data_1IGN
# 
_entry.id   1IGN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IGN         
RCSB  PDT035       
WWPDB D_1000174154 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IGN 
_pdbx_database_status.recvd_initial_deposition_date   1996-02-29 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Koenig, P.'  1 
'Giraldo, R.' 2 
'Chapman, L.' 3 
'Rhodes, D.'  4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.'                     
'Cell(Cambridge,Mass.)' 85 125  136 1996 CELLB5 US 0092-8674 0998 ? 8620531 '10.1016/S0092-8674(00)81088-0' 
1       'The Yeast Telomere-Binding Protein RAP1 Binds to and Promotes the Formation of DNA Quadruplexes in Telomeric DNA' 
'Embo J.'               13 2411 ?   1994 EMJODG UK 0261-4189 0897 ? ?       ?                               
2       'Purification and Cloning of a DNA Binding Protein from Yeast that Binds to Both Silencer and Activator Elements'  
'Cell(Cambridge,Mass.)' 51 721  ?   1987 CELLB5 US 0092-8674 0998 ? ?       ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Konig, P.'   1 
primary 'Giraldo, R.' 2 
primary 'Chapman, L.' 3 
primary 'Rhodes, D.'  4 
1       'Giraldo, R.' 5 
1       'Rhodes, D.'  6 
2       'Shore, D.'   7 
2       'Nasmyth, K.' 8 
# 
_cell.entry_id           1IGN 
_cell.length_a           90.610 
_cell.length_b           90.610 
_cell.length_c           80.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IGN 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*CP*CP*GP*CP*AP*CP*AP*CP*CP*CP*AP*CP*AP*CP*AP*CP*C P*AP*G)-3')
;
5673.695  2   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*CP*CP*TP*GP*GP*TP*GP*TP*GP*TP*GP*GP*GP*TP*GP*TP*G P*CP*G)-3')
;
5939.803  2   ? ? ? ? 
3 polymer man 'PROTEIN (RAP1)'                                                           28704.143 2   ? ? ? ? 
4 water   nat water                                                                      18.015    206 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DC)(DG)(DC)(DA)(DC)(DA)(DC)(DC)(DC)(DA)(DC)(DA)(DC)(DA)(DC)(DC)(DA)(DG)' CCGCACACCCACACACCAG 
C,E ? 
2 polydeoxyribonucleotide no no '(DC)(DC)(DT)(DG)(DG)(DT)(DG)(DT)(DG)(DT)(DG)(DG)(DG)(DT)(DG)(DT)(DG)(DC)(DG)' CCTGGTGTGTGGGTGTGCG 
D,F ? 
3 'polypeptide(L)'        no no 
;GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDD
GNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAY
RTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNY
NSAAKR
;
;GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDD
GNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAY
RTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNY
NSAAKR
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DC  n 
1 3   DG  n 
1 4   DC  n 
1 5   DA  n 
1 6   DC  n 
1 7   DA  n 
1 8   DC  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DA  n 
1 14  DC  n 
1 15  DA  n 
1 16  DC  n 
1 17  DC  n 
1 18  DA  n 
1 19  DG  n 
2 1   DC  n 
2 2   DC  n 
2 3   DT  n 
2 4   DG  n 
2 5   DG  n 
2 6   DT  n 
2 7   DG  n 
2 8   DT  n 
2 9   DG  n 
2 10  DT  n 
2 11  DG  n 
2 12  DG  n 
2 13  DG  n 
2 14  DT  n 
2 15  DG  n 
2 16  DT  n 
2 17  DG  n 
2 18  DC  n 
2 19  DG  n 
3 1   GLY n 
3 2   ALA n 
3 3   LEU n 
3 4   PRO n 
3 5   SER n 
3 6   HIS n 
3 7   ASN n 
3 8   LYS n 
3 9   ALA n 
3 10  SER n 
3 11  PHE n 
3 12  THR n 
3 13  ASP n 
3 14  GLU n 
3 15  GLU n 
3 16  ASP n 
3 17  GLU n 
3 18  PHE n 
3 19  ILE n 
3 20  LEU n 
3 21  ASP n 
3 22  VAL n 
3 23  VAL n 
3 24  ARG n 
3 25  LYS n 
3 26  ASN n 
3 27  PRO n 
3 28  THR n 
3 29  ARG n 
3 30  ARG n 
3 31  THR n 
3 32  THR n 
3 33  HIS n 
3 34  THR n 
3 35  LEU n 
3 36  TYR n 
3 37  ASP n 
3 38  GLU n 
3 39  ILE n 
3 40  SER n 
3 41  HIS n 
3 42  TYR n 
3 43  VAL n 
3 44  PRO n 
3 45  ASN n 
3 46  HIS n 
3 47  THR n 
3 48  GLY n 
3 49  ASN n 
3 50  SER n 
3 51  ILE n 
3 52  ARG n 
3 53  HIS n 
3 54  ARG n 
3 55  PHE n 
3 56  ARG n 
3 57  VAL n 
3 58  TYR n 
3 59  LEU n 
3 60  SER n 
3 61  LYS n 
3 62  ARG n 
3 63  LEU n 
3 64  GLU n 
3 65  TYR n 
3 66  VAL n 
3 67  TYR n 
3 68  GLU n 
3 69  VAL n 
3 70  ASP n 
3 71  LYS n 
3 72  PHE n 
3 73  GLY n 
3 74  LYS n 
3 75  LEU n 
3 76  VAL n 
3 77  ARG n 
3 78  ASP n 
3 79  ASP n 
3 80  ASP n 
3 81  GLY n 
3 82  ASN n 
3 83  LEU n 
3 84  ILE n 
3 85  LYS n 
3 86  THR n 
3 87  LYS n 
3 88  VAL n 
3 89  LEU n 
3 90  PRO n 
3 91  PRO n 
3 92  SER n 
3 93  ILE n 
3 94  LYS n 
3 95  ARG n 
3 96  LYS n 
3 97  PHE n 
3 98  SER n 
3 99  ALA n 
3 100 ASP n 
3 101 GLU n 
3 102 ASP n 
3 103 TYR n 
3 104 THR n 
3 105 LEU n 
3 106 ALA n 
3 107 ILE n 
3 108 ALA n 
3 109 VAL n 
3 110 LYS n 
3 111 LYS n 
3 112 GLN n 
3 113 PHE n 
3 114 TYR n 
3 115 ARG n 
3 116 ASP n 
3 117 LEU n 
3 118 PHE n 
3 119 GLN n 
3 120 ILE n 
3 121 ASP n 
3 122 PRO n 
3 123 ASP n 
3 124 THR n 
3 125 GLY n 
3 126 ARG n 
3 127 SER n 
3 128 LEU n 
3 129 ILE n 
3 130 THR n 
3 131 ASP n 
3 132 GLU n 
3 133 ASP n 
3 134 THR n 
3 135 PRO n 
3 136 THR n 
3 137 ALA n 
3 138 ILE n 
3 139 ALA n 
3 140 ARG n 
3 141 ARG n 
3 142 ASN n 
3 143 MET n 
3 144 THR n 
3 145 MET n 
3 146 ASP n 
3 147 PRO n 
3 148 ASN n 
3 149 HIS n 
3 150 VAL n 
3 151 PRO n 
3 152 GLY n 
3 153 SER n 
3 154 GLU n 
3 155 PRO n 
3 156 ASN n 
3 157 PHE n 
3 158 ALA n 
3 159 ALA n 
3 160 TYR n 
3 161 ARG n 
3 162 THR n 
3 163 GLN n 
3 164 SER n 
3 165 ARG n 
3 166 ARG n 
3 167 GLY n 
3 168 PRO n 
3 169 ILE n 
3 170 ALA n 
3 171 ARG n 
3 172 GLU n 
3 173 PHE n 
3 174 PHE n 
3 175 LYS n 
3 176 HIS n 
3 177 PHE n 
3 178 ALA n 
3 179 GLU n 
3 180 GLU n 
3 181 HIS n 
3 182 ALA n 
3 183 ALA n 
3 184 HIS n 
3 185 THR n 
3 186 GLU n 
3 187 ASN n 
3 188 ALA n 
3 189 TRP n 
3 190 ARG n 
3 191 ASP n 
3 192 ARG n 
3 193 PHE n 
3 194 ARG n 
3 195 LYS n 
3 196 PHE n 
3 197 LEU n 
3 198 LEU n 
3 199 ALA n 
3 200 TYR n 
3 201 GLY n 
3 202 ILE n 
3 203 ASP n 
3 204 ASP n 
3 205 TYR n 
3 206 ILE n 
3 207 SER n 
3 208 TYR n 
3 209 TYR n 
3 210 GLU n 
3 211 ALA n 
3 212 GLU n 
3 213 LYS n 
3 214 ALA n 
3 215 GLN n 
3 216 ASN n 
3 217 ARG n 
3 218 GLU n 
3 219 PRO n 
3 220 GLU n 
3 221 PRO n 
3 222 MET n 
3 223 LYS n 
3 224 ASN n 
3 225 LEU n 
3 226 THR n 
3 227 ASN n 
3 228 ARG n 
3 229 PRO n 
3 230 LYS n 
3 231 ARG n 
3 232 PRO n 
3 233 GLY n 
3 234 VAL n 
3 235 PRO n 
3 236 THR n 
3 237 PRO n 
3 238 GLY n 
3 239 ASN n 
3 240 TYR n 
3 241 ASN n 
3 242 SER n 
3 243 ALA n 
3 244 ALA n 
3 245 LYS n 
3 246 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 'RAP1 DNA BINDING DOMAIN' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 'RAP1 DNA BINDING DOMAIN 353 TO 598' 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'T7 PROMOTER' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RAP1_YEAST 3 ? ? P11938 ? 
2 PDB 1IGN       1 ? ? 1IGN   ? 
3 PDB 1IGN       2 ? ? 1IGN   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IGN A 1 ? 246 ? P11938 353 ? 598 ? 353 598 
2 1 1IGN B 1 ? 246 ? P11938 353 ? 598 ? 353 598 
3 2 1IGN C 1 ? 19  ? 1IGN   1   ? 19  ? 1   19  
4 3 1IGN D 1 ? 19  ? 1IGN   20  ? 38  ? 20  38  
5 2 1IGN E 1 ? 19  ? 1IGN   1   ? 19  ? 1   19  
6 3 1IGN F 1 ? 19  ? 1IGN   20  ? 38  ? 20  38  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1IGN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   49.1000 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-02-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IGN 
_reflns.observed_criterion_sigma_I   4.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             16.000 
_reflns.d_resolution_high            2.250 
_reflns.number_obs                   33281 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.000 
_reflns.pdbx_Rmerge_I_obs            0.0470000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.900 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1IGN 
_refine.ls_number_reflns_obs                     33264 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             16.000 
_refine.ls_d_res_high                            2.250 
_refine.ls_percent_reflns_obs                    95.900 
_refine.ls_R_factor_obs                          0.2190000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2190000 
_refine.ls_R_factor_R_free                       0.2940000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30.00 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'ESTIMATED COORD. ERROR 0.426 ANGSTROMS FINAL RMS COORD. SHIFT 0.111 ANGSTROMS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IGN 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3178 
_refine_hist.pdbx_number_atoms_nucleic_acid   1524 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             206 
_refine_hist.number_atoms_total               4908 
_refine_hist.d_res_high                       2.250 
_refine_hist.d_res_low                        16.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.90  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.0  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.61  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.570000 
_struct_ncs_oper.matrix[1][2]   0.821600 
_struct_ncs_oper.matrix[1][3]   -0.005400 
_struct_ncs_oper.matrix[2][1]   0.821700 
_struct_ncs_oper.matrix[2][2]   -0.570000 
_struct_ncs_oper.matrix[2][3]   0.006700 
_struct_ncs_oper.matrix[3][1]   0.002400 
_struct_ncs_oper.matrix[3][2]   -0.008200 
_struct_ncs_oper.matrix[3][3]   -1.000000 
_struct_ncs_oper.vector[1]      -42.46000 
_struct_ncs_oper.vector[2]      81.58000 
_struct_ncs_oper.vector[3]      80.71000 
# 
_struct.entry_id                  1IGN 
_struct.title                     'DNA-BINDING DOMAIN OF RAP1 IN COMPLEX WITH TELOMERIC DNA SITE' 
_struct.pdbx_descriptor           'RAP1/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IGN 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            'RAP1, YEAST, TELOMERES, HOMOEODOMAIN, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;MTRIX
 THE TRANSFORMATIONS PRESENTED ON MTRIX RECORDS BELOW
 DESCRIBE NON-CRYSTALLOGRAPHIC RELATIONSHIPS AMONG THE
 VARIOUS DOMAINS IN THIS ENTRY.  APPLYING THE APPROPRIATE
 MTRIX TRANSFORMATION TO THE RESIDUES LISTED FIRST WILL
 YIELD APPROXIMATE COORDINATES FOR THE RESIDUES LISTED
 SECOND.

           APPLIED TO           TRANSFORMED TO
 MTRIX      RESIDUES               RESIDUES         RMSD
   M1   A  360  ..  A  594     B  360  ..  B  594   0.62
;
? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP E 13  ? ARG E 24  ? ASP A 365 ARG A 376 1 ? 12 
HELX_P HELX_P2  2  THR E 34  ? ILE E 39  ? THR A 386 ILE A 391 1 ? 6  
HELX_P HELX_P3  3  GLY E 48  ? VAL E 57  ? GLY A 400 VAL A 409 1 ? 10 
HELX_P HELX_P4  4  ALA E 99  ? PHE E 118 ? ALA A 451 PHE A 470 1 ? 20 
HELX_P HELX_P5  5  PHE E 173 ? GLU E 180 ? PHE A 525 GLU A 532 1 ? 8  
HELX_P HELX_P6  6  GLU E 186 ? TYR E 200 ? GLU A 538 TYR A 552 1 ? 15 
HELX_P HELX_P7  7  ILE E 202 ? GLU E 210 ? ILE A 554 GLU A 562 1 ? 9  
HELX_P HELX_P8  8  ASP F 13  ? ARG F 24  ? ASP B 365 ARG B 376 1 ? 12 
HELX_P HELX_P9  9  THR F 34  ? ILE F 39  ? THR B 386 ILE B 391 1 ? 6  
HELX_P HELX_P10 10 GLY F 48  ? VAL F 57  ? GLY B 400 VAL B 409 1 ? 10 
HELX_P HELX_P11 11 ALA F 99  ? PHE F 118 ? ALA B 451 PHE B 470 1 ? 20 
HELX_P HELX_P12 12 PHE F 173 ? GLU F 180 ? PHE B 525 GLU B 532 1 ? 8  
HELX_P HELX_P13 13 GLU F 186 ? TYR F 200 ? GLU B 538 TYR B 552 1 ? 15 
HELX_P HELX_P14 14 ILE F 202 ? GLU F 210 ? ILE B 554 GLU B 562 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 19 N1 ? ? C DC 2  D DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 19 O6 ? ? C DC 2  D DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 19 N2 ? ? C DC 2  D DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 18 N3 ? ? C DG 3  D DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 18 O2 ? ? C DG 3  D DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 18 N4 ? ? C DG 3  D DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 17 N1 ? ? C DC 4  D DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 17 O6 ? ? C DC 4  D DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 17 N2 ? ? C DC 4  D DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 16 N3 ? ? C DA 5  D DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 16 O4 ? ? C DA 5  D DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 15 N1 ? ? C DC 6  D DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 15 O6 ? ? C DC 6  D DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 15 N2 ? ? C DC 6  D DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 14 N3 ? ? C DA 7  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 14 O4 ? ? C DA 7  D DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG 13 N1 ? ? C DC 8  D DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG 13 O6 ? ? C DC 8  D DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG 13 N2 ? ? C DC 8  D DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 12 N1 ? ? C DC 9  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 12 O6 ? ? C DC 9  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 12 N2 ? ? C DC 9  D DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 11 N1 ? ? C DC 10 D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 11 O6 ? ? C DC 10 D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 11 N2 ? ? C DC 10 D DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 10 N3 ? ? C DA 11 D DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 10 O4 ? ? C DA 11 D DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 9  N1 ? ? C DC 12 D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 9  O6 ? ? C DC 12 D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 9  N2 ? ? C DC 12 D DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 8  N3 ? ? C DA 13 D DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 8  O4 ? ? C DA 13 D DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? A DC 14 N3 ? ? ? 1_555 B DG 7  N1 ? ? C DC 14 D DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG 7  O6 ? ? C DC 14 D DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? A DC 14 O2 ? ? ? 1_555 B DG 7  N2 ? ? C DC 14 D DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 15 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? A DA 15 N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 15 D DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? A DC 16 N3 ? ? ? 1_555 B DG 5  N1 ? ? C DC 16 D DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? A DC 16 N4 ? ? ? 1_555 B DG 5  O6 ? ? C DC 16 D DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? A DC 16 O2 ? ? ? 1_555 B DG 5  N2 ? ? C DC 16 D DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? A DC 17 N3 ? ? ? 1_555 B DG 4  N1 ? ? C DC 17 D DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? A DC 17 N4 ? ? ? 1_555 B DG 4  O6 ? ? C DC 17 D DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? A DC 17 O2 ? ? ? 1_555 B DG 4  N2 ? ? C DC 17 D DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? A DA 18 N1 ? ? ? 1_555 B DT 3  N3 ? ? C DA 18 D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? A DA 18 N6 ? ? ? 1_555 B DT 3  O4 ? ? C DA 18 D DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46 hydrog ? ? A DG 19 N1 ? ? ? 1_555 B DC 2  N3 ? ? C DG 19 D DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47 hydrog ? ? A DG 19 N2 ? ? ? 1_555 B DC 2  O2 ? ? C DG 19 D DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? A DG 19 O6 ? ? ? 1_555 B DC 2  N4 ? ? C DG 19 D DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? B DC 1  O2 ? ? ? 1_555 B DC 2  N4 ? ? D DC 20 D DC 21 1_555 ? ? ? ? ? ? 'DC-DC MISPAIR' ? ? 
hydrog50 hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG 19 N1 ? ? E DC 2  F DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG 19 O6 ? ? E DC 2  F DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG 19 N2 ? ? E DC 2  F DG 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? C DG 3  N1 ? ? ? 1_555 D DC 18 N3 ? ? E DG 3  F DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? C DG 3  N2 ? ? ? 1_555 D DC 18 O2 ? ? E DG 3  F DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? C DG 3  O6 ? ? ? 1_555 D DC 18 N4 ? ? E DG 3  F DC 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? C DC 4  N3 ? ? ? 1_555 D DG 17 N1 ? ? E DC 4  F DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57 hydrog ? ? C DC 4  N4 ? ? ? 1_555 D DG 17 O6 ? ? E DC 4  F DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58 hydrog ? ? C DC 4  O2 ? ? ? 1_555 D DG 17 N2 ? ? E DC 4  F DG 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59 hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT 16 N3 ? ? E DA 5  F DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT 16 O4 ? ? E DA 5  F DT 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61 hydrog ? ? C DC 6  N3 ? ? ? 1_555 D DG 15 N1 ? ? E DC 6  F DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62 hydrog ? ? C DC 6  N4 ? ? ? 1_555 D DG 15 O6 ? ? E DC 6  F DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63 hydrog ? ? C DC 6  O2 ? ? ? 1_555 D DG 15 N2 ? ? E DC 6  F DG 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 14 N3 ? ? E DA 7  F DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 14 O4 ? ? E DA 7  F DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66 hydrog ? ? C DC 8  N3 ? ? ? 1_555 D DG 13 N1 ? ? E DC 8  F DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67 hydrog ? ? C DC 8  N4 ? ? ? 1_555 D DG 13 O6 ? ? E DC 8  F DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68 hydrog ? ? C DC 8  O2 ? ? ? 1_555 D DG 13 N2 ? ? E DC 8  F DG 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69 hydrog ? ? C DC 9  N3 ? ? ? 1_555 D DG 12 N1 ? ? E DC 9  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70 hydrog ? ? C DC 9  N4 ? ? ? 1_555 D DG 12 O6 ? ? E DC 9  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71 hydrog ? ? C DC 9  O2 ? ? ? 1_555 D DG 12 N2 ? ? E DC 9  F DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72 hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 11 N1 ? ? E DC 10 F DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73 hydrog ? ? C DC 10 N4 ? ? ? 1_555 D DG 11 O6 ? ? E DC 10 F DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74 hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 11 N2 ? ? E DC 10 F DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 10 N3 ? ? E DA 11 F DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 10 O4 ? ? E DA 11 F DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77 hydrog ? ? C DC 12 N3 ? ? ? 1_555 D DG 9  N1 ? ? E DC 12 F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78 hydrog ? ? C DC 12 N4 ? ? ? 1_555 D DG 9  O6 ? ? E DC 12 F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79 hydrog ? ? C DC 12 O2 ? ? ? 1_555 D DG 9  N2 ? ? E DC 12 F DG 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80 hydrog ? ? C DA 13 N1 ? ? ? 1_555 D DT 8  N3 ? ? E DA 13 F DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81 hydrog ? ? C DA 13 N6 ? ? ? 1_555 D DT 8  O4 ? ? E DA 13 F DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82 hydrog ? ? C DC 14 N3 ? ? ? 1_555 D DG 7  N1 ? ? E DC 14 F DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83 hydrog ? ? C DC 14 N4 ? ? ? 1_555 D DG 7  O6 ? ? E DC 14 F DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84 hydrog ? ? C DC 14 O2 ? ? ? 1_555 D DG 7  N2 ? ? E DC 14 F DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85 hydrog ? ? C DA 15 N1 ? ? ? 1_555 D DT 6  N3 ? ? E DA 15 F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86 hydrog ? ? C DA 15 N6 ? ? ? 1_555 D DT 6  O4 ? ? E DA 15 F DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87 hydrog ? ? C DC 16 N3 ? ? ? 1_555 D DG 5  N1 ? ? E DC 16 F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88 hydrog ? ? C DC 16 N4 ? ? ? 1_555 D DG 5  O6 ? ? E DC 16 F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89 hydrog ? ? C DC 16 O2 ? ? ? 1_555 D DG 5  N2 ? ? E DC 16 F DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90 hydrog ? ? C DC 17 N3 ? ? ? 1_555 D DG 4  N1 ? ? E DC 17 F DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91 hydrog ? ? C DC 17 N4 ? ? ? 1_555 D DG 4  O6 ? ? E DC 17 F DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92 hydrog ? ? C DC 17 O2 ? ? ? 1_555 D DG 4  N2 ? ? E DC 17 F DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93 hydrog ? ? C DA 18 N1 ? ? ? 1_555 D DT 3  N3 ? ? E DA 18 F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94 hydrog ? ? C DA 18 N6 ? ? ? 1_555 D DT 3  O4 ? ? E DA 18 F DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95 hydrog ? ? C DG 19 N1 ? ? ? 1_555 D DC 2  N3 ? ? E DG 19 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96 hydrog ? ? C DG 19 N2 ? ? ? 1_555 D DC 2  O2 ? ? E DG 19 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97 hydrog ? ? C DG 19 O6 ? ? ? 1_555 D DC 2  N4 ? ? E DG 19 F DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98 hydrog ? ? D DC 1  O2 ? ? ? 1_555 D DC 2  N4 ? ? F DC 20 F DC 21 1_555 ? ? ? ? ? ? 'DC-DC MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 167 E . ? GLY 519 A PRO 168 E ? PRO 520 A 1 0.84 
2 GLY 167 F . ? GLY 519 B PRO 168 F ? PRO 520 B 1 0.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL E 66 ? TYR E 67 ? VAL A 418 TYR A 419 
A 2 LYS E 85 ? THR E 86 ? LYS A 437 THR A 438 
B 1 VAL F 66 ? TYR F 67 ? VAL B 418 TYR B 419 
B 2 LYS F 85 ? THR F 86 ? LYS B 437 THR B 438 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL E 66 ? N VAL A 418 O THR E 86 ? O THR A 438 
B 1 2 O VAL F 66 ? O VAL B 418 N THR F 86 ? N THR B 438 
# 
_database_PDB_matrix.entry_id          1IGN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IGN 
_atom_sites.fract_transf_matrix[1][1]   0.011036 
_atom_sites.fract_transf_matrix[1][2]   0.006372 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012744 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012444 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DC  A 1 1   ? 18.631  2.795   -1.514 1.00 82.81  ? 1   DC  C "O5'" 1 
ATOM   2    C "C5'" . DC  A 1 1   ? 18.960  3.838   -2.468 1.00 82.32  ? 1   DC  C "C5'" 1 
ATOM   3    C "C4'" . DC  A 1 1   ? 19.045  5.297   -1.932 1.00 80.78  ? 1   DC  C "C4'" 1 
ATOM   4    O "O4'" . DC  A 1 1   ? 19.456  6.059   -3.071 1.00 78.41  ? 1   DC  C "O4'" 1 
ATOM   5    C "C3'" . DC  A 1 1   ? 17.730  6.052   -1.462 1.00 80.48  ? 1   DC  C "C3'" 1 
ATOM   6    O "O3'" . DC  A 1 1   ? 17.697  6.445   -0.070 1.00 81.49  ? 1   DC  C "O3'" 1 
ATOM   7    C "C2'" . DC  A 1 1   ? 17.644  7.311   -2.274 1.00 75.25  ? 1   DC  C "C2'" 1 
ATOM   8    C "C1'" . DC  A 1 1   ? 19.027  7.413   -2.831 1.00 76.30  ? 1   DC  C "C1'" 1 
ATOM   9    N N1    . DC  A 1 1   ? 19.158  8.198   -4.098 1.00 75.26  ? 1   DC  C N1    1 
ATOM   10   C C2    . DC  A 1 1   ? 20.488  8.448   -4.573 1.00 73.83  ? 1   DC  C C2    1 
ATOM   11   O O2    . DC  A 1 1   ? 21.487  8.042   -3.960 1.00 70.44  ? 1   DC  C O2    1 
ATOM   12   N N3    . DC  A 1 1   ? 20.609  9.190   -5.731 1.00 72.30  ? 1   DC  C N3    1 
ATOM   13   C C4    . DC  A 1 1   ? 19.518  9.644   -6.373 1.00 72.98  ? 1   DC  C C4    1 
ATOM   14   N N4    . DC  A 1 1   ? 19.696  10.347  -7.474 1.00 72.80  ? 1   DC  C N4    1 
ATOM   15   C C5    . DC  A 1 1   ? 18.176  9.400   -5.916 1.00 73.62  ? 1   DC  C C5    1 
ATOM   16   C C6    . DC  A 1 1   ? 18.046  8.682   -4.780 1.00 74.91  ? 1   DC  C C6    1 
ATOM   17   P P     . DC  A 1 2   ? 17.073  5.366   1.012  1.00 82.40  ? 2   DC  C P     1 
ATOM   18   O OP1   . DC  A 1 2   ? 17.710  4.029   0.805  1.00 77.78  ? 2   DC  C OP1   1 
ATOM   19   O OP2   . DC  A 1 2   ? 15.585  5.514   0.985  1.00 81.98  ? 2   DC  C OP2   1 
ATOM   20   O "O5'" . DC  A 1 2   ? 17.514  5.879   2.456  1.00 79.59  ? 2   DC  C "O5'" 1 
ATOM   21   C "C5'" . DC  A 1 2   ? 18.801  5.583   3.016  1.00 68.20  ? 2   DC  C "C5'" 1 
ATOM   22   C "C4'" . DC  A 1 2   ? 19.396  6.839   3.610  1.00 55.92  ? 2   DC  C "C4'" 1 
ATOM   23   O "O4'" . DC  A 1 2   ? 19.455  7.833   2.561  1.00 49.44  ? 2   DC  C "O4'" 1 
ATOM   24   C "C3'" . DC  A 1 2   ? 18.539  7.404   4.767  1.00 51.82  ? 2   DC  C "C3'" 1 
ATOM   25   O "O3'" . DC  A 1 2   ? 19.391  7.818   5.835  1.00 55.52  ? 2   DC  C "O3'" 1 
ATOM   26   C "C2'" . DC  A 1 2   ? 17.906  8.587   4.143  1.00 42.60  ? 2   DC  C "C2'" 1 
ATOM   27   C "C1'" . DC  A 1 2   ? 19.042  8.988   3.241  1.00 41.50  ? 2   DC  C "C1'" 1 
ATOM   28   N N1    . DC  A 1 2   ? 18.622  10.017  2.347  1.00 36.16  ? 2   DC  C N1    1 
ATOM   29   C C2    . DC  A 1 2   ? 19.535  11.042  2.130  1.00 35.89  ? 2   DC  C C2    1 
ATOM   30   O O2    . DC  A 1 2   ? 20.673  11.117  2.630  1.00 36.33  ? 2   DC  C O2    1 
ATOM   31   N N3    . DC  A 1 2   ? 19.118  12.032  1.310  1.00 32.43  ? 2   DC  C N3    1 
ATOM   32   C C4    . DC  A 1 2   ? 17.907  12.034  0.755  1.00 32.57  ? 2   DC  C C4    1 
ATOM   33   N N4    . DC  A 1 2   ? 17.583  13.049  -0.048 1.00 29.12  ? 2   DC  C N4    1 
ATOM   34   C C5    . DC  A 1 2   ? 16.976  10.983  0.969  1.00 33.36  ? 2   DC  C C5    1 
ATOM   35   C C6    . DC  A 1 2   ? 17.376  9.989   1.772  1.00 35.08  ? 2   DC  C C6    1 
ATOM   36   P P     . DG  A 1 3   ? 19.563  6.862   7.072  1.00 57.12  ? 3   DG  C P     1 
ATOM   37   O OP1   . DG  A 1 3   ? 20.118  5.533   6.647  1.00 57.32  ? 3   DG  C OP1   1 
ATOM   38   O OP2   . DG  A 1 3   ? 18.263  6.996   7.776  1.00 59.60  ? 3   DG  C OP2   1 
ATOM   39   O "O5'" . DG  A 1 3   ? 20.694  7.553   7.971  1.00 58.94  ? 3   DG  C "O5'" 1 
ATOM   40   C "C5'" . DG  A 1 3   ? 22.058  7.807   7.546  1.00 53.91  ? 3   DG  C "C5'" 1 
ATOM   41   C "C4'" . DG  A 1 3   ? 22.511  9.286   7.674  1.00 44.83  ? 3   DG  C "C4'" 1 
ATOM   42   O "O4'" . DG  A 1 3   ? 21.816  10.214  6.802  1.00 40.22  ? 3   DG  C "O4'" 1 
ATOM   43   C "C3'" . DG  A 1 3   ? 22.177  9.802   9.080  1.00 49.71  ? 3   DG  C "C3'" 1 
ATOM   44   O "O3'" . DG  A 1 3   ? 23.295  10.619  9.504  1.00 53.17  ? 3   DG  C "O3'" 1 
ATOM   45   C "C2'" . DG  A 1 3   ? 20.835  10.579  8.835  1.00 39.42  ? 3   DG  C "C2'" 1 
ATOM   46   C "C1'" . DG  A 1 3   ? 21.114  11.301  7.541  1.00 33.56  ? 3   DG  C "C1'" 1 
ATOM   47   N N9    . DG  A 1 3   ? 19.949  11.788  6.736  1.00 23.88  ? 3   DG  C N9    1 
ATOM   48   C C8    . DG  A 1 3   ? 18.681  11.258  6.657  1.00 22.24  ? 3   DG  C C8    1 
ATOM   49   N N7    . DG  A 1 3   ? 17.914  11.880  5.793  1.00 20.95  ? 3   DG  C N7    1 
ATOM   50   C C5    . DG  A 1 3   ? 18.732  12.885  5.269  1.00 17.42  ? 3   DG  C C5    1 
ATOM   51   C C6    . DG  A 1 3   ? 18.412  13.858  4.317  1.00 18.15  ? 3   DG  C C6    1 
ATOM   52   O O6    . DG  A 1 3   ? 17.340  14.014  3.716  1.00 23.88  ? 3   DG  C O6    1 
ATOM   53   N N1    . DG  A 1 3   ? 19.462  14.690  4.078  1.00 14.17  ? 3   DG  C N1    1 
ATOM   54   C C2    . DG  A 1 3   ? 20.682  14.563  4.690  1.00 16.13  ? 3   DG  C C2    1 
ATOM   55   N N2    . DG  A 1 3   ? 21.599  15.430  4.342  1.00 18.50  ? 3   DG  C N2    1 
ATOM   56   N N3    . DG  A 1 3   ? 21.022  13.656  5.588  1.00 17.71  ? 3   DG  C N3    1 
ATOM   57   C C4    . DG  A 1 3   ? 19.973  12.835  5.829  1.00 18.22  ? 3   DG  C C4    1 
ATOM   58   P P     . DC  A 1 4   ? 23.560  11.045  11.025 1.00 53.18  ? 4   DC  C P     1 
ATOM   59   O OP1   . DC  A 1 4   ? 24.884  10.499  11.417 1.00 54.98  ? 4   DC  C OP1   1 
ATOM   60   O OP2   . DC  A 1 4   ? 22.319  10.778  11.791 1.00 44.44  ? 4   DC  C OP2   1 
ATOM   61   O "O5'" . DC  A 1 4   ? 23.716  12.601  10.891 1.00 47.89  ? 4   DC  C "O5'" 1 
ATOM   62   C "C5'" . DC  A 1 4   ? 24.689  13.001  9.945  1.00 42.99  ? 4   DC  C "C5'" 1 
ATOM   63   C "C4'" . DC  A 1 4   ? 24.395  14.391  9.437  1.00 39.27  ? 4   DC  C "C4'" 1 
ATOM   64   O "O4'" . DC  A 1 4   ? 23.172  14.464  8.683  1.00 35.25  ? 4   DC  C "O4'" 1 
ATOM   65   C "C3'" . DC  A 1 4   ? 24.264  15.347  10.617 1.00 36.72  ? 4   DC  C "C3'" 1 
ATOM   66   O "O3'" . DC  A 1 4   ? 25.063  16.487  10.335 1.00 34.52  ? 4   DC  C "O3'" 1 
ATOM   67   C "C2'" . DC  A 1 4   ? 22.807  15.691  10.507 1.00 34.06  ? 4   DC  C "C2'" 1 
ATOM   68   C "C1'" . DC  A 1 4   ? 22.474  15.641  9.080  1.00 27.89  ? 4   DC  C "C1'" 1 
ATOM   69   N N1    . DC  A 1 4   ? 21.094  15.296  8.889  1.00 22.41  ? 4   DC  C N1    1 
ATOM   70   C C2    . DC  A 1 4   ? 20.461  15.973  7.937  1.00 25.03  ? 4   DC  C C2    1 
ATOM   71   O O2    . DC  A 1 4   ? 21.033  16.888  7.308  1.00 28.47  ? 4   DC  C O2    1 
ATOM   72   N N3    . DC  A 1 4   ? 19.143  15.619  7.746  1.00 24.49  ? 4   DC  C N3    1 
ATOM   73   C C4    . DC  A 1 4   ? 18.514  14.645  8.428  1.00 22.26  ? 4   DC  C C4    1 
ATOM   74   N N4    . DC  A 1 4   ? 17.222  14.318  8.228  1.00 24.65  ? 4   DC  C N4    1 
ATOM   75   C C5    . DC  A 1 4   ? 19.209  13.935  9.401  1.00 21.30  ? 4   DC  C C5    1 
ATOM   76   C C6    . DC  A 1 4   ? 20.495  14.303  9.581  1.00 23.32  ? 4   DC  C C6    1 
ATOM   77   P P     . DA  A 1 5   ? 25.409  17.657  11.335 1.00 33.98  ? 5   DA  C P     1 
ATOM   78   O OP1   . DA  A 1 5   ? 26.844  18.017  11.334 1.00 30.56  ? 5   DA  C OP1   1 
ATOM   79   O OP2   . DA  A 1 5   ? 24.666  17.421  12.577 1.00 33.49  ? 5   DA  C OP2   1 
ATOM   80   O "O5'" . DA  A 1 5   ? 24.652  18.831  10.563 1.00 41.16  ? 5   DA  C "O5'" 1 
ATOM   81   C "C5'" . DA  A 1 5   ? 25.126  19.372  9.313  1.00 29.50  ? 5   DA  C "C5'" 1 
ATOM   82   C "C4'" . DA  A 1 5   ? 24.224  20.428  8.713  1.00 21.38  ? 5   DA  C "C4'" 1 
ATOM   83   O "O4'" . DA  A 1 5   ? 22.904  19.849  8.468  1.00 22.59  ? 5   DA  C "O4'" 1 
ATOM   84   C "C3'" . DA  A 1 5   ? 24.038  21.484  9.733  1.00 24.27  ? 5   DA  C "C3'" 1 
ATOM   85   O "O3'" . DA  A 1 5   ? 24.088  22.714  8.992  1.00 30.55  ? 5   DA  C "O3'" 1 
ATOM   86   C "C2'" . DA  A 1 5   ? 22.660  21.076  10.251 1.00 18.91  ? 5   DA  C "C2'" 1 
ATOM   87   C "C1'" . DA  A 1 5   ? 21.862  20.550  9.066  1.00 15.94  ? 5   DA  C "C1'" 1 
ATOM   88   N N9    . DA  A 1 5   ? 20.821  19.590  9.518  1.00 13.41  ? 5   DA  C N9    1 
ATOM   89   C C8    . DA  A 1 5   ? 20.902  18.623  10.488 1.00 12.13  ? 5   DA  C C8    1 
ATOM   90   N N7    . DA  A 1 5   ? 19.791  17.920  10.633 1.00 10.59  ? 5   DA  C N7    1 
ATOM   91   C C5    . DA  A 1 5   ? 18.912  18.482  9.690  1.00 8.46   ? 5   DA  C C5    1 
ATOM   92   C C6    . DA  A 1 5   ? 17.609  18.196  9.371  1.00 11.11  ? 5   DA  C C6    1 
ATOM   93   N N6    . DA  A 1 5   ? 16.982  17.208  10.056 1.00 12.71  ? 5   DA  C N6    1 
ATOM   94   N N1    . DA  A 1 5   ? 16.990  18.892  8.388  1.00 10.03  ? 5   DA  C N1    1 
ATOM   95   C C2    . DA  A 1 5   ? 17.708  19.827  7.812  1.00 10.44  ? 5   DA  C C2    1 
ATOM   96   N N3    . DA  A 1 5   ? 18.973  20.189  8.013  1.00 13.21  ? 5   DA  C N3    1 
ATOM   97   C C4    . DA  A 1 5   ? 19.515  19.479  9.004  1.00 11.64  ? 5   DA  C C4    1 
ATOM   98   P P     . DC  A 1 6   ? 24.158  24.226  9.547  1.00 27.64  ? 6   DC  C P     1 
ATOM   99   O OP1   . DC  A 1 6   ? 24.933  25.144  8.685  1.00 26.37  ? 6   DC  C OP1   1 
ATOM   100  O OP2   . DC  A 1 6   ? 24.648  24.124  10.947 1.00 31.68  ? 6   DC  C OP2   1 
ATOM   101  O "O5'" . DC  A 1 6   ? 22.602  24.643  9.563  1.00 25.25  ? 6   DC  C "O5'" 1 
ATOM   102  C "C5'" . DC  A 1 6   ? 21.825  24.935  8.447  1.00 14.60  ? 6   DC  C "C5'" 1 
ATOM   103  C "C4'" . DC  A 1 6   ? 20.396  24.901  8.824  1.00 11.97  ? 6   DC  C "C4'" 1 
ATOM   104  O "O4'" . DC  A 1 6   ? 20.122  23.630  9.334  1.00 15.43  ? 6   DC  C "O4'" 1 
ATOM   105  C "C3'" . DC  A 1 6   ? 19.920  25.822  9.914  1.00 17.02  ? 6   DC  C "C3'" 1 
ATOM   106  O "O3'" . DC  A 1 6   ? 19.533  27.088  9.420  1.00 22.75  ? 6   DC  C "O3'" 1 
ATOM   107  C "C2'" . DC  A 1 6   ? 18.754  25.033  10.554 1.00 18.32  ? 6   DC  C "C2'" 1 
ATOM   108  C "C1'" . DC  A 1 6   ? 18.744  23.811  9.723  1.00 13.66  ? 6   DC  C "C1'" 1 
ATOM   109  N N1    . DC  A 1 6   ? 18.230  22.732  10.490 1.00 8.26   ? 6   DC  C N1    1 
ATOM   110  C C2    . DC  A 1 6   ? 17.024  22.277  10.133 1.00 13.23  ? 6   DC  C C2    1 
ATOM   111  O O2    . DC  A 1 6   ? 16.325  22.756  9.229  1.00 19.52  ? 6   DC  C O2    1 
ATOM   112  N N3    . DC  A 1 6   ? 16.537  21.231  10.838 1.00 15.46  ? 6   DC  C N3    1 
ATOM   113  C C4    . DC  A 1 6   ? 17.237  20.647  11.823 1.00 10.93  ? 6   DC  C C4    1 
ATOM   114  N N4    . DC  A 1 6   ? 16.669  19.599  12.481 1.00 6.26   ? 6   DC  C N4    1 
ATOM   115  C C5    . DC  A 1 6   ? 18.517  21.115  12.145 1.00 3.82   ? 6   DC  C C5    1 
ATOM   116  C C6    . DC  A 1 6   ? 18.972  22.165  11.459 1.00 8.76   ? 6   DC  C C6    1 
ATOM   117  P P     . DA  A 1 7   ? 18.338  27.971  9.920  1.00 23.66  ? 7   DA  C P     1 
ATOM   118  O OP1   . DA  A 1 7   ? 18.537  29.281  9.272  1.00 23.04  ? 7   DA  C OP1   1 
ATOM   119  O OP2   . DA  A 1 7   ? 18.382  27.927  11.399 1.00 34.14  ? 7   DA  C OP2   1 
ATOM   120  O "O5'" . DA  A 1 7   ? 16.975  27.370  9.559  1.00 24.54  ? 7   DA  C "O5'" 1 
ATOM   121  C "C5'" . DA  A 1 7   ? 16.517  27.164  8.248  1.00 27.49  ? 7   DA  C "C5'" 1 
ATOM   122  C "C4'" . DA  A 1 7   ? 15.002  26.972  8.183  1.00 25.39  ? 7   DA  C "C4'" 1 
ATOM   123  O "O4'" . DA  A 1 7   ? 14.627  25.780  8.884  1.00 26.54  ? 7   DA  C "O4'" 1 
ATOM   124  C "C3'" . DA  A 1 7   ? 14.207  28.080  8.826  1.00 29.25  ? 7   DA  C "C3'" 1 
ATOM   125  O "O3'" . DA  A 1 7   ? 13.050  28.442  8.057  1.00 27.84  ? 7   DA  C "O3'" 1 
ATOM   126  C "C2'" . DA  A 1 7   ? 13.878  27.399  10.158 1.00 21.98  ? 7   DA  C "C2'" 1 
ATOM   127  C "C1'" . DA  A 1 7   ? 13.585  25.951  9.896  1.00 20.58  ? 7   DA  C "C1'" 1 
ATOM   128  N N9    . DA  A 1 7   ? 14.012  25.102  11.045 1.00 12.68  ? 7   DA  C N9    1 
ATOM   129  C C8    . DA  A 1 7   ? 15.224  25.184  11.654 1.00 12.58  ? 7   DA  C C8    1 
ATOM   130  N N7    . DA  A 1 7   ? 15.429  24.300  12.582 1.00 14.81  ? 7   DA  C N7    1 
ATOM   131  C C5    . DA  A 1 7   ? 14.261  23.578  12.635 1.00 9.86   ? 7   DA  C C5    1 
ATOM   132  C C6    . DA  A 1 7   ? 13.888  22.509  13.442 1.00 11.43  ? 7   DA  C C6    1 
ATOM   133  N N6    . DA  A 1 7   ? 14.642  21.966  14.438 1.00 14.46  ? 7   DA  C N6    1 
ATOM   134  N N1    . DA  A 1 7   ? 12.702  21.978  13.197 1.00 12.07  ? 7   DA  C N1    1 
ATOM   135  C C2    . DA  A 1 7   ? 11.969  22.521  12.198 1.00 14.04  ? 7   DA  C C2    1 
ATOM   136  N N3    . DA  A 1 7   ? 12.202  23.551  11.376 1.00 14.47  ? 7   DA  C N3    1 
ATOM   137  C C4    . DA  A 1 7   ? 13.408  24.039  11.658 1.00 11.03  ? 7   DA  C C4    1 
ATOM   138  P P     . DC  A 1 8   ? 11.995  29.531  8.510  1.00 25.20  ? 8   DC  C P     1 
ATOM   139  O OP1   . DC  A 1 8   ? 11.027  29.901  7.491  1.00 35.64  ? 8   DC  C OP1   1 
ATOM   140  O OP2   . DC  A 1 8   ? 12.693  30.621  9.184  1.00 29.80  ? 8   DC  C OP2   1 
ATOM   141  O "O5'" . DC  A 1 8   ? 11.160  28.693  9.472  1.00 22.50  ? 8   DC  C "O5'" 1 
ATOM   142  C "C5'" . DC  A 1 8   ? 10.420  27.657  8.940  1.00 13.25  ? 8   DC  C "C5'" 1 
ATOM   143  C "C4'" . DC  A 1 8   ? 9.656   27.022  10.083 1.00 22.22  ? 8   DC  C "C4'" 1 
ATOM   144  O "O4'" . DC  A 1 8   ? 10.470  26.274  11.011 1.00 27.83  ? 8   DC  C "O4'" 1 
ATOM   145  C "C3'" . DC  A 1 8   ? 8.794   28.015  10.924 1.00 31.19  ? 8   DC  C "C3'" 1 
ATOM   146  O "O3'" . DC  A 1 8   ? 7.387   27.555  10.808 1.00 32.32  ? 8   DC  C "O3'" 1 
ATOM   147  C "C2'" . DC  A 1 8   ? 9.437   27.767  12.315 1.00 19.63  ? 8   DC  C "C2'" 1 
ATOM   148  C "C1'" . DC  A 1 8   ? 9.785   26.254  12.275 1.00 19.07  ? 8   DC  C "C1'" 1 
ATOM   149  N N1    . DC  A 1 8   ? 10.774  25.929  13.282 1.00 13.23  ? 8   DC  C N1    1 
ATOM   150  C C2    . DC  A 1 8   ? 10.656  24.869  14.068 1.00 16.19  ? 8   DC  C C2    1 
ATOM   151  O O2    . DC  A 1 8   ? 9.712   24.061  14.004 1.00 19.17  ? 8   DC  C O2    1 
ATOM   152  N N3    . DC  A 1 8   ? 11.643  24.664  14.997 1.00 19.03  ? 8   DC  C N3    1 
ATOM   153  C C4    . DC  A 1 8   ? 12.693  25.500  15.122 1.00 20.16  ? 8   DC  C C4    1 
ATOM   154  N N4    . DC  A 1 8   ? 13.664  25.305  16.014 1.00 18.34  ? 8   DC  C N4    1 
ATOM   155  C C5    . DC  A 1 8   ? 12.801  26.610  14.300 1.00 16.26  ? 8   DC  C C5    1 
ATOM   156  C C6    . DC  A 1 8   ? 11.831  26.773  13.400 1.00 18.34  ? 8   DC  C C6    1 
ATOM   157  P P     . DC  A 1 9   ? 6.054   28.284  11.317 1.00 24.88  ? 9   DC  C P     1 
ATOM   158  O OP1   . DC  A 1 9   ? 4.938   28.077  10.402 1.00 35.69  ? 9   DC  C OP1   1 
ATOM   159  O OP2   . DC  A 1 9   ? 6.529   29.657  11.643 1.00 22.56  ? 9   DC  C OP2   1 
ATOM   160  O "O5'" . DC  A 1 9   ? 5.784   27.330  12.500 1.00 22.77  ? 9   DC  C "O5'" 1 
ATOM   161  C "C5'" . DC  A 1 9   ? 5.538   25.973  12.229 1.00 19.90  ? 9   DC  C "C5'" 1 
ATOM   162  C "C4'" . DC  A 1 9   ? 5.211   25.281  13.515 1.00 28.63  ? 9   DC  C "C4'" 1 
ATOM   163  O "O4'" . DC  A 1 9   ? 6.376   25.183  14.308 1.00 28.63  ? 9   DC  C "O4'" 1 
ATOM   164  C "C3'" . DC  A 1 9   ? 4.263   26.143  14.339 1.00 29.75  ? 9   DC  C "C3'" 1 
ATOM   165  O "O3'" . DC  A 1 9   ? 3.098   25.362  14.433 1.00 34.78  ? 9   DC  C "O3'" 1 
ATOM   166  C "C2'" . DC  A 1 9   ? 4.987   26.362  15.646 1.00 28.47  ? 9   DC  C "C2'" 1 
ATOM   167  C "C1'" . DC  A 1 9   ? 5.937   25.182  15.724 1.00 31.28  ? 9   DC  C "C1'" 1 
ATOM   168  N N1    . DC  A 1 9   ? 7.214   25.379  16.528 1.00 25.34  ? 9   DC  C N1    1 
ATOM   169  C C2    . DC  A 1 9   ? 7.467   24.638  17.675 1.00 20.76  ? 9   DC  C C2    1 
ATOM   170  O O2    . DC  A 1 9   ? 6.676   23.830  18.131 1.00 18.21  ? 9   DC  C O2    1 
ATOM   171  N N3    . DC  A 1 9   ? 8.646   24.841  18.308 1.00 21.11  ? 9   DC  C N3    1 
ATOM   172  C C4    . DC  A 1 9   ? 9.547   25.715  17.848 1.00 20.43  ? 9   DC  C C4    1 
ATOM   173  N N4    . DC  A 1 9   ? 10.723  25.925  18.429 1.00 20.18  ? 9   DC  C N4    1 
ATOM   174  C C5    . DC  A 1 9   ? 9.297   26.485  16.694 1.00 22.58  ? 9   DC  C C5    1 
ATOM   175  C C6    . DC  A 1 9   ? 8.130   26.276  16.061 1.00 22.53  ? 9   DC  C C6    1 
ATOM   176  P P     . DC  A 1 10  ? 1.732   26.076  14.916 1.00 37.17  ? 10  DC  C P     1 
ATOM   177  O OP1   . DC  A 1 10  ? 0.677   25.163  14.473 1.00 41.17  ? 10  DC  C OP1   1 
ATOM   178  O OP2   . DC  A 1 10  ? 1.703   27.563  14.637 1.00 32.21  ? 10  DC  C OP2   1 
ATOM   179  O "O5'" . DC  A 1 10  ? 1.864   25.872  16.548 1.00 40.62  ? 10  DC  C "O5'" 1 
ATOM   180  C "C5'" . DC  A 1 10  ? 1.681   24.621  17.306 1.00 37.28  ? 10  DC  C "C5'" 1 
ATOM   181  C "C4'" . DC  A 1 10  ? 1.698   24.847  18.835 1.00 32.50  ? 10  DC  C "C4'" 1 
ATOM   182  O "O4'" . DC  A 1 10  ? 3.020   25.031  19.346 1.00 28.34  ? 10  DC  C "O4'" 1 
ATOM   183  C "C3'" . DC  A 1 10  ? 1.000   26.145  19.154 1.00 32.01  ? 10  DC  C "C3'" 1 
ATOM   184  O "O3'" . DC  A 1 10  ? 0.378   25.896  20.382 1.00 39.85  ? 10  DC  C "O3'" 1 
ATOM   185  C "C2'" . DC  A 1 10  ? 2.082   27.199  19.180 1.00 28.71  ? 10  DC  C "C2'" 1 
ATOM   186  C "C1'" . DC  A 1 10  ? 3.117   26.328  19.810 1.00 25.12  ? 10  DC  C "C1'" 1 
ATOM   187  N N1    . DC  A 1 10  ? 4.490   26.772  19.746 1.00 22.19  ? 10  DC  C N1    1 
ATOM   188  C C2    . DC  A 1 10  ? 5.370   26.109  20.639 1.00 22.83  ? 10  DC  C C2    1 
ATOM   189  O O2    . DC  A 1 10  ? 4.995   25.174  21.414 1.00 21.90  ? 10  DC  C O2    1 
ATOM   190  N N3    . DC  A 1 10  ? 6.671   26.539  20.589 1.00 17.29  ? 10  DC  C N3    1 
ATOM   191  C C4    . DC  A 1 10  ? 7.058   27.555  19.780 1.00 17.59  ? 10  DC  C C4    1 
ATOM   192  N N4    . DC  A 1 10  ? 8.328   27.939  19.798 1.00 15.66  ? 10  DC  C N4    1 
ATOM   193  C C5    . DC  A 1 10  ? 6.160   28.252  18.911 1.00 18.36  ? 10  DC  C C5    1 
ATOM   194  C C6    . DC  A 1 10  ? 4.875   27.815  18.927 1.00 21.28  ? 10  DC  C C6    1 
ATOM   195  P P     . DA  A 1 11  ? -1.222  25.963  20.476 1.00 41.71  ? 11  DA  C P     1 
ATOM   196  O OP1   . DA  A 1 11  ? -1.832  24.922  19.616 1.00 39.59  ? 11  DA  C OP1   1 
ATOM   197  O OP2   . DA  A 1 11  ? -1.512  27.427  20.307 1.00 27.99  ? 11  DA  C OP2   1 
ATOM   198  O "O5'" . DA  A 1 11  ? -1.343  25.458  21.975 1.00 35.55  ? 11  DA  C "O5'" 1 
ATOM   199  C "C5'" . DA  A 1 11  ? -1.005  24.131  22.293 1.00 29.71  ? 11  DA  C "C5'" 1 
ATOM   200  C "C4'" . DA  A 1 11  ? -0.384  24.087  23.650 1.00 29.79  ? 11  DA  C "C4'" 1 
ATOM   201  O "O4'" . DA  A 1 11  ? 0.967   24.556  23.592 1.00 31.11  ? 11  DA  C "O4'" 1 
ATOM   202  C "C3'" . DA  A 1 11  ? -1.099  24.955  24.702 1.00 25.28  ? 11  DA  C "C3'" 1 
ATOM   203  O "O3'" . DA  A 1 11  ? -0.770  24.321  25.946 1.00 34.06  ? 11  DA  C "O3'" 1 
ATOM   204  C "C2'" . DA  A 1 11  ? -0.371  26.240  24.547 1.00 20.79  ? 11  DA  C "C2'" 1 
ATOM   205  C "C1'" . DA  A 1 11  ? 1.062   25.759  24.407 1.00 21.73  ? 11  DA  C "C1'" 1 
ATOM   206  N N9    . DA  A 1 11  ? 1.878   26.776  23.767 1.00 13.27  ? 11  DA  C N9    1 
ATOM   207  C C8    . DA  A 1 11  ? 1.514   27.659  22.799 1.00 17.77  ? 11  DA  C C8    1 
ATOM   208  N N7    . DA  A 1 11  ? 2.480   28.466  22.402 1.00 20.10  ? 11  DA  C N7    1 
ATOM   209  C C5    . DA  A 1 11  ? 3.575   28.079  23.209 1.00 16.66  ? 11  DA  C C5    1 
ATOM   210  C C6    . DA  A 1 11  ? 4.902   28.547  23.329 1.00 12.73  ? 11  DA  C C6    1 
ATOM   211  N N6    . DA  A 1 11  ? 5.413   29.535  22.613 1.00 13.61  ? 11  DA  C N6    1 
ATOM   212  N N1    . DA  A 1 11  ? 5.691   28.007  24.230 1.00 13.83  ? 11  DA  C N1    1 
ATOM   213  C C2    . DA  A 1 11  ? 5.201   27.027  24.993 1.00 18.61  ? 11  DA  C C2    1 
ATOM   214  N N3    . DA  A 1 11  ? 3.996   26.461  24.980 1.00 20.36  ? 11  DA  C N3    1 
ATOM   215  C C4    . DA  A 1 11  ? 3.200   27.053  24.042 1.00 17.97  ? 11  DA  C C4    1 
ATOM   216  P P     . DC  A 1 12  ? -1.236  24.676  27.413 1.00 23.25  ? 12  DC  C P     1 
ATOM   217  O OP1   . DC  A 1 12  ? -1.238  23.472  28.223 1.00 23.78  ? 12  DC  C OP1   1 
ATOM   218  O OP2   . DC  A 1 12  ? -2.417  25.529  27.282 1.00 23.15  ? 12  DC  C OP2   1 
ATOM   219  O "O5'" . DC  A 1 12  ? -0.103  25.503  27.855 1.00 24.32  ? 12  DC  C "O5'" 1 
ATOM   220  C "C5'" . DC  A 1 12  ? 1.101   24.961  28.407 1.00 29.13  ? 12  DC  C "C5'" 1 
ATOM   221  C "C4'" . DC  A 1 12  ? 1.898   26.161  28.881 1.00 22.29  ? 12  DC  C "C4'" 1 
ATOM   222  O "O4'" . DC  A 1 12  ? 2.066   26.954  27.681 1.00 27.99  ? 12  DC  C "O4'" 1 
ATOM   223  C "C3'" . DC  A 1 12  ? 1.097   27.107  29.817 1.00 19.88  ? 12  DC  C "C3'" 1 
ATOM   224  O "O3'" . DC  A 1 12  ? 1.766   27.465  31.055 1.00 23.42  ? 12  DC  C "O3'" 1 
ATOM   225  C "C2'" . DC  A 1 12  ? 0.860   28.286  28.904 1.00 18.02  ? 12  DC  C "C2'" 1 
ATOM   226  C "C1'" . DC  A 1 12  ? 2.153   28.259  28.128 1.00 17.79  ? 12  DC  C "C1'" 1 
ATOM   227  N N1    . DC  A 1 12  ? 2.205   29.176  27.034 1.00 17.26  ? 12  DC  C N1    1 
ATOM   228  C C2    . DC  A 1 12  ? 3.429   29.753  26.774 1.00 19.57  ? 12  DC  C C2    1 
ATOM   229  O O2    . DC  A 1 12  ? 4.446   29.473  27.396 1.00 22.02  ? 12  DC  C O2    1 
ATOM   230  N N3    . DC  A 1 12  ? 3.502   30.671  25.759 1.00 22.10  ? 12  DC  C N3    1 
ATOM   231  C C4    . DC  A 1 12  ? 2.415   31.012  25.011 1.00 21.68  ? 12  DC  C C4    1 
ATOM   232  N N4    . DC  A 1 12  ? 2.572   31.918  24.007 1.00 20.32  ? 12  DC  C N4    1 
ATOM   233  C C5    . DC  A 1 12  ? 1.144   30.428  25.309 1.00 17.15  ? 12  DC  C C5    1 
ATOM   234  C C6    . DC  A 1 12  ? 1.083   29.525  26.312 1.00 17.94  ? 12  DC  C C6    1 
ATOM   235  P P     . DA  A 1 13  ? 1.597   26.576  32.385 1.00 27.05  ? 13  DA  C P     1 
ATOM   236  O OP1   . DA  A 1 13  ? 1.617   25.142  31.971 1.00 30.61  ? 13  DA  C OP1   1 
ATOM   237  O OP2   . DA  A 1 13  ? 0.437   27.094  33.160 1.00 25.40  ? 13  DA  C OP2   1 
ATOM   238  O "O5'" . DA  A 1 13  ? 2.955   26.917  33.156 1.00 25.85  ? 13  DA  C "O5'" 1 
ATOM   239  C "C5'" . DA  A 1 13  ? 4.245   26.329  32.892 1.00 21.00  ? 13  DA  C "C5'" 1 
ATOM   240  C "C4'" . DA  A 1 13  ? 5.330   27.356  33.197 1.00 18.91  ? 13  DA  C "C4'" 1 
ATOM   241  O "O4'" . DA  A 1 13  ? 5.258   28.424  32.265 1.00 22.32  ? 13  DA  C "O4'" 1 
ATOM   242  C "C3'" . DA  A 1 13  ? 5.229   28.049  34.526 1.00 20.86  ? 13  DA  C "C3'" 1 
ATOM   243  O "O3'" . DA  A 1 13  ? 6.580   28.265  34.845 1.00 22.26  ? 13  DA  C "O3'" 1 
ATOM   244  C "C2'" . DA  A 1 13  ? 4.455   29.305  34.174 1.00 17.48  ? 13  DA  C "C2'" 1 
ATOM   245  C "C1'" . DA  A 1 13  ? 5.016   29.712  32.867 1.00 16.70  ? 13  DA  C "C1'" 1 
ATOM   246  N N9    . DA  A 1 13  ? 4.116   30.366  31.905 1.00 14.85  ? 13  DA  C N9    1 
ATOM   247  C C8    . DA  A 1 13  ? 2.755   30.222  31.804 1.00 15.75  ? 13  DA  C C8    1 
ATOM   248  N N7    . DA  A 1 13  ? 2.217   30.919  30.845 1.00 16.01  ? 13  DA  C N7    1 
ATOM   249  C C5    . DA  A 1 13  ? 3.320   31.578  30.249 1.00 15.55  ? 13  DA  C C5    1 
ATOM   250  C C6    . DA  A 1 13  ? 3.414   32.485  29.161 1.00 14.17  ? 13  DA  C C6    1 
ATOM   251  N N6    . DA  A 1 13  ? 2.313   32.860  28.471 1.00 15.51  ? 13  DA  C N6    1 
ATOM   252  N N1    . DA  A 1 13  ? 4.641   32.969  28.848 1.00 15.56  ? 13  DA  C N1    1 
ATOM   253  C C2    . DA  A 1 13  ? 5.680   32.558  29.594 1.00 13.56  ? 13  DA  C C2    1 
ATOM   254  N N3    . DA  A 1 13  ? 5.726   31.689  30.596 1.00 12.84  ? 13  DA  C N3    1 
ATOM   255  C C4    . DA  A 1 13  ? 4.485   31.225  30.880 1.00 12.93  ? 13  DA  C C4    1 
ATOM   256  P P     . DC  A 1 14  ? 6.953   29.049  36.160 1.00 21.35  ? 14  DC  C P     1 
ATOM   257  O OP1   . DC  A 1 14  ? 8.325   28.771  36.471 1.00 17.13  ? 14  DC  C OP1   1 
ATOM   258  O OP2   . DC  A 1 14  ? 5.909   28.842  37.195 1.00 23.47  ? 14  DC  C OP2   1 
ATOM   259  O "O5'" . DC  A 1 14  ? 6.938   30.520  35.659 1.00 23.19  ? 14  DC  C "O5'" 1 
ATOM   260  C "C5'" . DC  A 1 14  ? 8.062   31.081  35.066 1.00 15.04  ? 14  DC  C "C5'" 1 
ATOM   261  C "C4'" . DC  A 1 14  ? 7.765   32.491  34.907 1.00 12.69  ? 14  DC  C "C4'" 1 
ATOM   262  O "O4'" . DC  A 1 14  ? 6.657   32.475  34.100 1.00 14.96  ? 14  DC  C "O4'" 1 
ATOM   263  C "C3'" . DC  A 1 14  ? 7.275   33.270  36.135 1.00 18.72  ? 14  DC  C "C3'" 1 
ATOM   264  O "O3'" . DC  A 1 14  ? 8.297   34.247  36.468 1.00 22.75  ? 14  DC  C "O3'" 1 
ATOM   265  C "C2'" . DC  A 1 14  ? 5.974   33.906  35.599 1.00 19.24  ? 14  DC  C "C2'" 1 
ATOM   266  C "C1'" . DC  A 1 14  ? 6.230   33.820  34.116 1.00 17.09  ? 14  DC  C "C1'" 1 
ATOM   267  N N1    . DC  A 1 14  ? 4.987   34.003  33.333 1.00 20.04  ? 14  DC  C N1    1 
ATOM   268  C C2    . DC  A 1 14  ? 5.052   34.814  32.180 1.00 19.53  ? 14  DC  C C2    1 
ATOM   269  O O2    . DC  A 1 14  ? 6.054   35.411  31.738 1.00 20.23  ? 14  DC  C O2    1 
ATOM   270  N N3    . DC  A 1 14  ? 3.871   34.951  31.529 1.00 15.51  ? 14  DC  C N3    1 
ATOM   271  C C4    . DC  A 1 14  ? 2.691   34.410  31.907 1.00 13.64  ? 14  DC  C C4    1 
ATOM   272  N N4    . DC  A 1 14  ? 1.578   34.695  31.143 1.00 10.00  ? 14  DC  C N4    1 
ATOM   273  C C5    . DC  A 1 14  ? 2.639   33.590  33.061 1.00 11.67  ? 14  DC  C C5    1 
ATOM   274  C C6    . DC  A 1 14  ? 3.791   33.410  33.731 1.00 16.32  ? 14  DC  C C6    1 
ATOM   275  P P     . DA  A 1 15  ? 8.253   35.631  37.218 1.00 17.25  ? 15  DA  C P     1 
ATOM   276  O OP1   . DA  A 1 15  ? 9.613   35.927  37.698 1.00 29.21  ? 15  DA  C OP1   1 
ATOM   277  O OP2   . DA  A 1 15  ? 7.187   35.548  38.225 1.00 23.38  ? 15  DA  C OP2   1 
ATOM   278  O "O5'" . DA  A 1 15  ? 7.861   36.716  36.135 1.00 21.49  ? 15  DA  C "O5'" 1 
ATOM   279  C "C5'" . DA  A 1 15  ? 8.697   36.908  34.982 1.00 19.89  ? 15  DA  C "C5'" 1 
ATOM   280  C "C4'" . DA  A 1 15  ? 8.079   37.937  34.097 1.00 18.85  ? 15  DA  C "C4'" 1 
ATOM   281  O "O4'" . DA  A 1 15  ? 6.815   37.430  33.771 1.00 18.28  ? 15  DA  C "O4'" 1 
ATOM   282  C "C3'" . DA  A 1 15  ? 7.765   39.187  34.864 1.00 24.53  ? 15  DA  C "C3'" 1 
ATOM   283  O "O3'" . DA  A 1 15  ? 8.474   40.292  34.397 1.00 27.84  ? 15  DA  C "O3'" 1 
ATOM   284  C "C2'" . DA  A 1 15  ? 6.356   39.454  34.658 1.00 19.87  ? 15  DA  C "C2'" 1 
ATOM   285  C "C1'" . DA  A 1 15  ? 6.014   38.589  33.534 1.00 20.42  ? 15  DA  C "C1'" 1 
ATOM   286  N N9    . DA  A 1 15  ? 4.611   38.191  33.575 1.00 16.13  ? 15  DA  C N9    1 
ATOM   287  C C8    . DA  A 1 15  ? 4.005   37.320  34.422 1.00 15.14  ? 15  DA  C C8    1 
ATOM   288  N N7    . DA  A 1 15  ? 2.748   37.142  34.167 1.00 16.74  ? 15  DA  C N7    1 
ATOM   289  C C5    . DA  A 1 15  ? 2.504   37.968  33.066 1.00 16.04  ? 15  DA  C C5    1 
ATOM   290  C C6    . DA  A 1 15  ? 1.337   38.265  32.330 1.00 14.97  ? 15  DA  C C6    1 
ATOM   291  N N6    . DA  A 1 15  ? 0.191   37.664  32.671 1.00 13.94  ? 15  DA  C N6    1 
ATOM   292  N N1    . DA  A 1 15  ? 1.390   39.149  31.300 1.00 14.15  ? 15  DA  C N1    1 
ATOM   293  C C2    . DA  A 1 15  ? 2.558   39.694  31.084 1.00 14.70  ? 15  DA  C C2    1 
ATOM   294  N N3    . DA  A 1 15  ? 3.726   39.520  31.708 1.00 18.78  ? 15  DA  C N3    1 
ATOM   295  C C4    . DA  A 1 15  ? 3.635   38.616  32.707 1.00 16.30  ? 15  DA  C C4    1 
ATOM   296  P P     . DC  A 1 16  ? 8.665   41.524  35.431 1.00 32.96  ? 16  DC  C P     1 
ATOM   297  O OP1   . DC  A 1 16  ? 9.995   42.158  35.208 1.00 37.13  ? 16  DC  C OP1   1 
ATOM   298  O OP2   . DC  A 1 16  ? 8.214   41.121  36.774 1.00 38.45  ? 16  DC  C OP2   1 
ATOM   299  O "O5'" . DC  A 1 16  ? 7.572   42.508  34.902 1.00 38.03  ? 16  DC  C "O5'" 1 
ATOM   300  C "C5'" . DC  A 1 16  ? 7.774   43.231  33.678 1.00 35.58  ? 16  DC  C "C5'" 1 
ATOM   301  C "C4'" . DC  A 1 16  ? 6.585   44.020  33.234 1.00 33.74  ? 16  DC  C "C4'" 1 
ATOM   302  O "O4'" . DC  A 1 16  ? 5.515   43.144  33.083 1.00 31.77  ? 16  DC  C "O4'" 1 
ATOM   303  C "C3'" . DC  A 1 16  ? 6.172   44.948  34.330 1.00 38.05  ? 16  DC  C "C3'" 1 
ATOM   304  O "O3'" . DC  A 1 16  ? 6.395   46.209  33.801 1.00 46.95  ? 16  DC  C "O3'" 1 
ATOM   305  C "C2'" . DC  A 1 16  ? 4.754   44.667  34.679 1.00 31.55  ? 16  DC  C "C2'" 1 
ATOM   306  C "C1'" . DC  A 1 16  ? 4.366   43.856  33.537 1.00 28.94  ? 16  DC  C "C1'" 1 
ATOM   307  N N1    . DC  A 1 16  ? 3.357   42.911  33.939 1.00 23.18  ? 16  DC  C N1    1 
ATOM   308  C C2    . DC  A 1 16  ? 2.306   42.771  33.068 1.00 25.38  ? 16  DC  C C2    1 
ATOM   309  O O2    . DC  A 1 16  ? 2.212   43.428  32.009 1.00 31.66  ? 16  DC  C O2    1 
ATOM   310  N N3    . DC  A 1 16  ? 1.319   41.891  33.373 1.00 21.22  ? 16  DC  C N3    1 
ATOM   311  C C4    . DC  A 1 16  ? 1.397   41.195  34.474 1.00 17.43  ? 16  DC  C C4    1 
ATOM   312  N N4    . DC  A 1 16  ? 0.400   40.358  34.679 1.00 19.19  ? 16  DC  C N4    1 
ATOM   313  C C5    . DC  A 1 16  ? 2.476   41.309  35.375 1.00 18.08  ? 16  DC  C C5    1 
ATOM   314  C C6    . DC  A 1 16  ? 3.455   42.180  35.064 1.00 20.74  ? 16  DC  C C6    1 
ATOM   315  P P     . DC  A 1 17  ? 6.281   47.416  34.812 1.00 50.23  ? 17  DC  C P     1 
ATOM   316  O OP1   . DC  A 1 17  ? 7.585   48.080  34.749 1.00 53.11  ? 17  DC  C OP1   1 
ATOM   317  O OP2   . DC  A 1 17  ? 5.699   47.048  36.137 1.00 48.58  ? 17  DC  C OP2   1 
ATOM   318  O "O5'" . DC  A 1 17  ? 5.154   48.131  33.960 1.00 48.03  ? 17  DC  C "O5'" 1 
ATOM   319  C "C5'" . DC  A 1 17  ? 5.008   48.031  32.537 1.00 41.80  ? 17  DC  C "C5'" 1 
ATOM   320  C "C4'" . DC  A 1 17  ? 3.558   48.227  32.146 1.00 43.97  ? 17  DC  C "C4'" 1 
ATOM   321  O "O4'" . DC  A 1 17  ? 2.741   47.073  32.344 1.00 41.54  ? 17  DC  C "O4'" 1 
ATOM   322  C "C3'" . DC  A 1 17  ? 2.895   49.315  32.977 1.00 45.10  ? 17  DC  C "C3'" 1 
ATOM   323  O "O3'" . DC  A 1 17  ? 2.134   50.174  32.159 1.00 55.09  ? 17  DC  C "O3'" 1 
ATOM   324  C "C2'" . DC  A 1 17  ? 1.897   48.595  33.810 1.00 40.50  ? 17  DC  C "C2'" 1 
ATOM   325  C "C1'" . DC  A 1 17  ? 1.458   47.525  32.858 1.00 37.37  ? 17  DC  C "C1'" 1 
ATOM   326  N N1    . DC  A 1 17  ? 0.890   46.475  33.678 1.00 26.99  ? 17  DC  C N1    1 
ATOM   327  C C2    . DC  A 1 17  ? -0.292  45.929  33.285 1.00 25.79  ? 17  DC  C C2    1 
ATOM   328  O O2    . DC  A 1 17  ? -0.926  46.281  32.267 1.00 21.34  ? 17  DC  C O2    1 
ATOM   329  N N3    . DC  A 1 17  ? -0.748  44.934  34.128 1.00 25.70  ? 17  DC  C N3    1 
ATOM   330  C C4    . DC  A 1 17  ? -0.104  44.510  35.252 1.00 22.77  ? 17  DC  C C4    1 
ATOM   331  N N4    . DC  A 1 17  ? -0.608  43.540  36.025 1.00 18.05  ? 17  DC  C N4    1 
ATOM   332  C C5    . DC  A 1 17  ? 1.122   45.090  35.624 1.00 25.13  ? 17  DC  C C5    1 
ATOM   333  C C6    . DC  A 1 17  ? 1.572   46.064  34.813 1.00 27.76  ? 17  DC  C C6    1 
ATOM   334  P P     . DA  A 1 18  ? 1.903   51.695  32.665 1.00 54.97  ? 18  DA  C P     1 
ATOM   335  O OP1   . DA  A 1 18  ? 2.802   52.555  31.877 1.00 58.53  ? 18  DA  C OP1   1 
ATOM   336  O OP2   . DA  A 1 18  ? 1.892   51.759  34.163 1.00 57.40  ? 18  DA  C OP2   1 
ATOM   337  O "O5'" . DA  A 1 18  ? 0.449   51.881  32.155 1.00 50.47  ? 18  DA  C "O5'" 1 
ATOM   338  C "C5'" . DA  A 1 18  ? 0.024   51.323  30.934 1.00 43.57  ? 18  DA  C "C5'" 1 
ATOM   339  C "C4'" . DA  A 1 18  ? -1.493  51.275  30.936 1.00 46.64  ? 18  DA  C "C4'" 1 
ATOM   340  O "O4'" . DA  A 1 18  ? -2.057  50.156  31.637 1.00 43.60  ? 18  DA  C "O4'" 1 
ATOM   341  C "C3'" . DA  A 1 18  ? -2.151  52.564  31.481 1.00 48.73  ? 18  DA  C "C3'" 1 
ATOM   342  O "O3'" . DA  A 1 18  ? -3.261  52.857  30.587 1.00 51.54  ? 18  DA  C "O3'" 1 
ATOM   343  C "C2'" . DA  A 1 18  ? -2.462  52.094  32.914 1.00 41.34  ? 18  DA  C "C2'" 1 
ATOM   344  C "C1'" . DA  A 1 18  ? -2.726  50.595  32.808 1.00 35.69  ? 18  DA  C "C1'" 1 
ATOM   345  N N9    . DA  A 1 18  ? -2.193  49.837  33.953 1.00 31.75  ? 18  DA  C N9    1 
ATOM   346  C C8    . DA  A 1 18  ? -1.073  50.058  34.746 1.00 32.73  ? 18  DA  C C8    1 
ATOM   347  N N7    . DA  A 1 18  ? -0.921  49.159  35.706 1.00 31.57  ? 18  DA  C N7    1 
ATOM   348  C C5    . DA  A 1 18  ? -2.012  48.318  35.534 1.00 24.84  ? 18  DA  C C5    1 
ATOM   349  C C6    . DA  A 1 18  ? -2.438  47.207  36.232 1.00 21.79  ? 18  DA  C C6    1 
ATOM   350  N N6    . DA  A 1 18  ? -1.776  46.724  37.258 1.00 28.02  ? 18  DA  C N6    1 
ATOM   351  N N1    . DA  A 1 18  ? -3.547  46.584  35.849 1.00 24.38  ? 18  DA  C N1    1 
ATOM   352  C C2    . DA  A 1 18  ? -4.220  47.079  34.805 1.00 27.09  ? 18  DA  C C2    1 
ATOM   353  N N3    . DA  A 1 18  ? -3.924  48.148  34.047 1.00 28.21  ? 18  DA  C N3    1 
ATOM   354  C C4    . DA  A 1 18  ? -2.771  48.717  34.472 1.00 27.07  ? 18  DA  C C4    1 
ATOM   355  P P     . DG  A 1 19  ? -4.229  54.101  30.702 1.00 48.96  ? 19  DG  C P     1 
ATOM   356  O OP1   . DG  A 1 19  ? -4.786  54.457  29.352 1.00 51.21  ? 19  DG  C OP1   1 
ATOM   357  O OP2   . DG  A 1 19  ? -3.524  55.077  31.573 1.00 45.63  ? 19  DG  C OP2   1 
ATOM   358  O "O5'" . DG  A 1 19  ? -5.427  53.395  31.450 1.00 46.04  ? 19  DG  C "O5'" 1 
ATOM   359  C "C5'" . DG  A 1 19  ? -6.233  52.395  30.816 1.00 41.33  ? 19  DG  C "C5'" 1 
ATOM   360  C "C4'" . DG  A 1 19  ? -7.135  51.762  31.881 1.00 45.43  ? 19  DG  C "C4'" 1 
ATOM   361  O "O4'" . DG  A 1 19  ? -6.339  51.177  32.964 1.00 44.11  ? 19  DG  C "O4'" 1 
ATOM   362  C "C3'" . DG  A 1 19  ? -8.075  52.786  32.625 1.00 44.75  ? 19  DG  C "C3'" 1 
ATOM   363  O "O3'" . DG  A 1 19  ? -9.339  52.113  32.980 1.00 42.36  ? 19  DG  C "O3'" 1 
ATOM   364  C "C2'" . DG  A 1 19  ? -7.188  53.180  33.872 1.00 37.27  ? 19  DG  C "C2'" 1 
ATOM   365  C "C1'" . DG  A 1 19  ? -6.653  51.830  34.250 1.00 36.43  ? 19  DG  C "C1'" 1 
ATOM   366  N N9    . DG  A 1 19  ? -5.590  51.649  35.274 1.00 29.71  ? 19  DG  C N9    1 
ATOM   367  C C8    . DG  A 1 19  ? -4.424  52.365  35.496 1.00 31.30  ? 19  DG  C C8    1 
ATOM   368  N N7    . DG  A 1 19  ? -3.690  51.885  36.497 1.00 32.65  ? 19  DG  C N7    1 
ATOM   369  C C5    . DG  A 1 19  ? -4.419  50.755  36.969 1.00 29.12  ? 19  DG  C C5    1 
ATOM   370  C C6    . DG  A 1 19  ? -4.118  49.804  38.035 1.00 28.66  ? 19  DG  C C6    1 
ATOM   371  O O6    . DG  A 1 19  ? -3.120  49.768  38.792 1.00 32.49  ? 19  DG  C O6    1 
ATOM   372  N N1    . DG  A 1 19  ? -5.109  48.824  38.155 1.00 20.01  ? 19  DG  C N1    1 
ATOM   373  C C2    . DG  A 1 19  ? -6.222  48.773  37.356 1.00 22.59  ? 19  DG  C C2    1 
ATOM   374  N N2    . DG  A 1 19  ? -7.084  47.806  37.588 1.00 24.04  ? 19  DG  C N2    1 
ATOM   375  N N3    . DG  A 1 19  ? -6.491  49.626  36.357 1.00 25.80  ? 19  DG  C N3    1 
ATOM   376  C C4    . DG  A 1 19  ? -5.561  50.608  36.214 1.00 27.18  ? 19  DG  C C4    1 
ATOM   377  O "O5'" . DC  B 2 1   ? 1.533   41.810  45.412 1.00 35.79  ? 20  DC  D "O5'" 1 
ATOM   378  C "C5'" . DC  B 2 1   ? 0.457   42.196  46.244 1.00 36.24  ? 20  DC  D "C5'" 1 
ATOM   379  C "C4'" . DC  B 2 1   ? -0.665  42.975  45.599 1.00 45.48  ? 20  DC  D "C4'" 1 
ATOM   380  O "O4'" . DC  B 2 1   ? -0.264  44.303  45.184 1.00 53.66  ? 20  DC  D "O4'" 1 
ATOM   381  C "C3'" . DC  B 2 1   ? -1.299  42.314  44.386 1.00 46.26  ? 20  DC  D "C3'" 1 
ATOM   382  O "O3'" . DC  B 2 1   ? -2.681  42.609  44.233 1.00 37.24  ? 20  DC  D "O3'" 1 
ATOM   383  C "C2'" . DC  B 2 1   ? -0.602  43.050  43.257 1.00 52.49  ? 20  DC  D "C2'" 1 
ATOM   384  C "C1'" . DC  B 2 1   ? -0.390  44.486  43.737 1.00 57.02  ? 20  DC  D "C1'" 1 
ATOM   385  N N1    . DC  B 2 1   ? 0.798   45.183  43.069 1.00 56.45  ? 20  DC  D N1    1 
ATOM   386  C C2    . DC  B 2 1   ? 0.560   46.311  42.291 1.00 56.76  ? 20  DC  D C2    1 
ATOM   387  O O2    . DC  B 2 1   ? -0.573  46.780  42.101 1.00 56.15  ? 20  DC  D O2    1 
ATOM   388  N N3    . DC  B 2 1   ? 1.680   46.882  41.736 1.00 59.35  ? 20  DC  D N3    1 
ATOM   389  C C4    . DC  B 2 1   ? 2.957   46.450  41.889 1.00 58.62  ? 20  DC  D C4    1 
ATOM   390  N N4    . DC  B 2 1   ? 3.993   47.101  41.290 1.00 57.48  ? 20  DC  D N4    1 
ATOM   391  C C5    . DC  B 2 1   ? 3.184   45.291  42.672 1.00 57.43  ? 20  DC  D C5    1 
ATOM   392  C C6    . DC  B 2 1   ? 2.095   44.713  43.231 1.00 57.75  ? 20  DC  D C6    1 
ATOM   393  P P     . DC  B 2 2   ? -3.719  41.720  44.999 1.00 41.45  ? 21  DC  D P     1 
ATOM   394  O OP1   . DC  B 2 2   ? -3.767  42.190  46.399 1.00 49.58  ? 21  DC  D OP1   1 
ATOM   395  O OP2   . DC  B 2 2   ? -3.397  40.275  44.787 1.00 47.83  ? 21  DC  D OP2   1 
ATOM   396  O "O5'" . DC  B 2 2   ? -5.128  42.111  44.366 1.00 38.74  ? 21  DC  D "O5'" 1 
ATOM   397  C "C5'" . DC  B 2 2   ? -6.428  42.061  44.978 1.00 38.32  ? 21  DC  D "C5'" 1 
ATOM   398  C "C4'" . DC  B 2 2   ? -7.382  42.882  44.102 1.00 41.96  ? 21  DC  D "C4'" 1 
ATOM   399  O "O4'" . DC  B 2 2   ? -6.836  44.219  43.826 1.00 41.38  ? 21  DC  D "O4'" 1 
ATOM   400  C "C3'" . DC  B 2 2   ? -7.499  42.214  42.732 1.00 44.30  ? 21  DC  D "C3'" 1 
ATOM   401  O "O3'" . DC  B 2 2   ? -8.545  41.207  42.714 1.00 49.20  ? 21  DC  D "O3'" 1 
ATOM   402  C "C2'" . DC  B 2 2   ? -7.759  43.403  41.789 1.00 41.30  ? 21  DC  D "C2'" 1 
ATOM   403  C "C1'" . DC  B 2 2   ? -7.112  44.607  42.451 1.00 33.89  ? 21  DC  D "C1'" 1 
ATOM   404  N N1    . DC  B 2 2   ? -5.907  45.296  41.853 1.00 29.70  ? 21  DC  D N1    1 
ATOM   405  C C2    . DC  B 2 2   ? -6.040  46.045  40.690 1.00 27.62  ? 21  DC  D C2    1 
ATOM   406  O O2    . DC  B 2 2   ? -7.152  46.130  40.120 1.00 29.69  ? 21  DC  D O2    1 
ATOM   407  N N3    . DC  B 2 2   ? -4.888  46.671  40.214 1.00 22.92  ? 21  DC  D N3    1 
ATOM   408  C C4    . DC  B 2 2   ? -3.709  46.585  40.850 1.00 20.77  ? 21  DC  D C4    1 
ATOM   409  N N4    . DC  B 2 2   ? -2.605  47.188  40.434 1.00 23.76  ? 21  DC  D N4    1 
ATOM   410  C C5    . DC  B 2 2   ? -3.574  45.825  42.009 1.00 22.69  ? 21  DC  D C5    1 
ATOM   411  C C6    . DC  B 2 2   ? -4.677  45.216  42.474 1.00 26.54  ? 21  DC  D C6    1 
ATOM   412  P P     . DT  B 2 3   ? -8.567  40.111  41.544 1.00 48.01  ? 22  DT  D P     1 
ATOM   413  O OP1   . DT  B 2 3   ? -9.769  39.268  41.759 1.00 50.38  ? 22  DT  D OP1   1 
ATOM   414  O OP2   . DT  B 2 3   ? -7.243  39.436  41.347 1.00 43.03  ? 22  DT  D OP2   1 
ATOM   415  O "O5'" . DT  B 2 3   ? -8.928  41.135  40.316 1.00 46.32  ? 22  DT  D "O5'" 1 
ATOM   416  C "C5'" . DT  B 2 3   ? -10.277 41.510  39.867 1.00 40.48  ? 22  DT  D "C5'" 1 
ATOM   417  C "C4'" . DT  B 2 3   ? -10.279 42.118  38.430 1.00 36.00  ? 22  DT  D "C4'" 1 
ATOM   418  O "O4'" . DT  B 2 3   ? -9.208  43.093  38.332 1.00 37.85  ? 22  DT  D "O4'" 1 
ATOM   419  C "C3'" . DT  B 2 3   ? -9.927  41.183  37.312 1.00 37.17  ? 22  DT  D "C3'" 1 
ATOM   420  O "O3'" . DT  B 2 3   ? -10.733 41.303  36.170 1.00 42.39  ? 22  DT  D "O3'" 1 
ATOM   421  C "C2'" . DT  B 2 3   ? -8.538  41.531  36.912 1.00 34.79  ? 22  DT  D "C2'" 1 
ATOM   422  C "C1'" . DT  B 2 3   ? -8.408  42.982  37.136 1.00 29.08  ? 22  DT  D "C1'" 1 
ATOM   423  N N1    . DT  B 2 3   ? -6.987  43.307  37.474 1.00 22.70  ? 22  DT  D N1    1 
ATOM   424  C C2    . DT  B 2 3   ? -6.430  44.372  36.805 1.00 21.89  ? 22  DT  D C2    1 
ATOM   425  O O2    . DT  B 2 3   ? -7.071  45.025  36.000 1.00 23.75  ? 22  DT  D O2    1 
ATOM   426  N N3    . DT  B 2 3   ? -5.091  44.679  37.099 1.00 20.17  ? 22  DT  D N3    1 
ATOM   427  C C4    . DT  B 2 3   ? -4.286  43.998  38.039 1.00 18.07  ? 22  DT  D C4    1 
ATOM   428  O O4    . DT  B 2 3   ? -3.117  44.363  38.244 1.00 24.68  ? 22  DT  D O4    1 
ATOM   429  C C5    . DT  B 2 3   ? -4.942  42.908  38.694 1.00 16.28  ? 22  DT  D C5    1 
ATOM   430  C C7    . DT  B 2 3   ? -4.149  42.154  39.697 1.00 14.90  ? 22  DT  D C7    1 
ATOM   431  C C6    . DT  B 2 3   ? -6.234  42.576  38.416 1.00 17.87  ? 22  DT  D C6    1 
ATOM   432  P P     . DG  B 2 4   ? -11.081 39.923  35.372 1.00 45.95  ? 23  DG  D P     1 
ATOM   433  O OP1   . DG  B 2 4   ? -12.464 39.524  35.737 1.00 48.83  ? 23  DG  D OP1   1 
ATOM   434  O OP2   . DG  B 2 4   ? -9.976  38.905  35.360 1.00 44.50  ? 23  DG  D OP2   1 
ATOM   435  O "O5'" . DG  B 2 4   ? -10.996 40.610  33.957 1.00 47.64  ? 23  DG  D "O5'" 1 
ATOM   436  C "C5'" . DG  B 2 4   ? -11.119 42.000  33.678 1.00 39.12  ? 23  DG  D "C5'" 1 
ATOM   437  C "C4'" . DG  B 2 4   ? -10.146 42.391  32.570 1.00 36.40  ? 23  DG  D "C4'" 1 
ATOM   438  O "O4'" . DG  B 2 4   ? -8.906  42.929  33.068 1.00 37.76  ? 23  DG  D "O4'" 1 
ATOM   439  C "C3'" . DG  B 2 4   ? -9.799  41.385  31.405 1.00 38.56  ? 23  DG  D "C3'" 1 
ATOM   440  O "O3'" . DG  B 2 4   ? -9.806  42.225  30.199 1.00 41.23  ? 23  DG  D "O3'" 1 
ATOM   441  C "C2'" . DG  B 2 4   ? -8.329  41.052  31.788 1.00 28.37  ? 23  DG  D "C2'" 1 
ATOM   442  C "C1'" . DG  B 2 4   ? -7.763  42.404  32.305 1.00 24.51  ? 23  DG  D "C1'" 1 
ATOM   443  N N9    . DG  B 2 4   ? -6.639  42.162  33.203 1.00 18.71  ? 23  DG  D N9    1 
ATOM   444  C C8    . DG  B 2 4   ? -6.595  41.163  34.176 1.00 15.54  ? 23  DG  D C8    1 
ATOM   445  N N7    . DG  B 2 4   ? -5.490  41.137  34.856 1.00 18.66  ? 23  DG  D N7    1 
ATOM   446  C C5    . DG  B 2 4   ? -4.763  42.217  34.325 1.00 17.42  ? 23  DG  D C5    1 
ATOM   447  C C6    . DG  B 2 4   ? -3.512  42.676  34.679 1.00 19.48  ? 23  DG  D C6    1 
ATOM   448  O O6    . DG  B 2 4   ? -2.778  42.219  35.563 1.00 21.91  ? 23  DG  D O6    1 
ATOM   449  N N1    . DG  B 2 4   ? -3.117  43.781  33.896 1.00 19.34  ? 23  DG  D N1    1 
ATOM   450  C C2    . DG  B 2 4   ? -3.839  44.386  32.903 1.00 17.19  ? 23  DG  D C2    1 
ATOM   451  N N2    . DG  B 2 4   ? -3.282  45.421  32.278 1.00 15.24  ? 23  DG  D N2    1 
ATOM   452  N N3    . DG  B 2 4   ? -5.031  43.953  32.581 1.00 19.25  ? 23  DG  D N3    1 
ATOM   453  C C4    . DG  B 2 4   ? -5.445  42.868  33.320 1.00 17.38  ? 23  DG  D C4    1 
ATOM   454  P P     . DG  B 2 5   ? -9.949  41.947  28.635 1.00 36.06  ? 24  DG  D P     1 
ATOM   455  O OP1   . DG  B 2 5   ? -10.789 43.066  28.136 1.00 34.72  ? 24  DG  D OP1   1 
ATOM   456  O OP2   . DG  B 2 5   ? -10.314 40.507  28.417 1.00 32.55  ? 24  DG  D OP2   1 
ATOM   457  O "O5'" . DG  B 2 5   ? -8.442  42.190  28.243 1.00 26.77  ? 24  DG  D "O5'" 1 
ATOM   458  C "C5'" . DG  B 2 5   ? -8.231  43.528  27.911 1.00 26.48  ? 24  DG  D "C5'" 1 
ATOM   459  C "C4'" . DG  B 2 5   ? -6.912  43.739  27.343 1.00 28.79  ? 24  DG  D "C4'" 1 
ATOM   460  O "O4'" . DG  B 2 5   ? -5.938  43.733  28.395 1.00 32.06  ? 24  DG  D "O4'" 1 
ATOM   461  C "C3'" . DG  B 2 5   ? -6.540  42.685  26.344 1.00 31.87  ? 24  DG  D "C3'" 1 
ATOM   462  O "O3'" . DG  B 2 5   ? -5.839  43.584  25.472 1.00 37.91  ? 24  DG  D "O3'" 1 
ATOM   463  C "C2'" . DG  B 2 5   ? -5.714  41.750  27.231 1.00 19.92  ? 24  DG  D "C2'" 1 
ATOM   464  C "C1'" . DG  B 2 5   ? -4.958  42.743  28.159 1.00 25.67  ? 24  DG  D "C1'" 1 
ATOM   465  N N9    . DG  B 2 5   ? -4.469  42.030  29.369 1.00 20.79  ? 24  DG  D N9    1 
ATOM   466  C C8    . DG  B 2 5   ? -5.158  41.026  29.990 1.00 21.52  ? 24  DG  D C8    1 
ATOM   467  N N7    . DG  B 2 5   ? -4.522  40.469  30.985 1.00 21.36  ? 24  DG  D N7    1 
ATOM   468  C C5    . DG  B 2 5   ? -3.324  41.183  31.055 1.00 17.29  ? 24  DG  D C5    1 
ATOM   469  C C6    . DG  B 2 5   ? -2.273  40.989  31.977 1.00 15.99  ? 24  DG  D C6    1 
ATOM   470  O O6    . DG  B 2 5   ? -2.284  40.124  32.889 1.00 18.81  ? 24  DG  D O6    1 
ATOM   471  N N1    . DG  B 2 5   ? -1.218  41.866  31.749 1.00 12.00  ? 24  DG  D N1    1 
ATOM   472  C C2    . DG  B 2 5   ? -1.209  42.816  30.722 1.00 14.53  ? 24  DG  D C2    1 
ATOM   473  N N2    . DG  B 2 5   ? -0.155  43.600  30.587 1.00 14.49  ? 24  DG  D N2    1 
ATOM   474  N N3    . DG  B 2 5   ? -2.199  42.987  29.855 1.00 18.47  ? 24  DG  D N3    1 
ATOM   475  C C4    . DG  B 2 5   ? -3.250  42.131  30.067 1.00 18.24  ? 24  DG  D C4    1 
ATOM   476  P P     . DT  B 2 6   ? -5.299  43.150  24.063 1.00 37.32  ? 25  DT  D P     1 
ATOM   477  O OP1   . DT  B 2 6   ? -5.181  44.341  23.182 1.00 36.87  ? 25  DT  D OP1   1 
ATOM   478  O OP2   . DT  B 2 6   ? -6.030  41.910  23.701 1.00 29.38  ? 25  DT  D OP2   1 
ATOM   479  O "O5'" . DT  B 2 6   ? -3.851  42.734  24.492 1.00 35.47  ? 25  DT  D "O5'" 1 
ATOM   480  C "C5'" . DT  B 2 6   ? -2.868  43.757  24.650 1.00 38.93  ? 25  DT  D "C5'" 1 
ATOM   481  C "C4'" . DT  B 2 6   ? -1.503  43.190  25.005 1.00 36.79  ? 25  DT  D "C4'" 1 
ATOM   482  O "O4'" . DT  B 2 6   ? -1.405  42.681  26.380 1.00 39.50  ? 25  DT  D "O4'" 1 
ATOM   483  C "C3'" . DT  B 2 6   ? -1.236  41.978  24.134 1.00 39.05  ? 25  DT  D "C3'" 1 
ATOM   484  O "O3'" . DT  B 2 6   ? 0.117   42.188  23.907 1.00 44.54  ? 25  DT  D "O3'" 1 
ATOM   485  C "C2'" . DT  B 2 6   ? -1.485  40.783  25.048 1.00 32.76  ? 25  DT  D "C2'" 1 
ATOM   486  C "C1'" . DT  B 2 6   ? -1.002  41.301  26.398 1.00 26.54  ? 25  DT  D "C1'" 1 
ATOM   487  N N1    . DT  B 2 6   ? -1.439  40.334  27.477 1.00 21.74  ? 25  DT  D N1    1 
ATOM   488  C C2    . DT  B 2 6   ? -0.535  40.087  28.502 1.00 19.01  ? 25  DT  D C2    1 
ATOM   489  O O2    . DT  B 2 6   ? 0.562   40.657  28.652 1.00 21.95  ? 25  DT  D O2    1 
ATOM   490  N N3    . DT  B 2 6   ? -0.902  39.152  29.437 1.00 17.35  ? 25  DT  D N3    1 
ATOM   491  C C4    . DT  B 2 6   ? -2.097  38.393  29.457 1.00 20.03  ? 25  DT  D C4    1 
ATOM   492  O O4    . DT  B 2 6   ? -2.353  37.569  30.373 1.00 21.38  ? 25  DT  D O4    1 
ATOM   493  C C5    . DT  B 2 6   ? -2.968  38.688  28.335 1.00 15.22  ? 25  DT  D C5    1 
ATOM   494  C C7    . DT  B 2 6   ? -4.275  37.898  28.294 1.00 10.23  ? 25  DT  D C7    1 
ATOM   495  C C6    . DT  B 2 6   ? -2.639  39.614  27.413 1.00 16.49  ? 25  DT  D C6    1 
ATOM   496  P P     . DG  B 2 7   ? 0.868   41.568  22.703 1.00 39.68  ? 26  DG  D P     1 
ATOM   497  O OP1   . DG  B 2 7   ? 0.747   42.483  21.557 1.00 40.15  ? 26  DG  D OP1   1 
ATOM   498  O OP2   . DG  B 2 7   ? 0.512   40.103  22.632 1.00 35.67  ? 26  DG  D OP2   1 
ATOM   499  O "O5'" . DG  B 2 7   ? 2.326   41.770  23.353 1.00 36.85  ? 26  DG  D "O5'" 1 
ATOM   500  C "C5'" . DG  B 2 7   ? 2.922   42.928  23.955 1.00 30.70  ? 26  DG  D "C5'" 1 
ATOM   501  C "C4'" . DG  B 2 7   ? 4.200   42.506  24.722 1.00 32.03  ? 26  DG  D "C4'" 1 
ATOM   502  O "O4'" . DG  B 2 7   ? 3.892   41.636  25.830 1.00 29.70  ? 26  DG  D "O4'" 1 
ATOM   503  C "C3'" . DG  B 2 7   ? 5.090   41.647  23.868 1.00 28.04  ? 26  DG  D "C3'" 1 
ATOM   504  O "O3'" . DG  B 2 7   ? 6.368   42.055  24.247 1.00 33.88  ? 26  DG  D "O3'" 1 
ATOM   505  C "C2'" . DG  B 2 7   ? 4.735   40.249  24.331 1.00 26.11  ? 26  DG  D "C2'" 1 
ATOM   506  C "C1'" . DG  B 2 7   ? 4.548   40.372  25.802 1.00 26.42  ? 26  DG  D "C1'" 1 
ATOM   507  N N9    . DG  B 2 7   ? 3.579   39.386  26.323 1.00 22.38  ? 26  DG  D N9    1 
ATOM   508  C C8    . DG  B 2 7   ? 2.286   39.106  25.927 1.00 21.52  ? 26  DG  D C8    1 
ATOM   509  N N7    . DG  B 2 7   ? 1.688   38.150  26.631 1.00 22.01  ? 26  DG  D N7    1 
ATOM   510  C C5    . DG  B 2 7   ? 2.664   37.825  27.594 1.00 20.17  ? 26  DG  D C5    1 
ATOM   511  C C6    . DG  B 2 7   ? 2.599   36.877  28.648 1.00 20.66  ? 26  DG  D C6    1 
ATOM   512  O O6    . DG  B 2 7   ? 1.651   36.131  28.952 1.00 18.89  ? 26  DG  D O6    1 
ATOM   513  N N1    . DG  B 2 7   ? 3.792   36.840  29.367 1.00 15.96  ? 26  DG  D N1    1 
ATOM   514  C C2    . DG  B 2 7   ? 4.906   37.637  29.134 1.00 19.80  ? 26  DG  D C2    1 
ATOM   515  N N2    . DG  B 2 7   ? 5.967   37.477  29.936 1.00 16.40  ? 26  DG  D N2    1 
ATOM   516  N N3    . DG  B 2 7   ? 4.968   38.554  28.125 1.00 21.04  ? 26  DG  D N3    1 
ATOM   517  C C4    . DG  B 2 7   ? 3.810   38.576  27.399 1.00 20.29  ? 26  DG  D C4    1 
ATOM   518  P P     . DT  B 2 8   ? 7.638   41.482  23.475 1.00 38.63  ? 27  DT  D P     1 
ATOM   519  O OP1   . DT  B 2 8   ? 8.674   42.491  23.680 1.00 38.00  ? 27  DT  D OP1   1 
ATOM   520  O OP2   . DT  B 2 8   ? 7.230   41.040  22.102 1.00 41.13  ? 27  DT  D OP2   1 
ATOM   521  O "O5'" . DT  B 2 8   ? 8.087   40.187  24.275 1.00 36.22  ? 27  DT  D "O5'" 1 
ATOM   522  C "C5'" . DT  B 2 8   ? 8.778   40.453  25.476 1.00 22.87  ? 27  DT  D "C5'" 1 
ATOM   523  C "C4'" . DT  B 2 8   ? 9.184   39.217  26.140 1.00 24.40  ? 27  DT  D "C4'" 1 
ATOM   524  O "O4'" . DT  B 2 8   ? 8.004   38.469  26.244 1.00 27.20  ? 27  DT  D "O4'" 1 
ATOM   525  C "C3'" . DT  B 2 8   ? 10.015  38.382  25.280 1.00 24.89  ? 27  DT  D "C3'" 1 
ATOM   526  O "O3'" . DT  B 2 8   ? 11.313  38.209  25.856 1.00 30.71  ? 27  DT  D "O3'" 1 
ATOM   527  C "C2'" . DT  B 2 8   ? 9.149   37.185  25.039 1.00 23.44  ? 27  DT  D "C2'" 1 
ATOM   528  C "C1'" . DT  B 2 8   ? 8.304   37.100  26.240 1.00 18.19  ? 27  DT  D "C1'" 1 
ATOM   529  N N1    . DT  B 2 8   ? 6.998   36.502  26.059 1.00 19.47  ? 27  DT  D N1    1 
ATOM   530  C C2    . DT  B 2 8   ? 6.733   35.484  26.912 1.00 17.78  ? 27  DT  D C2    1 
ATOM   531  O O2    . DT  B 2 8   ? 7.546   35.100  27.730 1.00 18.96  ? 27  DT  D O2    1 
ATOM   532  N N3    . DT  B 2 8   ? 5.485   34.884  26.803 1.00 18.51  ? 27  DT  D N3    1 
ATOM   533  C C4    . DT  B 2 8   ? 4.482   35.259  25.923 1.00 16.64  ? 27  DT  D C4    1 
ATOM   534  O O4    . DT  B 2 8   ? 3.398   34.675  25.920 1.00 20.63  ? 27  DT  D O4    1 
ATOM   535  C C5    . DT  B 2 8   ? 4.839   36.328  25.054 1.00 19.77  ? 27  DT  D C5    1 
ATOM   536  C C7    . DT  B 2 8   ? 3.782   36.754  24.038 1.00 21.81  ? 27  DT  D C7    1 
ATOM   537  C C6    . DT  B 2 8   ? 6.053   36.935  25.131 1.00 19.60  ? 27  DT  D C6    1 
ATOM   538  P P     . DG  B 2 9   ? 12.452  37.700  24.866 1.00 30.34  ? 28  DG  D P     1 
ATOM   539  O OP1   . DG  B 2 9   ? 13.719  38.243  25.400 1.00 34.11  ? 28  DG  D OP1   1 
ATOM   540  O OP2   . DG  B 2 9   ? 12.093  37.870  23.427 1.00 33.50  ? 28  DG  D OP2   1 
ATOM   541  O "O5'" . DG  B 2 9   ? 12.297  36.110  25.041 1.00 22.27  ? 28  DG  D "O5'" 1 
ATOM   542  C "C5'" . DG  B 2 9   ? 12.542  35.603  26.307 1.00 20.38  ? 28  DG  D "C5'" 1 
ATOM   543  C "C4'" . DG  B 2 9   ? 12.337  34.142  26.348 1.00 13.92  ? 28  DG  D "C4'" 1 
ATOM   544  O "O4'" . DG  B 2 9   ? 10.975  33.935  26.106 1.00 13.90  ? 28  DG  D "O4'" 1 
ATOM   545  C "C3'" . DG  B 2 9   ? 12.947  33.488  25.200 1.00 16.79  ? 28  DG  D "C3'" 1 
ATOM   546  O "O3'" . DG  B 2 9   ? 13.198  32.109  25.540 1.00 19.34  ? 28  DG  D "O3'" 1 
ATOM   547  C "C2'" . DG  B 2 9   ? 11.844  33.506  24.197 1.00 12.00  ? 28  DG  D "C2'" 1 
ATOM   548  C "C1'" . DG  B 2 9   ? 10.709  33.029  25.042 1.00 13.94  ? 28  DG  D "C1'" 1 
ATOM   549  N N9    . DG  B 2 9   ? 9.394   33.282  24.427 1.00 10.04  ? 28  DG  D N9    1 
ATOM   550  C C8    . DG  B 2 9   ? 9.070   34.184  23.411 1.00 7.56   ? 28  DG  D C8    1 
ATOM   551  N N7    . DG  B 2 9   ? 7.796   34.168  23.116 1.00 14.47  ? 28  DG  D N7    1 
ATOM   552  C C5    . DG  B 2 9   ? 7.251   33.204  24.002 1.00 11.90  ? 28  DG  D C5    1 
ATOM   553  C C6    . DG  B 2 9   ? 5.939   32.748  24.176 1.00 16.13  ? 28  DG  D C6    1 
ATOM   554  O O6    . DG  B 2 9   ? 4.962   33.113  23.536 1.00 23.36  ? 28  DG  D O6    1 
ATOM   555  N N1    . DG  B 2 9   ? 5.791   31.776  25.193 1.00 16.11  ? 28  DG  D N1    1 
ATOM   556  C C2    . DG  B 2 9   ? 6.839   31.317  25.971 1.00 14.36  ? 28  DG  D C2    1 
ATOM   557  N N2    . DG  B 2 9   ? 6.687   30.406  26.929 1.00 16.78  ? 28  DG  D N2    1 
ATOM   558  N N3    . DG  B 2 9   ? 8.078   31.770  25.774 1.00 13.84  ? 28  DG  D N3    1 
ATOM   559  C C4    . DG  B 2 9   ? 8.223   32.688  24.797 1.00 10.41  ? 28  DG  D C4    1 
ATOM   560  P P     . DT  B 2 10  ? 14.555  31.435  25.965 1.00 15.58  ? 29  DT  D P     1 
ATOM   561  O OP1   . DT  B 2 10  ? 15.588  32.362  26.434 1.00 19.19  ? 29  DT  D OP1   1 
ATOM   562  O OP2   . DT  B 2 10  ? 14.947  30.577  24.860 1.00 22.69  ? 29  DT  D OP2   1 
ATOM   563  O "O5'" . DT  B 2 10  ? 14.166  30.384  27.021 1.00 22.11  ? 29  DT  D "O5'" 1 
ATOM   564  C "C5'" . DT  B 2 10  ? 13.368  30.691  28.160 1.00 21.31  ? 29  DT  D "C5'" 1 
ATOM   565  C "C4'" . DT  B 2 10  ? 12.401  29.555  28.524 1.00 14.16  ? 29  DT  D "C4'" 1 
ATOM   566  O "O4'" . DT  B 2 10  ? 11.293  29.596  27.636 1.00 19.67  ? 29  DT  D "O4'" 1 
ATOM   567  C "C3'" . DT  B 2 10  ? 13.031  28.150  28.559 1.00 15.17  ? 29  DT  D "C3'" 1 
ATOM   568  O "O3'" . DT  B 2 10  ? 12.465  27.408  29.667 1.00 10.60  ? 29  DT  D "O3'" 1 
ATOM   569  C "C2'" . DT  B 2 10  ? 12.388  27.671  27.262 1.00 13.36  ? 29  DT  D "C2'" 1 
ATOM   570  C "C1'" . DT  B 2 10  ? 10.994  28.236  27.211 1.00 6.90   ? 29  DT  D "C1'" 1 
ATOM   571  N N1    . DT  B 2 10  ? 10.329  28.587  25.948 1.00 19.06  ? 29  DT  D N1    1 
ATOM   572  C C2    . DT  B 2 10  ? 9.009   28.301  25.817 1.00 19.31  ? 29  DT  D C2    1 
ATOM   573  O O2    . DT  B 2 10  ? 8.391   27.720  26.691 1.00 22.90  ? 29  DT  D O2    1 
ATOM   574  N N3    . DT  B 2 10  ? 8.390   28.691  24.650 1.00 20.27  ? 29  DT  D N3    1 
ATOM   575  C C4    . DT  B 2 10  ? 9.008   29.358  23.615 1.00 20.98  ? 29  DT  D C4    1 
ATOM   576  O O4    . DT  B 2 10  ? 8.358   29.686  22.645 1.00 24.41  ? 29  DT  D O4    1 
ATOM   577  C C5    . DT  B 2 10  ? 10.405  29.633  23.824 1.00 22.97  ? 29  DT  D C5    1 
ATOM   578  C C7    . DT  B 2 10  ? 11.245  30.351  22.749 1.00 24.32  ? 29  DT  D C7    1 
ATOM   579  C C6    . DT  B 2 10  ? 11.000  29.274  24.968 1.00 18.87  ? 29  DT  D C6    1 
ATOM   580  P P     . DG  B 2 11  ? 13.039  26.088  30.034 1.00 14.80  ? 30  DG  D P     1 
ATOM   581  O OP1   . DG  B 2 11  ? 12.961  25.917  31.466 1.00 22.79  ? 30  DG  D OP1   1 
ATOM   582  O OP2   . DG  B 2 11  ? 14.372  25.949  29.444 1.00 15.58  ? 30  DG  D OP2   1 
ATOM   583  O "O5'" . DG  B 2 11  ? 12.166  24.983  29.568 1.00 17.98  ? 30  DG  D "O5'" 1 
ATOM   584  C "C5'" . DG  B 2 11  ? 10.771  25.020  29.693 1.00 16.55  ? 30  DG  D "C5'" 1 
ATOM   585  C "C4'" . DG  B 2 11  ? 10.204  23.823  28.944 1.00 16.53  ? 30  DG  D "C4'" 1 
ATOM   586  O "O4'" . DG  B 2 11  ? 9.797   24.169  27.651 1.00 21.92  ? 30  DG  D "O4'" 1 
ATOM   587  C "C3'" . DG  B 2 11  ? 11.103  22.622  28.757 1.00 18.40  ? 30  DG  D "C3'" 1 
ATOM   588  O "O3'" . DG  B 2 11  ? 10.252  21.485  28.848 1.00 18.31  ? 30  DG  D "O3'" 1 
ATOM   589  C "C2'" . DG  B 2 11  ? 11.638  22.890  27.378 1.00 10.08  ? 30  DG  D "C2'" 1 
ATOM   590  C "C1'" . DG  B 2 11  ? 10.423  23.358  26.643 1.00 16.18  ? 30  DG  D "C1'" 1 
ATOM   591  N N9    . DG  B 2 11  ? 10.643  24.286  25.544 1.00 13.59  ? 30  DG  D N9    1 
ATOM   592  C C8    . DG  B 2 11  ? 11.747  24.991  25.200 1.00 11.43  ? 30  DG  D C8    1 
ATOM   593  N N7    . DG  B 2 11  ? 11.549  25.778  24.149 1.00 15.15  ? 30  DG  D N7    1 
ATOM   594  C C5    . DG  B 2 11  ? 10.222  25.554  23.814 1.00 10.37  ? 30  DG  D C5    1 
ATOM   595  C C6    . DG  B 2 11  ? 9.491   26.125  22.784 1.00 14.13  ? 30  DG  D C6    1 
ATOM   596  O O6    . DG  B 2 11  ? 9.915   26.955  21.942 1.00 15.69  ? 30  DG  D O6    1 
ATOM   597  N N1    . DG  B 2 11  ? 8.187   25.639  22.797 1.00 13.18  ? 30  DG  D N1    1 
ATOM   598  C C2    . DG  B 2 11  ? 7.688   24.725  23.669 1.00 12.92  ? 30  DG  D C2    1 
ATOM   599  N N2    . DG  B 2 11  ? 6.438   24.378  23.506 1.00 16.71  ? 30  DG  D N2    1 
ATOM   600  N N3    . DG  B 2 11  ? 8.386   24.188  24.664 1.00 15.83  ? 30  DG  D N3    1 
ATOM   601  C C4    . DG  B 2 11  ? 9.655   24.666  24.669 1.00 13.17  ? 30  DG  D C4    1 
ATOM   602  P P     . DG  B 2 12  ? 10.827  20.078  29.062 1.00 24.64  ? 31  DG  D P     1 
ATOM   603  O OP1   . DG  B 2 12  ? 10.059  19.433  30.165 1.00 29.46  ? 31  DG  D OP1   1 
ATOM   604  O OP2   . DG  B 2 12  ? 12.290  20.073  29.023 1.00 31.00  ? 31  DG  D OP2   1 
ATOM   605  O "O5'" . DG  B 2 12  ? 10.541  19.270  27.737 1.00 32.65  ? 31  DG  D "O5'" 1 
ATOM   606  C "C5'" . DG  B 2 12  ? 9.207   18.951  27.357 1.00 24.84  ? 31  DG  D "C5'" 1 
ATOM   607  C "C4'" . DG  B 2 12  ? 9.000   18.921  25.833 1.00 28.13  ? 31  DG  D "C4'" 1 
ATOM   608  O "O4'" . DG  B 2 12  ? 8.961   20.221  25.176 1.00 22.26  ? 31  DG  D "O4'" 1 
ATOM   609  C "C3'" . DG  B 2 12  ? 10.003  17.972  25.196 1.00 28.45  ? 31  DG  D "C3'" 1 
ATOM   610  O "O3'" . DG  B 2 12  ? 9.140   16.910  24.803 1.00 31.63  ? 31  DG  D "O3'" 1 
ATOM   611  C "C2'" . DG  B 2 12  ? 10.547  18.800  24.074 1.00 18.64  ? 31  DG  D "C2'" 1 
ATOM   612  C "C1'" . DG  B 2 12  ? 9.624   19.974  23.967 1.00 19.68  ? 31  DG  D "C1'" 1 
ATOM   613  N N9    . DG  B 2 12  ? 10.420  21.069  23.394 1.00 15.58  ? 31  DG  D N9    1 
ATOM   614  C C8    . DG  B 2 12  ? 11.707  21.463  23.554 1.00 10.17  ? 31  DG  D C8    1 
ATOM   615  N N7    . DG  B 2 12  ? 11.984  22.458  22.778 1.00 9.78   ? 31  DG  D N7    1 
ATOM   616  C C5    . DG  B 2 12  ? 10.838  22.702  22.045 1.00 8.05   ? 31  DG  D C5    1 
ATOM   617  C C6    . DG  B 2 12  ? 10.571  23.614  21.010 1.00 12.77  ? 31  DG  D C6    1 
ATOM   618  O O6    . DG  B 2 12  ? 11.335  24.476  20.511 1.00 14.45  ? 31  DG  D O6    1 
ATOM   619  N N1    . DG  B 2 12  ? 9.286   23.475  20.557 1.00 12.04  ? 31  DG  D N1    1 
ATOM   620  C C2    . DG  B 2 12  ? 8.357   22.560  20.987 1.00 16.60  ? 31  DG  D C2    1 
ATOM   621  N N2    . DG  B 2 12  ? 7.135   22.574  20.431 1.00 20.96  ? 31  DG  D N2    1 
ATOM   622  N N3    . DG  B 2 12  ? 8.629   21.697  21.925 1.00 17.15  ? 31  DG  D N3    1 
ATOM   623  C C4    . DG  B 2 12  ? 9.884   21.852  22.416 1.00 13.18  ? 31  DG  D C4    1 
ATOM   624  P P     . DG  B 2 13  ? 9.480   15.543  24.088 1.00 34.59  ? 32  DG  D P     1 
ATOM   625  O OP1   . DG  B 2 13  ? 8.174   14.973  23.767 1.00 42.37  ? 32  DG  D OP1   1 
ATOM   626  O OP2   . DG  B 2 13  ? 10.423  14.785  24.928 1.00 34.83  ? 32  DG  D OP2   1 
ATOM   627  O "O5'" . DG  B 2 13  ? 10.168  15.911  22.629 1.00 36.40  ? 32  DG  D "O5'" 1 
ATOM   628  C "C5'" . DG  B 2 13  ? 9.680   15.658  21.268 1.00 30.60  ? 32  DG  D "C5'" 1 
ATOM   629  C "C4'" . DG  B 2 13  ? 9.056   16.921  20.684 1.00 29.15  ? 32  DG  D "C4'" 1 
ATOM   630  O "O4'" . DG  B 2 13  ? 9.923   18.008  20.960 1.00 23.21  ? 32  DG  D "O4'" 1 
ATOM   631  C "C3'" . DG  B 2 13  ? 8.956   16.904  19.194 1.00 30.61  ? 32  DG  D "C3'" 1 
ATOM   632  O "O3'" . DG  B 2 13  ? 7.896   16.010  18.821 1.00 43.77  ? 32  DG  D "O3'" 1 
ATOM   633  C "C2'" . DG  B 2 13  ? 8.723   18.358  18.980 1.00 26.61  ? 32  DG  D "C2'" 1 
ATOM   634  C "C1'" . DG  B 2 13  ? 9.589   18.996  20.020 1.00 19.08  ? 32  DG  D "C1'" 1 
ATOM   635  N N9    . DG  B 2 13  ? 10.799  19.835  19.722 1.00 14.91  ? 32  DG  D N9    1 
ATOM   636  C C8    . DG  B 2 13  ? 12.041  19.926  20.363 1.00 10.04  ? 32  DG  D C8    1 
ATOM   637  N N7    . DG  B 2 13  ? 12.846  20.852  19.890 1.00 12.12  ? 32  DG  D N7    1 
ATOM   638  C C5    . DG  B 2 13  ? 12.094  21.412  18.829 1.00 12.72  ? 32  DG  D C5    1 
ATOM   639  C C6    . DG  B 2 13  ? 12.392  22.462  17.917 1.00 14.12  ? 32  DG  D C6    1 
ATOM   640  O O6    . DG  B 2 13  ? 13.370  23.181  17.791 1.00 15.89  ? 32  DG  D O6    1 
ATOM   641  N N1    . DG  B 2 13  ? 11.325  22.700  17.059 1.00 13.52  ? 32  DG  D N1    1 
ATOM   642  C C2    . DG  B 2 13  ? 10.113  22.024  17.075 1.00 13.69  ? 32  DG  D C2    1 
ATOM   643  N N2    . DG  B 2 13  ? 9.239   22.408  16.166 1.00 18.27  ? 32  DG  D N2    1 
ATOM   644  N N3    . DG  B 2 13  ? 9.791   21.058  17.911 1.00 13.16  ? 32  DG  D N3    1 
ATOM   645  C C4    . DG  B 2 13  ? 10.834  20.808  18.761 1.00 14.83  ? 32  DG  D C4    1 
ATOM   646  P P     . DT  B 2 14  ? 8.125   14.811  17.714 1.00 46.92  ? 33  DT  D P     1 
ATOM   647  O OP1   . DT  B 2 14  ? 7.298   13.586  17.941 1.00 49.95  ? 33  DT  D OP1   1 
ATOM   648  O OP2   . DT  B 2 14  ? 9.572   14.695  17.322 1.00 47.36  ? 33  DT  D OP2   1 
ATOM   649  O "O5'" . DT  B 2 14  ? 7.478   15.637  16.563 1.00 45.62  ? 33  DT  D "O5'" 1 
ATOM   650  C "C5'" . DT  B 2 14  ? 6.232   16.310  16.564 1.00 35.77  ? 33  DT  D "C5'" 1 
ATOM   651  C "C4'" . DT  B 2 14  ? 6.225   17.273  15.356 1.00 36.05  ? 33  DT  D "C4'" 1 
ATOM   652  O "O4'" . DT  B 2 14  ? 7.122   18.436  15.393 1.00 35.69  ? 33  DT  D "O4'" 1 
ATOM   653  C "C3'" . DT  B 2 14  ? 6.626   16.601  14.047 1.00 38.00  ? 33  DT  D "C3'" 1 
ATOM   654  O "O3'" . DT  B 2 14  ? 5.731   17.180  13.135 1.00 42.42  ? 33  DT  D "O3'" 1 
ATOM   655  C "C2'" . DT  B 2 14  ? 8.056   17.092  13.744 1.00 26.63  ? 33  DT  D "C2'" 1 
ATOM   656  C "C1'" . DT  B 2 14  ? 8.139   18.445  14.348 1.00 22.43  ? 33  DT  D "C1'" 1 
ATOM   657  N N1    . DT  B 2 14  ? 9.521   18.697  14.830 1.00 19.07  ? 33  DT  D N1    1 
ATOM   658  C C2    . DT  B 2 14  ? 10.101  19.738  14.259 1.00 20.72  ? 33  DT  D C2    1 
ATOM   659  O O2    . DT  B 2 14  ? 9.549   20.420  13.412 1.00 26.94  ? 33  DT  D O2    1 
ATOM   660  N N3    . DT  B 2 14  ? 11.365  20.046  14.637 1.00 19.50  ? 33  DT  D N3    1 
ATOM   661  C C4    . DT  B 2 14  ? 12.137  19.393  15.512 1.00 16.83  ? 33  DT  D C4    1 
ATOM   662  O O4    . DT  B 2 14  ? 13.279  19.878  15.665 1.00 20.05  ? 33  DT  D O4    1 
ATOM   663  C C5    . DT  B 2 14  ? 11.470  18.267  16.097 1.00 14.42  ? 33  DT  D C5    1 
ATOM   664  C C7    . DT  B 2 14  ? 12.133  17.393  17.159 1.00 20.71  ? 33  DT  D C7    1 
ATOM   665  C C6    . DT  B 2 14  ? 10.220  17.953  15.759 1.00 18.05  ? 33  DT  D C6    1 
ATOM   666  P P     . DG  B 2 15  ? 5.520   16.722  11.647 1.00 35.04  ? 34  DG  D P     1 
ATOM   667  O OP1   . DG  B 2 15  ? 4.064   17.012  11.481 1.00 33.70  ? 34  DG  D OP1   1 
ATOM   668  O OP2   . DG  B 2 15  ? 6.113   15.359  11.476 1.00 34.92  ? 34  DG  D OP2   1 
ATOM   669  O "O5'" . DG  B 2 15  ? 6.531   17.736  10.908 1.00 34.99  ? 34  DG  D "O5'" 1 
ATOM   670  C "C5'" . DG  B 2 15  ? 6.213   19.129  10.957 1.00 33.84  ? 34  DG  D "C5'" 1 
ATOM   671  C "C4'" . DG  B 2 15  ? 6.698   20.001  9.831  1.00 31.78  ? 34  DG  D "C4'" 1 
ATOM   672  O "O4'" . DG  B 2 15  ? 8.029   20.442  10.101 1.00 33.67  ? 34  DG  D "O4'" 1 
ATOM   673  C "C3'" . DG  B 2 15  ? 6.769   19.266  8.463  1.00 38.52  ? 34  DG  D "C3'" 1 
ATOM   674  O "O3'" . DG  B 2 15  ? 6.582   20.255  7.396  1.00 44.67  ? 34  DG  D "O3'" 1 
ATOM   675  C "C2'" . DG  B 2 15  ? 8.192   18.664  8.525  1.00 34.99  ? 34  DG  D "C2'" 1 
ATOM   676  C "C1'" . DG  B 2 15  ? 9.024   19.766  9.202  1.00 32.04  ? 34  DG  D "C1'" 1 
ATOM   677  N N9    . DG  B 2 15  ? 10.165  19.258  10.002 1.00 22.41  ? 34  DG  D N9    1 
ATOM   678  C C8    . DG  B 2 15  ? 10.125  18.237  10.959 1.00 19.62  ? 34  DG  D C8    1 
ATOM   679  N N7    . DG  B 2 15  ? 11.264  18.041  11.551 1.00 20.45  ? 34  DG  D N7    1 
ATOM   680  C C5    . DG  B 2 15  ? 12.107  19.030  10.973 1.00 19.73  ? 34  DG  D C5    1 
ATOM   681  C C6    . DG  B 2 15  ? 13.473  19.310  11.198 1.00 20.04  ? 34  DG  D C6    1 
ATOM   682  O O6    . DG  B 2 15  ? 14.237  18.755  12.004 1.00 22.12  ? 34  DG  D O6    1 
ATOM   683  N N1    . DG  B 2 15  ? 13.949  20.357  10.351 1.00 18.99  ? 34  DG  D N1    1 
ATOM   684  C C2    . DG  B 2 15  ? 13.205  21.072  9.418  1.00 16.65  ? 34  DG  D C2    1 
ATOM   685  N N2    . DG  B 2 15  ? 13.797  22.045  8.692  1.00 17.48  ? 34  DG  D N2    1 
ATOM   686  N N3    . DG  B 2 15  ? 11.910  20.809  9.240  1.00 19.92  ? 34  DG  D N3    1 
ATOM   687  C C4    . DG  B 2 15  ? 11.427  19.774  10.025 1.00 20.56  ? 34  DG  D C4    1 
ATOM   688  P P     . DT  B 2 16  ? 7.035   20.203  5.851  1.00 42.45  ? 35  DT  D P     1 
ATOM   689  O OP1   . DT  B 2 16  ? 6.170   21.193  5.194  1.00 44.80  ? 35  DT  D OP1   1 
ATOM   690  O OP2   . DT  B 2 16  ? 6.975   18.759  5.493  1.00 42.83  ? 35  DT  D OP2   1 
ATOM   691  O "O5'" . DT  B 2 16  ? 8.560   20.655  5.643  1.00 40.53  ? 35  DT  D "O5'" 1 
ATOM   692  C "C5'" . DT  B 2 16  ? 9.035   21.979  5.524  1.00 35.55  ? 35  DT  D "C5'" 1 
ATOM   693  C "C4'" . DT  B 2 16  ? 10.487  21.943  5.172  1.00 37.12  ? 35  DT  D "C4'" 1 
ATOM   694  O "O4'" . DT  B 2 16  ? 11.230  21.178  6.141  1.00 34.98  ? 35  DT  D "O4'" 1 
ATOM   695  C "C3'" . DT  B 2 16  ? 10.695  21.209  3.851  1.00 41.20  ? 35  DT  D "C3'" 1 
ATOM   696  O "O3'" . DT  B 2 16  ? 11.490  22.082  3.088  1.00 51.86  ? 35  DT  D "O3'" 1 
ATOM   697  C "C2'" . DT  B 2 16  ? 11.469  19.950  4.218  1.00 32.86  ? 35  DT  D "C2'" 1 
ATOM   698  C "C1'" . DT  B 2 16  ? 12.255  20.386  5.454  1.00 28.61  ? 35  DT  D "C1'" 1 
ATOM   699  N N1    . DT  B 2 16  ? 12.708  19.287  6.365  1.00 18.76  ? 35  DT  D N1    1 
ATOM   700  C C2    . DT  B 2 16  ? 14.027  19.257  6.783  1.00 19.27  ? 35  DT  D C2    1 
ATOM   701  O O2    . DT  B 2 16  ? 14.883  20.092  6.426  1.00 24.32  ? 35  DT  D O2    1 
ATOM   702  N N3    . DT  B 2 16  ? 14.370  18.234  7.641  1.00 17.84  ? 35  DT  D N3    1 
ATOM   703  C C4    . DT  B 2 16  ? 13.487  17.244  8.084  1.00 19.04  ? 35  DT  D C4    1 
ATOM   704  O O4    . DT  B 2 16  ? 13.878  16.343  8.873  1.00 22.44  ? 35  DT  D O4    1 
ATOM   705  C C5    . DT  B 2 16  ? 12.134  17.395  7.566  1.00 15.16  ? 35  DT  D C5    1 
ATOM   706  C C7    . DT  B 2 16  ? 11.032  16.424  7.946  1.00 18.99  ? 35  DT  D C7    1 
ATOM   707  C C6    . DT  B 2 16  ? 11.808  18.366  6.760  1.00 15.51  ? 35  DT  D C6    1 
ATOM   708  P P     . DG  B 2 17  ? 11.488  22.105  1.499  1.00 53.65  ? 36  DG  D P     1 
ATOM   709  O OP1   . DG  B 2 17  ? 11.283  23.516  1.076  1.00 51.05  ? 36  DG  D OP1   1 
ATOM   710  O OP2   . DG  B 2 17  ? 10.688  20.948  0.989  1.00 50.75  ? 36  DG  D OP2   1 
ATOM   711  O "O5'" . DG  B 2 17  ? 13.003  21.797  1.375  1.00 52.06  ? 36  DG  D "O5'" 1 
ATOM   712  C "C5'" . DG  B 2 17  ? 13.984  22.793  1.708  1.00 54.35  ? 36  DG  D "C5'" 1 
ATOM   713  C "C4'" . DG  B 2 17  ? 15.353  22.146  1.712  1.00 53.19  ? 36  DG  D "C4'" 1 
ATOM   714  O "O4'" . DG  B 2 17  ? 15.533  21.211  2.843  1.00 51.08  ? 36  DG  D "O4'" 1 
ATOM   715  C "C3'" . DG  B 2 17  ? 15.494  21.307  0.417  1.00 52.92  ? 36  DG  D "C3'" 1 
ATOM   716  O "O3'" . DG  B 2 17  ? 16.873  21.225  0.053  1.00 58.36  ? 36  DG  D "O3'" 1 
ATOM   717  C "C2'" . DG  B 2 17  ? 15.025  19.926  0.924  1.00 46.88  ? 36  DG  D "C2'" 1 
ATOM   718  C "C1'" . DG  B 2 17  ? 15.699  19.884  2.280  1.00 38.85  ? 36  DG  D "C1'" 1 
ATOM   719  N N9    . DG  B 2 17  ? 15.373  18.734  3.158  1.00 26.47  ? 36  DG  D N9    1 
ATOM   720  C C8    . DG  B 2 17  ? 14.205  17.945  3.316  1.00 27.19  ? 36  DG  D C8    1 
ATOM   721  N N7    . DG  B 2 17  ? 14.315  16.950  4.195  1.00 24.44  ? 36  DG  D N7    1 
ATOM   722  C C5    . DG  B 2 17  ? 15.639  17.129  4.636  1.00 20.76  ? 36  DG  D C5    1 
ATOM   723  C C6    . DG  B 2 17  ? 16.326  16.407  5.600  1.00 20.44  ? 36  DG  D C6    1 
ATOM   724  O O6    . DG  B 2 17  ? 15.913  15.462  6.283  1.00 25.18  ? 36  DG  D O6    1 
ATOM   725  N N1    . DG  B 2 17  ? 17.620  16.889  5.724  1.00 20.34  ? 36  DG  D N1    1 
ATOM   726  C C2    . DG  B 2 17  ? 18.192  17.958  5.044  1.00 18.63  ? 36  DG  D C2    1 
ATOM   727  N N2    . DG  B 2 17  ? 19.444  18.254  5.355  1.00 17.08  ? 36  DG  D N2    1 
ATOM   728  N N3    . DG  B 2 17  ? 17.543  18.677  4.130  1.00 18.99  ? 36  DG  D N3    1 
ATOM   729  C C4    . DG  B 2 17  ? 16.273  18.193  3.994  1.00 21.71  ? 36  DG  D C4    1 
ATOM   730  P P     . DC  B 2 18  ? 17.563  22.097  -1.104 1.00 61.91  ? 37  DC  D P     1 
ATOM   731  O OP1   . DC  B 2 18  ? 17.050  23.487  -1.059 1.00 61.05  ? 37  DC  D OP1   1 
ATOM   732  O OP2   . DC  B 2 18  ? 17.524  21.265  -2.344 1.00 56.75  ? 37  DC  D OP2   1 
ATOM   733  O "O5'" . DC  B 2 18  ? 19.029  22.122  -0.552 1.00 54.83  ? 37  DC  D "O5'" 1 
ATOM   734  C "C5'" . DC  B 2 18  ? 19.335  22.619  0.745  1.00 49.63  ? 37  DC  D "C5'" 1 
ATOM   735  C "C4'" . DC  B 2 18  ? 20.534  21.876  1.299  1.00 51.88  ? 37  DC  D "C4'" 1 
ATOM   736  O "O4'" . DC  B 2 18  ? 20.233  20.556  1.746  1.00 47.55  ? 37  DC  D "O4'" 1 
ATOM   737  C "C3'" . DC  B 2 18  ? 21.531  21.600  0.197  1.00 55.53  ? 37  DC  D "C3'" 1 
ATOM   738  O "O3'" . DC  B 2 18  ? 22.813  21.668  0.797  1.00 63.36  ? 37  DC  D "O3'" 1 
ATOM   739  C "C2'" . DC  B 2 18  ? 21.171  20.193  -0.333 1.00 46.62  ? 37  DC  D "C2'" 1 
ATOM   740  C "C1'" . DC  B 2 18  ? 20.874  19.502  0.968  1.00 38.31  ? 37  DC  D "C1'" 1 
ATOM   741  N N1    . DC  B 2 18  ? 19.821  18.483  1.057  1.00 29.86  ? 37  DC  D N1    1 
ATOM   742  C C2    . DC  B 2 18  ? 20.030  17.438  1.927  1.00 28.02  ? 37  DC  D C2    1 
ATOM   743  O O2    . DC  B 2 18  ? 21.076  17.311  2.563  1.00 32.50  ? 37  DC  D O2    1 
ATOM   744  N N3    . DC  B 2 18  ? 19.078  16.500  2.108  1.00 24.87  ? 37  DC  D N3    1 
ATOM   745  C C4    . DC  B 2 18  ? 17.929  16.607  1.439  1.00 25.71  ? 37  DC  D C4    1 
ATOM   746  N N4    . DC  B 2 18  ? 16.964  15.674  1.614  1.00 23.34  ? 37  DC  D N4    1 
ATOM   747  C C5    . DC  B 2 18  ? 17.699  17.698  0.550  1.00 25.91  ? 37  DC  D C5    1 
ATOM   748  C C6    . DC  B 2 18  ? 18.670  18.613  0.389  1.00 27.82  ? 37  DC  D C6    1 
ATOM   749  P P     . DG  B 2 19  ? 23.984  21.972  -0.249 1.00 74.18  ? 38  DG  D P     1 
ATOM   750  O OP1   . DG  B 2 19  ? 24.021  23.445  -0.400 1.00 71.28  ? 38  DG  D OP1   1 
ATOM   751  O OP2   . DG  B 2 19  ? 23.843  21.100  -1.475 1.00 63.92  ? 38  DG  D OP2   1 
ATOM   752  O "O5'" . DG  B 2 19  ? 25.290  21.594  0.659  1.00 65.97  ? 38  DG  D "O5'" 1 
ATOM   753  C "C5'" . DG  B 2 19  ? 25.528  20.418  1.489  1.00 58.83  ? 38  DG  D "C5'" 1 
ATOM   754  C "C4'" . DG  B 2 19  ? 25.614  18.967  0.895  1.00 53.31  ? 38  DG  D "C4'" 1 
ATOM   755  O "O4'" . DG  B 2 19  ? 24.371  18.299  0.574  1.00 52.24  ? 38  DG  D "O4'" 1 
ATOM   756  C "C3'" . DG  B 2 19  ? 26.611  18.711  -0.260 1.00 47.92  ? 38  DG  D "C3'" 1 
ATOM   757  O "O3'" . DG  B 2 19  ? 27.879  18.236  0.271  1.00 45.12  ? 38  DG  D "O3'" 1 
ATOM   758  C "C2'" . DG  B 2 19  ? 25.805  17.717  -1.176 1.00 41.99  ? 38  DG  D "C2'" 1 
ATOM   759  C "C1'" . DG  B 2 19  ? 24.683  17.129  -0.269 1.00 37.35  ? 38  DG  D "C1'" 1 
ATOM   760  N N9    . DG  B 2 19  ? 23.331  16.648  -0.713 1.00 27.04  ? 38  DG  D N9    1 
ATOM   761  C C8    . DG  B 2 19  ? 22.444  17.150  -1.665 1.00 22.15  ? 38  DG  D C8    1 
ATOM   762  N N7    . DG  B 2 19  ? 21.290  16.487  -1.708 1.00 22.27  ? 38  DG  D N7    1 
ATOM   763  C C5    . DG  B 2 19  ? 21.430  15.531  -0.715 1.00 17.41  ? 38  DG  D C5    1 
ATOM   764  C C6    . DG  B 2 19  ? 20.517  14.565  -0.336 1.00 21.93  ? 38  DG  D C6    1 
ATOM   765  O O6    . DG  B 2 19  ? 19.383  14.442  -0.844 1.00 26.22  ? 38  DG  D O6    1 
ATOM   766  N N1    . DG  B 2 19  ? 21.002  13.727  0.714  1.00 18.97  ? 38  DG  D N1    1 
ATOM   767  C C2    . DG  B 2 19  ? 22.236  13.858  1.326  1.00 22.61  ? 38  DG  D C2    1 
ATOM   768  N N2    . DG  B 2 19  ? 22.535  12.975  2.323  1.00 25.34  ? 38  DG  D N2    1 
ATOM   769  N N3    . DG  B 2 19  ? 23.122  14.812  0.952  1.00 20.61  ? 38  DG  D N3    1 
ATOM   770  C C4    . DG  B 2 19  ? 22.642  15.606  -0.075 1.00 22.87  ? 38  DG  D C4    1 
ATOM   771  P P     . DC  C 1 2   ? -29.288 91.839  76.859 1.00 105.98 ? 2   DC  E P     1 
ATOM   772  O OP1   . DC  C 1 2   ? -29.291 90.659  77.748 1.00 106.72 ? 2   DC  E OP1   1 
ATOM   773  O OP2   . DC  C 1 2   ? -30.517 92.405  76.262 1.00 108.88 ? 2   DC  E OP2   1 
ATOM   774  O "O5'" . DC  C 1 2   ? -28.196 92.998  77.319 1.00 96.42  ? 2   DC  E "O5'" 1 
ATOM   775  C "C5'" . DC  C 1 2   ? -27.710 94.041  76.412 1.00 78.13  ? 2   DC  E "C5'" 1 
ATOM   776  C "C4'" . DC  C 1 2   ? -26.723 93.636  75.284 1.00 61.21  ? 2   DC  E "C4'" 1 
ATOM   777  O "O4'" . DC  C 1 2   ? -25.552 93.100  75.915 1.00 49.90  ? 2   DC  E "O4'" 1 
ATOM   778  C "C3'" . DC  C 1 2   ? -27.215 92.587  74.296 1.00 53.15  ? 2   DC  E "C3'" 1 
ATOM   779  O "O3'" . DC  C 1 2   ? -26.434 92.503  73.110 1.00 58.22  ? 2   DC  E "O3'" 1 
ATOM   780  C "C2'" . DC  C 1 2   ? -26.820 91.347  75.054 1.00 46.63  ? 2   DC  E "C2'" 1 
ATOM   781  C "C1'" . DC  C 1 2   ? -25.565 91.732  75.722 1.00 39.25  ? 2   DC  E "C1'" 1 
ATOM   782  N N1    . DC  C 1 2   ? -25.038 90.956  76.848 1.00 32.17  ? 2   DC  E N1    1 
ATOM   783  C C2    . DC  C 1 2   ? -23.764 91.331  77.258 1.00 29.67  ? 2   DC  E C2    1 
ATOM   784  O O2    . DC  C 1 2   ? -23.215 92.309  76.737 1.00 29.53  ? 2   DC  E O2    1 
ATOM   785  N N3    . DC  C 1 2   ? -23.141 90.587  78.263 1.00 30.59  ? 2   DC  E N3    1 
ATOM   786  C C4    . DC  C 1 2   ? -23.755 89.522  78.838 1.00 31.58  ? 2   DC  E C4    1 
ATOM   787  N N4    . DC  C 1 2   ? -23.139 88.839  79.816 1.00 34.89  ? 2   DC  E N4    1 
ATOM   788  C C5    . DC  C 1 2   ? -25.058 89.120  78.405 1.00 30.84  ? 2   DC  E C5    1 
ATOM   789  C C6    . DC  C 1 2   ? -25.661 89.852  77.415 1.00 32.55  ? 2   DC  E C6    1 
ATOM   790  P P     . DG  C 1 3   ? -26.331 93.452  71.826 1.00 53.01  ? 3   DG  E P     1 
ATOM   791  O OP1   . DG  C 1 3   ? -26.839 94.802  72.166 1.00 54.54  ? 3   DG  E OP1   1 
ATOM   792  O OP2   . DG  C 1 3   ? -26.918 92.674  70.743 1.00 52.27  ? 3   DG  E OP2   1 
ATOM   793  O "O5'" . DG  C 1 3   ? -24.776 93.528  71.542 1.00 50.94  ? 3   DG  E "O5'" 1 
ATOM   794  C "C5'" . DG  C 1 3   ? -24.249 94.811  71.852 1.00 45.40  ? 3   DG  E "C5'" 1 
ATOM   795  C "C4'" . DG  C 1 3   ? -22.750 94.927  71.960 1.00 45.96  ? 3   DG  E "C4'" 1 
ATOM   796  O "O4'" . DG  C 1 3   ? -22.179 94.111  72.998 1.00 40.10  ? 3   DG  E "O4'" 1 
ATOM   797  C "C3'" . DG  C 1 3   ? -22.086 94.511  70.678 1.00 46.87  ? 3   DG  E "C3'" 1 
ATOM   798  O "O3'" . DG  C 1 3   ? -20.908 95.317  70.494 1.00 48.64  ? 3   DG  E "O3'" 1 
ATOM   799  C "C2'" . DG  C 1 3   ? -21.850 93.027  70.992 1.00 40.09  ? 3   DG  E "C2'" 1 
ATOM   800  C "C1'" . DG  C 1 3   ? -21.456 93.029  72.424 1.00 30.17  ? 3   DG  E "C1'" 1 
ATOM   801  N N9    . DG  C 1 3   ? -21.973 91.843  73.017 1.00 23.44  ? 3   DG  E N9    1 
ATOM   802  C C8    . DG  C 1 3   ? -23.152 91.143  72.844 1.00 20.61  ? 3   DG  E C8    1 
ATOM   803  N N7    . DG  C 1 3   ? -23.202 90.084  73.654 1.00 21.76  ? 3   DG  E N7    1 
ATOM   804  C C5    . DG  C 1 3   ? -21.981 90.130  74.377 1.00 13.76  ? 3   DG  E C5    1 
ATOM   805  C C6    . DG  C 1 3   ? -21.443 89.283  75.351 1.00 13.71  ? 3   DG  E C6    1 
ATOM   806  O O6    . DG  C 1 3   ? -21.949 88.261  75.826 1.00 20.88  ? 3   DG  E O6    1 
ATOM   807  N N1    . DG  C 1 3   ? -20.207 89.649  75.812 1.00 10.93  ? 3   DG  E N1    1 
ATOM   808  C C2    . DG  C 1 3   ? -19.543 90.756  75.399 1.00 12.24  ? 3   DG  E C2    1 
ATOM   809  N N2    . DG  C 1 3   ? -18.361 91.002  75.918 1.00 13.96  ? 3   DG  E N2    1 
ATOM   810  N N3    . DG  C 1 3   ? -20.027 91.572  74.468 1.00 19.33  ? 3   DG  E N3    1 
ATOM   811  C C4    . DG  C 1 3   ? -21.254 91.191  74.002 1.00 18.42  ? 3   DG  E C4    1 
ATOM   812  P P     . DC  C 1 4   ? -19.962 95.124  69.230 1.00 50.65  ? 4   DC  E P     1 
ATOM   813  O OP1   . DC  C 1 4   ? -19.450 96.426  68.800 1.00 46.63  ? 4   DC  E OP1   1 
ATOM   814  O OP2   . DC  C 1 4   ? -20.687 94.255  68.256 1.00 49.93  ? 4   DC  E OP2   1 
ATOM   815  O "O5'" . DC  C 1 4   ? -18.788 94.277  69.908 1.00 48.99  ? 4   DC  E "O5'" 1 
ATOM   816  C "C5'" . DC  C 1 4   ? -17.943 94.557  71.039 1.00 42.20  ? 4   DC  E "C5'" 1 
ATOM   817  C "C4'" . DC  C 1 4   ? -17.157 93.270  71.300 1.00 35.73  ? 4   DC  E "C4'" 1 
ATOM   818  O "O4'" . DC  C 1 4   ? -18.116 92.242  71.567 1.00 29.34  ? 4   DC  E "O4'" 1 
ATOM   819  C "C3'" . DC  C 1 4   ? -16.385 92.710  70.049 1.00 34.18  ? 4   DC  E "C3'" 1 
ATOM   820  O "O3'" . DC  C 1 4   ? -14.982 93.002  70.108 1.00 32.83  ? 4   DC  E "O3'" 1 
ATOM   821  C "C2'" . DC  C 1 4   ? -16.761 91.240  70.010 1.00 34.13  ? 4   DC  E "C2'" 1 
ATOM   822  C "C1'" . DC  C 1 4   ? -17.354 91.042  71.369 1.00 24.78  ? 4   DC  E "C1'" 1 
ATOM   823  N N1    . DC  C 1 4   ? -18.362 90.045  71.561 1.00 22.11  ? 4   DC  E N1    1 
ATOM   824  C C2    . DC  C 1 4   ? -18.171 89.170  72.620 1.00 22.10  ? 4   DC  E C2    1 
ATOM   825  O O2    . DC  C 1 4   ? -17.133 89.220  73.334 1.00 21.27  ? 4   DC  E O2    1 
ATOM   826  N N3    . DC  C 1 4   ? -19.196 88.241  72.816 1.00 17.76  ? 4   DC  E N3    1 
ATOM   827  C C4    . DC  C 1 4   ? -20.309 88.217  72.046 1.00 17.32  ? 4   DC  E C4    1 
ATOM   828  N N4    . DC  C 1 4   ? -21.315 87.331  72.248 1.00 19.29  ? 4   DC  E N4    1 
ATOM   829  C C5    . DC  C 1 4   ? -20.478 89.121  70.974 1.00 16.55  ? 4   DC  E C5    1 
ATOM   830  C C6    . DC  C 1 4   ? -19.487 90.023  70.783 1.00 20.69  ? 4   DC  E C6    1 
ATOM   831  P P     . DA  C 1 5   ? -13.835 92.470  69.148 1.00 29.71  ? 5   DA  E P     1 
ATOM   832  O OP1   . DA  C 1 5   ? -12.683 93.390  69.092 1.00 27.31  ? 5   DA  E OP1   1 
ATOM   833  O OP2   . DA  C 1 5   ? -14.524 92.061  67.939 1.00 33.45  ? 5   DA  E OP2   1 
ATOM   834  O "O5'" . DA  C 1 5   ? -13.418 91.196  69.933 1.00 34.75  ? 5   DA  E "O5'" 1 
ATOM   835  C "C5'" . DA  C 1 5   ? -12.751 91.367  71.183 1.00 28.94  ? 5   DA  E "C5'" 1 
ATOM   836  C "C4'" . DA  C 1 5   ? -12.401 90.019  71.748 1.00 22.12  ? 5   DA  E "C4'" 1 
ATOM   837  O "O4'" . DA  C 1 5   ? -13.602 89.286  71.929 1.00 19.81  ? 5   DA  E "O4'" 1 
ATOM   838  C "C3'" . DA  C 1 5   ? -11.456 89.171  70.890 1.00 21.27  ? 5   DA  E "C3'" 1 
ATOM   839  O "O3'" . DA  C 1 5   ? -10.484 88.610  71.734 1.00 18.71  ? 5   DA  E "O3'" 1 
ATOM   840  C "C2'" . DA  C 1 5   ? -12.373 88.061  70.478 1.00 18.79  ? 5   DA  E "C2'" 1 
ATOM   841  C "C1'" . DA  C 1 5   ? -13.410 87.901  71.542 1.00 14.25  ? 5   DA  E "C1'" 1 
ATOM   842  N N9    . DA  C 1 5   ? -14.729 87.497  71.040 1.00 11.22  ? 5   DA  E N9    1 
ATOM   843  C C8    . DA  C 1 5   ? -15.467 88.065  70.032 1.00 6.73   ? 5   DA  E C8    1 
ATOM   844  N N7    . DA  C 1 5   ? -16.664 87.551  69.888 1.00 12.70  ? 5   DA  E N7    1 
ATOM   845  C C5    . DA  C 1 5   ? -16.728 86.552  70.887 1.00 11.18  ? 5   DA  E C5    1 
ATOM   846  C C6    . DA  C 1 5   ? -17.710 85.625  71.254 1.00 10.76  ? 5   DA  E C6    1 
ATOM   847  N N6    . DA  C 1 5   ? -18.893 85.518  70.619 1.00 11.63  ? 5   DA  E N6    1 
ATOM   848  N N1    . DA  C 1 5   ? -17.444 84.792  72.274 1.00 9.22   ? 5   DA  E N1    1 
ATOM   849  C C2    . DA  C 1 5   ? -16.268 84.893  72.891 1.00 6.66   ? 5   DA  E C2    1 
ATOM   850  N N3    . DA  C 1 5   ? -15.257 85.710  72.666 1.00 10.89  ? 5   DA  E N3    1 
ATOM   851  C C4    . DA  C 1 5   ? -15.557 86.535  71.618 1.00 12.79  ? 5   DA  E C4    1 
ATOM   852  P P     . DC  C 1 6   ? -9.189  87.904  71.213 1.00 24.62  ? 6   DC  E P     1 
ATOM   853  O OP1   . DC  C 1 6   ? -8.114  88.022  72.183 1.00 25.04  ? 6   DC  E OP1   1 
ATOM   854  O OP2   . DC  C 1 6   ? -8.875  88.325  69.838 1.00 27.77  ? 6   DC  E OP2   1 
ATOM   855  O "O5'" . DC  C 1 6   ? -9.824  86.457  71.177 1.00 22.10  ? 6   DC  E "O5'" 1 
ATOM   856  C "C5'" . DC  C 1 6   ? -9.800  85.396  72.114 1.00 21.42  ? 6   DC  E "C5'" 1 
ATOM   857  C "C4'" . DC  C 1 6   ? -10.707 84.233  71.719 1.00 12.99  ? 6   DC  E "C4'" 1 
ATOM   858  O "O4'" . DC  C 1 6   ? -11.978 84.657  71.262 1.00 19.75  ? 6   DC  E "O4'" 1 
ATOM   859  C "C3'" . DC  C 1 6   ? -10.261 83.265  70.641 1.00 17.83  ? 6   DC  E "C3'" 1 
ATOM   860  O "O3'" . DC  C 1 6   ? -9.606  82.249  71.392 1.00 20.99  ? 6   DC  E "O3'" 1 
ATOM   861  C "C2'" . DC  C 1 6   ? -11.553 82.836  70.007 1.00 12.47  ? 6   DC  E "C2'" 1 
ATOM   862  C "C1'" . DC  C 1 6   ? -12.611 83.431  70.932 1.00 12.84  ? 6   DC  E "C1'" 1 
ATOM   863  N N1    . DC  C 1 6   ? -13.784 83.645  70.122 1.00 11.79  ? 6   DC  E N1    1 
ATOM   864  C C2    . DC  C 1 6   ? -14.882 82.881  70.396 1.00 12.16  ? 6   DC  E C2    1 
ATOM   865  O O2    . DC  C 1 6   ? -14.875 82.079  71.323 1.00 17.50  ? 6   DC  E O2    1 
ATOM   866  N N3    . DC  C 1 6   ? -16.000 83.036  69.617 1.00 11.37  ? 6   DC  E N3    1 
ATOM   867  C C4    . DC  C 1 6   ? -16.014 83.937  68.601 1.00 10.35  ? 6   DC  E C4    1 
ATOM   868  N N4    . DC  C 1 6   ? -17.111 84.069  67.854 1.00 8.32   ? 6   DC  E N4    1 
ATOM   869  C C5    . DC  C 1 6   ? -14.898 84.761  68.315 1.00 9.23   ? 6   DC  E C5    1 
ATOM   870  C C6    . DC  C 1 6   ? -13.793 84.586  69.100 1.00 14.28  ? 6   DC  E C6    1 
ATOM   871  P P     . DA  C 1 7   ? -9.152  80.886  70.830 1.00 21.20  ? 7   DA  E P     1 
ATOM   872  O OP1   . DA  C 1 7   ? -7.847  80.492  71.443 1.00 19.78  ? 7   DA  E OP1   1 
ATOM   873  O OP2   . DA  C 1 7   ? -9.144  81.041  69.338 1.00 32.86  ? 7   DA  E OP2   1 
ATOM   874  O "O5'" . DA  C 1 7   ? -10.392 79.991  71.129 1.00 25.45  ? 7   DA  E "O5'" 1 
ATOM   875  C "C5'" . DA  C 1 7   ? -10.875 79.730  72.412 1.00 20.75  ? 7   DA  E "C5'" 1 
ATOM   876  C "C4'" . DA  C 1 7   ? -11.882 78.728  72.356 1.00 18.91  ? 7   DA  E "C4'" 1 
ATOM   877  O "O4'" . DA  C 1 7   ? -12.939 79.227  71.597 1.00 23.95  ? 7   DA  E "O4'" 1 
ATOM   878  C "C3'" . DA  C 1 7   ? -11.350 77.512  71.721 1.00 23.73  ? 7   DA  E "C3'" 1 
ATOM   879  O "O3'" . DA  C 1 7   ? -11.748 76.377  72.542 1.00 27.38  ? 7   DA  E "O3'" 1 
ATOM   880  C "C2'" . DA  C 1 7   ? -12.062 77.632  70.366 1.00 18.85  ? 7   DA  E "C2'" 1 
ATOM   881  C "C1'" . DA  C 1 7   ? -13.385 78.266  70.620 1.00 19.08  ? 7   DA  E "C1'" 1 
ATOM   882  N N9    . DA  C 1 7   ? -13.890 79.036  69.465 1.00 14.60  ? 7   DA  E N9    1 
ATOM   883  C C8    . DA  C 1 7   ? -13.225 79.996  68.767 1.00 12.86  ? 7   DA  E C8    1 
ATOM   884  N N7    . DA  C 1 7   ? -13.899 80.565  67.802 1.00 13.21  ? 7   DA  E N7    1 
ATOM   885  C C5    . DA  C 1 7   ? -15.136 79.925  67.888 1.00 12.13  ? 7   DA  E C5    1 
ATOM   886  C C6    . DA  C 1 7   ? -16.299 80.078  67.135 1.00 14.22  ? 7   DA  E C6    1 
ATOM   887  N N6    . DA  C 1 7   ? -16.397 80.967  66.090 1.00 18.00  ? 7   DA  E N6    1 
ATOM   888  N N1    . DA  C 1 7   ? -17.330 79.326  67.486 1.00 16.41  ? 7   DA  E N1    1 
ATOM   889  C C2    . DA  C 1 7   ? -17.199 78.463  68.522 1.00 17.24  ? 7   DA  E C2    1 
ATOM   890  N N3    . DA  C 1 7   ? -16.155 78.233  69.313 1.00 16.07  ? 7   DA  E N3    1 
ATOM   891  C C4    . DA  C 1 7   ? -15.138 79.019  68.924 1.00 13.36  ? 7   DA  E C4    1 
ATOM   892  P P     . DC  C 1 8   ? -11.264 74.865  72.352 1.00 27.91  ? 8   DC  E P     1 
ATOM   893  O OP1   . DC  C 1 8   ? -11.405 74.104  73.617 1.00 40.82  ? 8   DC  E OP1   1 
ATOM   894  O OP2   . DC  C 1 8   ? -9.923  74.954  71.720 1.00 23.52  ? 8   DC  E OP2   1 
ATOM   895  O "O5'" . DC  C 1 8   ? -12.417 74.289  71.389 1.00 26.08  ? 8   DC  E "O5'" 1 
ATOM   896  C "C5'" . DC  C 1 8   ? -13.752 74.214  71.837 1.00 22.29  ? 8   DC  E "C5'" 1 
ATOM   897  C "C4'" . DC  C 1 8   ? -14.664 73.957  70.653 1.00 26.43  ? 8   DC  E "C4'" 1 
ATOM   898  O "O4'" . DC  C 1 8   ? -14.723 75.040  69.762 1.00 22.38  ? 8   DC  E "O4'" 1 
ATOM   899  C "C3'" . DC  C 1 8   ? -14.258 72.763  69.814 1.00 29.16  ? 8   DC  E "C3'" 1 
ATOM   900  O "O3'" . DC  C 1 8   ? -15.319 71.868  70.136 1.00 28.59  ? 8   DC  E "O3'" 1 
ATOM   901  C "C2'" . DC  C 1 8   ? -14.292 73.284  68.360 1.00 23.23  ? 8   DC  E "C2'" 1 
ATOM   902  C "C1'" . DC  C 1 8   ? -15.112 74.511  68.476 1.00 22.60  ? 8   DC  E "C1'" 1 
ATOM   903  N N1    . DC  C 1 8   ? -14.790 75.536  67.487 1.00 16.62  ? 8   DC  E N1    1 
ATOM   904  C C2    . DC  C 1 8   ? -15.779 76.007  66.701 1.00 18.56  ? 8   DC  E C2    1 
ATOM   905  O O2    . DC  C 1 8   ? -16.940 75.565  66.760 1.00 22.00  ? 8   DC  E O2    1 
ATOM   906  N N3    . DC  C 1 8   ? -15.498 76.986  65.817 1.00 18.93  ? 8   DC  E N3    1 
ATOM   907  C C4    . DC  C 1 8   ? -14.290 77.500  65.747 1.00 17.73  ? 8   DC  E C4    1 
ATOM   908  N N4    . DC  C 1 8   ? -14.008 78.472  64.862 1.00 13.15  ? 8   DC  E N4    1 
ATOM   909  C C5    . DC  C 1 8   ? -13.271 77.030  66.616 1.00 17.59  ? 8   DC  E C5    1 
ATOM   910  C C6    . DC  C 1 8   ? -13.569 76.054  67.471 1.00 17.16  ? 8   DC  E C6    1 
ATOM   911  P P     . DC  C 1 9   ? -15.581 70.528  69.369 1.00 32.55  ? 9   DC  E P     1 
ATOM   912  O OP1   . DC  C 1 9   ? -16.539 69.703  70.091 1.00 32.98  ? 9   DC  E OP1   1 
ATOM   913  O OP2   . DC  C 1 9   ? -14.186 70.093  69.018 1.00 29.22  ? 9   DC  E OP2   1 
ATOM   914  O "O5'" . DC  C 1 9   ? -16.430 70.948  68.164 1.00 29.12  ? 9   DC  E "O5'" 1 
ATOM   915  C "C5'" . DC  C 1 9   ? -17.724 71.370  68.509 1.00 21.60  ? 9   DC  E "C5'" 1 
ATOM   916  C "C4'" . DC  C 1 9   ? -18.572 71.468  67.268 1.00 34.00  ? 9   DC  E "C4'" 1 
ATOM   917  O "O4'" . DC  C 1 9   ? -18.215 72.567  66.406 1.00 34.62  ? 9   DC  E "O4'" 1 
ATOM   918  C "C3'" . DC  C 1 9   ? -18.427 70.181  66.456 1.00 34.42  ? 9   DC  E "C3'" 1 
ATOM   919  O "O3'" . DC  C 1 9   ? -19.723 69.709  66.009 1.00 39.25  ? 9   DC  E "O3'" 1 
ATOM   920  C "C2'" . DC  C 1 9   ? -17.546 70.656  65.318 1.00 36.46  ? 9   DC  E "C2'" 1 
ATOM   921  C "C1'" . DC  C 1 9   ? -18.065 72.044  65.060 1.00 30.81  ? 9   DC  E "C1'" 1 
ATOM   922  N N1    . DC  C 1 9   ? -17.118 72.921  64.352 1.00 22.60  ? 9   DC  E N1    1 
ATOM   923  C C2    . DC  C 1 9   ? -17.608 73.540  63.253 1.00 18.58  ? 9   DC  E C2    1 
ATOM   924  O O2    . DC  C 1 9   ? -18.760 73.362  62.837 1.00 21.58  ? 9   DC  E O2    1 
ATOM   925  N N3    . DC  C 1 9   ? -16.817 74.364  62.592 1.00 17.94  ? 9   DC  E N3    1 
ATOM   926  C C4    . DC  C 1 9   ? -15.600 74.572  63.008 1.00 19.16  ? 9   DC  E C4    1 
ATOM   927  N N4    . DC  C 1 9   ? -14.873 75.442  62.286 1.00 18.66  ? 9   DC  E N4    1 
ATOM   928  C C5    . DC  C 1 9   ? -15.037 73.923  64.167 1.00 20.78  ? 9   DC  E C5    1 
ATOM   929  C C6    . DC  C 1 9   ? -15.847 73.092  64.812 1.00 21.48  ? 9   DC  E C6    1 
ATOM   930  P P     . DC  C 1 10  ? -19.849 68.114  65.836 1.00 42.46  ? 10  DC  E P     1 
ATOM   931  O OP1   . DC  C 1 10  ? -21.240 67.777  66.243 1.00 37.44  ? 10  DC  E OP1   1 
ATOM   932  O OP2   . DC  C 1 10  ? -18.603 67.461  66.378 1.00 29.82  ? 10  DC  E OP2   1 
ATOM   933  O "O5'" . DC  C 1 10  ? -19.764 67.933  64.249 1.00 40.26  ? 10  DC  E "O5'" 1 
ATOM   934  C "C5'" . DC  C 1 10  ? -20.943 68.187  63.496 1.00 37.05  ? 10  DC  E "C5'" 1 
ATOM   935  C "C4'" . DC  C 1 10  ? -20.630 68.156  62.039 1.00 38.50  ? 10  DC  E "C4'" 1 
ATOM   936  O "O4'" . DC  C 1 10  ? -19.812 69.289  61.725 1.00 36.58  ? 10  DC  E "O4'" 1 
ATOM   937  C "C3'" . DC  C 1 10  ? -19.833 66.911  61.633 1.00 36.37  ? 10  DC  E "C3'" 1 
ATOM   938  O "O3'" . DC  C 1 10  ? -20.377 66.637  60.360 1.00 37.88  ? 10  DC  E "O3'" 1 
ATOM   939  C "C2'" . DC  C 1 10  ? -18.393 67.397  61.619 1.00 33.02  ? 10  DC  E "C2'" 1 
ATOM   940  C "C1'" . DC  C 1 10  ? -18.634 68.785  61.122 1.00 29.62  ? 10  DC  E "C1'" 1 
ATOM   941  N N1    . DC  C 1 10  ? -17.511 69.750  61.106 1.00 21.65  ? 10  DC  E N1    1 
ATOM   942  C C2    . DC  C 1 10  ? -17.621 70.775  60.138 1.00 17.74  ? 10  DC  E C2    1 
ATOM   943  O O2    . DC  C 1 10  ? -18.586 70.940  59.334 1.00 13.95  ? 10  DC  E O2    1 
ATOM   944  N N3    . DC  C 1 10  ? -16.581 71.647  60.109 1.00 15.18  ? 10  DC  E N3    1 
ATOM   945  C C4    . DC  C 1 10  ? -15.521 71.552  60.922 1.00 15.32  ? 10  DC  E C4    1 
ATOM   946  N N4    . DC  C 1 10  ? -14.591 72.497  60.749 1.00 9.51   ? 10  DC  E N4    1 
ATOM   947  C C5    . DC  C 1 10  ? -15.384 70.490  61.915 1.00 16.68  ? 10  DC  E C5    1 
ATOM   948  C C6    . DC  C 1 10  ? -16.411 69.612  61.962 1.00 18.50  ? 10  DC  E C6    1 
ATOM   949  P P     . DA  C 1 11  ? -21.498 65.539  60.150 1.00 35.67  ? 11  DA  E P     1 
ATOM   950  O OP1   . DA  C 1 11  ? -22.632 65.778  61.072 1.00 42.15  ? 11  DA  E OP1   1 
ATOM   951  O OP2   . DA  C 1 11  ? -20.656 64.324  60.200 1.00 30.73  ? 11  DA  E OP2   1 
ATOM   952  O "O5'" . DA  C 1 11  ? -22.114 65.761  58.703 1.00 33.19  ? 11  DA  E "O5'" 1 
ATOM   953  C "C5'" . DA  C 1 11  ? -23.003 66.829  58.405 1.00 25.73  ? 11  DA  E "C5'" 1 
ATOM   954  C "C4'" . DA  C 1 11  ? -22.666 67.485  57.046 1.00 30.65  ? 11  DA  E "C4'" 1 
ATOM   955  O "O4'" . DA  C 1 11  ? -21.467 68.301  57.085 1.00 32.03  ? 11  DA  E "O4'" 1 
ATOM   956  C "C3'" . DA  C 1 11  ? -22.349 66.464  55.951 1.00 28.77  ? 11  DA  E "C3'" 1 
ATOM   957  O "O3'" . DA  C 1 11  ? -22.792 67.095  54.771 1.00 38.39  ? 11  DA  E "O3'" 1 
ATOM   958  C "C2'" . DA  C 1 11  ? -20.835 66.300  56.025 1.00 27.51  ? 11  DA  E "C2'" 1 
ATOM   959  C "C1'" . DA  C 1 11  ? -20.387 67.699  56.330 1.00 25.35  ? 11  DA  E "C1'" 1 
ATOM   960  N N9    . DA  C 1 11  ? -19.065 67.757  56.977 1.00 16.81  ? 11  DA  E N9    1 
ATOM   961  C C8    . DA  C 1 11  ? -18.497 66.947  57.890 1.00 14.49  ? 11  DA  E C8    1 
ATOM   962  N N7    . DA  C 1 11  ? -17.250 67.294  58.186 1.00 17.93  ? 11  DA  E N7    1 
ATOM   963  C C5    . DA  C 1 11  ? -16.999 68.424  57.413 1.00 14.67  ? 11  DA  E C5    1 
ATOM   964  C C6    . DA  C 1 11  ? -15.891 69.248  57.279 1.00 14.63  ? 11  DA  E C6    1 
ATOM   965  N N6    . DA  C 1 11  ? -14.735 69.115  57.970 1.00 16.42  ? 11  DA  E N6    1 
ATOM   966  N N1    . DA  C 1 11  ? -15.965 70.223  56.383 1.00 12.69  ? 11  DA  E N1    1 
ATOM   967  C C2    . DA  C 1 11  ? -17.064 70.420  55.645 1.00 15.18  ? 11  DA  E C2    1 
ATOM   968  N N3    . DA  C 1 11  ? -18.191 69.726  55.703 1.00 17.27  ? 11  DA  E N3    1 
ATOM   969  C C4    . DA  C 1 11  ? -18.084 68.716  56.648 1.00 15.99  ? 11  DA  E C4    1 
ATOM   970  P P     . DC  C 1 12  ? -22.822 66.491  53.268 1.00 33.15  ? 12  DC  E P     1 
ATOM   971  O OP1   . DC  C 1 12  ? -23.848 67.236  52.519 1.00 28.18  ? 12  DC  E OP1   1 
ATOM   972  O OP2   . DC  C 1 12  ? -22.870 65.030  53.416 1.00 35.31  ? 12  DC  E OP2   1 
ATOM   973  O "O5'" . DC  C 1 12  ? -21.434 66.909  52.727 1.00 34.31  ? 12  DC  E "O5'" 1 
ATOM   974  C "C5'" . DC  C 1 12  ? -21.245 68.137  52.024 1.00 25.76  ? 12  DC  E "C5'" 1 
ATOM   975  C "C4'" . DC  C 1 12  ? -19.797 68.140  51.528 1.00 26.60  ? 12  DC  E "C4'" 1 
ATOM   976  O "O4'" . DC  C 1 12  ? -18.818 68.049  52.600 1.00 24.31  ? 12  DC  E "O4'" 1 
ATOM   977  C "C3'" . DC  C 1 12  ? -19.501 66.959  50.629 1.00 17.70  ? 12  DC  E "C3'" 1 
ATOM   978  O "O3'" . DC  C 1 12  ? -18.940 67.589  49.495 1.00 18.81  ? 12  DC  E "O3'" 1 
ATOM   979  C "C2'" . DC  C 1 12  ? -18.539 66.136  51.521 1.00 12.53  ? 12  DC  E "C2'" 1 
ATOM   980  C "C1'" . DC  C 1 12  ? -17.768 67.191  52.239 1.00 17.99  ? 12  DC  E "C1'" 1 
ATOM   981  N N1    . DC  C 1 12  ? -16.983 66.740  53.397 1.00 18.69  ? 12  DC  E N1    1 
ATOM   982  C C2    . DC  C 1 12  ? -15.755 67.306  53.642 1.00 21.24  ? 12  DC  E C2    1 
ATOM   983  O O2    . DC  C 1 12  ? -15.266 68.216  52.967 1.00 28.14  ? 12  DC  E O2    1 
ATOM   984  N N3    . DC  C 1 12  ? -15.022 66.898  54.693 1.00 22.15  ? 12  DC  E N3    1 
ATOM   985  C C4    . DC  C 1 12  ? -15.484 65.961  55.497 1.00 21.36  ? 12  DC  E C4    1 
ATOM   986  N N4    . DC  C 1 12  ? -14.748 65.588  56.563 1.00 25.68  ? 12  DC  E N4    1 
ATOM   987  C C5    . DC  C 1 12  ? -16.722 65.355  55.242 1.00 22.30  ? 12  DC  E C5    1 
ATOM   988  C C6    . DC  C 1 12  ? -17.442 65.782  54.181 1.00 20.41  ? 12  DC  E C6    1 
ATOM   989  P P     . DA  C 1 13  ? -19.748 68.122  48.289 1.00 21.27  ? 13  DA  E P     1 
ATOM   990  O OP1   . DA  C 1 13  ? -20.887 68.928  48.704 1.00 23.92  ? 13  DA  E OP1   1 
ATOM   991  O OP2   . DA  C 1 13  ? -20.000 66.939  47.486 1.00 20.11  ? 13  DA  E OP2   1 
ATOM   992  O "O5'" . DA  C 1 13  ? -18.755 69.006  47.523 1.00 24.93  ? 13  DA  E "O5'" 1 
ATOM   993  C "C5'" . DA  C 1 13  ? -18.309 70.288  47.847 1.00 24.44  ? 13  DA  E "C5'" 1 
ATOM   994  C "C4'" . DA  C 1 13  ? -16.845 70.430  47.544 1.00 20.42  ? 13  DA  E "C4'" 1 
ATOM   995  O "O4'" . DA  C 1 13  ? -16.108 69.735  48.522 1.00 22.69  ? 13  DA  E "O4'" 1 
ATOM   996  C "C3'" . DA  C 1 13  ? -16.317 69.970  46.188 1.00 21.11  ? 13  DA  E "C3'" 1 
ATOM   997  O "O3'" . DA  C 1 13  ? -15.352 70.929  45.845 1.00 15.89  ? 13  DA  E "O3'" 1 
ATOM   998  C "C2'" . DA  C 1 13  ? -15.665 68.664  46.538 1.00 13.52  ? 13  DA  E "C2'" 1 
ATOM   999  C "C1'" . DA  C 1 13  ? -15.057 68.921  47.904 1.00 23.18  ? 13  DA  E "C1'" 1 
ATOM   1000 N N9    . DA  C 1 13  ? -14.963 67.795  48.835 1.00 16.92  ? 13  DA  E N9    1 
ATOM   1001 C C8    . DA  C 1 13  ? -15.873 66.787  48.978 1.00 14.32  ? 13  DA  E C8    1 
ATOM   1002 N N7    . DA  C 1 13  ? -15.612 65.962  49.914 1.00 19.80  ? 13  DA  E N7    1 
ATOM   1003 C C5    . DA  C 1 13  ? -14.413 66.447  50.479 1.00 20.52  ? 13  DA  E C5    1 
ATOM   1004 C C6    . DA  C 1 13  ? -13.568 65.968  51.527 1.00 23.42  ? 13  DA  E C6    1 
ATOM   1005 N N6    . DA  C 1 13  ? -13.791 64.841  52.281 1.00 23.60  ? 13  DA  E N6    1 
ATOM   1006 N N1    . DA  C 1 13  ? -12.449 66.715  51.753 1.00 25.09  ? 13  DA  E N1    1 
ATOM   1007 C C2    . DA  C 1 13  ? -12.186 67.804  51.011 1.00 23.03  ? 13  DA  E C2    1 
ATOM   1008 N N3    . DA  C 1 13  ? -12.891 68.349  50.021 1.00 22.13  ? 13  DA  E N3    1 
ATOM   1009 C C4    . DA  C 1 13  ? -14.028 67.605  49.817 1.00 21.05  ? 13  DA  E C4    1 
ATOM   1010 P P     . DC  C 1 14  ? -14.637 70.960  44.532 1.00 18.85  ? 14  DC  E P     1 
ATOM   1011 O OP1   . DC  C 1 14  ? -14.087 72.296  44.263 1.00 12.86  ? 14  DC  E OP1   1 
ATOM   1012 O OP2   . DC  C 1 14  ? -15.548 70.331  43.555 1.00 24.26  ? 14  DC  E OP2   1 
ATOM   1013 O "O5'" . DC  C 1 14  ? -13.429 70.009  44.828 1.00 22.62  ? 14  DC  E "O5'" 1 
ATOM   1014 C "C5'" . DC  C 1 14  ? -12.182 70.526  45.188 1.00 20.90  ? 14  DC  E "C5'" 1 
ATOM   1015 C "C4'" . DC  C 1 14  ? -11.248 69.481  45.550 1.00 7.35   ? 14  DC  E "C4'" 1 
ATOM   1016 O "O4'" . DC  C 1 14  ? -11.898 68.674  46.472 1.00 15.21  ? 14  DC  E "O4'" 1 
ATOM   1017 C "C3'" . DC  C 1 14  ? -10.972 68.599  44.389 1.00 12.40  ? 14  DC  E "C3'" 1 
ATOM   1018 O "O3'" . DC  C 1 14  ? -9.594  68.893  44.244 1.00 20.10  ? 14  DC  E "O3'" 1 
ATOM   1019 C "C2'" . DC  C 1 14  ? -11.211 67.241  44.974 1.00 16.15  ? 14  DC  E "C2'" 1 
ATOM   1020 C "C1'" . DC  C 1 14  ? -11.181 67.485  46.459 1.00 18.12  ? 14  DC  E "C1'" 1 
ATOM   1021 N N1    . DC  C 1 14  ? -11.751 66.329  47.204 1.00 18.50  ? 14  DC  E N1    1 
ATOM   1022 C C2    . DC  C 1 14  ? -11.008 65.822  48.327 1.00 19.03  ? 14  DC  E C2    1 
ATOM   1023 O O2    . DC  C 1 14  ? -9.951  66.301  48.743 1.00 18.89  ? 14  DC  E O2    1 
ATOM   1024 N N3    . DC  C 1 14  ? -11.509 64.694  48.964 1.00 16.52  ? 14  DC  E N3    1 
ATOM   1025 C C4    . DC  C 1 14  ? -12.680 64.118  48.604 1.00 12.76  ? 14  DC  E C4    1 
ATOM   1026 N N4    . DC  C 1 14  ? -13.074 63.085  49.307 1.00 10.71  ? 14  DC  E N4    1 
ATOM   1027 C C5    . DC  C 1 14  ? -13.437 64.603  47.511 1.00 13.96  ? 14  DC  E C5    1 
ATOM   1028 C C6    . DC  C 1 14  ? -12.948 65.687  46.828 1.00 18.50  ? 14  DC  E C6    1 
ATOM   1029 P P     . DA  C 1 15  ? -8.514  68.224  43.285 1.00 18.15  ? 15  DA  E P     1 
ATOM   1030 O OP1   . DA  C 1 15  ? -7.577  69.236  42.757 1.00 18.40  ? 15  DA  E OP1   1 
ATOM   1031 O OP2   . DA  C 1 15  ? -9.286  67.375  42.341 1.00 26.45  ? 15  DA  E OP2   1 
ATOM   1032 O "O5'" . DA  C 1 15  ? -7.804  67.264  44.217 1.00 13.89  ? 15  DA  E "O5'" 1 
ATOM   1033 C "C5'" . DA  C 1 15  ? -6.962  67.716  45.240 1.00 19.55  ? 15  DA  E "C5'" 1 
ATOM   1034 C "C4'" . DA  C 1 15  ? -6.609  66.538  46.120 1.00 19.36  ? 15  DA  E "C4'" 1 
ATOM   1035 O "O4'" . DA  C 1 15  ? -7.746  65.929  46.654 1.00 15.70  ? 15  DA  E "O4'" 1 
ATOM   1036 C "C3'" . DA  C 1 15  ? -5.871  65.497  45.343 1.00 20.93  ? 15  DA  E "C3'" 1 
ATOM   1037 O "O3'" . DA  C 1 15  ? -4.592  65.764  45.728 1.00 30.91  ? 15  DA  E "O3'" 1 
ATOM   1038 C "C2'" . DA  C 1 15  ? -6.304  64.208  45.934 1.00 22.75  ? 15  DA  E "C2'" 1 
ATOM   1039 C "C1'" . DA  C 1 15  ? -7.322  64.561  46.916 1.00 17.15  ? 15  DA  E "C1'" 1 
ATOM   1040 N N9    . DA  C 1 15  ? -8.522  63.742  46.804 1.00 12.71  ? 15  DA  E N9    1 
ATOM   1041 C C8    . DA  C 1 15  ? -9.592  63.871  46.005 1.00 11.00  ? 15  DA  E C8    1 
ATOM   1042 N N7    . DA  C 1 15  ? -10.523 62.964  46.235 1.00 17.00  ? 15  DA  E N7    1 
ATOM   1043 C C5    . DA  C 1 15  ? -10.006 62.197  47.233 1.00 11.72  ? 15  DA  E C5    1 
ATOM   1044 C C6    . DA  C 1 15  ? -10.488 61.085  47.894 1.00 12.98  ? 15  DA  E C6    1 
ATOM   1045 N N6    . DA  C 1 15  ? -11.668 60.554  47.629 1.00 11.83  ? 15  DA  E N6    1 
ATOM   1046 N N1    . DA  C 1 15  ? -9.696  60.565  48.836 1.00 13.14  ? 15  DA  E N1    1 
ATOM   1047 C C2    . DA  C 1 15  ? -8.516  61.134  49.083 1.00 13.61  ? 15  DA  E C2    1 
ATOM   1048 N N3    . DA  C 1 15  ? -7.919  62.188  48.530 1.00 17.32  ? 15  DA  E N3    1 
ATOM   1049 C C4    . DA  C 1 15  ? -8.772  62.669  47.585 1.00 13.58  ? 15  DA  E C4    1 
ATOM   1050 P P     . DC  C 1 16  ? -3.349  65.237  44.937 1.00 40.55  ? 16  DC  E P     1 
ATOM   1051 O OP1   . DC  C 1 16  ? -2.214  66.044  45.462 1.00 47.50  ? 16  DC  E OP1   1 
ATOM   1052 O OP2   . DC  C 1 16  ? -3.608  65.123  43.484 1.00 35.46  ? 16  DC  E OP2   1 
ATOM   1053 O "O5'" . DC  C 1 16  ? -3.254  63.761  45.473 1.00 44.41  ? 16  DC  E "O5'" 1 
ATOM   1054 C "C5'" . DC  C 1 16  ? -2.500  63.395  46.620 1.00 42.93  ? 16  DC  E "C5'" 1 
ATOM   1055 C "C4'" . DC  C 1 16  ? -2.568  61.927  46.816 1.00 36.30  ? 16  DC  E "C4'" 1 
ATOM   1056 O "O4'" . DC  C 1 16  ? -3.936  61.556  47.108 1.00 35.58  ? 16  DC  E "O4'" 1 
ATOM   1057 C "C3'" . DC  C 1 16  ? -2.096  61.246  45.566 1.00 37.52  ? 16  DC  E "C3'" 1 
ATOM   1058 O "O3'" . DC  C 1 16  ? -1.118  60.361  46.071 1.00 47.15  ? 16  DC  E "O3'" 1 
ATOM   1059 C "C2'" . DC  C 1 16  ? -3.404  60.611  45.075 1.00 29.06  ? 16  DC  E "C2'" 1 
ATOM   1060 C "C1'" . DC  C 1 16  ? -4.228  60.418  46.367 1.00 28.27  ? 16  DC  E "C1'" 1 
ATOM   1061 N N1    . DC  C 1 16  ? -5.662  60.161  46.131 1.00 22.80  ? 16  DC  E N1    1 
ATOM   1062 C C2    . DC  C 1 16  ? -6.305  59.298  46.995 1.00 19.79  ? 16  DC  E C2    1 
ATOM   1063 O O2    . DC  C 1 16  ? -5.790  58.765  47.953 1.00 19.69  ? 16  DC  E O2    1 
ATOM   1064 N N3    . DC  C 1 16  ? -7.591  58.977  46.746 1.00 20.13  ? 16  DC  E N3    1 
ATOM   1065 C C4    . DC  C 1 16  ? -8.286  59.448  45.706 1.00 17.15  ? 16  DC  E C4    1 
ATOM   1066 N N4    . DC  C 1 16  ? -9.565  59.056  45.619 1.00 12.79  ? 16  DC  E N4    1 
ATOM   1067 C C5    . DC  C 1 16  ? -7.686  60.338  44.781 1.00 19.05  ? 16  DC  E C5    1 
ATOM   1068 C C6    . DC  C 1 16  ? -6.383  60.664  45.036 1.00 24.46  ? 16  DC  E C6    1 
ATOM   1069 P P     . DC  C 1 17  ? 0.205   59.869  45.349 1.00 50.18  ? 17  DC  E P     1 
ATOM   1070 O OP1   . DC  C 1 17  ? 1.248   60.883  45.595 1.00 53.34  ? 17  DC  E OP1   1 
ATOM   1071 O OP2   . DC  C 1 17  ? -0.078  59.371  43.983 1.00 50.46  ? 17  DC  E OP2   1 
ATOM   1072 O "O5'" . DC  C 1 17  ? 0.498   58.610  46.166 1.00 46.02  ? 17  DC  E "O5'" 1 
ATOM   1073 C "C5'" . DC  C 1 17  ? 0.170   58.552  47.534 1.00 47.64  ? 17  DC  E "C5'" 1 
ATOM   1074 C "C4'" . DC  C 1 17  ? -0.598  57.285  47.659 1.00 46.50  ? 17  DC  E "C4'" 1 
ATOM   1075 O "O4'" . DC  C 1 17  ? -1.849  57.422  47.034 1.00 39.52  ? 17  DC  E "O4'" 1 
ATOM   1076 C "C3'" . DC  C 1 17  ? 0.044   56.128  46.865 1.00 48.25  ? 17  DC  E "C3'" 1 
ATOM   1077 O "O3'" . DC  C 1 17  ? 0.408   55.184  47.861 1.00 57.11  ? 17  DC  E "O3'" 1 
ATOM   1078 C "C2'" . DC  C 1 17  ? -1.097  55.677  46.000 1.00 39.22  ? 17  DC  E "C2'" 1 
ATOM   1079 C "C1'" . DC  C 1 17  ? -2.269  56.095  46.841 1.00 30.95  ? 17  DC  E "C1'" 1 
ATOM   1080 N N1    . DC  C 1 17  ? -3.533  56.174  46.127 1.00 27.22  ? 17  DC  E N1    1 
ATOM   1081 C C2    . DC  C 1 17  ? -4.655  55.523  46.674 1.00 25.24  ? 17  DC  E C2    1 
ATOM   1082 O O2    . DC  C 1 17  ? -4.690  54.884  47.734 1.00 29.48  ? 17  DC  E O2    1 
ATOM   1083 N N3    . DC  C 1 17  ? -5.781  55.622  45.939 1.00 23.46  ? 17  DC  E N3    1 
ATOM   1084 C C4    . DC  C 1 17  ? -5.824  56.379  44.796 1.00 21.34  ? 17  DC  E C4    1 
ATOM   1085 N N4    . DC  C 1 17  ? -6.993  56.495  44.136 1.00 17.66  ? 17  DC  E N4    1 
ATOM   1086 C C5    . DC  C 1 17  ? -4.691  57.033  44.242 1.00 14.67  ? 17  DC  E C5    1 
ATOM   1087 C C6    . DC  C 1 17  ? -3.567  56.902  44.936 1.00 20.73  ? 17  DC  E C6    1 
ATOM   1088 P P     . DA  C 1 18  ? 1.322   53.881  47.688 1.00 59.94  ? 18  DA  E P     1 
ATOM   1089 O OP1   . DA  C 1 18  ? 2.664   54.293  48.173 1.00 61.97  ? 18  DA  E OP1   1 
ATOM   1090 O OP2   . DA  C 1 18  ? 1.133   53.229  46.357 1.00 55.89  ? 18  DA  E OP2   1 
ATOM   1091 O "O5'" . DA  C 1 18  ? 0.571   52.997  48.802 1.00 54.52  ? 18  DA  E "O5'" 1 
ATOM   1092 C "C5'" . DA  C 1 18  ? -0.811  52.758  48.478 1.00 50.52  ? 18  DA  E "C5'" 1 
ATOM   1093 C "C4'" . DA  C 1 18  ? -1.455  51.526  49.005 1.00 47.24  ? 18  DA  E "C4'" 1 
ATOM   1094 O "O4'" . DA  C 1 18  ? -2.841  51.359  48.582 1.00 43.05  ? 18  DA  E "O4'" 1 
ATOM   1095 C "C3'" . DA  C 1 18  ? -0.679  50.394  48.418 1.00 51.55  ? 18  DA  E "C3'" 1 
ATOM   1096 O "O3'" . DA  C 1 18  ? -0.833  49.336  49.396 1.00 58.63  ? 18  DA  E "O3'" 1 
ATOM   1097 C "C2'" . DA  C 1 18  ? -1.363  50.240  47.091 1.00 43.28  ? 18  DA  E "C2'" 1 
ATOM   1098 C "C1'" . DA  C 1 18  ? -2.809  50.640  47.340 1.00 38.44  ? 18  DA  E "C1'" 1 
ATOM   1099 N N9    . DA  C 1 18  ? -3.158  51.477  46.197 1.00 32.74  ? 18  DA  E N9    1 
ATOM   1100 C C8    . DA  C 1 18  ? -2.395  52.338  45.402 1.00 31.00  ? 18  DA  E C8    1 
ATOM   1101 N N7    . DA  C 1 18  ? -3.086  52.949  44.482 1.00 29.29  ? 18  DA  E N7    1 
ATOM   1102 C C5    . DA  C 1 18  ? -4.358  52.428  44.666 1.00 27.78  ? 18  DA  E C5    1 
ATOM   1103 C C6    . DA  C 1 18  ? -5.531  52.655  43.981 1.00 28.53  ? 18  DA  E C6    1 
ATOM   1104 N N6    . DA  C 1 18  ? -5.534  53.483  42.966 1.00 29.14  ? 18  DA  E N6    1 
ATOM   1105 N N1    . DA  C 1 18  ? -6.624  51.999  44.391 1.00 31.51  ? 18  DA  E N1    1 
ATOM   1106 C C2    . DA  C 1 18  ? -6.523  51.147  45.452 1.00 33.56  ? 18  DA  E C2    1 
ATOM   1107 N N3    . DA  C 1 18  ? -5.456  50.847  46.197 1.00 31.46  ? 18  DA  E N3    1 
ATOM   1108 C C4    . DA  C 1 18  ? -4.401  51.540  45.713 1.00 29.32  ? 18  DA  E C4    1 
ATOM   1109 P P     . DG  C 1 19  ? -0.851  47.733  49.305 1.00 50.75  ? 19  DG  E P     1 
ATOM   1110 O OP1   . DG  C 1 19  ? -0.074  47.273  50.465 1.00 62.28  ? 19  DG  E OP1   1 
ATOM   1111 O OP2   . DG  C 1 19  ? -0.407  47.339  47.953 1.00 56.82  ? 19  DG  E OP2   1 
ATOM   1112 O "O5'" . DG  C 1 19  ? -2.450  47.451  49.604 1.00 45.07  ? 19  DG  E "O5'" 1 
ATOM   1113 C "C5'" . DG  C 1 19  ? -3.138  46.320  49.093 1.00 42.02  ? 19  DG  E "C5'" 1 
ATOM   1114 C "C4'" . DG  C 1 19  ? -4.378  46.579  48.226 1.00 43.25  ? 19  DG  E "C4'" 1 
ATOM   1115 O "O4'" . DG  C 1 19  ? -3.968  47.421  47.103 1.00 40.97  ? 19  DG  E "O4'" 1 
ATOM   1116 C "C3'" . DG  C 1 19  ? -4.786  45.213  47.586 1.00 44.80  ? 19  DG  E "C3'" 1 
ATOM   1117 O "O3'" . DG  C 1 19  ? -6.251  45.025  47.522 1.00 48.16  ? 19  DG  E "O3'" 1 
ATOM   1118 C "C2'" . DG  C 1 19  ? -3.978  45.335  46.229 1.00 44.00  ? 19  DG  E "C2'" 1 
ATOM   1119 C "C1'" . DG  C 1 19  ? -4.240  46.790  45.829 1.00 36.87  ? 19  DG  E "C1'" 1 
ATOM   1120 N N9    . DG  C 1 19  ? -3.702  47.706  44.756 1.00 30.12  ? 19  DG  E N9    1 
ATOM   1121 C C8    . DG  C 1 19  ? -2.449  48.240  44.499 1.00 29.48  ? 19  DG  E C8    1 
ATOM   1122 N N7    . DG  C 1 19  ? -2.460  49.115  43.505 1.00 28.85  ? 19  DG  E N7    1 
ATOM   1123 C C5    . DG  C 1 19  ? -3.789  49.157  43.082 1.00 25.88  ? 19  DG  E C5    1 
ATOM   1124 C C6    . DG  C 1 19  ? -4.437  49.893  42.035 1.00 26.02  ? 19  DG  E C6    1 
ATOM   1125 O O6    . DG  C 1 19  ? -3.963  50.711  41.246 1.00 26.58  ? 19  DG  E O6    1 
ATOM   1126 N N1    . DG  C 1 19  ? -5.794  49.636  41.942 1.00 17.05  ? 19  DG  E N1    1 
ATOM   1127 C C2    . DG  C 1 19  ? -6.437  48.792  42.754 1.00 19.14  ? 19  DG  E C2    1 
ATOM   1128 N N2    . DG  C 1 19  ? -7.730  48.638  42.581 1.00 21.74  ? 19  DG  E N2    1 
ATOM   1129 N N3    . DG  C 1 19  ? -5.856  48.104  43.717 1.00 24.67  ? 19  DG  E N3    1 
ATOM   1130 C C4    . DG  C 1 19  ? -4.535  48.327  43.845 1.00 26.26  ? 19  DG  E C4    1 
ATOM   1131 O "O5'" . DC  D 2 1   ? -7.103  59.664  34.899 1.00 33.07  ? 20  DC  F "O5'" 1 
ATOM   1132 C "C5'" . DC  D 2 1   ? -8.026  58.794  34.194 1.00 30.31  ? 20  DC  F "C5'" 1 
ATOM   1133 C "C4'" . DC  D 2 1   ? -8.031  57.311  34.639 1.00 40.67  ? 20  DC  F "C4'" 1 
ATOM   1134 O "O4'" . DC  D 2 1   ? -6.660  56.811  34.678 1.00 49.53  ? 20  DC  F "O4'" 1 
ATOM   1135 C "C3'" . DC  D 2 1   ? -8.663  56.953  35.992 1.00 41.19  ? 20  DC  F "C3'" 1 
ATOM   1136 O "O3'" . DC  D 2 1   ? -9.345  55.704  36.088 1.00 32.41  ? 20  DC  F "O3'" 1 
ATOM   1137 C "C2'" . DC  D 2 1   ? -7.480  56.742  36.858 1.00 46.75  ? 20  DC  F "C2'" 1 
ATOM   1138 C "C1'" . DC  D 2 1   ? -6.319  56.304  36.012 1.00 52.65  ? 20  DC  F "C1'" 1 
ATOM   1139 N N1    . DC  D 2 1   ? -5.103  56.906  36.679 1.00 55.23  ? 20  DC  F N1    1 
ATOM   1140 C C2    . DC  D 2 1   ? -4.321  56.125  37.503 1.00 56.20  ? 20  DC  F C2    1 
ATOM   1141 O O2    . DC  D 2 1   ? -4.581  54.939  37.691 1.00 56.80  ? 20  DC  F O2    1 
ATOM   1142 N N3    . DC  D 2 1   ? -3.264  56.735  38.117 1.00 55.87  ? 20  DC  F N3    1 
ATOM   1143 C C4    . DC  D 2 1   ? -2.960  58.019  37.951 1.00 57.37  ? 20  DC  F C4    1 
ATOM   1144 N N4    . DC  D 2 1   ? -1.903  58.549  38.571 1.00 58.06  ? 20  DC  F N4    1 
ATOM   1145 C C5    . DC  D 2 1   ? -3.755  58.839  37.109 1.00 59.36  ? 20  DC  F C5    1 
ATOM   1146 C C6    . DC  D 2 1   ? -4.813  58.245  36.524 1.00 58.89  ? 20  DC  F C6    1 
ATOM   1147 P P     . DC  D 2 2   ? -10.637 55.225  35.240 1.00 36.02  ? 21  DC  F P     1 
ATOM   1148 O OP1   . DC  D 2 2   ? -10.144 55.047  33.842 1.00 37.86  ? 21  DC  F OP1   1 
ATOM   1149 O OP2   . DC  D 2 2   ? -11.841 56.046  35.429 1.00 39.32  ? 21  DC  F OP2   1 
ATOM   1150 O "O5'" . DC  D 2 2   ? -10.898 53.749  35.911 1.00 41.16  ? 21  DC  F "O5'" 1 
ATOM   1151 C "C5'" . DC  D 2 2   ? -11.891 52.775  35.407 1.00 45.66  ? 21  DC  F "C5'" 1 
ATOM   1152 C "C4'" . DC  D 2 2   ? -11.947 51.427  36.187 1.00 45.39  ? 21  DC  F "C4'" 1 
ATOM   1153 O "O4'" . DC  D 2 2   ? -10.572 51.017  36.481 1.00 35.02  ? 21  DC  F "O4'" 1 
ATOM   1154 C "C3'" . DC  D 2 2   ? -12.587 51.660  37.521 1.00 44.26  ? 21  DC  F "C3'" 1 
ATOM   1155 O "O3'" . DC  D 2 2   ? -13.978 51.289  37.614 1.00 47.33  ? 21  DC  F "O3'" 1 
ATOM   1156 C "C2'" . DC  D 2 2   ? -11.642 50.996  38.518 1.00 39.42  ? 21  DC  F "C2'" 1 
ATOM   1157 C "C1'" . DC  D 2 2   ? -10.379 50.615  37.832 1.00 28.91  ? 21  DC  F "C1'" 1 
ATOM   1158 N N1    . DC  D 2 2   ? -9.082  51.210  38.279 1.00 28.12  ? 21  DC  F N1    1 
ATOM   1159 C C2    . DC  D 2 2   ? -8.324  50.614  39.271 1.00 27.21  ? 21  DC  F C2    1 
ATOM   1160 O O2    . DC  D 2 2   ? -8.692  49.617  39.871 1.00 34.61  ? 21  DC  F O2    1 
ATOM   1161 N N3    . DC  D 2 2   ? -7.128  51.133  39.630 1.00 24.31  ? 21  DC  F N3    1 
ATOM   1162 C C4    . DC  D 2 2   ? -6.678  52.218  39.073 1.00 22.39  ? 21  DC  F C4    1 
ATOM   1163 N N4    . DC  D 2 2   ? -5.503  52.691  39.454 1.00 23.26  ? 21  DC  F N4    1 
ATOM   1164 C C5    . DC  D 2 2   ? -7.405  52.863  38.050 1.00 24.52  ? 21  DC  F C5    1 
ATOM   1165 C C6    . DC  D 2 2   ? -8.584  52.322  37.673 1.00 27.09  ? 21  DC  F C6    1 
ATOM   1166 P P     . DT  D 2 3   ? -14.787 52.022  38.804 1.00 51.58  ? 22  DT  F P     1 
ATOM   1167 O OP1   . DT  D 2 3   ? -16.223 51.681  38.719 1.00 55.30  ? 22  DT  F OP1   1 
ATOM   1168 O OP2   . DT  D 2 3   ? -14.383 53.435  38.954 1.00 47.02  ? 22  DT  F OP2   1 
ATOM   1169 O "O5'" . DT  D 2 3   ? -14.133 51.209  40.007 1.00 56.97  ? 22  DT  F "O5'" 1 
ATOM   1170 C "C5'" . DT  D 2 3   ? -14.310 49.791  40.281 1.00 50.79  ? 22  DT  F "C5'" 1 
ATOM   1171 C "C4'" . DT  D 2 3   ? -13.790 49.439  41.678 1.00 38.11  ? 22  DT  F "C4'" 1 
ATOM   1172 O "O4'" . DT  D 2 3   ? -12.378 49.653  41.787 1.00 32.41  ? 22  DT  F "O4'" 1 
ATOM   1173 C "C3'" . DT  D 2 3   ? -14.457 50.337  42.728 1.00 41.94  ? 22  DT  F "C3'" 1 
ATOM   1174 O "O3'" . DT  D 2 3   ? -14.621 49.598  43.905 1.00 46.56  ? 22  DT  F "O3'" 1 
ATOM   1175 C "C2'" . DT  D 2 3   ? -13.427 51.352  43.018 1.00 35.08  ? 22  DT  F "C2'" 1 
ATOM   1176 C "C1'" . DT  D 2 3   ? -12.182 50.506  42.911 1.00 32.26  ? 22  DT  F "C1'" 1 
ATOM   1177 N N1    . DT  D 2 3   ? -11.078 51.379  42.622 1.00 28.64  ? 22  DT  F N1    1 
ATOM   1178 C C2    . DT  D 2 3   ? -9.960  51.189  43.341 1.00 28.49  ? 22  DT  F C2    1 
ATOM   1179 O O2    . DT  D 2 3   ? -9.876  50.307  44.191 1.00 29.04  ? 22  DT  F O2    1 
ATOM   1180 N N3    . DT  D 2 3   ? -8.918  52.083  43.051 1.00 28.38  ? 22  DT  F N3    1 
ATOM   1181 C C4    . DT  D 2 3   ? -8.908  53.135  42.110 1.00 26.46  ? 22  DT  F C4    1 
ATOM   1182 O O4    . DT  D 2 3   ? -7.920  53.862  41.913 1.00 24.90  ? 22  DT  F O4    1 
ATOM   1183 C C5    . DT  D 2 3   ? -10.142 53.250  41.410 1.00 26.82  ? 22  DT  F C5    1 
ATOM   1184 C C7    . DT  D 2 3   ? -10.270 54.381  40.337 1.00 27.21  ? 22  DT  F C7    1 
ATOM   1185 C C6    . DT  D 2 3   ? -11.172 52.398  41.685 1.00 29.09  ? 22  DT  F C6    1 
ATOM   1186 P P     . DG  D 2 4   ? -15.833 49.927  44.875 1.00 46.86  ? 23  DG  F P     1 
ATOM   1187 O OP1   . DG  D 2 4   ? -16.914 48.916  44.741 1.00 42.48  ? 23  DG  F OP1   1 
ATOM   1188 O OP2   . DG  D 2 4   ? -16.117 51.384  44.777 1.00 43.62  ? 23  DG  F OP2   1 
ATOM   1189 O "O5'" . DG  D 2 4   ? -14.835 49.657  46.121 1.00 44.98  ? 23  DG  F "O5'" 1 
ATOM   1190 C "C5'" . DG  D 2 4   ? -13.843 48.615  46.271 1.00 40.79  ? 23  DG  F "C5'" 1 
ATOM   1191 C "C4'" . DG  D 2 4   ? -12.953 48.857  47.477 1.00 37.71  ? 23  DG  F "C4'" 1 
ATOM   1192 O "O4'" . DG  D 2 4   ? -11.812 49.676  47.181 1.00 37.82  ? 23  DG  F "O4'" 1 
ATOM   1193 C "C3'" . DG  D 2 4   ? -13.691 49.664  48.596 1.00 40.60  ? 23  DG  F "C3'" 1 
ATOM   1194 O "O3'" . DG  D 2 4   ? -13.227 49.290  49.928 1.00 47.66  ? 23  DG  F "O3'" 1 
ATOM   1195 C "C2'" . DG  D 2 4   ? -13.369 51.123  48.289 1.00 30.62  ? 23  DG  F "C2'" 1 
ATOM   1196 C "C1'" . DG  D 2 4   ? -11.959 51.005  47.824 1.00 33.61  ? 23  DG  F "C1'" 1 
ATOM   1197 N N9    . DG  D 2 4   ? -11.650 52.098  46.902 1.00 26.83  ? 23  DG  F N9    1 
ATOM   1198 C C8    . DG  D 2 4   ? -12.455 52.680  45.952 1.00 24.46  ? 23  DG  F C8    1 
ATOM   1199 N N7    . DG  D 2 4   ? -11.857 53.588  45.243 1.00 25.68  ? 23  DG  F N7    1 
ATOM   1200 C C5    . DG  D 2 4   ? -10.574 53.628  45.782 1.00 23.86  ? 23  DG  F C5    1 
ATOM   1201 C C6    . DG  D 2 4   ? -9.489  54.448  45.419 1.00 23.08  ? 23  DG  F C6    1 
ATOM   1202 O O6    . DG  D 2 4   ? -9.441  55.310  44.539 1.00 19.84  ? 23  DG  F O6    1 
ATOM   1203 N N1    . DG  D 2 4   ? -8.378  54.145  46.224 1.00 21.75  ? 23  DG  F N1    1 
ATOM   1204 C C2    . DG  D 2 4   ? -8.341  53.179  47.231 1.00 19.53  ? 23  DG  F C2    1 
ATOM   1205 N N2    . DG  D 2 4   ? -7.198  53.049  47.897 1.00 22.43  ? 23  DG  F N2    1 
ATOM   1206 N N3    . DG  D 2 4   ? -9.353  52.400  47.541 1.00 22.31  ? 23  DG  F N3    1 
ATOM   1207 C C4    . DG  D 2 4   ? -10.439 52.695  46.792 1.00 23.23  ? 23  DG  F C4    1 
ATOM   1208 P P     . DG  D 2 5   ? -13.643 49.780  51.450 1.00 40.90  ? 24  DG  F P     1 
ATOM   1209 O OP1   . DG  D 2 5   ? -13.505 48.621  52.329 1.00 53.99  ? 24  DG  F OP1   1 
ATOM   1210 O OP2   . DG  D 2 5   ? -14.915 50.559  51.457 1.00 41.98  ? 24  DG  F OP2   1 
ATOM   1211 O "O5'" . DG  D 2 5   ? -12.386 50.634  51.787 1.00 36.85  ? 24  DG  F "O5'" 1 
ATOM   1212 C "C5'" . DG  D 2 5   ? -11.115 49.980  51.874 1.00 34.13  ? 24  DG  F "C5'" 1 
ATOM   1213 C "C4'" . DG  D 2 5   ? -10.109 50.935  52.531 1.00 40.51  ? 24  DG  F "C4'" 1 
ATOM   1214 O "O4'" . DG  D 2 5   ? -9.461  51.892  51.627 1.00 43.99  ? 24  DG  F "O4'" 1 
ATOM   1215 C "C3'" . DG  D 2 5   ? -10.748 51.824  53.635 1.00 40.81  ? 24  DG  F "C3'" 1 
ATOM   1216 O "O3'" . DG  D 2 5   ? -9.766  52.083  54.669 1.00 47.12  ? 24  DG  F "O3'" 1 
ATOM   1217 C "C2'" . DG  D 2 5   ? -11.057 53.102  52.895 1.00 34.20  ? 24  DG  F "C2'" 1 
ATOM   1218 C "C1'" . DG  D 2 5   ? -9.857  53.270  51.969 1.00 33.97  ? 24  DG  F "C1'" 1 
ATOM   1219 N N9    . DG  D 2 5   ? -10.320 54.105  50.813 1.00 30.52  ? 24  DG  F N9    1 
ATOM   1220 C C8    . DG  D 2 5   ? -11.596 54.082  50.248 1.00 27.26  ? 24  DG  F C8    1 
ATOM   1221 N N7    . DG  D 2 5   ? -11.723 54.937  49.269 1.00 31.12  ? 24  DG  F N7    1 
ATOM   1222 C C5    . DG  D 2 5   ? -10.456 55.584  49.140 1.00 25.75  ? 24  DG  F C5    1 
ATOM   1223 C C6    . DG  D 2 5   ? -10.047 56.601  48.221 1.00 23.62  ? 24  DG  F C6    1 
ATOM   1224 O O6    . DG  D 2 5   ? -10.725 57.122  47.316 1.00 22.83  ? 24  DG  F O6    1 
ATOM   1225 N N1    . DG  D 2 5   ? -8.727  56.995  48.433 1.00 21.32  ? 24  DG  F N1    1 
ATOM   1226 C C2    . DG  D 2 5   ? -7.883  56.444  49.412 1.00 24.84  ? 24  DG  F C2    1 
ATOM   1227 N N2    . DG  D 2 5   ? -6.598  56.904  49.495 1.00 24.81  ? 24  DG  F N2    1 
ATOM   1228 N N3    . DG  D 2 5   ? -8.289  55.483  50.258 1.00 22.37  ? 24  DG  F N3    1 
ATOM   1229 C C4    . DG  D 2 5   ? -9.577  55.091  50.077 1.00 26.26  ? 24  DG  F C4    1 
ATOM   1230 P P     . DT  D 2 6   ? -9.962  52.950  56.011 1.00 43.86  ? 25  DT  F P     1 
ATOM   1231 O OP1   . DT  D 2 6   ? -8.962  52.391  56.962 1.00 44.22  ? 25  DT  F OP1   1 
ATOM   1232 O OP2   . DT  D 2 6   ? -11.431 53.033  56.313 1.00 37.90  ? 25  DT  F OP2   1 
ATOM   1233 O "O5'" . DT  D 2 6   ? -9.504  54.396  55.576 1.00 42.57  ? 25  DT  F "O5'" 1 
ATOM   1234 C "C5'" . DT  D 2 6   ? -8.090  54.619  55.461 1.00 41.78  ? 25  DT  F "C5'" 1 
ATOM   1235 C "C4'" . DT  D 2 6   ? -7.849  56.061  55.133 1.00 39.27  ? 25  DT  F "C4'" 1 
ATOM   1236 O "O4'" . DT  D 2 6   ? -8.384  56.296  53.813 1.00 37.10  ? 25  DT  F "O4'" 1 
ATOM   1237 C "C3'" . DT  D 2 6   ? -8.607  56.961  56.083 1.00 38.08  ? 25  DT  F "C3'" 1 
ATOM   1238 O "O3'" . DT  D 2 6   ? -7.647  57.936  56.327 1.00 45.80  ? 25  DT  F "O3'" 1 
ATOM   1239 C "C2'" . DT  D 2 6   ? -9.756  57.472  55.227 1.00 31.92  ? 25  DT  F "C2'" 1 
ATOM   1240 C "C1'" . DT  D 2 6   ? -9.112  57.482  53.856 1.00 31.05  ? 25  DT  F "C1'" 1 
ATOM   1241 N N1    . DT  D 2 6   ? -10.093 57.607  52.769 1.00 24.66  ? 25  DT  F N1    1 
ATOM   1242 C C2    . DT  D 2 6   ? -9.708  58.362  51.720 1.00 21.02  ? 25  DT  F C2    1 
ATOM   1243 O O2    . DT  D 2 6   ? -8.609  58.881  51.622 1.00 18.93  ? 25  DT  F O2    1 
ATOM   1244 N N3    . DT  D 2 6   ? -10.629 58.518  50.741 1.00 21.41  ? 25  DT  F N3    1 
ATOM   1245 C C4    . DT  D 2 6   ? -11.911 57.979  50.731 1.00 20.76  ? 25  DT  F C4    1 
ATOM   1246 O O4    . DT  D 2 6   ? -12.716 58.145  49.819 1.00 18.30  ? 25  DT  F O4    1 
ATOM   1247 C C5    . DT  D 2 6   ? -12.216 57.209  51.869 1.00 21.09  ? 25  DT  F C5    1 
ATOM   1248 C C7    . DT  D 2 6   ? -13.613 56.602  51.889 1.00 21.55  ? 25  DT  F C7    1 
ATOM   1249 C C6    . DT  D 2 6   ? -11.341 57.064  52.840 1.00 22.72  ? 25  DT  F C6    1 
ATOM   1250 P P     . DG  D 2 7   ? -7.617  58.738  57.646 1.00 46.69  ? 26  DG  F P     1 
ATOM   1251 O OP1   . DG  D 2 7   ? -7.175  57.893  58.736 1.00 50.07  ? 26  DG  F OP1   1 
ATOM   1252 O OP2   . DG  D 2 7   ? -8.915  59.478  57.752 1.00 49.29  ? 26  DG  F OP2   1 
ATOM   1253 O "O5'" . DG  D 2 7   ? -6.453  59.742  57.335 1.00 43.11  ? 26  DG  F "O5'" 1 
ATOM   1254 C "C5'" . DG  D 2 7   ? -5.283  59.448  56.590 1.00 37.61  ? 26  DG  F "C5'" 1 
ATOM   1255 C "C4'" . DG  D 2 7   ? -4.853  60.673  55.741 1.00 40.57  ? 26  DG  F "C4'" 1 
ATOM   1256 O "O4'" . DG  D 2 7   ? -5.651  60.948  54.544 1.00 36.00  ? 26  DG  F "O4'" 1 
ATOM   1257 C "C3'" . DG  D 2 7   ? -4.944  61.961  56.531 1.00 37.96  ? 26  DG  F "C3'" 1 
ATOM   1258 O "O3'" . DG  D 2 7   ? -3.846  62.802  56.124 1.00 44.48  ? 26  DG  F "O3'" 1 
ATOM   1259 C "C2'" . DG  D 2 7   ? -6.315  62.524  56.101 1.00 36.15  ? 26  DG  F "C2'" 1 
ATOM   1260 C "C1'" . DG  D 2 7   ? -6.354  62.216  54.610 1.00 28.88  ? 26  DG  F "C1'" 1 
ATOM   1261 N N9    . DG  D 2 7   ? -7.728  62.017  54.120 1.00 24.92  ? 26  DG  F N9    1 
ATOM   1262 C C8    . DG  D 2 7   ? -8.700  61.129  54.574 1.00 25.22  ? 26  DG  F C8    1 
ATOM   1263 N N7    . DG  D 2 7   ? -9.856  61.192  53.921 1.00 25.37  ? 26  DG  F N7    1 
ATOM   1264 C C5    . DG  D 2 7   ? -9.597  62.169  52.923 1.00 21.75  ? 26  DG  F C5    1 
ATOM   1265 C C6    . DG  D 2 7   ? -10.448 62.684  51.892 1.00 20.34  ? 26  DG  F C6    1 
ATOM   1266 O O6    . DG  D 2 7   ? -11.621 62.398  51.594 1.00 17.01  ? 26  DG  F O6    1 
ATOM   1267 N N1    . DG  D 2 7   ? -9.798  63.680  51.154 1.00 16.20  ? 26  DG  F N1    1 
ATOM   1268 C C2    . DG  D 2 7   ? -8.512  64.123  51.339 1.00 19.54  ? 26  DG  F C2    1 
ATOM   1269 N N2    . DG  D 2 7   ? -8.069  65.091  50.501 1.00 19.47  ? 26  DG  F N2    1 
ATOM   1270 N N3    . DG  D 2 7   ? -7.710  63.639  52.314 1.00 21.26  ? 26  DG  F N3    1 
ATOM   1271 C C4    . DG  D 2 7   ? -8.311  62.673  53.056 1.00 22.58  ? 26  DG  F C4    1 
ATOM   1272 P P     . DT  D 2 8   ? -3.564  64.117  57.023 1.00 41.06  ? 27  DT  F P     1 
ATOM   1273 O OP1   . DT  D 2 8   ? -2.099  64.258  57.034 1.00 31.49  ? 27  DT  F OP1   1 
ATOM   1274 O OP2   . DT  D 2 8   ? -4.413  64.099  58.259 1.00 44.60  ? 27  DT  F OP2   1 
ATOM   1275 O "O5'" . DT  D 2 8   ? -4.300  65.268  56.203 1.00 41.62  ? 27  DT  F "O5'" 1 
ATOM   1276 C "C5'" . DT  D 2 8   ? -3.953  65.730  54.905 1.00 33.79  ? 27  DT  F "C5'" 1 
ATOM   1277 C "C4'" . DT  D 2 8   ? -4.972  66.710  54.389 1.00 28.89  ? 27  DT  F "C4'" 1 
ATOM   1278 O "O4'" . DT  D 2 8   ? -6.191  66.079  54.139 1.00 27.48  ? 27  DT  F "O4'" 1 
ATOM   1279 C "C3'" . DT  D 2 8   ? -5.342  67.796  55.360 1.00 27.35  ? 27  DT  F "C3'" 1 
ATOM   1280 O "O3'" . DT  D 2 8   ? -4.913  68.998  54.736 1.00 35.42  ? 27  DT  F "O3'" 1 
ATOM   1281 C "C2'" . DT  D 2 8   ? -6.831  67.712  55.416 1.00 26.52  ? 27  DT  F "C2'" 1 
ATOM   1282 C "C1'" . DT  D 2 8   ? -7.223  67.057  54.186 1.00 17.40  ? 27  DT  F "C1'" 1 
ATOM   1283 N N1    . DT  D 2 8   ? -8.470  66.321  54.340 1.00 16.29  ? 27  DT  F N1    1 
ATOM   1284 C C2    . DT  D 2 8   ? -9.472  66.602  53.469 1.00 17.83  ? 27  DT  F C2    1 
ATOM   1285 O O2    . DT  D 2 8   ? -9.369  67.450  52.584 1.00 19.20  ? 27  DT  F O2    1 
ATOM   1286 N N3    . DT  D 2 8   ? -10.668 65.897  53.618 1.00 17.44  ? 27  DT  F N3    1 
ATOM   1287 C C4    . DT  D 2 8   ? -10.950 64.933  54.561 1.00 18.58  ? 27  DT  F C4    1 
ATOM   1288 O O4    . DT  D 2 8   ? -12.082 64.387  54.554 1.00 21.19  ? 27  DT  F O4    1 
ATOM   1289 C C5    . DT  D 2 8   ? -9.812  64.712  55.423 1.00 17.98  ? 27  DT  F C5    1 
ATOM   1290 C C7    . DT  D 2 8   ? -9.904  63.674  56.545 1.00 24.93  ? 27  DT  F C7    1 
ATOM   1291 C C6    . DT  D 2 8   ? -8.644  65.372  55.298 1.00 16.03  ? 27  DT  F C6    1 
ATOM   1292 P P     . DG  D 2 9   ? -4.249  70.271  55.489 1.00 35.43  ? 28  DG  F P     1 
ATOM   1293 O OP1   . DG  D 2 9   ? -3.146  70.662  54.580 1.00 32.06  ? 28  DG  F OP1   1 
ATOM   1294 O OP2   . DG  D 2 9   ? -4.062  70.007  56.949 1.00 31.27  ? 28  DG  F OP2   1 
ATOM   1295 O "O5'" . DG  D 2 9   ? -5.477  71.298  55.528 1.00 32.33  ? 28  DG  F "O5'" 1 
ATOM   1296 C "C5'" . DG  D 2 9   ? -5.813  71.941  54.347 1.00 23.31  ? 28  DG  F "C5'" 1 
ATOM   1297 C "C4'" . DG  D 2 9   ? -7.172  72.449  54.459 1.00 17.93  ? 28  DG  F "C4'" 1 
ATOM   1298 O "O4'" . DG  D 2 9   ? -8.073  71.346  54.580 1.00 21.65  ? 28  DG  F "O4'" 1 
ATOM   1299 C "C3'" . DG  D 2 9   ? -7.334  73.324  55.638 1.00 15.71  ? 28  DG  F "C3'" 1 
ATOM   1300 O "O3'" . DG  D 2 9   ? -8.362  74.208  55.279 1.00 22.32  ? 28  DG  F "O3'" 1 
ATOM   1301 C "C2'" . DG  D 2 9   ? -8.035  72.401  56.548 1.00 9.94   ? 28  DG  F "C2'" 1 
ATOM   1302 C "C1'" . DG  D 2 9   ? -8.942  71.646  55.627 1.00 15.27  ? 28  DG  F "C1'" 1 
ATOM   1303 N N9    . DG  D 2 9   ? -9.441  70.402  56.216 1.00 10.22  ? 28  DG  F N9    1 
ATOM   1304 C C8    . DG  D 2 9   ? -8.962  69.673  57.252 1.00 9.36   ? 28  DG  F C8    1 
ATOM   1305 N N7    . DG  D 2 9   ? -9.699  68.617  57.508 1.00 14.07  ? 28  DG  F N7    1 
ATOM   1306 C C5    . DG  D 2 9   ? -10.743 68.682  56.598 1.00 10.45  ? 28  DG  F C5    1 
ATOM   1307 C C6    . DG  D 2 9   ? -11.863 67.835  56.391 1.00 15.71  ? 28  DG  F C6    1 
ATOM   1308 O O6    . DG  D 2 9   ? -12.165 66.796  56.993 1.00 21.17  ? 28  DG  F O6    1 
ATOM   1309 N N1    . DG  D 2 9   ? -12.683 68.284  55.346 1.00 11.55  ? 28  DG  F N1    1 
ATOM   1310 C C2    . DG  D 2 9   ? -12.392 69.374  54.623 1.00 9.21   ? 28  DG  F C2    1 
ATOM   1311 N N2    . DG  D 2 9   ? -13.249 69.699  53.661 1.00 18.51  ? 28  DG  F N2    1 
ATOM   1312 N N3    . DG  D 2 9   ? -11.340 70.150  54.806 1.00 9.55   ? 28  DG  F N3    1 
ATOM   1313 C C4    . DG  D 2 9   ? -10.559 69.758  55.795 1.00 10.60  ? 28  DG  F C4    1 
ATOM   1314 P P     . DT  D 2 10  ? -8.198  75.721  54.811 1.00 16.86  ? 29  DT  F P     1 
ATOM   1315 O OP1   . DT  D 2 10  ? -6.849  75.988  54.285 1.00 20.20  ? 29  DT  F OP1   1 
ATOM   1316 O OP2   . DT  D 2 10  ? -8.752  76.581  55.867 1.00 16.05  ? 29  DT  F OP2   1 
ATOM   1317 O "O5'" . DT  D 2 10  ? -9.285  75.810  53.671 1.00 19.45  ? 29  DT  F "O5'" 1 
ATOM   1318 C "C5'" . DT  D 2 10  ? -9.340  75.059  52.469 1.00 8.85   ? 29  DT  F "C5'" 1 
ATOM   1319 C "C4'" . DT  D 2 10  ? -10.800 74.929  52.030 1.00 11.07  ? 29  DT  F "C4'" 1 
ATOM   1320 O "O4'" . DT  D 2 10  ? -11.411 74.096  52.982 1.00 15.26  ? 29  DT  F "O4'" 1 
ATOM   1321 C "C3'" . DT  D 2 10  ? -11.640 76.241  52.144 1.00 14.45  ? 29  DT  F "C3'" 1 
ATOM   1322 O "O3'" . DT  D 2 10  ? -12.648 76.232  51.143 1.00 19.72  ? 29  DT  F "O3'" 1 
ATOM   1323 C "C2'" . DT  D 2 10  ? -12.404 76.090  53.459 1.00 17.59  ? 29  DT  F "C2'" 1 
ATOM   1324 C "C1'" . DT  D 2 10  ? -12.717 74.622  53.465 1.00 14.28  ? 29  DT  F "C1'" 1 
ATOM   1325 N N1    . DT  D 2 10  ? -12.804 73.893  54.712 1.00 16.30  ? 29  DT  F N1    1 
ATOM   1326 C C2    . DT  D 2 10  ? -13.742 72.936  54.820 1.00 17.32  ? 29  DT  F C2    1 
ATOM   1327 O O2    . DT  D 2 10  ? -14.601 72.674  53.976 1.00 17.49  ? 29  DT  F O2    1 
ATOM   1328 N N3    . DT  D 2 10  ? -13.666 72.251  56.022 1.00 21.37  ? 29  DT  F N3    1 
ATOM   1329 C C4    . DT  D 2 10  ? -12.740 72.433  57.084 1.00 19.24  ? 29  DT  F C4    1 
ATOM   1330 O O4    . DT  D 2 10  ? -12.742 71.752  58.109 1.00 19.56  ? 29  DT  F O4    1 
ATOM   1331 C C5    . DT  D 2 10  ? -11.827 73.461  56.845 1.00 17.35  ? 29  DT  F C5    1 
ATOM   1332 C C7    . DT  D 2 10  ? -10.813 73.770  57.930 1.00 16.68  ? 29  DT  F C7    1 
ATOM   1333 C C6    . DT  D 2 10  ? -11.871 74.133  55.682 1.00 17.68  ? 29  DT  F C6    1 
ATOM   1334 P P     . DG  D 2 11  ? -13.421 77.491  50.699 1.00 16.70  ? 30  DG  F P     1 
ATOM   1335 O OP1   . DG  D 2 11  ? -13.497 77.319  49.233 1.00 24.43  ? 30  DG  F OP1   1 
ATOM   1336 O OP2   . DG  D 2 11  ? -12.762 78.692  51.225 1.00 20.05  ? 30  DG  F OP2   1 
ATOM   1337 O "O5'" . DG  D 2 11  ? -14.798 77.331  51.385 1.00 21.38  ? 30  DG  F "O5'" 1 
ATOM   1338 C "C5'" . DG  D 2 11  ? -15.696 76.353  50.875 1.00 19.09  ? 30  DG  F "C5'" 1 
ATOM   1339 C "C4'" . DG  D 2 11  ? -17.005 76.395  51.586 1.00 18.28  ? 30  DG  F "C4'" 1 
ATOM   1340 O "O4'" . DG  D 2 11  ? -16.770 75.831  52.877 1.00 24.29  ? 30  DG  F "O4'" 1 
ATOM   1341 C "C3'" . DG  D 2 11  ? -17.424 77.774  51.911 1.00 21.46  ? 30  DG  F "C3'" 1 
ATOM   1342 O "O3'" . DG  D 2 11  ? -18.793 77.864  51.624 1.00 22.81  ? 30  DG  F "O3'" 1 
ATOM   1343 C "C2'" . DG  D 2 11  ? -17.043 77.994  53.353 1.00 22.72  ? 30  DG  F "C2'" 1 
ATOM   1344 C "C1'" . DG  D 2 11  ? -17.199 76.674  53.953 1.00 18.31  ? 30  DG  F "C1'" 1 
ATOM   1345 N N9    . DG  D 2 11  ? -16.249 76.471  55.023 1.00 18.51  ? 30  DG  F N9    1 
ATOM   1346 C C8    . DG  D 2 11  ? -15.061 77.073  55.364 1.00 18.37  ? 30  DG  F C8    1 
ATOM   1347 N N7    . DG  D 2 11  ? -14.479 76.504  56.428 1.00 18.82  ? 30  DG  F N7    1 
ATOM   1348 C C5    . DG  D 2 11  ? -15.406 75.489  56.786 1.00 14.47  ? 30  DG  F C5    1 
ATOM   1349 C C6    . DG  D 2 11  ? -15.422 74.536  57.842 1.00 11.86  ? 30  DG  F C6    1 
ATOM   1350 O O6    . DG  D 2 11  ? -14.584 74.370  58.729 1.00 17.36  ? 30  DG  F O6    1 
ATOM   1351 N N1    . DG  D 2 11  ? -16.510 73.701  57.833 1.00 8.36   ? 30  DG  F N1    1 
ATOM   1352 C C2    . DG  D 2 11  ? -17.528 73.759  56.914 1.00 10.23  ? 30  DG  F C2    1 
ATOM   1353 N N2    . DG  D 2 11  ? -18.568 72.897  56.976 1.00 13.43  ? 30  DG  F N2    1 
ATOM   1354 N N3    . DG  D 2 11  ? -17.508 74.672  55.954 1.00 14.73  ? 30  DG  F N3    1 
ATOM   1355 C C4    . DG  D 2 11  ? -16.436 75.472  55.918 1.00 14.47  ? 30  DG  F C4    1 
ATOM   1356 P P     . DG  D 2 12  ? -19.641 79.149  51.680 1.00 21.40  ? 31  DG  F P     1 
ATOM   1357 O OP1   . DG  D 2 12  ? -20.637 79.046  50.607 1.00 21.54  ? 31  DG  F OP1   1 
ATOM   1358 O OP2   . DG  D 2 12  ? -18.847 80.350  51.894 1.00 21.56  ? 31  DG  F OP2   1 
ATOM   1359 O "O5'" . DG  D 2 12  ? -20.321 78.814  53.076 1.00 32.95  ? 31  DG  F "O5'" 1 
ATOM   1360 C "C5'" . DG  D 2 12  ? -21.398 77.906  53.322 1.00 28.07  ? 31  DG  F "C5'" 1 
ATOM   1361 C "C4'" . DG  D 2 12  ? -21.801 77.939  54.757 1.00 22.34  ? 31  DG  F "C4'" 1 
ATOM   1362 O "O4'" . DG  D 2 12  ? -20.598 77.561  55.422 1.00 24.69  ? 31  DG  F "O4'" 1 
ATOM   1363 C "C3'" . DG  D 2 12  ? -22.098 79.315  55.285 1.00 23.51  ? 31  DG  F "C3'" 1 
ATOM   1364 O "O3'" . DG  D 2 12  ? -23.271 79.151  56.058 1.00 27.67  ? 31  DG  F "O3'" 1 
ATOM   1365 C "C2'" . DG  D 2 12  ? -20.853 79.614  56.093 1.00 12.44  ? 31  DG  F "C2'" 1 
ATOM   1366 C "C1'" . DG  D 2 12  ? -20.572 78.274  56.647 1.00 16.63  ? 31  DG  F "C1'" 1 
ATOM   1367 N N9    . DG  D 2 12  ? -19.257 78.218  57.287 1.00 15.16  ? 31  DG  F N9    1 
ATOM   1368 C C8    . DG  D 2 12  ? -18.164 79.060  57.080 1.00 17.45  ? 31  DG  F C8    1 
ATOM   1369 N N7    . DG  D 2 12  ? -17.119 78.716  57.819 1.00 17.24  ? 31  DG  F N7    1 
ATOM   1370 C C5    . DG  D 2 12  ? -17.584 77.631  58.589 1.00 13.18  ? 31  DG  F C5    1 
ATOM   1371 C C6    . DG  D 2 12  ? -16.918 76.900  59.574 1.00 15.33  ? 31  DG  F C6    1 
ATOM   1372 O O6    . DG  D 2 12  ? -15.749 77.085  59.945 1.00 16.30  ? 31  DG  F O6    1 
ATOM   1373 N N1    . DG  D 2 12  ? -17.700 75.853  60.107 1.00 17.36  ? 31  DG  F N1    1 
ATOM   1374 C C2    . DG  D 2 12  ? -19.000 75.567  59.743 1.00 14.57  ? 31  DG  F C2    1 
ATOM   1375 N N2    . DG  D 2 12  ? -19.614 74.555  60.374 1.00 15.96  ? 31  DG  F N2    1 
ATOM   1376 N N3    . DG  D 2 12  ? -19.610 76.271  58.823 1.00 14.89  ? 31  DG  F N3    1 
ATOM   1377 C C4    . DG  D 2 12  ? -18.861 77.296  58.269 1.00 14.21  ? 31  DG  F C4    1 
ATOM   1378 P P     . DG  D 2 13  ? -24.052 80.420  56.604 1.00 33.30  ? 32  DG  F P     1 
ATOM   1379 O OP1   . DG  D 2 13  ? -25.362 79.895  56.973 1.00 33.17  ? 32  DG  F OP1   1 
ATOM   1380 O OP2   . DG  D 2 13  ? -23.941 81.582  55.668 1.00 34.68  ? 32  DG  F OP2   1 
ATOM   1381 O "O5'" . DG  D 2 13  ? -23.154 80.836  57.894 1.00 28.15  ? 32  DG  F "O5'" 1 
ATOM   1382 C "C5'" . DG  D 2 13  ? -23.544 80.695  59.235 1.00 25.60  ? 32  DG  F "C5'" 1 
ATOM   1383 C "C4'" . DG  D 2 13  ? -23.166 79.371  59.744 1.00 26.58  ? 32  DG  F "C4'" 1 
ATOM   1384 O "O4'" . DG  D 2 13  ? -21.792 79.378  59.527 1.00 27.82  ? 32  DG  F "O4'" 1 
ATOM   1385 C "C3'" . DG  D 2 13  ? -23.320 79.307  61.242 1.00 26.60  ? 32  DG  F "C3'" 1 
ATOM   1386 O "O3'" . DG  D 2 13  ? -24.699 79.015  61.426 1.00 36.90  ? 32  DG  F "O3'" 1 
ATOM   1387 C "C2'" . DG  D 2 13  ? -22.394 78.152  61.464 1.00 26.04  ? 32  DG  F "C2'" 1 
ATOM   1388 C "C1'" . DG  D 2 13  ? -21.316 78.538  60.556 1.00 22.47  ? 32  DG  F "C1'" 1 
ATOM   1389 N N9    . DG  D 2 13  ? -19.985 79.007  60.925 1.00 21.66  ? 32  DG  F N9    1 
ATOM   1390 C C8    . DG  D 2 13  ? -19.236 79.975  60.311 1.00 16.53  ? 32  DG  F C8    1 
ATOM   1391 N N7    . DG  D 2 13  ? -18.038 80.105  60.801 1.00 18.93  ? 32  DG  F N7    1 
ATOM   1392 C C5    . DG  D 2 13  ? -17.985 79.158  61.834 1.00 16.77  ? 32  DG  F C5    1 
ATOM   1393 C C6    . DG  D 2 13  ? -16.948 78.855  62.728 1.00 17.45  ? 32  DG  F C6    1 
ATOM   1394 O O6    . DG  D 2 13  ? -15.795 79.352  62.807 1.00 16.01  ? 32  DG  F O6    1 
ATOM   1395 N N1    . DG  D 2 13  ? -17.352 77.818  63.594 1.00 18.42  ? 32  DG  F N1    1 
ATOM   1396 C C2    . DG  D 2 13  ? -18.559 77.167  63.611 1.00 17.01  ? 32  DG  F C2    1 
ATOM   1397 N N2    . DG  D 2 13  ? -18.727 76.190  64.528 1.00 17.75  ? 32  DG  F N2    1 
ATOM   1398 N N3    . DG  D 2 13  ? -19.539 77.477  62.769 1.00 19.75  ? 32  DG  F N3    1 
ATOM   1399 C C4    . DG  D 2 13  ? -19.168 78.464  61.899 1.00 20.52  ? 32  DG  F C4    1 
ATOM   1400 P P     . DT  D 2 14  ? -25.705 79.585  62.558 1.00 35.50  ? 33  DT  F P     1 
ATOM   1401 O OP1   . DT  D 2 14  ? -27.132 79.181  62.301 1.00 40.42  ? 33  DT  F OP1   1 
ATOM   1402 O OP2   . DT  D 2 14  ? -25.345 80.994  62.798 1.00 26.15  ? 33  DT  F OP2   1 
ATOM   1403 O "O5'" . DT  D 2 14  ? -25.100 78.668  63.699 1.00 31.90  ? 33  DT  F "O5'" 1 
ATOM   1404 C "C5'" . DT  D 2 14  ? -25.249 77.246  63.672 1.00 27.09  ? 33  DT  F "C5'" 1 
ATOM   1405 C "C4'" . DT  D 2 14  ? -24.647 76.607  64.887 1.00 23.59  ? 33  DT  F "C4'" 1 
ATOM   1406 O "O4'" . DT  D 2 14  ? -23.261 76.932  65.009 1.00 26.62  ? 33  DT  F "O4'" 1 
ATOM   1407 C "C3'" . DT  D 2 14  ? -25.132 77.213  66.147 1.00 27.77  ? 33  DT  F "C3'" 1 
ATOM   1408 O "O3'" . DT  D 2 14  ? -25.141 76.174  67.145 1.00 36.71  ? 33  DT  F "O3'" 1 
ATOM   1409 C "C2'" . DT  D 2 14  ? -24.110 78.298  66.432 1.00 20.40  ? 33  DT  F "C2'" 1 
ATOM   1410 C "C1'" . DT  D 2 14  ? -22.839 77.621  66.197 1.00 17.97  ? 33  DT  F "C1'" 1 
ATOM   1411 N N1    . DT  D 2 14  ? -21.727 78.539  65.864 1.00 20.13  ? 33  DT  F N1    1 
ATOM   1412 C C2    . DT  D 2 14  ? -20.494 78.374  66.454 1.00 19.82  ? 33  DT  F C2    1 
ATOM   1413 O O2    . DT  D 2 14  ? -20.241 77.504  67.273 1.00 26.42  ? 33  DT  F O2    1 
ATOM   1414 N N3    . DT  D 2 14  ? -19.496 79.237  66.057 1.00 17.41  ? 33  DT  F N3    1 
ATOM   1415 C C4    . DT  D 2 14  ? -19.608 80.273  65.118 1.00 19.03  ? 33  DT  F C4    1 
ATOM   1416 O O4    . DT  D 2 14  ? -18.619 81.010  64.840 1.00 20.48  ? 33  DT  F O4    1 
ATOM   1417 C C5    . DT  D 2 14  ? -20.917 80.365  64.556 1.00 14.98  ? 33  DT  F C5    1 
ATOM   1418 C C7    . DT  D 2 14  ? -21.192 81.432  63.517 1.00 21.28  ? 33  DT  F C7    1 
ATOM   1419 C C6    . DT  D 2 14  ? -21.906 79.525  64.910 1.00 18.57  ? 33  DT  F C6    1 
ATOM   1420 P P     . DG  D 2 15  ? -25.611 76.308  68.719 1.00 33.96  ? 34  DG  F P     1 
ATOM   1421 O OP1   . DG  D 2 15  ? -26.328 75.057  69.114 1.00 32.39  ? 34  DG  F OP1   1 
ATOM   1422 O OP2   . DG  D 2 15  ? -26.264 77.654  68.825 1.00 33.28  ? 34  DG  F OP2   1 
ATOM   1423 O "O5'" . DG  D 2 15  ? -24.269 76.417  69.496 1.00 26.28  ? 34  DG  F "O5'" 1 
ATOM   1424 C "C5'" . DG  D 2 15  ? -23.436 75.289  69.677 1.00 21.78  ? 34  DG  F "C5'" 1 
ATOM   1425 C "C4'" . DG  D 2 15  ? -22.328 75.547  70.717 1.00 23.72  ? 34  DG  F "C4'" 1 
ATOM   1426 O "O4'" . DG  D 2 15  ? -21.303 76.458  70.369 1.00 27.70  ? 34  DG  F "O4'" 1 
ATOM   1427 C "C3'" . DG  D 2 15  ? -22.868 76.153  71.985 1.00 29.68  ? 34  DG  F "C3'" 1 
ATOM   1428 O "O3'" . DG  D 2 15  ? -22.091 75.531  72.989 1.00 37.51  ? 34  DG  F "O3'" 1 
ATOM   1429 C "C2'" . DG  D 2 15  ? -22.563 77.611  71.822 1.00 26.67  ? 34  DG  F "C2'" 1 
ATOM   1430 C "C1'" . DG  D 2 15  ? -21.186 77.569  71.252 1.00 25.29  ? 34  DG  F "C1'" 1 
ATOM   1431 N N9    . DG  D 2 15  ? -20.959 78.752  70.446 1.00 16.54  ? 34  DG  F N9    1 
ATOM   1432 C C8    . DG  D 2 15  ? -21.799 79.287  69.535 1.00 16.40  ? 34  DG  F C8    1 
ATOM   1433 N N7    . DG  D 2 15  ? -21.367 80.386  68.994 1.00 15.77  ? 34  DG  F N7    1 
ATOM   1434 C C5    . DG  D 2 15  ? -20.109 80.536  69.579 1.00 16.52  ? 34  DG  F C5    1 
ATOM   1435 C C6    . DG  D 2 15  ? -19.094 81.524  69.353 1.00 17.32  ? 34  DG  F C6    1 
ATOM   1436 O O6    . DG  D 2 15  ? -19.114 82.475  68.557 1.00 18.94  ? 34  DG  F O6    1 
ATOM   1437 N N1    . DG  D 2 15  ? -17.964 81.344  70.190 1.00 18.62  ? 34  DG  F N1    1 
ATOM   1438 C C2    . DG  D 2 15  ? -17.784 80.322  71.103 1.00 15.74  ? 34  DG  F C2    1 
ATOM   1439 N N2    . DG  D 2 15  ? -16.613 80.337  71.809 1.00 16.36  ? 34  DG  F N2    1 
ATOM   1440 N N3    . DG  D 2 15  ? -18.744 79.375  71.263 1.00 16.82  ? 34  DG  F N3    1 
ATOM   1441 C C4    . DG  D 2 15  ? -19.876 79.544  70.500 1.00 16.20  ? 34  DG  F C4    1 
ATOM   1442 P P     . DT  D 2 16  ? -22.216 75.837  74.544 1.00 39.47  ? 35  DT  F P     1 
ATOM   1443 O OP1   . DT  D 2 16  ? -21.878 74.605  75.281 1.00 39.92  ? 35  DT  F OP1   1 
ATOM   1444 O OP2   . DT  D 2 16  ? -23.500 76.550  74.817 1.00 40.96  ? 35  DT  F OP2   1 
ATOM   1445 O "O5'" . DT  D 2 16  ? -20.969 76.865  74.576 1.00 40.65  ? 35  DT  F "O5'" 1 
ATOM   1446 C "C5'" . DT  D 2 16  ? -19.591 76.520  74.763 1.00 34.64  ? 35  DT  F "C5'" 1 
ATOM   1447 C "C4'" . DT  D 2 16  ? -18.881 77.739  75.364 1.00 37.46  ? 35  DT  F "C4'" 1 
ATOM   1448 O "O4'" . DT  D 2 16  ? -18.862 78.866  74.507 1.00 27.40  ? 35  DT  F "O4'" 1 
ATOM   1449 C "C3'" . DT  D 2 16  ? -19.562 78.210  76.671 1.00 35.01  ? 35  DT  F "C3'" 1 
ATOM   1450 O "O3'" . DT  D 2 16  ? -18.482 78.100  77.593 1.00 46.09  ? 35  DT  F "O3'" 1 
ATOM   1451 C "C2'" . DT  D 2 16  ? -20.001 79.628  76.426 1.00 25.12  ? 35  DT  F "C2'" 1 
ATOM   1452 C "C1'" . DT  D 2 16  ? -19.016 80.028  75.330 1.00 28.22  ? 35  DT  F "C1'" 1 
ATOM   1453 N N1    . DT  D 2 16  ? -19.528 80.997  74.358 1.00 18.79  ? 35  DT  F N1    1 
ATOM   1454 C C2    . DT  D 2 16  ? -18.734 82.048  74.017 1.00 19.59  ? 35  DT  F C2    1 
ATOM   1455 O O2    . DT  D 2 16  ? -17.605 82.241  74.506 1.00 21.75  ? 35  DT  F O2    1 
ATOM   1456 N N3    . DT  D 2 16  ? -19.283 82.899  73.051 1.00 19.41  ? 35  DT  F N3    1 
ATOM   1457 C C4    . DT  D 2 16  ? -20.534 82.740  72.447 1.00 15.07  ? 35  DT  F C4    1 
ATOM   1458 O O4    . DT  D 2 16  ? -20.905 83.565  71.598 1.00 21.15  ? 35  DT  F O4    1 
ATOM   1459 C C5    . DT  D 2 16  ? -21.247 81.588  72.911 1.00 14.40  ? 35  DT  F C5    1 
ATOM   1460 C C7    . DT  D 2 16  ? -22.616 81.198  72.414 1.00 16.83  ? 35  DT  F C7    1 
ATOM   1461 C C6    . DT  D 2 16  ? -20.728 80.774  73.808 1.00 15.29  ? 35  DT  F C6    1 
ATOM   1462 P P     . DG  D 2 17  ? -18.600 78.298  79.169 1.00 46.44  ? 36  DG  F P     1 
ATOM   1463 O OP1   . DG  D 2 17  ? -17.650 77.339  79.803 1.00 42.80  ? 36  DG  F OP1   1 
ATOM   1464 O OP2   . DG  D 2 17  ? -20.070 78.326  79.452 1.00 39.17  ? 36  DG  F OP2   1 
ATOM   1465 O "O5'" . DG  D 2 17  ? -18.047 79.755  79.368 1.00 42.67  ? 36  DG  F "O5'" 1 
ATOM   1466 C "C5'" . DG  D 2 17  ? -16.670 80.084  79.195 1.00 46.01  ? 36  DG  F "C5'" 1 
ATOM   1467 C "C4'" . DG  D 2 17  ? -16.503 81.590  79.210 1.00 46.20  ? 36  DG  F "C4'" 1 
ATOM   1468 O "O4'" . DG  D 2 17  ? -17.002 82.243  77.991 1.00 45.64  ? 36  DG  F "O4'" 1 
ATOM   1469 C "C3'" . DG  D 2 17  ? -17.367 82.130  80.392 1.00 47.51  ? 36  DG  F "C3'" 1 
ATOM   1470 O "O3'" . DG  D 2 17  ? -16.826 83.329  80.931 1.00 53.12  ? 36  DG  F "O3'" 1 
ATOM   1471 C "C2'" . DG  D 2 17  ? -18.628 82.547  79.685 1.00 42.23  ? 36  DG  F "C2'" 1 
ATOM   1472 C "C1'" . DG  D 2 17  ? -18.016 83.167  78.458 1.00 40.36  ? 36  DG  F "C1'" 1 
ATOM   1473 N N9    . DG  D 2 17  ? -19.086 83.514  77.524 1.00 35.33  ? 36  DG  F N9    1 
ATOM   1474 C C8    . DG  D 2 17  ? -20.341 82.957  77.384 1.00 34.83  ? 36  DG  F C8    1 
ATOM   1475 N N7    . DG  D 2 17  ? -21.083 83.538  76.462 1.00 35.70  ? 36  DG  F N7    1 
ATOM   1476 C C5    . DG  D 2 17  ? -20.256 84.550  75.946 1.00 31.23  ? 36  DG  F C5    1 
ATOM   1477 C C6    . DG  D 2 17  ? -20.507 85.492  74.907 1.00 29.55  ? 36  DG  F C6    1 
ATOM   1478 O O6    . DG  D 2 17  ? -21.528 85.578  74.207 1.00 28.57  ? 36  DG  F O6    1 
ATOM   1479 N N1    . DG  D 2 17  ? -19.400 86.381  74.732 1.00 26.74  ? 36  DG  F N1    1 
ATOM   1480 C C2    . DG  D 2 17  ? -18.200 86.329  75.442 1.00 26.03  ? 36  DG  F C2    1 
ATOM   1481 N N2    . DG  D 2 17  ? -17.245 87.228  75.155 1.00 22.21  ? 36  DG  F N2    1 
ATOM   1482 N N3    . DG  D 2 17  ? -17.977 85.400  76.385 1.00 30.56  ? 36  DG  F N3    1 
ATOM   1483 C C4    . DG  D 2 17  ? -19.035 84.548  76.596 1.00 32.66  ? 36  DG  F C4    1 
ATOM   1484 P P     . DC  D 2 18  ? -15.883 83.382  82.233 1.00 59.47  ? 37  DC  F P     1 
ATOM   1485 O OP1   . DC  D 2 18  ? -14.834 82.318  82.165 1.00 57.96  ? 37  DC  F OP1   1 
ATOM   1486 O OP2   . DC  D 2 18  ? -16.780 83.565  83.406 1.00 56.46  ? 37  DC  F OP2   1 
ATOM   1487 O "O5'" . DC  D 2 18  ? -15.179 84.761  81.973 1.00 54.60  ? 37  DC  F "O5'" 1 
ATOM   1488 C "C5'" . DC  D 2 18  ? -14.105 84.867  81.051 1.00 50.23  ? 37  DC  F "C5'" 1 
ATOM   1489 C "C4'" . DC  D 2 18  ? -13.997 86.303  80.607 1.00 47.91  ? 37  DC  F "C4'" 1 
ATOM   1490 O "O4'" . DC  D 2 18  ? -15.033 86.546  79.666 1.00 43.76  ? 37  DC  F "O4'" 1 
ATOM   1491 C "C3'" . DC  D 2 18  ? -14.256 87.336  81.723 1.00 50.26  ? 37  DC  F "C3'" 1 
ATOM   1492 O "O3'" . DC  D 2 18  ? -13.391 88.371  81.291 1.00 62.10  ? 37  DC  F "O3'" 1 
ATOM   1493 C "C2'" . DC  D 2 18  ? -15.738 87.674  81.589 1.00 37.73  ? 37  DC  F "C2'" 1 
ATOM   1494 C "C1'" . DC  D 2 18  ? -15.921 87.607  80.097 1.00 33.98  ? 37  DC  F "C1'" 1 
ATOM   1495 N N1    . DC  D 2 18  ? -17.314 87.375  79.618 1.00 21.58  ? 37  DC  F N1    1 
ATOM   1496 C C2    . DC  D 2 18  ? -17.844 88.174  78.616 1.00 20.04  ? 37  DC  F C2    1 
ATOM   1497 O O2    . DC  D 2 18  ? -17.261 89.118  78.031 1.00 22.40  ? 37  DC  F O2    1 
ATOM   1498 N N3    . DC  D 2 18  ? -19.115 87.914  78.262 1.00 20.30  ? 37  DC  F N3    1 
ATOM   1499 C C4    . DC  D 2 18  ? -19.869 86.952  78.820 1.00 20.33  ? 37  DC  F C4    1 
ATOM   1500 N N4    . DC  D 2 18  ? -21.142 86.742  78.404 1.00 22.72  ? 37  DC  F N4    1 
ATOM   1501 C C5    . DC  D 2 18  ? -19.326 86.149  79.840 1.00 21.71  ? 37  DC  F C5    1 
ATOM   1502 C C6    . DC  D 2 18  ? -18.048 86.405  80.200 1.00 22.35  ? 37  DC  F C6    1 
ATOM   1503 P P     . DG  D 2 19  ? -12.805 89.601  82.127 1.00 68.98  ? 38  DG  F P     1 
ATOM   1504 O OP1   . DG  D 2 19  ? -11.540 89.136  82.774 1.00 61.86  ? 38  DG  F OP1   1 
ATOM   1505 O OP2   . DG  D 2 19  ? -13.949 90.230  82.897 1.00 58.55  ? 38  DG  F OP2   1 
ATOM   1506 O "O5'" . DG  D 2 19  ? -12.390 90.477  80.781 1.00 69.55  ? 38  DG  F "O5'" 1 
ATOM   1507 C "C5'" . DG  D 2 19  ? -13.386 90.731  79.739 1.00 67.14  ? 38  DG  F "C5'" 1 
ATOM   1508 C "C4'" . DG  D 2 19  ? -13.676 92.220  79.349 1.00 67.14  ? 38  DG  F "C4'" 1 
ATOM   1509 O "O4'" . DG  D 2 19  ? -15.112 92.410  79.096 1.00 63.47  ? 38  DG  F "O4'" 1 
ATOM   1510 C "C3'" . DG  D 2 19  ? -13.320 93.296  80.432 1.00 67.55  ? 38  DG  F "C3'" 1 
ATOM   1511 O "O3'" . DG  D 2 19  ? -12.722 94.515  79.873 1.00 66.80  ? 38  DG  F "O3'" 1 
ATOM   1512 C "C2'" . DG  D 2 19  ? -14.679 93.449  81.208 1.00 61.44  ? 38  DG  F "C2'" 1 
ATOM   1513 C "C1'" . DG  D 2 19  ? -15.854 93.092  80.212 1.00 49.89  ? 38  DG  F "C1'" 1 
ATOM   1514 N N9    . DG  D 2 19  ? -16.970 92.143  80.619 1.00 38.05  ? 38  DG  F N9    1 
ATOM   1515 C C8    . DG  D 2 19  ? -16.912 91.160  81.585 1.00 35.12  ? 38  DG  F C8    1 
ATOM   1516 N N7    . DG  D 2 19  ? -18.013 90.427  81.657 1.00 32.91  ? 38  DG  F N7    1 
ATOM   1517 C C5    . DG  D 2 19  ? -18.886 90.921  80.665 1.00 28.76  ? 38  DG  F C5    1 
ATOM   1518 C C6    . DG  D 2 19  ? -20.237 90.510  80.272 1.00 27.46  ? 38  DG  F C6    1 
ATOM   1519 O O6    . DG  D 2 19  ? -20.985 89.615  80.693 1.00 22.97  ? 38  DG  F O6    1 
ATOM   1520 N N1    . DG  D 2 19  ? -20.733 91.282  79.230 1.00 25.36  ? 38  DG  F N1    1 
ATOM   1521 C C2    . DG  D 2 19  ? -20.018 92.316  78.637 1.00 28.37  ? 38  DG  F C2    1 
ATOM   1522 N N2    . DG  D 2 19  ? -20.600 93.003  77.633 1.00 30.66  ? 38  DG  F N2    1 
ATOM   1523 N N3    . DG  D 2 19  ? -18.762 92.683  78.994 1.00 30.87  ? 38  DG  F N3    1 
ATOM   1524 C C4    . DG  D 2 19  ? -18.248 91.959  80.020 1.00 31.97  ? 38  DG  F C4    1 
ATOM   1525 N N     . LYS E 3 8   ? 24.693  24.757  4.206  1.00 46.16  ? 360 LYS A N     1 
ATOM   1526 C CA    . LYS E 3 8   ? 24.879  23.732  5.236  1.00 46.91  ? 360 LYS A CA    1 
ATOM   1527 C C     . LYS E 3 8   ? 26.345  23.409  5.538  1.00 45.37  ? 360 LYS A C     1 
ATOM   1528 O O     . LYS E 3 8   ? 27.185  23.351  4.633  1.00 49.89  ? 360 LYS A O     1 
ATOM   1529 C CB    . LYS E 3 8   ? 24.152  22.430  4.868  1.00 44.92  ? 360 LYS A CB    1 
ATOM   1530 C CG    . LYS E 3 8   ? 22.637  22.485  4.961  1.00 45.38  ? 360 LYS A CG    1 
ATOM   1531 C CD    . LYS E 3 8   ? 22.078  21.085  5.187  1.00 39.94  ? 360 LYS A CD    1 
ATOM   1532 C CE    . LYS E 3 8   ? 20.564  21.083  5.180  1.00 37.90  ? 360 LYS A CE    1 
ATOM   1533 N NZ    . LYS E 3 8   ? 19.893  21.969  6.180  1.00 30.28  ? 360 LYS A NZ    1 
ATOM   1534 N N     . ALA E 3 9   ? 26.627  23.153  6.813  1.00 40.84  ? 361 ALA A N     1 
ATOM   1535 C CA    . ALA E 3 9   ? 27.969  22.827  7.265  1.00 34.16  ? 361 ALA A CA    1 
ATOM   1536 C C     . ALA E 3 9   ? 27.931  21.717  8.313  1.00 33.82  ? 361 ALA A C     1 
ATOM   1537 O O     . ALA E 3 9   ? 26.987  21.607  9.093  1.00 31.49  ? 361 ALA A O     1 
ATOM   1538 C CB    . ALA E 3 9   ? 28.636  24.060  7.831  1.00 32.32  ? 361 ALA A CB    1 
ATOM   1539 N N     . SER E 3 10  ? 28.949  20.869  8.298  1.00 33.97  ? 362 SER A N     1 
ATOM   1540 C CA    . SER E 3 10  ? 29.057  19.776  9.245  1.00 33.89  ? 362 SER A CA    1 
ATOM   1541 C C     . SER E 3 10  ? 29.643  20.223  10.574 1.00 32.87  ? 362 SER A C     1 
ATOM   1542 O O     . SER E 3 10  ? 30.430  21.177  10.637 1.00 31.51  ? 362 SER A O     1 
ATOM   1543 C CB    . SER E 3 10  ? 29.938  18.671  8.671  1.00 37.64  ? 362 SER A CB    1 
ATOM   1544 O OG    . SER E 3 10  ? 29.268  17.996  7.627  1.00 47.98  ? 362 SER A OG    1 
ATOM   1545 N N     . PHE E 3 11  ? 29.229  19.539  11.637 1.00 32.04  ? 363 PHE A N     1 
ATOM   1546 C CA    . PHE E 3 11  ? 29.719  19.819  12.977 1.00 29.65  ? 363 PHE A CA    1 
ATOM   1547 C C     . PHE E 3 11  ? 30.992  19.022  13.180 1.00 30.06  ? 363 PHE A C     1 
ATOM   1548 O O     . PHE E 3 11  ? 31.034  17.812  12.949 1.00 29.06  ? 363 PHE A O     1 
ATOM   1549 C CB    . PHE E 3 11  ? 28.688  19.446  14.051 1.00 22.71  ? 363 PHE A CB    1 
ATOM   1550 C CG    . PHE E 3 11  ? 27.541  20.414  14.155 1.00 20.13  ? 363 PHE A CG    1 
ATOM   1551 C CD1   . PHE E 3 11  ? 27.627  21.532  14.988 1.00 19.73  ? 363 PHE A CD1   1 
ATOM   1552 C CD2   . PHE E 3 11  ? 26.379  20.218  13.418 1.00 15.99  ? 363 PHE A CD2   1 
ATOM   1553 C CE1   . PHE E 3 11  ? 26.571  22.443  15.079 1.00 15.23  ? 363 PHE A CE1   1 
ATOM   1554 C CE2   . PHE E 3 11  ? 25.315  21.123  13.500 1.00 9.60   ? 363 PHE A CE2   1 
ATOM   1555 C CZ    . PHE E 3 11  ? 25.412  22.236  14.330 1.00 12.35  ? 363 PHE A CZ    1 
ATOM   1556 N N     . THR E 3 12  ? 32.044  19.738  13.550 1.00 31.87  ? 364 THR A N     1 
ATOM   1557 C CA    . THR E 3 12  ? 33.347  19.149  13.800 1.00 30.46  ? 364 THR A CA    1 
ATOM   1558 C C     . THR E 3 12  ? 33.372  18.680  15.259 1.00 32.60  ? 364 THR A C     1 
ATOM   1559 O O     . THR E 3 12  ? 32.536  19.112  16.055 1.00 34.66  ? 364 THR A O     1 
ATOM   1560 C CB    . THR E 3 12  ? 34.437  20.197  13.547 1.00 25.37  ? 364 THR A CB    1 
ATOM   1561 O OG1   . THR E 3 12  ? 34.329  21.246  14.511 1.00 27.14  ? 364 THR A OG1   1 
ATOM   1562 C CG2   . THR E 3 12  ? 34.247  20.820  12.176 1.00 23.93  ? 364 THR A CG2   1 
ATOM   1563 N N     . ASP E 3 13  ? 34.285  17.777  15.609 1.00 31.49  ? 365 ASP A N     1 
ATOM   1564 C CA    . ASP E 3 13  ? 34.364  17.303  16.986 1.00 28.73  ? 365 ASP A CA    1 
ATOM   1565 C C     . ASP E 3 13  ? 34.672  18.466  17.928 1.00 26.76  ? 365 ASP A C     1 
ATOM   1566 O O     . ASP E 3 13  ? 34.158  18.538  19.036 1.00 24.43  ? 365 ASP A O     1 
ATOM   1567 C CB    . ASP E 3 13  ? 35.452  16.242  17.132 1.00 37.09  ? 365 ASP A CB    1 
ATOM   1568 C CG    . ASP E 3 13  ? 35.843  16.016  18.592 1.00 47.57  ? 365 ASP A CG    1 
ATOM   1569 O OD1   . ASP E 3 13  ? 34.931  15.671  19.379 1.00 52.36  ? 365 ASP A OD1   1 
ATOM   1570 O OD2   . ASP E 3 13  ? 37.033  16.226  18.961 1.00 47.05  ? 365 ASP A OD2   1 
ATOM   1571 N N     . GLU E 3 14  ? 35.492  19.391  17.452 1.00 23.64  ? 366 GLU A N     1 
ATOM   1572 C CA    . GLU E 3 14  ? 35.909  20.542  18.228 1.00 23.84  ? 366 GLU A CA    1 
ATOM   1573 C C     . GLU E 3 14  ? 34.688  21.388  18.604 1.00 26.55  ? 366 GLU A C     1 
ATOM   1574 O O     . GLU E 3 14  ? 34.503  21.743  19.768 1.00 30.06  ? 366 GLU A O     1 
ATOM   1575 C CB    . GLU E 3 14  ? 36.945  21.346  17.430 1.00 24.10  ? 366 GLU A CB    1 
ATOM   1576 C CG    . GLU E 3 14  ? 38.259  20.567  17.027 1.00 34.61  ? 366 GLU A CG    1 
ATOM   1577 C CD    . GLU E 3 14  ? 38.066  19.280  16.135 1.00 38.59  ? 366 GLU A CD    1 
ATOM   1578 O OE1   . GLU E 3 14  ? 37.438  19.331  15.041 1.00 26.79  ? 366 GLU A OE1   1 
ATOM   1579 O OE2   . GLU E 3 14  ? 38.589  18.206  16.528 1.00 41.22  ? 366 GLU A OE2   1 
ATOM   1580 N N     . GLU E 3 15  ? 33.834  21.667  17.620 1.00 25.92  ? 367 GLU A N     1 
ATOM   1581 C CA    . GLU E 3 15  ? 32.610  22.445  17.826 1.00 20.20  ? 367 GLU A CA    1 
ATOM   1582 C C     . GLU E 3 15  ? 31.633  21.754  18.798 1.00 19.94  ? 367 GLU A C     1 
ATOM   1583 O O     . GLU E 3 15  ? 31.013  22.410  19.642 1.00 18.17  ? 367 GLU A O     1 
ATOM   1584 C CB    . GLU E 3 15  ? 31.910  22.704  16.485 1.00 21.36  ? 367 GLU A CB    1 
ATOM   1585 C CG    . GLU E 3 15  ? 32.599  23.730  15.550 1.00 21.97  ? 367 GLU A CG    1 
ATOM   1586 C CD    . GLU E 3 15  ? 31.898  23.857  14.181 1.00 24.10  ? 367 GLU A CD    1 
ATOM   1587 O OE1   . GLU E 3 15  ? 31.302  22.863  13.703 1.00 21.79  ? 367 GLU A OE1   1 
ATOM   1588 O OE2   . GLU E 3 15  ? 31.931  24.953  13.583 1.00 28.67  ? 367 GLU A OE2   1 
ATOM   1589 N N     . ASP E 3 16  ? 31.447  20.448  18.624 1.00 18.59  ? 368 ASP A N     1 
ATOM   1590 C CA    . ASP E 3 16  ? 30.590  19.644  19.495 1.00 20.14  ? 368 ASP A CA    1 
ATOM   1591 C C     . ASP E 3 16  ? 31.071  19.742  20.942 1.00 22.38  ? 368 ASP A C     1 
ATOM   1592 O O     . ASP E 3 16  ? 30.263  19.881  21.864 1.00 23.79  ? 368 ASP A O     1 
ATOM   1593 C CB    . ASP E 3 16  ? 30.621  18.169  19.078 1.00 17.93  ? 368 ASP A CB    1 
ATOM   1594 C CG    . ASP E 3 16  ? 29.772  17.883  17.850 1.00 27.27  ? 368 ASP A CG    1 
ATOM   1595 O OD1   . ASP E 3 16  ? 28.892  18.697  17.486 1.00 27.92  ? 368 ASP A OD1   1 
ATOM   1596 O OD2   . ASP E 3 16  ? 29.979  16.817  17.247 1.00 32.00  ? 368 ASP A OD2   1 
ATOM   1597 N N     . GLU E 3 17  ? 32.383  19.630  21.145 1.00 20.72  ? 369 GLU A N     1 
ATOM   1598 C CA    . GLU E 3 17  ? 32.943  19.717  22.481 1.00 19.04  ? 369 GLU A CA    1 
ATOM   1599 C C     . GLU E 3 17  ? 32.783  21.132  23.008 1.00 19.63  ? 369 GLU A C     1 
ATOM   1600 O O     . GLU E 3 17  ? 32.673  21.334  24.207 1.00 21.23  ? 369 GLU A O     1 
ATOM   1601 C CB    . GLU E 3 17  ? 34.415  19.275  22.502 1.00 20.11  ? 369 GLU A CB    1 
ATOM   1602 C CG    . GLU E 3 17  ? 34.610  17.763  22.349 1.00 28.12  ? 369 GLU A CG    1 
ATOM   1603 C CD    . GLU E 3 17  ? 33.926  16.927  23.448 1.00 33.35  ? 369 GLU A CD    1 
ATOM   1604 O OE1   . GLU E 3 17  ? 33.976  17.329  24.634 1.00 32.62  ? 369 GLU A OE1   1 
ATOM   1605 O OE2   . GLU E 3 17  ? 33.348  15.856  23.126 1.00 34.53  ? 369 GLU A OE2   1 
ATOM   1606 N N     . PHE E 3 18  ? 32.779  22.123  22.128 1.00 21.34  ? 370 PHE A N     1 
ATOM   1607 C CA    . PHE E 3 18  ? 32.574  23.495  22.588 1.00 21.99  ? 370 PHE A CA    1 
ATOM   1608 C C     . PHE E 3 18  ? 31.113  23.690  23.056 1.00 23.73  ? 370 PHE A C     1 
ATOM   1609 O O     . PHE E 3 18  ? 30.864  24.257  24.125 1.00 27.76  ? 370 PHE A O     1 
ATOM   1610 C CB    . PHE E 3 18  ? 32.917  24.492  21.490 1.00 23.45  ? 370 PHE A CB    1 
ATOM   1611 C CG    . PHE E 3 18  ? 32.741  25.910  21.909 1.00 22.39  ? 370 PHE A CG    1 
ATOM   1612 C CD1   . PHE E 3 18  ? 33.567  26.459  22.881 1.00 23.55  ? 370 PHE A CD1   1 
ATOM   1613 C CD2   . PHE E 3 18  ? 31.724  26.685  21.373 1.00 19.19  ? 370 PHE A CD2   1 
ATOM   1614 C CE1   . PHE E 3 18  ? 33.383  27.763  23.316 1.00 24.41  ? 370 PHE A CE1   1 
ATOM   1615 C CE2   . PHE E 3 18  ? 31.528  27.996  21.804 1.00 22.00  ? 370 PHE A CE2   1 
ATOM   1616 C CZ    . PHE E 3 18  ? 32.364  28.536  22.779 1.00 22.32  ? 370 PHE A CZ    1 
ATOM   1617 N N     . ILE E 3 19  ? 30.156  23.241  22.242 1.00 21.76  ? 371 ILE A N     1 
ATOM   1618 C CA    . ILE E 3 19  ? 28.733  23.309  22.569 1.00 17.87  ? 371 ILE A CA    1 
ATOM   1619 C C     . ILE E 3 19  ? 28.491  22.608  23.920 1.00 17.37  ? 371 ILE A C     1 
ATOM   1620 O O     . ILE E 3 19  ? 27.820  23.155  24.792 1.00 19.36  ? 371 ILE A O     1 
ATOM   1621 C CB    . ILE E 3 19  ? 27.880  22.635  21.451 1.00 20.15  ? 371 ILE A CB    1 
ATOM   1622 C CG1   . ILE E 3 19  ? 27.991  23.439  20.153 1.00 18.51  ? 371 ILE A CG1   1 
ATOM   1623 C CG2   . ILE E 3 19  ? 26.405  22.476  21.859 1.00 11.68  ? 371 ILE A CG2   1 
ATOM   1624 C CD1   . ILE E 3 19  ? 27.509  22.649  18.917 1.00 23.08  ? 371 ILE A CD1   1 
ATOM   1625 N N     . LEU E 3 20  ? 29.029  21.398  24.091 1.00 19.30  ? 372 LEU A N     1 
ATOM   1626 C CA    . LEU E 3 20  ? 28.890  20.646  25.346 1.00 14.16  ? 372 LEU A CA    1 
ATOM   1627 C C     . LEU E 3 20  ? 29.420  21.408  26.557 1.00 16.40  ? 372 LEU A C     1 
ATOM   1628 O O     . LEU E 3 20  ? 28.779  21.459  27.602 1.00 18.54  ? 372 LEU A O     1 
ATOM   1629 C CB    . LEU E 3 20  ? 29.617  19.310  25.249 1.00 12.79  ? 372 LEU A CB    1 
ATOM   1630 C CG    . LEU E 3 20  ? 28.926  18.246  24.399 1.00 12.59  ? 372 LEU A CG    1 
ATOM   1631 C CD1   . LEU E 3 20  ? 29.860  17.084  24.111 1.00 13.34  ? 372 LEU A CD1   1 
ATOM   1632 C CD2   . LEU E 3 20  ? 27.687  17.767  25.106 1.00 11.33  ? 372 LEU A CD2   1 
ATOM   1633 N N     . ASP E 3 21  ? 30.594  22.005  26.407 1.00 18.96  ? 373 ASP A N     1 
ATOM   1634 C CA    . ASP E 3 21  ? 31.225  22.759  27.475 1.00 15.85  ? 373 ASP A CA    1 
ATOM   1635 C C     . ASP E 3 21  ? 30.355  23.932  27.876 1.00 18.47  ? 373 ASP A C     1 
ATOM   1636 O O     . ASP E 3 21  ? 30.189  24.224  29.063 1.00 22.51  ? 373 ASP A O     1 
ATOM   1637 C CB    . ASP E 3 21  ? 32.612  23.247  27.027 1.00 14.68  ? 373 ASP A CB    1 
ATOM   1638 C CG    . ASP E 3 21  ? 33.385  23.943  28.143 1.00 18.24  ? 373 ASP A CG    1 
ATOM   1639 O OD1   . ASP E 3 21  ? 33.663  23.293  29.174 1.00 23.77  ? 373 ASP A OD1   1 
ATOM   1640 O OD2   . ASP E 3 21  ? 33.724  25.137  27.985 1.00 24.88  ? 373 ASP A OD2   1 
ATOM   1641 N N     . VAL E 3 22  ? 29.816  24.631  26.886 1.00 18.31  ? 374 VAL A N     1 
ATOM   1642 C CA    . VAL E 3 22  ? 28.967  25.780  27.155 1.00 15.84  ? 374 VAL A CA    1 
ATOM   1643 C C     . VAL E 3 22  ? 27.680  25.409  27.922 1.00 17.91  ? 374 VAL A C     1 
ATOM   1644 O O     . VAL E 3 22  ? 27.223  26.156  28.798 1.00 20.41  ? 374 VAL A O     1 
ATOM   1645 C CB    . VAL E 3 22  ? 28.620  26.510  25.844 1.00 14.17  ? 374 VAL A CB    1 
ATOM   1646 C CG1   . VAL E 3 22  ? 27.551  27.550  26.099 1.00 16.66  ? 374 VAL A CG1   1 
ATOM   1647 C CG2   . VAL E 3 22  ? 29.876  27.173  25.254 1.00 5.33   ? 374 VAL A CG2   1 
ATOM   1648 N N     . VAL E 3 23  ? 27.086  24.272  27.582 1.00 15.62  ? 375 VAL A N     1 
ATOM   1649 C CA    . VAL E 3 23  ? 25.870  23.830  28.239 1.00 12.91  ? 375 VAL A CA    1 
ATOM   1650 C C     . VAL E 3 23  ? 26.159  23.409  29.672 1.00 15.00  ? 375 VAL A C     1 
ATOM   1651 O O     . VAL E 3 23  ? 25.376  23.680  30.564 1.00 18.13  ? 375 VAL A O     1 
ATOM   1652 C CB    . VAL E 3 23  ? 25.196  22.726  27.423 1.00 13.64  ? 375 VAL A CB    1 
ATOM   1653 C CG1   . VAL E 3 23  ? 24.063  22.102  28.184 1.00 12.63  ? 375 VAL A CG1   1 
ATOM   1654 C CG2   . VAL E 3 23  ? 24.675  23.322  26.125 1.00 16.07  ? 375 VAL A CG2   1 
ATOM   1655 N N     . ARG E 3 24  ? 27.310  22.789  29.903 1.00 18.49  ? 376 ARG A N     1 
ATOM   1656 C CA    . ARG E 3 24  ? 27.691  22.377  31.259 1.00 15.57  ? 376 ARG A CA    1 
ATOM   1657 C C     . ARG E 3 24  ? 27.941  23.590  32.137 1.00 12.96  ? 376 ARG A C     1 
ATOM   1658 O O     . ARG E 3 24  ? 27.661  23.544  33.323 1.00 12.06  ? 376 ARG A O     1 
ATOM   1659 C CB    . ARG E 3 24  ? 28.927  21.477  31.248 1.00 15.24  ? 376 ARG A CB    1 
ATOM   1660 C CG    . ARG E 3 24  ? 28.695  20.116  30.605 1.00 12.84  ? 376 ARG A CG    1 
ATOM   1661 C CD    . ARG E 3 24  ? 29.998  19.351  30.562 1.00 15.10  ? 376 ARG A CD    1 
ATOM   1662 N NE    . ARG E 3 24  ? 29.891  18.080  29.849 1.00 17.07  ? 376 ARG A NE    1 
ATOM   1663 C CZ    . ARG E 3 24  ? 30.768  17.672  28.934 1.00 23.16  ? 376 ARG A CZ    1 
ATOM   1664 N NH1   . ARG E 3 24  ? 31.813  18.441  28.641 1.00 27.42  ? 376 ARG A NH1   1 
ATOM   1665 N NH2   . ARG E 3 24  ? 30.582  16.523  28.282 1.00 22.64  ? 376 ARG A NH2   1 
ATOM   1666 N N     . LYS E 3 25  ? 28.487  24.664  31.568 1.00 13.27  ? 377 LYS A N     1 
ATOM   1667 C CA    . LYS E 3 25  ? 28.735  25.886  32.335 1.00 10.52  ? 377 LYS A CA    1 
ATOM   1668 C C     . LYS E 3 25  ? 27.518  26.801  32.404 1.00 12.65  ? 377 LYS A C     1 
ATOM   1669 O O     . LYS E 3 25  ? 27.569  27.849  33.060 1.00 14.29  ? 377 LYS A O     1 
ATOM   1670 C CB    . LYS E 3 25  ? 29.955  26.659  31.816 1.00 14.76  ? 377 LYS A CB    1 
ATOM   1671 C CG    . LYS E 3 25  ? 31.304  26.053  32.217 1.00 13.14  ? 377 LYS A CG    1 
ATOM   1672 C CD    . LYS E 3 25  ? 32.484  26.633  31.432 1.00 15.64  ? 377 LYS A CD    1 
ATOM   1673 C CE    . LYS E 3 25  ? 33.674  25.665  31.481 1.00 16.64  ? 377 LYS A CE    1 
ATOM   1674 N NZ    . LYS E 3 25  ? 34.815  26.085  30.607 1.00 16.98  ? 377 LYS A NZ    1 
ATOM   1675 N N     . ASN E 3 26  ? 26.420  26.393  31.763 1.00 14.76  ? 378 ASN A N     1 
ATOM   1676 C CA    . ASN E 3 26  ? 25.154  27.153  31.765 1.00 17.77  ? 378 ASN A CA    1 
ATOM   1677 C C     . ASN E 3 26  ? 23.999  26.147  31.778 1.00 18.36  ? 378 ASN A C     1 
ATOM   1678 O O     . ASN E 3 26  ? 22.999  26.339  31.085 1.00 21.01  ? 378 ASN A O     1 
ATOM   1679 C CB    . ASN E 3 26  ? 25.019  28.027  30.505 1.00 12.01  ? 378 ASN A CB    1 
ATOM   1680 C CG    . ASN E 3 26  ? 26.036  29.147  30.442 1.00 7.44   ? 378 ASN A CG    1 
ATOM   1681 O OD1   . ASN E 3 26  ? 25.781  30.266  30.901 1.00 13.09  ? 378 ASN A OD1   1 
ATOM   1682 N ND2   . ASN E 3 26  ? 27.180  28.868  29.835 1.00 8.73   ? 378 ASN A ND2   1 
ATOM   1683 N N     . PRO E 3 27  ? 24.070  25.120  32.653 1.00 21.59  ? 379 PRO A N     1 
ATOM   1684 C CA    . PRO E 3 27  ? 23.031  24.088  32.739 1.00 16.73  ? 379 PRO A CA    1 
ATOM   1685 C C     . PRO E 3 27  ? 21.555  24.501  32.862 1.00 15.50  ? 379 PRO A C     1 
ATOM   1686 O O     . PRO E 3 27  ? 20.699  23.790  32.374 1.00 17.98  ? 379 PRO A O     1 
ATOM   1687 C CB    . PRO E 3 27  ? 23.490  23.259  33.930 1.00 17.64  ? 379 PRO A CB    1 
ATOM   1688 C CG    . PRO E 3 27  ? 24.037  24.284  34.838 1.00 14.75  ? 379 PRO A CG    1 
ATOM   1689 C CD    . PRO E 3 27  ? 24.847  25.164  33.915 1.00 20.26  ? 379 PRO A CD    1 
ATOM   1690 N N     . THR E 3 28  ? 21.251  25.608  33.535 1.00 15.03  ? 380 THR A N     1 
ATOM   1691 C CA    . THR E 3 28  ? 19.869  26.038  33.694 1.00 14.85  ? 380 THR A CA    1 
ATOM   1692 C C     . THR E 3 28  ? 19.275  26.526  32.382 1.00 17.81  ? 380 THR A C     1 
ATOM   1693 O O     . THR E 3 28  ? 18.048  26.623  32.237 1.00 17.07  ? 380 THR A O     1 
ATOM   1694 C CB    . THR E 3 28  ? 19.698  27.152  34.777 1.00 18.26  ? 380 THR A CB    1 
ATOM   1695 O OG1   . THR E 3 28  ? 20.472  28.305  34.439 1.00 26.19  ? 380 THR A OG1   1 
ATOM   1696 C CG2   . THR E 3 28  ? 20.147  26.667  36.131 1.00 25.56  ? 380 THR A CG2   1 
ATOM   1697 N N     . ARG E 3 29  ? 20.151  26.816  31.423 1.00 16.45  ? 381 ARG A N     1 
ATOM   1698 C CA    . ARG E 3 29  ? 19.729  27.289  30.116 1.00 13.35  ? 381 ARG A CA    1 
ATOM   1699 C C     . ARG E 3 29  ? 19.771  26.197  29.041 1.00 16.50  ? 381 ARG A C     1 
ATOM   1700 O O     . ARG E 3 29  ? 19.478  26.450  27.887 1.00 19.16  ? 381 ARG A O     1 
ATOM   1701 C CB    . ARG E 3 29  ? 20.601  28.452  29.703 1.00 14.98  ? 381 ARG A CB    1 
ATOM   1702 C CG    . ARG E 3 29  ? 20.510  29.632  30.623 1.00 11.43  ? 381 ARG A CG    1 
ATOM   1703 C CD    . ARG E 3 29  ? 21.325  30.774  30.089 1.00 14.45  ? 381 ARG A CD    1 
ATOM   1704 N NE    . ARG E 3 29  ? 20.688  31.359  28.911 1.00 22.84  ? 381 ARG A NE    1 
ATOM   1705 C CZ    . ARG E 3 29  ? 21.320  32.076  27.987 1.00 23.25  ? 381 ARG A CZ    1 
ATOM   1706 N NH1   . ARG E 3 29  ? 22.631  32.297  28.093 1.00 17.79  ? 381 ARG A NH1   1 
ATOM   1707 N NH2   . ARG E 3 29  ? 20.630  32.585  26.967 1.00 19.26  ? 381 ARG A NH2   1 
ATOM   1708 N N     . ARG E 3 30  ? 20.088  24.971  29.434 1.00 18.21  ? 382 ARG A N     1 
ATOM   1709 C CA    . ARG E 3 30  ? 20.154  23.843  28.523 1.00 18.01  ? 382 ARG A CA    1 
ATOM   1710 C C     . ARG E 3 30  ? 18.943  23.664  27.591 1.00 21.73  ? 382 ARG A C     1 
ATOM   1711 O O     . ARG E 3 30  ? 19.087  23.153  26.478 1.00 21.49  ? 382 ARG A O     1 
ATOM   1712 C CB    . ARG E 3 30  ? 20.367  22.562  29.329 1.00 18.93  ? 382 ARG A CB    1 
ATOM   1713 C CG    . ARG E 3 30  ? 19.189  22.234  30.244 1.00 23.51  ? 382 ARG A CG    1 
ATOM   1714 C CD    . ARG E 3 30  ? 19.485  21.073  31.151 1.00 24.08  ? 382 ARG A CD    1 
ATOM   1715 N NE    . ARG E 3 30  ? 18.336  20.746  31.992 1.00 28.51  ? 382 ARG A NE    1 
ATOM   1716 C CZ    . ARG E 3 30  ? 18.050  21.337  33.153 1.00 29.18  ? 382 ARG A CZ    1 
ATOM   1717 N NH1   . ARG E 3 30  ? 18.824  22.302  33.621 1.00 29.73  ? 382 ARG A NH1   1 
ATOM   1718 N NH2   . ARG E 3 30  ? 17.011  20.929  33.875 1.00 28.56  ? 382 ARG A NH2   1 
ATOM   1719 N N     . THR E 3 31  ? 17.742  23.998  28.057 1.00 22.24  ? 383 THR A N     1 
ATOM   1720 C CA    . THR E 3 31  ? 16.553  23.831  27.218 1.00 23.36  ? 383 THR A CA    1 
ATOM   1721 C C     . THR E 3 31  ? 16.010  25.105  26.565 1.00 22.51  ? 383 THR A C     1 
ATOM   1722 O O     . THR E 3 31  ? 14.908  25.106  25.986 1.00 24.85  ? 383 THR A O     1 
ATOM   1723 C CB    . THR E 3 31  ? 15.403  23.020  27.917 1.00 23.78  ? 383 THR A CB    1 
ATOM   1724 O OG1   . THR E 3 31  ? 15.342  23.325  29.317 1.00 29.56  ? 383 THR A OG1   1 
ATOM   1725 C CG2   . THR E 3 31  ? 15.606  21.531  27.715 1.00 23.48  ? 383 THR A CG2   1 
ATOM   1726 N N     . THR E 3 32  ? 16.794  26.176  26.632 1.00 18.82  ? 384 THR A N     1 
ATOM   1727 C CA    . THR E 3 32  ? 16.411  27.425  26.002 1.00 15.85  ? 384 THR A CA    1 
ATOM   1728 C C     . THR E 3 32  ? 16.778  27.323  24.524 1.00 17.02  ? 384 THR A C     1 
ATOM   1729 O O     . THR E 3 32  ? 17.216  26.276  24.037 1.00 18.97  ? 384 THR A O     1 
ATOM   1730 C CB    . THR E 3 32  ? 17.194  28.617  26.566 1.00 15.11  ? 384 THR A CB    1 
ATOM   1731 O OG1   . THR E 3 32  ? 18.578  28.479  26.236 1.00 18.29  ? 384 THR A OG1   1 
ATOM   1732 C CG2   . THR E 3 32  ? 17.024  28.729  28.059 1.00 14.37  ? 384 THR A CG2   1 
ATOM   1733 N N     . HIS E 3 33  ? 16.559  28.418  23.812 1.00 19.83  ? 385 HIS A N     1 
ATOM   1734 C CA    . HIS E 3 33  ? 16.888  28.533  22.401 1.00 15.77  ? 385 HIS A CA    1 
ATOM   1735 C C     . HIS E 3 33  ? 17.965  29.599  22.415 1.00 11.56  ? 385 HIS A C     1 
ATOM   1736 O O     . HIS E 3 33  ? 19.006  29.444  21.789 1.00 17.97  ? 385 HIS A O     1 
ATOM   1737 C CB    . HIS E 3 33  ? 15.664  28.997  21.583 1.00 14.40  ? 385 HIS A CB    1 
ATOM   1738 C CG    . HIS E 3 33  ? 14.668  27.910  21.285 1.00 10.24  ? 385 HIS A CG    1 
ATOM   1739 N ND1   . HIS E 3 33  ? 14.719  27.141  20.139 1.00 13.57  ? 385 HIS A ND1   1 
ATOM   1740 C CD2   . HIS E 3 33  ? 13.611  27.449  21.991 1.00 12.28  ? 385 HIS A CD2   1 
ATOM   1741 C CE1   . HIS E 3 33  ? 13.739  26.256  20.154 1.00 10.03  ? 385 HIS A CE1   1 
ATOM   1742 N NE2   . HIS E 3 33  ? 13.052  26.423  21.267 1.00 16.12  ? 385 HIS A NE2   1 
ATOM   1743 N N     . THR E 3 34  ? 17.781  30.608  23.265 1.00 11.94  ? 386 THR A N     1 
ATOM   1744 C CA    . THR E 3 34  ? 18.741  31.703  23.368 1.00 9.13   ? 386 THR A CA    1 
ATOM   1745 C C     . THR E 3 34  ? 20.152  31.281  23.689 1.00 11.39  ? 386 THR A C     1 
ATOM   1746 O O     . THR E 3 34  ? 21.101  31.926  23.255 1.00 11.32  ? 386 THR A O     1 
ATOM   1747 C CB    . THR E 3 34  ? 18.302  32.785  24.379 1.00 15.13  ? 386 THR A CB    1 
ATOM   1748 O OG1   . THR E 3 34  ? 18.143  32.215  25.684 1.00 15.80  ? 386 THR A OG1   1 
ATOM   1749 C CG2   . THR E 3 34  ? 16.999  33.431  23.934 1.00 13.12  ? 386 THR A CG2   1 
ATOM   1750 N N     . LEU E 3 35  ? 20.311  30.209  24.460 1.00 11.76  ? 387 LEU A N     1 
ATOM   1751 C CA    . LEU E 3 35  ? 21.655  29.764  24.791 1.00 9.61   ? 387 LEU A CA    1 
ATOM   1752 C C     . LEU E 3 35  ? 22.361  29.392  23.496 1.00 8.82   ? 387 LEU A C     1 
ATOM   1753 O O     . LEU E 3 35  ? 23.488  29.800  23.229 1.00 12.02  ? 387 LEU A O     1 
ATOM   1754 C CB    . LEU E 3 35  ? 21.618  28.550  25.730 1.00 5.96   ? 387 LEU A CB    1 
ATOM   1755 C CG    . LEU E 3 35  ? 23.017  28.072  26.124 1.00 7.91   ? 387 LEU A CG    1 
ATOM   1756 C CD1   . LEU E 3 35  ? 23.725  29.154  26.936 1.00 11.04  ? 387 LEU A CD1   1 
ATOM   1757 C CD2   . LEU E 3 35  ? 22.964  26.793  26.898 1.00 8.18   ? 387 LEU A CD2   1 
ATOM   1758 N N     . TYR E 3 36  ? 21.647  28.663  22.663 1.00 9.11   ? 388 TYR A N     1 
ATOM   1759 C CA    . TYR E 3 36  ? 22.179  28.191  21.398 1.00 13.45  ? 388 TYR A CA    1 
ATOM   1760 C C     . TYR E 3 36  ? 22.371  29.265  20.333 1.00 12.40  ? 388 TYR A C     1 
ATOM   1761 O O     . TYR E 3 36  ? 23.294  29.197  19.523 1.00 13.32  ? 388 TYR A O     1 
ATOM   1762 C CB    . TYR E 3 36  ? 21.328  27.036  20.942 1.00 11.02  ? 388 TYR A CB    1 
ATOM   1763 C CG    . TYR E 3 36  ? 21.286  26.009  22.027 1.00 8.32   ? 388 TYR A CG    1 
ATOM   1764 C CD1   . TYR E 3 36  ? 22.418  25.250  22.325 1.00 7.26   ? 388 TYR A CD1   1 
ATOM   1765 C CD2   . TYR E 3 36  ? 20.141  25.844  22.809 1.00 7.79   ? 388 TYR A CD2   1 
ATOM   1766 C CE1   . TYR E 3 36  ? 22.410  24.356  23.376 1.00 10.96  ? 388 TYR A CE1   1 
ATOM   1767 C CE2   . TYR E 3 36  ? 20.118  24.949  23.863 1.00 6.95   ? 388 TYR A CE2   1 
ATOM   1768 C CZ    . TYR E 3 36  ? 21.257  24.213  24.144 1.00 11.30  ? 388 TYR A CZ    1 
ATOM   1769 O OH    . TYR E 3 36  ? 21.277  23.357  25.215 1.00 11.17  ? 388 TYR A OH    1 
ATOM   1770 N N     . ASP E 3 37  ? 21.537  30.292  20.394 1.00 15.04  ? 389 ASP A N     1 
ATOM   1771 C CA    . ASP E 3 37  ? 21.658  31.414  19.501 1.00 10.92  ? 389 ASP A CA    1 
ATOM   1772 C C     . ASP E 3 37  ? 22.944  32.145  19.872 1.00 17.38  ? 389 ASP A C     1 
ATOM   1773 O O     . ASP E 3 37  ? 23.627  32.694  19.008 1.00 25.63  ? 389 ASP A O     1 
ATOM   1774 C CB    . ASP E 3 37  ? 20.482  32.351  19.684 1.00 12.82  ? 389 ASP A CB    1 
ATOM   1775 C CG    . ASP E 3 37  ? 20.574  33.571  18.791 1.00 24.56  ? 389 ASP A CG    1 
ATOM   1776 O OD1   . ASP E 3 37  ? 20.634  33.384  17.556 1.00 30.65  ? 389 ASP A OD1   1 
ATOM   1777 O OD2   . ASP E 3 37  ? 20.613  34.709  19.317 1.00 25.52  ? 389 ASP A OD2   1 
ATOM   1778 N N     . GLU E 3 38  ? 23.265  32.190  21.161 1.00 16.47  ? 390 GLU A N     1 
ATOM   1779 C CA    . GLU E 3 38  ? 24.482  32.853  21.602 1.00 14.38  ? 390 GLU A CA    1 
ATOM   1780 C C     . GLU E 3 38  ? 25.683  32.050  21.199 1.00 13.88  ? 390 GLU A C     1 
ATOM   1781 O O     . GLU E 3 38  ? 26.722  32.585  20.843 1.00 20.11  ? 390 GLU A O     1 
ATOM   1782 C CB    . GLU E 3 38  ? 24.465  33.034  23.101 1.00 18.14  ? 390 GLU A CB    1 
ATOM   1783 C CG    . GLU E 3 38  ? 23.495  34.096  23.526 1.00 21.31  ? 390 GLU A CG    1 
ATOM   1784 C CD    . GLU E 3 38  ? 23.098  33.989  24.970 1.00 24.17  ? 390 GLU A CD    1 
ATOM   1785 O OE1   . GLU E 3 38  ? 23.890  33.474  25.782 1.00 28.84  ? 390 GLU A OE1   1 
ATOM   1786 O OE2   . GLU E 3 38  ? 21.976  34.419  25.294 1.00 32.62  ? 390 GLU A OE2   1 
ATOM   1787 N N     . ILE E 3 39  ? 25.559  30.746  21.302 1.00 13.55  ? 391 ILE A N     1 
ATOM   1788 C CA    . ILE E 3 39  ? 26.647  29.894  20.904 1.00 15.11  ? 391 ILE A CA    1 
ATOM   1789 C C     . ILE E 3 39  ? 26.976  30.166  19.435 1.00 14.94  ? 391 ILE A C     1 
ATOM   1790 O O     . ILE E 3 39  ? 28.144  30.270  19.076 1.00 21.38  ? 391 ILE A O     1 
ATOM   1791 C CB    . ILE E 3 39  ? 26.305  28.396  21.132 1.00 17.28  ? 391 ILE A CB    1 
ATOM   1792 C CG1   . ILE E 3 39  ? 26.200  28.100  22.630 1.00 15.67  ? 391 ILE A CG1   1 
ATOM   1793 C CG2   . ILE E 3 39  ? 27.388  27.504  20.518 1.00 17.99  ? 391 ILE A CG2   1 
ATOM   1794 C CD1   . ILE E 3 39  ? 25.976  26.658  22.929 1.00 11.39  ? 391 ILE A CD1   1 
ATOM   1795 N N     . SER E 3 40  ? 25.961  30.354  18.598 1.00 14.24  ? 392 SER A N     1 
ATOM   1796 C CA    . SER E 3 40  ? 26.196  30.610  17.175 1.00 14.93  ? 392 SER A CA    1 
ATOM   1797 C C     . SER E 3 40  ? 27.134  31.779  16.911 1.00 17.68  ? 392 SER A C     1 
ATOM   1798 O O     . SER E 3 40  ? 27.745  31.864  15.852 1.00 24.19  ? 392 SER A O     1 
ATOM   1799 C CB    . SER E 3 40  ? 24.887  30.801  16.427 1.00 8.98   ? 392 SER A CB    1 
ATOM   1800 O OG    . SER E 3 40  ? 24.413  32.120  16.552 1.00 18.66  ? 392 SER A OG    1 
ATOM   1801 N N     . HIS E 3 41  ? 27.279  32.666  17.889 1.00 19.14  ? 393 HIS A N     1 
ATOM   1802 C CA    . HIS E 3 41  ? 28.181  33.813  17.773 1.00 12.50  ? 393 HIS A CA    1 
ATOM   1803 C C     . HIS E 3 41  ? 29.664  33.413  17.699 1.00 16.34  ? 393 HIS A C     1 
ATOM   1804 O O     . HIS E 3 41  ? 30.508  34.164  17.182 1.00 13.97  ? 393 HIS A O     1 
ATOM   1805 C CB    . HIS E 3 41  ? 27.999  34.714  18.983 1.00 9.48   ? 393 HIS A CB    1 
ATOM   1806 C CG    . HIS E 3 41  ? 29.037  35.780  19.103 1.00 3.12   ? 393 HIS A CG    1 
ATOM   1807 N ND1   . HIS E 3 41  ? 28.917  37.012  18.500 1.00 8.51   ? 393 HIS A ND1   1 
ATOM   1808 C CD2   . HIS E 3 41  ? 30.207  35.817  19.779 1.00 7.13   ? 393 HIS A CD2   1 
ATOM   1809 C CE1   . HIS E 3 41  ? 29.960  37.759  18.797 1.00 2.89   ? 393 HIS A CE1   1 
ATOM   1810 N NE2   . HIS E 3 41  ? 30.761  37.052  19.574 1.00 4.21   ? 393 HIS A NE2   1 
ATOM   1811 N N     . TYR E 3 42  ? 29.979  32.257  18.278 1.00 17.89  ? 394 TYR A N     1 
ATOM   1812 C CA    . TYR E 3 42  ? 31.341  31.748  18.349 1.00 17.12  ? 394 TYR A CA    1 
ATOM   1813 C C     . TYR E 3 42  ? 31.623  30.700  17.295 1.00 17.65  ? 394 TYR A C     1 
ATOM   1814 O O     . TYR E 3 42  ? 32.774  30.399  17.006 1.00 16.44  ? 394 TYR A O     1 
ATOM   1815 C CB    . TYR E 3 42  ? 31.591  31.137  19.734 1.00 22.86  ? 394 TYR A CB    1 
ATOM   1816 C CG    . TYR E 3 42  ? 31.409  32.101  20.890 1.00 16.91  ? 394 TYR A CG    1 
ATOM   1817 C CD1   . TYR E 3 42  ? 30.154  32.271  21.495 1.00 15.06  ? 394 TYR A CD1   1 
ATOM   1818 C CD2   . TYR E 3 42  ? 32.483  32.870  21.355 1.00 15.85  ? 394 TYR A CD2   1 
ATOM   1819 C CE1   . TYR E 3 42  ? 29.973  33.198  22.542 1.00 16.62  ? 394 TYR A CE1   1 
ATOM   1820 C CE2   . TYR E 3 42  ? 32.309  33.790  22.390 1.00 20.57  ? 394 TYR A CE2   1 
ATOM   1821 C CZ    . TYR E 3 42  ? 31.057  33.951  22.977 1.00 11.34  ? 394 TYR A CZ    1 
ATOM   1822 O OH    . TYR E 3 42  ? 30.897  34.862  23.996 1.00 21.28  ? 394 TYR A OH    1 
ATOM   1823 N N     . VAL E 3 43  ? 30.564  30.071  16.809 1.00 19.91  ? 395 VAL A N     1 
ATOM   1824 C CA    . VAL E 3 43  ? 30.663  29.058  15.763 1.00 21.66  ? 395 VAL A CA    1 
ATOM   1825 C C     . VAL E 3 43  ? 29.697  29.473  14.637 1.00 18.65  ? 395 VAL A C     1 
ATOM   1826 O O     . VAL E 3 43  ? 28.705  28.807  14.367 1.00 20.66  ? 395 VAL A O     1 
ATOM   1827 C CB    . VAL E 3 43  ? 30.358  27.619  16.327 1.00 27.40  ? 395 VAL A CB    1 
ATOM   1828 C CG1   . VAL E 3 43  ? 31.455  27.201  17.308 1.00 33.37  ? 395 VAL A CG1   1 
ATOM   1829 C CG2   . VAL E 3 43  ? 29.013  27.564  17.054 1.00 25.14  ? 395 VAL A CG2   1 
ATOM   1830 N N     . PRO E 3 44  ? 30.004  30.586  13.952 1.00 23.35  ? 396 PRO A N     1 
ATOM   1831 C CA    . PRO E 3 44  ? 29.247  31.190  12.857 1.00 30.82  ? 396 PRO A CA    1 
ATOM   1832 C C     . PRO E 3 44  ? 28.823  30.301  11.701 1.00 34.13  ? 396 PRO A C     1 
ATOM   1833 O O     . PRO E 3 44  ? 27.868  30.625  10.991 1.00 39.68  ? 396 PRO A O     1 
ATOM   1834 C CB    . PRO E 3 44  ? 30.161  32.331  12.406 1.00 34.91  ? 396 PRO A CB    1 
ATOM   1835 C CG    . PRO E 3 44  ? 31.508  31.815  12.703 1.00 32.83  ? 396 PRO A CG    1 
ATOM   1836 C CD    . PRO E 3 44  ? 31.308  31.252  14.076 1.00 31.62  ? 396 PRO A CD    1 
ATOM   1837 N N     . ASN E 3 45  ? 29.531  29.201  11.483 1.00 33.49  ? 397 ASN A N     1 
ATOM   1838 C CA    . ASN E 3 45  ? 29.144  28.296  10.414 1.00 35.77  ? 397 ASN A CA    1 
ATOM   1839 C C     . ASN E 3 45  ? 27.769  27.676  10.722 1.00 35.15  ? 397 ASN A C     1 
ATOM   1840 O O     . ASN E 3 45  ? 27.152  27.050  9.860  1.00 37.61  ? 397 ASN A O     1 
ATOM   1841 C CB    . ASN E 3 45  ? 30.190  27.182  10.247 1.00 43.00  ? 397 ASN A CB    1 
ATOM   1842 C CG    . ASN E 3 45  ? 31.323  27.567  9.299  1.00 52.84  ? 397 ASN A CG    1 
ATOM   1843 O OD1   . ASN E 3 45  ? 31.462  28.729  8.898  1.00 57.16  ? 397 ASN A OD1   1 
ATOM   1844 N ND2   . ASN E 3 45  ? 32.144  26.585  8.939  1.00 56.68  ? 397 ASN A ND2   1 
ATOM   1845 N N     . HIS E 3 46  ? 27.309  27.822  11.961 1.00 30.46  ? 398 HIS A N     1 
ATOM   1846 C CA    . HIS E 3 46  ? 26.044  27.244  12.376 1.00 23.10  ? 398 HIS A CA    1 
ATOM   1847 C C     . HIS E 3 46  ? 25.066  28.276  12.944 1.00 22.28  ? 398 HIS A C     1 
ATOM   1848 O O     . HIS E 3 46  ? 25.409  29.443  13.116 1.00 24.42  ? 398 HIS A O     1 
ATOM   1849 C CB    . HIS E 3 46  ? 26.315  26.149  13.406 1.00 21.68  ? 398 HIS A CB    1 
ATOM   1850 C CG    . HIS E 3 46  ? 27.332  25.140  12.970 1.00 15.13  ? 398 HIS A CG    1 
ATOM   1851 N ND1   . HIS E 3 46  ? 27.045  24.126  12.082 1.00 15.48  ? 398 HIS A ND1   1 
ATOM   1852 C CD2   . HIS E 3 46  ? 28.634  24.978  13.310 1.00 17.73  ? 398 HIS A CD2   1 
ATOM   1853 C CE1   . HIS E 3 46  ? 28.121  23.382  11.889 1.00 13.82  ? 398 HIS A CE1   1 
ATOM   1854 N NE2   . HIS E 3 46  ? 29.099  23.881  12.622 1.00 17.23  ? 398 HIS A NE2   1 
ATOM   1855 N N     . THR E 3 47  ? 23.838  27.846  13.211 1.00 19.09  ? 399 THR A N     1 
ATOM   1856 C CA    . THR E 3 47  ? 22.832  28.739  13.762 1.00 17.93  ? 399 THR A CA    1 
ATOM   1857 C C     . THR E 3 47  ? 22.274  28.169  15.070 1.00 16.20  ? 399 THR A C     1 
ATOM   1858 O O     . THR E 3 47  ? 22.457  26.986  15.362 1.00 16.00  ? 399 THR A O     1 
ATOM   1859 C CB    . THR E 3 47  ? 21.647  28.969  12.778 1.00 12.70  ? 399 THR A CB    1 
ATOM   1860 O OG1   . THR E 3 47  ? 20.945  27.745  12.567 1.00 11.17  ? 399 THR A OG1   1 
ATOM   1861 C CG2   . THR E 3 47  ? 22.144  29.490  11.456 1.00 17.37  ? 399 THR A CG2   1 
ATOM   1862 N N     . GLY E 3 48  ? 21.587  29.016  15.836 1.00 16.09  ? 400 GLY A N     1 
ATOM   1863 C CA    . GLY E 3 48  ? 20.981  28.595  17.084 1.00 15.90  ? 400 GLY A CA    1 
ATOM   1864 C C     . GLY E 3 48  ? 20.167  27.347  16.878 1.00 17.21  ? 400 GLY A C     1 
ATOM   1865 O O     . GLY E 3 48  ? 20.280  26.406  17.658 1.00 19.46  ? 400 GLY A O     1 
ATOM   1866 N N     . ASN E 3 49  ? 19.393  27.321  15.792 1.00 20.24  ? 401 ASN A N     1 
ATOM   1867 C CA    . ASN E 3 49  ? 18.563  26.167  15.427 1.00 17.75  ? 401 ASN A CA    1 
ATOM   1868 C C     . ASN E 3 49  ? 19.379  24.892  15.211 1.00 11.93  ? 401 ASN A C     1 
ATOM   1869 O O     . ASN E 3 49  ? 18.975  23.830  15.657 1.00 18.44  ? 401 ASN A O     1 
ATOM   1870 C CB    . ASN E 3 49  ? 17.771  26.424  14.128 1.00 17.33  ? 401 ASN A CB    1 
ATOM   1871 C CG    . ASN E 3 49  ? 16.552  27.299  14.318 1.00 17.55  ? 401 ASN A CG    1 
ATOM   1872 O OD1   . ASN E 3 49  ? 15.672  27.016  15.130 1.00 25.41  ? 401 ASN A OD1   1 
ATOM   1873 N ND2   . ASN E 3 49  ? 16.457  28.326  13.507 1.00 22.59  ? 401 ASN A ND2   1 
ATOM   1874 N N     . SER E 3 50  ? 20.479  24.973  14.471 1.00 9.66   ? 402 SER A N     1 
ATOM   1875 C CA    . SER E 3 50  ? 21.269  23.772  14.200 1.00 12.84  ? 402 SER A CA    1 
ATOM   1876 C C     . SER E 3 50  ? 22.063  23.332  15.406 1.00 11.31  ? 402 SER A C     1 
ATOM   1877 O O     . SER E 3 50  ? 22.252  22.135  15.640 1.00 12.56  ? 402 SER A O     1 
ATOM   1878 C CB    . SER E 3 50  ? 22.168  23.927  12.956 1.00 4.79   ? 402 SER A CB    1 
ATOM   1879 O OG    . SER E 3 50  ? 23.094  24.981  13.073 1.00 6.39   ? 402 SER A OG    1 
ATOM   1880 N N     . ILE E 3 51  ? 22.514  24.305  16.183 1.00 12.89  ? 403 ILE A N     1 
ATOM   1881 C CA    . ILE E 3 51  ? 23.262  24.026  17.405 1.00 11.83  ? 403 ILE A CA    1 
ATOM   1882 C C     . ILE E 3 51  ? 22.350  23.361  18.447 1.00 12.44  ? 403 ILE A C     1 
ATOM   1883 O O     . ILE E 3 51  ? 22.698  22.328  19.025 1.00 19.31  ? 403 ILE A O     1 
ATOM   1884 C CB    . ILE E 3 51  ? 23.918  25.318  17.941 1.00 12.04  ? 403 ILE A CB    1 
ATOM   1885 C CG1   . ILE E 3 51  ? 25.005  25.760  16.963 1.00 7.13   ? 403 ILE A CG1   1 
ATOM   1886 C CG2   . ILE E 3 51  ? 24.516  25.108  19.316 1.00 9.35   ? 403 ILE A CG2   1 
ATOM   1887 C CD1   . ILE E 3 51  ? 25.536  27.131  17.218 1.00 8.36   ? 403 ILE A CD1   1 
ATOM   1888 N N     . ARG E 3 52  ? 21.141  23.876  18.610 1.00 12.16  ? 404 ARG A N     1 
ATOM   1889 C CA    . ARG E 3 52  ? 20.220  23.300  19.585 1.00 10.46  ? 404 ARG A CA    1 
ATOM   1890 C C     . ARG E 3 52  ? 19.880  21.882  19.215 1.00 11.91  ? 404 ARG A C     1 
ATOM   1891 O O     . ARG E 3 52  ? 19.990  20.981  20.040 1.00 18.68  ? 404 ARG A O     1 
ATOM   1892 C CB    . ARG E 3 52  ? 18.946  24.127  19.668 1.00 8.77   ? 404 ARG A CB    1 
ATOM   1893 C CG    . ARG E 3 52  ? 18.000  23.641  20.712 1.00 11.80  ? 404 ARG A CG    1 
ATOM   1894 C CD    . ARG E 3 52  ? 16.925  24.658  20.903 1.00 14.95  ? 404 ARG A CD    1 
ATOM   1895 N NE    . ARG E 3 52  ? 16.061  24.385  22.053 1.00 19.36  ? 404 ARG A NE    1 
ATOM   1896 C CZ    . ARG E 3 52  ? 15.097  23.474  22.082 1.00 18.50  ? 404 ARG A CZ    1 
ATOM   1897 N NH1   . ARG E 3 52  ? 14.851  22.719  21.034 1.00 23.13  ? 404 ARG A NH1   1 
ATOM   1898 N NH2   . ARG E 3 52  ? 14.359  23.338  23.161 1.00 21.78  ? 404 ARG A NH2   1 
ATOM   1899 N N     . HIS E 3 53  ? 19.496  21.687  17.958 1.00 12.87  ? 405 HIS A N     1 
ATOM   1900 C CA    . HIS E 3 53  ? 19.145  20.372  17.441 1.00 14.59  ? 405 HIS A CA    1 
ATOM   1901 C C     . HIS E 3 53  ? 20.336  19.430  17.558 1.00 16.79  ? 405 HIS A C     1 
ATOM   1902 O O     . HIS E 3 53  ? 20.188  18.270  17.946 1.00 18.62  ? 405 HIS A O     1 
ATOM   1903 C CB    . HIS E 3 53  ? 18.698  20.455  15.966 1.00 15.75  ? 405 HIS A CB    1 
ATOM   1904 C CG    . HIS E 3 53  ? 18.298  19.128  15.389 1.00 9.79   ? 405 HIS A CG    1 
ATOM   1905 N ND1   . HIS E 3 53  ? 17.033  18.607  15.540 1.00 16.71  ? 405 HIS A ND1   1 
ATOM   1906 C CD2   . HIS E 3 53  ? 19.025  18.173  14.771 1.00 8.44   ? 405 HIS A CD2   1 
ATOM   1907 C CE1   . HIS E 3 53  ? 16.997  17.379  15.054 1.00 11.94  ? 405 HIS A CE1   1 
ATOM   1908 N NE2   . HIS E 3 53  ? 18.194  17.091  14.580 1.00 13.62  ? 405 HIS A NE2   1 
ATOM   1909 N N     . ARG E 3 54  ? 21.499  19.905  17.135 1.00 15.28  ? 406 ARG A N     1 
ATOM   1910 C CA    . ARG E 3 54  ? 22.708  19.113  17.218 1.00 16.86  ? 406 ARG A CA    1 
ATOM   1911 C C     . ARG E 3 54  ? 22.885  18.666  18.665 1.00 18.36  ? 406 ARG A C     1 
ATOM   1912 O O     . ARG E 3 54  ? 23.121  17.491  18.943 1.00 19.17  ? 406 ARG A O     1 
ATOM   1913 C CB    . ARG E 3 54  ? 23.907  19.958  16.784 1.00 13.85  ? 406 ARG A CB    1 
ATOM   1914 C CG    . ARG E 3 54  ? 25.235  19.264  16.942 1.00 12.56  ? 406 ARG A CG    1 
ATOM   1915 C CD    . ARG E 3 54  ? 25.234  17.983  16.165 1.00 18.53  ? 406 ARG A CD    1 
ATOM   1916 N NE    . ARG E 3 54  ? 26.556  17.379  16.163 1.00 26.34  ? 406 ARG A NE    1 
ATOM   1917 C CZ    . ARG E 3 54  ? 26.895  16.353  15.399 1.00 22.92  ? 406 ARG A CZ    1 
ATOM   1918 N NH1   . ARG E 3 54  ? 26.010  15.826  14.578 1.00 29.03  ? 406 ARG A NH1   1 
ATOM   1919 N NH2   . ARG E 3 54  ? 28.100  15.834  15.480 1.00 25.05  ? 406 ARG A NH2   1 
ATOM   1920 N N     . PHE E 3 55  ? 22.781  19.613  19.590 1.00 19.87  ? 407 PHE A N     1 
ATOM   1921 C CA    . PHE E 3 55  ? 22.925  19.274  20.984 1.00 15.01  ? 407 PHE A CA    1 
ATOM   1922 C C     . PHE E 3 55  ? 21.846  18.277  21.414 1.00 17.64  ? 407 PHE A C     1 
ATOM   1923 O O     . PHE E 3 55  ? 22.153  17.145  21.771 1.00 18.35  ? 407 PHE A O     1 
ATOM   1924 C CB    . PHE E 3 55  ? 22.841  20.509  21.863 1.00 13.78  ? 407 PHE A CB    1 
ATOM   1925 C CG    . PHE E 3 55  ? 22.885  20.180  23.318 1.00 19.25  ? 407 PHE A CG    1 
ATOM   1926 C CD1   . PHE E 3 55  ? 24.060  19.699  23.890 1.00 16.37  ? 407 PHE A CD1   1 
ATOM   1927 C CD2   . PHE E 3 55  ? 21.730  20.240  24.096 1.00 17.15  ? 407 PHE A CD2   1 
ATOM   1928 C CE1   . PHE E 3 55  ? 24.080  19.294  25.201 1.00 17.32  ? 407 PHE A CE1   1 
ATOM   1929 C CE2   . PHE E 3 55  ? 21.749  19.836  25.412 1.00 17.66  ? 407 PHE A CE2   1 
ATOM   1930 C CZ    . PHE E 3 55  ? 22.918  19.356  25.962 1.00 12.59  ? 407 PHE A CZ    1 
ATOM   1931 N N     . ARG E 3 56  ? 20.590  18.713  21.368 1.00 18.77  ? 408 ARG A N     1 
ATOM   1932 C CA    . ARG E 3 56  ? 19.432  17.911  21.747 1.00 20.27  ? 408 ARG A CA    1 
ATOM   1933 C C     . ARG E 3 56  ? 19.458  16.477  21.276 1.00 24.00  ? 408 ARG A C     1 
ATOM   1934 O O     . ARG E 3 56  ? 19.385  15.552  22.071 1.00 32.21  ? 408 ARG A O     1 
ATOM   1935 C CB    . ARG E 3 56  ? 18.155  18.513  21.173 1.00 22.36  ? 408 ARG A CB    1 
ATOM   1936 C CG    . ARG E 3 56  ? 17.595  19.708  21.856 1.00 25.14  ? 408 ARG A CG    1 
ATOM   1937 C CD    . ARG E 3 56  ? 16.077  19.559  21.970 1.00 32.10  ? 408 ARG A CD    1 
ATOM   1938 N NE    . ARG E 3 56  ? 15.528  18.659  20.954 1.00 39.70  ? 408 ARG A NE    1 
ATOM   1939 C CZ    . ARG E 3 56  ? 14.529  17.804  21.161 1.00 42.56  ? 408 ARG A CZ    1 
ATOM   1940 N NH1   . ARG E 3 56  ? 13.946  17.729  22.357 1.00 43.36  ? 408 ARG A NH1   1 
ATOM   1941 N NH2   . ARG E 3 56  ? 14.143  16.991  20.184 1.00 34.42  ? 408 ARG A NH2   1 
ATOM   1942 N N     . VAL E 3 57  ? 19.508  16.302  19.966 1.00 23.51  ? 409 VAL A N     1 
ATOM   1943 C CA    . VAL E 3 57  ? 19.483  14.989  19.353 1.00 23.51  ? 409 VAL A CA    1 
ATOM   1944 C C     . VAL E 3 57  ? 20.801  14.201  19.292 1.00 26.99  ? 409 VAL A C     1 
ATOM   1945 O O     . VAL E 3 57  ? 20.790  12.967  19.388 1.00 27.12  ? 409 VAL A O     1 
ATOM   1946 C CB    . VAL E 3 57  ? 18.805  15.117  17.959 1.00 23.37  ? 409 VAL A CB    1 
ATOM   1947 C CG1   . VAL E 3 57  ? 19.094  13.916  17.049 1.00 14.72  ? 409 VAL A CG1   1 
ATOM   1948 C CG2   . VAL E 3 57  ? 17.304  15.279  18.174 1.00 20.35  ? 409 VAL A CG2   1 
ATOM   1949 N N     . TYR E 3 58  ? 21.934  14.890  19.182 1.00 27.58  ? 410 TYR A N     1 
ATOM   1950 C CA    . TYR E 3 58  ? 23.207  14.183  19.073 1.00 29.83  ? 410 TYR A CA    1 
ATOM   1951 C C     . TYR E 3 58  ? 24.130  14.305  20.269 1.00 32.70  ? 410 TYR A C     1 
ATOM   1952 O O     . TYR E 3 58  ? 24.618  13.300  20.794 1.00 35.16  ? 410 TYR A O     1 
ATOM   1953 C CB    . TYR E 3 58  ? 23.959  14.610  17.801 1.00 33.46  ? 410 TYR A CB    1 
ATOM   1954 C CG    . TYR E 3 58  ? 23.232  14.309  16.496 1.00 39.75  ? 410 TYR A CG    1 
ATOM   1955 C CD1   . TYR E 3 58  ? 23.166  13.007  15.992 1.00 42.13  ? 410 TYR A CD1   1 
ATOM   1956 C CD2   . TYR E 3 58  ? 22.599  15.324  15.771 1.00 42.07  ? 410 TYR A CD2   1 
ATOM   1957 C CE1   . TYR E 3 58  ? 22.488  12.724  14.801 1.00 41.56  ? 410 TYR A CE1   1 
ATOM   1958 C CE2   . TYR E 3 58  ? 21.918  15.050  14.581 1.00 43.92  ? 410 TYR A CE2   1 
ATOM   1959 C CZ    . TYR E 3 58  ? 21.867  13.749  14.103 1.00 43.91  ? 410 TYR A CZ    1 
ATOM   1960 O OH    . TYR E 3 58  ? 21.198  13.470  12.930 1.00 45.59  ? 410 TYR A OH    1 
ATOM   1961 N N     . LEU E 3 59  ? 24.370  15.532  20.710 1.00 30.06  ? 411 LEU A N     1 
ATOM   1962 C CA    . LEU E 3 59  ? 25.275  15.757  21.826 1.00 26.48  ? 411 LEU A CA    1 
ATOM   1963 C C     . LEU E 3 59  ? 24.792  15.439  23.241 1.00 27.41  ? 411 LEU A C     1 
ATOM   1964 O O     . LEU E 3 59  ? 25.610  15.154  24.109 1.00 26.23  ? 411 LEU A O     1 
ATOM   1965 C CB    . LEU E 3 59  ? 25.814  17.185  21.784 1.00 23.27  ? 411 LEU A CB    1 
ATOM   1966 C CG    . LEU E 3 59  ? 26.468  17.608  20.475 1.00 9.29   ? 411 LEU A CG    1 
ATOM   1967 C CD1   . LEU E 3 59  ? 27.055  18.980  20.626 1.00 12.63  ? 411 LEU A CD1   1 
ATOM   1968 C CD2   . LEU E 3 59  ? 27.557  16.619  20.117 1.00 16.65  ? 411 LEU A CD2   1 
ATOM   1969 N N     . SER E 3 60  ? 23.487  15.479  23.487 1.00 28.77  ? 412 SER A N     1 
ATOM   1970 C CA    . SER E 3 60  ? 22.955  15.218  24.830 1.00 27.70  ? 412 SER A CA    1 
ATOM   1971 C C     . SER E 3 60  ? 23.357  13.866  25.420 1.00 30.48  ? 412 SER A C     1 
ATOM   1972 O O     . SER E 3 60  ? 23.603  13.753  26.618 1.00 32.30  ? 412 SER A O     1 
ATOM   1973 C CB    . SER E 3 60  ? 21.438  15.376  24.846 1.00 24.89  ? 412 SER A CB    1 
ATOM   1974 O OG    . SER E 3 60  ? 20.835  14.471  23.943 1.00 28.09  ? 412 SER A OG    1 
ATOM   1975 N N     . LYS E 3 61  ? 23.464  12.848  24.576 1.00 34.08  ? 413 LYS A N     1 
ATOM   1976 C CA    . LYS E 3 61  ? 23.860  11.515  25.026 1.00 36.34  ? 413 LYS A CA    1 
ATOM   1977 C C     . LYS E 3 61  ? 25.307  11.512  25.532 1.00 33.56  ? 413 LYS A C     1 
ATOM   1978 O O     . LYS E 3 61  ? 25.763  10.520  26.089 1.00 37.45  ? 413 LYS A O     1 
ATOM   1979 C CB    . LYS E 3 61  ? 23.715  10.499  23.882 1.00 43.68  ? 413 LYS A CB    1 
ATOM   1980 C CG    . LYS E 3 61  ? 22.332  10.480  23.210 1.00 53.10  ? 413 LYS A CG    1 
ATOM   1981 C CD    . LYS E 3 61  ? 22.243  9.473   22.058 1.00 59.27  ? 413 LYS A CD    1 
ATOM   1982 C CE    . LYS E 3 61  ? 23.076  9.894   20.848 1.00 64.99  ? 413 LYS A CE    1 
ATOM   1983 N NZ    . LYS E 3 61  ? 24.552  9.811   21.081 1.00 69.85  ? 413 LYS A NZ    1 
ATOM   1984 N N     . ARG E 3 62  ? 26.020  12.615  25.311 1.00 32.47  ? 414 ARG A N     1 
ATOM   1985 C CA    . ARG E 3 62  ? 27.414  12.784  25.728 1.00 31.04  ? 414 ARG A CA    1 
ATOM   1986 C C     . ARG E 3 62  ? 27.587  13.832  26.840 1.00 30.99  ? 414 ARG A C     1 
ATOM   1987 O O     . ARG E 3 62  ? 28.721  14.154  27.210 1.00 33.29  ? 414 ARG A O     1 
ATOM   1988 C CB    . ARG E 3 62  ? 28.273  13.294  24.568 1.00 31.51  ? 414 ARG A CB    1 
ATOM   1989 C CG    . ARG E 3 62  ? 28.379  12.478  23.320 1.00 32.04  ? 414 ARG A CG    1 
ATOM   1990 C CD    . ARG E 3 62  ? 29.679  12.907  22.668 1.00 32.87  ? 414 ARG A CD    1 
ATOM   1991 N NE    . ARG E 3 62  ? 29.573  13.153  21.235 1.00 37.31  ? 414 ARG A NE    1 
ATOM   1992 C CZ    . ARG E 3 62  ? 30.432  13.906  20.546 1.00 39.93  ? 414 ARG A CZ    1 
ATOM   1993 N NH1   . ARG E 3 62  ? 31.457  14.491  21.165 1.00 39.77  ? 414 ARG A NH1   1 
ATOM   1994 N NH2   . ARG E 3 62  ? 30.278  14.059  19.234 1.00 37.68  ? 414 ARG A NH2   1 
ATOM   1995 N N     . LEU E 3 63  ? 26.501  14.440  27.309 1.00 28.92  ? 415 LEU A N     1 
ATOM   1996 C CA    . LEU E 3 63  ? 26.638  15.456  28.353 1.00 28.25  ? 415 LEU A CA    1 
ATOM   1997 C C     . LEU E 3 63  ? 27.424  14.862  29.512 1.00 28.42  ? 415 LEU A C     1 
ATOM   1998 O O     . LEU E 3 63  ? 28.481  15.373  29.874 1.00 28.40  ? 415 LEU A O     1 
ATOM   1999 C CB    . LEU E 3 63  ? 25.274  15.938  28.856 1.00 24.30  ? 415 LEU A CB    1 
ATOM   2000 C CG    . LEU E 3 63  ? 24.939  17.433  28.907 1.00 19.71  ? 415 LEU A CG    1 
ATOM   2001 C CD1   . LEU E 3 63  ? 24.006  17.636  30.075 1.00 22.25  ? 415 LEU A CD1   1 
ATOM   2002 C CD2   . LEU E 3 63  ? 26.154  18.323  29.050 1.00 6.39   ? 415 LEU A CD2   1 
ATOM   2003 N N     . GLU E 3 64  ? 26.900  13.766  30.057 1.00 29.53  ? 416 GLU A N     1 
ATOM   2004 C CA    . GLU E 3 64  ? 27.498  13.042  31.177 1.00 32.90  ? 416 GLU A CA    1 
ATOM   2005 C C     . GLU E 3 64  ? 27.437  13.790  32.494 1.00 29.16  ? 416 GLU A C     1 
ATOM   2006 O O     . GLU E 3 64  ? 27.079  13.217  33.513 1.00 31.86  ? 416 GLU A O     1 
ATOM   2007 C CB    . GLU E 3 64  ? 28.946  12.624  30.874 1.00 36.97  ? 416 GLU A CB    1 
ATOM   2008 C CG    . GLU E 3 64  ? 29.107  11.171  30.401 1.00 47.06  ? 416 GLU A CG    1 
ATOM   2009 C CD    . GLU E 3 64  ? 30.533  10.840  29.947 1.00 55.62  ? 416 GLU A CD    1 
ATOM   2010 O OE1   . GLU E 3 64  ? 31.501  11.122  30.695 1.00 56.64  ? 416 GLU A OE1   1 
ATOM   2011 O OE2   . GLU E 3 64  ? 30.685  10.299  28.824 1.00 59.13  ? 416 GLU A OE2   1 
ATOM   2012 N N     . TYR E 3 65  ? 27.702  15.087  32.457 1.00 25.71  ? 417 TYR A N     1 
ATOM   2013 C CA    . TYR E 3 65  ? 27.713  15.875  33.663 1.00 20.77  ? 417 TYR A CA    1 
ATOM   2014 C C     . TYR E 3 65  ? 27.636  17.325  33.262 1.00 22.70  ? 417 TYR A C     1 
ATOM   2015 O O     . TYR E 3 65  ? 27.855  17.666  32.104 1.00 26.36  ? 417 TYR A O     1 
ATOM   2016 C CB    . TYR E 3 65  ? 29.047  15.651  34.408 1.00 22.57  ? 417 TYR A CB    1 
ATOM   2017 C CG    . TYR E 3 65  ? 30.276  16.209  33.684 1.00 18.81  ? 417 TYR A CG    1 
ATOM   2018 C CD1   . TYR E 3 65  ? 30.945  15.455  32.709 1.00 18.63  ? 417 TYR A CD1   1 
ATOM   2019 C CD2   . TYR E 3 65  ? 30.747  17.496  33.952 1.00 13.39  ? 417 TYR A CD2   1 
ATOM   2020 C CE1   . TYR E 3 65  ? 32.043  15.970  32.022 1.00 16.46  ? 417 TYR A CE1   1 
ATOM   2021 C CE2   . TYR E 3 65  ? 31.839  18.020  33.267 1.00 14.12  ? 417 TYR A CE2   1 
ATOM   2022 C CZ    . TYR E 3 65  ? 32.486  17.249  32.302 1.00 17.94  ? 417 TYR A CZ    1 
ATOM   2023 O OH    . TYR E 3 65  ? 33.579  17.762  31.615 1.00 20.37  ? 417 TYR A OH    1 
ATOM   2024 N N     . VAL E 3 66  ? 27.279  18.163  34.228 1.00 21.49  ? 418 VAL A N     1 
ATOM   2025 C CA    . VAL E 3 66  ? 27.240  19.603  34.067 1.00 19.02  ? 418 VAL A CA    1 
ATOM   2026 C C     . VAL E 3 66  ? 28.001  20.122  35.287 1.00 21.03  ? 418 VAL A C     1 
ATOM   2027 O O     . VAL E 3 66  ? 28.541  19.342  36.066 1.00 19.60  ? 418 VAL A O     1 
ATOM   2028 C CB    . VAL E 3 66  ? 25.798  20.186  34.010 1.00 18.64  ? 418 VAL A CB    1 
ATOM   2029 C CG1   . VAL E 3 66  ? 25.161  19.866  32.666 1.00 21.14  ? 418 VAL A CG1   1 
ATOM   2030 C CG2   . VAL E 3 66  ? 24.930  19.654  35.150 1.00 19.44  ? 418 VAL A CG2   1 
ATOM   2031 N N     . TYR E 3 67  ? 28.148  21.428  35.397 1.00 21.78  ? 419 TYR A N     1 
ATOM   2032 C CA    . TYR E 3 67  ? 28.838  21.990  36.532 1.00 21.83  ? 419 TYR A CA    1 
ATOM   2033 C C     . TYR E 3 67  ? 27.739  22.599  37.402 1.00 25.26  ? 419 TYR A C     1 
ATOM   2034 O O     . TYR E 3 67  ? 26.731  23.102  36.880 1.00 27.99  ? 419 TYR A O     1 
ATOM   2035 C CB    . TYR E 3 67  ? 29.861  23.032  36.073 1.00 17.75  ? 419 TYR A CB    1 
ATOM   2036 C CG    . TYR E 3 67  ? 30.993  22.454  35.237 1.00 22.48  ? 419 TYR A CG    1 
ATOM   2037 C CD1   . TYR E 3 67  ? 31.995  21.675  35.814 1.00 19.74  ? 419 TYR A CD1   1 
ATOM   2038 C CD2   . TYR E 3 67  ? 31.073  22.710  33.872 1.00 21.88  ? 419 TYR A CD2   1 
ATOM   2039 C CE1   . TYR E 3 67  ? 33.046  21.177  35.050 1.00 21.86  ? 419 TYR A CE1   1 
ATOM   2040 C CE2   . TYR E 3 67  ? 32.115  22.214  33.104 1.00 24.44  ? 419 TYR A CE2   1 
ATOM   2041 C CZ    . TYR E 3 67  ? 33.095  21.453  33.692 1.00 26.50  ? 419 TYR A CZ    1 
ATOM   2042 O OH    . TYR E 3 67  ? 34.121  20.971  32.905 1.00 35.38  ? 419 TYR A OH    1 
ATOM   2043 N N     . GLU E 3 68  ? 27.878  22.497  38.720 1.00 21.98  ? 420 GLU A N     1 
ATOM   2044 C CA    . GLU E 3 68  ? 26.840  23.033  39.569 1.00 20.91  ? 420 GLU A CA    1 
ATOM   2045 C C     . GLU E 3 68  ? 26.910  24.529  39.678 1.00 14.91  ? 420 GLU A C     1 
ATOM   2046 O O     . GLU E 3 68  ? 27.983  25.118  39.617 1.00 15.62  ? 420 GLU A O     1 
ATOM   2047 C CB    . GLU E 3 68  ? 26.839  22.373  40.951 1.00 29.39  ? 420 GLU A CB    1 
ATOM   2048 C CG    . GLU E 3 68  ? 27.812  22.955  41.955 1.00 39.74  ? 420 GLU A CG    1 
ATOM   2049 C CD    . GLU E 3 68  ? 27.359  22.750  43.394 1.00 47.16  ? 420 GLU A CD    1 
ATOM   2050 O OE1   . GLU E 3 68  ? 26.236  22.236  43.605 1.00 50.02  ? 420 GLU A OE1   1 
ATOM   2051 O OE2   . GLU E 3 68  ? 28.117  23.119  44.316 1.00 50.95  ? 420 GLU A OE2   1 
ATOM   2052 N N     . VAL E 3 69  ? 25.733  25.140  39.786 1.00 17.40  ? 421 VAL A N     1 
ATOM   2053 C CA    . VAL E 3 69  ? 25.590  26.584  39.916 1.00 20.13  ? 421 VAL A CA    1 
ATOM   2054 C C     . VAL E 3 69  ? 24.891  26.858  41.249 1.00 19.90  ? 421 VAL A C     1 
ATOM   2055 O O     . VAL E 3 69  ? 24.235  25.965  41.801 1.00 22.21  ? 421 VAL A O     1 
ATOM   2056 C CB    . VAL E 3 69  ? 24.729  27.186  38.761 1.00 20.28  ? 421 VAL A CB    1 
ATOM   2057 C CG1   . VAL E 3 69  ? 25.510  27.207  37.450 1.00 20.49  ? 421 VAL A CG1   1 
ATOM   2058 C CG2   . VAL E 3 69  ? 23.437  26.404  38.602 1.00 18.05  ? 421 VAL A CG2   1 
ATOM   2059 N N     . ASP E 3 70  ? 25.058  28.064  41.774 1.00 24.50  ? 422 ASP A N     1 
ATOM   2060 C CA    . ASP E 3 70  ? 24.436  28.476  43.038 1.00 27.18  ? 422 ASP A CA    1 
ATOM   2061 C C     . ASP E 3 70  ? 23.040  29.072  42.823 1.00 28.99  ? 422 ASP A C     1 
ATOM   2062 O O     . ASP E 3 70  ? 22.553  29.137  41.697 1.00 31.51  ? 422 ASP A O     1 
ATOM   2063 C CB    . ASP E 3 70  ? 25.359  29.446  43.827 1.00 22.95  ? 422 ASP A CB    1 
ATOM   2064 C CG    . ASP E 3 70  ? 25.551  30.802  43.138 1.00 21.13  ? 422 ASP A CG    1 
ATOM   2065 O OD1   . ASP E 3 70  ? 24.763  31.177  42.256 1.00 26.88  ? 422 ASP A OD1   1 
ATOM   2066 O OD2   . ASP E 3 70  ? 26.497  31.535  43.512 1.00 23.59  ? 422 ASP A OD2   1 
ATOM   2067 N N     . LYS E 3 71  ? 22.407  29.549  43.899 1.00 32.75  ? 423 LYS A N     1 
ATOM   2068 C CA    . LYS E 3 71  ? 21.073  30.140  43.786 1.00 32.93  ? 423 LYS A CA    1 
ATOM   2069 C C     . LYS E 3 71  ? 20.986  31.460  43.016 1.00 35.58  ? 423 LYS A C     1 
ATOM   2070 O O     . LYS E 3 71  ? 19.898  31.915  42.699 1.00 40.97  ? 423 LYS A O     1 
ATOM   2071 C CB    . LYS E 3 71  ? 20.394  30.288  45.160 1.00 34.25  ? 423 LYS A CB    1 
ATOM   2072 C CG    . LYS E 3 71  ? 21.309  30.727  46.315 1.00 39.65  ? 423 LYS A CG    1 
ATOM   2073 C CD    . LYS E 3 71  ? 20.559  31.543  47.369 1.00 36.38  ? 423 LYS A CD    1 
ATOM   2074 C CE    . LYS E 3 71  ? 21.350  31.678  48.667 1.00 39.51  ? 423 LYS A CE    1 
ATOM   2075 N NZ    . LYS E 3 71  ? 21.515  30.357  49.385 1.00 38.84  ? 423 LYS A NZ    1 
ATOM   2076 N N     . PHE E 3 72  ? 22.129  32.098  42.762 1.00 35.36  ? 424 PHE A N     1 
ATOM   2077 C CA    . PHE E 3 72  ? 22.160  33.355  42.012 1.00 34.27  ? 424 PHE A CA    1 
ATOM   2078 C C     . PHE E 3 72  ? 22.393  33.068  40.528 1.00 33.36  ? 424 PHE A C     1 
ATOM   2079 O O     . PHE E 3 72  ? 22.697  33.984  39.751 1.00 38.15  ? 424 PHE A O     1 
ATOM   2080 C CB    . PHE E 3 72  ? 23.268  34.273  42.554 1.00 36.33  ? 424 PHE A CB    1 
ATOM   2081 C CG    . PHE E 3 72  ? 23.240  34.460  44.054 1.00 40.96  ? 424 PHE A CG    1 
ATOM   2082 C CD1   . PHE E 3 72  ? 22.485  35.485  44.640 1.00 42.94  ? 424 PHE A CD1   1 
ATOM   2083 C CD2   . PHE E 3 72  ? 23.959  33.604  44.890 1.00 42.34  ? 424 PHE A CD2   1 
ATOM   2084 C CE1   . PHE E 3 72  ? 22.452  35.654  46.040 1.00 40.14  ? 424 PHE A CE1   1 
ATOM   2085 C CE2   . PHE E 3 72  ? 23.932  33.764  46.288 1.00 43.46  ? 424 PHE A CE2   1 
ATOM   2086 C CZ    . PHE E 3 72  ? 23.179  34.797  46.860 1.00 39.59  ? 424 PHE A CZ    1 
ATOM   2087 N N     . GLY E 3 73  ? 22.261  31.794  40.148 1.00 27.15  ? 425 GLY A N     1 
ATOM   2088 C CA    . GLY E 3 73  ? 22.460  31.383  38.771 1.00 27.76  ? 425 GLY A CA    1 
ATOM   2089 C C     . GLY E 3 73  ? 23.912  31.312  38.312 1.00 25.17  ? 425 GLY A C     1 
ATOM   2090 O O     . GLY E 3 73  ? 24.179  30.975  37.160 1.00 25.64  ? 425 GLY A O     1 
ATOM   2091 N N     . LYS E 3 74  ? 24.844  31.609  39.216 1.00 21.91  ? 426 LYS A N     1 
ATOM   2092 C CA    . LYS E 3 74  ? 26.274  31.593  38.927 1.00 20.64  ? 426 LYS A CA    1 
ATOM   2093 C C     . LYS E 3 74  ? 26.948  30.235  39.186 1.00 20.47  ? 426 LYS A C     1 
ATOM   2094 O O     . LYS E 3 74  ? 26.431  29.403  39.910 1.00 21.79  ? 426 LYS A O     1 
ATOM   2095 C CB    . LYS E 3 74  ? 26.965  32.708  39.711 1.00 18.33  ? 426 LYS A CB    1 
ATOM   2096 C CG    . LYS E 3 74  ? 26.337  34.083  39.481 1.00 20.31  ? 426 LYS A CG    1 
ATOM   2097 C CD    . LYS E 3 74  ? 27.257  35.203  39.944 1.00 28.55  ? 426 LYS A CD    1 
ATOM   2098 C CE    . LYS E 3 74  ? 26.530  36.547  40.077 1.00 35.34  ? 426 LYS A CE    1 
ATOM   2099 N NZ    . LYS E 3 74  ? 25.775  36.946  38.859 1.00 35.16  ? 426 LYS A NZ    1 
ATOM   2100 N N     . LEU E 3 75  ? 28.074  29.986  38.536 1.00 20.19  ? 427 LEU A N     1 
ATOM   2101 C CA    . LEU E 3 75  ? 28.774  28.726  38.714 1.00 19.01  ? 427 LEU A CA    1 
ATOM   2102 C C     . LEU E 3 75  ? 29.427  28.692  40.101 1.00 21.12  ? 427 LEU A C     1 
ATOM   2103 O O     . LEU E 3 75  ? 29.793  29.734  40.648 1.00 17.22  ? 427 LEU A O     1 
ATOM   2104 C CB    . LEU E 3 75  ? 29.861  28.574  37.652 1.00 10.39  ? 427 LEU A CB    1 
ATOM   2105 C CG    . LEU E 3 75  ? 29.508  28.127  36.243 1.00 8.38   ? 427 LEU A CG    1 
ATOM   2106 C CD1   . LEU E 3 75  ? 30.638  28.509  35.312 1.00 6.24   ? 427 LEU A CD1   1 
ATOM   2107 C CD2   . LEU E 3 75  ? 29.253  26.615  36.209 1.00 2.96   ? 427 LEU A CD2   1 
ATOM   2108 N N     . VAL E 3 76  ? 29.554  27.497  40.667 1.00 22.00  ? 428 VAL A N     1 
ATOM   2109 C CA    . VAL E 3 76  ? 30.196  27.346  41.958 1.00 21.95  ? 428 VAL A CA    1 
ATOM   2110 C C     . VAL E 3 76  ? 31.690  27.169  41.715 1.00 22.18  ? 428 VAL A C     1 
ATOM   2111 O O     . VAL E 3 76  ? 32.100  26.324  40.920 1.00 21.63  ? 428 VAL A O     1 
ATOM   2112 C CB    . VAL E 3 76  ? 29.625  26.144  42.716 1.00 20.71  ? 428 VAL A CB    1 
ATOM   2113 C CG1   . VAL E 3 76  ? 30.518  25.788  43.900 1.00 17.31  ? 428 VAL A CG1   1 
ATOM   2114 C CG2   . VAL E 3 76  ? 28.227  26.481  43.200 1.00 14.95  ? 428 VAL A CG2   1 
ATOM   2115 N N     . ARG E 3 77  ? 32.493  28.026  42.330 1.00 23.38  ? 429 ARG A N     1 
ATOM   2116 C CA    . ARG E 3 77  ? 33.937  27.941  42.180 1.00 32.53  ? 429 ARG A CA    1 
ATOM   2117 C C     . ARG E 3 77  ? 34.601  27.813  43.535 1.00 35.96  ? 429 ARG A C     1 
ATOM   2118 O O     . ARG E 3 77  ? 34.109  28.363  44.513 1.00 38.16  ? 429 ARG A O     1 
ATOM   2119 C CB    . ARG E 3 77  ? 34.485  29.172  41.463 1.00 35.36  ? 429 ARG A CB    1 
ATOM   2120 C CG    . ARG E 3 77  ? 34.337  29.106  39.965 1.00 36.77  ? 429 ARG A CG    1 
ATOM   2121 C CD    . ARG E 3 77  ? 34.685  30.433  39.332 1.00 40.63  ? 429 ARG A CD    1 
ATOM   2122 N NE    . ARG E 3 77  ? 36.113  30.634  39.092 1.00 34.85  ? 429 ARG A NE    1 
ATOM   2123 C CZ    . ARG E 3 77  ? 36.769  31.751  39.399 1.00 31.57  ? 429 ARG A CZ    1 
ATOM   2124 N NH1   . ARG E 3 77  ? 36.128  32.765  39.982 1.00 28.42  ? 429 ARG A NH1   1 
ATOM   2125 N NH2   . ARG E 3 77  ? 38.041  31.895  39.031 1.00 28.53  ? 429 ARG A NH2   1 
ATOM   2126 N N     . ASP E 3 78  ? 35.691  27.049  43.594 1.00 38.42  ? 430 ASP A N     1 
ATOM   2127 C CA    . ASP E 3 78  ? 36.432  26.858  44.835 1.00 40.11  ? 430 ASP A CA    1 
ATOM   2128 C C     . ASP E 3 78  ? 37.529  27.901  45.053 1.00 46.24  ? 430 ASP A C     1 
ATOM   2129 O O     . ASP E 3 78  ? 37.658  28.861  44.286 1.00 46.78  ? 430 ASP A O     1 
ATOM   2130 C CB    . ASP E 3 78  ? 37.023  25.436  44.918 1.00 37.05  ? 430 ASP A CB    1 
ATOM   2131 C CG    . ASP E 3 78  ? 38.125  25.166  43.885 1.00 36.12  ? 430 ASP A CG    1 
ATOM   2132 O OD1   . ASP E 3 78  ? 38.747  26.114  43.358 1.00 32.54  ? 430 ASP A OD1   1 
ATOM   2133 O OD2   . ASP E 3 78  ? 38.386  23.972  43.610 1.00 35.83  ? 430 ASP A OD2   1 
ATOM   2134 N N     . ASP E 3 79  ? 38.390  27.610  46.028 1.00 50.34  ? 431 ASP A N     1 
ATOM   2135 C CA    . ASP E 3 79  ? 39.512  28.459  46.427 1.00 54.72  ? 431 ASP A CA    1 
ATOM   2136 C C     . ASP E 3 79  ? 40.385  28.929  45.263 1.00 55.47  ? 431 ASP A C     1 
ATOM   2137 O O     . ASP E 3 79  ? 40.753  30.099  45.186 1.00 57.07  ? 431 ASP A O     1 
ATOM   2138 C CB    . ASP E 3 79  ? 40.406  27.702  47.419 1.00 63.37  ? 431 ASP A CB    1 
ATOM   2139 C CG    . ASP E 3 79  ? 39.610  26.939  48.477 1.00 71.29  ? 431 ASP A CG    1 
ATOM   2140 O OD1   . ASP E 3 79  ? 39.140  25.810  48.181 1.00 70.39  ? 431 ASP A OD1   1 
ATOM   2141 O OD2   . ASP E 3 79  ? 39.472  27.466  49.606 1.00 73.84  ? 431 ASP A OD2   1 
ATOM   2142 N N     . ASP E 3 80  ? 40.721  27.998  44.373 1.00 53.42  ? 432 ASP A N     1 
ATOM   2143 C CA    . ASP E 3 80  ? 41.580  28.278  43.225 1.00 50.10  ? 432 ASP A CA    1 
ATOM   2144 C C     . ASP E 3 80  ? 40.824  28.617  41.950 1.00 45.19  ? 432 ASP A C     1 
ATOM   2145 O O     . ASP E 3 80  ? 41.455  28.851  40.922 1.00 45.99  ? 432 ASP A O     1 
ATOM   2146 C CB    . ASP E 3 80  ? 42.477  27.068  42.919 1.00 53.75  ? 432 ASP A CB    1 
ATOM   2147 C CG    . ASP E 3 80  ? 42.787  26.238  44.147 1.00 57.88  ? 432 ASP A CG    1 
ATOM   2148 O OD1   . ASP E 3 80  ? 43.333  26.793  45.123 1.00 62.94  ? 432 ASP A OD1   1 
ATOM   2149 O OD2   . ASP E 3 80  ? 42.479  25.026  44.137 1.00 61.11  ? 432 ASP A OD2   1 
ATOM   2150 N N     . GLY E 3 81  ? 39.494  28.582  41.996 1.00 40.17  ? 433 GLY A N     1 
ATOM   2151 C CA    . GLY E 3 81  ? 38.706  28.869  40.809 1.00 36.83  ? 433 GLY A CA    1 
ATOM   2152 C C     . GLY E 3 81  ? 38.250  27.661  39.993 1.00 40.07  ? 433 GLY A C     1 
ATOM   2153 O O     . GLY E 3 81  ? 37.823  27.803  38.846 1.00 40.77  ? 433 GLY A O     1 
ATOM   2154 N N     . ASN E 3 82  ? 38.338  26.468  40.572 1.00 39.66  ? 434 ASN A N     1 
ATOM   2155 C CA    . ASN E 3 82  ? 37.906  25.242  39.891 1.00 36.70  ? 434 ASN A CA    1 
ATOM   2156 C C     . ASN E 3 82  ? 36.394  25.051  40.046 1.00 33.10  ? 434 ASN A C     1 
ATOM   2157 O O     . ASN E 3 82  ? 35.802  25.467  41.052 1.00 25.73  ? 434 ASN A O     1 
ATOM   2158 C CB    . ASN E 3 82  ? 38.607  24.007  40.475 1.00 44.87  ? 434 ASN A CB    1 
ATOM   2159 C CG    . ASN E 3 82  ? 40.115  24.058  40.340 1.00 50.74  ? 434 ASN A CG    1 
ATOM   2160 O OD1   . ASN E 3 82  ? 40.654  24.410  39.283 1.00 44.78  ? 434 ASN A OD1   1 
ATOM   2161 N ND2   . ASN E 3 82  ? 40.808  23.682  41.411 1.00 52.53  ? 434 ASN A ND2   1 
ATOM   2162 N N     . LEU E 3 83  ? 35.791  24.364  39.080 1.00 29.40  ? 435 LEU A N     1 
ATOM   2163 C CA    . LEU E 3 83  ? 34.349  24.105  39.086 1.00 29.46  ? 435 LEU A CA    1 
ATOM   2164 C C     . LEU E 3 83  ? 33.995  22.742  39.704 1.00 26.83  ? 435 LEU A C     1 
ATOM   2165 O O     . LEU E 3 83  ? 34.875  21.911  39.907 1.00 29.34  ? 435 LEU A O     1 
ATOM   2166 C CB    . LEU E 3 83  ? 33.808  24.191  37.648 1.00 26.70  ? 435 LEU A CB    1 
ATOM   2167 C CG    . LEU E 3 83  ? 34.005  25.530  36.941 1.00 17.53  ? 435 LEU A CG    1 
ATOM   2168 C CD1   . LEU E 3 83  ? 33.393  25.486  35.555 1.00 12.50  ? 435 LEU A CD1   1 
ATOM   2169 C CD2   . LEU E 3 83  ? 33.364  26.623  37.766 1.00 17.73  ? 435 LEU A CD2   1 
ATOM   2170 N N     . ILE E 3 84  ? 32.711  22.505  39.975 1.00 24.53  ? 436 ILE A N     1 
ATOM   2171 C CA    . ILE E 3 84  ? 32.252  21.238  40.557 1.00 19.36  ? 436 ILE A CA    1 
ATOM   2172 C C     . ILE E 3 84  ? 31.276  20.491  39.632 1.00 21.34  ? 436 ILE A C     1 
ATOM   2173 O O     . ILE E 3 84  ? 30.201  21.012  39.307 1.00 17.76  ? 436 ILE A O     1 
ATOM   2174 C CB    . ILE E 3 84  ? 31.576  21.468  41.933 1.00 20.31  ? 436 ILE A CB    1 
ATOM   2175 C CG1   . ILE E 3 84  ? 32.529  22.213  42.867 1.00 21.78  ? 436 ILE A CG1   1 
ATOM   2176 C CG2   . ILE E 3 84  ? 31.174  20.145  42.561 1.00 12.45  ? 436 ILE A CG2   1 
ATOM   2177 C CD1   . ILE E 3 84  ? 31.920  22.581  44.201 1.00 32.35  ? 436 ILE A CD1   1 
ATOM   2178 N N     . LYS E 3 85  ? 31.668  19.281  39.211 1.00 24.65  ? 437 LYS A N     1 
ATOM   2179 C CA    . LYS E 3 85  ? 30.872  18.417  38.328 1.00 21.12  ? 437 LYS A CA    1 
ATOM   2180 C C     . LYS E 3 85  ? 29.648  17.832  39.037 1.00 24.95  ? 437 LYS A C     1 
ATOM   2181 O O     . LYS E 3 85  ? 29.654  17.669  40.259 1.00 23.08  ? 437 LYS A O     1 
ATOM   2182 C CB    . LYS E 3 85  ? 31.756  17.300  37.755 1.00 15.73  ? 437 LYS A CB    1 
ATOM   2183 C CG    . LYS E 3 85  ? 32.836  17.846  36.856 1.00 18.67  ? 437 LYS A CG    1 
ATOM   2184 C CD    . LYS E 3 85  ? 33.836  16.811  36.389 1.00 19.21  ? 437 LYS A CD    1 
ATOM   2185 C CE    . LYS E 3 85  ? 33.176  15.610  35.729 1.00 24.40  ? 437 LYS A CE    1 
ATOM   2186 N NZ    . LYS E 3 85  ? 34.161  14.830  34.886 1.00 16.60  ? 437 LYS A NZ    1 
ATOM   2187 N N     . THR E 3 86  ? 28.586  17.560  38.281 1.00 28.09  ? 438 THR A N     1 
ATOM   2188 C CA    . THR E 3 86  ? 27.372  17.001  38.857 1.00 27.53  ? 438 THR A CA    1 
ATOM   2189 C C     . THR E 3 86  ? 26.475  16.337  37.808 1.00 29.50  ? 438 THR A C     1 
ATOM   2190 O O     . THR E 3 86  ? 26.397  16.790  36.672 1.00 32.27  ? 438 THR A O     1 
ATOM   2191 C CB    . THR E 3 86  ? 26.581  18.087  39.641 1.00 27.87  ? 438 THR A CB    1 
ATOM   2192 O OG1   . THR E 3 86  ? 25.480  17.483  40.337 1.00 35.13  ? 438 THR A OG1   1 
ATOM   2193 C CG2   . THR E 3 86  ? 26.049  19.155  38.713 1.00 25.63  ? 438 THR A CG2   1 
ATOM   2194 N N     . LYS E 3 87  ? 25.852  15.222  38.181 1.00 28.77  ? 439 LYS A N     1 
ATOM   2195 C CA    . LYS E 3 87  ? 24.951  14.501  37.293 1.00 28.43  ? 439 LYS A CA    1 
ATOM   2196 C C     . LYS E 3 87  ? 23.520  14.893  37.644 1.00 28.81  ? 439 LYS A C     1 
ATOM   2197 O O     . LYS E 3 87  ? 22.548  14.310  37.159 1.00 33.99  ? 439 LYS A O     1 
ATOM   2198 C CB    . LYS E 3 87  ? 25.149  12.994  37.455 1.00 25.72  ? 439 LYS A CB    1 
ATOM   2199 C CG    . LYS E 3 87  ? 26.346  12.436  36.696 1.00 27.98  ? 439 LYS A CG    1 
ATOM   2200 C CD    . LYS E 3 87  ? 26.491  10.940  36.935 1.00 33.27  ? 439 LYS A CD    1 
ATOM   2201 C CE    . LYS E 3 87  ? 27.645  10.330  36.147 1.00 36.35  ? 439 LYS A CE    1 
ATOM   2202 N NZ    . LYS E 3 87  ? 27.390  10.309  34.670 1.00 42.70  ? 439 LYS A NZ    1 
ATOM   2203 N N     . VAL E 3 88  ? 23.412  15.880  38.521 1.00 30.71  ? 440 VAL A N     1 
ATOM   2204 C CA    . VAL E 3 88  ? 22.138  16.393  38.983 1.00 32.86  ? 440 VAL A CA    1 
ATOM   2205 C C     . VAL E 3 88  ? 21.872  17.745  38.336 1.00 34.15  ? 440 VAL A C     1 
ATOM   2206 O O     . VAL E 3 88  ? 22.475  18.758  38.705 1.00 34.91  ? 440 VAL A O     1 
ATOM   2207 C CB    . VAL E 3 88  ? 22.141  16.554  40.517 1.00 36.07  ? 440 VAL A CB    1 
ATOM   2208 C CG1   . VAL E 3 88  ? 20.748  16.970  41.014 1.00 35.53  ? 440 VAL A CG1   1 
ATOM   2209 C CG2   . VAL E 3 88  ? 22.603  15.243  41.178 1.00 40.10  ? 440 VAL A CG2   1 
ATOM   2210 N N     . LEU E 3 89  ? 20.972  17.747  37.361 1.00 33.43  ? 441 LEU A N     1 
ATOM   2211 C CA    . LEU E 3 89  ? 20.612  18.953  36.642 1.00 29.90  ? 441 LEU A CA    1 
ATOM   2212 C C     . LEU E 3 89  ? 19.917  19.963  37.547 1.00 31.94  ? 441 LEU A C     1 
ATOM   2213 O O     . LEU E 3 89  ? 19.047  19.598  38.336 1.00 35.49  ? 441 LEU A O     1 
ATOM   2214 C CB    . LEU E 3 89  ? 19.693  18.599  35.473 1.00 24.23  ? 441 LEU A CB    1 
ATOM   2215 C CG    . LEU E 3 89  ? 20.380  17.951  34.284 1.00 21.67  ? 441 LEU A CG    1 
ATOM   2216 C CD1   . LEU E 3 89  ? 19.349  17.531  33.260 1.00 26.45  ? 441 LEU A CD1   1 
ATOM   2217 C CD2   . LEU E 3 89  ? 21.346  18.937  33.695 1.00 19.08  ? 441 LEU A CD2   1 
ATOM   2218 N N     . PRO E 3 90  ? 20.296  21.246  37.445 1.00 32.82  ? 442 PRO A N     1 
ATOM   2219 C CA    . PRO E 3 90  ? 19.649  22.248  38.294 1.00 33.19  ? 442 PRO A CA    1 
ATOM   2220 C C     . PRO E 3 90  ? 18.259  22.551  37.764 1.00 34.50  ? 442 PRO A C     1 
ATOM   2221 O O     . PRO E 3 90  ? 17.843  22.010  36.736 1.00 34.53  ? 442 PRO A O     1 
ATOM   2222 C CB    . PRO E 3 90  ? 20.570  23.462  38.158 1.00 32.58  ? 442 PRO A CB    1 
ATOM   2223 C CG    . PRO E 3 90  ? 21.059  23.350  36.773 1.00 33.64  ? 442 PRO A CG    1 
ATOM   2224 C CD    . PRO E 3 90  ? 21.351  21.870  36.619 1.00 29.53  ? 442 PRO A CD    1 
ATOM   2225 N N     . PRO E 3 91  ? 17.494  23.367  38.498 1.00 39.03  ? 443 PRO A N     1 
ATOM   2226 C CA    . PRO E 3 91  ? 16.166  23.626  37.929 1.00 40.95  ? 443 PRO A CA    1 
ATOM   2227 C C     . PRO E 3 91  ? 16.271  24.499  36.663 1.00 41.28  ? 443 PRO A C     1 
ATOM   2228 O O     . PRO E 3 91  ? 17.146  25.372  36.565 1.00 38.36  ? 443 PRO A O     1 
ATOM   2229 C CB    . PRO E 3 91  ? 15.427  24.343  39.074 1.00 40.35  ? 443 PRO A CB    1 
ATOM   2230 C CG    . PRO E 3 91  ? 16.530  24.941  39.908 1.00 38.27  ? 443 PRO A CG    1 
ATOM   2231 C CD    . PRO E 3 91  ? 17.578  23.856  39.889 1.00 36.60  ? 443 PRO A CD    1 
ATOM   2232 N N     . SER E 3 92  ? 15.433  24.213  35.668 1.00 39.31  ? 444 SER A N     1 
ATOM   2233 C CA    . SER E 3 92  ? 15.460  25.001  34.444 1.00 33.96  ? 444 SER A CA    1 
ATOM   2234 C C     . SER E 3 92  ? 14.749  26.324  34.698 1.00 29.91  ? 444 SER A C     1 
ATOM   2235 O O     . SER E 3 92  ? 14.415  26.653  35.837 1.00 31.85  ? 444 SER A O     1 
ATOM   2236 C CB    . SER E 3 92  ? 14.856  24.234  33.253 1.00 31.72  ? 444 SER A CB    1 
ATOM   2237 O OG    . SER E 3 92  ? 13.483  23.924  33.427 1.00 35.31  ? 444 SER A OG    1 
ATOM   2238 N N     . ILE E 3 93  ? 14.485  27.056  33.627 1.00 26.77  ? 445 ILE A N     1 
ATOM   2239 C CA    . ILE E 3 93  ? 13.847  28.366  33.704 1.00 22.54  ? 445 ILE A CA    1 
ATOM   2240 C C     . ILE E 3 93  ? 12.354  28.379  34.058 1.00 23.65  ? 445 ILE A C     1 
ATOM   2241 O O     . ILE E 3 93  ? 11.874  29.251  34.799 1.00 24.17  ? 445 ILE A O     1 
ATOM   2242 C CB    . ILE E 3 93  ? 14.161  29.144  32.404 1.00 14.90  ? 445 ILE A CB    1 
ATOM   2243 C CG1   . ILE E 3 93  ? 15.696  29.226  32.261 1.00 17.44  ? 445 ILE A CG1   1 
ATOM   2244 C CG2   . ILE E 3 93  ? 13.525  30.516  32.423 1.00 9.33   ? 445 ILE A CG2   1 
ATOM   2245 C CD1   . ILE E 3 93  ? 16.186  29.714  30.964 1.00 22.87  ? 445 ILE A CD1   1 
ATOM   2246 N N     . LYS E 3 94  ? 11.644  27.369  33.583 1.00 22.98  ? 446 LYS A N     1 
ATOM   2247 C CA    . LYS E 3 94  ? 10.224  27.250  33.814 1.00 22.20  ? 446 LYS A CA    1 
ATOM   2248 C C     . LYS E 3 94  ? 9.941   25.924  34.479 1.00 23.90  ? 446 LYS A C     1 
ATOM   2249 O O     . LYS E 3 94  ? 10.536  24.912  34.111 1.00 27.44  ? 446 LYS A O     1 
ATOM   2250 C CB    . LYS E 3 94  ? 9.464   27.340  32.482 1.00 20.28  ? 446 LYS A CB    1 
ATOM   2251 C CG    . LYS E 3 94  ? 9.610   28.691  31.816 1.00 21.10  ? 446 LYS A CG    1 
ATOM   2252 C CD    . LYS E 3 94  ? 8.561   28.898  30.759 1.00 24.39  ? 446 LYS A CD    1 
ATOM   2253 C CE    . LYS E 3 94  ? 8.653   30.304  30.213 1.00 29.59  ? 446 LYS A CE    1 
ATOM   2254 N NZ    . LYS E 3 94  ? 8.405   31.326  31.278 1.00 28.42  ? 446 LYS A NZ    1 
ATOM   2255 N N     . ARG E 3 95  ? 9.058   25.940  35.476 1.00 25.58  ? 447 ARG A N     1 
ATOM   2256 C CA    . ARG E 3 95  ? 8.670   24.731  36.196 1.00 25.07  ? 447 ARG A CA    1 
ATOM   2257 C C     . ARG E 3 95  ? 7.223   24.401  35.820 1.00 23.74  ? 447 ARG A C     1 
ATOM   2258 O O     . ARG E 3 95  ? 6.385   25.297  35.749 1.00 25.32  ? 447 ARG A O     1 
ATOM   2259 C CB    . ARG E 3 95  ? 8.792   24.942  37.711 1.00 25.29  ? 447 ARG A CB    1 
ATOM   2260 C CG    . ARG E 3 95  ? 8.704   23.643  38.492 1.00 33.29  ? 447 ARG A CG    1 
ATOM   2261 C CD    . ARG E 3 95  ? 8.771   23.830  39.993 1.00 38.47  ? 447 ARG A CD    1 
ATOM   2262 N NE    . ARG E 3 95  ? 9.088   22.573  40.670 1.00 42.27  ? 447 ARG A NE    1 
ATOM   2263 C CZ    . ARG E 3 95  ? 8.203   21.626  40.975 1.00 47.36  ? 447 ARG A CZ    1 
ATOM   2264 N NH1   . ARG E 3 95  ? 6.914   21.766  40.670 1.00 45.81  ? 447 ARG A NH1   1 
ATOM   2265 N NH2   . ARG E 3 95  ? 8.614   20.534  41.608 1.00 49.80  ? 447 ARG A NH2   1 
ATOM   2266 N N     . LYS E 3 96  ? 6.942   23.136  35.520 1.00 24.88  ? 448 LYS A N     1 
ATOM   2267 C CA    . LYS E 3 96  ? 5.589   22.722  35.149 1.00 28.27  ? 448 LYS A CA    1 
ATOM   2268 C C     . LYS E 3 96  ? 4.680   22.588  36.375 1.00 30.28  ? 448 LYS A C     1 
ATOM   2269 O O     . LYS E 3 96  ? 5.158   22.411  37.498 1.00 33.11  ? 448 LYS A O     1 
ATOM   2270 C CB    . LYS E 3 96  ? 5.626   21.391  34.396 1.00 29.59  ? 448 LYS A CB    1 
ATOM   2271 C CG    . LYS E 3 96  ? 6.301   21.456  33.028 1.00 44.70  ? 448 LYS A CG    1 
ATOM   2272 C CD    . LYS E 3 96  ? 6.310   20.091  32.316 1.00 52.41  ? 448 LYS A CD    1 
ATOM   2273 C CE    . LYS E 3 96  ? 7.139   19.047  33.074 1.00 58.38  ? 448 LYS A CE    1 
ATOM   2274 N NZ    . LYS E 3 96  ? 7.240   17.771  32.307 1.00 64.82  ? 448 LYS A NZ    1 
ATOM   2275 N N     . PHE E 3 97  ? 3.373   22.715  36.166 1.00 29.12  ? 449 PHE A N     1 
ATOM   2276 C CA    . PHE E 3 97  ? 2.413   22.578  37.248 1.00 27.22  ? 449 PHE A CA    1 
ATOM   2277 C C     . PHE E 3 97  ? 2.024   21.115  37.420 1.00 26.57  ? 449 PHE A C     1 
ATOM   2278 O O     . PHE E 3 97  ? 1.859   20.383  36.439 1.00 30.44  ? 449 PHE A O     1 
ATOM   2279 C CB    . PHE E 3 97  ? 1.172   23.439  36.991 1.00 25.69  ? 449 PHE A CB    1 
ATOM   2280 C CG    . PHE E 3 97  ? 1.399   24.908  37.207 1.00 20.69  ? 449 PHE A CG    1 
ATOM   2281 C CD1   . PHE E 3 97  ? 1.367   25.438  38.484 1.00 20.23  ? 449 PHE A CD1   1 
ATOM   2282 C CD2   . PHE E 3 97  ? 1.664   25.758  36.137 1.00 18.15  ? 449 PHE A CD2   1 
ATOM   2283 C CE1   . PHE E 3 97  ? 1.600   26.791  38.694 1.00 18.00  ? 449 PHE A CE1   1 
ATOM   2284 C CE2   . PHE E 3 97  ? 1.898   27.113  36.340 1.00 12.94  ? 449 PHE A CE2   1 
ATOM   2285 C CZ    . PHE E 3 97  ? 1.867   27.628  37.617 1.00 16.19  ? 449 PHE A CZ    1 
ATOM   2286 N N     . SER E 3 98  ? 1.899   20.680  38.667 1.00 21.93  ? 450 SER A N     1 
ATOM   2287 C CA    . SER E 3 98  ? 1.533   19.309  38.929 1.00 20.34  ? 450 SER A CA    1 
ATOM   2288 C C     . SER E 3 98  ? 0.076   19.250  39.341 1.00 23.90  ? 450 SER A C     1 
ATOM   2289 O O     . SER E 3 98  ? -0.501  20.256  39.739 1.00 28.49  ? 450 SER A O     1 
ATOM   2290 C CB    . SER E 3 98  ? 2.404   18.750  40.041 1.00 18.65  ? 450 SER A CB    1 
ATOM   2291 O OG    . SER E 3 98  ? 1.999   19.249  41.291 1.00 25.71  ? 450 SER A OG    1 
ATOM   2292 N N     . ALA E 3 99  ? -0.513  18.063  39.284 1.00 31.24  ? 451 ALA A N     1 
ATOM   2293 C CA    . ALA E 3 99  ? -1.907  17.879  39.680 1.00 31.75  ? 451 ALA A CA    1 
ATOM   2294 C C     . ALA E 3 99  ? -2.093  18.289  41.138 1.00 32.85  ? 451 ALA A C     1 
ATOM   2295 O O     . ALA E 3 99  ? -3.108  18.866  41.512 1.00 38.45  ? 451 ALA A O     1 
ATOM   2296 C CB    . ALA E 3 99  ? -2.296  16.443  39.503 1.00 33.35  ? 451 ALA A CB    1 
ATOM   2297 N N     . ASP E 3 100 ? -1.104  17.972  41.965 1.00 34.62  ? 452 ASP A N     1 
ATOM   2298 C CA    . ASP E 3 100 ? -1.141  18.314  43.381 1.00 31.21  ? 452 ASP A CA    1 
ATOM   2299 C C     . ASP E 3 100 ? -1.233  19.808  43.532 1.00 30.08  ? 452 ASP A C     1 
ATOM   2300 O O     . ASP E 3 100 ? -1.982  20.314  44.357 1.00 33.65  ? 452 ASP A O     1 
ATOM   2301 C CB    . ASP E 3 100 ? 0.135   17.846  44.073 1.00 33.77  ? 452 ASP A CB    1 
ATOM   2302 C CG    . ASP E 3 100 ? 0.095   16.386  44.450 1.00 35.62  ? 452 ASP A CG    1 
ATOM   2303 O OD1   . ASP E 3 100 ? -0.805  15.669  43.970 1.00 32.22  ? 452 ASP A OD1   1 
ATOM   2304 O OD2   . ASP E 3 100 ? 0.961   15.964  45.247 1.00 39.88  ? 452 ASP A OD2   1 
ATOM   2305 N N     . GLU E 3 101 ? -0.407  20.503  42.763 1.00 28.40  ? 453 GLU A N     1 
ATOM   2306 C CA    . GLU E 3 101 ? -0.361  21.950  42.787 1.00 25.52  ? 453 GLU A CA    1 
ATOM   2307 C C     . GLU E 3 101 ? -1.706  22.540  42.369 1.00 23.12  ? 453 GLU A C     1 
ATOM   2308 O O     . GLU E 3 101 ? -2.263  23.398  43.060 1.00 21.39  ? 453 GLU A O     1 
ATOM   2309 C CB    . GLU E 3 101 ? 0.787   22.452  41.894 1.00 23.92  ? 453 GLU A CB    1 
ATOM   2310 C CG    . GLU E 3 101 ? 2.173   22.180  42.469 1.00 22.09  ? 453 GLU A CG    1 
ATOM   2311 C CD    . GLU E 3 101 ? 3.325   22.525  41.527 1.00 24.11  ? 453 GLU A CD    1 
ATOM   2312 O OE1   . GLU E 3 101 ? 3.097   22.714  40.319 1.00 23.35  ? 453 GLU A OE1   1 
ATOM   2313 O OE2   . GLU E 3 101 ? 4.475   22.594  42.003 1.00 26.91  ? 453 GLU A OE2   1 
ATOM   2314 N N     . ASP E 3 102 ? -2.244  22.053  41.261 1.00 23.47  ? 454 ASP A N     1 
ATOM   2315 C CA    . ASP E 3 102 ? -3.532  22.534  40.779 1.00 26.99  ? 454 ASP A CA    1 
ATOM   2316 C C     . ASP E 3 102 ? -4.628  22.391  41.854 1.00 23.74  ? 454 ASP A C     1 
ATOM   2317 O O     . ASP E 3 102 ? -5.425  23.295  42.058 1.00 21.78  ? 454 ASP A O     1 
ATOM   2318 C CB    . ASP E 3 102 ? -3.927  21.798  39.483 1.00 29.60  ? 454 ASP A CB    1 
ATOM   2319 C CG    . ASP E 3 102 ? -3.155  22.294  38.244 1.00 33.18  ? 454 ASP A CG    1 
ATOM   2320 O OD1   . ASP E 3 102 ? -2.573  23.408  38.262 1.00 36.04  ? 454 ASP A OD1   1 
ATOM   2321 O OD2   . ASP E 3 102 ? -3.155  21.568  37.229 1.00 31.80  ? 454 ASP A OD2   1 
ATOM   2322 N N     . TYR E 3 103 ? -4.658  21.243  42.523 1.00 27.90  ? 455 TYR A N     1 
ATOM   2323 C CA    . TYR E 3 103 ? -5.620  20.953  43.589 1.00 27.57  ? 455 TYR A CA    1 
ATOM   2324 C C     . TYR E 3 103 ? -5.389  21.878  44.791 1.00 27.99  ? 455 TYR A C     1 
ATOM   2325 O O     . TYR E 3 103 ? -6.339  22.463  45.319 1.00 25.15  ? 455 TYR A O     1 
ATOM   2326 C CB    . TYR E 3 103 ? -5.475  19.489  44.003 1.00 28.63  ? 455 TYR A CB    1 
ATOM   2327 C CG    . TYR E 3 103 ? -6.431  19.015  45.075 1.00 29.02  ? 455 TYR A CG    1 
ATOM   2328 C CD1   . TYR E 3 103 ? -7.811  19.037  44.873 1.00 25.19  ? 455 TYR A CD1   1 
ATOM   2329 C CD2   . TYR E 3 103 ? -5.945  18.501  46.283 1.00 30.94  ? 455 TYR A CD2   1 
ATOM   2330 C CE1   . TYR E 3 103 ? -8.690  18.549  45.853 1.00 29.85  ? 455 TYR A CE1   1 
ATOM   2331 C CE2   . TYR E 3 103 ? -6.805  18.013  47.266 1.00 28.95  ? 455 TYR A CE2   1 
ATOM   2332 C CZ    . TYR E 3 103 ? -8.174  18.042  47.049 1.00 32.98  ? 455 TYR A CZ    1 
ATOM   2333 O OH    . TYR E 3 103 ? -9.020  17.588  48.037 1.00 35.98  ? 455 TYR A OH    1 
ATOM   2334 N N     . THR E 3 104 ? -4.133  21.983  45.231 1.00 25.29  ? 456 THR A N     1 
ATOM   2335 C CA    . THR E 3 104 ? -3.758  22.860  46.340 1.00 22.90  ? 456 THR A CA    1 
ATOM   2336 C C     . THR E 3 104 ? -4.226  24.305  46.084 1.00 24.20  ? 456 THR A C     1 
ATOM   2337 O O     . THR E 3 104 ? -4.673  24.994  47.010 1.00 26.55  ? 456 THR A O     1 
ATOM   2338 C CB    . THR E 3 104 ? -2.232  22.857  46.537 1.00 18.42  ? 456 THR A CB    1 
ATOM   2339 O OG1   . THR E 3 104 ? -1.792  21.535  46.874 1.00 17.65  ? 456 THR A OG1   1 
ATOM   2340 C CG2   . THR E 3 104 ? -1.822  23.818  47.625 1.00 13.11  ? 456 THR A CG2   1 
ATOM   2341 N N     . LEU E 3 105 ? -4.105  24.759  44.833 1.00 23.37  ? 457 LEU A N     1 
ATOM   2342 C CA    . LEU E 3 105 ? -4.523  26.111  44.439 1.00 25.04  ? 457 LEU A CA    1 
ATOM   2343 C C     . LEU E 3 105 ? -6.040  26.256  44.438 1.00 26.95  ? 457 LEU A C     1 
ATOM   2344 O O     . LEU E 3 105 ? -6.576  27.220  44.993 1.00 29.06  ? 457 LEU A O     1 
ATOM   2345 C CB    . LEU E 3 105 ? -3.983  26.486  43.045 1.00 12.56  ? 457 LEU A CB    1 
ATOM   2346 C CG    . LEU E 3 105 ? -4.445  27.819  42.426 1.00 16.71  ? 457 LEU A CG    1 
ATOM   2347 C CD1   . LEU E 3 105 ? -3.875  29.010  43.197 1.00 11.56  ? 457 LEU A CD1   1 
ATOM   2348 C CD2   . LEU E 3 105 ? -4.018  27.888  40.974 1.00 11.61  ? 457 LEU A CD2   1 
ATOM   2349 N N     . ALA E 3 106 ? -6.713  25.324  43.765 1.00 28.02  ? 458 ALA A N     1 
ATOM   2350 C CA    . ALA E 3 106 ? -8.171  25.314  43.660 1.00 29.22  ? 458 ALA A CA    1 
ATOM   2351 C C     . ALA E 3 106 ? -8.840  25.306  45.037 1.00 27.73  ? 458 ALA A C     1 
ATOM   2352 O O     . ALA E 3 106 ? -9.810  26.034  45.276 1.00 27.21  ? 458 ALA A O     1 
ATOM   2353 C CB    . ALA E 3 106 ? -8.621  24.106  42.848 1.00 35.66  ? 458 ALA A CB    1 
ATOM   2354 N N     . ILE E 3 107 ? -8.331  24.454  45.924 1.00 26.26  ? 459 ILE A N     1 
ATOM   2355 C CA    . ILE E 3 107 ? -8.841  24.349  47.292 1.00 23.55  ? 459 ILE A CA    1 
ATOM   2356 C C     . ILE E 3 107 ? -8.633  25.661  48.055 1.00 21.23  ? 459 ILE A C     1 
ATOM   2357 O O     . ILE E 3 107 ? -9.568  26.165  48.685 1.00 22.58  ? 459 ILE A O     1 
ATOM   2358 C CB    . ILE E 3 107 ? -8.198  23.150  48.047 1.00 15.95  ? 459 ILE A CB    1 
ATOM   2359 C CG1   . ILE E 3 107 ? -8.769  21.844  47.511 1.00 18.02  ? 459 ILE A CG1   1 
ATOM   2360 C CG2   . ILE E 3 107 ? -8.482  23.223  49.537 1.00 23.47  ? 459 ILE A CG2   1 
ATOM   2361 C CD1   . ILE E 3 107 ? -10.260 21.666  47.792 1.00 22.95  ? 459 ILE A CD1   1 
ATOM   2362 N N     . ALA E 3 108 ? -7.441  26.244  47.941 1.00 18.30  ? 460 ALA A N     1 
ATOM   2363 C CA    . ALA E 3 108 ? -7.138  27.493  48.609 1.00 12.61  ? 460 ALA A CA    1 
ATOM   2364 C C     . ALA E 3 108 ? -8.127  28.561  48.181 1.00 19.12  ? 460 ALA A C     1 
ATOM   2365 O O     . ALA E 3 108 ? -8.655  29.296  49.026 1.00 21.88  ? 460 ALA A O     1 
ATOM   2366 C CB    . ALA E 3 108 ? -5.734  27.916  48.302 1.00 15.66  ? 460 ALA A CB    1 
ATOM   2367 N N     . VAL E 3 109 ? -8.387  28.644  46.876 1.00 19.10  ? 461 VAL A N     1 
ATOM   2368 C CA    . VAL E 3 109 ? -9.344  29.611  46.331 1.00 17.81  ? 461 VAL A CA    1 
ATOM   2369 C C     . VAL E 3 109 ? -10.767 29.327  46.816 1.00 21.56  ? 461 VAL A C     1 
ATOM   2370 O O     . VAL E 3 109 ? -11.506 30.250  47.151 1.00 23.59  ? 461 VAL A O     1 
ATOM   2371 C CB    . VAL E 3 109 ? -9.340  29.610  44.785 1.00 20.43  ? 461 VAL A CB    1 
ATOM   2372 C CG1   . VAL E 3 109 ? -10.330 30.627  44.257 1.00 20.28  ? 461 VAL A CG1   1 
ATOM   2373 C CG2   . VAL E 3 109 ? -7.950  29.936  44.259 1.00 15.85  ? 461 VAL A CG2   1 
ATOM   2374 N N     . LYS E 3 110 ? -11.160 28.055  46.827 1.00 25.27  ? 462 LYS A N     1 
ATOM   2375 C CA    . LYS E 3 110 ? -12.488 27.651  47.298 1.00 26.17  ? 462 LYS A CA    1 
ATOM   2376 C C     . LYS E 3 110 ? -12.685 28.103  48.747 1.00 26.67  ? 462 LYS A C     1 
ATOM   2377 O O     . LYS E 3 110 ? -13.724 28.681  49.082 1.00 26.97  ? 462 LYS A O     1 
ATOM   2378 C CB    . LYS E 3 110 ? -12.663 26.124  47.204 1.00 30.89  ? 462 LYS A CB    1 
ATOM   2379 C CG    . LYS E 3 110 ? -14.077 25.605  47.538 1.00 30.33  ? 462 LYS A CG    1 
ATOM   2380 C CD    . LYS E 3 110 ? -14.141 24.075  47.481 1.00 37.05  ? 462 LYS A CD    1 
ATOM   2381 C CE    . LYS E 3 110 ? -15.584 23.533  47.617 1.00 43.31  ? 462 LYS A CE    1 
ATOM   2382 N NZ    . LYS E 3 110 ? -15.661 22.037  47.437 1.00 38.36  ? 462 LYS A NZ    1 
ATOM   2383 N N     . LYS E 3 111 ? -11.692 27.823  49.600 1.00 26.98  ? 463 LYS A N     1 
ATOM   2384 C CA    . LYS E 3 111 ? -11.721 28.215  51.013 1.00 25.25  ? 463 LYS A CA    1 
ATOM   2385 C C     . LYS E 3 111 ? -11.835 29.733  51.120 1.00 21.81  ? 463 LYS A C     1 
ATOM   2386 O O     . LYS E 3 111 ? -12.579 30.263  51.938 1.00 23.01  ? 463 LYS A O     1 
ATOM   2387 C CB    . LYS E 3 111 ? -10.463 27.731  51.749 1.00 25.52  ? 463 LYS A CB    1 
ATOM   2388 C CG    . LYS E 3 111 ? -10.379 26.217  51.932 1.00 28.72  ? 463 LYS A CG    1 
ATOM   2389 C CD    . LYS E 3 111 ? -9.304  25.803  52.933 1.00 31.27  ? 463 LYS A CD    1 
ATOM   2390 C CE    . LYS E 3 111 ? -7.928  26.288  52.529 1.00 43.25  ? 463 LYS A CE    1 
ATOM   2391 N NZ    . LYS E 3 111 ? -6.930  26.044  53.614 1.00 50.52  ? 463 LYS A NZ    1 
ATOM   2392 N N     . GLN E 3 112 ? -11.101 30.430  50.277 1.00 20.78  ? 464 GLN A N     1 
ATOM   2393 C CA    . GLN E 3 112 ? -11.159 31.871  50.268 1.00 24.29  ? 464 GLN A CA    1 
ATOM   2394 C C     . GLN E 3 112 ? -12.599 32.319  50.013 1.00 24.36  ? 464 GLN A C     1 
ATOM   2395 O O     . GLN E 3 112 ? -13.161 33.085  50.793 1.00 30.36  ? 464 GLN A O     1 
ATOM   2396 C CB    . GLN E 3 112 ? -10.223 32.420  49.189 1.00 27.83  ? 464 GLN A CB    1 
ATOM   2397 C CG    . GLN E 3 112 ? -10.104 33.922  49.191 1.00 36.57  ? 464 GLN A CG    1 
ATOM   2398 C CD    . GLN E 3 112 ? -9.623  34.452  50.522 1.00 40.73  ? 464 GLN A CD    1 
ATOM   2399 O OE1   . GLN E 3 112 ? -8.546  34.098  50.985 1.00 48.32  ? 464 GLN A OE1   1 
ATOM   2400 N NE2   . GLN E 3 112 ? -10.423 35.302  51.149 1.00 45.06  ? 464 GLN A NE2   1 
ATOM   2401 N N     . PHE E 3 113 ? -13.195 31.845  48.925 1.00 26.11  ? 465 PHE A N     1 
ATOM   2402 C CA    . PHE E 3 113 ? -14.566 32.212  48.574 1.00 27.20  ? 465 PHE A CA    1 
ATOM   2403 C C     . PHE E 3 113 ? -15.558 31.806  49.668 1.00 29.14  ? 465 PHE A C     1 
ATOM   2404 O O     . PHE E 3 113 ? -16.515 32.532  49.954 1.00 33.12  ? 465 PHE A O     1 
ATOM   2405 C CB    . PHE E 3 113 ? -14.971 31.595  47.228 1.00 26.36  ? 465 PHE A CB    1 
ATOM   2406 C CG    . PHE E 3 113 ? -14.260 32.182  46.027 1.00 26.63  ? 465 PHE A CG    1 
ATOM   2407 C CD1   . PHE E 3 113 ? -13.449 33.300  46.141 1.00 26.35  ? 465 PHE A CD1   1 
ATOM   2408 C CD2   . PHE E 3 113 ? -14.419 31.608  44.769 1.00 28.42  ? 465 PHE A CD2   1 
ATOM   2409 C CE1   . PHE E 3 113 ? -12.804 33.835  45.019 1.00 29.28  ? 465 PHE A CE1   1 
ATOM   2410 C CE2   . PHE E 3 113 ? -13.780 32.134  43.640 1.00 27.07  ? 465 PHE A CE2   1 
ATOM   2411 C CZ    . PHE E 3 113 ? -12.974 33.249  43.768 1.00 28.23  ? 465 PHE A CZ    1 
ATOM   2412 N N     . TYR E 3 114 ? -15.329 30.656  50.290 1.00 29.03  ? 466 TYR A N     1 
ATOM   2413 C CA    . TYR E 3 114 ? -16.197 30.197  51.368 1.00 28.09  ? 466 TYR A CA    1 
ATOM   2414 C C     . TYR E 3 114 ? -16.180 31.178  52.544 1.00 28.78  ? 466 TYR A C     1 
ATOM   2415 O O     . TYR E 3 114 ? -17.226 31.539  53.082 1.00 28.79  ? 466 TYR A O     1 
ATOM   2416 C CB    . TYR E 3 114 ? -15.760 28.825  51.844 1.00 27.17  ? 466 TYR A CB    1 
ATOM   2417 C CG    . TYR E 3 114 ? -16.700 28.215  52.856 1.00 34.73  ? 466 TYR A CG    1 
ATOM   2418 C CD1   . TYR E 3 114 ? -16.576 28.498  54.220 1.00 31.27  ? 466 TYR A CD1   1 
ATOM   2419 C CD2   . TYR E 3 114 ? -17.709 27.337  52.452 1.00 35.91  ? 466 TYR A CD2   1 
ATOM   2420 C CE1   . TYR E 3 114 ? -17.425 27.924  55.151 1.00 32.11  ? 466 TYR A CE1   1 
ATOM   2421 C CE2   . TYR E 3 114 ? -18.564 26.758  53.375 1.00 37.34  ? 466 TYR A CE2   1 
ATOM   2422 C CZ    . TYR E 3 114 ? -18.417 27.052  54.726 1.00 37.16  ? 466 TYR A CZ    1 
ATOM   2423 O OH    . TYR E 3 114 ? -19.250 26.449  55.643 1.00 38.54  ? 466 TYR A OH    1 
ATOM   2424 N N     . ARG E 3 115 ? -14.989 31.582  52.964 1.00 29.77  ? 467 ARG A N     1 
ATOM   2425 C CA    . ARG E 3 115 ? -14.851 32.534  54.058 1.00 30.13  ? 467 ARG A CA    1 
ATOM   2426 C C     . ARG E 3 115 ? -15.512 33.840  53.692 1.00 30.06  ? 467 ARG A C     1 
ATOM   2427 O O     . ARG E 3 115 ? -16.191 34.444  54.512 1.00 30.35  ? 467 ARG A O     1 
ATOM   2428 C CB    . ARG E 3 115 ? -13.390 32.775  54.369 1.00 27.77  ? 467 ARG A CB    1 
ATOM   2429 C CG    . ARG E 3 115 ? -12.761 31.615  55.088 1.00 28.05  ? 467 ARG A CG    1 
ATOM   2430 C CD    . ARG E 3 115 ? -11.370 31.969  55.553 1.00 32.56  ? 467 ARG A CD    1 
ATOM   2431 N NE    . ARG E 3 115 ? -10.360 31.381  54.683 1.00 37.98  ? 467 ARG A NE    1 
ATOM   2432 C CZ    . ARG E 3 115 ? -9.632  32.063  53.810 1.00 34.05  ? 467 ARG A CZ    1 
ATOM   2433 N NH1   . ARG E 3 115 ? -9.807  33.369  53.675 1.00 38.34  ? 467 ARG A NH1   1 
ATOM   2434 N NH2   . ARG E 3 115 ? -8.690  31.441  53.112 1.00 35.56  ? 467 ARG A NH2   1 
ATOM   2435 N N     . ASP E 3 116 ? -15.314 34.257  52.447 1.00 30.90  ? 468 ASP A N     1 
ATOM   2436 C CA    . ASP E 3 116 ? -15.895 35.485  51.927 1.00 31.36  ? 468 ASP A CA    1 
ATOM   2437 C C     . ASP E 3 116 ? -17.404 35.465  52.006 1.00 34.03  ? 468 ASP A C     1 
ATOM   2438 O O     . ASP E 3 116 ? -18.024 36.385  52.544 1.00 39.33  ? 468 ASP A O     1 
ATOM   2439 C CB    . ASP E 3 116 ? -15.520 35.691  50.453 1.00 30.19  ? 468 ASP A CB    1 
ATOM   2440 C CG    . ASP E 3 116 ? -14.047 35.989  50.246 1.00 31.81  ? 468 ASP A CG    1 
ATOM   2441 O OD1   . ASP E 3 116 ? -13.350 36.358  51.215 1.00 33.58  ? 468 ASP A OD1   1 
ATOM   2442 O OD2   . ASP E 3 116 ? -13.589 35.862  49.091 1.00 35.36  ? 468 ASP A OD2   1 
ATOM   2443 N N     . LEU E 3 117 ? -17.993 34.433  51.417 1.00 35.35  ? 469 LEU A N     1 
ATOM   2444 C CA    . LEU E 3 117 ? -19.439 34.301  51.371 1.00 35.39  ? 469 LEU A CA    1 
ATOM   2445 C C     . LEU E 3 117 ? -20.158 33.933  52.660 1.00 35.12  ? 469 LEU A C     1 
ATOM   2446 O O     . LEU E 3 117 ? -21.238 34.452  52.933 1.00 38.41  ? 469 LEU A O     1 
ATOM   2447 C CB    . LEU E 3 117 ? -19.841 33.316  50.268 1.00 32.93  ? 469 LEU A CB    1 
ATOM   2448 C CG    . LEU E 3 117 ? -19.684 33.791  48.821 1.00 35.10  ? 469 LEU A CG    1 
ATOM   2449 C CD1   . LEU E 3 117 ? -20.192 32.731  47.852 1.00 33.24  ? 469 LEU A CD1   1 
ATOM   2450 C CD2   . LEU E 3 117 ? -20.470 35.070  48.632 1.00 34.31  ? 469 LEU A CD2   1 
ATOM   2451 N N     . PHE E 3 118 ? -19.566 33.056  53.459 1.00 35.62  ? 470 PHE A N     1 
ATOM   2452 C CA    . PHE E 3 118 ? -20.221 32.594  54.672 1.00 33.73  ? 470 PHE A CA    1 
ATOM   2453 C C     . PHE E 3 118 ? -19.626 33.002  56.007 1.00 34.88  ? 470 PHE A C     1 
ATOM   2454 O O     . PHE E 3 118 ? -20.206 32.698  57.045 1.00 38.25  ? 470 PHE A O     1 
ATOM   2455 C CB    . PHE E 3 118 ? -20.379 31.081  54.598 1.00 31.98  ? 470 PHE A CB    1 
ATOM   2456 C CG    . PHE E 3 118 ? -20.958 30.613  53.298 1.00 34.54  ? 470 PHE A CG    1 
ATOM   2457 C CD1   . PHE E 3 118 ? -22.163 31.137  52.831 1.00 34.07  ? 470 PHE A CD1   1 
ATOM   2458 C CD2   . PHE E 3 118 ? -20.294 29.671  52.527 1.00 34.55  ? 470 PHE A CD2   1 
ATOM   2459 C CE1   . PHE E 3 118 ? -22.702 30.730  51.614 1.00 36.34  ? 470 PHE A CE1   1 
ATOM   2460 C CE2   . PHE E 3 118 ? -20.826 29.255  51.304 1.00 37.42  ? 470 PHE A CE2   1 
ATOM   2461 C CZ    . PHE E 3 118 ? -22.033 29.787  50.848 1.00 36.89  ? 470 PHE A CZ    1 
ATOM   2462 N N     . GLN E 3 119 ? -18.474 33.664  55.993 1.00 31.54  ? 471 GLN A N     1 
ATOM   2463 C CA    . GLN E 3 119 ? -17.849 34.117  57.228 1.00 30.62  ? 471 GLN A CA    1 
ATOM   2464 C C     . GLN E 3 119 ? -17.786 32.995  58.235 1.00 28.38  ? 471 GLN A C     1 
ATOM   2465 O O     . GLN E 3 119 ? -18.008 33.191  59.423 1.00 24.73  ? 471 GLN A O     1 
ATOM   2466 C CB    . GLN E 3 119 ? -18.631 35.293  57.803 1.00 32.98  ? 471 GLN A CB    1 
ATOM   2467 C CG    . GLN E 3 119 ? -18.401 36.572  57.053 1.00 40.97  ? 471 GLN A CG    1 
ATOM   2468 C CD    . GLN E 3 119 ? -16.937 36.965  57.070 1.00 51.68  ? 471 GLN A CD    1 
ATOM   2469 O OE1   . GLN E 3 119 ? -16.350 37.285  56.034 1.00 56.66  ? 471 GLN A OE1   1 
ATOM   2470 N NE2   . GLN E 3 119 ? -16.331 36.933  58.254 1.00 56.89  ? 471 GLN A NE2   1 
ATOM   2471 N N     . ILE E 3 120 ? -17.470 31.815  57.733 1.00 28.70  ? 472 ILE A N     1 
ATOM   2472 C CA    . ILE E 3 120 ? -17.365 30.622  58.544 1.00 30.21  ? 472 ILE A CA    1 
ATOM   2473 C C     . ILE E 3 120 ? -16.112 29.874  58.142 1.00 30.04  ? 472 ILE A C     1 
ATOM   2474 O O     . ILE E 3 120 ? -15.767 29.807  56.964 1.00 29.60  ? 472 ILE A O     1 
ATOM   2475 C CB    . ILE E 3 120 ? -18.555 29.702  58.282 1.00 32.28  ? 472 ILE A CB    1 
ATOM   2476 C CG1   . ILE E 3 120 ? -19.842 30.385  58.722 1.00 32.00  ? 472 ILE A CG1   1 
ATOM   2477 C CG2   . ILE E 3 120 ? -18.371 28.380  59.004 1.00 32.65  ? 472 ILE A CG2   1 
ATOM   2478 C CD1   . ILE E 3 120 ? -21.063 29.753  58.147 1.00 38.29  ? 472 ILE A CD1   1 
ATOM   2479 N N     . ASP E 3 121 ? -15.429 29.321  59.131 1.00 32.17  ? 473 ASP A N     1 
ATOM   2480 C CA    . ASP E 3 121 ? -14.223 28.550  58.889 1.00 34.36  ? 473 ASP A CA    1 
ATOM   2481 C C     . ASP E 3 121 ? -14.599 27.210  58.267 1.00 37.83  ? 473 ASP A C     1 
ATOM   2482 O O     . ASP E 3 121 ? -15.347 26.444  58.868 1.00 40.87  ? 473 ASP A O     1 
ATOM   2483 C CB    . ASP E 3 121 ? -13.486 28.289  60.205 1.00 26.38  ? 473 ASP A CB    1 
ATOM   2484 C CG    . ASP E 3 121 ? -12.437 27.211  60.076 1.00 23.44  ? 473 ASP A CG    1 
ATOM   2485 O OD1   . ASP E 3 121 ? -11.757 27.170  59.026 1.00 26.31  ? 473 ASP A OD1   1 
ATOM   2486 O OD2   . ASP E 3 121 ? -12.292 26.401  61.010 1.00 18.18  ? 473 ASP A OD2   1 
ATOM   2487 N N     . PRO E 3 122 ? -14.009 26.874  57.107 1.00 44.24  ? 474 PRO A N     1 
ATOM   2488 C CA    . PRO E 3 122 ? -14.287 25.605  56.411 1.00 46.69  ? 474 PRO A CA    1 
ATOM   2489 C C     . PRO E 3 122 ? -13.848 24.346  57.183 1.00 48.48  ? 474 PRO A C     1 
ATOM   2490 O O     . PRO E 3 122 ? -14.437 23.273  57.030 1.00 50.48  ? 474 PRO A O     1 
ATOM   2491 C CB    . PRO E 3 122 ? -13.490 25.748  55.112 1.00 47.32  ? 474 PRO A CB    1 
ATOM   2492 C CG    . PRO E 3 122 ? -13.528 27.226  54.852 1.00 47.41  ? 474 PRO A CG    1 
ATOM   2493 C CD    . PRO E 3 122 ? -13.277 27.806  56.228 1.00 48.68  ? 474 PRO A CD    1 
ATOM   2494 N N     . ASP E 3 123 ? -12.806 24.476  57.996 1.00 47.78  ? 475 ASP A N     1 
ATOM   2495 C CA    . ASP E 3 123 ? -12.292 23.350  58.763 1.00 45.58  ? 475 ASP A CA    1 
ATOM   2496 C C     . ASP E 3 123 ? -13.128 22.919  59.956 1.00 45.36  ? 475 ASP A C     1 
ATOM   2497 O O     . ASP E 3 123 ? -13.280 21.731  60.198 1.00 47.74  ? 475 ASP A O     1 
ATOM   2498 C CB    . ASP E 3 123 ? -10.873 23.639  59.243 1.00 45.67  ? 475 ASP A CB    1 
ATOM   2499 C CG    . ASP E 3 123 ? -9.902  23.818  58.108 1.00 42.99  ? 475 ASP A CG    1 
ATOM   2500 O OD1   . ASP E 3 123 ? -10.221 23.414  56.965 1.00 41.67  ? 475 ASP A OD1   1 
ATOM   2501 O OD2   . ASP E 3 123 ? -8.809  24.361  58.372 1.00 42.50  ? 475 ASP A OD2   1 
ATOM   2502 N N     . THR E 3 124 ? -13.615 23.872  60.740 1.00 46.95  ? 476 THR A N     1 
ATOM   2503 C CA    . THR E 3 124 ? -14.401 23.525  61.916 1.00 48.44  ? 476 THR A CA    1 
ATOM   2504 C C     . THR E 3 124 ? -15.831 24.020  61.840 1.00 49.41  ? 476 THR A C     1 
ATOM   2505 O O     . THR E 3 124 ? -16.774 23.273  62.094 1.00 55.20  ? 476 THR A O     1 
ATOM   2506 C CB    . THR E 3 124 ? -13.768 24.096  63.199 1.00 51.03  ? 476 THR A CB    1 
ATOM   2507 O OG1   . THR E 3 124 ? -13.599 25.509  63.052 1.00 51.33  ? 476 THR A OG1   1 
ATOM   2508 C CG2   . THR E 3 124 ? -12.411 23.455  63.465 1.00 50.45  ? 476 THR A CG2   1 
ATOM   2509 N N     . GLY E 3 125 ? -15.988 25.287  61.500 1.00 46.38  ? 477 GLY A N     1 
ATOM   2510 C CA    . GLY E 3 125 ? -17.312 25.857  61.427 1.00 42.27  ? 477 GLY A CA    1 
ATOM   2511 C C     . GLY E 3 125 ? -17.352 27.037  62.361 1.00 40.29  ? 477 GLY A C     1 
ATOM   2512 O O     . GLY E 3 125 ? -18.410 27.576  62.625 1.00 44.63  ? 477 GLY A O     1 
ATOM   2513 N N     . ARG E 3 126 ? -16.200 27.406  62.907 1.00 40.52  ? 478 ARG A N     1 
ATOM   2514 C CA    . ARG E 3 126 ? -16.103 28.552  63.804 1.00 41.14  ? 478 ARG A CA    1 
ATOM   2515 C C     . ARG E 3 126 ? -16.613 29.772  63.039 1.00 38.87  ? 478 ARG A C     1 
ATOM   2516 O O     . ARG E 3 126 ? -16.527 29.826  61.811 1.00 38.23  ? 478 ARG A O     1 
ATOM   2517 C CB    . ARG E 3 126 ? -14.639 28.771  64.245 1.00 42.98  ? 478 ARG A CB    1 
ATOM   2518 C CG    . ARG E 3 126 ? -14.444 29.867  65.289 1.00 49.68  ? 478 ARG A CG    1 
ATOM   2519 C CD    . ARG E 3 126 ? -12.966 30.180  65.578 1.00 57.57  ? 478 ARG A CD    1 
ATOM   2520 N NE    . ARG E 3 126 ? -12.318 31.009  64.549 1.00 63.66  ? 478 ARG A NE    1 
ATOM   2521 C CZ    . ARG E 3 126 ? -12.217 32.342  64.579 1.00 62.87  ? 478 ARG A CZ    1 
ATOM   2522 N NH1   . ARG E 3 126 ? -12.724 33.044  65.586 1.00 68.02  ? 478 ARG A NH1   1 
ATOM   2523 N NH2   . ARG E 3 126 ? -11.607 32.985  63.592 1.00 64.46  ? 478 ARG A NH2   1 
ATOM   2524 N N     . SER E 3 127 ? -17.186 30.720  63.764 1.00 38.54  ? 479 SER A N     1 
ATOM   2525 C CA    . SER E 3 127 ? -17.709 31.930  63.158 1.00 38.07  ? 479 SER A CA    1 
ATOM   2526 C C     . SER E 3 127 ? -16.584 32.918  62.977 1.00 36.45  ? 479 SER A C     1 
ATOM   2527 O O     . SER E 3 127 ? -15.905 33.287  63.935 1.00 38.29  ? 479 SER A O     1 
ATOM   2528 C CB    . SER E 3 127 ? -18.790 32.564  64.042 1.00 37.52  ? 479 SER A CB    1 
ATOM   2529 O OG    . SER E 3 127 ? -19.128 33.859  63.561 1.00 35.86  ? 479 SER A OG    1 
ATOM   2530 N N     . LEU E 3 128 ? -16.434 33.404  61.760 1.00 33.76  ? 480 LEU A N     1 
ATOM   2531 C CA    . LEU E 3 128 ? -15.392 34.356  61.483 1.00 32.96  ? 480 LEU A CA    1 
ATOM   2532 C C     . LEU E 3 128 ? -15.861 35.775  61.761 1.00 39.18  ? 480 LEU A C     1 
ATOM   2533 O O     . LEU E 3 128 ? -15.182 36.739  61.408 1.00 44.24  ? 480 LEU A O     1 
ATOM   2534 C CB    . LEU E 3 128 ? -14.923 34.195  60.043 1.00 27.05  ? 480 LEU A CB    1 
ATOM   2535 C CG    . LEU E 3 128 ? -14.404 32.793  59.729 1.00 19.29  ? 480 LEU A CG    1 
ATOM   2536 C CD1   . LEU E 3 128 ? -13.738 32.833  58.378 1.00 21.71  ? 480 LEU A CD1   1 
ATOM   2537 C CD2   . LEU E 3 128 ? -13.397 32.347  60.787 1.00 19.92  ? 480 LEU A CD2   1 
ATOM   2538 N N     . ILE E 3 129 ? -17.028 35.909  62.387 1.00 42.19  ? 481 ILE A N     1 
ATOM   2539 C CA    . ILE E 3 129 ? -17.571 37.227  62.717 1.00 44.39  ? 481 ILE A CA    1 
ATOM   2540 C C     . ILE E 3 129 ? -16.888 37.747  63.986 1.00 45.58  ? 481 ILE A C     1 
ATOM   2541 O O     . ILE E 3 129 ? -16.529 38.923  64.086 1.00 46.80  ? 481 ILE A O     1 
ATOM   2542 C CB    . ILE E 3 129 ? -19.112 37.174  62.948 1.00 46.80  ? 481 ILE A CB    1 
ATOM   2543 C CG1   . ILE E 3 129 ? -19.814 36.495  61.768 1.00 44.10  ? 481 ILE A CG1   1 
ATOM   2544 C CG2   . ILE E 3 129 ? -19.681 38.588  63.106 1.00 47.54  ? 481 ILE A CG2   1 
ATOM   2545 C CD1   . ILE E 3 129 ? -19.794 37.293  60.489 1.00 40.78  ? 481 ILE A CD1   1 
ATOM   2546 N N     . ARG E 3 161 ? -19.286 22.876  49.246 1.00 56.41  ? 513 ARG A N     1 
ATOM   2547 C CA    . ARG E 3 161 ? -20.117 23.663  48.327 1.00 53.84  ? 513 ARG A CA    1 
ATOM   2548 C C     . ARG E 3 161 ? -19.586 23.705  46.883 1.00 54.86  ? 513 ARG A C     1 
ATOM   2549 O O     . ARG E 3 161 ? -18.657 22.958  46.540 1.00 57.63  ? 513 ARG A O     1 
ATOM   2550 C CB    . ARG E 3 161 ? -20.271 25.094  48.875 1.00 50.37  ? 513 ARG A CB    1 
ATOM   2551 C CG    . ARG E 3 161 ? -19.006 25.913  48.795 1.00 47.44  ? 513 ARG A CG    1 
ATOM   2552 C CD    . ARG E 3 161 ? -19.358 27.346  48.517 1.00 41.67  ? 513 ARG A CD    1 
ATOM   2553 N NE    . ARG E 3 161 ? -18.195 28.122  48.108 1.00 40.30  ? 513 ARG A NE    1 
ATOM   2554 C CZ    . ARG E 3 161 ? -18.268 29.211  47.353 1.00 41.00  ? 513 ARG A CZ    1 
ATOM   2555 N NH1   . ARG E 3 161 ? -19.441 29.657  46.924 1.00 43.99  ? 513 ARG A NH1   1 
ATOM   2556 N NH2   . ARG E 3 161 ? -17.173 29.870  47.040 1.00 41.90  ? 513 ARG A NH2   1 
ATOM   2557 N N     . THR E 3 162 ? -20.114 24.635  46.080 1.00 51.42  ? 514 THR A N     1 
ATOM   2558 C CA    . THR E 3 162 ? -19.779 24.756  44.665 1.00 52.77  ? 514 THR A CA    1 
ATOM   2559 C C     . THR E 3 162 ? -19.731 26.248  44.283 1.00 52.24  ? 514 THR A C     1 
ATOM   2560 O O     . THR E 3 162 ? -19.831 27.106  45.146 1.00 52.09  ? 514 THR A O     1 
ATOM   2561 C CB    . THR E 3 162 ? -20.877 23.941  43.854 1.00 54.64  ? 514 THR A CB    1 
ATOM   2562 O OG1   . THR E 3 162 ? -20.813 22.575  44.270 1.00 53.44  ? 514 THR A OG1   1 
ATOM   2563 C CG2   . THR E 3 162 ? -20.694 23.997  42.334 1.00 60.92  ? 514 THR A CG2   1 
ATOM   2564 N N     . GLN E 3 163 ? -19.536 26.582  43.008 1.00 55.14  ? 515 GLN A N     1 
ATOM   2565 C CA    . GLN E 3 163 ? -19.499 28.020  42.573 1.00 52.59  ? 515 GLN A CA    1 
ATOM   2566 C C     . GLN E 3 163 ? -19.439 28.227  41.054 1.00 50.71  ? 515 GLN A C     1 
ATOM   2567 O O     . GLN E 3 163 ? -19.404 27.279  40.306 1.00 50.76  ? 515 GLN A O     1 
ATOM   2568 C CB    . GLN E 3 163 ? -18.320 28.783  43.193 1.00 53.71  ? 515 GLN A CB    1 
ATOM   2569 C CG    . GLN E 3 163 ? -16.938 28.280  42.755 1.00 61.19  ? 515 GLN A CG    1 
ATOM   2570 C CD    . GLN E 3 163 ? -15.988 28.121  43.919 1.00 62.36  ? 515 GLN A CD    1 
ATOM   2571 O OE1   . GLN E 3 163 ? -15.499 29.098  44.476 1.00 64.13  ? 515 GLN A OE1   1 
ATOM   2572 N NE2   . GLN E 3 163 ? -15.694 26.886  44.269 1.00 64.57  ? 515 GLN A NE2   1 
ATOM   2573 N N     . SER E 3 164 ? -19.323 29.472  40.627 1.00 49.97  ? 516 SER A N     1 
ATOM   2574 C CA    . SER E 3 164 ? -19.239 29.894  39.243 1.00 45.70  ? 516 SER A CA    1 
ATOM   2575 C C     . SER E 3 164 ? -18.962 31.362  39.156 1.00 46.86  ? 516 SER A C     1 
ATOM   2576 O O     . SER E 3 164 ? -19.503 32.074  38.313 1.00 43.16  ? 516 SER A O     1 
ATOM   2577 C CB    . SER E 3 164 ? -20.544 29.592  38.481 1.00 49.38  ? 516 SER A CB    1 
ATOM   2578 O OG    . SER E 3 164 ? -20.672 28.203  38.194 1.00 58.69  ? 516 SER A OG    1 
ATOM   2579 N N     . ARG E 3 165 ? -18.085 31.796  40.058 1.00 48.92  ? 517 ARG A N     1 
ATOM   2580 C CA    . ARG E 3 165 ? -17.666 33.190  40.201 1.00 46.76  ? 517 ARG A CA    1 
ATOM   2581 C C     . ARG E 3 165 ? -16.163 33.287  40.054 1.00 43.15  ? 517 ARG A C     1 
ATOM   2582 O O     . ARG E 3 165 ? -15.447 32.353  40.459 1.00 40.01  ? 517 ARG A O     1 
ATOM   2583 C CB    . ARG E 3 165 ? -18.095 33.681  41.590 1.00 48.20  ? 517 ARG A CB    1 
ATOM   2584 C CG    . ARG E 3 165 ? -17.289 33.099  42.750 1.00 45.83  ? 517 ARG A CG    1 
ATOM   2585 C CD    . ARG E 3 165 ? -17.802 33.577  44.062 1.00 51.08  ? 517 ARG A CD    1 
ATOM   2586 N NE    . ARG E 3 165 ? -16.896 34.471  44.785 1.00 45.30  ? 517 ARG A NE    1 
ATOM   2587 C CZ    . ARG E 3 165 ? -17.289 35.556  45.462 1.00 49.37  ? 517 ARG A CZ    1 
ATOM   2588 N NH1   . ARG E 3 165 ? -18.574 35.918  45.504 1.00 43.56  ? 517 ARG A NH1   1 
ATOM   2589 N NH2   . ARG E 3 165 ? -16.401 36.255  46.160 1.00 50.90  ? 517 ARG A NH2   1 
ATOM   2590 N N     . ARG E 3 166 ? -15.684 34.394  39.505 1.00 41.20  ? 518 ARG A N     1 
ATOM   2591 C CA    . ARG E 3 166 ? -14.248 34.585  39.301 1.00 41.35  ? 518 ARG A CA    1 
ATOM   2592 C C     . ARG E 3 166 ? -13.526 35.111  40.541 1.00 42.02  ? 518 ARG A C     1 
ATOM   2593 O O     . ARG E 3 166 ? -12.464 34.606  40.885 1.00 46.29  ? 518 ARG A O     1 
ATOM   2594 C CB    . ARG E 3 166 ? -14.023 35.563  38.132 1.00 42.37  ? 518 ARG A CB    1 
ATOM   2595 C CG    . ARG E 3 166 ? -14.935 35.340  36.947 1.00 48.84  ? 518 ARG A CG    1 
ATOM   2596 C CD    . ARG E 3 166 ? -14.417 36.035  35.705 1.00 55.79  ? 518 ARG A CD    1 
ATOM   2597 N NE    . ARG E 3 166 ? -13.248 35.354  35.152 1.00 63.13  ? 518 ARG A NE    1 
ATOM   2598 C CZ    . ARG E 3 166 ? -12.133 35.965  34.758 1.00 67.71  ? 518 ARG A CZ    1 
ATOM   2599 N NH1   . ARG E 3 166 ? -12.027 37.279  34.848 1.00 70.53  ? 518 ARG A NH1   1 
ATOM   2600 N NH2   . ARG E 3 166 ? -11.101 35.259  34.305 1.00 69.56  ? 518 ARG A NH2   1 
ATOM   2601 N N     . GLY E 3 167 ? -14.100 36.112  41.196 1.00 37.67  ? 519 GLY A N     1 
ATOM   2602 C CA    . GLY E 3 167 ? -13.475 36.654  42.377 1.00 34.18  ? 519 GLY A CA    1 
ATOM   2603 C C     . GLY E 3 167 ? -14.488 37.409  43.212 1.00 36.00  ? 519 GLY A C     1 
ATOM   2604 O O     . GLY E 3 167 ? -15.618 36.943  43.355 1.00 36.27  ? 519 GLY A O     1 
ATOM   2605 N N     . PRO E 3 168 ? -14.112 38.549  43.833 1.00 39.38  ? 520 PRO A N     1 
ATOM   2606 C CA    . PRO E 3 168 ? -12.759 39.125  43.734 1.00 39.75  ? 520 PRO A CA    1 
ATOM   2607 C C     . PRO E 3 168 ? -11.764 38.283  44.535 1.00 36.04  ? 520 PRO A C     1 
ATOM   2608 O O     . PRO E 3 168 ? -12.143 37.526  45.433 1.00 36.34  ? 520 PRO A O     1 
ATOM   2609 C CB    . PRO E 3 168 ? -12.932 40.518  44.343 1.00 38.57  ? 520 PRO A CB    1 
ATOM   2610 C CG    . PRO E 3 168 ? -14.019 40.291  45.376 1.00 39.27  ? 520 PRO A CG    1 
ATOM   2611 C CD    . PRO E 3 168 ? -15.007 39.431  44.604 1.00 37.94  ? 520 PRO A CD    1 
ATOM   2612 N N     . ILE E 3 169 ? -10.496 38.382  44.178 1.00 31.47  ? 521 ILE A N     1 
ATOM   2613 C CA    . ILE E 3 169 ? -9.483  37.621  44.870 1.00 28.56  ? 521 ILE A CA    1 
ATOM   2614 C C     . ILE E 3 169 ? -9.005  38.498  46.018 1.00 28.56  ? 521 ILE A C     1 
ATOM   2615 O O     . ILE E 3 169 ? -8.827  39.710  45.871 1.00 30.64  ? 521 ILE A O     1 
ATOM   2616 C CB    . ILE E 3 169 ? -8.339  37.209  43.912 1.00 24.72  ? 521 ILE A CB    1 
ATOM   2617 C CG1   . ILE E 3 169 ? -8.807  36.078  42.992 1.00 23.40  ? 521 ILE A CG1   1 
ATOM   2618 C CG2   . ILE E 3 169 ? -7.129  36.754  44.696 1.00 24.38  ? 521 ILE A CG2   1 
ATOM   2619 C CD1   . ILE E 3 169 ? -9.014  34.732  43.701 1.00 24.16  ? 521 ILE A CD1   1 
ATOM   2620 N N     . ALA E 3 170 ? -8.905  37.887  47.185 1.00 27.10  ? 522 ALA A N     1 
ATOM   2621 C CA    . ALA E 3 170 ? -8.470  38.576  48.376 1.00 28.09  ? 522 ALA A CA    1 
ATOM   2622 C C     . ALA E 3 170 ? -7.116  39.221  48.184 1.00 32.84  ? 522 ALA A C     1 
ATOM   2623 O O     . ALA E 3 170 ? -6.264  38.746  47.415 1.00 36.62  ? 522 ALA A O     1 
ATOM   2624 C CB    . ALA E 3 170 ? -8.412  37.609  49.536 1.00 24.80  ? 522 ALA A CB    1 
ATOM   2625 N N     . ARG E 3 171 ? -6.933  40.307  48.919 1.00 35.31  ? 523 ARG A N     1 
ATOM   2626 C CA    . ARG E 3 171 ? -5.704  41.086  48.929 1.00 35.10  ? 523 ARG A CA    1 
ATOM   2627 C C     . ARG E 3 171 ? -4.509  40.182  49.282 1.00 30.93  ? 523 ARG A C     1 
ATOM   2628 O O     . ARG E 3 171 ? -4.538  39.432  50.266 1.00 33.86  ? 523 ARG A O     1 
ATOM   2629 C CB    . ARG E 3 171 ? -5.891  42.226  49.948 1.00 37.70  ? 523 ARG A CB    1 
ATOM   2630 C CG    . ARG E 3 171 ? -4.650  42.838  50.525 1.00 36.46  ? 523 ARG A CG    1 
ATOM   2631 C CD    . ARG E 3 171 ? -4.993  43.513  51.837 1.00 35.16  ? 523 ARG A CD    1 
ATOM   2632 N NE    . ARG E 3 171 ? -3.799  44.076  52.446 1.00 39.95  ? 523 ARG A NE    1 
ATOM   2633 C CZ    . ARG E 3 171 ? -2.876  43.365  53.086 1.00 43.36  ? 523 ARG A CZ    1 
ATOM   2634 N NH1   . ARG E 3 171 ? -3.017  42.055  53.219 1.00 45.55  ? 523 ARG A NH1   1 
ATOM   2635 N NH2   . ARG E 3 171 ? -1.774  43.958  53.529 1.00 46.20  ? 523 ARG A NH2   1 
ATOM   2636 N N     . GLU E 3 172 ? -3.483  40.225  48.444 1.00 26.97  ? 524 GLU A N     1 
ATOM   2637 C CA    . GLU E 3 172 ? -2.272  39.426  48.627 1.00 25.62  ? 524 GLU A CA    1 
ATOM   2638 C C     . GLU E 3 172 ? -2.447  37.909  48.704 1.00 23.34  ? 524 GLU A C     1 
ATOM   2639 O O     . GLU E 3 172 ? -1.614  37.207  49.281 1.00 25.70  ? 524 GLU A O     1 
ATOM   2640 C CB    . GLU E 3 172 ? -1.468  39.930  49.822 1.00 26.59  ? 524 GLU A CB    1 
ATOM   2641 C CG    . GLU E 3 172 ? -1.001  41.357  49.651 1.00 32.74  ? 524 GLU A CG    1 
ATOM   2642 C CD    . GLU E 3 172 ? -0.156  41.867  50.802 1.00 37.38  ? 524 GLU A CD    1 
ATOM   2643 O OE1   . GLU E 3 172 ? 0.214   41.068  51.692 1.00 38.35  ? 524 GLU A OE1   1 
ATOM   2644 O OE2   . GLU E 3 172 ? 0.144   43.082  50.801 1.00 39.50  ? 524 GLU A OE2   1 
ATOM   2645 N N     . PHE E 3 173 ? -3.505  37.404  48.082 1.00 23.17  ? 525 PHE A N     1 
ATOM   2646 C CA    . PHE E 3 173 ? -3.786  35.978  48.062 1.00 18.55  ? 525 PHE A CA    1 
ATOM   2647 C C     . PHE E 3 173 ? -2.691  35.212  47.347 1.00 20.02  ? 525 PHE A C     1 
ATOM   2648 O O     . PHE E 3 173 ? -2.204  34.180  47.822 1.00 21.38  ? 525 PHE A O     1 
ATOM   2649 C CB    . PHE E 3 173 ? -5.112  35.720  47.347 1.00 21.47  ? 525 PHE A CB    1 
ATOM   2650 C CG    . PHE E 3 173 ? -5.453  34.271  47.234 1.00 21.53  ? 525 PHE A CG    1 
ATOM   2651 C CD1   . PHE E 3 173 ? -4.924  33.501  46.207 1.00 21.47  ? 525 PHE A CD1   1 
ATOM   2652 C CD2   . PHE E 3 173 ? -6.226  33.655  48.203 1.00 20.97  ? 525 PHE A CD2   1 
ATOM   2653 C CE1   . PHE E 3 173 ? -5.139  32.136  46.158 1.00 21.38  ? 525 PHE A CE1   1 
ATOM   2654 C CE2   . PHE E 3 173 ? -6.449  32.294  48.165 1.00 20.88  ? 525 PHE A CE2   1 
ATOM   2655 C CZ    . PHE E 3 173 ? -5.900  31.531  47.136 1.00 22.28  ? 525 PHE A CZ    1 
ATOM   2656 N N     . PHE E 3 174 ? -2.319  35.703  46.178 1.00 18.72  ? 526 PHE A N     1 
ATOM   2657 C CA    . PHE E 3 174 ? -1.299  35.035  45.397 1.00 16.27  ? 526 PHE A CA    1 
ATOM   2658 C C     . PHE E 3 174 ? 0.094   35.252  45.959 1.00 16.36  ? 526 PHE A C     1 
ATOM   2659 O O     . PHE E 3 174 ? 0.949   34.374  45.864 1.00 19.10  ? 526 PHE A O     1 
ATOM   2660 C CB    . PHE E 3 174 ? -1.412  35.444  43.932 1.00 14.02  ? 526 PHE A CB    1 
ATOM   2661 C CG    . PHE E 3 174 ? -2.649  34.911  43.257 1.00 9.89   ? 526 PHE A CG    1 
ATOM   2662 C CD1   . PHE E 3 174 ? -2.869  33.540  43.165 1.00 8.58   ? 526 PHE A CD1   1 
ATOM   2663 C CD2   . PHE E 3 174 ? -3.587  35.771  42.724 1.00 10.58  ? 526 PHE A CD2   1 
ATOM   2664 C CE1   . PHE E 3 174 ? -4.003  33.042  42.556 1.00 5.17   ? 526 PHE A CE1   1 
ATOM   2665 C CE2   . PHE E 3 174 ? -4.723  35.276  42.112 1.00 10.14  ? 526 PHE A CE2   1 
ATOM   2666 C CZ    . PHE E 3 174 ? -4.926  33.910  42.031 1.00 6.52   ? 526 PHE A CZ    1 
ATOM   2667 N N     . LYS E 3 175 ? 0.316   36.405  46.578 1.00 19.20  ? 527 LYS A N     1 
ATOM   2668 C CA    . LYS E 3 175 ? 1.613   36.692  47.186 1.00 17.58  ? 527 LYS A CA    1 
ATOM   2669 C C     . LYS E 3 175 ? 1.812   35.708  48.328 1.00 19.95  ? 527 LYS A C     1 
ATOM   2670 O O     . LYS E 3 175 ? 2.856   35.075  48.447 1.00 24.51  ? 527 LYS A O     1 
ATOM   2671 C CB    . LYS E 3 175 ? 1.674   38.125  47.701 1.00 17.82  ? 527 LYS A CB    1 
ATOM   2672 C CG    . LYS E 3 175 ? 3.036   38.545  48.175 1.00 27.35  ? 527 LYS A CG    1 
ATOM   2673 C CD    . LYS E 3 175 ? 3.012   39.953  48.740 1.00 37.08  ? 527 LYS A CD    1 
ATOM   2674 C CE    . LYS E 3 175 ? 4.426   40.457  49.027 1.00 38.60  ? 527 LYS A CE    1 
ATOM   2675 N NZ    . LYS E 3 175 ? 4.438   41.876  49.483 1.00 39.18  ? 527 LYS A NZ    1 
ATOM   2676 N N     . HIS E 3 176 ? 0.791   35.524  49.149 1.00 22.37  ? 528 HIS A N     1 
ATOM   2677 C CA    . HIS E 3 176 ? 0.929   34.573  50.224 1.00 26.92  ? 528 HIS A CA    1 
ATOM   2678 C C     . HIS E 3 176 ? 0.853   33.128  49.767 1.00 25.86  ? 528 HIS A C     1 
ATOM   2679 O O     . HIS E 3 176 ? 1.496   32.272  50.367 1.00 29.90  ? 528 HIS A O     1 
ATOM   2680 C CB    . HIS E 3 176 ? -0.019  34.892  51.377 1.00 40.79  ? 528 HIS A CB    1 
ATOM   2681 C CG    . HIS E 3 176 ? 0.471   36.021  52.222 1.00 53.43  ? 528 HIS A CG    1 
ATOM   2682 N ND1   . HIS E 3 176 ? 0.141   37.340  51.969 1.00 55.61  ? 528 HIS A ND1   1 
ATOM   2683 C CD2   . HIS E 3 176 ? 1.388   36.054  53.223 1.00 56.05  ? 528 HIS A CD2   1 
ATOM   2684 C CE1   . HIS E 3 176 ? 0.840   38.128  52.764 1.00 56.67  ? 528 HIS A CE1   1 
ATOM   2685 N NE2   . HIS E 3 176 ? 1.605   37.375  53.534 1.00 60.80  ? 528 HIS A NE2   1 
ATOM   2686 N N     . PHE E 3 177 ? 0.119   32.845  48.690 1.00 21.71  ? 529 PHE A N     1 
ATOM   2687 C CA    . PHE E 3 177 ? 0.068   31.479  48.191 1.00 14.57  ? 529 PHE A CA    1 
ATOM   2688 C C     . PHE E 3 177 ? 1.484   31.109  47.755 1.00 18.96  ? 529 PHE A C     1 
ATOM   2689 O O     . PHE E 3 177 ? 1.993   30.056  48.146 1.00 22.90  ? 529 PHE A O     1 
ATOM   2690 C CB    . PHE E 3 177 ? -0.914  31.325  47.023 1.00 17.02  ? 529 PHE A CB    1 
ATOM   2691 C CG    . PHE E 3 177 ? -1.298  29.887  46.755 1.00 16.39  ? 529 PHE A CG    1 
ATOM   2692 C CD1   . PHE E 3 177 ? -2.304  29.278  47.483 1.00 11.41  ? 529 PHE A CD1   1 
ATOM   2693 C CD2   . PHE E 3 177 ? -0.598  29.124  45.831 1.00 15.00  ? 529 PHE A CD2   1 
ATOM   2694 C CE1   . PHE E 3 177 ? -2.590  27.944  47.313 1.00 12.77  ? 529 PHE A CE1   1 
ATOM   2695 C CE2   . PHE E 3 177 ? -0.883  27.779  45.656 1.00 11.50  ? 529 PHE A CE2   1 
ATOM   2696 C CZ    . PHE E 3 177 ? -1.880  27.190  46.396 1.00 13.46  ? 529 PHE A CZ    1 
ATOM   2697 N N     . ALA E 3 178 ? 2.147   32.008  47.021 1.00 20.83  ? 530 ALA A N     1 
ATOM   2698 C CA    . ALA E 3 178 ? 3.532   31.802  46.547 1.00 21.56  ? 530 ALA A CA    1 
ATOM   2699 C C     . ALA E 3 178 ? 4.547   31.569  47.674 1.00 24.28  ? 530 ALA A C     1 
ATOM   2700 O O     . ALA E 3 178 ? 5.478   30.778  47.521 1.00 28.65  ? 530 ALA A O     1 
ATOM   2701 C CB    . ALA E 3 178 ? 3.986   32.982  45.698 1.00 16.37  ? 530 ALA A CB    1 
ATOM   2702 N N     . GLU E 3 179 ? 4.431   32.335  48.757 1.00 24.58  ? 531 GLU A N     1 
ATOM   2703 C CA    . GLU E 3 179 ? 5.317   32.188  49.912 1.00 23.19  ? 531 GLU A CA    1 
ATOM   2704 C C     . GLU E 3 179 ? 5.184   30.803  50.539 1.00 22.84  ? 531 GLU A C     1 
ATOM   2705 O O     . GLU E 3 179 ? 6.175   30.151  50.861 1.00 23.14  ? 531 GLU A O     1 
ATOM   2706 C CB    . GLU E 3 179 ? 4.977   33.239  50.961 1.00 24.52  ? 531 GLU A CB    1 
ATOM   2707 C CG    . GLU E 3 179 ? 5.618   34.576  50.724 1.00 26.97  ? 531 GLU A CG    1 
ATOM   2708 C CD    . GLU E 3 179 ? 5.090   35.654  51.657 1.00 38.85  ? 531 GLU A CD    1 
ATOM   2709 O OE1   . GLU E 3 179 ? 4.550   35.322  52.740 1.00 40.70  ? 531 GLU A OE1   1 
ATOM   2710 O OE2   . GLU E 3 179 ? 5.214   36.849  51.299 1.00 48.40  ? 531 GLU A OE2   1 
ATOM   2711 N N     . GLU E 3 180 ? 3.944   30.368  50.727 1.00 28.31  ? 532 GLU A N     1 
ATOM   2712 C CA    . GLU E 3 180 ? 3.662   29.062  51.318 1.00 33.00  ? 532 GLU A CA    1 
ATOM   2713 C C     . GLU E 3 180 ? 3.928   27.878  50.362 1.00 34.18  ? 532 GLU A C     1 
ATOM   2714 O O     . GLU E 3 180 ? 4.088   26.739  50.817 1.00 34.66  ? 532 GLU A O     1 
ATOM   2715 C CB    . GLU E 3 180 ? 2.218   29.018  51.839 1.00 29.45  ? 532 GLU A CB    1 
ATOM   2716 C CG    . GLU E 3 180 ? 1.934   27.798  52.704 1.00 41.52  ? 532 GLU A CG    1 
ATOM   2717 C CD    . GLU E 3 180 ? 0.557   27.819  53.339 1.00 46.62  ? 532 GLU A CD    1 
ATOM   2718 O OE1   . GLU E 3 180 ? -0.094  28.876  53.361 1.00 48.28  ? 532 GLU A OE1   1 
ATOM   2719 O OE2   . GLU E 3 180 ? 0.138   26.755  53.829 1.00 51.62  ? 532 GLU A OE2   1 
ATOM   2720 N N     . HIS E 3 181 ? 3.913   28.145  49.049 1.00 33.46  ? 533 HIS A N     1 
ATOM   2721 C CA    . HIS E 3 181 ? 4.160   27.135  48.000 1.00 30.26  ? 533 HIS A CA    1 
ATOM   2722 C C     . HIS E 3 181 ? 5.082   27.776  46.946 1.00 29.73  ? 533 HIS A C     1 
ATOM   2723 O O     . HIS E 3 181 ? 4.643   28.108  45.840 1.00 30.45  ? 533 HIS A O     1 
ATOM   2724 C CB    . HIS E 3 181 ? 2.843   26.692  47.329 1.00 26.55  ? 533 HIS A CB    1 
ATOM   2725 C CG    . HIS E 3 181 ? 1.755   26.312  48.289 1.00 26.02  ? 533 HIS A CG    1 
ATOM   2726 N ND1   . HIS E 3 181 ? 1.640   25.050  48.829 1.00 28.15  ? 533 HIS A ND1   1 
ATOM   2727 C CD2   . HIS E 3 181 ? 0.724   27.029  48.796 1.00 26.52  ? 533 HIS A CD2   1 
ATOM   2728 C CE1   . HIS E 3 181 ? 0.586   25.003  49.624 1.00 22.92  ? 533 HIS A CE1   1 
ATOM   2729 N NE2   . HIS E 3 181 ? 0.015   26.193  49.620 1.00 23.83  ? 533 HIS A NE2   1 
ATOM   2730 N N     . ALA E 3 182 ? 6.356   27.932  47.291 1.00 27.68  ? 534 ALA A N     1 
ATOM   2731 C CA    . ALA E 3 182 ? 7.345   28.564  46.417 1.00 25.27  ? 534 ALA A CA    1 
ATOM   2732 C C     . ALA E 3 182 ? 7.901   27.777  45.205 1.00 26.88  ? 534 ALA A C     1 
ATOM   2733 O O     . ALA E 3 182 ? 8.994   28.058  44.728 1.00 27.93  ? 534 ALA A O     1 
ATOM   2734 C CB    . ALA E 3 182 ? 8.473   29.133  47.258 1.00 18.43  ? 534 ALA A CB    1 
ATOM   2735 N N     . ALA E 3 183 ? 7.176   26.769  44.733 1.00 28.24  ? 535 ALA A N     1 
ATOM   2736 C CA    . ALA E 3 183 ? 7.605   26.031  43.550 1.00 22.95  ? 535 ALA A CA    1 
ATOM   2737 C C     . ALA E 3 183 ? 7.309   26.939  42.338 1.00 26.28  ? 535 ALA A C     1 
ATOM   2738 O O     . ALA E 3 183 ? 7.821   26.717  41.247 1.00 29.79  ? 535 ALA A O     1 
ATOM   2739 C CB    . ALA E 3 183 ? 6.833   24.715  43.431 1.00 13.66  ? 535 ALA A CB    1 
ATOM   2740 N N     . HIS E 3 184 ? 6.429   27.926  42.527 1.00 27.93  ? 536 HIS A N     1 
ATOM   2741 C CA    . HIS E 3 184 ? 6.048   28.876  41.480 1.00 21.46  ? 536 HIS A CA    1 
ATOM   2742 C C     . HIS E 3 184 ? 5.962   30.263  42.102 1.00 18.41  ? 536 HIS A C     1 
ATOM   2743 O O     . HIS E 3 184 ? 5.719   30.383  43.288 1.00 22.05  ? 536 HIS A O     1 
ATOM   2744 C CB    . HIS E 3 184 ? 4.687   28.504  40.894 1.00 18.69  ? 536 HIS A CB    1 
ATOM   2745 C CG    . HIS E 3 184 ? 4.652   27.169  40.234 1.00 19.60  ? 536 HIS A CG    1 
ATOM   2746 N ND1   . HIS E 3 184 ? 4.914   27.000  38.889 1.00 20.40  ? 536 HIS A ND1   1 
ATOM   2747 C CD2   . HIS E 3 184 ? 4.363   25.938  40.715 1.00 19.61  ? 536 HIS A CD2   1 
ATOM   2748 C CE1   . HIS E 3 184 ? 4.786   25.726  38.574 1.00 18.65  ? 536 HIS A CE1   1 
ATOM   2749 N NE2   . HIS E 3 184 ? 4.453   25.060  39.661 1.00 18.59  ? 536 HIS A NE2   1 
ATOM   2750 N N     . THR E 3 185 ? 6.159   31.306  41.304 1.00 20.49  ? 537 THR A N     1 
ATOM   2751 C CA    . THR E 3 185 ? 6.097   32.680  41.785 1.00 16.63  ? 537 THR A CA    1 
ATOM   2752 C C     . THR E 3 185 ? 4.645   33.142  41.876 1.00 19.70  ? 537 THR A C     1 
ATOM   2753 O O     . THR E 3 185 ? 3.741   32.452  41.407 1.00 22.32  ? 537 THR A O     1 
ATOM   2754 C CB    . THR E 3 185 ? 6.846   33.621  40.827 1.00 17.44  ? 537 THR A CB    1 
ATOM   2755 O OG1   . THR E 3 185 ? 6.295   33.499  39.516 1.00 23.69  ? 537 THR A OG1   1 
ATOM   2756 C CG2   . THR E 3 185 ? 8.299   33.269  40.750 1.00 15.87  ? 537 THR A CG2   1 
ATOM   2757 N N     . GLU E 3 186 ? 4.427   34.313  42.469 1.00 19.39  ? 538 GLU A N     1 
ATOM   2758 C CA    . GLU E 3 186 ? 3.091   34.878  42.590 1.00 16.95  ? 538 GLU A CA    1 
ATOM   2759 C C     . GLU E 3 186 ? 2.450   35.042  41.197 1.00 20.14  ? 538 GLU A C     1 
ATOM   2760 O O     . GLU E 3 186 ? 1.253   34.780  41.018 1.00 20.77  ? 538 GLU A O     1 
ATOM   2761 C CB    . GLU E 3 186 ? 3.160   36.229  43.302 1.00 9.55   ? 538 GLU A CB    1 
ATOM   2762 C CG    . GLU E 3 186 ? 1.815   36.929  43.325 1.00 10.44  ? 538 GLU A CG    1 
ATOM   2763 C CD    . GLU E 3 186 ? 1.846   38.307  43.943 1.00 16.61  ? 538 GLU A CD    1 
ATOM   2764 O OE1   . GLU E 3 186 ? 2.891   38.713  44.497 1.00 23.40  ? 538 GLU A OE1   1 
ATOM   2765 O OE2   . GLU E 3 186 ? 0.804   38.993  43.871 1.00 22.47  ? 538 GLU A OE2   1 
ATOM   2766 N N     . ASN E 3 187 ? 3.248   35.486  40.223 1.00 18.16  ? 539 ASN A N     1 
ATOM   2767 C CA    . ASN E 3 187 ? 2.781   35.663  38.851 1.00 14.70  ? 539 ASN A CA    1 
ATOM   2768 C C     . ASN E 3 187 ? 2.362   34.342  38.214 1.00 13.63  ? 539 ASN A C     1 
ATOM   2769 O O     . ASN E 3 187 ? 1.342   34.250  37.536 1.00 14.38  ? 539 ASN A O     1 
ATOM   2770 C CB    . ASN E 3 187 ? 3.877   36.285  37.998 1.00 18.27  ? 539 ASN A CB    1 
ATOM   2771 C CG    . ASN E 3 187 ? 4.001   37.777  38.194 1.00 21.88  ? 539 ASN A CG    1 
ATOM   2772 O OD1   . ASN E 3 187 ? 3.269   38.384  38.969 1.00 28.04  ? 539 ASN A OD1   1 
ATOM   2773 N ND2   . ASN E 3 187 ? 4.924   38.382  37.469 1.00 26.13  ? 539 ASN A ND2   1 
ATOM   2774 N N     . ALA E 3 188 ? 3.161   33.310  38.418 1.00 13.79  ? 540 ALA A N     1 
ATOM   2775 C CA    . ALA E 3 188 ? 2.839   32.020  37.842 1.00 10.96  ? 540 ALA A CA    1 
ATOM   2776 C C     . ALA E 3 188 ? 1.540   31.473  38.388 1.00 13.98  ? 540 ALA A C     1 
ATOM   2777 O O     . ALA E 3 188 ? 0.689   31.003  37.634 1.00 23.36  ? 540 ALA A O     1 
ATOM   2778 C CB    . ALA E 3 188 ? 3.981   31.032  38.070 1.00 6.20   ? 540 ALA A CB    1 
ATOM   2779 N N     . TRP E 3 189 ? 1.374   31.539  39.703 1.00 15.67  ? 541 TRP A N     1 
ATOM   2780 C CA    . TRP E 3 189 ? 0.165   31.030  40.342 1.00 12.88  ? 541 TRP A CA    1 
ATOM   2781 C C     . TRP E 3 189 ? -1.074  31.788  39.889 1.00 10.09  ? 541 TRP A C     1 
ATOM   2782 O O     . TRP E 3 189 ? -2.129  31.205  39.669 1.00 9.92   ? 541 TRP A O     1 
ATOM   2783 C CB    . TRP E 3 189 ? 0.291   31.102  41.873 1.00 17.19  ? 541 TRP A CB    1 
ATOM   2784 C CG    . TRP E 3 189 ? 1.185   30.060  42.512 1.00 11.67  ? 541 TRP A CG    1 
ATOM   2785 C CD1   . TRP E 3 189 ? 2.311   30.294  43.241 1.00 9.81   ? 541 TRP A CD1   1 
ATOM   2786 C CD2   . TRP E 3 189 ? 0.962   28.640  42.570 1.00 10.37  ? 541 TRP A CD2   1 
ATOM   2787 N NE1   . TRP E 3 189 ? 2.800   29.119  43.763 1.00 11.97  ? 541 TRP A NE1   1 
ATOM   2788 C CE2   . TRP E 3 189 ? 1.986   28.086  43.367 1.00 13.47  ? 541 TRP A CE2   1 
ATOM   2789 C CE3   . TRP E 3 189 ? -0.005  27.787  42.037 1.00 8.31   ? 541 TRP A CE3   1 
ATOM   2790 C CZ2   . TRP E 3 189 ? 2.061   26.718  43.660 1.00 14.07  ? 541 TRP A CZ2   1 
ATOM   2791 C CZ3   . TRP E 3 189 ? 0.069   26.422  42.330 1.00 4.76   ? 541 TRP A CZ3   1 
ATOM   2792 C CH2   . TRP E 3 189 ? 1.094   25.907  43.130 1.00 8.92   ? 541 TRP A CH2   1 
ATOM   2793 N N     . ARG E 3 190 ? -0.955  33.102  39.806 1.00 10.76  ? 542 ARG A N     1 
ATOM   2794 C CA    . ARG E 3 190 ? -2.066  33.911  39.377 1.00 14.87  ? 542 ARG A CA    1 
ATOM   2795 C C     . ARG E 3 190 ? -2.497  33.592  37.973 1.00 17.05  ? 542 ARG A C     1 
ATOM   2796 O O     . ARG E 3 190 ? -3.688  33.530  37.702 1.00 23.70  ? 542 ARG A O     1 
ATOM   2797 C CB    . ARG E 3 190 ? -1.755  35.391  39.461 1.00 13.68  ? 542 ARG A CB    1 
ATOM   2798 C CG    . ARG E 3 190 ? -2.980  36.206  39.090 1.00 17.16  ? 542 ARG A CG    1 
ATOM   2799 C CD    . ARG E 3 190 ? -2.852  37.628  39.532 1.00 16.71  ? 542 ARG A CD    1 
ATOM   2800 N NE    . ARG E 3 190 ? -2.817  38.553  38.414 1.00 23.70  ? 542 ARG A NE    1 
ATOM   2801 C CZ    . ARG E 3 190 ? -3.877  39.159  37.899 1.00 18.41  ? 542 ARG A CZ    1 
ATOM   2802 N NH1   . ARG E 3 190 ? -5.093  38.948  38.390 1.00 24.60  ? 542 ARG A NH1   1 
ATOM   2803 N NH2   . ARG E 3 190 ? -3.705  39.997  36.895 1.00 20.85  ? 542 ARG A NH2   1 
ATOM   2804 N N     . ASP E 3 191 ? -1.544  33.447  37.061 1.00 21.10  ? 543 ASP A N     1 
ATOM   2805 C CA    . ASP E 3 191 ? -1.907  33.129  35.688 1.00 19.04  ? 543 ASP A CA    1 
ATOM   2806 C C     . ASP E 3 191 ? -2.470  31.729  35.584 1.00 17.69  ? 543 ASP A C     1 
ATOM   2807 O O     . ASP E 3 191 ? -3.409  31.489  34.840 1.00 23.38  ? 543 ASP A O     1 
ATOM   2808 C CB    . ASP E 3 191 ? -0.744  33.309  34.741 1.00 19.38  ? 543 ASP A CB    1 
ATOM   2809 C CG    . ASP E 3 191 ? -1.190  33.846  33.411 1.00 25.83  ? 543 ASP A CG    1 
ATOM   2810 O OD1   . ASP E 3 191 ? -1.985  34.803  33.413 1.00 28.23  ? 543 ASP A OD1   1 
ATOM   2811 O OD2   . ASP E 3 191 ? -0.775  33.321  32.361 1.00 30.71  ? 543 ASP A OD2   1 
ATOM   2812 N N     . ARG E 3 192 ? -1.928  30.809  36.365 1.00 15.38  ? 544 ARG A N     1 
ATOM   2813 C CA    . ARG E 3 192 ? -2.427  29.450  36.380 1.00 15.22  ? 544 ARG A CA    1 
ATOM   2814 C C     . ARG E 3 192 ? -3.895  29.461  36.808 1.00 20.10  ? 544 ARG A C     1 
ATOM   2815 O O     . ARG E 3 192 ? -4.689  28.633  36.366 1.00 26.58  ? 544 ARG A O     1 
ATOM   2816 C CB    . ARG E 3 192 ? -1.631  28.624  37.377 1.00 16.02  ? 544 ARG A CB    1 
ATOM   2817 C CG    . ARG E 3 192 ? -2.029  27.168  37.393 1.00 16.25  ? 544 ARG A CG    1 
ATOM   2818 C CD    . ARG E 3 192 ? -1.686  26.534  36.077 1.00 15.82  ? 544 ARG A CD    1 
ATOM   2819 N NE    . ARG E 3 192 ? -2.004  25.118  36.073 1.00 19.32  ? 544 ARG A NE    1 
ATOM   2820 C CZ    . ARG E 3 192 ? -1.749  24.308  35.048 1.00 28.74  ? 544 ARG A CZ    1 
ATOM   2821 N NH1   . ARG E 3 192 ? -1.161  24.786  33.953 1.00 24.17  ? 544 ARG A NH1   1 
ATOM   2822 N NH2   . ARG E 3 192 ? -2.110  23.027  35.101 1.00 22.47  ? 544 ARG A NH2   1 
ATOM   2823 N N     . PHE E 3 193 ? -4.235  30.358  37.728 1.00 22.76  ? 545 PHE A N     1 
ATOM   2824 C CA    . PHE E 3 193 ? -5.609  30.491  38.217 1.00 19.94  ? 545 PHE A CA    1 
ATOM   2825 C C     . PHE E 3 193 ? -6.505  31.112  37.146 1.00 18.16  ? 545 PHE A C     1 
ATOM   2826 O O     . PHE E 3 193 ? -7.601  30.616  36.878 1.00 19.24  ? 545 PHE A O     1 
ATOM   2827 C CB    . PHE E 3 193 ? -5.639  31.327  39.518 1.00 18.69  ? 545 PHE A CB    1 
ATOM   2828 C CG    . PHE E 3 193 ? -6.983  31.989  39.816 1.00 18.97  ? 545 PHE A CG    1 
ATOM   2829 C CD1   . PHE E 3 193 ? -8.024  31.270  40.410 1.00 18.49  ? 545 PHE A CD1   1 
ATOM   2830 C CD2   . PHE E 3 193 ? -7.192  33.347  39.520 1.00 20.52  ? 545 PHE A CD2   1 
ATOM   2831 C CE1   . PHE E 3 193 ? -9.244  31.889  40.706 1.00 12.67  ? 545 PHE A CE1   1 
ATOM   2832 C CE2   . PHE E 3 193 ? -8.410  33.977  39.808 1.00 11.05  ? 545 PHE A CE2   1 
ATOM   2833 C CZ    . PHE E 3 193 ? -9.432  33.250  40.400 1.00 17.25  ? 545 PHE A CZ    1 
ATOM   2834 N N     . ARG E 3 194 ? -6.023  32.176  36.514 1.00 20.79  ? 546 ARG A N     1 
ATOM   2835 C CA    . ARG E 3 194 ? -6.796  32.872  35.490 1.00 21.42  ? 546 ARG A CA    1 
ATOM   2836 C C     . ARG E 3 194 ? -7.033  32.083  34.228 1.00 22.45  ? 546 ARG A C     1 
ATOM   2837 O O     . ARG E 3 194 ? -8.162  31.953  33.769 1.00 26.48  ? 546 ARG A O     1 
ATOM   2838 C CB    . ARG E 3 194 ? -6.114  34.173  35.098 1.00 16.43  ? 546 ARG A CB    1 
ATOM   2839 C CG    . ARG E 3 194 ? -6.156  35.268  36.138 1.00 19.96  ? 546 ARG A CG    1 
ATOM   2840 C CD    . ARG E 3 194 ? -5.368  36.478  35.623 1.00 24.48  ? 546 ARG A CD    1 
ATOM   2841 N NE    . ARG E 3 194 ? -5.942  37.032  34.390 1.00 26.21  ? 546 ARG A NE    1 
ATOM   2842 C CZ    . ARG E 3 194 ? -5.339  37.901  33.579 1.00 23.32  ? 546 ARG A CZ    1 
ATOM   2843 N NH1   . ARG E 3 194 ? -4.115  38.348  33.840 1.00 19.02  ? 546 ARG A NH1   1 
ATOM   2844 N NH2   . ARG E 3 194 ? -5.971  38.331  32.490 1.00 30.07  ? 546 ARG A NH2   1 
ATOM   2845 N N     . LYS E 3 195 ? -5.948  31.566  33.673 1.00 24.14  ? 547 LYS A N     1 
ATOM   2846 C CA    . LYS E 3 195 ? -5.980  30.840  32.415 1.00 23.47  ? 547 LYS A CA    1 
ATOM   2847 C C     . LYS E 3 195 ? -6.397  29.379  32.453 1.00 23.36  ? 547 LYS A C     1 
ATOM   2848 O O     . LYS E 3 195 ? -6.947  28.874  31.479 1.00 27.44  ? 547 LYS A O     1 
ATOM   2849 C CB    . LYS E 3 195 ? -4.617  30.976  31.726 1.00 14.72  ? 547 LYS A CB    1 
ATOM   2850 C CG    . LYS E 3 195 ? -4.092  32.393  31.686 1.00 9.35   ? 547 LYS A CG    1 
ATOM   2851 C CD    . LYS E 3 195 ? -5.103  33.334  31.083 1.00 17.01  ? 547 LYS A CD    1 
ATOM   2852 C CE    . LYS E 3 195 ? -4.816  34.772  31.429 1.00 16.00  ? 547 LYS A CE    1 
ATOM   2853 N NZ    . LYS E 3 195 ? -3.444  35.141  31.030 1.00 22.88  ? 547 LYS A NZ    1 
ATOM   2854 N N     . PHE E 3 196 ? -6.125  28.689  33.555 1.00 25.74  ? 548 PHE A N     1 
ATOM   2855 C CA    . PHE E 3 196 ? -6.475  27.281  33.646 1.00 26.34  ? 548 PHE A CA    1 
ATOM   2856 C C     . PHE E 3 196 ? -7.583  26.979  34.620 1.00 29.77  ? 548 PHE A C     1 
ATOM   2857 O O     . PHE E 3 196 ? -8.604  26.421  34.231 1.00 30.96  ? 548 PHE A O     1 
ATOM   2858 C CB    . PHE E 3 196 ? -5.244  26.441  33.955 1.00 27.27  ? 548 PHE A CB    1 
ATOM   2859 C CG    . PHE E 3 196 ? -4.249  26.412  32.830 1.00 29.59  ? 548 PHE A CG    1 
ATOM   2860 C CD1   . PHE E 3 196 ? -3.440  27.514  32.571 1.00 25.85  ? 548 PHE A CD1   1 
ATOM   2861 C CD2   . PHE E 3 196 ? -4.148  25.296  32.002 1.00 26.43  ? 548 PHE A CD2   1 
ATOM   2862 C CE1   . PHE E 3 196 ? -2.550  27.508  31.508 1.00 25.66  ? 548 PHE A CE1   1 
ATOM   2863 C CE2   . PHE E 3 196 ? -3.259  25.280  30.933 1.00 24.20  ? 548 PHE A CE2   1 
ATOM   2864 C CZ    . PHE E 3 196 ? -2.459  26.387  30.686 1.00 25.18  ? 548 PHE A CZ    1 
ATOM   2865 N N     . LEU E 3 197 ? -7.402  27.353  35.879 1.00 31.15  ? 549 LEU A N     1 
ATOM   2866 C CA    . LEU E 3 197 ? -8.439  27.099  36.879 1.00 31.88  ? 549 LEU A CA    1 
ATOM   2867 C C     . LEU E 3 197 ? -9.785  27.714  36.511 1.00 32.12  ? 549 LEU A C     1 
ATOM   2868 O O     . LEU E 3 197 ? -10.790 27.019  36.476 1.00 35.13  ? 549 LEU A O     1 
ATOM   2869 C CB    . LEU E 3 197 ? -8.027  27.624  38.248 1.00 30.96  ? 549 LEU A CB    1 
ATOM   2870 C CG    . LEU E 3 197 ? -7.874  26.614  39.375 1.00 33.99  ? 549 LEU A CG    1 
ATOM   2871 C CD1   . LEU E 3 197 ? -8.033  27.347  40.709 1.00 32.87  ? 549 LEU A CD1   1 
ATOM   2872 C CD2   . LEU E 3 197 ? -8.907  25.497  39.246 1.00 30.92  ? 549 LEU A CD2   1 
ATOM   2873 N N     . LEU E 3 198 ? -9.817  29.022  36.274 1.00 32.55  ? 550 LEU A N     1 
ATOM   2874 C CA    . LEU E 3 198 ? -11.066 29.681  35.923 1.00 33.36  ? 550 LEU A CA    1 
ATOM   2875 C C     . LEU E 3 198 ? -11.658 29.126  34.638 1.00 39.22  ? 550 LEU A C     1 
ATOM   2876 O O     . LEU E 3 198 ? -12.878 29.120  34.466 1.00 43.73  ? 550 LEU A O     1 
ATOM   2877 C CB    . LEU E 3 198 ? -10.873 31.190  35.803 1.00 28.07  ? 550 LEU A CB    1 
ATOM   2878 C CG    . LEU E 3 198 ? -10.745 31.942  37.133 1.00 27.73  ? 550 LEU A CG    1 
ATOM   2879 C CD1   . LEU E 3 198 ? -10.736 33.443  36.870 1.00 23.06  ? 550 LEU A CD1   1 
ATOM   2880 C CD2   . LEU E 3 198 ? -11.885 31.579  38.079 1.00 22.35  ? 550 LEU A CD2   1 
ATOM   2881 N N     . ALA E 3 199 ? -10.783 28.647  33.756 1.00 41.15  ? 551 ALA A N     1 
ATOM   2882 C CA    . ALA E 3 199 ? -11.166 28.070  32.469 1.00 40.99  ? 551 ALA A CA    1 
ATOM   2883 C C     . ALA E 3 199 ? -11.831 26.693  32.597 1.00 42.53  ? 551 ALA A C     1 
ATOM   2884 O O     . ALA E 3 199 ? -12.876 26.434  31.994 1.00 44.21  ? 551 ALA A O     1 
ATOM   2885 C CB    . ALA E 3 199 ? -9.947  27.970  31.576 1.00 41.98  ? 551 ALA A CB    1 
ATOM   2886 N N     . TYR E 3 200 ? -11.188 25.807  33.347 1.00 40.21  ? 552 TYR A N     1 
ATOM   2887 C CA    . TYR E 3 200 ? -11.672 24.448  33.582 1.00 39.04  ? 552 TYR A CA    1 
ATOM   2888 C C     . TYR E 3 200 ? -12.824 24.441  34.598 1.00 39.90  ? 552 TYR A C     1 
ATOM   2889 O O     . TYR E 3 200 ? -13.727 23.599  34.523 1.00 38.21  ? 552 TYR A O     1 
ATOM   2890 C CB    . TYR E 3 200 ? -10.503 23.616  34.108 1.00 38.05  ? 552 TYR A CB    1 
ATOM   2891 C CG    . TYR E 3 200 ? -10.742 22.135  34.298 1.00 38.08  ? 552 TYR A CG    1 
ATOM   2892 C CD1   . TYR E 3 200 ? -11.394 21.651  35.423 1.00 39.32  ? 552 TYR A CD1   1 
ATOM   2893 C CD2   . TYR E 3 200 ? -10.199 21.208  33.412 1.00 42.05  ? 552 TYR A CD2   1 
ATOM   2894 C CE1   . TYR E 3 200 ? -11.486 20.280  35.672 1.00 40.52  ? 552 TYR A CE1   1 
ATOM   2895 C CE2   . TYR E 3 200 ? -10.286 19.836  33.654 1.00 44.04  ? 552 TYR A CE2   1 
ATOM   2896 C CZ    . TYR E 3 200 ? -10.928 19.378  34.791 1.00 41.40  ? 552 TYR A CZ    1 
ATOM   2897 O OH    . TYR E 3 200 ? -10.982 18.022  35.063 1.00 39.69  ? 552 TYR A OH    1 
ATOM   2898 N N     . GLY E 3 201 ? -12.753 25.359  35.561 1.00 39.27  ? 553 GLY A N     1 
ATOM   2899 C CA    . GLY E 3 201 ? -13.761 25.469  36.595 1.00 35.12  ? 553 GLY A CA    1 
ATOM   2900 C C     . GLY E 3 201 ? -13.221 24.909  37.890 1.00 36.44  ? 553 GLY A C     1 
ATOM   2901 O O     . GLY E 3 201 ? -12.784 23.755  37.946 1.00 39.45  ? 553 GLY A O     1 
ATOM   2902 N N     . ILE E 3 202 ? -13.276 25.712  38.949 1.00 38.42  ? 554 ILE A N     1 
ATOM   2903 C CA    . ILE E 3 202 ? -12.768 25.292  40.258 1.00 34.21  ? 554 ILE A CA    1 
ATOM   2904 C C     . ILE E 3 202 ? -13.410 24.003  40.779 1.00 30.23  ? 554 ILE A C     1 
ATOM   2905 O O     . ILE E 3 202 ? -12.719 23.059  41.144 1.00 21.06  ? 554 ILE A O     1 
ATOM   2906 C CB    . ILE E 3 202 ? -12.928 26.419  41.307 1.00 33.60  ? 554 ILE A CB    1 
ATOM   2907 C CG1   . ILE E 3 202 ? -12.213 27.683  40.823 1.00 33.82  ? 554 ILE A CG1   1 
ATOM   2908 C CG2   . ILE E 3 202 ? -12.334 25.980  42.639 1.00 33.23  ? 554 ILE A CG2   1 
ATOM   2909 C CD1   . ILE E 3 202 ? -12.603 28.949  41.565 1.00 38.23  ? 554 ILE A CD1   1 
ATOM   2910 N N     . ASP E 3 203 ? -14.737 23.955  40.780 1.00 33.42  ? 555 ASP A N     1 
ATOM   2911 C CA    . ASP E 3 203 ? -15.440 22.779  41.274 1.00 35.51  ? 555 ASP A CA    1 
ATOM   2912 C C     . ASP E 3 203 ? -15.141 21.567  40.425 1.00 34.18  ? 555 ASP A C     1 
ATOM   2913 O O     . ASP E 3 203 ? -14.904 20.477  40.944 1.00 36.27  ? 555 ASP A O     1 
ATOM   2914 C CB    . ASP E 3 203 ? -16.951 23.006  41.279 1.00 39.56  ? 555 ASP A CB    1 
ATOM   2915 C CG    . ASP E 3 203 ? -17.342 24.302  41.938 1.00 39.98  ? 555 ASP A CG    1 
ATOM   2916 O OD1   . ASP E 3 203 ? -16.923 24.528  43.092 1.00 36.94  ? 555 ASP A OD1   1 
ATOM   2917 O OD2   . ASP E 3 203 ? -18.066 25.091  41.290 1.00 38.93  ? 555 ASP A OD2   1 
ATOM   2918 N N     . ASP E 3 204 ? -15.156 21.763  39.114 1.00 33.48  ? 556 ASP A N     1 
ATOM   2919 C CA    . ASP E 3 204 ? -14.904 20.675  38.184 1.00 34.68  ? 556 ASP A CA    1 
ATOM   2920 C C     . ASP E 3 204 ? -13.536 20.066  38.456 1.00 34.83  ? 556 ASP A C     1 
ATOM   2921 O O     . ASP E 3 204 ? -13.407 18.845  38.603 1.00 38.13  ? 556 ASP A O     1 
ATOM   2922 C CB    . ASP E 3 204 ? -15.023 21.174  36.743 1.00 37.26  ? 556 ASP A CB    1 
ATOM   2923 C CG    . ASP E 3 204 ? -16.399 21.748  36.439 1.00 42.11  ? 556 ASP A CG    1 
ATOM   2924 O OD1   . ASP E 3 204 ? -16.662 22.906  36.836 1.00 47.04  ? 556 ASP A OD1   1 
ATOM   2925 O OD2   . ASP E 3 204 ? -17.222 21.038  35.819 1.00 44.42  ? 556 ASP A OD2   1 
ATOM   2926 N N     . TYR E 3 205 ? -12.512 20.904  38.593 1.00 33.53  ? 557 TYR A N     1 
ATOM   2927 C CA    . TYR E 3 205 ? -11.202 20.345  38.867 1.00 32.20  ? 557 TYR A CA    1 
ATOM   2928 C C     . TYR E 3 205 ? -11.120 19.631  40.217 1.00 33.97  ? 557 TYR A C     1 
ATOM   2929 O O     . TYR E 3 205 ? -10.451 18.605  40.336 1.00 35.40  ? 557 TYR A O     1 
ATOM   2930 C CB    . TYR E 3 205 ? -10.078 21.370  38.721 1.00 30.68  ? 557 TYR A CB    1 
ATOM   2931 C CG    . TYR E 3 205 ? -8.740  20.671  38.638 1.00 29.58  ? 557 TYR A CG    1 
ATOM   2932 C CD1   . TYR E 3 205 ? -8.256  20.191  37.409 1.00 29.01  ? 557 TYR A CD1   1 
ATOM   2933 C CD2   . TYR E 3 205 ? -8.002  20.403  39.790 1.00 21.84  ? 557 TYR A CD2   1 
ATOM   2934 C CE1   . TYR E 3 205 ? -7.079  19.462  37.336 1.00 22.63  ? 557 TYR A CE1   1 
ATOM   2935 C CE2   . TYR E 3 205 ? -6.822  19.672  39.731 1.00 28.00  ? 557 TYR A CE2   1 
ATOM   2936 C CZ    . TYR E 3 205 ? -6.363  19.206  38.503 1.00 29.40  ? 557 TYR A CZ    1 
ATOM   2937 O OH    . TYR E 3 205 ? -5.177  18.502  38.452 1.00 34.71  ? 557 TYR A OH    1 
ATOM   2938 N N     . ILE E 3 206 ? -11.786 20.171  41.235 1.00 37.96  ? 558 ILE A N     1 
ATOM   2939 C CA    . ILE E 3 206 ? -11.777 19.545  42.556 1.00 36.22  ? 558 ILE A CA    1 
ATOM   2940 C C     . ILE E 3 206 ? -12.465 18.179  42.543 1.00 35.91  ? 558 ILE A C     1 
ATOM   2941 O O     . ILE E 3 206 ? -11.955 17.224  43.139 1.00 30.60  ? 558 ILE A O     1 
ATOM   2942 C CB    . ILE E 3 206 ? -12.390 20.471  43.631 1.00 37.77  ? 558 ILE A CB    1 
ATOM   2943 C CG1   . ILE E 3 206 ? -11.516 21.723  43.764 1.00 35.40  ? 558 ILE A CG1   1 
ATOM   2944 C CG2   . ILE E 3 206 ? -12.479 19.747  44.977 1.00 35.37  ? 558 ILE A CG2   1 
ATOM   2945 C CD1   . ILE E 3 206 ? -11.865 22.615  44.925 1.00 36.19  ? 558 ILE A CD1   1 
ATOM   2946 N N     . SER E 3 207 ? -13.618 18.086  41.878 1.00 39.01  ? 559 SER A N     1 
ATOM   2947 C CA    . SER E 3 207 ? -14.327 16.807  41.776 1.00 42.67  ? 559 SER A CA    1 
ATOM   2948 C C     . SER E 3 207 ? -13.443 15.814  41.028 1.00 41.35  ? 559 SER A C     1 
ATOM   2949 O O     . SER E 3 207 ? -13.251 14.694  41.500 1.00 42.91  ? 559 SER A O     1 
ATOM   2950 C CB    . SER E 3 207 ? -15.702 16.955  41.097 1.00 42.82  ? 559 SER A CB    1 
ATOM   2951 O OG    . SER E 3 207 ? -15.638 17.701  39.895 1.00 51.09  ? 559 SER A OG    1 
ATOM   2952 N N     . TYR E 3 208 ? -12.857 16.257  39.910 1.00 42.11  ? 560 TYR A N     1 
ATOM   2953 C CA    . TYR E 3 208 ? -11.953 15.432  39.101 1.00 43.22  ? 560 TYR A CA    1 
ATOM   2954 C C     . TYR E 3 208 ? -10.750 14.887  39.888 1.00 42.62  ? 560 TYR A C     1 
ATOM   2955 O O     . TYR E 3 208 ? -10.520 13.681  39.913 1.00 43.92  ? 560 TYR A O     1 
ATOM   2956 C CB    . TYR E 3 208 ? -11.448 16.207  37.872 1.00 46.61  ? 560 TYR A CB    1 
ATOM   2957 C CG    . TYR E 3 208 ? -10.253 15.548  37.188 1.00 50.65  ? 560 TYR A CG    1 
ATOM   2958 C CD1   . TYR E 3 208 ? -10.413 14.400  36.399 1.00 51.82  ? 560 TYR A CD1   1 
ATOM   2959 C CD2   . TYR E 3 208 ? -8.954  16.031  37.387 1.00 48.92  ? 560 TYR A CD2   1 
ATOM   2960 C CE1   . TYR E 3 208 ? -9.307  13.745  35.835 1.00 51.87  ? 560 TYR A CE1   1 
ATOM   2961 C CE2   . TYR E 3 208 ? -7.844  15.386  36.828 1.00 50.55  ? 560 TYR A CE2   1 
ATOM   2962 C CZ    . TYR E 3 208 ? -8.026  14.242  36.056 1.00 52.43  ? 560 TYR A CZ    1 
ATOM   2963 O OH    . TYR E 3 208 ? -6.933  13.590  35.526 1.00 49.84  ? 560 TYR A OH    1 
ATOM   2964 N N     . TYR E 3 209 ? -9.956  15.773  40.481 1.00 43.65  ? 561 TYR A N     1 
ATOM   2965 C CA    . TYR E 3 209 ? -8.790  15.356  41.260 1.00 44.59  ? 561 TYR A CA    1 
ATOM   2966 C C     . TYR E 3 209 ? -9.172  14.371  42.369 1.00 46.91  ? 561 TYR A C     1 
ATOM   2967 O O     . TYR E 3 209 ? -8.567  13.310  42.493 1.00 49.58  ? 561 TYR A O     1 
ATOM   2968 C CB    . TYR E 3 209 ? -8.076  16.577  41.864 1.00 39.26  ? 561 TYR A CB    1 
ATOM   2969 C CG    . TYR E 3 209 ? -6.859  16.250  42.723 1.00 37.27  ? 561 TYR A CG    1 
ATOM   2970 C CD1   . TYR E 3 209 ? -7.005  15.720  44.011 1.00 35.58  ? 561 TYR A CD1   1 
ATOM   2971 C CD2   . TYR E 3 209 ? -5.564  16.517  42.266 1.00 36.24  ? 561 TYR A CD2   1 
ATOM   2972 C CE1   . TYR E 3 209 ? -5.896  15.472  44.823 1.00 33.91  ? 561 TYR A CE1   1 
ATOM   2973 C CE2   . TYR E 3 209 ? -4.452  16.272  43.068 1.00 35.46  ? 561 TYR A CE2   1 
ATOM   2974 C CZ    . TYR E 3 209 ? -4.624  15.753  44.351 1.00 33.87  ? 561 TYR A CZ    1 
ATOM   2975 O OH    . TYR E 3 209 ? -3.526  15.564  45.174 1.00 29.83  ? 561 TYR A OH    1 
ATOM   2976 N N     . GLU E 3 210 ? -10.144 14.749  43.195 1.00 51.40  ? 562 GLU A N     1 
ATOM   2977 C CA    . GLU E 3 210 ? -10.600 13.904  44.296 1.00 54.96  ? 562 GLU A CA    1 
ATOM   2978 C C     . GLU E 3 210 ? -11.155 12.563  43.834 1.00 56.15  ? 562 GLU A C     1 
ATOM   2979 O O     . GLU E 3 210 ? -11.020 11.555  44.536 1.00 56.27  ? 562 GLU A O     1 
ATOM   2980 C CB    . GLU E 3 210 ? -11.670 14.620  45.107 1.00 56.64  ? 562 GLU A CB    1 
ATOM   2981 C CG    . GLU E 3 210 ? -11.141 15.741  45.967 1.00 62.28  ? 562 GLU A CG    1 
ATOM   2982 C CD    . GLU E 3 210 ? -12.219 16.373  46.828 1.00 65.11  ? 562 GLU A CD    1 
ATOM   2983 O OE1   . GLU E 3 210 ? -13.333 15.799  46.923 1.00 64.76  ? 562 GLU A OE1   1 
ATOM   2984 O OE2   . GLU E 3 210 ? -11.941 17.448  47.411 1.00 65.79  ? 562 GLU A OE2   1 
ATOM   2985 N N     . ALA E 3 211 ? -11.789 12.560  42.663 1.00 56.16  ? 563 ALA A N     1 
ATOM   2986 C CA    . ALA E 3 211 ? -12.374 11.349  42.090 1.00 57.18  ? 563 ALA A CA    1 
ATOM   2987 C C     . ALA E 3 211 ? -11.365 10.275  41.652 1.00 58.87  ? 563 ALA A C     1 
ATOM   2988 O O     . ALA E 3 211 ? -11.718 9.389   40.871 1.00 61.56  ? 563 ALA A O     1 
ATOM   2989 C CB    . ALA E 3 211 ? -13.299 11.710  40.925 1.00 52.23  ? 563 ALA A CB    1 
ATOM   2990 N N     . GLU E 3 212 ? -10.126 10.352  42.142 1.00 58.25  ? 564 GLU A N     1 
ATOM   2991 C CA    . GLU E 3 212 ? -9.097  9.370   41.814 1.00 55.55  ? 564 GLU A CA    1 
ATOM   2992 C C     . GLU E 3 212 ? -8.653  8.647   43.081 1.00 56.90  ? 564 GLU A C     1 
ATOM   2993 O O     . GLU E 3 212 ? -8.016  9.232   43.957 1.00 56.59  ? 564 GLU A O     1 
ATOM   2994 C CB    . GLU E 3 212 ? -7.896  10.047  41.161 1.00 56.06  ? 564 GLU A CB    1 
ATOM   2995 C CG    . GLU E 3 212 ? -8.212  10.823  39.879 1.00 59.55  ? 564 GLU A CG    1 
ATOM   2996 C CD    . GLU E 3 212 ? -8.521  9.934   38.677 1.00 62.02  ? 564 GLU A CD    1 
ATOM   2997 O OE1   . GLU E 3 212 ? -7.954  8.819   38.579 1.00 63.66  ? 564 GLU A OE1   1 
ATOM   2998 O OE2   . GLU E 3 212 ? -9.318  10.368  37.815 1.00 60.55  ? 564 GLU A OE2   1 
ATOM   2999 N N     . GLU E 3 220 ? -3.134  14.252  34.645 1.00 46.89  ? 572 GLU A N     1 
ATOM   3000 C CA    . GLU E 3 220 ? -3.769  14.839  35.824 1.00 45.52  ? 572 GLU A CA    1 
ATOM   3001 C C     . GLU E 3 220 ? -3.797  16.388  35.862 1.00 45.02  ? 572 GLU A C     1 
ATOM   3002 O O     . GLU E 3 220 ? -4.866  16.975  36.055 1.00 45.33  ? 572 GLU A O     1 
ATOM   3003 C CB    . GLU E 3 220 ? -3.177  14.247  37.111 1.00 41.93  ? 572 GLU A CB    1 
ATOM   3004 C CG    . GLU E 3 220 ? -3.746  12.886  37.497 1.00 47.28  ? 572 GLU A CG    1 
ATOM   3005 C CD    . GLU E 3 220 ? -4.670  12.941  38.707 1.00 49.07  ? 572 GLU A CD    1 
ATOM   3006 O OE1   . GLU E 3 220 ? -5.768  13.519  38.581 1.00 45.53  ? 572 GLU A OE1   1 
ATOM   3007 O OE2   . GLU E 3 220 ? -4.303  12.402  39.782 1.00 48.35  ? 572 GLU A OE2   1 
ATOM   3008 N N     . PRO E 3 221 ? -2.634  17.067  35.686 1.00 42.64  ? 573 PRO A N     1 
ATOM   3009 C CA    . PRO E 3 221 ? -2.771  18.536  35.734 1.00 40.21  ? 573 PRO A CA    1 
ATOM   3010 C C     . PRO E 3 221 ? -3.577  19.125  34.572 1.00 40.03  ? 573 PRO A C     1 
ATOM   3011 O O     . PRO E 3 221 ? -3.679  18.518  33.509 1.00 40.11  ? 573 PRO A O     1 
ATOM   3012 C CB    . PRO E 3 221 ? -1.313  19.022  35.715 1.00 40.52  ? 573 PRO A CB    1 
ATOM   3013 C CG    . PRO E 3 221 ? -0.560  17.897  35.096 1.00 39.25  ? 573 PRO A CG    1 
ATOM   3014 C CD    . PRO E 3 221 ? -1.213  16.686  35.699 1.00 40.07  ? 573 PRO A CD    1 
ATOM   3015 N N     . MET E 3 222 ? -4.173  20.295  34.793 1.00 38.11  ? 574 MET A N     1 
ATOM   3016 C CA    . MET E 3 222 ? -4.954  20.953  33.760 1.00 36.92  ? 574 MET A CA    1 
ATOM   3017 C C     . MET E 3 222 ? -4.000  21.204  32.611 1.00 40.20  ? 574 MET A C     1 
ATOM   3018 O O     . MET E 3 222 ? -2.819  21.487  32.825 1.00 37.46  ? 574 MET A O     1 
ATOM   3019 C CB    . MET E 3 222 ? -5.525  22.281  34.258 1.00 35.66  ? 574 MET A CB    1 
ATOM   3020 C CG    . MET E 3 222 ? -6.528  22.163  35.401 1.00 32.67  ? 574 MET A CG    1 
ATOM   3021 S SD    . MET E 3 222 ? -7.150  23.778  35.935 1.00 28.59  ? 574 MET A SD    1 
ATOM   3022 C CE    . MET E 3 222 ? -5.914  24.186  37.129 1.00 17.97  ? 574 MET A CE    1 
ATOM   3023 N N     . LYS E 3 223 ? -4.518  21.137  31.393 1.00 45.44  ? 575 LYS A N     1 
ATOM   3024 C CA    . LYS E 3 223 ? -3.677  21.320  30.230 1.00 49.16  ? 575 LYS A CA    1 
ATOM   3025 C C     . LYS E 3 223 ? -4.466  21.773  29.013 1.00 49.66  ? 575 LYS A C     1 
ATOM   3026 O O     . LYS E 3 223 ? -5.677  21.588  28.922 1.00 47.84  ? 575 LYS A O     1 
ATOM   3027 C CB    . LYS E 3 223 ? -2.967  20.003  29.916 1.00 53.52  ? 575 LYS A CB    1 
ATOM   3028 C CG    . LYS E 3 223 ? -1.717  20.135  29.058 1.00 60.96  ? 575 LYS A CG    1 
ATOM   3029 C CD    . LYS E 3 223 ? -0.512  20.689  29.831 1.00 61.96  ? 575 LYS A CD    1 
ATOM   3030 C CE    . LYS E 3 223 ? 0.748   20.712  28.955 1.00 58.20  ? 575 LYS A CE    1 
ATOM   3031 N NZ    . LYS E 3 223 ? 0.511   21.403  27.642 1.00 53.91  ? 575 LYS A NZ    1 
ATOM   3032 N N     . ASN E 3 224 ? -3.738  22.373  28.084 1.00 50.31  ? 576 ASN A N     1 
ATOM   3033 C CA    . ASN E 3 224 ? -4.272  22.880  26.830 1.00 49.80  ? 576 ASN A CA    1 
ATOM   3034 C C     . ASN E 3 224 ? -5.524  23.729  26.958 1.00 46.34  ? 576 ASN A C     1 
ATOM   3035 O O     . ASN E 3 224 ? -6.531  23.473  26.311 1.00 47.48  ? 576 ASN A O     1 
ATOM   3036 C CB    . ASN E 3 224 ? -4.483  21.741  25.827 1.00 52.90  ? 576 ASN A CB    1 
ATOM   3037 C CG    . ASN E 3 224 ? -4.655  22.250  24.405 1.00 57.98  ? 576 ASN A CG    1 
ATOM   3038 O OD1   . ASN E 3 224 ? -4.310  23.394  24.096 1.00 61.41  ? 576 ASN A OD1   1 
ATOM   3039 N ND2   . ASN E 3 224 ? -5.187  21.403  23.535 1.00 59.24  ? 576 ASN A ND2   1 
ATOM   3040 N N     . LEU E 3 225 ? -5.445  24.761  27.787 1.00 42.88  ? 577 LEU A N     1 
ATOM   3041 C CA    . LEU E 3 225 ? -6.571  25.662  27.968 1.00 38.03  ? 577 LEU A CA    1 
ATOM   3042 C C     . LEU E 3 225 ? -6.255  27.084  27.496 1.00 35.42  ? 577 LEU A C     1 
ATOM   3043 O O     . LEU E 3 225 ? -7.088  27.972  27.617 1.00 37.24  ? 577 LEU A O     1 
ATOM   3044 C CB    . LEU E 3 225 ? -7.049  25.672  29.428 1.00 36.82  ? 577 LEU A CB    1 
ATOM   3045 C CG    . LEU E 3 225 ? -7.946  24.541  29.963 1.00 35.04  ? 577 LEU A CG    1 
ATOM   3046 C CD1   . LEU E 3 225 ? -8.517  23.739  28.807 1.00 38.83  ? 577 LEU A CD1   1 
ATOM   3047 C CD2   . LEU E 3 225 ? -7.196  23.634  30.917 1.00 30.40  ? 577 LEU A CD2   1 
ATOM   3048 N N     . THR E 3 226 ? -5.075  27.303  26.925 1.00 33.45  ? 578 THR A N     1 
ATOM   3049 C CA    . THR E 3 226 ? -4.719  28.642  26.450 1.00 32.37  ? 578 THR A CA    1 
ATOM   3050 C C     . THR E 3 226 ? -5.617  29.104  25.297 1.00 35.02  ? 578 THR A C     1 
ATOM   3051 O O     . THR E 3 226 ? -5.948  30.293  25.181 1.00 36.26  ? 578 THR A O     1 
ATOM   3052 C CB    . THR E 3 226 ? -3.231  28.721  26.013 1.00 31.47  ? 578 THR A CB    1 
ATOM   3053 O OG1   . THR E 3 226 ? -2.388  28.384  27.120 1.00 22.12  ? 578 THR A OG1   1 
ATOM   3054 C CG2   . THR E 3 226 ? -2.883  30.131  25.549 1.00 24.66  ? 578 THR A CG2   1 
ATOM   3055 N N     . PRO E 3 235 ? 6.622   37.045  14.721 1.00 63.69  ? 587 PRO A N     1 
ATOM   3056 C CA    . PRO E 3 235 ? 7.327   35.831  14.278 1.00 64.16  ? 587 PRO A CA    1 
ATOM   3057 C C     . PRO E 3 235 ? 7.248   34.658  15.260 1.00 61.20  ? 587 PRO A C     1 
ATOM   3058 O O     . PRO E 3 235 ? 7.304   34.860  16.474 1.00 63.89  ? 587 PRO A O     1 
ATOM   3059 C CB    . PRO E 3 235 ? 8.776   36.313  14.098 1.00 65.92  ? 587 PRO A CB    1 
ATOM   3060 C CG    . PRO E 3 235 ? 8.880   37.503  15.036 1.00 67.04  ? 587 PRO A CG    1 
ATOM   3061 C CD    . PRO E 3 235 ? 7.549   38.189  14.823 1.00 63.40  ? 587 PRO A CD    1 
ATOM   3062 N N     . THR E 3 236 ? 7.104   33.441  14.739 1.00 57.15  ? 588 THR A N     1 
ATOM   3063 C CA    . THR E 3 236 ? 7.051   32.259  15.598 1.00 53.52  ? 588 THR A CA    1 
ATOM   3064 C C     . THR E 3 236 ? 8.314   32.209  16.462 1.00 51.84  ? 588 THR A C     1 
ATOM   3065 O O     . THR E 3 236 ? 9.437   32.323  15.952 1.00 53.35  ? 588 THR A O     1 
ATOM   3066 C CB    . THR E 3 236 ? 6.899   30.934  14.782 1.00 52.53  ? 588 THR A CB    1 
ATOM   3067 O OG1   . THR E 3 236 ? 5.509   30.617  14.643 1.00 51.98  ? 588 THR A OG1   1 
ATOM   3068 C CG2   . THR E 3 236 ? 7.592   29.757  15.476 1.00 47.88  ? 588 THR A CG2   1 
ATOM   3069 N N     . PRO E 3 237 ? 8.134   32.097  17.792 1.00 47.41  ? 589 PRO A N     1 
ATOM   3070 C CA    . PRO E 3 237 ? 9.244   32.035  18.743 1.00 40.49  ? 589 PRO A CA    1 
ATOM   3071 C C     . PRO E 3 237 ? 9.981   30.714  18.605 1.00 34.11  ? 589 PRO A C     1 
ATOM   3072 O O     . PRO E 3 237 ? 9.451   29.753  18.054 1.00 27.15  ? 589 PRO A O     1 
ATOM   3073 C CB    . PRO E 3 237 ? 8.530   32.098  20.097 1.00 39.54  ? 589 PRO A CB    1 
ATOM   3074 C CG    . PRO E 3 237 ? 7.269   32.798  19.797 1.00 43.73  ? 589 PRO A CG    1 
ATOM   3075 C CD    . PRO E 3 237 ? 6.853   32.162  18.517 1.00 44.94  ? 589 PRO A CD    1 
ATOM   3076 N N     . GLY E 3 238 ? 11.194  30.668  19.135 1.00 32.09  ? 590 GLY A N     1 
ATOM   3077 C CA    . GLY E 3 238 ? 11.963  29.445  19.087 1.00 28.87  ? 590 GLY A CA    1 
ATOM   3078 C C     . GLY E 3 238 ? 12.438  29.141  17.691 1.00 28.18  ? 590 GLY A C     1 
ATOM   3079 O O     . GLY E 3 238 ? 12.568  27.979  17.303 1.00 27.11  ? 590 GLY A O     1 
ATOM   3080 N N     . ASN E 3 239 ? 12.691  30.198  16.939 1.00 29.01  ? 591 ASN A N     1 
ATOM   3081 C CA    . ASN E 3 239 ? 13.157  30.060  15.581 1.00 30.29  ? 591 ASN A CA    1 
ATOM   3082 C C     . ASN E 3 239 ? 14.332  31.007  15.418 1.00 23.77  ? 591 ASN A C     1 
ATOM   3083 O O     . ASN E 3 239 ? 14.196  32.099  14.890 1.00 30.43  ? 591 ASN A O     1 
ATOM   3084 C CB    . ASN E 3 239 ? 12.020  30.390  14.594 1.00 33.96  ? 591 ASN A CB    1 
ATOM   3085 C CG    . ASN E 3 239 ? 12.379  30.079  13.130 1.00 36.51  ? 591 ASN A CG    1 
ATOM   3086 O OD1   . ASN E 3 239 ? 13.483  29.596  12.820 1.00 38.16  ? 591 ASN A OD1   1 
ATOM   3087 N ND2   . ASN E 3 239 ? 11.434  30.337  12.233 1.00 31.92  ? 591 ASN A ND2   1 
ATOM   3088 N N     . TYR E 3 240 ? 15.489  30.598  15.915 1.00 21.13  ? 592 TYR A N     1 
ATOM   3089 C CA    . TYR E 3 240 ? 16.676  31.434  15.816 1.00 24.52  ? 592 TYR A CA    1 
ATOM   3090 C C     . TYR E 3 240 ? 17.501  30.972  14.611 1.00 29.72  ? 592 TYR A C     1 
ATOM   3091 O O     . TYR E 3 240 ? 18.434  30.165  14.737 1.00 24.30  ? 592 TYR A O     1 
ATOM   3092 C CB    . TYR E 3 240 ? 17.480  31.387  17.129 1.00 23.90  ? 592 TYR A CB    1 
ATOM   3093 C CG    . TYR E 3 240 ? 16.761  32.020  18.318 1.00 19.41  ? 592 TYR A CG    1 
ATOM   3094 C CD1   . TYR E 3 240 ? 15.816  31.311  19.056 1.00 16.90  ? 592 TYR A CD1   1 
ATOM   3095 C CD2   . TYR E 3 240 ? 17.018  33.328  18.686 1.00 21.42  ? 592 TYR A CD2   1 
ATOM   3096 C CE1   . TYR E 3 240 ? 15.149  31.899  20.126 1.00 20.74  ? 592 TYR A CE1   1 
ATOM   3097 C CE2   . TYR E 3 240 ? 16.360  33.921  19.745 1.00 19.77  ? 592 TYR A CE2   1 
ATOM   3098 C CZ    . TYR E 3 240 ? 15.432  33.206  20.460 1.00 22.25  ? 592 TYR A CZ    1 
ATOM   3099 O OH    . TYR E 3 240 ? 14.790  33.820  21.508 1.00 30.43  ? 592 TYR A OH    1 
ATOM   3100 N N     . ASN E 3 241 ? 17.079  31.440  13.434 1.00 32.48  ? 593 ASN A N     1 
ATOM   3101 C CA    . ASN E 3 241 ? 17.712  31.104  12.153 1.00 35.29  ? 593 ASN A CA    1 
ATOM   3102 C C     . ASN E 3 241 ? 18.860  32.043  11.729 1.00 36.77  ? 593 ASN A C     1 
ATOM   3103 O O     . ASN E 3 241 ? 19.272  32.912  12.501 1.00 38.82  ? 593 ASN A O     1 
ATOM   3104 C CB    . ASN E 3 241 ? 16.642  30.996  11.046 1.00 36.67  ? 593 ASN A CB    1 
ATOM   3105 C CG    . ASN E 3 241 ? 15.723  32.218  10.968 1.00 33.71  ? 593 ASN A CG    1 
ATOM   3106 O OD1   . ASN E 3 241 ? 16.072  33.316  11.390 1.00 30.62  ? 593 ASN A OD1   1 
ATOM   3107 N ND2   . ASN E 3 241 ? 14.541  32.020  10.417 1.00 31.62  ? 593 ASN A ND2   1 
ATOM   3108 N N     . SER E 3 242 ? 19.409  31.837  10.533 1.00 36.40  ? 594 SER A N     1 
ATOM   3109 C CA    . SER E 3 242 ? 20.510  32.673  10.047 1.00 41.69  ? 594 SER A CA    1 
ATOM   3110 C C     . SER E 3 242 ? 20.196  34.167  9.929  1.00 43.10  ? 594 SER A C     1 
ATOM   3111 O O     . SER E 3 242 ? 19.103  34.564  9.517  1.00 48.06  ? 594 SER A O     1 
ATOM   3112 C CB    . SER E 3 242 ? 21.047  32.141  8.714  1.00 40.79  ? 594 SER A CB    1 
ATOM   3113 O OG    . SER E 3 242 ? 19.995  31.786  7.839  1.00 48.02  ? 594 SER A OG    1 
ATOM   3114 N N     . LYS F 3 8   ? -8.322  88.581  76.451 1.00 49.50  ? 360 LYS B N     1 
ATOM   3115 C CA    . LYS F 3 8   ? -9.106  88.963  75.280 1.00 48.17  ? 360 LYS B CA    1 
ATOM   3116 C C     . LYS F 3 8   ? -8.870  90.402  74.802 1.00 47.94  ? 360 LYS B C     1 
ATOM   3117 O O     . LYS F 3 8   ? -9.387  91.366  75.381 1.00 52.32  ? 360 LYS B O     1 
ATOM   3118 C CB    . LYS F 3 8   ? -10.592 88.714  75.534 1.00 43.28  ? 360 LYS B CB    1 
ATOM   3119 C CG    . LYS F 3 8   ? -10.953 87.250  75.495 1.00 47.02  ? 360 LYS B CG    1 
ATOM   3120 C CD    . LYS F 3 8   ? -12.449 87.045  75.692 1.00 51.42  ? 360 LYS B CD    1 
ATOM   3121 C CE    . LYS F 3 8   ? -12.815 85.562  75.662 1.00 51.38  ? 360 LYS B CE    1 
ATOM   3122 N NZ    . LYS F 3 8   ? -13.072 85.018  74.301 1.00 45.25  ? 360 LYS B NZ    1 
ATOM   3123 N N     . ALA F 3 9   ? -8.112  90.527  73.716 1.00 44.16  ? 361 ALA B N     1 
ATOM   3124 C CA    . ALA F 3 9   ? -7.776  91.818  73.131 1.00 39.89  ? 361 ALA B CA    1 
ATOM   3125 C C     . ALA F 3 9   ? -8.854  92.357  72.184 1.00 37.42  ? 361 ALA B C     1 
ATOM   3126 O O     . ALA F 3 9   ? -9.479  91.599  71.454 1.00 36.49  ? 361 ALA B O     1 
ATOM   3127 C CB    . ALA F 3 9   ? -6.443  91.714  72.405 1.00 36.72  ? 361 ALA B CB    1 
ATOM   3128 N N     . SER F 3 10  ? -9.061  93.673  72.208 1.00 36.57  ? 362 SER B N     1 
ATOM   3129 C CA    . SER F 3 10  ? -10.032 94.331  71.338 1.00 34.09  ? 362 SER B CA    1 
ATOM   3130 C C     . SER F 3 10  ? -9.351  94.568  69.990 1.00 33.24  ? 362 SER B C     1 
ATOM   3131 O O     . SER F 3 10  ? -8.125  94.754  69.925 1.00 28.62  ? 362 SER B O     1 
ATOM   3132 C CB    . SER F 3 10  ? -10.449 95.699  71.912 1.00 34.62  ? 362 SER B CB    1 
ATOM   3133 O OG    . SER F 3 10  ? -11.004 95.592  73.213 1.00 41.39  ? 362 SER B OG    1 
ATOM   3134 N N     . PHE F 3 11  ? -10.126 94.511  68.911 1.00 31.73  ? 363 PHE B N     1 
ATOM   3135 C CA    . PHE F 3 11  ? -9.566  94.770  67.588 1.00 28.37  ? 363 PHE B CA    1 
ATOM   3136 C C     . PHE F 3 11  ? -9.510  96.274  67.360 1.00 24.42  ? 363 PHE B C     1 
ATOM   3137 O O     . PHE F 3 11  ? -10.518 96.974  67.489 1.00 24.55  ? 363 PHE B O     1 
ATOM   3138 C CB    . PHE F 3 11  ? -10.390 94.098  66.472 1.00 23.78  ? 363 PHE B CB    1 
ATOM   3139 C CG    . PHE F 3 11  ? -10.196 92.615  66.380 1.00 15.46  ? 363 PHE B CG    1 
ATOM   3140 C CD1   . PHE F 3 11  ? -9.144  92.084  65.642 1.00 14.25  ? 363 PHE B CD1   1 
ATOM   3141 C CD2   . PHE F 3 11  ? -11.063 91.750  67.023 1.00 14.68  ? 363 PHE B CD2   1 
ATOM   3142 C CE1   . PHE F 3 11  ? -8.952  90.692  65.545 1.00 16.64  ? 363 PHE B CE1   1 
ATOM   3143 C CE2   . PHE F 3 11  ? -10.887 90.357  66.940 1.00 13.67  ? 363 PHE B CE2   1 
ATOM   3144 C CZ    . PHE F 3 11  ? -9.828  89.826  66.199 1.00 13.51  ? 363 PHE B CZ    1 
ATOM   3145 N N     . THR F 3 12  ? -8.311  96.766  67.077 1.00 24.27  ? 364 THR B N     1 
ATOM   3146 C CA    . THR F 3 12  ? -8.103  98.178  66.810 1.00 26.46  ? 364 THR B CA    1 
ATOM   3147 C C     . THR F 3 12  ? -8.458  98.423  65.333 1.00 31.68  ? 364 THR B C     1 
ATOM   3148 O O     . THR F 3 12  ? -8.536  97.478  64.550 1.00 34.22  ? 364 THR B O     1 
ATOM   3149 C CB    . THR F 3 12  ? -6.623  98.585  67.056 1.00 22.45  ? 364 THR B CB    1 
ATOM   3150 O OG1   . THR F 3 12  ? -5.792  97.955  66.083 1.00 23.67  ? 364 THR B OG1   1 
ATOM   3151 C CG2   . THR F 3 12  ? -6.149  98.143  68.433 1.00 19.81  ? 364 THR B CG2   1 
ATOM   3152 N N     . ASP F 3 13  ? -8.650  99.678  64.935 1.00 32.26  ? 365 ASP B N     1 
ATOM   3153 C CA    . ASP F 3 13  ? -8.965  99.946  63.549 1.00 28.47  ? 365 ASP B CA    1 
ATOM   3154 C C     . ASP F 3 13  ? -7.800  99.551  62.627 1.00 24.63  ? 365 ASP B C     1 
ATOM   3155 O O     . ASP F 3 13  ? -8.029  99.098  61.514 1.00 22.99  ? 365 ASP B O     1 
ATOM   3156 C CB    . ASP F 3 13  ? -9.358  101.409 63.361 1.00 36.06  ? 365 ASP B CB    1 
ATOM   3157 C CG    . ASP F 3 13  ? -9.776  101.715 61.933 1.00 45.19  ? 365 ASP B CG    1 
ATOM   3158 O OD1   . ASP F 3 13  ? -10.857 101.251 61.497 1.00 46.48  ? 365 ASP B OD1   1 
ATOM   3159 O OD2   . ASP F 3 13  ? -9.007  102.413 61.239 1.00 52.03  ? 365 ASP B OD2   1 
ATOM   3160 N N     . GLU F 3 14  ? -6.565  99.644  63.127 1.00 24.30  ? 366 GLU B N     1 
ATOM   3161 C CA    . GLU F 3 14  ? -5.349  99.298  62.357 1.00 27.56  ? 366 GLU B CA    1 
ATOM   3162 C C     . GLU F 3 14  ? -5.288  97.806  62.040 1.00 27.73  ? 366 GLU B C     1 
ATOM   3163 O O     . GLU F 3 14  ? -4.798  97.391  60.982 1.00 26.88  ? 366 GLU B O     1 
ATOM   3164 C CB    . GLU F 3 14  ? -4.066  99.676  63.122 1.00 34.30  ? 366 GLU B CB    1 
ATOM   3165 C CG    . GLU F 3 14  ? -3.759  101.183 63.244 1.00 46.80  ? 366 GLU B CG    1 
ATOM   3166 C CD    . GLU F 3 14  ? -4.638  101.906 64.273 1.00 50.04  ? 366 GLU B CD    1 
ATOM   3167 O OE1   . GLU F 3 14  ? -4.605  101.519 65.469 1.00 50.41  ? 366 GLU B OE1   1 
ATOM   3168 O OE2   . GLU F 3 14  ? -5.358  102.859 63.879 1.00 48.49  ? 366 GLU B OE2   1 
ATOM   3169 N N     . GLU F 3 15  ? -5.702  97.002  63.010 1.00 24.03  ? 367 GLU B N     1 
ATOM   3170 C CA    . GLU F 3 15  ? -5.733  95.561  62.840 1.00 25.07  ? 367 GLU B CA    1 
ATOM   3171 C C     . GLU F 3 15  ? -6.821  95.203  61.833 1.00 23.63  ? 367 GLU B C     1 
ATOM   3172 O O     . GLU F 3 15  ? -6.599  94.371  60.968 1.00 31.40  ? 367 GLU B O     1 
ATOM   3173 C CB    . GLU F 3 15  ? -5.967  94.867  64.185 1.00 21.99  ? 367 GLU B CB    1 
ATOM   3174 C CG    . GLU F 3 15  ? -4.800  95.059  65.152 1.00 25.62  ? 367 GLU B CG    1 
ATOM   3175 C CD    . GLU F 3 15  ? -5.084  94.562  66.556 1.00 24.75  ? 367 GLU B CD    1 
ATOM   3176 O OE1   . GLU F 3 15  ? -6.251  94.606  67.001 1.00 23.11  ? 367 GLU B OE1   1 
ATOM   3177 O OE2   . GLU F 3 15  ? -4.126  94.140  67.233 1.00 33.24  ? 367 GLU B OE2   1 
ATOM   3178 N N     . ASP F 3 16  ? -7.975  95.861  61.929 1.00 22.81  ? 368 ASP B N     1 
ATOM   3179 C CA    . ASP F 3 16  ? -9.110  95.648  61.022 1.00 17.63  ? 368 ASP B CA    1 
ATOM   3180 C C     . ASP F 3 16  ? -8.757  95.924  59.574 1.00 15.21  ? 368 ASP B C     1 
ATOM   3181 O O     . ASP F 3 16  ? -9.177  95.191  58.700 1.00 19.68  ? 368 ASP B O     1 
ATOM   3182 C CB    . ASP F 3 16  ? -10.279 96.562  61.398 1.00 18.71  ? 368 ASP B CB    1 
ATOM   3183 C CG    . ASP F 3 16  ? -11.075 96.054  62.568 1.00 16.73  ? 368 ASP B CG    1 
ATOM   3184 O OD1   . ASP F 3 16  ? -10.875 94.893  62.993 1.00 21.65  ? 368 ASP B OD1   1 
ATOM   3185 O OD2   . ASP F 3 16  ? -11.939 96.815  63.042 1.00 21.54  ? 368 ASP B OD2   1 
ATOM   3186 N N     . GLU F 3 17  ? -8.052  97.026  59.325 1.00 18.02  ? 369 GLU B N     1 
ATOM   3187 C CA    . GLU F 3 17  ? -7.621  97.420  57.978 1.00 19.54  ? 369 GLU B CA    1 
ATOM   3188 C C     . GLU F 3 17  ? -6.585  96.481  57.431 1.00 17.97  ? 369 GLU B C     1 
ATOM   3189 O O     . GLU F 3 17  ? -6.517  96.247  56.229 1.00 24.64  ? 369 GLU B O     1 
ATOM   3190 C CB    . GLU F 3 17  ? -7.052  98.832  57.983 1.00 15.37  ? 369 GLU B CB    1 
ATOM   3191 C CG    . GLU F 3 17  ? -8.121  99.881  58.138 1.00 24.42  ? 369 GLU B CG    1 
ATOM   3192 C CD    . GLU F 3 17  ? -9.172  99.821  57.033 1.00 22.69  ? 369 GLU B CD    1 
ATOM   3193 O OE1   . GLU F 3 17  ? -8.794  99.844  55.846 1.00 36.53  ? 369 GLU B OE1   1 
ATOM   3194 O OE2   . GLU F 3 17  ? -10.375 99.764  57.345 1.00 23.49  ? 369 GLU B OE2   1 
ATOM   3195 N N     . PHE F 3 18  ? -5.724  96.011  58.318 1.00 20.52  ? 370 PHE B N     1 
ATOM   3196 C CA    . PHE F 3 18  ? -4.690  95.060  57.964 1.00 15.04  ? 370 PHE B CA    1 
ATOM   3197 C C     . PHE F 3 18  ? -5.347  93.760  57.509 1.00 16.27  ? 370 PHE B C     1 
ATOM   3198 O O     . PHE F 3 18  ? -4.998  93.218  56.473 1.00 21.28  ? 370 PHE B O     1 
ATOM   3199 C CB    . PHE F 3 18  ? -3.797  94.793  59.177 1.00 17.66  ? 370 PHE B CB    1 
ATOM   3200 C CG    . PHE F 3 18  ? -2.676  93.843  58.891 1.00 19.13  ? 370 PHE B CG    1 
ATOM   3201 C CD1   . PHE F 3 18  ? -1.563  94.265  58.169 1.00 20.12  ? 370 PHE B CD1   1 
ATOM   3202 C CD2   . PHE F 3 18  ? -2.763  92.508  59.268 1.00 16.56  ? 370 PHE B CD2   1 
ATOM   3203 C CE1   . PHE F 3 18  ? -0.538  93.355  57.812 1.00 22.03  ? 370 PHE B CE1   1 
ATOM   3204 C CE2   . PHE F 3 18  ? -1.754  91.600  58.917 1.00 19.52  ? 370 PHE B CE2   1 
ATOM   3205 C CZ    . PHE F 3 18  ? -0.636  92.027  58.183 1.00 15.31  ? 370 PHE B CZ    1 
ATOM   3206 N N     . ILE F 3 19  ? -6.306  93.264  58.286 1.00 17.88  ? 371 ILE B N     1 
ATOM   3207 C CA    . ILE F 3 19  ? -7.029  92.028  57.977 1.00 14.02  ? 371 ILE B CA    1 
ATOM   3208 C C     . ILE F 3 19  ? -7.709  92.177  56.626 1.00 14.39  ? 371 ILE B C     1 
ATOM   3209 O O     . ILE F 3 19  ? -7.629  91.301  55.785 1.00 19.23  ? 371 ILE B O     1 
ATOM   3210 C CB    . ILE F 3 19  ? -8.088  91.732  59.069 1.00 15.19  ? 371 ILE B CB    1 
ATOM   3211 C CG1   . ILE F 3 19  ? -7.382  91.445  60.393 1.00 14.51  ? 371 ILE B CG1   1 
ATOM   3212 C CG2   . ILE F 3 19  ? -9.006  90.567  58.666 1.00 9.97   ? 371 ILE B CG2   1 
ATOM   3213 C CD1   . ILE F 3 19  ? -8.270  91.553  61.583 1.00 11.83  ? 371 ILE B CD1   1 
ATOM   3214 N N     . LEU F 3 20  ? -8.403  93.287  56.441 1.00 15.30  ? 372 LEU B N     1 
ATOM   3215 C CA    . LEU F 3 20  ? -9.077  93.578  55.193 1.00 12.63  ? 372 LEU B CA    1 
ATOM   3216 C C     . LEU F 3 20  ? -8.092  93.578  54.030 1.00 13.72  ? 372 LEU B C     1 
ATOM   3217 O O     . LEU F 3 20  ? -8.314  92.914  53.035 1.00 20.34  ? 372 LEU B O     1 
ATOM   3218 C CB    . LEU F 3 20  ? -9.764  94.930  55.306 1.00 12.67  ? 372 LEU B CB    1 
ATOM   3219 C CG    . LEU F 3 20  ? -11.045 94.843  56.120 1.00 11.43  ? 372 LEU B CG    1 
ATOM   3220 C CD1   . LEU F 3 20  ? -11.559 96.230  56.457 1.00 9.41   ? 372 LEU B CD1   1 
ATOM   3221 C CD2   . LEU F 3 20  ? -12.050 94.071  55.310 1.00 12.07  ? 372 LEU B CD2   1 
ATOM   3222 N N     . ASP F 3 21  ? -6.989  94.296  54.161 1.00 14.49  ? 373 ASP B N     1 
ATOM   3223 C CA    . ASP F 3 21  ? -5.994  94.344  53.101 1.00 18.74  ? 373 ASP B CA    1 
ATOM   3224 C C     . ASP F 3 21  ? -5.436  92.951  52.770 1.00 20.96  ? 373 ASP B C     1 
ATOM   3225 O O     . ASP F 3 21  ? -5.166  92.631  51.609 1.00 25.26  ? 373 ASP B O     1 
ATOM   3226 C CB    . ASP F 3 21  ? -4.868  95.307  53.499 1.00 19.06  ? 373 ASP B CB    1 
ATOM   3227 C CG    . ASP F 3 21  ? -3.837  95.505  52.399 1.00 20.24  ? 373 ASP B CG    1 
ATOM   3228 O OD1   . ASP F 3 21  ? -4.132  96.194  51.395 1.00 19.70  ? 373 ASP B OD1   1 
ATOM   3229 O OD2   . ASP F 3 21  ? -2.717  94.978  52.550 1.00 24.08  ? 373 ASP B OD2   1 
ATOM   3230 N N     . VAL F 3 22  ? -5.259  92.111  53.779 1.00 18.91  ? 374 VAL B N     1 
ATOM   3231 C CA    . VAL F 3 22  ? -4.739  90.785  53.530 1.00 15.76  ? 374 VAL B CA    1 
ATOM   3232 C C     . VAL F 3 22  ? -5.739  89.924  52.759 1.00 20.54  ? 374 VAL B C     1 
ATOM   3233 O O     . VAL F 3 22  ? -5.345  89.162  51.867 1.00 21.31  ? 374 VAL B O     1 
ATOM   3234 C CB    . VAL F 3 22  ? -4.352  90.090  54.834 1.00 18.99  ? 374 VAL B CB    1 
ATOM   3235 C CG1   . VAL F 3 22  ? -3.972  88.627  54.574 1.00 20.92  ? 374 VAL B CG1   1 
ATOM   3236 C CG2   . VAL F 3 22  ? -3.183  90.806  55.464 1.00 17.59  ? 374 VAL B CG2   1 
ATOM   3237 N N     . VAL F 3 23  ? -7.014  90.011  53.135 1.00 17.55  ? 375 VAL B N     1 
ATOM   3238 C CA    . VAL F 3 23  ? -8.081  89.253  52.491 1.00 19.28  ? 375 VAL B CA    1 
ATOM   3239 C C     . VAL F 3 23  ? -8.283  89.744  51.045 1.00 19.93  ? 375 VAL B C     1 
ATOM   3240 O O     . VAL F 3 23  ? -8.525  88.961  50.133 1.00 20.17  ? 375 VAL B O     1 
ATOM   3241 C CB    . VAL F 3 23  ? -9.398  89.331  53.317 1.00 14.75  ? 375 VAL B CB    1 
ATOM   3242 C CG1   . VAL F 3 23  ? -10.472 88.544  52.661 1.00 14.88  ? 375 VAL B CG1   1 
ATOM   3243 C CG2   . VAL F 3 23  ? -9.181  88.766  54.704 1.00 13.03  ? 375 VAL B CG2   1 
ATOM   3244 N N     . ARG F 3 24  ? -8.152  91.044  50.835 1.00 20.94  ? 376 ARG B N     1 
ATOM   3245 C CA    . ARG F 3 24  ? -8.282  91.608  49.493 1.00 16.32  ? 376 ARG B CA    1 
ATOM   3246 C C     . ARG F 3 24  ? -7.193  91.065  48.591 1.00 14.11  ? 376 ARG B C     1 
ATOM   3247 O O     . ARG F 3 24  ? -7.420  90.854  47.413 1.00 18.73  ? 376 ARG B O     1 
ATOM   3248 C CB    . ARG F 3 24  ? -8.178  93.133  49.534 1.00 8.37   ? 376 ARG B CB    1 
ATOM   3249 C CG    . ARG F 3 24  ? -9.352  93.768  50.207 1.00 12.74  ? 376 ARG B CG    1 
ATOM   3250 C CD    . ARG F 3 24  ? -9.327  95.261  50.028 1.00 19.95  ? 376 ARG B CD    1 
ATOM   3251 N NE    . ARG F 3 24  ? -10.393 95.932  50.776 1.00 17.68  ? 376 ARG B NE    1 
ATOM   3252 C CZ    . ARG F 3 24  ? -10.164 96.813  51.748 1.00 22.59  ? 376 ARG B CZ    1 
ATOM   3253 N NH1   . ARG F 3 24  ? -8.918  97.123  52.086 1.00 21.97  ? 376 ARG B NH1   1 
ATOM   3254 N NH2   . ARG F 3 24  ? -11.174 97.400  52.377 1.00 22.52  ? 376 ARG B NH2   1 
ATOM   3255 N N     . LYS F 3 25  ? -6.000  90.882  49.144 1.00 12.53  ? 377 LYS B N     1 
ATOM   3256 C CA    . LYS F 3 25  ? -4.867  90.379  48.382 1.00 10.54  ? 377 LYS B CA    1 
ATOM   3257 C C     . LYS F 3 25  ? -4.822  88.871  48.238 1.00 11.84  ? 377 LYS B C     1 
ATOM   3258 O O     . LYS F 3 25  ? -4.008  88.336  47.488 1.00 12.13  ? 377 LYS B O     1 
ATOM   3259 C CB    . LYS F 3 25  ? -3.561  90.905  48.969 1.00 10.71  ? 377 LYS B CB    1 
ATOM   3260 C CG    . LYS F 3 25  ? -3.389  92.390  48.726 1.00 12.15  ? 377 LYS B CG    1 
ATOM   3261 C CD    . LYS F 3 25  ? -2.253  92.962  49.536 1.00 11.44  ? 377 LYS B CD    1 
ATOM   3262 C CE    . LYS F 3 25  ? -2.203  94.452  49.326 1.00 15.96  ? 377 LYS B CE    1 
ATOM   3263 N NZ    . LYS F 3 25  ? -1.186  95.095  50.180 1.00 16.65  ? 377 LYS B NZ    1 
ATOM   3264 N N     . ASN F 3 26  ? -5.698  88.185  48.956 1.00 11.19  ? 378 ASN B N     1 
ATOM   3265 C CA    . ASN F 3 26  ? -5.788  86.739  48.902 1.00 13.48  ? 378 ASN B CA    1 
ATOM   3266 C C     . ASN F 3 26  ? -7.259  86.387  48.872 1.00 17.32  ? 378 ASN B C     1 
ATOM   3267 O O     . ASN F 3 26  ? -7.709  85.536  49.641 1.00 21.63  ? 378 ASN B O     1 
ATOM   3268 C CB    . ASN F 3 26  ? -5.164  86.116  50.143 1.00 10.21  ? 378 ASN B CB    1 
ATOM   3269 C CG    . ASN F 3 26  ? -3.684  86.290  50.190 1.00 9.23   ? 378 ASN B CG    1 
ATOM   3270 O OD1   . ASN F 3 26  ? -2.936  85.449  49.690 1.00 13.68  ? 378 ASN B OD1   1 
ATOM   3271 N ND2   . ASN F 3 26  ? -3.236  87.370  50.799 1.00 8.09   ? 378 ASN B ND2   1 
ATOM   3272 N N     . PRO F 3 27  ? -8.026  87.017  47.957 1.00 19.71  ? 379 PRO B N     1 
ATOM   3273 C CA    . PRO F 3 27  ? -9.462  86.791  47.811 1.00 15.93  ? 379 PRO B CA    1 
ATOM   3274 C C     . PRO F 3 27  ? -9.933  85.330  47.668 1.00 17.49  ? 379 PRO B C     1 
ATOM   3275 O O     . PRO F 3 27  ? -11.008 84.985  48.148 1.00 18.56  ? 379 PRO B O     1 
ATOM   3276 C CB    . PRO F 3 27  ? -9.794  87.626  46.585 1.00 19.17  ? 379 PRO B CB    1 
ATOM   3277 C CG    . PRO F 3 27  ? -8.553  87.492  45.753 1.00 15.29  ? 379 PRO B CG    1 
ATOM   3278 C CD    . PRO F 3 27  ? -7.516  87.759  46.787 1.00 20.79  ? 379 PRO B CD    1 
ATOM   3279 N N     . THR F 3 28  ? -9.163  84.479  46.994 1.00 16.40  ? 380 THR B N     1 
ATOM   3280 C CA    . THR F 3 28  ? -9.568  83.083  46.841 1.00 18.10  ? 380 THR B CA    1 
ATOM   3281 C C     . THR F 3 28  ? -9.549  82.346  48.176 1.00 19.78  ? 380 THR B C     1 
ATOM   3282 O O     . THR F 3 28  ? -10.158 81.273  48.318 1.00 16.91  ? 380 THR B O     1 
ATOM   3283 C CB    . THR F 3 28  ? -8.657  82.318  45.859 1.00 18.90  ? 380 THR B CB    1 
ATOM   3284 O OG1   . THR F 3 28  ? -7.292  82.467  46.260 1.00 25.58  ? 380 THR B OG1   1 
ATOM   3285 C CG2   . THR F 3 28  ? -8.827  82.861  44.435 1.00 24.21  ? 380 THR B CG2   1 
ATOM   3286 N N     . ARG F 3 29  ? -8.925  82.971  49.173 1.00 17.63  ? 381 ARG B N     1 
ATOM   3287 C CA    . ARG F 3 29  ? -8.783  82.370  50.482 1.00 16.22  ? 381 ARG B CA    1 
ATOM   3288 C C     . ARG F 3 29  ? -9.642  83.003  51.559 1.00 16.06  ? 381 ARG B C     1 
ATOM   3289 O O     . ARG F 3 29  ? -9.486  82.723  52.746 1.00 20.07  ? 381 ARG B O     1 
ATOM   3290 C CB    . ARG F 3 29  ? -7.309  82.396  50.866 1.00 15.38  ? 381 ARG B CB    1 
ATOM   3291 C CG    . ARG F 3 29  ? -6.451  81.653  49.879 1.00 11.18  ? 381 ARG B CG    1 
ATOM   3292 C CD    . ARG F 3 29  ? -5.064  81.529  50.417 1.00 25.45  ? 381 ARG B CD    1 
ATOM   3293 N NE    . ARG F 3 29  ? -5.061  80.772  51.664 1.00 33.38  ? 381 ARG B NE    1 
ATOM   3294 C CZ    . ARG F 3 29  ? -4.106  80.827  52.593 1.00 32.32  ? 381 ARG B CZ    1 
ATOM   3295 N NH1   . ARG F 3 29  ? -3.035  81.611  52.444 1.00 27.49  ? 381 ARG B NH1   1 
ATOM   3296 N NH2   . ARG F 3 29  ? -4.231  80.092  53.690 1.00 31.05  ? 381 ARG B NH2   1 
ATOM   3297 N N     . ARG F 3 30  ? -10.614 83.782  51.133 1.00 13.04  ? 382 ARG B N     1 
ATOM   3298 C CA    . ARG F 3 30  ? -11.484 84.460  52.052 1.00 11.42  ? 382 ARG B CA    1 
ATOM   3299 C C     . ARG F 3 30  ? -12.235 83.574  53.049 1.00 14.78  ? 382 ARG B C     1 
ATOM   3300 O O     . ARG F 3 30  ? -12.537 84.030  54.145 1.00 14.66  ? 382 ARG B O     1 
ATOM   3301 C CB    . ARG F 3 30  ? -12.464 85.321  51.265 1.00 12.91  ? 382 ARG B CB    1 
ATOM   3302 C CG    . ARG F 3 30  ? -13.326 84.528  50.310 1.00 16.48  ? 382 ARG B CG    1 
ATOM   3303 C CD    . ARG F 3 30  ? -14.199 85.442  49.512 1.00 21.47  ? 382 ARG B CD    1 
ATOM   3304 N NE    . ARG F 3 30  ? -15.041 84.726  48.561 1.00 20.59  ? 382 ARG B NE    1 
ATOM   3305 C CZ    . ARG F 3 30  ? -14.621 84.272  47.387 1.00 15.68  ? 382 ARG B CZ    1 
ATOM   3306 N NH1   . ARG F 3 30  ? -13.362 84.444  47.019 1.00 16.08  ? 382 ARG B NH1   1 
ATOM   3307 N NH2   . ARG F 3 30  ? -15.478 83.700  46.551 1.00 13.67  ? 382 ARG B NH2   1 
ATOM   3308 N N     . THR F 3 31  ? -12.622 82.361  52.656 1.00 18.86  ? 383 THR B N     1 
ATOM   3309 C CA    . THR F 3 31  ? -13.352 81.475  53.566 1.00 19.20  ? 383 THR B CA    1 
ATOM   3310 C C     . THR F 3 31  ? -12.570 80.297  54.152 1.00 17.27  ? 383 THR B C     1 
ATOM   3311 O O     . THR F 3 31  ? -13.136 79.347  54.691 1.00 19.22  ? 383 THR B O     1 
ATOM   3312 C CB    . THR F 3 31  ? -14.730 81.033  53.008 1.00 20.60  ? 383 THR B CB    1 
ATOM   3313 O OG1   . THR F 3 31  ? -14.596 80.504  51.683 1.00 21.97  ? 383 THR B OG1   1 
ATOM   3314 C CG2   . THR F 3 31  ? -15.668 82.203  52.988 1.00 19.36  ? 383 THR B CG2   1 
ATOM   3315 N N     . THR F 3 32  ? -11.254 80.371  54.048 1.00 16.95  ? 384 THR B N     1 
ATOM   3316 C CA    . THR F 3 32  ? -10.402 79.363  54.637 1.00 14.51  ? 384 THR B CA    1 
ATOM   3317 C C     . THR F 3 32  ? -10.291 79.745  56.126 1.00 16.37  ? 384 THR B C     1 
ATOM   3318 O O     . THR F 3 32  ? -10.874 80.733  56.581 1.00 12.18  ? 384 THR B O     1 
ATOM   3319 C CB    . THR F 3 32  ? -8.985  79.447  54.056 1.00 9.93   ? 384 THR B CB    1 
ATOM   3320 O OG1   . THR F 3 32  ? -8.444  80.736  54.338 1.00 12.22  ? 384 THR B OG1   1 
ATOM   3321 C CG2   . THR F 3 32  ? -8.992  79.217  52.555 1.00 9.02   ? 384 THR B CG2   1 
ATOM   3322 N N     . HIS F 3 33  ? -9.566  78.940  56.887 1.00 14.82  ? 385 HIS B N     1 
ATOM   3323 C CA    . HIS F 3 33  ? -9.318  79.230  58.288 1.00 14.93  ? 385 HIS B CA    1 
ATOM   3324 C C     . HIS F 3 33  ? -7.851  79.540  58.331 1.00 12.70  ? 385 HIS B C     1 
ATOM   3325 O O     . HIS F 3 33  ? -7.394  80.353  59.135 1.00 13.61  ? 385 HIS B O     1 
ATOM   3326 C CB    . HIS F 3 33  ? -9.586  78.012  59.169 1.00 13.79  ? 385 HIS B CB    1 
ATOM   3327 C CG    . HIS F 3 33  ? -11.036 77.743  59.396 1.00 4.61   ? 385 HIS B CG    1 
ATOM   3328 N ND1   . HIS F 3 33  ? -11.717 78.250  60.480 1.00 13.40  ? 385 HIS B ND1   1 
ATOM   3329 C CD2   . HIS F 3 33  ? -11.940 77.056  58.667 1.00 12.73  ? 385 HIS B CD2   1 
ATOM   3330 C CE1   . HIS F 3 33  ? -12.984 77.885  60.409 1.00 16.71  ? 385 HIS B CE1   1 
ATOM   3331 N NE2   . HIS F 3 33  ? -13.148 77.161  59.316 1.00 17.81  ? 385 HIS B NE2   1 
ATOM   3332 N N     . THR F 3 34  ? -7.111  78.899  57.431 1.00 14.32  ? 386 THR B N     1 
ATOM   3333 C CA    . THR F 3 34  ? -5.670  79.096  57.366 1.00 14.28  ? 386 THR B CA    1 
ATOM   3334 C C     . THR F 3 34  ? -5.224  80.519  57.090 1.00 12.75  ? 386 THR B C     1 
ATOM   3335 O O     . THR F 3 34  ? -4.179  80.935  57.573 1.00 15.07  ? 386 THR B O     1 
ATOM   3336 C CB    . THR F 3 34  ? -4.994  78.145  56.343 1.00 13.90  ? 386 THR B CB    1 
ATOM   3337 O OG1   . THR F 3 34  ? -5.723  78.158  55.103 1.00 14.41  ? 386 THR B OG1   1 
ATOM   3338 C CG2   . THR F 3 34  ? -4.924  76.719  56.904 1.00 14.24  ? 386 THR B CG2   1 
ATOM   3339 N N     . LEU F 3 35  ? -5.998  81.272  56.317 1.00 10.49  ? 387 LEU B N     1 
ATOM   3340 C CA    . LEU F 3 35  ? -5.583  82.625  56.003 1.00 10.31  ? 387 LEU B CA    1 
ATOM   3341 C C     . LEU F 3 35  ? -5.523  83.485  57.264 1.00 6.58   ? 387 LEU B C     1 
ATOM   3342 O O     . LEU F 3 35  ? -4.574  84.230  57.481 1.00 8.89   ? 387 LEU B O     1 
ATOM   3343 C CB    . LEU F 3 35  ? -6.524  83.243  54.964 1.00 4.39   ? 387 LEU B CB    1 
ATOM   3344 C CG    . LEU F 3 35  ? -6.125  84.664  54.564 1.00 2.00   ? 387 LEU B CG    1 
ATOM   3345 C CD1   . LEU F 3 35  ? -4.789  84.647  53.850 1.00 4.67   ? 387 LEU B CD1   1 
ATOM   3346 C CD2   . LEU F 3 35  ? -7.190  85.280  53.708 1.00 2.06   ? 387 LEU B CD2   1 
ATOM   3347 N N     . TYR F 3 36  ? -6.521  83.327  58.114 1.00 7.49   ? 388 TYR B N     1 
ATOM   3348 C CA    . TYR F 3 36  ? -6.611  84.088  59.348 1.00 11.37  ? 388 TYR B CA    1 
ATOM   3349 C C     . TYR F 3 36  ? -5.559  83.643  60.355 1.00 14.75  ? 388 TYR B C     1 
ATOM   3350 O O     . TYR F 3 36  ? -4.979  84.460  61.071 1.00 19.75  ? 388 TYR B O     1 
ATOM   3351 C CB    . TYR F 3 36  ? -8.035  84.014  59.836 1.00 6.55   ? 388 TYR B CB    1 
ATOM   3352 C CG    . TYR F 3 36  ? -8.937  84.502  58.725 1.00 14.63  ? 388 TYR B CG    1 
ATOM   3353 C CD1   . TYR F 3 36  ? -9.013  85.867  58.419 1.00 15.95  ? 388 TYR B CD1   1 
ATOM   3354 C CD2   . TYR F 3 36  ? -9.642  83.604  57.908 1.00 13.05  ? 388 TYR B CD2   1 
ATOM   3355 C CE1   . TYR F 3 36  ? -9.752  86.327  57.334 1.00 12.42  ? 388 TYR B CE1   1 
ATOM   3356 C CE2   . TYR F 3 36  ? -10.399 84.062  56.808 1.00 10.23  ? 388 TYR B CE2   1 
ATOM   3357 C CZ    . TYR F 3 36  ? -10.440 85.426  56.528 1.00 16.60  ? 388 TYR B CZ    1 
ATOM   3358 O OH    . TYR F 3 36  ? -11.123 85.903  55.427 1.00 15.87  ? 388 TYR B OH    1 
ATOM   3359 N N     . ASP F 3 37  ? -5.209  82.366  60.309 1.00 15.73  ? 389 ASP B N     1 
ATOM   3360 C CA    . ASP F 3 37  ? -4.152  81.866  61.162 1.00 14.88  ? 389 ASP B CA    1 
ATOM   3361 C C     . ASP F 3 37  ? -2.836  82.491  60.699 1.00 18.15  ? 389 ASP B C     1 
ATOM   3362 O O     . ASP F 3 37  ? -1.968  82.786  61.504 1.00 20.97  ? 389 ASP B O     1 
ATOM   3363 C CB    . ASP F 3 37  ? -4.054  80.352  61.095 1.00 16.69  ? 389 ASP B CB    1 
ATOM   3364 C CG    . ASP F 3 37  ? -3.008  79.812  62.031 1.00 20.93  ? 389 ASP B CG    1 
ATOM   3365 O OD1   . ASP F 3 37  ? -3.121  80.088  63.238 1.00 22.91  ? 389 ASP B OD1   1 
ATOM   3366 O OD2   . ASP F 3 37  ? -2.055  79.149  61.568 1.00 27.10  ? 389 ASP B OD2   1 
ATOM   3367 N N     . GLU F 3 38  ? -2.653  82.631  59.393 1.00 20.07  ? 390 GLU B N     1 
ATOM   3368 C CA    . GLU F 3 38  ? -1.445  83.265  58.874 1.00 18.62  ? 390 GLU B CA    1 
ATOM   3369 C C     . GLU F 3 38  ? -1.441  84.735  59.284 1.00 17.52  ? 390 GLU B C     1 
ATOM   3370 O O     . GLU F 3 38  ? -0.397  85.297  59.593 1.00 18.20  ? 390 GLU B O     1 
ATOM   3371 C CB    . GLU F 3 38  ? -1.396  83.179  57.351 1.00 24.74  ? 390 GLU B CB    1 
ATOM   3372 C CG    . GLU F 3 38  ? -1.055  81.812  56.803 1.00 33.25  ? 390 GLU B CG    1 
ATOM   3373 C CD    . GLU F 3 38  ? -1.164  81.747  55.281 1.00 42.51  ? 390 GLU B CD    1 
ATOM   3374 O OE1   . GLU F 3 38  ? -0.912  82.772  54.600 1.00 49.18  ? 390 GLU B OE1   1 
ATOM   3375 O OE2   . GLU F 3 38  ? -1.501  80.660  54.764 1.00 44.21  ? 390 GLU B OE2   1 
ATOM   3376 N N     . ILE F 3 39  ? -2.605  85.371  59.255 1.00 18.12  ? 391 ILE B N     1 
ATOM   3377 C CA    . ILE F 3 39  ? -2.703  86.778  59.648 1.00 16.89  ? 391 ILE B CA    1 
ATOM   3378 C C     . ILE F 3 39  ? -2.263  86.962  61.110 1.00 18.22  ? 391 ILE B C     1 
ATOM   3379 O O     . ILE F 3 39  ? -1.633  87.967  61.455 1.00 16.91  ? 391 ILE B O     1 
ATOM   3380 C CB    . ILE F 3 39  ? -4.143  87.325  59.446 1.00 14.72  ? 391 ILE B CB    1 
ATOM   3381 C CG1   . ILE F 3 39  ? -4.518  87.318  57.955 1.00 13.05  ? 391 ILE B CG1   1 
ATOM   3382 C CG2   . ILE F 3 39  ? -4.274  88.726  60.020 1.00 12.15  ? 391 ILE B CG2   1 
ATOM   3383 C CD1   . ILE F 3 39  ? -5.942  87.782  57.660 1.00 6.57   ? 391 ILE B CD1   1 
ATOM   3384 N N     . SER F 3 40  ? -2.534  85.968  61.954 1.00 19.73  ? 392 SER B N     1 
ATOM   3385 C CA    . SER F 3 40  ? -2.165  86.062  63.363 1.00 18.71  ? 392 SER B CA    1 
ATOM   3386 C C     . SER F 3 40  ? -0.680  86.199  63.617 1.00 15.62  ? 392 SER B C     1 
ATOM   3387 O O     . SER F 3 40  ? -0.263  86.619  64.686 1.00 21.62  ? 392 SER B O     1 
ATOM   3388 C CB    . SER F 3 40  ? -2.767  84.923  64.197 1.00 16.99  ? 392 SER B CB    1 
ATOM   3389 O OG    . SER F 3 40  ? -2.201  83.664  63.901 1.00 19.30  ? 392 SER B OG    1 
ATOM   3390 N N     . HIS F 3 41  ? 0.120   85.919  62.608 1.00 14.14  ? 393 HIS B N     1 
ATOM   3391 C CA    . HIS F 3 41  ? 1.556   86.040  62.741 1.00 10.62  ? 393 HIS B CA    1 
ATOM   3392 C C     . HIS F 3 41  ? 1.903   87.497  62.925 1.00 11.46  ? 393 HIS B C     1 
ATOM   3393 O O     . HIS F 3 41  ? 2.908   87.842  63.561 1.00 12.63  ? 393 HIS B O     1 
ATOM   3394 C CB    . HIS F 3 41  ? 2.202   85.533  61.461 1.00 9.00   ? 393 HIS B CB    1 
ATOM   3395 C CG    . HIS F 3 41  ? 3.664   85.827  61.350 1.00 2.00   ? 393 HIS B CG    1 
ATOM   3396 N ND1   . HIS F 3 41  ? 4.631   85.045  61.936 1.00 3.70   ? 393 HIS B ND1   1 
ATOM   3397 C CD2   . HIS F 3 41  ? 4.322   86.820  60.717 1.00 4.91   ? 393 HIS B CD2   1 
ATOM   3398 C CE1   . HIS F 3 41  ? 5.822   85.549  61.673 1.00 7.79   ? 393 HIS B CE1   1 
ATOM   3399 N NE2   . HIS F 3 41  ? 5.663   86.630  60.935 1.00 2.00   ? 393 HIS B NE2   1 
ATOM   3400 N N     . TYR F 3 42  ? 1.078   88.339  62.303 1.00 17.02  ? 394 TYR B N     1 
ATOM   3401 C CA    . TYR F 3 42  ? 1.225   89.794  62.293 1.00 13.72  ? 394 TYR B CA    1 
ATOM   3402 C C     . TYR F 3 42  ? 0.444   90.513  63.383 1.00 15.48  ? 394 TYR B C     1 
ATOM   3403 O O     . TYR F 3 42  ? 0.769   91.637  63.738 1.00 17.83  ? 394 TYR B O     1 
ATOM   3404 C CB    . TYR F 3 42  ? 0.788   90.336  60.935 1.00 16.57  ? 394 TYR B CB    1 
ATOM   3405 C CG    . TYR F 3 42  ? 1.582   89.776  59.798 1.00 12.11  ? 394 TYR B CG    1 
ATOM   3406 C CD1   . TYR F 3 42  ? 2.806   90.326  59.463 1.00 13.22  ? 394 TYR B CD1   1 
ATOM   3407 C CD2   . TYR F 3 42  ? 1.120   88.685  59.063 1.00 13.12  ? 394 TYR B CD2   1 
ATOM   3408 C CE1   . TYR F 3 42  ? 3.566   89.818  58.422 1.00 14.32  ? 394 TYR B CE1   1 
ATOM   3409 C CE2   . TYR F 3 42  ? 1.875   88.159  58.011 1.00 14.76  ? 394 TYR B CE2   1 
ATOM   3410 C CZ    . TYR F 3 42  ? 3.102   88.742  57.699 1.00 13.79  ? 394 TYR B CZ    1 
ATOM   3411 O OH    . TYR F 3 42  ? 3.882   88.261  56.662 1.00 22.02  ? 394 TYR B OH    1 
ATOM   3412 N N     . VAL F 3 43  ? -0.673  89.932  63.793 1.00 16.53  ? 395 VAL B N     1 
ATOM   3413 C CA    . VAL F 3 43  ? -1.486  90.496  64.868 1.00 22.04  ? 395 VAL B CA    1 
ATOM   3414 C C     . VAL F 3 43  ? -1.605  89.372  65.911 1.00 20.53  ? 395 VAL B C     1 
ATOM   3415 O O     . VAL F 3 43  ? -2.671  88.816  66.128 1.00 21.25  ? 395 VAL B O     1 
ATOM   3416 C CB    . VAL F 3 43  ? -2.876  90.997  64.343 1.00 19.19  ? 395 VAL B CB    1 
ATOM   3417 C CG1   . VAL F 3 43  ? -2.672  92.070  63.296 1.00 24.73  ? 395 VAL B CG1   1 
ATOM   3418 C CG2   . VAL F 3 43  ? -3.661  89.890  63.722 1.00 19.02  ? 395 VAL B CG2   1 
ATOM   3419 N N     . PRO F 3 44  ? -0.482  89.031  66.570 1.00 25.94  ? 396 PRO B N     1 
ATOM   3420 C CA    . PRO F 3 44  ? -0.345  87.987  67.594 1.00 32.31  ? 396 PRO B CA    1 
ATOM   3421 C C     . PRO F 3 44  ? -1.245  88.124  68.830 1.00 35.54  ? 396 PRO B C     1 
ATOM   3422 O O     . PRO F 3 44  ? -1.360  87.194  69.626 1.00 36.66  ? 396 PRO B O     1 
ATOM   3423 C CB    . PRO F 3 44  ? 1.142   88.068  67.949 1.00 31.48  ? 396 PRO B CB    1 
ATOM   3424 C CG    . PRO F 3 44  ? 1.413   89.535  67.845 1.00 30.12  ? 396 PRO B CG    1 
ATOM   3425 C CD    . PRO F 3 44  ? 0.709   89.900  66.560 1.00 27.44  ? 396 PRO B CD    1 
ATOM   3426 N N     . ASN F 3 45  ? -1.839  89.299  69.011 1.00 34.73  ? 397 ASN B N     1 
ATOM   3427 C CA    . ASN F 3 45  ? -2.735  89.540  70.132 1.00 35.21  ? 397 ASN B CA    1 
ATOM   3428 C C     . ASN F 3 45  ? -4.031  88.755  69.938 1.00 31.10  ? 397 ASN B C     1 
ATOM   3429 O O     . ASN F 3 45  ? -4.837  88.631  70.855 1.00 31.85  ? 397 ASN B O     1 
ATOM   3430 C CB    . ASN F 3 45  ? -3.066  91.036  70.230 1.00 44.76  ? 397 ASN B CB    1 
ATOM   3431 C CG    . ASN F 3 45  ? -1.893  91.874  70.710 1.00 53.11  ? 397 ASN B CG    1 
ATOM   3432 O OD1   . ASN F 3 45  ? -0.739  91.639  70.334 1.00 59.01  ? 397 ASN B OD1   1 
ATOM   3433 N ND2   . ASN F 3 45  ? -2.188  92.876  71.529 1.00 56.36  ? 397 ASN B ND2   1 
ATOM   3434 N N     . HIS F 3 46  ? -4.245  88.266  68.724 1.00 27.17  ? 398 HIS B N     1 
ATOM   3435 C CA    . HIS F 3 46  ? -5.447  87.530  68.387 1.00 21.72  ? 398 HIS B CA    1 
ATOM   3436 C C     . HIS F 3 46  ? -5.084  86.179  67.813 1.00 19.68  ? 398 HIS B C     1 
ATOM   3437 O O     . HIS F 3 46  ? -3.928  85.912  67.496 1.00 19.80  ? 398 HIS B O     1 
ATOM   3438 C CB    . HIS F 3 46  ? -6.234  88.297  67.337 1.00 21.54  ? 398 HIS B CB    1 
ATOM   3439 C CG    . HIS F 3 46  ? -6.432  89.742  67.662 1.00 19.68  ? 398 HIS B CG    1 
ATOM   3440 N ND1   . HIS F 3 46  ? -7.530  90.206  68.363 1.00 15.90  ? 398 HIS B ND1   1 
ATOM   3441 C CD2   . HIS F 3 46  ? -5.689  90.832  67.372 1.00 15.77  ? 398 HIS B CD2   1 
ATOM   3442 C CE1   . HIS F 3 46  ? -7.449  91.513  68.486 1.00 16.67  ? 398 HIS B CE1   1 
ATOM   3443 N NE2   . HIS F 3 46  ? -6.341  91.922  67.895 1.00 17.56  ? 398 HIS B NE2   1 
ATOM   3444 N N     . THR F 3 47  ? -6.101  85.359  67.603 1.00 20.55  ? 399 THR B N     1 
ATOM   3445 C CA    . THR F 3 47  ? -5.899  84.023  67.055 1.00 19.01  ? 399 THR B CA    1 
ATOM   3446 C C     . THR F 3 47  ? -6.529  83.922  65.666 1.00 16.65  ? 399 THR B C     1 
ATOM   3447 O O     . THR F 3 47  ? -7.319  84.787  65.251 1.00 16.42  ? 399 THR B O     1 
ATOM   3448 C CB    . THR F 3 47  ? -6.558  82.921  67.967 1.00 12.86  ? 399 THR B CB    1 
ATOM   3449 O OG1   . THR F 3 47  ? -7.956  83.171  68.084 1.00 14.88  ? 399 THR B OG1   1 
ATOM   3450 C CG2   . THR F 3 47  ? -5.973  82.932  69.355 1.00 16.73  ? 399 THR B CG2   1 
ATOM   3451 N N     . GLY F 3 48  ? -6.243  82.818  64.993 1.00 14.27  ? 400 GLY B N     1 
ATOM   3452 C CA    . GLY F 3 48  ? -6.818  82.582  63.692 1.00 12.77  ? 400 GLY B CA    1 
ATOM   3453 C C     . GLY F 3 48  ? -8.313  82.666  63.835 1.00 14.45  ? 400 GLY B C     1 
ATOM   3454 O O     . GLY F 3 48  ? -8.973  83.342  63.045 1.00 17.58  ? 400 GLY B O     1 
ATOM   3455 N N     . ASN F 3 49  ? -8.835  82.045  64.897 1.00 19.46  ? 401 ASN B N     1 
ATOM   3456 C CA    . ASN F 3 49  ? -10.273 82.045  65.189 1.00 15.04  ? 401 ASN B CA    1 
ATOM   3457 C C     . ASN F 3 49  ? -10.875 83.438  65.343 1.00 15.87  ? 401 ASN B C     1 
ATOM   3458 O O     . ASN F 3 49  ? -11.839 83.766  64.662 1.00 20.04  ? 401 ASN B O     1 
ATOM   3459 C CB    . ASN F 3 49  ? -10.585 81.254  66.459 1.00 18.86  ? 401 ASN B CB    1 
ATOM   3460 C CG    . ASN F 3 49  ? -10.524 79.756  66.259 1.00 18.39  ? 401 ASN B CG    1 
ATOM   3461 O OD1   . ASN F 3 49  ? -11.171 79.199  65.366 1.00 18.97  ? 401 ASN B OD1   1 
ATOM   3462 N ND2   . ASN F 3 49  ? -9.776  79.089  67.127 1.00 19.16  ? 401 ASN B ND2   1 
ATOM   3463 N N     . SER F 3 50  ? -10.345 84.251  66.253 1.00 14.86  ? 402 SER B N     1 
ATOM   3464 C CA    . SER F 3 50  ? -10.899 85.584  66.452 1.00 13.22  ? 402 SER B CA    1 
ATOM   3465 C C     . SER F 3 50  ? -10.761 86.482  65.230 1.00 13.19  ? 402 SER B C     1 
ATOM   3466 O O     . SER F 3 50  ? -11.676 87.238  64.884 1.00 14.79  ? 402 SER B O     1 
ATOM   3467 C CB    . SER F 3 50  ? -10.309 86.261  67.697 1.00 11.94  ? 402 SER B CB    1 
ATOM   3468 O OG    . SER F 3 50  ? -8.894  86.298  67.677 1.00 16.86  ? 402 SER B OG    1 
ATOM   3469 N N     . ILE F 3 51  ? -9.614  86.416  64.580 1.00 16.01  ? 403 ILE B N     1 
ATOM   3470 C CA    . ILE F 3 51  ? -9.392  87.226  63.388 1.00 15.43  ? 403 ILE B CA    1 
ATOM   3471 C C     . ILE F 3 51  ? -10.423 86.833  62.319 1.00 17.72  ? 403 ILE B C     1 
ATOM   3472 O O     . ILE F 3 51  ? -11.023 87.703  61.678 1.00 22.15  ? 403 ILE B O     1 
ATOM   3473 C CB    . ILE F 3 51  ? -7.963  87.013  62.846 1.00 15.09  ? 403 ILE B CB    1 
ATOM   3474 C CG1   . ILE F 3 51  ? -6.940  87.349  63.931 1.00 12.28  ? 403 ILE B CG1   1 
ATOM   3475 C CG2   . ILE F 3 51  ? -7.724  87.866  61.618 1.00 14.56  ? 403 ILE B CG2   1 
ATOM   3476 C CD1   . ILE F 3 51  ? -5.555  86.929  63.589 1.00 9.79   ? 403 ILE B CD1   1 
ATOM   3477 N N     . ARG F 3 52  ? -10.660 85.528  62.168 1.00 16.11  ? 404 ARG B N     1 
ATOM   3478 C CA    . ARG F 3 52  ? -11.615 85.013  61.185 1.00 16.46  ? 404 ARG B CA    1 
ATOM   3479 C C     . ARG F 3 52  ? -13.030 85.463  61.471 1.00 19.16  ? 404 ARG B C     1 
ATOM   3480 O O     . ARG F 3 52  ? -13.783 85.827  60.548 1.00 17.25  ? 404 ARG B O     1 
ATOM   3481 C CB    . ARG F 3 52  ? -11.583 83.487  61.123 1.00 12.92  ? 404 ARG B CB    1 
ATOM   3482 C CG    . ARG F 3 52  ? -12.543 82.916  60.092 1.00 15.75  ? 404 ARG B CG    1 
ATOM   3483 C CD    . ARG F 3 52  ? -12.308 81.429  59.908 1.00 21.79  ? 404 ARG B CD    1 
ATOM   3484 N NE    . ARG F 3 52  ? -12.918 80.864  58.697 1.00 17.91  ? 404 ARG B NE    1 
ATOM   3485 C CZ    . ARG F 3 52  ? -14.170 80.423  58.597 1.00 18.99  ? 404 ARG B CZ    1 
ATOM   3486 N NH1   . ARG F 3 52  ? -15.002 80.479  59.626 1.00 18.65  ? 404 ARG B NH1   1 
ATOM   3487 N NH2   . ARG F 3 52  ? -14.572 79.847  57.476 1.00 23.19  ? 404 ARG B NH2   1 
ATOM   3488 N N     . HIS F 3 53  ? -13.406 85.390  62.745 1.00 14.39  ? 405 HIS B N     1 
ATOM   3489 C CA    . HIS F 3 53  ? -14.734 85.805  63.168 1.00 12.99  ? 405 HIS B CA    1 
ATOM   3490 C C     . HIS F 3 53  ? -14.868 87.313  63.030 1.00 9.50   ? 405 HIS B C     1 
ATOM   3491 O O     . HIS F 3 53  ? -15.917 87.830  62.668 1.00 12.86  ? 405 HIS B O     1 
ATOM   3492 C CB    . HIS F 3 53  ? -14.980 85.391  64.616 1.00 18.28  ? 405 HIS B CB    1 
ATOM   3493 C CG    . HIS F 3 53  ? -16.355 85.707  65.094 1.00 22.32  ? 405 HIS B CG    1 
ATOM   3494 N ND1   . HIS F 3 53  ? -17.430 84.888  64.829 1.00 27.43  ? 405 HIS B ND1   1 
ATOM   3495 C CD2   . HIS F 3 53  ? -16.850 86.782  65.747 1.00 23.90  ? 405 HIS B CD2   1 
ATOM   3496 C CE1   . HIS F 3 53  ? -18.535 85.452  65.286 1.00 28.21  ? 405 HIS B CE1   1 
ATOM   3497 N NE2   . HIS F 3 53  ? -18.207 86.603  65.848 1.00 31.89  ? 405 HIS B NE2   1 
ATOM   3498 N N     . ARG F 3 54  ? -13.806 88.022  63.369 1.00 10.00  ? 406 ARG B N     1 
ATOM   3499 C CA    . ARG F 3 54  ? -13.808 89.458  63.254 1.00 17.61  ? 406 ARG B CA    1 
ATOM   3500 C C     . ARG F 3 54  ? -14.085 89.823  61.783 1.00 19.27  ? 406 ARG B C     1 
ATOM   3501 O O     . ARG F 3 54  ? -14.927 90.678  61.488 1.00 16.96  ? 406 ARG B O     1 
ATOM   3502 C CB    . ARG F 3 54  ? -12.455 90.005  63.722 1.00 18.21  ? 406 ARG B CB    1 
ATOM   3503 C CG    . ARG F 3 54  ? -12.355 91.499  63.664 1.00 19.02  ? 406 ARG B CG    1 
ATOM   3504 C CD    . ARG F 3 54  ? -13.412 92.165  64.519 1.00 19.76  ? 406 ARG B CD    1 
ATOM   3505 N NE    . ARG F 3 54  ? -13.320 93.613  64.382 1.00 24.62  ? 406 ARG B NE    1 
ATOM   3506 C CZ    . ARG F 3 54  ? -13.904 94.496  65.189 1.00 24.96  ? 406 ARG B CZ    1 
ATOM   3507 N NH1   . ARG F 3 54  ? -14.637 94.090  66.217 1.00 21.26  ? 406 ARG B NH1   1 
ATOM   3508 N NH2   . ARG F 3 54  ? -13.780 95.790  64.948 1.00 27.23  ? 406 ARG B NH2   1 
ATOM   3509 N N     . PHE F 3 55  ? -13.383 89.177  60.858 1.00 17.75  ? 407 PHE B N     1 
ATOM   3510 C CA    . PHE F 3 55  ? -13.614 89.458  59.458 1.00 20.34  ? 407 PHE B CA    1 
ATOM   3511 C C     . PHE F 3 55  ? -15.041 89.112  59.033 1.00 21.80  ? 407 PHE B C     1 
ATOM   3512 O O     . PHE F 3 55  ? -15.758 89.946  58.485 1.00 26.12  ? 407 PHE B O     1 
ATOM   3513 C CB    . PHE F 3 55  ? -12.612 88.726  58.556 1.00 16.45  ? 407 PHE B CB    1 
ATOM   3514 C CG    . PHE F 3 55  ? -12.896 88.906  57.087 1.00 18.57  ? 407 PHE B CG    1 
ATOM   3515 C CD1   . PHE F 3 55  ? -12.655 90.127  56.472 1.00 15.40  ? 407 PHE B CD1   1 
ATOM   3516 C CD2   . PHE F 3 55  ? -13.496 87.886  56.342 1.00 17.29  ? 407 PHE B CD2   1 
ATOM   3517 C CE1   . PHE F 3 55  ? -13.015 90.345  55.130 1.00 21.27  ? 407 PHE B CE1   1 
ATOM   3518 C CE2   . PHE F 3 55  ? -13.863 88.091  55.001 1.00 17.28  ? 407 PHE B CE2   1 
ATOM   3519 C CZ    . PHE F 3 55  ? -13.623 89.328  54.395 1.00 14.96  ? 407 PHE B CZ    1 
ATOM   3520 N N     . ARG F 3 56  ? -15.471 87.892  59.307 1.00 23.67  ? 408 ARG B N     1 
ATOM   3521 C CA    . ARG F 3 56  ? -16.802 87.471  58.899 1.00 22.33  ? 408 ARG B CA    1 
ATOM   3522 C C     . ARG F 3 56  ? -17.955 88.320  59.399 1.00 23.76  ? 408 ARG B C     1 
ATOM   3523 O O     . ARG F 3 56  ? -18.772 88.769  58.617 1.00 29.73  ? 408 ARG B O     1 
ATOM   3524 C CB    . ARG F 3 56  ? -17.050 86.023  59.290 1.00 23.23  ? 408 ARG B CB    1 
ATOM   3525 C CG    . ARG F 3 56  ? -16.076 85.020  58.702 1.00 28.77  ? 408 ARG B CG    1 
ATOM   3526 C CD    . ARG F 3 56  ? -16.741 83.664  58.567 1.00 34.47  ? 408 ARG B CD    1 
ATOM   3527 N NE    . ARG F 3 56  ? -17.730 83.462  59.621 1.00 42.44  ? 408 ARG B NE    1 
ATOM   3528 C CZ    . ARG F 3 56  ? -19.028 83.259  59.409 1.00 46.80  ? 408 ARG B CZ    1 
ATOM   3529 N NH1   . ARG F 3 56  ? -19.506 83.210  58.166 1.00 48.32  ? 408 ARG B NH1   1 
ATOM   3530 N NH2   . ARG F 3 56  ? -19.859 83.182  60.445 1.00 40.87  ? 408 ARG B NH2   1 
ATOM   3531 N N     . VAL F 3 57  ? -17.991 88.593  60.691 1.00 23.61  ? 409 VAL B N     1 
ATOM   3532 C CA    . VAL F 3 57  ? -19.091 89.344  61.268 1.00 19.28  ? 409 VAL B CA    1 
ATOM   3533 C C     . VAL F 3 57  ? -19.060 90.862  61.151 1.00 24.56  ? 409 VAL B C     1 
ATOM   3534 O O     . VAL F 3 57  ? -20.103 91.499  60.981 1.00 30.27  ? 409 VAL B O     1 
ATOM   3535 C CB    . VAL F 3 57  ? -19.260 88.936  62.745 1.00 22.11  ? 409 VAL B CB    1 
ATOM   3536 C CG1   . VAL F 3 57  ? -20.410 89.673  63.392 1.00 17.75  ? 409 VAL B CG1   1 
ATOM   3537 C CG2   . VAL F 3 57  ? -19.487 87.431  62.829 1.00 20.39  ? 409 VAL B CG2   1 
ATOM   3538 N N     . TYR F 3 58  ? -17.874 91.450  61.183 1.00 24.28  ? 410 TYR B N     1 
ATOM   3539 C CA    . TYR F 3 58  ? -17.791 92.888  61.149 1.00 23.13  ? 410 TYR B CA    1 
ATOM   3540 C C     . TYR F 3 58  ? -17.144 93.506  59.935 1.00 27.24  ? 410 TYR B C     1 
ATOM   3541 O O     . TYR F 3 58  ? -17.662 94.473  59.367 1.00 29.37  ? 410 TYR B O     1 
ATOM   3542 C CB    . TYR F 3 58  ? -17.079 93.382  62.414 1.00 28.92  ? 410 TYR B CB    1 
ATOM   3543 C CG    . TYR F 3 58  ? -17.791 93.031  63.721 1.00 36.76  ? 410 TYR B CG    1 
ATOM   3544 C CD1   . TYR F 3 58  ? -18.936 93.732  64.129 1.00 37.53  ? 410 TYR B CD1   1 
ATOM   3545 C CD2   . TYR F 3 58  ? -17.318 92.004  64.547 1.00 34.54  ? 410 TYR B CD2   1 
ATOM   3546 C CE1   . TYR F 3 58  ? -19.587 93.420  65.322 1.00 38.42  ? 410 TYR B CE1   1 
ATOM   3547 C CE2   . TYR F 3 58  ? -17.961 91.684  65.741 1.00 39.11  ? 410 TYR B CE2   1 
ATOM   3548 C CZ    . TYR F 3 58  ? -19.097 92.392  66.126 1.00 41.90  ? 410 TYR B CZ    1 
ATOM   3549 O OH    . TYR F 3 58  ? -19.760 92.051  67.295 1.00 42.67  ? 410 TYR B OH    1 
ATOM   3550 N N     . LEU F 3 59  ? -16.005 92.961  59.531 1.00 28.63  ? 411 LEU B N     1 
ATOM   3551 C CA    . LEU F 3 59  ? -15.266 93.523  58.406 1.00 23.53  ? 411 LEU B CA    1 
ATOM   3552 C C     . LEU F 3 59  ? -15.752 93.195  56.996 1.00 26.76  ? 411 LEU B C     1 
ATOM   3553 O O     . LEU F 3 59  ? -15.581 94.003  56.098 1.00 28.89  ? 411 LEU B O     1 
ATOM   3554 C CB    . LEU F 3 59  ? -13.779 93.220  58.562 1.00 15.95  ? 411 LEU B CB    1 
ATOM   3555 C CG    . LEU F 3 59  ? -13.341 93.437  60.003 1.00 5.28   ? 411 LEU B CG    1 
ATOM   3556 C CD1   . LEU F 3 59  ? -11.912 93.028  60.148 1.00 6.36   ? 411 LEU B CD1   1 
ATOM   3557 C CD2   . LEU F 3 59  ? -13.542 94.892  60.364 1.00 7.77   ? 411 LEU B CD2   1 
ATOM   3558 N N     . SER F 3 60  ? -16.342 92.026  56.780 1.00 27.07  ? 412 SER B N     1 
ATOM   3559 C CA    . SER F 3 60  ? -16.836 91.685  55.451 1.00 29.24  ? 412 SER B CA    1 
ATOM   3560 C C     . SER F 3 60  ? -17.864 92.722  54.956 1.00 33.76  ? 412 SER B C     1 
ATOM   3561 O O     . SER F 3 60  ? -18.026 92.931  53.751 1.00 32.87  ? 412 SER B O     1 
ATOM   3562 C CB    . SER F 3 60  ? -17.451 90.293  55.459 1.00 28.24  ? 412 SER B CB    1 
ATOM   3563 O OG    . SER F 3 60  ? -18.450 90.196  56.453 1.00 33.62  ? 412 SER B OG    1 
ATOM   3564 N N     . LYS F 3 61  ? -18.519 93.398  55.894 1.00 35.74  ? 413 LYS B N     1 
ATOM   3565 C CA    . LYS F 3 61  ? -19.510 94.415  55.565 1.00 36.79  ? 413 LYS B CA    1 
ATOM   3566 C C     . LYS F 3 61  ? -18.865 95.609  54.875 1.00 34.92  ? 413 LYS B C     1 
ATOM   3567 O O     . LYS F 3 61  ? -19.493 96.277  54.057 1.00 37.71  ? 413 LYS B O     1 
ATOM   3568 C CB    . LYS F 3 61  ? -20.236 94.872  56.834 1.00 41.42  ? 413 LYS B CB    1 
ATOM   3569 C CG    . LYS F 3 61  ? -20.786 93.717  57.656 1.00 44.31  ? 413 LYS B CG    1 
ATOM   3570 C CD    . LYS F 3 61  ? -21.722 94.176  58.781 1.00 57.16  ? 413 LYS B CD    1 
ATOM   3571 C CE    . LYS F 3 61  ? -20.995 94.687  60.040 1.00 57.77  ? 413 LYS B CE    1 
ATOM   3572 N NZ    . LYS F 3 61  ? -20.259 95.964  59.832 1.00 58.60  ? 413 LYS B NZ    1 
ATOM   3573 N N     . ARG F 3 62  ? -17.611 95.880  55.207 1.00 35.05  ? 414 ARG B N     1 
ATOM   3574 C CA    . ARG F 3 62  ? -16.896 96.993  54.604 1.00 32.62  ? 414 ARG B CA    1 
ATOM   3575 C C     . ARG F 3 62  ? -15.713 96.575  53.680 1.00 32.36  ? 414 ARG B C     1 
ATOM   3576 O O     . ARG F 3 62  ? -14.788 97.369  53.424 1.00 36.45  ? 414 ARG B O     1 
ATOM   3577 C CB    . ARG F 3 62  ? -16.497 98.024  55.696 1.00 33.01  ? 414 ARG B CB    1 
ATOM   3578 C CG    . ARG F 3 62  ? -15.811 97.474  56.969 1.00 31.10  ? 414 ARG B CG    1 
ATOM   3579 C CD    . ARG F 3 62  ? -14.769 98.475  57.547 1.00 31.87  ? 414 ARG B CD    1 
ATOM   3580 N NE    . ARG F 3 62  ? -14.532 98.377  59.001 1.00 34.57  ? 414 ARG B NE    1 
ATOM   3581 C CZ    . ARG F 3 62  ? -13.372 98.690  59.586 1.00 36.85  ? 414 ARG B CZ    1 
ATOM   3582 N NH1   . ARG F 3 62  ? -12.364 99.083  58.829 1.00 34.51  ? 414 ARG B NH1   1 
ATOM   3583 N NH2   . ARG F 3 62  ? -13.241 98.734  60.919 1.00 35.84  ? 414 ARG B NH2   1 
ATOM   3584 N N     . LEU F 3 63  ? -15.781 95.345  53.146 1.00 29.37  ? 415 LEU B N     1 
ATOM   3585 C CA    . LEU F 3 63  ? -14.756 94.813  52.225 1.00 26.43  ? 415 LEU B CA    1 
ATOM   3586 C C     . LEU F 3 63  ? -14.675 95.748  51.025 1.00 27.05  ? 415 LEU B C     1 
ATOM   3587 O O     . LEU F 3 63  ? -13.603 96.255  50.701 1.00 28.85  ? 415 LEU B O     1 
ATOM   3588 C CB    . LEU F 3 63  ? -15.136 93.419  51.713 1.00 23.56  ? 415 LEU B CB    1 
ATOM   3589 C CG    . LEU F 3 63  ? -14.079 92.314  51.590 1.00 16.90  ? 415 LEU B CG    1 
ATOM   3590 C CD1   . LEU F 3 63  ? -14.433 91.472  50.409 1.00 16.49  ? 415 LEU B CD1   1 
ATOM   3591 C CD2   . LEU F 3 63  ? -12.662 92.848  51.455 1.00 13.29  ? 415 LEU B CD2   1 
ATOM   3592 N N     . GLU F 3 64  ? -15.827 95.976  50.393 1.00 25.79  ? 416 GLU B N     1 
ATOM   3593 C CA    . GLU F 3 64  ? -15.970 96.859  49.235 1.00 29.05  ? 416 GLU B CA    1 
ATOM   3594 C C     . GLU F 3 64  ? -15.317 96.364  47.959 1.00 26.62  ? 416 GLU B C     1 
ATOM   3595 O O     . GLU F 3 64  ? -15.923 96.425  46.899 1.00 27.83  ? 416 GLU B O     1 
ATOM   3596 C CB    . GLU F 3 64  ? -15.505 98.279  49.559 1.00 32.87  ? 416 GLU B CB    1 
ATOM   3597 C CG    . GLU F 3 64  ? -16.396 98.973  50.572 1.00 45.92  ? 416 GLU B CG    1 
ATOM   3598 C CD    . GLU F 3 64  ? -15.873 100.332 50.966 1.00 52.27  ? 416 GLU B CD    1 
ATOM   3599 O OE1   . GLU F 3 64  ? -16.098 101.305 50.213 1.00 59.14  ? 416 GLU B OE1   1 
ATOM   3600 O OE2   . GLU F 3 64  ? -15.232 100.426 52.032 1.00 55.98  ? 416 GLU B OE2   1 
ATOM   3601 N N     . TYR F 3 65  ? -14.106 95.834  48.063 1.00 23.98  ? 417 TYR B N     1 
ATOM   3602 C CA    . TYR F 3 65  ? -13.403 95.343  46.897 1.00 19.39  ? 417 TYR B CA    1 
ATOM   3603 C C     . TYR F 3 65  ? -12.248 94.432  47.299 1.00 20.64  ? 417 TYR B C     1 
ATOM   3604 O O     . TYR F 3 65  ? -11.825 94.425  48.451 1.00 20.06  ? 417 TYR B O     1 
ATOM   3605 C CB    . TYR F 3 65  ? -12.840 96.535  46.105 1.00 20.22  ? 417 TYR B CB    1 
ATOM   3606 C CG    . TYR F 3 65  ? -11.699 97.250  46.808 1.00 15.93  ? 417 TYR B CG    1 
ATOM   3607 C CD1   . TYR F 3 65  ? -11.943 98.255  47.740 1.00 18.35  ? 417 TYR B CD1   1 
ATOM   3608 C CD2   . TYR F 3 65  ? -10.379 96.848  46.608 1.00 20.19  ? 417 TYR B CD2   1 
ATOM   3609 C CE1   . TYR F 3 65  ? -10.899 98.836  48.463 1.00 25.13  ? 417 TYR B CE1   1 
ATOM   3610 C CE2   . TYR F 3 65  ? -9.330  97.412  47.324 1.00 24.46  ? 417 TYR B CE2   1 
ATOM   3611 C CZ    . TYR F 3 65  ? -9.593  98.400  48.250 1.00 27.48  ? 417 TYR B CZ    1 
ATOM   3612 O OH    . TYR F 3 65  ? -8.543  98.931  48.971 1.00 38.15  ? 417 TYR B OH    1 
ATOM   3613 N N     . VAL F 3 66  ? -11.746 93.680  46.322 1.00 22.15  ? 418 VAL B N     1 
ATOM   3614 C CA    . VAL F 3 66  ? -10.596 92.791  46.462 1.00 18.78  ? 418 VAL B CA    1 
ATOM   3615 C C     . VAL F 3 66  ? -9.728  93.078  45.237 1.00 19.08  ? 418 VAL B C     1 
ATOM   3616 O O     . VAL F 3 66  ? -10.130 93.850  44.373 1.00 17.30  ? 418 VAL B O     1 
ATOM   3617 C CB    . VAL F 3 66  ? -10.994 91.287  46.485 1.00 17.43  ? 418 VAL B CB    1 
ATOM   3618 C CG1   . VAL F 3 66  ? -11.831 90.996  47.717 1.00 13.48  ? 418 VAL B CG1   1 
ATOM   3619 C CG2   . VAL F 3 66  ? -11.764 90.890  45.224 1.00 19.94  ? 418 VAL B CG2   1 
ATOM   3620 N N     . TYR F 3 67  ? -8.523  92.535  45.198 1.00 16.74  ? 419 TYR B N     1 
ATOM   3621 C CA    . TYR F 3 67  ? -7.643  92.726  44.060 1.00 18.92  ? 419 TYR B CA    1 
ATOM   3622 C C     . TYR F 3 67  ? -7.799  91.464  43.242 1.00 18.70  ? 419 TYR B C     1 
ATOM   3623 O O     . TYR F 3 67  ? -7.894  90.381  43.810 1.00 19.88  ? 419 TYR B O     1 
ATOM   3624 C CB    . TYR F 3 67  ? -6.200  92.890  44.534 1.00 22.36  ? 419 TYR B CB    1 
ATOM   3625 C CG    . TYR F 3 67  ? -6.021  94.108  45.412 1.00 24.31  ? 419 TYR B CG    1 
ATOM   3626 C CD1   . TYR F 3 67  ? -6.114  95.393  44.878 1.00 22.74  ? 419 TYR B CD1   1 
ATOM   3627 C CD2   . TYR F 3 67  ? -5.758  93.978  46.776 1.00 18.80  ? 419 TYR B CD2   1 
ATOM   3628 C CE1   . TYR F 3 67  ? -5.948  96.522  45.680 1.00 20.71  ? 419 TYR B CE1   1 
ATOM   3629 C CE2   . TYR F 3 67  ? -5.590  95.097  47.585 1.00 21.41  ? 419 TYR B CE2   1 
ATOM   3630 C CZ    . TYR F 3 67  ? -5.686  96.365  47.030 1.00 23.92  ? 419 TYR B CZ    1 
ATOM   3631 O OH    . TYR F 3 67  ? -5.522  97.479  47.822 1.00 27.89  ? 419 TYR B OH    1 
ATOM   3632 N N     . GLU F 3 68  ? -7.867  91.574  41.922 1.00 20.44  ? 420 GLU B N     1 
ATOM   3633 C CA    . GLU F 3 68  ? -8.045  90.367  41.130 1.00 20.29  ? 420 GLU B CA    1 
ATOM   3634 C C     . GLU F 3 68  ? -6.805  89.509  40.956 1.00 16.16  ? 420 GLU B C     1 
ATOM   3635 O O     . GLU F 3 68  ? -5.679  89.999  41.011 1.00 17.46  ? 420 GLU B O     1 
ATOM   3636 C CB    . GLU F 3 68  ? -8.745  90.649  39.788 1.00 25.07  ? 420 GLU B CB    1 
ATOM   3637 C CG    . GLU F 3 68  ? -8.026  91.544  38.805 1.00 32.40  ? 420 GLU B CG    1 
ATOM   3638 C CD    . GLU F 3 68  ? -8.695  91.557  37.422 1.00 32.09  ? 420 GLU B CD    1 
ATOM   3639 O OE1   . GLU F 3 68  ? -9.936  91.446  37.350 1.00 27.23  ? 420 GLU B OE1   1 
ATOM   3640 O OE2   . GLU F 3 68  ? -7.975  91.684  36.407 1.00 38.16  ? 420 GLU B OE2   1 
ATOM   3641 N N     . VAL F 3 69  ? -7.020  88.206  40.826 1.00 16.32  ? 421 VAL B N     1 
ATOM   3642 C CA    . VAL F 3 69  ? -5.919  87.267  40.639 1.00 21.57  ? 421 VAL B CA    1 
ATOM   3643 C C     . VAL F 3 69  ? -6.171  86.546  39.322 1.00 21.04  ? 421 VAL B C     1 
ATOM   3644 O O     . VAL F 3 69  ? -7.286  86.534  38.828 1.00 20.98  ? 421 VAL B O     1 
ATOM   3645 C CB    . VAL F 3 69  ? -5.786  86.214  41.806 1.00 20.04  ? 421 VAL B CB    1 
ATOM   3646 C CG1   . VAL F 3 69  ? -5.674  86.918  43.157 1.00 21.65  ? 421 VAL B CG1   1 
ATOM   3647 C CG2   . VAL F 3 69  ? -6.941  85.255  41.803 1.00 12.53  ? 421 VAL B CG2   1 
ATOM   3648 N N     . ASP F 3 70  ? -5.116  85.985  38.749 1.00 25.52  ? 422 ASP B N     1 
ATOM   3649 C CA    . ASP F 3 70  ? -5.188  85.277  37.486 1.00 25.62  ? 422 ASP B CA    1 
ATOM   3650 C C     . ASP F 3 70  ? -5.374  83.776  37.690 1.00 29.72  ? 422 ASP B C     1 
ATOM   3651 O O     . ASP F 3 70  ? -5.429  83.300  38.820 1.00 31.81  ? 422 ASP B O     1 
ATOM   3652 C CB    . ASP F 3 70  ? -3.915  85.569  36.660 1.00 24.76  ? 422 ASP B CB    1 
ATOM   3653 C CG    . ASP F 3 70  ? -2.620  85.140  37.359 1.00 23.05  ? 422 ASP B CG    1 
ATOM   3654 O OD1   . ASP F 3 70  ? -2.660  84.286  38.258 1.00 27.38  ? 422 ASP B OD1   1 
ATOM   3655 O OD2   . ASP F 3 70  ? -1.533  85.628  36.986 1.00 21.96  ? 422 ASP B OD2   1 
ATOM   3656 N N     . LYS F 3 71  ? -5.392  83.030  36.589 1.00 33.42  ? 423 LYS B N     1 
ATOM   3657 C CA    . LYS F 3 71  ? -5.556  81.577  36.618 1.00 32.33  ? 423 LYS B CA    1 
ATOM   3658 C C     . LYS F 3 71  ? -4.406  80.850  37.321 1.00 31.11  ? 423 LYS B C     1 
ATOM   3659 O O     . LYS F 3 71  ? -4.547  79.696  37.717 1.00 31.58  ? 423 LYS B O     1 
ATOM   3660 C CB    . LYS F 3 71  ? -5.755  81.030  35.188 1.00 30.98  ? 423 LYS B CB    1 
ATOM   3661 C CG    . LYS F 3 71  ? -4.606  81.298  34.211 1.00 25.21  ? 423 LYS B CG    1 
ATOM   3662 C CD    . LYS F 3 71  ? -5.034  80.952  32.784 1.00 33.08  ? 423 LYS B CD    1 
ATOM   3663 C CE    . LYS F 3 71  ? -4.008  81.353  31.735 1.00 26.45  ? 423 LYS B CE    1 
ATOM   3664 N NZ    . LYS F 3 71  ? -4.612  81.433  30.367 1.00 30.73  ? 423 LYS B NZ    1 
ATOM   3665 N N     . PHE F 3 72  ? -3.259  81.513  37.427 1.00 32.28  ? 424 PHE B N     1 
ATOM   3666 C CA    . PHE F 3 72  ? -2.097  80.940  38.102 1.00 34.90  ? 424 PHE B CA    1 
ATOM   3667 C C     . PHE F 3 72  ? -2.129  81.340  39.581 1.00 35.47  ? 424 PHE B C     1 
ATOM   3668 O O     . PHE F 3 72  ? -1.134  81.189  40.296 1.00 39.90  ? 424 PHE B O     1 
ATOM   3669 C CB    . PHE F 3 72  ? -0.803  81.449  37.466 1.00 35.38  ? 424 PHE B CB    1 
ATOM   3670 C CG    . PHE F 3 72  ? -0.722  81.224  35.984 1.00 40.53  ? 424 PHE B CG    1 
ATOM   3671 C CD1   . PHE F 3 72  ? -0.279  80.009  35.472 1.00 44.92  ? 424 PHE B CD1   1 
ATOM   3672 C CD2   . PHE F 3 72  ? -1.057  82.242  35.094 1.00 43.95  ? 424 PHE B CD2   1 
ATOM   3673 C CE1   . PHE F 3 72  ? -0.168  79.817  34.097 1.00 39.77  ? 424 PHE B CE1   1 
ATOM   3674 C CE2   . PHE F 3 72  ? -0.949  82.056  33.721 1.00 38.67  ? 424 PHE B CE2   1 
ATOM   3675 C CZ    . PHE F 3 72  ? -0.502  80.846  33.225 1.00 39.75  ? 424 PHE B CZ    1 
ATOM   3676 N N     . GLY F 3 73  ? -3.242  81.941  39.999 1.00 33.87  ? 425 GLY B N     1 
ATOM   3677 C CA    . GLY F 3 73  ? -3.415  82.362  41.378 1.00 34.34  ? 425 GLY B CA    1 
ATOM   3678 C C     . GLY F 3 73  ? -2.631  83.571  41.866 1.00 34.34  ? 425 GLY B C     1 
ATOM   3679 O O     . GLY F 3 73  ? -2.638  83.860  43.067 1.00 38.35  ? 425 GLY B O     1 
ATOM   3680 N N     . LYS F 3 74  ? -1.936  84.262  40.967 1.00 29.19  ? 426 LYS B N     1 
ATOM   3681 C CA    . LYS F 3 74  ? -1.160  85.443  41.336 1.00 23.37  ? 426 LYS B CA    1 
ATOM   3682 C C     . LYS F 3 74  ? -1.954  86.737  41.122 1.00 24.13  ? 426 LYS B C     1 
ATOM   3683 O O     . LYS F 3 74  ? -2.907  86.774  40.337 1.00 20.27  ? 426 LYS B O     1 
ATOM   3684 C CB    . LYS F 3 74  ? 0.166   85.449  40.583 1.00 22.16  ? 426 LYS B CB    1 
ATOM   3685 C CG    . LYS F 3 74  ? 0.908   84.133  40.751 1.00 20.61  ? 426 LYS B CG    1 
ATOM   3686 C CD    . LYS F 3 74  ? 2.406   84.294  40.631 1.00 33.12  ? 426 LYS B CD    1 
ATOM   3687 C CE    . LYS F 3 74  ? 3.104   82.937  40.647 1.00 28.30  ? 426 LYS B CE    1 
ATOM   3688 N NZ    . LYS F 3 74  ? 2.886   82.187  41.912 1.00 36.50  ? 426 LYS B NZ    1 
ATOM   3689 N N     . LEU F 3 75  ? -1.633  87.768  41.897 1.00 24.29  ? 427 LEU B N     1 
ATOM   3690 C CA    . LEU F 3 75  ? -2.335  89.041  41.786 1.00 22.97  ? 427 LEU B CA    1 
ATOM   3691 C C     . LEU F 3 75  ? -2.078  89.684  40.427 1.00 25.60  ? 427 LEU B C     1 
ATOM   3692 O O     . LEU F 3 75  ? -0.948  89.676  39.931 1.00 24.44  ? 427 LEU B O     1 
ATOM   3693 C CB    . LEU F 3 75  ? -1.900  89.992  42.897 1.00 15.77  ? 427 LEU B CB    1 
ATOM   3694 C CG    . LEU F 3 75  ? -2.361  89.659  44.315 1.00 12.07  ? 427 LEU B CG    1 
ATOM   3695 C CD1   . LEU F 3 75  ? -1.686  90.590  45.312 1.00 11.82  ? 427 LEU B CD1   1 
ATOM   3696 C CD2   . LEU F 3 75  ? -3.864  89.782  44.408 1.00 4.58   ? 427 LEU B CD2   1 
ATOM   3697 N N     . VAL F 3 76  ? -3.129  90.240  39.833 1.00 25.06  ? 428 VAL B N     1 
ATOM   3698 C CA    . VAL F 3 76  ? -3.023  90.893  38.535 1.00 26.14  ? 428 VAL B CA    1 
ATOM   3699 C C     . VAL F 3 76  ? -2.567  92.330  38.713 1.00 26.58  ? 428 VAL B C     1 
ATOM   3700 O O     . VAL F 3 76  ? -3.134  93.079  39.511 1.00 29.45  ? 428 VAL B O     1 
ATOM   3701 C CB    . VAL F 3 76  ? -4.380  90.848  37.780 1.00 24.72  ? 428 VAL B CB    1 
ATOM   3702 C CG1   . VAL F 3 76  ? -4.399  91.845  36.644 1.00 21.29  ? 428 VAL B CG1   1 
ATOM   3703 C CG2   . VAL F 3 76  ? -4.627  89.450  37.254 1.00 11.88  ? 428 VAL B CG2   1 
ATOM   3704 N N     . ARG F 3 77  ? -1.504  92.696  38.013 1.00 31.58  ? 429 ARG B N     1 
ATOM   3705 C CA    . ARG F 3 77  ? -0.978  94.060  38.076 1.00 38.11  ? 429 ARG B CA    1 
ATOM   3706 C C     . ARG F 3 77  ? -1.010  94.672  36.682 1.00 43.55  ? 429 ARG B C     1 
ATOM   3707 O O     . ARG F 3 77  ? -0.891  93.949  35.691 1.00 47.02  ? 429 ARG B O     1 
ATOM   3708 C CB    . ARG F 3 77  ? 0.456   94.065  38.619 1.00 30.47  ? 429 ARG B CB    1 
ATOM   3709 C CG    . ARG F 3 77  ? 0.514   93.812  40.096 1.00 33.04  ? 429 ARG B CG    1 
ATOM   3710 C CD    . ARG F 3 77  ? 1.846   93.270  40.503 1.00 44.58  ? 429 ARG B CD    1 
ATOM   3711 N NE    . ARG F 3 77  ? 2.903   94.278  40.482 1.00 50.91  ? 429 ARG B NE    1 
ATOM   3712 C CZ    . ARG F 3 77  ? 4.197   94.022  40.265 1.00 51.57  ? 429 ARG B CZ    1 
ATOM   3713 N NH1   . ARG F 3 77  ? 4.631   92.781  40.030 1.00 47.43  ? 429 ARG B NH1   1 
ATOM   3714 N NH2   . ARG F 3 77  ? 5.077   95.015  40.347 1.00 50.23  ? 429 ARG B NH2   1 
ATOM   3715 N N     . ASP F 3 78  ? -1.257  95.977  36.597 1.00 47.60  ? 430 ASP B N     1 
ATOM   3716 C CA    . ASP F 3 78  ? -1.269  96.643  35.297 1.00 54.18  ? 430 ASP B CA    1 
ATOM   3717 C C     . ASP F 3 78  ? 0.155   97.111  34.894 1.00 60.19  ? 430 ASP B C     1 
ATOM   3718 O O     . ASP F 3 78  ? 1.147   96.637  35.459 1.00 58.57  ? 430 ASP B O     1 
ATOM   3719 C CB    . ASP F 3 78  ? -2.306  97.787  35.266 1.00 50.57  ? 430 ASP B CB    1 
ATOM   3720 C CG    . ASP F 3 78  ? -1.962  98.955  36.201 1.00 52.10  ? 430 ASP B CG    1 
ATOM   3721 O OD1   . ASP F 3 78  ? -0.839  99.013  36.745 1.00 51.22  ? 430 ASP B OD1   1 
ATOM   3722 O OD2   . ASP F 3 78  ? -2.826  99.844  36.381 1.00 51.49  ? 430 ASP B OD2   1 
ATOM   3723 N N     . ASP F 3 79  ? 0.244   98.082  33.977 1.00 66.38  ? 431 ASP B N     1 
ATOM   3724 C CA    . ASP F 3 79  ? 1.527   98.612  33.477 1.00 67.48  ? 431 ASP B CA    1 
ATOM   3725 C C     . ASP F 3 79  ? 2.485   99.270  34.472 1.00 63.80  ? 431 ASP B C     1 
ATOM   3726 O O     . ASP F 3 79  ? 3.708   99.234  34.287 1.00 59.50  ? 431 ASP B O     1 
ATOM   3727 C CB    . ASP F 3 79  ? 1.281   99.558  32.299 1.00 75.20  ? 431 ASP B CB    1 
ATOM   3728 C CG    . ASP F 3 79  ? 0.923   98.812  31.027 1.00 81.04  ? 431 ASP B CG    1 
ATOM   3729 O OD1   . ASP F 3 79  ? -0.282  98.536  30.814 1.00 82.48  ? 431 ASP B OD1   1 
ATOM   3730 O OD2   . ASP F 3 79  ? 1.856   98.489  30.254 1.00 83.48  ? 431 ASP B OD2   1 
ATOM   3731 N N     . ASP F 3 80  ? 1.932   99.901  35.501 1.00 61.93  ? 432 ASP B N     1 
ATOM   3732 C CA    . ASP F 3 80  ? 2.753   100.548 36.519 1.00 61.61  ? 432 ASP B CA    1 
ATOM   3733 C C     . ASP F 3 80  ? 2.871   99.651  37.751 1.00 60.65  ? 432 ASP B C     1 
ATOM   3734 O O     . ASP F 3 80  ? 3.467   100.047 38.756 1.00 61.64  ? 432 ASP B O     1 
ATOM   3735 C CB    . ASP F 3 80  ? 2.157   101.904 36.897 1.00 62.40  ? 432 ASP B CB    1 
ATOM   3736 C CG    . ASP F 3 80  ? 1.903   102.773 35.689 1.00 67.29  ? 432 ASP B CG    1 
ATOM   3737 O OD1   . ASP F 3 80  ? 2.888   103.228 35.066 1.00 67.61  ? 432 ASP B OD1   1 
ATOM   3738 O OD2   . ASP F 3 80  ? 0.719   102.972 35.341 1.00 71.08  ? 432 ASP B OD2   1 
ATOM   3739 N N     . GLY F 3 81  ? 2.324   98.436  37.652 1.00 55.28  ? 433 GLY B N     1 
ATOM   3740 C CA    . GLY F 3 81  ? 2.368   97.494  38.756 1.00 51.32  ? 433 GLY B CA    1 
ATOM   3741 C C     . GLY F 3 81  ? 1.267   97.671  39.791 1.00 48.81  ? 433 GLY B C     1 
ATOM   3742 O O     . GLY F 3 81  ? 1.341   97.121  40.894 1.00 49.38  ? 433 GLY B O     1 
ATOM   3743 N N     . ASN F 3 82  ? 0.240   98.436  39.441 1.00 45.41  ? 434 ASN B N     1 
ATOM   3744 C CA    . ASN F 3 82  ? -0.886  98.667  40.347 1.00 39.23  ? 434 ASN B CA    1 
ATOM   3745 C C     . ASN F 3 82  ? -1.729  97.424  40.346 1.00 30.58  ? 434 ASN B C     1 
ATOM   3746 O O     . ASN F 3 82  ? -1.930  96.818  39.293 1.00 22.53  ? 434 ASN B O     1 
ATOM   3747 C CB    . ASN F 3 82  ? -1.801  99.803  39.857 1.00 47.96  ? 434 ASN B CB    1 
ATOM   3748 C CG    . ASN F 3 82  ? -1.088  101.137 39.706 1.00 49.33  ? 434 ASN B CG    1 
ATOM   3749 O OD1   . ASN F 3 82  ? -0.372  101.586 40.606 1.00 48.67  ? 434 ASN B OD1   1 
ATOM   3750 N ND2   . ASN F 3 82  ? -1.324  101.799 38.576 1.00 46.64  ? 434 ASN B ND2   1 
ATOM   3751 N N     . LEU F 3 83  ? -2.217  97.049  41.523 1.00 28.69  ? 435 LEU B N     1 
ATOM   3752 C CA    . LEU F 3 83  ? -3.093  95.901  41.646 1.00 26.56  ? 435 LEU B CA    1 
ATOM   3753 C C     . LEU F 3 83  ? -4.421  96.361  41.076 1.00 27.75  ? 435 LEU B C     1 
ATOM   3754 O O     . LEU F 3 83  ? -4.685  97.568  40.984 1.00 29.10  ? 435 LEU B O     1 
ATOM   3755 C CB    . LEU F 3 83  ? -3.264  95.506  43.104 1.00 18.24  ? 435 LEU B CB    1 
ATOM   3756 C CG    . LEU F 3 83  ? -1.997  94.972  43.757 1.00 18.20  ? 435 LEU B CG    1 
ATOM   3757 C CD1   . LEU F 3 83  ? -2.221  94.808  45.242 1.00 23.93  ? 435 LEU B CD1   1 
ATOM   3758 C CD2   . LEU F 3 83  ? -1.628  93.667  43.139 1.00 9.70   ? 435 LEU B CD2   1 
ATOM   3759 N N     . ILE F 3 84  ? -5.250  95.412  40.674 1.00 25.43  ? 436 ILE B N     1 
ATOM   3760 C CA    . ILE F 3 84  ? -6.528  95.758  40.109 1.00 22.40  ? 436 ILE B CA    1 
ATOM   3761 C C     . ILE F 3 84  ? -7.679  95.500  41.083 1.00 20.70  ? 436 ILE B C     1 
ATOM   3762 O O     . ILE F 3 84  ? -7.928  94.375  41.494 1.00 20.65  ? 436 ILE B O     1 
ATOM   3763 C CB    . ILE F 3 84  ? -6.693  95.062  38.736 1.00 23.07  ? 436 ILE B CB    1 
ATOM   3764 C CG1   . ILE F 3 84  ? -5.636  95.646  37.769 1.00 24.17  ? 436 ILE B CG1   1 
ATOM   3765 C CG2   . ILE F 3 84  ? -8.127  95.220  38.210 1.00 20.05  ? 436 ILE B CG2   1 
ATOM   3766 C CD1   . ILE F 3 84  ? -5.535  94.979  36.406 1.00 29.92  ? 436 ILE B CD1   1 
ATOM   3767 N N     . LYS F 3 85  ? -8.348  96.577  41.473 1.00 22.10  ? 437 LYS B N     1 
ATOM   3768 C CA    . LYS F 3 85  ? -9.470  96.518  42.402 1.00 26.54  ? 437 LYS B CA    1 
ATOM   3769 C C     . LYS F 3 85  ? -10.760 96.086  41.680 1.00 27.91  ? 437 LYS B C     1 
ATOM   3770 O O     . LYS F 3 85  ? -11.074 96.571  40.585 1.00 29.40  ? 437 LYS B O     1 
ATOM   3771 C CB    . LYS F 3 85  ? -9.645  97.871  43.102 1.00 22.32  ? 437 LYS B CB    1 
ATOM   3772 C CG    . LYS F 3 85  ? -8.325  98.498  43.553 1.00 32.11  ? 437 LYS B CG    1 
ATOM   3773 C CD    . LYS F 3 85  ? -8.483  99.416  44.756 1.00 40.98  ? 437 LYS B CD    1 
ATOM   3774 C CE    . LYS F 3 85  ? -9.660  100.365 44.605 1.00 51.27  ? 437 LYS B CE    1 
ATOM   3775 N NZ    . LYS F 3 85  ? -9.923  101.204 45.834 1.00 61.16  ? 437 LYS B NZ    1 
ATOM   3776 N N     . THR F 3 86  ? -11.504 95.174  42.298 1.00 25.93  ? 438 THR B N     1 
ATOM   3777 C CA    . THR F 3 86  ? -12.729 94.660  41.709 1.00 23.79  ? 438 THR B CA    1 
ATOM   3778 C C     . THR F 3 86  ? -13.710 94.206  42.796 1.00 22.31  ? 438 THR B C     1 
ATOM   3779 O O     . THR F 3 86  ? -13.302 93.880  43.903 1.00 28.41  ? 438 THR B O     1 
ATOM   3780 C CB    . THR F 3 86  ? -12.387 93.497  40.726 1.00 18.57  ? 438 THR B CB    1 
ATOM   3781 O OG1   . THR F 3 86  ? -13.570 93.010  40.080 1.00 25.76  ? 438 THR B OG1   1 
ATOM   3782 C CG2   . THR F 3 86  ? -11.698 92.353  41.449 1.00 22.45  ? 438 THR B CG2   1 
ATOM   3783 N N     . LYS F 3 87  ? -15.003 94.300  42.505 1.00 22.52  ? 439 LYS B N     1 
ATOM   3784 C CA    . LYS F 3 87  ? -16.055 93.875  43.419 1.00 18.32  ? 439 LYS B CA    1 
ATOM   3785 C C     . LYS F 3 87  ? -16.433 92.459  43.048 1.00 19.03  ? 439 LYS B C     1 
ATOM   3786 O O     . LYS F 3 87  ? -17.301 91.845  43.658 1.00 24.34  ? 439 LYS B O     1 
ATOM   3787 C CB    . LYS F 3 87  ? -17.281 94.769  43.281 1.00 16.04  ? 439 LYS B CB    1 
ATOM   3788 C CG    . LYS F 3 87  ? -17.146 96.093  43.979 1.00 16.71  ? 439 LYS B CG    1 
ATOM   3789 C CD    . LYS F 3 87  ? -18.448 96.853  43.964 1.00 19.36  ? 439 LYS B CD    1 
ATOM   3790 C CE    . LYS F 3 87  ? -18.357 98.114  44.823 1.00 19.67  ? 439 LYS B CE    1 
ATOM   3791 N NZ    . LYS F 3 87  ? -18.321 97.847  46.285 1.00 24.95  ? 439 LYS B NZ    1 
ATOM   3792 N N     . VAL F 3 88  ? -15.798 91.966  41.999 1.00 18.73  ? 440 VAL B N     1 
ATOM   3793 C CA    . VAL F 3 88  ? -16.033 90.628  41.502 1.00 25.48  ? 440 VAL B CA    1 
ATOM   3794 C C     . VAL F 3 88  ? -15.204 89.612  42.300 1.00 28.61  ? 440 VAL B C     1 
ATOM   3795 O O     . VAL F 3 88  ? -13.988 89.513  42.115 1.00 31.17  ? 440 VAL B O     1 
ATOM   3796 C CB    . VAL F 3 88  ? -15.629 90.532  40.008 1.00 26.90  ? 440 VAL B CB    1 
ATOM   3797 C CG1   . VAL F 3 88  ? -16.050 89.186  39.438 1.00 29.59  ? 440 VAL B CG1   1 
ATOM   3798 C CG2   . VAL F 3 88  ? -16.227 91.700  39.208 1.00 22.70  ? 440 VAL B CG2   1 
ATOM   3799 N N     . LEU F 3 89  ? -15.861 88.888  43.205 1.00 32.61  ? 441 LEU B N     1 
ATOM   3800 C CA    . LEU F 3 89  ? -15.197 87.871  44.029 1.00 24.72  ? 441 LEU B CA    1 
ATOM   3801 C C     . LEU F 3 89  ? -14.870 86.670  43.191 1.00 20.01  ? 441 LEU B C     1 
ATOM   3802 O O     . LEU F 3 89  ? -15.746 86.116  42.528 1.00 26.53  ? 441 LEU B O     1 
ATOM   3803 C CB    . LEU F 3 89  ? -16.095 87.413  45.181 1.00 22.56  ? 441 LEU B CB    1 
ATOM   3804 C CG    . LEU F 3 89  ? -16.457 88.438  46.250 1.00 24.05  ? 441 LEU B CG    1 
ATOM   3805 C CD1   . LEU F 3 89  ? -17.439 87.819  47.241 1.00 20.55  ? 441 LEU B CD1   1 
ATOM   3806 C CD2   . LEU F 3 89  ? -15.199 88.890  46.944 1.00 16.40  ? 441 LEU B CD2   1 
ATOM   3807 N N     . PRO F 3 90  ? -13.600 86.246  43.210 1.00 19.86  ? 442 PRO B N     1 
ATOM   3808 C CA    . PRO F 3 90  ? -13.228 85.075  42.416 1.00 20.68  ? 442 PRO B CA    1 
ATOM   3809 C C     . PRO F 3 90  ? -13.698 83.774  43.061 1.00 26.37  ? 442 PRO B C     1 
ATOM   3810 O O     . PRO F 3 90  ? -14.331 83.774  44.127 1.00 24.73  ? 442 PRO B O     1 
ATOM   3811 C CB    . PRO F 3 90  ? -11.703 85.150  42.405 1.00 14.86  ? 442 PRO B CB    1 
ATOM   3812 C CG    . PRO F 3 90  ? -11.395 85.756  43.729 1.00 15.63  ? 442 PRO B CG    1 
ATOM   3813 C CD    . PRO F 3 90  ? -12.410 86.862  43.820 1.00 16.76  ? 442 PRO B CD    1 
ATOM   3814 N N     . PRO F 3 91  ? -13.498 82.653  42.356 1.00 30.27  ? 443 PRO B N     1 
ATOM   3815 C CA    . PRO F 3 91  ? -13.960 81.449  43.048 1.00 28.29  ? 443 PRO B CA    1 
ATOM   3816 C C     . PRO F 3 91  ? -13.050 81.152  44.258 1.00 28.08  ? 443 PRO B C     1 
ATOM   3817 O O     . PRO F 3 91  ? -11.886 81.577  44.318 1.00 23.00  ? 443 PRO B O     1 
ATOM   3818 C CB    . PRO F 3 91  ? -13.849 80.369  41.966 1.00 28.83  ? 443 PRO B CB    1 
ATOM   3819 C CG    . PRO F 3 91  ? -12.815 80.920  41.005 1.00 27.81  ? 443 PRO B CG    1 
ATOM   3820 C CD    . PRO F 3 91  ? -13.197 82.363  40.942 1.00 23.00  ? 443 PRO B CD    1 
ATOM   3821 N N     . SER F 3 92  ? -13.607 80.474  45.251 1.00 29.84  ? 444 SER B N     1 
ATOM   3822 C CA    . SER F 3 92  ? -12.837 80.115  46.425 1.00 28.63  ? 444 SER B CA    1 
ATOM   3823 C C     . SER F 3 92  ? -12.064 78.836  46.097 1.00 27.64  ? 444 SER B C     1 
ATOM   3824 O O     . SER F 3 92  ? -11.764 78.561  44.935 1.00 30.48  ? 444 SER B O     1 
ATOM   3825 C CB    . SER F 3 92  ? -13.744 79.957  47.656 1.00 21.80  ? 444 SER B CB    1 
ATOM   3826 O OG    . SER F 3 92  ? -14.884 79.159  47.381 1.00 25.21  ? 444 SER B OG    1 
ATOM   3827 N N     . ILE F 3 93  ? -11.798 78.025  47.104 1.00 25.66  ? 445 ILE B N     1 
ATOM   3828 C CA    . ILE F 3 93  ? -11.028 76.812  46.907 1.00 24.01  ? 445 ILE B CA    1 
ATOM   3829 C C     . ILE F 3 93  ? -11.881 75.602  46.506 1.00 26.26  ? 445 ILE B C     1 
ATOM   3830 O O     . ILE F 3 93  ? -11.468 74.770  45.699 1.00 28.03  ? 445 ILE B O     1 
ATOM   3831 C CB    . ILE F 3 93  ? -10.204 76.572  48.175 1.00 22.79  ? 445 ILE B CB    1 
ATOM   3832 C CG1   . ILE F 3 93  ? -9.419  77.858  48.470 1.00 16.89  ? 445 ILE B CG1   1 
ATOM   3833 C CG2   . ILE F 3 93  ? -9.292  75.368  48.019 1.00 23.74  ? 445 ILE B CG2   1 
ATOM   3834 C CD1   . ILE F 3 93  ? -8.571  77.805  49.677 1.00 20.62  ? 445 ILE B CD1   1 
ATOM   3835 N N     . LYS F 3 94  ? -13.093 75.543  47.043 1.00 24.02  ? 446 LYS B N     1 
ATOM   3836 C CA    . LYS F 3 94  ? -14.006 74.460  46.760 1.00 20.30  ? 446 LYS B CA    1 
ATOM   3837 C C     . LYS F 3 94  ? -15.281 75.053  46.201 1.00 21.25  ? 446 LYS B C     1 
ATOM   3838 O O     . LYS F 3 94  ? -15.637 76.178  46.545 1.00 23.18  ? 446 LYS B O     1 
ATOM   3839 C CB    . LYS F 3 94  ? -14.312 73.679  48.037 1.00 20.77  ? 446 LYS B CB    1 
ATOM   3840 C CG    . LYS F 3 94  ? -13.121 73.002  48.658 1.00 18.38  ? 446 LYS B CG    1 
ATOM   3841 C CD    . LYS F 3 94  ? -13.570 72.140  49.803 1.00 17.44  ? 446 LYS B CD    1 
ATOM   3842 C CE    . LYS F 3 94  ? -12.379 71.462  50.444 1.00 25.09  ? 446 LYS B CE    1 
ATOM   3843 N NZ    . LYS F 3 94  ? -11.515 70.812  49.406 1.00 25.93  ? 446 LYS B NZ    1 
ATOM   3844 N N     . ARG F 3 95  ? -15.964 74.288  45.345 1.00 25.69  ? 447 ARG B N     1 
ATOM   3845 C CA    . ARG F 3 95  ? -17.211 74.708  44.700 1.00 22.97  ? 447 ARG B CA    1 
ATOM   3846 C C     . ARG F 3 95  ? -18.306 73.714  45.039 1.00 24.40  ? 447 ARG B C     1 
ATOM   3847 O O     . ARG F 3 95  ? -18.071 72.511  45.066 1.00 28.52  ? 447 ARG B O     1 
ATOM   3848 C CB    . ARG F 3 95  ? -17.035 74.782  43.171 1.00 25.36  ? 447 ARG B CB    1 
ATOM   3849 C CG    . ARG F 3 95  ? -18.242 75.371  42.389 1.00 27.63  ? 447 ARG B CG    1 
ATOM   3850 C CD    . ARG F 3 95  ? -17.899 75.589  40.908 1.00 37.82  ? 447 ARG B CD    1 
ATOM   3851 N NE    . ARG F 3 95  ? -18.576 76.738  40.297 1.00 44.69  ? 447 ARG B NE    1 
ATOM   3852 C CZ    . ARG F 3 95  ? -19.817 76.718  39.812 1.00 48.09  ? 447 ARG B CZ    1 
ATOM   3853 N NH1   . ARG F 3 95  ? -20.542 75.605  39.868 1.00 52.32  ? 447 ARG B NH1   1 
ATOM   3854 N NH2   . ARG F 3 95  ? -20.322 77.801  39.238 1.00 44.42  ? 447 ARG B NH2   1 
ATOM   3855 N N     . LYS F 3 96  ? -19.509 74.214  45.270 1.00 28.42  ? 448 LYS B N     1 
ATOM   3856 C CA    . LYS F 3 96  ? -20.633 73.354  45.613 1.00 31.95  ? 448 LYS B CA    1 
ATOM   3857 C C     . LYS F 3 96  ? -21.264 72.716  44.369 1.00 28.55  ? 448 LYS B C     1 
ATOM   3858 O O     . LYS F 3 96  ? -21.041 73.163  43.235 1.00 26.69  ? 448 LYS B O     1 
ATOM   3859 C CB    . LYS F 3 96  ? -21.683 74.136  46.432 1.00 36.35  ? 448 LYS B CB    1 
ATOM   3860 C CG    . LYS F 3 96  ? -21.382 74.187  47.928 1.00 42.72  ? 448 LYS B CG    1 
ATOM   3861 C CD    . LYS F 3 96  ? -22.419 74.992  48.718 1.00 49.89  ? 448 LYS B CD    1 
ATOM   3862 C CE    . LYS F 3 96  ? -22.356 76.489  48.410 1.00 52.02  ? 448 LYS B CE    1 
ATOM   3863 N NZ    . LYS F 3 96  ? -23.327 77.266  49.238 1.00 48.65  ? 448 LYS B NZ    1 
ATOM   3864 N N     . PHE F 3 97  ? -22.069 71.685  44.601 1.00 30.10  ? 449 PHE B N     1 
ATOM   3865 C CA    . PHE F 3 97  ? -22.751 70.955  43.544 1.00 31.31  ? 449 PHE B CA    1 
ATOM   3866 C C     . PHE F 3 97  ? -24.214 71.409  43.428 1.00 32.53  ? 449 PHE B C     1 
ATOM   3867 O O     . PHE F 3 97  ? -24.954 71.435  44.416 1.00 32.12  ? 449 PHE B O     1 
ATOM   3868 C CB    . PHE F 3 97  ? -22.690 69.442  43.820 1.00 26.51  ? 449 PHE B CB    1 
ATOM   3869 C CG    . PHE F 3 97  ? -21.388 68.796  43.428 1.00 20.21  ? 449 PHE B CG    1 
ATOM   3870 C CD1   . PHE F 3 97  ? -21.185 68.340  42.128 1.00 20.41  ? 449 PHE B CD1   1 
ATOM   3871 C CD2   . PHE F 3 97  ? -20.376 68.623  44.352 1.00 16.47  ? 449 PHE B CD2   1 
ATOM   3872 C CE1   . PHE F 3 97  ? -19.989 67.722  41.759 1.00 19.53  ? 449 PHE B CE1   1 
ATOM   3873 C CE2   . PHE F 3 97  ? -19.174 68.006  43.992 1.00 19.74  ? 449 PHE B CE2   1 
ATOM   3874 C CZ    . PHE F 3 97  ? -18.979 67.554  42.691 1.00 20.08  ? 449 PHE B CZ    1 
ATOM   3875 N N     . SER F 3 98  ? -24.602 71.823  42.227 1.00 30.45  ? 450 SER B N     1 
ATOM   3876 C CA    . SER F 3 98  ? -25.968 72.251  41.965 1.00 30.32  ? 450 SER B CA    1 
ATOM   3877 C C     . SER F 3 98  ? -26.715 71.017  41.514 1.00 30.72  ? 450 SER B C     1 
ATOM   3878 O O     . SER F 3 98  ? -26.094 70.016  41.159 1.00 30.00  ? 450 SER B O     1 
ATOM   3879 C CB    . SER F 3 98  ? -26.002 73.296  40.848 1.00 29.36  ? 450 SER B CB    1 
ATOM   3880 O OG    . SER F 3 98  ? -25.394 72.792  39.671 1.00 31.63  ? 450 SER B OG    1 
ATOM   3881 N N     . ALA F 3 99  ? -28.041 71.100  41.492 1.00 33.69  ? 451 ALA B N     1 
ATOM   3882 C CA    . ALA F 3 99  ? -28.884 69.985  41.066 1.00 31.35  ? 451 ALA B CA    1 
ATOM   3883 C C     . ALA F 3 99  ? -28.618 69.662  39.596 1.00 30.30  ? 451 ALA B C     1 
ATOM   3884 O O     . ALA F 3 99  ? -28.623 68.511  39.187 1.00 31.00  ? 451 ALA B O     1 
ATOM   3885 C CB    . ALA F 3 99  ? -30.336 70.335  41.271 1.00 33.18  ? 451 ALA B CB    1 
ATOM   3886 N N     . ASP F 3 100 ? -28.384 70.692  38.798 1.00 32.07  ? 452 ASP B N     1 
ATOM   3887 C CA    . ASP F 3 100 ? -28.088 70.493  37.391 1.00 35.43  ? 452 ASP B CA    1 
ATOM   3888 C C     . ASP F 3 100 ? -26.837 69.643  37.229 1.00 35.50  ? 452 ASP B C     1 
ATOM   3889 O O     . ASP F 3 100 ? -26.763 68.810  36.326 1.00 41.85  ? 452 ASP B O     1 
ATOM   3890 C CB    . ASP F 3 100 ? -27.898 71.835  36.690 1.00 39.19  ? 452 ASP B CB    1 
ATOM   3891 C CG    . ASP F 3 100 ? -29.189 72.615  36.568 1.00 40.54  ? 452 ASP B CG    1 
ATOM   3892 O OD1   . ASP F 3 100 ? -30.226 72.140  37.080 1.00 41.54  ? 452 ASP B OD1   1 
ATOM   3893 O OD2   . ASP F 3 100 ? -29.163 73.702  35.955 1.00 43.13  ? 452 ASP B OD2   1 
ATOM   3894 N N     . GLU F 3 101 ? -25.851 69.859  38.094 1.00 33.87  ? 453 GLU B N     1 
ATOM   3895 C CA    . GLU F 3 101 ? -24.612 69.090  38.049 1.00 30.13  ? 453 GLU B CA    1 
ATOM   3896 C C     . GLU F 3 101 ? -24.853 67.641  38.455 1.00 27.30  ? 453 GLU B C     1 
ATOM   3897 O O     . GLU F 3 101 ? -24.377 66.723  37.794 1.00 27.40  ? 453 GLU B O     1 
ATOM   3898 C CB    . GLU F 3 101 ? -23.553 69.738  38.941 1.00 33.23  ? 453 GLU B CB    1 
ATOM   3899 C CG    . GLU F 3 101 ? -23.175 71.124  38.453 1.00 35.22  ? 453 GLU B CG    1 
ATOM   3900 C CD    . GLU F 3 101 ? -22.149 71.797  39.309 1.00 30.65  ? 453 GLU B CD    1 
ATOM   3901 O OE1   . GLU F 3 101 ? -22.231 71.684  40.541 1.00 31.86  ? 453 GLU B OE1   1 
ATOM   3902 O OE2   . GLU F 3 101 ? -21.254 72.446  38.740 1.00 39.45  ? 453 GLU B OE2   1 
ATOM   3903 N N     . ASP F 3 102 ? -25.598 67.431  39.533 1.00 25.00  ? 454 ASP B N     1 
ATOM   3904 C CA    . ASP F 3 102 ? -25.895 66.082  39.971 1.00 27.01  ? 454 ASP B CA    1 
ATOM   3905 C C     . ASP F 3 102 ? -26.749 65.349  38.939 1.00 29.70  ? 454 ASP B C     1 
ATOM   3906 O O     . ASP F 3 102 ? -26.530 64.171  38.679 1.00 34.97  ? 454 ASP B O     1 
ATOM   3907 C CB    . ASP F 3 102 ? -26.581 66.097  41.329 1.00 31.32  ? 454 ASP B CB    1 
ATOM   3908 C CG    . ASP F 3 102 ? -25.615 66.351  42.464 1.00 37.12  ? 454 ASP B CG    1 
ATOM   3909 O OD1   . ASP F 3 102 ? -24.394 66.230  42.246 1.00 43.52  ? 454 ASP B OD1   1 
ATOM   3910 O OD2   . ASP F 3 102 ? -26.077 66.655  43.581 1.00 40.25  ? 454 ASP B OD2   1 
ATOM   3911 N N     . TYR F 3 103 ? -27.721 66.042  38.356 1.00 29.24  ? 455 TYR B N     1 
ATOM   3912 C CA    . TYR F 3 103 ? -28.569 65.460  37.326 1.00 30.29  ? 455 TYR B CA    1 
ATOM   3913 C C     . TYR F 3 103 ? -27.734 65.097  36.092 1.00 31.62  ? 455 TYR B C     1 
ATOM   3914 O O     . TYR F 3 103 ? -27.845 63.982  35.598 1.00 36.84  ? 455 TYR B O     1 
ATOM   3915 C CB    . TYR F 3 103 ? -29.682 66.429  36.939 1.00 32.97  ? 455 TYR B CB    1 
ATOM   3916 C CG    . TYR F 3 103 ? -30.690 65.860  35.961 1.00 39.67  ? 455 TYR B CG    1 
ATOM   3917 C CD1   . TYR F 3 103 ? -31.422 64.702  36.258 1.00 39.68  ? 455 TYR B CD1   1 
ATOM   3918 C CD2   . TYR F 3 103 ? -30.909 66.478  34.725 1.00 44.66  ? 455 TYR B CD2   1 
ATOM   3919 C CE1   . TYR F 3 103 ? -32.349 64.174  35.343 1.00 39.33  ? 455 TYR B CE1   1 
ATOM   3920 C CE2   . TYR F 3 103 ? -31.830 65.959  33.805 1.00 43.52  ? 455 TYR B CE2   1 
ATOM   3921 C CZ    . TYR F 3 103 ? -32.541 64.811  34.118 1.00 43.82  ? 455 TYR B CZ    1 
ATOM   3922 O OH    . TYR F 3 103 ? -33.423 64.308  33.189 1.00 45.54  ? 455 TYR B OH    1 
ATOM   3923 N N     . THR F 3 104 ? -26.905 66.019  35.594 1.00 30.28  ? 456 THR B N     1 
ATOM   3924 C CA    . THR F 3 104 ? -26.045 65.740  34.428 1.00 28.04  ? 456 THR B CA    1 
ATOM   3925 C C     . THR F 3 104 ? -25.229 64.477  34.671 1.00 26.52  ? 456 THR B C     1 
ATOM   3926 O O     . THR F 3 104 ? -25.036 63.679  33.759 1.00 29.07  ? 456 THR B O     1 
ATOM   3927 C CB    . THR F 3 104 ? -25.056 66.900  34.129 1.00 24.40  ? 456 THR B CB    1 
ATOM   3928 O OG1   . THR F 3 104 ? -25.783 68.073  33.755 1.00 27.98  ? 456 THR B OG1   1 
ATOM   3929 C CG2   . THR F 3 104 ? -24.094 66.529  33.011 1.00 22.32  ? 456 THR B CG2   1 
ATOM   3930 N N     . LEU F 3 105 ? -24.747 64.311  35.902 1.00 26.58  ? 457 LEU B N     1 
ATOM   3931 C CA    . LEU F 3 105 ? -23.962 63.138  36.280 1.00 26.86  ? 457 LEU B CA    1 
ATOM   3932 C C     . LEU F 3 105 ? -24.853 61.902  36.330 1.00 28.09  ? 457 LEU B C     1 
ATOM   3933 O O     . LEU F 3 105 ? -24.459 60.826  35.890 1.00 34.06  ? 457 LEU B O     1 
ATOM   3934 C CB    . LEU F 3 105 ? -23.285 63.362  37.637 1.00 22.36  ? 457 LEU B CB    1 
ATOM   3935 C CG    . LEU F 3 105 ? -22.386 62.273  38.241 1.00 20.95  ? 457 LEU B CG    1 
ATOM   3936 C CD1   . LEU F 3 105 ? -21.147 62.084  37.398 1.00 15.99  ? 457 LEU B CD1   1 
ATOM   3937 C CD2   . LEU F 3 105 ? -21.996 62.646  39.668 1.00 23.37  ? 457 LEU B CD2   1 
ATOM   3938 N N     . ALA F 3 106 ? -26.054 62.055  36.867 1.00 30.35  ? 458 ALA B N     1 
ATOM   3939 C CA    . ALA F 3 106 ? -26.994 60.947  36.959 1.00 29.86  ? 458 ALA B CA    1 
ATOM   3940 C C     . ALA F 3 106 ? -27.348 60.439  35.557 1.00 28.80  ? 458 ALA B C     1 
ATOM   3941 O O     . ALA F 3 106 ? -27.217 59.243  35.266 1.00 26.63  ? 458 ALA B O     1 
ATOM   3942 C CB    . ALA F 3 106 ? -28.240 61.388  37.704 1.00 32.07  ? 458 ALA B CB    1 
ATOM   3943 N N     . ILE F 3 107 ? -27.784 61.348  34.689 1.00 28.65  ? 459 ILE B N     1 
ATOM   3944 C CA    . ILE F 3 107 ? -28.121 60.996  33.315 1.00 29.33  ? 459 ILE B CA    1 
ATOM   3945 C C     . ILE F 3 107 ? -26.910 60.386  32.616 1.00 30.28  ? 459 ILE B C     1 
ATOM   3946 O O     . ILE F 3 107 ? -27.000 59.289  32.082 1.00 35.38  ? 459 ILE B O     1 
ATOM   3947 C CB    . ILE F 3 107 ? -28.619 62.219  32.502 1.00 29.64  ? 459 ILE B CB    1 
ATOM   3948 C CG1   . ILE F 3 107 ? -30.036 62.595  32.931 1.00 29.52  ? 459 ILE B CG1   1 
ATOM   3949 C CG2   . ILE F 3 107 ? -28.628 61.903  31.002 1.00 28.97  ? 459 ILE B CG2   1 
ATOM   3950 C CD1   . ILE F 3 107 ? -31.084 61.517  32.654 1.00 31.92  ? 459 ILE B CD1   1 
ATOM   3951 N N     . ALA F 3 108 ? -25.772 61.071  32.666 1.00 32.88  ? 460 ALA B N     1 
ATOM   3952 C CA    . ALA F 3 108 ? -24.542 60.595  32.026 1.00 29.64  ? 460 ALA B CA    1 
ATOM   3953 C C     . ALA F 3 108 ? -24.095 59.206  32.452 1.00 29.47  ? 460 ALA B C     1 
ATOM   3954 O O     . ALA F 3 108 ? -23.562 58.450  31.633 1.00 32.16  ? 460 ALA B O     1 
ATOM   3955 C CB    . ALA F 3 108 ? -23.415 61.587  32.236 1.00 32.32  ? 460 ALA B CB    1 
ATOM   3956 N N     . VAL F 3 109 ? -24.228 58.890  33.735 1.00 25.87  ? 461 VAL B N     1 
ATOM   3957 C CA    . VAL F 3 109 ? -23.858 57.567  34.231 1.00 26.06  ? 461 VAL B CA    1 
ATOM   3958 C C     . VAL F 3 109 ? -24.884 56.532  33.714 1.00 29.90  ? 461 VAL B C     1 
ATOM   3959 O O     . VAL F 3 109 ? -24.537 55.393  33.383 1.00 30.25  ? 461 VAL B O     1 
ATOM   3960 C CB    . VAL F 3 109 ? -23.810 57.537  35.779 1.00 22.80  ? 461 VAL B CB    1 
ATOM   3961 C CG1   . VAL F 3 109 ? -23.511 56.146  36.265 1.00 23.43  ? 461 VAL B CG1   1 
ATOM   3962 C CG2   . VAL F 3 109 ? -22.756 58.484  36.290 1.00 18.49  ? 461 VAL B CG2   1 
ATOM   3963 N N     . LYS F 3 110 ? -26.143 56.941  33.611 1.00 30.49  ? 462 LYS B N     1 
ATOM   3964 C CA    . LYS F 3 110 ? -27.178 56.040  33.117 1.00 31.69  ? 462 LYS B CA    1 
ATOM   3965 C C     . LYS F 3 110 ? -26.972 55.745  31.644 1.00 29.51  ? 462 LYS B C     1 
ATOM   3966 O O     . LYS F 3 110 ? -27.138 54.606  31.228 1.00 31.47  ? 462 LYS B O     1 
ATOM   3967 C CB    . LYS F 3 110 ? -28.576 56.615  33.340 1.00 30.84  ? 462 LYS B CB    1 
ATOM   3968 C CG    . LYS F 3 110 ? -29.689 55.641  33.033 1.00 27.37  ? 462 LYS B CG    1 
ATOM   3969 C CD    . LYS F 3 110 ? -31.015 56.328  33.204 1.00 34.05  ? 462 LYS B CD    1 
ATOM   3970 C CE    . LYS F 3 110 ? -32.181 55.413  32.919 1.00 34.48  ? 462 LYS B CE    1 
ATOM   3971 N NZ    . LYS F 3 110 ? -33.444 56.191  33.076 1.00 33.37  ? 462 LYS B NZ    1 
ATOM   3972 N N     . LYS F 3 111 ? -26.642 56.762  30.847 1.00 25.56  ? 463 LYS B N     1 
ATOM   3973 C CA    . LYS F 3 111 ? -26.404 56.539  29.424 1.00 26.30  ? 463 LYS B CA    1 
ATOM   3974 C C     . LYS F 3 111 ? -25.241 55.554  29.260 1.00 28.95  ? 463 LYS B C     1 
ATOM   3975 O O     . LYS F 3 111 ? -25.255 54.708  28.364 1.00 31.53  ? 463 LYS B O     1 
ATOM   3976 C CB    . LYS F 3 111 ? -26.141 57.852  28.667 1.00 24.92  ? 463 LYS B CB    1 
ATOM   3977 C CG    . LYS F 3 111 ? -27.323 58.832  28.656 1.00 26.58  ? 463 LYS B CG    1 
ATOM   3978 C CD    . LYS F 3 111 ? -27.229 59.857  27.523 1.00 32.51  ? 463 LYS B CD    1 
ATOM   3979 C CE    . LYS F 3 111 ? -25.922 60.646  27.540 1.00 39.13  ? 463 LYS B CE    1 
ATOM   3980 N NZ    . LYS F 3 111 ? -25.854 61.694  26.467 1.00 39.15  ? 463 LYS B NZ    1 
ATOM   3981 N N     . GLN F 3 112 ? -24.269 55.623  30.165 1.00 29.32  ? 464 GLN B N     1 
ATOM   3982 C CA    . GLN F 3 112 ? -23.126 54.715  30.132 1.00 31.32  ? 464 GLN B CA    1 
ATOM   3983 C C     . GLN F 3 112 ? -23.578 53.277  30.432 1.00 34.38  ? 464 GLN B C     1 
ATOM   3984 O O     . GLN F 3 112 ? -23.258 52.356  29.675 1.00 38.88  ? 464 GLN B O     1 
ATOM   3985 C CB    . GLN F 3 112 ? -22.042 55.168  31.123 1.00 29.48  ? 464 GLN B CB    1 
ATOM   3986 C CG    . GLN F 3 112 ? -20.809 54.251  31.224 1.00 33.31  ? 464 GLN B CG    1 
ATOM   3987 C CD    . GLN F 3 112 ? -19.978 54.196  29.949 1.00 41.39  ? 464 GLN B CD    1 
ATOM   3988 O OE1   . GLN F 3 112 ? -19.802 55.202  29.261 1.00 50.03  ? 464 GLN B OE1   1 
ATOM   3989 N NE2   . GLN F 3 112 ? -19.444 53.022  29.639 1.00 42.22  ? 464 GLN B NE2   1 
ATOM   3990 N N     . PHE F 3 113 ? -24.330 53.089  31.519 1.00 33.90  ? 465 PHE B N     1 
ATOM   3991 C CA    . PHE F 3 113 ? -24.831 51.766  31.908 1.00 30.38  ? 465 PHE B CA    1 
ATOM   3992 C C     . PHE F 3 113 ? -25.732 51.166  30.813 1.00 30.51  ? 465 PHE B C     1 
ATOM   3993 O O     . PHE F 3 113 ? -25.601 49.990  30.447 1.00 26.51  ? 465 PHE B O     1 
ATOM   3994 C CB    . PHE F 3 113 ? -25.592 51.855  33.242 1.00 28.76  ? 465 PHE B CB    1 
ATOM   3995 C CG    . PHE F 3 113 ? -24.702 52.013  34.459 1.00 29.96  ? 465 PHE B CG    1 
ATOM   3996 C CD1   . PHE F 3 113 ? -23.338 51.761  34.394 1.00 28.91  ? 465 PHE B CD1   1 
ATOM   3997 C CD2   . PHE F 3 113 ? -25.243 52.406  35.683 1.00 28.54  ? 465 PHE B CD2   1 
ATOM   3998 C CE1   . PHE F 3 113 ? -22.530 51.888  35.534 1.00 24.96  ? 465 PHE B CE1   1 
ATOM   3999 C CE2   . PHE F 3 113 ? -24.443 52.534  36.825 1.00 21.56  ? 465 PHE B CE2   1 
ATOM   4000 C CZ    . PHE F 3 113 ? -23.087 52.278  36.742 1.00 25.57  ? 465 PHE B CZ    1 
ATOM   4001 N N     . TYR F 3 114 ? -26.643 51.987  30.299 1.00 31.53  ? 466 TYR B N     1 
ATOM   4002 C CA    . TYR F 3 114 ? -27.558 51.600  29.231 1.00 33.98  ? 466 TYR B CA    1 
ATOM   4003 C C     . TYR F 3 114 ? -26.753 51.065  28.042 1.00 36.24  ? 466 TYR B C     1 
ATOM   4004 O O     . TYR F 3 114 ? -27.070 50.010  27.499 1.00 39.76  ? 466 TYR B O     1 
ATOM   4005 C CB    . TYR F 3 114 ? -28.398 52.814  28.805 1.00 34.80  ? 466 TYR B CB    1 
ATOM   4006 C CG    . TYR F 3 114 ? -29.460 52.506  27.780 1.00 40.51  ? 466 TYR B CG    1 
ATOM   4007 C CD1   . TYR F 3 114 ? -30.741 52.126  28.170 1.00 45.79  ? 466 TYR B CD1   1 
ATOM   4008 C CD2   . TYR F 3 114 ? -29.188 52.590  26.414 1.00 46.21  ? 466 TYR B CD2   1 
ATOM   4009 C CE1   . TYR F 3 114 ? -31.735 51.835  27.223 1.00 46.45  ? 466 TYR B CE1   1 
ATOM   4010 C CE2   . TYR F 3 114 ? -30.173 52.300  25.457 1.00 43.07  ? 466 TYR B CE2   1 
ATOM   4011 C CZ    . TYR F 3 114 ? -31.444 51.922  25.869 1.00 44.09  ? 466 TYR B CZ    1 
ATOM   4012 O OH    . TYR F 3 114 ? -32.422 51.630  24.940 1.00 37.82  ? 466 TYR B OH    1 
ATOM   4013 N N     . ARG F 3 115 ? -25.696 51.777  27.663 1.00 36.32  ? 467 ARG B N     1 
ATOM   4014 C CA    . ARG F 3 115 ? -24.842 51.369  26.550 1.00 36.32  ? 467 ARG B CA    1 
ATOM   4015 C C     . ARG F 3 115 ? -24.162 50.017  26.735 1.00 37.93  ? 467 ARG B C     1 
ATOM   4016 O O     . ARG F 3 115 ? -24.189 49.178  25.830 1.00 38.67  ? 467 ARG B O     1 
ATOM   4017 C CB    . ARG F 3 115 ? -23.799 52.446  26.243 1.00 36.67  ? 467 ARG B CB    1 
ATOM   4018 C CG    . ARG F 3 115 ? -24.312 53.496  25.270 1.00 34.76  ? 467 ARG B CG    1 
ATOM   4019 C CD    . ARG F 3 115 ? -23.232 54.463  24.852 1.00 35.27  ? 467 ARG B CD    1 
ATOM   4020 N NE    . ARG F 3 115 ? -23.109 55.546  25.818 1.00 43.38  ? 467 ARG B NE    1 
ATOM   4021 C CZ    . ARG F 3 115 ? -22.081 55.702  26.638 1.00 40.46  ? 467 ARG B CZ    1 
ATOM   4022 N NH1   . ARG F 3 115 ? -21.069 54.843  26.613 1.00 47.90  ? 467 ARG B NH1   1 
ATOM   4023 N NH2   . ARG F 3 115 ? -22.081 56.698  27.504 1.00 42.42  ? 467 ARG B NH2   1 
ATOM   4024 N N     . ASP F 3 116 ? -23.554 49.808  27.897 1.00 38.72  ? 468 ASP B N     1 
ATOM   4025 C CA    . ASP F 3 116 ? -22.874 48.549  28.203 1.00 40.33  ? 468 ASP B CA    1 
ATOM   4026 C C     . ASP F 3 116 ? -23.857 47.383  28.283 1.00 42.88  ? 468 ASP B C     1 
ATOM   4027 O O     . ASP F 3 116 ? -23.503 46.241  27.983 1.00 44.45  ? 468 ASP B O     1 
ATOM   4028 C CB    . ASP F 3 116 ? -22.149 48.642  29.546 1.00 41.26  ? 468 ASP B CB    1 
ATOM   4029 C CG    . ASP F 3 116 ? -21.391 49.934  29.716 1.00 41.12  ? 468 ASP B CG    1 
ATOM   4030 O OD1   . ASP F 3 116 ? -20.943 50.509  28.696 1.00 41.41  ? 468 ASP B OD1   1 
ATOM   4031 O OD2   . ASP F 3 116 ? -21.260 50.372  30.881 1.00 43.16  ? 468 ASP B OD2   1 
ATOM   4032 N N     . LEU F 3 117 ? -25.068 47.668  28.752 1.00 41.51  ? 469 LEU B N     1 
ATOM   4033 C CA    . LEU F 3 117 ? -26.092 46.648  28.894 1.00 44.05  ? 469 LEU B CA    1 
ATOM   4034 C C     . LEU F 3 117 ? -26.822 46.250  27.627 1.00 45.41  ? 469 LEU B C     1 
ATOM   4035 O O     . LEU F 3 117 ? -26.968 45.069  27.313 1.00 48.00  ? 469 LEU B O     1 
ATOM   4036 C CB    . LEU F 3 117 ? -27.136 47.091  29.907 1.00 44.71  ? 469 LEU B CB    1 
ATOM   4037 C CG    . LEU F 3 117 ? -26.741 46.970  31.369 1.00 51.64  ? 469 LEU B CG    1 
ATOM   4038 C CD1   . LEU F 3 117 ? -27.987 47.149  32.221 1.00 48.50  ? 469 LEU B CD1   1 
ATOM   4039 C CD2   . LEU F 3 117 ? -26.119 45.600  31.615 1.00 52.08  ? 469 LEU B CD2   1 
ATOM   4040 N N     . PHE F 3 118 ? -27.319 47.250  26.922 1.00 45.25  ? 470 PHE B N     1 
ATOM   4041 C CA    . PHE F 3 118 ? -28.097 47.018  25.727 1.00 42.20  ? 470 PHE B CA    1 
ATOM   4042 C C     . PHE F 3 118 ? -27.361 47.215  24.404 1.00 39.52  ? 470 PHE B C     1 
ATOM   4043 O O     . PHE F 3 118 ? -27.835 46.778  23.362 1.00 38.54  ? 470 PHE B O     1 
ATOM   4044 C CB    . PHE F 3 118 ? -29.370 47.873  25.815 1.00 41.32  ? 470 PHE B CB    1 
ATOM   4045 C CG    . PHE F 3 118 ? -30.135 47.679  27.111 1.00 42.80  ? 470 PHE B CG    1 
ATOM   4046 C CD1   . PHE F 3 118 ? -30.419 46.396  27.584 1.00 46.13  ? 470 PHE B CD1   1 
ATOM   4047 C CD2   . PHE F 3 118 ? -30.536 48.767  27.873 1.00 43.97  ? 470 PHE B CD2   1 
ATOM   4048 C CE1   . PHE F 3 118 ? -31.087 46.202  28.795 1.00 46.06  ? 470 PHE B CE1   1 
ATOM   4049 C CE2   . PHE F 3 118 ? -31.205 48.584  29.086 1.00 44.91  ? 470 PHE B CE2   1 
ATOM   4050 C CZ    . PHE F 3 118 ? -31.480 47.298  29.546 1.00 45.48  ? 470 PHE B CZ    1 
ATOM   4051 N N     . GLN F 3 119 ? -26.182 47.817  24.451 1.00 39.04  ? 471 GLN B N     1 
ATOM   4052 C CA    . GLN F 3 119 ? -25.408 48.060  23.243 1.00 39.20  ? 471 GLN B CA    1 
ATOM   4053 C C     . GLN F 3 119 ? -26.246 48.823  22.225 1.00 39.11  ? 471 GLN B C     1 
ATOM   4054 O O     . GLN F 3 119 ? -26.073 48.681  21.014 1.00 38.78  ? 471 GLN B O     1 
ATOM   4055 C CB    . GLN F 3 119 ? -24.906 46.739  22.661 1.00 45.32  ? 471 GLN B CB    1 
ATOM   4056 C CG    . GLN F 3 119 ? -23.682 46.179  23.368 1.00 54.16  ? 471 GLN B CG    1 
ATOM   4057 C CD    . GLN F 3 119 ? -22.472 47.105  23.253 1.00 62.33  ? 471 GLN B CD    1 
ATOM   4058 O OE1   . GLN F 3 119 ? -21.933 47.571  24.262 1.00 66.21  ? 471 GLN B OE1   1 
ATOM   4059 N NE2   . GLN F 3 119 ? -22.047 47.381  22.019 1.00 61.80  ? 471 GLN B NE2   1 
ATOM   4060 N N     . ILE F 3 120 ? -27.127 49.672  22.739 1.00 40.17  ? 472 ILE B N     1 
ATOM   4061 C CA    . ILE F 3 120 ? -28.014 50.476  21.915 1.00 40.19  ? 472 ILE B CA    1 
ATOM   4062 C C     . ILE F 3 120 ? -27.835 51.932  22.322 1.00 39.18  ? 472 ILE B C     1 
ATOM   4063 O O     . ILE F 3 120 ? -27.385 52.218  23.433 1.00 38.55  ? 472 ILE B O     1 
ATOM   4064 C CB    . ILE F 3 120 ? -29.482 50.026  22.121 1.00 44.40  ? 472 ILE B CB    1 
ATOM   4065 C CG1   . ILE F 3 120 ? -29.641 48.577  21.652 1.00 44.66  ? 472 ILE B CG1   1 
ATOM   4066 C CG2   . ILE F 3 120 ? -30.443 50.922  21.357 1.00 43.92  ? 472 ILE B CG2   1 
ATOM   4067 C CD1   . ILE F 3 120 ? -30.920 47.921  22.093 1.00 48.44  ? 472 ILE B CD1   1 
ATOM   4068 N N     . ASP F 3 121 ? -28.130 52.837  21.395 1.00 36.16  ? 473 ASP B N     1 
ATOM   4069 C CA    . ASP F 3 121 ? -28.012 54.274  21.613 1.00 33.65  ? 473 ASP B CA    1 
ATOM   4070 C C     . ASP F 3 121 ? -29.214 54.788  22.387 1.00 33.97  ? 473 ASP B C     1 
ATOM   4071 O O     . ASP F 3 121 ? -30.347 54.667  21.909 1.00 31.54  ? 473 ASP B O     1 
ATOM   4072 C CB    . ASP F 3 121 ? -27.899 54.977  20.247 1.00 33.23  ? 473 ASP B CB    1 
ATOM   4073 C CG    . ASP F 3 121 ? -27.946 56.493  20.347 1.00 34.70  ? 473 ASP B CG    1 
ATOM   4074 O OD1   . ASP F 3 121 ? -27.489 57.050  21.365 1.00 35.43  ? 473 ASP B OD1   1 
ATOM   4075 O OD2   . ASP F 3 121 ? -28.430 57.135  19.393 1.00 31.38  ? 473 ASP B OD2   1 
ATOM   4076 N N     . PRO F 3 122 ? -28.978 55.433  23.561 1.00 35.50  ? 474 PRO B N     1 
ATOM   4077 C CA    . PRO F 3 122 ? -30.054 55.978  24.407 1.00 33.36  ? 474 PRO B CA    1 
ATOM   4078 C C     . PRO F 3 122 ? -30.882 57.022  23.674 1.00 35.72  ? 474 PRO B C     1 
ATOM   4079 O O     . PRO F 3 122 ? -32.104 57.049  23.777 1.00 35.64  ? 474 PRO B O     1 
ATOM   4080 C CB    . PRO F 3 122 ? -29.286 56.624  25.564 1.00 28.84  ? 474 PRO B CB    1 
ATOM   4081 C CG    . PRO F 3 122 ? -28.078 55.800  25.670 1.00 29.94  ? 474 PRO B CG    1 
ATOM   4082 C CD    . PRO F 3 122 ? -27.675 55.629  24.223 1.00 30.98  ? 474 PRO B CD    1 
ATOM   4083 N N     . ASP F 3 123 ? -30.197 57.876  22.928 1.00 37.61  ? 475 ASP B N     1 
ATOM   4084 C CA    . ASP F 3 123 ? -30.849 58.940  22.187 1.00 40.21  ? 475 ASP B CA    1 
ATOM   4085 C C     . ASP F 3 123 ? -31.739 58.473  21.038 1.00 42.01  ? 475 ASP B C     1 
ATOM   4086 O O     . ASP F 3 123 ? -32.869 58.950  20.912 1.00 42.97  ? 475 ASP B O     1 
ATOM   4087 C CB    . ASP F 3 123 ? -29.816 59.931  21.620 1.00 44.73  ? 475 ASP B CB    1 
ATOM   4088 C CG    . ASP F 3 123 ? -29.064 60.715  22.702 1.00 48.05  ? 475 ASP B CG    1 
ATOM   4089 O OD1   . ASP F 3 123 ? -29.541 60.801  23.862 1.00 47.66  ? 475 ASP B OD1   1 
ATOM   4090 O OD2   . ASP F 3 123 ? -27.982 61.253  22.371 1.00 42.68  ? 475 ASP B OD2   1 
ATOM   4091 N N     . THR F 3 124 ? -31.245 57.558  20.201 1.00 40.24  ? 476 THR B N     1 
ATOM   4092 C CA    . THR F 3 124 ? -32.026 57.134  19.038 1.00 40.01  ? 476 THR B CA    1 
ATOM   4093 C C     . THR F 3 124 ? -32.434 55.676  18.897 1.00 40.17  ? 476 THR B C     1 
ATOM   4094 O O     . THR F 3 124 ? -33.471 55.378  18.312 1.00 44.18  ? 476 THR B O     1 
ATOM   4095 C CB    . THR F 3 124 ? -31.324 57.534  17.714 1.00 40.71  ? 476 THR B CB    1 
ATOM   4096 O OG1   . THR F 3 124 ? -30.284 56.597  17.419 1.00 43.77  ? 476 THR B OG1   1 
ATOM   4097 C CG2   . THR F 3 124 ? -30.704 58.920  17.829 1.00 38.84  ? 476 THR B CG2   1 
ATOM   4098 N N     . GLY F 3 125 ? -31.615 54.765  19.393 1.00 40.77  ? 477 GLY B N     1 
ATOM   4099 C CA    . GLY F 3 125 ? -31.938 53.361  19.244 1.00 40.05  ? 477 GLY B CA    1 
ATOM   4100 C C     . GLY F 3 125 ? -30.966 52.686  18.297 1.00 41.42  ? 477 GLY B C     1 
ATOM   4101 O O     . GLY F 3 125 ? -30.980 51.465  18.162 1.00 43.01  ? 477 GLY B O     1 
ATOM   4102 N N     . ARG F 3 126 ? -30.127 53.481  17.635 1.00 42.77  ? 478 ARG B N     1 
ATOM   4103 C CA    . ARG F 3 126 ? -29.115 52.965  16.709 1.00 44.00  ? 478 ARG B CA    1 
ATOM   4104 C C     . ARG F 3 126 ? -28.315 51.873  17.420 1.00 43.96  ? 478 ARG B C     1 
ATOM   4105 O O     . ARG F 3 126 ? -28.198 51.887  18.647 1.00 43.84  ? 478 ARG B O     1 
ATOM   4106 C CB    . ARG F 3 126 ? -28.175 54.106  16.264 1.00 44.66  ? 478 ARG B CB    1 
ATOM   4107 C CG    . ARG F 3 126 ? -27.075 53.700  15.282 1.00 46.56  ? 478 ARG B CG    1 
ATOM   4108 C CD    . ARG F 3 126 ? -25.868 54.664  15.284 1.00 51.10  ? 478 ARG B CD    1 
ATOM   4109 N NE    . ARG F 3 126 ? -24.600 53.924  15.283 1.00 53.40  ? 478 ARG B NE    1 
ATOM   4110 C CZ    . ARG F 3 126 ? -23.527 54.248  16.003 1.00 55.99  ? 478 ARG B CZ    1 
ATOM   4111 N NH1   . ARG F 3 126 ? -23.533 55.322  16.781 1.00 52.77  ? 478 ARG B NH1   1 
ATOM   4112 N NH2   . ARG F 3 126 ? -22.473 53.439  16.018 1.00 60.40  ? 478 ARG B NH2   1 
ATOM   4113 N N     . SER F 3 127 ? -27.796 50.914  16.662 1.00 46.05  ? 479 SER B N     1 
ATOM   4114 C CA    . SER F 3 127 ? -27.020 49.840  17.259 1.00 48.21  ? 479 SER B CA    1 
ATOM   4115 C C     . SER F 3 127 ? -25.548 50.181  17.309 1.00 47.71  ? 479 SER B C     1 
ATOM   4116 O O     . SER F 3 127 ? -24.976 50.659  16.328 1.00 46.81  ? 479 SER B O     1 
ATOM   4117 C CB    . SER F 3 127 ? -27.196 48.530  16.498 1.00 53.76  ? 479 SER B CB    1 
ATOM   4118 O OG    . SER F 3 127 ? -26.288 47.549  16.993 1.00 57.42  ? 479 SER B OG    1 
ATOM   4119 N N     . LEU F 3 128 ? -24.929 49.847  18.435 1.00 46.53  ? 480 LEU B N     1 
ATOM   4120 C CA    . LEU F 3 128 ? -23.518 50.110  18.654 1.00 47.68  ? 480 LEU B CA    1 
ATOM   4121 C C     . LEU F 3 128 ? -22.665 48.870  18.339 1.00 50.53  ? 480 LEU B C     1 
ATOM   4122 O O     . LEU F 3 128 ? -21.603 48.666  18.927 1.00 51.39  ? 480 LEU B O     1 
ATOM   4123 C CB    . LEU F 3 128 ? -23.311 50.577  20.106 1.00 42.20  ? 480 LEU B CB    1 
ATOM   4124 C CG    . LEU F 3 128 ? -24.281 51.651  20.632 1.00 36.58  ? 480 LEU B CG    1 
ATOM   4125 C CD1   . LEU F 3 128 ? -23.850 52.100  22.016 1.00 32.11  ? 480 LEU B CD1   1 
ATOM   4126 C CD2   . LEU F 3 128 ? -24.337 52.840  19.689 1.00 28.87  ? 480 LEU B CD2   1 
ATOM   4127 N N     . ILE F 3 129 ? -23.153 48.027  17.432 1.00 55.68  ? 481 ILE B N     1 
ATOM   4128 C CA    . ILE F 3 129 ? -22.440 46.811  17.031 1.00 56.28  ? 481 ILE B CA    1 
ATOM   4129 C C     . ILE F 3 129 ? -21.682 47.063  15.721 1.00 55.79  ? 481 ILE B C     1 
ATOM   4130 O O     . ILE F 3 129 ? -20.527 46.657  15.563 1.00 55.56  ? 481 ILE B O     1 
ATOM   4131 C CB    . ILE F 3 129 ? -23.426 45.612  16.828 1.00 58.07  ? 481 ILE B CB    1 
ATOM   4132 C CG1   . ILE F 3 129 ? -24.395 45.484  18.013 1.00 54.48  ? 481 ILE B CG1   1 
ATOM   4133 C CG2   . ILE F 3 129 ? -22.652 44.309  16.658 1.00 60.00  ? 481 ILE B CG2   1 
ATOM   4134 C CD1   . ILE F 3 129 ? -23.729 45.290  19.354 1.00 54.70  ? 481 ILE B CD1   1 
ATOM   4135 N N     . ARG F 3 161 ? -35.347 53.223  31.255 1.00 58.81  ? 513 ARG B N     1 
ATOM   4136 C CA    . ARG F 3 161 ? -35.132 52.024  32.066 1.00 56.09  ? 513 ARG B CA    1 
ATOM   4137 C C     . ARG F 3 161 ? -34.688 52.371  33.508 1.00 57.53  ? 513 ARG B C     1 
ATOM   4138 O O     . ARG F 3 161 ? -34.749 53.537  33.901 1.00 61.46  ? 513 ARG B O     1 
ATOM   4139 C CB    . ARG F 3 161 ? -34.121 51.111  31.374 1.00 52.87  ? 513 ARG B CB    1 
ATOM   4140 C CG    . ARG F 3 161 ? -32.693 51.590  31.434 1.00 47.46  ? 513 ARG B CG    1 
ATOM   4141 C CD    . ARG F 3 161 ? -31.855 50.590  32.210 1.00 41.66  ? 513 ARG B CD    1 
ATOM   4142 N NE    . ARG F 3 161 ? -30.529 51.110  32.493 1.00 42.18  ? 513 ARG B NE    1 
ATOM   4143 C CZ    . ARG F 3 161 ? -29.577 50.420  33.109 1.00 47.73  ? 513 ARG B CZ    1 
ATOM   4144 N NH1   . ARG F 3 161 ? -29.791 49.172  33.510 1.00 51.20  ? 513 ARG B NH1   1 
ATOM   4145 N NH2   . ARG F 3 161 ? -28.409 50.988  33.340 1.00 53.85  ? 513 ARG B NH2   1 
ATOM   4146 N N     . THR F 3 162 ? -34.202 51.389  34.272 1.00 54.75  ? 514 THR B N     1 
ATOM   4147 C CA    . THR F 3 162 ? -33.802 51.615  35.669 1.00 54.84  ? 514 THR B CA    1 
ATOM   4148 C C     . THR F 3 162 ? -32.669 50.649  36.097 1.00 56.82  ? 514 THR B C     1 
ATOM   4149 O O     . THR F 3 162 ? -32.356 49.725  35.352 1.00 56.84  ? 514 THR B O     1 
ATOM   4150 C CB    . THR F 3 162 ? -35.065 51.463  36.581 1.00 52.51  ? 514 THR B CB    1 
ATOM   4151 O OG1   . THR F 3 162 ? -36.042 52.455  36.219 1.00 53.87  ? 514 THR B OG1   1 
ATOM   4152 C CG2   . THR F 3 162 ? -34.733 51.614  38.053 1.00 56.25  ? 514 THR B CG2   1 
ATOM   4153 N N     . GLN F 3 163 ? -32.038 50.873  37.261 1.00 59.08  ? 515 GLN B N     1 
ATOM   4154 C CA    . GLN F 3 163 ? -30.944 50.007  37.741 1.00 59.68  ? 515 GLN B CA    1 
ATOM   4155 C C     . GLN F 3 163 ? -30.745 49.941  39.261 1.00 60.03  ? 515 GLN B C     1 
ATOM   4156 O O     . GLN F 3 163 ? -31.390 50.649  40.035 1.00 58.93  ? 515 GLN B O     1 
ATOM   4157 C CB    . GLN F 3 163 ? -29.613 50.430  37.120 1.00 59.88  ? 515 GLN B CB    1 
ATOM   4158 C CG    . GLN F 3 163 ? -29.118 51.797  37.600 1.00 69.64  ? 515 GLN B CG    1 
ATOM   4159 C CD    . GLN F 3 163 ? -29.005 52.804  36.472 1.00 73.11  ? 515 GLN B CD    1 
ATOM   4160 O OE1   . GLN F 3 163 ? -28.052 52.784  35.706 1.00 78.26  ? 515 GLN B OE1   1 
ATOM   4161 N NE2   . GLN F 3 163 ? -29.989 53.679  36.352 1.00 76.58  ? 515 GLN B NE2   1 
ATOM   4162 N N     . SER F 3 164 ? -29.798 49.098  39.656 1.00 62.15  ? 516 SER B N     1 
ATOM   4163 C CA    . SER F 3 164 ? -29.414 48.889  41.046 1.00 61.66  ? 516 SER B CA    1 
ATOM   4164 C C     . SER F 3 164 ? -28.020 48.271  40.996 1.00 59.74  ? 516 SER B C     1 
ATOM   4165 O O     . SER F 3 164 ? -27.776 47.217  41.577 1.00 60.30  ? 516 SER B O     1 
ATOM   4166 C CB    . SER F 3 164 ? -30.386 47.928  41.742 1.00 67.86  ? 516 SER B CB    1 
ATOM   4167 O OG    . SER F 3 164 ? -31.584 48.579  42.141 1.00 79.10  ? 516 SER B OG    1 
ATOM   4168 N N     . ARG F 3 165 ? -27.119 48.922  40.266 1.00 57.56  ? 517 ARG B N     1 
ATOM   4169 C CA    . ARG F 3 165 ? -25.752 48.435  40.113 1.00 54.90  ? 517 ARG B CA    1 
ATOM   4170 C C     . ARG F 3 165 ? -24.730 49.564  40.232 1.00 54.14  ? 517 ARG B C     1 
ATOM   4171 O O     . ARG F 3 165 ? -24.974 50.698  39.788 1.00 47.95  ? 517 ARG B O     1 
ATOM   4172 C CB    . ARG F 3 165 ? -25.588 47.722  38.769 1.00 57.47  ? 517 ARG B CB    1 
ATOM   4173 C CG    . ARG F 3 165 ? -25.426 48.643  37.559 1.00 54.15  ? 517 ARG B CG    1 
ATOM   4174 C CD    . ARG F 3 165 ? -25.447 47.857  36.246 1.00 57.78  ? 517 ARG B CD    1 
ATOM   4175 N NE    . ARG F 3 165 ? -24.389 48.282  35.330 1.00 53.83  ? 517 ARG B NE    1 
ATOM   4176 C CZ    . ARG F 3 165 ? -23.438 47.476  34.863 1.00 53.65  ? 517 ARG B CZ    1 
ATOM   4177 N NH1   . ARG F 3 165 ? -23.418 46.193  35.217 1.00 51.19  ? 517 ARG B NH1   1 
ATOM   4178 N NH2   . ARG F 3 165 ? -22.467 47.968  34.096 1.00 51.59  ? 517 ARG B NH2   1 
ATOM   4179 N N     . ARG F 3 166 ? -23.577 49.225  40.805 1.00 52.86  ? 518 ARG B N     1 
ATOM   4180 C CA    . ARG F 3 166 ? -22.502 50.184  41.028 1.00 53.83  ? 518 ARG B CA    1 
ATOM   4181 C C     . ARG F 3 166 ? -21.622 50.538  39.816 1.00 54.82  ? 518 ARG B C     1 
ATOM   4182 O O     . ARG F 3 166 ? -21.029 51.617  39.792 1.00 55.43  ? 518 ARG B O     1 
ATOM   4183 C CB    . ARG F 3 166 ? -21.607 49.719  42.187 1.00 57.31  ? 518 ARG B CB    1 
ATOM   4184 C CG    . ARG F 3 166 ? -22.343 49.441  43.494 1.00 59.61  ? 518 ARG B CG    1 
ATOM   4185 C CD    . ARG F 3 166 ? -21.396 49.491  44.691 1.00 61.72  ? 518 ARG B CD    1 
ATOM   4186 N NE    . ARG F 3 166 ? -21.040 50.867  45.034 1.00 67.09  ? 518 ARG B NE    1 
ATOM   4187 C CZ    . ARG F 3 166 ? -19.868 51.244  45.539 1.00 71.61  ? 518 ARG B CZ    1 
ATOM   4188 N NH1   . ARG F 3 166 ? -18.918 50.349  45.777 1.00 76.53  ? 518 ARG B NH1   1 
ATOM   4189 N NH2   . ARG F 3 166 ? -19.632 52.530  45.776 1.00 72.86  ? 518 ARG B NH2   1 
ATOM   4190 N N     . GLY F 3 167 ? -21.494 49.628  38.849 1.00 51.95  ? 519 GLY B N     1 
ATOM   4191 C CA    . GLY F 3 167 ? -20.666 49.898  37.680 1.00 44.63  ? 519 GLY B CA    1 
ATOM   4192 C C     . GLY F 3 167 ? -20.307 48.647  36.898 1.00 43.96  ? 519 GLY B C     1 
ATOM   4193 O O     . GLY F 3 167 ? -21.160 47.789  36.694 1.00 41.11  ? 519 GLY B O     1 
ATOM   4194 N N     . PRO F 3 168 ? -19.041 48.492  36.455 1.00 44.65  ? 520 PRO B N     1 
ATOM   4195 C CA    . PRO F 3 168 ? -17.909 49.405  36.639 1.00 39.78  ? 520 PRO B CA    1 
ATOM   4196 C C     . PRO F 3 168 ? -18.084 50.646  35.795 1.00 35.44  ? 520 PRO B C     1 
ATOM   4197 O O     . PRO F 3 168 ? -18.966 50.709  34.936 1.00 30.39  ? 520 PRO B O     1 
ATOM   4198 C CB    . PRO F 3 168 ? -16.734 48.577  36.124 1.00 43.08  ? 520 PRO B CB    1 
ATOM   4199 C CG    . PRO F 3 168 ? -17.360 47.825  34.979 1.00 44.23  ? 520 PRO B CG    1 
ATOM   4200 C CD    . PRO F 3 168 ? -18.671 47.358  35.594 1.00 45.38  ? 520 PRO B CD    1 
ATOM   4201 N N     . ILE F 3 169 ? -17.269 51.653  36.068 1.00 32.61  ? 521 ILE B N     1 
ATOM   4202 C CA    . ILE F 3 169 ? -17.347 52.878  35.306 1.00 32.68  ? 521 ILE B CA    1 
ATOM   4203 C C     . ILE F 3 169 ? -16.320 52.793  34.189 1.00 31.86  ? 521 ILE B C     1 
ATOM   4204 O O     . ILE F 3 169 ? -15.184 52.366  34.397 1.00 33.02  ? 521 ILE B O     1 
ATOM   4205 C CB    . ILE F 3 169 ? -17.169 54.130  36.209 1.00 31.40  ? 521 ILE B CB    1 
ATOM   4206 C CG1   . ILE F 3 169 ? -18.444 54.354  37.024 1.00 34.79  ? 521 ILE B CG1   1 
ATOM   4207 C CG2   . ILE F 3 169 ? -16.980 55.373  35.384 1.00 33.51  ? 521 ILE B CG2   1 
ATOM   4208 C CD1   . ILE F 3 169 ? -19.681 54.697  36.171 1.00 29.48  ? 521 ILE B CD1   1 
ATOM   4209 N N     . ALA F 3 170 ? -16.764 53.141  32.987 1.00 32.42  ? 522 ALA B N     1 
ATOM   4210 C CA    . ALA F 3 170 ? -15.930 53.110  31.800 1.00 31.60  ? 522 ALA B CA    1 
ATOM   4211 C C     . ALA F 3 170 ? -14.583 53.778  32.013 1.00 33.97  ? 522 ALA B C     1 
ATOM   4212 O O     . ALA F 3 170 ? -14.405 54.606  32.912 1.00 37.03  ? 522 ALA B O     1 
ATOM   4213 C CB    . ALA F 3 170 ? -16.655 53.765  30.638 1.00 27.81  ? 522 ALA B CB    1 
ATOM   4214 N N     . ARG F 3 171 ? -13.645 53.422  31.147 1.00 33.66  ? 523 ARG B N     1 
ATOM   4215 C CA    . ARG F 3 171 ? -12.291 53.952  31.177 1.00 36.99  ? 523 ARG B CA    1 
ATOM   4216 C C     . ARG F 3 171 ? -12.330 55.469  30.933 1.00 36.61  ? 523 ARG B C     1 
ATOM   4217 O O     . ARG F 3 171 ? -12.982 55.936  29.988 1.00 39.40  ? 523 ARG B O     1 
ATOM   4218 C CB    . ARG F 3 171 ? -11.461 53.219  30.106 1.00 36.47  ? 523 ARG B CB    1 
ATOM   4219 C CG    . ARG F 3 171 ? -10.115 53.813  29.734 1.00 37.84  ? 523 ARG B CG    1 
ATOM   4220 C CD    . ARG F 3 171 ? -9.739  53.318  28.329 1.00 43.12  ? 523 ARG B CD    1 
ATOM   4221 N NE    . ARG F 3 171 ? -8.615  54.042  27.726 1.00 49.17  ? 523 ARG B NE    1 
ATOM   4222 C CZ    . ARG F 3 171 ? -8.721  55.113  26.939 1.00 43.21  ? 523 ARG B CZ    1 
ATOM   4223 N NH1   . ARG F 3 171 ? -9.914  55.616  26.641 1.00 38.64  ? 523 ARG B NH1   1 
ATOM   4224 N NH2   . ARG F 3 171 ? -7.621  55.680  26.458 1.00 39.97  ? 523 ARG B NH2   1 
ATOM   4225 N N     . GLU F 3 172 ? -11.677 56.221  31.826 1.00 33.23  ? 524 GLU B N     1 
ATOM   4226 C CA    . GLU F 3 172 ? -11.575 57.690  31.772 1.00 28.15  ? 524 GLU B CA    1 
ATOM   4227 C C     . GLU F 3 172 ? -12.901 58.456  31.783 1.00 25.85  ? 524 GLU B C     1 
ATOM   4228 O O     . GLU F 3 172 ? -12.957 59.632  31.388 1.00 28.98  ? 524 GLU B O     1 
ATOM   4229 C CB    . GLU F 3 172 ? -10.710 58.125  30.576 1.00 23.56  ? 524 GLU B CB    1 
ATOM   4230 C CG    . GLU F 3 172 ? -9.275  57.643  30.665 1.00 29.18  ? 524 GLU B CG    1 
ATOM   4231 C CD    . GLU F 3 172 ? -8.411  58.040  29.484 1.00 33.65  ? 524 GLU B CD    1 
ATOM   4232 O OE1   . GLU F 3 172 ? -8.865  58.832  28.631 1.00 40.60  ? 524 GLU B OE1   1 
ATOM   4233 O OE2   . GLU F 3 172 ? -7.259  57.553  29.414 1.00 39.07  ? 524 GLU B OE2   1 
ATOM   4234 N N     . PHE F 3 173 ? -13.954 57.805  32.272 1.00 27.31  ? 525 PHE B N     1 
ATOM   4235 C CA    . PHE F 3 173 ? -15.289 58.400  32.329 1.00 25.07  ? 525 PHE B CA    1 
ATOM   4236 C C     . PHE F 3 173 ? -15.302 59.742  33.069 1.00 22.47  ? 525 PHE B C     1 
ATOM   4237 O O     . PHE F 3 173 ? -15.844 60.729  32.566 1.00 27.27  ? 525 PHE B O     1 
ATOM   4238 C CB    . PHE F 3 173 ? -16.283 57.416  32.968 1.00 20.26  ? 525 PHE B CB    1 
ATOM   4239 C CG    . PHE F 3 173 ? -17.621 58.023  33.277 1.00 25.28  ? 525 PHE B CG    1 
ATOM   4240 C CD1   . PHE F 3 173 ? -18.599 58.119  32.296 1.00 28.30  ? 525 PHE B CD1   1 
ATOM   4241 C CD2   . PHE F 3 173 ? -17.881 58.562  34.534 1.00 21.68  ? 525 PHE B CD2   1 
ATOM   4242 C CE1   . PHE F 3 173 ? -19.813 58.748  32.563 1.00 23.22  ? 525 PHE B CE1   1 
ATOM   4243 C CE2   . PHE F 3 173 ? -19.080 59.191  34.812 1.00 9.90   ? 525 PHE B CE2   1 
ATOM   4244 C CZ    . PHE F 3 173 ? -20.050 59.292  33.828 1.00 20.79  ? 525 PHE B CZ    1 
ATOM   4245 N N     . PHE F 3 174 ? -14.662 59.790  34.233 1.00 18.59  ? 526 PHE B N     1 
ATOM   4246 C CA    . PHE F 3 174 ? -14.637 61.011  35.026 1.00 19.08  ? 526 PHE B CA    1 
ATOM   4247 C C     . PHE F 3 174 ? -13.670 62.040  34.507 1.00 18.03  ? 526 PHE B C     1 
ATOM   4248 O O     . PHE F 3 174 ? -13.870 63.232  34.719 1.00 20.36  ? 526 PHE B O     1 
ATOM   4249 C CB    . PHE F 3 174 ? -14.357 60.708  36.498 1.00 18.86  ? 526 PHE B CB    1 
ATOM   4250 C CG    . PHE F 3 174 ? -15.430 59.913  37.155 1.00 13.04  ? 526 PHE B CG    1 
ATOM   4251 C CD1   . PHE F 3 174 ? -16.678 60.468  37.383 1.00 12.98  ? 526 PHE B CD1   1 
ATOM   4252 C CD2   . PHE F 3 174 ? -15.202 58.594  37.525 1.00 17.26  ? 526 PHE B CD2   1 
ATOM   4253 C CE1   . PHE F 3 174 ? -17.690 59.706  37.981 1.00 16.52  ? 526 PHE B CE1   1 
ATOM   4254 C CE2   . PHE F 3 174 ? -16.198 57.834  38.118 1.00 15.63  ? 526 PHE B CE2   1 
ATOM   4255 C CZ    . PHE F 3 174 ? -17.442 58.388  38.344 1.00 14.98  ? 526 PHE B CZ    1 
ATOM   4256 N N     . LYS F 3 175 ? -12.651 61.586  33.784 1.00 20.65  ? 527 LYS B N     1 
ATOM   4257 C CA    . LYS F 3 175 ? -11.661 62.489  33.214 1.00 20.30  ? 527 LYS B CA    1 
ATOM   4258 C C     . LYS F 3 175 ? -12.378 63.321  32.173 1.00 23.06  ? 527 LYS B C     1 
ATOM   4259 O O     . LYS F 3 175 ? -12.281 64.543  32.155 1.00 25.07  ? 527 LYS B O     1 
ATOM   4260 C CB    . LYS F 3 175 ? -10.553 61.697  32.524 1.00 25.04  ? 527 LYS B CB    1 
ATOM   4261 C CG    . LYS F 3 175 ? -9.425  62.560  31.990 1.00 26.69  ? 527 LYS B CG    1 
ATOM   4262 C CD    . LYS F 3 175 ? -8.525  61.785  31.057 1.00 32.12  ? 527 LYS B CD    1 
ATOM   4263 C CE    . LYS F 3 175 ? -7.447  62.679  30.499 1.00 36.03  ? 527 LYS B CE    1 
ATOM   4264 N NZ    . LYS F 3 175 ? -6.586  61.959  29.529 1.00 46.73  ? 527 LYS B NZ    1 
ATOM   4265 N N     . HIS F 3 176 ? -13.113 62.629  31.309 1.00 27.58  ? 528 HIS B N     1 
ATOM   4266 C CA    . HIS F 3 176 ? -13.863 63.273  30.244 1.00 30.92  ? 528 HIS B CA    1 
ATOM   4267 C C     . HIS F 3 176 ? -15.076 64.036  30.719 1.00 25.31  ? 528 HIS B C     1 
ATOM   4268 O O     . HIS F 3 176 ? -15.422 65.059  30.145 1.00 25.15  ? 528 HIS B O     1 
ATOM   4269 C CB    . HIS F 3 176 ? -14.218 62.264  29.165 1.00 39.54  ? 528 HIS B CB    1 
ATOM   4270 C CG    . HIS F 3 176 ? -13.029 61.836  28.370 1.00 53.62  ? 528 HIS B CG    1 
ATOM   4271 N ND1   . HIS F 3 176 ? -12.228 60.781  28.746 1.00 57.99  ? 528 HIS B ND1   1 
ATOM   4272 C CD2   . HIS F 3 176 ? -12.443 62.390  27.282 1.00 58.64  ? 528 HIS B CD2   1 
ATOM   4273 C CE1   . HIS F 3 176 ? -11.190 60.707  27.928 1.00 59.27  ? 528 HIS B CE1   1 
ATOM   4274 N NE2   . HIS F 3 176 ? -11.300 61.670  27.031 1.00 62.74  ? 528 HIS B NE2   1 
ATOM   4275 N N     . PHE F 3 177 ? -15.766 63.502  31.712 1.00 19.52  ? 529 PHE B N     1 
ATOM   4276 C CA    . PHE F 3 177 ? -16.897 64.196  32.283 1.00 20.12  ? 529 PHE B CA    1 
ATOM   4277 C C     . PHE F 3 177 ? -16.376 65.543  32.822 1.00 20.12  ? 529 PHE B C     1 
ATOM   4278 O O     . PHE F 3 177 ? -16.973 66.584  32.563 1.00 23.41  ? 529 PHE B O     1 
ATOM   4279 C CB    . PHE F 3 177 ? -17.523 63.361  33.415 1.00 22.46  ? 529 PHE B CB    1 
ATOM   4280 C CG    . PHE F 3 177 ? -18.879 63.840  33.836 1.00 19.76  ? 529 PHE B CG    1 
ATOM   4281 C CD1   . PHE F 3 177 ? -19.014 64.851  34.768 1.00 16.53  ? 529 PHE B CD1   1 
ATOM   4282 C CD2   . PHE F 3 177 ? -20.025 63.334  33.232 1.00 22.46  ? 529 PHE B CD2   1 
ATOM   4283 C CE1   . PHE F 3 177 ? -20.280 65.350  35.089 1.00 15.83  ? 529 PHE B CE1   1 
ATOM   4284 C CE2   . PHE F 3 177 ? -21.283 63.822  33.547 1.00 15.21  ? 529 PHE B CE2   1 
ATOM   4285 C CZ    . PHE F 3 177 ? -21.410 64.830  34.467 1.00 22.78  ? 529 PHE B CZ    1 
ATOM   4286 N N     . ALA F 3 178 ? -15.250 65.527  33.537 1.00 21.26  ? 530 ALA B N     1 
ATOM   4287 C CA    . ALA F 3 178 ? -14.659 66.753  34.093 1.00 21.96  ? 530 ALA B CA    1 
ATOM   4288 C C     . ALA F 3 178 ? -14.207 67.702  32.990 1.00 26.18  ? 530 ALA B C     1 
ATOM   4289 O O     . ALA F 3 178 ? -14.132 68.911  33.194 1.00 29.64  ? 530 ALA B O     1 
ATOM   4290 C CB    . ALA F 3 178 ? -13.488 66.425  34.999 1.00 13.62  ? 530 ALA B CB    1 
ATOM   4291 N N     . GLU F 3 179 ? -13.828 67.140  31.845 1.00 30.63  ? 531 GLU B N     1 
ATOM   4292 C CA    . GLU F 3 179 ? -13.400 67.934  30.708 1.00 28.00  ? 531 GLU B CA    1 
ATOM   4293 C C     . GLU F 3 179 ? -14.603 68.647  30.112 1.00 30.02  ? 531 GLU B C     1 
ATOM   4294 O O     . GLU F 3 179 ? -14.574 69.859  29.931 1.00 37.64  ? 531 GLU B O     1 
ATOM   4295 C CB    . GLU F 3 179 ? -12.719 67.057  29.660 1.00 30.58  ? 531 GLU B CB    1 
ATOM   4296 C CG    . GLU F 3 179 ? -11.200 66.968  29.815 1.00 36.61  ? 531 GLU B CG    1 
ATOM   4297 C CD    . GLU F 3 179 ? -10.562 65.803  29.055 1.00 38.51  ? 531 GLU B CD    1 
ATOM   4298 O OE1   . GLU F 3 179 ? -11.211 65.219  28.161 1.00 41.11  ? 531 GLU B OE1   1 
ATOM   4299 O OE2   . GLU F 3 179 ? -9.399  65.465  29.365 1.00 40.20  ? 531 GLU B OE2   1 
ATOM   4300 N N     . GLU F 3 180 ? -15.679 67.911  29.856 1.00 30.48  ? 532 GLU B N     1 
ATOM   4301 C CA    . GLU F 3 180 ? -16.898 68.496  29.286 1.00 34.61  ? 532 GLU B CA    1 
ATOM   4302 C C     . GLU F 3 180 ? -17.710 69.345  30.282 1.00 36.62  ? 532 GLU B C     1 
ATOM   4303 O O     . GLU F 3 180 ? -18.560 70.146  29.875 1.00 38.31  ? 532 GLU B O     1 
ATOM   4304 C CB    . GLU F 3 180 ? -17.778 67.409  28.644 1.00 34.98  ? 532 GLU B CB    1 
ATOM   4305 C CG    . GLU F 3 180 ? -17.056 66.621  27.535 1.00 50.25  ? 532 GLU B CG    1 
ATOM   4306 C CD    . GLU F 3 180 ? -17.963 66.201  26.379 1.00 61.21  ? 532 GLU B CD    1 
ATOM   4307 O OE1   . GLU F 3 180 ? -19.088 66.741  26.265 1.00 69.40  ? 532 GLU B OE1   1 
ATOM   4308 O OE2   . GLU F 3 180 ? -17.543 65.339  25.569 1.00 66.63  ? 532 GLU B OE2   1 
ATOM   4309 N N     . HIS F 3 181 ? -17.457 69.157  31.578 1.00 36.95  ? 533 HIS B N     1 
ATOM   4310 C CA    . HIS F 3 181 ? -18.136 69.894  32.652 1.00 32.23  ? 533 HIS B CA    1 
ATOM   4311 C C     . HIS F 3 181 ? -17.087 70.229  33.716 1.00 31.71  ? 533 HIS B C     1 
ATOM   4312 O O     . HIS F 3 181 ? -17.113 69.689  34.833 1.00 26.13  ? 533 HIS B O     1 
ATOM   4313 C CB    . HIS F 3 181 ? -19.237 69.042  33.284 1.00 32.87  ? 533 HIS B CB    1 
ATOM   4314 C CG    . HIS F 3 181 ? -20.125 68.358  32.293 1.00 34.56  ? 533 HIS B CG    1 
ATOM   4315 N ND1   . HIS F 3 181 ? -21.234 68.960  31.744 1.00 37.56  ? 533 HIS B ND1   1 
ATOM   4316 C CD2   . HIS F 3 181 ? -20.099 67.098  31.795 1.00 38.16  ? 533 HIS B CD2   1 
ATOM   4317 C CE1   . HIS F 3 181 ? -21.861 68.099  30.961 1.00 41.71  ? 533 HIS B CE1   1 
ATOM   4318 N NE2   . HIS F 3 181 ? -21.191 66.961  30.975 1.00 39.26  ? 533 HIS B NE2   1 
ATOM   4319 N N     . ALA F 3 182 ? -16.205 71.168  33.363 1.00 30.65  ? 534 ALA B N     1 
ATOM   4320 C CA    . ALA F 3 182 ? -15.083 71.593  34.197 1.00 26.35  ? 534 ALA B CA    1 
ATOM   4321 C C     . ALA F 3 182 ? -15.338 72.504  35.405 1.00 26.18  ? 534 ALA B C     1 
ATOM   4322 O O     . ALA F 3 182 ? -14.420 73.154  35.898 1.00 28.60  ? 534 ALA B O     1 
ATOM   4323 C CB    . ALA F 3 182 ? -13.966 72.160  33.310 1.00 23.21  ? 534 ALA B CB    1 
ATOM   4324 N N     . ALA F 3 183 ? -16.577 72.570  35.880 1.00 26.39  ? 535 ALA B N     1 
ATOM   4325 C CA    . ALA F 3 183 ? -16.874 73.364  37.067 1.00 22.98  ? 535 ALA B CA    1 
ATOM   4326 C C     . ALA F 3 183 ? -16.222 72.642  38.254 1.00 22.81  ? 535 ALA B C     1 
ATOM   4327 O O     . ALA F 3 183 ? -15.950 73.239  39.287 1.00 27.46  ? 535 ALA B O     1 
ATOM   4328 C CB    . ALA F 3 183 ? -18.376 73.453  37.274 1.00 18.37  ? 535 ALA B CB    1 
ATOM   4329 N N     . HIS F 3 184 ? -15.993 71.341  38.092 1.00 23.07  ? 536 HIS B N     1 
ATOM   4330 C CA    . HIS F 3 184 ? -15.389 70.484  39.110 1.00 21.69  ? 536 HIS B CA    1 
ATOM   4331 C C     . HIS F 3 184 ? -14.292 69.622  38.450 1.00 19.60  ? 536 HIS B C     1 
ATOM   4332 O O     . HIS F 3 184 ? -14.324 69.396  37.251 1.00 20.56  ? 536 HIS B O     1 
ATOM   4333 C CB    . HIS F 3 184 ? -16.452 69.556  39.730 1.00 18.47  ? 536 HIS B CB    1 
ATOM   4334 C CG    . HIS F 3 184 ? -17.571 70.270  40.420 1.00 15.42  ? 536 HIS B CG    1 
ATOM   4335 N ND1   . HIS F 3 184 ? -17.502 70.658  41.743 1.00 14.45  ? 536 HIS B ND1   1 
ATOM   4336 C CD2   . HIS F 3 184 ? -18.793 70.649  39.984 1.00 14.31  ? 536 HIS B CD2   1 
ATOM   4337 C CE1   . HIS F 3 184 ? -18.629 71.246  42.088 1.00 13.83  ? 536 HIS B CE1   1 
ATOM   4338 N NE2   . HIS F 3 184 ? -19.433 71.255  41.040 1.00 11.00  ? 536 HIS B NE2   1 
ATOM   4339 N N     . THR F 3 185 ? -13.342 69.131  39.242 1.00 19.57  ? 537 THR B N     1 
ATOM   4340 C CA    . THR F 3 185 ? -12.261 68.297  38.742 1.00 13.22  ? 537 THR B CA    1 
ATOM   4341 C C     . THR F 3 185 ? -12.727 66.846  38.551 1.00 17.47  ? 537 THR B C     1 
ATOM   4342 O O     . THR F 3 185 ? -13.826 66.452  38.965 1.00 18.08  ? 537 THR B O     1 
ATOM   4343 C CB    . THR F 3 185 ? -11.091 68.258  39.748 1.00 18.58  ? 537 THR B CB    1 
ATOM   4344 O OG1   . THR F 3 185 ? -11.540 67.705  40.992 1.00 21.29  ? 537 THR B OG1   1 
ATOM   4345 C CG2   . THR F 3 185 ? -10.553 69.633  40.011 1.00 19.88  ? 537 THR B CG2   1 
ATOM   4346 N N     . GLU F 3 186 ? -11.858 66.036  37.964 1.00 20.14  ? 538 GLU B N     1 
ATOM   4347 C CA    . GLU F 3 186 ? -12.145 64.625  37.788 1.00 17.56  ? 538 GLU B CA    1 
ATOM   4348 C C     . GLU F 3 186 ? -12.382 64.002  39.160 1.00 19.16  ? 538 GLU B C     1 
ATOM   4349 O O     . GLU F 3 186 ? -13.311 63.207  39.331 1.00 24.21  ? 538 GLU B O     1 
ATOM   4350 C CB    . GLU F 3 186 ? -10.955 63.930  37.141 1.00 15.89  ? 538 GLU B CB    1 
ATOM   4351 C CG    . GLU F 3 186 ? -11.089 62.419  37.155 1.00 8.50   ? 538 GLU B CG    1 
ATOM   4352 C CD    . GLU F 3 186 ? -9.924  61.715  36.512 1.00 15.60  ? 538 GLU B CD    1 
ATOM   4353 O OE1   . GLU F 3 186 ? -9.012  62.387  35.952 1.00 18.10  ? 538 GLU B OE1   1 
ATOM   4354 O OE2   . GLU F 3 186 ? -9.930  60.465  36.564 1.00 27.10  ? 538 GLU B OE2   1 
ATOM   4355 N N     . ASN F 3 187 ? -11.527 64.355  40.126 1.00 17.73  ? 539 ASN B N     1 
ATOM   4356 C CA    . ASN F 3 187 ? -11.629 63.841  41.496 1.00 16.94  ? 539 ASN B CA    1 
ATOM   4357 C C     . ASN F 3 187 ? -12.912 64.256  42.194 1.00 19.76  ? 539 ASN B C     1 
ATOM   4358 O O     . ASN F 3 187 ? -13.518 63.471  42.932 1.00 18.50  ? 539 ASN B O     1 
ATOM   4359 C CB    . ASN F 3 187 ? -10.448 64.301  42.343 1.00 17.81  ? 539 ASN B CB    1 
ATOM   4360 C CG    . ASN F 3 187 ? -9.170  63.621  41.965 1.00 19.37  ? 539 ASN B CG    1 
ATOM   4361 O OD1   . ASN F 3 187 ? -9.193  62.562  41.356 1.00 26.92  ? 539 ASN B OD1   1 
ATOM   4362 N ND2   . ASN F 3 187 ? -8.035  64.213  42.335 1.00 16.16  ? 539 ASN B ND2   1 
ATOM   4363 N N     . ALA F 3 188 ? -13.303 65.509  42.013 1.00 20.32  ? 540 ALA B N     1 
ATOM   4364 C CA    . ALA F 3 188 ? -14.518 65.980  42.646 1.00 19.51  ? 540 ALA B CA    1 
ATOM   4365 C C     . ALA F 3 188 ? -15.737 65.242  42.086 1.00 22.45  ? 540 ALA B C     1 
ATOM   4366 O O     . ALA F 3 188 ? -16.638 64.840  42.840 1.00 27.47  ? 540 ALA B O     1 
ATOM   4367 C CB    . ALA F 3 188 ? -14.649 67.485  42.482 1.00 13.60  ? 540 ALA B CB    1 
ATOM   4368 N N     . TRP F 3 189 ? -15.773 65.031  40.772 1.00 21.84  ? 541 TRP B N     1 
ATOM   4369 C CA    . TRP F 3 189 ? -16.910 64.317  40.178 1.00 19.61  ? 541 TRP B CA    1 
ATOM   4370 C C     . TRP F 3 189 ? -17.004 62.860  40.641 1.00 17.53  ? 541 TRP B C     1 
ATOM   4371 O O     . TRP F 3 189 ? -18.101 62.349  40.908 1.00 15.12  ? 541 TRP B O     1 
ATOM   4372 C CB    . TRP F 3 189 ? -16.865 64.369  38.640 1.00 20.29  ? 541 TRP B CB    1 
ATOM   4373 C CG    . TRP F 3 189 ? -17.224 65.699  38.052 1.00 15.56  ? 541 TRP B CG    1 
ATOM   4374 C CD1   . TRP F 3 189 ? -16.395 66.539  37.380 1.00 12.89  ? 541 TRP B CD1   1 
ATOM   4375 C CD2   . TRP F 3 189 ? -18.511 66.337  38.082 1.00 17.97  ? 541 TRP B CD2   1 
ATOM   4376 N NE1   . TRP F 3 189 ? -17.079 67.668  36.982 1.00 15.41  ? 541 TRP B NE1   1 
ATOM   4377 C CE2   . TRP F 3 189 ? -18.380 67.574  37.402 1.00 17.87  ? 541 TRP B CE2   1 
ATOM   4378 C CE3   . TRP F 3 189 ? -19.764 65.991  38.608 1.00 12.95  ? 541 TRP B CE3   1 
ATOM   4379 C CZ2   . TRP F 3 189 ? -19.452 68.458  37.236 1.00 15.28  ? 541 TRP B CZ2   1 
ATOM   4380 C CZ3   . TRP F 3 189 ? -20.825 66.868  38.442 1.00 14.37  ? 541 TRP B CZ3   1 
ATOM   4381 C CH2   . TRP F 3 189 ? -20.662 68.087  37.760 1.00 14.53  ? 541 TRP B CH2   1 
ATOM   4382 N N     . ARG F 3 190 ? -15.861 62.185  40.729 1.00 16.62  ? 542 ARG B N     1 
ATOM   4383 C CA    . ARG F 3 190 ? -15.887 60.802  41.137 1.00 14.56  ? 542 ARG B CA    1 
ATOM   4384 C C     . ARG F 3 190 ? -16.423 60.591  42.537 1.00 20.81  ? 542 ARG B C     1 
ATOM   4385 O O     . ARG F 3 190 ? -17.286 59.730  42.752 1.00 27.24  ? 542 ARG B O     1 
ATOM   4386 C CB    . ARG F 3 190 ? -14.525 60.126  40.985 1.00 11.71  ? 542 ARG B CB    1 
ATOM   4387 C CG    . ARG F 3 190 ? -14.611 58.686  41.446 1.00 16.02  ? 542 ARG B CG    1 
ATOM   4388 C CD    . ARG F 3 190 ? -13.595 57.759  40.858 1.00 15.20  ? 542 ARG B CD    1 
ATOM   4389 N NE    . ARG F 3 190 ? -12.555 57.434  41.811 1.00 23.52  ? 542 ARG B NE    1 
ATOM   4390 C CZ    . ARG F 3 190 ? -12.458 56.295  42.478 1.00 19.11  ? 542 ARG B CZ    1 
ATOM   4391 N NH1   . ARG F 3 190 ? -13.345 55.320  42.324 1.00 18.87  ? 542 ARG B NH1   1 
ATOM   4392 N NH2   . ARG F 3 190 ? -11.433 56.130  43.293 1.00 20.77  ? 542 ARG B NH2   1 
ATOM   4393 N N     . ASP F 3 191 ? -15.948 61.383  43.491 1.00 20.31  ? 543 ASP B N     1 
ATOM   4394 C CA    . ASP F 3 191 ? -16.397 61.216  44.861 1.00 14.57  ? 543 ASP B CA    1 
ATOM   4395 C C     . ASP F 3 191 ? -17.866 61.542  45.000 1.00 16.35  ? 543 ASP B C     1 
ATOM   4396 O O     . ASP F 3 191 ? -18.575 60.859  45.715 1.00 22.32  ? 543 ASP B O     1 
ATOM   4397 C CB    . ASP F 3 191 ? -15.555 62.052  45.801 1.00 21.80  ? 543 ASP B CB    1 
ATOM   4398 C CG    . ASP F 3 191 ? -15.253 61.339  47.097 1.00 21.56  ? 543 ASP B CG    1 
ATOM   4399 O OD1   . ASP F 3 191 ? -14.807 60.178  47.065 1.00 24.70  ? 543 ASP B OD1   1 
ATOM   4400 O OD2   . ASP F 3 191 ? -15.449 61.948  48.159 1.00 31.19  ? 543 ASP B OD2   1 
ATOM   4401 N N     . ARG F 3 192 ? -18.336 62.546  44.274 1.00 18.08  ? 544 ARG B N     1 
ATOM   4402 C CA    . ARG F 3 192 ? -19.739 62.928  44.305 1.00 17.77  ? 544 ARG B CA    1 
ATOM   4403 C C     . ARG F 3 192 ? -20.592 61.760  43.820 1.00 25.86  ? 544 ARG B C     1 
ATOM   4404 O O     . ARG F 3 192 ? -21.774 61.641  44.161 1.00 30.03  ? 544 ARG B O     1 
ATOM   4405 C CB    . ARG F 3 192 ? -19.968 64.135  43.396 1.00 19.71  ? 544 ARG B CB    1 
ATOM   4406 C CG    . ARG F 3 192 ? -21.393 64.688  43.424 1.00 23.54  ? 544 ARG B CG    1 
ATOM   4407 C CD    . ARG F 3 192 ? -21.770 65.182  44.816 1.00 20.15  ? 544 ARG B CD    1 
ATOM   4408 N NE    . ARG F 3 192 ? -22.993 65.983  44.815 1.00 25.46  ? 544 ARG B NE    1 
ATOM   4409 C CZ    . ARG F 3 192 ? -23.484 66.603  45.886 1.00 24.59  ? 544 ARG B CZ    1 
ATOM   4410 N NH1   . ARG F 3 192 ? -22.863 66.521  47.041 1.00 21.34  ? 544 ARG B NH1   1 
ATOM   4411 N NH2   . ARG F 3 192 ? -24.590 67.325  45.799 1.00 22.31  ? 544 ARG B NH2   1 
ATOM   4412 N N     . PHE F 3 193 ? -20.015 60.941  42.948 1.00 28.62  ? 545 PHE B N     1 
ATOM   4413 C CA    . PHE F 3 193 ? -20.716 59.782  42.423 1.00 23.99  ? 545 PHE B CA    1 
ATOM   4414 C C     . PHE F 3 193 ? -20.689 58.699  43.483 1.00 21.47  ? 545 PHE B C     1 
ATOM   4415 O O     . PHE F 3 193 ? -21.736 58.224  43.917 1.00 22.48  ? 545 PHE B O     1 
ATOM   4416 C CB    . PHE F 3 193 ? -20.041 59.300  41.132 1.00 25.87  ? 545 PHE B CB    1 
ATOM   4417 C CG    . PHE F 3 193 ? -20.406 57.889  40.727 1.00 19.00  ? 545 PHE B CG    1 
ATOM   4418 C CD1   . PHE F 3 193 ? -21.615 57.618  40.111 1.00 18.89  ? 545 PHE B CD1   1 
ATOM   4419 C CD2   . PHE F 3 193 ? -19.510 56.841  40.933 1.00 22.51  ? 545 PHE B CD2   1 
ATOM   4420 C CE1   . PHE F 3 193 ? -21.930 56.323  39.703 1.00 20.53  ? 545 PHE B CE1   1 
ATOM   4421 C CE2   . PHE F 3 193 ? -19.812 55.550  40.532 1.00 20.61  ? 545 PHE B CE2   1 
ATOM   4422 C CZ    . PHE F 3 193 ? -21.026 55.290  39.913 1.00 20.54  ? 545 PHE B CZ    1 
ATOM   4423 N N     . ARG F 3 194 ? -19.488 58.352  43.932 1.00 17.95  ? 546 ARG B N     1 
ATOM   4424 C CA    . ARG F 3 194 ? -19.316 57.320  44.938 1.00 20.51  ? 546 ARG B CA    1 
ATOM   4425 C C     . ARG F 3 194 ? -20.047 57.538  46.242 1.00 25.77  ? 546 ARG B C     1 
ATOM   4426 O O     . ARG F 3 194 ? -20.614 56.607  46.808 1.00 28.92  ? 546 ARG B O     1 
ATOM   4427 C CB    . ARG F 3 194 ? -17.851 57.172  45.290 1.00 19.99  ? 546 ARG B CB    1 
ATOM   4428 C CG    . ARG F 3 194 ? -16.978 56.767  44.149 1.00 19.94  ? 546 ARG B CG    1 
ATOM   4429 C CD    . ARG F 3 194 ? -15.572 56.706  44.643 1.00 21.94  ? 546 ARG B CD    1 
ATOM   4430 N NE    . ARG F 3 194 ? -15.470 55.827  45.802 1.00 25.87  ? 546 ARG B NE    1 
ATOM   4431 C CZ    . ARG F 3 194 ? -14.402 55.754  46.584 1.00 20.32  ? 546 ARG B CZ    1 
ATOM   4432 N NH1   . ARG F 3 194 ? -13.349 56.521  46.333 1.00 20.54  ? 546 ARG B NH1   1 
ATOM   4433 N NH2   . ARG F 3 194 ? -14.373 54.891  47.594 1.00 25.18  ? 546 ARG B NH2   1 
ATOM   4434 N N     . LYS F 3 195 ? -19.976 58.761  46.751 1.00 27.81  ? 547 LYS B N     1 
ATOM   4435 C CA    . LYS F 3 195 ? -20.564 59.078  48.042 1.00 27.12  ? 547 LYS B CA    1 
ATOM   4436 C C     . LYS F 3 195 ? -21.956 59.661  48.025 1.00 28.06  ? 547 LYS B C     1 
ATOM   4437 O O     . LYS F 3 195 ? -22.658 59.582  49.029 1.00 30.63  ? 547 LYS B O     1 
ATOM   4438 C CB    . LYS F 3 195 ? -19.642 60.021  48.821 1.00 23.64  ? 547 LYS B CB    1 
ATOM   4439 C CG    . LYS F 3 195 ? -18.173 59.697  48.733 1.00 15.84  ? 547 LYS B CG    1 
ATOM   4440 C CD    . LYS F 3 195 ? -17.863 58.331  49.249 1.00 19.17  ? 547 LYS B CD    1 
ATOM   4441 C CE    . LYS F 3 195 ? -16.416 57.987  49.004 1.00 16.12  ? 547 LYS B CE    1 
ATOM   4442 N NZ    . LYS F 3 195 ? -15.525 59.018  49.602 1.00 26.66  ? 547 LYS B NZ    1 
ATOM   4443 N N     . PHE F 3 196 ? -22.342 60.300  46.927 1.00 33.24  ? 548 PHE B N     1 
ATOM   4444 C CA    . PHE F 3 196 ? -23.674 60.904  46.841 1.00 36.50  ? 548 PHE B CA    1 
ATOM   4445 C C     . PHE F 3 196 ? -24.614 60.222  45.855 1.00 38.32  ? 548 PHE B C     1 
ATOM   4446 O O     . PHE F 3 196 ? -25.650 59.699  46.261 1.00 40.38  ? 548 PHE B O     1 
ATOM   4447 C CB    . PHE F 3 196 ? -23.580 62.408  46.567 1.00 33.00  ? 548 PHE B CB    1 
ATOM   4448 C CG    . PHE F 3 196 ? -23.032 63.189  47.724 1.00 33.42  ? 548 PHE B CG    1 
ATOM   4449 C CD1   . PHE F 3 196 ? -21.681 63.125  48.045 1.00 34.70  ? 548 PHE B CD1   1 
ATOM   4450 C CD2   . PHE F 3 196 ? -23.877 63.923  48.546 1.00 34.18  ? 548 PHE B CD2   1 
ATOM   4451 C CE1   . PHE F 3 196 ? -21.179 63.771  49.168 1.00 32.36  ? 548 PHE B CE1   1 
ATOM   4452 C CE2   . PHE F 3 196 ? -23.384 64.573  49.672 1.00 33.83  ? 548 PHE B CE2   1 
ATOM   4453 C CZ    . PHE F 3 196 ? -22.030 64.492  49.983 1.00 33.38  ? 548 PHE B CZ    1 
ATOM   4454 N N     . LEU F 3 197 ? -24.251 60.194  44.575 1.00 38.98  ? 549 LEU B N     1 
ATOM   4455 C CA    . LEU F 3 197 ? -25.097 59.547  43.572 1.00 37.77  ? 549 LEU B CA    1 
ATOM   4456 C C     . LEU F 3 197 ? -25.407 58.092  43.925 1.00 37.29  ? 549 LEU B C     1 
ATOM   4457 O O     . LEU F 3 197 ? -26.550 57.659  43.804 1.00 39.30  ? 549 LEU B O     1 
ATOM   4458 C CB    . LEU F 3 197 ? -24.456 59.595  42.187 1.00 37.21  ? 549 LEU B CB    1 
ATOM   4459 C CG    . LEU F 3 197 ? -25.251 60.314  41.102 1.00 40.13  ? 549 LEU B CG    1 
ATOM   4460 C CD1   . LEU F 3 197 ? -24.679 59.998  39.736 1.00 41.87  ? 549 LEU B CD1   1 
ATOM   4461 C CD2   . LEU F 3 197 ? -26.697 59.891  41.156 1.00 43.38  ? 549 LEU B CD2   1 
ATOM   4462 N N     . LEU F 3 198 ? -24.400 57.336  44.358 1.00 35.64  ? 550 LEU B N     1 
ATOM   4463 C CA    . LEU F 3 198 ? -24.618 55.932  44.700 1.00 33.86  ? 550 LEU B CA    1 
ATOM   4464 C C     . LEU F 3 198 ? -25.320 55.692  46.014 1.00 36.49  ? 550 LEU B C     1 
ATOM   4465 O O     . LEU F 3 198 ? -25.840 54.602  46.246 1.00 41.68  ? 550 LEU B O     1 
ATOM   4466 C CB    . LEU F 3 198 ? -23.317 55.142  44.685 1.00 30.41  ? 550 LEU B CB    1 
ATOM   4467 C CG    . LEU F 3 198 ? -22.717 54.916  43.299 1.00 32.76  ? 550 LEU B CG    1 
ATOM   4468 C CD1   . LEU F 3 198 ? -21.580 53.906  43.423 1.00 24.66  ? 550 LEU B CD1   1 
ATOM   4469 C CD2   . LEU F 3 198 ? -23.786 54.430  42.309 1.00 28.00  ? 550 LEU B CD2   1 
ATOM   4470 N N     . ALA F 3 199 ? -25.319 56.688  46.890 1.00 37.12  ? 551 ALA B N     1 
ATOM   4471 C CA    . ALA F 3 199 ? -25.982 56.524  48.173 1.00 37.80  ? 551 ALA B CA    1 
ATOM   4472 C C     . ALA F 3 199 ? -27.449 56.911  48.063 1.00 39.11  ? 551 ALA B C     1 
ATOM   4473 O O     . ALA F 3 199 ? -28.291 56.355  48.757 1.00 42.45  ? 551 ALA B O     1 
ATOM   4474 C CB    . ALA F 3 199 ? -25.291 57.326  49.230 1.00 41.51  ? 551 ALA B CB    1 
ATOM   4475 N N     . TYR F 3 200 ? -27.755 57.850  47.174 1.00 39.45  ? 552 TYR B N     1 
ATOM   4476 C CA    . TYR F 3 200 ? -29.135 58.281  46.955 1.00 41.20  ? 552 TYR B CA    1 
ATOM   4477 C C     . TYR F 3 200 ? -29.829 57.395  45.909 1.00 42.29  ? 552 TYR B C     1 
ATOM   4478 O O     . TYR F 3 200 ? -31.056 57.204  45.958 1.00 40.95  ? 552 TYR B O     1 
ATOM   4479 C CB    . TYR F 3 200 ? -29.168 59.744  46.483 1.00 42.36  ? 552 TYR B CB    1 
ATOM   4480 C CG    . TYR F 3 200 ? -30.551 60.374  46.478 1.00 45.12  ? 552 TYR B CG    1 
ATOM   4481 C CD1   . TYR F 3 200 ? -31.437 60.175  45.414 1.00 46.46  ? 552 TYR B CD1   1 
ATOM   4482 C CD2   . TYR F 3 200 ? -30.967 61.183  47.535 1.00 47.48  ? 552 TYR B CD2   1 
ATOM   4483 C CE1   . TYR F 3 200 ? -32.712 60.770  45.406 1.00 49.10  ? 552 TYR B CE1   1 
ATOM   4484 C CE2   . TYR F 3 200 ? -32.234 61.782  47.541 1.00 49.98  ? 552 TYR B CE2   1 
ATOM   4485 C CZ    . TYR F 3 200 ? -33.103 61.578  46.476 1.00 51.78  ? 552 TYR B CZ    1 
ATOM   4486 O OH    . TYR F 3 200 ? -34.345 62.196  46.487 1.00 50.54  ? 552 TYR B OH    1 
ATOM   4487 N N     . GLY F 3 201 ? -29.042 56.910  44.942 1.00 40.88  ? 553 GLY B N     1 
ATOM   4488 C CA    . GLY F 3 201 ? -29.554 56.072  43.867 1.00 37.19  ? 553 GLY B CA    1 
ATOM   4489 C C     . GLY F 3 201 ? -29.736 56.908  42.613 1.00 35.73  ? 553 GLY B C     1 
ATOM   4490 O O     . GLY F 3 201 ? -30.405 57.941  42.642 1.00 31.68  ? 553 GLY B O     1 
ATOM   4491 N N     . ILE F 3 202 ? -29.172 56.450  41.499 1.00 37.45  ? 554 ILE B N     1 
ATOM   4492 C CA    . ILE F 3 202 ? -29.246 57.184  40.228 1.00 37.41  ? 554 ILE B CA    1 
ATOM   4493 C C     . ILE F 3 202 ? -30.654 57.419  39.681 1.00 39.66  ? 554 ILE B C     1 
ATOM   4494 O O     . ILE F 3 202 ? -30.972 58.496  39.177 1.00 40.36  ? 554 ILE B O     1 
ATOM   4495 C CB    . ILE F 3 202 ? -28.402 56.488  39.143 1.00 36.27  ? 554 ILE B CB    1 
ATOM   4496 C CG1   . ILE F 3 202 ? -26.947 56.403  39.593 1.00 32.58  ? 554 ILE B CG1   1 
ATOM   4497 C CG2   . ILE F 3 202 ? -28.500 57.245  37.825 1.00 41.52  ? 554 ILE B CG2   1 
ATOM   4498 C CD1   . ILE F 3 202 ? -26.068 55.655  38.643 1.00 37.02  ? 554 ILE B CD1   1 
ATOM   4499 N N     . ASP F 3 203 ? -31.491 56.395  39.764 1.00 43.44  ? 555 ASP B N     1 
ATOM   4500 C CA    . ASP F 3 203 ? -32.866 56.478  39.275 1.00 45.13  ? 555 ASP B CA    1 
ATOM   4501 C C     . ASP F 3 203 ? -33.647 57.441  40.161 1.00 45.82  ? 555 ASP B C     1 
ATOM   4502 O O     . ASP F 3 203 ? -34.329 58.354  39.694 1.00 48.10  ? 555 ASP B O     1 
ATOM   4503 C CB    . ASP F 3 203 ? -33.523 55.093  39.352 1.00 45.85  ? 555 ASP B CB    1 
ATOM   4504 C CG    . ASP F 3 203 ? -32.599 53.978  38.889 1.00 42.91  ? 555 ASP B CG    1 
ATOM   4505 O OD1   . ASP F 3 203 ? -32.507 53.775  37.664 1.00 37.73  ? 555 ASP B OD1   1 
ATOM   4506 O OD2   . ASP F 3 203 ? -31.971 53.311  39.749 1.00 45.91  ? 555 ASP B OD2   1 
ATOM   4507 N N     . ASP F 3 204 ? -33.524 57.202  41.459 1.00 46.95  ? 556 ASP B N     1 
ATOM   4508 C CA    . ASP F 3 204 ? -34.178 57.976  42.496 1.00 46.14  ? 556 ASP B CA    1 
ATOM   4509 C C     . ASP F 3 204 ? -34.002 59.476  42.264 1.00 45.61  ? 556 ASP B C     1 
ATOM   4510 O O     . ASP F 3 204 ? -34.978 60.234  42.273 1.00 47.87  ? 556 ASP B O     1 
ATOM   4511 C CB    . ASP F 3 204 ? -33.592 57.572  43.850 1.00 47.68  ? 556 ASP B CB    1 
ATOM   4512 C CG    . ASP F 3 204 ? -33.541 56.066  44.035 1.00 49.75  ? 556 ASP B CG    1 
ATOM   4513 O OD1   . ASP F 3 204 ? -32.709 55.395  43.369 1.00 45.99  ? 556 ASP B OD1   1 
ATOM   4514 O OD2   . ASP F 3 204 ? -34.344 55.556  44.842 1.00 47.12  ? 556 ASP B OD2   1 
ATOM   4515 N N     . TYR F 3 205 ? -32.760 59.904  42.056 1.00 40.55  ? 557 TYR B N     1 
ATOM   4516 C CA    . TYR F 3 205 ? -32.491 61.309  41.821 1.00 36.45  ? 557 TYR B CA    1 
ATOM   4517 C C     . TYR F 3 205 ? -32.998 61.790  40.457 1.00 38.73  ? 557 TYR B C     1 
ATOM   4518 O O     . TYR F 3 205 ? -33.455 62.928  40.332 1.00 38.05  ? 557 TYR B O     1 
ATOM   4519 C CB    . TYR F 3 205 ? -31.005 61.629  41.993 1.00 33.72  ? 557 TYR B CB    1 
ATOM   4520 C CG    . TYR F 3 205 ? -30.752 63.114  41.994 1.00 33.77  ? 557 TYR B CG    1 
ATOM   4521 C CD1   . TYR F 3 205 ? -30.905 63.865  43.157 1.00 33.60  ? 557 TYR B CD1   1 
ATOM   4522 C CD2   . TYR F 3 205 ? -30.438 63.786  40.816 1.00 34.55  ? 557 TYR B CD2   1 
ATOM   4523 C CE1   . TYR F 3 205 ? -30.757 65.244  43.140 1.00 34.15  ? 557 TYR B CE1   1 
ATOM   4524 C CE2   . TYR F 3 205 ? -30.290 65.159  40.787 1.00 30.89  ? 557 TYR B CE2   1 
ATOM   4525 C CZ    . TYR F 3 205 ? -30.449 65.884  41.946 1.00 31.79  ? 557 TYR B CZ    1 
ATOM   4526 O OH    . TYR F 3 205 ? -30.290 67.250  41.909 1.00 34.73  ? 557 TYR B OH    1 
ATOM   4527 N N     . ILE F 3 206 ? -32.903 60.943  39.435 1.00 41.30  ? 558 ILE B N     1 
ATOM   4528 C CA    . ILE F 3 206 ? -33.385 61.311  38.105 1.00 43.30  ? 558 ILE B CA    1 
ATOM   4529 C C     . ILE F 3 206 ? -34.879 61.649  38.125 1.00 43.81  ? 558 ILE B C     1 
ATOM   4530 O O     . ILE F 3 206 ? -35.297 62.667  37.564 1.00 44.07  ? 558 ILE B O     1 
ATOM   4531 C CB    . ILE F 3 206 ? -33.083 60.192  37.060 1.00 46.34  ? 558 ILE B CB    1 
ATOM   4532 C CG1   . ILE F 3 206 ? -31.614 60.278  36.629 1.00 46.42  ? 558 ILE B CG1   1 
ATOM   4533 C CG2   . ILE F 3 206 ? -34.000 60.316  35.836 1.00 45.88  ? 558 ILE B CG2   1 
ATOM   4534 C CD1   . ILE F 3 206 ? -31.194 59.251  35.607 1.00 45.13  ? 558 ILE B CD1   1 
ATOM   4535 N N     . SER F 3 207 ? -35.672 60.801  38.781 1.00 45.55  ? 559 SER B N     1 
ATOM   4536 C CA    . SER F 3 207 ? -37.120 61.000  38.888 1.00 47.42  ? 559 SER B CA    1 
ATOM   4537 C C     . SER F 3 207 ? -37.416 62.205  39.768 1.00 48.14  ? 559 SER B C     1 
ATOM   4538 O O     . SER F 3 207 ? -38.276 63.033  39.445 1.00 48.02  ? 559 SER B O     1 
ATOM   4539 C CB    . SER F 3 207 ? -37.791 59.755  39.469 1.00 45.18  ? 559 SER B CB    1 
ATOM   4540 O OG    . SER F 3 207 ? -37.143 59.339  40.661 1.00 51.15  ? 559 SER B OG    1 
ATOM   4541 N N     . TYR F 3 208 ? -36.702 62.288  40.886 1.00 46.55  ? 560 TYR B N     1 
ATOM   4542 C CA    . TYR F 3 208 ? -36.863 63.387  41.814 1.00 43.53  ? 560 TYR B CA    1 
ATOM   4543 C C     . TYR F 3 208 ? -36.653 64.701  41.065 1.00 44.29  ? 560 TYR B C     1 
ATOM   4544 O O     . TYR F 3 208 ? -37.562 65.531  40.970 1.00 41.91  ? 560 TYR B O     1 
ATOM   4545 C CB    . TYR F 3 208 ? -35.862 63.259  42.967 1.00 42.12  ? 560 TYR B CB    1 
ATOM   4546 C CG    . TYR F 3 208 ? -35.605 64.574  43.648 1.00 45.48  ? 560 TYR B CG    1 
ATOM   4547 C CD1   . TYR F 3 208 ? -36.551 65.129  44.508 1.00 46.37  ? 560 TYR B CD1   1 
ATOM   4548 C CD2   . TYR F 3 208 ? -34.474 65.330  43.333 1.00 42.31  ? 560 TYR B CD2   1 
ATOM   4549 C CE1   . TYR F 3 208 ? -36.383 66.412  45.025 1.00 49.87  ? 560 TYR B CE1   1 
ATOM   4550 C CE2   . TYR F 3 208 ? -34.297 66.610  43.837 1.00 44.21  ? 560 TYR B CE2   1 
ATOM   4551 C CZ    . TYR F 3 208 ? -35.254 67.152  44.681 1.00 49.27  ? 560 TYR B CZ    1 
ATOM   4552 O OH    . TYR F 3 208 ? -35.102 68.445  45.151 1.00 50.59  ? 560 TYR B OH    1 
ATOM   4553 N N     . TYR F 3 209 ? -35.463 64.863  40.499 1.00 46.47  ? 561 TYR B N     1 
ATOM   4554 C CA    . TYR F 3 209 ? -35.126 66.076  39.766 1.00 49.28  ? 561 TYR B CA    1 
ATOM   4555 C C     . TYR F 3 209 ? -36.163 66.376  38.679 1.00 53.74  ? 561 TYR B C     1 
ATOM   4556 O O     . TYR F 3 209 ? -36.676 67.501  38.600 1.00 55.38  ? 561 TYR B O     1 
ATOM   4557 C CB    . TYR F 3 209 ? -33.710 65.970  39.171 1.00 41.48  ? 561 TYR B CB    1 
ATOM   4558 C CG    . TYR F 3 209 ? -33.298 67.156  38.315 1.00 39.71  ? 561 TYR B CG    1 
ATOM   4559 C CD1   . TYR F 3 209 ? -33.798 67.303  37.023 1.00 41.48  ? 561 TYR B CD1   1 
ATOM   4560 C CD2   . TYR F 3 209 ? -32.397 68.121  38.786 1.00 36.62  ? 561 TYR B CD2   1 
ATOM   4561 C CE1   . TYR F 3 209 ? -33.416 68.369  36.215 1.00 45.33  ? 561 TYR B CE1   1 
ATOM   4562 C CE2   . TYR F 3 209 ? -32.002 69.204  37.980 1.00 34.30  ? 561 TYR B CE2   1 
ATOM   4563 C CZ    . TYR F 3 209 ? -32.520 69.316  36.693 1.00 41.21  ? 561 TYR B CZ    1 
ATOM   4564 O OH    . TYR F 3 209 ? -32.162 70.343  35.848 1.00 38.66  ? 561 TYR B OH    1 
ATOM   4565 N N     . GLU F 3 210 ? -36.473 65.374  37.857 1.00 53.29  ? 562 GLU B N     1 
ATOM   4566 C CA    . GLU F 3 210 ? -37.441 65.537  36.777 1.00 55.06  ? 562 GLU B CA    1 
ATOM   4567 C C     . GLU F 3 210 ? -38.873 65.818  37.229 1.00 54.37  ? 562 GLU B C     1 
ATOM   4568 O O     . GLU F 3 210 ? -39.657 66.400  36.479 1.00 49.38  ? 562 GLU B O     1 
ATOM   4569 C CB    . GLU F 3 210 ? -37.426 64.317  35.861 1.00 59.62  ? 562 GLU B CB    1 
ATOM   4570 C CG    . GLU F 3 210 ? -36.278 64.300  34.882 1.00 63.15  ? 562 GLU B CG    1 
ATOM   4571 C CD    . GLU F 3 210 ? -36.451 63.238  33.826 1.00 66.91  ? 562 GLU B CD    1 
ATOM   4572 O OE1   . GLU F 3 210 ? -37.496 63.242  33.139 1.00 69.48  ? 562 GLU B OE1   1 
ATOM   4573 O OE2   . GLU F 3 210 ? -35.546 62.392  33.683 1.00 73.00  ? 562 GLU B OE2   1 
ATOM   4574 N N     . ALA F 3 211 ? -39.212 65.386  38.440 1.00 55.47  ? 563 ALA B N     1 
ATOM   4575 C CA    . ALA F 3 211 ? -40.550 65.588  38.991 1.00 57.65  ? 563 ALA B CA    1 
ATOM   4576 C C     . ALA F 3 211 ? -40.905 67.070  39.143 1.00 57.47  ? 563 ALA B C     1 
ATOM   4577 O O     . ALA F 3 211 ? -42.036 67.480  38.856 1.00 61.43  ? 563 ALA B O     1 
ATOM   4578 C CB    . ALA F 3 211 ? -40.680 64.864  40.341 1.00 56.69  ? 563 ALA B CB    1 
ATOM   4579 N N     . GLU F 3 212 ? -39.937 67.868  39.586 1.00 55.47  ? 564 GLU B N     1 
ATOM   4580 C CA    . GLU F 3 212 ? -40.144 69.297  39.787 1.00 53.35  ? 564 GLU B CA    1 
ATOM   4581 C C     . GLU F 3 212 ? -40.458 70.010  38.478 1.00 51.28  ? 564 GLU B C     1 
ATOM   4582 O O     . GLU F 3 212 ? -39.564 70.285  37.684 1.00 48.41  ? 564 GLU B O     1 
ATOM   4583 C CB    . GLU F 3 212 ? -38.910 69.915  40.429 1.00 55.20  ? 564 GLU B CB    1 
ATOM   4584 C CG    . GLU F 3 212 ? -38.390 69.145  41.636 1.00 60.54  ? 564 GLU B CG    1 
ATOM   4585 C CD    . GLU F 3 212 ? -39.369 69.125  42.788 1.00 62.53  ? 564 GLU B CD    1 
ATOM   4586 O OE1   . GLU F 3 212 ? -39.937 70.196  43.095 1.00 68.50  ? 564 GLU B OE1   1 
ATOM   4587 O OE2   . GLU F 3 212 ? -39.565 68.047  43.391 1.00 60.45  ? 564 GLU B OE2   1 
ATOM   4588 N N     . GLU F 3 220 ? -32.510 71.075  46.044 1.00 44.05  ? 572 GLU B N     1 
ATOM   4589 C CA    . GLU F 3 220 ? -32.339 70.381  44.772 1.00 46.89  ? 572 GLU B CA    1 
ATOM   4590 C C     . GLU F 3 220 ? -31.055 69.517  44.714 1.00 45.88  ? 572 GLU B C     1 
ATOM   4591 O O     . GLU F 3 220 ? -31.140 68.319  44.418 1.00 43.78  ? 572 GLU B O     1 
ATOM   4592 C CB    . GLU F 3 220 ? -32.437 71.367  43.590 1.00 47.93  ? 572 GLU B CB    1 
ATOM   4593 C CG    . GLU F 3 220 ? -33.834 71.949  43.363 1.00 56.63  ? 572 GLU B CG    1 
ATOM   4594 C CD    . GLU F 3 220 ? -34.532 71.460  42.089 1.00 58.95  ? 572 GLU B CD    1 
ATOM   4595 O OE1   . GLU F 3 220 ? -34.309 70.303  41.664 1.00 57.04  ? 572 GLU B OE1   1 
ATOM   4596 O OE2   . GLU F 3 220 ? -35.325 72.249  41.521 1.00 61.26  ? 572 GLU B OE2   1 
ATOM   4597 N N     . PRO F 3 221 ? -29.857 70.108  44.939 1.00 42.20  ? 573 PRO B N     1 
ATOM   4598 C CA    . PRO F 3 221 ? -28.734 69.162  44.860 1.00 39.88  ? 573 PRO B CA    1 
ATOM   4599 C C     . PRO F 3 221 ? -28.777 68.206  46.060 1.00 38.89  ? 573 PRO B C     1 
ATOM   4600 O O     . PRO F 3 221 ? -29.421 68.512  47.062 1.00 40.47  ? 573 PRO B O     1 
ATOM   4601 C CB    . PRO F 3 221 ? -27.508 70.078  44.900 1.00 40.25  ? 573 PRO B CB    1 
ATOM   4602 C CG    . PRO F 3 221 ? -27.969 71.225  45.704 1.00 40.86  ? 573 PRO B CG    1 
ATOM   4603 C CD    . PRO F 3 221 ? -29.342 71.478  45.122 1.00 41.36  ? 573 PRO B CD    1 
ATOM   4604 N N     . MET F 3 222 ? -28.159 67.034  45.936 1.00 37.50  ? 574 MET B N     1 
ATOM   4605 C CA    . MET F 3 222 ? -28.161 66.067  47.029 1.00 37.30  ? 574 MET B CA    1 
ATOM   4606 C C     . MET F 3 222 ? -27.423 66.685  48.204 1.00 39.26  ? 574 MET B C     1 
ATOM   4607 O O     . MET F 3 222 ? -26.538 67.510  48.001 1.00 41.69  ? 574 MET B O     1 
ATOM   4608 C CB    . MET F 3 222 ? -27.498 64.765  46.602 1.00 36.45  ? 574 MET B CB    1 
ATOM   4609 C CG    . MET F 3 222 ? -28.303 63.956  45.595 1.00 36.28  ? 574 MET B CG    1 
ATOM   4610 S SD    . MET F 3 222 ? -27.404 62.476  45.042 1.00 39.76  ? 574 MET B SD    1 
ATOM   4611 C CE    . MET F 3 222 ? -26.245 63.208  43.883 1.00 36.91  ? 574 MET B CE    1 
ATOM   4612 N N     . LYS F 3 223 ? -27.747 66.262  49.420 1.00 40.62  ? 575 LYS B N     1 
ATOM   4613 C CA    . LYS F 3 223 ? -27.127 66.859  50.599 1.00 44.92  ? 575 LYS B CA    1 
ATOM   4614 C C     . LYS F 3 223 ? -27.076 65.913  51.797 1.00 43.92  ? 575 LYS B C     1 
ATOM   4615 O O     . LYS F 3 223 ? -27.781 64.911  51.827 1.00 46.31  ? 575 LYS B O     1 
ATOM   4616 C CB    . LYS F 3 223 ? -27.915 68.122  50.985 1.00 46.25  ? 575 LYS B CB    1 
ATOM   4617 C CG    . LYS F 3 223 ? -27.104 69.182  51.703 1.00 55.05  ? 575 LYS B CG    1 
ATOM   4618 C CD    . LYS F 3 223 ? -25.988 69.740  50.808 1.00 60.21  ? 575 LYS B CD    1 
ATOM   4619 C CE    . LYS F 3 223 ? -25.050 70.652  51.595 1.00 62.56  ? 575 LYS B CE    1 
ATOM   4620 N NZ    . LYS F 3 223 ? -24.547 69.990  52.842 1.00 59.38  ? 575 LYS B NZ    1 
ATOM   4621 N N     . ASN F 3 224 ? -26.256 66.263  52.785 1.00 42.82  ? 576 ASN B N     1 
ATOM   4622 C CA    . ASN F 3 224 ? -26.091 65.492  54.014 1.00 44.44  ? 576 ASN B CA    1 
ATOM   4623 C C     . ASN F 3 224 ? -26.236 63.983  53.801 1.00 43.84  ? 576 ASN B C     1 
ATOM   4624 O O     . ASN F 3 224 ? -27.257 63.386  54.156 1.00 46.44  ? 576 ASN B O     1 
ATOM   4625 C CB    . ASN F 3 224 ? -27.065 65.987  55.099 1.00 44.20  ? 576 ASN B CB    1 
ATOM   4626 C CG    . ASN F 3 224 ? -26.962 65.173  56.383 1.00 47.37  ? 576 ASN B CG    1 
ATOM   4627 O OD1   . ASN F 3 224 ? -25.859 64.834  56.839 1.00 45.39  ? 576 ASN B OD1   1 
ATOM   4628 N ND2   . ASN F 3 224 ? -28.109 64.807  56.941 1.00 42.40  ? 576 ASN B ND2   1 
ATOM   4629 N N     . LEU F 3 225 ? -25.203 63.381  53.218 1.00 41.64  ? 577 LEU B N     1 
ATOM   4630 C CA    . LEU F 3 225 ? -25.180 61.946  52.921 1.00 38.17  ? 577 LEU B CA    1 
ATOM   4631 C C     . LEU F 3 225 ? -23.845 61.276  53.288 1.00 33.77  ? 577 LEU B C     1 
ATOM   4632 O O     . LEU F 3 225 ? -23.687 60.069  53.152 1.00 30.56  ? 577 LEU B O     1 
ATOM   4633 C CB    . LEU F 3 225 ? -25.476 61.732  51.430 1.00 37.04  ? 577 LEU B CB    1 
ATOM   4634 C CG    . LEU F 3 225 ? -26.854 61.329  50.878 1.00 37.91  ? 577 LEU B CG    1 
ATOM   4635 C CD1   . LEU F 3 225 ? -28.011 61.833  51.702 1.00 40.20  ? 577 LEU B CD1   1 
ATOM   4636 C CD2   . LEU F 3 225 ? -26.969 61.851  49.457 1.00 41.92  ? 577 LEU B CD2   1 
ATOM   4637 N N     . THR F 3 226 ? -22.896 62.061  53.781 1.00 36.37  ? 578 THR B N     1 
ATOM   4638 C CA    . THR F 3 226 ? -21.579 61.545  54.154 1.00 36.32  ? 578 THR B CA    1 
ATOM   4639 C C     . THR F 3 226 ? -21.638 60.430  55.210 1.00 39.89  ? 578 THR B C     1 
ATOM   4640 O O     . THR F 3 226 ? -20.798 59.514  55.227 1.00 44.47  ? 578 THR B O     1 
ATOM   4641 C CB    . THR F 3 226 ? -20.688 62.709  54.636 1.00 33.28  ? 578 THR B CB    1 
ATOM   4642 O OG1   . THR F 3 226 ? -20.643 63.696  53.603 1.00 27.64  ? 578 THR B OG1   1 
ATOM   4643 C CG2   . THR F 3 226 ? -19.261 62.243  54.955 1.00 21.91  ? 578 THR B CG2   1 
ATOM   4644 N N     . PRO F 3 235 ? -8.376  65.394  65.751 1.00 45.59  ? 587 PRO B N     1 
ATOM   4645 C CA    . PRO F 3 235 ? -8.844  66.638  66.375 1.00 48.80  ? 587 PRO B CA    1 
ATOM   4646 C C     . PRO F 3 235 ? -9.761  67.427  65.451 1.00 49.62  ? 587 PRO B C     1 
ATOM   4647 O O     . PRO F 3 235 ? -9.671  67.299  64.233 1.00 56.35  ? 587 PRO B O     1 
ATOM   4648 C CB    . PRO F 3 235 ? -7.539  67.397  66.665 1.00 46.56  ? 587 PRO B CB    1 
ATOM   4649 C CG    . PRO F 3 235 ? -6.610  66.917  65.621 1.00 42.41  ? 587 PRO B CG    1 
ATOM   4650 C CD    . PRO F 3 235 ? -6.916  65.430  65.550 1.00 48.01  ? 587 PRO B CD    1 
ATOM   4651 N N     . THR F 3 236 ? -10.646 68.239  66.021 1.00 47.16  ? 588 THR B N     1 
ATOM   4652 C CA    . THR F 3 236 ? -11.559 69.024  65.207 1.00 44.41  ? 588 THR B CA    1 
ATOM   4653 C C     . THR F 3 236 ? -10.826 70.051  64.334 1.00 44.67  ? 588 THR B C     1 
ATOM   4654 O O     . THR F 3 236 ? -9.927  70.760  64.811 1.00 47.23  ? 588 THR B O     1 
ATOM   4655 C CB    . THR F 3 236 ? -12.668 69.690  66.077 1.00 44.77  ? 588 THR B CB    1 
ATOM   4656 O OG1   . THR F 3 236 ? -13.688 68.723  66.352 1.00 42.26  ? 588 THR B OG1   1 
ATOM   4657 C CG2   . THR F 3 236 ? -13.301 70.897  65.385 1.00 41.60  ? 588 THR B CG2   1 
ATOM   4658 N N     . PRO F 3 237 ? -11.139 70.071  63.023 1.00 39.63  ? 589 PRO B N     1 
ATOM   4659 C CA    . PRO F 3 237 ? -10.549 70.983  62.042 1.00 35.47  ? 589 PRO B CA    1 
ATOM   4660 C C     . PRO F 3 237 ? -11.309 72.302  62.078 1.00 31.01  ? 589 PRO B C     1 
ATOM   4661 O O     . PRO F 3 237 ? -12.492 72.329  62.421 1.00 31.66  ? 589 PRO B O     1 
ATOM   4662 C CB    . PRO F 3 237 ? -10.830 70.289  60.709 1.00 32.62  ? 589 PRO B CB    1 
ATOM   4663 C CG    . PRO F 3 237 ? -11.052 68.875  61.077 1.00 38.92  ? 589 PRO B CG    1 
ATOM   4664 C CD    . PRO F 3 237 ? -11.851 68.987  62.321 1.00 36.59  ? 589 PRO B CD    1 
ATOM   4665 N N     . GLY F 3 238 ? -10.635 73.392  61.743 1.00 30.04  ? 590 GLY B N     1 
ATOM   4666 C CA    . GLY F 3 238 ? -11.312 74.674  61.713 1.00 28.61  ? 590 GLY B CA    1 
ATOM   4667 C C     . GLY F 3 238 ? -11.387 75.285  63.086 1.00 25.35  ? 590 GLY B C     1 
ATOM   4668 O O     . GLY F 3 238 ? -12.392 75.868  63.464 1.00 26.08  ? 590 GLY B O     1 
ATOM   4669 N N     . ASN F 3 239 ? -10.295 75.143  63.817 1.00 23.82  ? 591 ASN B N     1 
ATOM   4670 C CA    . ASN F 3 239 ? -10.173 75.671  65.154 1.00 24.49  ? 591 ASN B CA    1 
ATOM   4671 C C     . ASN F 3 239 ? -8.703  76.019  65.295 1.00 23.17  ? 591 ASN B C     1 
ATOM   4672 O O     . ASN F 3 239 ? -7.918  75.225  65.782 1.00 32.13  ? 591 ASN B O     1 
ATOM   4673 C CB    . ASN F 3 239 ? -10.574 74.607  66.185 1.00 25.08  ? 591 ASN B CB    1 
ATOM   4674 C CG    . ASN F 3 239 ? -10.426 75.091  67.631 1.00 26.68  ? 591 ASN B CG    1 
ATOM   4675 O OD1   . ASN F 3 239 ? -10.423 76.293  67.906 1.00 29.42  ? 591 ASN B OD1   1 
ATOM   4676 N ND2   . ASN F 3 239 ? -10.320 74.148  68.556 1.00 26.84  ? 591 ASN B ND2   1 
ATOM   4677 N N     . TYR F 3 240 ? -8.311  77.170  64.766 1.00 21.68  ? 592 TYR B N     1 
ATOM   4678 C CA    . TYR F 3 240 ? -6.930  77.605  64.868 1.00 22.30  ? 592 TYR B CA    1 
ATOM   4679 C C     . TYR F 3 240 ? -6.888  78.537  66.074 1.00 23.25  ? 592 TYR B C     1 
ATOM   4680 O O     . TYR F 3 240 ? -7.122  79.737  65.962 1.00 21.67  ? 592 TYR B O     1 
ATOM   4681 C CB    . TYR F 3 240 ? -6.474  78.275  63.560 1.00 22.31  ? 592 TYR B CB    1 
ATOM   4682 C CG    . TYR F 3 240 ? -6.460  77.316  62.359 1.00 21.14  ? 592 TYR B CG    1 
ATOM   4683 C CD1   . TYR F 3 240 ? -7.647  76.874  61.792 1.00 20.52  ? 592 TYR B CD1   1 
ATOM   4684 C CD2   . TYR F 3 240 ? -5.263  76.849  61.814 1.00 22.90  ? 592 TYR B CD2   1 
ATOM   4685 C CE1   . TYR F 3 240 ? -7.662  76.001  60.731 1.00 28.19  ? 592 TYR B CE1   1 
ATOM   4686 C CE2   . TYR F 3 240 ? -5.261  75.969  60.733 1.00 24.47  ? 592 TYR B CE2   1 
ATOM   4687 C CZ    . TYR F 3 240 ? -6.479  75.547  60.198 1.00 31.75  ? 592 TYR B CZ    1 
ATOM   4688 O OH    . TYR F 3 240 ? -6.547  74.678  59.126 1.00 35.85  ? 592 TYR B OH    1 
ATOM   4689 N N     . ASN F 3 241 ? -6.707  77.927  67.243 1.00 27.08  ? 593 ASN B N     1 
ATOM   4690 C CA    . ASN F 3 241 ? -6.673  78.624  68.525 1.00 31.60  ? 593 ASN B CA    1 
ATOM   4691 C C     . ASN F 3 241 ? -5.293  79.126  68.969 1.00 34.29  ? 593 ASN B C     1 
ATOM   4692 O O     . ASN F 3 241 ? -4.393  79.267  68.142 1.00 36.65  ? 593 ASN B O     1 
ATOM   4693 C CB    . ASN F 3 241 ? -7.319  77.747  69.607 1.00 36.49  ? 593 ASN B CB    1 
ATOM   4694 C CG    . ASN F 3 241 ? -6.617  76.409  69.793 1.00 41.20  ? 593 ASN B CG    1 
ATOM   4695 O OD1   . ASN F 3 241 ? -5.514  76.185  69.287 1.00 44.44  ? 593 ASN B OD1   1 
ATOM   4696 N ND2   . ASN F 3 241 ? -7.261  75.507  70.528 1.00 42.27  ? 593 ASN B ND2   1 
ATOM   4697 N N     . SER F 3 242 ? -5.148  79.468  70.251 1.00 35.66  ? 594 SER B N     1 
ATOM   4698 C CA    . SER F 3 242 ? -3.868  79.964  70.762 1.00 39.66  ? 594 SER B CA    1 
ATOM   4699 C C     . SER F 3 242 ? -2.862  78.863  71.077 1.00 38.61  ? 594 SER B C     1 
ATOM   4700 O O     . SER F 3 242 ? -3.234  77.797  71.569 1.00 45.21  ? 594 SER B O     1 
ATOM   4701 C CB    . SER F 3 242 ? -4.093  80.833  71.995 1.00 39.34  ? 594 SER B CB    1 
ATOM   4702 O OG    . SER F 3 242 ? -5.031  80.231  72.865 1.00 42.75  ? 594 SER B OG    1 
HETATM 4703 O O     . HOH G 4 .   ? -0.638  32.280  28.184 1.00 40.58  ? 800 HOH C O     1 
HETATM 4704 O O     . HOH G 4 .   ? 7.901   22.461  12.897 1.00 21.97  ? 804 HOH C O     1 
HETATM 4705 O O     . HOH G 4 .   ? 22.262  18.073  13.513 1.00 18.30  ? 805 HOH C O     1 
HETATM 4706 O O     . HOH G 4 .   ? -0.533  29.464  33.343 1.00 21.07  ? 809 HOH C O     1 
HETATM 4707 O O     . HOH G 4 .   ? 28.875  15.884  11.999 1.00 24.60  ? 811 HOH C O     1 
HETATM 4708 O O     . HOH G 4 .   ? -6.720  48.416  31.846 1.00 31.16  ? 815 HOH C O     1 
HETATM 4709 O O     . HOH G 4 .   ? 0.870   36.568  35.893 1.00 29.27  ? 841 HOH C O     1 
HETATM 4710 O O     . HOH G 4 .   ? 3.734   31.404  20.633 1.00 42.18  ? 849 HOH C O     1 
HETATM 4711 O O     . HOH G 4 .   ? 5.560   27.954  29.129 1.00 19.50  ? 851 HOH C O     1 
HETATM 4712 O O     . HOH G 4 .   ? 3.836   24.237  26.368 1.00 29.88  ? 852 HOH C O     1 
HETATM 4713 O O     . HOH G 4 .   ? 4.121   22.774  18.602 1.00 51.33  ? 858 HOH C O     1 
HETATM 4714 O O     . HOH G 4 .   ? -8.751  48.555  35.132 1.00 45.45  ? 869 HOH C O     1 
HETATM 4715 O O     . HOH G 4 .   ? 8.444   32.160  10.657 1.00 43.34  ? 879 HOH C O     1 
HETATM 4716 O O     . HOH G 4 .   ? 2.619   23.252  33.506 1.00 25.26  ? 880 HOH C O     1 
HETATM 4717 O O     . HOH G 4 .   ? -0.375  23.334  31.296 1.00 30.90  ? 888 HOH C O     1 
HETATM 4718 O O     . HOH G 4 .   ? 19.804  16.131  12.375 1.00 40.83  ? 892 HOH C O     1 
HETATM 4719 O O     . HOH G 4 .   ? 3.018   23.133  22.238 1.00 36.95  ? 893 HOH C O     1 
HETATM 4720 O O     . HOH H 4 .   ? -1.544  38.565  45.636 1.00 18.91  ? 806 HOH D O     1 
HETATM 4721 O O     . HOH H 4 .   ? 16.756  25.545  30.211 1.00 17.17  ? 820 HOH D O     1 
HETATM 4722 O O     . HOH H 4 .   ? 15.224  19.482  17.419 1.00 22.24  ? 825 HOH D O     1 
HETATM 4723 O O     . HOH H 4 .   ? -4.343  38.595  42.431 1.00 31.68  ? 840 HOH D O     1 
HETATM 4724 O O     . HOH H 4 .   ? 13.595  24.008  6.598  1.00 42.72  ? 844 HOH D O     1 
HETATM 4725 O O     . HOH H 4 .   ? 16.645  22.453  5.659  1.00 62.82  ? 845 HOH D O     1 
HETATM 4726 O O     . HOH H 4 .   ? 6.804   35.746  21.070 1.00 26.68  ? 848 HOH D O     1 
HETATM 4727 O O     . HOH H 4 .   ? 7.405   26.132  28.759 1.00 29.15  ? 850 HOH D O     1 
HETATM 4728 O O     . HOH H 4 .   ? 9.477   32.808  28.478 1.00 23.64  ? 854 HOH D O     1 
HETATM 4729 O O     . HOH H 4 .   ? -8.863  45.746  34.219 1.00 18.72  ? 856 HOH D O     1 
HETATM 4730 O O     . HOH H 4 .   ? 15.523  22.211  18.512 1.00 15.94  ? 860 HOH D O     1 
HETATM 4731 O O     . HOH H 4 .   ? 13.995  21.324  30.677 1.00 33.08  ? 870 HOH D O     1 
HETATM 4732 O O     . HOH H 4 .   ? 6.971   24.618  31.267 1.00 25.86  ? 882 HOH D O     1 
HETATM 4733 O O     . HOH H 4 .   ? 6.511   23.292  27.322 1.00 55.97  ? 883 HOH D O     1 
HETATM 4734 O O     . HOH H 4 .   ? -0.686  37.002  25.985 1.00 27.36  ? 894 HOH D O     1 
HETATM 4735 O O     . HOH H 4 .   ? 18.071  21.238  3.726  1.00 76.31  ? 900 HOH D O     1 
HETATM 4736 O O     . HOH I 4 .   ? -16.455 62.662  52.248 1.00 32.38  ? 800 HOH E O     1 
HETATM 4737 O O     . HOH I 4 .   ? -19.088 75.151  68.259 1.00 15.63  ? 804 HOH E O     1 
HETATM 4738 O O     . HOH I 4 .   ? -15.129 89.765  66.983 1.00 23.12  ? 805 HOH E O     1 
HETATM 4739 O O     . HOH I 4 .   ? -18.445 64.683  47.025 1.00 17.55  ? 809 HOH E O     1 
HETATM 4740 O O     . HOH I 4 .   ? -7.659  49.189  48.086 1.00 34.25  ? 815 HOH E O     1 
HETATM 4741 O O     . HOH I 4 .   ? -14.946 66.984  59.885 1.00 27.87  ? 849 HOH E O     1 
HETATM 4742 O O     . HOH I 4 .   ? -16.170 70.290  51.300 1.00 21.22  ? 851 HOH E O     1 
HETATM 4743 O O     . HOH I 4 .   ? -20.641 71.174  54.439 1.00 43.48  ? 852 HOH E O     1 
HETATM 4744 O O     . HOH I 4 .   ? -10.319 59.670  43.057 1.00 36.13  ? 855 HOH E O     1 
HETATM 4745 O O     . HOH I 4 .   ? -21.742 72.458  61.967 1.00 42.96  ? 858 HOH E O     1 
HETATM 4746 O O     . HOH I 4 .   ? -7.536  47.125  45.856 1.00 38.18  ? 869 HOH E O     1 
HETATM 4747 O O     . HOH I 4 .   ? -11.858 71.070  68.655 1.00 51.81  ? 879 HOH E O     1 
HETATM 4748 O O     . HOH I 4 .   ? -21.710 70.767  47.112 1.00 25.58  ? 880 HOH E O     1 
HETATM 4749 O O     . HOH I 4 .   ? -23.534 68.170  49.522 1.00 19.03  ? 888 HOH E O     1 
HETATM 4750 O O     . HOH I 4 .   ? -21.168 71.421  58.461 1.00 45.86  ? 893 HOH E O     1 
HETATM 4751 O O     . HOH J 4 .   ? -18.145 51.541  40.705 1.00 38.55  ? 837 HOH F O     1 
HETATM 4752 O O     . HOH J 4 .   ? -13.222 56.030  38.159 1.00 33.71  ? 840 HOH F O     1 
HETATM 4753 O O     . HOH J 4 .   ? -15.518 78.341  74.115 1.00 42.21  ? 844 HOH F O     1 
HETATM 4754 O O     . HOH J 4 .   ? -15.521 81.066  75.614 1.00 34.22  ? 845 HOH F O     1 
HETATM 4755 O O     . HOH J 4 .   ? -8.968  66.559  59.575 1.00 30.10  ? 848 HOH F O     1 
HETATM 4756 O O     . HOH J 4 .   ? -16.465 72.806  51.993 1.00 21.58  ? 850 HOH F O     1 
HETATM 4757 O O     . HOH J 4 .   ? -9.566  70.814  51.891 1.00 24.18  ? 854 HOH F O     1 
HETATM 4758 O O     . HOH J 4 .   ? -9.679  48.512  46.196 1.00 25.86  ? 856 HOH F O     1 
HETATM 4759 O O     . HOH J 4 .   ? -15.126 81.909  62.047 1.00 31.62  ? 860 HOH F O     1 
HETATM 4760 O O     . HOH J 4 .   ? -8.020  72.639  50.878 1.00 40.58  ? 868 HOH F O     1 
HETATM 4761 O O     . HOH J 4 .   ? -19.021 73.418  53.129 1.00 34.91  ? 883 HOH F O     1 
HETATM 4762 O O     . HOH J 4 .   ? -12.749 59.861  54.180 1.00 31.16  ? 894 HOH F O     1 
HETATM 4763 O O     . HOH J 4 .   ? -15.504 85.881  76.728 1.00 44.11  ? 900 HOH F O     1 
HETATM 4764 O O     . HOH K 4 .   ? 1.286   30.499  34.919 1.00 14.72  ? 801 HOH A O     1 
HETATM 4765 O O     . HOH K 4 .   ? 23.285  28.386  34.476 1.00 2.00   ? 802 HOH A O     1 
HETATM 4766 O O     . HOH K 4 .   ? 16.584  23.190  15.984 1.00 20.42  ? 803 HOH A O     1 
HETATM 4767 O O     . HOH K 4 .   ? 5.778   36.795  40.676 1.00 23.75  ? 804 HOH A O     1 
HETATM 4768 O O     . HOH K 4 .   ? -6.523  30.580  29.102 1.00 34.84  ? 805 HOH A O     1 
HETATM 4769 O O     . HOH K 4 .   ? -3.371  25.373  50.589 1.00 34.13  ? 806 HOH A O     1 
HETATM 4770 O O     . HOH K 4 .   ? 36.111  23.145  14.575 1.00 39.96  ? 807 HOH A O     1 
HETATM 4771 O O     . HOH K 4 .   ? 1.297   20.467  33.663 1.00 38.94  ? 808 HOH A O     1 
HETATM 4772 O O     . HOH K 4 .   ? 21.516  20.632  13.390 1.00 19.16  ? 809 HOH A O     1 
HETATM 4773 O O     . HOH K 4 .   ? -11.155 36.212  47.717 1.00 56.26  ? 810 HOH A O     1 
HETATM 4774 O O     . HOH K 4 .   ? 33.041  20.626  30.116 1.00 28.51  ? 811 HOH A O     1 
HETATM 4775 O O     . HOH K 4 .   ? 34.759  28.660  30.091 1.00 34.35  ? 812 HOH A O     1 
HETATM 4776 O O     . HOH K 4 .   ? 23.437  30.698  32.602 1.00 37.27  ? 813 HOH A O     1 
HETATM 4777 O O     . HOH K 4 .   ? 18.442  18.420  28.139 1.00 37.91  ? 814 HOH A O     1 
HETATM 4778 O O     . HOH K 4 .   ? 18.095  20.848  24.918 1.00 22.66  ? 815 HOH A O     1 
HETATM 4779 O O     . HOH K 4 .   ? 16.086  28.083  18.073 1.00 23.28  ? 816 HOH A O     1 
HETATM 4780 O O     . HOH K 4 .   ? 18.417  28.490  19.189 1.00 18.86  ? 817 HOH A O     1 
HETATM 4781 O O     . HOH K 4 .   ? 14.903  20.185  24.643 1.00 32.91  ? 818 HOH A O     1 
HETATM 4782 O O     . HOH K 4 .   ? 31.790  11.119  25.881 1.00 37.82  ? 819 HOH A O     1 
HETATM 4783 O O     . HOH K 4 .   ? 23.074  14.240  33.795 1.00 25.55  ? 820 HOH A O     1 
HETATM 4784 O O     . HOH K 4 .   ? 30.748  24.577  39.399 1.00 21.83  ? 821 HOH A O     1 
HETATM 4785 O O     . HOH K 4 .   ? 18.684  15.768  37.434 1.00 30.46  ? 822 HOH A O     1 
HETATM 4786 O O     . HOH K 4 .   ? 12.507  21.463  33.164 1.00 41.09  ? 823 HOH A O     1 
HETATM 4787 O O     . HOH K 4 .   ? 3.790   18.876  43.121 1.00 23.69  ? 824 HOH A O     1 
HETATM 4788 O O     . HOH K 4 .   ? 2.007   21.300  46.669 1.00 33.51  ? 825 HOH A O     1 
HETATM 4789 O O     . HOH K 4 .   ? -9.419  27.305  57.830 1.00 15.88  ? 826 HOH A O     1 
HETATM 4790 O O     . HOH K 4 .   ? 24.148  31.989  12.486 1.00 57.85  ? 827 HOH A O     1 
HETATM 4791 O O     . HOH K 4 .   ? -9.750  28.273  55.467 1.00 56.14  ? 828 HOH A O     1 
HETATM 4792 O O     . HOH K 4 .   ? -11.280 37.160  39.151 1.00 38.17  ? 829 HOH A O     1 
HETATM 4793 O O     . HOH K 4 .   ? -4.295  39.768  54.112 1.00 54.69  ? 830 HOH A O     1 
HETATM 4794 O O     . HOH K 4 .   ? -2.788  33.103  50.016 1.00 33.50  ? 831 HOH A O     1 
HETATM 4795 O O     . HOH K 4 .   ? -1.983  36.530  35.604 1.00 18.94  ? 832 HOH A O     1 
HETATM 4796 O O     . HOH K 4 .   ? -0.550  30.906  31.113 1.00 12.23  ? 833 HOH A O     1 
HETATM 4797 O O     . HOH K 4 .   ? 10.672  33.163  13.073 1.00 40.25  ? 834 HOH A O     1 
HETATM 4798 O O     . HOH K 4 .   ? 12.979  33.232  17.413 1.00 33.85  ? 835 HOH A O     1 
HETATM 4799 O O     . HOH K 4 .   ? 10.362  32.695  32.629 1.00 25.30  ? 836 HOH A O     1 
HETATM 4800 O O     . HOH K 4 .   ? 0.147   38.993  37.625 1.00 31.73  ? 837 HOH A O     1 
HETATM 4801 O O     . HOH K 4 .   ? 19.202  14.114  35.194 1.00 44.29  ? 838 HOH A O     1 
HETATM 4802 O O     . HOH K 4 .   ? 33.002  15.614  27.019 1.00 48.80  ? 839 HOH A O     1 
HETATM 4803 O O     . HOH K 4 .   ? 21.218  31.784  15.444 1.00 22.44  ? 840 HOH A O     1 
HETATM 4804 O O     . HOH K 4 .   ? 19.467  35.429  21.664 1.00 21.52  ? 841 HOH A O     1 
HETATM 4805 O O     . HOH K 4 .   ? 26.314  36.812  17.576 1.00 21.89  ? 842 HOH A O     1 
HETATM 4806 O O     . HOH K 4 .   ? 31.354  15.309  14.524 1.00 34.05  ? 843 HOH A O     1 
HETATM 4807 O O     . HOH K 4 .   ? 29.088  34.521  27.536 1.00 31.30  ? 844 HOH A O     1 
HETATM 4808 O O     . HOH K 4 .   ? 33.683  31.209  26.105 1.00 30.61  ? 845 HOH A O     1 
HETATM 4809 O O     . HOH K 4 .   ? 17.969  32.143  29.403 1.00 27.87  ? 846 HOH A O     1 
HETATM 4810 O O     . HOH K 4 .   ? 12.117  32.590  30.453 1.00 27.37  ? 847 HOH A O     1 
HETATM 4811 O O     . HOH K 4 .   ? 7.857   30.402  39.095 1.00 38.85  ? 848 HOH A O     1 
HETATM 4812 O O     . HOH K 4 .   ? 24.478  12.181  29.136 1.00 31.61  ? 849 HOH A O     1 
HETATM 4813 O O     . HOH K 4 .   ? 35.753  19.392  34.185 1.00 29.10  ? 850 HOH A O     1 
HETATM 4814 O O     . HOH K 4 .   ? 33.095  12.680  33.442 1.00 32.78  ? 851 HOH A O     1 
HETATM 4815 O O     . HOH K 4 .   ? 21.227  11.848  38.307 1.00 35.59  ? 852 HOH A O     1 
HETATM 4816 O O     . HOH K 4 .   ? 30.151  30.434  43.749 1.00 39.78  ? 853 HOH A O     1 
HETATM 4817 O O     . HOH K 4 .   ? 9.221   20.794  35.556 1.00 30.77  ? 854 HOH A O     1 
HETATM 4818 O O     . HOH K 4 .   ? 11.764  33.264  20.330 1.00 33.13  ? 855 HOH A O     1 
HETATM 4819 O O     . HOH K 4 .   ? -16.469 22.177  44.438 1.00 33.55  ? 856 HOH A O     1 
HETATM 4820 O O     . HOH K 4 .   ? 36.028  19.877  38.992 1.00 25.00  ? 857 HOH A O     1 
HETATM 4821 O O     . HOH K 4 .   ? 33.476  19.318  26.350 1.00 22.84  ? 858 HOH A O     1 
HETATM 4822 O O     . HOH K 4 .   ? 9.918   22.429  32.462 1.00 29.29  ? 859 HOH A O     1 
HETATM 4823 O O     . HOH K 4 .   ? -7.538  29.960  51.360 1.00 19.98  ? 860 HOH A O     1 
HETATM 4824 O O     . HOH K 4 .   ? -14.738 17.459  35.903 1.00 44.48  ? 861 HOH A O     1 
HETATM 4825 O O     . HOH K 4 .   ? -19.599 19.932  44.982 1.00 41.99  ? 862 HOH A O     1 
HETATM 4826 O O     . HOH K 4 .   ? 16.204  19.285  30.365 1.00 31.99  ? 863 HOH A O     1 
HETATM 4827 O O     . HOH K 4 .   ? 5.497   24.491  46.441 1.00 41.50  ? 864 HOH A O     1 
HETATM 4828 O O     . HOH K 4 .   ? 3.675   23.430  49.727 1.00 21.48  ? 865 HOH A O     1 
HETATM 4829 O O     . HOH K 4 .   ? 4.280   21.923  45.610 1.00 36.22  ? 866 HOH A O     1 
HETATM 4830 O O     . HOH K 4 .   ? 0.955   15.744  40.987 1.00 44.96  ? 867 HOH A O     1 
HETATM 4831 O O     . HOH K 4 .   ? 12.552  22.743  36.481 1.00 43.83  ? 868 HOH A O     1 
HETATM 4832 O O     . HOH K 4 .   ? -2.472  25.796  53.787 1.00 33.40  ? 869 HOH A O     1 
HETATM 4833 O O     . HOH K 4 .   ? 5.426   37.987  45.467 1.00 22.75  ? 870 HOH A O     1 
HETATM 4834 O O     . HOH K 4 .   ? 33.003  29.216  27.916 1.00 40.86  ? 871 HOH A O     1 
HETATM 4835 O O     . HOH L 4 .   ? -16.548 65.354  45.493 1.00 10.44  ? 801 HOH B O     1 
HETATM 4836 O O     . HOH L 4 .   ? -5.772  84.525  46.375 1.00 2.00   ? 802 HOH B O     1 
HETATM 4837 O O     . HOH L 4 .   ? -14.065 81.874  64.444 1.00 22.99  ? 803 HOH B O     1 
HETATM 4838 O O     . HOH L 4 .   ? -11.819 59.111  34.779 1.00 27.62  ? 806 HOH B O     1 
HETATM 4839 O O     . HOH L 4 .   ? -9.047  65.802  39.593 1.00 24.18  ? 807 HOH B O     1 
HETATM 4840 O O     . HOH L 4 .   ? -20.979 58.434  51.760 1.00 43.69  ? 808 HOH B O     1 
HETATM 4841 O O     . HOH L 4 .   ? -25.239 64.208  30.804 1.00 23.32  ? 810 HOH B O     1 
HETATM 4842 O O     . HOH L 4 .   ? -12.911 96.347  68.829 1.00 21.63  ? 811 HOH B O     1 
HETATM 4843 O O     . HOH L 4 .   ? -2.987  98.201  66.766 1.00 32.08  ? 812 HOH B O     1 
HETATM 4844 O O     . HOH L 4 .   ? -24.471 71.278  47.096 1.00 40.08  ? 813 HOH B O     1 
HETATM 4845 O O     . HOH L 4 .   ? -13.603 87.534  67.116 1.00 26.83  ? 814 HOH B O     1 
HETATM 4846 O O     . HOH L 4 .   ? -19.156 52.015  32.341 1.00 41.73  ? 816 HOH B O     1 
HETATM 4847 O O     . HOH L 4 .   ? -6.526  97.085  50.615 1.00 41.21  ? 817 HOH B O     1 
HETATM 4848 O O     . HOH L 4 .   ? 1.414   95.075  50.986 1.00 41.19  ? 818 HOH B O     1 
HETATM 4849 O O     . HOH L 4 .   ? -3.509  83.494  47.821 1.00 24.36  ? 819 HOH B O     1 
HETATM 4850 O O     . HOH L 4 .   ? -11.644 80.866  50.383 1.00 20.69  ? 820 HOH B O     1 
HETATM 4851 O O     . HOH L 4 .   ? -16.474 86.244  51.992 1.00 34.04  ? 821 HOH B O     1 
HETATM 4852 O O     . HOH L 4 .   ? -15.514 84.728  55.150 1.00 65.90  ? 822 HOH B O     1 
HETATM 4853 O O     . HOH L 4 .   ? -10.264 79.027  62.664 1.00 15.75  ? 823 HOH B O     1 
HETATM 4854 O O     . HOH L 4 .   ? -8.499  80.682  61.547 1.00 15.42  ? 824 HOH B O     1 
HETATM 4855 O O     . HOH L 4 .   ? -17.980 83.103  62.963 1.00 21.38  ? 825 HOH B O     1 
HETATM 4856 O O     . HOH L 4 .   ? -17.655 82.243  55.971 1.00 38.95  ? 826 HOH B O     1 
HETATM 4857 O O     . HOH L 4 .   ? -15.994 101.749 54.570 1.00 52.00  ? 827 HOH B O     1 
HETATM 4858 O O     . HOH L 4 .   ? -17.866 92.449  47.539 1.00 23.15  ? 828 HOH B O     1 
HETATM 4859 O O     . HOH L 4 .   ? -4.619  92.792  41.593 1.00 12.91  ? 829 HOH B O     1 
HETATM 4860 O O     . HOH L 4 .   ? -18.434 86.091  42.262 1.00 53.73  ? 830 HOH B O     1 
HETATM 4861 O O     . HOH L 4 .   ? -17.456 79.719  48.091 1.00 28.09  ? 831 HOH B O     1 
HETATM 4862 O O     . HOH L 4 .   ? -25.001 74.614  37.942 1.00 37.22  ? 832 HOH B O     1 
HETATM 4863 O O     . HOH L 4 .   ? -24.171 71.620  34.244 1.00 27.86  ? 833 HOH B O     1 
HETATM 4864 O O     . HOH L 4 .   ? -26.193 59.010  22.747 1.00 20.46  ? 834 HOH B O     1 
HETATM 4865 O O     . HOH L 4 .   ? -37.189 55.442  30.701 1.00 25.28  ? 835 HOH B O     1 
HETATM 4866 O O     . HOH L 4 .   ? -25.189 57.777  24.965 1.00 33.06  ? 836 HOH B O     1 
HETATM 4867 O O     . HOH L 4 .   ? -12.600 55.555  27.027 1.00 39.56  ? 838 HOH B O     1 
HETATM 4868 O O     . HOH L 4 .   ? -17.878 61.094  30.286 1.00 52.82  ? 839 HOH B O     1 
HETATM 4869 O O     . HOH L 4 .   ? -12.059 61.449  44.300 1.00 23.45  ? 841 HOH B O     1 
HETATM 4870 O O     . HOH L 4 .   ? -13.477 59.210  44.909 1.00 27.63  ? 842 HOH B O     1 
HETATM 4871 O O     . HOH L 4 .   ? -17.445 63.683  49.266 1.00 19.34  ? 843 HOH B O     1 
HETATM 4872 O O     . HOH L 4 .   ? -8.823  70.887  67.611 1.00 35.53  ? 846 HOH B O     1 
HETATM 4873 O O     . HOH L 4 .   ? -7.737  73.233  63.223 1.00 31.01  ? 847 HOH B O     1 
HETATM 4874 O O     . HOH L 4 .   ? -9.696  71.490  47.669 1.00 29.70  ? 853 HOH B O     1 
HETATM 4875 O O     . HOH L 4 .   ? -18.966 88.656  43.311 1.00 22.27  ? 857 HOH B O     1 
HETATM 4876 O O     . HOH L 4 .   ? -11.984 99.426  53.992 1.00 34.22  ? 859 HOH B O     1 
HETATM 4877 O O     . HOH L 4 .   ? -3.760  81.457  65.574 1.00 47.00  ? 861 HOH B O     1 
HETATM 4878 O O     . HOH L 4 .   ? -2.486  77.777  59.041 1.00 41.85  ? 862 HOH B O     1 
HETATM 4879 O O     . HOH L 4 .   ? 3.101   82.903  63.125 1.00 50.53  ? 863 HOH B O     1 
HETATM 4880 O O     . HOH L 4 .   ? -11.838 98.528  65.621 1.00 26.00  ? 864 HOH B O     1 
HETATM 4881 O O     . HOH L 4 .   ? 3.310   86.138  53.305 1.00 28.35  ? 865 HOH B O     1 
HETATM 4882 O O     . HOH L 4 .   ? -5.062  77.839  51.242 1.00 29.97  ? 867 HOH B O     1 
HETATM 4883 O O     . HOH L 4 .   ? -16.732 81.267  50.107 1.00 27.67  ? 870 HOH B O     1 
HETATM 4884 O O     . HOH L 4 .   ? -13.064 71.139  41.488 1.00 24.29  ? 871 HOH B O     1 
HETATM 4885 O O     . HOH L 4 .   ? -18.657 95.684  50.545 1.00 29.70  ? 872 HOH B O     1 
HETATM 4886 O O     . HOH L 4 .   ? -6.423  101.647 46.857 1.00 54.27  ? 873 HOH B O     1 
HETATM 4887 O O     . HOH L 4 .   ? -14.834 101.554 47.342 1.00 42.20  ? 874 HOH B O     1 
HETATM 4888 O O     . HOH L 4 .   ? -19.537 92.560  41.006 1.00 24.50  ? 875 HOH B O     1 
HETATM 4889 O O     . HOH L 4 .   ? -0.251  88.381  37.272 1.00 34.27  ? 876 HOH B O     1 
HETATM 4890 O O     . HOH L 4 .   ? -19.438 77.016  45.810 1.00 47.39  ? 877 HOH B O     1 
HETATM 4891 O O     . HOH L 4 .   ? -8.338  72.838  60.305 1.00 30.72  ? 878 HOH B O     1 
HETATM 4892 O O     . HOH L 4 .   ? -33.628 55.915  35.786 1.00 24.99  ? 881 HOH B O     1 
HETATM 4893 O O     . HOH L 4 .   ? -18.010 73.372  49.427 1.00 13.90  ? 882 HOH B O     1 
HETATM 4894 O O     . HOH L 4 .   ? -4.913  99.689  42.500 1.00 53.37  ? 884 HOH B O     1 
HETATM 4895 O O     . HOH L 4 .   ? -7.206  97.970  54.204 1.00 31.92  ? 885 HOH B O     1 
HETATM 4896 O O     . HOH L 4 .   ? -17.729 75.663  48.102 1.00 28.00  ? 886 HOH B O     1 
HETATM 4897 O O     . HOH L 4 .   ? -22.480 59.122  28.932 1.00 39.25  ? 887 HOH B O     1 
HETATM 4898 O O     . HOH L 4 .   ? -36.667 60.077  44.278 1.00 32.19  ? 889 HOH B O     1 
HETATM 4899 O O     . HOH L 4 .   ? -37.490 54.458  35.405 1.00 27.92  ? 890 HOH B O     1 
HETATM 4900 O O     . HOH L 4 .   ? -17.502 83.948  49.909 1.00 42.36  ? 891 HOH B O     1 
HETATM 4901 O O     . HOH L 4 .   ? -18.769 88.159  68.024 1.00 39.99  ? 892 HOH B O     1 
HETATM 4902 O O     . HOH L 4 .   ? -18.908 72.913  34.069 1.00 46.76  ? 895 HOH B O     1 
HETATM 4903 O O     . HOH L 4 .   ? -21.287 71.810  30.978 1.00 26.49  ? 896 HOH B O     1 
HETATM 4904 O O     . HOH L 4 .   ? -21.824 73.227  35.011 1.00 48.13  ? 897 HOH B O     1 
HETATM 4905 O O     . HOH L 4 .   ? -29.386 73.603  40.601 1.00 60.26  ? 898 HOH B O     1 
HETATM 4906 O O     . HOH L 4 .   ? -14.911 78.084  44.502 1.00 25.77  ? 899 HOH B O     1 
HETATM 4907 O O     . HOH L 4 .   ? -17.001 62.687  27.242 1.00 35.55  ? 901 HOH B O     1 
HETATM 4908 O O     . HOH L 4 .   ? -8.535  65.111  34.713 1.00 35.15  ? 902 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DC  1   1   1   DC  C   C . n 
A 1 2   DC  2   2   2   DC  C   C . n 
A 1 3   DG  3   3   3   DG  G   C . n 
A 1 4   DC  4   4   4   DC  C   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DC  6   6   6   DC  C   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DC  8   8   8   DC  C   C . n 
A 1 9   DC  9   9   9   DC  C   C . n 
A 1 10  DC  10  10  10  DC  C   C . n 
A 1 11  DA  11  11  11  DA  A   C . n 
A 1 12  DC  12  12  12  DC  C   C . n 
A 1 13  DA  13  13  13  DA  A   C . n 
A 1 14  DC  14  14  14  DC  C   C . n 
A 1 15  DA  15  15  15  DA  A   C . n 
A 1 16  DC  16  16  16  DC  C   C . n 
A 1 17  DC  17  17  17  DC  C   C . n 
A 1 18  DA  18  18  18  DA  A   C . n 
A 1 19  DG  19  19  19  DG  G   C . n 
B 2 1   DC  1   20  20  DC  C   D . n 
B 2 2   DC  2   21  21  DC  C   D . n 
B 2 3   DT  3   22  22  DT  T   D . n 
B 2 4   DG  4   23  23  DG  G   D . n 
B 2 5   DG  5   24  24  DG  G   D . n 
B 2 6   DT  6   25  25  DT  T   D . n 
B 2 7   DG  7   26  26  DG  G   D . n 
B 2 8   DT  8   27  27  DT  T   D . n 
B 2 9   DG  9   28  28  DG  G   D . n 
B 2 10  DT  10  29  29  DT  T   D . n 
B 2 11  DG  11  30  30  DG  G   D . n 
B 2 12  DG  12  31  31  DG  G   D . n 
B 2 13  DG  13  32  32  DG  G   D . n 
B 2 14  DT  14  33  33  DT  T   D . n 
B 2 15  DG  15  34  34  DG  G   D . n 
B 2 16  DT  16  35  35  DT  T   D . n 
B 2 17  DG  17  36  36  DG  G   D . n 
B 2 18  DC  18  37  37  DC  C   D . n 
B 2 19  DG  19  38  38  DG  G   D . n 
C 1 1   DC  1   1   ?   ?   ?   E . n 
C 1 2   DC  2   2   2   DC  C   E . n 
C 1 3   DG  3   3   3   DG  G   E . n 
C 1 4   DC  4   4   4   DC  C   E . n 
C 1 5   DA  5   5   5   DA  A   E . n 
C 1 6   DC  6   6   6   DC  C   E . n 
C 1 7   DA  7   7   7   DA  A   E . n 
C 1 8   DC  8   8   8   DC  C   E . n 
C 1 9   DC  9   9   9   DC  C   E . n 
C 1 10  DC  10  10  10  DC  C   E . n 
C 1 11  DA  11  11  11  DA  A   E . n 
C 1 12  DC  12  12  12  DC  C   E . n 
C 1 13  DA  13  13  13  DA  A   E . n 
C 1 14  DC  14  14  14  DC  C   E . n 
C 1 15  DA  15  15  15  DA  A   E . n 
C 1 16  DC  16  16  16  DC  C   E . n 
C 1 17  DC  17  17  17  DC  C   E . n 
C 1 18  DA  18  18  18  DA  A   E . n 
C 1 19  DG  19  19  19  DG  G   E . n 
D 2 1   DC  1   20  20  DC  C   F . n 
D 2 2   DC  2   21  21  DC  C   F . n 
D 2 3   DT  3   22  22  DT  T   F . n 
D 2 4   DG  4   23  23  DG  G   F . n 
D 2 5   DG  5   24  24  DG  G   F . n 
D 2 6   DT  6   25  25  DT  T   F . n 
D 2 7   DG  7   26  26  DG  G   F . n 
D 2 8   DT  8   27  27  DT  T   F . n 
D 2 9   DG  9   28  28  DG  G   F . n 
D 2 10  DT  10  29  29  DT  T   F . n 
D 2 11  DG  11  30  30  DG  G   F . n 
D 2 12  DG  12  31  31  DG  G   F . n 
D 2 13  DG  13  32  32  DG  G   F . n 
D 2 14  DT  14  33  33  DT  T   F . n 
D 2 15  DG  15  34  34  DG  G   F . n 
D 2 16  DT  16  35  35  DT  T   F . n 
D 2 17  DG  17  36  36  DG  G   F . n 
D 2 18  DC  18  37  37  DC  C   F . n 
D 2 19  DG  19  38  38  DG  G   F . n 
E 3 1   GLY 1   353 ?   ?   ?   A . n 
E 3 2   ALA 2   354 ?   ?   ?   A . n 
E 3 3   LEU 3   355 ?   ?   ?   A . n 
E 3 4   PRO 4   356 ?   ?   ?   A . n 
E 3 5   SER 5   357 ?   ?   ?   A . n 
E 3 6   HIS 6   358 ?   ?   ?   A . n 
E 3 7   ASN 7   359 ?   ?   ?   A . n 
E 3 8   LYS 8   360 360 LYS LYS A . n 
E 3 9   ALA 9   361 361 ALA ALA A . n 
E 3 10  SER 10  362 362 SER SER A . n 
E 3 11  PHE 11  363 363 PHE PHE A . n 
E 3 12  THR 12  364 364 THR THR A . n 
E 3 13  ASP 13  365 365 ASP ASP A . n 
E 3 14  GLU 14  366 366 GLU GLU A . n 
E 3 15  GLU 15  367 367 GLU GLU A . n 
E 3 16  ASP 16  368 368 ASP ASP A . n 
E 3 17  GLU 17  369 369 GLU GLU A . n 
E 3 18  PHE 18  370 370 PHE PHE A . n 
E 3 19  ILE 19  371 371 ILE ILE A . n 
E 3 20  LEU 20  372 372 LEU LEU A . n 
E 3 21  ASP 21  373 373 ASP ASP A . n 
E 3 22  VAL 22  374 374 VAL VAL A . n 
E 3 23  VAL 23  375 375 VAL VAL A . n 
E 3 24  ARG 24  376 376 ARG ARG A . n 
E 3 25  LYS 25  377 377 LYS LYS A . n 
E 3 26  ASN 26  378 378 ASN ASN A . n 
E 3 27  PRO 27  379 379 PRO PRO A . n 
E 3 28  THR 28  380 380 THR THR A . n 
E 3 29  ARG 29  381 381 ARG ARG A . n 
E 3 30  ARG 30  382 382 ARG ARG A . n 
E 3 31  THR 31  383 383 THR THR A . n 
E 3 32  THR 32  384 384 THR THR A . n 
E 3 33  HIS 33  385 385 HIS HIS A . n 
E 3 34  THR 34  386 386 THR THR A . n 
E 3 35  LEU 35  387 387 LEU LEU A . n 
E 3 36  TYR 36  388 388 TYR TYR A . n 
E 3 37  ASP 37  389 389 ASP ASP A . n 
E 3 38  GLU 38  390 390 GLU GLU A . n 
E 3 39  ILE 39  391 391 ILE ILE A . n 
E 3 40  SER 40  392 392 SER SER A . n 
E 3 41  HIS 41  393 393 HIS HIS A . n 
E 3 42  TYR 42  394 394 TYR TYR A . n 
E 3 43  VAL 43  395 395 VAL VAL A . n 
E 3 44  PRO 44  396 396 PRO PRO A . n 
E 3 45  ASN 45  397 397 ASN ASN A . n 
E 3 46  HIS 46  398 398 HIS HIS A . n 
E 3 47  THR 47  399 399 THR THR A . n 
E 3 48  GLY 48  400 400 GLY GLY A . n 
E 3 49  ASN 49  401 401 ASN ASN A . n 
E 3 50  SER 50  402 402 SER SER A . n 
E 3 51  ILE 51  403 403 ILE ILE A . n 
E 3 52  ARG 52  404 404 ARG ARG A . n 
E 3 53  HIS 53  405 405 HIS HIS A . n 
E 3 54  ARG 54  406 406 ARG ARG A . n 
E 3 55  PHE 55  407 407 PHE PHE A . n 
E 3 56  ARG 56  408 408 ARG ARG A . n 
E 3 57  VAL 57  409 409 VAL VAL A . n 
E 3 58  TYR 58  410 410 TYR TYR A . n 
E 3 59  LEU 59  411 411 LEU LEU A . n 
E 3 60  SER 60  412 412 SER SER A . n 
E 3 61  LYS 61  413 413 LYS LYS A . n 
E 3 62  ARG 62  414 414 ARG ARG A . n 
E 3 63  LEU 63  415 415 LEU LEU A . n 
E 3 64  GLU 64  416 416 GLU GLU A . n 
E 3 65  TYR 65  417 417 TYR TYR A . n 
E 3 66  VAL 66  418 418 VAL VAL A . n 
E 3 67  TYR 67  419 419 TYR TYR A . n 
E 3 68  GLU 68  420 420 GLU GLU A . n 
E 3 69  VAL 69  421 421 VAL VAL A . n 
E 3 70  ASP 70  422 422 ASP ASP A . n 
E 3 71  LYS 71  423 423 LYS LYS A . n 
E 3 72  PHE 72  424 424 PHE PHE A . n 
E 3 73  GLY 73  425 425 GLY GLY A . n 
E 3 74  LYS 74  426 426 LYS LYS A . n 
E 3 75  LEU 75  427 427 LEU LEU A . n 
E 3 76  VAL 76  428 428 VAL VAL A . n 
E 3 77  ARG 77  429 429 ARG ARG A . n 
E 3 78  ASP 78  430 430 ASP ASP A . n 
E 3 79  ASP 79  431 431 ASP ASP A . n 
E 3 80  ASP 80  432 432 ASP ASP A . n 
E 3 81  GLY 81  433 433 GLY GLY A . n 
E 3 82  ASN 82  434 434 ASN ASN A . n 
E 3 83  LEU 83  435 435 LEU LEU A . n 
E 3 84  ILE 84  436 436 ILE ILE A . n 
E 3 85  LYS 85  437 437 LYS LYS A . n 
E 3 86  THR 86  438 438 THR THR A . n 
E 3 87  LYS 87  439 439 LYS LYS A . n 
E 3 88  VAL 88  440 440 VAL VAL A . n 
E 3 89  LEU 89  441 441 LEU LEU A . n 
E 3 90  PRO 90  442 442 PRO PRO A . n 
E 3 91  PRO 91  443 443 PRO PRO A . n 
E 3 92  SER 92  444 444 SER SER A . n 
E 3 93  ILE 93  445 445 ILE ILE A . n 
E 3 94  LYS 94  446 446 LYS LYS A . n 
E 3 95  ARG 95  447 447 ARG ARG A . n 
E 3 96  LYS 96  448 448 LYS LYS A . n 
E 3 97  PHE 97  449 449 PHE PHE A . n 
E 3 98  SER 98  450 450 SER SER A . n 
E 3 99  ALA 99  451 451 ALA ALA A . n 
E 3 100 ASP 100 452 452 ASP ASP A . n 
E 3 101 GLU 101 453 453 GLU GLU A . n 
E 3 102 ASP 102 454 454 ASP ASP A . n 
E 3 103 TYR 103 455 455 TYR TYR A . n 
E 3 104 THR 104 456 456 THR THR A . n 
E 3 105 LEU 105 457 457 LEU LEU A . n 
E 3 106 ALA 106 458 458 ALA ALA A . n 
E 3 107 ILE 107 459 459 ILE ILE A . n 
E 3 108 ALA 108 460 460 ALA ALA A . n 
E 3 109 VAL 109 461 461 VAL VAL A . n 
E 3 110 LYS 110 462 462 LYS LYS A . n 
E 3 111 LYS 111 463 463 LYS LYS A . n 
E 3 112 GLN 112 464 464 GLN GLN A . n 
E 3 113 PHE 113 465 465 PHE PHE A . n 
E 3 114 TYR 114 466 466 TYR TYR A . n 
E 3 115 ARG 115 467 467 ARG ARG A . n 
E 3 116 ASP 116 468 468 ASP ASP A . n 
E 3 117 LEU 117 469 469 LEU LEU A . n 
E 3 118 PHE 118 470 470 PHE PHE A . n 
E 3 119 GLN 119 471 471 GLN GLN A . n 
E 3 120 ILE 120 472 472 ILE ILE A . n 
E 3 121 ASP 121 473 473 ASP ASP A . n 
E 3 122 PRO 122 474 474 PRO PRO A . n 
E 3 123 ASP 123 475 475 ASP ASP A . n 
E 3 124 THR 124 476 476 THR THR A . n 
E 3 125 GLY 125 477 477 GLY GLY A . n 
E 3 126 ARG 126 478 478 ARG ARG A . n 
E 3 127 SER 127 479 479 SER SER A . n 
E 3 128 LEU 128 480 480 LEU LEU A . n 
E 3 129 ILE 129 481 481 ILE ILE A . n 
E 3 130 THR 130 482 ?   ?   ?   A . n 
E 3 131 ASP 131 483 ?   ?   ?   A . n 
E 3 132 GLU 132 484 ?   ?   ?   A . n 
E 3 133 ASP 133 485 ?   ?   ?   A . n 
E 3 134 THR 134 486 ?   ?   ?   A . n 
E 3 135 PRO 135 487 ?   ?   ?   A . n 
E 3 136 THR 136 488 ?   ?   ?   A . n 
E 3 137 ALA 137 489 ?   ?   ?   A . n 
E 3 138 ILE 138 490 ?   ?   ?   A . n 
E 3 139 ALA 139 491 ?   ?   ?   A . n 
E 3 140 ARG 140 492 ?   ?   ?   A . n 
E 3 141 ARG 141 493 ?   ?   ?   A . n 
E 3 142 ASN 142 494 ?   ?   ?   A . n 
E 3 143 MET 143 495 ?   ?   ?   A . n 
E 3 144 THR 144 496 ?   ?   ?   A . n 
E 3 145 MET 145 497 ?   ?   ?   A . n 
E 3 146 ASP 146 498 ?   ?   ?   A . n 
E 3 147 PRO 147 499 ?   ?   ?   A . n 
E 3 148 ASN 148 500 ?   ?   ?   A . n 
E 3 149 HIS 149 501 ?   ?   ?   A . n 
E 3 150 VAL 150 502 ?   ?   ?   A . n 
E 3 151 PRO 151 503 ?   ?   ?   A . n 
E 3 152 GLY 152 504 ?   ?   ?   A . n 
E 3 153 SER 153 505 ?   ?   ?   A . n 
E 3 154 GLU 154 506 ?   ?   ?   A . n 
E 3 155 PRO 155 507 ?   ?   ?   A . n 
E 3 156 ASN 156 508 ?   ?   ?   A . n 
E 3 157 PHE 157 509 ?   ?   ?   A . n 
E 3 158 ALA 158 510 ?   ?   ?   A . n 
E 3 159 ALA 159 511 ?   ?   ?   A . n 
E 3 160 TYR 160 512 ?   ?   ?   A . n 
E 3 161 ARG 161 513 513 ARG ARG A . n 
E 3 162 THR 162 514 514 THR THR A . n 
E 3 163 GLN 163 515 515 GLN GLN A . n 
E 3 164 SER 164 516 516 SER SER A . n 
E 3 165 ARG 165 517 517 ARG ARG A . n 
E 3 166 ARG 166 518 518 ARG ARG A . n 
E 3 167 GLY 167 519 519 GLY GLY A . n 
E 3 168 PRO 168 520 520 PRO PRO A . n 
E 3 169 ILE 169 521 521 ILE ILE A . n 
E 3 170 ALA 170 522 522 ALA ALA A . n 
E 3 171 ARG 171 523 523 ARG ARG A . n 
E 3 172 GLU 172 524 524 GLU GLU A . n 
E 3 173 PHE 173 525 525 PHE PHE A . n 
E 3 174 PHE 174 526 526 PHE PHE A . n 
E 3 175 LYS 175 527 527 LYS LYS A . n 
E 3 176 HIS 176 528 528 HIS HIS A . n 
E 3 177 PHE 177 529 529 PHE PHE A . n 
E 3 178 ALA 178 530 530 ALA ALA A . n 
E 3 179 GLU 179 531 531 GLU GLU A . n 
E 3 180 GLU 180 532 532 GLU GLU A . n 
E 3 181 HIS 181 533 533 HIS HIS A . n 
E 3 182 ALA 182 534 534 ALA ALA A . n 
E 3 183 ALA 183 535 535 ALA ALA A . n 
E 3 184 HIS 184 536 536 HIS HIS A . n 
E 3 185 THR 185 537 537 THR THR A . n 
E 3 186 GLU 186 538 538 GLU GLU A . n 
E 3 187 ASN 187 539 539 ASN ASN A . n 
E 3 188 ALA 188 540 540 ALA ALA A . n 
E 3 189 TRP 189 541 541 TRP TRP A . n 
E 3 190 ARG 190 542 542 ARG ARG A . n 
E 3 191 ASP 191 543 543 ASP ASP A . n 
E 3 192 ARG 192 544 544 ARG ARG A . n 
E 3 193 PHE 193 545 545 PHE PHE A . n 
E 3 194 ARG 194 546 546 ARG ARG A . n 
E 3 195 LYS 195 547 547 LYS LYS A . n 
E 3 196 PHE 196 548 548 PHE PHE A . n 
E 3 197 LEU 197 549 549 LEU LEU A . n 
E 3 198 LEU 198 550 550 LEU LEU A . n 
E 3 199 ALA 199 551 551 ALA ALA A . n 
E 3 200 TYR 200 552 552 TYR TYR A . n 
E 3 201 GLY 201 553 553 GLY GLY A . n 
E 3 202 ILE 202 554 554 ILE ILE A . n 
E 3 203 ASP 203 555 555 ASP ASP A . n 
E 3 204 ASP 204 556 556 ASP ASP A . n 
E 3 205 TYR 205 557 557 TYR TYR A . n 
E 3 206 ILE 206 558 558 ILE ILE A . n 
E 3 207 SER 207 559 559 SER SER A . n 
E 3 208 TYR 208 560 560 TYR TYR A . n 
E 3 209 TYR 209 561 561 TYR TYR A . n 
E 3 210 GLU 210 562 562 GLU GLU A . n 
E 3 211 ALA 211 563 563 ALA ALA A . n 
E 3 212 GLU 212 564 564 GLU GLU A . n 
E 3 213 LYS 213 565 ?   ?   ?   A . n 
E 3 214 ALA 214 566 ?   ?   ?   A . n 
E 3 215 GLN 215 567 ?   ?   ?   A . n 
E 3 216 ASN 216 568 ?   ?   ?   A . n 
E 3 217 ARG 217 569 ?   ?   ?   A . n 
E 3 218 GLU 218 570 ?   ?   ?   A . n 
E 3 219 PRO 219 571 ?   ?   ?   A . n 
E 3 220 GLU 220 572 572 GLU GLU A . n 
E 3 221 PRO 221 573 573 PRO PRO A . n 
E 3 222 MET 222 574 574 MET MET A . n 
E 3 223 LYS 223 575 575 LYS LYS A . n 
E 3 224 ASN 224 576 576 ASN ASN A . n 
E 3 225 LEU 225 577 577 LEU LEU A . n 
E 3 226 THR 226 578 578 THR THR A . n 
E 3 227 ASN 227 579 ?   ?   ?   A . n 
E 3 228 ARG 228 580 ?   ?   ?   A . n 
E 3 229 PRO 229 581 ?   ?   ?   A . n 
E 3 230 LYS 230 582 ?   ?   ?   A . n 
E 3 231 ARG 231 583 ?   ?   ?   A . n 
E 3 232 PRO 232 584 ?   ?   ?   A . n 
E 3 233 GLY 233 585 ?   ?   ?   A . n 
E 3 234 VAL 234 586 ?   ?   ?   A . n 
E 3 235 PRO 235 587 587 PRO PRO A . n 
E 3 236 THR 236 588 588 THR THR A . n 
E 3 237 PRO 237 589 589 PRO PRO A . n 
E 3 238 GLY 238 590 590 GLY GLY A . n 
E 3 239 ASN 239 591 591 ASN ASN A . n 
E 3 240 TYR 240 592 592 TYR TYR A . n 
E 3 241 ASN 241 593 593 ASN ASN A . n 
E 3 242 SER 242 594 594 SER SER A . n 
E 3 243 ALA 243 595 ?   ?   ?   A . n 
E 3 244 ALA 244 596 ?   ?   ?   A . n 
E 3 245 LYS 245 597 ?   ?   ?   A . n 
E 3 246 ARG 246 598 ?   ?   ?   A . n 
F 3 1   GLY 1   353 ?   ?   ?   B . n 
F 3 2   ALA 2   354 ?   ?   ?   B . n 
F 3 3   LEU 3   355 ?   ?   ?   B . n 
F 3 4   PRO 4   356 ?   ?   ?   B . n 
F 3 5   SER 5   357 ?   ?   ?   B . n 
F 3 6   HIS 6   358 ?   ?   ?   B . n 
F 3 7   ASN 7   359 ?   ?   ?   B . n 
F 3 8   LYS 8   360 360 LYS LYS B . n 
F 3 9   ALA 9   361 361 ALA ALA B . n 
F 3 10  SER 10  362 362 SER SER B . n 
F 3 11  PHE 11  363 363 PHE PHE B . n 
F 3 12  THR 12  364 364 THR THR B . n 
F 3 13  ASP 13  365 365 ASP ASP B . n 
F 3 14  GLU 14  366 366 GLU GLU B . n 
F 3 15  GLU 15  367 367 GLU GLU B . n 
F 3 16  ASP 16  368 368 ASP ASP B . n 
F 3 17  GLU 17  369 369 GLU GLU B . n 
F 3 18  PHE 18  370 370 PHE PHE B . n 
F 3 19  ILE 19  371 371 ILE ILE B . n 
F 3 20  LEU 20  372 372 LEU LEU B . n 
F 3 21  ASP 21  373 373 ASP ASP B . n 
F 3 22  VAL 22  374 374 VAL VAL B . n 
F 3 23  VAL 23  375 375 VAL VAL B . n 
F 3 24  ARG 24  376 376 ARG ARG B . n 
F 3 25  LYS 25  377 377 LYS LYS B . n 
F 3 26  ASN 26  378 378 ASN ASN B . n 
F 3 27  PRO 27  379 379 PRO PRO B . n 
F 3 28  THR 28  380 380 THR THR B . n 
F 3 29  ARG 29  381 381 ARG ARG B . n 
F 3 30  ARG 30  382 382 ARG ARG B . n 
F 3 31  THR 31  383 383 THR THR B . n 
F 3 32  THR 32  384 384 THR THR B . n 
F 3 33  HIS 33  385 385 HIS HIS B . n 
F 3 34  THR 34  386 386 THR THR B . n 
F 3 35  LEU 35  387 387 LEU LEU B . n 
F 3 36  TYR 36  388 388 TYR TYR B . n 
F 3 37  ASP 37  389 389 ASP ASP B . n 
F 3 38  GLU 38  390 390 GLU GLU B . n 
F 3 39  ILE 39  391 391 ILE ILE B . n 
F 3 40  SER 40  392 392 SER SER B . n 
F 3 41  HIS 41  393 393 HIS HIS B . n 
F 3 42  TYR 42  394 394 TYR TYR B . n 
F 3 43  VAL 43  395 395 VAL VAL B . n 
F 3 44  PRO 44  396 396 PRO PRO B . n 
F 3 45  ASN 45  397 397 ASN ASN B . n 
F 3 46  HIS 46  398 398 HIS HIS B . n 
F 3 47  THR 47  399 399 THR THR B . n 
F 3 48  GLY 48  400 400 GLY GLY B . n 
F 3 49  ASN 49  401 401 ASN ASN B . n 
F 3 50  SER 50  402 402 SER SER B . n 
F 3 51  ILE 51  403 403 ILE ILE B . n 
F 3 52  ARG 52  404 404 ARG ARG B . n 
F 3 53  HIS 53  405 405 HIS HIS B . n 
F 3 54  ARG 54  406 406 ARG ARG B . n 
F 3 55  PHE 55  407 407 PHE PHE B . n 
F 3 56  ARG 56  408 408 ARG ARG B . n 
F 3 57  VAL 57  409 409 VAL VAL B . n 
F 3 58  TYR 58  410 410 TYR TYR B . n 
F 3 59  LEU 59  411 411 LEU LEU B . n 
F 3 60  SER 60  412 412 SER SER B . n 
F 3 61  LYS 61  413 413 LYS LYS B . n 
F 3 62  ARG 62  414 414 ARG ARG B . n 
F 3 63  LEU 63  415 415 LEU LEU B . n 
F 3 64  GLU 64  416 416 GLU GLU B . n 
F 3 65  TYR 65  417 417 TYR TYR B . n 
F 3 66  VAL 66  418 418 VAL VAL B . n 
F 3 67  TYR 67  419 419 TYR TYR B . n 
F 3 68  GLU 68  420 420 GLU GLU B . n 
F 3 69  VAL 69  421 421 VAL VAL B . n 
F 3 70  ASP 70  422 422 ASP ASP B . n 
F 3 71  LYS 71  423 423 LYS LYS B . n 
F 3 72  PHE 72  424 424 PHE PHE B . n 
F 3 73  GLY 73  425 425 GLY GLY B . n 
F 3 74  LYS 74  426 426 LYS LYS B . n 
F 3 75  LEU 75  427 427 LEU LEU B . n 
F 3 76  VAL 76  428 428 VAL VAL B . n 
F 3 77  ARG 77  429 429 ARG ARG B . n 
F 3 78  ASP 78  430 430 ASP ASP B . n 
F 3 79  ASP 79  431 431 ASP ASP B . n 
F 3 80  ASP 80  432 432 ASP ASP B . n 
F 3 81  GLY 81  433 433 GLY GLY B . n 
F 3 82  ASN 82  434 434 ASN ASN B . n 
F 3 83  LEU 83  435 435 LEU LEU B . n 
F 3 84  ILE 84  436 436 ILE ILE B . n 
F 3 85  LYS 85  437 437 LYS LYS B . n 
F 3 86  THR 86  438 438 THR THR B . n 
F 3 87  LYS 87  439 439 LYS LYS B . n 
F 3 88  VAL 88  440 440 VAL VAL B . n 
F 3 89  LEU 89  441 441 LEU LEU B . n 
F 3 90  PRO 90  442 442 PRO PRO B . n 
F 3 91  PRO 91  443 443 PRO PRO B . n 
F 3 92  SER 92  444 444 SER SER B . n 
F 3 93  ILE 93  445 445 ILE ILE B . n 
F 3 94  LYS 94  446 446 LYS LYS B . n 
F 3 95  ARG 95  447 447 ARG ARG B . n 
F 3 96  LYS 96  448 448 LYS LYS B . n 
F 3 97  PHE 97  449 449 PHE PHE B . n 
F 3 98  SER 98  450 450 SER SER B . n 
F 3 99  ALA 99  451 451 ALA ALA B . n 
F 3 100 ASP 100 452 452 ASP ASP B . n 
F 3 101 GLU 101 453 453 GLU GLU B . n 
F 3 102 ASP 102 454 454 ASP ASP B . n 
F 3 103 TYR 103 455 455 TYR TYR B . n 
F 3 104 THR 104 456 456 THR THR B . n 
F 3 105 LEU 105 457 457 LEU LEU B . n 
F 3 106 ALA 106 458 458 ALA ALA B . n 
F 3 107 ILE 107 459 459 ILE ILE B . n 
F 3 108 ALA 108 460 460 ALA ALA B . n 
F 3 109 VAL 109 461 461 VAL VAL B . n 
F 3 110 LYS 110 462 462 LYS LYS B . n 
F 3 111 LYS 111 463 463 LYS LYS B . n 
F 3 112 GLN 112 464 464 GLN GLN B . n 
F 3 113 PHE 113 465 465 PHE PHE B . n 
F 3 114 TYR 114 466 466 TYR TYR B . n 
F 3 115 ARG 115 467 467 ARG ARG B . n 
F 3 116 ASP 116 468 468 ASP ASP B . n 
F 3 117 LEU 117 469 469 LEU LEU B . n 
F 3 118 PHE 118 470 470 PHE PHE B . n 
F 3 119 GLN 119 471 471 GLN GLN B . n 
F 3 120 ILE 120 472 472 ILE ILE B . n 
F 3 121 ASP 121 473 473 ASP ASP B . n 
F 3 122 PRO 122 474 474 PRO PRO B . n 
F 3 123 ASP 123 475 475 ASP ASP B . n 
F 3 124 THR 124 476 476 THR THR B . n 
F 3 125 GLY 125 477 477 GLY GLY B . n 
F 3 126 ARG 126 478 478 ARG ARG B . n 
F 3 127 SER 127 479 479 SER SER B . n 
F 3 128 LEU 128 480 480 LEU LEU B . n 
F 3 129 ILE 129 481 481 ILE ILE B . n 
F 3 130 THR 130 482 ?   ?   ?   B . n 
F 3 131 ASP 131 483 ?   ?   ?   B . n 
F 3 132 GLU 132 484 ?   ?   ?   B . n 
F 3 133 ASP 133 485 ?   ?   ?   B . n 
F 3 134 THR 134 486 ?   ?   ?   B . n 
F 3 135 PRO 135 487 ?   ?   ?   B . n 
F 3 136 THR 136 488 ?   ?   ?   B . n 
F 3 137 ALA 137 489 ?   ?   ?   B . n 
F 3 138 ILE 138 490 ?   ?   ?   B . n 
F 3 139 ALA 139 491 ?   ?   ?   B . n 
F 3 140 ARG 140 492 ?   ?   ?   B . n 
F 3 141 ARG 141 493 ?   ?   ?   B . n 
F 3 142 ASN 142 494 ?   ?   ?   B . n 
F 3 143 MET 143 495 ?   ?   ?   B . n 
F 3 144 THR 144 496 ?   ?   ?   B . n 
F 3 145 MET 145 497 ?   ?   ?   B . n 
F 3 146 ASP 146 498 ?   ?   ?   B . n 
F 3 147 PRO 147 499 ?   ?   ?   B . n 
F 3 148 ASN 148 500 ?   ?   ?   B . n 
F 3 149 HIS 149 501 ?   ?   ?   B . n 
F 3 150 VAL 150 502 ?   ?   ?   B . n 
F 3 151 PRO 151 503 ?   ?   ?   B . n 
F 3 152 GLY 152 504 ?   ?   ?   B . n 
F 3 153 SER 153 505 ?   ?   ?   B . n 
F 3 154 GLU 154 506 ?   ?   ?   B . n 
F 3 155 PRO 155 507 ?   ?   ?   B . n 
F 3 156 ASN 156 508 ?   ?   ?   B . n 
F 3 157 PHE 157 509 ?   ?   ?   B . n 
F 3 158 ALA 158 510 ?   ?   ?   B . n 
F 3 159 ALA 159 511 ?   ?   ?   B . n 
F 3 160 TYR 160 512 ?   ?   ?   B . n 
F 3 161 ARG 161 513 513 ARG ARG B . n 
F 3 162 THR 162 514 514 THR THR B . n 
F 3 163 GLN 163 515 515 GLN GLN B . n 
F 3 164 SER 164 516 516 SER SER B . n 
F 3 165 ARG 165 517 517 ARG ARG B . n 
F 3 166 ARG 166 518 518 ARG ARG B . n 
F 3 167 GLY 167 519 519 GLY GLY B . n 
F 3 168 PRO 168 520 520 PRO PRO B . n 
F 3 169 ILE 169 521 521 ILE ILE B . n 
F 3 170 ALA 170 522 522 ALA ALA B . n 
F 3 171 ARG 171 523 523 ARG ARG B . n 
F 3 172 GLU 172 524 524 GLU GLU B . n 
F 3 173 PHE 173 525 525 PHE PHE B . n 
F 3 174 PHE 174 526 526 PHE PHE B . n 
F 3 175 LYS 175 527 527 LYS LYS B . n 
F 3 176 HIS 176 528 528 HIS HIS B . n 
F 3 177 PHE 177 529 529 PHE PHE B . n 
F 3 178 ALA 178 530 530 ALA ALA B . n 
F 3 179 GLU 179 531 531 GLU GLU B . n 
F 3 180 GLU 180 532 532 GLU GLU B . n 
F 3 181 HIS 181 533 533 HIS HIS B . n 
F 3 182 ALA 182 534 534 ALA ALA B . n 
F 3 183 ALA 183 535 535 ALA ALA B . n 
F 3 184 HIS 184 536 536 HIS HIS B . n 
F 3 185 THR 185 537 537 THR THR B . n 
F 3 186 GLU 186 538 538 GLU GLU B . n 
F 3 187 ASN 187 539 539 ASN ASN B . n 
F 3 188 ALA 188 540 540 ALA ALA B . n 
F 3 189 TRP 189 541 541 TRP TRP B . n 
F 3 190 ARG 190 542 542 ARG ARG B . n 
F 3 191 ASP 191 543 543 ASP ASP B . n 
F 3 192 ARG 192 544 544 ARG ARG B . n 
F 3 193 PHE 193 545 545 PHE PHE B . n 
F 3 194 ARG 194 546 546 ARG ARG B . n 
F 3 195 LYS 195 547 547 LYS LYS B . n 
F 3 196 PHE 196 548 548 PHE PHE B . n 
F 3 197 LEU 197 549 549 LEU LEU B . n 
F 3 198 LEU 198 550 550 LEU LEU B . n 
F 3 199 ALA 199 551 551 ALA ALA B . n 
F 3 200 TYR 200 552 552 TYR TYR B . n 
F 3 201 GLY 201 553 553 GLY GLY B . n 
F 3 202 ILE 202 554 554 ILE ILE B . n 
F 3 203 ASP 203 555 555 ASP ASP B . n 
F 3 204 ASP 204 556 556 ASP ASP B . n 
F 3 205 TYR 205 557 557 TYR TYR B . n 
F 3 206 ILE 206 558 558 ILE ILE B . n 
F 3 207 SER 207 559 559 SER SER B . n 
F 3 208 TYR 208 560 560 TYR TYR B . n 
F 3 209 TYR 209 561 561 TYR TYR B . n 
F 3 210 GLU 210 562 562 GLU GLU B . n 
F 3 211 ALA 211 563 563 ALA ALA B . n 
F 3 212 GLU 212 564 564 GLU GLU B . n 
F 3 213 LYS 213 565 ?   ?   ?   B . n 
F 3 214 ALA 214 566 ?   ?   ?   B . n 
F 3 215 GLN 215 567 ?   ?   ?   B . n 
F 3 216 ASN 216 568 ?   ?   ?   B . n 
F 3 217 ARG 217 569 ?   ?   ?   B . n 
F 3 218 GLU 218 570 ?   ?   ?   B . n 
F 3 219 PRO 219 571 ?   ?   ?   B . n 
F 3 220 GLU 220 572 572 GLU GLU B . n 
F 3 221 PRO 221 573 573 PRO PRO B . n 
F 3 222 MET 222 574 574 MET MET B . n 
F 3 223 LYS 223 575 575 LYS LYS B . n 
F 3 224 ASN 224 576 576 ASN ASN B . n 
F 3 225 LEU 225 577 577 LEU LEU B . n 
F 3 226 THR 226 578 578 THR THR B . n 
F 3 227 ASN 227 579 ?   ?   ?   B . n 
F 3 228 ARG 228 580 ?   ?   ?   B . n 
F 3 229 PRO 229 581 ?   ?   ?   B . n 
F 3 230 LYS 230 582 ?   ?   ?   B . n 
F 3 231 ARG 231 583 ?   ?   ?   B . n 
F 3 232 PRO 232 584 ?   ?   ?   B . n 
F 3 233 GLY 233 585 ?   ?   ?   B . n 
F 3 234 VAL 234 586 ?   ?   ?   B . n 
F 3 235 PRO 235 587 587 PRO PRO B . n 
F 3 236 THR 236 588 588 THR THR B . n 
F 3 237 PRO 237 589 589 PRO PRO B . n 
F 3 238 GLY 238 590 590 GLY GLY B . n 
F 3 239 ASN 239 591 591 ASN ASN B . n 
F 3 240 TYR 240 592 592 TYR TYR B . n 
F 3 241 ASN 241 593 593 ASN ASN B . n 
F 3 242 SER 242 594 594 SER SER B . n 
F 3 243 ALA 243 595 ?   ?   ?   B . n 
F 3 244 ALA 244 596 ?   ?   ?   B . n 
F 3 245 LYS 245 597 ?   ?   ?   B . n 
F 3 246 ARG 246 598 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1  800 800 HOH HOH C . 
G 4 HOH 2  804 804 HOH HOH C . 
G 4 HOH 3  805 805 HOH HOH C . 
G 4 HOH 4  809 809 HOH HOH C . 
G 4 HOH 5  811 811 HOH HOH C . 
G 4 HOH 6  815 815 HOH HOH C . 
G 4 HOH 7  841 841 HOH HOH C . 
G 4 HOH 8  849 849 HOH HOH C . 
G 4 HOH 9  851 851 HOH HOH C . 
G 4 HOH 10 852 852 HOH HOH C . 
G 4 HOH 11 858 858 HOH HOH C . 
G 4 HOH 12 869 869 HOH HOH C . 
G 4 HOH 13 879 879 HOH HOH C . 
G 4 HOH 14 880 880 HOH HOH C . 
G 4 HOH 15 888 888 HOH HOH C . 
G 4 HOH 16 892 892 HOH HOH C . 
G 4 HOH 17 893 893 HOH HOH C . 
H 4 HOH 1  806 806 HOH HOH D . 
H 4 HOH 2  820 820 HOH HOH D . 
H 4 HOH 3  825 825 HOH HOH D . 
H 4 HOH 4  840 840 HOH HOH D . 
H 4 HOH 5  844 844 HOH HOH D . 
H 4 HOH 6  845 845 HOH HOH D . 
H 4 HOH 7  848 848 HOH HOH D . 
H 4 HOH 8  850 850 HOH HOH D . 
H 4 HOH 9  854 854 HOH HOH D . 
H 4 HOH 10 856 856 HOH HOH D . 
H 4 HOH 11 860 860 HOH HOH D . 
H 4 HOH 12 870 870 HOH HOH D . 
H 4 HOH 13 882 882 HOH HOH D . 
H 4 HOH 14 883 883 HOH HOH D . 
H 4 HOH 15 894 894 HOH HOH D . 
H 4 HOH 16 900 900 HOH HOH D . 
I 4 HOH 1  800 800 HOH HOH E . 
I 4 HOH 2  804 804 HOH HOH E . 
I 4 HOH 3  805 805 HOH HOH E . 
I 4 HOH 4  809 809 HOH HOH E . 
I 4 HOH 5  815 815 HOH HOH E . 
I 4 HOH 6  849 849 HOH HOH E . 
I 4 HOH 7  851 851 HOH HOH E . 
I 4 HOH 8  852 852 HOH HOH E . 
I 4 HOH 9  855 855 HOH HOH E . 
I 4 HOH 10 858 858 HOH HOH E . 
I 4 HOH 11 869 869 HOH HOH E . 
I 4 HOH 12 879 879 HOH HOH E . 
I 4 HOH 13 880 880 HOH HOH E . 
I 4 HOH 14 888 888 HOH HOH E . 
I 4 HOH 15 893 893 HOH HOH E . 
J 4 HOH 1  837 837 HOH HOH F . 
J 4 HOH 2  840 840 HOH HOH F . 
J 4 HOH 3  844 844 HOH HOH F . 
J 4 HOH 4  845 845 HOH HOH F . 
J 4 HOH 5  848 848 HOH HOH F . 
J 4 HOH 6  850 850 HOH HOH F . 
J 4 HOH 7  854 854 HOH HOH F . 
J 4 HOH 8  856 856 HOH HOH F . 
J 4 HOH 9  860 860 HOH HOH F . 
J 4 HOH 10 868 868 HOH HOH F . 
J 4 HOH 11 883 883 HOH HOH F . 
J 4 HOH 12 894 894 HOH HOH F . 
J 4 HOH 13 900 900 HOH HOH F . 
K 4 HOH 1  801 801 HOH HOH A . 
K 4 HOH 2  802 802 HOH HOH A . 
K 4 HOH 3  803 803 HOH HOH A . 
K 4 HOH 4  804 807 HOH HOH A . 
K 4 HOH 5  805 808 HOH HOH A . 
K 4 HOH 6  806 810 HOH HOH A . 
K 4 HOH 7  807 812 HOH HOH A . 
K 4 HOH 8  808 813 HOH HOH A . 
K 4 HOH 9  809 814 HOH HOH A . 
K 4 HOH 10 810 816 HOH HOH A . 
K 4 HOH 11 811 817 HOH HOH A . 
K 4 HOH 12 812 818 HOH HOH A . 
K 4 HOH 13 813 819 HOH HOH A . 
K 4 HOH 14 814 821 HOH HOH A . 
K 4 HOH 15 815 822 HOH HOH A . 
K 4 HOH 16 816 823 HOH HOH A . 
K 4 HOH 17 817 824 HOH HOH A . 
K 4 HOH 18 818 826 HOH HOH A . 
K 4 HOH 19 819 827 HOH HOH A . 
K 4 HOH 20 820 828 HOH HOH A . 
K 4 HOH 21 821 829 HOH HOH A . 
K 4 HOH 22 822 830 HOH HOH A . 
K 4 HOH 23 823 831 HOH HOH A . 
K 4 HOH 24 824 832 HOH HOH A . 
K 4 HOH 25 825 833 HOH HOH A . 
K 4 HOH 26 826 834 HOH HOH A . 
K 4 HOH 27 827 835 HOH HOH A . 
K 4 HOH 28 828 836 HOH HOH A . 
K 4 HOH 29 829 837 HOH HOH A . 
K 4 HOH 30 830 838 HOH HOH A . 
K 4 HOH 31 831 839 HOH HOH A . 
K 4 HOH 32 832 842 HOH HOH A . 
K 4 HOH 33 833 843 HOH HOH A . 
K 4 HOH 34 834 846 HOH HOH A . 
K 4 HOH 35 835 847 HOH HOH A . 
K 4 HOH 36 836 853 HOH HOH A . 
K 4 HOH 37 837 855 HOH HOH A . 
K 4 HOH 38 838 857 HOH HOH A . 
K 4 HOH 39 839 859 HOH HOH A . 
K 4 HOH 40 840 861 HOH HOH A . 
K 4 HOH 41 841 862 HOH HOH A . 
K 4 HOH 42 842 863 HOH HOH A . 
K 4 HOH 43 843 864 HOH HOH A . 
K 4 HOH 44 844 865 HOH HOH A . 
K 4 HOH 45 845 866 HOH HOH A . 
K 4 HOH 46 846 867 HOH HOH A . 
K 4 HOH 47 847 868 HOH HOH A . 
K 4 HOH 48 848 871 HOH HOH A . 
K 4 HOH 49 849 872 HOH HOH A . 
K 4 HOH 50 850 873 HOH HOH A . 
K 4 HOH 51 851 874 HOH HOH A . 
K 4 HOH 52 852 875 HOH HOH A . 
K 4 HOH 53 853 876 HOH HOH A . 
K 4 HOH 54 854 877 HOH HOH A . 
K 4 HOH 55 855 878 HOH HOH A . 
K 4 HOH 56 856 881 HOH HOH A . 
K 4 HOH 57 857 884 HOH HOH A . 
K 4 HOH 58 858 885 HOH HOH A . 
K 4 HOH 59 859 886 HOH HOH A . 
K 4 HOH 60 860 887 HOH HOH A . 
K 4 HOH 61 861 889 HOH HOH A . 
K 4 HOH 62 862 890 HOH HOH A . 
K 4 HOH 63 863 891 HOH HOH A . 
K 4 HOH 64 864 895 HOH HOH A . 
K 4 HOH 65 865 896 HOH HOH A . 
K 4 HOH 66 866 897 HOH HOH A . 
K 4 HOH 67 867 898 HOH HOH A . 
K 4 HOH 68 868 899 HOH HOH A . 
K 4 HOH 69 869 901 HOH HOH A . 
K 4 HOH 70 870 902 HOH HOH A . 
K 4 HOH 71 871 866 HOH HOH A . 
L 4 HOH 1  801 801 HOH HOH B . 
L 4 HOH 2  802 802 HOH HOH B . 
L 4 HOH 3  803 803 HOH HOH B . 
L 4 HOH 4  806 806 HOH HOH B . 
L 4 HOH 5  807 807 HOH HOH B . 
L 4 HOH 6  808 808 HOH HOH B . 
L 4 HOH 7  810 810 HOH HOH B . 
L 4 HOH 8  811 811 HOH HOH B . 
L 4 HOH 9  812 812 HOH HOH B . 
L 4 HOH 10 813 813 HOH HOH B . 
L 4 HOH 11 814 814 HOH HOH B . 
L 4 HOH 12 816 816 HOH HOH B . 
L 4 HOH 13 817 817 HOH HOH B . 
L 4 HOH 14 818 818 HOH HOH B . 
L 4 HOH 15 819 819 HOH HOH B . 
L 4 HOH 16 820 820 HOH HOH B . 
L 4 HOH 17 821 821 HOH HOH B . 
L 4 HOH 18 822 822 HOH HOH B . 
L 4 HOH 19 823 823 HOH HOH B . 
L 4 HOH 20 824 824 HOH HOH B . 
L 4 HOH 21 825 825 HOH HOH B . 
L 4 HOH 22 826 826 HOH HOH B . 
L 4 HOH 23 827 827 HOH HOH B . 
L 4 HOH 24 828 828 HOH HOH B . 
L 4 HOH 25 829 829 HOH HOH B . 
L 4 HOH 26 830 830 HOH HOH B . 
L 4 HOH 27 831 831 HOH HOH B . 
L 4 HOH 28 832 832 HOH HOH B . 
L 4 HOH 29 833 833 HOH HOH B . 
L 4 HOH 30 834 834 HOH HOH B . 
L 4 HOH 31 835 835 HOH HOH B . 
L 4 HOH 32 836 836 HOH HOH B . 
L 4 HOH 33 838 838 HOH HOH B . 
L 4 HOH 34 839 839 HOH HOH B . 
L 4 HOH 35 841 841 HOH HOH B . 
L 4 HOH 36 842 842 HOH HOH B . 
L 4 HOH 37 843 843 HOH HOH B . 
L 4 HOH 38 846 846 HOH HOH B . 
L 4 HOH 39 847 847 HOH HOH B . 
L 4 HOH 40 853 853 HOH HOH B . 
L 4 HOH 41 857 857 HOH HOH B . 
L 4 HOH 42 859 859 HOH HOH B . 
L 4 HOH 43 861 861 HOH HOH B . 
L 4 HOH 44 862 862 HOH HOH B . 
L 4 HOH 45 863 863 HOH HOH B . 
L 4 HOH 46 864 864 HOH HOH B . 
L 4 HOH 47 865 865 HOH HOH B . 
L 4 HOH 48 867 867 HOH HOH B . 
L 4 HOH 49 870 870 HOH HOH B . 
L 4 HOH 50 871 871 HOH HOH B . 
L 4 HOH 51 872 872 HOH HOH B . 
L 4 HOH 52 873 873 HOH HOH B . 
L 4 HOH 53 874 874 HOH HOH B . 
L 4 HOH 54 875 875 HOH HOH B . 
L 4 HOH 55 876 876 HOH HOH B . 
L 4 HOH 56 877 877 HOH HOH B . 
L 4 HOH 57 878 878 HOH HOH B . 
L 4 HOH 58 881 881 HOH HOH B . 
L 4 HOH 59 882 882 HOH HOH B . 
L 4 HOH 60 884 884 HOH HOH B . 
L 4 HOH 61 885 885 HOH HOH B . 
L 4 HOH 62 886 886 HOH HOH B . 
L 4 HOH 63 887 887 HOH HOH B . 
L 4 HOH 64 889 889 HOH HOH B . 
L 4 HOH 65 890 890 HOH HOH B . 
L 4 HOH 66 891 891 HOH HOH B . 
L 4 HOH 67 892 892 HOH HOH B . 
L 4 HOH 68 895 895 HOH HOH B . 
L 4 HOH 69 896 896 HOH HOH B . 
L 4 HOH 70 897 897 HOH HOH B . 
L 4 HOH 71 898 898 HOH HOH B . 
L 4 HOH 72 899 899 HOH HOH B . 
L 4 HOH 73 901 901 HOH HOH B . 
L 4 HOH 74 902 902 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H,K 
2 1 C,D,F,I,J,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-01-27 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' struct_ref     
2 4 'Structure model' struct_ref_seq 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR refinement       3.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
CCP4   'data reduction' .   ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 "C5'" C DC 1  ? ? "C4'" C DC 1  ? ? 1.557 1.512 0.045  0.007 N 
2  1 "O4'" C DG 3  ? ? "C1'" C DG 3  ? ? 1.490 1.420 0.070  0.011 N 
3  1 N1    C DC 4  ? ? C2    C DC 4  ? ? 1.329 1.397 -0.068 0.010 N 
4  1 P     C DA 7  ? ? "O5'" C DA 7  ? ? 1.533 1.593 -0.060 0.010 N 
5  1 P     C DC 8  ? ? "O5'" C DC 8  ? ? 1.525 1.593 -0.068 0.010 N 
6  1 N1    C DC 8  ? ? C2    C DC 8  ? ? 1.325 1.397 -0.072 0.010 N 
7  1 P     C DC 12 ? ? "O5'" C DC 12 ? ? 1.471 1.593 -0.122 0.010 N 
8  1 "O4'" C DC 14 ? ? "C4'" C DC 14 ? ? 1.371 1.446 -0.075 0.010 N 
9  1 "C3'" C DA 15 ? ? "C2'" C DA 15 ? ? 1.449 1.516 -0.067 0.008 N 
10 1 "C2'" C DC 16 ? ? "C1'" C DC 16 ? ? 1.453 1.518 -0.065 0.010 N 
11 1 C5    C DG 19 ? ? N7    C DG 19 ? ? 1.425 1.388 0.037  0.006 N 
12 1 "C5'" D DT 22 ? ? "C4'" D DT 22 ? ? 1.560 1.512 0.048  0.007 N 
13 1 "C4'" D DT 27 ? ? "C3'" D DT 27 ? ? 1.459 1.521 -0.062 0.010 N 
14 1 "C4'" D DG 28 ? ? "C3'" D DG 28 ? ? 1.455 1.521 -0.066 0.010 N 
15 1 C5    D DT 29 ? ? C7    D DT 29 ? ? 1.542 1.496 0.046  0.006 N 
16 1 "O3'" D DT 29 ? ? P     D DG 30 ? ? 1.485 1.607 -0.122 0.012 Y 
17 1 P     D DG 30 ? ? "O5'" D DG 30 ? ? 1.483 1.593 -0.110 0.010 N 
18 1 "O3'" D DG 30 ? ? P     D DG 31 ? ? 1.535 1.607 -0.072 0.012 Y 
19 1 C4    D DG 31 ? ? C5    D DG 31 ? ? 1.331 1.379 -0.048 0.007 N 
20 1 P     D DG 32 ? ? "O5'" D DG 32 ? ? 1.655 1.593 0.062  0.010 N 
21 1 N1    D DT 33 ? ? C2    D DT 33 ? ? 1.321 1.376 -0.055 0.008 N 
22 1 "O4'" D DG 34 ? ? "C1'" D DG 34 ? ? 1.502 1.420 0.082  0.011 N 
23 1 C8    D DG 36 ? ? N9    D DG 36 ? ? 1.418 1.374 0.044  0.007 N 
24 1 "C5'" D DG 38 ? ? "C4'" D DG 38 ? ? 1.570 1.512 0.058  0.007 N 
25 1 P     E DC 2  ? ? "O5'" E DC 2  ? ? 1.658 1.593 0.065  0.010 N 
26 1 "C5'" E DA 7  ? ? "C4'" E DA 7  ? ? 1.422 1.509 -0.087 0.011 N 
27 1 N1    E DC 8  ? ? C6    E DC 8  ? ? 1.326 1.367 -0.041 0.006 N 
28 1 P     E DC 9  ? ? "O5'" E DC 9  ? ? 1.533 1.593 -0.060 0.010 N 
29 1 N3    E DA 11 ? ? C4    E DA 11 ? ? 1.387 1.344 0.043  0.006 N 
30 1 N9    E DA 11 ? ? C4    E DA 11 ? ? 1.411 1.374 0.037  0.006 N 
31 1 N1    E DC 12 ? ? C6    E DC 12 ? ? 1.320 1.367 -0.047 0.006 N 
32 1 "O3'" E DA 13 ? ? P     E DC 14 ? ? 1.495 1.607 -0.112 0.012 Y 
33 1 N1    E DC 14 ? ? C6    E DC 14 ? ? 1.409 1.367 0.042  0.006 N 
34 1 P     E DA 15 ? ? "O5'" E DA 15 ? ? 1.515 1.593 -0.078 0.010 N 
35 1 "C2'" E DA 15 ? ? "C1'" E DA 15 ? ? 1.458 1.518 -0.060 0.010 N 
36 1 "O3'" E DA 15 ? ? "C3'" E DA 15 ? ? 1.362 1.419 -0.057 0.006 N 
37 1 N1    E DC 16 ? ? C6    E DC 16 ? ? 1.404 1.367 0.037  0.006 N 
38 1 P     E DC 17 ? ? "O5'" E DC 17 ? ? 1.529 1.593 -0.064 0.010 N 
39 1 N9    E DA 18 ? ? C4    E DA 18 ? ? 1.335 1.374 -0.039 0.006 N 
40 1 "C5'" F DC 21 ? ? "C4'" F DC 21 ? ? 1.558 1.512 0.046  0.007 N 
41 1 C5    F DT 22 ? ? C7    F DT 22 ? ? 1.564 1.496 0.068  0.006 N 
42 1 C5    F DG 24 ? ? N7    F DG 24 ? ? 1.428 1.388 0.040  0.006 N 
43 1 N9    F DG 24 ? ? C4    F DG 24 ? ? 1.437 1.375 0.062  0.008 N 
44 1 "C2'" F DT 27 ? ? "C1'" F DT 27 ? ? 1.448 1.518 -0.070 0.010 N 
45 1 "O4'" F DT 29 ? ? "C1'" F DT 29 ? ? 1.488 1.420 0.068  0.011 N 
46 1 P     F DG 38 ? ? "O5'" F DG 38 ? ? 1.659 1.593 0.066  0.010 N 
47 1 "C5'" F DG 38 ? ? "C4'" F DG 38 ? ? 1.566 1.512 0.054  0.007 N 
48 1 "C2'" F DG 38 ? ? "C1'" F DG 38 ? ? 1.581 1.519 0.062  0.010 N 
49 1 "O4'" F DG 38 ? ? "C1'" F DG 38 ? ? 1.504 1.420 0.084  0.011 N 
50 1 N9    F DG 38 ? ? C4    F DG 38 ? ? 1.423 1.375 0.048  0.008 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 "C1'" C DC 2  ? ? "O4'" C DC 2  ? ? "C4'" C DC 2  ? ? 101.67 110.10 -8.43  1.00 N 
2   1 "O4'" C DC 2  ? ? "C1'" C DC 2  ? ? N1    C DC 2  ? ? 112.14 108.30 3.84   0.30 N 
3   1 C6    C DC 2  ? ? N1    C DC 2  ? ? C2    C DC 2  ? ? 123.09 120.30 2.79   0.40 N 
4   1 N1    C DC 2  ? ? C2    C DC 2  ? ? O2    C DC 2  ? ? 125.60 118.90 6.70   0.60 N 
5   1 "O4'" C DG 3  ? ? "C1'" C DG 3  ? ? "C2'" C DG 3  ? ? 99.41  105.90 -6.49  0.80 N 
6   1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? "C2'" C DC 4  ? ? 100.84 105.90 -5.06  0.80 N 
7   1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? N1    C DC 4  ? ? 103.61 108.00 -4.39  0.70 N 
8   1 C2    C DC 4  ? ? N3    C DC 4  ? ? C4    C DC 4  ? ? 124.26 119.90 4.36   0.50 N 
9   1 N3    C DC 4  ? ? C4    C DC 4  ? ? C5    C DC 4  ? ? 119.39 121.90 -2.51  0.40 N 
10  1 N3    C DC 4  ? ? C4    C DC 4  ? ? N4    C DC 4  ? ? 123.28 118.00 5.28   0.70 N 
11  1 "O4'" C DA 5  ? ? "C1'" C DA 5  ? ? "C2'" C DA 5  ? ? 96.67  105.90 -9.23  0.80 N 
12  1 C5    C DA 5  ? ? C6    C DA 5  ? ? N6    C DA 5  ? ? 118.28 123.70 -5.42  0.80 N 
13  1 "C3'" C DA 5  ? ? "O3'" C DA 5  ? ? P     C DC 6  ? ? 128.82 119.70 9.12   1.20 Y 
14  1 "C1'" C DC 6  ? ? "O4'" C DC 6  ? ? "C4'" C DC 6  ? ? 99.88  110.10 -10.22 1.00 N 
15  1 "O4'" C DC 6  ? ? "C1'" C DC 6  ? ? N1    C DC 6  ? ? 113.32 108.30 5.02   0.30 N 
16  1 C6    C DC 6  ? ? N1    C DC 6  ? ? C2    C DC 6  ? ? 123.09 120.30 2.79   0.40 N 
17  1 N1    C DC 6  ? ? C2    C DC 6  ? ? O2    C DC 6  ? ? 124.88 118.90 5.98   0.60 N 
18  1 "C3'" C DC 6  ? ? "O3'" C DC 6  ? ? P     C DA 7  ? ? 127.01 119.70 7.31   1.20 Y 
19  1 "C1'" C DA 7  ? ? "O4'" C DA 7  ? ? "C4'" C DA 7  ? ? 115.32 110.30 5.02   0.70 N 
20  1 "O4'" C DA 7  ? ? "C1'" C DA 7  ? ? "C2'" C DA 7  ? ? 95.42  105.90 -10.48 0.80 N 
21  1 C4    C DA 7  ? ? C5    C DA 7  ? ? C6    C DA 7  ? ? 120.21 117.00 3.21   0.50 N 
22  1 "O4'" C DC 8  ? ? "C1'" C DC 8  ? ? "C2'" C DC 8  ? ? 96.65  105.90 -9.25  0.80 N 
23  1 N1    C DC 8  ? ? C2    C DC 8  ? ? O2    C DC 8  ? ? 123.82 118.90 4.92   0.60 N 
24  1 N3    C DC 8  ? ? C4    C DC 8  ? ? N4    C DC 8  ? ? 122.60 118.00 4.60   0.70 N 
25  1 "C3'" C DC 8  ? ? "O3'" C DC 8  ? ? P     C DC 9  ? ? 128.50 119.70 8.80   1.20 Y 
26  1 "O4'" C DC 9  ? ? "C1'" C DC 9  ? ? "C2'" C DC 9  ? ? 97.81  105.90 -8.09  0.80 N 
27  1 N1    C DC 9  ? ? C2    C DC 9  ? ? O2    C DC 9  ? ? 122.98 118.90 4.08   0.60 N 
28  1 N3    C DC 9  ? ? C4    C DC 9  ? ? N4    C DC 9  ? ? 123.33 118.00 5.33   0.70 N 
29  1 C5    C DC 9  ? ? C4    C DC 9  ? ? N4    C DC 9  ? ? 115.39 120.20 -4.81  0.70 N 
30  1 "C3'" C DC 10 ? ? "C2'" C DC 10 ? ? "C1'" C DC 10 ? ? 95.55  102.40 -6.85  0.80 N 
31  1 "O4'" C DC 10 ? ? "C1'" C DC 10 ? ? "C2'" C DC 10 ? ? 110.96 106.80 4.16   0.50 N 
32  1 C6    C DC 10 ? ? N1    C DC 10 ? ? C2    C DC 10 ? ? 123.61 120.30 3.31   0.40 N 
33  1 N1    C DC 10 ? ? C2    C DC 10 ? ? N3    C DC 10 ? ? 114.78 119.20 -4.42  0.70 N 
34  1 N1    C DC 10 ? ? C2    C DC 10 ? ? O2    C DC 10 ? ? 123.01 118.90 4.11   0.60 N 
35  1 "O4'" C DA 11 ? ? "C1'" C DA 11 ? ? N9    C DA 11 ? ? 111.62 108.30 3.32   0.30 N 
36  1 "C3'" C DA 11 ? ? "O3'" C DA 11 ? ? P     C DC 12 ? ? 129.67 119.70 9.97   1.20 Y 
37  1 "O4'" C DC 12 ? ? "C1'" C DC 12 ? ? "C2'" C DC 12 ? ? 97.43  105.90 -8.47  0.80 N 
38  1 "O4'" C DC 12 ? ? "C1'" C DC 12 ? ? N1    C DC 12 ? ? 111.14 108.30 2.84   0.30 N 
39  1 N3    C DC 12 ? ? C4    C DC 12 ? ? C5    C DC 12 ? ? 119.49 121.90 -2.41  0.40 N 
40  1 N1    C DC 12 ? ? C2    C DC 12 ? ? O2    C DC 12 ? ? 123.10 118.90 4.20   0.60 N 
41  1 "O4'" C DA 13 ? ? "C1'" C DA 13 ? ? "C2'" C DA 13 ? ? 100.76 105.90 -5.14  0.80 N 
42  1 "O4'" C DA 13 ? ? "C1'" C DA 13 ? ? N9    C DA 13 ? ? 103.11 108.00 -4.89  0.70 N 
43  1 "C1'" C DC 14 ? ? "O4'" C DC 14 ? ? "C4'" C DC 14 ? ? 103.11 110.10 -6.99  1.00 N 
44  1 "O4'" C DC 14 ? ? "C1'" C DC 14 ? ? "C2'" C DC 14 ? ? 96.71  105.90 -9.19  0.80 N 
45  1 "O4'" C DC 14 ? ? "C1'" C DC 14 ? ? N1    C DC 14 ? ? 111.46 108.30 3.16   0.30 N 
46  1 N1    C DC 14 ? ? C2    C DC 14 ? ? N3    C DC 14 ? ? 114.23 119.20 -4.97  0.70 N 
47  1 C2    C DC 14 ? ? N3    C DC 14 ? ? C4    C DC 14 ? ? 125.85 119.90 5.95   0.50 N 
48  1 N3    C DC 14 ? ? C4    C DC 14 ? ? C5    C DC 14 ? ? 119.43 121.90 -2.47  0.40 N 
49  1 N1    C DC 14 ? ? C2    C DC 14 ? ? O2    C DC 14 ? ? 126.99 118.90 8.09   0.60 N 
50  1 "C3'" C DC 14 ? ? "O3'" C DC 14 ? ? P     C DA 15 ? ? 132.89 119.70 13.19  1.20 Y 
51  1 C5    C DA 15 ? ? C6    C DA 15 ? ? N6    C DA 15 ? ? 118.73 123.70 -4.97  0.80 N 
52  1 "C4'" C DC 16 ? ? "C3'" C DC 16 ? ? "C2'" C DC 16 ? ? 108.56 103.10 5.46   0.90 N 
53  1 N1    C DC 16 ? ? C2    C DC 16 ? ? O2    C DC 16 ? ? 122.81 118.90 3.91   0.60 N 
54  1 "O4'" C DC 17 ? ? "C1'" C DC 17 ? ? "C2'" C DC 17 ? ? 100.84 105.90 -5.06  0.80 N 
55  1 C6    C DC 17 ? ? N1    C DC 17 ? ? C2    C DC 17 ? ? 123.03 120.30 2.73   0.40 N 
56  1 N1    C DC 17 ? ? C2    C DC 17 ? ? N3    C DC 17 ? ? 113.56 119.20 -5.64  0.70 N 
57  1 C2    C DC 17 ? ? N3    C DC 17 ? ? C4    C DC 17 ? ? 124.84 119.90 4.94   0.50 N 
58  1 N1    C DC 17 ? ? C2    C DC 17 ? ? O2    C DC 17 ? ? 124.27 118.90 5.37   0.60 N 
59  1 "O4'" C DG 19 ? ? "C1'" C DG 19 ? ? N9    C DG 19 ? ? 113.21 108.30 4.91   0.30 N 
60  1 "O4'" D DC 20 ? ? "C1'" D DC 20 ? ? N1    D DC 20 ? ? 114.93 108.30 6.63   0.30 N 
61  1 C2    D DC 20 ? ? N3    D DC 20 ? ? C4    D DC 20 ? ? 126.10 119.90 6.20   0.50 N 
62  1 N3    D DC 20 ? ? C4    D DC 20 ? ? C5    D DC 20 ? ? 118.26 121.90 -3.64  0.40 N 
63  1 N1    D DC 20 ? ? C2    D DC 20 ? ? O2    D DC 20 ? ? 123.26 118.90 4.36   0.60 N 
64  1 "O4'" D DC 21 ? ? "C1'" D DC 21 ? ? N1    D DC 21 ? ? 110.13 108.30 1.83   0.30 N 
65  1 N3    D DC 21 ? ? C4    D DC 21 ? ? N4    D DC 21 ? ? 123.64 118.00 5.64   0.70 N 
66  1 C5    D DC 21 ? ? C4    D DC 21 ? ? N4    D DC 21 ? ? 115.40 120.20 -4.80  0.70 N 
67  1 "O4'" D DT 22 ? ? "C4'" D DT 22 ? ? "C3'" D DT 22 ? ? 101.26 104.50 -3.24  0.40 N 
68  1 "O4'" D DT 22 ? ? "C1'" D DT 22 ? ? "C2'" D DT 22 ? ? 98.79  105.90 -7.11  0.80 N 
69  1 C4    D DT 22 ? ? C5    D DT 22 ? ? C6    D DT 22 ? ? 121.80 118.00 3.80   0.60 N 
70  1 "C3'" D DG 23 ? ? "O3'" D DG 23 ? ? P     D DG 24 ? ? 134.87 119.70 15.17  1.20 Y 
71  1 P     D DG 24 ? ? "O5'" D DG 24 ? ? "C5'" D DG 24 ? ? 110.60 120.90 -10.30 1.60 N 
72  1 "O4'" D DG 24 ? ? "C1'" D DG 24 ? ? N9    D DG 24 ? ? 115.35 108.30 7.05   0.30 N 
73  1 N1    D DG 24 ? ? C6    D DG 24 ? ? O6    D DG 24 ? ? 124.02 119.90 4.12   0.60 N 
74  1 C5    D DG 24 ? ? C6    D DG 24 ? ? O6    D DG 24 ? ? 124.19 128.60 -4.41  0.60 N 
75  1 "O4'" D DT 25 ? ? "C1'" D DT 25 ? ? N1    D DT 25 ? ? 122.77 108.30 14.47  0.30 N 
76  1 N3    D DT 25 ? ? C2    D DT 25 ? ? O2    D DT 25 ? ? 117.73 122.30 -4.57  0.60 N 
77  1 "C1'" D DG 26 ? ? "O4'" D DG 26 ? ? "C4'" D DG 26 ? ? 114.96 110.30 4.66   0.70 N 
78  1 "O4'" D DG 26 ? ? "C1'" D DG 26 ? ? "C2'" D DG 26 ? ? 98.67  105.90 -7.23  0.80 N 
79  1 "O4'" D DT 27 ? ? "C1'" D DT 27 ? ? "C2'" D DT 27 ? ? 93.95  105.90 -11.95 0.80 N 
80  1 "O4'" D DT 27 ? ? "C1'" D DT 27 ? ? N1    D DT 27 ? ? 102.17 108.00 -5.83  0.70 N 
81  1 C4    D DT 27 ? ? C5    D DT 27 ? ? C6    D DT 27 ? ? 121.66 118.00 3.66   0.60 N 
82  1 "O4'" D DG 28 ? ? "C4'" D DG 28 ? ? "C3'" D DG 28 ? ? 101.84 104.50 -2.66  0.40 N 
83  1 "O4'" D DG 28 ? ? "C1'" D DG 28 ? ? "C2'" D DG 28 ? ? 94.46  105.90 -11.44 0.80 N 
84  1 "O4'" D DG 28 ? ? "C1'" D DG 28 ? ? N9    D DG 28 ? ? 111.70 108.30 3.40   0.30 N 
85  1 C2    D DG 28 ? ? N3    D DG 28 ? ? C4    D DG 28 ? ? 115.98 111.90 4.08   0.50 N 
86  1 N1    D DG 28 ? ? C2    D DG 28 ? ? N2    D DG 28 ? ? 123.05 116.20 6.85   0.90 N 
87  1 "C3'" D DG 28 ? ? "O3'" D DG 28 ? ? P     D DT 29 ? ? 128.55 119.70 8.85   1.20 Y 
88  1 "O4'" D DT 29 ? ? "C4'" D DT 29 ? ? "C3'" D DT 29 ? ? 111.07 106.00 5.07   0.60 N 
89  1 "C4'" D DT 29 ? ? "C3'" D DT 29 ? ? "C2'" D DT 29 ? ? 95.44  102.20 -6.76  0.70 N 
90  1 "O4'" D DT 29 ? ? "C1'" D DT 29 ? ? "C2'" D DT 29 ? ? 98.66  105.90 -7.24  0.80 N 
91  1 "O4'" D DT 29 ? ? "C1'" D DT 29 ? ? N1    D DT 29 ? ? 96.93  108.00 -11.07 0.70 N 
92  1 C6    D DT 29 ? ? C5    D DT 29 ? ? C7    D DT 29 ? ? 118.60 122.90 -4.30  0.60 N 
93  1 "O4'" D DG 30 ? ? "C1'" D DG 30 ? ? "C2'" D DG 30 ? ? 100.71 105.90 -5.19  0.80 N 
94  1 "O4'" D DG 30 ? ? "C1'" D DG 30 ? ? N9    D DG 30 ? ? 103.63 108.00 -4.37  0.70 N 
95  1 N1    D DG 30 ? ? C6    D DG 30 ? ? O6    D DG 30 ? ? 123.60 119.90 3.70   0.60 N 
96  1 "O5'" D DG 31 ? ? P     D DG 31 ? ? OP2   D DG 31 ? ? 99.04  105.70 -6.66  0.90 N 
97  1 "O4'" D DG 31 ? ? "C4'" D DG 31 ? ? "C3'" D DG 31 ? ? 112.68 106.00 6.68   0.60 N 
98  1 "C1'" D DG 31 ? ? "O4'" D DG 31 ? ? "C4'" D DG 31 ? ? 102.66 110.10 -7.44  1.00 N 
99  1 "O4'" D DG 31 ? ? "C1'" D DG 31 ? ? "C2'" D DG 31 ? ? 111.61 106.80 4.81   0.50 N 
100 1 "O4'" D DG 31 ? ? "C1'" D DG 31 ? ? N9    D DG 31 ? ? 117.47 108.30 9.17   0.30 N 
101 1 "C3'" D DG 31 ? ? "O3'" D DG 31 ? ? P     D DG 32 ? ? 129.79 119.70 10.09  1.20 Y 
102 1 N9    D DG 32 ? ? "C1'" D DG 32 ? ? "C2'" D DG 32 ? ? 124.50 114.30 10.20  1.40 N 
103 1 "C5'" D DT 33 ? ? "C4'" D DT 33 ? ? "O4'" D DT 33 ? ? 118.10 109.80 8.30   1.10 N 
104 1 "O4'" D DT 33 ? ? "C1'" D DT 33 ? ? N1    D DT 33 ? ? 114.67 108.30 6.37   0.30 N 
105 1 N3    D DT 33 ? ? C4    D DT 33 ? ? O4    D DT 33 ? ? 114.71 119.90 -5.19  0.60 N 
106 1 C5    D DT 33 ? ? C4    D DT 33 ? ? O4    D DT 33 ? ? 132.83 124.90 7.93   0.70 N 
107 1 C6    D DT 33 ? ? C5    D DT 33 ? ? C7    D DT 33 ? ? 116.67 122.90 -6.23  0.60 N 
108 1 "C3'" D DG 34 ? ? "O3'" D DG 34 ? ? P     D DT 35 ? ? 129.80 119.70 10.10  1.20 Y 
109 1 "O4'" D DT 35 ? ? "C1'" D DT 35 ? ? "C2'" D DT 35 ? ? 99.99  105.90 -5.91  0.80 N 
110 1 C4    D DT 35 ? ? C5    D DT 35 ? ? C6    D DT 35 ? ? 121.97 118.00 3.97   0.60 N 
111 1 C6    D DT 35 ? ? C5    D DT 35 ? ? C7    D DT 35 ? ? 116.75 122.90 -6.15  0.60 N 
112 1 "O4'" D DG 36 ? ? "C1'" D DG 36 ? ? N9    D DG 36 ? ? 117.02 108.30 8.72   0.30 N 
113 1 C5    D DG 36 ? ? N7    D DG 36 ? ? C8    D DG 36 ? ? 100.92 104.30 -3.38  0.50 N 
114 1 "O4'" D DC 37 ? ? "C4'" D DC 37 ? ? "C3'" D DC 37 ? ? 101.47 104.50 -3.03  0.40 N 
115 1 "O4'" D DC 37 ? ? "C1'" D DC 37 ? ? N1    D DC 37 ? ? 98.86  108.00 -9.14  0.70 N 
116 1 N3    D DC 37 ? ? C2    D DC 37 ? ? O2    D DC 37 ? ? 117.31 121.90 -4.59  0.70 N 
117 1 "C5'" D DG 38 ? ? "C4'" D DG 38 ? ? "O4'" D DG 38 ? ? 117.61 109.80 7.81   1.10 N 
118 1 "O4'" D DG 38 ? ? "C1'" D DG 38 ? ? "C2'" D DG 38 ? ? 100.70 105.90 -5.20  0.80 N 
119 1 N9    D DG 38 ? ? "C1'" D DG 38 ? ? "C2'" D DG 38 ? ? 126.65 114.30 12.35  1.40 N 
120 1 "O4'" D DG 38 ? ? "C1'" D DG 38 ? ? N9    D DG 38 ? ? 103.44 108.00 -4.56  0.70 N 
121 1 C5    D DG 38 ? ? C6    D DG 38 ? ? O6    D DG 38 ? ? 123.86 128.60 -4.74  0.60 N 
122 1 "O4'" E DC 2  ? ? "C1'" E DC 2  ? ? N1    E DC 2  ? ? 114.43 108.30 6.13   0.30 N 
123 1 "C3'" E DC 2  ? ? "O3'" E DC 2  ? ? P     E DG 3  ? ? 132.02 119.70 12.32  1.20 Y 
124 1 C5    E DG 3  ? ? C6    E DG 3  ? ? N1    E DG 3  ? ? 114.83 111.50 3.33   0.50 N 
125 1 P     E DC 4  ? ? "O5'" E DC 4  ? ? "C5'" E DC 4  ? ? 131.40 120.90 10.50  1.60 N 
126 1 "C1'" E DC 4  ? ? "O4'" E DC 4  ? ? "C4'" E DC 4  ? ? 102.66 110.10 -7.44  1.00 N 
127 1 "O4'" E DC 4  ? ? "C1'" E DC 4  ? ? N1    E DC 4  ? ? 100.96 108.00 -7.04  0.70 N 
128 1 N3    E DC 4  ? ? C4    E DC 4  ? ? N4    E DC 4  ? ? 122.48 118.00 4.48   0.70 N 
129 1 "C3'" E DC 4  ? ? "O3'" E DC 4  ? ? P     E DA 5  ? ? 127.85 119.70 8.15   1.20 Y 
130 1 "O4'" E DA 5  ? ? "C1'" E DA 5  ? ? "C2'" E DA 5  ? ? 100.34 105.90 -5.56  0.80 N 
131 1 "O4'" E DA 5  ? ? "C1'" E DA 5  ? ? N9    E DA 5  ? ? 103.59 108.00 -4.41  0.70 N 
132 1 P     E DC 6  ? ? "O5'" E DC 6  ? ? "C5'" E DC 6  ? ? 131.62 120.90 10.72  1.60 N 
133 1 "C1'" E DC 6  ? ? "O4'" E DC 6  ? ? "C4'" E DC 6  ? ? 102.52 110.10 -7.58  1.00 N 
134 1 "O4'" E DC 6  ? ? "C1'" E DC 6  ? ? "C2'" E DC 6  ? ? 99.71  105.90 -6.19  0.80 N 
135 1 "O4'" E DC 6  ? ? "C1'" E DC 6  ? ? N1    E DC 6  ? ? 111.44 108.30 3.14   0.30 N 
136 1 "O4'" E DA 7  ? ? "C1'" E DA 7  ? ? "C2'" E DA 7  ? ? 97.16  105.90 -8.74  0.80 N 
137 1 C6    E DC 9  ? ? N1    E DC 9  ? ? C2    E DC 9  ? ? 123.68 120.30 3.38   0.40 N 
138 1 N1    E DC 9  ? ? C2    E DC 9  ? ? O2    E DC 9  ? ? 122.97 118.90 4.07   0.60 N 
139 1 "O4'" E DC 10 ? ? "C1'" E DC 10 ? ? N1    E DC 10 ? ? 113.80 108.30 5.50   0.30 N 
140 1 C6    E DC 10 ? ? N1    E DC 10 ? ? C2    E DC 10 ? ? 123.43 120.30 3.13   0.40 N 
141 1 N1    E DC 10 ? ? C2    E DC 10 ? ? N3    E DC 10 ? ? 114.87 119.20 -4.33  0.70 N 
142 1 C2    E DC 10 ? ? N3    E DC 10 ? ? C4    E DC 10 ? ? 123.22 119.90 3.32   0.50 N 
143 1 N1    E DC 10 ? ? C2    E DC 10 ? ? O2    E DC 10 ? ? 126.02 118.90 7.12   0.60 N 
144 1 "O4'" E DA 11 ? ? "C1'" E DA 11 ? ? N9    E DA 11 ? ? 115.07 108.30 6.77   0.30 N 
145 1 "C3'" E DA 11 ? ? "O3'" E DA 11 ? ? P     E DC 12 ? ? 127.99 119.70 8.29   1.20 Y 
146 1 "O4'" E DC 12 ? ? "C1'" E DC 12 ? ? "C2'" E DC 12 ? ? 99.76  105.90 -6.14  0.80 N 
147 1 "O4'" E DC 12 ? ? "C1'" E DC 12 ? ? N1    E DC 12 ? ? 112.62 108.30 4.32   0.30 N 
148 1 N1    E DC 12 ? ? C2    E DC 12 ? ? O2    E DC 12 ? ? 124.08 118.90 5.18   0.60 N 
149 1 N3    E DC 12 ? ? C2    E DC 12 ? ? O2    E DC 12 ? ? 115.80 121.90 -6.10  0.70 N 
150 1 "O4'" E DA 13 ? ? "C1'" E DA 13 ? ? "C2'" E DA 13 ? ? 100.74 105.90 -5.16  0.80 N 
151 1 "O4'" E DA 13 ? ? "C1'" E DA 13 ? ? N9    E DA 13 ? ? 101.83 108.00 -6.17  0.70 N 
152 1 "O4'" E DC 14 ? ? "C1'" E DC 14 ? ? "C2'" E DC 14 ? ? 97.92  105.90 -7.98  0.80 N 
153 1 "O4'" E DC 14 ? ? "C1'" E DC 14 ? ? N1    E DC 14 ? ? 117.55 108.30 9.25   0.30 N 
154 1 N1    E DC 14 ? ? C2    E DC 14 ? ? O2    E DC 14 ? ? 124.70 118.90 5.80   0.60 N 
155 1 "C3'" E DC 14 ? ? "O3'" E DC 14 ? ? P     E DA 15 ? ? 129.38 119.70 9.68   1.20 Y 
156 1 "C1'" E DA 15 ? ? "O4'" E DA 15 ? ? "C4'" E DA 15 ? ? 103.98 110.10 -6.12  1.00 N 
157 1 C2    E DA 15 ? ? N3    E DA 15 ? ? C4    E DA 15 ? ? 106.69 110.60 -3.91  0.50 N 
158 1 "O4'" E DC 16 ? ? "C4'" E DC 16 ? ? "C3'" E DC 16 ? ? 110.44 106.00 4.44   0.60 N 
159 1 "O4'" E DC 16 ? ? "C1'" E DC 16 ? ? N1    E DC 16 ? ? 115.61 108.30 7.31   0.30 N 
160 1 C2    E DC 16 ? ? N3    E DC 16 ? ? C4    E DC 16 ? ? 123.75 119.90 3.85   0.50 N 
161 1 N1    E DC 16 ? ? C2    E DC 16 ? ? O2    E DC 16 ? ? 124.91 118.90 6.01   0.60 N 
162 1 N3    E DC 16 ? ? C2    E DC 16 ? ? O2    E DC 16 ? ? 116.53 121.90 -5.37  0.70 N 
163 1 "C3'" E DC 16 ? ? "O3'" E DC 16 ? ? P     E DC 17 ? ? 127.55 119.70 7.85   1.20 Y 
164 1 "O5'" E DC 17 ? ? "C5'" E DC 17 ? ? "C4'" E DC 17 ? ? 103.72 109.40 -5.68  0.80 N 
165 1 "C1'" E DC 17 ? ? "O4'" E DC 17 ? ? "C4'" E DC 17 ? ? 103.60 110.10 -6.50  1.00 N 
166 1 "O4'" E DC 17 ? ? "C1'" E DC 17 ? ? "C2'" E DC 17 ? ? 96.11  105.90 -9.79  0.80 N 
167 1 C6    E DC 17 ? ? N1    E DC 17 ? ? C2    E DC 17 ? ? 123.58 120.30 3.28   0.40 N 
168 1 N1    E DC 17 ? ? C2    E DC 17 ? ? N3    E DC 17 ? ? 114.82 119.20 -4.38  0.70 N 
169 1 N1    E DC 17 ? ? C2    E DC 17 ? ? O2    E DC 17 ? ? 126.43 118.90 7.53   0.60 N 
170 1 "C3'" E DC 17 ? ? "O3'" E DC 17 ? ? P     E DA 18 ? ? 127.71 119.70 8.01   1.20 Y 
171 1 "O4'" E DA 18 ? ? "C1'" E DA 18 ? ? N9    E DA 18 ? ? 112.65 108.30 4.35   0.30 N 
172 1 N1    E DA 18 ? ? C6    E DA 18 ? ? N6    E DA 18 ? ? 123.03 118.60 4.43   0.60 N 
173 1 "C3'" E DA 18 ? ? "O3'" E DA 18 ? ? P     E DG 19 ? ? 133.78 119.70 14.08  1.20 Y 
174 1 "O4'" E DG 19 ? ? "C1'" E DG 19 ? ? "C2'" E DG 19 ? ? 98.75  105.90 -7.15  0.80 N 
175 1 N9    E DG 19 ? ? "C1'" E DG 19 ? ? "C2'" E DG 19 ? ? 134.51 114.30 20.21  1.40 N 
176 1 N9    E DG 19 ? ? C4    E DG 19 ? ? C5    E DG 19 ? ? 108.38 105.40 2.98   0.40 N 
177 1 "O4'" F DC 20 ? ? "C1'" F DC 20 ? ? N1    F DC 20 ? ? 116.77 108.30 8.47   0.30 N 
178 1 C2    F DC 20 ? ? N3    F DC 20 ? ? C4    F DC 20 ? ? 123.50 119.90 3.60   0.50 N 
179 1 "C3'" F DC 20 ? ? "O3'" F DC 20 ? ? P     F DC 21 ? ? 127.29 119.70 7.59   1.20 Y 
180 1 N1    F DC 21 ? ? C2    F DC 21 ? ? O2    F DC 21 ? ? 122.63 118.90 3.73   0.60 N 
181 1 N3    F DC 21 ? ? C2    F DC 21 ? ? O2    F DC 21 ? ? 116.72 121.90 -5.18  0.70 N 
182 1 "O3'" F DT 22 ? ? P     F DG 23 ? ? "O5'" F DG 23 ? ? 88.00  104.00 -16.00 1.90 Y 
183 1 "O4'" F DG 23 ? ? "C1'" F DG 23 ? ? N9    F DG 23 ? ? 112.03 108.30 3.73   0.30 N 
184 1 "C3'" F DG 23 ? ? "O3'" F DG 23 ? ? P     F DG 24 ? ? 133.22 119.70 13.52  1.20 Y 
185 1 "O4'" F DG 24 ? ? "C1'" F DG 24 ? ? N9    F DG 24 ? ? 115.13 108.30 6.83   0.30 N 
186 1 "C3'" F DG 24 ? ? "O3'" F DG 24 ? ? P     F DT 25 ? ? 127.48 119.70 7.78   1.20 Y 
187 1 "O4'" F DT 25 ? ? "C1'" F DT 25 ? ? N1    F DT 25 ? ? 113.49 108.30 5.19   0.30 N 
188 1 N3    F DT 25 ? ? C4    F DT 25 ? ? O4    F DT 25 ? ? 123.87 119.90 3.97   0.60 N 
189 1 C4    F DT 25 ? ? C5    F DT 25 ? ? C7    F DT 25 ? ? 115.30 119.00 -3.70  0.60 N 
190 1 "O5'" F DT 27 ? ? P     F DT 27 ? ? OP2   F DT 27 ? ? 99.86  105.70 -5.84  0.90 N 
191 1 "O4'" F DT 27 ? ? "C1'" F DT 27 ? ? "C2'" F DT 27 ? ? 98.20  105.90 -7.70  0.80 N 
192 1 N3    F DT 27 ? ? C4    F DT 27 ? ? C5    F DT 27 ? ? 110.75 115.20 -4.45  0.60 N 
193 1 C4    F DT 27 ? ? C5    F DT 27 ? ? C6    F DT 27 ? ? 123.54 118.00 5.54   0.60 N 
194 1 C5    F DT 27 ? ? C4    F DT 27 ? ? O4    F DT 27 ? ? 130.27 124.90 5.37   0.70 N 
195 1 C6    F DT 27 ? ? C5    F DT 27 ? ? C7    F DT 27 ? ? 116.88 122.90 -6.02  0.60 N 
196 1 "O4'" F DT 29 ? ? "C1'" F DT 29 ? ? "C2'" F DT 29 ? ? 99.29  105.90 -6.61  0.80 N 
197 1 "O4'" F DT 29 ? ? "C1'" F DT 29 ? ? N1    F DT 29 ? ? 98.88  108.00 -9.12  0.70 N 
198 1 "O4'" F DG 30 ? ? "C1'" F DG 30 ? ? "C2'" F DG 30 ? ? 101.04 105.90 -4.86  0.80 N 
199 1 N1    F DG 30 ? ? C2    F DG 30 ? ? N3    F DG 30 ? ? 120.20 123.90 -3.70  0.60 N 
200 1 C2    F DG 30 ? ? N3    F DG 30 ? ? C4    F DG 30 ? ? 116.33 111.90 4.43   0.50 N 
201 1 N9    F DG 30 ? ? C4    F DG 30 ? ? C5    F DG 30 ? ? 108.12 105.40 2.72   0.40 N 
202 1 "O4'" F DG 31 ? ? "C1'" F DG 31 ? ? "C2'" F DG 31 ? ? 97.39  105.90 -8.51  0.80 N 
203 1 "O4'" F DG 31 ? ? "C1'" F DG 31 ? ? N9    F DG 31 ? ? 112.03 108.30 3.73   0.30 N 
204 1 C2    F DG 31 ? ? N3    F DG 31 ? ? C4    F DG 31 ? ? 115.28 111.90 3.38   0.50 N 
205 1 "C1'" F DG 32 ? ? "O4'" F DG 32 ? ? "C4'" F DG 32 ? ? 102.50 110.10 -7.60  1.00 N 
206 1 "C4'" F DG 32 ? ? "C3'" F DG 32 ? ? "C2'" F DG 32 ? ? 96.72  102.20 -5.48  0.70 N 
207 1 "O4'" F DG 32 ? ? "C1'" F DG 32 ? ? "C2'" F DG 32 ? ? 111.19 106.80 4.39   0.50 N 
208 1 N9    F DG 32 ? ? "C1'" F DG 32 ? ? "C2'" F DG 32 ? ? 126.93 114.30 12.63  1.40 N 
209 1 "C3'" F DG 32 ? ? "O3'" F DG 32 ? ? P     F DT 33 ? ? 128.41 119.70 8.71   1.20 Y 
210 1 "O4'" F DT 33 ? ? "C4'" F DT 33 ? ? "C3'" F DT 33 ? ? 98.75  104.50 -5.75  0.40 N 
211 1 "C1'" F DT 33 ? ? "O4'" F DT 33 ? ? "C4'" F DT 33 ? ? 117.69 110.30 7.39   0.70 N 
212 1 "O4'" F DT 33 ? ? "C1'" F DT 33 ? ? "C2'" F DT 33 ? ? 95.73  105.90 -10.17 0.80 N 
213 1 C4    F DT 33 ? ? C5    F DT 33 ? ? C6    F DT 33 ? ? 122.03 118.00 4.03   0.60 N 
214 1 C6    F DT 33 ? ? C5    F DT 33 ? ? C7    F DT 33 ? ? 119.15 122.90 -3.75  0.60 N 
215 1 "C3'" F DT 33 ? ? "O3'" F DT 33 ? ? P     F DG 34 ? ? 127.21 119.70 7.51   1.20 Y 
216 1 "O4'" F DG 34 ? ? "C4'" F DG 34 ? ? "C3'" F DG 34 ? ? 102.00 104.50 -2.50  0.40 N 
217 1 "C5'" F DG 34 ? ? "C4'" F DG 34 ? ? "O4'" F DG 34 ? ? 117.56 109.80 7.76   1.10 N 
218 1 "O4'" F DG 34 ? ? "C1'" F DG 34 ? ? "C2'" F DG 34 ? ? 100.55 105.90 -5.35  0.80 N 
219 1 N1    F DG 34 ? ? C2    F DG 34 ? ? N3    F DG 34 ? ? 120.09 123.90 -3.81  0.60 N 
220 1 C2    F DG 34 ? ? N3    F DG 34 ? ? C4    F DG 34 ? ? 115.51 111.90 3.61   0.50 N 
221 1 "O4'" F DT 35 ? ? "C1'" F DT 35 ? ? N1    F DT 35 ? ? 101.13 108.00 -6.87  0.70 N 
222 1 C4    F DT 35 ? ? C5    F DT 35 ? ? C7    F DT 35 ? ? 123.60 119.00 4.60   0.60 N 
223 1 C6    F DT 35 ? ? C5    F DT 35 ? ? C7    F DT 35 ? ? 114.97 122.90 -7.93  0.60 N 
224 1 "O4'" F DG 36 ? ? "C1'" F DG 36 ? ? N9    F DG 36 ? ? 117.23 108.30 8.93   0.30 N 
225 1 "O4'" F DC 37 ? ? "C1'" F DC 37 ? ? N1    F DC 37 ? ? 111.28 108.30 2.98   0.30 N 
226 1 C2    F DC 37 ? ? N3    F DC 37 ? ? C4    F DC 37 ? ? 124.02 119.90 4.12   0.50 N 
227 1 N1    F DC 37 ? ? C2    F DC 37 ? ? O2    F DC 37 ? ? 126.37 118.90 7.47   0.60 N 
228 1 N3    F DC 37 ? ? C2    F DC 37 ? ? O2    F DC 37 ? ? 117.52 121.90 -4.38  0.70 N 
229 1 "C3'" F DC 37 ? ? "O3'" F DC 37 ? ? P     F DG 38 ? ? 128.80 119.70 9.10   1.20 Y 
230 1 N3    F DG 38 ? ? C4    F DG 38 ? ? C5    F DG 38 ? ? 125.47 128.60 -3.13  0.50 N 
231 1 C4    F DG 38 ? ? C5    F DG 38 ? ? N7    F DG 38 ? ? 107.83 110.80 -2.97  0.40 N 
232 1 C8    F DG 38 ? ? N9    F DG 38 ? ? C4    F DG 38 ? ? 103.91 106.40 -2.49  0.40 N 
233 1 N9    F DG 38 ? ? C4    F DG 38 ? ? C5    F DG 38 ? ? 108.42 105.40 3.02   0.40 N 
234 1 N1    F DG 38 ? ? C6    F DG 38 ? ? O6    F DG 38 ? ? 116.14 119.90 -3.76  0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 378 ? ? -144.46 46.57   
2  1 GLU A 416 ? ? 69.79   -41.92  
3  1 SER A 444 ? ? -77.46  -168.77 
4  1 GLN A 515 ? ? -172.82 -176.01 
5  1 SER A 516 ? ? -173.66 40.07   
6  1 ALA A 534 ? ? -75.32  22.01   
7  1 ALA A 563 ? ? -67.64  17.88   
8  1 GLU B 416 ? ? 68.90   -43.01  
9  1 ASP B 430 ? ? -87.12  -159.11 
10 1 SER B 444 ? ? -83.04  -150.59 
11 1 SER B 516 ? ? -159.98 52.03   
12 1 ALA B 522 ? ? -48.09  159.65  
13 1 ASN B 576 ? ? 33.30   75.15   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 E DC  1   ? C DC  1   
2   1 Y 1 A GLY 353 ? E GLY 1   
3   1 Y 1 A ALA 354 ? E ALA 2   
4   1 Y 1 A LEU 355 ? E LEU 3   
5   1 Y 1 A PRO 356 ? E PRO 4   
6   1 Y 1 A SER 357 ? E SER 5   
7   1 Y 1 A HIS 358 ? E HIS 6   
8   1 Y 1 A ASN 359 ? E ASN 7   
9   1 Y 1 A THR 482 ? E THR 130 
10  1 Y 1 A ASP 483 ? E ASP 131 
11  1 Y 1 A GLU 484 ? E GLU 132 
12  1 Y 1 A ASP 485 ? E ASP 133 
13  1 Y 1 A THR 486 ? E THR 134 
14  1 Y 1 A PRO 487 ? E PRO 135 
15  1 Y 1 A THR 488 ? E THR 136 
16  1 Y 1 A ALA 489 ? E ALA 137 
17  1 Y 1 A ILE 490 ? E ILE 138 
18  1 Y 1 A ALA 491 ? E ALA 139 
19  1 Y 1 A ARG 492 ? E ARG 140 
20  1 Y 1 A ARG 493 ? E ARG 141 
21  1 Y 1 A ASN 494 ? E ASN 142 
22  1 Y 1 A MET 495 ? E MET 143 
23  1 Y 1 A THR 496 ? E THR 144 
24  1 Y 1 A MET 497 ? E MET 145 
25  1 Y 1 A ASP 498 ? E ASP 146 
26  1 Y 1 A PRO 499 ? E PRO 147 
27  1 Y 1 A ASN 500 ? E ASN 148 
28  1 Y 1 A HIS 501 ? E HIS 149 
29  1 Y 1 A VAL 502 ? E VAL 150 
30  1 Y 1 A PRO 503 ? E PRO 151 
31  1 Y 1 A GLY 504 ? E GLY 152 
32  1 Y 1 A SER 505 ? E SER 153 
33  1 Y 1 A GLU 506 ? E GLU 154 
34  1 Y 1 A PRO 507 ? E PRO 155 
35  1 Y 1 A ASN 508 ? E ASN 156 
36  1 Y 1 A PHE 509 ? E PHE 157 
37  1 Y 1 A ALA 510 ? E ALA 158 
38  1 Y 1 A ALA 511 ? E ALA 159 
39  1 Y 1 A TYR 512 ? E TYR 160 
40  1 Y 1 A LYS 565 ? E LYS 213 
41  1 Y 1 A ALA 566 ? E ALA 214 
42  1 Y 1 A GLN 567 ? E GLN 215 
43  1 Y 1 A ASN 568 ? E ASN 216 
44  1 Y 1 A ARG 569 ? E ARG 217 
45  1 Y 1 A GLU 570 ? E GLU 218 
46  1 Y 1 A PRO 571 ? E PRO 219 
47  1 Y 1 A ASN 579 ? E ASN 227 
48  1 Y 1 A ARG 580 ? E ARG 228 
49  1 Y 1 A PRO 581 ? E PRO 229 
50  1 Y 1 A LYS 582 ? E LYS 230 
51  1 Y 1 A ARG 583 ? E ARG 231 
52  1 Y 1 A PRO 584 ? E PRO 232 
53  1 Y 1 A GLY 585 ? E GLY 233 
54  1 Y 1 A VAL 586 ? E VAL 234 
55  1 Y 1 A ALA 595 ? E ALA 243 
56  1 Y 1 A ALA 596 ? E ALA 244 
57  1 Y 1 A LYS 597 ? E LYS 245 
58  1 Y 1 A ARG 598 ? E ARG 246 
59  1 Y 1 B GLY 353 ? F GLY 1   
60  1 Y 1 B ALA 354 ? F ALA 2   
61  1 Y 1 B LEU 355 ? F LEU 3   
62  1 Y 1 B PRO 356 ? F PRO 4   
63  1 Y 1 B SER 357 ? F SER 5   
64  1 Y 1 B HIS 358 ? F HIS 6   
65  1 Y 1 B ASN 359 ? F ASN 7   
66  1 Y 1 B THR 482 ? F THR 130 
67  1 Y 1 B ASP 483 ? F ASP 131 
68  1 Y 1 B GLU 484 ? F GLU 132 
69  1 Y 1 B ASP 485 ? F ASP 133 
70  1 Y 1 B THR 486 ? F THR 134 
71  1 Y 1 B PRO 487 ? F PRO 135 
72  1 Y 1 B THR 488 ? F THR 136 
73  1 Y 1 B ALA 489 ? F ALA 137 
74  1 Y 1 B ILE 490 ? F ILE 138 
75  1 Y 1 B ALA 491 ? F ALA 139 
76  1 Y 1 B ARG 492 ? F ARG 140 
77  1 Y 1 B ARG 493 ? F ARG 141 
78  1 Y 1 B ASN 494 ? F ASN 142 
79  1 Y 1 B MET 495 ? F MET 143 
80  1 Y 1 B THR 496 ? F THR 144 
81  1 Y 1 B MET 497 ? F MET 145 
82  1 Y 1 B ASP 498 ? F ASP 146 
83  1 Y 1 B PRO 499 ? F PRO 147 
84  1 Y 1 B ASN 500 ? F ASN 148 
85  1 Y 1 B HIS 501 ? F HIS 149 
86  1 Y 1 B VAL 502 ? F VAL 150 
87  1 Y 1 B PRO 503 ? F PRO 151 
88  1 Y 1 B GLY 504 ? F GLY 152 
89  1 Y 1 B SER 505 ? F SER 153 
90  1 Y 1 B GLU 506 ? F GLU 154 
91  1 Y 1 B PRO 507 ? F PRO 155 
92  1 Y 1 B ASN 508 ? F ASN 156 
93  1 Y 1 B PHE 509 ? F PHE 157 
94  1 Y 1 B ALA 510 ? F ALA 158 
95  1 Y 1 B ALA 511 ? F ALA 159 
96  1 Y 1 B TYR 512 ? F TYR 160 
97  1 Y 1 B LYS 565 ? F LYS 213 
98  1 Y 1 B ALA 566 ? F ALA 214 
99  1 Y 1 B GLN 567 ? F GLN 215 
100 1 Y 1 B ASN 568 ? F ASN 216 
101 1 Y 1 B ARG 569 ? F ARG 217 
102 1 Y 1 B GLU 570 ? F GLU 218 
103 1 Y 1 B PRO 571 ? F PRO 219 
104 1 Y 1 B ASN 579 ? F ASN 227 
105 1 Y 1 B ARG 580 ? F ARG 228 
106 1 Y 1 B PRO 581 ? F PRO 229 
107 1 Y 1 B LYS 582 ? F LYS 230 
108 1 Y 1 B ARG 583 ? F ARG 231 
109 1 Y 1 B PRO 584 ? F PRO 232 
110 1 Y 1 B GLY 585 ? F GLY 233 
111 1 Y 1 B VAL 586 ? F VAL 234 
112 1 Y 1 B ALA 595 ? F ALA 243 
113 1 Y 1 B ALA 596 ? F ALA 244 
114 1 Y 1 B LYS 597 ? F LYS 245 
115 1 Y 1 B ARG 598 ? F ARG 246 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1IGN 'double helix'        
1IGN 'b-form double helix' 
1IGN 'triple helix'        
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 2  1_555 B DG 19 1_555 0.268  -0.569 0.358  -8.254  -6.765  -9.122 1  C_DC2:DG38_D  C 2  ? D 38 ? 19 1 
1 A DG 3  1_555 B DC 18 1_555 -0.195 -0.363 0.373  4.392   -4.715  -1.849 2  C_DG3:DC37_D  C 3  ? D 37 ? 19 1 
1 A DC 4  1_555 B DG 17 1_555 0.001  -0.342 0.147  1.124   -3.276  -6.180 3  C_DC4:DG36_D  C 4  ? D 36 ? 19 1 
1 A DA 5  1_555 B DT 16 1_555 -0.545 -0.122 0.405  6.722   -6.514  8.563  4  C_DA5:DT35_D  C 5  ? D 35 ? 20 1 
1 A DC 6  1_555 B DG 15 1_555 0.045  -0.293 -0.106 8.996   -2.438  -3.181 5  C_DC6:DG34_D  C 6  ? D 34 ? 19 1 
1 A DA 7  1_555 B DT 14 1_555 0.138  -0.211 -0.313 -2.209  -5.250  4.130  6  C_DA7:DT33_D  C 7  ? D 33 ? 20 1 
1 A DC 8  1_555 B DG 13 1_555 -0.021 -0.199 -0.293 5.660   -9.424  -0.729 7  C_DC8:DG32_D  C 8  ? D 32 ? 19 1 
1 A DC 9  1_555 B DG 12 1_555 -0.063 -0.378 -0.063 -9.765  -2.706  -3.328 8  C_DC9:DG31_D  C 9  ? D 31 ? 19 1 
1 A DC 10 1_555 B DG 11 1_555 0.287  -0.298 -0.555 8.446   -3.661  -1.394 9  C_DC10:DG30_D C 10 ? D 30 ? 19 1 
1 A DA 11 1_555 B DT 10 1_555 0.124  -0.113 0.085  -1.836  -19.500 -0.177 10 C_DA11:DT29_D C 11 ? D 29 ? 20 1 
1 A DC 12 1_555 B DG 9  1_555 -0.025 -0.360 -0.037 -1.039  2.228   1.630  11 C_DC12:DG28_D C 12 ? D 28 ? 19 1 
1 A DA 13 1_555 B DT 8  1_555 0.269  0.060  0.437  9.945   -11.309 3.848  12 C_DA13:DT27_D C 13 ? D 27 ? 20 1 
1 A DC 14 1_555 B DG 7  1_555 0.082  -0.224 -0.165 4.607   -10.290 -3.912 13 C_DC14:DG26_D C 14 ? D 26 ? 19 1 
1 A DA 15 1_555 B DT 6  1_555 -0.588 -0.021 0.222  -11.023 -8.157  5.351  14 C_DA15:DT25_D C 15 ? D 25 ? 20 1 
1 A DC 16 1_555 B DG 5  1_555 0.056  0.052  -0.278 6.797   -5.471  3.151  15 C_DC16:DG24_D C 16 ? D 24 ? 19 1 
1 A DC 17 1_555 B DG 4  1_555 -0.269 -0.448 -0.148 2.729   -9.183  -3.085 16 C_DC17:DG23_D C 17 ? D 23 ? 19 1 
1 A DA 18 1_555 B DT 3  1_555 0.475  -0.186 -0.154 5.555   -13.548 -0.034 17 C_DA18:DT22_D C 18 ? D 22 ? 20 1 
1 A DG 19 1_555 B DC 2  1_555 0.179  -0.003 0.701  13.770  -16.398 -3.064 18 C_DG19:DC21_D C 19 ? D 21 ? 19 1 
1 D DC 2  1_555 C DG 19 1_555 0.356  0.003  0.123  -4.637  -18.941 0.552  19 F_DC21:DG19_E F 21 ? E 19 ? 19 1 
1 D DT 3  1_555 C DA 18 1_555 -0.253 -0.378 -0.068 -4.683  -10.103 -6.108 20 F_DT22:DA18_E F 22 ? E 18 ? 20 1 
1 D DG 4  1_555 C DC 17 1_555 0.386  -0.079 -0.331 -7.609  -9.436  -7.731 21 F_DG23:DC17_E F 23 ? E 17 ? 19 1 
1 D DG 5  1_555 C DC 16 1_555 -0.153 -0.164 -0.170 -5.688  -3.969  1.014  22 F_DG24:DC16_E F 24 ? E 16 ? 19 1 
1 D DT 6  1_555 C DA 15 1_555 0.259  0.031  -0.305 18.864  -1.463  7.308  23 F_DT25:DA15_E F 25 ? E 15 ? 20 1 
1 D DG 7  1_555 C DC 14 1_555 -0.270 -0.113 0.029  -1.675  -11.209 -2.998 24 F_DG26:DC14_E F 26 ? E 14 ? 19 1 
1 D DT 8  1_555 C DA 13 1_555 0.201  -0.233 0.111  -5.509  -12.000 5.470  25 F_DT27:DA13_E F 27 ? E 13 ? 20 1 
1 D DG 9  1_555 C DC 12 1_555 -0.050 -0.177 0.116  6.555   7.784   2.377  26 F_DG28:DC12_E F 28 ? E 12 ? 19 1 
1 D DT 10 1_555 C DA 11 1_555 0.139  0.072  0.092  3.995   -23.002 1.194  27 F_DT29:DA11_E F 29 ? E 11 ? 20 1 
1 D DG 11 1_555 C DC 10 1_555 -0.100 -0.006 -0.283 -5.883  -2.730  -5.087 28 F_DG30:DC10_E F 30 ? E 10 ? 19 1 
1 D DG 12 1_555 C DC 9  1_555 0.075  0.010  -0.089 10.166  -3.925  -1.437 29 F_DG31:DC9_E  F 31 ? E 9  ? 19 1 
1 D DG 13 1_555 C DC 8  1_555 0.118  -0.072 -0.402 -4.816  -3.306  -2.704 30 F_DG32:DC8_E  F 32 ? E 8  ? 19 1 
1 D DT 14 1_555 C DA 7  1_555 -0.114 -0.424 -0.425 4.320   -5.796  -2.353 31 F_DT33:DA7_E  F 33 ? E 7  ? 20 1 
1 D DG 15 1_555 C DC 6  1_555 -0.283 -0.395 0.008  -8.112  -6.321  -1.527 32 F_DG34:DC6_E  F 34 ? E 6  ? 19 1 
1 D DT 16 1_555 C DA 5  1_555 0.184  -0.186 0.267  -8.435  -2.800  3.155  33 F_DT35:DA5_E  F 35 ? E 5  ? 20 1 
1 D DG 17 1_555 C DC 4  1_555 0.437  -0.333 0.142  -2.674  -5.358  -4.113 34 F_DG36:DC4_E  F 36 ? E 4  ? 19 1 
1 D DC 18 1_555 C DG 3  1_555 0.258  0.076  0.312  0.136   -9.011  -3.169 35 F_DC37:DG3_E  F 37 ? E 3  ? 19 1 
1 D DG 19 1_555 C DC 2  1_555 0.039  -0.296 0.139  -0.554  -3.491  -4.847 36 F_DG38:DC2_E  F 38 ? E 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 2  1_555 B DG 19 1_555 A DG 3  1_555 B DC 18 1_555 -0.116 0.927  3.213 0.894  -1.988 33.186 1.943  0.348  3.149 -3.475  
-1.563  33.256 1  CC_DC2DG3:DC37DG38_DD   C 2  ? D 38 ? C 3  ? D 37 ? 
1 A DG 3  1_555 B DC 18 1_555 A DC 4  1_555 B DG 17 1_555 0.458  0.596  3.408 3.041  -4.019 44.864 1.151  -0.314 3.367 -5.246  
-3.970  45.132 2  CC_DG3DC4:DG36DC37_DD   C 3  ? D 37 ? C 4  ? D 36 ? 
1 A DC 4  1_555 B DG 17 1_555 A DA 5  1_555 B DT 16 1_555 0.317  -0.059 3.100 -2.321 1.218  29.937 -0.350 -1.061 3.062 2.352   
4.482   30.049 3  CC_DC4DA5:DT35DG36_DD   C 4  ? D 36 ? C 5  ? D 35 ? 
1 A DA 5  1_555 B DT 16 1_555 A DC 6  1_555 B DG 15 1_555 -0.046 -0.797 3.380 3.373  -2.681 31.656 -0.942 0.721  3.411 -4.886  
-6.147  31.940 4  CC_DA5DC6:DG34DT35_DD   C 5  ? D 35 ? C 6  ? D 34 ? 
1 A DC 6  1_555 B DG 15 1_555 A DA 7  1_555 B DT 14 1_555 0.387  -0.828 3.729 3.083  -0.076 42.728 -1.125 -0.179 3.748 -0.105  
-4.224  42.834 5  CC_DC6DA7:DT33DG34_DD   C 6  ? D 34 ? C 7  ? D 33 ? 
1 A DA 7  1_555 B DT 14 1_555 A DC 8  1_555 B DG 13 1_555 0.703  -0.660 3.231 -0.501 -4.529 34.158 -0.411 -1.265 3.278 -7.668  
0.848   34.452 6  CC_DA7DC8:DG32DT33_DD   C 7  ? D 33 ? C 8  ? D 32 ? 
1 A DC 8  1_555 B DG 13 1_555 A DC 9  1_555 B DG 12 1_555 -1.290 -1.540 3.730 -3.300 5.387  23.512 -5.542 1.904  3.442 12.924  
7.917   24.335 7  CC_DC8DC9:DG31DG32_DD   C 8  ? D 32 ? C 9  ? D 31 ? 
1 A DC 9  1_555 B DG 12 1_555 A DC 10 1_555 B DG 11 1_555 -0.246 0.286  2.916 5.624  5.484  25.874 -0.635 1.804  2.801 11.902  
-12.207 27.021 8  CC_DC9DC10:DG30DG31_DD  C 9  ? D 31 ? C 10 ? D 30 ? 
1 A DC 10 1_555 B DG 11 1_555 A DA 11 1_555 B DT 10 1_555 -0.524 1.255  3.615 -4.481 6.410  38.748 0.994  0.171  3.802 9.542   
6.671   39.500 9  CC_DC10DA11:DT29DG30_DD C 10 ? D 30 ? C 11 ? D 29 ? 
1 A DA 11 1_555 B DT 10 1_555 A DC 12 1_555 B DG 9  1_555 1.471  -0.040 3.425 3.601  -7.349 34.764 1.075  -1.841 3.491 -12.093 
-5.925  35.685 10 CC_DA11DC12:DG28DT29_DD C 11 ? D 29 ? C 12 ? D 28 ? 
1 A DC 12 1_555 B DG 9  1_555 A DA 13 1_555 B DT 8  1_555 -0.960 1.300  3.275 -2.733 2.751  39.826 1.577  1.082  3.410 4.026   
4.000   40.007 11 CC_DC12DA13:DT27DG28_DD C 12 ? D 28 ? C 13 ? D 27 ? 
1 A DA 13 1_555 B DT 8  1_555 A DC 14 1_555 B DG 7  1_555 0.231  -0.755 3.418 4.380  2.541  28.046 -2.139 0.572  3.334 5.190   
-8.946  28.490 12 CC_DA13DC14:DG26DT27_DD C 13 ? D 27 ? C 14 ? D 26 ? 
1 A DC 14 1_555 B DG 7  1_555 A DA 15 1_555 B DT 6  1_555 1.492  -0.979 3.694 0.480  3.378  33.591 -2.298 -2.483 3.602 5.827   
-0.828  33.759 13 CC_DC14DA15:DT25DG26_DD C 14 ? D 26 ? C 15 ? D 25 ? 
1 A DA 15 1_555 B DT 6  1_555 A DC 16 1_555 B DG 5  1_555 -0.680 -0.478 3.001 6.289  3.857  27.946 -1.717 2.602  2.698 7.816   
-12.743 28.885 14 CC_DA15DC16:DG24DT25_DD C 15 ? D 25 ? C 16 ? D 24 ? 
1 A DC 16 1_555 B DG 5  1_555 A DC 17 1_555 B DG 4  1_555 -0.086 -0.186 3.432 -0.267 3.873  32.520 -1.028 0.105  3.388 6.886   
0.476   32.745 15 CC_DC16DC17:DG23DG24_DD C 16 ? D 24 ? C 17 ? D 23 ? 
1 A DC 17 1_555 B DG 4  1_555 A DA 18 1_555 B DT 3  1_555 0.004  0.734  3.420 1.231  4.636  40.106 0.512  0.140  3.479 6.731   
-1.788  40.380 16 CC_DC17DA18:DT22DG23_DD C 17 ? D 23 ? C 18 ? D 22 ? 
1 A DA 18 1_555 B DT 3  1_555 A DG 19 1_555 B DC 2  1_555 0.347  -0.003 3.170 -7.630 1.552  32.717 -0.249 -1.795 3.011 2.708   
13.311  33.606 17 CC_DA18DG19:DC21DT22_DD C 18 ? D 22 ? C 19 ? D 21 ? 
1 A DG 19 1_555 B DC 2  1_555 D DC 2  1_555 C DG 19 1_555 -0.044 -0.542 3.519 5.110  0.729  42.679 -0.818 0.604  3.482 0.997   
-6.991  42.976 18 CF_DG19DC21:DG19DC21_ED C 19 ? D 21 ? F 21 ? E 19 ? 
1 D DC 2  1_555 C DG 19 1_555 D DT 3  1_555 C DA 18 1_555 -0.603 -0.076 3.440 1.661  2.851  30.214 -0.744 1.498  3.382 5.449   
-3.175  30.390 19 FF_DC21DT22:DA18DG19_EE F 21 ? E 19 ? F 22 ? E 18 ? 
1 D DT 3  1_555 C DA 18 1_555 D DG 4  1_555 C DC 17 1_555 0.129  0.266  3.442 0.974  5.452  42.456 -0.212 -0.074 3.451 7.490   
-1.338  42.799 20 FF_DT22DG23:DC17DA18_EE F 22 ? E 18 ? F 23 ? E 17 ? 
1 D DG 4  1_555 C DC 17 1_555 D DG 5  1_555 C DC 16 1_555 0.249  -0.070 3.442 -2.217 0.779  32.854 -0.263 -0.835 3.416 1.375   
3.913   32.935 21 FF_DG23DG24:DC16DC17_EE F 23 ? E 17 ? F 24 ? E 16 ? 
1 D DG 5  1_555 C DC 16 1_555 D DT 6  1_555 C DA 15 1_555 0.650  -0.492 2.746 -1.813 5.215  23.861 -2.482 -1.992 2.526 12.401  
4.311   24.483 22 FF_DG24DT25:DA15DC16_EE F 24 ? E 16 ? F 25 ? E 15 ? 
1 D DT 6  1_555 C DA 15 1_555 D DG 7  1_555 C DC 14 1_555 -1.498 -0.669 3.830 -4.178 2.680  35.560 -1.542 1.720  3.916 4.362   
6.799   35.894 23 FF_DT25DG26:DC14DA15_EE F 25 ? E 15 ? F 26 ? E 14 ? 
1 D DG 7  1_555 C DC 14 1_555 D DT 8  1_555 C DA 13 1_555 -0.139 -0.774 3.418 -0.876 1.142  28.992 -1.807 0.077  3.388 2.280   
1.749   29.027 24 FF_DG26DT27:DA13DC14_EE F 26 ? E 14 ? F 27 ? E 13 ? 
1 D DT 8  1_555 C DA 13 1_555 D DG 9  1_555 C DC 12 1_555 1.013  1.437  3.163 4.079  0.137  36.925 2.239  -1.055 3.258 0.215   
-6.416  37.142 25 FF_DT27DG28:DC12DA13_EE F 27 ? E 13 ? F 28 ? E 12 ? 
1 D DG 9  1_555 C DC 12 1_555 D DT 10 1_555 C DA 11 1_555 -1.247 0.055  3.538 -0.378 -2.017 38.383 0.355  1.843  3.542 -3.065  
0.574   38.436 26 FF_DG28DT29:DA11DC12_EE F 28 ? E 12 ? F 29 ? E 11 ? 
1 D DT 10 1_555 C DA 11 1_555 D DG 11 1_555 C DC 10 1_555 0.447  1.113  3.582 2.460  2.866  39.122 1.276  -0.339 3.672 4.267   
-3.663  39.296 27 FF_DT29DG30:DC10DA11_EE F 29 ? E 11 ? F 30 ? E 10 ? 
1 D DG 11 1_555 C DC 10 1_555 D DG 12 1_555 C DC 9  1_555 0.387  0.185  3.078 -2.366 9.456  24.839 -1.941 -1.425 2.902 20.980  
5.250   26.655 28 FF_DG30DG31:DC9DC10_EE  F 30 ? E 10 ? F 31 ? E 9  ? 
1 D DG 12 1_555 C DC 9  1_555 D DG 13 1_555 C DC 8  1_555 1.073  -1.480 3.728 2.071  0.526  23.243 -3.864 -1.840 3.773 1.302   
-5.127  23.340 29 FF_DG31DG32:DC8DC9_EE   F 31 ? E 9  ? F 32 ? E 8  ? 
1 D DG 13 1_555 C DC 8  1_555 D DT 14 1_555 C DA 7  1_555 -0.754 -0.573 3.124 1.114  -0.112 35.523 -0.923 1.390  3.102 -0.183  
-1.826  35.540 30 FF_DG32DT33:DA7DC8_EE   F 32 ? E 8  ? F 33 ? E 7  ? 
1 D DT 14 1_555 C DA 7  1_555 D DG 15 1_555 C DC 6  1_555 -0.178 -0.766 3.726 -5.647 -1.307 39.298 -0.953 -0.492 3.738 -1.931  
8.341   39.707 31 FF_DT33DG34:DC6DA7_EE   F 33 ? E 7  ? F 34 ? E 6  ? 
1 D DG 15 1_555 C DC 6  1_555 D DT 16 1_555 C DA 5  1_555 -0.459 -1.012 3.441 -1.716 0.083  30.530 -1.936 0.512  3.458 0.158   
3.256   30.577 32 FF_DG34DT35:DA5DC6_EE   F 34 ? E 6  ? F 35 ? E 5  ? 
1 D DT 16 1_555 C DA 5  1_555 D DG 17 1_555 C DC 4  1_555 0.137  0.189  3.208 1.990  1.224  33.394 0.130  0.085  3.215 2.126   
-3.458  33.473 33 FF_DT35DG36:DC4DA5_EE   F 35 ? E 5  ? F 36 ? E 4  ? 
1 D DG 17 1_555 C DC 4  1_555 D DC 18 1_555 C DG 3  1_555 -0.639 0.016  3.224 -3.619 -0.759 35.949 0.132  0.521  3.270 -1.226  
5.844   36.132 34 FF_DG36DC37:DG3DC4_EE   F 36 ? E 4  ? F 37 ? E 3  ? 
1 D DC 18 1_555 C DG 3  1_555 D DG 19 1_555 C DC 2  1_555 0.131  0.865  3.404 1.693  -0.953 45.130 1.215  -0.013 3.389 -1.241  
-2.204  45.170 35 FF_DC37DG38:DC2DG3_EE   F 37 ? E 3  ? F 38 ? E 2  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#