     6  
ATOM   10611 C C      . ASP C 2 7  ? 2.245   4.656   13.047  1.00 0.00 ? 7   ASP A C      6  
ATOM   10612 O O      . ASP C 2 7  ? 1.337   3.861   12.896  1.00 0.00 ? 7   ASP A O      6  
ATOM   10613 C CB     . ASP C 2 7  ? 2.388   6.208   15.022  1.00 0.00 ? 7   ASP A CB     6  
ATOM   10614 C CG     . ASP C 2 7  ? 2.487   7.688   15.397  1.00 0.00 ? 7   ASP A CG     6  
ATOM   10615 O OD1    . ASP C 2 7  ? 3.234   8.396   14.742  1.00 0.00 ? 7   ASP A OD1    6  
ATOM   10616 O OD2    . ASP C 2 7  ? 1.814   8.088   16.333  1.00 0.00 ? 7   ASP A OD2    6  
ATOM   10617 H H      . ASP C 2 7  ? 0.092   6.776   14.316  1.00 0.00 ? 7   ASP A H      6  
ATOM   10618 H HA     . ASP C 2 7  ? 2.531   6.795   12.959  1.00 0.00 ? 7   ASP A HA     6  
ATOM   10619 H HB2    . ASP C 2 7  ? 1.646   5.727   15.642  1.00 0.00 ? 7   ASP A HB2    6  
ATOM   10620 H HB3    . ASP C 2 7  ? 3.347   5.735   15.174  1.00 0.00 ? 7   ASP A HB3    6  
ATOM   10621 N N      . CYS C 2 8  ? 3.483   4.334   12.787  1.00 0.00 ? 8   CYS A N      6  
ATOM   10622 C CA     . CYS C 2 8  ? 3.822   2.972   12.293  1.00 0.00 ? 8   CYS A CA     6  
ATOM   10623 C C      . CYS C 2 8  ? 5.168   2.532   12.878  1.00 0.00 ? 8   CYS A C      6  
ATOM   10624 O O      . CYS C 2 8  ? 6.200   2.700   12.258  1.00 0.00 ? 8   CYS A O      6  
ATOM   10625 C CB     . CYS C 2 8  ? 3.913   3.112   10.774  1.00 0.00 ? 8   CYS A CB     6  
ATOM   10626 S SG     . CYS C 2 8  ? 4.145   1.479   10.029  1.00 0.00 ? 8   CYS A SG     6  
ATOM   10627 H H      . CYS C 2 8  ? 4.192   4.992   12.920  1.00 0.00 ? 8   CYS A H      6  
ATOM   10628 H HA     . CYS C 2 8  ? 3.046   2.269   12.555  1.00 0.00 ? 8   CYS A HA     6  
ATOM   10629 H HB2    . CYS C 2 8  ? 3.002   3.554   10.397  1.00 0.00 ? 8   CYS A HB2    6  
ATOM   10630 H HB3    . CYS C 2 8  ? 4.751   3.745   10.521  1.00 0.00 ? 8   CYS A HB3    6  
ATOM   10631 H HG     . CYS C 2 8  ? 3.674   1.465   9.192   1.00 0.00 ? 8   CYS A HG     6  
ATOM   10632 N N      . PRO C 2 9  ? 5.111   1.982   14.063  1.00 0.00 ? 9   PRO A N      6  
ATOM   10633 C CA     . PRO C 2 9  ? 6.341   1.514   14.751  1.00 0.00 ? 9   PRO A CA     6  
ATOM   10634 C C      . PRO C 2 9  ? 6.919   0.273   14.071  1.00 0.00 ? 9   PRO A C      6  
ATOM   10635 O O      . PRO C 2 9  ? 8.001   -0.173  14.400  1.00 0.00 ? 9   PRO A O      6  
ATOM   10636 C CB     . PRO C 2 9  ? 5.862   1.169   16.154  1.00 0.00 ? 9   PRO A CB     6  
ATOM   10637 C CG     . PRO C 2 9  ? 4.400   0.892   16.007  1.00 0.00 ? 9   PRO A CG     6  
ATOM   10638 C CD     . PRO C 2 9  ? 3.907   1.743   14.868  1.00 0.00 ? 9   PRO A CD     6  
ATOM   10639 H HA     . PRO C 2 9  ? 7.075   2.300   14.796  1.00 0.00 ? 9   PRO A HA     6  
ATOM   10640 H HB2    . PRO C 2 9  ? 6.377   0.285   16.510  1.00 0.00 ? 9   PRO A HB2    6  
ATOM   10641 H HB3    . PRO C 2 9  ? 6.019   1.999   16.824  1.00 0.00 ? 9   PRO A HB3    6  
ATOM   10642 H HG2    . PRO C 2 9  ? 4.243   -0.153  15.786  1.00 0.00 ? 9   PRO A HG2    6  
ATOM   10643 H HG3    . PRO C 2 9  ? 3.880   1.164   16.912  1.00 0.00 ? 9   PRO A HG3    6  
ATOM   10644 H HD2    . PRO C 2 9  ? 3.162   1.209   14.294  1.00 0.00 ? 9   PRO A HD2    6  
ATOM   10645 H HD3    . PRO C 2 9  ? 3.511   2.676   15.234  1.00 0.00 ? 9   PRO A HD3    6  
ATOM   10646 N N      . ALA C 2 10 ? 6.208   -0.297  13.140  1.00 0.00 ? 10  ALA A N      6  
ATOM   10647 C CA     . ALA C 2 10 ? 6.725   -1.517  12.461  1.00 0.00 ? 10  ALA A CA     6  
ATOM   10648 C C      . ALA C 2 10 ? 8.048   -1.223  11.743  1.00 0.00 ? 10  ALA A C      6  
ATOM   10649 O O      . ALA C 2 10 ? 8.761   -2.126  11.353  1.00 0.00 ? 10  ALA A O      6  
ATOM   10650 C CB     . ALA C 2 10 ? 5.646   -1.901  11.448  1.00 0.00 ? 10  ALA A CB     6  
ATOM   10651 H H      . ALA C 2 10 ? 5.334   0.070   12.894  1.00 0.00 ? 10  ALA A H      6  
ATOM   10652 H HA     . ALA C 2 10 ? 6.853   -2.308  13.181  1.00 0.00 ? 10  ALA A HA     6  
ATOM   10653 H HB1    . ALA C 2 10 ? 4.762   -1.306  11.617  1.00 0.00 ? 10  ALA A HB1    6  
ATOM   10654 H HB2    . ALA C 2 10 ? 5.404   -2.947  11.559  1.00 0.00 ? 10  ALA A HB2    6  
ATOM   10655 H HB3    . ALA C 2 10 ? 6.013   -1.722  10.449  1.00 0.00 ? 10  ALA A HB3    6  
ATOM   10656 N N      . LEU C 2 11 ? 8.379   0.027   11.552  1.00 0.00 ? 11  LEU A N      6  
ATOM   10657 C CA     . LEU C 2 11 ? 9.653   0.356   10.848  1.00 0.00 ? 11  LEU A CA     6  
ATOM   10658 C C      . LEU C 2 11 ? 10.492  1.334   11.677  1.00 0.00 ? 11  LEU A C      6  
ATOM   10659 O O      . LEU C 2 11 ? 11.550  0.988   12.167  1.00 0.00 ? 11  LEU A O      6  
ATOM   10660 C CB     . LEU C 2 11 ? 9.215   0.996   9.533   1.00 0.00 ? 11  LEU A CB     6  
ATOM   10661 C CG     . LEU C 2 11 ? 8.491   -0.049  8.677   1.00 0.00 ? 11  LEU A CG     6  
ATOM   10662 C CD1    . LEU C 2 11 ? 7.073   0.434   8.364   1.00 0.00 ? 11  LEU A CD1    6  
ATOM   10663 C CD2    . LEU C 2 11 ? 9.257   -0.256  7.368   1.00 0.00 ? 11  LEU A CD2    6  
ATOM   10664 H H      . LEU C 2 11 ? 7.789   0.745   11.860  1.00 0.00 ? 11  LEU A H      6  
ATOM   10665 H HA     . LEU C 2 11 ? 10.213  -0.542  10.649  1.00 0.00 ? 11  LEU A HA     6  
ATOM   10666 H HB2    . LEU C 2 11 ? 8.548   1.821   9.739   1.00 0.00 ? 11  LEU A HB2    6  
ATOM   10667 H HB3    . LEU C 2 11 ? 10.083  1.358   9.002   1.00 0.00 ? 11  LEU A HB3    6  
ATOM   10668 H HG     . LEU C 2 11 ? 8.440   -0.986  9.216   1.00 0.00 ? 11  LEU A HG     6  
ATOM   10669 H HD11   . LEU C 2 11 ? 6.640   -0.192  7.598   1.00 0.00 ? 11  LEU A HD11   6  
ATOM   10670 H HD12   . LEU C 2 11 ? 7.109   1.455   8.016   1.00 0.00 ? 11  LEU A HD12   6  
ATOM   10671 H HD13   . LEU C 2 11 ? 6.469   0.379   9.258   1.00 0.00 ? 11  LEU A HD13   6  
ATOM   10672 H HD21   . LEU C 2 11 ? 9.147   0.620   6.745   1.00 0.00 ? 11  LEU A HD21   6  
ATOM   10673 H HD22   . LEU C 2 11 ? 8.860   -1.117  6.852   1.00 0.00 ? 11  LEU A HD22   6  
ATOM   10674 H HD23   . LEU C 2 11 ? 10.303  -0.414  7.584   1.00 0.00 ? 11  LEU A HD23   6  
ATOM   10675 N N      . GLY C 2 12 ? 10.037  2.549   11.835  1.00 0.00 ? 12  GLY A N      6  
ATOM   10676 C CA     . GLY C 2 12 ? 10.825  3.535   12.632  1.00 0.00 ? 12  GLY A CA     6  
ATOM   10677 C C      . GLY C 2 12 ? 10.079  4.871   12.707  1.00 0.00 ? 12  GLY A C      6  
ATOM   10678 O O      . GLY C 2 12 ? 8.926   4.960   12.333  1.00 0.00 ? 12  GLY A O      6  
ATOM   10679 H H      . GLY C 2 12 ? 9.183   2.811   11.432  1.00 0.00 ? 12  GLY A H      6  
ATOM   10680 H HA2    . GLY C 2 12 ? 10.974  3.151   13.630  1.00 0.00 ? 12  GLY A HA2    6  
ATOM   10681 H HA3    . GLY C 2 12 ? 11.784  3.691   12.161  1.00 0.00 ? 12  GLY A HA3    6  
ATOM   10682 N N      . PRO C 2 13 ? 10.769  5.874   13.198  1.00 0.00 ? 13  PRO A N      6  
ATOM   10683 C CA     . PRO C 2 13 ? 10.164  7.223   13.332  1.00 0.00 ? 13  PRO A CA     6  
ATOM   10684 C C      . PRO C 2 13 ? 10.032  7.897   11.963  1.00 0.00 ? 13  PRO A C      6  
ATOM   10685 O O      . PRO C 2 13 ? 11.009  8.288   11.354  1.00 0.00 ? 13  PRO A O      6  
ATOM   10686 C CB     . PRO C 2 13 ? 11.157  7.976   14.210  1.00 0.00 ? 13  PRO A CB     6  
ATOM   10687 C CG     . PRO C 2 13 ? 12.465  7.283   14.002  1.00 0.00 ? 13  PRO A CG     6  
ATOM   10688 C CD     . PRO C 2 13 ? 12.159  5.845   13.671  1.00 0.00 ? 13  PRO A CD     6  
ATOM   10689 H HA     . PRO C 2 13 ? 9.206   7.165   13.822  1.00 0.00 ? 13  PRO A HA     6  
ATOM   10690 H HB2    . PRO C 2 13 ? 11.223  9.010   13.899  1.00 0.00 ? 13  PRO A HB2    6  
ATOM   10691 H HB3    . PRO C 2 13 ? 10.866  7.913   15.248  1.00 0.00 ? 13  PRO A HB3    6  
ATOM   10692 H HG2    . PRO C 2 13 ? 13.001  7.746   13.185  1.00 0.00 ? 13  PRO A HG2    6  
ATOM   10693 H HG3    . PRO C 2 13 ? 13.055  7.329   14.904  1.00 0.00 ? 13  PRO A HG3    6  
ATOM   10694 H HD2    . PRO C 2 13 ? 12.821  5.489   12.892  1.00 0.00 ? 13  PRO A HD2    6  
ATOM   10695 H HD3    . PRO C 2 13 ? 12.241  5.227   14.551  1.00 0.00 ? 13  PRO A HD3    6  
ATOM   10696 N N      . GLY C 2 14 ? 8.829   8.033   11.478  1.00 0.00 ? 14  GLY A N      6  
ATOM   10697 C CA     . GLY C 2 14 ? 8.616   8.679   10.154  1.00 0.00 ? 14  GLY A CA     6  
ATOM   10698 C C      . GLY C 2 14 ? 7.505   7.936   9.409   1.00 0.00 ? 14  GLY A C      6  
ATOM   10699 O O      . GLY C 2 14 ? 6.702   8.529   8.715   1.00 0.00 ? 14  GLY A O      6  
ATOM   10700 H H      . GLY C 2 14 ? 8.061   7.707   11.988  1.00 0.00 ? 14  GLY A H      6  
ATOM   10701 H HA2    . GLY C 2 14 ? 8.334   9.712   10.296  1.00 0.00 ? 14  GLY A HA2    6  
ATOM   10702 H HA3    . GLY C 2 14 ? 9.532   8.629   9.571   1.00 0.00 ? 14  GLY A HA3    6  
ATOM   10703 N N      . TRP C 2 15 ? 7.470   6.637   9.536   1.00 0.00 ? 15  TRP A N      6  
ATOM   10704 C CA     . TRP C 2 15 ? 6.432   5.834   8.824   1.00 0.00 ? 15  TRP A CA     6  
ATOM   10705 C C      . TRP C 2 15 ? 5.029   6.155   9.342   1.00 0.00 ? 15  TRP A C      6  
ATOM   10706 O O      . TRP C 2 15 ? 4.814   6.331   10.525  1.00 0.00 ? 15  TRP A O      6  
ATOM   10707 C CB     . TRP C 2 15 ? 6.789   4.377   9.118   1.00 0.00 ? 15  TRP A CB     6  
ATOM   10708 C CG     . TRP C 2 15 ? 7.915   3.956   8.230   1.00 0.00 ? 15  TRP A CG     6  
ATOM   10709 C CD1    . TRP C 2 15 ? 9.218   3.919   8.592   1.00 0.00 ? 15  TRP A CD1    6  
ATOM   10710 C CD2    . TRP C 2 15 ? 7.861   3.517   6.843   1.00 0.00 ? 15  TRP A CD2    6  
ATOM   10711 N NE1    . TRP C 2 15 ? 9.968   3.486   7.512   1.00 0.00 ? 15  TRP A NE1    6  
ATOM   10712 C CE2    . TRP C 2 15 ? 9.177   3.225   6.412   1.00 0.00 ? 15  TRP A CE2    6  
ATOM   10713 C CE3    . TRP C 2 15 ? 6.810   3.346   5.924   1.00 0.00 ? 15  TRP A CE3    6  
ATOM   10714 C CZ2    . TRP C 2 15 ? 9.441   2.782   5.118   1.00 0.00 ? 15  TRP A CZ2    6  
ATOM   10715 C CZ3    . TRP C 2 15 ? 7.072   2.899   4.620   1.00 0.00 ? 15  TRP A CZ3    6  
ATOM   10716 C CH2    . TRP C 2 15 ? 8.387   2.618   4.218   1.00 0.00 ? 15  TRP A CH2    6  
ATOM   10717 H H      . TRP C 2 15 ? 8.141   6.185   10.090  1.00 0.00 ? 15  TRP A H      6  
ATOM   10718 H HA     . TRP C 2 15 ? 6.486   6.013   7.761   1.00 0.00 ? 15  TRP A HA     6  
ATOM   10719 H HB2    . TRP C 2 15 ? 7.090   4.280   10.151  1.00 0.00 ? 15  TRP A HB2    6  
ATOM   10720 H HB3    . TRP C 2 15 ? 5.930   3.750   8.931   1.00 0.00 ? 15  TRP A HB3    6  
ATOM   10721 H HD1    . TRP C 2 15 ? 9.609   4.184   9.563   1.00 0.00 ? 15  TRP A HD1    6  
ATOM   10722 H HE1    . TRP C 2 15 ? 10.940  3.371   7.509   1.00 0.00 ? 15  TRP A HE1    6  
ATOM   10723 H HE3    . TRP C 2 15 ? 5.795   3.560   6.224   1.00 0.00 ? 15  TRP A HE3    6  
ATOM   10724 H HZ2    . TRP C 2 15 ? 10.455  2.566   4.813   1.00 0.00 ? 15  TRP A HZ2    6  
ATOM   10725 H HZ3    . TRP C 2 15 ? 6.258   2.771   3.923   1.00 0.00 ? 15  TRP A HZ3    6  
ATOM   10726 H HH2    . TRP C 2 15 ? 8.584   2.273   3.214   1.00 0.00 ? 15  TRP A HH2    6  
ATOM   10727 N N      . LYS C 2 16 ? 4.074   6.216   8.454   1.00 0.00 ? 16  LYS A N      6  
ATOM   10728 C CA     . LYS C 2 16 ? 2.670   6.509   8.870   1.00 0.00 ? 16  LYS A CA     6  
ATOM   10729 C C      . LYS C 2 16 ? 1.723   5.500   8.212   1.00 0.00 ? 16  LYS A C      6  
ATOM   10730 O O      . LYS C 2 16 ? 1.982   5.012   7.131   1.00 0.00 ? 16  LYS A O      6  
ATOM   10731 C CB     . LYS C 2 16 ? 2.394   7.926   8.368   1.00 0.00 ? 16  LYS A CB     6  
ATOM   10732 C CG     . LYS C 2 16 ? 3.013   8.937   9.337   1.00 0.00 ? 16  LYS A CG     6  
ATOM   10733 C CD     . LYS C 2 16 ? 2.226   8.940   10.652  1.00 0.00 ? 16  LYS A CD     6  
ATOM   10734 C CE     . LYS C 2 16 ? 1.483   10.269  10.804  1.00 0.00 ? 16  LYS A CE     6  
ATOM   10735 N NZ     . LYS C 2 16 ? 2.407   11.140  11.582  1.00 0.00 ? 16  LYS A NZ     6  
ATOM   10736 H H      . LYS C 2 16 ? 4.279   6.060   7.507   1.00 0.00 ? 16  LYS A H      6  
ATOM   10737 H HA     . LYS C 2 16 ? 2.574   6.472   9.946   1.00 0.00 ? 16  LYS A HA     6  
ATOM   10738 H HB2    . LYS C 2 16 ? 2.828   8.052   7.387   1.00 0.00 ? 16  LYS A HB2    6  
ATOM   10739 H HB3    . LYS C 2 16 ? 1.329   8.089   8.316   1.00 0.00 ? 16  LYS A HB3    6  
ATOM   10740 H HG2    . LYS C 2 16 ? 4.040   8.662   9.532   1.00 0.00 ? 16  LYS A HG2    6  
ATOM   10741 H HG3    . LYS C 2 16 ? 2.983   9.922   8.897   1.00 0.00 ? 16  LYS A HG3    6  
ATOM   10742 H HD2    . LYS C 2 16 ? 1.514   8.127   10.648  1.00 0.00 ? 16  LYS A HD2    6  
ATOM   10743 H HD3    . LYS C 2 16 ? 2.909   8.816   11.479  1.00 0.00 ? 16  LYS A HD3    6  
ATOM   10744 H HE2    . LYS C 2 16 ? 1.284   10.701  9.833   1.00 0.00 ? 16  LYS A HE2    6  
ATOM   10745 H HE3    . LYS C 2 16 ? 0.563   10.127  11.350  1.00 0.00 ? 16  LYS A HE3    6  
ATOM   10746 H HZ1    . LYS C 2 16 ? 1.951   12.056  11.765  1.00 0.00 ? 16  LYS A HZ1    6  
ATOM   10747 H HZ2    . LYS C 2 16 ? 2.638   10.679  12.486  1.00 0.00 ? 16  LYS A HZ2    6  
ATOM   10748 H HZ3    . LYS C 2 16 ? 3.280   11.294  11.038  1.00 0.00 ? 16  LYS A HZ3    6  
ATOM   10749 N N      . ARG C 2 17 ? 0.637   5.174   8.860   1.00 0.00 ? 17  ARG A N      6  
ATOM   10750 C CA     . ARG C 2 17 ? -0.316  4.185   8.276   1.00 0.00 ? 17  ARG A CA     6  
ATOM   10751 C C      . ARG C 2 17 ? -1.678  4.839   8.014   1.00 0.00 ? 17  ARG A C      6  
ATOM   10752 O O      . ARG C 2 17 ? -2.148  5.652   8.785   1.00 0.00 ? 17  ARG A O      6  
ATOM   10753 C CB     . ARG C 2 17 ? -0.433  3.085   9.339   1.00 0.00 ? 17  ARG A CB     6  
ATOM   10754 C CG     . ARG C 2 17 ? -1.655  2.204   9.047   1.00 0.00 ? 17  ARG A CG     6  
ATOM   10755 C CD     . ARG C 2 17 ? -1.435  0.804   9.627   1.00 0.00 ? 17  ARG A CD     6  
ATOM   10756 N NE     . ARG C 2 17 ? -1.922  0.887   11.033  1.00 0.00 ? 17  ARG A NE     6  
ATOM   10757 C CZ     . ARG C 2 17 ? -1.203  1.492   11.939  1.00 0.00 ? 17  ARG A CZ     6  
ATOM   10758 N NH1    . ARG C 2 17 ? 0.079   1.259   12.020  1.00 0.00 ? 17  ARG A NH1    6  
ATOM   10759 N NH2    . ARG C 2 17 ? -1.768  2.330   12.766  1.00 0.00 ? 17  ARG A NH2    6  
ATOM   10760 H H      . ARG C 2 17 ? 0.453   5.572   9.737   1.00 0.00 ? 17  ARG A H      6  
ATOM   10761 H HA     . ARG C 2 17 ? 0.082   3.772   7.362   1.00 0.00 ? 17  ARG A HA     6  
ATOM   10762 H HB2    . ARG C 2 17 ? 0.461   2.477   9.326   1.00 0.00 ? 17  ARG A HB2    6  
ATOM   10763 H HB3    . ARG C 2 17 ? -0.543  3.538   10.314  1.00 0.00 ? 17  ARG A HB3    6  
ATOM   10764 H HG2    . ARG C 2 17 ? -2.531  2.646   9.497   1.00 0.00 ? 17  ARG A HG2    6  
ATOM   10765 H HG3    . ARG C 2 17 ? -1.797  2.130   7.980   1.00 0.00 ? 17  ARG A HG3    6  
ATOM   10766 H HD2    . ARG C 2 17 ? -2.012  0.076   9.070   1.00 0.00 ? 17  ARG A HD2    6  
ATOM   10767 H HD3    . ARG C 2 17 ? -0.387  0.549   9.611   1.00 0.00 ? 17  ARG A HD3    6  
ATOM   10768 H HE     . ARG C 2 17 ? -2.781  0.487   11.277  1.00 0.00 ? 17  ARG A HE     6  
ATOM   10769 H HH11   . ARG C 2 17 ? 0.512   0.617   11.388  1.00 0.00 ? 17  ARG A HH11   6  
ATOM   10770 H HH12   . ARG C 2 17 ? 0.628   1.723   12.716  1.00 0.00 ? 17  ARG A HH12   6  
ATOM   10771 H HH21   . ARG C 2 17 ? -2.749  2.507   12.705  1.00 0.00 ? 17  ARG A HH21   6  
ATOM   10772 H HH22   . ARG C 2 17 ? -1.218  2.793   13.461  1.00 0.00 ? 17  ARG A HH22   6  
ATOM   10773 N N      . ARG C 2 18 ? -2.314  4.473   6.933   1.00 0.00 ? 18  ARG A N      6  
ATOM   10774 C CA     . ARG C 2 18 ? -3.650  5.051   6.610   1.00 0.00 ? 18  ARG A CA     6  
ATOM   10775 C C      . ARG C 2 18 ? -4.581  3.944   6.109   1.00 0.00 ? 18  ARG A C      6  
ATOM   10776 O O      . ARG C 2 18 ? -4.215  3.150   5.264   1.00 0.00 ? 18  ARG A O      6  
ATOM   10777 C CB     . ARG C 2 18 ? -3.390  6.076   5.505   1.00 0.00 ? 18  ARG A CB     6  
ATOM   10778 C CG     . ARG C 2 18 ? -4.707  6.746   5.105   1.00 0.00 ? 18  ARG A CG     6  
ATOM   10779 C CD     . ARG C 2 18 ? -4.423  8.135   4.528   1.00 0.00 ? 18  ARG A CD     6  
ATOM   10780 N NE     . ARG C 2 18 ? -3.854  7.884   3.172   1.00 0.00 ? 18  ARG A NE     6  
ATOM   10781 C CZ     . ARG C 2 18 ? -4.609  7.424   2.202   1.00 0.00 ? 18  ARG A CZ     6  
ATOM   10782 N NH1    . ARG C 2 18 ? -5.897  7.262   2.375   1.00 0.00 ? 18  ARG A NH1    6  
ATOM   10783 N NH2    . ARG C 2 18 ? -4.071  7.123   1.052   1.00 0.00 ? 18  ARG A NH2    6  
ATOM   10784 H H      . ARG C 2 18 ? -1.914  3.809   6.335   1.00 0.00 ? 18  ARG A H      6  
ATOM   10785 H HA     . ARG C 2 18 ? -4.072  5.537   7.476   1.00 0.00 ? 18  ARG A HA     6  
ATOM   10786 H HB2    . ARG C 2 18 ? -2.699  6.825   5.864   1.00 0.00 ? 18  ARG A HB2    6  
ATOM   10787 H HB3    . ARG C 2 18 ? -2.966  5.579   4.645   1.00 0.00 ? 18  ARG A HB3    6  
ATOM   10788 H HG2    . ARG C 2 18 ? -5.207  6.142   4.362   1.00 0.00 ? 18  ARG A HG2    6  
ATOM   10789 H HG3    . ARG C 2 18 ? -5.339  6.843   5.975   1.00 0.00 ? 18  ARG A HG3    6  
ATOM   10790 H HD2    . ARG C 2 18 ? -5.340  8.705   4.455   1.00 0.00 ? 18  ARG A HD2    6  
ATOM   10791 H HD3    . ARG C 2 18 ? -3.703  8.656   5.140   1.00 0.00 ? 18  ARG A HD3    6  
ATOM   10792 H HE     . ARG C 2 18 ? -2.906  8.065   3.003   1.00 0.00 ? 18  ARG A HE     6  
ATOM   10793 H HH11   . ARG C 2 18 ? -6.319  7.489   3.251   1.00 0.00 ? 18  ARG A HH11   6  
ATOM   10794 H HH12   . ARG C 2 18 ? -6.459  6.910   1.626   1.00 0.00 ? 18  ARG A HH12   6  
ATOM   10795 H HH21   . ARG C 2 18 ? -3.088  7.246   0.913   1.00 0.00 ? 18  ARG A HH21   6  
ATOM   10796 H HH22   . ARG C 2 18 ? -4.641  6.773   0.308   1.00 0.00 ? 18  ARG A HH22   6  
ATOM   10797 N N      . GLU C 2 19 ? -5.779  3.879   6.625   1.00 0.00 ? 19  GLU A N      6  
ATOM   10798 C CA     . GLU C 2 19 ? -6.725  2.815   6.177   1.00 0.00 ? 19  GLU A CA     6  
ATOM   10799 C C      . GLU C 2 19 ? -7.710  3.382   5.151   1.00 0.00 ? 19  GLU A C      6  
ATOM   10800 O O      . GLU C 2 19 ? -8.224  4.473   5.304   1.00 0.00 ? 19  GLU A O      6  
ATOM   10801 C CB     . GLU C 2 19 ? -7.457  2.370   7.445   1.00 0.00 ? 19  GLU A CB     6  
ATOM   10802 C CG     . GLU C 2 19 ? -7.090  0.917   7.764   1.00 0.00 ? 19  GLU A CG     6  
ATOM   10803 C CD     . GLU C 2 19 ? -7.903  0.437   8.968   1.00 0.00 ? 19  GLU A CD     6  
ATOM   10804 O OE1    . GLU C 2 19 ? -9.040  0.040   8.770   1.00 0.00 ? 19  GLU A OE1    6  
ATOM   10805 O OE2    . GLU C 2 19 ? -7.375  0.473   10.067  1.00 0.00 ? 19  GLU A OE2    6  
ATOM   10806 H H      . GLU C 2 19 ? -6.055  4.525   7.308   1.00 0.00 ? 19  GLU A H      6  
ATOM   10807 H HA     . GLU C 2 19 ? -6.181  1.984   5.754   1.00 0.00 ? 19  GLU A HA     6  
ATOM   10808 H HB2    . GLU C 2 19 ? -7.168  3.005   8.270   1.00 0.00 ? 19  GLU A HB2    6  
ATOM   10809 H HB3    . GLU C 2 19 ? -8.523  2.443   7.291   1.00 0.00 ? 19  GLU A HB3    6  
ATOM   10810 H HG2    . GLU C 2 19 ? -7.311  0.295   6.908   1.00 0.00 ? 19  GLU A HG2    6  
ATOM   10811 H HG3    . GLU C 2 19 ? -6.036  0.854   7.995   1.00 0.00 ? 19  GLU A HG3    6  
ATOM   10812 N N      . VAL C 2 20 ? -7.968  2.646   4.105   1.00 0.00 ? 20  VAL A N      6  
ATOM   10813 C CA     . VAL C 2 20 ? -8.912  3.132   3.055   1.00 0.00 ? 20  VAL A CA     6  
ATOM   10814 C C      . VAL C 2 20 ? -10.085 2.157   2.914   1.00 0.00 ? 20  VAL A C      6  
ATOM   10815 O O      . VAL C 2 20 ? -9.966  1.124   2.288   1.00 0.00 ? 20  VAL A O      6  
ATOM   10816 C CB     . VAL C 2 20 ? -8.092  3.159   1.763   1.00 0.00 ? 20  VAL A CB     6  
ATOM   10817 C CG1    . VAL C 2 20 ? -8.908  3.819   0.651   1.00 0.00 ? 20  VAL A CG1    6  
ATOM   10818 C CG2    . VAL C 2 20 ? -6.804  3.956   1.986   1.00 0.00 ? 20  VAL A CG2    6  
ATOM   10819 H H      . VAL C 2 20 ? -7.535  1.773   4.004   1.00 0.00 ? 20  VAL A H      6  
ATOM   10820 H HA     . VAL C 2 20 ? -9.263  4.122   3.292   1.00 0.00 ? 20  VAL A HA     6  
ATOM   10821 H HB     . VAL C 2 20 ? -7.844  2.149   1.473   1.00 0.00 ? 20  VAL A HB     6  
ATOM   10822 H HG11   . VAL C 2 20 ? -8.557  3.470   -0.309  1.00 0.00 ? 20  VAL A HG11   6  
ATOM   10823 H HG12   . VAL C 2 20 ? -8.793  4.892   0.708   1.00 0.00 ? 20  VAL A HG12   6  
ATOM   10824 H HG13   . VAL C 2 20 ? -9.951  3.562   0.769   1.00 0.00 ? 20  VAL A HG13   6  
ATOM   10825 H HG21   . VAL C 2 20 ? -6.233  3.981   1.069   1.00 0.00 ? 20  VAL A HG21   6  
ATOM   10826 H HG22   . VAL C 2 20 ? -6.219  3.484   2.761   1.00 0.00 ? 20  VAL A HG22   6  
ATOM   10827 H HG23   . VAL C 2 20 ? -7.051  4.964   2.284   1.00 0.00 ? 20  VAL A HG23   6  
ATOM   10828 N N      . PHE C 2 21 ? -11.215 2.472   3.490   1.00 0.00 ? 21  PHE A N      6  
ATOM   10829 C CA     . PHE C 2 21 ? -12.389 1.558   3.388   1.00 0.00 ? 21  PHE A CA     6  
ATOM   10830 C C      . PHE C 2 21 ? -13.127 1.762   2.057   1.00 0.00 ? 21  PHE A C      6  
ATOM   10831 O O      . PHE C 2 21 ? -14.341 1.764   2.012   1.00 0.00 ? 21  PHE A O      6  
ATOM   10832 C CB     . PHE C 2 21 ? -13.285 1.954   4.561   1.00 0.00 ? 21  PHE A CB     6  
ATOM   10833 C CG     . PHE C 2 21 ? -14.451 1.006   4.636   1.00 0.00 ? 21  PHE A CG     6  
ATOM   10834 C CD1    . PHE C 2 21 ? -14.224 -0.361  4.810   1.00 0.00 ? 21  PHE A CD1    6  
ATOM   10835 C CD2    . PHE C 2 21 ? -15.756 1.494   4.532   1.00 0.00 ? 21  PHE A CD2    6  
ATOM   10836 C CE1    . PHE C 2 21 ? -15.306 -1.246  4.878   1.00 0.00 ? 21  PHE A CE1    6  
ATOM   10837 C CE2    . PHE C 2 21 ? -16.841 0.611   4.600   1.00 0.00 ? 21  PHE A CE2    6  
ATOM   10838 C CZ     . PHE C 2 21 ? -16.616 -0.760  4.774   1.00 0.00 ? 21  PHE A CZ     6  
ATOM   10839 H H      . PHE C 2 21 ? -11.294 3.309   3.992   1.00 0.00 ? 21  PHE A H      6  
ATOM   10840 H HA     . PHE C 2 21 ? -12.078 0.531   3.495   1.00 0.00 ? 21  PHE A HA     6  
ATOM   10841 H HB2    . PHE C 2 21 ? -12.719 1.904   5.480   1.00 0.00 ? 21  PHE A HB2    6  
ATOM   10842 H HB3    . PHE C 2 21 ? -13.648 2.960   4.414   1.00 0.00 ? 21  PHE A HB3    6  
ATOM   10843 H HD1    . PHE C 2 21 ? -13.212 -0.731  4.889   1.00 0.00 ? 21  PHE A HD1    6  
ATOM   10844 H HD2    . PHE C 2 21 ? -15.926 2.553   4.398   1.00 0.00 ? 21  PHE A HD2    6  
ATOM   10845 H HE1    . PHE C 2 21 ? -15.131 -2.304  5.011   1.00 0.00 ? 21  PHE A HE1    6  
ATOM   10846 H HE2    . PHE C 2 21 ? -17.850 0.988   4.520   1.00 0.00 ? 21  PHE A HE2    6  
ATOM   10847 H HZ     . PHE C 2 21 ? -17.451 -1.442  4.826   1.00 0.00 ? 21  PHE A HZ     6  
ATOM   10848 N N      . ARG C 2 22 ? -12.403 1.917   0.976   1.00 0.00 ? 22  ARG A N      6  
ATOM   10849 C CA     . ARG C 2 22 ? -13.049 2.112   -0.359  1.00 0.00 ? 22  ARG A CA     6  
ATOM   10850 C C      . ARG C 2 22 ? -14.092 3.238   -0.310  1.00 0.00 ? 22  ARG A C      6  
ATOM   10851 O O      . ARG C 2 22 ? -14.528 3.653   0.744   1.00 0.00 ? 22  ARG A O      6  
ATOM   10852 C CB     . ARG C 2 22 ? -13.719 0.777   -0.665  1.00 0.00 ? 22  ARG A CB     6  
ATOM   10853 C CG     . ARG C 2 22 ? -12.824 -0.037  -1.598  1.00 0.00 ? 22  ARG A CG     6  
ATOM   10854 C CD     . ARG C 2 22 ? -12.767 0.636   -2.970  1.00 0.00 ? 22  ARG A CD     6  
ATOM   10855 N NE     . ARG C 2 22 ? -11.324 0.647   -3.333  1.00 0.00 ? 22  ARG A NE     6  
ATOM   10856 C CZ     . ARG C 2 22 ? -10.704 -0.466  -3.622  1.00 0.00 ? 22  ARG A CZ     6  
ATOM   10857 N NH1    . ARG C 2 22 ? -10.674 -0.895  -4.852  1.00 0.00 ? 22  ARG A NH1    6  
ATOM   10858 N NH2    . ARG C 2 22 ? -10.106 -1.145  -2.681  1.00 0.00 ? 22  ARG A NH2    6  
ATOM   10859 H H      . ARG C 2 22 ? -11.432 1.893   1.038   1.00 0.00 ? 22  ARG A H      6  
ATOM   10860 H HA     . ARG C 2 22 ? -12.303 2.325   -1.113  1.00 0.00 ? 22  ARG A HA     6  
ATOM   10861 H HB2    . ARG C 2 22 ? -13.874 0.231   0.256   1.00 0.00 ? 22  ARG A HB2    6  
ATOM   10862 H HB3    . ARG C 2 22 ? -14.665 0.957   -1.144  1.00 0.00 ? 22  ARG A HB3    6  
ATOM   10863 H HG2    . ARG C 2 22 ? -11.829 -0.093  -1.181  1.00 0.00 ? 22  ARG A HG2    6  
ATOM   10864 H HG3    . ARG C 2 22 ? -13.225 -1.030  -1.704  1.00 0.00 ? 22  ARG A HG3    6  
ATOM   10865 H HD2    . ARG C 2 22 ? -13.335 0.066   -3.691  1.00 0.00 ? 22  ARG A HD2    6  
ATOM   10866 H HD3    . ARG C 2 22 ? -13.139 1.647   -2.908  1.00 0.00 ? 22  ARG A HD3    6  
ATOM   10867 H HE     . ARG C 2 22 ? -10.839 1.496   -3.355  1.00 0.00 ? 22  ARG A HE     6  
ATOM   10868 H HH11   . ARG C 2 22 ? -11.125 -0.374  -5.576  1.00 0.00 ? 22  ARG A HH11   6  
ATOM   10869 H HH12   . ARG C 2 22 ? -10.199 -1.747  -5.073  1.00 0.00 ? 22  ARG A HH12   6  
ATOM   10870 H HH21   . ARG C 2 22 ? -10.123 -0.815  -1.738  1.00 0.00 ? 22  ARG A HH21   6  
ATOM   10871 H HH22   . ARG C 2 22 ? -9.634  -1.997  -2.905  1.00 0.00 ? 22  ARG A HH22   6  
ATOM   10872 N N      . LYS C 2 23 ? -14.492 3.736   -1.448  1.00 0.00 ? 23  LYS A N      6  
ATOM   10873 C CA     . LYS C 2 23 ? -15.501 4.833   -1.467  1.00 0.00 ?