data_1II4
# 
_entry.id   1II4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1II4         
RCSB  RCSB013288   
WWPDB D_1000013288 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1EV2 'CRYSTAL STRUCTURE OF FGF2 IN COMPLEX WITH THE EXTRACELLULAR LIGAND BINDING DOMAIN OF FGF RECEPTOR 2 (FGFR2)' unspecified 
PDB 1IIL 'CRYSTAL STRUCTURE OF PRO253ARG APERT MUTANT FGF RECEPTOR 2 (FGFR2) IN COMPLEX WITH FGF2'                     unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1II4 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ibrahimi, O.A.'    1 
'Eliseenkova, A.V.' 2 
'Plotnikov, A.N.'   3 
'Ornitz, D.M.'      4 
'Mohammadi, M.'     5 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            98 
_citation.page_first                7182 
_citation.page_last                 7187 
_citation.year                      2001 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11390973 
_citation.pdbx_database_id_DOI      10.1073/pnas.121183798 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ibrahimi, O.A.'    1 
primary 'Eliseenkova, A.V.' 2 
primary 'Plotnikov, A.N.'   3 
primary 'Yu, K.'            4 
primary 'Ornitz, D.M.'      5 
primary 'Mohammadi, M.'     6 
# 
_cell.entry_id           1II4 
_cell.length_a           70.970 
_cell.length_b           72.657 
_cell.length_c           89.739 
_cell.angle_alpha        89.98 
_cell.angle_beta         89.70 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1II4 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'HEPARIN-BINDING GROWTH FACTOR 2'     17249.732 4 ?         C78S,C96S ? ? 
2 polymer man 'FIBROBLAST GROWTH FACTOR RECEPTOR 2' 24740.064 4 2.7.1.112 S252W     
'EXTRACELLULAR LIGAND BINDING DOMAIN CONSISTING OF IG-LIKE DOMAINS II (D2) AND III (D3), RESIDUES 147-366' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'FGF2, HBGF-2, BASIC FIBROBLAST GROWTH FACTOR, BFGF' 
2 'FGFR2, KERATINOCYTE GROWTH FACTOR RECEPTOR'         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSAN
RYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
;
;MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSAN
RYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
;
A,B,C,D ? 
2 'polypeptide(L)' no no 
;NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDK
GNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGL
PYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
;
;NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDK
GNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGL
PYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
;
E,F,G,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   GLY n 
1 5   SER n 
1 6   ILE n 
1 7   THR n 
1 8   THR n 
1 9   LEU n 
1 10  PRO n 
1 11  ALA n 
1 12  LEU n 
1 13  PRO n 
1 14  GLU n 
1 15  ASP n 
1 16  GLY n 
1 17  GLY n 
1 18  SER n 
1 19  GLY n 
1 20  ALA n 
1 21  PHE n 
1 22  PRO n 
1 23  PRO n 
1 24  GLY n 
1 25  HIS n 
1 26  PHE n 
1 27  LYS n 
1 28  ASP n 
1 29  PRO n 
1 30  LYS n 
1 31  ARG n 
1 32  LEU n 
1 33  TYR n 
1 34  CYS n 
1 35  LYS n 
1 36  ASN n 
1 37  GLY n 
1 38  GLY n 
1 39  PHE n 
1 40  PHE n 
1 41  LEU n 
1 42  ARG n 
1 43  ILE n 
1 44  HIS n 
1 45  PRO n 
1 46  ASP n 
1 47  GLY n 
1 48  ARG n 
1 49  VAL n 
1 50  ASP n 
1 51  GLY n 
1 52  VAL n 
1 53  ARG n 
1 54  GLU n 
1 55  LYS n 
1 56  SER n 
1 57  ASP n 
1 58  PRO n 
1 59  HIS n 
1 60  ILE n 
1 61  LYS n 
1 62  LEU n 
1 63  GLN n 
1 64  LEU n 
1 65  GLN n 
1 66  ALA n 
1 67  GLU n 
1 68  GLU n 
1 69  ARG n 
1 70  GLY n 
1 71  VAL n 
1 72  VAL n 
1 73  SER n 
1 74  ILE n 
1 75  LYS n 
1 76  GLY n 
1 77  VAL n 
1 78  SER n 
1 79  ALA n 
1 80  ASN n 
1 81  ARG n 
1 82  TYR n 
1 83  LEU n 
1 84  ALA n 
1 85  MET n 
1 86  LYS n 
1 87  GLU n 
1 88  ASP n 
1 89  GLY n 
1 90  ARG n 
1 91  LEU n 
1 92  LEU n 
1 93  ALA n 
1 94  SER n 
1 95  LYS n 
1 96  SER n 
1 97  VAL n 
1 98  THR n 
1 99  ASP n 
1 100 GLU n 
1 101 CYS n 
1 102 PHE n 
1 103 PHE n 
1 104 PHE n 
1 105 GLU n 
1 106 ARG n 
1 107 LEU n 
1 108 GLU n 
1 109 SER n 
1 110 ASN n 
1 111 ASN n 
1 112 TYR n 
1 113 ASN n 
1 114 THR n 
1 115 TYR n 
1 116 ARG n 
1 117 SER n 
1 118 ARG n 
1 119 LYS n 
1 120 TYR n 
1 121 THR n 
1 122 SER n 
1 123 TRP n 
1 124 TYR n 
1 125 VAL n 
1 126 ALA n 
1 127 LEU n 
1 128 LYS n 
1 129 ARG n 
1 130 THR n 
1 131 GLY n 
1 132 GLN n 
1 133 TYR n 
1 134 LYS n 
1 135 LEU n 
1 136 GLY n 
1 137 SER n 
1 138 LYS n 
1 139 THR n 
1 140 GLY n 
1 141 PRO n 
1 142 GLY n 
1 143 GLN n 
1 144 LYS n 
1 145 ALA n 
1 146 ILE n 
1 147 LEU n 
1 148 PHE n 
1 149 LEU n 
1 150 PRO n 
1 151 MET n 
1 152 SER n 
1 153 ALA n 
1 154 LYS n 
1 155 SER n 
2 1   ASN n 
2 2   SER n 
2 3   ASN n 
2 4   ASN n 
2 5   LYS n 
2 6   ARG n 
2 7   ALA n 
2 8   PRO n 
2 9   TYR n 
2 10  TRP n 
2 11  THR n 
2 12  ASN n 
2 13  THR n 
2 14  GLU n 
2 15  LYS n 
2 16  MET n 
2 17  GLU n 
2 18  LYS n 
2 19  ARG n 
2 20  LEU n 
2 21  HIS n 
2 22  ALA n 
2 23  VAL n 
2 24  PRO n 
2 25  ALA n 
2 26  ALA n 
2 27  ASN n 
2 28  THR n 
2 29  VAL n 
2 30  LYS n 
2 31  PHE n 
2 32  ARG n 
2 33  CYS n 
2 34  PRO n 
2 35  ALA n 
2 36  GLY n 
2 37  GLY n 
2 38  ASN n 
2 39  PRO n 
2 40  MET n 
2 41  PRO n 
2 42  THR n 
2 43  MET n 
2 44  ARG n 
2 45  TRP n 
2 46  LEU n 
2 47  LYS n 
2 48  ASN n 
2 49  GLY n 
2 50  LYS n 
2 51  GLU n 
2 52  PHE n 
2 53  LYS n 
2 54  GLN n 
2 55  GLU n 
2 56  HIS n 
2 57  ARG n 
2 58  ILE n 
2 59  GLY n 
2 60  GLY n 
2 61  TYR n 
2 62  LYS n 
2 63  VAL n 
2 64  ARG n 
2 65  ASN n 
2 66  GLN n 
2 67  HIS n 
2 68  TRP n 
2 69  SER n 
2 70  LEU n 
2 71  ILE n 
2 72  MET n 
2 73  GLU n 
2 74  SER n 
2 75  VAL n 
2 76  VAL n 
2 77  PRO n 
2 78  SER n 
2 79  ASP n 
2 80  LYS n 
2 81  GLY n 
2 82  ASN n 
2 83  TYR n 
2 84  THR n 
2 85  CYS n 
2 86  VAL n 
2 87  VAL n 
2 88  GLU n 
2 89  ASN n 
2 90  GLU n 
2 91  TYR n 
2 92  GLY n 
2 93  SER n 
2 94  ILE n 
2 95  ASN n 
2 96  HIS n 
2 97  THR n 
2 98  TYR n 
2 99  HIS n 
2 100 LEU n 
2 101 ASP n 
2 102 VAL n 
2 103 VAL n 
2 104 GLU n 
2 105 ARG n 
2 106 TRP n 
2 107 PRO n 
2 108 HIS n 
2 109 ARG n 
2 110 PRO n 
2 111 ILE n 
2 112 LEU n 
2 113 GLN n 
2 114 ALA n 
2 115 GLY n 
2 116 LEU n 
2 117 PRO n 
2 118 ALA n 
2 119 ASN n 
2 120 ALA n 
2 121 SER n 
2 122 THR n 
2 123 VAL n 
2 124 VAL n 
2 125 GLY n 
2 126 GLY n 
2 127 ASP n 
2 128 VAL n 
2 129 GLU n 
2 130 PHE n 
2 131 VAL n 
2 132 CYS n 
2 133 LYS n 
2 134 VAL n 
2 135 TYR n 
2 136 SER n 
2 137 ASP n 
2 138 ALA n 
2 139 GLN n 
2 140 PRO n 
2 141 HIS n 
2 142 ILE n 
2 143 GLN n 
2 144 TRP n 
2 145 ILE n 
2 146 LYS n 
2 147 HIS n 
2 148 VAL n 
2 149 GLU n 
2 150 LYS n 
2 151 ASN n 
2 152 GLY n 
2 153 SER n 
2 154 LYS n 
2 155 TYR n 
2 156 GLY n 
2 157 PRO n 
2 158 ASP n 
2 159 GLY n 
2 160 LEU n 
2 161 PRO n 
2 162 TYR n 
2 163 LEU n 
2 164 LYS n 
2 165 VAL n 
2 166 LEU n 
2 167 LYS n 
2 168 ALA n 
2 169 ALA n 
2 170 GLY n 
2 171 VAL n 
2 172 ASN n 
2 173 THR n 
2 174 THR n 
2 175 ASP n 
2 176 LYS n 
2 177 GLU n 
2 178 ILE n 
2 179 GLU n 
2 180 VAL n 
2 181 LEU n 
2 182 TYR n 
2 183 ILE n 
2 184 ARG n 
2 185 ASN n 
2 186 VAL n 
2 187 THR n 
2 188 PHE n 
2 189 GLU n 
2 190 ASP n 
2 191 ALA n 
2 192 GLY n 
2 193 GLU n 
2 194 TYR n 
2 195 THR n 
2 196 CYS n 
2 197 LEU n 
2 198 ALA n 
2 199 GLY n 
2 200 ASN n 
2 201 SER n 
2 202 ILE n 
2 203 GLY n 
2 204 ILE n 
2 205 SER n 
2 206 PHE n 
2 207 HIS n 
2 208 SER n 
2 209 ALA n 
2 210 TRP n 
2 211 LEU n 
2 212 THR n 
2 213 VAL n 
2 214 LEU n 
2 215 PRO n 
2 216 ALA n 
2 217 PRO n 
2 218 GLY n 
2 219 ARG n 
2 220 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? plasmid ? ? ? pET-28a ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? plasmid ? ? ? pET-28a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP FGF2_HUMAN P09038 1 1   ? ? 
2 UNP FGR2_HUMAN P21802 2 147 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1II4 A 1 ? 155 ? P09038 1   ? 155 ? 1   155 
2 1 1II4 B 1 ? 155 ? P09038 1   ? 155 ? 1   155 
3 1 1II4 C 1 ? 155 ? P09038 1   ? 155 ? 1   155 
4 1 1II4 D 1 ? 155 ? P09038 1   ? 155 ? 1   155 
5 2 1II4 E 1 ? 220 ? P21802 147 ? 366 ? 147 366 
6 2 1II4 F 1 ? 220 ? P21802 147 ? 366 ? 147 366 
7 2 1II4 G 1 ? 220 ? P21802 147 ? 366 ? 147 366 
8 2 1II4 H 1 ? 220 ? P21802 147 ? 366 ? 147 366 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1II4 SER A 78  ? UNP P09038 CYS 78  ENGINEERED 78  1  
1 1II4 SER A 96  ? UNP P09038 CYS 96  ENGINEERED 96  2  
2 1II4 SER B 78  ? UNP P09038 CYS 78  ENGINEERED 78  3  
2 1II4 SER B 96  ? UNP P09038 CYS 96  ENGINEERED 96  4  
3 1II4 SER C 78  ? UNP P09038 CYS 78  ENGINEERED 78  5  
3 1II4 SER C 96  ? UNP P09038 CYS 96  ENGINEERED 96  6  
4 1II4 SER D 78  ? UNP P09038 CYS 78  ENGINEERED 78  7  
4 1II4 SER D 96  ? UNP P09038 CYS 96  ENGINEERED 96  8  
5 1II4 TRP E 106 ? UNP P21802 SER 252 ENGINEERED 252 9  
6 1II4 TRP F 106 ? UNP P21802 SER 252 ENGINEERED 252 10 
7 1II4 TRP G 106 ? UNP P21802 SER 252 ENGINEERED 252 11 
8 1II4 TRP H 106 ? UNP P21802 SER 252 ENGINEERED 252 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1II4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   55.33 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, Isopropanol, HEPES-NaOH, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   2000-08-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1II4 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.7 
_reflns.number_obs                   74426 
_reflns.number_all                   74426 
_reflns.percent_possible_obs         91.6 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   79.7 
_reflns_shell.Rmerge_I_obs           0.25 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1II4 
_refine.ls_number_reflns_obs                     46161 
_refine.ls_number_reflns_all                     46161 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             25.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    93.8 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.238 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.7 
_refine.ls_number_reflns_R_free                  2307 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            3.533 
_refine.aniso_B[2][2]                            -18.701 
_refine.aniso_B[3][3]                            15.167 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            2.644 
_refine.aniso_B[2][3]                            0.0 
_refine.solvent_model_details                    CNS 
_refine.solvent_model_param_ksol                 0.324 
_refine.solvent_model_param_bsol                 27.5 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EV2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10280 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               10280 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        25.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               1.4   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.795 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.01  1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.79  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.29  2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.04  2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1II4 
_struct.title                     'CRYSTAL STRUCTURE OF SER252TRP APERT MUTANT FGF RECEPTOR 2 (FGFR2) IN COMPLEX WITH FGF2' 
_struct.pdbx_descriptor           'HEPARIN-BINDING GROWTH FACTOR 2, FIBROBLAST GROWTH FACTOR RECEPTOR 2 (E.C.2.7.1.112)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1II4 
_struct_keywords.pdbx_keywords   'GROWTH FACTOR/GROWTH FACTOR RECEPTOR' 
_struct_keywords.text            'IMMUNOGLOBULIN LIKE DOMAIN, B-TREFOIL, GROWTH FACTOR-GROWTH FACTOR RECEPTOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
3 ? ? 
4 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 57  ? ILE A 60  ? ASP A 57  ILE A 60  5 ? 4 
HELX_P HELX_P2  2  LEU A 135 ? THR A 139 ? LEU A 135 THR A 139 5 ? 5 
HELX_P HELX_P3  3  ASP B 57  ? ILE B 60  ? ASP B 57  ILE B 60  5 ? 4 
HELX_P HELX_P4  4  LEU B 135 ? THR B 139 ? LEU B 135 THR B 139 5 ? 5 
HELX_P HELX_P5  5  ASP C 57  ? ILE C 60  ? ASP C 57  ILE C 60  5 ? 4 
HELX_P HELX_P6  6  LEU C 135 ? THR C 139 ? LEU C 135 THR C 139 5 ? 5 
HELX_P HELX_P7  7  ASP D 57  ? ILE D 60  ? ASP D 57  ILE D 60  5 ? 4 
HELX_P HELX_P8  8  LEU D 135 ? THR D 139 ? LEU D 135 THR D 139 5 ? 5 
HELX_P HELX_P9  9  ASN E 12  ? GLU E 17  ? ASN E 158 GLU E 163 5 ? 6 
HELX_P HELX_P10 10 LYS E 53  ? ARG E 57  ? LYS E 199 ARG E 203 5 ? 5 
HELX_P HELX_P11 11 ASN E 65  ? HIS E 67  ? ASN E 211 HIS E 213 5 ? 3 
HELX_P HELX_P12 12 VAL E 76  ? LYS E 80  ? VAL E 222 LYS E 226 5 ? 5 
HELX_P HELX_P13 13 THR E 174 ? GLU E 179 ? THR E 320 GLU E 325 1 ? 6 
HELX_P HELX_P14 14 ASN F 12  ? GLU F 17  ? ASN F 158 GLU F 163 5 ? 6 
HELX_P HELX_P15 15 LYS F 53  ? ARG F 57  ? LYS F 199 ARG F 203 5 ? 5 
HELX_P HELX_P16 16 ASN F 65  ? HIS F 67  ? ASN F 211 HIS F 213 5 ? 3 
HELX_P HELX_P17 17 VAL F 76  ? LYS F 80  ? VAL F 222 LYS F 226 5 ? 5 
HELX_P HELX_P18 18 THR F 174 ? GLU F 179 ? THR F 320 GLU F 325 1 ? 6 
HELX_P HELX_P19 19 ASN G 12  ? GLU G 17  ? ASN G 158 GLU G 163 5 ? 6 
HELX_P HELX_P20 20 LYS G 53  ? ARG G 57  ? LYS G 199 ARG G 203 5 ? 5 
HELX_P HELX_P21 21 ASN G 65  ? HIS G 67  ? ASN G 211 HIS G 213 5 ? 3 
HELX_P HELX_P22 22 VAL G 76  ? LYS G 80  ? VAL G 222 LYS G 226 5 ? 5 
HELX_P HELX_P23 23 THR G 174 ? GLU G 179 ? THR G 320 GLU G 325 1 ? 6 
HELX_P HELX_P24 24 ASN H 12  ? GLU H 17  ? ASN H 158 GLU H 163 5 ? 6 
HELX_P HELX_P25 25 LYS H 53  ? ARG H 57  ? LYS H 199 ARG H 203 5 ? 5 
HELX_P HELX_P26 26 ASN H 65  ? HIS H 67  ? ASN H 211 HIS H 213 5 ? 3 
HELX_P HELX_P27 27 VAL H 76  ? LYS H 80  ? VAL H 222 LYS H 226 5 ? 5 
HELX_P HELX_P28 28 THR H 174 ? GLU H 179 ? THR H 320 GLU H 325 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? E CYS 33  SG ? ? ? 1_555 E CYS 85  SG ? ? E CYS 179 E CYS 231 1_555 ? ? ? ? ? ? ? 2.452 ? 
disulf2 disulf ? ? E CYS 132 SG ? ? ? 1_555 E CYS 196 SG ? ? E CYS 278 E CYS 342 1_555 ? ? ? ? ? ? ? 2.449 ? 
disulf3 disulf ? ? F CYS 33  SG ? ? ? 1_555 F CYS 85  SG ? ? F CYS 179 F CYS 231 1_555 ? ? ? ? ? ? ? 2.563 ? 
disulf4 disulf ? ? F CYS 132 SG ? ? ? 1_555 F CYS 196 SG ? ? F CYS 278 F CYS 342 1_555 ? ? ? ? ? ? ? 2.492 ? 
disulf5 disulf ? ? G CYS 33  SG ? ? ? 1_555 G CYS 85  SG ? ? G CYS 179 G CYS 231 1_555 ? ? ? ? ? ? ? 2.464 ? 
disulf6 disulf ? ? G CYS 132 SG ? ? ? 1_555 G CYS 196 SG ? ? G CYS 278 G CYS 342 1_555 ? ? ? ? ? ? ? 2.450 ? 
disulf7 disulf ? ? H CYS 33  SG ? ? ? 1_555 H CYS 85  SG ? ? H CYS 179 H CYS 231 1_555 ? ? ? ? ? ? ? 2.470 ? 
disulf8 disulf ? ? H CYS 132 SG ? ? ? 1_555 H CYS 196 SG ? ? H CYS 278 H CYS 342 1_555 ? ? ? ? ? ? ? 2.466 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 38  E . ? ASN 184 E PRO 39  E ? PRO 185 E 1 0.23  
2 LEU 116 E . ? LEU 262 E PRO 117 E ? PRO 263 E 1 0.06  
3 ASN 38  F . ? ASN 184 F PRO 39  F ? PRO 185 F 1 -0.37 
4 LEU 116 F . ? LEU 262 F PRO 117 F ? PRO 263 F 1 0.05  
5 ASN 38  G . ? ASN 184 G PRO 39  G ? PRO 185 G 1 -0.25 
6 LEU 116 G . ? LEU 262 G PRO 117 G ? PRO 263 G 1 -0.23 
7 ASN 38  H . ? ASN 184 H PRO 39  H ? PRO 185 H 1 0.21  
8 LEU 116 H . ? LEU 262 H PRO 117 H ? PRO 263 H 1 -0.26 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 4 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 4 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 2 ? 
N  ? 5 ? 
O  ? 3 ? 
P  ? 2 ? 
Q  ? 5 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 5 ? 
X  ? 2 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 3 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 5 ? 
AJ ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? parallel      
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? parallel      
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? parallel      
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? parallel      
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? parallel      
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? parallel      
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AJ 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL A 49  ? VAL A 52  ? VAL A 49  VAL A 52  
A  2 PHE A 39  ? ILE A 43  ? PHE A 39  ILE A 43  
A  3 LYS A 30  ? CYS A 34  ? LYS A 30  CYS A 34  
A  4 PHE A 148 ? SER A 152 ? PHE A 148 SER A 152 
B  1 LEU A 62  ? GLU A 68  ? LEU A 62  GLU A 68  
B  2 VAL A 71  ? GLY A 76  ? VAL A 71  GLY A 76  
B  3 ARG A 81  ? MET A 85  ? ARG A 81  MET A 85  
B  4 LEU A 91  ? SER A 94  ? LEU A 91  SER A 94  
C  1 LEU A 62  ? GLU A 68  ? LEU A 62  GLU A 68  
C  2 VAL A 71  ? GLY A 76  ? VAL A 71  GLY A 76  
C  3 PHE A 103 ? LEU A 107 ? PHE A 103 LEU A 107 
C  4 ASN A 113 ? SER A 117 ? ASN A 113 SER A 117 
D  1 VAL B 49  ? VAL B 52  ? VAL B 49  VAL B 52  
D  2 PHE B 39  ? ILE B 43  ? PHE B 39  ILE B 43  
D  3 LYS B 30  ? CYS B 34  ? LYS B 30  CYS B 34  
D  4 PHE B 148 ? SER B 152 ? PHE B 148 SER B 152 
E  1 LEU B 62  ? GLU B 68  ? LEU B 62  GLU B 68  
E  2 VAL B 71  ? GLY B 76  ? VAL B 71  GLY B 76  
E  3 ARG B 81  ? MET B 85  ? ARG B 81  MET B 85  
E  4 LEU B 91  ? SER B 94  ? LEU B 91  SER B 94  
F  1 LEU B 62  ? GLU B 68  ? LEU B 62  GLU B 68  
F  2 VAL B 71  ? GLY B 76  ? VAL B 71  GLY B 76  
F  3 PHE B 103 ? LEU B 107 ? PHE B 103 LEU B 107 
F  4 ASN B 113 ? SER B 117 ? ASN B 113 SER B 117 
G  1 VAL C 49  ? VAL C 52  ? VAL C 49  VAL C 52  
G  2 PHE C 39  ? ILE C 43  ? PHE C 39  ILE C 43  
G  3 LYS C 30  ? CYS C 34  ? LYS C 30  CYS C 34  
G  4 PHE C 148 ? SER C 152 ? PHE C 148 SER C 152 
H  1 LEU C 62  ? GLU C 68  ? LEU C 62  GLU C 68  
H  2 VAL C 71  ? GLY C 76  ? VAL C 71  GLY C 76  
H  3 ARG C 81  ? MET C 85  ? ARG C 81  MET C 85  
H  4 LEU C 91  ? SER C 94  ? LEU C 91  SER C 94  
I  1 LEU C 62  ? GLU C 68  ? LEU C 62  GLU C 68  
I  2 VAL C 71  ? GLY C 76  ? VAL C 71  GLY C 76  
I  3 PHE C 103 ? LEU C 107 ? PHE C 103 LEU C 107 
I  4 ASN C 113 ? SER C 117 ? ASN C 113 SER C 117 
J  1 VAL D 49  ? VAL D 52  ? VAL D 49  VAL D 52  
J  2 PHE D 39  ? ILE D 43  ? PHE D 39  ILE D 43  
J  3 LYS D 30  ? CYS D 34  ? LYS D 30  CYS D 34  
J  4 PHE D 148 ? SER D 152 ? PHE D 148 SER D 152 
K  1 LEU D 62  ? GLU D 68  ? LEU D 62  GLU D 68  
K  2 VAL D 71  ? GLY D 76  ? VAL D 71  GLY D 76  
K  3 ARG D 81  ? MET D 85  ? ARG D 81  MET D 85  
K  4 LEU D 91  ? SER D 94  ? LEU D 91  SER D 94  
L  1 LEU D 62  ? GLU D 68  ? LEU D 62  GLU D 68  
L  2 VAL D 71  ? GLY D 76  ? VAL D 71  GLY D 76  
L  3 PHE D 103 ? LEU D 107 ? PHE D 103 LEU D 107 
L  4 ASN D 113 ? SER D 117 ? ASN D 113 SER D 117 
M  1 ARG E 6   ? TRP E 10  ? ARG E 152 TRP E 156 
M  2 ALA E 35  ? ASN E 38  ? ALA E 181 ASN E 184 
N  1 LEU E 20  ? PRO E 24  ? LEU E 166 PRO E 170 
N  2 GLY E 92  ? VAL E 103 ? GLY E 238 VAL E 249 
N  3 GLY E 81  ? ASN E 89  ? GLY E 227 ASN E 235 
N  4 THR E 42  ? LYS E 47  ? THR E 188 LYS E 193 
N  5 LYS E 50  ? GLU E 51  ? LYS E 196 GLU E 197 
O  1 VAL E 29  ? ARG E 32  ? VAL E 175 ARG E 178 
O  2 SER E 69  ? MET E 72  ? SER E 215 MET E 218 
O  3 LYS E 62  ? ARG E 64  ? LYS E 208 ARG E 210 
P  1 ILE E 111 ? LEU E 112 ? ILE E 257 LEU E 258 
P  2 VAL E 134 ? TYR E 135 ? VAL E 280 TYR E 281 
Q  1 ALA E 120 ? VAL E 123 ? ALA E 266 VAL E 269 
Q  2 ILE E 204 ? LEU E 214 ? ILE E 350 LEU E 360 
Q  3 GLY E 192 ? GLY E 199 ? GLY E 338 GLY E 345 
Q  4 HIS E 141 ? HIS E 147 ? HIS E 287 HIS E 293 
Q  5 LEU E 163 ? ALA E 168 ? LEU E 309 ALA E 314 
R  1 VAL E 128 ? VAL E 131 ? VAL E 274 VAL E 277 
R  2 VAL E 180 ? ILE E 183 ? VAL E 326 ILE E 329 
S  1 ARG F 6   ? TRP F 10  ? ARG F 152 TRP F 156 
S  2 ALA F 35  ? ASN F 38  ? ALA F 181 ASN F 184 
T  1 LEU F 20  ? PRO F 24  ? LEU F 166 PRO F 170 
T  2 GLY F 92  ? VAL F 103 ? GLY F 238 VAL F 249 
T  3 GLY F 81  ? ASN F 89  ? GLY F 227 ASN F 235 
T  4 THR F 42  ? LYS F 47  ? THR F 188 LYS F 193 
T  5 LYS F 50  ? GLU F 51  ? LYS F 196 GLU F 197 
U  1 VAL F 29  ? ARG F 32  ? VAL F 175 ARG F 178 
U  2 SER F 69  ? MET F 72  ? SER F 215 MET F 218 
U  3 LYS F 62  ? ARG F 64  ? LYS F 208 ARG F 210 
V  1 ILE F 111 ? LEU F 112 ? ILE F 257 LEU F 258 
V  2 VAL F 134 ? TYR F 135 ? VAL F 280 TYR F 281 
W  1 ALA F 120 ? VAL F 123 ? ALA F 266 VAL F 269 
W  2 ILE F 204 ? LEU F 214 ? ILE F 350 LEU F 360 
W  3 GLY F 192 ? GLY F 199 ? GLY F 338 GLY F 345 
W  4 HIS F 141 ? HIS F 147 ? HIS F 287 HIS F 293 
W  5 LEU F 163 ? ALA F 168 ? LEU F 309 ALA F 314 
X  1 VAL F 128 ? VAL F 131 ? VAL F 274 VAL F 277 
X  2 VAL F 180 ? ILE F 183 ? VAL F 326 ILE F 329 
Y  1 ARG G 6   ? TRP G 10  ? ARG G 152 TRP G 156 
Y  2 ALA G 35  ? ASN G 38  ? ALA G 181 ASN G 184 
Z  1 LEU G 20  ? PRO G 24  ? LEU G 166 PRO G 170 
Z  2 GLY G 92  ? VAL G 103 ? GLY G 238 VAL G 249 
Z  3 GLY G 81  ? ASN G 89  ? GLY G 227 ASN G 235 
Z  4 THR G 42  ? LYS G 47  ? THR G 188 LYS G 193 
Z  5 LYS G 50  ? GLU G 51  ? LYS G 196 GLU G 197 
AA 1 VAL G 29  ? ARG G 32  ? VAL G 175 ARG G 178 
AA 2 SER G 69  ? MET G 72  ? SER G 215 MET G 218 
AA 3 LYS G 62  ? ARG G 64  ? LYS G 208 ARG G 210 
AB 1 ILE G 111 ? LEU G 112 ? ILE G 257 LEU G 258 
AB 2 VAL G 134 ? TYR G 135 ? VAL G 280 TYR G 281 
AC 1 ALA G 120 ? VAL G 123 ? ALA G 266 VAL G 269 
AC 2 ILE G 204 ? LEU G 214 ? ILE G 350 LEU G 360 
AC 3 GLY G 192 ? GLY G 199 ? GLY G 338 GLY G 345 
AC 4 HIS G 141 ? HIS G 147 ? HIS G 287 HIS G 293 
AC 5 LEU G 163 ? ALA G 168 ? LEU G 309 ALA G 314 
AD 1 VAL G 128 ? VAL G 131 ? VAL G 274 VAL G 277 
AD 2 VAL G 180 ? ILE G 183 ? VAL G 326 ILE G 329 
AE 1 ARG H 6   ? TRP H 10  ? ARG H 152 TRP H 156 
AE 2 ALA H 35  ? ASN H 38  ? ALA H 181 ASN H 184 
AF 1 LEU H 20  ? PRO H 24  ? LEU H 166 PRO H 170 
AF 2 GLY H 92  ? VAL H 103 ? GLY H 238 VAL H 249 
AF 3 GLY H 81  ? ASN H 89  ? GLY H 227 ASN H 235 
AF 4 THR H 42  ? LYS H 47  ? THR H 188 LYS H 193 
AF 5 LYS H 50  ? GLU H 51  ? LYS H 196 GLU H 197 
AG 1 VAL H 29  ? ARG H 32  ? VAL H 175 ARG H 178 
AG 2 SER H 69  ? MET H 72  ? SER H 215 MET H 218 
AG 3 LYS H 62  ? ARG H 64  ? LYS H 208 ARG H 210 
AH 1 ILE H 111 ? LEU H 112 ? ILE H 257 LEU H 258 
AH 2 VAL H 134 ? TYR H 135 ? VAL H 280 TYR H 281 
AI 1 ALA H 120 ? VAL H 123 ? ALA H 266 VAL H 269 
AI 2 ILE H 204 ? LEU H 214 ? ILE H 350 LEU H 360 
AI 3 GLY H 192 ? GLY H 199 ? GLY H 338 GLY H 345 
AI 4 HIS H 141 ? HIS H 147 ? HIS H 287 HIS H 293 
AI 5 LEU H 163 ? ALA H 168 ? LEU H 309 ALA H 314 
AJ 1 VAL H 128 ? VAL H 131 ? VAL H 274 VAL H 277 
AJ 2 VAL H 180 ? ILE H 183 ? VAL H 326 ILE H 329 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O VAL A 52  ? O VAL A 52  N PHE A 40  ? N PHE A 40  
A  2 3 N LEU A 41  ? N LEU A 41  O LEU A 32  ? O LEU A 32  
A  3 4 O TYR A 33  ? O TYR A 33  N LEU A 149 ? N LEU A 149 
B  1 2 O GLU A 68  ? O GLU A 68  N VAL A 71  ? N VAL A 71  
B  2 3 N GLY A 76  ? N GLY A 76  O ARG A 81  ? O ARG A 81  
B  3 4 O ALA A 84  ? O ALA A 84  N LEU A 92  ? N LEU A 92  
C  1 2 O GLU A 68  ? O GLU A 68  N VAL A 71  ? N VAL A 71  
C  2 3 N VAL A 72  ? N VAL A 72  O PHE A 103 ? O PHE A 103 
C  3 4 N ARG A 106 ? N ARG A 106 O THR A 114 ? O THR A 114 
D  1 2 O VAL B 52  ? O VAL B 52  N PHE B 40  ? N PHE B 40  
D  2 3 N LEU B 41  ? N LEU B 41  O LEU B 32  ? O LEU B 32  
D  3 4 O TYR B 33  ? O TYR B 33  N LEU B 149 ? N LEU B 149 
E  1 2 O GLU B 68  ? O GLU B 68  N VAL B 71  ? N VAL B 71  
E  2 3 N GLY B 76  ? N GLY B 76  O ARG B 81  ? O ARG B 81  
E  3 4 O ALA B 84  ? O ALA B 84  N LEU B 92  ? N LEU B 92  
F  1 2 O GLU B 68  ? O GLU B 68  N VAL B 71  ? N VAL B 71  
F  2 3 N VAL B 72  ? N VAL B 72  O PHE B 103 ? O PHE B 103 
F  3 4 O ARG B 106 ? O ARG B 106 N THR B 114 ? N THR B 114 
G  1 2 O VAL C 52  ? O VAL C 52  N PHE C 40  ? N PHE C 40  
G  2 3 N LEU C 41  ? N LEU C 41  O LEU C 32  ? O LEU C 32  
G  3 4 O TYR C 33  ? O TYR C 33  N LEU C 149 ? N LEU C 149 
H  1 2 O GLU C 68  ? O GLU C 68  N VAL C 71  ? N VAL C 71  
H  2 3 N GLY C 76  ? N GLY C 76  O ARG C 81  ? O ARG C 81  
H  3 4 O ALA C 84  ? O ALA C 84  N LEU C 92  ? N LEU C 92  
I  1 2 O GLU C 68  ? O GLU C 68  N VAL C 71  ? N VAL C 71  
I  2 3 N VAL C 72  ? N VAL C 72  O PHE C 103 ? O PHE C 103 
I  3 4 O ARG C 106 ? O ARG C 106 N THR C 114 ? N THR C 114 
J  1 2 O VAL D 52  ? O VAL D 52  N PHE D 40  ? N PHE D 40  
J  2 3 N LEU D 41  ? N LEU D 41  O LEU D 32  ? O LEU D 32  
J  3 4 O TYR D 33  ? O TYR D 33  N LEU D 149 ? N LEU D 149 
K  1 2 O GLU D 68  ? O GLU D 68  N VAL D 71  ? N VAL D 71  
K  2 3 N GLY D 76  ? N GLY D 76  O ARG D 81  ? O ARG D 81  
K  3 4 O ALA D 84  ? O ALA D 84  N LEU D 92  ? N LEU D 92  
L  1 2 O GLU D 68  ? O GLU D 68  N VAL D 71  ? N VAL D 71  
L  2 3 N VAL D 72  ? N VAL D 72  O PHE D 103 ? O PHE D 103 
L  3 4 O ARG D 106 ? O ARG D 106 N THR D 114 ? N THR D 114 
M  1 2 N TYR E 9   ? N TYR E 155 O GLY E 36  ? O GLY E 182 
N  1 2 N HIS E 21  ? N HIS E 167 O HIS E 99  ? O HIS E 245 
N  2 3 N LEU E 100 ? N LEU E 246 O GLY E 81  ? O GLY E 227 
N  3 4 O GLU E 88  ? O GLU E 234 N THR E 42  ? N THR E 188 
N  4 5 N LYS E 47  ? N LYS E 193 O LYS E 50  ? O LYS E 196 
O  1 2 N PHE E 31  ? N PHE E 177 O LEU E 70  ? O LEU E 216 
O  2 3 N ILE E 71  ? N ILE E 217 O LYS E 62  ? O LYS E 208 
P  1 2 N ILE E 111 ? N ILE E 257 O TYR E 135 ? O TYR E 281 
Q  1 2 N ALA E 120 ? N ALA E 266 O TRP E 210 ? O TRP E 356 
Q  2 3 N LEU E 211 ? N LEU E 357 O GLY E 192 ? O GLY E 338 
Q  3 4 O GLY E 199 ? O GLY E 345 N HIS E 141 ? N HIS E 287 
Q  4 5 N LYS E 146 ? N LYS E 292 O LYS E 164 ? O LYS E 310 
R  1 2 O PHE E 130 ? O PHE E 276 N LEU E 181 ? N LEU E 327 
S  1 2 N TYR F 9   ? N TYR F 155 O GLY F 36  ? O GLY F 182 
T  1 2 N HIS F 21  ? N HIS F 167 O HIS F 99  ? O HIS F 245 
T  2 3 N LEU F 100 ? N LEU F 246 O GLY F 81  ? O GLY F 227 
T  3 4 O GLU F 88  ? O GLU F 234 N THR F 42  ? N THR F 188 
T  4 5 N LYS F 47  ? N LYS F 193 O LYS F 50  ? O LYS F 196 
U  1 2 O PHE F 31  ? O PHE F 177 N LEU F 70  ? N LEU F 216 
U  2 3 N ILE F 71  ? N ILE F 217 O LYS F 62  ? O LYS F 208 
V  1 2 N ILE F 111 ? N ILE F 257 O TYR F 135 ? O TYR F 281 
W  1 2 N ALA F 120 ? N ALA F 266 O TRP F 210 ? O TRP F 356 
W  2 3 N LEU F 211 ? N LEU F 357 O GLY F 192 ? O GLY F 338 
W  3 4 O GLY F 199 ? O GLY F 345 N HIS F 141 ? N HIS F 287 
W  4 5 N LYS F 146 ? N LYS F 292 O LYS F 164 ? O LYS F 310 
X  1 2 O PHE F 130 ? O PHE F 276 N LEU F 181 ? N LEU F 327 
Y  1 2 N TYR G 9   ? N TYR G 155 O GLY G 36  ? O GLY G 182 
Z  1 2 N HIS G 21  ? N HIS G 167 O HIS G 99  ? O HIS G 245 
Z  2 3 N LEU G 100 ? N LEU G 246 O GLY G 81  ? O GLY G 227 
Z  3 4 O GLU G 88  ? O GLU G 234 N THR G 42  ? N THR G 188 
Z  4 5 N LYS G 47  ? N LYS G 193 O LYS G 50  ? O LYS G 196 
AA 1 2 O PHE G 31  ? O PHE G 177 N LEU G 70  ? N LEU G 216 
AA 2 3 N ILE G 71  ? N ILE G 217 O LYS G 62  ? O LYS G 208 
AB 1 2 N ILE G 111 ? N ILE G 257 O TYR G 135 ? O TYR G 281 
AC 1 2 N ALA G 120 ? N ALA G 266 O TRP G 210 ? O TRP G 356 
AC 2 3 N LEU G 211 ? N LEU G 357 O GLY G 192 ? O GLY G 338 
AC 3 4 O GLY G 199 ? O GLY G 345 N HIS G 141 ? N HIS G 287 
AC 4 5 N LYS G 146 ? N LYS G 292 O LYS G 164 ? O LYS G 310 
AD 1 2 O PHE G 130 ? O PHE G 276 N LEU G 181 ? N LEU G 327 
AE 1 2 N TYR H 9   ? N TYR H 155 O GLY H 36  ? O GLY H 182 
AF 1 2 N HIS H 21  ? N HIS H 167 O HIS H 99  ? O HIS H 245 
AF 2 3 N LEU H 100 ? N LEU H 246 O GLY H 81  ? O GLY H 227 
AF 3 4 O GLU H 88  ? O GLU H 234 N THR H 42  ? N THR H 188 
AF 4 5 N LYS H 47  ? N LYS H 193 O LYS H 50  ? O LYS H 196 
AG 1 2 O PHE H 31  ? O PHE H 177 N LEU H 70  ? N LEU H 216 
AG 2 3 N ILE H 71  ? N ILE H 217 O LYS H 62  ? O LYS H 208 
AH 1 2 N ILE H 111 ? N ILE H 257 O TYR H 135 ? O TYR H 281 
AI 1 2 N ALA H 120 ? N ALA H 266 O TRP H 210 ? O TRP H 356 
AI 2 3 N LEU H 211 ? N LEU H 357 O GLY H 192 ? O GLY H 338 
AI 3 4 O GLY H 199 ? O GLY H 345 N HIS H 141 ? N HIS H 287 
AI 4 5 N LYS H 146 ? N LYS H 292 O LYS H 164 ? O LYS H 310 
AJ 1 2 O PHE H 130 ? O PHE H 276 N LEU H 181 ? N LEU H 327 
# 
_database_PDB_matrix.entry_id          1II4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1II4 
_atom_sites.fract_transf_matrix[1][1]   0.014090 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000074 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013763 
_atom_sites.fract_transf_matrix[2][3]   -0.000005 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011144 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PHE A 1 21  ? 0.636   -12.703 -11.106 1.00 66.92 ? 21  PHE A N   1 
ATOM 2     C CA  . PHE A 1 21  ? 0.652   -11.311 -10.573 1.00 66.46 ? 21  PHE A CA  1 
ATOM 3     C C   . PHE A 1 21  ? 0.109   -11.228 -9.152  1.00 66.17 ? 21  PHE A C   1 
ATOM 4     O O   . PHE A 1 21  ? -0.795  -11.986 -8.773  1.00 66.47 ? 21  PHE A O   1 
ATOM 5     C CB  . PHE A 1 21  ? -0.160  -10.385 -11.471 1.00 66.60 ? 21  PHE A CB  1 
ATOM 6     C CG  . PHE A 1 21  ? 0.341   -10.321 -12.882 1.00 67.44 ? 21  PHE A CG  1 
ATOM 7     C CD1 . PHE A 1 21  ? 0.081   -11.359 -13.778 1.00 68.04 ? 21  PHE A CD1 1 
ATOM 8     C CD2 . PHE A 1 21  ? 1.098   -9.236  -13.312 1.00 67.53 ? 21  PHE A CD2 1 
ATOM 9     C CE1 . PHE A 1 21  ? 0.569   -11.316 -15.081 1.00 67.79 ? 21  PHE A CE1 1 
ATOM 10    C CE2 . PHE A 1 21  ? 1.591   -9.181  -14.610 1.00 67.67 ? 21  PHE A CE2 1 
ATOM 11    C CZ  . PHE A 1 21  ? 1.328   -10.222 -15.500 1.00 68.23 ? 21  PHE A CZ  1 
ATOM 12    N N   . PRO A 1 22  ? 0.664   -10.306 -8.335  1.00 65.58 ? 22  PRO A N   1 
ATOM 13    C CA  . PRO A 1 22  ? 0.215   -10.137 -6.947  1.00 64.75 ? 22  PRO A CA  1 
ATOM 14    C C   . PRO A 1 22  ? -1.304  -9.902  -6.933  1.00 63.71 ? 22  PRO A C   1 
ATOM 15    O O   . PRO A 1 22  ? -1.842  -9.247  -7.823  1.00 64.36 ? 22  PRO A O   1 
ATOM 16    C CB  . PRO A 1 22  ? 1.009   -8.910  -6.484  1.00 64.23 ? 22  PRO A CB  1 
ATOM 17    C CG  . PRO A 1 22  ? 2.292   -9.043  -7.255  1.00 64.15 ? 22  PRO A CG  1 
ATOM 18    C CD  . PRO A 1 22  ? 1.787   -9.398  -8.637  1.00 64.66 ? 22  PRO A CD  1 
ATOM 19    N N   . PRO A 1 23  ? -2.018  -10.438 -5.927  1.00 62.50 ? 23  PRO A N   1 
ATOM 20    C CA  . PRO A 1 23  ? -3.479  -10.296 -5.818  1.00 61.53 ? 23  PRO A CA  1 
ATOM 21    C C   . PRO A 1 23  ? -4.157  -8.944  -6.090  1.00 60.14 ? 23  PRO A C   1 
ATOM 22    O O   . PRO A 1 23  ? -4.655  -8.722  -7.197  1.00 61.26 ? 23  PRO A O   1 
ATOM 23    C CB  . PRO A 1 23  ? -3.776  -10.821 -4.405  1.00 60.57 ? 23  PRO A CB  1 
ATOM 24    C CG  . PRO A 1 23  ? -2.496  -10.611 -3.682  1.00 61.36 ? 23  PRO A CG  1 
ATOM 25    C CD  . PRO A 1 23  ? -1.478  -11.052 -4.708  1.00 61.77 ? 23  PRO A CD  1 
ATOM 26    N N   . GLY A 1 24  ? -4.194  -8.067  -5.093  1.00 58.03 ? 24  GLY A N   1 
ATOM 27    C CA  . GLY A 1 24  ? -4.843  -6.764  -5.225  1.00 55.61 ? 24  GLY A CA  1 
ATOM 28    C C   . GLY A 1 24  ? -5.171  -6.159  -6.588  1.00 53.12 ? 24  GLY A C   1 
ATOM 29    O O   . GLY A 1 24  ? -4.440  -6.338  -7.567  1.00 53.69 ? 24  GLY A O   1 
ATOM 30    N N   . HIS A 1 25  ? -6.286  -5.431  -6.646  1.00 50.47 ? 25  HIS A N   1 
ATOM 31    C CA  . HIS A 1 25  ? -6.692  -4.755  -7.876  1.00 47.42 ? 25  HIS A CA  1 
ATOM 32    C C   . HIS A 1 25  ? -6.665  -3.245  -7.652  1.00 44.16 ? 25  HIS A C   1 
ATOM 33    O O   . HIS A 1 25  ? -7.171  -2.750  -6.646  1.00 43.52 ? 25  HIS A O   1 
ATOM 34    C CB  . HIS A 1 25  ? -8.083  -5.185  -8.330  1.00 48.54 ? 25  HIS A CB  1 
ATOM 35    C CG  . HIS A 1 25  ? -8.468  -4.598  -9.653  1.00 51.44 ? 25  HIS A CG  1 
ATOM 36    N ND1 . HIS A 1 25  ? -9.174  -3.419  -9.767  1.00 51.66 ? 25  HIS A ND1 1 
ATOM 37    C CD2 . HIS A 1 25  ? -8.141  -4.965  -10.914 1.00 52.46 ? 25  HIS A CD2 1 
ATOM 38    C CE1 . HIS A 1 25  ? -9.263  -3.084  -11.042 1.00 52.04 ? 25  HIS A CE1 1 
ATOM 39    N NE2 . HIS A 1 25  ? -8.643  -4.003  -11.762 1.00 52.80 ? 25  HIS A NE2 1 
ATOM 40    N N   . PHE A 1 26  ? -6.084  -2.523  -8.605  1.00 41.09 ? 26  PHE A N   1 
ATOM 41    C CA  . PHE A 1 26  ? -5.922  -1.073  -8.512  1.00 39.02 ? 26  PHE A CA  1 
ATOM 42    C C   . PHE A 1 26  ? -7.125  -0.192  -8.178  1.00 38.28 ? 26  PHE A C   1 
ATOM 43    O O   . PHE A 1 26  ? -6.954  0.902   -7.644  1.00 37.29 ? 26  PHE A O   1 
ATOM 44    C CB  . PHE A 1 26  ? -5.257  -0.555  -9.792  1.00 37.29 ? 26  PHE A CB  1 
ATOM 45    C CG  . PHE A 1 26  ? -6.186  -0.408  -10.959 1.00 35.07 ? 26  PHE A CG  1 
ATOM 46    C CD1 . PHE A 1 26  ? -6.939  0.742   -11.121 1.00 33.69 ? 26  PHE A CD1 1 
ATOM 47    C CD2 . PHE A 1 26  ? -6.270  -1.403  -11.925 1.00 35.18 ? 26  PHE A CD2 1 
ATOM 48    C CE1 . PHE A 1 26  ? -7.758  0.909   -12.232 1.00 33.75 ? 26  PHE A CE1 1 
ATOM 49    C CE2 . PHE A 1 26  ? -7.088  -1.250  -13.045 1.00 33.93 ? 26  PHE A CE2 1 
ATOM 50    C CZ  . PHE A 1 26  ? -7.834  -0.088  -13.202 1.00 34.32 ? 26  PHE A CZ  1 
ATOM 51    N N   . LYS A 1 27  ? -8.337  -0.639  -8.484  1.00 38.88 ? 27  LYS A N   1 
ATOM 52    C CA  . LYS A 1 27  ? -9.475  0.204   -8.169  1.00 39.17 ? 27  LYS A CA  1 
ATOM 53    C C   . LYS A 1 27  ? -10.057 -0.022  -6.784  1.00 39.01 ? 27  LYS A C   1 
ATOM 54    O O   . LYS A 1 27  ? -10.826 0.804   -6.291  1.00 39.63 ? 27  LYS A O   1 
ATOM 55    C CB  . LYS A 1 27  ? -10.556 0.116   -9.245  1.00 40.26 ? 27  LYS A CB  1 
ATOM 56    C CG  . LYS A 1 27  ? -11.239 -1.207  -9.393  1.00 42.92 ? 27  LYS A CG  1 
ATOM 57    C CD  . LYS A 1 27  ? -11.937 -1.226  -10.743 1.00 44.54 ? 27  LYS A CD  1 
ATOM 58    C CE  . LYS A 1 27  ? -12.403 -2.616  -11.121 1.00 46.03 ? 27  LYS A CE  1 
ATOM 59    N NZ  . LYS A 1 27  ? -12.585 -2.686  -12.598 1.00 47.60 ? 27  LYS A NZ  1 
ATOM 60    N N   . ASP A 1 28  ? -9.659  -1.112  -6.137  1.00 38.63 ? 28  ASP A N   1 
ATOM 61    C CA  . ASP A 1 28  ? -10.135 -1.420  -4.791  1.00 38.10 ? 28  ASP A CA  1 
ATOM 62    C C   . ASP A 1 28  ? -9.628  -0.428  -3.757  1.00 37.73 ? 28  ASP A C   1 
ATOM 63    O O   . ASP A 1 28  ? -8.549  0.136   -3.896  1.00 38.49 ? 28  ASP A O   1 
ATOM 64    C CB  . ASP A 1 28  ? -9.659  -2.804  -4.368  1.00 39.52 ? 28  ASP A CB  1 
ATOM 65    C CG  . ASP A 1 28  ? -10.175 -3.903  -5.266  1.00 41.13 ? 28  ASP A CG  1 
ATOM 66    O OD1 . ASP A 1 28  ? -9.653  -5.035  -5.164  1.00 41.54 ? 28  ASP A OD1 1 
ATOM 67    O OD2 . ASP A 1 28  ? -11.103 -3.644  -6.061  1.00 42.28 ? 28  ASP A OD2 1 
ATOM 68    N N   . PRO A 1 29  ? -10.417 -0.183  -2.706  1.00 37.12 ? 29  PRO A N   1 
ATOM 69    C CA  . PRO A 1 29  ? -9.971  0.748   -1.670  1.00 35.40 ? 29  PRO A CA  1 
ATOM 70    C C   . PRO A 1 29  ? -8.771  0.096   -0.978  1.00 34.00 ? 29  PRO A C   1 
ATOM 71    O O   . PRO A 1 29  ? -8.628  -1.121  -1.012  1.00 32.89 ? 29  PRO A O   1 
ATOM 72    C CB  . PRO A 1 29  ? -11.197 0.870   -0.763  1.00 35.63 ? 29  PRO A CB  1 
ATOM 73    C CG  . PRO A 1 29  ? -11.924 -0.427  -0.980  1.00 36.19 ? 29  PRO A CG  1 
ATOM 74    C CD  . PRO A 1 29  ? -11.810 -0.597  -2.474  1.00 36.76 ? 29  PRO A CD  1 
ATOM 75    N N   . LYS A 1 30  ? -7.919  0.898   -0.348  1.00 34.02 ? 30  LYS A N   1 
ATOM 76    C CA  . LYS A 1 30  ? -6.716  0.373   0.290   1.00 33.57 ? 30  LYS A CA  1 
ATOM 77    C C   . LYS A 1 30  ? -6.430  1.020   1.629   1.00 33.25 ? 30  LYS A C   1 
ATOM 78    O O   . LYS A 1 30  ? -7.045  2.023   1.990   1.00 33.60 ? 30  LYS A O   1 
ATOM 79    C CB  . LYS A 1 30  ? -5.484  0.657   -0.581  1.00 33.48 ? 30  LYS A CB  1 
ATOM 80    C CG  . LYS A 1 30  ? -5.551  0.258   -2.032  1.00 34.17 ? 30  LYS A CG  1 
ATOM 81    C CD  . LYS A 1 30  ? -4.274  0.703   -2.745  1.00 37.51 ? 30  LYS A CD  1 
ATOM 82    C CE  . LYS A 1 30  ? -4.122  0.058   -4.128  1.00 40.55 ? 30  LYS A CE  1 
ATOM 83    N NZ  . LYS A 1 30  ? -5.333  0.228   -5.022  1.00 42.57 ? 30  LYS A NZ  1 
ATOM 84    N N   . ARG A 1 31  ? -5.467  0.443   2.342   1.00 32.36 ? 31  ARG A N   1 
ATOM 85    C CA  . ARG A 1 31  ? -5.010  0.972   3.614   1.00 31.61 ? 31  ARG A CA  1 
ATOM 86    C C   . ARG A 1 31  ? -3.579  1.408   3.314   1.00 31.11 ? 31  ARG A C   1 
ATOM 87    O O   . ARG A 1 31  ? -2.871  0.743   2.569   1.00 31.54 ? 31  ARG A O   1 
ATOM 88    C CB  . ARG A 1 31  ? -4.997  -0.107  4.705   1.00 31.60 ? 31  ARG A CB  1 
ATOM 89    C CG  . ARG A 1 31  ? -6.367  -0.618  5.135   1.00 33.74 ? 31  ARG A CG  1 
ATOM 90    C CD  . ARG A 1 31  ? -6.274  -1.358  6.468   1.00 36.96 ? 31  ARG A CD  1 
ATOM 91    N NE  . ARG A 1 31  ? -6.611  -2.781  6.370   1.00 40.91 ? 31  ARG A NE  1 
ATOM 92    C CZ  . ARG A 1 31  ? -7.849  -3.272  6.391   1.00 41.37 ? 31  ARG A CZ  1 
ATOM 93    N NH1 . ARG A 1 31  ? -8.888  -2.458  6.512   1.00 43.34 ? 31  ARG A NH1 1 
ATOM 94    N NH2 . ARG A 1 31  ? -8.052  -4.577  6.285   1.00 41.20 ? 31  ARG A NH2 1 
ATOM 95    N N   . LEU A 1 32  ? -3.159  2.541   3.851   1.00 30.30 ? 32  LEU A N   1 
ATOM 96    C CA  . LEU A 1 32  ? -1.795  2.980   3.625   1.00 29.46 ? 32  LEU A CA  1 
ATOM 97    C C   . LEU A 1 32  ? -0.983  2.820   4.904   1.00 30.16 ? 32  LEU A C   1 
ATOM 98    O O   . LEU A 1 32  ? -1.069  3.632   5.820   1.00 31.48 ? 32  LEU A O   1 
ATOM 99    C CB  . LEU A 1 32  ? -1.750  4.431   3.123   1.00 27.27 ? 32  LEU A CB  1 
ATOM 100   C CG  . LEU A 1 32  ? -1.905  4.565   1.595   1.00 25.97 ? 32  LEU A CG  1 
ATOM 101   C CD1 . LEU A 1 32  ? -1.786  6.011   1.182   1.00 23.99 ? 32  LEU A CD1 1 
ATOM 102   C CD2 . LEU A 1 32  ? -0.836  3.739   0.887   1.00 23.52 ? 32  LEU A CD2 1 
ATOM 103   N N   . TYR A 1 33  ? -0.200  1.746   4.949   1.00 29.97 ? 33  TYR A N   1 
ATOM 104   C CA  . TYR A 1 33  ? 0.637   1.424   6.097   1.00 30.01 ? 33  TYR A CA  1 
ATOM 105   C C   . TYR A 1 33  ? 1.960   2.161   6.041   1.00 29.66 ? 33  TYR A C   1 
ATOM 106   O O   . TYR A 1 33  ? 2.650   2.139   5.037   1.00 30.85 ? 33  TYR A O   1 
ATOM 107   C CB  . TYR A 1 33  ? 0.862   -0.086  6.148   1.00 30.92 ? 33  TYR A CB  1 
ATOM 108   C CG  . TYR A 1 33  ? 1.791   -0.565  7.241   1.00 32.36 ? 33  TYR A CG  1 
ATOM 109   C CD1 . TYR A 1 33  ? 3.177   -0.566  7.048   1.00 32.01 ? 33  TYR A CD1 1 
ATOM 110   C CD2 . TYR A 1 33  ? 1.284   -1.086  8.442   1.00 31.79 ? 33  TYR A CD2 1 
ATOM 111   C CE1 . TYR A 1 33  ? 4.036   -1.084  8.017   1.00 32.99 ? 33  TYR A CE1 1 
ATOM 112   C CE2 . TYR A 1 33  ? 2.133   -1.609  9.417   1.00 31.39 ? 33  TYR A CE2 1 
ATOM 113   C CZ  . TYR A 1 33  ? 3.508   -1.608  9.197   1.00 33.55 ? 33  TYR A CZ  1 
ATOM 114   O OH  . TYR A 1 33  ? 4.354   -2.156  10.144  1.00 34.14 ? 33  TYR A OH  1 
ATOM 115   N N   . CYS A 1 34  ? 2.310   2.812   7.137   1.00 29.92 ? 34  CYS A N   1 
ATOM 116   C CA  . CYS A 1 34  ? 3.539   3.589   7.203   1.00 31.42 ? 34  CYS A CA  1 
ATOM 117   C C   . CYS A 1 34  ? 4.661   2.846   7.926   1.00 32.35 ? 34  CYS A C   1 
ATOM 118   O O   . CYS A 1 34  ? 4.503   2.432   9.077   1.00 32.48 ? 34  CYS A O   1 
ATOM 119   C CB  . CYS A 1 34  ? 3.254   4.911   7.913   1.00 31.06 ? 34  CYS A CB  1 
ATOM 120   S SG  . CYS A 1 34  ? 4.685   5.959   8.088   1.00 31.94 ? 34  CYS A SG  1 
ATOM 121   N N   . LYS A 1 35  ? 5.794   2.679   7.252   1.00 33.44 ? 35  LYS A N   1 
ATOM 122   C CA  . LYS A 1 35  ? 6.929   1.979   7.854   1.00 36.51 ? 35  LYS A CA  1 
ATOM 123   C C   . LYS A 1 35  ? 7.232   2.551   9.236   1.00 38.29 ? 35  LYS A C   1 
ATOM 124   O O   . LYS A 1 35  ? 7.474   1.811   10.194  1.00 38.87 ? 35  LYS A O   1 
ATOM 125   C CB  . LYS A 1 35  ? 8.188   2.109   6.975   1.00 35.13 ? 35  LYS A CB  1 
ATOM 126   N N   . ASN A 1 36  ? 7.207   3.876   9.335   1.00 40.23 ? 36  ASN A N   1 
ATOM 127   C CA  . ASN A 1 36  ? 7.511   4.548   10.589  1.00 41.60 ? 36  ASN A CA  1 
ATOM 128   C C   . ASN A 1 36  ? 6.493   4.271   11.690  1.00 41.55 ? 36  ASN A C   1 
ATOM 129   O O   . ASN A 1 36  ? 5.468   4.940   11.770  1.00 42.29 ? 36  ASN A O   1 
ATOM 130   C CB  . ASN A 1 36  ? 7.612   6.054   10.365  1.00 43.58 ? 36  ASN A CB  1 
ATOM 131   C CG  . ASN A 1 36  ? 8.508   6.738   11.394  1.00 46.28 ? 36  ASN A CG  1 
ATOM 132   O OD1 . ASN A 1 36  ? 8.466   7.968   11.552  1.00 46.86 ? 36  ASN A OD1 1 
ATOM 133   N ND2 . ASN A 1 36  ? 9.336   5.946   12.089  1.00 45.64 ? 36  ASN A ND2 1 
ATOM 134   N N   . GLY A 1 37  ? 6.778   3.279   12.530  1.00 41.04 ? 37  GLY A N   1 
ATOM 135   C CA  . GLY A 1 37  ? 5.891   2.952   13.633  1.00 39.94 ? 37  GLY A CA  1 
ATOM 136   C C   . GLY A 1 37  ? 4.792   1.956   13.320  1.00 40.15 ? 37  GLY A C   1 
ATOM 137   O O   . GLY A 1 37  ? 4.154   1.429   14.234  1.00 40.18 ? 37  GLY A O   1 
ATOM 138   N N   . GLY A 1 38  ? 4.549   1.703   12.039  1.00 39.76 ? 38  GLY A N   1 
ATOM 139   C CA  . GLY A 1 38  ? 3.507   0.764   11.666  1.00 38.85 ? 38  GLY A CA  1 
ATOM 140   C C   . GLY A 1 38  ? 2.094   1.316   11.793  1.00 38.61 ? 38  GLY A C   1 
ATOM 141   O O   . GLY A 1 38  ? 1.152   0.589   12.126  1.00 38.94 ? 38  GLY A O   1 
ATOM 142   N N   . PHE A 1 39  ? 1.933   2.607   11.532  1.00 38.10 ? 39  PHE A N   1 
ATOM 143   C CA  . PHE A 1 39  ? 0.616   3.233   11.611  1.00 37.69 ? 39  PHE A CA  1 
ATOM 144   C C   . PHE A 1 39  ? -0.050  3.252   10.246  1.00 37.07 ? 39  PHE A C   1 
ATOM 145   O O   . PHE A 1 39  ? 0.614   3.439   9.224   1.00 37.54 ? 39  PHE A O   1 
ATOM 146   C CB  . PHE A 1 39  ? 0.719   4.698   12.065  1.00 39.84 ? 39  PHE A CB  1 
ATOM 147   C CG  . PHE A 1 39  ? 1.238   4.884   13.463  1.00 40.67 ? 39  PHE A CG  1 
ATOM 148   C CD1 . PHE A 1 39  ? 2.556   5.246   13.681  1.00 39.73 ? 39  PHE A CD1 1 
ATOM 149   C CD2 . PHE A 1 39  ? 0.405   4.689   14.563  1.00 40.90 ? 39  PHE A CD2 1 
ATOM 150   C CE1 . PHE A 1 39  ? 3.041   5.406   14.973  1.00 40.86 ? 39  PHE A CE1 1 
ATOM 151   C CE2 . PHE A 1 39  ? 0.885   4.850   15.854  1.00 40.18 ? 39  PHE A CE2 1 
ATOM 152   C CZ  . PHE A 1 39  ? 2.207   5.208   16.060  1.00 40.03 ? 39  PHE A CZ  1 
ATOM 153   N N   . PHE A 1 40  ? -1.363  3.076   10.237  1.00 35.87 ? 40  PHE A N   1 
ATOM 154   C CA  . PHE A 1 40  ? -2.147  3.140   9.013   1.00 34.79 ? 40  PHE A CA  1 
ATOM 155   C C   . PHE A 1 40  ? -2.602  4.590   8.910   1.00 34.43 ? 40  PHE A C   1 
ATOM 156   O O   . PHE A 1 40  ? -2.970  5.200   9.911   1.00 34.18 ? 40  PHE A O   1 
ATOM 157   C CB  . PHE A 1 40  ? -3.363  2.224   9.119   1.00 34.47 ? 40  PHE A CB  1 
ATOM 158   C CG  . PHE A 1 40  ? -3.031  0.775   8.988   1.00 33.95 ? 40  PHE A CG  1 
ATOM 159   C CD1 . PHE A 1 40  ? -2.740  0.225   7.742   1.00 33.33 ? 40  PHE A CD1 1 
ATOM 160   C CD2 . PHE A 1 40  ? -2.987  -0.044  10.111  1.00 33.66 ? 40  PHE A CD2 1 
ATOM 161   C CE1 . PHE A 1 40  ? -2.408  -1.124  7.615   1.00 32.83 ? 40  PHE A CE1 1 
ATOM 162   C CE2 . PHE A 1 40  ? -2.655  -1.396  9.994   1.00 33.95 ? 40  PHE A CE2 1 
ATOM 163   C CZ  . PHE A 1 40  ? -2.365  -1.934  8.740   1.00 33.19 ? 40  PHE A CZ  1 
ATOM 164   N N   . LEU A 1 41  ? -2.565  5.150   7.711   1.00 34.55 ? 41  LEU A N   1 
ATOM 165   C CA  . LEU A 1 41  ? -2.987  6.530   7.523   1.00 35.90 ? 41  LEU A CA  1 
ATOM 166   C C   . LEU A 1 41  ? -4.492  6.598   7.765   1.00 37.18 ? 41  LEU A C   1 
ATOM 167   O O   . LEU A 1 41  ? -5.248  5.811   7.193   1.00 38.34 ? 41  LEU A O   1 
ATOM 168   C CB  . LEU A 1 41  ? -2.653  6.988   6.100   1.00 35.32 ? 41  LEU A CB  1 
ATOM 169   C CG  . LEU A 1 41  ? -2.930  8.442   5.717   1.00 35.51 ? 41  LEU A CG  1 
ATOM 170   C CD1 . LEU A 1 41  ? -2.131  9.410   6.609   1.00 34.64 ? 41  LEU A CD1 1 
ATOM 171   C CD2 . LEU A 1 41  ? -2.557  8.625   4.248   1.00 33.88 ? 41  LEU A CD2 1 
ATOM 172   N N   . ARG A 1 42  ? -4.922  7.516   8.626   1.00 38.24 ? 42  ARG A N   1 
ATOM 173   C CA  . ARG A 1 42  ? -6.345  7.659   8.937   1.00 39.17 ? 42  ARG A CA  1 
ATOM 174   C C   . ARG A 1 42  ? -6.899  9.042   8.639   1.00 39.56 ? 42  ARG A C   1 
ATOM 175   O O   . ARG A 1 42  ? -6.295  10.054  8.994   1.00 39.79 ? 42  ARG A O   1 
ATOM 176   C CB  . ARG A 1 42  ? -6.614  7.343   10.404  1.00 39.35 ? 42  ARG A CB  1 
ATOM 177   C CG  . ARG A 1 42  ? -8.068  7.539   10.792  1.00 39.90 ? 42  ARG A CG  1 
ATOM 178   C CD  . ARG A 1 42  ? -8.371  7.011   12.186  1.00 40.11 ? 42  ARG A CD  1 
ATOM 179   N NE  . ARG A 1 42  ? -7.592  7.684   13.224  1.00 39.37 ? 42  ARG A NE  1 
ATOM 180   C CZ  . ARG A 1 42  ? -7.683  7.406   14.523  1.00 38.53 ? 42  ARG A CZ  1 
ATOM 181   N NH1 . ARG A 1 42  ? -8.524  6.471   14.940  1.00 37.55 ? 42  ARG A NH1 1 
ATOM 182   N NH2 . ARG A 1 42  ? -6.914  8.039   15.400  1.00 37.72 ? 42  ARG A NH2 1 
ATOM 183   N N   . ILE A 1 43  ? -8.055  9.073   7.987   1.00 39.71 ? 43  ILE A N   1 
ATOM 184   C CA  . ILE A 1 43  ? -8.704  10.330  7.652   1.00 40.58 ? 43  ILE A CA  1 
ATOM 185   C C   . ILE A 1 43  ? -10.044 10.434  8.374   1.00 41.35 ? 43  ILE A C   1 
ATOM 186   O O   . ILE A 1 43  ? -11.009 9.734   8.050   1.00 40.63 ? 43  ILE A O   1 
ATOM 187   C CB  . ILE A 1 43  ? -8.919  10.462  6.143   1.00 40.79 ? 43  ILE A CB  1 
ATOM 188   C CG1 . ILE A 1 43  ? -7.561  10.551  5.444   1.00 41.27 ? 43  ILE A CG1 1 
ATOM 189   C CG2 . ILE A 1 43  ? -9.769  11.689  5.842   1.00 39.94 ? 43  ILE A CG2 1 
ATOM 190   C CD1 . ILE A 1 43  ? -7.643  10.444  3.939   1.00 42.55 ? 43  ILE A CD1 1 
ATOM 191   N N   . HIS A 1 44  ? -10.075 11.320  9.365   1.00 43.38 ? 44  HIS A N   1 
ATOM 192   C CA  . HIS A 1 44  ? -11.255 11.567  10.188  1.00 45.06 ? 44  HIS A CA  1 
ATOM 193   C C   . HIS A 1 44  ? -12.369 12.357  9.502   1.00 45.23 ? 44  HIS A C   1 
ATOM 194   O O   . HIS A 1 44  ? -12.115 13.198  8.624   1.00 44.42 ? 44  HIS A O   1 
ATOM 195   C CB  . HIS A 1 44  ? -10.851 12.301  11.458  1.00 46.22 ? 44  HIS A CB  1 
ATOM 196   C CG  . HIS A 1 44  ? -10.052 11.468  12.403  1.00 47.01 ? 44  HIS A CG  1 
ATOM 197   N ND1 . HIS A 1 44  ? -10.606 10.445  13.140  1.00 47.94 ? 44  HIS A ND1 1 
ATOM 198   C CD2 . HIS A 1 44  ? -8.742  11.514  12.743  1.00 46.84 ? 44  HIS A CD2 1 
ATOM 199   C CE1 . HIS A 1 44  ? -9.672  9.898   13.898  1.00 48.10 ? 44  HIS A CE1 1 
ATOM 200   N NE2 . HIS A 1 44  ? -8.532  10.529  13.675  1.00 47.17 ? 44  HIS A NE2 1 
ATOM 201   N N   . PRO A 1 45  ? -13.626 12.111  9.921   1.00 45.28 ? 45  PRO A N   1 
ATOM 202   C CA  . PRO A 1 45  ? -14.812 12.778  9.367   1.00 45.74 ? 45  PRO A CA  1 
ATOM 203   C C   . PRO A 1 45  ? -14.771 14.298  9.492   1.00 45.82 ? 45  PRO A C   1 
ATOM 204   O O   . PRO A 1 45  ? -15.360 15.009  8.683   1.00 45.47 ? 45  PRO A O   1 
ATOM 205   C CB  . PRO A 1 45  ? -15.966 12.161  10.156  1.00 44.03 ? 45  PRO A CB  1 
ATOM 206   C CG  . PRO A 1 45  ? -15.439 10.808  10.517  1.00 44.71 ? 45  PRO A CG  1 
ATOM 207   C CD  . PRO A 1 45  ? -14.016 11.096  10.918  1.00 44.69 ? 45  PRO A CD  1 
ATOM 208   N N   . ASP A 1 46  ? -14.079 14.794  10.508  1.00 46.50 ? 46  ASP A N   1 
ATOM 209   C CA  . ASP A 1 46  ? -13.980 16.232  10.703  1.00 47.98 ? 46  ASP A CA  1 
ATOM 210   C C   . ASP A 1 46  ? -12.769 16.819  9.984   1.00 48.16 ? 46  ASP A C   1 
ATOM 211   O O   . ASP A 1 46  ? -12.391 17.962  10.226  1.00 48.52 ? 46  ASP A O   1 
ATOM 212   C CB  . ASP A 1 46  ? -13.913 16.559  12.197  1.00 48.45 ? 46  ASP A CB  1 
ATOM 213   C CG  . ASP A 1 46  ? -12.809 15.809  12.906  1.00 48.95 ? 46  ASP A CG  1 
ATOM 214   O OD1 . ASP A 1 46  ? -12.884 14.565  12.982  1.00 49.57 ? 46  ASP A OD1 1 
ATOM 215   O OD2 . ASP A 1 46  ? -11.866 16.469  13.381  1.00 48.96 ? 46  ASP A OD2 1 
ATOM 216   N N   . GLY A 1 47  ? -12.159 16.033  9.103   1.00 48.13 ? 47  GLY A N   1 
ATOM 217   C CA  . GLY A 1 47  ? -11.004 16.518  8.367   1.00 47.74 ? 47  GLY A CA  1 
ATOM 218   C C   . GLY A 1 47  ? -9.651  16.292  9.026   1.00 47.41 ? 47  GLY A C   1 
ATOM 219   O O   . GLY A 1 47  ? -8.619  16.607  8.435   1.00 46.72 ? 47  GLY A O   1 
ATOM 220   N N   . ARG A 1 48  ? -9.645  15.761  10.246  1.00 47.56 ? 48  ARG A N   1 
ATOM 221   C CA  . ARG A 1 48  ? -8.397  15.484  10.956  1.00 47.79 ? 48  ARG A CA  1 
ATOM 222   C C   . ARG A 1 48  ? -7.637  14.360  10.262  1.00 47.75 ? 48  ARG A C   1 
ATOM 223   O O   . ARG A 1 48  ? -8.241  13.400  9.779   1.00 46.89 ? 48  ARG A O   1 
ATOM 224   C CB  . ARG A 1 48  ? -8.675  15.036  12.392  1.00 48.61 ? 48  ARG A CB  1 
ATOM 225   C CG  . ARG A 1 48  ? -8.918  16.135  13.415  1.00 49.66 ? 48  ARG A CG  1 
ATOM 226   C CD  . ARG A 1 48  ? -9.316  15.513  14.754  1.00 49.94 ? 48  ARG A CD  1 
ATOM 227   N NE  . ARG A 1 48  ? -10.617 14.846  14.671  1.00 50.86 ? 48  ARG A NE  1 
ATOM 228   C CZ  . ARG A 1 48  ? -10.877 13.620  15.122  1.00 51.97 ? 48  ARG A CZ  1 
ATOM 229   N NH1 . ARG A 1 48  ? -12.100 13.110  15.001  1.00 52.26 ? 48  ARG A NH1 1 
ATOM 230   N NH2 . ARG A 1 48  ? -9.920  12.894  15.684  1.00 51.70 ? 48  ARG A NH2 1 
ATOM 231   N N   . VAL A 1 49  ? -6.311  14.469  10.241  1.00 47.78 ? 49  VAL A N   1 
ATOM 232   C CA  . VAL A 1 49  ? -5.467  13.455  9.614   1.00 47.79 ? 49  VAL A CA  1 
ATOM 233   C C   . VAL A 1 49  ? -4.391  12.952  10.576  1.00 47.41 ? 49  VAL A C   1 
ATOM 234   O O   . VAL A 1 49  ? -3.694  13.745  11.213  1.00 47.55 ? 49  VAL A O   1 
ATOM 235   C CB  . VAL A 1 49  ? -4.797  14.023  8.337   1.00 48.02 ? 49  VAL A CB  1 
ATOM 236   C CG1 . VAL A 1 49  ? -3.786  13.031  7.788   1.00 48.16 ? 49  VAL A CG1 1 
ATOM 237   C CG2 . VAL A 1 49  ? -5.859  14.320  7.286   1.00 47.06 ? 49  VAL A CG2 1 
ATOM 238   N N   . ASP A 1 50  ? -4.266  11.635  10.682  1.00 47.17 ? 50  ASP A N   1 
ATOM 239   C CA  . ASP A 1 50  ? -3.271  11.026  11.555  1.00 46.68 ? 50  ASP A CA  1 
ATOM 240   C C   . ASP A 1 50  ? -3.119  9.549   11.221  1.00 46.74 ? 50  ASP A C   1 
ATOM 241   O O   . ASP A 1 50  ? -3.548  9.112   10.153  1.00 46.81 ? 50  ASP A O   1 
ATOM 242   C CB  . ASP A 1 50  ? -3.668  11.193  13.023  1.00 46.86 ? 50  ASP A CB  1 
ATOM 243   C CG  . ASP A 1 50  ? -4.787  10.257  13.449  1.00 48.23 ? 50  ASP A CG  1 
ATOM 244   O OD1 . ASP A 1 50  ? -5.157  10.295  14.643  1.00 49.35 ? 50  ASP A OD1 1 
ATOM 245   O OD2 . ASP A 1 50  ? -5.299  9.483   12.610  1.00 48.74 ? 50  ASP A OD2 1 
ATOM 246   N N   . GLY A 1 51  ? -2.522  8.787   12.136  1.00 47.00 ? 51  GLY A N   1 
ATOM 247   C CA  . GLY A 1 51  ? -2.331  7.367   11.910  1.00 47.38 ? 51  GLY A CA  1 
ATOM 248   C C   . GLY A 1 51  ? -2.697  6.533   13.119  1.00 47.84 ? 51  GLY A C   1 
ATOM 249   O O   . GLY A 1 51  ? -2.642  7.021   14.240  1.00 48.16 ? 51  GLY A O   1 
ATOM 250   N N   . VAL A 1 52  ? -3.078  5.278   12.888  1.00 48.46 ? 52  VAL A N   1 
ATOM 251   C CA  . VAL A 1 52  ? -3.453  4.355   13.957  1.00 48.13 ? 52  VAL A CA  1 
ATOM 252   C C   . VAL A 1 52  ? -2.939  2.968   13.606  1.00 48.77 ? 52  VAL A C   1 
ATOM 253   O O   . VAL A 1 52  ? -2.570  2.706   12.466  1.00 49.47 ? 52  VAL A O   1 
ATOM 254   C CB  . VAL A 1 52  ? -4.971  4.274   14.100  1.00 47.79 ? 52  VAL A CB  1 
ATOM 255   C CG1 . VAL A 1 52  ? -5.554  5.626   13.916  1.00 48.51 ? 52  VAL A CG1 1 
ATOM 256   C CG2 . VAL A 1 52  ? -5.556  3.337   13.067  1.00 48.04 ? 52  VAL A CG2 1 
ATOM 257   N N   . ARG A 1 53  ? -2.931  2.067   14.577  1.00 49.57 ? 53  ARG A N   1 
ATOM 258   C CA  . ARG A 1 53  ? -2.450  0.724   14.312  1.00 49.39 ? 53  ARG A CA  1 
ATOM 259   C C   . ARG A 1 53  ? -3.579  -0.295  14.201  1.00 49.96 ? 53  ARG A C   1 
ATOM 260   O O   . ARG A 1 53  ? -3.376  -1.389  13.688  1.00 51.19 ? 53  ARG A O   1 
ATOM 261   C CB  . ARG A 1 53  ? -1.421  0.335   15.381  1.00 48.69 ? 53  ARG A CB  1 
ATOM 262   C CG  . ARG A 1 53  ? -0.170  1.206   15.292  1.00 48.24 ? 53  ARG A CG  1 
ATOM 263   C CD  . ARG A 1 53  ? 0.868   0.917   16.368  1.00 48.42 ? 53  ARG A CD  1 
ATOM 264   N NE  . ARG A 1 53  ? 2.135   1.595   16.067  1.00 48.94 ? 53  ARG A NE  1 
ATOM 265   C CZ  . ARG A 1 53  ? 3.054   1.924   16.976  1.00 48.11 ? 53  ARG A CZ  1 
ATOM 266   N NH1 . ARG A 1 53  ? 2.858   1.645   18.253  1.00 48.12 ? 53  ARG A NH1 1 
ATOM 267   N NH2 . ARG A 1 53  ? 4.171   2.540   16.612  1.00 47.48 ? 53  ARG A NH2 1 
ATOM 268   N N   . GLU A 1 54  ? -4.780  0.072   14.636  1.00 50.08 ? 54  GLU A N   1 
ATOM 269   C CA  . GLU A 1 54  ? -5.897  -0.853  14.579  1.00 51.46 ? 54  GLU A CA  1 
ATOM 270   C C   . GLU A 1 54  ? -6.489  -1.012  13.179  1.00 52.30 ? 54  GLU A C   1 
ATOM 271   O O   . GLU A 1 54  ? -7.248  -0.161  12.699  1.00 52.99 ? 54  GLU A O   1 
ATOM 272   C CB  . GLU A 1 54  ? -6.975  -0.429  15.577  1.00 52.44 ? 54  GLU A CB  1 
ATOM 273   C CG  . GLU A 1 54  ? -8.144  -1.401  15.658  1.00 54.61 ? 54  GLU A CG  1 
ATOM 274   C CD  . GLU A 1 54  ? -7.709  -2.857  15.520  1.00 55.98 ? 54  GLU A CD  1 
ATOM 275   O OE1 . GLU A 1 54  ? -6.789  -3.291  16.258  1.00 56.88 ? 54  GLU A OE1 1 
ATOM 276   O OE2 . GLU A 1 54  ? -8.293  -3.565  14.668  1.00 56.42 ? 54  GLU A OE2 1 
ATOM 277   N N   . LYS A 1 55  ? -6.144  -2.124  12.536  1.00 52.32 ? 55  LYS A N   1 
ATOM 278   C CA  . LYS A 1 55  ? -6.612  -2.420  11.188  1.00 52.77 ? 55  LYS A CA  1 
ATOM 279   C C   . LYS A 1 55  ? -8.129  -2.354  11.032  1.00 52.86 ? 55  LYS A C   1 
ATOM 280   O O   . LYS A 1 55  ? -8.635  -2.149  9.927   1.00 53.75 ? 55  LYS A O   1 
ATOM 281   C CB  . LYS A 1 55  ? -6.114  -3.805  10.748  1.00 52.58 ? 55  LYS A CB  1 
ATOM 282   N N   . SER A 1 56  ? -8.859  -2.528  12.126  1.00 52.70 ? 56  SER A N   1 
ATOM 283   C CA  . SER A 1 56  ? -10.313 -2.498  12.050  1.00 52.83 ? 56  SER A CA  1 
ATOM 284   C C   . SER A 1 56  ? -10.867 -1.080  11.962  1.00 52.41 ? 56  SER A C   1 
ATOM 285   O O   . SER A 1 56  ? -12.014 -0.889  11.566  1.00 52.95 ? 56  SER A O   1 
ATOM 286   C CB  . SER A 1 56  ? -10.924 -3.217  13.255  1.00 53.14 ? 56  SER A CB  1 
ATOM 287   O OG  . SER A 1 56  ? -12.338 -3.229  13.172  1.00 53.99 ? 56  SER A OG  1 
ATOM 288   N N   . ASP A 1 57  ? -10.062 -0.088  12.327  1.00 51.88 ? 57  ASP A N   1 
ATOM 289   C CA  . ASP A 1 57  ? -10.520 1.297   12.269  1.00 51.81 ? 57  ASP A CA  1 
ATOM 290   C C   . ASP A 1 57  ? -11.147 1.566   10.902  1.00 51.15 ? 57  ASP A C   1 
ATOM 291   O O   . ASP A 1 57  ? -10.523 1.361   9.859   1.00 51.40 ? 57  ASP A O   1 
ATOM 292   C CB  . ASP A 1 57  ? -9.359  2.261   12.527  1.00 52.84 ? 57  ASP A CB  1 
ATOM 293   C CG  . ASP A 1 57  ? -9.802  3.712   12.527  1.00 54.52 ? 57  ASP A CG  1 
ATOM 294   O OD1 . ASP A 1 57  ? -9.235  4.506   13.314  1.00 55.24 ? 57  ASP A OD1 1 
ATOM 295   O OD2 . ASP A 1 57  ? -10.712 4.060   11.739  1.00 55.07 ? 57  ASP A OD2 1 
ATOM 296   N N   . PRO A 1 58  ? -12.396 2.041   10.891  1.00 50.26 ? 58  PRO A N   1 
ATOM 297   C CA  . PRO A 1 58  ? -13.091 2.319   9.632   1.00 49.73 ? 58  PRO A CA  1 
ATOM 298   C C   . PRO A 1 58  ? -12.618 3.555   8.851   1.00 48.79 ? 58  PRO A C   1 
ATOM 299   O O   . PRO A 1 58  ? -12.964 3.713   7.673   1.00 48.36 ? 58  PRO A O   1 
ATOM 300   C CB  . PRO A 1 58  ? -14.544 2.435   10.081  1.00 49.23 ? 58  PRO A CB  1 
ATOM 301   C CG  . PRO A 1 58  ? -14.396 3.137   11.395  1.00 49.06 ? 58  PRO A CG  1 
ATOM 302   C CD  . PRO A 1 58  ? -13.224 2.424   12.048  1.00 49.47 ? 58  PRO A CD  1 
ATOM 303   N N   . HIS A 1 59  ? -11.834 4.420   9.491   1.00 47.25 ? 59  HIS A N   1 
ATOM 304   C CA  . HIS A 1 59  ? -11.369 5.635   8.827   1.00 46.31 ? 59  HIS A CA  1 
ATOM 305   C C   . HIS A 1 59  ? -9.999  5.520   8.160   1.00 44.38 ? 59  HIS A C   1 
ATOM 306   O O   . HIS A 1 59  ? -9.346  6.533   7.885   1.00 42.54 ? 59  HIS A O   1 
ATOM 307   C CB  . HIS A 1 59  ? -11.375 6.807   9.813   1.00 48.05 ? 59  HIS A CB  1 
ATOM 308   C CG  . HIS A 1 59  ? -12.716 7.056   10.446  1.00 49.36 ? 59  HIS A CG  1 
ATOM 309   N ND1 . HIS A 1 59  ? -13.884 7.132   9.717   1.00 49.03 ? 59  HIS A ND1 1 
ATOM 310   C CD2 . HIS A 1 59  ? -13.066 7.254   11.739  1.00 49.02 ? 59  HIS A CD2 1 
ATOM 311   C CE1 . HIS A 1 59  ? -14.896 7.364   10.532  1.00 48.45 ? 59  HIS A CE1 1 
ATOM 312   N NE2 . HIS A 1 59  ? -14.426 7.442   11.765  1.00 48.75 ? 59  HIS A NE2 1 
ATOM 313   N N   . ILE A 1 60  ? -9.570  4.284   7.905   1.00 42.64 ? 60  ILE A N   1 
ATOM 314   C CA  . ILE A 1 60  ? -8.298  4.056   7.243   1.00 40.31 ? 60  ILE A CA  1 
ATOM 315   C C   . ILE A 1 60  ? -8.511  3.410   5.881   1.00 38.53 ? 60  ILE A C   1 
ATOM 316   O O   . ILE A 1 60  ? -7.553  3.145   5.164   1.00 39.30 ? 60  ILE A O   1 
ATOM 317   C CB  . ILE A 1 60  ? -7.341  3.173   8.076   1.00 40.78 ? 60  ILE A CB  1 
ATOM 318   C CG1 . ILE A 1 60  ? -7.999  1.829   8.389   1.00 41.43 ? 60  ILE A CG1 1 
ATOM 319   C CG2 . ILE A 1 60  ? -6.912  3.923   9.329   1.00 39.73 ? 60  ILE A CG2 1 
ATOM 320   C CD1 . ILE A 1 60  ? -7.019  0.784   8.917   1.00 41.74 ? 60  ILE A CD1 1 
ATOM 321   N N   . LYS A 1 61  ? -9.760  3.136   5.525   1.00 36.47 ? 61  LYS A N   1 
ATOM 322   C CA  . LYS A 1 61  ? -10.040 2.562   4.215   1.00 35.47 ? 61  LYS A CA  1 
ATOM 323   C C   . LYS A 1 61  ? -10.005 3.763   3.269   1.00 34.96 ? 61  LYS A C   1 
ATOM 324   O O   . LYS A 1 61  ? -10.838 4.671   3.377   1.00 35.60 ? 61  LYS A O   1 
ATOM 325   C CB  . LYS A 1 61  ? -11.417 1.891   4.197   1.00 34.50 ? 61  LYS A CB  1 
ATOM 326   N N   . LEU A 1 62  ? -9.022  3.786   2.371   1.00 32.90 ? 62  LEU A N   1 
ATOM 327   C CA  . LEU A 1 62  ? -8.860  4.903   1.446   1.00 30.63 ? 62  LEU A CA  1 
ATOM 328   C C   . LEU A 1 62  ? -9.078  4.510   -0.014  1.00 30.65 ? 62  LEU A C   1 
ATOM 329   O O   . LEU A 1 62  ? -8.968  3.335   -0.386  1.00 29.72 ? 62  LEU A O   1 
ATOM 330   C CB  . LEU A 1 62  ? -7.462  5.513   1.595   1.00 28.54 ? 62  LEU A CB  1 
ATOM 331   C CG  . LEU A 1 62  ? -6.932  5.716   3.015   1.00 29.41 ? 62  LEU A CG  1 
ATOM 332   C CD1 . LEU A 1 62  ? -5.527  6.261   2.953   1.00 27.75 ? 62  LEU A CD1 1 
ATOM 333   C CD2 . LEU A 1 62  ? -7.845  6.660   3.794   1.00 29.77 ? 62  LEU A CD2 1 
ATOM 334   N N   . GLN A 1 63  ? -9.392  5.507   -0.837  1.00 28.97 ? 63  GLN A N   1 
ATOM 335   C CA  . GLN A 1 63  ? -9.598  5.288   -2.253  1.00 28.00 ? 63  GLN A CA  1 
ATOM 336   C C   . GLN A 1 63  ? -8.617  6.157   -3.013  1.00 28.30 ? 63  GLN A C   1 
ATOM 337   O O   . GLN A 1 63  ? -8.708  7.382   -2.961  1.00 28.25 ? 63  GLN A O   1 
ATOM 338   C CB  . GLN A 1 63  ? -11.008 5.680   -2.679  1.00 26.48 ? 63  GLN A CB  1 
ATOM 339   C CG  . GLN A 1 63  ? -11.316 5.389   -4.149  1.00 24.11 ? 63  GLN A CG  1 
ATOM 340   C CD  . GLN A 1 63  ? -11.313 3.903   -4.461  1.00 24.62 ? 63  GLN A CD  1 
ATOM 341   O OE1 . GLN A 1 63  ? -11.883 3.114   -3.715  1.00 24.80 ? 63  GLN A OE1 1 
ATOM 342   N NE2 . GLN A 1 63  ? -10.681 3.515   -5.570  1.00 25.18 ? 63  GLN A NE2 1 
ATOM 343   N N   . LEU A 1 64  ? -7.682  5.524   -3.720  1.00 28.79 ? 64  LEU A N   1 
ATOM 344   C CA  . LEU A 1 64  ? -6.695  6.255   -4.512  1.00 27.94 ? 64  LEU A CA  1 
ATOM 345   C C   . LEU A 1 64  ? -7.269  6.385   -5.911  1.00 27.83 ? 64  LEU A C   1 
ATOM 346   O O   . LEU A 1 64  ? -7.908  5.467   -6.419  1.00 29.38 ? 64  LEU A O   1 
ATOM 347   C CB  . LEU A 1 64  ? -5.364  5.494   -4.576  1.00 27.95 ? 64  LEU A CB  1 
ATOM 348   C CG  . LEU A 1 64  ? -4.450  5.306   -3.355  1.00 27.12 ? 64  LEU A CG  1 
ATOM 349   C CD1 . LEU A 1 64  ? -3.788  6.597   -3.025  1.00 29.35 ? 64  LEU A CD1 1 
ATOM 350   C CD2 . LEU A 1 64  ? -5.236  4.811   -2.165  1.00 28.77 ? 64  LEU A CD2 1 
ATOM 351   N N   . GLN A 1 65  ? -7.037  7.528   -6.536  1.00 26.65 ? 65  GLN A N   1 
ATOM 352   C CA  . GLN A 1 65  ? -7.545  7.771   -7.862  1.00 25.47 ? 65  GLN A CA  1 
ATOM 353   C C   . GLN A 1 65  ? -6.507  8.560   -8.616  1.00 26.39 ? 65  GLN A C   1 
ATOM 354   O O   . GLN A 1 65  ? -6.045  9.575   -8.127  1.00 28.16 ? 65  GLN A O   1 
ATOM 355   C CB  . GLN A 1 65  ? -8.825  8.579   -7.752  1.00 24.24 ? 65  GLN A CB  1 
ATOM 356   C CG  . GLN A 1 65  ? -9.468  8.945   -9.061  1.00 22.45 ? 65  GLN A CG  1 
ATOM 357   C CD  . GLN A 1 65  ? -9.915  7.739   -9.839  1.00 22.52 ? 65  GLN A CD  1 
ATOM 358   O OE1 . GLN A 1 65  ? -10.673 6.905   -9.341  1.00 22.24 ? 65  GLN A OE1 1 
ATOM 359   N NE2 . GLN A 1 65  ? -9.451  7.637   -11.075 1.00 23.39 ? 65  GLN A NE2 1 
ATOM 360   N N   . ALA A 1 66  ? -6.128  8.094   -9.797  1.00 27.22 ? 66  ALA A N   1 
ATOM 361   C CA  . ALA A 1 66  ? -5.149  8.806   -10.602 1.00 28.07 ? 66  ALA A CA  1 
ATOM 362   C C   . ALA A 1 66  ? -5.861  9.989   -11.268 1.00 29.19 ? 66  ALA A C   1 
ATOM 363   O O   . ALA A 1 66  ? -6.952  9.823   -11.819 1.00 28.98 ? 66  ALA A O   1 
ATOM 364   C CB  . ALA A 1 66  ? -4.579  7.872   -11.666 1.00 26.02 ? 66  ALA A CB  1 
ATOM 365   N N   . GLU A 1 67  ? -5.270  11.183  -11.200 1.00 29.72 ? 67  GLU A N   1 
ATOM 366   C CA  . GLU A 1 67  ? -5.873  12.343  -11.849 1.00 30.33 ? 67  GLU A CA  1 
ATOM 367   C C   . GLU A 1 67  ? -5.173  12.486  -13.186 1.00 30.43 ? 67  GLU A C   1 
ATOM 368   O O   . GLU A 1 67  ? -5.702  13.043  -14.131 1.00 30.36 ? 67  GLU A O   1 
ATOM 369   C CB  . GLU A 1 67  ? -5.673  13.602  -11.016 1.00 31.83 ? 67  GLU A CB  1 
ATOM 370   C CG  . GLU A 1 67  ? -6.719  14.685  -11.292 1.00 32.94 ? 67  GLU A CG  1 
ATOM 371   C CD  . GLU A 1 67  ? -8.138  14.216  -11.015 1.00 33.52 ? 67  GLU A CD  1 
ATOM 372   O OE1 . GLU A 1 67  ? -8.373  13.574  -9.968  1.00 34.11 ? 67  GLU A OE1 1 
ATOM 373   O OE2 . GLU A 1 67  ? -9.026  14.491  -11.846 1.00 36.06 ? 67  GLU A OE2 1 
ATOM 374   N N   . GLU A 1 68  ? -3.956  11.973  -13.235 1.00 32.55 ? 68  GLU A N   1 
ATOM 375   C CA  . GLU A 1 68  ? -3.131  11.961  -14.439 1.00 33.31 ? 68  GLU A CA  1 
ATOM 376   C C   . GLU A 1 68  ? -1.960  11.032  -14.101 1.00 31.64 ? 68  GLU A C   1 
ATOM 377   O O   . GLU A 1 68  ? -1.809  10.629  -12.946 1.00 31.43 ? 68  GLU A O   1 
ATOM 378   C CB  . GLU A 1 68  ? -2.673  13.383  -14.824 1.00 34.58 ? 68  GLU A CB  1 
ATOM 379   C CG  . GLU A 1 68  ? -1.491  13.938  -14.066 1.00 38.12 ? 68  GLU A CG  1 
ATOM 380   C CD  . GLU A 1 68  ? -0.957  15.214  -14.705 1.00 40.32 ? 68  GLU A CD  1 
ATOM 381   O OE1 . GLU A 1 68  ? -0.772  15.231  -15.944 1.00 41.45 ? 68  GLU A OE1 1 
ATOM 382   O OE2 . GLU A 1 68  ? -0.714  16.196  -13.972 1.00 41.36 ? 68  GLU A OE2 1 
ATOM 383   N N   . ARG A 1 69  ? -1.150  10.674  -15.090 1.00 30.18 ? 69  ARG A N   1 
ATOM 384   C CA  . ARG A 1 69  ? -0.049  9.752   -14.841 1.00 28.58 ? 69  ARG A CA  1 
ATOM 385   C C   . ARG A 1 69  ? 0.779   10.058  -13.600 1.00 28.33 ? 69  ARG A C   1 
ATOM 386   O O   . ARG A 1 69  ? 1.222   11.187  -13.395 1.00 29.14 ? 69  ARG A O   1 
ATOM 387   C CB  . ARG A 1 69  ? 0.869   9.672   -16.063 1.00 28.07 ? 69  ARG A CB  1 
ATOM 388   C CG  . ARG A 1 69  ? 1.882   8.542   -15.971 1.00 28.74 ? 69  ARG A CG  1 
ATOM 389   C CD  . ARG A 1 69  ? 2.378   8.148   -17.337 1.00 28.38 ? 69  ARG A CD  1 
ATOM 390   N NE  . ARG A 1 69  ? 3.316   9.116   -17.888 1.00 29.95 ? 69  ARG A NE  1 
ATOM 391   C CZ  . ARG A 1 69  ? 4.635   9.058   -17.723 1.00 30.82 ? 69  ARG A CZ  1 
ATOM 392   N NH1 . ARG A 1 69  ? 5.178   8.074   -17.020 1.00 30.71 ? 69  ARG A NH1 1 
ATOM 393   N NH2 . ARG A 1 69  ? 5.414   9.978   -18.274 1.00 31.00 ? 69  ARG A NH2 1 
ATOM 394   N N   . GLY A 1 70  ? 0.973   9.040   -12.764 1.00 27.54 ? 70  GLY A N   1 
ATOM 395   C CA  . GLY A 1 70  ? 1.771   9.214   -11.565 1.00 26.10 ? 70  GLY A CA  1 
ATOM 396   C C   . GLY A 1 70  ? 1.228   10.155  -10.510 1.00 25.68 ? 70  GLY A C   1 
ATOM 397   O O   . GLY A 1 70  ? 1.851   10.326  -9.453  1.00 26.01 ? 70  GLY A O   1 
ATOM 398   N N   . VAL A 1 71  ? 0.084   10.778  -10.769 1.00 25.29 ? 71  VAL A N   1 
ATOM 399   C CA  . VAL A 1 71  ? -0.501  11.688  -9.783  1.00 25.85 ? 71  VAL A CA  1 
ATOM 400   C C   . VAL A 1 71  ? -1.858  11.179  -9.291  1.00 26.27 ? 71  VAL A C   1 
ATOM 401   O O   . VAL A 1 71  ? -2.701  10.753  -10.092 1.00 26.55 ? 71  VAL A O   1 
ATOM 402   C CB  . VAL A 1 71  ? -0.643  13.113  -10.343 1.00 25.57 ? 71  VAL A CB  1 
ATOM 403   C CG1 . VAL A 1 71  ? -1.317  14.004  -9.315  1.00 24.96 ? 71  VAL A CG1 1 
ATOM 404   C CG2 . VAL A 1 71  ? 0.743   13.669  -10.693 1.00 24.30 ? 71  VAL A CG2 1 
ATOM 405   N N   . VAL A 1 72  ? -2.069  11.220  -7.973  1.00 25.14 ? 72  VAL A N   1 
ATOM 406   C CA  . VAL A 1 72  ? -3.318  10.721  -7.399  1.00 24.69 ? 72  VAL A CA  1 
ATOM 407   C C   . VAL A 1 72  ? -3.939  11.570  -6.287  1.00 24.38 ? 72  VAL A C   1 
ATOM 408   O O   . VAL A 1 72  ? -3.330  12.513  -5.773  1.00 23.86 ? 72  VAL A O   1 
ATOM 409   C CB  . VAL A 1 72  ? -3.144  9.283   -6.806  1.00 24.08 ? 72  VAL A CB  1 
ATOM 410   C CG1 . VAL A 1 72  ? -2.422  8.399   -7.778  1.00 23.34 ? 72  VAL A CG1 1 
ATOM 411   C CG2 . VAL A 1 72  ? -2.385  9.343   -5.485  1.00 24.15 ? 72  VAL A CG2 1 
ATOM 412   N N   . SER A 1 73  ? -5.170  11.216  -5.935  1.00 23.88 ? 73  SER A N   1 
ATOM 413   C CA  . SER A 1 73  ? -5.872  11.871  -4.851  1.00 25.35 ? 73  SER A CA  1 
ATOM 414   C C   . SER A 1 73  ? -6.105  10.712  -3.881  1.00 26.07 ? 73  SER A C   1 
ATOM 415   O O   . SER A 1 73  ? -6.143  9.549   -4.282  1.00 27.17 ? 73  SER A O   1 
ATOM 416   C CB  . SER A 1 73  ? -7.194  12.505  -5.327  1.00 25.24 ? 73  SER A CB  1 
ATOM 417   O OG  . SER A 1 73  ? -8.188  11.546  -5.621  1.00 25.88 ? 73  SER A OG  1 
ATOM 418   N N   . ILE A 1 74  ? -6.222  11.020  -2.605  1.00 26.61 ? 74  ILE A N   1 
ATOM 419   C CA  . ILE A 1 74  ? -6.406  9.994   -1.599  1.00 27.75 ? 74  ILE A CA  1 
ATOM 420   C C   . ILE A 1 74  ? -7.643  10.359  -0.798  1.00 29.57 ? 74  ILE A C   1 
ATOM 421   O O   . ILE A 1 74  ? -7.638  11.315  -0.028  1.00 29.53 ? 74  ILE A O   1 
ATOM 422   C CB  . ILE A 1 74  ? -5.192  9.954   -0.681  1.00 27.48 ? 74  ILE A CB  1 
ATOM 423   C CG1 . ILE A 1 74  ? -3.937  9.703   -1.528  1.00 26.54 ? 74  ILE A CG1 1 
ATOM 424   C CG2 . ILE A 1 74  ? -5.392  8.901   0.401   1.00 27.86 ? 74  ILE A CG2 1 
ATOM 425   C CD1 . ILE A 1 74  ? -2.617  10.016  -0.821  1.00 25.31 ? 74  ILE A CD1 1 
ATOM 426   N N   . LYS A 1 75  ? -8.707  9.592   -0.978  1.00 31.43 ? 75  LYS A N   1 
ATOM 427   C CA  . LYS A 1 75  ? -9.953  9.888   -0.304  1.00 32.96 ? 75  LYS A CA  1 
ATOM 428   C C   . LYS A 1 75  ? -10.266 8.929   0.819   1.00 33.98 ? 75  LYS A C   1 
ATOM 429   O O   . LYS A 1 75  ? -10.276 7.717   0.606   1.00 34.62 ? 75  LYS A O   1 
ATOM 430   C CB  . LYS A 1 75  ? -11.087 9.864   -1.330  1.00 33.21 ? 75  LYS A CB  1 
ATOM 431   C CG  . LYS A 1 75  ? -12.446 10.211  -0.767  1.00 35.58 ? 75  LYS A CG  1 
ATOM 432   C CD  . LYS A 1 75  ? -13.488 10.304  -1.860  1.00 36.70 ? 75  LYS A CD  1 
ATOM 433   C CE  . LYS A 1 75  ? -14.798 10.830  -1.305  1.00 38.85 ? 75  LYS A CE  1 
ATOM 434   N NZ  . LYS A 1 75  ? -15.834 10.977  -2.376  1.00 40.64 ? 75  LYS A NZ  1 
ATOM 435   N N   . GLY A 1 76  ? -10.508 9.468   2.014   1.00 35.02 ? 76  GLY A N   1 
ATOM 436   C CA  . GLY A 1 76  ? -10.879 8.619   3.136   1.00 36.24 ? 76  GLY A CA  1 
ATOM 437   C C   . GLY A 1 76  ? -12.317 8.236   2.835   1.00 37.54 ? 76  GLY A C   1 
ATOM 438   O O   . GLY A 1 76  ? -13.192 9.102   2.809   1.00 38.04 ? 76  GLY A O   1 
ATOM 439   N N   . VAL A 1 77  ? -12.573 6.957   2.578   1.00 38.41 ? 77  VAL A N   1 
ATOM 440   C CA  . VAL A 1 77  ? -13.924 6.534   2.239   1.00 39.59 ? 77  VAL A CA  1 
ATOM 441   C C   . VAL A 1 77  ? -14.963 6.998   3.239   1.00 40.68 ? 77  VAL A C   1 
ATOM 442   O O   . VAL A 1 77  ? -15.904 7.691   2.867   1.00 42.12 ? 77  VAL A O   1 
ATOM 443   C CB  . VAL A 1 77  ? -14.028 5.017   2.107   1.00 39.70 ? 77  VAL A CB  1 
ATOM 444   C CG1 . VAL A 1 77  ? -15.467 4.618   1.889   1.00 38.80 ? 77  VAL A CG1 1 
ATOM 445   C CG2 . VAL A 1 77  ? -13.183 4.550   0.940   1.00 41.05 ? 77  VAL A CG2 1 
ATOM 446   N N   . SER A 1 78  ? -14.803 6.620   4.501   1.00 41.87 ? 78  SER A N   1 
ATOM 447   C CA  . SER A 1 78  ? -15.760 7.025   5.529   1.00 43.48 ? 78  SER A CA  1 
ATOM 448   C C   . SER A 1 78  ? -15.861 8.534   5.641   1.00 44.07 ? 78  SER A C   1 
ATOM 449   O O   . SER A 1 78  ? -16.914 9.107   5.391   1.00 45.00 ? 78  SER A O   1 
ATOM 450   C CB  . SER A 1 78  ? -15.375 6.450   6.890   1.00 44.33 ? 78  SER A CB  1 
ATOM 451   O OG  . SER A 1 78  ? -16.054 5.231   7.121   1.00 45.97 ? 78  SER A OG  1 
ATOM 452   N N   . ALA A 1 79  ? -14.758 9.171   6.018   1.00 45.27 ? 79  ALA A N   1 
ATOM 453   C CA  . ALA A 1 79  ? -14.714 10.621  6.172   1.00 46.34 ? 79  ALA A CA  1 
ATOM 454   C C   . ALA A 1 79  ? -15.219 11.345  4.925   1.00 47.14 ? 79  ALA A C   1 
ATOM 455   O O   . ALA A 1 79  ? -15.571 12.524  4.985   1.00 47.90 ? 79  ALA A O   1 
ATOM 456   C CB  . ALA A 1 79  ? -13.286 11.066  6.480   1.00 46.09 ? 79  ALA A CB  1 
ATOM 457   N N   . ASN A 1 80  ? -15.272 10.629  3.805   1.00 47.09 ? 80  ASN A N   1 
ATOM 458   C CA  . ASN A 1 80  ? -15.687 11.208  2.536   1.00 47.16 ? 80  ASN A CA  1 
ATOM 459   C C   . ASN A 1 80  ? -14.961 12.534  2.303   1.00 47.21 ? 80  ASN A C   1 
ATOM 460   O O   . ASN A 1 80  ? -15.536 13.505  1.819   1.00 46.85 ? 80  ASN A O   1 
ATOM 461   C CB  . ASN A 1 80  ? -17.195 11.425  2.487   1.00 47.97 ? 80  ASN A CB  1 
ATOM 462   C CG  . ASN A 1 80  ? -17.687 11.759  1.076   1.00 49.78 ? 80  ASN A CG  1 
ATOM 463   O OD1 . ASN A 1 80  ? -17.547 10.955  0.146   1.00 49.22 ? 80  ASN A OD1 1 
ATOM 464   N ND2 . ASN A 1 80  ? -18.258 12.953  0.913   1.00 49.93 ? 80  ASN A ND2 1 
ATOM 465   N N   . ARG A 1 81  ? -13.682 12.558  2.662   1.00 47.30 ? 81  ARG A N   1 
ATOM 466   C CA  . ARG A 1 81  ? -12.847 13.736  2.489   1.00 47.19 ? 81  ARG A CA  1 
ATOM 467   C C   . ARG A 1 81  ? -11.559 13.346  1.766   1.00 46.38 ? 81  ARG A C   1 
ATOM 468   O O   . ARG A 1 81  ? -11.153 12.178  1.774   1.00 45.35 ? 81  ARG A O   1 
ATOM 469   C CB  . ARG A 1 81  ? -12.498 14.332  3.842   1.00 48.58 ? 81  ARG A CB  1 
ATOM 470   C CG  . ARG A 1 81  ? -13.676 14.790  4.660   1.00 50.52 ? 81  ARG A CG  1 
ATOM 471   C CD  . ARG A 1 81  ? -13.245 14.855  6.112   1.00 53.50 ? 81  ARG A CD  1 
ATOM 472   N NE  . ARG A 1 81  ? -13.998 15.833  6.891   1.00 56.07 ? 81  ARG A NE  1 
ATOM 473   C CZ  . ARG A 1 81  ? -14.172 17.098  6.528   1.00 56.11 ? 81  ARG A CZ  1 
ATOM 474   N NH1 . ARG A 1 81  ? -13.654 17.533  5.391   1.00 57.13 ? 81  ARG A NH1 1 
ATOM 475   N NH2 . ARG A 1 81  ? -14.844 17.929  7.312   1.00 56.06 ? 81  ARG A NH2 1 
ATOM 476   N N   . TYR A 1 82  ? -10.916 14.328  1.145   1.00 45.81 ? 82  TYR A N   1 
ATOM 477   C CA  . TYR A 1 82  ? -9.677  14.082  0.415   1.00 44.91 ? 82  TYR A CA  1 
ATOM 478   C C   . TYR A 1 82  ? -8.460  14.566  1.174   1.00 43.50 ? 82  TYR A C   1 
ATOM 479   O O   . TYR A 1 82  ? -8.459  15.661  1.726   1.00 44.21 ? 82  TYR A O   1 
ATOM 480   C CB  . TYR A 1 82  ? -9.701  14.767  -0.947  1.00 46.03 ? 82  TYR A CB  1 
ATOM 481   C CG  . TYR A 1 82  ? -10.816 14.291  -1.837  1.00 48.01 ? 82  TYR A CG  1 
ATOM 482   C CD1 . TYR A 1 82  ? -12.129 14.730  -1.635  1.00 48.95 ? 82  TYR A CD1 1 
ATOM 483   C CD2 . TYR A 1 82  ? -10.566 13.404  -2.889  1.00 48.05 ? 82  TYR A CD2 1 
ATOM 484   C CE1 . TYR A 1 82  ? -13.174 14.302  -2.467  1.00 49.64 ? 82  TYR A CE1 1 
ATOM 485   C CE2 . TYR A 1 82  ? -11.604 12.966  -3.727  1.00 49.57 ? 82  TYR A CE2 1 
ATOM 486   C CZ  . TYR A 1 82  ? -12.905 13.423  -3.509  1.00 49.98 ? 82  TYR A CZ  1 
ATOM 487   O OH  . TYR A 1 82  ? -13.923 13.011  -4.336  1.00 50.81 ? 82  TYR A OH  1 
ATOM 488   N N   . LEU A 1 83  ? -7.419  13.745  1.197   1.00 42.00 ? 83  LEU A N   1 
ATOM 489   C CA  . LEU A 1 83  ? -6.195  14.112  1.881   1.00 40.10 ? 83  LEU A CA  1 
ATOM 490   C C   . LEU A 1 83  ? -5.654  15.339  1.185   1.00 39.12 ? 83  LEU A C   1 
ATOM 491   O O   . LEU A 1 83  ? -5.711  15.437  -0.039  1.00 39.32 ? 83  LEU A O   1 
ATOM 492   C CB  . LEU A 1 83  ? -5.175  12.980  1.800   1.00 41.14 ? 83  LEU A CB  1 
ATOM 493   C CG  . LEU A 1 83  ? -3.836  13.312  2.456   1.00 41.47 ? 83  LEU A CG  1 
ATOM 494   C CD1 . LEU A 1 83  ? -4.018  13.305  3.960   1.00 40.67 ? 83  LEU A CD1 1 
ATOM 495   C CD2 . LEU A 1 83  ? -2.765  12.311  2.024   1.00 41.29 ? 83  LEU A CD2 1 
ATOM 496   N N   . ALA A 1 84  ? -5.137  16.280  1.965   1.00 39.15 ? 84  ALA A N   1 
ATOM 497   C CA  . ALA A 1 84  ? -4.595  17.510  1.408   1.00 39.64 ? 84  ALA A CA  1 
ATOM 498   C C   . ALA A 1 84  ? -3.479  18.073  2.274   1.00 39.82 ? 84  ALA A C   1 
ATOM 499   O O   . ALA A 1 84  ? -3.470  17.889  3.487   1.00 40.06 ? 84  ALA A O   1 
ATOM 500   C CB  . ALA A 1 84  ? -5.700  18.531  1.249   1.00 39.30 ? 84  ALA A CB  1 
ATOM 501   N N   . MET A 1 85  ? -2.522  18.741  1.640   1.00 40.38 ? 85  MET A N   1 
ATOM 502   C CA  . MET A 1 85  ? -1.421  19.333  2.371   1.00 41.23 ? 85  MET A CA  1 
ATOM 503   C C   . MET A 1 85  ? -1.444  20.836  2.138   1.00 41.81 ? 85  MET A C   1 
ATOM 504   O O   . MET A 1 85  ? -1.248  21.308  1.017   1.00 40.75 ? 85  MET A O   1 
ATOM 505   C CB  . MET A 1 85  ? -0.081  18.761  1.916   1.00 41.22 ? 85  MET A CB  1 
ATOM 506   C CG  . MET A 1 85  ? 1.064   19.170  2.835   1.00 40.93 ? 85  MET A CG  1 
ATOM 507   S SD  . MET A 1 85  ? 2.681   18.936  2.113   1.00 40.13 ? 85  MET A SD  1 
ATOM 508   C CE  . MET A 1 85  ? 3.037   17.299  2.659   1.00 41.39 ? 85  MET A CE  1 
ATOM 509   N N   . LYS A 1 86  ? -1.682  21.580  3.218   1.00 43.37 ? 86  LYS A N   1 
ATOM 510   C CA  . LYS A 1 86  ? -1.761  23.036  3.166   1.00 44.08 ? 86  LYS A CA  1 
ATOM 511   C C   . LYS A 1 86  ? -0.406  23.734  3.029   1.00 44.74 ? 86  LYS A C   1 
ATOM 512   O O   . LYS A 1 86  ? 0.657   23.119  3.189   1.00 44.63 ? 86  LYS A O   1 
ATOM 513   C CB  . LYS A 1 86  ? -2.496  23.558  4.404   1.00 43.19 ? 86  LYS A CB  1 
ATOM 514   N N   . GLU A 1 87  ? -0.467  25.026  2.714   1.00 45.74 ? 87  GLU A N   1 
ATOM 515   C CA  . GLU A 1 87  ? 0.717   25.867  2.537   1.00 46.89 ? 87  GLU A CA  1 
ATOM 516   C C   . GLU A 1 87  ? 1.809   25.654  3.598   1.00 47.87 ? 87  GLU A C   1 
ATOM 517   O O   . GLU A 1 87  ? 2.995   25.571  3.272   1.00 48.39 ? 87  GLU A O   1 
ATOM 518   C CB  . GLU A 1 87  ? 0.297   27.346  2.526   1.00 46.18 ? 87  GLU A CB  1 
ATOM 519   N N   . ASP A 1 88  ? 1.414   25.569  4.865   1.00 48.62 ? 88  ASP A N   1 
ATOM 520   C CA  . ASP A 1 88  ? 2.388   25.392  5.936   1.00 49.63 ? 88  ASP A CA  1 
ATOM 521   C C   . ASP A 1 88  ? 2.978   23.991  6.050   1.00 49.54 ? 88  ASP A C   1 
ATOM 522   O O   . ASP A 1 88  ? 3.976   23.795  6.741   1.00 49.96 ? 88  ASP A O   1 
ATOM 523   C CB  . ASP A 1 88  ? 1.791   25.829  7.280   1.00 51.24 ? 88  ASP A CB  1 
ATOM 524   C CG  . ASP A 1 88  ? 0.439   25.205  7.556   1.00 54.09 ? 88  ASP A CG  1 
ATOM 525   O OD1 . ASP A 1 88  ? -0.186  25.589  8.570   1.00 55.96 ? 88  ASP A OD1 1 
ATOM 526   O OD2 . ASP A 1 88  ? -0.005  24.335  6.770   1.00 55.08 ? 88  ASP A OD2 1 
ATOM 527   N N   . GLY A 1 89  ? 2.381   23.022  5.362   1.00 49.33 ? 89  GLY A N   1 
ATOM 528   C CA  . GLY A 1 89  ? 2.887   21.660  5.425   1.00 48.51 ? 89  GLY A CA  1 
ATOM 529   C C   . GLY A 1 89  ? 2.008   20.764  6.278   1.00 48.30 ? 89  GLY A C   1 
ATOM 530   O O   . GLY A 1 89  ? 2.268   19.569  6.415   1.00 48.13 ? 89  GLY A O   1 
ATOM 531   N N   . ARG A 1 90  ? 0.968   21.352  6.860   1.00 47.86 ? 90  ARG A N   1 
ATOM 532   C CA  . ARG A 1 90  ? 0.030   20.619  7.699   1.00 47.91 ? 90  ARG A CA  1 
ATOM 533   C C   . ARG A 1 90  ? -0.836  19.708  6.818   1.00 48.17 ? 90  ARG A C   1 
ATOM 534   O O   . ARG A 1 90  ? -1.107  20.027  5.657   1.00 47.10 ? 90  ARG A O   1 
ATOM 535   C CB  . ARG A 1 90  ? -0.856  21.607  8.475   1.00 47.32 ? 90  ARG A CB  1 
ATOM 536   N N   . LEU A 1 91  ? -1.258  18.573  7.371   1.00 48.56 ? 91  LEU A N   1 
ATOM 537   C CA  . LEU A 1 91  ? -2.090  17.626  6.640   1.00 48.58 ? 91  LEU A CA  1 
ATOM 538   C C   . LEU A 1 91  ? -3.504  17.602  7.185   1.00 49.50 ? 91  LEU A C   1 
ATOM 539   O O   . LEU A 1 91  ? -3.706  17.529  8.400   1.00 50.21 ? 91  LEU A O   1 
ATOM 540   C CB  . LEU A 1 91  ? -1.541  16.210  6.757   1.00 48.75 ? 91  LEU A CB  1 
ATOM 541   C CG  . LEU A 1 91  ? -0.299  15.732  6.019   1.00 48.91 ? 91  LEU A CG  1 
ATOM 542   C CD1 . LEU A 1 91  ? -0.083  14.251  6.367   1.00 49.17 ? 91  LEU A CD1 1 
ATOM 543   C CD2 . LEU A 1 91  ? -0.467  15.902  4.524   1.00 48.93 ? 91  LEU A CD2 1 
ATOM 544   N N   . LEU A 1 92  ? -4.479  17.640  6.284   1.00 49.78 ? 92  LEU A N   1 
ATOM 545   C CA  . LEU A 1 92  ? -5.888  17.583  6.667   1.00 49.63 ? 92  LEU A CA  1 
ATOM 546   C C   . LEU A 1 92  ? -6.723  17.002  5.532   1.00 49.14 ? 92  LEU A C   1 
ATOM 547   O O   . LEU A 1 92  ? -6.216  16.780  4.434   1.00 49.87 ? 92  LEU A O   1 
ATOM 548   C CB  . LEU A 1 92  ? -6.393  18.976  7.050   1.00 50.22 ? 92  LEU A CB  1 
ATOM 549   C CG  . LEU A 1 92  ? -6.261  20.102  6.026   1.00 49.91 ? 92  LEU A CG  1 
ATOM 550   C CD1 . LEU A 1 92  ? -7.487  20.152  5.119   1.00 49.89 ? 92  LEU A CD1 1 
ATOM 551   C CD2 . LEU A 1 92  ? -6.109  21.408  6.780   1.00 50.23 ? 92  LEU A CD2 1 
ATOM 552   N N   . ALA A 1 93  ? -7.997  16.748  5.796   1.00 48.29 ? 93  ALA A N   1 
ATOM 553   C CA  . ALA A 1 93  ? -8.872  16.178  4.783   1.00 47.75 ? 93  ALA A CA  1 
ATOM 554   C C   . ALA A 1 93  ? -10.022 17.117  4.471   1.00 47.72 ? 93  ALA A C   1 
ATOM 555   O O   . ALA A 1 93  ? -10.829 17.420  5.347   1.00 47.54 ? 93  ALA A O   1 
ATOM 556   C CB  . ALA A 1 93  ? -9.410  14.846  5.270   1.00 48.08 ? 93  ALA A CB  1 
ATOM 557   N N   . SER A 1 94  ? -10.107 17.570  3.224   1.00 47.44 ? 94  SER A N   1 
ATOM 558   C CA  . SER A 1 94  ? -11.177 18.483  2.837   1.00 47.21 ? 94  SER A CA  1 
ATOM 559   C C   . SER A 1 94  ? -12.329 17.780  2.129   1.00 46.86 ? 94  SER A C   1 
ATOM 560   O O   . SER A 1 94  ? -12.125 16.796  1.406   1.00 46.75 ? 94  SER A O   1 
ATOM 561   C CB  . SER A 1 94  ? -10.637 19.609  1.953   1.00 47.39 ? 94  SER A CB  1 
ATOM 562   O OG  . SER A 1 94  ? -10.247 19.140  0.680   1.00 48.10 ? 94  SER A OG  1 
ATOM 563   N N   . LYS A 1 95  ? -13.542 18.287  2.347   1.00 46.09 ? 95  LYS A N   1 
ATOM 564   C CA  . LYS A 1 95  ? -14.727 17.696  1.733   1.00 45.15 ? 95  LYS A CA  1 
ATOM 565   C C   . LYS A 1 95  ? -14.693 17.920  0.226   1.00 44.06 ? 95  LYS A C   1 
ATOM 566   O O   . LYS A 1 95  ? -15.205 17.113  -0.539  1.00 43.26 ? 95  LYS A O   1 
ATOM 567   C CB  . LYS A 1 95  ? -16.014 18.295  2.316   1.00 44.05 ? 95  LYS A CB  1 
ATOM 568   N N   . SER A 1 96  ? -14.059 19.002  -0.202  1.00 43.87 ? 96  SER A N   1 
ATOM 569   C CA  . SER A 1 96  ? -13.990 19.309  -1.616  1.00 44.22 ? 96  SER A CA  1 
ATOM 570   C C   . SER A 1 96  ? -12.579 19.266  -2.188  1.00 44.46 ? 96  SER A C   1 
ATOM 571   O O   . SER A 1 96  ? -11.655 19.858  -1.627  1.00 45.62 ? 96  SER A O   1 
ATOM 572   C CB  . SER A 1 96  ? -14.601 20.681  -1.856  1.00 44.42 ? 96  SER A CB  1 
ATOM 573   O OG  . SER A 1 96  ? -14.479 21.039  -3.213  1.00 47.61 ? 96  SER A OG  1 
ATOM 574   N N   . VAL A 1 97  ? -12.424 18.575  -3.316  1.00 43.73 ? 97  VAL A N   1 
ATOM 575   C CA  . VAL A 1 97  ? -11.126 18.448  -3.984  1.00 42.26 ? 97  VAL A CA  1 
ATOM 576   C C   . VAL A 1 97  ? -10.568 19.776  -4.457  1.00 41.62 ? 97  VAL A C   1 
ATOM 577   O O   . VAL A 1 97  ? -11.228 20.520  -5.173  1.00 41.10 ? 97  VAL A O   1 
ATOM 578   C CB  . VAL A 1 97  ? -11.195 17.522  -5.217  1.00 42.01 ? 97  VAL A CB  1 
ATOM 579   C CG1 . VAL A 1 97  ? -9.923  17.662  -6.048  1.00 41.15 ? 97  VAL A CG1 1 
ATOM 580   C CG2 . VAL A 1 97  ? -11.382 16.077  -4.771  1.00 41.83 ? 97  VAL A CG2 1 
ATOM 581   N N   . THR A 1 98  ? -9.337  20.060  -4.058  1.00 42.02 ? 98  THR A N   1 
ATOM 582   C CA  . THR A 1 98  ? -8.672  21.294  -4.451  1.00 42.75 ? 98  THR A CA  1 
ATOM 583   C C   . THR A 1 98  ? -7.336  20.906  -5.080  1.00 42.79 ? 98  THR A C   1 
ATOM 584   O O   . THR A 1 98  ? -7.056  19.722  -5.249  1.00 43.69 ? 98  THR A O   1 
ATOM 585   C CB  . THR A 1 98  ? -8.447  22.221  -3.236  1.00 42.36 ? 98  THR A CB  1 
ATOM 586   O OG1 . THR A 1 98  ? -7.192  21.918  -2.615  1.00 42.59 ? 98  THR A OG1 1 
ATOM 587   C CG2 . THR A 1 98  ? -9.562  22.014  -2.218  1.00 41.52 ? 98  THR A CG2 1 
ATOM 588   N N   . ASP A 1 99  ? -6.507  21.877  -5.432  1.00 43.31 ? 99  ASP A N   1 
ATOM 589   C CA  . ASP A 1 99  ? -5.230  21.529  -6.051  1.00 44.27 ? 99  ASP A CA  1 
ATOM 590   C C   . ASP A 1 99  ? -4.162  21.087  -5.029  1.00 43.73 ? 99  ASP A C   1 
ATOM 591   O O   . ASP A 1 99  ? -3.014  20.802  -5.387  1.00 43.25 ? 99  ASP A O   1 
ATOM 592   C CB  . ASP A 1 99  ? -4.730  22.689  -6.934  1.00 45.66 ? 99  ASP A CB  1 
ATOM 593   C CG  . ASP A 1 99  ? -4.369  23.930  -6.132  1.00 47.86 ? 99  ASP A CG  1 
ATOM 594   O OD1 . ASP A 1 99  ? -4.987  24.167  -5.062  1.00 49.41 ? 99  ASP A OD1 1 
ATOM 595   O OD2 . ASP A 1 99  ? -3.470  24.675  -6.587  1.00 48.28 ? 99  ASP A OD2 1 
ATOM 596   N N   . GLU A 1 100 ? -4.559  21.008  -3.761  1.00 42.84 ? 100 GLU A N   1 
ATOM 597   C CA  . GLU A 1 100 ? -3.656  20.581  -2.701  1.00 42.38 ? 100 GLU A CA  1 
ATOM 598   C C   . GLU A 1 100 ? -3.996  19.152  -2.302  1.00 41.21 ? 100 GLU A C   1 
ATOM 599   O O   . GLU A 1 100 ? -3.499  18.650  -1.293  1.00 41.01 ? 100 GLU A O   1 
ATOM 600   C CB  . GLU A 1 100 ? -3.780  21.503  -1.477  1.00 43.50 ? 100 GLU A CB  1 
ATOM 601   C CG  . GLU A 1 100 ? -3.408  22.970  -1.740  1.00 45.69 ? 100 GLU A CG  1 
ATOM 602   C CD  . GLU A 1 100 ? -3.481  23.855  -0.485  1.00 46.74 ? 100 GLU A CD  1 
ATOM 603   O OE1 . GLU A 1 100 ? -4.508  23.811  0.234   1.00 47.10 ? 100 GLU A OE1 1 
ATOM 604   O OE2 . GLU A 1 100 ? -2.515  24.607  -0.223  1.00 46.39 ? 100 GLU A OE2 1 
ATOM 605   N N   . CYS A 1 101 ? -4.846  18.508  -3.097  1.00 39.99 ? 101 CYS A N   1 
ATOM 606   C CA  . CYS A 1 101 ? -5.265  17.129  -2.843  1.00 39.25 ? 101 CYS A CA  1 
ATOM 607   C C   . CYS A 1 101 ? -4.626  16.131  -3.809  1.00 38.16 ? 101 CYS A C   1 
ATOM 608   O O   . CYS A 1 101 ? -5.084  14.987  -3.924  1.00 37.37 ? 101 CYS A O   1 
ATOM 609   C CB  . CYS A 1 101 ? -6.781  17.030  -2.953  1.00 39.97 ? 101 CYS A CB  1 
ATOM 610   S SG  . CYS A 1 101 ? -7.642  18.049  -1.766  1.00 41.61 ? 101 CYS A SG  1 
ATOM 611   N N   . PHE A 1 102 ? -3.571  16.570  -4.492  1.00 36.52 ? 102 PHE A N   1 
ATOM 612   C CA  . PHE A 1 102 ? -2.875  15.738  -5.459  1.00 35.76 ? 102 PHE A CA  1 
ATOM 613   C C   . PHE A 1 102 ? -1.420  15.473  -5.073  1.00 35.13 ? 102 PHE A C   1 
ATOM 614   O O   . PHE A 1 102 ? -0.682  16.393  -4.692  1.00 36.04 ? 102 PHE A O   1 
ATOM 615   C CB  . PHE A 1 102 ? -2.982  16.394  -6.831  1.00 35.49 ? 102 PHE A CB  1 
ATOM 616   C CG  . PHE A 1 102 ? -4.392  16.481  -7.322  1.00 36.56 ? 102 PHE A CG  1 
ATOM 617   C CD1 . PHE A 1 102 ? -5.080  15.327  -7.692  1.00 36.02 ? 102 PHE A CD1 1 
ATOM 618   C CD2 . PHE A 1 102 ? -5.065  17.700  -7.339  1.00 36.47 ? 102 PHE A CD2 1 
ATOM 619   C CE1 . PHE A 1 102 ? -6.411  15.385  -8.065  1.00 36.14 ? 102 PHE A CE1 1 
ATOM 620   C CE2 . PHE A 1 102 ? -6.400  17.764  -7.711  1.00 35.46 ? 102 PHE A CE2 1 
ATOM 621   C CZ  . PHE A 1 102 ? -7.072  16.606  -8.072  1.00 35.94 ? 102 PHE A CZ  1 
ATOM 622   N N   . PHE A 1 103 ? -1.018  14.206  -5.175  1.00 32.37 ? 103 PHE A N   1 
ATOM 623   C CA  . PHE A 1 103 ? 0.332   13.804  -4.803  1.00 31.76 ? 103 PHE A CA  1 
ATOM 624   C C   . PHE A 1 103 ? 0.979   12.894  -5.828  1.00 31.33 ? 103 PHE A C   1 
ATOM 625   O O   . PHE A 1 103 ? 0.304   12.039  -6.414  1.00 32.42 ? 103 PHE A O   1 
ATOM 626   C CB  . PHE A 1 103 ? 0.274   13.074  -3.471  1.00 31.29 ? 103 PHE A CB  1 
ATOM 627   C CG  . PHE A 1 103 ? -0.540  13.785  -2.438  1.00 31.51 ? 103 PHE A CG  1 
ATOM 628   C CD1 . PHE A 1 103 ? 0.027   14.778  -1.646  1.00 31.62 ? 103 PHE A CD1 1 
ATOM 629   C CD2 . PHE A 1 103 ? -1.888  13.483  -2.275  1.00 29.86 ? 103 PHE A CD2 1 
ATOM 630   C CE1 . PHE A 1 103 ? -0.742  15.459  -0.706  1.00 31.50 ? 103 PHE A CE1 1 
ATOM 631   C CE2 . PHE A 1 103 ? -2.659  14.157  -1.343  1.00 29.78 ? 103 PHE A CE2 1 
ATOM 632   C CZ  . PHE A 1 103 ? -2.092  15.146  -0.556  1.00 30.11 ? 103 PHE A CZ  1 
ATOM 633   N N   . PHE A 1 104 ? 2.275   13.076  -6.066  1.00 29.58 ? 104 PHE A N   1 
ATOM 634   C CA  . PHE A 1 104 ? 2.956   12.185  -6.996  1.00 29.67 ? 104 PHE A CA  1 
ATOM 635   C C   . PHE A 1 104 ? 3.141   10.873  -6.245  1.00 29.39 ? 104 PHE A C   1 
ATOM 636   O O   . PHE A 1 104 ? 3.695   10.851  -5.145  1.00 27.31 ? 104 PHE A O   1 
ATOM 637   C CB  . PHE A 1 104 ? 4.340   12.700  -7.403  1.00 28.23 ? 104 PHE A CB  1 
ATOM 638   C CG  . PHE A 1 104 ? 4.317   13.926  -8.269  1.00 27.45 ? 104 PHE A CG  1 
ATOM 639   C CD1 . PHE A 1 104 ? 4.593   15.180  -7.724  1.00 28.17 ? 104 PHE A CD1 1 
ATOM 640   C CD2 . PHE A 1 104 ? 4.055   13.833  -9.632  1.00 26.77 ? 104 PHE A CD2 1 
ATOM 641   C CE1 . PHE A 1 104 ? 4.616   16.321  -8.520  1.00 26.58 ? 104 PHE A CE1 1 
ATOM 642   C CE2 . PHE A 1 104 ? 4.074   14.974  -10.442 1.00 25.93 ? 104 PHE A CE2 1 
ATOM 643   C CZ  . PHE A 1 104 ? 4.355   16.213  -9.884  1.00 26.28 ? 104 PHE A CZ  1 
ATOM 644   N N   . GLU A 1 105 ? 2.642   9.787   -6.824  1.00 30.99 ? 105 GLU A N   1 
ATOM 645   C CA  . GLU A 1 105 ? 2.796   8.483   -6.206  1.00 32.50 ? 105 GLU A CA  1 
ATOM 646   C C   . GLU A 1 105 ? 4.016   7.849   -6.839  1.00 32.81 ? 105 GLU A C   1 
ATOM 647   O O   . GLU A 1 105 ? 4.122   7.768   -8.057  1.00 33.17 ? 105 GLU A O   1 
ATOM 648   C CB  . GLU A 1 105 ? 1.572   7.599   -6.446  1.00 33.01 ? 105 GLU A CB  1 
ATOM 649   C CG  . GLU A 1 105 ? 1.737   6.175   -5.892  1.00 34.02 ? 105 GLU A CG  1 
ATOM 650   C CD  . GLU A 1 105 ? 0.457   5.359   -5.974  1.00 35.18 ? 105 GLU A CD  1 
ATOM 651   O OE1 . GLU A 1 105 ? -0.067  5.187   -7.088  1.00 37.57 ? 105 GLU A OE1 1 
ATOM 652   O OE2 . GLU A 1 105 ? -0.039  4.887   -4.932  1.00 35.51 ? 105 GLU A OE2 1 
ATOM 653   N N   . ARG A 1 106 ? 4.941   7.407   -6.007  1.00 33.55 ? 106 ARG A N   1 
ATOM 654   C CA  . ARG A 1 106 ? 6.146   6.792   -6.509  1.00 34.79 ? 106 ARG A CA  1 
ATOM 655   C C   . ARG A 1 106 ? 6.433   5.498   -5.755  1.00 34.26 ? 106 ARG A C   1 
ATOM 656   O O   . ARG A 1 106 ? 6.322   5.436   -4.531  1.00 33.75 ? 106 ARG A O   1 
ATOM 657   C CB  . ARG A 1 106 ? 7.323   7.766   -6.351  1.00 36.66 ? 106 ARG A CB  1 
ATOM 658   C CG  . ARG A 1 106 ? 8.651   7.263   -6.901  1.00 38.88 ? 106 ARG A CG  1 
ATOM 659   C CD  . ARG A 1 106 ? 8.774   7.499   -8.412  1.00 40.34 ? 106 ARG A CD  1 
ATOM 660   N NE  . ARG A 1 106 ? 9.620   8.658   -8.709  1.00 41.91 ? 106 ARG A NE  1 
ATOM 661   C CZ  . ARG A 1 106 ? 10.858  8.829   -8.245  1.00 41.70 ? 106 ARG A CZ  1 
ATOM 662   N NH1 . ARG A 1 106 ? 11.409  7.917   -7.451  1.00 42.99 ? 106 ARG A NH1 1 
ATOM 663   N NH2 . ARG A 1 106 ? 11.553  9.908   -8.581  1.00 40.97 ? 106 ARG A NH2 1 
ATOM 664   N N   . LEU A 1 107 ? 6.765   4.459   -6.510  1.00 34.80 ? 107 LEU A N   1 
ATOM 665   C CA  . LEU A 1 107 ? 7.135   3.177   -5.930  1.00 35.12 ? 107 LEU A CA  1 
ATOM 666   C C   . LEU A 1 107 ? 8.653   3.221   -5.905  1.00 34.89 ? 107 LEU A C   1 
ATOM 667   O O   . LEU A 1 107 ? 9.306   3.052   -6.931  1.00 34.55 ? 107 LEU A O   1 
ATOM 668   C CB  . LEU A 1 107 ? 6.650   2.005   -6.791  1.00 36.29 ? 107 LEU A CB  1 
ATOM 669   C CG  . LEU A 1 107 ? 7.312   0.653   -6.476  1.00 37.70 ? 107 LEU A CG  1 
ATOM 670   C CD1 . LEU A 1 107 ? 7.440   0.461   -4.967  1.00 39.35 ? 107 LEU A CD1 1 
ATOM 671   C CD2 . LEU A 1 107 ? 6.509   -0.471  -7.091  1.00 38.03 ? 107 LEU A CD2 1 
ATOM 672   N N   . GLU A 1 108 ? 9.202   3.476   -4.725  1.00 35.00 ? 108 GLU A N   1 
ATOM 673   C CA  . GLU A 1 108 ? 10.641  3.578   -4.545  1.00 35.15 ? 108 GLU A CA  1 
ATOM 674   C C   . GLU A 1 108 ? 11.355  2.263   -4.786  1.00 35.30 ? 108 GLU A C   1 
ATOM 675   O O   . GLU A 1 108 ? 10.729  1.204   -4.817  1.00 35.63 ? 108 GLU A O   1 
ATOM 676   C CB  . GLU A 1 108 ? 10.932  4.069   -3.131  1.00 35.01 ? 108 GLU A CB  1 
ATOM 677   C CG  . GLU A 1 108 ? 10.168  5.331   -2.777  1.00 35.37 ? 108 GLU A CG  1 
ATOM 678   C CD  . GLU A 1 108 ? 10.511  6.492   -3.687  1.00 35.16 ? 108 GLU A CD  1 
ATOM 679   O OE1 . GLU A 1 108 ? 9.774   7.489   -3.684  1.00 36.76 ? 108 GLU A OE1 1 
ATOM 680   O OE2 . GLU A 1 108 ? 11.523  6.418   -4.405  1.00 36.84 ? 108 GLU A OE2 1 
ATOM 681   N N   . SER A 1 109 ? 12.675  2.342   -4.940  1.00 35.69 ? 109 SER A N   1 
ATOM 682   C CA  . SER A 1 109 ? 13.515  1.170   -5.178  1.00 35.01 ? 109 SER A CA  1 
ATOM 683   C C   . SER A 1 109 ? 13.432  0.178   -4.022  1.00 34.42 ? 109 SER A C   1 
ATOM 684   O O   . SER A 1 109 ? 13.747  -1.003  -4.193  1.00 34.10 ? 109 SER A O   1 
ATOM 685   C CB  . SER A 1 109 ? 14.967  1.594   -5.354  1.00 35.15 ? 109 SER A CB  1 
ATOM 686   O OG  . SER A 1 109 ? 15.485  2.062   -4.116  1.00 36.99 ? 109 SER A OG  1 
ATOM 687   N N   . ASN A 1 110 ? 13.030  0.662   -2.845  1.00 33.27 ? 110 ASN A N   1 
ATOM 688   C CA  . ASN A 1 110 ? 12.898  -0.195  -1.670  1.00 32.28 ? 110 ASN A CA  1 
ATOM 689   C C   . ASN A 1 110 ? 11.519  -0.865  -1.593  1.00 31.96 ? 110 ASN A C   1 
ATOM 690   O O   . ASN A 1 110 ? 11.210  -1.570  -0.628  1.00 32.23 ? 110 ASN A O   1 
ATOM 691   C CB  . ASN A 1 110 ? 13.154  0.601   -0.395  1.00 32.43 ? 110 ASN A CB  1 
ATOM 692   C CG  . ASN A 1 110 ? 12.227  1.787   -0.254  1.00 35.42 ? 110 ASN A CG  1 
ATOM 693   O OD1 . ASN A 1 110 ? 11.195  1.878   -0.932  1.00 35.22 ? 110 ASN A OD1 1 
ATOM 694   N ND2 . ASN A 1 110 ? 12.582  2.706   0.644   1.00 36.78 ? 110 ASN A ND2 1 
ATOM 695   N N   . ASN A 1 111 ? 10.703  -0.637  -2.619  1.00 30.84 ? 111 ASN A N   1 
ATOM 696   C CA  . ASN A 1 111 ? 9.370   -1.211  -2.721  1.00 29.36 ? 111 ASN A CA  1 
ATOM 697   C C   . ASN A 1 111 ? 8.308   -0.632  -1.799  1.00 28.91 ? 111 ASN A C   1 
ATOM 698   O O   . ASN A 1 111 ? 7.342   -1.322  -1.467  1.00 29.23 ? 111 ASN A O   1 
ATOM 699   C CB  . ASN A 1 111 ? 9.416   -2.732  -2.531  1.00 28.03 ? 111 ASN A CB  1 
ATOM 700   C CG  . ASN A 1 111 ? 9.959   -3.453  -3.742  1.00 26.55 ? 111 ASN A CG  1 
ATOM 701   O OD1 . ASN A 1 111 ? 9.772   -3.022  -4.879  1.00 23.27 ? 111 ASN A OD1 1 
ATOM 702   N ND2 . ASN A 1 111 ? 10.614  -4.572  -3.506  1.00 26.94 ? 111 ASN A ND2 1 
ATOM 703   N N   . TYR A 1 112 ? 8.494   0.614   -1.373  1.00 27.20 ? 112 TYR A N   1 
ATOM 704   C CA  . TYR A 1 112 ? 7.499   1.291   -0.554  1.00 26.19 ? 112 TYR A CA  1 
ATOM 705   C C   . TYR A 1 112 ? 7.043   2.418   -1.452  1.00 25.92 ? 112 TYR A C   1 
ATOM 706   O O   . TYR A 1 112 ? 7.720   2.717   -2.441  1.00 26.04 ? 112 TYR A O   1 
ATOM 707   C CB  . TYR A 1 112 ? 8.109   1.885   0.712   1.00 25.18 ? 112 TYR A CB  1 
ATOM 708   C CG  . TYR A 1 112 ? 8.348   0.903   1.835   1.00 24.57 ? 112 TYR A CG  1 
ATOM 709   C CD1 . TYR A 1 112 ? 7.362   0.636   2.793   1.00 22.89 ? 112 TYR A CD1 1 
ATOM 710   C CD2 . TYR A 1 112 ? 9.566   0.234   1.941   1.00 24.26 ? 112 TYR A CD2 1 
ATOM 711   C CE1 . TYR A 1 112 ? 7.597   -0.281  3.829   1.00 22.54 ? 112 TYR A CE1 1 
ATOM 712   C CE2 . TYR A 1 112 ? 9.808   -0.674  2.961   1.00 21.59 ? 112 TYR A CE2 1 
ATOM 713   C CZ  . TYR A 1 112 ? 8.832   -0.928  3.894   1.00 21.96 ? 112 TYR A CZ  1 
ATOM 714   O OH  . TYR A 1 112 ? 9.112   -1.842  4.880   1.00 23.64 ? 112 TYR A OH  1 
ATOM 715   N N   . ASN A 1 113 ? 5.907   3.032   -1.132  1.00 25.42 ? 113 ASN A N   1 
ATOM 716   C CA  . ASN A 1 113 ? 5.417   4.150   -1.930  1.00 25.52 ? 113 ASN A CA  1 
ATOM 717   C C   . ASN A 1 113 ? 5.629   5.459   -1.180  1.00 26.29 ? 113 ASN A C   1 
ATOM 718   O O   . ASN A 1 113 ? 5.693   5.477   0.047   1.00 26.29 ? 113 ASN A O   1 
ATOM 719   C CB  . ASN A 1 113 ? 3.926   3.999   -2.233  1.00 24.94 ? 113 ASN A CB  1 
ATOM 720   C CG  . ASN A 1 113 ? 3.624   2.871   -3.203  1.00 24.61 ? 113 ASN A CG  1 
ATOM 721   O OD1 . ASN A 1 113 ? 4.509   2.133   -3.623  1.00 25.20 ? 113 ASN A OD1 1 
ATOM 722   N ND2 . ASN A 1 113 ? 2.353   2.726   -3.550  1.00 25.01 ? 113 ASN A ND2 1 
ATOM 723   N N   . THR A 1 114 ? 5.774   6.552   -1.920  1.00 26.93 ? 114 THR A N   1 
ATOM 724   C CA  . THR A 1 114 ? 5.900   7.865   -1.297  1.00 27.91 ? 114 THR A CA  1 
ATOM 725   C C   . THR A 1 114 ? 4.870   8.743   -1.986  1.00 28.50 ? 114 THR A C   1 
ATOM 726   O O   . THR A 1 114 ? 4.554   8.546   -3.161  1.00 27.86 ? 114 THR A O   1 
ATOM 727   C CB  . THR A 1 114 ? 7.277   8.537   -1.507  1.00 27.86 ? 114 THR A CB  1 
ATOM 728   O OG1 . THR A 1 114 ? 7.479   8.779   -2.908  1.00 27.80 ? 114 THR A OG1 1 
ATOM 729   C CG2 . THR A 1 114 ? 8.388   7.686   -0.923  1.00 26.65 ? 114 THR A CG2 1 
ATOM 730   N N   . TYR A 1 115 ? 4.347   9.712   -1.248  1.00 29.58 ? 115 TYR A N   1 
ATOM 731   C CA  . TYR A 1 115 ? 3.365   10.621  -1.802  1.00 29.61 ? 115 TYR A CA  1 
ATOM 732   C C   . TYR A 1 115 ? 3.860   12.040  -1.602  1.00 31.12 ? 115 TYR A C   1 
ATOM 733   O O   . TYR A 1 115 ? 3.811   12.592  -0.505  1.00 31.19 ? 115 TYR A O   1 
ATOM 734   C CB  . TYR A 1 115 ? 2.009   10.383  -1.135  1.00 27.97 ? 115 TYR A CB  1 
ATOM 735   C CG  . TYR A 1 115 ? 1.468   9.016   -1.462  1.00 26.16 ? 115 TYR A CG  1 
ATOM 736   C CD1 . TYR A 1 115 ? 0.776   8.776   -2.655  1.00 26.44 ? 115 TYR A CD1 1 
ATOM 737   C CD2 . TYR A 1 115 ? 1.773   7.927   -0.649  1.00 26.91 ? 115 TYR A CD2 1 
ATOM 738   C CE1 . TYR A 1 115 ? 0.414   7.473   -3.037  1.00 27.10 ? 115 TYR A CE1 1 
ATOM 739   C CE2 . TYR A 1 115 ? 1.426   6.621   -1.013  1.00 26.99 ? 115 TYR A CE2 1 
ATOM 740   C CZ  . TYR A 1 115 ? 0.753   6.394   -2.205  1.00 28.20 ? 115 TYR A CZ  1 
ATOM 741   O OH  . TYR A 1 115 ? 0.476   5.088   -2.571  1.00 27.54 ? 115 TYR A OH  1 
ATOM 742   N N   . ARG A 1 116 ? 4.358   12.608  -2.691  1.00 32.43 ? 116 ARG A N   1 
ATOM 743   C CA  . ARG A 1 116 ? 4.901   13.955  -2.706  1.00 33.74 ? 116 ARG A CA  1 
ATOM 744   C C   . ARG A 1 116 ? 3.860   14.934  -3.252  1.00 34.30 ? 116 ARG A C   1 
ATOM 745   O O   . ARG A 1 116 ? 3.314   14.728  -4.339  1.00 34.17 ? 116 ARG A O   1 
ATOM 746   C CB  . ARG A 1 116 ? 6.159   13.953  -3.584  1.00 33.64 ? 116 ARG A CB  1 
ATOM 747   C CG  . ARG A 1 116 ? 7.021   15.207  -3.562  1.00 32.31 ? 116 ARG A CG  1 
ATOM 748   C CD  . ARG A 1 116 ? 8.355   14.891  -4.233  1.00 31.15 ? 116 ARG A CD  1 
ATOM 749   N NE  . ARG A 1 116 ? 8.194   14.510  -5.638  1.00 29.47 ? 116 ARG A NE  1 
ATOM 750   C CZ  . ARG A 1 116 ? 7.933   15.377  -6.608  1.00 29.03 ? 116 ARG A CZ  1 
ATOM 751   N NH1 . ARG A 1 116 ? 7.812   16.669  -6.310  1.00 29.12 ? 116 ARG A NH1 1 
ATOM 752   N NH2 . ARG A 1 116 ? 7.786   14.963  -7.865  1.00 26.86 ? 116 ARG A NH2 1 
ATOM 753   N N   . SER A 1 117 ? 3.583   15.989  -2.488  1.00 35.09 ? 117 SER A N   1 
ATOM 754   C CA  . SER A 1 117 ? 2.616   17.007  -2.899  1.00 34.74 ? 117 SER A CA  1 
ATOM 755   C C   . SER A 1 117 ? 2.936   17.559  -4.266  1.00 35.21 ? 117 SER A C   1 
ATOM 756   O O   . SER A 1 117 ? 4.086   17.905  -4.533  1.00 34.53 ? 117 SER A O   1 
ATOM 757   C CB  . SER A 1 117 ? 2.608   18.181  -1.931  1.00 34.13 ? 117 SER A CB  1 
ATOM 758   O OG  . SER A 1 117 ? 1.918   19.275  -2.518  1.00 34.03 ? 117 SER A OG  1 
ATOM 759   N N   . ARG A 1 118 ? 1.925   17.658  -5.128  1.00 36.39 ? 118 ARG A N   1 
ATOM 760   C CA  . ARG A 1 118 ? 2.163   18.201  -6.457  1.00 38.18 ? 118 ARG A CA  1 
ATOM 761   C C   . ARG A 1 118 ? 2.231   19.711  -6.398  1.00 38.73 ? 118 ARG A C   1 
ATOM 762   O O   . ARG A 1 118 ? 2.871   20.337  -7.233  1.00 38.72 ? 118 ARG A O   1 
ATOM 763   C CB  . ARG A 1 118 ? 1.083   17.792  -7.455  1.00 38.23 ? 118 ARG A CB  1 
ATOM 764   C CG  . ARG A 1 118 ? 1.413   18.268  -8.873  1.00 37.05 ? 118 ARG A CG  1 
ATOM 765   C CD  . ARG A 1 118 ? 0.485   17.683  -9.913  1.00 37.54 ? 118 ARG A CD  1 
ATOM 766   N NE  . ARG A 1 118 ? -0.901  18.079  -9.689  1.00 39.95 ? 118 ARG A NE  1 
ATOM 767   C CZ  . ARG A 1 118 ? -1.898  17.802  -10.527 1.00 41.01 ? 118 ARG A CZ  1 
ATOM 768   N NH1 . ARG A 1 118 ? -1.647  17.130  -11.644 1.00 40.30 ? 118 ARG A NH1 1 
ATOM 769   N NH2 . ARG A 1 118 ? -3.140  18.211  -10.261 1.00 40.49 ? 118 ARG A NH2 1 
ATOM 770   N N   . LYS A 1 119 ? 1.574   20.294  -5.406  1.00 40.24 ? 119 LYS A N   1 
ATOM 771   C CA  . LYS A 1 119 ? 1.575   21.744  -5.236  1.00 42.71 ? 119 LYS A CA  1 
ATOM 772   C C   . LYS A 1 119 ? 2.899   22.180  -4.576  1.00 43.05 ? 119 LYS A C   1 
ATOM 773   O O   . LYS A 1 119 ? 3.639   23.002  -5.117  1.00 43.63 ? 119 LYS A O   1 
ATOM 774   C CB  . LYS A 1 119 ? 0.380   22.151  -4.368  1.00 43.69 ? 119 LYS A CB  1 
ATOM 775   C CG  . LYS A 1 119 ? 0.195   23.644  -4.186  1.00 45.36 ? 119 LYS A CG  1 
ATOM 776   C CD  . LYS A 1 119 ? -0.613  24.264  -5.314  1.00 46.53 ? 119 LYS A CD  1 
ATOM 777   C CE  . LYS A 1 119 ? -0.727  25.765  -5.106  1.00 47.04 ? 119 LYS A CE  1 
ATOM 778   N NZ  . LYS A 1 119 ? -0.979  26.059  -3.661  1.00 48.09 ? 119 LYS A NZ  1 
ATOM 779   N N   . TYR A 1 120 ? 3.185   21.615  -3.409  1.00 43.25 ? 120 TYR A N   1 
ATOM 780   C CA  . TYR A 1 120 ? 4.413   21.898  -2.672  1.00 43.33 ? 120 TYR A CA  1 
ATOM 781   C C   . TYR A 1 120 ? 5.339   20.717  -2.945  1.00 43.23 ? 120 TYR A C   1 
ATOM 782   O O   . TYR A 1 120 ? 5.439   19.786  -2.143  1.00 43.61 ? 120 TYR A O   1 
ATOM 783   C CB  . TYR A 1 120 ? 4.073   21.995  -1.196  1.00 44.45 ? 120 TYR A CB  1 
ATOM 784   C CG  . TYR A 1 120 ? 2.912   22.924  -0.980  1.00 45.83 ? 120 TYR A CG  1 
ATOM 785   C CD1 . TYR A 1 120 ? 3.030   24.279  -1.272  1.00 45.63 ? 120 TYR A CD1 1 
ATOM 786   C CD2 . TYR A 1 120 ? 1.676   22.444  -0.537  1.00 46.21 ? 120 TYR A CD2 1 
ATOM 787   C CE1 . TYR A 1 120 ? 1.956   25.138  -1.134  1.00 47.21 ? 120 TYR A CE1 1 
ATOM 788   C CE2 . TYR A 1 120 ? 0.584   23.299  -0.397  1.00 47.35 ? 120 TYR A CE2 1 
ATOM 789   C CZ  . TYR A 1 120 ? 0.735   24.646  -0.700  1.00 47.46 ? 120 TYR A CZ  1 
ATOM 790   O OH  . TYR A 1 120 ? -0.331  25.505  -0.593  1.00 48.01 ? 120 TYR A OH  1 
ATOM 791   N N   . THR A 1 121 ? 6.009   20.790  -4.091  1.00 42.62 ? 121 THR A N   1 
ATOM 792   C CA  . THR A 1 121 ? 6.898   19.761  -4.619  1.00 42.43 ? 121 THR A CA  1 
ATOM 793   C C   . THR A 1 121 ? 8.036   19.145  -3.808  1.00 42.57 ? 121 THR A C   1 
ATOM 794   O O   . THR A 1 121 ? 8.711   18.242  -4.297  1.00 43.54 ? 121 THR A O   1 
ATOM 795   C CB  . THR A 1 121 ? 7.522   20.242  -5.912  1.00 42.05 ? 121 THR A CB  1 
ATOM 796   O OG1 . THR A 1 121 ? 8.532   21.205  -5.603  1.00 43.56 ? 121 THR A OG1 1 
ATOM 797   C CG2 . THR A 1 121 ? 6.470   20.892  -6.789  1.00 41.68 ? 121 THR A CG2 1 
ATOM 798   N N   . SER A 1 122 ? 8.281   19.601  -2.594  1.00 42.21 ? 122 SER A N   1 
ATOM 799   C CA  . SER A 1 122 ? 9.369   19.000  -1.833  1.00 42.01 ? 122 SER A CA  1 
ATOM 800   C C   . SER A 1 122 ? 8.836   18.375  -0.566  1.00 42.17 ? 122 SER A C   1 
ATOM 801   O O   . SER A 1 122 ? 9.586   17.799  0.219   1.00 42.78 ? 122 SER A O   1 
ATOM 802   C CB  . SER A 1 122 ? 10.412  20.054  -1.464  1.00 42.69 ? 122 SER A CB  1 
ATOM 803   O OG  . SER A 1 122 ? 9.893   20.931  -0.481  1.00 44.94 ? 122 SER A OG  1 
ATOM 804   N N   . TRP A 1 123 ? 7.532   18.496  -0.357  1.00 42.10 ? 123 TRP A N   1 
ATOM 805   C CA  . TRP A 1 123 ? 6.925   17.948  0.837   1.00 41.56 ? 123 TRP A CA  1 
ATOM 806   C C   . TRP A 1 123 ? 6.237   16.615  0.591   1.00 39.91 ? 123 TRP A C   1 
ATOM 807   O O   . TRP A 1 123 ? 5.561   16.417  -0.420  1.00 39.40 ? 123 TRP A O   1 
ATOM 808   C CB  . TRP A 1 123 ? 5.972   18.984  1.428   1.00 44.67 ? 123 TRP A CB  1 
ATOM 809   C CG  . TRP A 1 123 ? 6.697   20.268  1.789   1.00 48.55 ? 123 TRP A CG  1 
ATOM 810   C CD1 . TRP A 1 123 ? 8.054   20.478  1.767   1.00 48.94 ? 123 TRP A CD1 1 
ATOM 811   C CD2 . TRP A 1 123 ? 6.116   21.485  2.276   1.00 49.41 ? 123 TRP A CD2 1 
ATOM 812   N NE1 . TRP A 1 123 ? 8.346   21.741  2.212   1.00 49.52 ? 123 TRP A NE1 1 
ATOM 813   C CE2 . TRP A 1 123 ? 7.177   22.382  2.531   1.00 50.19 ? 123 TRP A CE2 1 
ATOM 814   C CE3 . TRP A 1 123 ? 4.803   21.904  2.524   1.00 50.52 ? 123 TRP A CE3 1 
ATOM 815   C CZ2 . TRP A 1 123 ? 6.965   23.673  3.023   1.00 50.50 ? 123 TRP A CZ2 1 
ATOM 816   C CZ3 . TRP A 1 123 ? 4.592   23.191  3.017   1.00 51.38 ? 123 TRP A CZ3 1 
ATOM 817   C CH2 . TRP A 1 123 ? 5.671   24.059  3.259   1.00 51.58 ? 123 TRP A CH2 1 
ATOM 818   N N   . TYR A 1 124 ? 6.442   15.698  1.531   1.00 37.21 ? 124 TYR A N   1 
ATOM 819   C CA  . TYR A 1 124 ? 5.888   14.360  1.466   1.00 34.72 ? 124 TYR A CA  1 
ATOM 820   C C   . TYR A 1 124 ? 4.826   14.114  2.525   1.00 33.46 ? 124 TYR A C   1 
ATOM 821   O O   . TYR A 1 124 ? 4.859   14.704  3.597   1.00 33.95 ? 124 TYR A O   1 
ATOM 822   C CB  . TYR A 1 124 ? 7.000   13.319  1.667   1.00 35.14 ? 124 TYR A CB  1 
ATOM 823   C CG  . TYR A 1 124 ? 7.969   13.172  0.513   1.00 35.14 ? 124 TYR A CG  1 
ATOM 824   C CD1 . TYR A 1 124 ? 9.120   13.968  0.418   1.00 34.71 ? 124 TYR A CD1 1 
ATOM 825   C CD2 . TYR A 1 124 ? 7.713   12.256  -0.509  1.00 35.48 ? 124 TYR A CD2 1 
ATOM 826   C CE1 . TYR A 1 124 ? 9.990   13.851  -0.677  1.00 34.55 ? 124 TYR A CE1 1 
ATOM 827   C CE2 . TYR A 1 124 ? 8.566   12.134  -1.601  1.00 36.01 ? 124 TYR A CE2 1 
ATOM 828   C CZ  . TYR A 1 124 ? 9.703   12.930  -1.683  1.00 35.82 ? 124 TYR A CZ  1 
ATOM 829   O OH  . TYR A 1 124 ? 10.535  12.772  -2.769  1.00 35.52 ? 124 TYR A OH  1 
ATOM 830   N N   . VAL A 1 125 ? 3.879   13.239  2.208   1.00 31.59 ? 125 VAL A N   1 
ATOM 831   C CA  . VAL A 1 125 ? 2.845   12.852  3.153   1.00 29.61 ? 125 VAL A CA  1 
ATOM 832   C C   . VAL A 1 125 ? 3.646   11.936  4.080   1.00 30.28 ? 125 VAL A C   1 
ATOM 833   O O   . VAL A 1 125 ? 4.413   11.095  3.608   1.00 29.67 ? 125 VAL A O   1 
ATOM 834   C CB  . VAL A 1 125 ? 1.727   12.035  2.455   1.00 28.40 ? 125 VAL A CB  1 
ATOM 835   C CG1 . VAL A 1 125 ? 0.716   11.562  3.473   1.00 25.95 ? 125 VAL A CG1 1 
ATOM 836   C CG2 . VAL A 1 125 ? 1.065   12.871  1.358   1.00 26.34 ? 125 VAL A CG2 1 
ATOM 837   N N   . ALA A 1 126 ? 3.503   12.098  5.389   1.00 30.92 ? 126 ALA A N   1 
ATOM 838   C CA  . ALA A 1 126 ? 4.274   11.277  6.303   1.00 31.10 ? 126 ALA A CA  1 
ATOM 839   C C   . ALA A 1 126 ? 3.666   11.241  7.683   1.00 32.74 ? 126 ALA A C   1 
ATOM 840   O O   . ALA A 1 126 ? 2.756   12.003  7.989   1.00 32.64 ? 126 ALA A O   1 
ATOM 841   C CB  . ALA A 1 126 ? 5.694   11.792  6.381   1.00 31.04 ? 126 ALA A CB  1 
ATOM 842   N N   . LEU A 1 127 ? 4.182   10.342  8.515   1.00 35.05 ? 127 LEU A N   1 
ATOM 843   C CA  . LEU A 1 127 ? 3.695   10.187  9.876   1.00 37.09 ? 127 LEU A CA  1 
ATOM 844   C C   . LEU A 1 127 ? 4.851   10.140  10.866  1.00 38.65 ? 127 LEU A C   1 
ATOM 845   O O   . LEU A 1 127 ? 5.859   9.477   10.615  1.00 40.13 ? 127 LEU A O   1 
ATOM 846   C CB  . LEU A 1 127 ? 2.859   8.905   10.005  1.00 36.05 ? 127 LEU A CB  1 
ATOM 847   C CG  . LEU A 1 127 ? 1.532   8.838   9.234   1.00 37.08 ? 127 LEU A CG  1 
ATOM 848   C CD1 . LEU A 1 127 ? 0.736   7.616   9.675   1.00 37.64 ? 127 LEU A CD1 1 
ATOM 849   C CD2 . LEU A 1 127 ? 0.716   10.081  9.500   1.00 35.97 ? 127 LEU A CD2 1 
ATOM 850   N N   . LYS A 1 128 ? 4.711   10.852  11.980  1.00 39.41 ? 128 LYS A N   1 
ATOM 851   C CA  . LYS A 1 128 ? 5.738   10.862  13.007  1.00 39.83 ? 128 LYS A CA  1 
ATOM 852   C C   . LYS A 1 128 ? 5.654   9.506   13.711  1.00 40.56 ? 128 LYS A C   1 
ATOM 853   O O   . LYS A 1 128 ? 4.620   8.849   13.653  1.00 40.39 ? 128 LYS A O   1 
ATOM 854   C CB  . LYS A 1 128 ? 5.483   12.013  13.992  1.00 40.93 ? 128 LYS A CB  1 
ATOM 855   N N   . ARG A 1 129 ? 6.735   9.076   14.364  1.00 41.81 ? 129 ARG A N   1 
ATOM 856   C CA  . ARG A 1 129 ? 6.731   7.781   15.054  1.00 41.58 ? 129 ARG A CA  1 
ATOM 857   C C   . ARG A 1 129 ? 5.684   7.752   16.161  1.00 41.87 ? 129 ARG A C   1 
ATOM 858   O O   . ARG A 1 129 ? 5.379   6.706   16.711  1.00 41.94 ? 129 ARG A O   1 
ATOM 859   C CB  . ARG A 1 129 ? 8.114   7.474   15.635  1.00 40.55 ? 129 ARG A CB  1 
ATOM 860   N N   . THR A 1 130 ? 5.126   8.914   16.468  1.00 43.35 ? 130 THR A N   1 
ATOM 861   C CA  . THR A 1 130 ? 4.113   9.058   17.508  1.00 45.28 ? 130 THR A CA  1 
ATOM 862   C C   . THR A 1 130 ? 2.718   8.683   17.029  1.00 45.99 ? 130 THR A C   1 
ATOM 863   O O   . THR A 1 130 ? 1.843   8.373   17.833  1.00 46.62 ? 130 THR A O   1 
ATOM 864   C CB  . THR A 1 130 ? 4.037   10.524  17.986  1.00 46.70 ? 130 THR A CB  1 
ATOM 865   O OG1 . THR A 1 130 ? 3.636   11.363  16.886  1.00 47.09 ? 130 THR A OG1 1 
ATOM 866   C CG2 . THR A 1 130 ? 5.405   10.997  18.508  1.00 46.80 ? 130 THR A CG2 1 
ATOM 867   N N   . GLY A 1 131 ? 2.504   8.738   15.720  1.00 46.96 ? 131 GLY A N   1 
ATOM 868   C CA  . GLY A 1 131 ? 1.191   8.431   15.182  1.00 48.01 ? 131 GLY A CA  1 
ATOM 869   C C   . GLY A 1 131 ? 0.546   9.695   14.636  1.00 49.17 ? 131 GLY A C   1 
ATOM 870   O O   . GLY A 1 131 ? -0.538  9.657   14.049  1.00 49.54 ? 131 GLY A O   1 
ATOM 871   N N   . GLN A 1 132 ? 1.212   10.824  14.849  1.00 49.49 ? 132 GLN A N   1 
ATOM 872   C CA  . GLN A 1 132 ? 0.727   12.102  14.359  1.00 49.85 ? 132 GLN A CA  1 
ATOM 873   C C   . GLN A 1 132 ? 1.451   12.341  13.049  1.00 49.31 ? 132 GLN A C   1 
ATOM 874   O O   . GLN A 1 132 ? 2.548   11.830  12.858  1.00 48.46 ? 132 GLN A O   1 
ATOM 875   C CB  . GLN A 1 132 ? 1.052   13.211  15.364  1.00 51.66 ? 132 GLN A CB  1 
ATOM 876   C CG  . GLN A 1 132 ? 0.127   13.207  16.562  1.00 54.24 ? 132 GLN A CG  1 
ATOM 877   C CD  . GLN A 1 132 ? -1.338  13.088  16.146  1.00 56.10 ? 132 GLN A CD  1 
ATOM 878   O OE1 . GLN A 1 132 ? -1.820  13.848  15.296  1.00 57.08 ? 132 GLN A OE1 1 
ATOM 879   N NE2 . GLN A 1 132 ? -2.053  12.132  16.742  1.00 55.91 ? 132 GLN A NE2 1 
ATOM 880   N N   . TYR A 1 133 ? 0.848   13.104  12.145  1.00 49.01 ? 133 TYR A N   1 
ATOM 881   C CA  . TYR A 1 133 ? 1.488   13.360  10.869  1.00 48.97 ? 133 TYR A CA  1 
ATOM 882   C C   . TYR A 1 133 ? 2.721   14.224  11.066  1.00 48.62 ? 133 TYR A C   1 
ATOM 883   O O   . TYR A 1 133 ? 2.943   14.763  12.142  1.00 48.01 ? 133 TYR A O   1 
ATOM 884   C CB  . TYR A 1 133 ? 0.500   14.023  9.900   1.00 50.82 ? 133 TYR A CB  1 
ATOM 885   C CG  . TYR A 1 133 ? 0.121   15.454  10.231  1.00 52.78 ? 133 TYR A CG  1 
ATOM 886   C CD1 . TYR A 1 133 ? 0.955   16.510  9.880   1.00 53.03 ? 133 TYR A CD1 1 
ATOM 887   C CD2 . TYR A 1 133 ? -1.076  15.751  10.885  1.00 53.27 ? 133 TYR A CD2 1 
ATOM 888   C CE1 . TYR A 1 133 ? 0.614   17.822  10.163  1.00 53.39 ? 133 TYR A CE1 1 
ATOM 889   C CE2 . TYR A 1 133 ? -1.425  17.068  11.177  1.00 53.60 ? 133 TYR A CE2 1 
ATOM 890   C CZ  . TYR A 1 133 ? -0.571  18.097  10.811  1.00 53.66 ? 133 TYR A CZ  1 
ATOM 891   O OH  . TYR A 1 133 ? -0.886  19.410  11.092  1.00 54.33 ? 133 TYR A OH  1 
ATOM 892   N N   . LYS A 1 134 ? 3.536   14.328  10.026  1.00 48.58 ? 134 LYS A N   1 
ATOM 893   C CA  . LYS A 1 134 ? 4.740   15.139  10.087  1.00 49.11 ? 134 LYS A CA  1 
ATOM 894   C C   . LYS A 1 134 ? 4.657   16.233  9.016   1.00 49.09 ? 134 LYS A C   1 
ATOM 895   O O   . LYS A 1 134 ? 4.386   15.961  7.842   1.00 49.37 ? 134 LYS A O   1 
ATOM 896   C CB  . LYS A 1 134 ? 5.987   14.263  9.877   1.00 49.53 ? 134 LYS A CB  1 
ATOM 897   N N   . LEU A 1 135 ? 4.872   17.473  9.436   1.00 48.33 ? 135 LEU A N   1 
ATOM 898   C CA  . LEU A 1 135 ? 4.827   18.615  8.532   1.00 48.54 ? 135 LEU A CA  1 
ATOM 899   C C   . LEU A 1 135 ? 5.599   18.359  7.241   1.00 48.19 ? 135 LEU A C   1 
ATOM 900   O O   . LEU A 1 135 ? 6.741   17.905  7.275   1.00 48.85 ? 135 LEU A O   1 
ATOM 901   C CB  . LEU A 1 135 ? 5.407   19.850  9.239   1.00 48.29 ? 135 LEU A CB  1 
ATOM 902   C CG  . LEU A 1 135 ? 4.621   20.320  10.467  1.00 47.79 ? 135 LEU A CG  1 
ATOM 903   C CD1 . LEU A 1 135 ? 5.491   21.192  11.346  1.00 47.89 ? 135 LEU A CD1 1 
ATOM 904   C CD2 . LEU A 1 135 ? 3.379   21.062  10.018  1.00 46.87 ? 135 LEU A CD2 1 
ATOM 905   N N   . GLY A 1 136 ? 4.975   18.655  6.106   1.00 47.82 ? 136 GLY A N   1 
ATOM 906   C CA  . GLY A 1 136 ? 5.640   18.451  4.833   1.00 47.84 ? 136 GLY A CA  1 
ATOM 907   C C   . GLY A 1 136 ? 6.984   19.142  4.817   1.00 47.59 ? 136 GLY A C   1 
ATOM 908   O O   . GLY A 1 136 ? 7.959   18.623  4.289   1.00 47.95 ? 136 GLY A O   1 
ATOM 909   N N   . SER A 1 137 ? 7.026   20.323  5.417   1.00 48.24 ? 137 SER A N   1 
ATOM 910   C CA  . SER A 1 137 ? 8.239   21.122  5.489   1.00 48.46 ? 137 SER A CA  1 
ATOM 911   C C   . SER A 1 137 ? 9.374   20.394  6.217   1.00 48.51 ? 137 SER A C   1 
ATOM 912   O O   . SER A 1 137 ? 10.546  20.731  6.050   1.00 48.61 ? 137 SER A O   1 
ATOM 913   C CB  . SER A 1 137 ? 7.927   22.439  6.201   1.00 48.60 ? 137 SER A CB  1 
ATOM 914   O OG  . SER A 1 137 ? 7.392   22.199  7.495   1.00 48.98 ? 137 SER A OG  1 
ATOM 915   N N   . LYS A 1 138 ? 9.026   19.394  7.018   1.00 48.10 ? 138 LYS A N   1 
ATOM 916   C CA  . LYS A 1 138 ? 10.025  18.640  7.774   1.00 47.86 ? 138 LYS A CA  1 
ATOM 917   C C   . LYS A 1 138 ? 10.324  17.253  7.208   1.00 47.00 ? 138 LYS A C   1 
ATOM 918   O O   . LYS A 1 138 ? 10.962  16.440  7.880   1.00 46.17 ? 138 LYS A O   1 
ATOM 919   C CB  . LYS A 1 138 ? 9.573   18.456  9.224   1.00 48.49 ? 138 LYS A CB  1 
ATOM 920   C CG  . LYS A 1 138 ? 9.463   19.721  10.055  1.00 50.61 ? 138 LYS A CG  1 
ATOM 921   C CD  . LYS A 1 138 ? 9.005   19.371  11.479  1.00 52.73 ? 138 LYS A CD  1 
ATOM 922   C CE  . LYS A 1 138 ? 9.925   18.309  12.118  1.00 54.62 ? 138 LYS A CE  1 
ATOM 923   N NZ  . LYS A 1 138 ? 9.539   17.930  13.515  1.00 55.27 ? 138 LYS A NZ  1 
ATOM 924   N N   . THR A 1 139 ? 9.862   16.969  5.993   1.00 46.46 ? 139 THR A N   1 
ATOM 925   C CA  . THR A 1 139 ? 10.098  15.655  5.408   1.00 45.20 ? 139 THR A CA  1 
ATOM 926   C C   . THR A 1 139 ? 11.163  15.688  4.329   1.00 45.55 ? 139 THR A C   1 
ATOM 927   O O   . THR A 1 139 ? 11.485  16.747  3.782   1.00 45.76 ? 139 THR A O   1 
ATOM 928   C CB  . THR A 1 139 ? 8.809   15.042  4.817   1.00 44.05 ? 139 THR A CB  1 
ATOM 929   O OG1 . THR A 1 139 ? 8.351   15.842  3.723   1.00 43.80 ? 139 THR A OG1 1 
ATOM 930   C CG2 . THR A 1 139 ? 7.723   14.967  5.876   1.00 43.03 ? 139 THR A CG2 1 
ATOM 931   N N   . GLY A 1 140 ? 11.711  14.512  4.038   1.00 45.88 ? 140 GLY A N   1 
ATOM 932   C CA  . GLY A 1 140 ? 12.754  14.386  3.032   1.00 45.93 ? 140 GLY A CA  1 
ATOM 933   C C   . GLY A 1 140 ? 12.788  12.985  2.445   1.00 45.82 ? 140 GLY A C   1 
ATOM 934   O O   . GLY A 1 140 ? 12.379  12.026  3.107   1.00 44.57 ? 140 GLY A O   1 
ATOM 935   N N   . PRO A 1 141 ? 13.303  12.836  1.214   1.00 46.22 ? 141 PRO A N   1 
ATOM 936   C CA  . PRO A 1 141 ? 13.389  11.547  0.517   1.00 46.99 ? 141 PRO A CA  1 
ATOM 937   C C   . PRO A 1 141 ? 14.006  10.388  1.297   1.00 46.82 ? 141 PRO A C   1 
ATOM 938   O O   . PRO A 1 141 ? 13.530  9.242   1.204   1.00 47.92 ? 141 PRO A O   1 
ATOM 939   C CB  . PRO A 1 141 ? 14.169  11.885  -0.756  1.00 46.45 ? 141 PRO A CB  1 
ATOM 940   C CG  . PRO A 1 141 ? 15.010  13.015  -0.342  1.00 46.81 ? 141 PRO A CG  1 
ATOM 941   C CD  . PRO A 1 141 ? 14.054  13.862  0.472   1.00 46.60 ? 141 PRO A CD  1 
ATOM 942   N N   . GLY A 1 142 ? 15.046  10.675  2.071   1.00 45.09 ? 142 GLY A N   1 
ATOM 943   C CA  . GLY A 1 142 ? 15.687  9.616   2.823   1.00 44.00 ? 142 GLY A CA  1 
ATOM 944   C C   . GLY A 1 142 ? 14.941  9.201   4.071   1.00 43.96 ? 142 GLY A C   1 
ATOM 945   O O   . GLY A 1 142 ? 15.205  8.136   4.629   1.00 44.02 ? 142 GLY A O   1 
ATOM 946   N N   . GLN A 1 143 ? 14.002  10.031  4.513   1.00 43.60 ? 143 GLN A N   1 
ATOM 947   C CA  . GLN A 1 143 ? 13.235  9.739   5.724   1.00 42.19 ? 143 GLN A CA  1 
ATOM 948   C C   . GLN A 1 143 ? 12.451  8.430   5.692   1.00 40.89 ? 143 GLN A C   1 
ATOM 949   O O   . GLN A 1 143 ? 12.206  7.850   4.626   1.00 41.07 ? 143 GLN A O   1 
ATOM 950   C CB  . GLN A 1 143 ? 12.288  10.898  6.032   1.00 42.81 ? 143 GLN A CB  1 
ATOM 951   C CG  . GLN A 1 143 ? 13.022  12.132  6.494   1.00 43.13 ? 143 GLN A CG  1 
ATOM 952   C CD  . GLN A 1 143 ? 12.104  13.203  7.014   1.00 44.20 ? 143 GLN A CD  1 
ATOM 953   O OE1 . GLN A 1 143 ? 11.166  12.930  7.777   1.00 45.08 ? 143 GLN A OE1 1 
ATOM 954   N NE2 . GLN A 1 143 ? 12.374  14.440  6.624   1.00 44.19 ? 143 GLN A NE2 1 
ATOM 955   N N   . LYS A 1 144 ? 12.065  7.977   6.879   1.00 38.78 ? 144 LYS A N   1 
ATOM 956   C CA  . LYS A 1 144 ? 11.311  6.744   7.050   1.00 37.01 ? 144 LYS A CA  1 
ATOM 957   C C   . LYS A 1 144 ? 9.843   7.064   7.355   1.00 36.64 ? 144 LYS A C   1 
ATOM 958   O O   . LYS A 1 144 ? 8.984   6.184   7.340   1.00 36.72 ? 144 LYS A O   1 
ATOM 959   C CB  . LYS A 1 144 ? 11.949  5.951   8.188   1.00 36.81 ? 144 LYS A CB  1 
ATOM 960   C CG  . LYS A 1 144 ? 11.156  4.811   8.752   1.00 36.51 ? 144 LYS A CG  1 
ATOM 961   C CD  . LYS A 1 144 ? 11.953  4.196   9.890   1.00 38.21 ? 144 LYS A CD  1 
ATOM 962   C CE  . LYS A 1 144 ? 11.188  3.064   10.565  1.00 40.44 ? 144 LYS A CE  1 
ATOM 963   N NZ  . LYS A 1 144 ? 11.898  2.531   11.760  1.00 40.37 ? 144 LYS A NZ  1 
ATOM 964   N N   . ALA A 1 145 ? 9.565   8.335   7.622   1.00 34.99 ? 145 ALA A N   1 
ATOM 965   C CA  . ALA A 1 145 ? 8.218   8.768   7.929   1.00 33.91 ? 145 ALA A CA  1 
ATOM 966   C C   . ALA A 1 145 ? 7.371   8.862   6.660   1.00 33.63 ? 145 ALA A C   1 
ATOM 967   O O   . ALA A 1 145 ? 6.139   8.823   6.724   1.00 33.16 ? 145 ALA A O   1 
ATOM 968   C CB  . ALA A 1 145 ? 8.265   10.114  8.620   1.00 33.90 ? 145 ALA A CB  1 
ATOM 969   N N   . ILE A 1 146 ? 8.040   8.981   5.512   1.00 32.04 ? 146 ILE A N   1 
ATOM 970   C CA  . ILE A 1 146 ? 7.349   9.104   4.233   1.00 29.98 ? 146 ILE A CA  1 
ATOM 971   C C   . ILE A 1 146 ? 7.119   7.782   3.491   1.00 29.70 ? 146 ILE A C   1 
ATOM 972   O O   . ILE A 1 146 ? 6.573   7.784   2.391   1.00 30.41 ? 146 ILE A O   1 
ATOM 973   C CB  . ILE A 1 146 ? 8.111   10.062  3.277   1.00 29.30 ? 146 ILE A CB  1 
ATOM 974   C CG1 . ILE A 1 146 ? 9.439   9.434   2.845   1.00 27.72 ? 146 ILE A CG1 1 
ATOM 975   C CG2 . ILE A 1 146 ? 8.377   11.392  3.971   1.00 28.33 ? 146 ILE A CG2 1 
ATOM 976   C CD1 . ILE A 1 146 ? 10.080  10.109  1.649   1.00 22.21 ? 146 ILE A CD1 1 
ATOM 977   N N   . LEU A 1 147 ? 7.519   6.661   4.083   1.00 28.97 ? 147 LEU A N   1 
ATOM 978   C CA  . LEU A 1 147 ? 7.354   5.366   3.433   1.00 27.35 ? 147 LEU A CA  1 
ATOM 979   C C   . LEU A 1 147 ? 6.056   4.639   3.771   1.00 26.12 ? 147 LEU A C   1 
ATOM 980   O O   . LEU A 1 147 ? 5.797   4.314   4.929   1.00 25.06 ? 147 LEU A O   1 
ATOM 981   C CB  . LEU A 1 147 ? 8.563   4.469   3.745   1.00 27.30 ? 147 LEU A CB  1 
ATOM 982   C CG  . LEU A 1 147 ? 9.888   5.122   3.318   1.00 28.11 ? 147 LEU A CG  1 
ATOM 983   C CD1 . LEU A 1 147 ? 11.051  4.128   3.330   1.00 27.50 ? 147 LEU A CD1 1 
ATOM 984   C CD2 . LEU A 1 147 ? 9.701   5.696   1.924   1.00 28.53 ? 147 LEU A CD2 1 
ATOM 985   N N   . PHE A 1 148 ? 5.249   4.390   2.736   1.00 24.76 ? 148 PHE A N   1 
ATOM 986   C CA  . PHE A 1 148 ? 3.978   3.696   2.880   1.00 23.82 ? 148 PHE A CA  1 
ATOM 987   C C   . PHE A 1 148 ? 3.887   2.452   2.015   1.00 24.26 ? 148 PHE A C   1 
ATOM 988   O O   . PHE A 1 148 ? 4.362   2.417   0.880   1.00 25.12 ? 148 PHE A O   1 
ATOM 989   C CB  . PHE A 1 148 ? 2.813   4.610   2.516   1.00 23.75 ? 148 PHE A CB  1 
ATOM 990   C CG  . PHE A 1 148 ? 2.656   5.784   3.427   1.00 25.46 ? 148 PHE A CG  1 
ATOM 991   C CD1 . PHE A 1 148 ? 3.432   6.933   3.248   1.00 25.63 ? 148 PHE A CD1 1 
ATOM 992   C CD2 . PHE A 1 148 ? 1.752   5.734   4.494   1.00 25.55 ? 148 PHE A CD2 1 
ATOM 993   C CE1 . PHE A 1 148 ? 3.313   8.016   4.117   1.00 24.29 ? 148 PHE A CE1 1 
ATOM 994   C CE2 . PHE A 1 148 ? 1.629   6.817   5.365   1.00 25.31 ? 148 PHE A CE2 1 
ATOM 995   C CZ  . PHE A 1 148 ? 2.414   7.961   5.174   1.00 24.17 ? 148 PHE A CZ  1 
ATOM 996   N N   . LEU A 1 149 ? 3.256   1.429   2.562   1.00 23.60 ? 149 LEU A N   1 
ATOM 997   C CA  . LEU A 1 149 ? 3.059   0.182   1.856   1.00 23.51 ? 149 LEU A CA  1 
ATOM 998   C C   . LEU A 1 149 ? 1.552   0.058   1.681   1.00 23.54 ? 149 LEU A C   1 
ATOM 999   O O   . LEU A 1 149 ? 0.817   -0.018  2.666   1.00 23.70 ? 149 LEU A O   1 
ATOM 1000  C CB  . LEU A 1 149 ? 3.579   -0.979  2.713   1.00 24.88 ? 149 LEU A CB  1 
ATOM 1001  C CG  . LEU A 1 149 ? 3.640   -2.401  2.139   1.00 25.33 ? 149 LEU A CG  1 
ATOM 1002  C CD1 . LEU A 1 149 ? 4.632   -2.423  0.970   1.00 26.17 ? 149 LEU A CD1 1 
ATOM 1003  C CD2 . LEU A 1 149 ? 4.066   -3.386  3.218   1.00 23.43 ? 149 LEU A CD2 1 
ATOM 1004  N N   . PRO A 1 150 ? 1.060   0.076   0.434   1.00 23.85 ? 150 PRO A N   1 
ATOM 1005  C CA  . PRO A 1 150 ? -0.387  -0.049  0.217   1.00 24.48 ? 150 PRO A CA  1 
ATOM 1006  C C   . PRO A 1 150 ? -0.847  -1.468  0.533   1.00 25.84 ? 150 PRO A C   1 
ATOM 1007  O O   . PRO A 1 150 ? -0.182  -2.439  0.173   1.00 26.49 ? 150 PRO A O   1 
ATOM 1008  C CB  . PRO A 1 150 ? -0.552  0.287   -1.262  1.00 23.88 ? 150 PRO A CB  1 
ATOM 1009  C CG  . PRO A 1 150 ? 0.755   -0.101  -1.852  1.00 23.80 ? 150 PRO A CG  1 
ATOM 1010  C CD  . PRO A 1 150 ? 1.773   0.331   -0.829  1.00 23.17 ? 150 PRO A CD  1 
ATOM 1011  N N   . MET A 1 151 ? -1.973  -1.593  1.218   1.00 27.68 ? 151 MET A N   1 
ATOM 1012  C CA  . MET A 1 151 ? -2.487  -2.904  1.579   1.00 29.49 ? 151 MET A CA  1 
ATOM 1013  C C   . MET A 1 151 ? -3.982  -2.998  1.306   1.00 32.11 ? 151 MET A C   1 
ATOM 1014  O O   . MET A 1 151 ? -4.674  -1.985  1.171   1.00 32.74 ? 151 MET A O   1 
ATOM 1015  C CB  . MET A 1 151 ? -2.205  -3.181  3.048   1.00 27.15 ? 151 MET A CB  1 
ATOM 1016  C CG  . MET A 1 151 ? -0.740  -3.062  3.409   1.00 27.08 ? 151 MET A CG  1 
ATOM 1017  S SD  . MET A 1 151 ? -0.404  -3.398  5.156   1.00 28.92 ? 151 MET A SD  1 
ATOM 1018  C CE  . MET A 1 151 ? -0.431  -5.228  5.155   1.00 26.31 ? 151 MET A CE  1 
ATOM 1019  N N   . SER A 1 152 ? -4.473  -4.226  1.209   1.00 34.90 ? 152 SER A N   1 
ATOM 1020  C CA  . SER A 1 152 ? -5.882  -4.476  0.954   1.00 36.96 ? 152 SER A CA  1 
ATOM 1021  C C   . SER A 1 152 ? -6.746  -4.048  2.131   1.00 38.67 ? 152 SER A C   1 
ATOM 1022  O O   . SER A 1 152 ? -6.283  -3.997  3.270   1.00 38.08 ? 152 SER A O   1 
ATOM 1023  C CB  . SER A 1 152 ? -6.090  -5.961  0.674   1.00 37.41 ? 152 SER A CB  1 
ATOM 1024  O OG  . SER A 1 152 ? -7.280  -6.434  1.283   1.00 39.94 ? 152 SER A OG  1 
ATOM 1025  N N   . ALA A 1 153 ? -8.008  -3.745  1.843   1.00 41.17 ? 153 ALA A N   1 
ATOM 1026  C CA  . ALA A 1 153 ? -8.953  -3.333  2.871   1.00 42.74 ? 153 ALA A CA  1 
ATOM 1027  C C   . ALA A 1 153 ? -9.706  -4.564  3.399   1.00 44.23 ? 153 ALA A C   1 
ATOM 1028  O O   . ALA A 1 153 ? -10.935 -4.543  3.522   1.00 45.43 ? 153 ALA A O   1 
ATOM 1029  C CB  . ALA A 1 153 ? -9.928  -2.324  2.284   1.00 41.20 ? 153 ALA A CB  1 
ATOM 1030  N N   . LYS A 1 154 ? -8.957  -5.628  3.717   1.00 45.44 ? 154 LYS A N   1 
ATOM 1031  C CA  . LYS A 1 154 ? -9.515  -6.897  4.218   1.00 45.31 ? 154 LYS A CA  1 
ATOM 1032  C C   . LYS A 1 154 ? -10.593 -7.408  3.268   1.00 44.59 ? 154 LYS A C   1 
ATOM 1033  O O   . LYS A 1 154 ? -10.593 -6.917  2.116   1.00 42.86 ? 154 LYS A O   1 
ATOM 1034  C CB  . LYS A 1 154 ? -10.112 -6.724  5.625   1.00 46.13 ? 154 LYS A CB  1 
ATOM 1035  N N   . PHE B 1 21  ? 53.282  23.635  8.833   1.00 67.40 ? 21  PHE B N   1 
ATOM 1036  C CA  . PHE B 1 21  ? 53.244  25.019  8.291   1.00 66.93 ? 21  PHE B CA  1 
ATOM 1037  C C   . PHE B 1 21  ? 53.801  25.104  6.878   1.00 66.59 ? 21  PHE B C   1 
ATOM 1038  O O   . PHE B 1 21  ? 54.712  24.357  6.505   1.00 66.55 ? 21  PHE B O   1 
ATOM 1039  C CB  . PHE B 1 21  ? 54.023  25.967  9.200   1.00 67.30 ? 21  PHE B CB  1 
ATOM 1040  C CG  . PHE B 1 21  ? 53.499  26.013  10.600  1.00 68.25 ? 21  PHE B CG  1 
ATOM 1041  C CD1 . PHE B 1 21  ? 53.778  24.982  11.495  1.00 68.68 ? 21  PHE B CD1 1 
ATOM 1042  C CD2 . PHE B 1 21  ? 52.691  27.064  11.014  1.00 68.01 ? 21  PHE B CD2 1 
ATOM 1043  C CE1 . PHE B 1 21  ? 53.258  24.996  12.786  1.00 68.78 ? 21  PHE B CE1 1 
ATOM 1044  C CE2 . PHE B 1 21  ? 52.165  27.090  12.300  1.00 68.66 ? 21  PHE B CE2 1 
ATOM 1045  C CZ  . PHE B 1 21  ? 52.447  26.053  13.190  1.00 69.08 ? 21  PHE B CZ  1 
ATOM 1046  N N   . PRO B 1 22  ? 53.234  26.011  6.056   1.00 66.08 ? 22  PRO B N   1 
ATOM 1047  C CA  . PRO B 1 22  ? 53.678  26.195  4.670   1.00 65.24 ? 22  PRO B CA  1 
ATOM 1048  C C   . PRO B 1 22  ? 55.199  26.428  4.656   1.00 63.93 ? 22  PRO B C   1 
ATOM 1049  O O   . PRO B 1 22  ? 55.737  27.078  5.547   1.00 64.69 ? 22  PRO B O   1 
ATOM 1050  C CB  . PRO B 1 22  ? 52.885  27.431  4.231   1.00 65.20 ? 22  PRO B CB  1 
ATOM 1051  C CG  . PRO B 1 22  ? 51.609  27.286  4.990   1.00 64.87 ? 22  PRO B CG  1 
ATOM 1052  C CD  . PRO B 1 22  ? 52.084  26.880  6.363   1.00 65.54 ? 22  PRO B CD  1 
ATOM 1053  N N   . PRO B 1 23  ? 55.908  25.892  3.650   1.00 62.46 ? 23  PRO B N   1 
ATOM 1054  C CA  . PRO B 1 23  ? 57.370  26.041  3.540   1.00 61.43 ? 23  PRO B CA  1 
ATOM 1055  C C   . PRO B 1 23  ? 58.046  27.398  3.809   1.00 60.07 ? 23  PRO B C   1 
ATOM 1056  O O   . PRO B 1 23  ? 58.543  27.631  4.913   1.00 60.96 ? 23  PRO B O   1 
ATOM 1057  C CB  . PRO B 1 23  ? 57.677  25.501  2.134   1.00 60.64 ? 23  PRO B CB  1 
ATOM 1058  C CG  . PRO B 1 23  ? 56.352  25.519  1.430   1.00 61.21 ? 23  PRO B CG  1 
ATOM 1059  C CD  . PRO B 1 23  ? 55.383  25.130  2.510   1.00 61.52 ? 23  PRO B CD  1 
ATOM 1060  N N   . GLY B 1 24  ? 58.084  28.271  2.806   1.00 58.17 ? 24  GLY B N   1 
ATOM 1061  C CA  . GLY B 1 24  ? 58.732  29.575  2.938   1.00 55.57 ? 24  GLY B CA  1 
ATOM 1062  C C   . GLY B 1 24  ? 59.072  30.172  4.302   1.00 53.32 ? 24  GLY B C   1 
ATOM 1063  O O   . GLY B 1 24  ? 58.351  29.985  5.282   1.00 53.80 ? 24  GLY B O   1 
ATOM 1064  N N   . HIS B 1 25  ? 60.178  30.910  4.357   1.00 50.85 ? 25  HIS B N   1 
ATOM 1065  C CA  . HIS B 1 25  ? 60.608  31.577  5.584   1.00 47.83 ? 25  HIS B CA  1 
ATOM 1066  C C   . HIS B 1 25  ? 60.569  33.095  5.370   1.00 45.21 ? 25  HIS B C   1 
ATOM 1067  O O   . HIS B 1 25  ? 61.077  33.599  4.369   1.00 45.03 ? 25  HIS B O   1 
ATOM 1068  C CB  . HIS B 1 25  ? 62.019  31.140  5.961   1.00 48.74 ? 25  HIS B CB  1 
ATOM 1069  C CG  . HIS B 1 25  ? 62.545  31.817  7.187   1.00 52.02 ? 25  HIS B CG  1 
ATOM 1070  N ND1 . HIS B 1 25  ? 61.916  31.736  8.413   1.00 53.18 ? 25  HIS B ND1 1 
ATOM 1071  C CD2 . HIS B 1 25  ? 63.629  32.603  7.373   1.00 52.34 ? 25  HIS B CD2 1 
ATOM 1072  C CE1 . HIS B 1 25  ? 62.593  32.445  9.300   1.00 53.35 ? 25  HIS B CE1 1 
ATOM 1073  N NE2 . HIS B 1 25  ? 63.636  32.983  8.694   1.00 52.72 ? 25  HIS B NE2 1 
ATOM 1074  N N   . PHE B 1 26  ? 59.988  33.818  6.323   1.00 41.98 ? 26  PHE B N   1 
ATOM 1075  C CA  . PHE B 1 26  ? 59.827  35.266  6.224   1.00 39.54 ? 26  PHE B CA  1 
ATOM 1076  C C   . PHE B 1 26  ? 61.026  36.144  5.893   1.00 39.28 ? 26  PHE B C   1 
ATOM 1077  O O   . PHE B 1 26  ? 60.853  37.246  5.370   1.00 38.84 ? 26  PHE B O   1 
ATOM 1078  C CB  . PHE B 1 26  ? 59.185  35.785  7.501   1.00 37.26 ? 26  PHE B CB  1 
ATOM 1079  C CG  . PHE B 1 26  ? 60.135  35.927  8.638   1.00 34.92 ? 26  PHE B CG  1 
ATOM 1080  C CD1 . PHE B 1 26  ? 60.874  37.091  8.799   1.00 32.59 ? 26  PHE B CD1 1 
ATOM 1081  C CD2 . PHE B 1 26  ? 60.283  34.901  9.568   1.00 34.15 ? 26  PHE B CD2 1 
ATOM 1082  C CE1 . PHE B 1 26  ? 61.742  37.234  9.870   1.00 31.71 ? 26  PHE B CE1 1 
ATOM 1083  C CE2 . PHE B 1 26  ? 61.153  35.033  10.647  1.00 32.60 ? 26  PHE B CE2 1 
ATOM 1084  C CZ  . PHE B 1 26  ? 61.884  36.204  10.800  1.00 32.48 ? 26  PHE B CZ  1 
ATOM 1085  N N   . LYS B 1 27  ? 62.240  35.702  6.201   1.00 39.66 ? 27  LYS B N   1 
ATOM 1086  C CA  . LYS B 1 27  ? 63.370  36.561  5.875   1.00 39.65 ? 27  LYS B CA  1 
ATOM 1087  C C   . LYS B 1 27  ? 63.962  36.322  4.490   1.00 39.13 ? 27  LYS B C   1 
ATOM 1088  O O   . LYS B 1 27  ? 64.743  37.132  3.995   1.00 39.09 ? 27  LYS B O   1 
ATOM 1089  C CB  . LYS B 1 27  ? 64.449  36.515  6.962   1.00 40.86 ? 27  LYS B CB  1 
ATOM 1090  C CG  . LYS B 1 27  ? 65.154  35.211  7.131   1.00 43.63 ? 27  LYS B CG  1 
ATOM 1091  C CD  . LYS B 1 27  ? 65.754  35.145  8.519   1.00 45.49 ? 27  LYS B CD  1 
ATOM 1092  C CE  . LYS B 1 27  ? 66.442  33.812  8.753   1.00 47.83 ? 27  LYS B CE  1 
ATOM 1093  N NZ  . LYS B 1 27  ? 66.820  33.651  10.189  1.00 50.10 ? 27  LYS B NZ  1 
ATOM 1094  N N   . ASP B 1 28  ? 63.555  35.233  3.846   1.00 38.70 ? 28  ASP B N   1 
ATOM 1095  C CA  . ASP B 1 28  ? 64.030  34.908  2.504   1.00 37.57 ? 28  ASP B CA  1 
ATOM 1096  C C   . ASP B 1 28  ? 63.527  35.906  1.475   1.00 37.19 ? 28  ASP B C   1 
ATOM 1097  O O   . ASP B 1 28  ? 62.444  36.464  1.618   1.00 38.03 ? 28  ASP B O   1 
ATOM 1098  C CB  . ASP B 1 28  ? 63.523  33.528  2.090   1.00 38.45 ? 28  ASP B CB  1 
ATOM 1099  C CG  . ASP B 1 28  ? 64.132  32.406  2.902   1.00 39.12 ? 28  ASP B CG  1 
ATOM 1100  O OD1 . ASP B 1 28  ? 63.593  31.281  2.835   1.00 38.20 ? 28  ASP B OD1 1 
ATOM 1101  O OD2 . ASP B 1 28  ? 65.151  32.638  3.590   1.00 39.66 ? 28  ASP B OD2 1 
ATOM 1102  N N   . PRO B 1 29  ? 64.317  36.154  0.421   1.00 36.52 ? 29  PRO B N   1 
ATOM 1103  C CA  . PRO B 1 29  ? 63.868  37.093  -0.610  1.00 34.66 ? 29  PRO B CA  1 
ATOM 1104  C C   . PRO B 1 29  ? 62.676  36.433  -1.317  1.00 33.52 ? 29  PRO B C   1 
ATOM 1105  O O   . PRO B 1 29  ? 62.534  35.210  -1.290  1.00 32.11 ? 29  PRO B O   1 
ATOM 1106  C CB  . PRO B 1 29  ? 65.093  37.227  -1.504  1.00 34.48 ? 29  PRO B CB  1 
ATOM 1107  C CG  . PRO B 1 29  ? 65.742  35.883  -1.380  1.00 35.34 ? 29  PRO B CG  1 
ATOM 1108  C CD  . PRO B 1 29  ? 65.662  35.645  0.115   1.00 36.03 ? 29  PRO B CD  1 
ATOM 1109  N N   . LYS B 1 30  ? 61.820  37.235  -1.944  1.00 33.12 ? 30  LYS B N   1 
ATOM 1110  C CA  . LYS B 1 30  ? 60.641  36.680  -2.596  1.00 32.89 ? 30  LYS B CA  1 
ATOM 1111  C C   . LYS B 1 30  ? 60.323  37.355  -3.916  1.00 32.58 ? 30  LYS B C   1 
ATOM 1112  O O   . LYS B 1 30  ? 60.922  38.368  -4.272  1.00 32.45 ? 30  LYS B O   1 
ATOM 1113  C CB  . LYS B 1 30  ? 59.414  36.810  -1.669  1.00 32.06 ? 30  LYS B CB  1 
ATOM 1114  C CG  . LYS B 1 30  ? 59.742  36.856  -0.195  1.00 31.28 ? 30  LYS B CG  1 
ATOM 1115  C CD  . LYS B 1 30  ? 58.573  36.450  0.690   1.00 32.86 ? 30  LYS B CD  1 
ATOM 1116  C CE  . LYS B 1 30  ? 59.047  36.233  2.151   1.00 34.86 ? 30  LYS B CE  1 
ATOM 1117  N NZ  . LYS B 1 30  ? 60.194  35.243  2.285   1.00 32.09 ? 30  LYS B NZ  1 
ATOM 1118  N N   . ARG B 1 31  ? 59.375  36.766  -4.638  1.00 31.56 ? 31  ARG B N   1 
ATOM 1119  C CA  . ARG B 1 31  ? 58.905  37.309  -5.899  1.00 31.25 ? 31  ARG B CA  1 
ATOM 1120  C C   . ARG B 1 31  ? 57.474  37.749  -5.601  1.00 30.17 ? 31  ARG B C   1 
ATOM 1121  O O   . ARG B 1 31  ? 56.770  37.097  -4.840  1.00 30.55 ? 31  ARG B O   1 
ATOM 1122  C CB  . ARG B 1 31  ? 58.897  36.237  -6.994  1.00 31.66 ? 31  ARG B CB  1 
ATOM 1123  C CG  . ARG B 1 31  ? 60.271  35.744  -7.432  1.00 34.09 ? 31  ARG B CG  1 
ATOM 1124  C CD  . ARG B 1 31  ? 60.149  34.855  -8.675  1.00 37.91 ? 31  ARG B CD  1 
ATOM 1125  N NE  . ARG B 1 31  ? 60.665  33.499  -8.465  1.00 41.36 ? 31  ARG B NE  1 
ATOM 1126  C CZ  . ARG B 1 31  ? 61.876  33.082  -8.828  1.00 42.13 ? 31  ARG B CZ  1 
ATOM 1127  N NH1 . ARG B 1 31  ? 62.725  33.908  -9.434  1.00 43.51 ? 31  ARG B NH1 1 
ATOM 1128  N NH2 . ARG B 1 31  ? 62.241  31.834  -8.582  1.00 41.70 ? 31  ARG B NH2 1 
ATOM 1129  N N   . LEU B 1 32  ? 57.046  38.872  -6.154  1.00 29.00 ? 32  LEU B N   1 
ATOM 1130  C CA  . LEU B 1 32  ? 55.685  39.302  -5.916  1.00 27.74 ? 32  LEU B CA  1 
ATOM 1131  C C   . LEU B 1 32  ? 54.878  39.134  -7.196  1.00 28.45 ? 32  LEU B C   1 
ATOM 1132  O O   . LEU B 1 32  ? 54.980  39.939  -8.127  1.00 28.83 ? 32  LEU B O   1 
ATOM 1133  C CB  . LEU B 1 32  ? 55.631  40.752  -5.416  1.00 25.08 ? 32  LEU B CB  1 
ATOM 1134  C CG  . LEU B 1 32  ? 55.897  40.908  -3.911  1.00 23.91 ? 32  LEU B CG  1 
ATOM 1135  C CD1 . LEU B 1 32  ? 55.628  42.332  -3.478  1.00 22.81 ? 32  LEU B CD1 1 
ATOM 1136  C CD2 . LEU B 1 32  ? 54.994  39.966  -3.121  1.00 23.08 ? 32  LEU B CD2 1 
ATOM 1137  N N   . TYR B 1 33  ? 54.082  38.065  -7.231  1.00 28.05 ? 33  TYR B N   1 
ATOM 1138  C CA  . TYR B 1 33  ? 53.247  37.744  -8.380  1.00 28.51 ? 33  TYR B CA  1 
ATOM 1139  C C   . TYR B 1 33  ? 51.927  38.493  -8.329  1.00 28.85 ? 33  TYR B C   1 
ATOM 1140  O O   . TYR B 1 33  ? 51.236  38.471  -7.326  1.00 30.23 ? 33  TYR B O   1 
ATOM 1141  C CB  . TYR B 1 33  ? 53.007  36.237  -8.422  1.00 28.85 ? 33  TYR B CB  1 
ATOM 1142  C CG  . TYR B 1 33  ? 52.068  35.749  -9.512  1.00 29.55 ? 33  TYR B CG  1 
ATOM 1143  C CD1 . TYR B 1 33  ? 50.691  35.681  -9.299  1.00 28.50 ? 33  TYR B CD1 1 
ATOM 1144  C CD2 . TYR B 1 33  ? 52.569  35.286  -10.738 1.00 29.32 ? 33  TYR B CD2 1 
ATOM 1145  C CE1 . TYR B 1 33  ? 49.837  35.159  -10.269 1.00 28.98 ? 33  TYR B CE1 1 
ATOM 1146  C CE2 . TYR B 1 33  ? 51.722  34.761  -11.716 1.00 28.37 ? 33  TYR B CE2 1 
ATOM 1147  C CZ  . TYR B 1 33  ? 50.357  34.697  -11.475 1.00 29.94 ? 33  TYR B CZ  1 
ATOM 1148  O OH  . TYR B 1 33  ? 49.513  34.163  -12.438 1.00 30.81 ? 33  TYR B OH  1 
ATOM 1149  N N   . CYS B 1 34  ? 51.579  39.154  -9.420  1.00 29.36 ? 34  CYS B N   1 
ATOM 1150  C CA  . CYS B 1 34  ? 50.346  39.925  -9.472  1.00 31.12 ? 34  CYS B CA  1 
ATOM 1151  C C   . CYS B 1 34  ? 49.241  39.171  -10.209 1.00 32.28 ? 34  CYS B C   1 
ATOM 1152  O O   . CYS B 1 34  ? 49.422  38.756  -11.356 1.00 32.07 ? 34  CYS B O   1 
ATOM 1153  C CB  . CYS B 1 34  ? 50.607  41.274  -10.156 1.00 30.52 ? 34  CYS B CB  1 
ATOM 1154  S SG  . CYS B 1 34  ? 49.144  42.324  -10.334 1.00 31.44 ? 34  CYS B SG  1 
ATOM 1155  N N   . LYS B 1 35  ? 48.098  38.998  -9.547  1.00 33.33 ? 35  LYS B N   1 
ATOM 1156  C CA  . LYS B 1 35  ? 46.974  38.284  -10.155 1.00 36.43 ? 35  LYS B CA  1 
ATOM 1157  C C   . LYS B 1 35  ? 46.663  38.868  -11.525 1.00 38.25 ? 35  LYS B C   1 
ATOM 1158  O O   . LYS B 1 35  ? 46.417  38.136  -12.482 1.00 38.89 ? 35  LYS B O   1 
ATOM 1159  C CB  . LYS B 1 35  ? 45.704  38.363  -9.283  1.00 35.81 ? 35  LYS B CB  1 
ATOM 1160  N N   . ASN B 1 36  ? 46.687  40.192  -11.618 1.00 40.23 ? 36  ASN B N   1 
ATOM 1161  C CA  . ASN B 1 36  ? 46.384  40.879  -12.865 1.00 41.19 ? 36  ASN B CA  1 
ATOM 1162  C C   . ASN B 1 36  ? 47.397  40.594  -13.967 1.00 41.57 ? 36  ASN B C   1 
ATOM 1163  O O   . ASN B 1 36  ? 48.423  41.262  -14.047 1.00 42.59 ? 36  ASN B O   1 
ATOM 1164  C CB  . ASN B 1 36  ? 46.329  42.381  -12.624 1.00 43.13 ? 36  ASN B CB  1 
ATOM 1165  C CG  . ASN B 1 36  ? 45.526  43.103  -13.679 1.00 45.57 ? 36  ASN B CG  1 
ATOM 1166  O OD1 . ASN B 1 36  ? 45.637  44.325  -13.837 1.00 46.49 ? 36  ASN B OD1 1 
ATOM 1167  N ND2 . ASN B 1 36  ? 44.688  42.356  -14.400 1.00 45.06 ? 36  ASN B ND2 1 
ATOM 1168  N N   . GLY B 1 37  ? 47.110  39.603  -14.812 1.00 40.99 ? 37  GLY B N   1 
ATOM 1169  C CA  . GLY B 1 37  ? 48.003  39.278  -15.912 1.00 39.46 ? 37  GLY B CA  1 
ATOM 1170  C C   . GLY B 1 37  ? 49.109  38.286  -15.602 1.00 39.49 ? 37  GLY B C   1 
ATOM 1171  O O   . GLY B 1 37  ? 49.753  37.768  -16.512 1.00 39.80 ? 37  GLY B O   1 
ATOM 1172  N N   . GLY B 1 38  ? 49.345  38.020  -14.325 1.00 38.96 ? 38  GLY B N   1 
ATOM 1173  C CA  . GLY B 1 38  ? 50.391  37.080  -13.963 1.00 38.49 ? 38  GLY B CA  1 
ATOM 1174  C C   . GLY B 1 38  ? 51.806  37.636  -14.079 1.00 38.21 ? 38  GLY B C   1 
ATOM 1175  O O   . GLY B 1 38  ? 52.753  36.915  -14.391 1.00 37.86 ? 38  GLY B O   1 
ATOM 1176  N N   . PHE B 1 39  ? 51.961  38.927  -13.818 1.00 37.94 ? 39  PHE B N   1 
ATOM 1177  C CA  . PHE B 1 39  ? 53.268  39.564  -13.894 1.00 37.35 ? 39  PHE B CA  1 
ATOM 1178  C C   . PHE B 1 39  ? 53.943  39.590  -12.533 1.00 36.99 ? 39  PHE B C   1 
ATOM 1179  O O   . PHE B 1 39  ? 53.283  39.770  -11.513 1.00 37.37 ? 39  PHE B O   1 
ATOM 1180  C CB  . PHE B 1 39  ? 53.130  41.016  -14.375 1.00 38.74 ? 39  PHE B CB  1 
ATOM 1181  C CG  . PHE B 1 39  ? 52.597  41.155  -15.777 1.00 39.13 ? 39  PHE B CG  1 
ATOM 1182  C CD1 . PHE B 1 39  ? 51.242  41.314  -16.009 1.00 38.41 ? 39  PHE B CD1 1 
ATOM 1183  C CD2 . PHE B 1 39  ? 53.464  41.111  -16.872 1.00 39.34 ? 39  PHE B CD2 1 
ATOM 1184  C CE1 . PHE B 1 39  ? 50.756  41.425  -17.316 1.00 39.92 ? 39  PHE B CE1 1 
ATOM 1185  C CE2 . PHE B 1 39  ? 52.984  41.222  -18.174 1.00 38.38 ? 39  PHE B CE2 1 
ATOM 1186  C CZ  . PHE B 1 39  ? 51.629  41.379  -18.399 1.00 38.30 ? 39  PHE B CZ  1 
ATOM 1187  N N   . PHE B 1 40  ? 55.257  39.403  -12.523 1.00 36.23 ? 40  PHE B N   1 
ATOM 1188  C CA  . PHE B 1 40  ? 56.037  39.469  -11.292 1.00 35.60 ? 40  PHE B CA  1 
ATOM 1189  C C   . PHE B 1 40  ? 56.494  40.919  -11.195 1.00 34.99 ? 40  PHE B C   1 
ATOM 1190  O O   . PHE B 1 40  ? 56.867  41.523  -12.197 1.00 34.67 ? 40  PHE B O   1 
ATOM 1191  C CB  . PHE B 1 40  ? 57.264  38.554  -11.374 1.00 36.13 ? 40  PHE B CB  1 
ATOM 1192  C CG  . PHE B 1 40  ? 56.943  37.096  -11.245 1.00 35.56 ? 40  PHE B CG  1 
ATOM 1193  C CD1 . PHE B 1 40  ? 56.649  36.546  -10.000 1.00 34.80 ? 40  PHE B CD1 1 
ATOM 1194  C CD2 . PHE B 1 40  ? 56.935  36.271  -12.367 1.00 34.88 ? 40  PHE B CD2 1 
ATOM 1195  C CE1 . PHE B 1 40  ? 56.347  35.186  -9.873  1.00 34.96 ? 40  PHE B CE1 1 
ATOM 1196  C CE2 . PHE B 1 40  ? 56.636  34.910  -12.249 1.00 35.22 ? 40  PHE B CE2 1 
ATOM 1197  C CZ  . PHE B 1 40  ? 56.341  34.369  -10.997 1.00 35.01 ? 40  PHE B CZ  1 
ATOM 1198  N N   . LEU B 1 41  ? 56.452  41.483  -9.997  1.00 35.11 ? 41  LEU B N   1 
ATOM 1199  C CA  . LEU B 1 41  ? 56.878  42.863  -9.816  1.00 36.13 ? 41  LEU B CA  1 
ATOM 1200  C C   . LEU B 1 41  ? 58.379  42.932  -10.046 1.00 37.03 ? 41  LEU B C   1 
ATOM 1201  O O   . LEU B 1 41  ? 59.130  42.153  -9.459  1.00 38.17 ? 41  LEU B O   1 
ATOM 1202  C CB  . LEU B 1 41  ? 56.543  43.335  -8.403  1.00 35.33 ? 41  LEU B CB  1 
ATOM 1203  C CG  . LEU B 1 41  ? 56.869  44.781  -8.028  1.00 35.02 ? 41  LEU B CG  1 
ATOM 1204  C CD1 . LEU B 1 41  ? 56.149  45.765  -8.947  1.00 32.67 ? 41  LEU B CD1 1 
ATOM 1205  C CD2 . LEU B 1 41  ? 56.453  44.991  -6.567  1.00 33.63 ? 41  LEU B CD2 1 
ATOM 1206  N N   . ARG B 1 42  ? 58.814  43.848  -10.908 1.00 38.33 ? 42  ARG B N   1 
ATOM 1207  C CA  . ARG B 1 42  ? 60.238  43.985  -11.207 1.00 39.47 ? 42  ARG B CA  1 
ATOM 1208  C C   . ARG B 1 42  ? 60.792  45.365  -10.923 1.00 39.57 ? 42  ARG B C   1 
ATOM 1209  O O   . ARG B 1 42  ? 60.193  46.376  -11.291 1.00 40.14 ? 42  ARG B O   1 
ATOM 1210  C CB  . ARG B 1 42  ? 60.514  43.642  -12.663 1.00 40.26 ? 42  ARG B CB  1 
ATOM 1211  C CG  . ARG B 1 42  ? 61.995  43.574  -12.975 1.00 41.51 ? 42  ARG B CG  1 
ATOM 1212  C CD  . ARG B 1 42  ? 62.222  43.109  -14.394 1.00 41.53 ? 42  ARG B CD  1 
ATOM 1213  N NE  . ARG B 1 42  ? 61.502  43.954  -15.343 1.00 40.53 ? 42  ARG B NE  1 
ATOM 1214  C CZ  . ARG B 1 42  ? 61.523  43.782  -16.659 1.00 39.09 ? 42  ARG B CZ  1 
ATOM 1215  N NH1 . ARG B 1 42  ? 62.234  42.794  -17.181 1.00 36.25 ? 42  ARG B NH1 1 
ATOM 1216  N NH2 . ARG B 1 42  ? 60.815  44.584  -17.448 1.00 38.06 ? 42  ARG B NH2 1 
ATOM 1217  N N   . ILE B 1 43  ? 61.940  45.401  -10.260 1.00 39.75 ? 43  ILE B N   1 
ATOM 1218  C CA  . ILE B 1 43  ? 62.589  46.663  -9.937  1.00 40.55 ? 43  ILE B CA  1 
ATOM 1219  C C   . ILE B 1 43  ? 63.929  46.767  -10.660 1.00 41.42 ? 43  ILE B C   1 
ATOM 1220  O O   . ILE B 1 43  ? 64.895  46.062  -10.336 1.00 40.65 ? 43  ILE B O   1 
ATOM 1221  C CB  . ILE B 1 43  ? 62.777  46.810  -8.420  1.00 41.08 ? 43  ILE B CB  1 
ATOM 1222  C CG1 . ILE B 1 43  ? 61.398  46.949  -7.764  1.00 41.26 ? 43  ILE B CG1 1 
ATOM 1223  C CG2 . ILE B 1 43  ? 63.671  48.013  -8.110  1.00 41.02 ? 43  ILE B CG2 1 
ATOM 1224  C CD1 . ILE B 1 43  ? 61.406  46.891  -6.251  1.00 42.85 ? 43  ILE B CD1 1 
ATOM 1225  N N   . HIS B 1 44  ? 63.955  47.651  -11.652 1.00 43.08 ? 44  HIS B N   1 
ATOM 1226  C CA  . HIS B 1 44  ? 65.130  47.895  -12.483 1.00 45.10 ? 44  HIS B CA  1 
ATOM 1227  C C   . HIS B 1 44  ? 66.250  48.687  -11.803 1.00 45.23 ? 44  HIS B C   1 
ATOM 1228  O O   . HIS B 1 44  ? 65.999  49.529  -10.925 1.00 44.36 ? 44  HIS B O   1 
ATOM 1229  C CB  . HIS B 1 44  ? 64.703  48.616  -13.758 1.00 45.65 ? 44  HIS B CB  1 
ATOM 1230  C CG  . HIS B 1 44  ? 63.988  47.738  -14.733 1.00 46.61 ? 44  HIS B CG  1 
ATOM 1231  N ND1 . HIS B 1 44  ? 64.651  46.885  -15.590 1.00 46.71 ? 44  HIS B ND1 1 
ATOM 1232  C CD2 . HIS B 1 44  ? 62.667  47.583  -14.993 1.00 46.77 ? 44  HIS B CD2 1 
ATOM 1233  C CE1 . HIS B 1 44  ? 63.770  46.247  -16.340 1.00 46.99 ? 44  HIS B CE1 1 
ATOM 1234  N NE2 . HIS B 1 44  ? 62.559  46.653  -15.998 1.00 46.72 ? 44  HIS B NE2 1 
ATOM 1235  N N   . PRO B 1 45  ? 67.509  48.434  -12.220 1.00 45.40 ? 45  PRO B N   1 
ATOM 1236  C CA  . PRO B 1 45  ? 68.693  49.107  -11.664 1.00 45.87 ? 45  PRO B CA  1 
ATOM 1237  C C   . PRO B 1 45  ? 68.654  50.625  -11.795 1.00 46.01 ? 45  PRO B C   1 
ATOM 1238  O O   . PRO B 1 45  ? 69.236  51.336  -10.981 1.00 45.56 ? 45  PRO B O   1 
ATOM 1239  C CB  . PRO B 1 45  ? 69.850  48.484  -12.443 1.00 44.77 ? 45  PRO B CB  1 
ATOM 1240  C CG  . PRO B 1 45  ? 69.328  47.124  -12.791 1.00 45.22 ? 45  PRO B CG  1 
ATOM 1241  C CD  . PRO B 1 45  ? 67.905  47.413  -13.205 1.00 44.79 ? 45  PRO B CD  1 
ATOM 1242  N N   . ASP B 1 46  ? 67.970  51.121  -12.818 1.00 46.74 ? 46  ASP B N   1 
ATOM 1243  C CA  . ASP B 1 46  ? 67.865  52.561  -13.015 1.00 48.19 ? 46  ASP B CA  1 
ATOM 1244  C C   . ASP B 1 46  ? 66.656  53.148  -12.287 1.00 48.64 ? 46  ASP B C   1 
ATOM 1245  O O   . ASP B 1 46  ? 66.275  54.296  -12.526 1.00 48.83 ? 46  ASP B O   1 
ATOM 1246  C CB  . ASP B 1 46  ? 67.773  52.894  -14.504 1.00 48.68 ? 46  ASP B CB  1 
ATOM 1247  C CG  . ASP B 1 46  ? 66.733  52.062  -15.223 1.00 49.49 ? 46  ASP B CG  1 
ATOM 1248  O OD1 . ASP B 1 46  ? 65.597  51.950  -14.719 1.00 50.10 ? 46  ASP B OD1 1 
ATOM 1249  O OD2 . ASP B 1 46  ? 67.052  51.525  -16.303 1.00 50.32 ? 46  ASP B OD2 1 
ATOM 1250  N N   . GLY B 1 47  ? 66.047  52.355  -11.408 1.00 48.72 ? 47  GLY B N   1 
ATOM 1251  C CA  . GLY B 1 47  ? 64.890  52.829  -10.666 1.00 48.10 ? 47  GLY B CA  1 
ATOM 1252  C C   . GLY B 1 47  ? 63.538  52.608  -11.329 1.00 47.38 ? 47  GLY B C   1 
ATOM 1253  O O   . GLY B 1 47  ? 62.503  52.927  -10.745 1.00 46.72 ? 47  GLY B O   1 
ATOM 1254  N N   . ARG B 1 48  ? 63.534  52.076  -12.546 1.00 47.42 ? 48  ARG B N   1 
ATOM 1255  C CA  . ARG B 1 48  ? 62.283  51.817  -13.248 1.00 47.67 ? 48  ARG B CA  1 
ATOM 1256  C C   . ARG B 1 48  ? 61.529  50.683  -12.570 1.00 48.03 ? 48  ARG B C   1 
ATOM 1257  O O   . ARG B 1 48  ? 62.133  49.718  -12.092 1.00 47.62 ? 48  ARG B O   1 
ATOM 1258  C CB  . ARG B 1 48  ? 62.545  51.442  -14.706 1.00 47.92 ? 48  ARG B CB  1 
ATOM 1259  C CG  . ARG B 1 48  ? 62.844  52.622  -15.626 1.00 48.92 ? 48  ARG B CG  1 
ATOM 1260  C CD  . ARG B 1 48  ? 63.161  52.177  -17.065 1.00 48.60 ? 48  ARG B CD  1 
ATOM 1261  N NE  . ARG B 1 48  ? 64.426  51.444  -17.169 1.00 49.48 ? 48  ARG B NE  1 
ATOM 1262  C CZ  . ARG B 1 48  ? 64.524  50.130  -17.357 1.00 50.12 ? 48  ARG B CZ  1 
ATOM 1263  N NH1 . ARG B 1 48  ? 65.717  49.548  -17.441 1.00 50.41 ? 48  ARG B NH1 1 
ATOM 1264  N NH2 . ARG B 1 48  ? 63.430  49.391  -17.470 1.00 50.47 ? 48  ARG B NH2 1 
ATOM 1265  N N   . VAL B 1 49  ? 60.203  50.800  -12.545 1.00 48.09 ? 49  VAL B N   1 
ATOM 1266  C CA  . VAL B 1 49  ? 59.352  49.792  -11.921 1.00 47.57 ? 49  VAL B CA  1 
ATOM 1267  C C   . VAL B 1 49  ? 58.280  49.280  -12.884 1.00 47.48 ? 49  VAL B C   1 
ATOM 1268  O O   . VAL B 1 49  ? 57.579  50.065  -13.525 1.00 47.29 ? 49  VAL B O   1 
ATOM 1269  C CB  . VAL B 1 49  ? 58.672  50.381  -10.673 1.00 46.97 ? 49  VAL B CB  1 
ATOM 1270  C CG1 . VAL B 1 49  ? 57.686  49.387  -10.105 1.00 46.86 ? 49  VAL B CG1 1 
ATOM 1271  C CG2 . VAL B 1 49  ? 59.724  50.747  -9.643  1.00 45.82 ? 49  VAL B CG2 1 
ATOM 1272  N N   . ASP B 1 50  ? 58.158  47.962  -12.979 1.00 47.40 ? 50  ASP B N   1 
ATOM 1273  C CA  . ASP B 1 50  ? 57.164  47.352  -13.851 1.00 46.81 ? 50  ASP B CA  1 
ATOM 1274  C C   . ASP B 1 50  ? 57.010  45.871  -13.522 1.00 46.98 ? 50  ASP B C   1 
ATOM 1275  O O   . ASP B 1 50  ? 57.432  45.427  -12.451 1.00 47.16 ? 50  ASP B O   1 
ATOM 1276  C CB  . ASP B 1 50  ? 57.556  47.548  -15.321 1.00 47.09 ? 50  ASP B CB  1 
ATOM 1277  C CG  . ASP B 1 50  ? 58.806  46.771  -15.721 1.00 48.19 ? 50  ASP B CG  1 
ATOM 1278  O OD1 . ASP B 1 50  ? 59.171  46.828  -16.920 1.00 48.58 ? 50  ASP B OD1 1 
ATOM 1279  O OD2 . ASP B 1 50  ? 59.423  46.105  -14.862 1.00 49.45 ? 50  ASP B OD2 1 
ATOM 1280  N N   . GLY B 1 51  ? 56.413  45.109  -14.433 1.00 47.35 ? 51  GLY B N   1 
ATOM 1281  C CA  . GLY B 1 51  ? 56.228  43.688  -14.200 1.00 47.74 ? 51  GLY B CA  1 
ATOM 1282  C C   . GLY B 1 51  ? 56.584  42.854  -15.413 1.00 48.09 ? 51  GLY B C   1 
ATOM 1283  O O   . GLY B 1 51  ? 56.526  43.343  -16.536 1.00 48.30 ? 51  GLY B O   1 
ATOM 1284  N N   . VAL B 1 52  ? 56.974  41.602  -15.184 1.00 48.64 ? 52  VAL B N   1 
ATOM 1285  C CA  . VAL B 1 52  ? 57.327  40.678  -16.259 1.00 48.65 ? 52  VAL B CA  1 
ATOM 1286  C C   . VAL B 1 52  ? 56.838  39.289  -15.897 1.00 48.92 ? 52  VAL B C   1 
ATOM 1287  O O   . VAL B 1 52  ? 56.479  39.033  -14.751 1.00 49.53 ? 52  VAL B O   1 
ATOM 1288  C CB  . VAL B 1 52  ? 58.832  40.619  -16.484 1.00 48.29 ? 52  VAL B CB  1 
ATOM 1289  C CG1 . VAL B 1 52  ? 59.311  41.957  -16.897 1.00 49.07 ? 52  VAL B CG1 1 
ATOM 1290  C CG2 . VAL B 1 52  ? 59.540  40.177  -15.220 1.00 48.85 ? 52  VAL B CG2 1 
ATOM 1291  N N   . ARG B 1 53  ? 56.830  38.386  -16.867 1.00 49.13 ? 53  ARG B N   1 
ATOM 1292  C CA  . ARG B 1 53  ? 56.359  37.040  -16.602 1.00 48.98 ? 53  ARG B CA  1 
ATOM 1293  C C   . ARG B 1 53  ? 57.483  36.024  -16.486 1.00 49.62 ? 53  ARG B C   1 
ATOM 1294  O O   . ARG B 1 53  ? 57.278  34.930  -15.975 1.00 50.75 ? 53  ARG B O   1 
ATOM 1295  C CB  . ARG B 1 53  ? 55.343  36.637  -17.674 1.00 47.86 ? 53  ARG B CB  1 
ATOM 1296  C CG  . ARG B 1 53  ? 54.100  37.513  -17.616 1.00 46.62 ? 53  ARG B CG  1 
ATOM 1297  C CD  . ARG B 1 53  ? 53.045  37.132  -18.630 1.00 45.66 ? 53  ARG B CD  1 
ATOM 1298  N NE  . ARG B 1 53  ? 51.779  37.795  -18.319 1.00 45.60 ? 53  ARG B NE  1 
ATOM 1299  C CZ  . ARG B 1 53  ? 50.883  38.162  -19.230 1.00 45.04 ? 53  ARG B CZ  1 
ATOM 1300  N NH1 . ARG B 1 53  ? 51.113  37.931  -20.513 1.00 45.48 ? 53  ARG B NH1 1 
ATOM 1301  N NH2 . ARG B 1 53  ? 49.768  38.776  -18.865 1.00 43.44 ? 53  ARG B NH2 1 
ATOM 1302  N N   . GLU B 1 54  ? 58.679  36.392  -16.923 1.00 50.08 ? 54  GLU B N   1 
ATOM 1303  C CA  . GLU B 1 54  ? 59.796  35.465  -16.856 1.00 51.24 ? 54  GLU B CA  1 
ATOM 1304  C C   . GLU B 1 54  ? 60.381  35.311  -15.452 1.00 51.75 ? 54  GLU B C   1 
ATOM 1305  O O   . GLU B 1 54  ? 61.129  36.163  -14.962 1.00 51.67 ? 54  GLU B O   1 
ATOM 1306  C CB  . GLU B 1 54  ? 60.887  35.875  -17.850 1.00 52.41 ? 54  GLU B CB  1 
ATOM 1307  C CG  . GLU B 1 54  ? 62.078  34.921  -17.877 1.00 54.33 ? 54  GLU B CG  1 
ATOM 1308  C CD  . GLU B 1 54  ? 61.664  33.460  -17.719 1.00 55.66 ? 54  GLU B CD  1 
ATOM 1309  O OE1 . GLU B 1 54  ? 60.745  33.008  -18.446 1.00 57.15 ? 54  GLU B OE1 1 
ATOM 1310  O OE2 . GLU B 1 54  ? 62.259  32.762  -16.868 1.00 55.67 ? 54  GLU B OE2 1 
ATOM 1311  N N   . LYS B 1 55  ? 60.040  34.196  -14.820 1.00 51.80 ? 55  LYS B N   1 
ATOM 1312  C CA  . LYS B 1 55  ? 60.506  33.893  -13.475 1.00 52.63 ? 55  LYS B CA  1 
ATOM 1313  C C   . LYS B 1 55  ? 62.028  33.961  -13.320 1.00 53.07 ? 55  LYS B C   1 
ATOM 1314  O O   . LYS B 1 55  ? 62.532  34.173  -12.215 1.00 54.00 ? 55  LYS B O   1 
ATOM 1315  C CB  . LYS B 1 55  ? 60.008  32.502  -13.050 1.00 51.87 ? 55  LYS B CB  1 
ATOM 1316  N N   . SER B 1 56  ? 62.766  33.792  -14.412 1.00 52.89 ? 56  SER B N   1 
ATOM 1317  C CA  . SER B 1 56  ? 64.221  33.828  -14.315 1.00 53.17 ? 56  SER B CA  1 
ATOM 1318  C C   . SER B 1 56  ? 64.767  35.244  -14.237 1.00 52.73 ? 56  SER B C   1 
ATOM 1319  O O   . SER B 1 56  ? 65.911  35.440  -13.844 1.00 53.26 ? 56  SER B O   1 
ATOM 1320  C CB  . SER B 1 56  ? 64.875  33.109  -15.496 1.00 54.02 ? 56  SER B CB  1 
ATOM 1321  O OG  . SER B 1 56  ? 64.791  33.888  -16.678 1.00 56.75 ? 56  SER B OG  1 
ATOM 1322  N N   . ASP B 1 57  ? 63.960  36.228  -14.616 1.00 51.88 ? 57  ASP B N   1 
ATOM 1323  C CA  . ASP B 1 57  ? 64.404  37.613  -14.572 1.00 51.53 ? 57  ASP B CA  1 
ATOM 1324  C C   . ASP B 1 57  ? 65.036  37.890  -13.204 1.00 50.76 ? 57  ASP B C   1 
ATOM 1325  O O   . ASP B 1 57  ? 64.411  37.690  -12.162 1.00 51.08 ? 57  ASP B O   1 
ATOM 1326  C CB  . ASP B 1 57  ? 63.216  38.541  -14.829 1.00 52.30 ? 57  ASP B CB  1 
ATOM 1327  C CG  . ASP B 1 57  ? 63.630  39.983  -14.955 1.00 52.79 ? 57  ASP B CG  1 
ATOM 1328  O OD1 . ASP B 1 57  ? 63.178  40.638  -15.919 1.00 52.51 ? 57  ASP B OD1 1 
ATOM 1329  O OD2 . ASP B 1 57  ? 64.404  40.459  -14.089 1.00 53.87 ? 57  ASP B OD2 1 
ATOM 1330  N N   . PRO B 1 58  ? 66.291  38.356  -13.191 1.00 50.01 ? 58  PRO B N   1 
ATOM 1331  C CA  . PRO B 1 58  ? 66.961  38.629  -11.919 1.00 49.64 ? 58  PRO B CA  1 
ATOM 1332  C C   . PRO B 1 58  ? 66.508  39.873  -11.145 1.00 48.60 ? 58  PRO B C   1 
ATOM 1333  O O   . PRO B 1 58  ? 66.856  40.032  -9.969  1.00 48.11 ? 58  PRO B O   1 
ATOM 1334  C CB  . PRO B 1 58  ? 68.439  38.669  -12.318 1.00 49.41 ? 58  PRO B CB  1 
ATOM 1335  C CG  . PRO B 1 58  ? 68.388  39.259  -13.677 1.00 49.47 ? 58  PRO B CG  1 
ATOM 1336  C CD  . PRO B 1 58  ? 67.192  38.598  -14.332 1.00 49.66 ? 58  PRO B CD  1 
ATOM 1337  N N   . HIS B 1 59  ? 65.720  40.735  -11.786 1.00 47.06 ? 59  HIS B N   1 
ATOM 1338  C CA  . HIS B 1 59  ? 65.266  41.956  -11.127 1.00 46.10 ? 59  HIS B CA  1 
ATOM 1339  C C   . HIS B 1 59  ? 63.893  41.848  -10.459 1.00 44.74 ? 59  HIS B C   1 
ATOM 1340  O O   . HIS B 1 59  ? 63.242  42.864  -10.173 1.00 43.48 ? 59  HIS B O   1 
ATOM 1341  C CB  . HIS B 1 59  ? 65.305  43.115  -12.125 1.00 47.12 ? 59  HIS B CB  1 
ATOM 1342  C CG  . HIS B 1 59  ? 66.664  43.345  -12.724 1.00 47.96 ? 59  HIS B CG  1 
ATOM 1343  N ND1 . HIS B 1 59  ? 67.777  43.635  -11.961 1.00 47.49 ? 59  HIS B ND1 1 
ATOM 1344  C CD2 . HIS B 1 59  ? 67.090  43.309  -14.009 1.00 47.52 ? 59  HIS B CD2 1 
ATOM 1345  C CE1 . HIS B 1 59  ? 68.827  43.769  -12.750 1.00 46.58 ? 59  HIS B CE1 1 
ATOM 1346  N NE2 . HIS B 1 59  ? 68.437  43.576  -13.996 1.00 47.10 ? 59  HIS B NE2 1 
ATOM 1347  N N   . ILE B 1 60  ? 63.462  40.613  -10.208 1.00 42.92 ? 60  ILE B N   1 
ATOM 1348  C CA  . ILE B 1 60  ? 62.189  40.389  -9.538  1.00 40.88 ? 60  ILE B CA  1 
ATOM 1349  C C   . ILE B 1 60  ? 62.396  39.741  -8.176  1.00 38.89 ? 60  ILE B C   1 
ATOM 1350  O O   . ILE B 1 60  ? 61.431  39.485  -7.465  1.00 39.83 ? 60  ILE B O   1 
ATOM 1351  C CB  . ILE B 1 60  ? 61.221  39.517  -10.365 1.00 41.80 ? 60  ILE B CB  1 
ATOM 1352  C CG1 . ILE B 1 60  ? 61.883  38.182  -10.706 1.00 42.79 ? 60  ILE B CG1 1 
ATOM 1353  C CG2 . ILE B 1 60  ? 60.766  40.286  -11.601 1.00 41.72 ? 60  ILE B CG2 1 
ATOM 1354  C CD1 . ILE B 1 60  ? 60.890  37.104  -11.086 1.00 44.25 ? 60  ILE B CD1 1 
ATOM 1355  N N   . LYS B 1 61  ? 63.644  39.462  -7.817  1.00 36.26 ? 61  LYS B N   1 
ATOM 1356  C CA  . LYS B 1 61  ? 63.916  38.890  -6.505  1.00 35.22 ? 61  LYS B CA  1 
ATOM 1357  C C   . LYS B 1 61  ? 63.898  40.096  -5.569  1.00 34.22 ? 61  LYS B C   1 
ATOM 1358  O O   . LYS B 1 61  ? 64.740  40.994  -5.680  1.00 34.53 ? 61  LYS B O   1 
ATOM 1359  C CB  . LYS B 1 61  ? 65.282  38.196  -6.473  1.00 34.65 ? 61  LYS B CB  1 
ATOM 1360  N N   . LEU B 1 62  ? 62.916  40.120  -4.671  1.00 32.38 ? 62  LEU B N   1 
ATOM 1361  C CA  . LEU B 1 62  ? 62.730  41.225  -3.740  1.00 29.52 ? 62  LEU B CA  1 
ATOM 1362  C C   . LEU B 1 62  ? 62.970  40.839  -2.287  1.00 29.42 ? 62  LEU B C   1 
ATOM 1363  O O   . LEU B 1 62  ? 62.879  39.670  -1.916  1.00 29.52 ? 62  LEU B O   1 
ATOM 1364  C CB  . LEU B 1 62  ? 61.309  41.774  -3.880  1.00 26.94 ? 62  LEU B CB  1 
ATOM 1365  C CG  . LEU B 1 62  ? 60.823  42.140  -5.284  1.00 27.14 ? 62  LEU B CG  1 
ATOM 1366  C CD1 . LEU B 1 62  ? 59.393  42.628  -5.208  1.00 25.87 ? 62  LEU B CD1 1 
ATOM 1367  C CD2 . LEU B 1 62  ? 61.714  43.220  -5.888  1.00 28.02 ? 62  LEU B CD2 1 
ATOM 1368  N N   . GLN B 1 63  ? 63.281  41.835  -1.466  1.00 28.44 ? 63  GLN B N   1 
ATOM 1369  C CA  . GLN B 1 63  ? 63.495  41.606  -0.053  1.00 28.40 ? 63  GLN B CA  1 
ATOM 1370  C C   . GLN B 1 63  ? 62.519  42.480  0.717   1.00 28.62 ? 63  GLN B C   1 
ATOM 1371  O O   . GLN B 1 63  ? 62.605  43.706  0.662   1.00 29.18 ? 63  GLN B O   1 
ATOM 1372  C CB  . GLN B 1 63  ? 64.922  41.973  0.339   1.00 27.89 ? 63  GLN B CB  1 
ATOM 1373  C CG  . GLN B 1 63  ? 65.293  41.678  1.795   1.00 27.05 ? 63  GLN B CG  1 
ATOM 1374  C CD  . GLN B 1 63  ? 65.223  40.199  2.138   1.00 28.52 ? 63  GLN B CD  1 
ATOM 1375  O OE1 . GLN B 1 63  ? 65.717  39.355  1.382   1.00 30.87 ? 63  GLN B OE1 1 
ATOM 1376  N NE2 . GLN B 1 63  ? 64.617  39.873  3.284   1.00 28.23 ? 63  GLN B NE2 1 
ATOM 1377  N N   . LEU B 1 64  ? 61.572  41.857  1.417   1.00 28.60 ? 64  LEU B N   1 
ATOM 1378  C CA  . LEU B 1 64  ? 60.627  42.637  2.201   1.00 27.87 ? 64  LEU B CA  1 
ATOM 1379  C C   . LEU B 1 64  ? 61.181  42.722  3.611   1.00 27.71 ? 64  LEU B C   1 
ATOM 1380  O O   . LEU B 1 64  ? 61.804  41.782  4.114   1.00 28.06 ? 64  LEU B O   1 
ATOM 1381  C CB  . LEU B 1 64  ? 59.220  42.013  2.209   1.00 27.52 ? 64  LEU B CB  1 
ATOM 1382  C CG  . LEU B 1 64  ? 58.497  41.605  0.913   1.00 26.70 ? 64  LEU B CG  1 
ATOM 1383  C CD1 . LEU B 1 64  ? 57.024  41.628  1.178   1.00 27.37 ? 64  LEU B CD1 1 
ATOM 1384  C CD2 . LEU B 1 64  ? 58.786  42.535  -0.232  1.00 28.62 ? 64  LEU B CD2 1 
ATOM 1385  N N   . GLN B 1 65  ? 60.967  43.870  4.238   1.00 26.81 ? 65  GLN B N   1 
ATOM 1386  C CA  . GLN B 1 65  ? 61.450  44.101  5.578   1.00 26.02 ? 65  GLN B CA  1 
ATOM 1387  C C   . GLN B 1 65  ? 60.404  44.894  6.320   1.00 26.73 ? 65  GLN B C   1 
ATOM 1388  O O   . GLN B 1 65  ? 59.939  45.910  5.824   1.00 29.12 ? 65  GLN B O   1 
ATOM 1389  C CB  . GLN B 1 65  ? 62.744  44.899  5.499   1.00 25.45 ? 65  GLN B CB  1 
ATOM 1390  C CG  . GLN B 1 65  ? 63.347  45.263  6.840   1.00 25.13 ? 65  GLN B CG  1 
ATOM 1391  C CD  . GLN B 1 65  ? 63.699  44.049  7.654   1.00 24.41 ? 65  GLN B CD  1 
ATOM 1392  O OE1 . GLN B 1 65  ? 64.541  43.245  7.258   1.00 24.55 ? 65  GLN B OE1 1 
ATOM 1393  N NE2 . GLN B 1 65  ? 63.052  43.902  8.803   1.00 25.16 ? 65  GLN B NE2 1 
ATOM 1394  N N   . ALA B 1 66  ? 60.020  44.434  7.502   1.00 27.71 ? 66  ALA B N   1 
ATOM 1395  C CA  . ALA B 1 66  ? 59.034  45.159  8.293   1.00 28.64 ? 66  ALA B CA  1 
ATOM 1396  C C   . ALA B 1 66  ? 59.749  46.333  8.977   1.00 30.02 ? 66  ALA B C   1 
ATOM 1397  O O   . ALA B 1 66  ? 60.837  46.157  9.536   1.00 30.21 ? 66  ALA B O   1 
ATOM 1398  C CB  . ALA B 1 66  ? 58.421  44.230  9.345   1.00 27.37 ? 66  ALA B CB  1 
ATOM 1399  N N   . GLU B 1 67  ? 59.163  47.526  8.915   1.00 30.27 ? 67  GLU B N   1 
ATOM 1400  C CA  . GLU B 1 67  ? 59.771  48.680  9.564   1.00 30.77 ? 67  GLU B CA  1 
ATOM 1401  C C   . GLU B 1 67  ? 59.074  48.822  10.899  1.00 30.98 ? 67  GLU B C   1 
ATOM 1402  O O   . GLU B 1 67  ? 59.604  49.382  11.849  1.00 30.76 ? 67  GLU B O   1 
ATOM 1403  C CB  . GLU B 1 67  ? 59.576  49.940  8.732   1.00 31.89 ? 67  GLU B CB  1 
ATOM 1404  C CG  . GLU B 1 67  ? 60.649  50.994  8.978   1.00 32.93 ? 67  GLU B CG  1 
ATOM 1405  C CD  . GLU B 1 67  ? 62.046  50.491  8.651   1.00 33.94 ? 67  GLU B CD  1 
ATOM 1406  O OE1 . GLU B 1 67  ? 62.225  49.819  7.607   1.00 35.49 ? 67  GLU B OE1 1 
ATOM 1407  O OE2 . GLU B 1 67  ? 62.970  50.772  9.440   1.00 36.09 ? 67  GLU B OE2 1 
ATOM 1408  N N   . GLU B 1 68  ? 57.857  48.303  10.941  1.00 32.72 ? 68  GLU B N   1 
ATOM 1409  C CA  . GLU B 1 68  ? 57.030  48.289  12.141  1.00 33.86 ? 68  GLU B CA  1 
ATOM 1410  C C   . GLU B 1 68  ? 55.863  47.361  11.801  1.00 32.64 ? 68  GLU B C   1 
ATOM 1411  O O   . GLU B 1 68  ? 55.717  46.946  10.647  1.00 32.58 ? 68  GLU B O   1 
ATOM 1412  C CB  . GLU B 1 68  ? 56.561  49.704  12.536  1.00 35.04 ? 68  GLU B CB  1 
ATOM 1413  C CG  . GLU B 1 68  ? 55.383  50.267  11.781  1.00 38.42 ? 68  GLU B CG  1 
ATOM 1414  C CD  . GLU B 1 68  ? 54.821  51.505  12.472  1.00 40.96 ? 68  GLU B CD  1 
ATOM 1415  O OE1 . GLU B 1 68  ? 54.599  51.442  13.704  1.00 42.73 ? 68  GLU B OE1 1 
ATOM 1416  O OE2 . GLU B 1 68  ? 54.594  52.533  11.795  1.00 42.27 ? 68  GLU B OE2 1 
ATOM 1417  N N   . ARG B 1 69  ? 55.056  47.012  12.792  1.00 30.97 ? 69  ARG B N   1 
ATOM 1418  C CA  . ARG B 1 69  ? 53.947  46.099  12.571  1.00 29.83 ? 69  ARG B CA  1 
ATOM 1419  C C   . ARG B 1 69  ? 53.118  46.398  11.313  1.00 29.29 ? 69  ARG B C   1 
ATOM 1420  O O   . ARG B 1 69  ? 52.679  47.534  11.088  1.00 28.63 ? 69  ARG B O   1 
ATOM 1421  C CB  . ARG B 1 69  ? 53.064  46.101  13.817  1.00 30.85 ? 69  ARG B CB  1 
ATOM 1422  C CG  . ARG B 1 69  ? 52.048  44.988  13.902  1.00 32.23 ? 69  ARG B CG  1 
ATOM 1423  C CD  . ARG B 1 69  ? 51.187  45.197  15.125  1.00 34.45 ? 69  ARG B CD  1 
ATOM 1424  N NE  . ARG B 1 69  ? 49.822  44.752  14.879  1.00 39.25 ? 69  ARG B NE  1 
ATOM 1425  C CZ  . ARG B 1 69  ? 48.749  45.287  15.450  1.00 40.54 ? 69  ARG B CZ  1 
ATOM 1426  N NH1 . ARG B 1 69  ? 48.885  46.290  16.306  1.00 41.07 ? 69  ARG B NH1 1 
ATOM 1427  N NH2 . ARG B 1 69  ? 47.537  44.824  15.157  1.00 43.62 ? 69  ARG B NH2 1 
ATOM 1428  N N   . GLY B 1 70  ? 52.922  45.375  10.483  1.00 27.69 ? 70  GLY B N   1 
ATOM 1429  C CA  . GLY B 1 70  ? 52.132  45.548  9.279   1.00 26.12 ? 70  GLY B CA  1 
ATOM 1430  C C   . GLY B 1 70  ? 52.671  46.497  8.221   1.00 25.19 ? 70  GLY B C   1 
ATOM 1431  O O   . GLY B 1 70  ? 52.037  46.669  7.163   1.00 24.40 ? 70  GLY B O   1 
ATOM 1432  N N   . VAL B 1 71  ? 53.820  47.122  8.480   1.00 24.21 ? 71  VAL B N   1 
ATOM 1433  C CA  . VAL B 1 71  ? 54.400  48.037  7.495   1.00 24.76 ? 71  VAL B CA  1 
ATOM 1434  C C   . VAL B 1 71  ? 55.761  47.537  7.000   1.00 25.59 ? 71  VAL B C   1 
ATOM 1435  O O   . VAL B 1 71  ? 56.612  47.116  7.797   1.00 25.71 ? 71  VAL B O   1 
ATOM 1436  C CB  . VAL B 1 71  ? 54.530  49.470  8.055   1.00 24.73 ? 71  VAL B CB  1 
ATOM 1437  C CG1 . VAL B 1 71  ? 55.132  50.377  6.999   1.00 23.99 ? 71  VAL B CG1 1 
ATOM 1438  C CG2 . VAL B 1 71  ? 53.150  50.004  8.465   1.00 23.68 ? 71  VAL B CG2 1 
ATOM 1439  N N   . VAL B 1 72  ? 55.968  47.578  5.681   1.00 24.74 ? 72  VAL B N   1 
ATOM 1440  C CA  . VAL B 1 72  ? 57.221  47.069  5.112   1.00 24.93 ? 72  VAL B CA  1 
ATOM 1441  C C   . VAL B 1 72  ? 57.843  47.907  3.994   1.00 24.75 ? 72  VAL B C   1 
ATOM 1442  O O   . VAL B 1 72  ? 57.234  48.847  3.472   1.00 24.50 ? 72  VAL B O   1 
ATOM 1443  C CB  . VAL B 1 72  ? 57.038  45.624  4.526   1.00 25.02 ? 72  VAL B CB  1 
ATOM 1444  C CG1 . VAL B 1 72  ? 56.286  44.735  5.500   1.00 23.94 ? 72  VAL B CG1 1 
ATOM 1445  C CG2 . VAL B 1 72  ? 56.298  45.689  3.190   1.00 25.00 ? 72  VAL B CG2 1 
ATOM 1446  N N   . SER B 1 73  ? 59.075  47.556  3.647   1.00 24.09 ? 73  SER B N   1 
ATOM 1447  C CA  . SER B 1 73  ? 59.766  48.211  2.548   1.00 25.08 ? 73  SER B CA  1 
ATOM 1448  C C   . SER B 1 73  ? 60.010  47.056  1.585   1.00 26.00 ? 73  SER B C   1 
ATOM 1449  O O   . SER B 1 73  ? 60.062  45.889  1.994   1.00 27.57 ? 73  SER B O   1 
ATOM 1450  C CB  . SER B 1 73  ? 61.076  48.879  3.006   1.00 24.63 ? 73  SER B CB  1 
ATOM 1451  O OG  . SER B 1 73  ? 62.042  47.956  3.455   1.00 24.25 ? 73  SER B OG  1 
ATOM 1452  N N   . ILE B 1 74  ? 60.116  47.361  0.305   1.00 26.15 ? 74  ILE B N   1 
ATOM 1453  C CA  . ILE B 1 74  ? 60.312  46.324  -0.690  1.00 27.22 ? 74  ILE B CA  1 
ATOM 1454  C C   . ILE B 1 74  ? 61.553  46.694  -1.489  1.00 29.07 ? 74  ILE B C   1 
ATOM 1455  O O   . ILE B 1 74  ? 61.558  47.661  -2.241  1.00 29.11 ? 74  ILE B O   1 
ATOM 1456  C CB  . ILE B 1 74  ? 59.086  46.244  -1.618  1.00 27.03 ? 74  ILE B CB  1 
ATOM 1457  C CG1 . ILE B 1 74  ? 57.825  45.991  -0.774  1.00 26.24 ? 74  ILE B CG1 1 
ATOM 1458  C CG2 . ILE B 1 74  ? 59.301  45.151  -2.674  1.00 26.61 ? 74  ILE B CG2 1 
ATOM 1459  C CD1 . ILE B 1 74  ? 56.503  46.296  -1.481  1.00 23.51 ? 74  ILE B CD1 1 
ATOM 1460  N N   . LYS B 1 75  ? 62.615  45.922  -1.322  1.00 30.90 ? 75  LYS B N   1 
ATOM 1461  C CA  . LYS B 1 75  ? 63.853  46.227  -2.010  1.00 32.74 ? 75  LYS B CA  1 
ATOM 1462  C C   . LYS B 1 75  ? 64.164  45.260  -3.120  1.00 33.98 ? 75  LYS B C   1 
ATOM 1463  O O   . LYS B 1 75  ? 64.180  44.051  -2.895  1.00 34.02 ? 75  LYS B O   1 
ATOM 1464  C CB  . LYS B 1 75  ? 65.013  46.220  -1.017  1.00 33.27 ? 75  LYS B CB  1 
ATOM 1465  C CG  . LYS B 1 75  ? 66.353  46.587  -1.623  1.00 34.25 ? 75  LYS B CG  1 
ATOM 1466  C CD  . LYS B 1 75  ? 67.428  46.651  -0.559  1.00 35.01 ? 75  LYS B CD  1 
ATOM 1467  C CE  . LYS B 1 75  ? 68.747  47.101  -1.152  1.00 37.07 ? 75  LYS B CE  1 
ATOM 1468  N NZ  . LYS B 1 75  ? 69.799  47.275  -0.104  1.00 38.76 ? 75  LYS B NZ  1 
ATOM 1469  N N   . GLY B 1 76  ? 64.406  45.795  -4.317  1.00 34.90 ? 76  GLY B N   1 
ATOM 1470  C CA  . GLY B 1 76  ? 64.777  44.948  -5.436  1.00 35.91 ? 76  GLY B CA  1 
ATOM 1471  C C   . GLY B 1 76  ? 66.218  44.571  -5.129  1.00 36.62 ? 76  GLY B C   1 
ATOM 1472  O O   . GLY B 1 76  ? 67.088  45.437  -5.102  1.00 36.48 ? 76  GLY B O   1 
ATOM 1473  N N   . VAL B 1 77  ? 66.477  43.296  -4.868  1.00 37.54 ? 77  VAL B N   1 
ATOM 1474  C CA  . VAL B 1 77  ? 67.829  42.881  -4.531  1.00 39.07 ? 77  VAL B CA  1 
ATOM 1475  C C   . VAL B 1 77  ? 68.861  43.338  -5.541  1.00 40.53 ? 77  VAL B C   1 
ATOM 1476  O O   . VAL B 1 77  ? 69.806  44.032  -5.176  1.00 42.52 ? 77  VAL B O   1 
ATOM 1477  C CB  . VAL B 1 77  ? 67.955  41.358  -4.381  1.00 39.31 ? 77  VAL B CB  1 
ATOM 1478  C CG1 . VAL B 1 77  ? 69.398  40.998  -4.110  1.00 38.40 ? 77  VAL B CG1 1 
ATOM 1479  C CG2 . VAL B 1 77  ? 67.085  40.874  -3.233  1.00 39.58 ? 77  VAL B CG2 1 
ATOM 1480  N N   . SER B 1 78  ? 68.698  42.960  -6.803  1.00 41.41 ? 78  SER B N   1 
ATOM 1481  C CA  . SER B 1 78  ? 69.658  43.364  -7.829  1.00 42.72 ? 78  SER B CA  1 
ATOM 1482  C C   . SER B 1 78  ? 69.756  44.868  -7.943  1.00 43.36 ? 78  SER B C   1 
ATOM 1483  O O   . SER B 1 78  ? 70.805  45.440  -7.692  1.00 44.06 ? 78  SER B O   1 
ATOM 1484  C CB  . SER B 1 78  ? 69.291  42.788  -9.198  1.00 43.16 ? 78  SER B CB  1 
ATOM 1485  O OG  . SER B 1 78  ? 69.849  41.500  -9.379  1.00 44.53 ? 78  SER B OG  1 
ATOM 1486  N N   . ALA B 1 79  ? 68.655  45.506  -8.323  1.00 44.99 ? 79  ALA B N   1 
ATOM 1487  C CA  . ALA B 1 79  ? 68.627  46.952  -8.482  1.00 46.18 ? 79  ALA B CA  1 
ATOM 1488  C C   . ALA B 1 79  ? 69.120  47.672  -7.233  1.00 47.08 ? 79  ALA B C   1 
ATOM 1489  O O   . ALA B 1 79  ? 69.474  48.848  -7.287  1.00 48.07 ? 79  ALA B O   1 
ATOM 1490  C CB  . ALA B 1 79  ? 67.220  47.410  -8.816  1.00 46.95 ? 79  ALA B CB  1 
ATOM 1491  N N   . ASN B 1 80  ? 69.161  46.958  -6.116  1.00 47.17 ? 80  ASN B N   1 
ATOM 1492  C CA  . ASN B 1 80  ? 69.574  47.535  -4.846  1.00 47.11 ? 80  ASN B CA  1 
ATOM 1493  C C   . ASN B 1 80  ? 68.858  48.865  -4.610  1.00 47.39 ? 80  ASN B C   1 
ATOM 1494  O O   . ASN B 1 80  ? 69.440  49.835  -4.121  1.00 47.11 ? 80  ASN B O   1 
ATOM 1495  C CB  . ASN B 1 80  ? 71.078  47.745  -4.796  1.00 47.31 ? 80  ASN B CB  1 
ATOM 1496  C CG  . ASN B 1 80  ? 71.569  48.027  -3.386  1.00 49.19 ? 80  ASN B CG  1 
ATOM 1497  O OD1 . ASN B 1 80  ? 71.325  47.242  -2.464  1.00 49.46 ? 80  ASN B OD1 1 
ATOM 1498  N ND2 . ASN B 1 80  ? 72.258  49.151  -3.208  1.00 49.98 ? 80  ASN B ND2 1 
ATOM 1499  N N   . ARG B 1 81  ? 67.580  48.896  -4.975  1.00 47.17 ? 81  ARG B N   1 
ATOM 1500  C CA  . ARG B 1 81  ? 66.750  50.074  -4.789  1.00 47.21 ? 81  ARG B CA  1 
ATOM 1501  C C   . ARG B 1 81  ? 65.455  49.678  -4.071  1.00 46.53 ? 81  ARG B C   1 
ATOM 1502  O O   . ARG B 1 81  ? 65.051  48.508  -4.074  1.00 45.72 ? 81  ARG B O   1 
ATOM 1503  C CB  . ARG B 1 81  ? 66.433  50.715  -6.134  1.00 48.83 ? 81  ARG B CB  1 
ATOM 1504  C CG  . ARG B 1 81  ? 67.607  51.395  -6.807  1.00 50.82 ? 81  ARG B CG  1 
ATOM 1505  C CD  . ARG B 1 81  ? 67.340  51.505  -8.300  1.00 54.14 ? 81  ARG B CD  1 
ATOM 1506  N NE  . ARG B 1 81  ? 68.296  52.370  -8.988  1.00 57.89 ? 81  ARG B NE  1 
ATOM 1507  C CZ  . ARG B 1 81  ? 68.293  53.698  -8.921  1.00 58.75 ? 81  ARG B CZ  1 
ATOM 1508  N NH1 . ARG B 1 81  ? 67.381  54.327  -8.194  1.00 59.98 ? 81  ARG B NH1 1 
ATOM 1509  N NH2 . ARG B 1 81  ? 69.200  54.400  -9.585  1.00 59.51 ? 81  ARG B NH2 1 
ATOM 1510  N N   . TYR B 1 82  ? 64.814  50.658  -3.445  1.00 45.84 ? 82  TYR B N   1 
ATOM 1511  C CA  . TYR B 1 82  ? 63.575  50.412  -2.716  1.00 44.48 ? 82  TYR B CA  1 
ATOM 1512  C C   . TYR B 1 82  ? 62.353  50.904  -3.475  1.00 43.30 ? 82  TYR B C   1 
ATOM 1513  O O   . TYR B 1 82  ? 62.354  51.996  -4.036  1.00 43.81 ? 82  TYR B O   1 
ATOM 1514  C CB  . TYR B 1 82  ? 63.614  51.082  -1.346  1.00 44.40 ? 82  TYR B CB  1 
ATOM 1515  C CG  . TYR B 1 82  ? 64.720  50.571  -0.461  1.00 45.43 ? 82  TYR B CG  1 
ATOM 1516  C CD1 . TYR B 1 82  ? 66.041  51.010  -0.631  1.00 45.85 ? 82  TYR B CD1 1 
ATOM 1517  C CD2 . TYR B 1 82  ? 64.451  49.664  0.568   1.00 45.27 ? 82  TYR B CD2 1 
ATOM 1518  C CE1 . TYR B 1 82  ? 67.073  50.561  0.214   1.00 45.67 ? 82  TYR B CE1 1 
ATOM 1519  C CE2 . TYR B 1 82  ? 65.470  49.208  1.416   1.00 46.29 ? 82  TYR B CE2 1 
ATOM 1520  C CZ  . TYR B 1 82  ? 66.776  49.663  1.235   1.00 46.52 ? 82  TYR B CZ  1 
ATOM 1521  O OH  . TYR B 1 82  ? 67.766  49.229  2.083   1.00 46.96 ? 82  TYR B OH  1 
ATOM 1522  N N   . LEU B 1 83  ? 61.309  50.085  -3.497  1.00 42.07 ? 83  LEU B N   1 
ATOM 1523  C CA  . LEU B 1 83  ? 60.084  50.452  -4.181  1.00 39.80 ? 83  LEU B CA  1 
ATOM 1524  C C   . LEU B 1 83  ? 59.554  51.678  -3.481  1.00 39.10 ? 83  LEU B C   1 
ATOM 1525  O O   . LEU B 1 83  ? 59.615  51.772  -2.254  1.00 38.90 ? 83  LEU B O   1 
ATOM 1526  C CB  . LEU B 1 83  ? 59.049  49.332  -4.097  1.00 40.37 ? 83  LEU B CB  1 
ATOM 1527  C CG  . LEU B 1 83  ? 57.740  49.717  -4.790  1.00 40.72 ? 83  LEU B CG  1 
ATOM 1528  C CD1 . LEU B 1 83  ? 57.953  49.652  -6.287  1.00 40.28 ? 83  LEU B CD1 1 
ATOM 1529  C CD2 . LEU B 1 83  ? 56.606  48.801  -4.371  1.00 40.45 ? 83  LEU B CD2 1 
ATOM 1530  N N   . ALA B 1 84  ? 59.035  52.617  -4.262  1.00 39.00 ? 84  ALA B N   1 
ATOM 1531  C CA  . ALA B 1 84  ? 58.499  53.852  -3.714  1.00 39.47 ? 84  ALA B CA  1 
ATOM 1532  C C   . ALA B 1 84  ? 57.375  54.402  -4.578  1.00 39.90 ? 84  ALA B C   1 
ATOM 1533  O O   . ALA B 1 84  ? 57.356  54.209  -5.793  1.00 39.88 ? 84  ALA B O   1 
ATOM 1534  C CB  . ALA B 1 84  ? 59.609  54.878  -3.586  1.00 38.90 ? 84  ALA B CB  1 
ATOM 1535  N N   . MET B 1 85  ? 56.426  55.077  -3.941  1.00 40.70 ? 85  MET B N   1 
ATOM 1536  C CA  . MET B 1 85  ? 55.319  55.663  -4.670  1.00 42.04 ? 85  MET B CA  1 
ATOM 1537  C C   . MET B 1 85  ? 55.336  57.167  -4.443  1.00 42.65 ? 85  MET B C   1 
ATOM 1538  O O   . MET B 1 85  ? 55.136  57.639  -3.320  1.00 41.61 ? 85  MET B O   1 
ATOM 1539  C CB  . MET B 1 85  ? 53.988  55.082  -4.210  1.00 42.27 ? 85  MET B CB  1 
ATOM 1540  C CG  . MET B 1 85  ? 52.873  55.336  -5.214  1.00 42.77 ? 85  MET B CG  1 
ATOM 1541  S SD  . MET B 1 85  ? 51.256  55.194  -4.490  1.00 43.11 ? 85  MET B SD  1 
ATOM 1542  C CE  . MET B 1 85  ? 50.954  53.453  -4.724  1.00 44.08 ? 85  MET B CE  1 
ATOM 1543  N N   . LYS B 1 86  ? 55.573  57.909  -5.525  1.00 43.75 ? 86  LYS B N   1 
ATOM 1544  C CA  . LYS B 1 86  ? 55.652  59.367  -5.483  1.00 44.52 ? 86  LYS B CA  1 
ATOM 1545  C C   . LYS B 1 86  ? 54.299  60.062  -5.333  1.00 45.19 ? 86  LYS B C   1 
ATOM 1546  O O   . LYS B 1 86  ? 53.241  59.448  -5.496  1.00 45.25 ? 86  LYS B O   1 
ATOM 1547  C CB  . LYS B 1 86  ? 56.364  59.880  -6.739  1.00 43.94 ? 86  LYS B CB  1 
ATOM 1548  N N   . GLU B 1 87  ? 54.353  61.352  -5.015  1.00 45.92 ? 87  GLU B N   1 
ATOM 1549  C CA  . GLU B 1 87  ? 53.161  62.179  -4.826  1.00 46.96 ? 87  GLU B CA  1 
ATOM 1550  C C   . GLU B 1 87  ? 52.079  61.981  -5.901  1.00 47.97 ? 87  GLU B C   1 
ATOM 1551  O O   . GLU B 1 87  ? 50.892  61.903  -5.587  1.00 48.60 ? 87  GLU B O   1 
ATOM 1552  C CB  . GLU B 1 87  ? 53.564  63.659  -4.766  1.00 46.15 ? 87  GLU B CB  1 
ATOM 1553  N N   . ASP B 1 88  ? 52.486  61.896  -7.163  1.00 48.69 ? 88  ASP B N   1 
ATOM 1554  C CA  . ASP B 1 88  ? 51.528  61.722  -8.253  1.00 49.82 ? 88  ASP B CA  1 
ATOM 1555  C C   . ASP B 1 88  ? 50.921  60.321  -8.361  1.00 49.76 ? 88  ASP B C   1 
ATOM 1556  O O   . ASP B 1 88  ? 49.917  60.126  -9.050  1.00 50.07 ? 88  ASP B O   1 
ATOM 1557  C CB  . ASP B 1 88  ? 52.171  62.130  -9.589  1.00 51.40 ? 88  ASP B CB  1 
ATOM 1558  C CG  . ASP B 1 88  ? 53.524  61.469  -9.827  1.00 53.73 ? 88  ASP B CG  1 
ATOM 1559  O OD1 . ASP B 1 88  ? 54.189  61.827  -10.825 1.00 55.07 ? 88  ASP B OD1 1 
ATOM 1560  O OD2 . ASP B 1 88  ? 53.927  60.594  -9.026  1.00 54.84 ? 88  ASP B OD2 1 
ATOM 1561  N N   . GLY B 1 89  ? 51.516  59.348  -7.677  1.00 49.51 ? 89  GLY B N   1 
ATOM 1562  C CA  . GLY B 1 89  ? 51.003  57.990  -7.732  1.00 48.44 ? 89  GLY B CA  1 
ATOM 1563  C C   . GLY B 1 89  ? 51.885  57.094  -8.579  1.00 48.13 ? 89  GLY B C   1 
ATOM 1564  O O   . GLY B 1 89  ? 51.627  55.898  -8.710  1.00 47.77 ? 89  GLY B O   1 
ATOM 1565  N N   . ARG B 1 90  ? 52.926  57.682  -9.160  1.00 47.55 ? 90  ARG B N   1 
ATOM 1566  C CA  . ARG B 1 90  ? 53.872  56.952  -9.994  1.00 47.77 ? 90  ARG B CA  1 
ATOM 1567  C C   . ARG B 1 90  ? 54.721  56.032  -9.112  1.00 48.24 ? 90  ARG B C   1 
ATOM 1568  O O   . ARG B 1 90  ? 54.981  56.336  -7.941  1.00 47.65 ? 90  ARG B O   1 
ATOM 1569  C CB  . ARG B 1 90  ? 54.779  57.937  -10.746 1.00 47.15 ? 90  ARG B CB  1 
ATOM 1570  N N   . LEU B 1 91  ? 55.158  54.913  -9.679  1.00 48.55 ? 91  LEU B N   1 
ATOM 1571  C CA  . LEU B 1 91  ? 55.960  53.940  -8.951  1.00 48.90 ? 91  LEU B CA  1 
ATOM 1572  C C   . LEU B 1 91  ? 57.390  53.913  -9.487  1.00 49.90 ? 91  LEU B C   1 
ATOM 1573  O O   . LEU B 1 91  ? 57.604  53.842  -10.701 1.00 50.92 ? 91  LEU B O   1 
ATOM 1574  C CB  . LEU B 1 91  ? 55.320  52.561  -9.119  1.00 48.35 ? 91  LEU B CB  1 
ATOM 1575  C CG  . LEU B 1 91  ? 55.040  51.643  -7.929  1.00 47.15 ? 91  LEU B CG  1 
ATOM 1576  C CD1 . LEU B 1 91  ? 54.153  52.331  -6.922  1.00 46.38 ? 91  LEU B CD1 1 
ATOM 1577  C CD2 . LEU B 1 91  ? 54.372  50.377  -8.452  1.00 46.48 ? 91  LEU B CD2 1 
ATOM 1578  N N   . LEU B 1 92  ? 58.363  53.962  -8.582  1.00 50.10 ? 92  LEU B N   1 
ATOM 1579  C CA  . LEU B 1 92  ? 59.776  53.922  -8.961  1.00 49.72 ? 92  LEU B CA  1 
ATOM 1580  C C   . LEU B 1 92  ? 60.612  53.326  -7.829  1.00 49.18 ? 92  LEU B C   1 
ATOM 1581  O O   . LEU B 1 92  ? 60.112  53.096  -6.731  1.00 49.54 ? 92  LEU B O   1 
ATOM 1582  C CB  . LEU B 1 92  ? 60.268  55.330  -9.304  1.00 50.37 ? 92  LEU B CB  1 
ATOM 1583  C CG  . LEU B 1 92  ? 60.074  56.407  -8.234  1.00 51.02 ? 92  LEU B CG  1 
ATOM 1584  C CD1 . LEU B 1 92  ? 61.224  56.370  -7.232  1.00 51.26 ? 92  LEU B CD1 1 
ATOM 1585  C CD2 . LEU B 1 92  ? 60.010  57.766  -8.906  1.00 51.33 ? 92  LEU B CD2 1 
ATOM 1586  N N   . ALA B 1 93  ? 61.886  53.077  -8.095  1.00 48.57 ? 93  ALA B N   1 
ATOM 1587  C CA  . ALA B 1 93  ? 62.764  52.500  -7.085  1.00 48.21 ? 93  ALA B CA  1 
ATOM 1588  C C   . ALA B 1 93  ? 63.916  53.444  -6.772  1.00 48.36 ? 93  ALA B C   1 
ATOM 1589  O O   . ALA B 1 93  ? 64.720  53.752  -7.648  1.00 48.32 ? 93  ALA B O   1 
ATOM 1590  C CB  . ALA B 1 93  ? 63.307  51.172  -7.579  1.00 48.32 ? 93  ALA B CB  1 
ATOM 1591  N N   . SER B 1 94  ? 64.000  53.894  -5.524  1.00 47.74 ? 94  SER B N   1 
ATOM 1592  C CA  . SER B 1 94  ? 65.063  54.809  -5.125  1.00 47.41 ? 94  SER B CA  1 
ATOM 1593  C C   . SER B 1 94  ? 66.231  54.104  -4.436  1.00 47.21 ? 94  SER B C   1 
ATOM 1594  O O   . SER B 1 94  ? 66.041  53.110  -3.721  1.00 46.54 ? 94  SER B O   1 
ATOM 1595  C CB  . SER B 1 94  ? 64.509  55.890  -4.195  1.00 47.85 ? 94  SER B CB  1 
ATOM 1596  O OG  . SER B 1 94  ? 63.996  55.335  -3.000  1.00 47.47 ? 94  SER B OG  1 
ATOM 1597  N N   . LYS B 1 95  ? 67.439  54.628  -4.653  1.00 46.47 ? 95  LYS B N   1 
ATOM 1598  C CA  . LYS B 1 95  ? 68.639  54.049  -4.040  1.00 45.91 ? 95  LYS B CA  1 
ATOM 1599  C C   . LYS B 1 95  ? 68.598  54.256  -2.532  1.00 44.55 ? 95  LYS B C   1 
ATOM 1600  O O   . LYS B 1 95  ? 69.100  53.439  -1.773  1.00 43.08 ? 95  LYS B O   1 
ATOM 1601  C CB  . LYS B 1 95  ? 69.920  54.689  -4.599  1.00 45.30 ? 95  LYS B CB  1 
ATOM 1602  N N   . SER B 1 96  ? 67.979  55.348  -2.103  1.00 44.27 ? 96  SER B N   1 
ATOM 1603  C CA  . SER B 1 96  ? 67.893  55.642  -0.685  1.00 44.68 ? 96  SER B CA  1 
ATOM 1604  C C   . SER B 1 96  ? 66.472  55.605  -0.115  1.00 44.90 ? 96  SER B C   1 
ATOM 1605  O O   . SER B 1 96  ? 65.544  56.200  -0.674  1.00 45.30 ? 96  SER B O   1 
ATOM 1606  C CB  . SER B 1 96  ? 68.515  57.003  -0.416  1.00 45.16 ? 96  SER B CB  1 
ATOM 1607  O OG  . SER B 1 96  ? 68.275  57.392  0.919   1.00 48.15 ? 96  SER B OG  1 
ATOM 1608  N N   . VAL B 1 97  ? 66.318  54.909  1.009   1.00 44.16 ? 97  VAL B N   1 
ATOM 1609  C CA  . VAL B 1 97  ? 65.025  54.774  1.681   1.00 43.22 ? 97  VAL B CA  1 
ATOM 1610  C C   . VAL B 1 97  ? 64.456  56.104  2.149   1.00 42.15 ? 97  VAL B C   1 
ATOM 1611  O O   . VAL B 1 97  ? 65.110  56.853  2.865   1.00 41.97 ? 97  VAL B O   1 
ATOM 1612  C CB  . VAL B 1 97  ? 65.126  53.854  2.923   1.00 43.76 ? 97  VAL B CB  1 
ATOM 1613  C CG1 . VAL B 1 97  ? 63.815  53.878  3.707   1.00 43.27 ? 97  VAL B CG1 1 
ATOM 1614  C CG2 . VAL B 1 97  ? 65.471  52.433  2.492   1.00 43.75 ? 97  VAL B CG2 1 
ATOM 1615  N N   . THR B 1 98  ? 63.228  56.392  1.743   1.00 42.24 ? 98  THR B N   1 
ATOM 1616  C CA  . THR B 1 98  ? 62.564  57.627  2.150   1.00 42.35 ? 98  THR B CA  1 
ATOM 1617  C C   . THR B 1 98  ? 61.225  57.236  2.771   1.00 41.99 ? 98  THR B C   1 
ATOM 1618  O O   . THR B 1 98  ? 60.938  56.052  2.935   1.00 41.80 ? 98  THR B O   1 
ATOM 1619  C CB  . THR B 1 98  ? 62.324  58.579  0.954   1.00 41.74 ? 98  THR B CB  1 
ATOM 1620  O OG1 . THR B 1 98  ? 61.040  58.317  0.374   1.00 41.59 ? 98  THR B OG1 1 
ATOM 1621  C CG2 . THR B 1 98  ? 63.401  58.374  -0.105  1.00 41.02 ? 98  THR B CG2 1 
ATOM 1622  N N   . ASP B 1 99  ? 60.402  58.213  3.119   1.00 42.65 ? 99  ASP B N   1 
ATOM 1623  C CA  . ASP B 1 99  ? 59.118  57.896  3.733   1.00 44.07 ? 99  ASP B CA  1 
ATOM 1624  C C   . ASP B 1 99  ? 58.061  57.434  2.714   1.00 43.65 ? 99  ASP B C   1 
ATOM 1625  O O   . ASP B 1 99  ? 56.923  57.139  3.073   1.00 43.42 ? 99  ASP B O   1 
ATOM 1626  C CB  . ASP B 1 99  ? 58.620  59.099  4.553   1.00 46.04 ? 99  ASP B CB  1 
ATOM 1627  C CG  . ASP B 1 99  ? 58.577  60.385  3.741   1.00 48.62 ? 99  ASP B CG  1 
ATOM 1628  O OD1 . ASP B 1 99  ? 59.561  60.671  3.015   1.00 50.84 ? 99  ASP B OD1 1 
ATOM 1629  O OD2 . ASP B 1 99  ? 57.566  61.113  3.835   1.00 48.77 ? 99  ASP B OD2 1 
ATOM 1630  N N   . GLU B 1 100 ? 58.453  57.355  1.447   1.00 43.18 ? 100 GLU B N   1 
ATOM 1631  C CA  . GLU B 1 100 ? 57.549  56.907  0.392   1.00 42.39 ? 100 GLU B CA  1 
ATOM 1632  C C   . GLU B 1 100 ? 57.893  55.473  0.001   1.00 41.25 ? 100 GLU B C   1 
ATOM 1633  O O   . GLU B 1 100 ? 57.403  54.963  -1.004  1.00 40.95 ? 100 GLU B O   1 
ATOM 1634  C CB  . GLU B 1 100 ? 57.663  57.814  -0.844  1.00 43.05 ? 100 GLU B CB  1 
ATOM 1635  C CG  . GLU B 1 100 ? 57.269  59.273  -0.597  1.00 44.38 ? 100 GLU B CG  1 
ATOM 1636  C CD  . GLU B 1 100 ? 57.469  60.173  -1.821  1.00 44.49 ? 100 GLU B CD  1 
ATOM 1637  O OE1 . GLU B 1 100 ? 58.578  60.168  -2.403  1.00 44.31 ? 100 GLU B OE1 1 
ATOM 1638  O OE2 . GLU B 1 100 ? 56.518  60.894  -2.193  1.00 44.00 ? 100 GLU B OE2 1 
ATOM 1639  N N   . CYS B 1 101 ? 58.742  54.833  0.798   1.00 39.73 ? 101 CYS B N   1 
ATOM 1640  C CA  . CYS B 1 101 ? 59.154  53.452  0.540   1.00 39.01 ? 101 CYS B CA  1 
ATOM 1641  C C   . CYS B 1 101 ? 58.515  52.462  1.516   1.00 37.86 ? 101 CYS B C   1 
ATOM 1642  O O   . CYS B 1 101 ? 58.971  51.326  1.651   1.00 36.88 ? 101 CYS B O   1 
ATOM 1643  C CB  . CYS B 1 101 ? 60.671  53.338  0.640   1.00 39.52 ? 101 CYS B CB  1 
ATOM 1644  S SG  . CYS B 1 101 ? 61.539  54.466  -0.448  1.00 39.42 ? 101 CYS B SG  1 
ATOM 1645  N N   . PHE B 1 102 ? 57.458  52.903  2.188   1.00 36.59 ? 102 PHE B N   1 
ATOM 1646  C CA  . PHE B 1 102 ? 56.763  52.076  3.160   1.00 36.21 ? 102 PHE B CA  1 
ATOM 1647  C C   . PHE B 1 102 ? 55.314  51.812  2.775   1.00 35.62 ? 102 PHE B C   1 
ATOM 1648  O O   . PHE B 1 102 ? 54.580  52.736  2.396   1.00 36.43 ? 102 PHE B O   1 
ATOM 1649  C CB  . PHE B 1 102 ? 56.858  52.733  4.538   1.00 36.12 ? 102 PHE B CB  1 
ATOM 1650  C CG  . PHE B 1 102 ? 58.257  52.774  5.062   1.00 37.05 ? 102 PHE B CG  1 
ATOM 1651  C CD1 . PHE B 1 102 ? 58.913  51.595  5.393   1.00 36.95 ? 102 PHE B CD1 1 
ATOM 1652  C CD2 . PHE B 1 102 ? 58.957  53.975  5.138   1.00 37.34 ? 102 PHE B CD2 1 
ATOM 1653  C CE1 . PHE B 1 102 ? 60.242  51.612  5.783   1.00 37.64 ? 102 PHE B CE1 1 
ATOM 1654  C CE2 . PHE B 1 102 ? 60.287  54.001  5.527   1.00 36.60 ? 102 PHE B CE2 1 
ATOM 1655  C CZ  . PHE B 1 102 ? 60.932  52.821  5.848   1.00 37.53 ? 102 PHE B CZ  1 
ATOM 1656  N N   . PHE B 1 103 ? 54.911  50.545  2.876   1.00 32.77 ? 103 PHE B N   1 
ATOM 1657  C CA  . PHE B 1 103 ? 53.561  50.144  2.508   1.00 31.91 ? 103 PHE B CA  1 
ATOM 1658  C C   . PHE B 1 103 ? 52.930  49.225  3.533   1.00 31.44 ? 103 PHE B C   1 
ATOM 1659  O O   . PHE B 1 103 ? 53.610  48.380  4.124   1.00 32.41 ? 103 PHE B O   1 
ATOM 1660  C CB  . PHE B 1 103 ? 53.606  49.440  1.158   1.00 31.36 ? 103 PHE B CB  1 
ATOM 1661  C CG  . PHE B 1 103 ? 54.408  50.180  0.128   1.00 31.99 ? 103 PHE B CG  1 
ATOM 1662  C CD1 . PHE B 1 103 ? 53.836  51.204  -0.624  1.00 32.07 ? 103 PHE B CD1 1 
ATOM 1663  C CD2 . PHE B 1 103 ? 55.752  49.889  -0.058  1.00 30.78 ? 103 PHE B CD2 1 
ATOM 1664  C CE1 . PHE B 1 103 ? 54.603  51.925  -1.546  1.00 30.77 ? 103 PHE B CE1 1 
ATOM 1665  C CE2 . PHE B 1 103 ? 56.516  50.605  -0.975  1.00 30.67 ? 103 PHE B CE2 1 
ATOM 1666  C CZ  . PHE B 1 103 ? 55.945  51.620  -1.717  1.00 29.29 ? 103 PHE B CZ  1 
ATOM 1667  N N   . PHE B 1 104 ? 51.635  49.403  3.767   1.00 30.33 ? 104 PHE B N   1 
ATOM 1668  C CA  . PHE B 1 104 ? 50.934  48.525  4.697   1.00 30.20 ? 104 PHE B CA  1 
ATOM 1669  C C   . PHE B 1 104 ? 50.760  47.213  3.954   1.00 29.62 ? 104 PHE B C   1 
ATOM 1670  O O   . PHE B 1 104 ? 50.212  47.193  2.853   1.00 27.99 ? 104 PHE B O   1 
ATOM 1671  C CB  . PHE B 1 104 ? 49.542  49.064  5.054   1.00 29.62 ? 104 PHE B CB  1 
ATOM 1672  C CG  . PHE B 1 104 ? 49.559  50.245  5.979   1.00 28.99 ? 104 PHE B CG  1 
ATOM 1673  C CD1 . PHE B 1 104 ? 49.124  51.492  5.540   1.00 28.14 ? 104 PHE B CD1 1 
ATOM 1674  C CD2 . PHE B 1 104 ? 49.982  50.109  7.295   1.00 28.37 ? 104 PHE B CD2 1 
ATOM 1675  C CE1 . PHE B 1 104 ? 49.105  52.590  6.397   1.00 26.82 ? 104 PHE B CE1 1 
ATOM 1676  C CE2 . PHE B 1 104 ? 49.966  51.203  8.159   1.00 28.36 ? 104 PHE B CE2 1 
ATOM 1677  C CZ  . PHE B 1 104 ? 49.526  52.443  7.707   1.00 27.28 ? 104 PHE B CZ  1 
ATOM 1678  N N   . GLU B 1 105 ? 51.258  46.128  4.535   1.00 30.70 ? 105 GLU B N   1 
ATOM 1679  C CA  . GLU B 1 105 ? 51.102  44.826  3.907   1.00 31.91 ? 105 GLU B CA  1 
ATOM 1680  C C   . GLU B 1 105 ? 49.881  44.192  4.548   1.00 32.28 ? 105 GLU B C   1 
ATOM 1681  O O   . GLU B 1 105 ? 49.763  44.127  5.771   1.00 32.26 ? 105 GLU B O   1 
ATOM 1682  C CB  . GLU B 1 105 ? 52.333  43.937  4.128   1.00 32.03 ? 105 GLU B CB  1 
ATOM 1683  C CG  . GLU B 1 105 ? 52.165  42.513  3.569   1.00 33.22 ? 105 GLU B CG  1 
ATOM 1684  C CD  . GLU B 1 105 ? 53.413  41.654  3.734   1.00 35.37 ? 105 GLU B CD  1 
ATOM 1685  O OE1 . GLU B 1 105 ? 53.823  41.390  4.879   1.00 37.27 ? 105 GLU B OE1 1 
ATOM 1686  O OE2 . GLU B 1 105 ? 53.998  41.232  2.717   1.00 36.83 ? 105 GLU B OE2 1 
ATOM 1687  N N   . ARG B 1 106 ? 48.958  43.745  3.719   1.00 33.23 ? 106 ARG B N   1 
ATOM 1688  C CA  . ARG B 1 106 ? 47.762  43.124  4.242   1.00 34.97 ? 106 ARG B CA  1 
ATOM 1689  C C   . ARG B 1 106 ? 47.461  41.845  3.475   1.00 34.40 ? 106 ARG B C   1 
ATOM 1690  O O   . ARG B 1 106 ? 47.563  41.791  2.246   1.00 34.40 ? 106 ARG B O   1 
ATOM 1691  C CB  . ARG B 1 106 ? 46.577  44.100  4.157   1.00 37.15 ? 106 ARG B CB  1 
ATOM 1692  C CG  . ARG B 1 106 ? 45.237  43.526  4.614   1.00 39.75 ? 106 ARG B CG  1 
ATOM 1693  C CD  . ARG B 1 106 ? 45.000  43.667  6.134   1.00 41.89 ? 106 ARG B CD  1 
ATOM 1694  N NE  . ARG B 1 106 ? 44.187  44.841  6.480   1.00 42.26 ? 106 ARG B NE  1 
ATOM 1695  C CZ  . ARG B 1 106 ? 43.004  45.140  5.938   1.00 42.29 ? 106 ARG B CZ  1 
ATOM 1696  N NH1 . ARG B 1 106 ? 42.464  44.355  5.009   1.00 43.07 ? 106 ARG B NH1 1 
ATOM 1697  N NH2 . ARG B 1 106 ? 42.361  46.237  6.318   1.00 42.03 ? 106 ARG B NH2 1 
ATOM 1698  N N   . LEU B 1 107 ? 47.130  40.808  4.231   1.00 34.70 ? 107 LEU B N   1 
ATOM 1699  C CA  . LEU B 1 107 ? 46.759  39.525  3.667   1.00 34.39 ? 107 LEU B CA  1 
ATOM 1700  C C   . LEU B 1 107 ? 45.243  39.575  3.631   1.00 33.95 ? 107 LEU B C   1 
ATOM 1701  O O   . LEU B 1 107 ? 44.587  39.424  4.655   1.00 33.31 ? 107 LEU B O   1 
ATOM 1702  C CB  . LEU B 1 107 ? 47.247  38.379  4.560   1.00 34.92 ? 107 LEU B CB  1 
ATOM 1703  C CG  . LEU B 1 107 ? 46.558  37.026  4.345   1.00 35.59 ? 107 LEU B CG  1 
ATOM 1704  C CD1 . LEU B 1 107 ? 46.403  36.733  2.860   1.00 36.53 ? 107 LEU B CD1 1 
ATOM 1705  C CD2 . LEU B 1 107 ? 47.356  35.949  5.026   1.00 36.53 ? 107 LEU B CD2 1 
ATOM 1706  N N   . GLU B 1 108 ? 44.696  39.814  2.447   1.00 34.11 ? 108 GLU B N   1 
ATOM 1707  C CA  . GLU B 1 108 ? 43.258  39.914  2.273   1.00 34.31 ? 108 GLU B CA  1 
ATOM 1708  C C   . GLU B 1 108 ? 42.540  38.597  2.513   1.00 34.94 ? 108 GLU B C   1 
ATOM 1709  O O   . GLU B 1 108 ? 43.164  37.533  2.546   1.00 35.60 ? 108 GLU B O   1 
ATOM 1710  C CB  . GLU B 1 108 ? 42.961  40.414  0.865   1.00 33.61 ? 108 GLU B CB  1 
ATOM 1711  C CG  . GLU B 1 108 ? 43.632  41.737  0.551   1.00 34.49 ? 108 GLU B CG  1 
ATOM 1712  C CD  . GLU B 1 108 ? 43.199  42.857  1.485   1.00 35.26 ? 108 GLU B CD  1 
ATOM 1713  O OE1 . GLU B 1 108 ? 43.874  43.902  1.498   1.00 36.75 ? 108 GLU B OE1 1 
ATOM 1714  O OE2 . GLU B 1 108 ? 42.183  42.704  2.200   1.00 35.81 ? 108 GLU B OE2 1 
ATOM 1715  N N   . SER B 1 109 ? 41.222  38.680  2.670   1.00 35.24 ? 109 SER B N   1 
ATOM 1716  C CA  . SER B 1 109 ? 40.380  37.509  2.904   1.00 34.86 ? 109 SER B CA  1 
ATOM 1717  C C   . SER B 1 109 ? 40.466  36.513  1.753   1.00 34.80 ? 109 SER B C   1 
ATOM 1718  O O   . SER B 1 109 ? 40.150  35.329  1.929   1.00 34.60 ? 109 SER B O   1 
ATOM 1719  C CB  . SER B 1 109 ? 38.927  37.936  3.073   1.00 34.24 ? 109 SER B CB  1 
ATOM 1720  O OG  . SER B 1 109 ? 38.454  38.509  1.865   1.00 35.25 ? 109 SER B OG  1 
ATOM 1721  N N   . ASN B 1 110 ? 40.867  36.998  0.576   1.00 33.79 ? 110 ASN B N   1 
ATOM 1722  C CA  . ASN B 1 110 ? 40.988  36.140  -0.603  1.00 32.94 ? 110 ASN B CA  1 
ATOM 1723  C C   . ASN B 1 110 ? 42.368  35.475  -0.691  1.00 32.42 ? 110 ASN B C   1 
ATOM 1724  O O   . ASN B 1 110 ? 42.671  34.771  -1.657  1.00 31.99 ? 110 ASN B O   1 
ATOM 1725  C CB  . ASN B 1 110 ? 40.702  36.950  -1.861  1.00 32.93 ? 110 ASN B CB  1 
ATOM 1726  C CG  . ASN B 1 110 ? 41.740  38.004  -2.113  1.00 35.74 ? 110 ASN B CG  1 
ATOM 1727  O OD1 . ASN B 1 110 ? 42.538  38.343  -1.227  1.00 36.35 ? 110 ASN B OD1 1 
ATOM 1728  N ND2 . ASN B 1 110 ? 41.739  38.546  -3.325  1.00 37.33 ? 110 ASN B ND2 1 
ATOM 1729  N N   . ASN B 1 111 ? 43.188  35.709  0.332   1.00 31.15 ? 111 ASN B N   1 
ATOM 1730  C CA  . ASN B 1 111 ? 44.516  35.135  0.428   1.00 29.46 ? 111 ASN B CA  1 
ATOM 1731  C C   . ASN B 1 111 ? 45.589  35.693  -0.500  1.00 29.01 ? 111 ASN B C   1 
ATOM 1732  O O   . ASN B 1 111 ? 46.556  35.001  -0.820  1.00 28.81 ? 111 ASN B O   1 
ATOM 1733  C CB  . ASN B 1 111 ? 44.430  33.619  0.280   1.00 28.25 ? 111 ASN B CB  1 
ATOM 1734  C CG  . ASN B 1 111 ? 43.977  32.952  1.549   1.00 26.39 ? 111 ASN B CG  1 
ATOM 1735  O OD1 . ASN B 1 111 ? 44.228  33.454  2.647   1.00 23.56 ? 111 ASN B OD1 1 
ATOM 1736  N ND2 . ASN B 1 111 ? 43.326  31.809  1.416   1.00 26.56 ? 111 ASN B ND2 1 
ATOM 1737  N N   . TYR B 1 112 ? 45.409  36.937  -0.928  1.00 27.40 ? 112 TYR B N   1 
ATOM 1738  C CA  . TYR B 1 112 ? 46.393  37.618  -1.750  1.00 26.47 ? 112 TYR B CA  1 
ATOM 1739  C C   . TYR B 1 112 ? 46.851  38.743  -0.840  1.00 26.13 ? 112 TYR B C   1 
ATOM 1740  O O   . TYR B 1 112 ? 46.178  39.036  0.151   1.00 26.12 ? 112 TYR B O   1 
ATOM 1741  C CB  . TYR B 1 112 ? 45.752  38.210  -3.006  1.00 26.24 ? 112 TYR B CB  1 
ATOM 1742  C CG  . TYR B 1 112 ? 45.538  37.241  -4.147  1.00 25.98 ? 112 TYR B CG  1 
ATOM 1743  C CD1 . TYR B 1 112 ? 46.564  36.952  -5.052  1.00 25.81 ? 112 TYR B CD1 1 
ATOM 1744  C CD2 . TYR B 1 112 ? 44.312  36.591  -4.309  1.00 25.58 ? 112 TYR B CD2 1 
ATOM 1745  C CE1 . TYR B 1 112 ? 46.373  36.032  -6.091  1.00 24.71 ? 112 TYR B CE1 1 
ATOM 1746  C CE2 . TYR B 1 112 ? 44.113  35.676  -5.330  1.00 23.12 ? 112 TYR B CE2 1 
ATOM 1747  C CZ  . TYR B 1 112 ? 45.137  35.400  -6.211  1.00 24.65 ? 112 TYR B CZ  1 
ATOM 1748  O OH  . TYR B 1 112 ? 44.920  34.476  -7.207  1.00 26.95 ? 112 TYR B OH  1 
ATOM 1749  N N   . ASN B 1 113 ? 47.988  39.360  -1.152  1.00 26.24 ? 113 ASN B N   1 
ATOM 1750  C CA  . ASN B 1 113 ? 48.482  40.476  -0.347  1.00 26.52 ? 113 ASN B CA  1 
ATOM 1751  C C   . ASN B 1 113 ? 48.264  41.786  -1.095  1.00 27.12 ? 113 ASN B C   1 
ATOM 1752  O O   . ASN B 1 113 ? 48.206  41.803  -2.327  1.00 27.80 ? 113 ASN B O   1 
ATOM 1753  C CB  . ASN B 1 113 ? 49.978  40.333  -0.054  1.00 25.98 ? 113 ASN B CB  1 
ATOM 1754  C CG  . ASN B 1 113 ? 50.298  39.199  0.906   1.00 26.53 ? 113 ASN B CG  1 
ATOM 1755  O OD1 . ASN B 1 113 ? 49.410  38.529  1.430   1.00 26.95 ? 113 ASN B OD1 1 
ATOM 1756  N ND2 . ASN B 1 113 ? 51.587  38.977  1.134   1.00 27.59 ? 113 ASN B ND2 1 
ATOM 1757  N N   . THR B 1 114 ? 48.116  42.877  -0.356  1.00 27.10 ? 114 THR B N   1 
ATOM 1758  C CA  . THR B 1 114 ? 47.986  44.192  -0.983  1.00 28.58 ? 114 THR B CA  1 
ATOM 1759  C C   . THR B 1 114 ? 49.022  45.082  -0.303  1.00 28.93 ? 114 THR B C   1 
ATOM 1760  O O   . THR B 1 114 ? 49.336  44.899  0.875   1.00 28.65 ? 114 THR B O   1 
ATOM 1761  C CB  . THR B 1 114 ? 46.593  44.860  -0.779  1.00 28.92 ? 114 THR B CB  1 
ATOM 1762  O OG1 . THR B 1 114 ? 46.415  45.183  0.608   1.00 29.05 ? 114 THR B OG1 1 
ATOM 1763  C CG2 . THR B 1 114 ? 45.480  43.951  -1.277  1.00 27.73 ? 114 THR B CG2 1 
ATOM 1764  N N   . TYR B 1 115 ? 49.549  46.042  -1.049  1.00 29.19 ? 115 TYR B N   1 
ATOM 1765  C CA  . TYR B 1 115 ? 50.533  46.953  -0.503  1.00 29.11 ? 115 TYR B CA  1 
ATOM 1766  C C   . TYR B 1 115 ? 50.035  48.378  -0.696  1.00 30.75 ? 115 TYR B C   1 
ATOM 1767  O O   . TYR B 1 115 ? 50.083  48.934  -1.795  1.00 29.79 ? 115 TYR B O   1 
ATOM 1768  C CB  . TYR B 1 115 ? 51.882  46.718  -1.182  1.00 26.49 ? 115 TYR B CB  1 
ATOM 1769  C CG  . TYR B 1 115 ? 52.427  45.356  -0.847  1.00 25.37 ? 115 TYR B CG  1 
ATOM 1770  C CD1 . TYR B 1 115 ? 53.135  45.134  0.336   1.00 24.61 ? 115 TYR B CD1 1 
ATOM 1771  C CD2 . TYR B 1 115 ? 52.111  44.255  -1.638  1.00 26.02 ? 115 TYR B CD2 1 
ATOM 1772  C CE1 . TYR B 1 115 ? 53.502  43.849  0.731   1.00 25.52 ? 115 TYR B CE1 1 
ATOM 1773  C CE2 . TYR B 1 115 ? 52.469  42.959  -1.260  1.00 25.00 ? 115 TYR B CE2 1 
ATOM 1774  C CZ  . TYR B 1 115 ? 53.157  42.755  -0.077  1.00 26.89 ? 115 TYR B CZ  1 
ATOM 1775  O OH  . TYR B 1 115 ? 53.465  41.453  0.300   1.00 26.81 ? 115 TYR B OH  1 
ATOM 1776  N N   . ARG B 1 116 ? 49.531  48.943  0.395   1.00 31.83 ? 116 ARG B N   1 
ATOM 1777  C CA  . ARG B 1 116 ? 48.995  50.293  0.405   1.00 33.29 ? 116 ARG B CA  1 
ATOM 1778  C C   . ARG B 1 116 ? 50.037  51.273  0.952   1.00 34.01 ? 116 ARG B C   1 
ATOM 1779  O O   . ARG B 1 116 ? 50.576  51.071  2.046   1.00 33.79 ? 116 ARG B O   1 
ATOM 1780  C CB  . ARG B 1 116 ? 47.731  50.308  1.274   1.00 32.94 ? 116 ARG B CB  1 
ATOM 1781  C CG  . ARG B 1 116 ? 46.958  51.613  1.313   1.00 31.72 ? 116 ARG B CG  1 
ATOM 1782  C CD  . ARG B 1 116 ? 45.588  51.371  1.943   1.00 31.28 ? 116 ARG B CD  1 
ATOM 1783  N NE  . ARG B 1 116 ? 45.692  50.850  3.305   1.00 30.44 ? 116 ARG B NE  1 
ATOM 1784  C CZ  . ARG B 1 116 ? 45.958  51.597  4.370   1.00 30.33 ? 116 ARG B CZ  1 
ATOM 1785  N NH1 . ARG B 1 116 ? 46.137  52.909  4.228   1.00 30.68 ? 116 ARG B NH1 1 
ATOM 1786  N NH2 . ARG B 1 116 ? 46.063  51.035  5.572   1.00 28.81 ? 116 ARG B NH2 1 
ATOM 1787  N N   . SER B 1 117 ? 50.323  52.325  0.186   1.00 34.90 ? 117 SER B N   1 
ATOM 1788  C CA  . SER B 1 117 ? 51.295  53.345  0.597   1.00 34.63 ? 117 SER B CA  1 
ATOM 1789  C C   . SER B 1 117 ? 50.966  53.903  1.965   1.00 34.61 ? 117 SER B C   1 
ATOM 1790  O O   . SER B 1 117 ? 49.818  54.253  2.230   1.00 33.10 ? 117 SER B O   1 
ATOM 1791  C CB  . SER B 1 117 ? 51.321  54.514  -0.388  1.00 34.25 ? 117 SER B CB  1 
ATOM 1792  O OG  . SER B 1 117 ? 52.227  55.522  0.053   1.00 34.63 ? 117 SER B OG  1 
ATOM 1793  N N   . ARG B 1 118 ? 51.970  53.984  2.836   1.00 35.94 ? 118 ARG B N   1 
ATOM 1794  C CA  . ARG B 1 118 ? 51.723  54.533  4.161   1.00 37.65 ? 118 ARG B CA  1 
ATOM 1795  C C   . ARG B 1 118 ? 51.666  56.056  4.102   1.00 38.91 ? 118 ARG B C   1 
ATOM 1796  O O   . ARG B 1 118 ? 51.031  56.689  4.944   1.00 38.61 ? 118 ARG B O   1 
ATOM 1797  C CB  . ARG B 1 118 ? 52.784  54.103  5.174   1.00 36.83 ? 118 ARG B CB  1 
ATOM 1798  C CG  . ARG B 1 118 ? 52.467  54.630  6.576   1.00 35.95 ? 118 ARG B CG  1 
ATOM 1799  C CD  . ARG B 1 118 ? 53.327  54.001  7.655   1.00 35.95 ? 118 ARG B CD  1 
ATOM 1800  N NE  . ARG B 1 118 ? 54.734  54.352  7.504   1.00 38.08 ? 118 ARG B NE  1 
ATOM 1801  C CZ  . ARG B 1 118 ? 55.687  53.998  8.363   1.00 38.76 ? 118 ARG B CZ  1 
ATOM 1802  N NH1 . ARG B 1 118 ? 55.370  53.281  9.435   1.00 38.67 ? 118 ARG B NH1 1 
ATOM 1803  N NH2 . ARG B 1 118 ? 56.950  54.369  8.158   1.00 37.36 ? 118 ARG B NH2 1 
ATOM 1804  N N   . LYS B 1 119 ? 52.324  56.637  3.104   1.00 40.24 ? 119 LYS B N   1 
ATOM 1805  C CA  . LYS B 1 119 ? 52.326  58.087  2.931   1.00 42.58 ? 119 LYS B CA  1 
ATOM 1806  C C   . LYS B 1 119 ? 50.998  58.516  2.284   1.00 42.97 ? 119 LYS B C   1 
ATOM 1807  O O   . LYS B 1 119 ? 50.261  59.339  2.824   1.00 43.38 ? 119 LYS B O   1 
ATOM 1808  C CB  . LYS B 1 119 ? 53.495  58.492  2.031   1.00 43.60 ? 119 LYS B CB  1 
ATOM 1809  C CG  . LYS B 1 119 ? 53.761  59.990  1.936   1.00 44.51 ? 119 LYS B CG  1 
ATOM 1810  C CD  . LYS B 1 119 ? 54.679  60.460  3.053   1.00 45.35 ? 119 LYS B CD  1 
ATOM 1811  C CE  . LYS B 1 119 ? 55.156  61.881  2.806   1.00 46.30 ? 119 LYS B CE  1 
ATOM 1812  N NZ  . LYS B 1 119 ? 54.034  62.860  2.807   1.00 48.03 ? 119 LYS B NZ  1 
ATOM 1813  N N   . TYR B 1 120 ? 50.712  57.947  1.118   1.00 42.84 ? 120 TYR B N   1 
ATOM 1814  C CA  . TYR B 1 120 ? 49.488  58.225  0.379   1.00 42.66 ? 120 TYR B CA  1 
ATOM 1815  C C   . TYR B 1 120 ? 48.563  57.044  0.646   1.00 42.10 ? 120 TYR B C   1 
ATOM 1816  O O   . TYR B 1 120 ? 48.470  56.112  -0.153  1.00 42.71 ? 120 TYR B O   1 
ATOM 1817  C CB  . TYR B 1 120 ? 49.842  58.338  -1.093  1.00 44.31 ? 120 TYR B CB  1 
ATOM 1818  C CG  . TYR B 1 120 ? 51.006  59.269  -1.292  1.00 46.30 ? 120 TYR B CG  1 
ATOM 1819  C CD1 . TYR B 1 120 ? 50.909  60.615  -0.932  1.00 46.27 ? 120 TYR B CD1 1 
ATOM 1820  C CD2 . TYR B 1 120 ? 52.220  58.804  -1.808  1.00 47.42 ? 120 TYR B CD2 1 
ATOM 1821  C CE1 . TYR B 1 120 ? 51.989  61.476  -1.080  1.00 47.65 ? 120 TYR B CE1 1 
ATOM 1822  C CE2 . TYR B 1 120 ? 53.314  59.661  -1.957  1.00 48.08 ? 120 TYR B CE2 1 
ATOM 1823  C CZ  . TYR B 1 120 ? 53.186  60.994  -1.591  1.00 48.11 ? 120 TYR B CZ  1 
ATOM 1824  O OH  . TYR B 1 120 ? 54.251  61.844  -1.728  1.00 49.18 ? 120 TYR B OH  1 
ATOM 1825  N N   . THR B 1 121 ? 47.887  57.121  1.788   1.00 41.16 ? 121 THR B N   1 
ATOM 1826  C CA  . THR B 1 121 ? 46.998  56.090  2.316   1.00 40.67 ? 121 THR B CA  1 
ATOM 1827  C C   . THR B 1 121 ? 45.862  55.468  1.505   1.00 41.21 ? 121 THR B C   1 
ATOM 1828  O O   . THR B 1 121 ? 45.194  54.562  1.995   1.00 41.56 ? 121 THR B O   1 
ATOM 1829  C CB  . THR B 1 121 ? 46.365  56.574  3.598   1.00 39.29 ? 121 THR B CB  1 
ATOM 1830  O OG1 . THR B 1 121 ? 45.330  57.505  3.271   1.00 39.72 ? 121 THR B OG1 1 
ATOM 1831  C CG2 . THR B 1 121 ? 47.403  57.255  4.473   1.00 38.01 ? 121 THR B CG2 1 
ATOM 1832  N N   . SER B 1 122 ? 45.611  55.926  0.292   1.00 41.23 ? 122 SER B N   1 
ATOM 1833  C CA  . SER B 1 122 ? 44.526  55.320  -0.464  1.00 41.14 ? 122 SER B CA  1 
ATOM 1834  C C   . SER B 1 122 ? 45.059  54.691  -1.727  1.00 41.56 ? 122 SER B C   1 
ATOM 1835  O O   . SER B 1 122 ? 44.314  54.093  -2.497  1.00 41.97 ? 122 SER B O   1 
ATOM 1836  C CB  . SER B 1 122 ? 43.467  56.359  -0.839  1.00 41.42 ? 122 SER B CB  1 
ATOM 1837  O OG  . SER B 1 122 ? 43.842  57.052  -2.016  1.00 43.06 ? 122 SER B OG  1 
ATOM 1838  N N   . TRP B 1 123 ? 46.359  54.828  -1.947  1.00 41.80 ? 123 TRP B N   1 
ATOM 1839  C CA  . TRP B 1 123 ? 46.961  54.274  -3.140  1.00 41.80 ? 123 TRP B CA  1 
ATOM 1840  C C   . TRP B 1 123 ? 47.660  52.942  -2.888  1.00 40.19 ? 123 TRP B C   1 
ATOM 1841  O O   . TRP B 1 123 ? 48.337  52.747  -1.874  1.00 39.13 ? 123 TRP B O   1 
ATOM 1842  C CB  . TRP B 1 123 ? 47.903  55.309  -3.750  1.00 44.94 ? 123 TRP B CB  1 
ATOM 1843  C CG  . TRP B 1 123 ? 47.178  56.596  -4.097  1.00 48.92 ? 123 TRP B CG  1 
ATOM 1844  C CD1 . TRP B 1 123 ? 45.821  56.808  -4.076  1.00 49.44 ? 123 TRP B CD1 1 
ATOM 1845  C CD2 . TRP B 1 123 ? 47.760  57.817  -4.569  1.00 49.93 ? 123 TRP B CD2 1 
ATOM 1846  N NE1 . TRP B 1 123 ? 45.530  58.077  -4.511  1.00 49.38 ? 123 TRP B NE1 1 
ATOM 1847  C CE2 . TRP B 1 123 ? 46.700  58.719  -4.821  1.00 50.28 ? 123 TRP B CE2 1 
ATOM 1848  C CE3 . TRP B 1 123 ? 49.077  58.236  -4.813  1.00 51.12 ? 123 TRP B CE3 1 
ATOM 1849  C CZ2 . TRP B 1 123 ? 46.916  60.012  -5.300  1.00 50.46 ? 123 TRP B CZ2 1 
ATOM 1850  C CZ3 . TRP B 1 123 ? 49.290  59.529  -5.294  1.00 51.50 ? 123 TRP B CZ3 1 
ATOM 1851  C CH2 . TRP B 1 123 ? 48.213  60.397  -5.532  1.00 51.75 ? 123 TRP B CH2 1 
ATOM 1852  N N   . TYR B 1 124 ? 47.458  52.019  -3.823  1.00 37.95 ? 124 TYR B N   1 
ATOM 1853  C CA  . TYR B 1 124 ? 48.029  50.689  -3.743  1.00 35.42 ? 124 TYR B CA  1 
ATOM 1854  C C   . TYR B 1 124 ? 49.077  50.448  -4.812  1.00 34.11 ? 124 TYR B C   1 
ATOM 1855  O O   . TYR B 1 124 ? 49.032  51.042  -5.884  1.00 34.31 ? 124 TYR B O   1 
ATOM 1856  C CB  . TYR B 1 124 ? 46.936  49.618  -3.910  1.00 35.87 ? 124 TYR B CB  1 
ATOM 1857  C CG  . TYR B 1 124 ? 45.934  49.523  -2.778  1.00 35.57 ? 124 TYR B CG  1 
ATOM 1858  C CD1 . TYR B 1 124 ? 44.773  50.302  -2.773  1.00 35.08 ? 124 TYR B CD1 1 
ATOM 1859  C CD2 . TYR B 1 124 ? 46.149  48.652  -1.711  1.00 36.05 ? 124 TYR B CD2 1 
ATOM 1860  C CE1 . TYR B 1 124 ? 43.850  50.216  -1.734  1.00 34.44 ? 124 TYR B CE1 1 
ATOM 1861  C CE2 . TYR B 1 124 ? 45.239  48.557  -0.667  1.00 36.52 ? 124 TYR B CE2 1 
ATOM 1862  C CZ  . TYR B 1 124 ? 44.088  49.339  -0.681  1.00 36.23 ? 124 TYR B CZ  1 
ATOM 1863  O OH  . TYR B 1 124 ? 43.187  49.228  0.356   1.00 36.71 ? 124 TYR B OH  1 
ATOM 1864  N N   . VAL B 1 125 ? 50.024  49.569  -4.504  1.00 32.38 ? 125 VAL B N   1 
ATOM 1865  C CA  . VAL B 1 125 ? 51.054  49.181  -5.451  1.00 29.96 ? 125 VAL B CA  1 
ATOM 1866  C C   . VAL B 1 125 ? 50.257  48.264  -6.375  1.00 30.48 ? 125 VAL B C   1 
ATOM 1867  O O   . VAL B 1 125 ? 49.492  47.424  -5.905  1.00 29.92 ? 125 VAL B O   1 
ATOM 1868  C CB  . VAL B 1 125 ? 52.169  48.389  -4.739  1.00 28.49 ? 125 VAL B CB  1 
ATOM 1869  C CG1 . VAL B 1 125 ? 53.241  47.974  -5.726  1.00 26.69 ? 125 VAL B CG1 1 
ATOM 1870  C CG2 . VAL B 1 125 ? 52.753  49.227  -3.612  1.00 27.08 ? 125 VAL B CG2 1 
ATOM 1871  N N   . ALA B 1 126 ? 50.403  48.427  -7.682  1.00 31.02 ? 126 ALA B N   1 
ATOM 1872  C CA  . ALA B 1 126 ? 49.632  47.606  -8.596  1.00 31.87 ? 126 ALA B CA  1 
ATOM 1873  C C   . ALA B 1 126 ? 50.243  47.562  -9.976  1.00 33.25 ? 126 ALA B C   1 
ATOM 1874  O O   . ALA B 1 126 ? 51.154  48.320  -10.283 1.00 32.51 ? 126 ALA B O   1 
ATOM 1875  C CB  . ALA B 1 126 ? 48.213  48.132  -8.673  1.00 31.86 ? 126 ALA B CB  1 
ATOM 1876  N N   . LEU B 1 127 ? 49.723  46.663  -10.805 1.00 35.73 ? 127 LEU B N   1 
ATOM 1877  C CA  . LEU B 1 127 ? 50.203  46.500  -12.170 1.00 38.10 ? 127 LEU B CA  1 
ATOM 1878  C C   . LEU B 1 127 ? 49.042  46.458  -13.159 1.00 39.41 ? 127 LEU B C   1 
ATOM 1879  O O   . LEU B 1 127 ? 48.035  45.794  -12.912 1.00 40.92 ? 127 LEU B O   1 
ATOM 1880  C CB  . LEU B 1 127 ? 51.021  45.212  -12.296 1.00 37.90 ? 127 LEU B CB  1 
ATOM 1881  C CG  . LEU B 1 127 ? 52.398  45.182  -11.621 1.00 40.06 ? 127 LEU B CG  1 
ATOM 1882  C CD1 . LEU B 1 127 ? 52.990  43.787  -11.736 1.00 41.60 ? 127 LEU B CD1 1 
ATOM 1883  C CD2 . LEU B 1 127 ? 53.330  46.184  -12.270 1.00 39.58 ? 127 LEU B CD2 1 
ATOM 1884  N N   . LYS B 1 128 ? 49.179  47.177  -14.269 1.00 40.13 ? 128 LYS B N   1 
ATOM 1885  C CA  . LYS B 1 128 ? 48.149  47.184  -15.296 1.00 40.51 ? 128 LYS B CA  1 
ATOM 1886  C C   . LYS B 1 128 ? 48.233  45.823  -15.999 1.00 41.19 ? 128 LYS B C   1 
ATOM 1887  O O   . LYS B 1 128 ? 49.269  45.161  -15.940 1.00 40.51 ? 128 LYS B O   1 
ATOM 1888  C CB  . LYS B 1 128 ? 48.401  48.334  -16.284 1.00 40.96 ? 128 LYS B CB  1 
ATOM 1889  N N   . ARG B 1 129 ? 47.151  45.393  -16.648 1.00 42.22 ? 129 ARG B N   1 
ATOM 1890  C CA  . ARG B 1 129 ? 47.162  44.098  -17.337 1.00 41.79 ? 129 ARG B CA  1 
ATOM 1891  C C   . ARG B 1 129 ? 48.205  44.069  -18.450 1.00 41.91 ? 129 ARG B C   1 
ATOM 1892  O O   . ARG B 1 129 ? 48.505  43.019  -19.004 1.00 41.65 ? 129 ARG B O   1 
ATOM 1893  C CB  . ARG B 1 129 ? 45.779  43.778  -17.911 1.00 41.27 ? 129 ARG B CB  1 
ATOM 1894  N N   . THR B 1 130 ? 48.765  45.232  -18.760 1.00 43.40 ? 130 THR B N   1 
ATOM 1895  C CA  . THR B 1 130 ? 49.775  45.360  -19.808 1.00 45.16 ? 130 THR B CA  1 
ATOM 1896  C C   . THR B 1 130 ? 51.176  44.998  -19.317 1.00 45.92 ? 130 THR B C   1 
ATOM 1897  O O   . THR B 1 130 ? 52.058  44.691  -20.111 1.00 46.63 ? 130 THR B O   1 
ATOM 1898  C CB  . THR B 1 130 ? 49.838  46.811  -20.327 1.00 46.03 ? 130 THR B CB  1 
ATOM 1899  O OG1 . THR B 1 130 ? 50.481  47.637  -19.343 1.00 47.24 ? 130 THR B OG1 1 
ATOM 1900  C CG2 . THR B 1 130 ? 48.431  47.357  -20.578 1.00 46.19 ? 130 THR B CG2 1 
ATOM 1901  N N   . GLY B 1 131 ? 51.384  45.051  -18.007 1.00 47.02 ? 131 GLY B N   1 
ATOM 1902  C CA  . GLY B 1 131 ? 52.698  44.753  -17.469 1.00 47.92 ? 131 GLY B CA  1 
ATOM 1903  C C   . GLY B 1 131 ? 53.345  46.022  -16.929 1.00 48.94 ? 131 GLY B C   1 
ATOM 1904  O O   . GLY B 1 131 ? 54.433  45.984  -16.346 1.00 48.73 ? 131 GLY B O   1 
ATOM 1905  N N   . GLN B 1 132 ? 52.678  47.153  -17.143 1.00 49.37 ? 132 GLN B N   1 
ATOM 1906  C CA  . GLN B 1 132 ? 53.168  48.431  -16.657 1.00 49.75 ? 132 GLN B CA  1 
ATOM 1907  C C   . GLN B 1 132 ? 52.444  48.661  -15.344 1.00 49.72 ? 132 GLN B C   1 
ATOM 1908  O O   . GLN B 1 132 ? 51.348  48.141  -15.149 1.00 49.30 ? 132 GLN B O   1 
ATOM 1909  C CB  . GLN B 1 132 ? 52.831  49.552  -17.650 1.00 51.56 ? 132 GLN B CB  1 
ATOM 1910  C CG  . GLN B 1 132 ? 53.641  49.510  -18.934 1.00 53.78 ? 132 GLN B CG  1 
ATOM 1911  C CD  . GLN B 1 132 ? 55.122  49.280  -18.669 1.00 55.67 ? 132 GLN B CD  1 
ATOM 1912  O OE1 . GLN B 1 132 ? 55.756  50.026  -17.914 1.00 56.45 ? 132 GLN B OE1 1 
ATOM 1913  N NE2 . GLN B 1 132 ? 55.681  48.239  -19.287 1.00 55.96 ? 132 GLN B NE2 1 
ATOM 1914  N N   . TYR B 1 133 ? 53.041  49.430  -14.442 1.00 49.34 ? 133 TYR B N   1 
ATOM 1915  C CA  . TYR B 1 133 ? 52.395  49.678  -13.168 1.00 49.22 ? 133 TYR B CA  1 
ATOM 1916  C C   . TYR B 1 133 ? 51.166  50.545  -13.363 1.00 48.78 ? 133 TYR B C   1 
ATOM 1917  O O   . TYR B 1 133 ? 50.948  51.091  -14.438 1.00 47.85 ? 133 TYR B O   1 
ATOM 1918  C CB  . TYR B 1 133 ? 53.376  50.335  -12.194 1.00 50.98 ? 133 TYR B CB  1 
ATOM 1919  C CG  . TYR B 1 133 ? 53.815  51.735  -12.569 1.00 52.79 ? 133 TYR B CG  1 
ATOM 1920  C CD1 . TYR B 1 133 ? 52.996  52.830  -12.315 1.00 52.49 ? 133 TYR B CD1 1 
ATOM 1921  C CD2 . TYR B 1 133 ? 55.059  51.966  -13.161 1.00 53.39 ? 133 TYR B CD2 1 
ATOM 1922  C CE1 . TYR B 1 133 ? 53.394  54.117  -12.630 1.00 52.57 ? 133 TYR B CE1 1 
ATOM 1923  C CE2 . TYR B 1 133 ? 55.468  53.259  -13.484 1.00 53.63 ? 133 TYR B CE2 1 
ATOM 1924  C CZ  . TYR B 1 133 ? 54.624  54.330  -13.210 1.00 53.29 ? 133 TYR B CZ  1 
ATOM 1925  O OH  . TYR B 1 133 ? 55.003  55.624  -13.500 1.00 54.09 ? 133 TYR B OH  1 
ATOM 1926  N N   . LYS B 1 134 ? 50.351  50.645  -12.324 1.00 48.71 ? 134 LYS B N   1 
ATOM 1927  C CA  . LYS B 1 134 ? 49.150  51.463  -12.386 1.00 48.99 ? 134 LYS B CA  1 
ATOM 1928  C C   . LYS B 1 134 ? 49.241  52.555  -11.314 1.00 48.75 ? 134 LYS B C   1 
ATOM 1929  O O   . LYS B 1 134 ? 49.525  52.282  -10.144 1.00 48.68 ? 134 LYS B O   1 
ATOM 1930  C CB  . LYS B 1 134 ? 47.900  50.589  -12.176 1.00 49.74 ? 134 LYS B CB  1 
ATOM 1931  N N   . LEU B 1 135 ? 49.024  53.795  -11.731 1.00 48.14 ? 135 LEU B N   1 
ATOM 1932  C CA  . LEU B 1 135 ? 49.073  54.930  -10.818 1.00 48.31 ? 135 LEU B CA  1 
ATOM 1933  C C   . LEU B 1 135 ? 48.297  54.674  -9.530  1.00 47.93 ? 135 LEU B C   1 
ATOM 1934  O O   . LEU B 1 135 ? 47.153  54.228  -9.564  1.00 48.44 ? 135 LEU B O   1 
ATOM 1935  C CB  . LEU B 1 135 ? 48.506  56.172  -11.512 1.00 48.15 ? 135 LEU B CB  1 
ATOM 1936  C CG  . LEU B 1 135 ? 49.363  56.716  -12.650 1.00 47.17 ? 135 LEU B CG  1 
ATOM 1937  C CD1 . LEU B 1 135 ? 48.514  57.564  -13.567 1.00 46.93 ? 135 LEU B CD1 1 
ATOM 1938  C CD2 . LEU B 1 135 ? 50.520  57.505  -12.074 1.00 46.59 ? 135 LEU B CD2 1 
ATOM 1939  N N   . GLY B 1 136 ? 48.924  54.965  -8.396  1.00 47.69 ? 136 GLY B N   1 
ATOM 1940  C CA  . GLY B 1 136 ? 48.257  54.766  -7.124  1.00 48.02 ? 136 GLY B CA  1 
ATOM 1941  C C   . GLY B 1 136 ? 46.914  55.467  -7.107  1.00 47.82 ? 136 GLY B C   1 
ATOM 1942  O O   . GLY B 1 136 ? 45.941  54.955  -6.564  1.00 48.18 ? 136 GLY B O   1 
ATOM 1943  N N   . SER B 1 137 ? 46.870  56.645  -7.717  1.00 47.99 ? 137 SER B N   1 
ATOM 1944  C CA  . SER B 1 137 ? 45.658  57.449  -7.795  1.00 48.12 ? 137 SER B CA  1 
ATOM 1945  C C   . SER B 1 137 ? 44.520  56.716  -8.510  1.00 48.10 ? 137 SER B C   1 
ATOM 1946  O O   . SER B 1 137 ? 43.349  57.051  -8.333  1.00 48.01 ? 137 SER B O   1 
ATOM 1947  C CB  . SER B 1 137 ? 45.973  58.745  -8.539  1.00 48.08 ? 137 SER B CB  1 
ATOM 1948  O OG  . SER B 1 137 ? 46.531  58.465  -9.816  1.00 47.94 ? 137 SER B OG  1 
ATOM 1949  N N   . LYS B 1 138 ? 44.861  55.718  -9.316  1.00 47.79 ? 138 LYS B N   1 
ATOM 1950  C CA  . LYS B 1 138 ? 43.849  54.970  -10.060 1.00 47.86 ? 138 LYS B CA  1 
ATOM 1951  C C   . LYS B 1 138 ? 43.568  53.576  -9.508  1.00 46.97 ? 138 LYS B C   1 
ATOM 1952  O O   . LYS B 1 138 ? 42.938  52.762  -10.185 1.00 46.17 ? 138 LYS B O   1 
ATOM 1953  C CB  . LYS B 1 138 ? 44.263  54.833  -11.530 1.00 48.93 ? 138 LYS B CB  1 
ATOM 1954  C CG  . LYS B 1 138 ? 44.320  56.142  -12.297 1.00 51.31 ? 138 LYS B CG  1 
ATOM 1955  C CD  . LYS B 1 138 ? 44.885  55.956  -13.712 1.00 53.81 ? 138 LYS B CD  1 
ATOM 1956  C CE  . LYS B 1 138 ? 44.031  55.017  -14.579 1.00 55.40 ? 138 LYS B CE  1 
ATOM 1957  N NZ  . LYS B 1 138 ? 44.397  55.104  -16.036 1.00 56.27 ? 138 LYS B NZ  1 
ATOM 1958  N N   . THR B 1 139 ? 44.031  53.300  -8.292  1.00 46.29 ? 139 THR B N   1 
ATOM 1959  C CA  . THR B 1 139 ? 43.821  51.990  -7.688  1.00 45.69 ? 139 THR B CA  1 
ATOM 1960  C C   . THR B 1 139 ? 42.742  52.016  -6.611  1.00 46.30 ? 139 THR B C   1 
ATOM 1961  O O   . THR B 1 139 ? 42.416  53.074  -6.058  1.00 46.65 ? 139 THR B O   1 
ATOM 1962  C CB  . THR B 1 139 ? 45.128  51.431  -7.067  1.00 45.29 ? 139 THR B CB  1 
ATOM 1963  O OG1 . THR B 1 139 ? 45.602  52.322  -6.045  1.00 45.28 ? 139 THR B OG1 1 
ATOM 1964  C CG2 . THR B 1 139 ? 46.198  51.274  -8.133  1.00 44.59 ? 139 THR B CG2 1 
ATOM 1965  N N   . GLY B 1 140 ? 42.192  50.838  -6.323  1.00 46.51 ? 140 GLY B N   1 
ATOM 1966  C CA  . GLY B 1 140 ? 41.151  50.715  -5.318  1.00 46.34 ? 140 GLY B CA  1 
ATOM 1967  C C   . GLY B 1 140 ? 41.111  49.309  -4.743  1.00 46.31 ? 140 GLY B C   1 
ATOM 1968  O O   . GLY B 1 140 ? 41.533  48.351  -5.403  1.00 45.62 ? 140 GLY B O   1 
ATOM 1969  N N   . PRO B 1 141 ? 40.580  49.152  -3.519  1.00 46.47 ? 141 PRO B N   1 
ATOM 1970  C CA  . PRO B 1 141 ? 40.457  47.885  -2.786  1.00 46.55 ? 141 PRO B CA  1 
ATOM 1971  C C   . PRO B 1 141 ? 39.887  46.718  -3.585  1.00 46.65 ? 141 PRO B C   1 
ATOM 1972  O O   . PRO B 1 141 ? 40.381  45.580  -3.503  1.00 47.81 ? 141 PRO B O   1 
ATOM 1973  C CB  . PRO B 1 141 ? 39.537  48.248  -1.624  1.00 46.29 ? 141 PRO B CB  1 
ATOM 1974  C CG  . PRO B 1 141 ? 39.843  49.678  -1.383  1.00 48.02 ? 141 PRO B CG  1 
ATOM 1975  C CD  . PRO B 1 141 ? 39.893  50.231  -2.791  1.00 47.04 ? 141 PRO B CD  1 
ATOM 1976  N N   . GLY B 1 142 ? 38.837  46.992  -4.346  1.00 45.22 ? 142 GLY B N   1 
ATOM 1977  C CA  . GLY B 1 142 ? 38.211  45.935  -5.110  1.00 43.98 ? 142 GLY B CA  1 
ATOM 1978  C C   . GLY B 1 142 ? 38.951  45.530  -6.362  1.00 43.68 ? 142 GLY B C   1 
ATOM 1979  O O   . GLY B 1 142 ? 38.672  44.475  -6.934  1.00 43.77 ? 142 GLY B O   1 
ATOM 1980  N N   . GLN B 1 143 ? 39.896  46.357  -6.796  1.00 43.17 ? 143 GLN B N   1 
ATOM 1981  C CA  . GLN B 1 143 ? 40.655  46.066  -8.011  1.00 42.07 ? 143 GLN B CA  1 
ATOM 1982  C C   . GLN B 1 143 ? 41.445  44.762  -7.977  1.00 40.60 ? 143 GLN B C   1 
ATOM 1983  O O   . GLN B 1 143 ? 41.706  44.191  -6.908  1.00 40.15 ? 143 GLN B O   1 
ATOM 1984  C CB  . GLN B 1 143 ? 41.595  47.226  -8.327  1.00 43.56 ? 143 GLN B CB  1 
ATOM 1985  C CG  . GLN B 1 143 ? 40.870  48.433  -8.851  1.00 45.80 ? 143 GLN B CG  1 
ATOM 1986  C CD  . GLN B 1 143 ? 41.802  49.491  -9.391  1.00 47.92 ? 143 GLN B CD  1 
ATOM 1987  O OE1 . GLN B 1 143 ? 42.732  49.200  -10.158 1.00 49.37 ? 143 GLN B OE1 1 
ATOM 1988  N NE2 . GLN B 1 143 ? 41.551  50.736  -9.008  1.00 48.27 ? 143 GLN B NE2 1 
ATOM 1989  N N   . LYS B 1 144 ? 41.820  44.305  -9.166  1.00 38.43 ? 144 LYS B N   1 
ATOM 1990  C CA  . LYS B 1 144 ? 42.581  43.079  -9.336  1.00 36.48 ? 144 LYS B CA  1 
ATOM 1991  C C   . LYS B 1 144 ? 44.051  43.400  -9.637  1.00 36.27 ? 144 LYS B C   1 
ATOM 1992  O O   . LYS B 1 144 ? 44.909  42.516  -9.622  1.00 36.42 ? 144 LYS B O   1 
ATOM 1993  C CB  . LYS B 1 144 ? 41.975  42.280  -10.482 1.00 35.33 ? 144 LYS B CB  1 
ATOM 1994  C CG  . LYS B 1 144 ? 42.686  41.003  -10.771 1.00 35.33 ? 144 LYS B CG  1 
ATOM 1995  C CD  . LYS B 1 144 ? 41.965  40.211  -11.825 1.00 36.53 ? 144 LYS B CD  1 
ATOM 1996  C CE  . LYS B 1 144 ? 42.324  40.677  -13.225 1.00 38.63 ? 144 LYS B CE  1 
ATOM 1997  N NZ  . LYS B 1 144 ? 41.945  39.639  -14.239 1.00 38.30 ? 144 LYS B NZ  1 
ATOM 1998  N N   . ALA B 1 145 ? 44.334  44.670  -9.915  1.00 34.73 ? 145 ALA B N   1 
ATOM 1999  C CA  . ALA B 1 145 ? 45.692  45.086  -10.225 1.00 34.06 ? 145 ALA B CA  1 
ATOM 2000  C C   . ALA B 1 145 ? 46.536  45.199  -8.956  1.00 33.97 ? 145 ALA B C   1 
ATOM 2001  O O   . ALA B 1 145 ? 47.771  45.171  -9.023  1.00 33.53 ? 145 ALA B O   1 
ATOM 2002  C CB  . ALA B 1 145 ? 45.673  46.403  -10.956 1.00 32.44 ? 145 ALA B CB  1 
ATOM 2003  N N   . ILE B 1 146 ? 45.868  45.307  -7.804  1.00 32.59 ? 146 ILE B N   1 
ATOM 2004  C CA  . ILE B 1 146 ? 46.568  45.436  -6.533  1.00 29.91 ? 146 ILE B CA  1 
ATOM 2005  C C   . ILE B 1 146 ? 46.795  44.126  -5.789  1.00 29.22 ? 146 ILE B C   1 
ATOM 2006  O O   . ILE B 1 146 ? 47.358  44.138  -4.699  1.00 29.35 ? 146 ILE B O   1 
ATOM 2007  C CB  . ILE B 1 146 ? 45.830  46.409  -5.586  1.00 29.06 ? 146 ILE B CB  1 
ATOM 2008  C CG1 . ILE B 1 146 ? 44.565  45.751  -5.028  1.00 27.75 ? 146 ILE B CG1 1 
ATOM 2009  C CG2 . ILE B 1 146 ? 45.460  47.677  -6.341  1.00 28.07 ? 146 ILE B CG2 1 
ATOM 2010  C CD1 . ILE B 1 146 ? 43.943  46.497  -3.850  1.00 22.30 ? 146 ILE B CD1 1 
ATOM 2011  N N   . LEU B 1 147 ? 46.379  43.003  -6.375  1.00 28.62 ? 147 LEU B N   1 
ATOM 2012  C CA  . LEU B 1 147 ? 46.539  41.697  -5.732  1.00 27.25 ? 147 LEU B CA  1 
ATOM 2013  C C   . LEU B 1 147 ? 47.835  40.969  -6.055  1.00 26.20 ? 147 LEU B C   1 
ATOM 2014  O O   . LEU B 1 147 ? 48.090  40.631  -7.206  1.00 25.02 ? 147 LEU B O   1 
ATOM 2015  C CB  . LEU B 1 147 ? 45.345  40.791  -6.071  1.00 26.56 ? 147 LEU B CB  1 
ATOM 2016  C CG  . LEU B 1 147 ? 44.012  41.404  -5.617  1.00 27.54 ? 147 LEU B CG  1 
ATOM 2017  C CD1 . LEU B 1 147 ? 42.886  40.377  -5.625  1.00 25.68 ? 147 LEU B CD1 1 
ATOM 2018  C CD2 . LEU B 1 147 ? 44.196  41.981  -4.228  1.00 27.71 ? 147 LEU B CD2 1 
ATOM 2019  N N   . PHE B 1 148 ? 48.639  40.720  -5.019  1.00 25.36 ? 148 PHE B N   1 
ATOM 2020  C CA  . PHE B 1 148 ? 49.906  40.019  -5.169  1.00 25.22 ? 148 PHE B CA  1 
ATOM 2021  C C   . PHE B 1 148 ? 50.000  38.775  -4.303  1.00 25.72 ? 148 PHE B C   1 
ATOM 2022  O O   . PHE B 1 148 ? 49.535  38.747  -3.164  1.00 27.19 ? 148 PHE B O   1 
ATOM 2023  C CB  . PHE B 1 148 ? 51.092  40.925  -4.821  1.00 24.73 ? 148 PHE B CB  1 
ATOM 2024  C CG  . PHE B 1 148 ? 51.326  42.019  -5.805  1.00 25.85 ? 148 PHE B CG  1 
ATOM 2025  C CD1 . PHE B 1 148 ? 50.664  43.245  -5.677  1.00 25.71 ? 148 PHE B CD1 1 
ATOM 2026  C CD2 . PHE B 1 148 ? 52.193  41.823  -6.888  1.00 26.47 ? 148 PHE B CD2 1 
ATOM 2027  C CE1 . PHE B 1 148 ? 50.859  44.270  -6.618  1.00 24.98 ? 148 PHE B CE1 1 
ATOM 2028  C CE2 . PHE B 1 148 ? 52.393  42.840  -7.836  1.00 26.94 ? 148 PHE B CE2 1 
ATOM 2029  C CZ  . PHE B 1 148 ? 51.720  44.072  -7.694  1.00 25.25 ? 148 PHE B CZ  1 
ATOM 2030  N N   . LEU B 1 149 ? 50.629  37.752  -4.850  1.00 25.01 ? 149 LEU B N   1 
ATOM 2031  C CA  . LEU B 1 149 ? 50.842  36.504  -4.146  1.00 25.06 ? 149 LEU B CA  1 
ATOM 2032  C C   . LEU B 1 149 ? 52.353  36.387  -3.960  1.00 24.68 ? 149 LEU B C   1 
ATOM 2033  O O   . LEU B 1 149 ? 53.090  36.300  -4.941  1.00 25.26 ? 149 LEU B O   1 
ATOM 2034  C CB  . LEU B 1 149 ? 50.353  35.339  -5.010  1.00 25.86 ? 149 LEU B CB  1 
ATOM 2035  C CG  . LEU B 1 149 ? 50.156  33.973  -4.350  1.00 25.62 ? 149 LEU B CG  1 
ATOM 2036  C CD1 . LEU B 1 149 ? 49.075  34.111  -3.278  1.00 25.19 ? 149 LEU B CD1 1 
ATOM 2037  C CD2 . LEU B 1 149 ? 49.750  32.938  -5.394  1.00 24.20 ? 149 LEU B CD2 1 
ATOM 2038  N N   . PRO B 1 150 ? 52.838  36.403  -2.715  1.00 24.69 ? 150 PRO B N   1 
ATOM 2039  C CA  . PRO B 1 150 ? 54.290  36.285  -2.520  1.00 24.99 ? 150 PRO B CA  1 
ATOM 2040  C C   . PRO B 1 150 ? 54.746  34.871  -2.825  1.00 26.64 ? 150 PRO B C   1 
ATOM 2041  O O   . PRO B 1 150 ? 54.088  33.899  -2.450  1.00 27.43 ? 150 PRO B O   1 
ATOM 2042  C CB  . PRO B 1 150 ? 54.473  36.636  -1.051  1.00 23.85 ? 150 PRO B CB  1 
ATOM 2043  C CG  . PRO B 1 150 ? 53.200  36.152  -0.439  1.00 24.45 ? 150 PRO B CG  1 
ATOM 2044  C CD  . PRO B 1 150 ? 52.139  36.578  -1.433  1.00 24.02 ? 150 PRO B CD  1 
ATOM 2045  N N   . MET B 1 151 ? 55.871  34.749  -3.511  1.00 28.53 ? 151 MET B N   1 
ATOM 2046  C CA  . MET B 1 151 ? 56.384  33.441  -3.862  1.00 30.16 ? 151 MET B CA  1 
ATOM 2047  C C   . MET B 1 151 ? 57.876  33.337  -3.585  1.00 32.28 ? 151 MET B C   1 
ATOM 2048  O O   . MET B 1 151 ? 58.570  34.342  -3.448  1.00 33.14 ? 151 MET B O   1 
ATOM 2049  C CB  . MET B 1 151 ? 56.103  33.169  -5.334  1.00 29.20 ? 151 MET B CB  1 
ATOM 2050  C CG  . MET B 1 151 ? 54.628  33.183  -5.690  1.00 29.52 ? 151 MET B CG  1 
ATOM 2051  S SD  . MET B 1 151 ? 54.311  32.859  -7.459  1.00 30.84 ? 151 MET B SD  1 
ATOM 2052  C CE  . MET B 1 151 ? 54.273  31.065  -7.455  1.00 29.45 ? 151 MET B CE  1 
ATOM 2053  N N   . SER B 1 152 ? 58.365  32.109  -3.493  1.00 35.01 ? 152 SER B N   1 
ATOM 2054  C CA  . SER B 1 152 ? 59.776  31.846  -3.257  1.00 36.84 ? 152 SER B CA  1 
ATOM 2055  C C   . SER B 1 152 ? 60.643  32.294  -4.430  1.00 38.41 ? 152 SER B C   1 
ATOM 2056  O O   . SER B 1 152 ? 60.181  32.358  -5.568  1.00 37.34 ? 152 SER B O   1 
ATOM 2057  C CB  . SER B 1 152 ? 59.987  30.353  -3.040  1.00 37.04 ? 152 SER B CB  1 
ATOM 2058  O OG  . SER B 1 152 ? 61.197  29.930  -3.649  1.00 37.70 ? 152 SER B OG  1 
ATOM 2059  N N   . ALA B 1 153 ? 61.909  32.593  -4.145  1.00 41.03 ? 153 ALA B N   1 
ATOM 2060  C CA  . ALA B 1 153 ? 62.840  33.006  -5.185  1.00 42.86 ? 153 ALA B CA  1 
ATOM 2061  C C   . ALA B 1 153 ? 63.602  31.776  -5.702  1.00 44.36 ? 153 ALA B C   1 
ATOM 2062  O O   . ALA B 1 153 ? 64.827  31.803  -5.822  1.00 44.99 ? 153 ALA B O   1 
ATOM 2063  C CB  . ALA B 1 153 ? 63.804  34.041  -4.633  1.00 41.79 ? 153 ALA B CB  1 
ATOM 2064  N N   . LYS B 1 154 ? 62.860  30.706  -6.014  1.00 45.81 ? 154 LYS B N   1 
ATOM 2065  C CA  . LYS B 1 154 ? 63.428  29.436  -6.509  1.00 46.24 ? 154 LYS B CA  1 
ATOM 2066  C C   . LYS B 1 154 ? 64.493  28.924  -5.549  1.00 45.99 ? 154 LYS B C   1 
ATOM 2067  O O   . LYS B 1 154 ? 64.496  29.418  -4.399  1.00 45.32 ? 154 LYS B O   1 
ATOM 2068  C CB  . LYS B 1 154 ? 64.051  29.606  -7.908  1.00 46.69 ? 154 LYS B CB  1 
ATOM 2069  N N   . PHE C 1 21  ? 43.252  19.538  8.805   1.00 68.80 ? 21  PHE C N   1 
ATOM 2070  C CA  . PHE C 1 21  ? 42.187  20.403  9.392   1.00 69.16 ? 21  PHE C CA  1 
ATOM 2071  C C   . PHE C 1 21  ? 41.845  20.024  10.821  1.00 68.81 ? 21  PHE C C   1 
ATOM 2072  O O   . PHE C 1 21  ? 41.780  18.831  11.151  1.00 69.03 ? 21  PHE C O   1 
ATOM 2073  C CB  . PHE C 1 21  ? 40.878  20.255  8.619   1.00 70.62 ? 21  PHE C CB  1 
ATOM 2074  C CG  . PHE C 1 21  ? 40.844  20.986  7.320   1.00 72.04 ? 21  PHE C CG  1 
ATOM 2075  C CD1 . PHE C 1 21  ? 40.703  20.291  6.123   1.00 72.63 ? 21  PHE C CD1 1 
ATOM 2076  C CD2 . PHE C 1 21  ? 40.872  22.372  7.294   1.00 72.57 ? 21  PHE C CD2 1 
ATOM 2077  C CE1 . PHE C 1 21  ? 40.577  20.962  4.914   1.00 73.59 ? 21  PHE C CE1 1 
ATOM 2078  C CE2 . PHE C 1 21  ? 40.746  23.055  6.098   1.00 73.45 ? 21  PHE C CE2 1 
ATOM 2079  C CZ  . PHE C 1 21  ? 40.596  22.353  4.902   1.00 74.27 ? 21  PHE C CZ  1 
ATOM 2080  N N   . PRO C 1 22  ? 41.618  21.035  11.691  1.00 68.06 ? 22  PRO C N   1 
ATOM 2081  C CA  . PRO C 1 22  ? 41.258  20.762  13.088  1.00 66.85 ? 22  PRO C CA  1 
ATOM 2082  C C   . PRO C 1 22  ? 40.019  19.838  13.088  1.00 65.98 ? 22  PRO C C   1 
ATOM 2083  O O   . PRO C 1 22  ? 39.139  19.960  12.229  1.00 65.36 ? 22  PRO C O   1 
ATOM 2084  C CB  . PRO C 1 22  ? 40.961  22.154  13.633  1.00 66.91 ? 22  PRO C CB  1 
ATOM 2085  C CG  . PRO C 1 22  ? 42.023  22.977  12.929  1.00 67.55 ? 22  PRO C CG  1 
ATOM 2086  C CD  . PRO C 1 22  ? 41.958  22.463  11.504  1.00 67.60 ? 22  PRO C CD  1 
ATOM 2087  N N   . PRO C 1 23  ? 39.944  18.895  14.048  1.00 64.97 ? 23  PRO C N   1 
ATOM 2088  C CA  . PRO C 1 23  ? 38.826  17.947  14.138  1.00 63.82 ? 23  PRO C CA  1 
ATOM 2089  C C   . PRO C 1 23  ? 37.375  18.431  13.932  1.00 62.59 ? 23  PRO C C   1 
ATOM 2090  O O   . PRO C 1 23  ? 36.840  18.327  12.813  1.00 63.24 ? 23  PRO C O   1 
ATOM 2091  C CB  . PRO C 1 23  ? 39.043  17.279  15.506  1.00 63.57 ? 23  PRO C CB  1 
ATOM 2092  C CG  . PRO C 1 23  ? 39.844  18.298  16.271  1.00 63.88 ? 23  PRO C CG  1 
ATOM 2093  C CD  . PRO C 1 23  ? 40.819  18.767  15.224  1.00 64.76 ? 23  PRO C CD  1 
ATOM 2094  N N   . GLY C 1 24  ? 36.752  18.934  15.001  1.00 59.84 ? 24  GLY C N   1 
ATOM 2095  C CA  . GLY C 1 24  ? 35.365  19.400  14.951  1.00 56.47 ? 24  GLY C CA  1 
ATOM 2096  C C   . GLY C 1 24  ? 34.660  19.653  13.620  1.00 54.34 ? 24  GLY C C   1 
ATOM 2097  O O   . GLY C 1 24  ? 35.272  20.093  12.637  1.00 55.30 ? 24  GLY C O   1 
ATOM 2098  N N   . HIS C 1 25  ? 33.358  19.378  13.584  1.00 51.21 ? 25  HIS C N   1 
ATOM 2099  C CA  . HIS C 1 25  ? 32.557  19.606  12.387  1.00 47.24 ? 25  HIS C CA  1 
ATOM 2100  C C   . HIS C 1 25  ? 31.498  20.665  12.728  1.00 44.37 ? 25  HIS C C   1 
ATOM 2101  O O   . HIS C 1 25  ? 30.827  20.576  13.759  1.00 43.05 ? 25  HIS C O   1 
ATOM 2102  C CB  . HIS C 1 25  ? 31.903  18.304  11.933  1.00 49.35 ? 25  HIS C CB  1 
ATOM 2103  C CG  . HIS C 1 25  ? 31.237  18.400  10.592  1.00 51.50 ? 25  HIS C CG  1 
ATOM 2104  N ND1 . HIS C 1 25  ? 31.935  18.706  9.439   1.00 51.96 ? 25  HIS C ND1 1 
ATOM 2105  C CD2 . HIS C 1 25  ? 29.940  18.269  10.230  1.00 50.95 ? 25  HIS C CD2 1 
ATOM 2106  C CE1 . HIS C 1 25  ? 31.089  18.759  8.426   1.00 53.36 ? 25  HIS C CE1 1 
ATOM 2107  N NE2 . HIS C 1 25  ? 29.874  18.499  8.876   1.00 52.51 ? 25  HIS C NE2 1 
ATOM 2108  N N   . PHE C 1 26  ? 31.338  21.653  11.850  1.00 41.30 ? 26  PHE C N   1 
ATOM 2109  C CA  . PHE C 1 26  ? 30.417  22.765  12.098  1.00 38.52 ? 26  PHE C CA  1 
ATOM 2110  C C   . PHE C 1 26  ? 28.948  22.475  12.405  1.00 38.26 ? 26  PHE C C   1 
ATOM 2111  O O   . PHE C 1 26  ? 28.266  23.316  12.987  1.00 38.01 ? 26  PHE C O   1 
ATOM 2112  C CB  . PHE C 1 26  ? 30.522  23.803  10.970  1.00 35.97 ? 26  PHE C CB  1 
ATOM 2113  C CG  . PHE C 1 26  ? 29.801  23.422  9.716   1.00 34.01 ? 26  PHE C CG  1 
ATOM 2114  C CD1 . PHE C 1 26  ? 28.433  23.647  9.587   1.00 32.45 ? 26  PHE C CD1 1 
ATOM 2115  C CD2 . PHE C 1 26  ? 30.486  22.845  8.653   1.00 32.51 ? 26  PHE C CD2 1 
ATOM 2116  C CE1 . PHE C 1 26  ? 27.758  23.306  8.421   1.00 31.28 ? 26  PHE C CE1 1 
ATOM 2117  C CE2 . PHE C 1 26  ? 29.817  22.501  7.479   1.00 31.66 ? 26  PHE C CE2 1 
ATOM 2118  C CZ  . PHE C 1 26  ? 28.447  22.735  7.366   1.00 31.16 ? 26  PHE C CZ  1 
ATOM 2119  N N   . LYS C 1 27  ? 28.458  21.296  12.042  1.00 37.97 ? 27  LYS C N   1 
ATOM 2120  C CA  . LYS C 1 27  ? 27.067  20.925  12.315  1.00 37.08 ? 27  LYS C CA  1 
ATOM 2121  C C   . LYS C 1 27  ? 26.862  20.389  13.727  1.00 36.38 ? 27  LYS C C   1 
ATOM 2122  O O   . LYS C 1 27  ? 25.768  20.432  14.270  1.00 37.36 ? 27  LYS C O   1 
ATOM 2123  C CB  . LYS C 1 27  ? 26.625  19.851  11.325  1.00 35.99 ? 27  LYS C CB  1 
ATOM 2124  C CG  . LYS C 1 27  ? 25.946  20.376  10.089  1.00 36.31 ? 27  LYS C CG  1 
ATOM 2125  C CD  . LYS C 1 27  ? 25.917  19.320  9.014   1.00 38.16 ? 27  LYS C CD  1 
ATOM 2126  C CE  . LYS C 1 27  ? 27.250  19.285  8.296   1.00 39.97 ? 27  LYS C CE  1 
ATOM 2127  N NZ  . LYS C 1 27  ? 27.398  18.087  7.436   1.00 40.10 ? 27  LYS C NZ  1 
ATOM 2128  N N   . ASP C 1 28  ? 27.926  19.873  14.315  1.00 36.48 ? 28  ASP C N   1 
ATOM 2129  C CA  . ASP C 1 28  ? 27.868  19.293  15.648  1.00 36.19 ? 28  ASP C CA  1 
ATOM 2130  C C   . ASP C 1 28  ? 27.526  20.268  16.754  1.00 36.04 ? 28  ASP C C   1 
ATOM 2131  O O   . ASP C 1 28  ? 27.862  21.442  16.689  1.00 36.92 ? 28  ASP C O   1 
ATOM 2132  C CB  . ASP C 1 28  ? 29.211  18.673  16.001  1.00 36.63 ? 28  ASP C CB  1 
ATOM 2133  C CG  . ASP C 1 28  ? 29.525  17.474  15.178  1.00 36.35 ? 28  ASP C CG  1 
ATOM 2134  O OD1 . ASP C 1 28  ? 30.675  17.012  15.260  1.00 36.06 ? 28  ASP C OD1 1 
ATOM 2135  O OD2 . ASP C 1 28  ? 28.626  16.992  14.461  1.00 37.96 ? 28  ASP C OD2 1 
ATOM 2136  N N   . PRO C 1 29  ? 26.854  19.785  17.802  1.00 35.56 ? 29  PRO C N   1 
ATOM 2137  C CA  . PRO C 1 29  ? 26.514  20.679  18.913  1.00 35.28 ? 29  PRO C CA  1 
ATOM 2138  C C   . PRO C 1 29  ? 27.850  21.059  19.559  1.00 35.10 ? 29  PRO C C   1 
ATOM 2139  O O   . PRO C 1 29  ? 28.838  20.311  19.417  1.00 34.49 ? 29  PRO C O   1 
ATOM 2140  C CB  . PRO C 1 29  ? 25.689  19.781  19.844  1.00 33.67 ? 29  PRO C CB  1 
ATOM 2141  C CG  . PRO C 1 29  ? 25.138  18.736  18.941  1.00 34.34 ? 29  PRO C CG  1 
ATOM 2142  C CD  . PRO C 1 29  ? 26.304  18.440  18.027  1.00 35.23 ? 29  PRO C CD  1 
ATOM 2143  N N   . LYS C 1 30  ? 27.894  22.187  20.270  1.00 34.33 ? 30  LYS C N   1 
ATOM 2144  C CA  . LYS C 1 30  ? 29.136  22.601  20.917  1.00 34.28 ? 30  LYS C CA  1 
ATOM 2145  C C   . LYS C 1 30  ? 28.923  23.244  22.270  1.00 34.29 ? 30  LYS C C   1 
ATOM 2146  O O   . LYS C 1 30  ? 27.785  23.514  22.678  1.00 34.32 ? 30  LYS C O   1 
ATOM 2147  C CB  . LYS C 1 30  ? 29.927  23.555  20.013  1.00 33.91 ? 30  LYS C CB  1 
ATOM 2148  C CG  . LYS C 1 30  ? 30.432  22.874  18.753  1.00 38.33 ? 30  LYS C CG  1 
ATOM 2149  C CD  . LYS C 1 30  ? 31.023  23.839  17.741  1.00 41.79 ? 30  LYS C CD  1 
ATOM 2150  C CE  . LYS C 1 30  ? 31.274  23.131  16.409  1.00 43.55 ? 30  LYS C CE  1 
ATOM 2151  N NZ  . LYS C 1 30  ? 30.130  23.290  15.452  1.00 45.50 ? 30  LYS C NZ  1 
ATOM 2152  N N   . ARG C 1 31  ? 30.035  23.451  22.974  1.00 33.04 ? 31  ARG C N   1 
ATOM 2153  C CA  . ARG C 1 31  ? 30.027  24.105  24.270  1.00 31.88 ? 31  ARG C CA  1 
ATOM 2154  C C   . ARG C 1 31  ? 30.670  25.460  24.016  1.00 31.05 ? 31  ARG C C   1 
ATOM 2155  O O   . ARG C 1 31  ? 31.616  25.560  23.228  1.00 31.16 ? 31  ARG C O   1 
ATOM 2156  C CB  . ARG C 1 31  ? 30.905  23.364  25.288  1.00 33.53 ? 31  ARG C CB  1 
ATOM 2157  C CG  . ARG C 1 31  ? 30.467  21.959  25.705  1.00 36.33 ? 31  ARG C CG  1 
ATOM 2158  C CD  . ARG C 1 31  ? 31.221  21.561  26.978  1.00 39.51 ? 31  ARG C CD  1 
ATOM 2159  N NE  . ARG C 1 31  ? 31.746  20.196  26.953  1.00 42.47 ? 31  ARG C NE  1 
ATOM 2160  C CZ  . ARG C 1 31  ? 31.005  19.097  27.060  1.00 43.44 ? 31  ARG C CZ  1 
ATOM 2161  N NH1 . ARG C 1 31  ? 29.687  19.186  27.205  1.00 44.12 ? 31  ARG C NH1 1 
ATOM 2162  N NH2 . ARG C 1 31  ? 31.588  17.906  27.009  1.00 44.07 ? 31  ARG C NH2 1 
ATOM 2163  N N   . LEU C 1 32  ? 30.161  26.508  24.650  1.00 28.91 ? 32  LEU C N   1 
ATOM 2164  C CA  . LEU C 1 32  ? 30.784  27.808  24.483  1.00 27.27 ? 32  LEU C CA  1 
ATOM 2165  C C   . LEU C 1 32  ? 31.509  28.203  25.758  1.00 26.51 ? 32  LEU C C   1 
ATOM 2166  O O   . LEU C 1 32  ? 30.902  28.627  26.733  1.00 24.81 ? 32  LEU C O   1 
ATOM 2167  C CB  . LEU C 1 32  ? 29.758  28.861  24.085  1.00 26.70 ? 32  LEU C CB  1 
ATOM 2168  C CG  . LEU C 1 32  ? 29.491  28.829  22.581  1.00 26.87 ? 32  LEU C CG  1 
ATOM 2169  C CD1 . LEU C 1 32  ? 28.525  29.935  22.220  1.00 26.08 ? 32  LEU C CD1 1 
ATOM 2170  C CD2 . LEU C 1 32  ? 30.805  28.981  21.817  1.00 24.29 ? 32  LEU C CD2 1 
ATOM 2171  N N   . TYR C 1 33  ? 32.822  28.032  25.726  1.00 26.45 ? 33  TYR C N   1 
ATOM 2172  C CA  . TYR C 1 33  ? 33.688  28.338  26.843  1.00 27.65 ? 33  TYR C CA  1 
ATOM 2173  C C   . TYR C 1 33  ? 34.068  29.814  26.856  1.00 28.28 ? 33  TYR C C   1 
ATOM 2174  O O   . TYR C 1 33  ? 34.534  30.342  25.848  1.00 28.88 ? 33  TYR C O   1 
ATOM 2175  C CB  . TYR C 1 33  ? 34.935  27.474  26.736  1.00 26.73 ? 33  TYR C CB  1 
ATOM 2176  C CG  . TYR C 1 33  ? 36.028  27.834  27.705  1.00 26.58 ? 33  TYR C CG  1 
ATOM 2177  C CD1 . TYR C 1 33  ? 37.016  28.751  27.361  1.00 26.59 ? 33  TYR C CD1 1 
ATOM 2178  C CD2 . TYR C 1 33  ? 36.104  27.219  28.952  1.00 26.49 ? 33  TYR C CD2 1 
ATOM 2179  C CE1 . TYR C 1 33  ? 38.060  29.039  28.237  1.00 26.87 ? 33  TYR C CE1 1 
ATOM 2180  C CE2 . TYR C 1 33  ? 37.138  27.498  29.827  1.00 26.98 ? 33  TYR C CE2 1 
ATOM 2181  C CZ  . TYR C 1 33  ? 38.110  28.403  29.464  1.00 27.04 ? 33  TYR C CZ  1 
ATOM 2182  O OH  . TYR C 1 33  ? 39.150  28.646  30.329  1.00 29.93 ? 33  TYR C OH  1 
ATOM 2183  N N   . CYS C 1 34  ? 33.879  30.469  27.999  1.00 28.48 ? 34  CYS C N   1 
ATOM 2184  C CA  . CYS C 1 34  ? 34.187  31.888  28.134  1.00 29.28 ? 34  CYS C CA  1 
ATOM 2185  C C   . CYS C 1 34  ? 35.530  32.115  28.842  1.00 30.47 ? 34  CYS C C   1 
ATOM 2186  O O   . CYS C 1 34  ? 35.742  31.643  29.958  1.00 30.25 ? 34  CYS C O   1 
ATOM 2187  C CB  . CYS C 1 34  ? 33.044  32.576  28.899  1.00 29.29 ? 34  CYS C CB  1 
ATOM 2188  S SG  . CYS C 1 34  ? 33.137  34.378  29.064  1.00 27.27 ? 34  CYS C SG  1 
ATOM 2189  N N   . LYS C 1 35  ? 36.439  32.829  28.181  1.00 32.01 ? 35  LYS C N   1 
ATOM 2190  C CA  . LYS C 1 35  ? 37.751  33.112  28.756  1.00 34.75 ? 35  LYS C CA  1 
ATOM 2191  C C   . LYS C 1 35  ? 37.601  33.652  30.184  1.00 37.40 ? 35  LYS C C   1 
ATOM 2192  O O   . LYS C 1 35  ? 38.337  33.251  31.104  1.00 37.50 ? 35  LYS C O   1 
ATOM 2193  C CB  . LYS C 1 35  ? 38.493  34.143  27.901  1.00 34.19 ? 35  LYS C CB  1 
ATOM 2194  N N   . ASN C 1 36  ? 36.634  34.553  30.358  1.00 38.58 ? 36  ASN C N   1 
ATOM 2195  C CA  . ASN C 1 36  ? 36.356  35.181  31.646  1.00 39.11 ? 36  ASN C CA  1 
ATOM 2196  C C   . ASN C 1 36  ? 35.923  34.197  32.731  1.00 39.15 ? 36  ASN C C   1 
ATOM 2197  O O   . ASN C 1 36  ? 34.734  33.907  32.858  1.00 40.09 ? 36  ASN C O   1 
ATOM 2198  C CB  . ASN C 1 36  ? 35.248  36.215  31.469  1.00 38.76 ? 36  ASN C CB  1 
ATOM 2199  C CG  . ASN C 1 36  ? 35.255  37.256  32.560  1.00 38.75 ? 36  ASN C CG  1 
ATOM 2200  O OD1 . ASN C 1 36  ? 34.246  37.916  32.817  1.00 38.38 ? 36  ASN C OD1 1 
ATOM 2201  N ND2 . ASN C 1 36  ? 36.405  37.425  33.200  1.00 38.11 ? 36  ASN C ND2 1 
ATOM 2202  N N   . GLY C 1 37  ? 36.871  33.684  33.509  1.00 38.47 ? 37  GLY C N   1 
ATOM 2203  C CA  . GLY C 1 37  ? 36.519  32.754  34.571  1.00 38.32 ? 37  GLY C CA  1 
ATOM 2204  C C   . GLY C 1 37  ? 36.446  31.287  34.186  1.00 38.70 ? 37  GLY C C   1 
ATOM 2205  O O   . GLY C 1 37  ? 36.409  30.417  35.053  1.00 38.61 ? 37  GLY C O   1 
ATOM 2206  N N   . GLY C 1 38  ? 36.424  31.005  32.889  1.00 38.75 ? 38  GLY C N   1 
ATOM 2207  C CA  . GLY C 1 38  ? 36.361  29.628  32.443  1.00 38.74 ? 38  GLY C CA  1 
ATOM 2208  C C   . GLY C 1 38  ? 34.992  28.991  32.573  1.00 38.36 ? 38  GLY C C   1 
ATOM 2209  O O   . GLY C 1 38  ? 34.879  27.797  32.852  1.00 39.44 ? 38  GLY C O   1 
ATOM 2210  N N   . PHE C 1 39  ? 33.939  29.774  32.376  1.00 37.68 ? 39  PHE C N   1 
ATOM 2211  C CA  . PHE C 1 39  ? 32.594  29.217  32.474  1.00 37.09 ? 39  PHE C CA  1 
ATOM 2212  C C   . PHE C 1 39  ? 32.071  28.846  31.103  1.00 36.24 ? 39  PHE C C   1 
ATOM 2213  O O   . PHE C 1 39  ? 32.397  29.493  30.109  1.00 35.84 ? 39  PHE C O   1 
ATOM 2214  C CB  . PHE C 1 39  ? 31.593  30.212  33.086  1.00 37.34 ? 39  PHE C CB  1 
ATOM 2215  C CG  . PHE C 1 39  ? 32.035  30.805  34.384  1.00 37.19 ? 39  PHE C CG  1 
ATOM 2216  C CD1 . PHE C 1 39  ? 32.856  31.931  34.399  1.00 36.40 ? 39  PHE C CD1 1 
ATOM 2217  C CD2 . PHE C 1 39  ? 31.612  30.251  35.597  1.00 37.55 ? 39  PHE C CD2 1 
ATOM 2218  C CE1 . PHE C 1 39  ? 33.253  32.510  35.607  1.00 37.31 ? 39  PHE C CE1 1 
ATOM 2219  C CE2 . PHE C 1 39  ? 32.000  30.819  36.815  1.00 37.67 ? 39  PHE C CE2 1 
ATOM 2220  C CZ  . PHE C 1 39  ? 32.826  31.956  36.820  1.00 37.65 ? 39  PHE C CZ  1 
ATOM 2221  N N   . PHE C 1 40  ? 31.257  27.797  31.068  1.00 35.47 ? 40  PHE C N   1 
ATOM 2222  C CA  . PHE C 1 40  ? 30.621  27.353  29.840  1.00 34.73 ? 40  PHE C CA  1 
ATOM 2223  C C   . PHE C 1 40  ? 29.266  28.048  29.835  1.00 34.77 ? 40  PHE C C   1 
ATOM 2224  O O   . PHE C 1 40  ? 28.620  28.147  30.875  1.00 34.01 ? 40  PHE C O   1 
ATOM 2225  C CB  . PHE C 1 40  ? 30.403  25.840  29.851  1.00 34.19 ? 40  PHE C CB  1 
ATOM 2226  C CG  . PHE C 1 40  ? 31.654  25.044  29.653  1.00 33.85 ? 40  PHE C CG  1 
ATOM 2227  C CD1 . PHE C 1 40  ? 32.273  25.002  28.403  1.00 33.37 ? 40  PHE C CD1 1 
ATOM 2228  C CD2 . PHE C 1 40  ? 32.226  24.351  30.714  1.00 32.55 ? 40  PHE C CD2 1 
ATOM 2229  C CE1 . PHE C 1 40  ? 33.450  24.279  28.212  1.00 32.99 ? 40  PHE C CE1 1 
ATOM 2230  C CE2 . PHE C 1 40  ? 33.399  23.627  30.537  1.00 32.67 ? 40  PHE C CE2 1 
ATOM 2231  C CZ  . PHE C 1 40  ? 34.017  23.589  29.282  1.00 32.56 ? 40  PHE C CZ  1 
ATOM 2232  N N   . LEU C 1 41  ? 28.843  28.535  28.672  1.00 35.15 ? 41  LEU C N   1 
ATOM 2233  C CA  . LEU C 1 41  ? 27.561  29.203  28.562  1.00 35.58 ? 41  LEU C CA  1 
ATOM 2234  C C   . LEU C 1 41  ? 26.473  28.163  28.759  1.00 36.58 ? 41  LEU C C   1 
ATOM 2235  O O   . LEU C 1 41  ? 26.479  27.133  28.098  1.00 37.98 ? 41  LEU C O   1 
ATOM 2236  C CB  . LEU C 1 41  ? 27.439  29.854  27.189  1.00 34.78 ? 41  LEU C CB  1 
ATOM 2237  C CG  . LEU C 1 41  ? 26.117  30.552  26.865  1.00 34.55 ? 41  LEU C CG  1 
ATOM 2238  C CD1 . LEU C 1 41  ? 25.798  31.587  27.919  1.00 33.44 ? 41  LEU C CD1 1 
ATOM 2239  C CD2 . LEU C 1 41  ? 26.217  31.195  25.491  1.00 33.22 ? 41  LEU C CD2 1 
ATOM 2240  N N   . ARG C 1 42  ? 25.550  28.423  29.678  1.00 37.83 ? 42  ARG C N   1 
ATOM 2241  C CA  . ARG C 1 42  ? 24.466  27.489  29.956  1.00 38.56 ? 42  ARG C CA  1 
ATOM 2242  C C   . ARG C 1 42  ? 23.072  28.071  29.735  1.00 39.61 ? 42  ARG C C   1 
ATOM 2243  O O   . ARG C 1 42  ? 22.766  29.195  30.151  1.00 40.59 ? 42  ARG C O   1 
ATOM 2244  C CB  . ARG C 1 42  ? 24.568  26.975  31.385  1.00 38.58 ? 42  ARG C CB  1 
ATOM 2245  C CG  . ARG C 1 42  ? 23.410  26.101  31.780  1.00 39.20 ? 42  ARG C CG  1 
ATOM 2246  C CD  . ARG C 1 42  ? 23.620  25.538  33.162  1.00 41.29 ? 42  ARG C CD  1 
ATOM 2247  N NE  . ARG C 1 42  ? 23.956  26.579  34.130  1.00 43.41 ? 42  ARG C NE  1 
ATOM 2248  C CZ  . ARG C 1 42  ? 23.849  26.425  35.445  1.00 43.84 ? 42  ARG C CZ  1 
ATOM 2249  N NH1 . ARG C 1 42  ? 23.413  25.270  35.927  1.00 44.79 ? 42  ARG C NH1 1 
ATOM 2250  N NH2 . ARG C 1 42  ? 24.192  27.408  36.274  1.00 43.72 ? 42  ARG C NH2 1 
ATOM 2251  N N   . ILE C 1 43  ? 22.222  27.288  29.086  1.00 39.74 ? 43  ILE C N   1 
ATOM 2252  C CA  . ILE C 1 43  ? 20.868  27.714  28.801  1.00 40.06 ? 43  ILE C CA  1 
ATOM 2253  C C   . ILE C 1 43  ? 19.878  26.801  29.520  1.00 41.35 ? 43  ILE C C   1 
ATOM 2254  O O   . ILE C 1 43  ? 19.689  25.646  29.147  1.00 41.95 ? 43  ILE C O   1 
ATOM 2255  C CB  . ILE C 1 43  ? 20.628  27.701  27.279  1.00 38.51 ? 43  ILE C CB  1 
ATOM 2256  C CG1 . ILE C 1 43  ? 21.555  28.721  26.612  1.00 35.76 ? 43  ILE C CG1 1 
ATOM 2257  C CG2 . ILE C 1 43  ? 19.173  27.985  26.977  1.00 38.73 ? 43  ILE C CG2 1 
ATOM 2258  C CD1 . ILE C 1 43  ? 21.330  28.879  25.132  1.00 35.87 ? 43  ILE C CD1 1 
ATOM 2259  N N   . HIS C 1 44  ? 19.256  27.346  30.560  1.00 43.37 ? 44  HIS C N   1 
ATOM 2260  C CA  . HIS C 1 44  ? 18.300  26.629  31.396  1.00 45.29 ? 44  HIS C CA  1 
ATOM 2261  C C   . HIS C 1 44  ? 16.928  26.414  30.753  1.00 45.87 ? 44  HIS C C   1 
ATOM 2262  O O   . HIS C 1 44  ? 16.469  27.222  29.946  1.00 46.19 ? 44  HIS C O   1 
ATOM 2263  C CB  . HIS C 1 44  ? 18.129  27.381  32.721  1.00 46.26 ? 44  HIS C CB  1 
ATOM 2264  C CG  . HIS C 1 44  ? 19.349  27.370  33.590  1.00 47.59 ? 44  HIS C CG  1 
ATOM 2265  N ND1 . HIS C 1 44  ? 19.735  26.265  34.322  1.00 48.44 ? 44  HIS C ND1 1 
ATOM 2266  C CD2 . HIS C 1 44  ? 20.262  28.336  33.864  1.00 48.21 ? 44  HIS C CD2 1 
ATOM 2267  C CE1 . HIS C 1 44  ? 20.828  26.551  35.010  1.00 48.20 ? 44  HIS C CE1 1 
ATOM 2268  N NE2 . HIS C 1 44  ? 21.169  27.800  34.749  1.00 48.18 ? 44  HIS C NE2 1 
ATOM 2269  N N   . PRO C 1 45  ? 16.250  25.317  31.126  1.00 46.78 ? 45  PRO C N   1 
ATOM 2270  C CA  . PRO C 1 45  ? 14.921  24.953  30.613  1.00 47.27 ? 45  PRO C CA  1 
ATOM 2271  C C   . PRO C 1 45  ? 13.869  26.040  30.818  1.00 47.59 ? 45  PRO C C   1 
ATOM 2272  O O   . PRO C 1 45  ? 12.940  26.177  30.023  1.00 47.16 ? 45  PRO C O   1 
ATOM 2273  C CB  . PRO C 1 45  ? 14.586  23.691  31.400  1.00 47.00 ? 45  PRO C CB  1 
ATOM 2274  C CG  . PRO C 1 45  ? 15.927  23.067  31.609  1.00 47.70 ? 45  PRO C CG  1 
ATOM 2275  C CD  . PRO C 1 45  ? 16.782  24.255  31.998  1.00 47.38 ? 45  PRO C CD  1 
ATOM 2276  N N   . ASP C 1 46  ? 14.016  26.805  31.892  1.00 48.38 ? 46  ASP C N   1 
ATOM 2277  C CA  . ASP C 1 46  ? 13.070  27.869  32.198  1.00 49.57 ? 46  ASP C CA  1 
ATOM 2278  C C   . ASP C 1 46  ? 13.463  29.177  31.509  1.00 50.05 ? 46  ASP C C   1 
ATOM 2279  O O   . ASP C 1 46  ? 12.905  30.239  31.814  1.00 50.79 ? 46  ASP C O   1 
ATOM 2280  C CB  . ASP C 1 46  ? 13.028  28.102  33.704  1.00 50.55 ? 46  ASP C CB  1 
ATOM 2281  C CG  . ASP C 1 46  ? 14.321  28.699  34.224  1.00 52.22 ? 46  ASP C CG  1 
ATOM 2282  O OD1 . ASP C 1 46  ? 15.345  27.980  34.276  1.00 52.36 ? 46  ASP C OD1 1 
ATOM 2283  O OD2 . ASP C 1 46  ? 14.315  29.903  34.566  1.00 54.06 ? 46  ASP C OD2 1 
ATOM 2284  N N   . GLY C 1 47  ? 14.438  29.111  30.604  1.00 49.31 ? 47  GLY C N   1 
ATOM 2285  C CA  . GLY C 1 47  ? 14.868  30.309  29.905  1.00 48.15 ? 47  GLY C CA  1 
ATOM 2286  C C   . GLY C 1 47  ? 15.989  31.087  30.571  1.00 47.37 ? 47  GLY C C   1 
ATOM 2287  O O   . GLY C 1 47  ? 16.471  32.073  30.018  1.00 46.72 ? 47  GLY C O   1 
ATOM 2288  N N   . ARG C 1 48  ? 16.405  30.667  31.758  1.00 47.38 ? 48  ARG C N   1 
ATOM 2289  C CA  . ARG C 1 48  ? 17.490  31.364  32.449  1.00 48.08 ? 48  ARG C CA  1 
ATOM 2290  C C   . ARG C 1 48  ? 18.819  31.156  31.731  1.00 47.67 ? 48  ARG C C   1 
ATOM 2291  O O   . ARG C 1 48  ? 19.084  30.078  31.201  1.00 47.97 ? 48  ARG C O   1 
ATOM 2292  C CB  . ARG C 1 48  ? 17.621  30.873  33.890  1.00 48.19 ? 48  ARG C CB  1 
ATOM 2293  C CG  . ARG C 1 48  ? 17.073  31.825  34.933  1.00 48.70 ? 48  ARG C CG  1 
ATOM 2294  C CD  . ARG C 1 48  ? 17.137  31.165  36.287  1.00 49.43 ? 48  ARG C CD  1 
ATOM 2295  N NE  . ARG C 1 48  ? 16.506  29.850  36.223  1.00 50.57 ? 48  ARG C NE  1 
ATOM 2296  C CZ  . ARG C 1 48  ? 16.991  28.757  36.803  1.00 50.91 ? 48  ARG C CZ  1 
ATOM 2297  N NH1 . ARG C 1 48  ? 16.348  27.601  36.687  1.00 50.97 ? 48  ARG C NH1 1 
ATOM 2298  N NH2 . ARG C 1 48  ? 18.120  28.822  37.500  1.00 50.36 ? 48  ARG C NH2 1 
ATOM 2299  N N   . VAL C 1 49  ? 19.655  32.188  31.717  1.00 46.90 ? 49  VAL C N   1 
ATOM 2300  C CA  . VAL C 1 49  ? 20.953  32.085  31.064  1.00 47.31 ? 49  VAL C CA  1 
ATOM 2301  C C   . VAL C 1 49  ? 22.090  32.454  32.013  1.00 47.58 ? 49  VAL C C   1 
ATOM 2302  O O   . VAL C 1 49  ? 22.031  33.467  32.709  1.00 47.98 ? 49  VAL C O   1 
ATOM 2303  C CB  . VAL C 1 49  ? 21.049  33.000  29.810  1.00 47.25 ? 49  VAL C CB  1 
ATOM 2304  C CG1 . VAL C 1 49  ? 22.493  33.051  29.310  1.00 47.40 ? 49  VAL C CG1 1 
ATOM 2305  C CG2 . VAL C 1 49  ? 20.150  32.482  28.712  1.00 46.68 ? 49  VAL C CG2 1 
ATOM 2306  N N   . ASP C 1 50  ? 23.133  31.631  32.023  1.00 47.74 ? 50  ASP C N   1 
ATOM 2307  C CA  . ASP C 1 50  ? 24.295  31.870  32.877  1.00 48.05 ? 50  ASP C CA  1 
ATOM 2308  C C   . ASP C 1 50  ? 25.456  30.989  32.437  1.00 47.68 ? 50  ASP C C   1 
ATOM 2309  O O   . ASP C 1 50  ? 25.449  30.452  31.334  1.00 47.29 ? 50  ASP C O   1 
ATOM 2310  C CB  . ASP C 1 50  ? 23.969  31.545  34.334  1.00 48.86 ? 50  ASP C CB  1 
ATOM 2311  C CG  . ASP C 1 50  ? 23.733  30.060  34.565  1.00 49.96 ? 50  ASP C CG  1 
ATOM 2312  O OD1 . ASP C 1 50  ? 23.596  29.665  35.739  1.00 51.42 ? 50  ASP C OD1 1 
ATOM 2313  O OD2 . ASP C 1 50  ? 23.676  29.286  33.583  1.00 51.25 ? 50  ASP C OD2 1 
ATOM 2314  N N   . GLY C 1 51  ? 26.441  30.832  33.319  1.00 47.31 ? 51  GLY C N   1 
ATOM 2315  C CA  . GLY C 1 51  ? 27.593  30.002  33.010  1.00 47.42 ? 51  GLY C CA  1 
ATOM 2316  C C   . GLY C 1 51  ? 27.976  29.080  34.156  1.00 47.25 ? 51  GLY C C   1 
ATOM 2317  O O   . GLY C 1 51  ? 27.717  29.399  35.313  1.00 47.35 ? 51  GLY C O   1 
ATOM 2318  N N   . VAL C 1 52  ? 28.571  27.932  33.830  1.00 46.76 ? 52  VAL C N   1 
ATOM 2319  C CA  . VAL C 1 52  ? 29.021  26.946  34.826  1.00 47.38 ? 52  VAL C CA  1 
ATOM 2320  C C   . VAL C 1 52  ? 30.376  26.397  34.411  1.00 47.81 ? 52  VAL C C   1 
ATOM 2321  O O   . VAL C 1 52  ? 30.799  26.568  33.271  1.00 48.88 ? 52  VAL C O   1 
ATOM 2322  C CB  . VAL C 1 52  ? 28.074  25.705  34.960  1.00 46.95 ? 52  VAL C CB  1 
ATOM 2323  C CG1 . VAL C 1 52  ? 26.810  26.079  35.688  1.00 46.28 ? 52  VAL C CG1 1 
ATOM 2324  C CG2 . VAL C 1 52  ? 27.756  25.133  33.591  1.00 46.34 ? 52  VAL C CG2 1 
ATOM 2325  N N   . ARG C 1 53  ? 31.044  25.715  35.332  1.00 47.52 ? 53  ARG C N   1 
ATOM 2326  C CA  . ARG C 1 53  ? 32.351  25.144  35.056  1.00 48.45 ? 53  ARG C CA  1 
ATOM 2327  C C   . ARG C 1 53  ? 32.284  23.646  34.790  1.00 49.15 ? 53  ARG C C   1 
ATOM 2328  O O   . ARG C 1 53  ? 33.197  23.071  34.193  1.00 49.44 ? 53  ARG C O   1 
ATOM 2329  C CB  . ARG C 1 53  ? 33.297  25.390  36.240  1.00 48.29 ? 53  ARG C CB  1 
ATOM 2330  C CG  . ARG C 1 53  ? 33.740  26.840  36.435  1.00 48.44 ? 53  ARG C CG  1 
ATOM 2331  C CD  . ARG C 1 53  ? 34.814  26.940  37.511  1.00 48.69 ? 53  ARG C CD  1 
ATOM 2332  N NE  . ARG C 1 53  ? 35.473  28.249  37.559  1.00 50.79 ? 53  ARG C NE  1 
ATOM 2333  C CZ  . ARG C 1 53  ? 34.959  29.344  38.117  1.00 51.22 ? 53  ARG C CZ  1 
ATOM 2334  N NH1 . ARG C 1 53  ? 33.763  29.309  38.688  1.00 52.25 ? 53  ARG C NH1 1 
ATOM 2335  N NH2 . ARG C 1 53  ? 35.648  30.479  38.116  1.00 51.61 ? 53  ARG C NH2 1 
ATOM 2336  N N   . GLU C 1 54  ? 31.200  23.019  35.233  1.00 50.14 ? 54  GLU C N   1 
ATOM 2337  C CA  . GLU C 1 54  ? 31.022  21.578  35.079  1.00 51.47 ? 54  GLU C CA  1 
ATOM 2338  C C   . GLU C 1 54  ? 30.716  21.127  33.647  1.00 51.18 ? 54  GLU C C   1 
ATOM 2339  O O   . GLU C 1 54  ? 29.577  21.218  33.188  1.00 51.29 ? 54  GLU C O   1 
ATOM 2340  C CB  . GLU C 1 54  ? 29.912  21.099  36.024  1.00 52.96 ? 54  GLU C CB  1 
ATOM 2341  C CG  . GLU C 1 54  ? 29.659  19.602  35.960  1.00 55.61 ? 54  GLU C CG  1 
ATOM 2342  C CD  . GLU C 1 54  ? 30.944  18.805  36.084  1.00 57.19 ? 54  GLU C CD  1 
ATOM 2343  O OE1 . GLU C 1 54  ? 31.656  19.009  37.093  1.00 58.19 ? 54  GLU C OE1 1 
ATOM 2344  O OE2 . GLU C 1 54  ? 31.245  17.986  35.180  1.00 57.33 ? 54  GLU C OE2 1 
ATOM 2345  N N   . LYS C 1 55  ? 31.735  20.619  32.958  1.00 50.63 ? 55  LYS C N   1 
ATOM 2346  C CA  . LYS C 1 55  ? 31.587  20.160  31.580  1.00 50.62 ? 55  LYS C CA  1 
ATOM 2347  C C   . LYS C 1 55  ? 30.464  19.134  31.394  1.00 50.89 ? 55  LYS C C   1 
ATOM 2348  O O   . LYS C 1 55  ? 29.913  18.997  30.301  1.00 51.20 ? 55  LYS C O   1 
ATOM 2349  C CB  . LYS C 1 55  ? 32.911  19.569  31.078  1.00 48.84 ? 55  LYS C CB  1 
ATOM 2350  N N   . SER C 1 56  ? 30.122  18.420  32.460  1.00 51.14 ? 56  SER C N   1 
ATOM 2351  C CA  . SER C 1 56  ? 29.080  17.405  32.390  1.00 51.38 ? 56  SER C CA  1 
ATOM 2352  C C   . SER C 1 56  ? 27.680  17.998  32.371  1.00 51.73 ? 56  SER C C   1 
ATOM 2353  O O   . SER C 1 56  ? 26.731  17.324  31.975  1.00 52.55 ? 56  SER C O   1 
ATOM 2354  C CB  . SER C 1 56  ? 29.188  16.447  33.582  1.00 51.82 ? 56  SER C CB  1 
ATOM 2355  O OG  . SER C 1 56  ? 28.854  17.088  34.808  1.00 52.11 ? 56  SER C OG  1 
ATOM 2356  N N   . ASP C 1 57  ? 27.542  19.244  32.815  1.00 51.32 ? 57  ASP C N   1 
ATOM 2357  C CA  . ASP C 1 57  ? 26.231  19.885  32.836  1.00 50.85 ? 57  ASP C CA  1 
ATOM 2358  C C   . ASP C 1 57  ? 25.543  19.702  31.486  1.00 50.83 ? 57  ASP C C   1 
ATOM 2359  O O   . ASP C 1 57  ? 26.087  20.062  30.444  1.00 52.37 ? 57  ASP C O   1 
ATOM 2360  C CB  . ASP C 1 57  ? 26.377  21.371  33.165  1.00 50.40 ? 57  ASP C CB  1 
ATOM 2361  C CG  . ASP C 1 57  ? 25.036  22.067  33.338  1.00 50.41 ? 57  ASP C CG  1 
ATOM 2362  O OD1 . ASP C 1 57  ? 24.960  23.004  34.170  1.00 50.08 ? 57  ASP C OD1 1 
ATOM 2363  O OD2 . ASP C 1 57  ? 24.064  21.688  32.641  1.00 49.89 ? 57  ASP C OD2 1 
ATOM 2364  N N   . PRO C 1 58  ? 24.333  19.137  31.485  1.00 50.07 ? 58  PRO C N   1 
ATOM 2365  C CA  . PRO C 1 58  ? 23.587  18.910  30.244  1.00 49.94 ? 58  PRO C CA  1 
ATOM 2366  C C   . PRO C 1 58  ? 23.026  20.154  29.551  1.00 49.17 ? 58  PRO C C   1 
ATOM 2367  O O   . PRO C 1 58  ? 22.639  20.087  28.378  1.00 49.88 ? 58  PRO C O   1 
ATOM 2368  C CB  . PRO C 1 58  ? 22.467  17.976  30.692  1.00 50.29 ? 58  PRO C CB  1 
ATOM 2369  C CG  . PRO C 1 58  ? 22.162  18.503  32.060  1.00 50.12 ? 58  PRO C CG  1 
ATOM 2370  C CD  . PRO C 1 58  ? 23.559  18.669  32.648  1.00 50.11 ? 58  PRO C CD  1 
ATOM 2371  N N   . HIS C 1 59  ? 22.970  21.280  30.258  1.00 47.14 ? 59  HIS C N   1 
ATOM 2372  C CA  . HIS C 1 59  ? 22.416  22.489  29.660  1.00 45.81 ? 59  HIS C CA  1 
ATOM 2373  C C   . HIS C 1 59  ? 23.427  23.430  29.015  1.00 43.36 ? 59  HIS C C   1 
ATOM 2374  O O   . HIS C 1 59  ? 23.140  24.607  28.800  1.00 42.69 ? 59  HIS C O   1 
ATOM 2375  C CB  . HIS C 1 59  ? 21.571  23.229  30.693  1.00 47.79 ? 59  HIS C CB  1 
ATOM 2376  C CG  . HIS C 1 59  ? 20.428  22.412  31.209  1.00 50.20 ? 59  HIS C CG  1 
ATOM 2377  N ND1 . HIS C 1 59  ? 19.343  22.073  30.427  1.00 50.51 ? 59  HIS C ND1 1 
ATOM 2378  C CD2 . HIS C 1 59  ? 20.240  21.793  32.401  1.00 50.00 ? 59  HIS C CD2 1 
ATOM 2379  C CE1 . HIS C 1 59  ? 18.541  21.277  31.112  1.00 50.30 ? 59  HIS C CE1 1 
ATOM 2380  N NE2 . HIS C 1 59  ? 19.063  21.092  32.311  1.00 50.24 ? 59  HIS C NE2 1 
ATOM 2381  N N   . ILE C 1 60  ? 24.602  22.899  28.691  1.00 41.08 ? 60  ILE C N   1 
ATOM 2382  C CA  . ILE C 1 60  ? 25.644  23.685  28.039  1.00 38.98 ? 60  ILE C CA  1 
ATOM 2383  C C   . ILE C 1 60  ? 25.907  23.173  26.619  1.00 37.59 ? 60  ILE C C   1 
ATOM 2384  O O   . ILE C 1 60  ? 26.739  23.722  25.904  1.00 36.41 ? 60  ILE C O   1 
ATOM 2385  C CB  . ILE C 1 60  ? 26.989  23.671  28.833  1.00 38.89 ? 60  ILE C CB  1 
ATOM 2386  C CG1 . ILE C 1 60  ? 27.672  22.310  28.712  1.00 37.00 ? 60  ILE C CG1 1 
ATOM 2387  C CG2 . ILE C 1 60  ? 26.735  24.033  30.305  1.00 37.98 ? 60  ILE C CG2 1 
ATOM 2388  C CD1 . ILE C 1 60  ? 28.920  22.200  29.577  1.00 37.43 ? 60  ILE C CD1 1 
ATOM 2389  N N   . LYS C 1 61  ? 25.210  22.111  26.218  1.00 36.39 ? 61  LYS C N   1 
ATOM 2390  C CA  . LYS C 1 61  ? 25.374  21.585  24.865  1.00 34.73 ? 61  LYS C CA  1 
ATOM 2391  C C   . LYS C 1 61  ? 24.502  22.508  24.024  1.00 33.48 ? 61  LYS C C   1 
ATOM 2392  O O   . LYS C 1 61  ? 23.283  22.560  24.200  1.00 33.77 ? 61  LYS C O   1 
ATOM 2393  C CB  . LYS C 1 61  ? 24.882  20.134  24.763  1.00 33.22 ? 61  LYS C CB  1 
ATOM 2394  N N   . LEU C 1 62  ? 25.136  23.249  23.128  1.00 32.01 ? 62  LEU C N   1 
ATOM 2395  C CA  . LEU C 1 62  ? 24.437  24.215  22.293  1.00 30.19 ? 62  LEU C CA  1 
ATOM 2396  C C   . LEU C 1 62  ? 24.508  23.855  20.818  1.00 30.59 ? 62  LEU C C   1 
ATOM 2397  O O   . LEU C 1 62  ? 25.409  23.139  20.375  1.00 30.63 ? 62  LEU C O   1 
ATOM 2398  C CB  . LEU C 1 62  ? 25.062  25.597  22.486  1.00 27.76 ? 62  LEU C CB  1 
ATOM 2399  C CG  . LEU C 1 62  ? 25.408  26.016  23.916  1.00 26.28 ? 62  LEU C CG  1 
ATOM 2400  C CD1 . LEU C 1 62  ? 26.457  27.102  23.900  1.00 24.94 ? 62  LEU C CD1 1 
ATOM 2401  C CD2 . LEU C 1 62  ? 24.158  26.460  24.627  1.00 26.13 ? 62  LEU C CD2 1 
ATOM 2402  N N   . GLN C 1 63  ? 23.560  24.378  20.057  1.00 30.23 ? 63  GLN C N   1 
ATOM 2403  C CA  . GLN C 1 63  ? 23.509  24.136  18.630  1.00 29.67 ? 63  GLN C CA  1 
ATOM 2404  C C   . GLN C 1 63  ? 23.526  25.478  17.912  1.00 29.72 ? 63  GLN C C   1 
ATOM 2405  O O   . GLN C 1 63  ? 22.564  26.253  18.015  1.00 29.68 ? 63  GLN C O   1 
ATOM 2406  C CB  . GLN C 1 63  ? 22.225  23.397  18.277  1.00 30.26 ? 63  GLN C CB  1 
ATOM 2407  C CG  . GLN C 1 63  ? 22.052  23.127  16.795  1.00 29.83 ? 63  GLN C CG  1 
ATOM 2408  C CD  . GLN C 1 63  ? 23.106  22.194  16.256  1.00 30.23 ? 63  GLN C CD  1 
ATOM 2409  O OE1 . GLN C 1 63  ? 23.165  21.021  16.629  1.00 30.15 ? 63  GLN C OE1 1 
ATOM 2410  N NE2 . GLN C 1 63  ? 23.952  22.711  15.374  1.00 30.32 ? 63  GLN C NE2 1 
ATOM 2411  N N   . LEU C 1 64  ? 24.620  25.752  17.200  1.00 29.28 ? 64  LEU C N   1 
ATOM 2412  C CA  . LEU C 1 64  ? 24.749  26.998  16.449  1.00 29.41 ? 64  LEU C CA  1 
ATOM 2413  C C   . LEU C 1 64  ? 24.189  26.760  15.049  1.00 29.30 ? 64  LEU C C   1 
ATOM 2414  O O   . LEU C 1 64  ? 24.360  25.688  14.475  1.00 28.70 ? 64  LEU C O   1 
ATOM 2415  C CB  . LEU C 1 64  ? 26.219  27.420  16.314  1.00 29.30 ? 64  LEU C CB  1 
ATOM 2416  C CG  . LEU C 1 64  ? 27.119  27.721  17.517  1.00 29.90 ? 64  LEU C CG  1 
ATOM 2417  C CD1 . LEU C 1 64  ? 27.718  29.114  17.281  1.00 29.84 ? 64  LEU C CD1 1 
ATOM 2418  C CD2 . LEU C 1 64  ? 26.358  27.654  18.854  1.00 28.83 ? 64  LEU C CD2 1 
ATOM 2419  N N   . GLN C 1 65  ? 23.524  27.762  14.498  1.00 28.48 ? 65  GLN C N   1 
ATOM 2420  C CA  . GLN C 1 65  ? 22.978  27.644  13.160  1.00 28.06 ? 65  GLN C CA  1 
ATOM 2421  C C   . GLN C 1 65  ? 23.099  29.002  12.490  1.00 28.06 ? 65  GLN C C   1 
ATOM 2422  O O   . GLN C 1 65  ? 22.699  30.016  13.057  1.00 29.75 ? 65  GLN C O   1 
ATOM 2423  C CB  . GLN C 1 65  ? 21.511  27.202  13.219  1.00 28.49 ? 65  GLN C CB  1 
ATOM 2424  C CG  . GLN C 1 65  ? 20.764  27.270  11.888  1.00 29.66 ? 65  GLN C CG  1 
ATOM 2425  C CD  . GLN C 1 65  ? 21.428  26.456  10.778  1.00 32.02 ? 65  GLN C CD  1 
ATOM 2426  O OE1 . GLN C 1 65  ? 21.560  25.230  10.875  1.00 32.07 ? 65  GLN C OE1 1 
ATOM 2427  N NE2 . GLN C 1 65  ? 21.843  27.137  9.710   1.00 32.47 ? 65  GLN C NE2 1 
ATOM 2428  N N   . ALA C 1 66  ? 23.688  29.039  11.304  1.00 27.10 ? 66  ALA C N   1 
ATOM 2429  C CA  . ALA C 1 66  ? 23.805  30.306  10.593  1.00 27.42 ? 66  ALA C CA  1 
ATOM 2430  C C   . ALA C 1 66  ? 22.446  30.630  9.965   1.00 28.90 ? 66  ALA C C   1 
ATOM 2431  O O   . ALA C 1 66  ? 21.812  29.762  9.346   1.00 27.76 ? 66  ALA C O   1 
ATOM 2432  C CB  . ALA C 1 66  ? 24.866  30.223  9.508   1.00 25.25 ? 66  ALA C CB  1 
ATOM 2433  N N   . GLU C 1 67  ? 21.991  31.870  10.139  1.00 29.57 ? 67  GLU C N   1 
ATOM 2434  C CA  . GLU C 1 67  ? 20.720  32.284  9.563   1.00 31.02 ? 67  GLU C CA  1 
ATOM 2435  C C   . GLU C 1 67  ? 21.049  32.952  8.233   1.00 31.70 ? 67  GLU C C   1 
ATOM 2436  O O   . GLU C 1 67  ? 20.237  32.988  7.303   1.00 32.76 ? 67  GLU C O   1 
ATOM 2437  C CB  . GLU C 1 67  ? 20.017  33.267  10.491  1.00 30.17 ? 67  GLU C CB  1 
ATOM 2438  C CG  . GLU C 1 67  ? 18.524  33.356  10.252  1.00 31.30 ? 67  GLU C CG  1 
ATOM 2439  C CD  . GLU C 1 67  ? 17.841  32.002  10.350  1.00 32.42 ? 67  GLU C CD  1 
ATOM 2440  O OE1 . GLU C 1 67  ? 18.385  31.098  11.028  1.00 33.05 ? 67  GLU C OE1 1 
ATOM 2441  O OE2 . GLU C 1 67  ? 16.754  31.847  9.757   1.00 32.24 ? 67  GLU C OE2 1 
ATOM 2442  N N   . GLU C 1 68  ? 22.264  33.480  8.171   1.00 31.82 ? 68  GLU C N   1 
ATOM 2443  C CA  . GLU C 1 68  ? 22.797  34.143  6.994   1.00 31.95 ? 68  GLU C CA  1 
ATOM 2444  C C   . GLU C 1 68  ? 24.296  34.295  7.296   1.00 31.46 ? 68  GLU C C   1 
ATOM 2445  O O   . GLU C 1 68  ? 24.730  34.038  8.425   1.00 30.19 ? 68  GLU C O   1 
ATOM 2446  C CB  . GLU C 1 68  ? 22.129  35.510  6.789   1.00 32.82 ? 68  GLU C CB  1 
ATOM 2447  C CG  . GLU C 1 68  ? 22.615  36.612  7.730   1.00 35.55 ? 68  GLU C CG  1 
ATOM 2448  C CD  . GLU C 1 68  ? 21.979  37.969  7.442   1.00 37.10 ? 68  GLU C CD  1 
ATOM 2449  O OE1 . GLU C 1 68  ? 21.646  38.235  6.260   1.00 39.08 ? 68  GLU C OE1 1 
ATOM 2450  O OE2 . GLU C 1 68  ? 21.829  38.778  8.389   1.00 35.62 ? 68  GLU C OE2 1 
ATOM 2451  N N   . ARG C 1 69  ? 25.086  34.701  6.306   1.00 30.88 ? 69  ARG C N   1 
ATOM 2452  C CA  . ARG C 1 69  ? 26.523  34.834  6.518   1.00 30.61 ? 69  ARG C CA  1 
ATOM 2453  C C   . ARG C 1 69  ? 26.919  35.575  7.797   1.00 30.19 ? 69  ARG C C   1 
ATOM 2454  O O   . ARG C 1 69  ? 26.403  36.657  8.092   1.00 30.45 ? 69  ARG C O   1 
ATOM 2455  C CB  . ARG C 1 69  ? 27.188  35.526  5.333   1.00 30.50 ? 69  ARG C CB  1 
ATOM 2456  C CG  . ARG C 1 69  ? 28.664  35.227  5.269   1.00 32.34 ? 69  ARG C CG  1 
ATOM 2457  C CD  . ARG C 1 69  ? 29.342  36.006  4.182   1.00 34.39 ? 69  ARG C CD  1 
ATOM 2458  N NE  . ARG C 1 69  ? 29.887  37.257  4.682   1.00 37.16 ? 69  ARG C NE  1 
ATOM 2459  C CZ  . ARG C 1 69  ? 30.610  38.085  3.942   1.00 39.38 ? 69  ARG C CZ  1 
ATOM 2460  N NH1 . ARG C 1 69  ? 30.857  37.773  2.673   1.00 40.57 ? 69  ARG C NH1 1 
ATOM 2461  N NH2 . ARG C 1 69  ? 31.088  39.213  4.464   1.00 40.17 ? 69  ARG C NH2 1 
ATOM 2462  N N   . GLY C 1 70  ? 27.835  34.983  8.559   1.00 29.10 ? 70  GLY C N   1 
ATOM 2463  C CA  . GLY C 1 70  ? 28.296  35.609  9.784   1.00 27.12 ? 70  GLY C CA  1 
ATOM 2464  C C   . GLY C 1 70  ? 27.271  35.815  10.886  1.00 26.50 ? 70  GLY C C   1 
ATOM 2465  O O   . GLY C 1 70  ? 27.611  36.323  11.947  1.00 26.04 ? 70  GLY C O   1 
ATOM 2466  N N   . VAL C 1 71  ? 26.026  35.409  10.653  1.00 26.35 ? 71  VAL C N   1 
ATOM 2467  C CA  . VAL C 1 71  ? 24.956  35.562  11.639  1.00 25.21 ? 71  VAL C CA  1 
ATOM 2468  C C   . VAL C 1 71  ? 24.438  34.204  12.091  1.00 25.64 ? 71  VAL C C   1 
ATOM 2469  O O   . VAL C 1 71  ? 24.144  33.351  11.256  1.00 26.14 ? 71  VAL C O   1 
ATOM 2470  C CB  . VAL C 1 71  ? 23.787  36.335  11.024  1.00 25.35 ? 71  VAL C CB  1 
ATOM 2471  C CG1 . VAL C 1 71  ? 22.661  36.511  12.048  1.00 23.42 ? 71  VAL C CG1 1 
ATOM 2472  C CG2 . VAL C 1 71  ? 24.299  37.670  10.487  1.00 25.62 ? 71  VAL C CG2 1 
ATOM 2473  N N   . VAL C 1 72  ? 24.290  34.018  13.404  1.00 25.64 ? 72  VAL C N   1 
ATOM 2474  C CA  . VAL C 1 72  ? 23.828  32.738  13.949  1.00 25.12 ? 72  VAL C CA  1 
ATOM 2475  C C   . VAL C 1 72  ? 22.799  32.813  15.090  1.00 25.73 ? 72  VAL C C   1 
ATOM 2476  O O   . VAL C 1 72  ? 22.559  33.860  15.684  1.00 26.13 ? 72  VAL C O   1 
ATOM 2477  C CB  . VAL C 1 72  ? 25.033  31.904  14.518  1.00 24.91 ? 72  VAL C CB  1 
ATOM 2478  C CG1 . VAL C 1 72  ? 26.137  31.780  13.493  1.00 23.10 ? 72  VAL C CG1 1 
ATOM 2479  C CG2 . VAL C 1 72  ? 25.557  32.556  15.818  1.00 24.31 ? 72  VAL C CG2 1 
ATOM 2480  N N   . SER C 1 73  ? 22.219  31.659  15.394  1.00 25.99 ? 73  SER C N   1 
ATOM 2481  C CA  . SER C 1 73  ? 21.279  31.497  16.491  1.00 27.03 ? 73  SER C CA  1 
ATOM 2482  C C   . SER C 1 73  ? 22.014  30.515  17.404  1.00 27.43 ? 73  SER C C   1 
ATOM 2483  O O   . SER C 1 73  ? 22.827  29.715  16.933  1.00 27.59 ? 73  SER C O   1 
ATOM 2484  C CB  . SER C 1 73  ? 19.988  30.841  16.008  1.00 28.46 ? 73  SER C CB  1 
ATOM 2485  O OG  . SER C 1 73  ? 20.196  29.462  15.705  1.00 31.70 ? 73  SER C OG  1 
ATOM 2486  N N   . ILE C 1 74  ? 21.749  30.566  18.701  1.00 27.44 ? 74  ILE C N   1 
ATOM 2487  C CA  . ILE C 1 74  ? 22.411  29.650  19.621  1.00 26.78 ? 74  ILE C CA  1 
ATOM 2488  C C   . ILE C 1 74  ? 21.301  28.981  20.413  1.00 28.89 ? 74  ILE C C   1 
ATOM 2489  O O   . ILE C 1 74  ? 20.606  29.621  21.196  1.00 29.73 ? 74  ILE C O   1 
ATOM 2490  C CB  . ILE C 1 74  ? 23.407  30.424  20.529  1.00 25.26 ? 74  ILE C CB  1 
ATOM 2491  C CG1 . ILE C 1 74  ? 24.520  31.018  19.655  1.00 24.66 ? 74  ILE C CG1 1 
ATOM 2492  C CG2 . ILE C 1 74  ? 24.010  29.509  21.578  1.00 24.87 ? 74  ILE C CG2 1 
ATOM 2493  C CD1 . ILE C 1 74  ? 25.359  32.085  20.327  1.00 21.29 ? 74  ILE C CD1 1 
ATOM 2494  N N   . LYS C 1 75  ? 21.109  27.687  20.187  1.00 30.91 ? 75  LYS C N   1 
ATOM 2495  C CA  . LYS C 1 75  ? 20.036  26.984  20.867  1.00 32.53 ? 75  LYS C CA  1 
ATOM 2496  C C   . LYS C 1 75  ? 20.526  26.013  21.908  1.00 33.29 ? 75  LYS C C   1 
ATOM 2497  O O   . LYS C 1 75  ? 21.378  25.168  21.616  1.00 34.07 ? 75  LYS C O   1 
ATOM 2498  C CB  . LYS C 1 75  ? 19.188  26.250  19.840  1.00 34.29 ? 75  LYS C CB  1 
ATOM 2499  C CG  . LYS C 1 75  ? 17.924  25.619  20.383  1.00 36.55 ? 75  LYS C CG  1 
ATOM 2500  C CD  . LYS C 1 75  ? 17.151  25.003  19.246  1.00 37.43 ? 75  LYS C CD  1 
ATOM 2501  C CE  . LYS C 1 75  ? 15.892  24.338  19.724  1.00 39.46 ? 75  LYS C CE  1 
ATOM 2502  N NZ  . LYS C 1 75  ? 15.135  23.829  18.551  1.00 40.21 ? 75  LYS C NZ  1 
ATOM 2503  N N   . GLY C 1 76  ? 20.006  26.148  23.129  1.00 33.42 ? 76  GLY C N   1 
ATOM 2504  C CA  . GLY C 1 76  ? 20.385  25.235  24.189  1.00 35.05 ? 76  GLY C CA  1 
ATOM 2505  C C   . GLY C 1 76  ? 19.668  23.959  23.818  1.00 36.63 ? 76  GLY C C   1 
ATOM 2506  O O   . GLY C 1 76  ? 18.445  23.929  23.814  1.00 37.33 ? 76  GLY C O   1 
ATOM 2507  N N   . VAL C 1 77  ? 20.398  22.909  23.477  1.00 37.67 ? 77  VAL C N   1 
ATOM 2508  C CA  . VAL C 1 77  ? 19.735  21.682  23.082  1.00 39.55 ? 77  VAL C CA  1 
ATOM 2509  C C   . VAL C 1 77  ? 18.723  21.183  24.105  1.00 40.79 ? 77  VAL C C   1 
ATOM 2510  O O   . VAL C 1 77  ? 17.556  21.014  23.772  1.00 40.89 ? 77  VAL C O   1 
ATOM 2511  C CB  . VAL C 1 77  ? 20.744  20.569  22.771  1.00 39.71 ? 77  VAL C CB  1 
ATOM 2512  C CG1 . VAL C 1 77  ? 20.001  19.291  22.437  1.00 39.65 ? 77  VAL C CG1 1 
ATOM 2513  C CG2 . VAL C 1 77  ? 21.614  20.988  21.592  1.00 39.47 ? 77  VAL C CG2 1 
ATOM 2514  N N   . SER C 1 78  ? 19.158  20.955  25.340  1.00 42.12 ? 78  SER C N   1 
ATOM 2515  C CA  . SER C 1 78  ? 18.258  20.477  26.387  1.00 43.92 ? 78  SER C CA  1 
ATOM 2516  C C   . SER C 1 78  ? 17.104  21.458  26.609  1.00 44.41 ? 78  SER C C   1 
ATOM 2517  O O   . SER C 1 78  ? 15.936  21.127  26.385  1.00 44.40 ? 78  SER C O   1 
ATOM 2518  C CB  . SER C 1 78  ? 19.052  20.269  27.678  1.00 44.86 ? 78  SER C CB  1 
ATOM 2519  O OG  . SER C 1 78  ? 20.341  20.877  27.568  1.00 48.96 ? 78  SER C OG  1 
ATOM 2520  N N   . ALA C 1 79  ? 17.441  22.669  27.033  1.00 45.02 ? 79  ALA C N   1 
ATOM 2521  C CA  . ALA C 1 79  ? 16.457  23.714  27.269  1.00 45.91 ? 79  ALA C CA  1 
ATOM 2522  C C   . ALA C 1 79  ? 15.517  23.898  26.079  1.00 46.36 ? 79  ALA C C   1 
ATOM 2523  O O   . ALA C 1 79  ? 14.421  24.440  26.216  1.00 46.91 ? 79  ALA C O   1 
ATOM 2524  C CB  . ALA C 1 79  ? 17.174  25.023  27.555  1.00 46.12 ? 79  ALA C CB  1 
ATOM 2525  N N   . ASN C 1 80  ? 15.954  23.445  24.908  1.00 46.81 ? 80  ASN C N   1 
ATOM 2526  C CA  . ASN C 1 80  ? 15.169  23.598  23.694  1.00 46.51 ? 80  ASN C CA  1 
ATOM 2527  C C   . ASN C 1 80  ? 14.729  25.066  23.557  1.00 46.74 ? 80  ASN C C   1 
ATOM 2528  O O   . ASN C 1 80  ? 13.622  25.363  23.110  1.00 46.90 ? 80  ASN C O   1 
ATOM 2529  C CB  . ASN C 1 80  ? 13.961  22.665  23.742  1.00 46.55 ? 80  ASN C CB  1 
ATOM 2530  C CG  . ASN C 1 80  ? 13.143  22.704  22.465  1.00 47.57 ? 80  ASN C CG  1 
ATOM 2531  O OD1 . ASN C 1 80  ? 13.679  22.567  21.361  1.00 47.57 ? 80  ASN C OD1 1 
ATOM 2532  N ND2 . ASN C 1 80  ? 11.830  22.885  22.610  1.00 46.55 ? 80  ASN C ND2 1 
ATOM 2533  N N   . ARG C 1 81  ? 15.613  25.978  23.959  1.00 46.66 ? 81  ARG C N   1 
ATOM 2534  C CA  . ARG C 1 81  ? 15.354  27.412  23.884  1.00 46.61 ? 81  ARG C CA  1 
ATOM 2535  C C   . ARG C 1 81  ? 16.489  28.100  23.124  1.00 45.88 ? 81  ARG C C   1 
ATOM 2536  O O   . ARG C 1 81  ? 17.603  27.574  23.049  1.00 46.33 ? 81  ARG C O   1 
ATOM 2537  C CB  . ARG C 1 81  ? 15.265  28.018  25.287  1.00 48.01 ? 81  ARG C CB  1 
ATOM 2538  C CG  . ARG C 1 81  ? 14.016  27.686  26.089  1.00 50.07 ? 81  ARG C CG  1 
ATOM 2539  C CD  . ARG C 1 81  ? 14.036  28.441  27.426  1.00 52.05 ? 81  ARG C CD  1 
ATOM 2540  N NE  . ARG C 1 81  ? 12.936  28.082  28.324  1.00 53.54 ? 81  ARG C NE  1 
ATOM 2541  C CZ  . ARG C 1 81  ? 11.867  28.841  28.574  1.00 53.89 ? 81  ARG C CZ  1 
ATOM 2542  N NH1 . ARG C 1 81  ? 11.720  30.034  27.999  1.00 52.39 ? 81  ARG C NH1 1 
ATOM 2543  N NH2 . ARG C 1 81  ? 10.937  28.400  29.410  1.00 53.84 ? 81  ARG C NH2 1 
ATOM 2544  N N   . TYR C 1 82  ? 16.207  29.280  22.577  1.00 43.92 ? 82  TYR C N   1 
ATOM 2545  C CA  . TYR C 1 82  ? 17.204  30.033  21.831  1.00 42.86 ? 82  TYR C CA  1 
ATOM 2546  C C   . TYR C 1 82  ? 17.756  31.202  22.642  1.00 41.55 ? 82  TYR C C   1 
ATOM 2547  O O   . TYR C 1 82  ? 17.000  31.928  23.274  1.00 42.18 ? 82  TYR C O   1 
ATOM 2548  C CB  . TYR C 1 82  ? 16.589  30.556  20.527  1.00 43.23 ? 82  TYR C CB  1 
ATOM 2549  C CG  . TYR C 1 82  ? 16.160  29.458  19.570  1.00 43.47 ? 82  TYR C CG  1 
ATOM 2550  C CD1 . TYR C 1 82  ? 14.958  28.767  19.756  1.00 43.15 ? 82  TYR C CD1 1 
ATOM 2551  C CD2 . TYR C 1 82  ? 16.977  29.076  18.505  1.00 43.48 ? 82  TYR C CD2 1 
ATOM 2552  C CE1 . TYR C 1 82  ? 14.588  27.726  18.909  1.00 42.59 ? 82  TYR C CE1 1 
ATOM 2553  C CE2 . TYR C 1 82  ? 16.615  28.035  17.656  1.00 43.53 ? 82  TYR C CE2 1 
ATOM 2554  C CZ  . TYR C 1 82  ? 15.425  27.366  17.866  1.00 43.19 ? 82  TYR C CZ  1 
ATOM 2555  O OH  . TYR C 1 82  ? 15.096  26.313  17.052  1.00 43.55 ? 82  TYR C OH  1 
ATOM 2556  N N   . LEU C 1 83  ? 19.073  31.378  22.626  1.00 40.18 ? 83  LEU C N   1 
ATOM 2557  C CA  . LEU C 1 83  ? 19.697  32.483  23.349  1.00 39.19 ? 83  LEU C CA  1 
ATOM 2558  C C   . LEU C 1 83  ? 19.156  33.766  22.750  1.00 39.18 ? 83  LEU C C   1 
ATOM 2559  O O   . LEU C 1 83  ? 18.995  33.868  21.531  1.00 39.54 ? 83  LEU C O   1 
ATOM 2560  C CB  . LEU C 1 83  ? 21.222  32.463  23.188  1.00 37.44 ? 83  LEU C CB  1 
ATOM 2561  C CG  . LEU C 1 83  ? 21.981  33.530  23.983  1.00 36.77 ? 83  LEU C CG  1 
ATOM 2562  C CD1 . LEU C 1 83  ? 22.033  33.128  25.446  1.00 34.53 ? 83  LEU C CD1 1 
ATOM 2563  C CD2 . LEU C 1 83  ? 23.390  33.679  23.436  1.00 35.97 ? 83  LEU C CD2 1 
ATOM 2564  N N   . ALA C 1 84  ? 18.874  34.742  23.608  1.00 39.23 ? 84  ALA C N   1 
ATOM 2565  C CA  . ALA C 1 84  ? 18.335  36.019  23.163  1.00 39.04 ? 84  ALA C CA  1 
ATOM 2566  C C   . ALA C 1 84  ? 18.769  37.154  24.084  1.00 39.72 ? 84  ALA C C   1 
ATOM 2567  O O   . ALA C 1 84  ? 18.957  36.964  25.288  1.00 39.47 ? 84  ALA C O   1 
ATOM 2568  C CB  . ALA C 1 84  ? 16.815  35.952  23.113  1.00 36.01 ? 84  ALA C CB  1 
ATOM 2569  N N   . MET C 1 85  ? 18.934  38.337  23.505  1.00 40.72 ? 85  MET C N   1 
ATOM 2570  C CA  . MET C 1 85  ? 19.316  39.510  24.273  1.00 41.82 ? 85  MET C CA  1 
ATOM 2571  C C   . MET C 1 85  ? 18.193  40.543  24.143  1.00 42.69 ? 85  MET C C   1 
ATOM 2572  O O   . MET C 1 85  ? 17.931  41.062  23.052  1.00 42.35 ? 85  MET C O   1 
ATOM 2573  C CB  . MET C 1 85  ? 20.629  40.092  23.748  1.00 41.94 ? 85  MET C CB  1 
ATOM 2574  C CG  . MET C 1 85  ? 21.160  41.214  24.610  1.00 42.88 ? 85  MET C CG  1 
ATOM 2575  S SD  . MET C 1 85  ? 22.501  42.130  23.833  1.00 45.33 ? 85  MET C SD  1 
ATOM 2576  C CE  . MET C 1 85  ? 23.902  41.084  24.283  1.00 44.64 ? 85  MET C CE  1 
ATOM 2577  N N   . LYS C 1 86  ? 17.534  40.828  25.265  1.00 43.24 ? 86  LYS C N   1 
ATOM 2578  C CA  . LYS C 1 86  ? 16.429  41.772  25.310  1.00 43.78 ? 86  LYS C CA  1 
ATOM 2579  C C   . LYS C 1 86  ? 16.868  43.237  25.249  1.00 44.79 ? 86  LYS C C   1 
ATOM 2580  O O   . LYS C 1 86  ? 18.048  43.559  25.417  1.00 44.06 ? 86  LYS C O   1 
ATOM 2581  C CB  . LYS C 1 86  ? 15.602  41.517  26.569  1.00 42.76 ? 86  LYS C CB  1 
ATOM 2582  N N   . GLU C 1 87  ? 15.897  44.115  24.996  1.00 46.15 ? 87  GLU C N   1 
ATOM 2583  C CA  . GLU C 1 87  ? 16.119  45.560  24.898  1.00 46.95 ? 87  GLU C CA  1 
ATOM 2584  C C   . GLU C 1 87  ? 17.060  46.132  25.965  1.00 47.71 ? 87  GLU C C   1 
ATOM 2585  O O   . GLU C 1 87  ? 17.923  46.950  25.664  1.00 48.26 ? 87  GLU C O   1 
ATOM 2586  C CB  . GLU C 1 87  ? 14.774  46.290  24.977  1.00 47.00 ? 87  GLU C CB  1 
ATOM 2587  N N   . ASP C 1 88  ? 16.877  45.704  27.209  1.00 47.93 ? 88  ASP C N   1 
ATOM 2588  C CA  . ASP C 1 88  ? 17.686  46.169  28.330  1.00 48.48 ? 88  ASP C CA  1 
ATOM 2589  C C   . ASP C 1 88  ? 19.125  45.659  28.319  1.00 49.18 ? 88  ASP C C   1 
ATOM 2590  O O   . ASP C 1 88  ? 19.992  46.225  28.986  1.00 50.28 ? 88  ASP C O   1 
ATOM 2591  C CB  . ASP C 1 88  ? 17.029  45.743  29.650  1.00 49.32 ? 88  ASP C CB  1 
ATOM 2592  C CG  . ASP C 1 88  ? 16.786  44.240  29.730  1.00 50.36 ? 88  ASP C CG  1 
ATOM 2593  O OD1 . ASP C 1 88  ? 16.387  43.741  30.804  1.00 50.46 ? 88  ASP C OD1 1 
ATOM 2594  O OD2 . ASP C 1 88  ? 16.986  43.549  28.710  1.00 52.03 ? 88  ASP C OD2 1 
ATOM 2595  N N   . GLY C 1 89  ? 19.379  44.587  27.580  1.00 48.56 ? 89  GLY C N   1 
ATOM 2596  C CA  . GLY C 1 89  ? 20.716  44.032  27.546  1.00 47.89 ? 89  GLY C CA  1 
ATOM 2597  C C   . GLY C 1 89  ? 20.784  42.734  28.332  1.00 48.37 ? 89  GLY C C   1 
ATOM 2598  O O   . GLY C 1 89  ? 21.831  42.079  28.393  1.00 47.76 ? 89  GLY C O   1 
ATOM 2599  N N   . ARG C 1 90  ? 19.665  42.360  28.945  1.00 48.31 ? 90  ARG C N   1 
ATOM 2600  C CA  . ARG C 1 90  ? 19.589  41.121  29.719  1.00 48.51 ? 90  ARG C CA  1 
ATOM 2601  C C   . ARG C 1 90  ? 19.600  39.923  28.772  1.00 48.12 ? 90  ARG C C   1 
ATOM 2602  O O   . ARG C 1 90  ? 19.134  40.024  27.635  1.00 47.20 ? 90  ARG C O   1 
ATOM 2603  C CB  . ARG C 1 90  ? 18.309  41.097  30.572  1.00 48.33 ? 90  ARG C CB  1 
ATOM 2604  N N   . LEU C 1 91  ? 20.139  38.799  29.237  1.00 48.07 ? 91  LEU C N   1 
ATOM 2605  C CA  . LEU C 1 91  ? 20.190  37.588  28.415  1.00 48.42 ? 91  LEU C CA  1 
ATOM 2606  C C   . LEU C 1 91  ? 19.248  36.525  28.927  1.00 48.75 ? 91  LEU C C   1 
ATOM 2607  O O   . LEU C 1 91  ? 19.190  36.263  30.127  1.00 50.07 ? 91  LEU C O   1 
ATOM 2608  C CB  . LEU C 1 91  ? 21.598  36.979  28.375  1.00 48.17 ? 91  LEU C CB  1 
ATOM 2609  C CG  . LEU C 1 91  ? 22.705  37.612  27.528  1.00 47.55 ? 91  LEU C CG  1 
ATOM 2610  C CD1 . LEU C 1 91  ? 23.878  36.645  27.440  1.00 46.97 ? 91  LEU C CD1 1 
ATOM 2611  C CD2 . LEU C 1 91  ? 22.182  37.925  26.133  1.00 47.81 ? 91  LEU C CD2 1 
ATOM 2612  N N   . LEU C 1 92  ? 18.513  35.907  28.012  1.00 48.59 ? 92  LEU C N   1 
ATOM 2613  C CA  . LEU C 1 92  ? 17.587  34.845  28.375  1.00 48.09 ? 92  LEU C CA  1 
ATOM 2614  C C   . LEU C 1 92  ? 17.391  33.896  27.189  1.00 47.92 ? 92  LEU C C   1 
ATOM 2615  O O   . LEU C 1 92  ? 17.870  34.159  26.088  1.00 47.48 ? 92  LEU C O   1 
ATOM 2616  C CB  . LEU C 1 92  ? 16.259  35.454  28.813  1.00 48.34 ? 92  LEU C CB  1 
ATOM 2617  C CG  . LEU C 1 92  ? 15.553  36.309  27.761  1.00 49.55 ? 92  LEU C CG  1 
ATOM 2618  C CD1 . LEU C 1 92  ? 14.834  35.414  26.746  1.00 48.80 ? 92  LEU C CD1 1 
ATOM 2619  C CD2 . LEU C 1 92  ? 14.555  37.222  28.464  1.00 50.35 ? 92  LEU C CD2 1 
ATOM 2620  N N   . ALA C 1 93  ? 16.694  32.790  27.413  1.00 47.71 ? 93  ALA C N   1 
ATOM 2621  C CA  . ALA C 1 93  ? 16.463  31.825  26.347  1.00 47.85 ? 93  ALA C CA  1 
ATOM 2622  C C   . ALA C 1 93  ? 14.975  31.670  26.079  1.00 47.70 ? 93  ALA C C   1 
ATOM 2623  O O   . ALA C 1 93  ? 14.225  31.269  26.965  1.00 48.31 ? 93  ALA C O   1 
ATOM 2624  C CB  . ALA C 1 93  ? 17.069  30.483  26.725  1.00 47.77 ? 93  ALA C CB  1 
ATOM 2625  N N   . SER C 1 94  ? 14.550  31.986  24.859  1.00 47.09 ? 94  SER C N   1 
ATOM 2626  C CA  . SER C 1 94  ? 13.140  31.884  24.508  1.00 46.53 ? 94  SER C CA  1 
ATOM 2627  C C   . SER C 1 94  ? 12.811  30.599  23.755  1.00 47.39 ? 94  SER C C   1 
ATOM 2628  O O   . SER C 1 94  ? 13.638  30.077  22.993  1.00 47.78 ? 94  SER C O   1 
ATOM 2629  C CB  . SER C 1 94  ? 12.715  33.092  23.677  1.00 44.50 ? 94  SER C CB  1 
ATOM 2630  O OG  . SER C 1 94  ? 13.262  33.029  22.382  1.00 43.47 ? 94  SER C OG  1 
ATOM 2631  N N   . LYS C 1 95  ? 11.598  30.093  23.980  1.00 47.22 ? 95  LYS C N   1 
ATOM 2632  C CA  . LYS C 1 95  ? 11.135  28.875  23.334  1.00 46.71 ? 95  LYS C CA  1 
ATOM 2633  C C   . LYS C 1 95  ? 10.986  29.130  21.837  1.00 46.49 ? 95  LYS C C   1 
ATOM 2634  O O   . LYS C 1 95  ? 11.208  28.239  21.009  1.00 45.80 ? 95  LYS C O   1 
ATOM 2635  C CB  . LYS C 1 95  ? 9.784   28.454  23.926  1.00 46.30 ? 95  LYS C CB  1 
ATOM 2636  N N   . SER C 1 96  ? 10.624  30.360  21.492  1.00 45.79 ? 96  SER C N   1 
ATOM 2637  C CA  . SER C 1 96  ? 10.433  30.702  20.090  1.00 46.57 ? 96  SER C CA  1 
ATOM 2638  C C   . SER C 1 96  ? 11.435  31.716  19.549  1.00 45.89 ? 96  SER C C   1 
ATOM 2639  O O   . SER C 1 96  ? 11.688  32.750  20.164  1.00 45.59 ? 96  SER C O   1 
ATOM 2640  C CB  . SER C 1 96  ? 9.007   31.225  19.870  1.00 47.79 ? 96  SER C CB  1 
ATOM 2641  O OG  . SER C 1 96  ? 8.767   32.381  20.653  1.00 49.42 ? 96  SER C OG  1 
ATOM 2642  N N   . VAL C 1 97  ? 11.981  31.403  18.378  1.00 44.60 ? 97  VAL C N   1 
ATOM 2643  C CA  . VAL C 1 97  ? 12.953  32.242  17.687  1.00 43.67 ? 97  VAL C CA  1 
ATOM 2644  C C   . VAL C 1 97  ? 12.371  33.620  17.325  1.00 43.34 ? 97  VAL C C   1 
ATOM 2645  O O   . VAL C 1 97  ? 11.340  33.715  16.668  1.00 42.26 ? 97  VAL C O   1 
ATOM 2646  C CB  . VAL C 1 97  ? 13.429  31.517  16.389  1.00 43.99 ? 97  VAL C CB  1 
ATOM 2647  C CG1 . VAL C 1 97  ? 14.409  32.375  15.605  1.00 43.36 ? 97  VAL C CG1 1 
ATOM 2648  C CG2 . VAL C 1 97  ? 14.066  30.186  16.752  1.00 44.25 ? 97  VAL C CG2 1 
ATOM 2649  N N   . THR C 1 98  ? 13.049  34.681  17.749  1.00 43.03 ? 98  THR C N   1 
ATOM 2650  C CA  . THR C 1 98  ? 12.607  36.041  17.472  1.00 42.26 ? 98  THR C CA  1 
ATOM 2651  C C   . THR C 1 98  ? 13.794  36.764  16.854  1.00 41.48 ? 98  THR C C   1 
ATOM 2652  O O   . THR C 1 98  ? 14.831  36.157  16.643  1.00 41.86 ? 98  THR C O   1 
ATOM 2653  C CB  . THR C 1 98  ? 12.177  36.753  18.780  1.00 42.70 ? 98  THR C CB  1 
ATOM 2654  O OG1 . THR C 1 98  ? 13.335  37.125  19.543  1.00 44.21 ? 98  THR C OG1 1 
ATOM 2655  C CG2 . THR C 1 98  ? 11.332  35.815  19.631  1.00 41.71 ? 98  THR C CG2 1 
ATOM 2656  N N   . ASP C 1 99  ? 13.653  38.052  16.576  1.00 41.36 ? 99  ASP C N   1 
ATOM 2657  C CA  . ASP C 1 99  ? 14.738  38.811  15.977  1.00 42.04 ? 99  ASP C CA  1 
ATOM 2658  C C   . ASP C 1 99  ? 15.839  39.175  16.971  1.00 42.12 ? 99  ASP C C   1 
ATOM 2659  O O   . ASP C 1 99  ? 16.820  39.817  16.612  1.00 42.52 ? 99  ASP C O   1 
ATOM 2660  C CB  . ASP C 1 99  ? 14.176  40.071  15.306  1.00 43.85 ? 99  ASP C CB  1 
ATOM 2661  C CG  . ASP C 1 99  ? 13.509  41.036  16.292  1.00 46.36 ? 99  ASP C CG  1 
ATOM 2662  O OD1 . ASP C 1 99  ? 12.871  40.584  17.273  1.00 47.46 ? 99  ASP C OD1 1 
ATOM 2663  O OD2 . ASP C 1 99  ? 13.610  42.264  16.062  1.00 47.33 ? 99  ASP C OD2 1 
ATOM 2664  N N   . GLU C 1 100 ? 15.677  38.757  18.220  1.00 41.82 ? 100 GLU C N   1 
ATOM 2665  C CA  . GLU C 1 100 ? 16.675  39.033  19.254  1.00 42.31 ? 100 GLU C CA  1 
ATOM 2666  C C   . GLU C 1 100 ? 17.486  37.778  19.547  1.00 40.84 ? 100 GLU C C   1 
ATOM 2667  O O   . GLU C 1 100 ? 18.232  37.721  20.520  1.00 40.30 ? 100 GLU C O   1 
ATOM 2668  C CB  . GLU C 1 100 ? 16.011  39.475  20.551  1.00 43.29 ? 100 GLU C CB  1 
ATOM 2669  C CG  . GLU C 1 100 ? 15.099  40.662  20.436  1.00 44.45 ? 100 GLU C CG  1 
ATOM 2670  C CD  . GLU C 1 100 ? 14.426  40.947  21.757  1.00 46.09 ? 100 GLU C CD  1 
ATOM 2671  O OE1 . GLU C 1 100 ? 13.811  40.005  22.322  1.00 45.31 ? 100 GLU C OE1 1 
ATOM 2672  O OE2 . GLU C 1 100 ? 14.521  42.104  22.232  1.00 46.22 ? 100 GLU C OE2 1 
ATOM 2673  N N   . CYS C 1 101 ? 17.311  36.768  18.708  1.00 39.57 ? 101 CYS C N   1 
ATOM 2674  C CA  . CYS C 1 101 ? 18.021  35.503  18.856  1.00 38.51 ? 101 CYS C CA  1 
ATOM 2675  C C   . CYS C 1 101 ? 19.155  35.341  17.841  1.00 37.94 ? 101 CYS C C   1 
ATOM 2676  O O   . CYS C 1 101 ? 19.656  34.235  17.645  1.00 38.91 ? 101 CYS C O   1 
ATOM 2677  C CB  . CYS C 1 101 ? 17.049  34.349  18.686  1.00 38.50 ? 101 CYS C CB  1 
ATOM 2678  S SG  . CYS C 1 101 ? 15.849  34.265  19.990  1.00 37.98 ? 101 CYS C SG  1 
ATOM 2679  N N   . PHE C 1 102 ? 19.559  36.441  17.210  1.00 35.70 ? 102 PHE C N   1 
ATOM 2680  C CA  . PHE C 1 102 ? 20.610  36.402  16.212  1.00 33.37 ? 102 PHE C CA  1 
ATOM 2681  C C   . PHE C 1 102 ? 21.801  37.248  16.609  1.00 33.00 ? 102 PHE C C   1 
ATOM 2682  O O   . PHE C 1 102 ? 21.658  38.369  17.091  1.00 33.82 ? 102 PHE C O   1 
ATOM 2683  C CB  . PHE C 1 102 ? 20.033  36.834  14.874  1.00 32.96 ? 102 PHE C CB  1 
ATOM 2684  C CG  . PHE C 1 102 ? 18.942  35.919  14.391  1.00 33.62 ? 102 PHE C CG  1 
ATOM 2685  C CD1 . PHE C 1 102 ? 19.242  34.629  13.955  1.00 31.88 ? 102 PHE C CD1 1 
ATOM 2686  C CD2 . PHE C 1 102 ? 17.606  36.308  14.455  1.00 32.99 ? 102 PHE C CD2 1 
ATOM 2687  C CE1 . PHE C 1 102 ? 18.236  33.745  13.597  1.00 30.84 ? 102 PHE C CE1 1 
ATOM 2688  C CE2 . PHE C 1 102 ? 16.595  35.428  14.099  1.00 32.05 ? 102 PHE C CE2 1 
ATOM 2689  C CZ  . PHE C 1 102 ? 16.912  34.143  13.670  1.00 32.29 ? 102 PHE C CZ  1 
ATOM 2690  N N   . PHE C 1 103 ? 22.986  36.694  16.408  1.00 31.50 ? 103 PHE C N   1 
ATOM 2691  C CA  . PHE C 1 103 ? 24.207  37.370  16.788  1.00 31.02 ? 103 PHE C CA  1 
ATOM 2692  C C   . PHE C 1 103 ? 25.268  37.230  15.704  1.00 31.60 ? 103 PHE C C   1 
ATOM 2693  O O   . PHE C 1 103 ? 25.357  36.177  15.048  1.00 32.42 ? 103 PHE C O   1 
ATOM 2694  C CB  . PHE C 1 103 ? 24.730  36.746  18.088  1.00 29.89 ? 103 PHE C CB  1 
ATOM 2695  C CG  . PHE C 1 103 ? 23.698  36.663  19.187  1.00 29.20 ? 103 PHE C CG  1 
ATOM 2696  C CD1 . PHE C 1 103 ? 23.615  37.662  20.171  1.00 28.36 ? 103 PHE C CD1 1 
ATOM 2697  C CD2 . PHE C 1 103 ? 22.798  35.596  19.238  1.00 26.86 ? 103 PHE C CD2 1 
ATOM 2698  C CE1 . PHE C 1 103 ? 22.649  37.595  21.190  1.00 26.53 ? 103 PHE C CE1 1 
ATOM 2699  C CE2 . PHE C 1 103 ? 21.828  35.521  20.252  1.00 26.03 ? 103 PHE C CE2 1 
ATOM 2700  C CZ  . PHE C 1 103 ? 21.754  36.519  21.229  1.00 25.82 ? 103 PHE C CZ  1 
ATOM 2701  N N   . PHE C 1 104 ? 26.061  38.284  15.504  1.00 30.75 ? 104 PHE C N   1 
ATOM 2702  C CA  . PHE C 1 104 ? 27.149  38.223  14.531  1.00 30.16 ? 104 PHE C CA  1 
ATOM 2703  C C   . PHE C 1 104 ? 28.251  37.409  15.198  1.00 29.99 ? 104 PHE C C   1 
ATOM 2704  O O   . PHE C 1 104 ? 28.697  37.726  16.301  1.00 28.74 ? 104 PHE C O   1 
ATOM 2705  C CB  . PHE C 1 104 ? 27.736  39.603  14.189  1.00 30.05 ? 104 PHE C CB  1 
ATOM 2706  C CG  . PHE C 1 104 ? 26.777  40.554  13.515  1.00 29.71 ? 104 PHE C CG  1 
ATOM 2707  C CD1 . PHE C 1 104 ? 26.092  41.508  14.254  1.00 29.13 ? 104 PHE C CD1 1 
ATOM 2708  C CD2 . PHE C 1 104 ? 26.584  40.519  12.140  1.00 29.68 ? 104 PHE C CD2 1 
ATOM 2709  C CE1 . PHE C 1 104 ? 25.225  42.415  13.625  1.00 29.69 ? 104 PHE C CE1 1 
ATOM 2710  C CE2 . PHE C 1 104 ? 25.718  41.425  11.506  1.00 29.78 ? 104 PHE C CE2 1 
ATOM 2711  C CZ  . PHE C 1 104 ? 25.041  42.368  12.248  1.00 27.94 ? 104 PHE C CZ  1 
ATOM 2712  N N   . GLU C 1 105 ? 28.671  36.337  14.547  1.00 31.00 ? 105 GLU C N   1 
ATOM 2713  C CA  . GLU C 1 105 ? 29.727  35.533  15.104  1.00 32.06 ? 105 GLU C CA  1 
ATOM 2714  C C   . GLU C 1 105 ? 30.997  36.001  14.434  1.00 33.04 ? 105 GLU C C   1 
ATOM 2715  O O   . GLU C 1 105 ? 31.082  36.105  13.209  1.00 32.85 ? 105 GLU C O   1 
ATOM 2716  C CB  . GLU C 1 105 ? 29.517  34.051  14.829  1.00 33.49 ? 105 GLU C CB  1 
ATOM 2717  C CG  . GLU C 1 105 ? 30.584  33.190  15.489  1.00 34.59 ? 105 GLU C CG  1 
ATOM 2718  C CD  . GLU C 1 105 ? 30.666  31.829  14.881  1.00 36.58 ? 105 GLU C CD  1 
ATOM 2719  O OE1 . GLU C 1 105 ? 30.869  31.768  13.650  1.00 37.58 ? 105 GLU C OE1 1 
ATOM 2720  O OE2 . GLU C 1 105 ? 30.527  30.828  15.621  1.00 38.69 ? 105 GLU C OE2 1 
ATOM 2721  N N   . ARG C 1 106 ? 31.995  36.269  15.255  1.00 34.11 ? 106 ARG C N   1 
ATOM 2722  C CA  . ARG C 1 106 ? 33.252  36.767  14.771  1.00 34.35 ? 106 ARG C CA  1 
ATOM 2723  C C   . ARG C 1 106 ? 34.386  36.015  15.422  1.00 33.59 ? 106 ARG C C   1 
ATOM 2724  O O   . ARG C 1 106 ? 34.393  35.810  16.629  1.00 32.07 ? 106 ARG C O   1 
ATOM 2725  C CB  . ARG C 1 106 ? 33.346  38.257  15.132  1.00 37.40 ? 106 ARG C CB  1 
ATOM 2726  C CG  . ARG C 1 106 ? 34.587  38.976  14.667  1.00 40.16 ? 106 ARG C CG  1 
ATOM 2727  C CD  . ARG C 1 106 ? 34.214  40.018  13.649  1.00 44.18 ? 106 ARG C CD  1 
ATOM 2728  N NE  . ARG C 1 106 ? 34.826  41.307  13.955  1.00 49.19 ? 106 ARG C NE  1 
ATOM 2729  C CZ  . ARG C 1 106 ? 36.137  41.538  13.959  1.00 51.98 ? 106 ARG C CZ  1 
ATOM 2730  N NH1 . ARG C 1 106 ? 36.991  40.558  13.668  1.00 53.18 ? 106 ARG C NH1 1 
ATOM 2731  N NH2 . ARG C 1 106 ? 36.595  42.753  14.256  1.00 53.02 ? 106 ARG C NH2 1 
ATOM 2732  N N   . LEU C 1 107 ? 35.338  35.600  14.598  1.00 35.50 ? 107 LEU C N   1 
ATOM 2733  C CA  . LEU C 1 107 ? 36.542  34.912  15.046  1.00 35.97 ? 107 LEU C CA  1 
ATOM 2734  C C   . LEU C 1 107 ? 37.572  36.032  15.140  1.00 36.65 ? 107 LEU C C   1 
ATOM 2735  O O   . LEU C 1 107 ? 38.147  36.427  14.133  1.00 36.52 ? 107 LEU C O   1 
ATOM 2736  C CB  . LEU C 1 107 ? 36.975  33.891  13.995  1.00 35.81 ? 107 LEU C CB  1 
ATOM 2737  C CG  . LEU C 1 107 ? 38.381  33.278  14.116  1.00 37.28 ? 107 LEU C CG  1 
ATOM 2738  C CD1 . LEU C 1 107 ? 38.680  32.818  15.539  1.00 36.41 ? 107 LEU C CD1 1 
ATOM 2739  C CD2 . LEU C 1 107 ? 38.474  32.103  13.155  1.00 37.09 ? 107 LEU C CD2 1 
ATOM 2740  N N   . GLU C 1 108 ? 37.788  36.561  16.338  1.00 37.69 ? 108 GLU C N   1 
ATOM 2741  C CA  . GLU C 1 108 ? 38.726  37.662  16.499  1.00 39.27 ? 108 GLU C CA  1 
ATOM 2742  C C   . GLU C 1 108 ? 40.171  37.248  16.216  1.00 39.63 ? 108 GLU C C   1 
ATOM 2743  O O   . GLU C 1 108 ? 40.498  36.059  16.113  1.00 39.62 ? 108 GLU C O   1 
ATOM 2744  C CB  . GLU C 1 108 ? 38.626  38.264  17.912  1.00 41.55 ? 108 GLU C CB  1 
ATOM 2745  C CG  . GLU C 1 108 ? 37.211  38.596  18.393  1.00 44.21 ? 108 GLU C CG  1 
ATOM 2746  C CD  . GLU C 1 108 ? 36.559  39.754  17.640  1.00 47.89 ? 108 GLU C CD  1 
ATOM 2747  O OE1 . GLU C 1 108 ? 35.488  40.218  18.101  1.00 48.59 ? 108 GLU C OE1 1 
ATOM 2748  O OE2 . GLU C 1 108 ? 37.101  40.199  16.596  1.00 49.28 ? 108 GLU C OE2 1 
ATOM 2749  N N   . SER C 1 109 ? 41.029  38.255  16.088  1.00 39.52 ? 109 SER C N   1 
ATOM 2750  C CA  . SER C 1 109 ? 42.451  38.058  15.822  1.00 39.13 ? 109 SER C CA  1 
ATOM 2751  C C   . SER C 1 109 ? 43.132  37.221  16.907  1.00 37.49 ? 109 SER C C   1 
ATOM 2752  O O   . SER C 1 109 ? 44.176  36.615  16.665  1.00 37.74 ? 109 SER C O   1 
ATOM 2753  C CB  . SER C 1 109 ? 43.141  39.424  15.730  1.00 41.44 ? 109 SER C CB  1 
ATOM 2754  O OG  . SER C 1 109 ? 42.859  40.198  16.894  1.00 43.91 ? 109 SER C OG  1 
ATOM 2755  N N   . ASN C 1 110 ? 42.550  37.206  18.102  1.00 35.80 ? 110 ASN C N   1 
ATOM 2756  C CA  . ASN C 1 110 ? 43.099  36.446  19.225  1.00 34.27 ? 110 ASN C CA  1 
ATOM 2757  C C   . ASN C 1 110 ? 42.615  34.994  19.225  1.00 33.87 ? 110 ASN C C   1 
ATOM 2758  O O   . ASN C 1 110 ? 42.922  34.232  20.143  1.00 35.15 ? 110 ASN C O   1 
ATOM 2759  C CB  . ASN C 1 110 ? 42.699  37.098  20.554  1.00 34.68 ? 110 ASN C CB  1 
ATOM 2760  C CG  . ASN C 1 110 ? 41.181  37.191  20.741  1.00 34.42 ? 110 ASN C CG  1 
ATOM 2761  O OD1 . ASN C 1 110 ? 40.398  36.802  19.859  1.00 33.83 ? 110 ASN C OD1 1 
ATOM 2762  N ND2 . ASN C 1 110 ? 40.761  37.718  21.892  1.00 33.34 ? 110 ASN C ND2 1 
ATOM 2763  N N   . ASN C 1 111 ? 41.846  34.633  18.198  1.00 32.13 ? 111 ASN C N   1 
ATOM 2764  C CA  . ASN C 1 111 ? 41.292  33.290  18.027  1.00 30.80 ? 111 ASN C CA  1 
ATOM 2765  C C   . ASN C 1 111 ? 40.207  32.856  18.970  1.00 30.26 ? 111 ASN C C   1 
ATOM 2766  O O   . ASN C 1 111 ? 40.052  31.668  19.235  1.00 30.25 ? 111 ASN C O   1 
ATOM 2767  C CB  . ASN C 1 111 ? 42.369  32.223  18.035  1.00 32.21 ? 111 ASN C CB  1 
ATOM 2768  C CG  . ASN C 1 111 ? 43.182  32.246  16.784  1.00 34.36 ? 111 ASN C CG  1 
ATOM 2769  O OD1 . ASN C 1 111 ? 42.636  32.398  15.689  1.00 35.13 ? 111 ASN C OD1 1 
ATOM 2770  N ND2 . ASN C 1 111 ? 44.496  32.102  16.923  1.00 35.07 ? 111 ASN C ND2 1 
ATOM 2771  N N   . TYR C 1 112 ? 39.459  33.820  19.484  1.00 28.67 ? 112 TYR C N   1 
ATOM 2772  C CA  . TYR C 1 112 ? 38.327  33.539  20.344  1.00 26.57 ? 112 TYR C CA  1 
ATOM 2773  C C   . TYR C 1 112 ? 37.152  34.059  19.519  1.00 26.87 ? 112 TYR C C   1 
ATOM 2774  O O   . TYR C 1 112 ? 37.353  34.835  18.586  1.00 26.85 ? 112 TYR C O   1 
ATOM 2775  C CB  . TYR C 1 112 ? 38.433  34.332  21.637  1.00 26.50 ? 112 TYR C CB  1 
ATOM 2776  C CG  . TYR C 1 112 ? 39.287  33.693  22.700  1.00 26.51 ? 112 TYR C CG  1 
ATOM 2777  C CD1 . TYR C 1 112 ? 38.757  32.722  23.552  1.00 26.09 ? 112 TYR C CD1 1 
ATOM 2778  C CD2 . TYR C 1 112 ? 40.627  34.062  22.868  1.00 26.21 ? 112 TYR C CD2 1 
ATOM 2779  C CE1 . TYR C 1 112 ? 39.544  32.128  24.552  1.00 24.75 ? 112 TYR C CE1 1 
ATOM 2780  C CE2 . TYR C 1 112 ? 41.421  33.472  23.868  1.00 24.22 ? 112 TYR C CE2 1 
ATOM 2781  C CZ  . TYR C 1 112 ? 40.871  32.507  24.703  1.00 23.99 ? 112 TYR C CZ  1 
ATOM 2782  O OH  . TYR C 1 112 ? 41.641  31.901  25.679  1.00 23.61 ? 112 TYR C OH  1 
ATOM 2783  N N   . ASN C 1 113 ? 35.939  33.625  19.833  1.00 26.39 ? 113 ASN C N   1 
ATOM 2784  C CA  . ASN C 1 113 ? 34.757  34.101  19.121  1.00 25.97 ? 113 ASN C CA  1 
ATOM 2785  C C   . ASN C 1 113 ? 34.011  35.137  19.954  1.00 26.47 ? 113 ASN C C   1 
ATOM 2786  O O   . ASN C 1 113 ? 34.086  35.135  21.181  1.00 26.88 ? 113 ASN C O   1 
ATOM 2787  C CB  . ASN C 1 113 ? 33.797  32.950  18.838  1.00 25.40 ? 113 ASN C CB  1 
ATOM 2788  C CG  . ASN C 1 113 ? 34.305  32.012  17.776  1.00 27.65 ? 113 ASN C CG  1 
ATOM 2789  O OD1 . ASN C 1 113 ? 35.459  32.107  17.335  1.00 28.77 ? 113 ASN C OD1 1 
ATOM 2790  N ND2 . ASN C 1 113 ? 33.447  31.081  17.357  1.00 27.40 ? 113 ASN C ND2 1 
ATOM 2791  N N   . THR C 1 114 ? 33.304  36.032  19.283  1.00 26.83 ? 114 THR C N   1 
ATOM 2792  C CA  . THR C 1 114 ? 32.501  37.030  19.978  1.00 27.06 ? 114 THR C CA  1 
ATOM 2793  C C   . THR C 1 114 ? 31.115  36.964  19.345  1.00 28.17 ? 114 THR C C   1 
ATOM 2794  O O   . THR C 1 114 ? 30.971  36.658  18.153  1.00 28.39 ? 114 THR C O   1 
ATOM 2795  C CB  . THR C 1 114 ? 33.086  38.474  19.842  1.00 26.14 ? 114 THR C CB  1 
ATOM 2796  O OG1 . THR C 1 114 ? 33.327  38.782  18.466  1.00 24.82 ? 114 THR C OG1 1 
ATOM 2797  C CG2 . THR C 1 114 ? 34.381  38.599  20.614  1.00 25.95 ? 114 THR C CG2 1 
ATOM 2798  N N   . TYR C 1 115 ? 30.091  37.225  20.140  1.00 28.39 ? 115 TYR C N   1 
ATOM 2799  C CA  . TYR C 1 115 ? 28.741  37.169  19.624  1.00 28.45 ? 115 TYR C CA  1 
ATOM 2800  C C   . TYR C 1 115 ? 28.067  38.471  19.927  1.00 30.84 ? 115 TYR C C   1 
ATOM 2801  O O   . TYR C 1 115 ? 27.666  38.733  21.062  1.00 31.18 ? 115 TYR C O   1 
ATOM 2802  C CB  . TYR C 1 115 ? 28.003  36.000  20.256  1.00 26.32 ? 115 TYR C CB  1 
ATOM 2803  C CG  . TYR C 1 115 ? 28.634  34.703  19.857  1.00 22.76 ? 115 TYR C CG  1 
ATOM 2804  C CD1 . TYR C 1 115 ? 28.316  34.109  18.647  1.00 22.35 ? 115 TYR C CD1 1 
ATOM 2805  C CD2 . TYR C 1 115 ? 29.618  34.119  20.639  1.00 20.85 ? 115 TYR C CD2 1 
ATOM 2806  C CE1 . TYR C 1 115 ? 28.962  32.966  18.221  1.00 22.33 ? 115 TYR C CE1 1 
ATOM 2807  C CE2 . TYR C 1 115 ? 30.275  32.980  20.224  1.00 20.16 ? 115 TYR C CE2 1 
ATOM 2808  C CZ  . TYR C 1 115 ? 29.945  32.405  19.012  1.00 21.60 ? 115 TYR C CZ  1 
ATOM 2809  O OH  . TYR C 1 115 ? 30.594  31.272  18.574  1.00 23.46 ? 115 TYR C OH  1 
ATOM 2810  N N   . ARG C 1 116 ? 27.963  39.289  18.885  1.00 33.23 ? 116 ARG C N   1 
ATOM 2811  C CA  . ARG C 1 116 ? 27.367  40.612  18.974  1.00 34.50 ? 116 ARG C CA  1 
ATOM 2812  C C   . ARG C 1 116 ? 25.920  40.583  18.482  1.00 34.79 ? 116 ARG C C   1 
ATOM 2813  O O   . ARG C 1 116 ? 25.644  40.127  17.374  1.00 35.15 ? 116 ARG C O   1 
ATOM 2814  C CB  . ARG C 1 116 ? 28.205  41.574  18.134  1.00 35.15 ? 116 ARG C CB  1 
ATOM 2815  C CG  . ARG C 1 116 ? 27.932  43.050  18.356  1.00 37.15 ? 116 ARG C CG  1 
ATOM 2816  C CD  . ARG C 1 116 ? 29.045  43.867  17.709  1.00 37.58 ? 116 ARG C CD  1 
ATOM 2817  N NE  . ARG C 1 116 ? 29.191  43.547  16.293  1.00 37.71 ? 116 ARG C NE  1 
ATOM 2818  C CZ  . ARG C 1 116 ? 28.407  44.033  15.342  1.00 38.27 ? 116 ARG C CZ  1 
ATOM 2819  N NH1 . ARG C 1 116 ? 27.425  44.869  15.653  1.00 39.48 ? 116 ARG C NH1 1 
ATOM 2820  N NH2 . ARG C 1 116 ? 28.593  43.682  14.081  1.00 38.71 ? 116 ARG C NH2 1 
ATOM 2821  N N   . SER C 1 117 ? 25.000  41.060  19.314  1.00 35.10 ? 117 SER C N   1 
ATOM 2822  C CA  . SER C 1 117 ? 23.586  41.082  18.948  1.00 35.52 ? 117 SER C CA  1 
ATOM 2823  C C   . SER C 1 117 ? 23.375  41.771  17.612  1.00 36.24 ? 117 SER C C   1 
ATOM 2824  O O   . SER C 1 117 ? 23.941  42.838  17.363  1.00 36.21 ? 117 SER C O   1 
ATOM 2825  C CB  . SER C 1 117 ? 22.766  41.815  20.013  1.00 34.53 ? 117 SER C CB  1 
ATOM 2826  O OG  . SER C 1 117 ? 21.499  42.200  19.499  1.00 32.16 ? 117 SER C OG  1 
ATOM 2827  N N   . ARG C 1 118 ? 22.558  41.170  16.752  1.00 37.16 ? 118 ARG C N   1 
ATOM 2828  C CA  . ARG C 1 118 ? 22.292  41.786  15.467  1.00 38.69 ? 118 ARG C CA  1 
ATOM 2829  C C   . ARG C 1 118 ? 21.255  42.891  15.637  1.00 39.59 ? 118 ARG C C   1 
ATOM 2830  O O   . ARG C 1 118 ? 21.230  43.843  14.862  1.00 40.84 ? 118 ARG C O   1 
ATOM 2831  C CB  . ARG C 1 118 ? 21.804  40.760  14.441  1.00 37.86 ? 118 ARG C CB  1 
ATOM 2832  C CG  . ARG C 1 118 ? 21.770  41.330  13.022  1.00 38.51 ? 118 ARG C CG  1 
ATOM 2833  C CD  . ARG C 1 118 ? 21.311  40.307  12.005  1.00 38.53 ? 118 ARG C CD  1 
ATOM 2834  N NE  . ARG C 1 118 ? 19.943  39.866  12.262  1.00 39.93 ? 118 ARG C NE  1 
ATOM 2835  C CZ  . ARG C 1 118 ? 19.270  39.025  11.480  1.00 40.41 ? 118 ARG C CZ  1 
ATOM 2836  N NH1 . ARG C 1 118 ? 19.835  38.527  10.388  1.00 40.97 ? 118 ARG C NH1 1 
ATOM 2837  N NH2 . ARG C 1 118 ? 18.031  38.680  11.789  1.00 40.12 ? 118 ARG C NH2 1 
ATOM 2838  N N   . LYS C 1 119 ? 20.395  42.762  16.644  1.00 40.75 ? 119 LYS C N   1 
ATOM 2839  C CA  . LYS C 1 119 ? 19.385  43.790  16.895  1.00 42.10 ? 119 LYS C CA  1 
ATOM 2840  C C   . LYS C 1 119 ? 20.015  44.992  17.599  1.00 42.39 ? 119 LYS C C   1 
ATOM 2841  O O   . LYS C 1 119 ? 19.914  46.128  17.129  1.00 42.39 ? 119 LYS C O   1 
ATOM 2842  C CB  . LYS C 1 119 ? 18.245  43.255  17.759  1.00 42.92 ? 119 LYS C CB  1 
ATOM 2843  C CG  . LYS C 1 119 ? 17.107  42.618  16.973  1.00 44.30 ? 119 LYS C CG  1 
ATOM 2844  C CD  . LYS C 1 119 ? 15.790  42.726  17.747  1.00 44.97 ? 119 LYS C CD  1 
ATOM 2845  C CE  . LYS C 1 119 ? 15.343  44.186  17.889  1.00 44.52 ? 119 LYS C CE  1 
ATOM 2846  N NZ  . LYS C 1 119 ? 14.047  44.324  18.613  1.00 43.96 ? 119 LYS C NZ  1 
ATOM 2847  N N   . TYR C 1 120 ? 20.661  44.734  18.731  1.00 42.45 ? 120 TYR C N   1 
ATOM 2848  C CA  . TYR C 1 120 ? 21.332  45.778  19.494  1.00 42.27 ? 120 TYR C CA  1 
ATOM 2849  C C   . TYR C 1 120 ? 22.808  45.614  19.170  1.00 42.07 ? 120 TYR C C   1 
ATOM 2850  O O   . TYR C 1 120 ? 23.574  44.999  19.911  1.00 42.65 ? 120 TYR C O   1 
ATOM 2851  C CB  . TYR C 1 120 ? 21.023  45.587  20.979  1.00 42.44 ? 120 TYR C CB  1 
ATOM 2852  C CG  . TYR C 1 120 ? 19.549  45.307  21.179  1.00 42.29 ? 120 TYR C CG  1 
ATOM 2853  C CD1 . TYR C 1 120 ? 18.592  46.014  20.454  1.00 42.69 ? 120 TYR C CD1 1 
ATOM 2854  C CD2 . TYR C 1 120 ? 19.111  44.290  22.020  1.00 42.70 ? 120 TYR C CD2 1 
ATOM 2855  C CE1 . TYR C 1 120 ? 17.238  45.710  20.546  1.00 43.66 ? 120 TYR C CE1 1 
ATOM 2856  C CE2 . TYR C 1 120 ? 17.757  43.979  22.124  1.00 43.75 ? 120 TYR C CE2 1 
ATOM 2857  C CZ  . TYR C 1 120 ? 16.825  44.694  21.376  1.00 44.08 ? 120 TYR C CZ  1 
ATOM 2858  O OH  . TYR C 1 120 ? 15.485  44.385  21.430  1.00 44.82 ? 120 TYR C OH  1 
ATOM 2859  N N   . THR C 1 121 ? 23.185  46.197  18.038  1.00 41.58 ? 121 THR C N   1 
ATOM 2860  C CA  . THR C 1 121 ? 24.528  46.093  17.492  1.00 41.42 ? 121 THR C CA  1 
ATOM 2861  C C   . THR C 1 121 ? 25.776  46.503  18.262  1.00 41.32 ? 121 THR C C   1 
ATOM 2862  O O   . THR C 1 121 ? 26.879  46.408  17.725  1.00 41.14 ? 121 THR C O   1 
ATOM 2863  C CB  . THR C 1 121 ? 24.575  46.738  16.099  1.00 41.60 ? 121 THR C CB  1 
ATOM 2864  O OG1 . THR C 1 121 ? 24.175  48.109  16.188  1.00 43.56 ? 121 THR C OG1 1 
ATOM 2865  C CG2 . THR C 1 121 ? 23.637  45.998  15.161  1.00 39.85 ? 121 THR C CG2 1 
ATOM 2866  N N   . SER C 1 122 ? 25.641  46.936  19.507  1.00 41.42 ? 122 SER C N   1 
ATOM 2867  C CA  . SER C 1 122 ? 26.840  47.288  20.262  1.00 42.17 ? 122 SER C CA  1 
ATOM 2868  C C   . SER C 1 122 ? 26.994  46.391  21.484  1.00 42.29 ? 122 SER C C   1 
ATOM 2869  O O   . SER C 1 122 ? 27.983  46.473  22.219  1.00 42.46 ? 122 SER C O   1 
ATOM 2870  C CB  . SER C 1 122 ? 26.790  48.753  20.684  1.00 41.82 ? 122 SER C CB  1 
ATOM 2871  O OG  . SER C 1 122 ? 26.901  49.583  19.547  1.00 42.76 ? 122 SER C OG  1 
ATOM 2872  N N   . TRP C 1 123 ? 26.010  45.524  21.687  1.00 41.75 ? 123 TRP C N   1 
ATOM 2873  C CA  . TRP C 1 123 ? 26.042  44.624  22.818  1.00 41.32 ? 123 TRP C CA  1 
ATOM 2874  C C   . TRP C 1 123 ? 26.512  43.219  22.459  1.00 39.93 ? 123 TRP C C   1 
ATOM 2875  O O   . TRP C 1 123 ? 26.151  42.664  21.407  1.00 39.55 ? 123 TRP C O   1 
ATOM 2876  C CB  . TRP C 1 123 ? 24.664  44.583  23.467  1.00 44.05 ? 123 TRP C CB  1 
ATOM 2877  C CG  . TRP C 1 123 ? 24.208  45.953  23.870  1.00 46.43 ? 123 TRP C CG  1 
ATOM 2878  C CD1 . TRP C 1 123 ? 24.953  47.099  23.856  1.00 45.97 ? 123 TRP C CD1 1 
ATOM 2879  C CD2 . TRP C 1 123 ? 22.917  46.319  24.373  1.00 46.94 ? 123 TRP C CD2 1 
ATOM 2880  N NE1 . TRP C 1 123 ? 24.208  48.151  24.318  1.00 46.41 ? 123 TRP C NE1 1 
ATOM 2881  C CE2 . TRP C 1 123 ? 22.954  47.705  24.642  1.00 47.28 ? 123 TRP C CE2 1 
ATOM 2882  C CE3 . TRP C 1 123 ? 21.733  45.611  24.622  1.00 47.43 ? 123 TRP C CE3 1 
ATOM 2883  C CZ2 . TRP C 1 123 ? 21.852  48.401  25.152  1.00 47.29 ? 123 TRP C CZ2 1 
ATOM 2884  C CZ3 . TRP C 1 123 ? 20.638  46.302  25.127  1.00 47.79 ? 123 TRP C CZ3 1 
ATOM 2885  C CH2 . TRP C 1 123 ? 20.706  47.686  25.387  1.00 47.69 ? 123 TRP C CH2 1 
ATOM 2886  N N   . TYR C 1 124 ? 27.334  42.661  23.347  1.00 37.33 ? 124 TYR C N   1 
ATOM 2887  C CA  . TYR C 1 124 ? 27.891  41.332  23.172  1.00 34.85 ? 124 TYR C CA  1 
ATOM 2888  C C   . TYR C 1 124 ? 27.370  40.356  24.191  1.00 33.26 ? 124 TYR C C   1 
ATOM 2889  O O   . TYR C 1 124 ? 27.007  40.740  25.293  1.00 33.52 ? 124 TYR C O   1 
ATOM 2890  C CB  . TYR C 1 124 ? 29.407  41.343  23.316  1.00 35.61 ? 124 TYR C CB  1 
ATOM 2891  C CG  . TYR C 1 124 ? 30.152  42.047  22.223  1.00 36.97 ? 124 TYR C CG  1 
ATOM 2892  C CD1 . TYR C 1 124 ? 30.559  43.373  22.375  1.00 37.29 ? 124 TYR C CD1 1 
ATOM 2893  C CD2 . TYR C 1 124 ? 30.494  41.378  21.048  1.00 37.04 ? 124 TYR C CD2 1 
ATOM 2894  C CE1 . TYR C 1 124 ? 31.301  44.013  21.384  1.00 37.36 ? 124 TYR C CE1 1 
ATOM 2895  C CE2 . TYR C 1 124 ? 31.230  42.004  20.054  1.00 37.56 ? 124 TYR C CE2 1 
ATOM 2896  C CZ  . TYR C 1 124 ? 31.636  43.322  20.227  1.00 37.66 ? 124 TYR C CZ  1 
ATOM 2897  O OH  . TYR C 1 124 ? 32.397  43.933  19.253  1.00 38.54 ? 124 TYR C OH  1 
ATOM 2898  N N   . VAL C 1 125 ? 27.332  39.085  23.808  1.00 32.06 ? 125 VAL C N   1 
ATOM 2899  C CA  . VAL C 1 125 ? 26.926  38.024  24.721  1.00 31.30 ? 125 VAL C CA  1 
ATOM 2900  C C   . VAL C 1 125 ? 28.177  37.912  25.600  1.00 30.72 ? 125 VAL C C   1 
ATOM 2901  O O   . VAL C 1 125 ? 29.298  37.891  25.089  1.00 31.48 ? 125 VAL C O   1 
ATOM 2902  C CB  . VAL C 1 125 ? 26.660  36.674  23.965  1.00 29.69 ? 125 VAL C CB  1 
ATOM 2903  C CG1 . VAL C 1 125 ? 26.534  35.526  24.940  1.00 28.08 ? 125 VAL C CG1 1 
ATOM 2904  C CG2 . VAL C 1 125 ? 25.391  36.778  23.154  1.00 29.30 ? 125 VAL C CG2 1 
ATOM 2905  N N   . ALA C 1 126 ? 27.998  37.863  26.908  1.00 30.29 ? 126 ALA C N   1 
ATOM 2906  C CA  . ALA C 1 126 ? 29.149  37.800  27.784  1.00 31.95 ? 126 ALA C CA  1 
ATOM 2907  C C   . ALA C 1 126 ? 28.811  37.215  29.149  1.00 33.50 ? 126 ALA C C   1 
ATOM 2908  O O   . ALA C 1 126 ? 27.642  37.019  29.481  1.00 34.10 ? 126 ALA C O   1 
ATOM 2909  C CB  . ALA C 1 126 ? 29.725  39.199  27.950  1.00 30.38 ? 126 ALA C CB  1 
ATOM 2910  N N   . LEU C 1 127 ? 29.840  36.932  29.937  1.00 34.32 ? 127 LEU C N   1 
ATOM 2911  C CA  . LEU C 1 127 ? 29.637  36.399  31.271  1.00 35.82 ? 127 LEU C CA  1 
ATOM 2912  C C   . LEU C 1 127 ? 30.523  37.132  32.274  1.00 37.48 ? 127 LEU C C   1 
ATOM 2913  O O   . LEU C 1 127 ? 31.690  37.417  31.996  1.00 38.51 ? 127 LEU C O   1 
ATOM 2914  C CB  . LEU C 1 127 ? 29.943  34.901  31.306  1.00 35.48 ? 127 LEU C CB  1 
ATOM 2915  C CG  . LEU C 1 127 ? 29.126  33.963  30.410  1.00 35.03 ? 127 LEU C CG  1 
ATOM 2916  C CD1 . LEU C 1 127 ? 29.670  32.546  30.562  1.00 35.75 ? 127 LEU C CD1 1 
ATOM 2917  C CD2 . LEU C 1 127 ? 27.661  34.003  30.785  1.00 33.54 ? 127 LEU C CD2 1 
ATOM 2918  N N   . LYS C 1 128 ? 29.957  37.455  33.433  1.00 38.76 ? 128 LYS C N   1 
ATOM 2919  C CA  . LYS C 1 128 ? 30.705  38.142  34.485  1.00 39.76 ? 128 LYS C CA  1 
ATOM 2920  C C   . LYS C 1 128 ? 31.660  37.113  35.088  1.00 40.02 ? 128 LYS C C   1 
ATOM 2921  O O   . LYS C 1 128 ? 31.431  35.907  34.949  1.00 40.91 ? 128 LYS C O   1 
ATOM 2922  C CB  . LYS C 1 128 ? 29.744  38.672  35.561  1.00 38.40 ? 128 LYS C CB  1 
ATOM 2923  N N   . ARG C 1 129 ? 32.730  37.573  35.736  1.00 39.95 ? 129 ARG C N   1 
ATOM 2924  C CA  . ARG C 1 129 ? 33.692  36.654  36.355  1.00 40.67 ? 129 ARG C CA  1 
ATOM 2925  C C   . ARG C 1 129 ? 33.009  35.788  37.417  1.00 40.48 ? 129 ARG C C   1 
ATOM 2926  O O   . ARG C 1 129 ? 33.558  34.786  37.868  1.00 40.38 ? 129 ARG C O   1 
ATOM 2927  C CB  . ARG C 1 129 ? 34.850  37.433  37.002  1.00 40.07 ? 129 ARG C CB  1 
ATOM 2928  N N   . THR C 1 130 ? 31.801  36.174  37.812  1.00 41.33 ? 130 THR C N   1 
ATOM 2929  C CA  . THR C 1 130 ? 31.070  35.429  38.830  1.00 41.80 ? 130 THR C CA  1 
ATOM 2930  C C   . THR C 1 130 ? 30.312  34.232  38.289  1.00 43.28 ? 130 THR C C   1 
ATOM 2931  O O   . THR C 1 130 ? 29.932  33.343  39.046  1.00 44.22 ? 130 THR C O   1 
ATOM 2932  C CB  . THR C 1 130 ? 30.065  36.323  39.598  1.00 39.67 ? 130 THR C CB  1 
ATOM 2933  O OG1 . THR C 1 130 ? 29.183  36.973  38.680  1.00 39.03 ? 130 THR C OG1 1 
ATOM 2934  C CG2 . THR C 1 130 ? 30.800  37.359  40.398  1.00 39.56 ? 130 THR C CG2 1 
ATOM 2935  N N   . GLY C 1 131 ? 30.092  34.198  36.981  1.00 44.88 ? 131 GLY C N   1 
ATOM 2936  C CA  . GLY C 1 131 ? 29.359  33.085  36.405  1.00 46.04 ? 131 GLY C CA  1 
ATOM 2937  C C   . GLY C 1 131 ? 27.985  33.526  35.933  1.00 46.68 ? 131 GLY C C   1 
ATOM 2938  O O   . GLY C 1 131 ? 27.244  32.750  35.325  1.00 47.00 ? 131 GLY C O   1 
ATOM 2939  N N   . GLN C 1 132 ? 27.639  34.776  36.233  1.00 46.77 ? 132 GLN C N   1 
ATOM 2940  C CA  . GLN C 1 132 ? 26.367  35.349  35.814  1.00 46.11 ? 132 GLN C CA  1 
ATOM 2941  C C   . GLN C 1 132 ? 26.657  36.110  34.537  1.00 45.73 ? 132 GLN C C   1 
ATOM 2942  O O   . GLN C 1 132 ? 27.786  36.550  34.324  1.00 45.25 ? 132 GLN C O   1 
ATOM 2943  C CB  . GLN C 1 132 ? 25.826  36.306  36.881  1.00 46.08 ? 132 GLN C CB  1 
ATOM 2944  C CG  . GLN C 1 132 ? 25.591  35.652  38.234  1.00 46.49 ? 132 GLN C CG  1 
ATOM 2945  C CD  . GLN C 1 132 ? 24.858  34.326  38.119  1.00 47.27 ? 132 GLN C CD  1 
ATOM 2946  O OE1 . GLN C 1 132 ? 23.760  34.260  37.567  1.00 46.43 ? 132 GLN C OE1 1 
ATOM 2947  N NE2 . GLN C 1 132 ? 25.468  33.257  38.637  1.00 47.66 ? 132 GLN C NE2 1 
ATOM 2948  N N   . TYR C 1 133 ? 25.655  36.265  33.681  1.00 45.79 ? 133 TYR C N   1 
ATOM 2949  C CA  . TYR C 1 133 ? 25.874  36.973  32.430  1.00 46.37 ? 133 TYR C CA  1 
ATOM 2950  C C   . TYR C 1 133 ? 26.130  38.452  32.691  1.00 46.36 ? 133 TYR C C   1 
ATOM 2951  O O   . TYR C 1 133 ? 25.909  38.933  33.795  1.00 46.84 ? 133 TYR C O   1 
ATOM 2952  C CB  . TYR C 1 133 ? 24.674  36.794  31.489  1.00 46.11 ? 133 TYR C CB  1 
ATOM 2953  C CG  . TYR C 1 133 ? 23.395  37.473  31.932  1.00 46.35 ? 133 TYR C CG  1 
ATOM 2954  C CD1 . TYR C 1 133 ? 23.278  38.866  31.923  1.00 45.53 ? 133 TYR C CD1 1 
ATOM 2955  C CD2 . TYR C 1 133 ? 22.297  36.722  32.362  1.00 46.27 ? 133 TYR C CD2 1 
ATOM 2956  C CE1 . TYR C 1 133 ? 22.107  39.492  32.331  1.00 45.60 ? 133 TYR C CE1 1 
ATOM 2957  C CE2 . TYR C 1 133 ? 21.120  37.345  32.771  1.00 45.06 ? 133 TYR C CE2 1 
ATOM 2958  C CZ  . TYR C 1 133 ? 21.035  38.725  32.753  1.00 44.69 ? 133 TYR C CZ  1 
ATOM 2959  O OH  . TYR C 1 133 ? 19.881  39.341  33.157  1.00 44.91 ? 133 TYR C OH  1 
ATOM 2960  N N   . LYS C 1 134 ? 26.615  39.162  31.679  1.00 45.88 ? 134 LYS C N   1 
ATOM 2961  C CA  . LYS C 1 134 ? 26.882  40.587  31.802  1.00 46.50 ? 134 LYS C CA  1 
ATOM 2962  C C   . LYS C 1 134 ? 25.980  41.343  30.816  1.00 46.95 ? 134 LYS C C   1 
ATOM 2963  O O   . LYS C 1 134 ? 25.944  41.013  29.625  1.00 47.31 ? 134 LYS C O   1 
ATOM 2964  C CB  . LYS C 1 134 ? 28.363  40.885  31.512  1.00 44.08 ? 134 LYS C CB  1 
ATOM 2965  N N   . LEU C 1 135 ? 25.247  42.341  31.312  1.00 46.80 ? 135 LEU C N   1 
ATOM 2966  C CA  . LEU C 1 135 ? 24.354  43.127  30.463  1.00 47.42 ? 135 LEU C CA  1 
ATOM 2967  C C   . LEU C 1 135 ? 25.034  43.597  29.195  1.00 47.63 ? 135 LEU C C   1 
ATOM 2968  O O   . LEU C 1 135 ? 26.153  44.118  29.229  1.00 48.14 ? 135 LEU C O   1 
ATOM 2969  C CB  . LEU C 1 135 ? 23.818  44.345  31.207  1.00 47.57 ? 135 LEU C CB  1 
ATOM 2970  C CG  . LEU C 1 135 ? 22.739  44.059  32.239  1.00 47.68 ? 135 LEU C CG  1 
ATOM 2971  C CD1 . LEU C 1 135 ? 22.353  45.354  32.907  1.00 47.48 ? 135 LEU C CD1 1 
ATOM 2972  C CD2 . LEU C 1 135 ? 21.531  43.419  31.565  1.00 48.14 ? 135 LEU C CD2 1 
ATOM 2973  N N   . GLY C 1 136 ? 24.346  43.418  28.074  1.00 47.13 ? 136 GLY C N   1 
ATOM 2974  C CA  . GLY C 1 136 ? 24.913  43.827  26.805  1.00 47.61 ? 136 GLY C CA  1 
ATOM 2975  C C   . GLY C 1 136 ? 25.356  45.271  26.859  1.00 47.54 ? 136 GLY C C   1 
ATOM 2976  O O   . GLY C 1 136 ? 26.398  45.641  26.313  1.00 47.88 ? 136 GLY C O   1 
ATOM 2977  N N   . SER C 1 137 ? 24.559  46.090  27.534  1.00 47.67 ? 137 SER C N   1 
ATOM 2978  C CA  . SER C 1 137 ? 24.857  47.505  27.645  1.00 47.72 ? 137 SER C CA  1 
ATOM 2979  C C   . SER C 1 137 ? 26.173  47.764  28.365  1.00 47.19 ? 137 SER C C   1 
ATOM 2980  O O   . SER C 1 137 ? 26.735  48.847  28.256  1.00 47.00 ? 137 SER C O   1 
ATOM 2981  C CB  . SER C 1 137 ? 23.701  48.238  28.342  1.00 47.98 ? 137 SER C CB  1 
ATOM 2982  O OG  . SER C 1 137 ? 23.326  47.596  29.546  1.00 49.65 ? 137 SER C OG  1 
ATOM 2983  N N   . LYS C 1 138 ? 26.682  46.766  29.077  1.00 47.32 ? 138 LYS C N   1 
ATOM 2984  C CA  . LYS C 1 138 ? 27.933  46.950  29.795  1.00 47.73 ? 138 LYS C CA  1 
ATOM 2985  C C   . LYS C 1 138 ? 29.114  46.222  29.176  1.00 46.92 ? 138 LYS C C   1 
ATOM 2986  O O   . LYS C 1 138 ? 30.162  46.109  29.807  1.00 46.59 ? 138 LYS C O   1 
ATOM 2987  C CB  . LYS C 1 138 ? 27.769  46.527  31.260  1.00 48.95 ? 138 LYS C CB  1 
ATOM 2988  C CG  . LYS C 1 138 ? 26.692  47.325  31.994  1.00 50.65 ? 138 LYS C CG  1 
ATOM 2989  C CD  . LYS C 1 138 ? 26.604  46.998  33.480  1.00 51.97 ? 138 LYS C CD  1 
ATOM 2990  C CE  . LYS C 1 138 ? 27.716  47.658  34.301  1.00 53.43 ? 138 LYS C CE  1 
ATOM 2991  N NZ  . LYS C 1 138 ? 27.583  47.357  35.772  1.00 54.25 ? 138 LYS C NZ  1 
ATOM 2992  N N   . THR C 1 139 ? 28.952  45.745  27.942  1.00 46.44 ? 139 THR C N   1 
ATOM 2993  C CA  . THR C 1 139 ? 30.032  45.025  27.257  1.00 45.94 ? 139 THR C CA  1 
ATOM 2994  C C   . THR C 1 139 ? 30.720  45.880  26.196  1.00 46.41 ? 139 THR C C   1 
ATOM 2995  O O   . THR C 1 139 ? 30.157  46.861  25.705  1.00 47.37 ? 139 THR C O   1 
ATOM 2996  C CB  . THR C 1 139 ? 29.539  43.723  26.540  1.00 45.03 ? 139 THR C CB  1 
ATOM 2997  O OG1 . THR C 1 139 ? 28.836  44.066  25.340  1.00 43.65 ? 139 THR C OG1 1 
ATOM 2998  C CG2 . THR C 1 139 ? 28.631  42.912  27.439  1.00 43.70 ? 139 THR C CG2 1 
ATOM 2999  N N   . GLY C 1 140 ? 31.937  45.482  25.839  1.00 46.01 ? 140 GLY C N   1 
ATOM 3000  C CA  . GLY C 1 140 ? 32.701  46.202  24.841  1.00 45.42 ? 140 GLY C CA  1 
ATOM 3001  C C   . GLY C 1 140 ? 33.706  45.287  24.171  1.00 45.69 ? 140 GLY C C   1 
ATOM 3002  O O   . GLY C 1 140 ? 34.121  44.277  24.758  1.00 45.58 ? 140 GLY C O   1 
ATOM 3003  N N   . PRO C 1 141 ? 34.133  45.623  22.943  1.00 45.70 ? 141 PRO C N   1 
ATOM 3004  C CA  . PRO C 1 141 ? 35.098  44.837  22.164  1.00 46.17 ? 141 PRO C CA  1 
ATOM 3005  C C   . PRO C 1 141 ? 36.389  44.438  22.874  1.00 46.50 ? 141 PRO C C   1 
ATOM 3006  O O   . PRO C 1 141 ? 36.884  43.320  22.687  1.00 47.48 ? 141 PRO C O   1 
ATOM 3007  C CB  . PRO C 1 141 ? 35.339  45.709  20.926  1.00 45.62 ? 141 PRO C CB  1 
ATOM 3008  C CG  . PRO C 1 141 ? 34.962  47.084  21.381  1.00 44.85 ? 141 PRO C CG  1 
ATOM 3009  C CD  . PRO C 1 141 ? 33.752  46.841  22.212  1.00 44.72 ? 141 PRO C CD  1 
ATOM 3010  N N   . GLY C 1 142 ? 36.932  45.332  23.691  1.00 45.94 ? 142 GLY C N   1 
ATOM 3011  C CA  . GLY C 1 142 ? 38.164  45.005  24.385  1.00 45.45 ? 142 GLY C CA  1 
ATOM 3012  C C   . GLY C 1 142 ? 37.993  44.093  25.589  1.00 44.67 ? 142 GLY C C   1 
ATOM 3013  O O   . GLY C 1 142 ? 38.960  43.485  26.063  1.00 45.13 ? 142 GLY C O   1 
ATOM 3014  N N   . GLN C 1 143 ? 36.763  43.986  26.083  1.00 43.15 ? 143 GLN C N   1 
ATOM 3015  C CA  . GLN C 1 143 ? 36.484  43.170  27.258  1.00 41.30 ? 143 GLN C CA  1 
ATOM 3016  C C   . GLN C 1 143 ? 36.869  41.708  27.123  1.00 40.13 ? 143 GLN C C   1 
ATOM 3017  O O   . GLN C 1 143 ? 37.071  41.193  26.019  1.00 40.24 ? 143 GLN C O   1 
ATOM 3018  C CB  . GLN C 1 143 ? 35.008  43.291  27.638  1.00 41.72 ? 143 GLN C CB  1 
ATOM 3019  C CG  . GLN C 1 143 ? 34.672  44.603  28.321  1.00 41.83 ? 143 GLN C CG  1 
ATOM 3020  C CD  . GLN C 1 143 ? 33.192  44.773  28.575  1.00 42.43 ? 143 GLN C CD  1 
ATOM 3021  O OE1 . GLN C 1 143 ? 32.551  43.926  29.188  1.00 41.74 ? 143 GLN C OE1 1 
ATOM 3022  N NE2 . GLN C 1 143 ? 32.642  45.884  28.112  1.00 42.88 ? 143 GLN C NE2 1 
ATOM 3023  N N   . LYS C 1 144 ? 36.973  41.054  28.272  1.00 38.35 ? 144 LYS C N   1 
ATOM 3024  C CA  . LYS C 1 144 ? 37.328  39.647  28.359  1.00 36.60 ? 144 LYS C CA  1 
ATOM 3025  C C   . LYS C 1 144 ? 36.089  38.795  28.626  1.00 35.61 ? 144 LYS C C   1 
ATOM 3026  O O   . LYS C 1 144 ? 36.131  37.570  28.508  1.00 36.23 ? 144 LYS C O   1 
ATOM 3027  C CB  . LYS C 1 144 ? 38.324  39.453  29.492  1.00 35.56 ? 144 LYS C CB  1 
ATOM 3028  C CG  . LYS C 1 144 ? 38.592  38.020  29.814  1.00 36.71 ? 144 LYS C CG  1 
ATOM 3029  C CD  . LYS C 1 144 ? 39.502  37.929  30.994  1.00 38.02 ? 144 LYS C CD  1 
ATOM 3030  C CE  . LYS C 1 144 ? 39.885  36.506  31.275  1.00 38.01 ? 144 LYS C CE  1 
ATOM 3031  N NZ  . LYS C 1 144 ? 40.621  36.479  32.558  1.00 39.10 ? 144 LYS C NZ  1 
ATOM 3032  N N   . ALA C 1 145 ? 34.992  39.455  28.988  1.00 33.70 ? 145 ALA C N   1 
ATOM 3033  C CA  . ALA C 1 145 ? 33.735  38.783  29.289  1.00 32.48 ? 145 ALA C CA  1 
ATOM 3034  C C   . ALA C 1 145 ? 33.044  38.313  28.024  1.00 31.84 ? 145 ALA C C   1 
ATOM 3035  O O   . ALA C 1 145 ? 32.194  37.429  28.074  1.00 31.30 ? 145 ALA C O   1 
ATOM 3036  C CB  . ALA C 1 145 ? 32.809  39.726  30.046  1.00 31.84 ? 145 ALA C CB  1 
ATOM 3037  N N   . ILE C 1 146 ? 33.413  38.909  26.893  1.00 31.17 ? 146 ILE C N   1 
ATOM 3038  C CA  . ILE C 1 146 ? 32.801  38.564  25.615  1.00 30.05 ? 146 ILE C CA  1 
ATOM 3039  C C   . ILE C 1 146 ? 33.567  37.526  24.795  1.00 29.37 ? 146 ILE C C   1 
ATOM 3040  O O   . ILE C 1 146 ? 33.162  37.206  23.675  1.00 29.41 ? 146 ILE C O   1 
ATOM 3041  C CB  . ILE C 1 146 ? 32.653  39.806  24.721  1.00 30.33 ? 146 ILE C CB  1 
ATOM 3042  C CG1 . ILE C 1 146 ? 34.033  40.401  24.450  1.00 29.30 ? 146 ILE C CG1 1 
ATOM 3043  C CG2 . ILE C 1 146 ? 31.749  40.831  25.381  1.00 29.86 ? 146 ILE C CG2 1 
ATOM 3044  C CD1 . ILE C 1 146 ? 34.055  41.322  23.251  1.00 29.75 ? 146 ILE C CD1 1 
ATOM 3045  N N   . LEU C 1 147 ? 34.669  37.004  25.326  1.00 28.03 ? 147 LEU C N   1 
ATOM 3046  C CA  . LEU C 1 147 ? 35.450  36.030  24.569  1.00 27.11 ? 147 LEU C CA  1 
ATOM 3047  C C   . LEU C 1 147 ? 35.091  34.572  24.835  1.00 27.26 ? 147 LEU C C   1 
ATOM 3048  O O   . LEU C 1 147 ? 35.218  34.075  25.957  1.00 26.22 ? 147 LEU C O   1 
ATOM 3049  C CB  . LEU C 1 147 ? 36.943  36.235  24.811  1.00 26.44 ? 147 LEU C CB  1 
ATOM 3050  C CG  . LEU C 1 147 ? 37.594  37.522  24.276  1.00 27.31 ? 147 LEU C CG  1 
ATOM 3051  C CD1 . LEU C 1 147 ? 39.009  37.636  24.870  1.00 25.12 ? 147 LEU C CD1 1 
ATOM 3052  C CD2 . LEU C 1 147 ? 37.624  37.532  22.734  1.00 24.82 ? 147 LEU C CD2 1 
ATOM 3053  N N   . PHE C 1 148 ? 34.647  33.893  23.779  1.00 26.79 ? 148 PHE C N   1 
ATOM 3054  C CA  . PHE C 1 148 ? 34.267  32.489  23.853  1.00 25.63 ? 148 PHE C CA  1 
ATOM 3055  C C   . PHE C 1 148 ? 35.068  31.615  22.916  1.00 26.21 ? 148 PHE C C   1 
ATOM 3056  O O   . PHE C 1 148 ? 35.372  31.989  21.781  1.00 26.99 ? 148 PHE C O   1 
ATOM 3057  C CB  . PHE C 1 148 ? 32.807  32.299  23.492  1.00 25.04 ? 148 PHE C CB  1 
ATOM 3058  C CG  . PHE C 1 148 ? 31.855  32.923  24.450  1.00 24.58 ? 148 PHE C CG  1 
ATOM 3059  C CD1 . PHE C 1 148 ? 31.512  34.261  24.335  1.00 24.27 ? 148 PHE C CD1 1 
ATOM 3060  C CD2 . PHE C 1 148 ? 31.280  32.159  25.463  1.00 24.16 ? 148 PHE C CD2 1 
ATOM 3061  C CE1 . PHE C 1 148 ? 30.597  34.838  25.221  1.00 24.99 ? 148 PHE C CE1 1 
ATOM 3062  C CE2 . PHE C 1 148 ? 30.370  32.719  26.353  1.00 23.86 ? 148 PHE C CE2 1 
ATOM 3063  C CZ  . PHE C 1 148 ? 30.027  34.065  26.230  1.00 25.30 ? 148 PHE C CZ  1 
ATOM 3064  N N   . LEU C 1 149 ? 35.386  30.423  23.381  1.00 26.43 ? 149 LEU C N   1 
ATOM 3065  C CA  . LEU C 1 149 ? 36.121  29.475  22.564  1.00 25.74 ? 149 LEU C CA  1 
ATOM 3066  C C   . LEU C 1 149 ? 35.157  28.300  22.369  1.00 25.08 ? 149 LEU C C   1 
ATOM 3067  O O   . LEU C 1 149 ? 34.748  27.655  23.339  1.00 24.59 ? 149 LEU C O   1 
ATOM 3068  C CB  . LEU C 1 149 ? 37.378  29.036  23.314  1.00 27.70 ? 149 LEU C CB  1 
ATOM 3069  C CG  . LEU C 1 149 ? 38.457  28.237  22.585  1.00 30.69 ? 149 LEU C CG  1 
ATOM 3070  C CD1 . LEU C 1 149 ? 39.003  29.079  21.441  1.00 32.16 ? 149 LEU C CD1 1 
ATOM 3071  C CD2 . LEU C 1 149 ? 39.586  27.842  23.552  1.00 30.50 ? 149 LEU C CD2 1 
ATOM 3072  N N   . PRO C 1 150 ? 34.734  28.039  21.118  1.00 24.91 ? 150 PRO C N   1 
ATOM 3073  C CA  . PRO C 1 150 ? 33.814  26.913  20.910  1.00 25.82 ? 150 PRO C CA  1 
ATOM 3074  C C   . PRO C 1 150 ? 34.546  25.594  21.106  1.00 28.04 ? 150 PRO C C   1 
ATOM 3075  O O   . PRO C 1 150 ? 35.701  25.438  20.688  1.00 28.19 ? 150 PRO C O   1 
ATOM 3076  C CB  . PRO C 1 150 ? 33.328  27.115  19.475  1.00 24.16 ? 150 PRO C CB  1 
ATOM 3077  C CG  . PRO C 1 150 ? 34.478  27.778  18.822  1.00 24.76 ? 150 PRO C CG  1 
ATOM 3078  C CD  . PRO C 1 150 ? 34.949  28.776  19.863  1.00 24.56 ? 150 PRO C CD  1 
ATOM 3079  N N   . MET C 1 151 ? 33.884  24.659  21.776  1.00 29.66 ? 151 MET C N   1 
ATOM 3080  C CA  . MET C 1 151 ? 34.473  23.353  22.050  1.00 31.41 ? 151 MET C CA  1 
ATOM 3081  C C   . MET C 1 151 ? 33.492  22.218  21.741  1.00 33.37 ? 151 MET C C   1 
ATOM 3082  O O   . MET C 1 151 ? 32.271  22.418  21.680  1.00 34.07 ? 151 MET C O   1 
ATOM 3083  C CB  . MET C 1 151 ? 34.905  23.280  23.518  1.00 30.18 ? 151 MET C CB  1 
ATOM 3084  C CG  . MET C 1 151 ? 35.925  24.340  23.909  1.00 30.68 ? 151 MET C CG  1 
ATOM 3085  S SD  . MET C 1 151 ? 36.386  24.317  25.671  1.00 31.60 ? 151 MET C SD  1 
ATOM 3086  C CE  . MET C 1 151 ? 37.739  23.118  25.605  1.00 29.38 ? 151 MET C CE  1 
ATOM 3087  N N   . SER C 1 152 ? 34.036  21.027  21.536  1.00 35.26 ? 152 SER C N   1 
ATOM 3088  C CA  . SER C 1 152 ? 33.229  19.848  21.250  1.00 37.84 ? 152 SER C CA  1 
ATOM 3089  C C   . SER C 1 152 ? 32.351  19.446  22.443  1.00 39.66 ? 152 SER C C   1 
ATOM 3090  O O   . SER C 1 152 ? 32.681  19.726  23.602  1.00 39.21 ? 152 SER C O   1 
ATOM 3091  C CB  . SER C 1 152 ? 34.142  18.678  20.873  1.00 37.94 ? 152 SER C CB  1 
ATOM 3092  O OG  . SER C 1 152 ? 33.613  17.448  21.346  1.00 39.20 ? 152 SER C OG  1 
ATOM 3093  N N   . ALA C 1 153 ? 31.232  18.785  22.150  1.00 41.57 ? 153 ALA C N   1 
ATOM 3094  C CA  . ALA C 1 153 ? 30.324  18.332  23.195  1.00 42.78 ? 153 ALA C CA  1 
ATOM 3095  C C   . ALA C 1 153 ? 30.700  16.905  23.627  1.00 43.86 ? 153 ALA C C   1 
ATOM 3096  O O   . ALA C 1 153 ? 29.843  16.028  23.737  1.00 44.03 ? 153 ALA C O   1 
ATOM 3097  C CB  . ALA C 1 153 ? 28.891  18.381  22.688  1.00 42.28 ? 153 ALA C CB  1 
ATOM 3098  N N   . LYS C 1 154 ? 31.994  16.691  23.875  1.00 45.56 ? 154 LYS C N   1 
ATOM 3099  C CA  . LYS C 1 154 ? 32.524  15.390  24.292  1.00 45.60 ? 154 LYS C CA  1 
ATOM 3100  C C   . LYS C 1 154 ? 32.090  14.313  23.308  1.00 45.51 ? 154 LYS C C   1 
ATOM 3101  O O   . LYS C 1 154 ? 31.709  14.707  22.186  1.00 45.94 ? 154 LYS C O   1 
ATOM 3102  C CB  . LYS C 1 154 ? 32.033  15.031  25.702  1.00 45.78 ? 154 LYS C CB  1 
ATOM 3103  N N   . PHE D 1 21  ? 10.703  -16.786 -11.029 1.00 68.42 ? 21  PHE D N   1 
ATOM 3104  C CA  . PHE D 1 21  ? 11.681  -15.860 -11.672 1.00 69.17 ? 21  PHE D CA  1 
ATOM 3105  C C   . PHE D 1 21  ? 12.025  -16.270 -13.093 1.00 68.87 ? 21  PHE D C   1 
ATOM 3106  O O   . PHE D 1 21  ? 12.077  -17.472 -13.400 1.00 69.02 ? 21  PHE D O   1 
ATOM 3107  C CB  . PHE D 1 21  ? 13.028  -15.842 -10.945 1.00 70.47 ? 21  PHE D CB  1 
ATOM 3108  C CG  . PHE D 1 21  ? 12.986  -15.332 -9.542  1.00 72.17 ? 21  PHE D CG  1 
ATOM 3109  C CD1 . PHE D 1 21  ? 12.634  -16.175 -8.490  1.00 72.77 ? 21  PHE D CD1 1 
ATOM 3110  C CD2 . PHE D 1 21  ? 13.372  -14.030 -9.259  1.00 72.10 ? 21  PHE D CD2 1 
ATOM 3111  C CE1 . PHE D 1 21  ? 12.675  -15.728 -7.178  1.00 73.45 ? 21  PHE D CE1 1 
ATOM 3112  C CE2 . PHE D 1 21  ? 13.417  -13.573 -7.954  1.00 73.44 ? 21  PHE D CE2 1 
ATOM 3113  C CZ  . PHE D 1 21  ? 13.074  -14.425 -6.907  1.00 74.03 ? 21  PHE D CZ  1 
ATOM 3114  N N   . PRO D 1 22  ? 12.278  -15.284 -13.972 1.00 68.32 ? 22  PRO D N   1 
ATOM 3115  C CA  . PRO D 1 22  ? 12.647  -15.553 -15.364 1.00 66.99 ? 22  PRO D CA  1 
ATOM 3116  C C   . PRO D 1 22  ? 13.882  -16.478 -15.356 1.00 65.88 ? 22  PRO D C   1 
ATOM 3117  O O   . PRO D 1 22  ? 14.754  -16.346 -14.487 1.00 65.45 ? 22  PRO D O   1 
ATOM 3118  C CB  . PRO D 1 22  ? 12.936  -14.163 -15.900 1.00 66.99 ? 22  PRO D CB  1 
ATOM 3119  C CG  . PRO D 1 22  ? 11.856  -13.353 -15.217 1.00 67.40 ? 22  PRO D CG  1 
ATOM 3120  C CD  . PRO D 1 22  ? 11.944  -13.857 -13.787 1.00 67.89 ? 22  PRO D CD  1 
ATOM 3121  N N   . PRO D 1 23  ? 13.971  -17.416 -16.324 1.00 64.66 ? 23  PRO D N   1 
ATOM 3122  C CA  . PRO D 1 23  ? 15.086  -18.370 -16.420 1.00 63.46 ? 23  PRO D CA  1 
ATOM 3123  C C   . PRO D 1 23  ? 16.531  -17.883 -16.206 1.00 62.22 ? 23  PRO D C   1 
ATOM 3124  O O   . PRO D 1 23  ? 17.061  -17.988 -15.087 1.00 62.75 ? 23  PRO D O   1 
ATOM 3125  C CB  . PRO D 1 23  ? 14.873  -19.014 -17.797 1.00 63.10 ? 23  PRO D CB  1 
ATOM 3126  C CG  . PRO D 1 23  ? 14.072  -18.000 -18.552 1.00 63.32 ? 23  PRO D CG  1 
ATOM 3127  C CD  . PRO D 1 23  ? 13.103  -17.521 -17.516 1.00 64.04 ? 23  PRO D CD  1 
ATOM 3128  N N   . GLY D 1 24  ? 17.159  -17.383 -17.273 1.00 59.67 ? 24  GLY D N   1 
ATOM 3129  C CA  . GLY D 1 24  ? 18.538  -16.914 -17.220 1.00 56.32 ? 24  GLY D CA  1 
ATOM 3130  C C   . GLY D 1 24  ? 19.240  -16.658 -15.885 1.00 54.25 ? 24  GLY D C   1 
ATOM 3131  O O   . GLY D 1 24  ? 18.622  -16.221 -14.905 1.00 54.99 ? 24  GLY D O   1 
ATOM 3132  N N   . HIS D 1 25  ? 20.545  -16.932 -15.846 1.00 50.97 ? 25  HIS D N   1 
ATOM 3133  C CA  . HIS D 1 25  ? 21.338  -16.700 -14.644 1.00 46.86 ? 25  HIS D CA  1 
ATOM 3134  C C   . HIS D 1 25  ? 22.403  -15.657 -14.987 1.00 44.09 ? 25  HIS D C   1 
ATOM 3135  O O   . HIS D 1 25  ? 23.075  -15.754 -16.014 1.00 42.55 ? 25  HIS D O   1 
ATOM 3136  C CB  . HIS D 1 25  ? 21.979  -17.995 -14.169 1.00 48.57 ? 25  HIS D CB  1 
ATOM 3137  C CG  . HIS D 1 25  ? 22.612  -17.887 -12.814 1.00 50.39 ? 25  HIS D CG  1 
ATOM 3138  N ND1 . HIS D 1 25  ? 21.876  -17.629 -11.674 1.00 51.12 ? 25  HIS D ND1 1 
ATOM 3139  C CD2 . HIS D 1 25  ? 23.900  -17.988 -12.423 1.00 49.41 ? 25  HIS D CD2 1 
ATOM 3140  C CE1 . HIS D 1 25  ? 22.692  -17.578 -10.635 1.00 51.78 ? 25  HIS D CE1 1 
ATOM 3141  N NE2 . HIS D 1 25  ? 23.926  -17.793 -11.061 1.00 50.70 ? 25  HIS D NE2 1 
ATOM 3142  N N   . PHE D 1 26  ? 22.563  -14.669 -14.114 1.00 41.49 ? 26  PHE D N   1 
ATOM 3143  C CA  . PHE D 1 26  ? 23.484  -13.562 -14.363 1.00 38.84 ? 26  PHE D CA  1 
ATOM 3144  C C   . PHE D 1 26  ? 24.953  -13.851 -14.677 1.00 38.93 ? 26  PHE D C   1 
ATOM 3145  O O   . PHE D 1 26  ? 25.630  -13.006 -15.268 1.00 38.37 ? 26  PHE D O   1 
ATOM 3146  C CB  . PHE D 1 26  ? 23.374  -12.530 -13.232 1.00 35.64 ? 26  PHE D CB  1 
ATOM 3147  C CG  . PHE D 1 26  ? 24.104  -12.908 -11.979 1.00 34.50 ? 26  PHE D CG  1 
ATOM 3148  C CD1 . PHE D 1 26  ? 25.468  -12.663 -11.854 1.00 33.28 ? 26  PHE D CD1 1 
ATOM 3149  C CD2 . PHE D 1 26  ? 23.430  -13.495 -10.912 1.00 32.89 ? 26  PHE D CD2 1 
ATOM 3150  C CE1 . PHE D 1 26  ? 26.148  -12.991 -10.693 1.00 32.30 ? 26  PHE D CE1 1 
ATOM 3151  C CE2 . PHE D 1 26  ? 24.102  -13.829 -9.745  1.00 31.46 ? 26  PHE D CE2 1 
ATOM 3152  C CZ  . PHE D 1 26  ? 25.467  -13.575 -9.637  1.00 32.14 ? 26  PHE D CZ  1 
ATOM 3153  N N   . LYS D 1 27  ? 25.446  -15.029 -14.308 1.00 38.40 ? 27  LYS D N   1 
ATOM 3154  C CA  . LYS D 1 27  ? 26.836  -15.398 -14.585 1.00 37.74 ? 27  LYS D CA  1 
ATOM 3155  C C   . LYS D 1 27  ? 27.036  -15.932 -15.998 1.00 37.40 ? 27  LYS D C   1 
ATOM 3156  O O   . LYS D 1 27  ? 28.133  -15.897 -16.540 1.00 39.29 ? 27  LYS D O   1 
ATOM 3157  C CB  . LYS D 1 27  ? 27.280  -16.486 -13.612 1.00 36.70 ? 27  LYS D CB  1 
ATOM 3158  C CG  . LYS D 1 27  ? 27.974  -15.991 -12.377 1.00 37.37 ? 27  LYS D CG  1 
ATOM 3159  C CD  . LYS D 1 27  ? 28.085  -17.106 -11.348 1.00 38.76 ? 27  LYS D CD  1 
ATOM 3160  C CE  . LYS D 1 27  ? 26.728  -17.377 -10.701 1.00 40.06 ? 27  LYS D CE  1 
ATOM 3161  N NZ  . LYS D 1 27  ? 26.670  -18.667 -9.968  1.00 40.52 ? 27  LYS D NZ  1 
ATOM 3162  N N   . ASP D 1 28  ? 25.971  -16.446 -16.585 1.00 37.27 ? 28  ASP D N   1 
ATOM 3163  C CA  . ASP D 1 28  ? 26.030  -17.026 -17.918 1.00 36.56 ? 28  ASP D CA  1 
ATOM 3164  C C   . ASP D 1 28  ? 26.368  -16.056 -19.021 1.00 36.36 ? 28  ASP D C   1 
ATOM 3165  O O   . ASP D 1 28  ? 26.019  -14.885 -18.959 1.00 37.04 ? 28  ASP D O   1 
ATOM 3166  C CB  . ASP D 1 28  ? 24.687  -17.651 -18.259 1.00 37.62 ? 28  ASP D CB  1 
ATOM 3167  C CG  . ASP D 1 28  ? 24.370  -18.839 -17.402 1.00 37.74 ? 28  ASP D CG  1 
ATOM 3168  O OD1 . ASP D 1 28  ? 23.234  -19.339 -17.502 1.00 38.86 ? 28  ASP D OD1 1 
ATOM 3169  O OD2 . ASP D 1 28  ? 25.253  -19.278 -16.639 1.00 38.36 ? 28  ASP D OD2 1 
ATOM 3170  N N   . PRO D 1 29  ? 27.065  -16.530 -20.056 1.00 36.21 ? 29  PRO D N   1 
ATOM 3171  C CA  . PRO D 1 29  ? 27.372  -15.590 -21.131 1.00 35.99 ? 29  PRO D CA  1 
ATOM 3172  C C   . PRO D 1 29  ? 26.046  -15.258 -21.817 1.00 35.79 ? 29  PRO D C   1 
ATOM 3173  O O   . PRO D 1 29  ? 25.074  -16.022 -21.690 1.00 35.79 ? 29  PRO D O   1 
ATOM 3174  C CB  . PRO D 1 29  ? 28.348  -16.373 -22.019 1.00 35.02 ? 29  PRO D CB  1 
ATOM 3175  C CG  . PRO D 1 29  ? 28.060  -17.798 -21.705 1.00 35.25 ? 29  PRO D CG  1 
ATOM 3176  C CD  . PRO D 1 29  ? 27.822  -17.781 -20.222 1.00 35.99 ? 29  PRO D CD  1 
ATOM 3177  N N   . LYS D 1 30  ? 25.989  -14.132 -22.526 1.00 35.43 ? 30  LYS D N   1 
ATOM 3178  C CA  . LYS D 1 30  ? 24.747  -13.733 -23.190 1.00 34.97 ? 30  LYS D CA  1 
ATOM 3179  C C   . LYS D 1 30  ? 24.973  -13.095 -24.539 1.00 34.10 ? 30  LYS D C   1 
ATOM 3180  O O   . LYS D 1 30  ? 26.117  -12.833 -24.938 1.00 33.69 ? 30  LYS D O   1 
ATOM 3181  C CB  . LYS D 1 30  ? 23.954  -12.749 -22.314 1.00 34.95 ? 30  LYS D CB  1 
ATOM 3182  C CG  . LYS D 1 30  ? 23.615  -13.288 -20.939 1.00 37.97 ? 30  LYS D CG  1 
ATOM 3183  C CD  . LYS D 1 30  ? 23.182  -12.179 -19.974 1.00 41.90 ? 30  LYS D CD  1 
ATOM 3184  C CE  . LYS D 1 30  ? 23.347  -12.633 -18.520 1.00 43.77 ? 30  LYS D CE  1 
ATOM 3185  N NZ  . LYS D 1 30  ? 22.925  -14.066 -18.365 1.00 43.05 ? 30  LYS D NZ  1 
ATOM 3186  N N   . ARG D 1 31  ? 23.864  -12.871 -25.242 1.00 32.89 ? 31  ARG D N   1 
ATOM 3187  C CA  . ARG D 1 31  ? 23.877  -12.210 -26.538 1.00 32.36 ? 31  ARG D CA  1 
ATOM 3188  C C   . ARG D 1 31  ? 23.227  -10.852 -26.280 1.00 31.65 ? 31  ARG D C   1 
ATOM 3189  O O   . ARG D 1 31  ? 22.279  -10.752 -25.495 1.00 30.77 ? 31  ARG D O   1 
ATOM 3190  C CB  . ARG D 1 31  ? 23.009  -12.942 -27.568 1.00 33.56 ? 31  ARG D CB  1 
ATOM 3191  C CG  . ARG D 1 31  ? 23.445  -14.334 -27.987 1.00 36.55 ? 31  ARG D CG  1 
ATOM 3192  C CD  . ARG D 1 31  ? 22.549  -14.803 -29.135 1.00 39.88 ? 31  ARG D CD  1 
ATOM 3193  N NE  . ARG D 1 31  ? 22.147  -16.201 -29.014 1.00 42.74 ? 31  ARG D NE  1 
ATOM 3194  C CZ  . ARG D 1 31  ? 22.973  -17.234 -29.134 1.00 43.91 ? 31  ARG D CZ  1 
ATOM 3195  N NH1 . ARG D 1 31  ? 24.263  -17.031 -29.384 1.00 44.77 ? 31  ARG D NH1 1 
ATOM 3196  N NH2 . ARG D 1 31  ? 22.505  -18.469 -28.990 1.00 44.29 ? 31  ARG D NH2 1 
ATOM 3197  N N   . LEU D 1 32  ? 23.737  -9.802  -26.913 1.00 30.03 ? 32  LEU D N   1 
ATOM 3198  C CA  . LEU D 1 32  ? 23.112  -8.503  -26.745 1.00 28.66 ? 32  LEU D CA  1 
ATOM 3199  C C   . LEU D 1 32  ? 22.384  -8.115  -28.023 1.00 27.54 ? 32  LEU D C   1 
ATOM 3200  O O   . LEU D 1 32  ? 22.988  -7.689  -28.998 1.00 26.66 ? 32  LEU D O   1 
ATOM 3201  C CB  . LEU D 1 32  ? 24.141  -7.434  -26.358 1.00 28.31 ? 32  LEU D CB  1 
ATOM 3202  C CG  . LEU D 1 32  ? 24.533  -7.466  -24.876 1.00 28.82 ? 32  LEU D CG  1 
ATOM 3203  C CD1 . LEU D 1 32  ? 25.514  -6.346  -24.608 1.00 27.72 ? 32  LEU D CD1 1 
ATOM 3204  C CD2 . LEU D 1 32  ? 23.294  -7.335  -23.984 1.00 25.63 ? 32  LEU D CD2 1 
ATOM 3205  N N   . TYR D 1 33  ? 21.073  -8.292  -27.998 1.00 27.05 ? 33  TYR D N   1 
ATOM 3206  C CA  . TYR D 1 33  ? 20.227  -7.976  -29.127 1.00 27.92 ? 33  TYR D CA  1 
ATOM 3207  C C   . TYR D 1 33  ? 19.843  -6.498  -29.131 1.00 28.77 ? 33  TYR D C   1 
ATOM 3208  O O   . TYR D 1 33  ? 19.393  -5.964  -28.118 1.00 29.03 ? 33  TYR D O   1 
ATOM 3209  C CB  . TYR D 1 33  ? 18.990  -8.866  -29.070 1.00 26.62 ? 33  TYR D CB  1 
ATOM 3210  C CG  . TYR D 1 33  ? 17.891  -8.485  -30.019 1.00 24.86 ? 33  TYR D CG  1 
ATOM 3211  C CD1 . TYR D 1 33  ? 16.901  -7.589  -29.636 1.00 24.99 ? 33  TYR D CD1 1 
ATOM 3212  C CD2 . TYR D 1 33  ? 17.803  -9.068  -31.279 1.00 25.35 ? 33  TYR D CD2 1 
ATOM 3213  C CE1 . TYR D 1 33  ? 15.833  -7.286  -30.485 1.00 25.87 ? 33  TYR D CE1 1 
ATOM 3214  C CE2 . TYR D 1 33  ? 16.746  -8.771  -32.139 1.00 26.93 ? 33  TYR D CE2 1 
ATOM 3215  C CZ  . TYR D 1 33  ? 15.765  -7.883  -31.731 1.00 26.70 ? 33  TYR D CZ  1 
ATOM 3216  O OH  . TYR D 1 33  ? 14.709  -7.622  -32.568 1.00 28.39 ? 33  TYR D OH  1 
ATOM 3217  N N   . CYS D 1 34  ? 20.032  -5.842  -30.274 1.00 28.90 ? 34  CYS D N   1 
ATOM 3218  C CA  . CYS D 1 34  ? 19.715  -4.423  -30.407 1.00 29.85 ? 34  CYS D CA  1 
ATOM 3219  C C   . CYS D 1 34  ? 18.377  -4.209  -31.114 1.00 30.77 ? 34  CYS D C   1 
ATOM 3220  O O   . CYS D 1 34  ? 18.171  -4.683  -32.227 1.00 30.35 ? 34  CYS D O   1 
ATOM 3221  C CB  . CYS D 1 34  ? 20.854  -3.712  -31.160 1.00 29.65 ? 34  CYS D CB  1 
ATOM 3222  S SG  . CYS D 1 34  ? 20.696  -1.913  -31.354 1.00 29.23 ? 34  CYS D SG  1 
ATOM 3223  N N   . LYS D 1 35  ? 17.466  -3.499  -30.456 1.00 32.70 ? 35  LYS D N   1 
ATOM 3224  C CA  . LYS D 1 35  ? 16.155  -3.240  -31.029 1.00 35.48 ? 35  LYS D CA  1 
ATOM 3225  C C   . LYS D 1 35  ? 16.304  -2.670  -32.440 1.00 37.86 ? 35  LYS D C   1 
ATOM 3226  O O   . LYS D 1 35  ? 15.563  -3.054  -33.357 1.00 38.44 ? 35  LYS D O   1 
ATOM 3227  C CB  . LYS D 1 35  ? 15.367  -2.269  -30.143 1.00 35.43 ? 35  LYS D CB  1 
ATOM 3228  N N   . ASN D 1 36  ? 17.279  -1.777  -32.616 1.00 39.17 ? 36  ASN D N   1 
ATOM 3229  C CA  . ASN D 1 36  ? 17.521  -1.148  -33.914 1.00 40.17 ? 36  ASN D CA  1 
ATOM 3230  C C   . ASN D 1 36  ? 17.963  -2.133  -34.992 1.00 40.02 ? 36  ASN D C   1 
ATOM 3231  O O   . ASN D 1 36  ? 19.151  -2.430  -35.105 1.00 41.23 ? 36  ASN D O   1 
ATOM 3232  C CB  . ASN D 1 36  ? 18.591  -0.070  -33.778 1.00 40.63 ? 36  ASN D CB  1 
ATOM 3233  C CG  . ASN D 1 36  ? 18.476  0.992   -34.850 1.00 41.14 ? 36  ASN D CG  1 
ATOM 3234  O OD1 . ASN D 1 36  ? 19.426  1.723   -35.124 1.00 41.59 ? 36  ASN D OD1 1 
ATOM 3235  N ND2 . ASN D 1 36  ? 17.297  1.093   -35.452 1.00 40.02 ? 36  ASN D ND2 1 
ATOM 3236  N N   . GLY D 1 37  ? 17.017  -2.642  -35.775 1.00 38.75 ? 37  GLY D N   1 
ATOM 3237  C CA  . GLY D 1 37  ? 17.370  -3.567  -36.838 1.00 39.01 ? 37  GLY D CA  1 
ATOM 3238  C C   . GLY D 1 37  ? 17.443  -5.034  -36.456 1.00 39.16 ? 37  GLY D C   1 
ATOM 3239  O O   . GLY D 1 37  ? 17.481  -5.903  -37.329 1.00 38.79 ? 37  GLY D O   1 
ATOM 3240  N N   . GLY D 1 38  ? 17.470  -5.316  -35.158 1.00 38.89 ? 38  GLY D N   1 
ATOM 3241  C CA  . GLY D 1 38  ? 17.537  -6.694  -34.714 1.00 38.41 ? 38  GLY D CA  1 
ATOM 3242  C C   . GLY D 1 38  ? 18.909  -7.327  -34.854 1.00 37.55 ? 38  GLY D C   1 
ATOM 3243  O O   . GLY D 1 38  ? 19.025  -8.512  -35.153 1.00 38.65 ? 38  GLY D O   1 
ATOM 3244  N N   . PHE D 1 39  ? 19.961  -6.551  -34.643 1.00 36.49 ? 39  PHE D N   1 
ATOM 3245  C CA  . PHE D 1 39  ? 21.304  -7.110  -34.747 1.00 35.20 ? 39  PHE D CA  1 
ATOM 3246  C C   . PHE D 1 39  ? 21.825  -7.480  -33.380 1.00 35.05 ? 39  PHE D C   1 
ATOM 3247  O O   . PHE D 1 39  ? 21.510  -6.824  -32.390 1.00 35.96 ? 39  PHE D O   1 
ATOM 3248  C CB  . PHE D 1 39  ? 22.302  -6.117  -35.358 1.00 33.90 ? 39  PHE D CB  1 
ATOM 3249  C CG  . PHE D 1 39  ? 21.915  -5.605  -36.709 1.00 31.86 ? 39  PHE D CG  1 
ATOM 3250  C CD1 . PHE D 1 39  ? 21.069  -4.506  -36.830 1.00 30.80 ? 39  PHE D CD1 1 
ATOM 3251  C CD2 . PHE D 1 39  ? 22.404  -6.217  -37.863 1.00 31.69 ? 39  PHE D CD2 1 
ATOM 3252  C CE1 . PHE D 1 39  ? 20.713  -4.016  -38.084 1.00 31.09 ? 39  PHE D CE1 1 
ATOM 3253  C CE2 . PHE D 1 39  ? 22.058  -5.742  -39.122 1.00 31.21 ? 39  PHE D CE2 1 
ATOM 3254  C CZ  . PHE D 1 39  ? 21.208  -4.636  -39.237 1.00 31.10 ? 39  PHE D CZ  1 
ATOM 3255  N N   . PHE D 1 40  ? 22.625  -8.537  -33.336 1.00 34.99 ? 40  PHE D N   1 
ATOM 3256  C CA  . PHE D 1 40  ? 23.262  -8.979  -32.105 1.00 33.81 ? 40  PHE D CA  1 
ATOM 3257  C C   . PHE D 1 40  ? 24.623  -8.283  -32.105 1.00 34.12 ? 40  PHE D C   1 
ATOM 3258  O O   . PHE D 1 40  ? 25.265  -8.184  -33.148 1.00 32.89 ? 40  PHE D O   1 
ATOM 3259  C CB  . PHE D 1 40  ? 23.491  -10.495 -32.110 1.00 32.68 ? 40  PHE D CB  1 
ATOM 3260  C CG  . PHE D 1 40  ? 22.241  -11.309 -31.930 1.00 32.67 ? 40  PHE D CG  1 
ATOM 3261  C CD1 . PHE D 1 40  ? 21.596  -11.361 -30.693 1.00 32.43 ? 40  PHE D CD1 1 
ATOM 3262  C CD2 . PHE D 1 40  ? 21.698  -12.014 -32.998 1.00 31.91 ? 40  PHE D CD2 1 
ATOM 3263  C CE1 . PHE D 1 40  ? 20.431  -12.101 -30.525 1.00 31.34 ? 40  PHE D CE1 1 
ATOM 3264  C CE2 . PHE D 1 40  ? 20.534  -12.756 -32.843 1.00 31.86 ? 40  PHE D CE2 1 
ATOM 3265  C CZ  . PHE D 1 40  ? 19.897  -12.801 -31.603 1.00 31.55 ? 40  PHE D CZ  1 
ATOM 3266  N N   . LEU D 1 41  ? 25.050  -7.791  -30.943 1.00 34.93 ? 41  LEU D N   1 
ATOM 3267  C CA  . LEU D 1 41  ? 26.343  -7.131  -30.830 1.00 35.30 ? 41  LEU D CA  1 
ATOM 3268  C C   . LEU D 1 41  ? 27.434  -8.172  -31.036 1.00 35.96 ? 41  LEU D C   1 
ATOM 3269  O O   . LEU D 1 41  ? 27.437  -9.200  -30.372 1.00 36.90 ? 41  LEU D O   1 
ATOM 3270  C CB  . LEU D 1 41  ? 26.487  -6.495  -29.452 1.00 34.33 ? 41  LEU D CB  1 
ATOM 3271  C CG  . LEU D 1 41  ? 27.791  -5.736  -29.194 1.00 34.74 ? 41  LEU D CG  1 
ATOM 3272  C CD1 . LEU D 1 41  ? 27.995  -4.663  -30.260 1.00 34.36 ? 41  LEU D CD1 1 
ATOM 3273  C CD2 . LEU D 1 41  ? 27.736  -5.108  -27.803 1.00 34.10 ? 41  LEU D CD2 1 
ATOM 3274  N N   . ARG D 1 42  ? 28.345  -7.911  -31.965 1.00 37.13 ? 42  ARG D N   1 
ATOM 3275  C CA  . ARG D 1 42  ? 29.433  -8.841  -32.245 1.00 38.22 ? 42  ARG D CA  1 
ATOM 3276  C C   . ARG D 1 42  ? 30.830  -8.256  -32.018 1.00 39.15 ? 42  ARG D C   1 
ATOM 3277  O O   . ARG D 1 42  ? 31.139  -7.131  -32.435 1.00 39.24 ? 42  ARG D O   1 
ATOM 3278  C CB  . ARG D 1 42  ? 29.333  -9.351  -33.681 1.00 38.72 ? 42  ARG D CB  1 
ATOM 3279  C CG  . ARG D 1 42  ? 30.481  -10.256 -34.091 1.00 39.71 ? 42  ARG D CG  1 
ATOM 3280  C CD  . ARG D 1 42  ? 30.254  -10.842 -35.474 1.00 41.88 ? 42  ARG D CD  1 
ATOM 3281  N NE  . ARG D 1 42  ? 30.159  -9.798  -36.496 1.00 44.86 ? 42  ARG D NE  1 
ATOM 3282  C CZ  . ARG D 1 42  ? 29.997  -10.032 -37.796 1.00 45.20 ? 42  ARG D CZ  1 
ATOM 3283  N NH1 . ARG D 1 42  ? 29.914  -11.280 -38.234 1.00 47.04 ? 42  ARG D NH1 1 
ATOM 3284  N NH2 . ARG D 1 42  ? 29.905  -9.022  -38.654 1.00 43.94 ? 42  ARG D NH2 1 
ATOM 3285  N N   . ILE D 1 43  ? 31.676  -9.038  -31.357 1.00 39.46 ? 43  ILE D N   1 
ATOM 3286  C CA  . ILE D 1 43  ? 33.036  -8.617  -31.078 1.00 39.99 ? 43  ILE D CA  1 
ATOM 3287  C C   . ILE D 1 43  ? 34.023  -9.523  -31.799 1.00 41.28 ? 43  ILE D C   1 
ATOM 3288  O O   . ILE D 1 43  ? 34.212  -10.676 -31.422 1.00 42.21 ? 43  ILE D O   1 
ATOM 3289  C CB  . ILE D 1 43  ? 33.326  -8.666  -29.584 1.00 38.78 ? 43  ILE D CB  1 
ATOM 3290  C CG1 . ILE D 1 43  ? 32.369  -7.734  -28.836 1.00 36.16 ? 43  ILE D CG1 1 
ATOM 3291  C CG2 . ILE D 1 43  ? 34.774  -8.297  -29.343 1.00 38.65 ? 43  ILE D CG2 1 
ATOM 3292  C CD1 . ILE D 1 43  ? 32.690  -7.584  -27.375 1.00 36.04 ? 43  ILE D CD1 1 
ATOM 3293  N N   . HIS D 1 44  ? 34.650  -8.978  -32.836 1.00 43.32 ? 44  HIS D N   1 
ATOM 3294  C CA  . HIS D 1 44  ? 35.613  -9.700  -33.663 1.00 45.31 ? 44  HIS D CA  1 
ATOM 3295  C C   . HIS D 1 44  ? 36.978  -9.924  -33.020 1.00 45.59 ? 44  HIS D C   1 
ATOM 3296  O O   . HIS D 1 44  ? 37.439  -9.121  -32.211 1.00 45.68 ? 44  HIS D O   1 
ATOM 3297  C CB  . HIS D 1 44  ? 35.801  -8.959  -34.982 1.00 46.77 ? 44  HIS D CB  1 
ATOM 3298  C CG  . HIS D 1 44  ? 34.580  -8.954  -35.844 1.00 48.62 ? 44  HIS D CG  1 
ATOM 3299  N ND1 . HIS D 1 44  ? 34.067  -10.103 -36.407 1.00 49.55 ? 44  HIS D ND1 1 
ATOM 3300  C CD2 . HIS D 1 44  ? 33.767  -7.945  -36.240 1.00 49.78 ? 44  HIS D CD2 1 
ATOM 3301  C CE1 . HIS D 1 44  ? 32.993  -9.800  -37.116 1.00 50.34 ? 44  HIS D CE1 1 
ATOM 3302  N NE2 . HIS D 1 44  ? 32.787  -8.499  -37.031 1.00 50.15 ? 44  HIS D NE2 1 
ATOM 3303  N N   . PRO D 1 45  ? 37.652  -11.018 -33.400 1.00 46.19 ? 45  PRO D N   1 
ATOM 3304  C CA  . PRO D 1 45  ? 38.975  -11.371 -32.870 1.00 46.79 ? 45  PRO D CA  1 
ATOM 3305  C C   . PRO D 1 45  ? 40.030  -10.288 -33.089 1.00 47.69 ? 45  PRO D C   1 
ATOM 3306  O O   . PRO D 1 45  ? 40.962  -10.149 -32.298 1.00 46.89 ? 45  PRO D O   1 
ATOM 3307  C CB  . PRO D 1 45  ? 39.313  -12.659 -33.613 1.00 46.47 ? 45  PRO D CB  1 
ATOM 3308  C CG  . PRO D 1 45  ? 37.962  -13.264 -33.881 1.00 46.98 ? 45  PRO D CG  1 
ATOM 3309  C CD  . PRO D 1 45  ? 37.159  -12.059 -34.318 1.00 46.63 ? 45  PRO D CD  1 
ATOM 3310  N N   . ASP D 1 46  ? 39.879  -9.524  -34.164 1.00 48.79 ? 46  ASP D N   1 
ATOM 3311  C CA  . ASP D 1 46  ? 40.822  -8.458  -34.478 1.00 50.36 ? 46  ASP D CA  1 
ATOM 3312  C C   . ASP D 1 46  ? 40.433  -7.151  -33.788 1.00 50.51 ? 46  ASP D C   1 
ATOM 3313  O O   . ASP D 1 46  ? 40.991  -6.092  -34.092 1.00 50.94 ? 46  ASP D O   1 
ATOM 3314  C CB  . ASP D 1 46  ? 40.869  -8.229  -35.992 1.00 52.52 ? 46  ASP D CB  1 
ATOM 3315  C CG  . ASP D 1 46  ? 39.502  -7.884  -36.569 1.00 55.27 ? 46  ASP D CG  1 
ATOM 3316  O OD1 . ASP D 1 46  ? 38.639  -8.788  -36.658 1.00 56.94 ? 46  ASP D OD1 1 
ATOM 3317  O OD2 . ASP D 1 46  ? 39.288  -6.705  -36.924 1.00 56.19 ? 46  ASP D OD2 1 
ATOM 3318  N N   . GLY D 1 47  ? 39.464  -7.218  -32.878 1.00 49.86 ? 47  GLY D N   1 
ATOM 3319  C CA  . GLY D 1 47  ? 39.032  -6.021  -32.176 1.00 48.68 ? 47  GLY D CA  1 
ATOM 3320  C C   . GLY D 1 47  ? 37.913  -5.239  -32.846 1.00 48.01 ? 47  GLY D C   1 
ATOM 3321  O O   . GLY D 1 47  ? 37.434  -4.248  -32.297 1.00 47.36 ? 47  GLY D O   1 
ATOM 3322  N N   . ARG D 1 48  ? 37.493  -5.665  -34.031 1.00 47.94 ? 48  ARG D N   1 
ATOM 3323  C CA  . ARG D 1 48  ? 36.415  -4.968  -34.730 1.00 48.45 ? 48  ARG D CA  1 
ATOM 3324  C C   . ARG D 1 48  ? 35.078  -5.173  -34.014 1.00 48.04 ? 48  ARG D C   1 
ATOM 3325  O O   . ARG D 1 48  ? 34.805  -6.255  -33.488 1.00 48.40 ? 48  ARG D O   1 
ATOM 3326  C CB  . ARG D 1 48  ? 36.301  -5.481  -36.165 1.00 49.45 ? 48  ARG D CB  1 
ATOM 3327  C CG  . ARG D 1 48  ? 36.544  -4.434  -37.241 1.00 50.95 ? 48  ARG D CG  1 
ATOM 3328  C CD  . ARG D 1 48  ? 36.389  -5.074  -38.610 1.00 52.80 ? 48  ARG D CD  1 
ATOM 3329  N NE  . ARG D 1 48  ? 37.160  -6.315  -38.676 1.00 54.90 ? 48  ARG D NE  1 
ATOM 3330  C CZ  . ARG D 1 48  ? 36.663  -7.494  -39.041 1.00 55.56 ? 48  ARG D CZ  1 
ATOM 3331  N NH1 . ARG D 1 48  ? 37.450  -8.562  -39.063 1.00 55.82 ? 48  ARG D NH1 1 
ATOM 3332  N NH2 . ARG D 1 48  ? 35.383  -7.608  -39.385 1.00 55.79 ? 48  ARG D NH2 1 
ATOM 3333  N N   . VAL D 1 49  ? 34.246  -4.139  -33.988 1.00 46.81 ? 49  VAL D N   1 
ATOM 3334  C CA  . VAL D 1 49  ? 32.943  -4.254  -33.342 1.00 46.88 ? 49  VAL D CA  1 
ATOM 3335  C C   . VAL D 1 49  ? 31.813  -3.873  -34.291 1.00 47.30 ? 49  VAL D C   1 
ATOM 3336  O O   . VAL D 1 49  ? 31.882  -2.861  -34.992 1.00 47.51 ? 49  VAL D O   1 
ATOM 3337  C CB  . VAL D 1 49  ? 32.822  -3.366  -32.058 1.00 46.55 ? 49  VAL D CB  1 
ATOM 3338  C CG1 . VAL D 1 49  ? 31.350  -3.254  -31.632 1.00 46.48 ? 49  VAL D CG1 1 
ATOM 3339  C CG2 . VAL D 1 49  ? 33.624  -3.969  -30.922 1.00 46.20 ? 49  VAL D CG2 1 
ATOM 3340  N N   . ASP D 1 50  ? 30.768  -4.692  -34.304 1.00 47.52 ? 50  ASP D N   1 
ATOM 3341  C CA  . ASP D 1 50  ? 29.603  -4.447  -35.145 1.00 48.24 ? 50  ASP D CA  1 
ATOM 3342  C C   . ASP D 1 50  ? 28.442  -5.337  -34.712 1.00 47.97 ? 50  ASP D C   1 
ATOM 3343  O O   . ASP D 1 50  ? 28.446  -5.879  -33.608 1.00 47.58 ? 50  ASP D O   1 
ATOM 3344  C CB  . ASP D 1 50  ? 29.924  -4.713  -36.621 1.00 49.26 ? 50  ASP D CB  1 
ATOM 3345  C CG  . ASP D 1 50  ? 30.195  -6.178  -36.909 1.00 51.23 ? 50  ASP D CG  1 
ATOM 3346  O OD1 . ASP D 1 50  ? 30.388  -6.517  -38.098 1.00 52.75 ? 50  ASP D OD1 1 
ATOM 3347  O OD2 . ASP D 1 50  ? 30.217  -6.993  -35.959 1.00 52.45 ? 50  ASP D OD2 1 
ATOM 3348  N N   . GLY D 1 51  ? 27.455  -5.488  -35.591 1.00 47.80 ? 51  GLY D N   1 
ATOM 3349  C CA  . GLY D 1 51  ? 26.305  -6.322  -35.284 1.00 47.70 ? 51  GLY D CA  1 
ATOM 3350  C C   . GLY D 1 51  ? 25.919  -7.241  -36.432 1.00 47.59 ? 51  GLY D C   1 
ATOM 3351  O O   . GLY D 1 51  ? 26.186  -6.927  -37.588 1.00 47.59 ? 51  GLY D O   1 
ATOM 3352  N N   . VAL D 1 52  ? 25.315  -8.385  -36.110 1.00 47.20 ? 52  VAL D N   1 
ATOM 3353  C CA  . VAL D 1 52  ? 24.864  -9.358  -37.111 1.00 47.63 ? 52  VAL D CA  1 
ATOM 3354  C C   . VAL D 1 52  ? 23.522  -9.923  -36.687 1.00 47.98 ? 52  VAL D C   1 
ATOM 3355  O O   . VAL D 1 52  ? 23.110  -9.761  -35.544 1.00 48.76 ? 52  VAL D O   1 
ATOM 3356  C CB  . VAL D 1 52  ? 25.826  -10.566 -37.281 1.00 47.42 ? 52  VAL D CB  1 
ATOM 3357  C CG1 . VAL D 1 52  ? 27.100  -10.125 -37.941 1.00 47.94 ? 52  VAL D CG1 1 
ATOM 3358  C CG2 . VAL D 1 52  ? 26.108  -11.213 -35.942 1.00 47.07 ? 52  VAL D CG2 1 
ATOM 3359  N N   . ARG D 1 53  ? 22.850  -10.602 -37.606 1.00 47.93 ? 53  ARG D N   1 
ATOM 3360  C CA  . ARG D 1 53  ? 21.548  -11.177 -37.314 1.00 48.87 ? 53  ARG D CA  1 
ATOM 3361  C C   . ARG D 1 53  ? 21.609  -12.682 -37.061 1.00 49.06 ? 53  ARG D C   1 
ATOM 3362  O O   . ARG D 1 53  ? 20.694  -13.255 -36.469 1.00 48.80 ? 53  ARG D O   1 
ATOM 3363  C CB  . ARG D 1 53  ? 20.576  -10.899 -38.472 1.00 48.85 ? 53  ARG D CB  1 
ATOM 3364  C CG  . ARG D 1 53  ? 20.167  -9.430  -38.663 1.00 49.57 ? 53  ARG D CG  1 
ATOM 3365  C CD  . ARG D 1 53  ? 19.024  -9.320  -39.679 1.00 50.11 ? 53  ARG D CD  1 
ATOM 3366  N NE  . ARG D 1 53  ? 18.446  -7.979  -39.774 1.00 51.34 ? 53  ARG D NE  1 
ATOM 3367  C CZ  . ARG D 1 53  ? 19.010  -6.957  -40.413 1.00 52.64 ? 53  ARG D CZ  1 
ATOM 3368  N NH1 . ARG D 1 53  ? 20.179  -7.113  -41.022 1.00 53.75 ? 53  ARG D NH1 1 
ATOM 3369  N NH2 . ARG D 1 53  ? 18.402  -5.777  -40.456 1.00 52.69 ? 53  ARG D NH2 1 
ATOM 3370  N N   . GLU D 1 54  ? 22.692  -13.312 -37.499 1.00 50.11 ? 54  GLU D N   1 
ATOM 3371  C CA  . GLU D 1 54  ? 22.860  -14.757 -37.353 1.00 51.59 ? 54  GLU D CA  1 
ATOM 3372  C C   . GLU D 1 54  ? 23.179  -15.209 -35.924 1.00 51.23 ? 54  GLU D C   1 
ATOM 3373  O O   . GLU D 1 54  ? 24.321  -15.123 -35.469 1.00 50.86 ? 54  GLU D O   1 
ATOM 3374  C CB  . GLU D 1 54  ? 23.947  -15.240 -38.332 1.00 53.56 ? 54  GLU D CB  1 
ATOM 3375  C CG  . GLU D 1 54  ? 24.272  -16.739 -38.274 1.00 57.02 ? 54  GLU D CG  1 
ATOM 3376  C CD  . GLU D 1 54  ? 23.063  -17.628 -38.542 1.00 58.80 ? 54  GLU D CD  1 
ATOM 3377  O OE1 . GLU D 1 54  ? 22.449  -17.481 -39.626 1.00 59.88 ? 54  GLU D OE1 1 
ATOM 3378  O OE2 . GLU D 1 54  ? 22.731  -18.471 -37.670 1.00 58.83 ? 54  GLU D OE2 1 
ATOM 3379  N N   . LYS D 1 55  ? 22.160  -15.709 -35.232 1.00 50.97 ? 55  LYS D N   1 
ATOM 3380  C CA  . LYS D 1 55  ? 22.301  -16.169 -33.853 1.00 51.25 ? 55  LYS D CA  1 
ATOM 3381  C C   . LYS D 1 55  ? 23.425  -17.191 -33.660 1.00 51.70 ? 55  LYS D C   1 
ATOM 3382  O O   . LYS D 1 55  ? 23.979  -17.324 -32.565 1.00 52.24 ? 55  LYS D O   1 
ATOM 3383  C CB  . LYS D 1 55  ? 20.977  -16.768 -33.364 1.00 49.69 ? 55  LYS D CB  1 
ATOM 3384  N N   . SER D 1 56  ? 23.764  -17.907 -34.724 1.00 51.82 ? 56  SER D N   1 
ATOM 3385  C CA  . SER D 1 56  ? 24.809  -18.920 -34.650 1.00 51.65 ? 56  SER D CA  1 
ATOM 3386  C C   . SER D 1 56  ? 26.208  -18.323 -34.630 1.00 51.56 ? 56  SER D C   1 
ATOM 3387  O O   . SER D 1 56  ? 27.157  -18.991 -34.219 1.00 52.21 ? 56  SER D O   1 
ATOM 3388  C CB  . SER D 1 56  ? 24.698  -19.883 -35.838 1.00 51.79 ? 56  SER D CB  1 
ATOM 3389  O OG  . SER D 1 56  ? 25.044  -19.243 -37.060 1.00 51.81 ? 56  SER D OG  1 
ATOM 3390  N N   . ASP D 1 57  ? 26.348  -17.081 -35.086 1.00 50.85 ? 57  ASP D N   1 
ATOM 3391  C CA  . ASP D 1 57  ? 27.663  -16.450 -35.108 1.00 50.61 ? 57  ASP D CA  1 
ATOM 3392  C C   . ASP D 1 57  ? 28.349  -16.626 -33.755 1.00 50.89 ? 57  ASP D C   1 
ATOM 3393  O O   . ASP D 1 57  ? 27.799  -16.275 -32.712 1.00 52.51 ? 57  ASP D O   1 
ATOM 3394  C CB  . ASP D 1 57  ? 27.544  -14.970 -35.449 1.00 49.23 ? 57  ASP D CB  1 
ATOM 3395  C CG  . ASP D 1 57  ? 28.889  -14.320 -35.689 1.00 48.51 ? 57  ASP D CG  1 
ATOM 3396  O OD1 . ASP D 1 57  ? 28.961  -13.406 -36.539 1.00 48.18 ? 57  ASP D OD1 1 
ATOM 3397  O OD2 . ASP D 1 57  ? 29.872  -14.715 -35.025 1.00 47.61 ? 57  ASP D OD2 1 
ATOM 3398  N N   . PRO D 1 58  ? 29.562  -17.187 -33.754 1.00 50.30 ? 58  PRO D N   1 
ATOM 3399  C CA  . PRO D 1 58  ? 30.317  -17.415 -32.517 1.00 49.98 ? 58  PRO D CA  1 
ATOM 3400  C C   . PRO D 1 58  ? 30.871  -16.173 -31.818 1.00 49.51 ? 58  PRO D C   1 
ATOM 3401  O O   . PRO D 1 58  ? 31.249  -16.242 -30.647 1.00 50.24 ? 58  PRO D O   1 
ATOM 3402  C CB  . PRO D 1 58  ? 31.439  -18.336 -32.978 1.00 50.13 ? 58  PRO D CB  1 
ATOM 3403  C CG  . PRO D 1 58  ? 31.726  -17.811 -34.348 1.00 50.12 ? 58  PRO D CG  1 
ATOM 3404  C CD  . PRO D 1 58  ? 30.324  -17.665 -34.920 1.00 50.00 ? 58  PRO D CD  1 
ATOM 3405  N N   . HIS D 1 59  ? 30.937  -15.048 -32.526 1.00 47.99 ? 59  HIS D N   1 
ATOM 3406  C CA  . HIS D 1 59  ? 31.486  -13.832 -31.927 1.00 46.65 ? 59  HIS D CA  1 
ATOM 3407  C C   . HIS D 1 59  ? 30.464  -12.894 -31.279 1.00 44.29 ? 59  HIS D C   1 
ATOM 3408  O O   . HIS D 1 59  ? 30.748  -11.715 -31.052 1.00 43.21 ? 59  HIS D O   1 
ATOM 3409  C CB  . HIS D 1 59  ? 32.317  -13.083 -32.961 1.00 48.55 ? 59  HIS D CB  1 
ATOM 3410  C CG  . HIS D 1 59  ? 33.439  -13.900 -33.513 1.00 52.20 ? 59  HIS D CG  1 
ATOM 3411  N ND1 . HIS D 1 59  ? 34.504  -14.317 -32.744 1.00 52.71 ? 59  HIS D ND1 1 
ATOM 3412  C CD2 . HIS D 1 59  ? 33.636  -14.428 -34.746 1.00 52.43 ? 59  HIS D CD2 1 
ATOM 3413  C CE1 . HIS D 1 59  ? 35.309  -15.066 -33.477 1.00 52.74 ? 59  HIS D CE1 1 
ATOM 3414  N NE2 . HIS D 1 59  ? 34.803  -15.149 -34.696 1.00 52.83 ? 59  HIS D NE2 1 
ATOM 3415  N N   . ILE D 1 60  ? 29.287  -13.430 -30.971 1.00 41.44 ? 60  ILE D N   1 
ATOM 3416  C CA  . ILE D 1 60  ? 28.247  -12.653 -30.323 1.00 39.05 ? 60  ILE D CA  1 
ATOM 3417  C C   . ILE D 1 60  ? 27.981  -13.164 -28.903 1.00 37.74 ? 60  ILE D C   1 
ATOM 3418  O O   . ILE D 1 60  ? 27.145  -12.618 -28.190 1.00 37.69 ? 60  ILE D O   1 
ATOM 3419  C CB  . ILE D 1 60  ? 26.915  -12.664 -31.132 1.00 38.47 ? 60  ILE D CB  1 
ATOM 3420  C CG1 . ILE D 1 60  ? 26.265  -14.045 -31.081 1.00 36.76 ? 60  ILE D CG1 1 
ATOM 3421  C CG2 . ILE D 1 60  ? 27.178  -12.231 -32.575 1.00 37.37 ? 60  ILE D CG2 1 
ATOM 3422  C CD1 . ILE D 1 60  ? 24.946  -14.116 -31.849 1.00 35.91 ? 60  ILE D CD1 1 
ATOM 3423  N N   . LYS D 1 61  ? 28.679  -14.219 -28.494 1.00 36.41 ? 61  LYS D N   1 
ATOM 3424  C CA  . LYS D 1 61  ? 28.508  -14.738 -27.138 1.00 34.87 ? 61  LYS D CA  1 
ATOM 3425  C C   . LYS D 1 61  ? 29.388  -13.820 -26.301 1.00 33.46 ? 61  LYS D C   1 
ATOM 3426  O O   . LYS D 1 61  ? 30.609  -13.774 -26.483 1.00 33.03 ? 61  LYS D O   1 
ATOM 3427  C CB  . LYS D 1 61  ? 28.979  -16.200 -27.032 1.00 33.58 ? 61  LYS D CB  1 
ATOM 3428  N N   . LEU D 1 62  ? 28.756  -13.071 -25.403 1.00 31.97 ? 62  LEU D N   1 
ATOM 3429  C CA  . LEU D 1 62  ? 29.467  -12.109 -24.568 1.00 30.33 ? 62  LEU D CA  1 
ATOM 3430  C C   . LEU D 1 62  ? 29.388  -12.465 -23.094 1.00 30.84 ? 62  LEU D C   1 
ATOM 3431  O O   . LEU D 1 62  ? 28.494  -13.194 -22.661 1.00 31.37 ? 62  LEU D O   1 
ATOM 3432  C CB  . LEU D 1 62  ? 28.877  -10.709 -24.777 1.00 27.03 ? 62  LEU D CB  1 
ATOM 3433  C CG  . LEU D 1 62  ? 28.479  -10.318 -26.206 1.00 25.47 ? 62  LEU D CG  1 
ATOM 3434  C CD1 . LEU D 1 62  ? 27.605  -9.083  -26.192 1.00 25.61 ? 62  LEU D CD1 1 
ATOM 3435  C CD2 . LEU D 1 62  ? 29.717  -10.092 -27.036 1.00 25.58 ? 62  LEU D CD2 1 
ATOM 3436  N N   . GLN D 1 63  ? 30.335  -11.945 -22.328 1.00 30.44 ? 63  GLN D N   1 
ATOM 3437  C CA  . GLN D 1 63  ? 30.369  -12.183 -20.896 1.00 29.73 ? 63  GLN D CA  1 
ATOM 3438  C C   . GLN D 1 63  ? 30.365  -10.835 -20.186 1.00 29.95 ? 63  GLN D C   1 
ATOM 3439  O O   . GLN D 1 63  ? 31.330  -10.059 -20.295 1.00 29.71 ? 63  GLN D O   1 
ATOM 3440  C CB  . GLN D 1 63  ? 31.627  -12.952 -20.500 1.00 29.24 ? 63  GLN D CB  1 
ATOM 3441  C CG  . GLN D 1 63  ? 31.751  -13.202 -19.002 1.00 28.85 ? 63  GLN D CG  1 
ATOM 3442  C CD  . GLN D 1 63  ? 30.674  -14.134 -18.473 1.00 29.37 ? 63  GLN D CD  1 
ATOM 3443  O OE1 . GLN D 1 63  ? 30.608  -15.306 -18.847 1.00 28.67 ? 63  GLN D OE1 1 
ATOM 3444  N NE2 . GLN D 1 63  ? 29.821  -13.612 -17.600 1.00 29.17 ? 63  GLN D NE2 1 
ATOM 3445  N N   . LEU D 1 64  ? 29.273  -10.558 -19.475 1.00 28.98 ? 64  LEU D N   1 
ATOM 3446  C CA  . LEU D 1 64  ? 29.141  -9.316  -18.727 1.00 29.16 ? 64  LEU D CA  1 
ATOM 3447  C C   . LEU D 1 64  ? 29.702  -9.559  -17.326 1.00 29.54 ? 64  LEU D C   1 
ATOM 3448  O O   . LEU D 1 64  ? 29.532  -10.636 -16.756 1.00 29.06 ? 64  LEU D O   1 
ATOM 3449  C CB  . LEU D 1 64  ? 27.665  -8.905  -18.585 1.00 28.34 ? 64  LEU D CB  1 
ATOM 3450  C CG  . LEU D 1 64  ? 26.740  -8.484  -19.740 1.00 27.77 ? 64  LEU D CG  1 
ATOM 3451  C CD1 . LEU D 1 64  ? 26.329  -7.020  -19.519 1.00 27.20 ? 64  LEU D CD1 1 
ATOM 3452  C CD2 . LEU D 1 64  ? 27.404  -8.685  -21.097 1.00 25.28 ? 64  LEU D CD2 1 
ATOM 3453  N N   . GLN D 1 65  ? 30.372  -8.558  -16.773 1.00 28.80 ? 65  GLN D N   1 
ATOM 3454  C CA  . GLN D 1 65  ? 30.913  -8.680  -15.433 1.00 27.93 ? 65  GLN D CA  1 
ATOM 3455  C C   . GLN D 1 65  ? 30.803  -7.318  -14.761 1.00 28.13 ? 65  GLN D C   1 
ATOM 3456  O O   . GLN D 1 65  ? 31.217  -6.304  -15.314 1.00 29.53 ? 65  GLN D O   1 
ATOM 3457  C CB  . GLN D 1 65  ? 32.373  -9.149  -15.480 1.00 28.67 ? 65  GLN D CB  1 
ATOM 3458  C CG  . GLN D 1 65  ? 33.131  -9.027  -14.150 1.00 29.25 ? 65  GLN D CG  1 
ATOM 3459  C CD  . GLN D 1 65  ? 32.505  -9.825  -13.014 1.00 30.90 ? 65  GLN D CD  1 
ATOM 3460  O OE1 . GLN D 1 65  ? 32.460  -11.057 -13.054 1.00 31.30 ? 65  GLN D OE1 1 
ATOM 3461  N NE2 . GLN D 1 65  ? 32.023  -9.124  -11.988 1.00 30.61 ? 65  GLN D NE2 1 
ATOM 3462  N N   . ALA D 1 66  ? 30.214  -7.283  -13.576 1.00 27.89 ? 66  ALA D N   1 
ATOM 3463  C CA  . ALA D 1 66  ? 30.100  -6.020  -12.863 1.00 28.15 ? 66  ALA D CA  1 
ATOM 3464  C C   . ALA D 1 66  ? 31.459  -5.694  -12.240 1.00 29.07 ? 66  ALA D C   1 
ATOM 3465  O O   . ALA D 1 66  ? 32.093  -6.560  -11.630 1.00 28.00 ? 66  ALA D O   1 
ATOM 3466  C CB  . ALA D 1 66  ? 29.039  -6.109  -11.772 1.00 26.79 ? 66  ALA D CB  1 
ATOM 3467  N N   . GLU D 1 67  ? 31.913  -4.452  -12.409 1.00 29.55 ? 67  GLU D N   1 
ATOM 3468  C CA  . GLU D 1 67  ? 33.187  -4.039  -11.833 1.00 31.01 ? 67  GLU D CA  1 
ATOM 3469  C C   . GLU D 1 67  ? 32.857  -3.375  -10.506 1.00 31.85 ? 67  GLU D C   1 
ATOM 3470  O O   . GLU D 1 67  ? 33.667  -3.342  -9.574  1.00 32.57 ? 67  GLU D O   1 
ATOM 3471  C CB  . GLU D 1 67  ? 33.900  -3.048  -12.741 1.00 30.27 ? 67  GLU D CB  1 
ATOM 3472  C CG  . GLU D 1 67  ? 35.366  -2.919  -12.429 1.00 31.25 ? 67  GLU D CG  1 
ATOM 3473  C CD  . GLU D 1 67  ? 36.092  -4.243  -12.552 1.00 32.23 ? 67  GLU D CD  1 
ATOM 3474  O OE1 . GLU D 1 67  ? 35.598  -5.130  -13.293 1.00 32.07 ? 67  GLU D OE1 1 
ATOM 3475  O OE2 . GLU D 1 67  ? 37.164  -4.388  -11.920 1.00 31.97 ? 67  GLU D OE2 1 
ATOM 3476  N N   . GLU D 1 68  ? 31.642  -2.844  -10.446 1.00 32.20 ? 68  GLU D N   1 
ATOM 3477  C CA  . GLU D 1 68  ? 31.107  -2.190  -9.261  1.00 32.32 ? 68  GLU D CA  1 
ATOM 3478  C C   . GLU D 1 68  ? 29.611  -2.027  -9.561  1.00 31.86 ? 68  GLU D C   1 
ATOM 3479  O O   . GLU D 1 68  ? 29.178  -2.271  -10.692 1.00 30.83 ? 68  GLU D O   1 
ATOM 3480  C CB  . GLU D 1 68  ? 31.781  -0.832  -9.034  1.00 33.10 ? 68  GLU D CB  1 
ATOM 3481  C CG  . GLU D 1 68  ? 31.260  0.296   -9.920  1.00 35.06 ? 68  GLU D CG  1 
ATOM 3482  C CD  . GLU D 1 68  ? 31.884  1.646   -9.582  1.00 35.88 ? 68  GLU D CD  1 
ATOM 3483  O OE1 . GLU D 1 68  ? 32.178  1.884   -8.389  1.00 36.92 ? 68  GLU D OE1 1 
ATOM 3484  O OE2 . GLU D 1 68  ? 32.065  2.474   -10.503 1.00 35.16 ? 68  GLU D OE2 1 
ATOM 3485  N N   . ARG D 1 69  ? 28.823  -1.622  -8.569  1.00 31.31 ? 69  ARG D N   1 
ATOM 3486  C CA  . ARG D 1 69  ? 27.382  -1.483  -8.778  1.00 31.25 ? 69  ARG D CA  1 
ATOM 3487  C C   . ARG D 1 69  ? 26.982  -0.748  -10.061 1.00 30.73 ? 69  ARG D C   1 
ATOM 3488  O O   . ARG D 1 69  ? 27.482  0.336   -10.351 1.00 31.82 ? 69  ARG D O   1 
ATOM 3489  C CB  . ARG D 1 69  ? 26.729  -0.791  -7.581  1.00 31.70 ? 69  ARG D CB  1 
ATOM 3490  C CG  . ARG D 1 69  ? 25.212  -0.875  -7.607  1.00 34.30 ? 69  ARG D CG  1 
ATOM 3491  C CD  . ARG D 1 69  ? 24.611  -0.529  -6.255  1.00 37.43 ? 69  ARG D CD  1 
ATOM 3492  N NE  . ARG D 1 69  ? 24.342  0.894   -6.078  1.00 39.77 ? 69  ARG D NE  1 
ATOM 3493  C CZ  . ARG D 1 69  ? 23.241  1.495   -6.514  1.00 42.38 ? 69  ARG D CZ  1 
ATOM 3494  N NH1 . ARG D 1 69  ? 22.316  0.786   -7.151  1.00 44.95 ? 69  ARG D NH1 1 
ATOM 3495  N NH2 . ARG D 1 69  ? 23.055  2.795   -6.310  1.00 43.28 ? 69  ARG D NH2 1 
ATOM 3496  N N   . GLY D 1 70  ? 26.081  -1.349  -10.832 1.00 29.30 ? 70  GLY D N   1 
ATOM 3497  C CA  . GLY D 1 70  ? 25.614  -0.720  -12.053 1.00 27.02 ? 70  GLY D CA  1 
ATOM 3498  C C   . GLY D 1 70  ? 26.638  -0.509  -13.152 1.00 26.13 ? 70  GLY D C   1 
ATOM 3499  O O   . GLY D 1 70  ? 26.302  0.006   -14.211 1.00 25.75 ? 70  GLY D O   1 
ATOM 3500  N N   . VAL D 1 71  ? 27.878  -0.920  -12.922 1.00 25.89 ? 71  VAL D N   1 
ATOM 3501  C CA  . VAL D 1 71  ? 28.941  -0.765  -13.915 1.00 25.80 ? 71  VAL D CA  1 
ATOM 3502  C C   . VAL D 1 71  ? 29.474  -2.123  -14.368 1.00 25.91 ? 71  VAL D C   1 
ATOM 3503  O O   . VAL D 1 71  ? 29.778  -2.977  -13.538 1.00 26.06 ? 71  VAL D O   1 
ATOM 3504  C CB  . VAL D 1 71  ? 30.101  0.050   -13.317 1.00 26.43 ? 71  VAL D CB  1 
ATOM 3505  C CG1 . VAL D 1 71  ? 31.214  0.242   -14.351 1.00 24.37 ? 71  VAL D CG1 1 
ATOM 3506  C CG2 . VAL D 1 71  ? 29.564  1.383   -12.799 1.00 27.29 ? 71  VAL D CG2 1 
ATOM 3507  N N   . VAL D 1 72  ? 29.625  -2.310  -15.680 1.00 26.23 ? 72  VAL D N   1 
ATOM 3508  C CA  . VAL D 1 72  ? 30.096  -3.594  -16.217 1.00 25.38 ? 72  VAL D CA  1 
ATOM 3509  C C   . VAL D 1 72  ? 31.114  -3.512  -17.362 1.00 25.76 ? 72  VAL D C   1 
ATOM 3510  O O   . VAL D 1 72  ? 31.345  -2.458  -17.952 1.00 26.29 ? 72  VAL D O   1 
ATOM 3511  C CB  . VAL D 1 72  ? 28.903  -4.429  -16.781 1.00 24.96 ? 72  VAL D CB  1 
ATOM 3512  C CG1 . VAL D 1 72  ? 27.795  -4.520  -15.772 1.00 23.83 ? 72  VAL D CG1 1 
ATOM 3513  C CG2 . VAL D 1 72  ? 28.394  -3.796  -18.080 1.00 24.69 ? 72  VAL D CG2 1 
ATOM 3514  N N   . SER D 1 73  ? 31.705  -4.661  -17.668 1.00 25.59 ? 73  SER D N   1 
ATOM 3515  C CA  . SER D 1 73  ? 32.632  -4.808  -18.777 1.00 26.27 ? 73  SER D CA  1 
ATOM 3516  C C   . SER D 1 73  ? 31.893  -5.807  -19.680 1.00 27.12 ? 73  SER D C   1 
ATOM 3517  O O   . SER D 1 73  ? 31.088  -6.619  -19.196 1.00 27.40 ? 73  SER D O   1 
ATOM 3518  C CB  . SER D 1 73  ? 33.939  -5.441  -18.322 1.00 25.85 ? 73  SER D CB  1 
ATOM 3519  O OG  . SER D 1 73  ? 33.789  -6.851  -18.227 1.00 28.91 ? 73  SER D OG  1 
ATOM 3520  N N   . ILE D 1 74  ? 32.151  -5.755  -20.979 1.00 26.71 ? 74  ILE D N   1 
ATOM 3521  C CA  . ILE D 1 74  ? 31.498  -6.673  -21.901 1.00 26.46 ? 74  ILE D CA  1 
ATOM 3522  C C   . ILE D 1 74  ? 32.608  -7.352  -22.691 1.00 28.60 ? 74  ILE D C   1 
ATOM 3523  O O   . ILE D 1 74  ? 33.302  -6.725  -23.487 1.00 28.77 ? 74  ILE D O   1 
ATOM 3524  C CB  . ILE D 1 74  ? 30.533  -5.902  -22.831 1.00 25.89 ? 74  ILE D CB  1 
ATOM 3525  C CG1 . ILE D 1 74  ? 29.429  -5.268  -21.982 1.00 25.14 ? 74  ILE D CG1 1 
ATOM 3526  C CG2 . ILE D 1 74  ? 29.928  -6.827  -23.878 1.00 25.01 ? 74  ILE D CG2 1 
ATOM 3527  C CD1 . ILE D 1 74  ? 28.635  -4.198  -22.681 1.00 22.40 ? 74  ILE D CD1 1 
ATOM 3528  N N   . LYS D 1 75  ? 32.795  -8.643  -22.459 1.00 30.30 ? 75  LYS D N   1 
ATOM 3529  C CA  . LYS D 1 75  ? 33.861  -9.353  -23.141 1.00 31.87 ? 75  LYS D CA  1 
ATOM 3530  C C   . LYS D 1 75  ? 33.366  -10.318 -24.186 1.00 32.77 ? 75  LYS D C   1 
ATOM 3531  O O   . LYS D 1 75  ? 32.525  -11.167 -23.896 1.00 33.90 ? 75  LYS D O   1 
ATOM 3532  C CB  . LYS D 1 75  ? 34.697  -10.105 -22.118 1.00 32.64 ? 75  LYS D CB  1 
ATOM 3533  C CG  . LYS D 1 75  ? 35.927  -10.779 -22.660 1.00 33.25 ? 75  LYS D CG  1 
ATOM 3534  C CD  . LYS D 1 75  ? 36.733  -11.307 -21.501 1.00 34.41 ? 75  LYS D CD  1 
ATOM 3535  C CE  . LYS D 1 75  ? 37.997  -11.991 -21.948 1.00 36.04 ? 75  LYS D CE  1 
ATOM 3536  N NZ  . LYS D 1 75  ? 38.780  -12.376 -20.745 1.00 37.40 ? 75  LYS D NZ  1 
ATOM 3537  N N   . GLY D 1 76  ? 33.877  -10.176 -25.407 1.00 33.51 ? 76  GLY D N   1 
ATOM 3538  C CA  . GLY D 1 76  ? 33.499  -11.090 -26.466 1.00 34.87 ? 76  GLY D CA  1 
ATOM 3539  C C   . GLY D 1 76  ? 34.229  -12.364 -26.096 1.00 36.67 ? 76  GLY D C   1 
ATOM 3540  O O   . GLY D 1 76  ? 35.457  -12.390 -26.086 1.00 37.02 ? 76  GLY D O   1 
ATOM 3541  N N   . VAL D 1 77  ? 33.496  -13.418 -25.764 1.00 38.02 ? 77  VAL D N   1 
ATOM 3542  C CA  . VAL D 1 77  ? 34.157  -14.647 -25.368 1.00 39.62 ? 77  VAL D CA  1 
ATOM 3543  C C   . VAL D 1 77  ? 35.169  -15.146 -26.387 1.00 41.00 ? 77  VAL D C   1 
ATOM 3544  O O   . VAL D 1 77  ? 36.332  -15.323 -26.041 1.00 40.84 ? 77  VAL D O   1 
ATOM 3545  C CB  . VAL D 1 77  ? 33.154  -15.757 -25.067 1.00 39.61 ? 77  VAL D CB  1 
ATOM 3546  C CG1 . VAL D 1 77  ? 33.905  -17.055 -24.800 1.00 39.78 ? 77  VAL D CG1 1 
ATOM 3547  C CG2 . VAL D 1 77  ? 32.314  -15.369 -23.853 1.00 39.05 ? 77  VAL D CG2 1 
ATOM 3548  N N   . SER D 1 78  ? 34.741  -15.367 -27.632 1.00 42.44 ? 78  SER D N   1 
ATOM 3549  C CA  . SER D 1 78  ? 35.657  -15.845 -28.677 1.00 43.96 ? 78  SER D CA  1 
ATOM 3550  C C   . SER D 1 78  ? 36.816  -14.873 -28.880 1.00 44.84 ? 78  SER D C   1 
ATOM 3551  O O   . SER D 1 78  ? 37.980  -15.209 -28.650 1.00 44.79 ? 78  SER D O   1 
ATOM 3552  C CB  . SER D 1 78  ? 34.937  -16.001 -30.013 1.00 44.44 ? 78  SER D CB  1 
ATOM 3553  O OG  . SER D 1 78  ? 33.653  -16.554 -29.833 1.00 46.97 ? 78  SER D OG  1 
ATOM 3554  N N   . ALA D 1 79  ? 36.482  -13.666 -29.324 1.00 45.36 ? 79  ALA D N   1 
ATOM 3555  C CA  . ALA D 1 79  ? 37.470  -12.628 -29.560 1.00 45.88 ? 79  ALA D CA  1 
ATOM 3556  C C   . ALA D 1 79  ? 38.390  -12.429 -28.361 1.00 46.37 ? 79  ALA D C   1 
ATOM 3557  O O   . ALA D 1 79  ? 39.480  -11.876 -28.489 1.00 46.46 ? 79  ALA D O   1 
ATOM 3558  C CB  . ALA D 1 79  ? 36.763  -11.323 -29.887 1.00 46.53 ? 79  ALA D CB  1 
ATOM 3559  N N   . ASN D 1 80  ? 37.949  -12.892 -27.198 1.00 46.91 ? 80  ASN D N   1 
ATOM 3560  C CA  . ASN D 1 80  ? 38.711  -12.727 -25.972 1.00 46.90 ? 80  ASN D CA  1 
ATOM 3561  C C   . ASN D 1 80  ? 39.157  -11.261 -25.826 1.00 47.07 ? 80  ASN D C   1 
ATOM 3562  O O   . ASN D 1 80  ? 40.269  -10.967 -25.373 1.00 47.23 ? 80  ASN D O   1 
ATOM 3563  C CB  . ASN D 1 80  ? 39.917  -13.654 -25.972 1.00 46.33 ? 80  ASN D CB  1 
ATOM 3564  C CG  . ASN D 1 80  ? 40.633  -13.661 -24.640 1.00 46.97 ? 80  ASN D CG  1 
ATOM 3565  O OD1 . ASN D 1 80  ? 39.997  -13.748 -23.586 1.00 46.93 ? 80  ASN D OD1 1 
ATOM 3566  N ND2 . ASN D 1 80  ? 41.960  -13.579 -24.676 1.00 45.85 ? 80  ASN D ND2 1 
ATOM 3567  N N   . ARG D 1 81  ? 38.277  -10.346 -26.228 1.00 46.55 ? 81  ARG D N   1 
ATOM 3568  C CA  . ARG D 1 81  ? 38.549  -8.919  -26.131 1.00 46.92 ? 81  ARG D CA  1 
ATOM 3569  C C   . ARG D 1 81  ? 37.407  -8.223  -25.392 1.00 46.10 ? 81  ARG D C   1 
ATOM 3570  O O   . ARG D 1 81  ? 36.288  -8.737  -25.333 1.00 46.73 ? 81  ARG D O   1 
ATOM 3571  C CB  . ARG D 1 81  ? 38.704  -8.299  -27.520 1.00 48.59 ? 81  ARG D CB  1 
ATOM 3572  C CG  . ARG D 1 81  ? 39.869  -8.828  -28.337 1.00 50.48 ? 81  ARG D CG  1 
ATOM 3573  C CD  . ARG D 1 81  ? 40.216  -7.862  -29.470 1.00 52.62 ? 81  ARG D CD  1 
ATOM 3574  N NE  . ARG D 1 81  ? 41.266  -8.371  -30.354 1.00 54.10 ? 81  ARG D NE  1 
ATOM 3575  C CZ  . ARG D 1 81  ? 42.204  -7.618  -30.931 1.00 54.16 ? 81  ARG D CZ  1 
ATOM 3576  N NH1 . ARG D 1 81  ? 42.244  -6.303  -30.722 1.00 52.64 ? 81  ARG D NH1 1 
ATOM 3577  N NH2 . ARG D 1 81  ? 43.105  -8.183  -31.724 1.00 53.42 ? 81  ARG D NH2 1 
ATOM 3578  N N   . TYR D 1 82  ? 37.690  -7.050  -24.836 1.00 43.91 ? 82  TYR D N   1 
ATOM 3579  C CA  . TYR D 1 82  ? 36.690  -6.292  -24.100 1.00 42.56 ? 82  TYR D CA  1 
ATOM 3580  C C   . TYR D 1 82  ? 36.147  -5.123  -24.914 1.00 41.22 ? 82  TYR D C   1 
ATOM 3581  O O   . TYR D 1 82  ? 36.908  -4.400  -25.545 1.00 41.25 ? 82  TYR D O   1 
ATOM 3582  C CB  . TYR D 1 82  ? 37.293  -5.766  -22.794 1.00 43.00 ? 82  TYR D CB  1 
ATOM 3583  C CG  . TYR D 1 82  ? 37.750  -6.856  -21.843 1.00 43.56 ? 82  TYR D CG  1 
ATOM 3584  C CD1 . TYR D 1 82  ? 38.924  -7.580  -22.081 1.00 42.87 ? 82  TYR D CD1 1 
ATOM 3585  C CD2 . TYR D 1 82  ? 36.973  -7.209  -20.737 1.00 43.17 ? 82  TYR D CD2 1 
ATOM 3586  C CE1 . TYR D 1 82  ? 39.304  -8.629  -21.243 1.00 42.25 ? 82  TYR D CE1 1 
ATOM 3587  C CE2 . TYR D 1 82  ? 37.346  -8.257  -19.899 1.00 43.14 ? 82  TYR D CE2 1 
ATOM 3588  C CZ  . TYR D 1 82  ? 38.505  -8.964  -20.158 1.00 42.82 ? 82  TYR D CZ  1 
ATOM 3589  O OH  . TYR D 1 82  ? 38.838  -10.029 -19.353 1.00 42.30 ? 82  TYR D OH  1 
ATOM 3590  N N   . LEU D 1 83  ? 34.830  -4.946  -24.900 1.00 39.72 ? 83  LEU D N   1 
ATOM 3591  C CA  . LEU D 1 83  ? 34.201  -3.841  -25.619 1.00 38.50 ? 83  LEU D CA  1 
ATOM 3592  C C   . LEU D 1 83  ? 34.739  -2.557  -25.025 1.00 38.32 ? 83  LEU D C   1 
ATOM 3593  O O   . LEU D 1 83  ? 34.895  -2.456  -23.810 1.00 38.62 ? 83  LEU D O   1 
ATOM 3594  C CB  . LEU D 1 83  ? 32.683  -3.854  -25.441 1.00 36.98 ? 83  LEU D CB  1 
ATOM 3595  C CG  . LEU D 1 83  ? 31.971  -2.682  -26.119 1.00 35.29 ? 83  LEU D CG  1 
ATOM 3596  C CD1 . LEU D 1 83  ? 31.981  -2.894  -27.612 1.00 34.33 ? 83  LEU D CD1 1 
ATOM 3597  C CD2 . LEU D 1 83  ? 30.555  -2.578  -25.626 1.00 35.22 ? 83  LEU D CD2 1 
ATOM 3598  N N   . ALA D 1 84  ? 35.013  -1.578  -25.879 1.00 38.07 ? 84  ALA D N   1 
ATOM 3599  C CA  . ALA D 1 84  ? 35.544  -0.304  -25.427 1.00 38.34 ? 84  ALA D CA  1 
ATOM 3600  C C   . ALA D 1 84  ? 35.122  0.824   -26.355 1.00 39.08 ? 84  ALA D C   1 
ATOM 3601  O O   . ALA D 1 84  ? 34.947  0.624   -27.560 1.00 39.07 ? 84  ALA D O   1 
ATOM 3602  C CB  . ALA D 1 84  ? 37.062  -0.365  -25.355 1.00 35.58 ? 84  ALA D CB  1 
ATOM 3603  N N   . MET D 1 85  ? 34.951  2.010   -25.782 1.00 40.18 ? 85  MET D N   1 
ATOM 3604  C CA  . MET D 1 85  ? 34.581  3.188   -26.554 1.00 41.04 ? 85  MET D CA  1 
ATOM 3605  C C   . MET D 1 85  ? 35.707  4.214   -26.419 1.00 42.12 ? 85  MET D C   1 
ATOM 3606  O O   . MET D 1 85  ? 35.971  4.725   -25.325 1.00 41.70 ? 85  MET D O   1 
ATOM 3607  C CB  . MET D 1 85  ? 33.276  3.791   -26.043 1.00 40.19 ? 85  MET D CB  1 
ATOM 3608  C CG  . MET D 1 85  ? 32.804  4.952   -26.898 1.00 41.51 ? 85  MET D CG  1 
ATOM 3609  S SD  . MET D 1 85  ? 31.409  5.863   -26.208 1.00 42.98 ? 85  MET D SD  1 
ATOM 3610  C CE  . MET D 1 85  ? 30.043  4.790   -26.672 1.00 41.73 ? 85  MET D CE  1 
ATOM 3611  N N   . LYS D 1 86  ? 36.364  4.499   -27.541 1.00 43.27 ? 86  LYS D N   1 
ATOM 3612  C CA  . LYS D 1 86  ? 37.473  5.442   -27.599 1.00 44.29 ? 86  LYS D CA  1 
ATOM 3613  C C   . LYS D 1 86  ? 37.038  6.912   -27.527 1.00 45.08 ? 86  LYS D C   1 
ATOM 3614  O O   . LYS D 1 86  ? 35.862  7.242   -27.699 1.00 44.99 ? 86  LYS D O   1 
ATOM 3615  C CB  . LYS D 1 86  ? 38.272  5.195   -28.882 1.00 43.80 ? 86  LYS D CB  1 
ATOM 3616  N N   . GLU D 1 87  ? 38.009  7.786   -27.273 1.00 46.20 ? 87  GLU D N   1 
ATOM 3617  C CA  . GLU D 1 87  ? 37.781  9.226   -27.167 1.00 47.16 ? 87  GLU D CA  1 
ATOM 3618  C C   . GLU D 1 87  ? 36.849  9.802   -28.239 1.00 48.12 ? 87  GLU D C   1 
ATOM 3619  O O   . GLU D 1 87  ? 35.981  10.621  -27.938 1.00 48.74 ? 87  GLU D O   1 
ATOM 3620  C CB  . GLU D 1 87  ? 39.126  9.965   -27.208 1.00 46.85 ? 87  GLU D CB  1 
ATOM 3621  N N   . ASP D 1 88  ? 37.029  9.371   -29.484 1.00 48.68 ? 88  ASP D N   1 
ATOM 3622  C CA  . ASP D 1 88  ? 36.216  9.850   -30.599 1.00 49.40 ? 88  ASP D CA  1 
ATOM 3623  C C   . ASP D 1 88  ? 34.782  9.338   -30.594 1.00 49.90 ? 88  ASP D C   1 
ATOM 3624  O O   . ASP D 1 88  ? 33.920  9.903   -31.262 1.00 51.61 ? 88  ASP D O   1 
ATOM 3625  C CB  . ASP D 1 88  ? 36.866  9.460   -31.933 1.00 50.62 ? 88  ASP D CB  1 
ATOM 3626  C CG  . ASP D 1 88  ? 37.068  7.953   -32.077 1.00 51.95 ? 88  ASP D CG  1 
ATOM 3627  O OD1 . ASP D 1 88  ? 37.386  7.487   -33.192 1.00 52.67 ? 88  ASP D OD1 1 
ATOM 3628  O OD2 . ASP D 1 88  ? 36.920  7.227   -31.075 1.00 53.63 ? 88  ASP D OD2 1 
ATOM 3629  N N   . GLY D 1 89  ? 34.526  8.267   -29.850 1.00 49.46 ? 89  GLY D N   1 
ATOM 3630  C CA  . GLY D 1 89  ? 33.189  7.704   -29.816 1.00 48.69 ? 89  GLY D CA  1 
ATOM 3631  C C   . GLY D 1 89  ? 33.117  6.410   -30.606 1.00 49.10 ? 89  GLY D C   1 
ATOM 3632  O O   . GLY D 1 89  ? 32.072  5.764   -30.666 1.00 48.60 ? 89  GLY D O   1 
ATOM 3633  N N   . ARG D 1 90  ? 34.234  6.032   -31.219 1.00 48.90 ? 90  ARG D N   1 
ATOM 3634  C CA  . ARG D 1 90  ? 34.304  4.799   -31.999 1.00 48.80 ? 90  ARG D CA  1 
ATOM 3635  C C   . ARG D 1 90  ? 34.301  3.603   -31.050 1.00 48.46 ? 90  ARG D C   1 
ATOM 3636  O O   . ARG D 1 90  ? 34.763  3.708   -29.912 1.00 48.02 ? 90  ARG D O   1 
ATOM 3637  C CB  . ARG D 1 90  ? 35.578  4.781   -32.868 1.00 48.33 ? 90  ARG D CB  1 
ATOM 3638  N N   . LEU D 1 91  ? 33.767  2.476   -31.515 1.00 48.37 ? 91  LEU D N   1 
ATOM 3639  C CA  . LEU D 1 91  ? 33.717  1.263   -30.698 1.00 48.56 ? 91  LEU D CA  1 
ATOM 3640  C C   . LEU D 1 91  ? 34.647  0.188   -31.206 1.00 48.61 ? 91  LEU D C   1 
ATOM 3641  O O   . LEU D 1 91  ? 34.693  -0.085  -32.405 1.00 49.48 ? 91  LEU D O   1 
ATOM 3642  C CB  . LEU D 1 91  ? 32.304  0.675   -30.650 1.00 48.94 ? 91  LEU D CB  1 
ATOM 3643  C CG  . LEU D 1 91  ? 31.256  1.375   -29.780 1.00 49.63 ? 91  LEU D CG  1 
ATOM 3644  C CD1 . LEU D 1 91  ? 30.020  0.489   -29.677 1.00 48.68 ? 91  LEU D CD1 1 
ATOM 3645  C CD2 . LEU D 1 91  ? 31.837  1.652   -28.397 1.00 49.16 ? 91  LEU D CD2 1 
ATOM 3646  N N   . LEU D 1 92  ? 35.396  -0.418  -30.293 1.00 48.56 ? 92  LEU D N   1 
ATOM 3647  C CA  . LEU D 1 92  ? 36.304  -1.502  -30.652 1.00 48.35 ? 92  LEU D CA  1 
ATOM 3648  C C   . LEU D 1 92  ? 36.505  -2.442  -29.465 1.00 48.29 ? 92  LEU D C   1 
ATOM 3649  O O   . LEU D 1 92  ? 36.021  -2.177  -28.367 1.00 47.92 ? 92  LEU D O   1 
ATOM 3650  C CB  . LEU D 1 92  ? 37.640  -0.946  -31.142 1.00 47.74 ? 92  LEU D CB  1 
ATOM 3651  C CG  . LEU D 1 92  ? 38.471  -0.061  -30.218 1.00 47.92 ? 92  LEU D CG  1 
ATOM 3652  C CD1 . LEU D 1 92  ? 38.911  -0.821  -28.976 1.00 47.50 ? 92  LEU D CD1 1 
ATOM 3653  C CD2 . LEU D 1 92  ? 39.683  0.415   -31.003 1.00 48.64 ? 92  LEU D CD2 1 
ATOM 3654  N N   . ALA D 1 93  ? 37.212  -3.543  -29.685 1.00 48.40 ? 93  ALA D N   1 
ATOM 3655  C CA  . ALA D 1 93  ? 37.447  -4.508  -28.619 1.00 48.63 ? 93  ALA D CA  1 
ATOM 3656  C C   . ALA D 1 93  ? 38.935  -4.663  -28.353 1.00 48.77 ? 93  ALA D C   1 
ATOM 3657  O O   . ALA D 1 93  ? 39.688  -5.062  -29.236 1.00 49.63 ? 93  ALA D O   1 
ATOM 3658  C CB  . ALA D 1 93  ? 36.846  -5.846  -28.994 1.00 48.44 ? 93  ALA D CB  1 
ATOM 3659  N N   . SER D 1 94  ? 39.355  -4.351  -27.131 1.00 48.48 ? 94  SER D N   1 
ATOM 3660  C CA  . SER D 1 94  ? 40.762  -4.443  -26.769 1.00 47.93 ? 94  SER D CA  1 
ATOM 3661  C C   . SER D 1 94  ? 41.091  -5.732  -26.035 1.00 48.37 ? 94  SER D C   1 
ATOM 3662  O O   . SER D 1 94  ? 40.268  -6.259  -25.280 1.00 48.95 ? 94  SER D O   1 
ATOM 3663  C CB  . SER D 1 94  ? 41.152  -3.256  -25.893 1.00 47.22 ? 94  SER D CB  1 
ATOM 3664  O OG  . SER D 1 94  ? 40.515  -3.333  -24.640 1.00 46.64 ? 94  SER D OG  1 
ATOM 3665  N N   . LYS D 1 95  ? 42.305  -6.230  -26.257 1.00 48.20 ? 95  LYS D N   1 
ATOM 3666  C CA  . LYS D 1 95  ? 42.769  -7.454  -25.616 1.00 47.40 ? 95  LYS D CA  1 
ATOM 3667  C C   . LYS D 1 95  ? 42.920  -7.200  -24.113 1.00 46.79 ? 95  LYS D C   1 
ATOM 3668  O O   . LYS D 1 95  ? 42.697  -8.092  -23.282 1.00 46.05 ? 95  LYS D O   1 
ATOM 3669  C CB  . LYS D 1 95  ? 44.119  -7.870  -26.219 1.00 46.82 ? 95  LYS D CB  1 
ATOM 3670  N N   . SER D 1 96  ? 43.277  -5.969  -23.767 1.00 45.87 ? 96  SER D N   1 
ATOM 3671  C CA  . SER D 1 96  ? 43.477  -5.627  -22.367 1.00 46.52 ? 96  SER D CA  1 
ATOM 3672  C C   . SER D 1 96  ? 42.470  -4.615  -21.824 1.00 45.78 ? 96  SER D C   1 
ATOM 3673  O O   . SER D 1 96  ? 42.215  -3.581  -22.441 1.00 45.85 ? 96  SER D O   1 
ATOM 3674  C CB  . SER D 1 96  ? 44.897  -5.088  -22.160 1.00 47.74 ? 96  SER D CB  1 
ATOM 3675  O OG  . SER D 1 96  ? 45.092  -3.879  -22.879 1.00 49.84 ? 96  SER D OG  1 
ATOM 3676  N N   . VAL D 1 97  ? 41.924  -4.924  -20.651 1.00 44.47 ? 97  VAL D N   1 
ATOM 3677  C CA  . VAL D 1 97  ? 40.948  -4.083  -19.972 1.00 43.79 ? 97  VAL D CA  1 
ATOM 3678  C C   . VAL D 1 97  ? 41.525  -2.715  -19.602 1.00 43.87 ? 97  VAL D C   1 
ATOM 3679  O O   . VAL D 1 97  ? 42.554  -2.622  -18.941 1.00 43.28 ? 97  VAL D O   1 
ATOM 3680  C CB  . VAL D 1 97  ? 40.451  -4.793  -18.686 1.00 44.13 ? 97  VAL D CB  1 
ATOM 3681  C CG1 . VAL D 1 97  ? 39.417  -3.944  -17.964 1.00 43.82 ? 97  VAL D CG1 1 
ATOM 3682  C CG2 . VAL D 1 97  ? 39.871  -6.158  -19.044 1.00 44.21 ? 97  VAL D CG2 1 
ATOM 3683  N N   . THR D 1 98  ? 40.844  -1.656  -20.027 1.00 43.64 ? 98  THR D N   1 
ATOM 3684  C CA  . THR D 1 98  ? 41.280  -0.295  -19.744 1.00 42.83 ? 98  THR D CA  1 
ATOM 3685  C C   . THR D 1 98  ? 40.100  0.428   -19.115 1.00 42.13 ? 98  THR D C   1 
ATOM 3686  O O   . THR D 1 98  ? 39.066  -0.177  -18.885 1.00 42.56 ? 98  THR D O   1 
ATOM 3687  C CB  . THR D 1 98  ? 41.676  0.425   -21.043 1.00 43.14 ? 98  THR D CB  1 
ATOM 3688  O OG1 . THR D 1 98  ? 40.494  0.801   -21.766 1.00 44.97 ? 98  THR D OG1 1 
ATOM 3689  C CG2 . THR D 1 98  ? 42.505  -0.501  -21.919 1.00 42.55 ? 98  THR D CG2 1 
ATOM 3690  N N   . ASP D 1 99  ? 40.244  1.718   -18.856 1.00 41.81 ? 99  ASP D N   1 
ATOM 3691  C CA  . ASP D 1 99  ? 39.172  2.491   -18.255 1.00 42.20 ? 99  ASP D CA  1 
ATOM 3692  C C   . ASP D 1 99  ? 38.065  2.851   -19.250 1.00 42.21 ? 99  ASP D C   1 
ATOM 3693  O O   . ASP D 1 99  ? 37.083  3.497   -18.893 1.00 42.47 ? 99  ASP D O   1 
ATOM 3694  C CB  . ASP D 1 99  ? 39.759  3.761   -17.627 1.00 43.81 ? 99  ASP D CB  1 
ATOM 3695  C CG  . ASP D 1 99  ? 40.336  4.732   -18.661 1.00 46.15 ? 99  ASP D CG  1 
ATOM 3696  O OD1 . ASP D 1 99  ? 40.876  4.286   -19.703 1.00 47.20 ? 99  ASP D OD1 1 
ATOM 3697  O OD2 . ASP D 1 99  ? 40.261  5.957   -18.411 1.00 47.24 ? 99  ASP D OD2 1 
ATOM 3698  N N   . GLU D 1 100 ? 38.228  2.434   -20.501 1.00 41.70 ? 100 GLU D N   1 
ATOM 3699  C CA  . GLU D 1 100 ? 37.231  2.714   -21.532 1.00 41.44 ? 100 GLU D CA  1 
ATOM 3700  C C   . GLU D 1 100 ? 36.419  1.453   -21.826 1.00 40.08 ? 100 GLU D C   1 
ATOM 3701  O O   . GLU D 1 100 ? 35.670  1.393   -22.796 1.00 39.30 ? 100 GLU D O   1 
ATOM 3702  C CB  . GLU D 1 100 ? 37.900  3.177   -22.828 1.00 41.83 ? 100 GLU D CB  1 
ATOM 3703  C CG  . GLU D 1 100 ? 38.855  4.350   -22.701 1.00 41.84 ? 100 GLU D CG  1 
ATOM 3704  C CD  . GLU D 1 100 ? 39.508  4.675   -24.039 1.00 42.32 ? 100 GLU D CD  1 
ATOM 3705  O OE1 . GLU D 1 100 ? 40.044  3.738   -24.682 1.00 40.92 ? 100 GLU D OE1 1 
ATOM 3706  O OE2 . GLU D 1 100 ? 39.482  5.858   -24.450 1.00 42.26 ? 100 GLU D OE2 1 
ATOM 3707  N N   . CYS D 1 101 ? 36.590  0.442   -20.988 1.00 38.59 ? 101 CYS D N   1 
ATOM 3708  C CA  . CYS D 1 101 ? 35.874  -0.817  -21.139 1.00 37.33 ? 101 CYS D CA  1 
ATOM 3709  C C   . CYS D 1 101 ? 34.748  -0.981  -20.119 1.00 36.56 ? 101 CYS D C   1 
ATOM 3710  O O   . CYS D 1 101 ? 34.252  -2.090  -19.914 1.00 36.93 ? 101 CYS D O   1 
ATOM 3711  C CB  . CYS D 1 101 ? 36.838  -1.986  -20.986 1.00 37.35 ? 101 CYS D CB  1 
ATOM 3712  S SG  . CYS D 1 101 ? 37.977  -2.168  -22.343 1.00 35.29 ? 101 CYS D SG  1 
ATOM 3713  N N   . PHE D 1 102 ? 34.346  0.120   -19.489 1.00 34.61 ? 102 PHE D N   1 
ATOM 3714  C CA  . PHE D 1 102 ? 33.300  0.079   -18.488 1.00 32.90 ? 102 PHE D CA  1 
ATOM 3715  C C   . PHE D 1 102 ? 32.111  0.922   -18.882 1.00 32.34 ? 102 PHE D C   1 
ATOM 3716  O O   . PHE D 1 102 ? 32.257  2.040   -19.365 1.00 33.06 ? 102 PHE D O   1 
ATOM 3717  C CB  . PHE D 1 102 ? 33.880  0.502   -17.141 1.00 33.49 ? 102 PHE D CB  1 
ATOM 3718  C CG  . PHE D 1 102 ? 34.931  -0.455  -16.632 1.00 34.29 ? 102 PHE D CG  1 
ATOM 3719  C CD1 . PHE D 1 102 ? 34.569  -1.723  -16.182 1.00 32.87 ? 102 PHE D CD1 1 
ATOM 3720  C CD2 . PHE D 1 102 ? 36.284  -0.127  -16.686 1.00 33.38 ? 102 PHE D CD2 1 
ATOM 3721  C CE1 . PHE D 1 102 ? 35.526  -2.643  -15.801 1.00 32.80 ? 102 PHE D CE1 1 
ATOM 3722  C CE2 . PHE D 1 102 ? 37.248  -1.044  -16.307 1.00 32.86 ? 102 PHE D CE2 1 
ATOM 3723  C CZ  . PHE D 1 102 ? 36.866  -2.308  -15.863 1.00 34.41 ? 102 PHE D CZ  1 
ATOM 3724  N N   . PHE D 1 103 ? 30.923  0.361   -18.681 1.00 30.87 ? 103 PHE D N   1 
ATOM 3725  C CA  . PHE D 1 103 ? 29.691  1.020   -19.058 1.00 29.81 ? 103 PHE D CA  1 
ATOM 3726  C C   . PHE D 1 103 ? 28.640  0.891   -17.970 1.00 30.87 ? 103 PHE D C   1 
ATOM 3727  O O   . PHE D 1 103 ? 28.557  -0.151  -17.302 1.00 31.87 ? 103 PHE D O   1 
ATOM 3728  C CB  . PHE D 1 103 ? 29.170  0.376   -20.339 1.00 27.20 ? 103 PHE D CB  1 
ATOM 3729  C CG  . PHE D 1 103 ? 30.195  0.295   -21.432 1.00 25.85 ? 103 PHE D CG  1 
ATOM 3730  C CD1 . PHE D 1 103 ? 30.313  1.325   -22.378 1.00 25.26 ? 103 PHE D CD1 1 
ATOM 3731  C CD2 . PHE D 1 103 ? 31.073  -0.787  -21.501 1.00 22.73 ? 103 PHE D CD2 1 
ATOM 3732  C CE1 . PHE D 1 103 ? 31.297  1.278   -23.382 1.00 22.66 ? 103 PHE D CE1 1 
ATOM 3733  C CE2 . PHE D 1 103 ? 32.059  -0.843  -22.497 1.00 22.10 ? 103 PHE D CE2 1 
ATOM 3734  C CZ  . PHE D 1 103 ? 32.170  0.192   -23.437 1.00 22.16 ? 103 PHE D CZ  1 
ATOM 3735  N N   . PHE D 1 104 ? 27.845  1.945   -17.785 1.00 30.16 ? 104 PHE D N   1 
ATOM 3736  C CA  . PHE D 1 104 ? 26.767  1.908   -16.812 1.00 29.81 ? 104 PHE D CA  1 
ATOM 3737  C C   . PHE D 1 104 ? 25.668  1.091   -17.474 1.00 29.49 ? 104 PHE D C   1 
ATOM 3738  O O   . PHE D 1 104 ? 25.231  1.406   -18.579 1.00 28.64 ? 104 PHE D O   1 
ATOM 3739  C CB  . PHE D 1 104 ? 26.206  3.307   -16.510 1.00 30.11 ? 104 PHE D CB  1 
ATOM 3740  C CG  . PHE D 1 104 ? 27.169  4.228   -15.807 1.00 30.09 ? 104 PHE D CG  1 
ATOM 3741  C CD1 . PHE D 1 104 ? 27.853  5.210   -16.513 1.00 29.96 ? 104 PHE D CD1 1 
ATOM 3742  C CD2 . PHE D 1 104 ? 27.378  4.129   -14.437 1.00 30.58 ? 104 PHE D CD2 1 
ATOM 3743  C CE1 . PHE D 1 104 ? 28.732  6.079   -15.856 1.00 30.34 ? 104 PHE D CE1 1 
ATOM 3744  C CE2 . PHE D 1 104 ? 28.260  5.000   -13.777 1.00 31.01 ? 104 PHE D CE2 1 
ATOM 3745  C CZ  . PHE D 1 104 ? 28.933  5.970   -14.487 1.00 29.16 ? 104 PHE D CZ  1 
ATOM 3746  N N   . GLU D 1 105 ? 25.246  0.020   -16.822 1.00 30.15 ? 105 GLU D N   1 
ATOM 3747  C CA  . GLU D 1 105 ? 24.183  -0.777  -17.379 1.00 31.20 ? 105 GLU D CA  1 
ATOM 3748  C C   . GLU D 1 105 ? 22.911  -0.326  -16.712 1.00 32.30 ? 105 GLU D C   1 
ATOM 3749  O O   . GLU D 1 105 ? 22.818  -0.241  -15.487 1.00 32.42 ? 105 GLU D O   1 
ATOM 3750  C CB  . GLU D 1 105 ? 24.385  -2.258  -17.120 1.00 31.97 ? 105 GLU D CB  1 
ATOM 3751  C CG  . GLU D 1 105 ? 23.250  -3.096  -17.694 1.00 31.34 ? 105 GLU D CG  1 
ATOM 3752  C CD  . GLU D 1 105 ? 23.347  -4.527  -17.276 1.00 32.56 ? 105 GLU D CD  1 
ATOM 3753  O OE1 . GLU D 1 105 ? 23.358  -4.764  -16.046 1.00 32.85 ? 105 GLU D OE1 1 
ATOM 3754  O OE2 . GLU D 1 105 ? 23.422  -5.406  -18.166 1.00 33.52 ? 105 GLU D OE2 1 
ATOM 3755  N N   . ARG D 1 106 ? 21.917  -0.042  -17.532 1.00 33.88 ? 106 ARG D N   1 
ATOM 3756  C CA  . ARG D 1 106 ? 20.658  0.430   -17.022 1.00 33.99 ? 106 ARG D CA  1 
ATOM 3757  C C   . ARG D 1 106 ? 19.526  -0.310  -17.687 1.00 32.74 ? 106 ARG D C   1 
ATOM 3758  O O   . ARG D 1 106 ? 19.529  -0.510  -18.897 1.00 31.54 ? 106 ARG D O   1 
ATOM 3759  C CB  . ARG D 1 106 ? 20.524  1.931   -17.303 1.00 36.33 ? 106 ARG D CB  1 
ATOM 3760  C CG  . ARG D 1 106 ? 19.443  2.609   -16.499 1.00 39.98 ? 106 ARG D CG  1 
ATOM 3761  C CD  . ARG D 1 106 ? 19.136  3.972   -17.044 1.00 43.26 ? 106 ARG D CD  1 
ATOM 3762  N NE  . ARG D 1 106 ? 18.267  4.714   -16.137 1.00 48.36 ? 106 ARG D NE  1 
ATOM 3763  C CZ  . ARG D 1 106 ? 17.758  5.914   -16.406 1.00 50.72 ? 106 ARG D CZ  1 
ATOM 3764  N NH1 . ARG D 1 106 ? 18.038  6.505   -17.566 1.00 51.35 ? 106 ARG D NH1 1 
ATOM 3765  N NH2 . ARG D 1 106 ? 16.963  6.522   -15.524 1.00 51.04 ? 106 ARG D NH2 1 
ATOM 3766  N N   . LEU D 1 107 ? 18.571  -0.727  -16.868 1.00 34.01 ? 107 LEU D N   1 
ATOM 3767  C CA  . LEU D 1 107 ? 17.367  -1.409  -17.318 1.00 34.25 ? 107 LEU D CA  1 
ATOM 3768  C C   . LEU D 1 107 ? 16.332  -0.291  -17.411 1.00 34.84 ? 107 LEU D C   1 
ATOM 3769  O O   . LEU D 1 107 ? 15.754  0.103   -16.414 1.00 34.88 ? 107 LEU D O   1 
ATOM 3770  C CB  . LEU D 1 107 ? 16.942  -2.439  -16.273 1.00 33.05 ? 107 LEU D CB  1 
ATOM 3771  C CG  . LEU D 1 107 ? 15.548  -3.077  -16.363 1.00 33.44 ? 107 LEU D CG  1 
ATOM 3772  C CD1 . LEU D 1 107 ? 15.146  -3.359  -17.803 1.00 32.87 ? 107 LEU D CD1 1 
ATOM 3773  C CD2 . LEU D 1 107 ? 15.569  -4.374  -15.566 1.00 33.28 ? 107 LEU D CD2 1 
ATOM 3774  N N   . GLU D 1 108 ? 16.119  0.236   -18.608 1.00 36.31 ? 108 GLU D N   1 
ATOM 3775  C CA  . GLU D 1 108 ? 15.179  1.330   -18.789 1.00 38.48 ? 108 GLU D CA  1 
ATOM 3776  C C   . GLU D 1 108 ? 13.735  0.924   -18.494 1.00 39.06 ? 108 GLU D C   1 
ATOM 3777  O O   . GLU D 1 108 ? 13.407  -0.261  -18.386 1.00 39.79 ? 108 GLU D O   1 
ATOM 3778  C CB  . GLU D 1 108 ? 15.278  1.880   -20.218 1.00 40.67 ? 108 GLU D CB  1 
ATOM 3779  C CG  . GLU D 1 108 ? 16.691  2.220   -20.685 1.00 44.23 ? 108 GLU D CG  1 
ATOM 3780  C CD  . GLU D 1 108 ? 17.286  3.440   -19.989 1.00 47.92 ? 108 GLU D CD  1 
ATOM 3781  O OE1 . GLU D 1 108 ? 18.380  3.881   -20.412 1.00 49.62 ? 108 GLU D OE1 1 
ATOM 3782  O OE2 . GLU D 1 108 ? 16.673  3.962   -19.025 1.00 49.67 ? 108 GLU D OE2 1 
ATOM 3783  N N   . SER D 1 109 ? 12.880  1.931   -18.372 1.00 38.91 ? 109 SER D N   1 
ATOM 3784  C CA  . SER D 1 109 ? 11.461  1.740   -18.095 1.00 38.86 ? 109 SER D CA  1 
ATOM 3785  C C   . SER D 1 109 ? 10.773  0.899   -19.166 1.00 37.54 ? 109 SER D C   1 
ATOM 3786  O O   . SER D 1 109 ? 9.730   0.296   -18.919 1.00 37.73 ? 109 SER D O   1 
ATOM 3787  C CB  . SER D 1 109 ? 10.783  3.110   -18.024 1.00 41.16 ? 109 SER D CB  1 
ATOM 3788  O OG  . SER D 1 109 ? 11.122  3.886   -19.173 1.00 43.22 ? 109 SER D OG  1 
ATOM 3789  N N   . ASN D 1 110 ? 11.352  0.879   -20.360 1.00 36.26 ? 110 ASN D N   1 
ATOM 3790  C CA  . ASN D 1 110 ? 10.793  0.132   -21.484 1.00 34.72 ? 110 ASN D CA  1 
ATOM 3791  C C   . ASN D 1 110 ? 11.283  -1.321  -21.492 1.00 34.25 ? 110 ASN D C   1 
ATOM 3792  O O   . ASN D 1 110 ? 10.973  -2.088  -22.410 1.00 35.25 ? 110 ASN D O   1 
ATOM 3793  C CB  . ASN D 1 110 ? 11.192  0.819   -22.788 1.00 34.39 ? 110 ASN D CB  1 
ATOM 3794  C CG  . ASN D 1 110 ? 12.701  0.816   -23.009 1.00 34.77 ? 110 ASN D CG  1 
ATOM 3795  O OD1 . ASN D 1 110 ? 13.479  0.506   -22.094 1.00 33.59 ? 110 ASN D OD1 1 
ATOM 3796  N ND2 . ASN D 1 110 ? 13.120  1.166   -24.225 1.00 34.19 ? 110 ASN D ND2 1 
ATOM 3797  N N   . ASN D 1 111 ? 12.055  -1.680  -20.468 1.00 32.32 ? 111 ASN D N   1 
ATOM 3798  C CA  . ASN D 1 111 ? 12.601  -3.023  -20.303 1.00 31.08 ? 111 ASN D CA  1 
ATOM 3799  C C   . ASN D 1 111 ? 13.685  -3.467  -21.244 1.00 30.66 ? 111 ASN D C   1 
ATOM 3800  O O   . ASN D 1 111 ? 13.822  -4.658  -21.509 1.00 29.98 ? 111 ASN D O   1 
ATOM 3801  C CB  . ASN D 1 111 ? 11.514  -4.078  -20.317 1.00 32.44 ? 111 ASN D CB  1 
ATOM 3802  C CG  . ASN D 1 111 ? 10.797  -4.154  -19.008 1.00 33.79 ? 111 ASN D CG  1 
ATOM 3803  O OD1 . ASN D 1 111 ? 11.392  -3.910  -17.952 1.00 34.66 ? 111 ASN D OD1 1 
ATOM 3804  N ND2 . ASN D 1 111 ? 9.515   -4.503  -19.053 1.00 33.36 ? 111 ASN D ND2 1 
ATOM 3805  N N   . TYR D 1 112 ? 14.448  -2.508  -21.750 1.00 29.74 ? 112 TYR D N   1 
ATOM 3806  C CA  . TYR D 1 112 ? 15.585  -2.797  -22.601 1.00 27.92 ? 112 TYR D CA  1 
ATOM 3807  C C   . TYR D 1 112 ? 16.754  -2.272  -21.781 1.00 28.25 ? 112 TYR D C   1 
ATOM 3808  O O   . TYR D 1 112 ? 16.550  -1.498  -20.846 1.00 28.84 ? 112 TYR D O   1 
ATOM 3809  C CB  . TYR D 1 112 ? 15.491  -2.019  -23.903 1.00 29.37 ? 112 TYR D CB  1 
ATOM 3810  C CG  . TYR D 1 112 ? 14.646  -2.675  -24.967 1.00 30.13 ? 112 TYR D CG  1 
ATOM 3811  C CD1 . TYR D 1 112 ? 15.166  -3.700  -25.759 1.00 30.37 ? 112 TYR D CD1 1 
ATOM 3812  C CD2 . TYR D 1 112 ? 13.332  -2.253  -25.207 1.00 29.37 ? 112 TYR D CD2 1 
ATOM 3813  C CE1 . TYR D 1 112 ? 14.399  -4.283  -26.769 1.00 29.61 ? 112 TYR D CE1 1 
ATOM 3814  C CE2 . TYR D 1 112 ? 12.561  -2.834  -26.213 1.00 28.22 ? 112 TYR D CE2 1 
ATOM 3815  C CZ  . TYR D 1 112 ? 13.102  -3.846  -26.990 1.00 27.96 ? 112 TYR D CZ  1 
ATOM 3816  O OH  . TYR D 1 112 ? 12.362  -4.429  -27.993 1.00 27.45 ? 112 TYR D OH  1 
ATOM 3817  N N   . ASN D 1 113 ? 17.971  -2.698  -22.100 1.00 27.59 ? 113 ASN D N   1 
ATOM 3818  C CA  . ASN D 1 113 ? 19.154  -2.216  -21.387 1.00 26.64 ? 113 ASN D CA  1 
ATOM 3819  C C   . ASN D 1 113 ? 19.887  -1.184  -22.222 1.00 27.13 ? 113 ASN D C   1 
ATOM 3820  O O   . ASN D 1 113 ? 19.795  -1.184  -23.450 1.00 27.95 ? 113 ASN D O   1 
ATOM 3821  C CB  . ASN D 1 113 ? 20.133  -3.349  -21.113 1.00 25.33 ? 113 ASN D CB  1 
ATOM 3822  C CG  . ASN D 1 113 ? 19.654  -4.281  -20.058 1.00 26.67 ? 113 ASN D CG  1 
ATOM 3823  O OD1 . ASN D 1 113 ? 18.506  -4.196  -19.615 1.00 28.48 ? 113 ASN D OD1 1 
ATOM 3824  N ND2 . ASN D 1 113 ? 20.521  -5.194  -19.641 1.00 25.93 ? 113 ASN D ND2 1 
ATOM 3825  N N   . THR D 1 114 ? 20.615  -0.303  -21.554 1.00 27.66 ? 114 THR D N   1 
ATOM 3826  C CA  . THR D 1 114 ? 21.407  0.703   -22.250 1.00 27.77 ? 114 THR D CA  1 
ATOM 3827  C C   . THR D 1 114 ? 22.793  0.638   -21.616 1.00 28.99 ? 114 THR D C   1 
ATOM 3828  O O   . THR D 1 114 ? 22.941  0.349   -20.420 1.00 28.95 ? 114 THR D O   1 
ATOM 3829  C CB  . THR D 1 114 ? 20.813  2.127   -22.097 1.00 26.53 ? 114 THR D CB  1 
ATOM 3830  O OG1 . THR D 1 114 ? 20.688  2.459   -20.710 1.00 25.64 ? 114 THR D OG1 1 
ATOM 3831  C CG2 . THR D 1 114 ? 19.448  2.199   -22.749 1.00 26.40 ? 114 THR D CG2 1 
ATOM 3832  N N   . TYR D 1 115 ? 23.813  0.885   -22.416 1.00 29.06 ? 115 TYR D N   1 
ATOM 3833  C CA  . TYR D 1 115 ? 25.156  0.827   -21.900 1.00 29.23 ? 115 TYR D CA  1 
ATOM 3834  C C   . TYR D 1 115 ? 25.836  2.137   -22.199 1.00 31.71 ? 115 TYR D C   1 
ATOM 3835  O O   . TYR D 1 115 ? 26.243  2.398   -23.329 1.00 32.61 ? 115 TYR D O   1 
ATOM 3836  C CB  . TYR D 1 115 ? 25.877  -0.355  -22.532 1.00 26.90 ? 115 TYR D CB  1 
ATOM 3837  C CG  . TYR D 1 115 ? 25.279  -1.668  -22.088 1.00 24.08 ? 115 TYR D CG  1 
ATOM 3838  C CD1 . TYR D 1 115 ? 25.592  -2.209  -20.841 1.00 23.82 ? 115 TYR D CD1 1 
ATOM 3839  C CD2 . TYR D 1 115 ? 24.342  -2.330  -22.875 1.00 22.03 ? 115 TYR D CD2 1 
ATOM 3840  C CE1 . TYR D 1 115 ? 24.986  -3.377  -20.385 1.00 22.83 ? 115 TYR D CE1 1 
ATOM 3841  C CE2 . TYR D 1 115 ? 23.722  -3.492  -22.433 1.00 21.29 ? 115 TYR D CE2 1 
ATOM 3842  C CZ  . TYR D 1 115 ? 24.048  -4.015  -21.187 1.00 22.26 ? 115 TYR D CZ  1 
ATOM 3843  O OH  . TYR D 1 115 ? 23.449  -5.174  -20.735 1.00 20.80 ? 115 TYR D OH  1 
ATOM 3844  N N   . ARG D 1 116 ? 25.937  2.960   -21.159 1.00 33.60 ? 116 ARG D N   1 
ATOM 3845  C CA  . ARG D 1 116 ? 26.541  4.282   -21.253 1.00 34.61 ? 116 ARG D CA  1 
ATOM 3846  C C   . ARG D 1 116 ? 27.985  4.256   -20.758 1.00 34.59 ? 116 ARG D C   1 
ATOM 3847  O O   . ARG D 1 116 ? 28.255  3.801   -19.654 1.00 34.21 ? 116 ARG D O   1 
ATOM 3848  C CB  . ARG D 1 116 ? 25.709  5.262   -20.423 1.00 35.85 ? 116 ARG D CB  1 
ATOM 3849  C CG  . ARG D 1 116 ? 25.953  6.735   -20.714 1.00 37.74 ? 116 ARG D CG  1 
ATOM 3850  C CD  . ARG D 1 116 ? 24.856  7.561   -20.059 1.00 37.68 ? 116 ARG D CD  1 
ATOM 3851  N NE  . ARG D 1 116 ? 24.716  7.225   -18.648 1.00 37.85 ? 116 ARG D NE  1 
ATOM 3852  C CZ  . ARG D 1 116 ? 25.616  7.530   -17.725 1.00 38.47 ? 116 ARG D CZ  1 
ATOM 3853  N NH1 . ARG D 1 116 ? 26.715  8.181   -18.068 1.00 41.03 ? 116 ARG D NH1 1 
ATOM 3854  N NH2 . ARG D 1 116 ? 25.424  7.185   -16.465 1.00 37.75 ? 116 ARG D NH2 1 
ATOM 3855  N N   . SER D 1 117 ? 28.908  4.732   -21.588 1.00 35.32 ? 117 SER D N   1 
ATOM 3856  C CA  . SER D 1 117 ? 30.326  4.757   -21.226 1.00 35.83 ? 117 SER D CA  1 
ATOM 3857  C C   . SER D 1 117 ? 30.541  5.455   -19.893 1.00 36.74 ? 117 SER D C   1 
ATOM 3858  O O   . SER D 1 117 ? 29.985  6.533   -19.652 1.00 36.68 ? 117 SER D O   1 
ATOM 3859  C CB  . SER D 1 117 ? 31.140  5.482   -22.306 1.00 35.46 ? 117 SER D CB  1 
ATOM 3860  O OG  . SER D 1 117 ? 32.434  5.828   -21.837 1.00 32.77 ? 117 SER D OG  1 
ATOM 3861  N N   . ARG D 1 118 ? 31.344  4.846   -19.026 1.00 37.56 ? 118 ARG D N   1 
ATOM 3862  C CA  . ARG D 1 118 ? 31.610  5.459   -17.737 1.00 39.25 ? 118 ARG D CA  1 
ATOM 3863  C C   . ARG D 1 118 ? 32.647  6.561   -17.906 1.00 40.52 ? 118 ARG D C   1 
ATOM 3864  O O   . ARG D 1 118 ? 32.667  7.519   -17.136 1.00 41.35 ? 118 ARG D O   1 
ATOM 3865  C CB  . ARG D 1 118 ? 32.102  4.429   -16.716 1.00 38.05 ? 118 ARG D CB  1 
ATOM 3866  C CG  . ARG D 1 118 ? 32.229  5.019   -15.314 1.00 38.66 ? 118 ARG D CG  1 
ATOM 3867  C CD  . ARG D 1 118 ? 32.604  3.982   -14.275 1.00 38.67 ? 118 ARG D CD  1 
ATOM 3868  N NE  . ARG D 1 118 ? 33.926  3.413   -14.520 1.00 39.48 ? 118 ARG D NE  1 
ATOM 3869  C CZ  . ARG D 1 118 ? 34.546  2.589   -13.679 1.00 39.60 ? 118 ARG D CZ  1 
ATOM 3870  N NH1 . ARG D 1 118 ? 33.962  2.237   -12.543 1.00 39.79 ? 118 ARG D NH1 1 
ATOM 3871  N NH2 . ARG D 1 118 ? 35.749  2.119   -13.971 1.00 39.44 ? 118 ARG D NH2 1 
ATOM 3872  N N   . LYS D 1 119 ? 33.502  6.427   -18.915 1.00 41.83 ? 119 LYS D N   1 
ATOM 3873  C CA  . LYS D 1 119 ? 34.525  7.440   -19.169 1.00 42.91 ? 119 LYS D CA  1 
ATOM 3874  C C   . LYS D 1 119 ? 33.903  8.652   -19.878 1.00 42.81 ? 119 LYS D C   1 
ATOM 3875  O O   . LYS D 1 119 ? 33.996  9.782   -19.397 1.00 42.68 ? 119 LYS D O   1 
ATOM 3876  C CB  . LYS D 1 119 ? 35.658  6.841   -20.007 1.00 44.11 ? 119 LYS D CB  1 
ATOM 3877  C CG  . LYS D 1 119 ? 36.837  7.782   -20.195 1.00 46.41 ? 119 LYS D CG  1 
ATOM 3878  C CD  . LYS D 1 119 ? 38.154  7.028   -20.303 1.00 46.70 ? 119 LYS D CD  1 
ATOM 3879  C CE  . LYS D 1 119 ? 39.305  8.002   -20.456 1.00 47.38 ? 119 LYS D CE  1 
ATOM 3880  N NZ  . LYS D 1 119 ? 40.611  7.306   -20.590 1.00 49.62 ? 119 LYS D NZ  1 
ATOM 3881  N N   . TYR D 1 120 ? 33.258  8.404   -21.015 1.00 42.93 ? 120 TYR D N   1 
ATOM 3882  C CA  . TYR D 1 120 ? 32.589  9.451   -21.779 1.00 42.57 ? 120 TYR D CA  1 
ATOM 3883  C C   . TYR D 1 120 ? 31.103  9.292   -21.451 1.00 42.33 ? 120 TYR D C   1 
ATOM 3884  O O   . TYR D 1 120 ? 30.333  8.672   -22.191 1.00 43.04 ? 120 TYR D O   1 
ATOM 3885  C CB  . TYR D 1 120 ? 32.896  9.254   -23.264 1.00 42.70 ? 120 TYR D CB  1 
ATOM 3886  C CG  . TYR D 1 120 ? 34.367  8.974   -23.470 1.00 42.80 ? 120 TYR D CG  1 
ATOM 3887  C CD1 . TYR D 1 120 ? 35.327  9.874   -23.027 1.00 43.23 ? 120 TYR D CD1 1 
ATOM 3888  C CD2 . TYR D 1 120 ? 34.802  7.765   -24.001 1.00 43.07 ? 120 TYR D CD2 1 
ATOM 3889  C CE1 . TYR D 1 120 ? 36.690  9.576   -23.094 1.00 44.23 ? 120 TYR D CE1 1 
ATOM 3890  C CE2 . TYR D 1 120 ? 36.160  7.455   -24.073 1.00 44.11 ? 120 TYR D CE2 1 
ATOM 3891  C CZ  . TYR D 1 120 ? 37.103  8.366   -23.612 1.00 44.40 ? 120 TYR D CZ  1 
ATOM 3892  O OH  . TYR D 1 120 ? 38.450  8.064   -23.639 1.00 43.81 ? 120 TYR D OH  1 
ATOM 3893  N N   . THR D 1 121 ? 30.729  9.877   -20.318 1.00 41.26 ? 121 THR D N   1 
ATOM 3894  C CA  . THR D 1 121 ? 29.388  9.791   -19.760 1.00 41.30 ? 121 THR D CA  1 
ATOM 3895  C C   . THR D 1 121 ? 28.135  10.189  -20.535 1.00 41.01 ? 121 THR D C   1 
ATOM 3896  O O   . THR D 1 121 ? 27.031  10.095  -19.994 1.00 40.82 ? 121 THR D O   1 
ATOM 3897  C CB  . THR D 1 121 ? 29.343  10.504  -18.419 1.00 41.09 ? 121 THR D CB  1 
ATOM 3898  O OG1 . THR D 1 121 ? 29.574  11.898  -18.622 1.00 43.09 ? 121 THR D OG1 1 
ATOM 3899  C CG2 . THR D 1 121 ? 30.409  9.946   -17.504 1.00 40.09 ? 121 THR D CG2 1 
ATOM 3900  N N   . SER D 1 122 ? 28.270  10.621  -21.781 1.00 40.81 ? 122 SER D N   1 
ATOM 3901  C CA  . SER D 1 122 ? 27.073  10.973  -22.542 1.00 41.68 ? 122 SER D CA  1 
ATOM 3902  C C   . SER D 1 122 ? 26.915  10.066  -23.755 1.00 41.66 ? 122 SER D C   1 
ATOM 3903  O O   . SER D 1 122 ? 25.926  10.144  -24.492 1.00 41.47 ? 122 SER D O   1 
ATOM 3904  C CB  . SER D 1 122 ? 27.133  12.433  -22.995 1.00 41.39 ? 122 SER D CB  1 
ATOM 3905  O OG  . SER D 1 122 ? 26.905  13.306  -21.906 1.00 41.80 ? 122 SER D OG  1 
ATOM 3906  N N   . TRP D 1 123 ? 27.898  9.200   -23.954 1.00 41.15 ? 123 TRP D N   1 
ATOM 3907  C CA  . TRP D 1 123 ? 27.855  8.296   -25.082 1.00 41.09 ? 123 TRP D CA  1 
ATOM 3908  C C   . TRP D 1 123 ? 27.385  6.891   -24.733 1.00 39.50 ? 123 TRP D C   1 
ATOM 3909  O O   . TRP D 1 123 ? 27.745  6.322   -23.693 1.00 39.36 ? 123 TRP D O   1 
ATOM 3910  C CB  . TRP D 1 123 ? 29.221  8.270   -25.759 1.00 43.30 ? 123 TRP D CB  1 
ATOM 3911  C CG  . TRP D 1 123 ? 29.635  9.642   -26.209 1.00 45.02 ? 123 TRP D CG  1 
ATOM 3912  C CD1 . TRP D 1 123 ? 28.845  10.759  -26.271 1.00 44.59 ? 123 TRP D CD1 1 
ATOM 3913  C CD2 . TRP D 1 123 ? 30.933  10.043  -26.657 1.00 44.85 ? 123 TRP D CD2 1 
ATOM 3914  N NE1 . TRP D 1 123 ? 29.573  11.826  -26.729 1.00 44.85 ? 123 TRP D NE1 1 
ATOM 3915  C CE2 . TRP D 1 123 ? 30.858  11.419  -26.973 1.00 45.49 ? 123 TRP D CE2 1 
ATOM 3916  C CE3 . TRP D 1 123 ? 32.151  9.375   -26.824 1.00 44.58 ? 123 TRP D CE3 1 
ATOM 3917  C CZ2 . TRP D 1 123 ? 31.961  12.142  -27.443 1.00 45.16 ? 123 TRP D CZ2 1 
ATOM 3918  C CZ3 . TRP D 1 123 ? 33.246  10.090  -27.291 1.00 45.23 ? 123 TRP D CZ3 1 
ATOM 3919  C CH2 . TRP D 1 123 ? 33.144  11.462  -27.596 1.00 45.26 ? 123 TRP D CH2 1 
ATOM 3920  N N   . TYR D 1 124 ? 26.559  6.348   -25.623 1.00 36.84 ? 124 TYR D N   1 
ATOM 3921  C CA  . TYR D 1 124 ? 25.999  5.022   -25.459 1.00 34.29 ? 124 TYR D CA  1 
ATOM 3922  C C   . TYR D 1 124 ? 26.524  4.039   -26.474 1.00 32.25 ? 124 TYR D C   1 
ATOM 3923  O O   . TYR D 1 124 ? 26.894  4.418   -27.576 1.00 31.85 ? 124 TYR D O   1 
ATOM 3924  C CB  . TYR D 1 124 ? 24.488  5.063   -25.613 1.00 35.03 ? 124 TYR D CB  1 
ATOM 3925  C CG  . TYR D 1 124 ? 23.755  5.755   -24.505 1.00 36.89 ? 124 TYR D CG  1 
ATOM 3926  C CD1 . TYR D 1 124 ? 23.463  7.118   -24.580 1.00 37.54 ? 124 TYR D CD1 1 
ATOM 3927  C CD2 . TYR D 1 124 ? 23.295  5.039   -23.406 1.00 37.10 ? 124 TYR D CD2 1 
ATOM 3928  C CE1 . TYR D 1 124 ? 22.715  7.747   -23.588 1.00 37.11 ? 124 TYR D CE1 1 
ATOM 3929  C CE2 . TYR D 1 124 ? 22.554  5.653   -22.411 1.00 37.85 ? 124 TYR D CE2 1 
ATOM 3930  C CZ  . TYR D 1 124 ? 22.259  7.005   -22.507 1.00 37.74 ? 124 TYR D CZ  1 
ATOM 3931  O OH  . TYR D 1 124 ? 21.475  7.591   -21.540 1.00 38.20 ? 124 TYR D OH  1 
ATOM 3932  N N   . VAL D 1 125 ? 26.558  2.770   -26.088 1.00 31.28 ? 125 VAL D N   1 
ATOM 3933  C CA  . VAL D 1 125 ? 26.966  1.705   -26.998 1.00 30.94 ? 125 VAL D CA  1 
ATOM 3934  C C   . VAL D 1 125 ? 25.721  1.581   -27.872 1.00 30.66 ? 125 VAL D C   1 
ATOM 3935  O O   . VAL D 1 125 ? 24.602  1.548   -27.359 1.00 31.44 ? 125 VAL D O   1 
ATOM 3936  C CB  . VAL D 1 125 ? 27.232  0.376   -26.239 1.00 29.82 ? 125 VAL D CB  1 
ATOM 3937  C CG1 . VAL D 1 125 ? 27.350  -0.780  -27.218 1.00 27.94 ? 125 VAL D CG1 1 
ATOM 3938  C CG2 . VAL D 1 125 ? 28.505  0.508   -25.417 1.00 29.68 ? 125 VAL D CG2 1 
ATOM 3939  N N   . ALA D 1 126 ? 25.899  1.537   -29.180 1.00 30.70 ? 126 ALA D N   1 
ATOM 3940  C CA  . ALA D 1 126 ? 24.746  1.475   -30.056 1.00 32.14 ? 126 ALA D CA  1 
ATOM 3941  C C   . ALA D 1 126 ? 25.089  0.889   -31.421 1.00 33.93 ? 126 ALA D C   1 
ATOM 3942  O O   . ALA D 1 126 ? 26.259  0.685   -31.747 1.00 34.67 ? 126 ALA D O   1 
ATOM 3943  C CB  . ALA D 1 126 ? 24.173  2.874   -30.224 1.00 31.01 ? 126 ALA D CB  1 
ATOM 3944  N N   . LEU D 1 127 ? 24.060  0.620   -32.216 1.00 35.07 ? 127 LEU D N   1 
ATOM 3945  C CA  . LEU D 1 127 ? 24.244  0.067   -33.550 1.00 36.64 ? 127 LEU D CA  1 
ATOM 3946  C C   . LEU D 1 127 ? 23.365  0.804   -34.551 1.00 38.54 ? 127 LEU D C   1 
ATOM 3947  O O   . LEU D 1 127 ? 22.193  1.079   -34.280 1.00 39.47 ? 127 LEU D O   1 
ATOM 3948  C CB  . LEU D 1 127 ? 23.886  -1.418  -33.571 1.00 36.25 ? 127 LEU D CB  1 
ATOM 3949  C CG  . LEU D 1 127 ? 24.798  -2.378  -32.802 1.00 36.46 ? 127 LEU D CG  1 
ATOM 3950  C CD1 . LEU D 1 127 ? 24.284  -3.805  -32.948 1.00 36.85 ? 127 LEU D CD1 1 
ATOM 3951  C CD2 . LEU D 1 127 ? 26.210  -2.283  -33.335 1.00 35.14 ? 127 LEU D CD2 1 
ATOM 3952  N N   . LYS D 1 128 ? 23.936  1.137   -35.705 1.00 39.58 ? 128 LYS D N   1 
ATOM 3953  C CA  . LYS D 1 128 ? 23.191  1.825   -36.756 1.00 40.20 ? 128 LYS D CA  1 
ATOM 3954  C C   . LYS D 1 128 ? 22.241  0.790   -37.358 1.00 40.46 ? 128 LYS D C   1 
ATOM 3955  O O   . LYS D 1 128 ? 22.476  -0.411  -37.221 1.00 41.58 ? 128 LYS D O   1 
ATOM 3956  C CB  . LYS D 1 128 ? 24.155  2.352   -37.833 1.00 39.16 ? 128 LYS D CB  1 
ATOM 3957  N N   . ARG D 1 129 ? 21.170  1.242   -38.005 1.00 40.22 ? 129 ARG D N   1 
ATOM 3958  C CA  . ARG D 1 129 ? 20.213  0.320   -38.619 1.00 40.37 ? 129 ARG D CA  1 
ATOM 3959  C C   . ARG D 1 129 ? 20.891  -0.536  -39.686 1.00 40.52 ? 129 ARG D C   1 
ATOM 3960  O O   . ARG D 1 129 ? 20.337  -1.531  -40.144 1.00 40.51 ? 129 ARG D O   1 
ATOM 3961  C CB  . ARG D 1 129 ? 19.049  1.093   -39.259 1.00 39.87 ? 129 ARG D CB  1 
ATOM 3962  N N   . THR D 1 130 ? 22.098  -0.152  -40.083 1.00 41.18 ? 130 THR D N   1 
ATOM 3963  C CA  . THR D 1 130 ? 22.813  -0.905  -41.108 1.00 41.51 ? 130 THR D CA  1 
ATOM 3964  C C   . THR D 1 130 ? 23.582  -2.093  -40.566 1.00 42.89 ? 130 THR D C   1 
ATOM 3965  O O   . THR D 1 130 ? 23.965  -2.978  -41.321 1.00 43.75 ? 130 THR D O   1 
ATOM 3966  C CB  . THR D 1 130 ? 23.792  -0.022  -41.900 1.00 39.63 ? 130 THR D CB  1 
ATOM 3967  O OG1 . THR D 1 130 ? 24.787  0.514   -41.022 1.00 39.18 ? 130 THR D OG1 1 
ATOM 3968  C CG2 . THR D 1 130 ? 23.044  1.098   -42.571 1.00 39.21 ? 130 THR D CG2 1 
ATOM 3969  N N   . GLY D 1 131 ? 23.807  -2.125  -39.259 1.00 44.29 ? 131 GLY D N   1 
ATOM 3970  C CA  . GLY D 1 131 ? 24.546  -3.234  -38.682 1.00 45.55 ? 131 GLY D CA  1 
ATOM 3971  C C   . GLY D 1 131 ? 25.917  -2.798  -38.204 1.00 46.05 ? 131 GLY D C   1 
ATOM 3972  O O   . GLY D 1 131 ? 26.651  -3.577  -37.593 1.00 46.20 ? 131 GLY D O   1 
ATOM 3973  N N   . GLN D 1 132 ? 26.265  -1.549  -38.502 1.00 46.46 ? 132 GLN D N   1 
ATOM 3974  C CA  . GLN D 1 132 ? 27.537  -0.969  -38.083 1.00 45.79 ? 132 GLN D CA  1 
ATOM 3975  C C   . GLN D 1 132 ? 27.245  -0.212  -36.806 1.00 45.35 ? 132 GLN D C   1 
ATOM 3976  O O   . GLN D 1 132 ? 26.115  0.225   -36.593 1.00 44.47 ? 132 GLN D O   1 
ATOM 3977  C CB  . GLN D 1 132 ? 28.073  0.005   -39.135 1.00 45.85 ? 132 GLN D CB  1 
ATOM 3978  C CG  . GLN D 1 132 ? 28.268  -0.609  -40.512 1.00 47.10 ? 132 GLN D CG  1 
ATOM 3979  C CD  . GLN D 1 132 ? 28.952  -1.964  -40.453 1.00 47.95 ? 132 GLN D CD  1 
ATOM 3980  O OE1 . GLN D 1 132 ? 30.069  -2.089  -39.946 1.00 47.60 ? 132 GLN D OE1 1 
ATOM 3981  N NE2 . GLN D 1 132 ? 28.280  -2.991  -40.972 1.00 48.06 ? 132 GLN D NE2 1 
ATOM 3982  N N   . TYR D 1 133 ? 28.250  -0.054  -35.955 1.00 45.60 ? 133 TYR D N   1 
ATOM 3983  C CA  . TYR D 1 133 ? 28.035  0.651   -34.703 1.00 46.46 ? 133 TYR D CA  1 
ATOM 3984  C C   . TYR D 1 133 ? 27.772  2.130   -34.969 1.00 46.46 ? 133 TYR D C   1 
ATOM 3985  O O   . TYR D 1 133 ? 27.976  2.610   -36.078 1.00 46.10 ? 133 TYR D O   1 
ATOM 3986  C CB  . TYR D 1 133 ? 29.243  0.473   -33.770 1.00 47.10 ? 133 TYR D CB  1 
ATOM 3987  C CG  . TYR D 1 133 ? 30.521  1.153   -34.220 1.00 48.77 ? 133 TYR D CG  1 
ATOM 3988  C CD1 . TYR D 1 133 ? 30.612  2.547   -34.285 1.00 49.41 ? 133 TYR D CD1 1 
ATOM 3989  C CD2 . TYR D 1 133 ? 31.645  0.403   -34.582 1.00 48.67 ? 133 TYR D CD2 1 
ATOM 3990  C CE1 . TYR D 1 133 ? 31.787  3.176   -34.699 1.00 49.63 ? 133 TYR D CE1 1 
ATOM 3991  C CE2 . TYR D 1 133 ? 32.824  1.025   -34.996 1.00 48.53 ? 133 TYR D CE2 1 
ATOM 3992  C CZ  . TYR D 1 133 ? 32.884  2.410   -35.052 1.00 48.80 ? 133 TYR D CZ  1 
ATOM 3993  O OH  . TYR D 1 133 ? 34.036  3.035   -35.461 1.00 49.17 ? 133 TYR D OH  1 
ATOM 3994  N N   . LYS D 1 134 ? 27.294  2.840   -33.954 1.00 46.54 ? 134 LYS D N   1 
ATOM 3995  C CA  . LYS D 1 134 ? 27.027  4.267   -34.079 1.00 46.64 ? 134 LYS D CA  1 
ATOM 3996  C C   . LYS D 1 134 ? 27.926  5.016   -33.089 1.00 46.81 ? 134 LYS D C   1 
ATOM 3997  O O   . LYS D 1 134 ? 27.961  4.684   -31.902 1.00 47.25 ? 134 LYS D O   1 
ATOM 3998  C CB  . LYS D 1 134 ? 25.552  4.573   -33.787 1.00 44.27 ? 134 LYS D CB  1 
ATOM 3999  N N   . LEU D 1 135 ? 28.664  6.010   -33.583 1.00 46.63 ? 135 LEU D N   1 
ATOM 4000  C CA  . LEU D 1 135 ? 29.559  6.796   -32.734 1.00 47.15 ? 135 LEU D CA  1 
ATOM 4001  C C   . LEU D 1 135 ? 28.870  7.272   -31.469 1.00 47.40 ? 135 LEU D C   1 
ATOM 4002  O O   . LEU D 1 135 ? 27.749  7.794   -31.510 1.00 47.80 ? 135 LEU D O   1 
ATOM 4003  C CB  . LEU D 1 135 ? 30.098  8.012   -33.483 1.00 47.12 ? 135 LEU D CB  1 
ATOM 4004  C CG  . LEU D 1 135 ? 31.201  7.748   -34.500 1.00 47.01 ? 135 LEU D CG  1 
ATOM 4005  C CD1 . LEU D 1 135 ? 31.380  8.978   -35.355 1.00 47.04 ? 135 LEU D CD1 1 
ATOM 4006  C CD2 . LEU D 1 135 ? 32.495  7.388   -33.779 1.00 47.48 ? 135 LEU D CD2 1 
ATOM 4007  N N   . GLY D 1 136 ? 29.552  7.097   -30.345 1.00 47.12 ? 136 GLY D N   1 
ATOM 4008  C CA  . GLY D 1 136 ? 28.980  7.504   -29.076 1.00 47.40 ? 136 GLY D CA  1 
ATOM 4009  C C   . GLY D 1 136 ? 28.541  8.947   -29.131 1.00 47.17 ? 136 GLY D C   1 
ATOM 4010  O O   . GLY D 1 136 ? 27.504  9.319   -28.585 1.00 47.31 ? 136 GLY D O   1 
ATOM 4011  N N   . SER D 1 137 ? 29.340  9.761   -29.808 1.00 47.33 ? 137 SER D N   1 
ATOM 4012  C CA  . SER D 1 137 ? 29.062  11.179  -29.943 1.00 47.24 ? 137 SER D CA  1 
ATOM 4013  C C   . SER D 1 137 ? 27.735  11.441  -30.648 1.00 46.70 ? 137 SER D C   1 
ATOM 4014  O O   . SER D 1 137 ? 27.172  12.521  -30.530 1.00 46.47 ? 137 SER D O   1 
ATOM 4015  C CB  . SER D 1 137 ? 30.217  11.858  -30.691 1.00 47.27 ? 137 SER D CB  1 
ATOM 4016  O OG  . SER D 1 137 ? 30.707  11.037  -31.740 1.00 48.63 ? 137 SER D OG  1 
ATOM 4017  N N   . LYS D 1 138 ? 27.224  10.447  -31.361 1.00 46.82 ? 138 LYS D N   1 
ATOM 4018  C CA  . LYS D 1 138 ? 25.967  10.620  -32.074 1.00 47.12 ? 138 LYS D CA  1 
ATOM 4019  C C   . LYS D 1 138 ? 24.787  9.903   -31.442 1.00 46.80 ? 138 LYS D C   1 
ATOM 4020  O O   . LYS D 1 138 ? 23.730  9.790   -32.062 1.00 47.04 ? 138 LYS D O   1 
ATOM 4021  C CB  . LYS D 1 138 ? 26.115  10.169  -33.533 1.00 47.74 ? 138 LYS D CB  1 
ATOM 4022  C CG  . LYS D 1 138 ? 26.787  11.200  -34.433 1.00 48.35 ? 138 LYS D CG  1 
ATOM 4023  C CD  . LYS D 1 138 ? 26.546  10.893  -35.902 1.00 49.52 ? 138 LYS D CD  1 
ATOM 4024  C CE  . LYS D 1 138 ? 26.766  12.127  -36.780 1.00 50.35 ? 138 LYS D CE  1 
ATOM 4025  N NZ  . LYS D 1 138 ? 26.477  11.848  -38.221 1.00 49.85 ? 138 LYS D NZ  1 
ATOM 4026  N N   . THR D 1 139 ? 24.956  9.427   -30.212 1.00 46.52 ? 139 THR D N   1 
ATOM 4027  C CA  . THR D 1 139 ? 23.879  8.710   -29.529 1.00 45.59 ? 139 THR D CA  1 
ATOM 4028  C C   . THR D 1 139 ? 23.187  9.554   -28.467 1.00 45.90 ? 139 THR D C   1 
ATOM 4029  O O   . THR D 1 139 ? 23.743  10.535  -27.972 1.00 46.48 ? 139 THR D O   1 
ATOM 4030  C CB  . THR D 1 139 ? 24.392  7.412   -28.856 1.00 44.36 ? 139 THR D CB  1 
ATOM 4031  O OG1 . THR D 1 139 ? 25.165  7.735   -27.693 1.00 43.00 ? 139 THR D OG1 1 
ATOM 4032  C CG2 . THR D 1 139 ? 25.237  6.619   -29.822 1.00 42.80 ? 139 THR D CG2 1 
ATOM 4033  N N   . GLY D 1 140 ? 21.969  9.155   -28.118 1.00 45.53 ? 140 GLY D N   1 
ATOM 4034  C CA  . GLY D 1 140 ? 21.206  9.871   -27.118 1.00 45.56 ? 140 GLY D CA  1 
ATOM 4035  C C   . GLY D 1 140 ? 20.198  8.959   -26.451 1.00 45.77 ? 140 GLY D C   1 
ATOM 4036  O O   . GLY D 1 140 ? 19.785  7.956   -27.036 1.00 45.59 ? 140 GLY D O   1 
ATOM 4037  N N   . PRO D 1 141 ? 19.772  9.295   -25.226 1.00 45.61 ? 141 PRO D N   1 
ATOM 4038  C CA  . PRO D 1 141 ? 18.807  8.521   -24.442 1.00 45.82 ? 141 PRO D CA  1 
ATOM 4039  C C   . PRO D 1 141 ? 17.522  8.116   -25.154 1.00 46.09 ? 141 PRO D C   1 
ATOM 4040  O O   . PRO D 1 141 ? 17.034  6.992   -24.978 1.00 46.72 ? 141 PRO D O   1 
ATOM 4041  C CB  . PRO D 1 141 ? 18.556  9.410   -23.221 1.00 45.92 ? 141 PRO D CB  1 
ATOM 4042  C CG  . PRO D 1 141 ? 18.919  10.784  -23.698 1.00 45.23 ? 141 PRO D CG  1 
ATOM 4043  C CD  . PRO D 1 141 ? 20.140  10.533  -24.523 1.00 44.89 ? 141 PRO D CD  1 
ATOM 4044  N N   . GLY D 1 142 ? 16.974  9.012   -25.964 1.00 45.77 ? 142 GLY D N   1 
ATOM 4045  C CA  . GLY D 1 142 ? 15.741  8.678   -26.659 1.00 45.01 ? 142 GLY D CA  1 
ATOM 4046  C C   . GLY D 1 142 ? 15.910  7.769   -27.866 1.00 44.09 ? 142 GLY D C   1 
ATOM 4047  O O   . GLY D 1 142 ? 14.947  7.158   -28.339 1.00 44.64 ? 142 GLY D O   1 
ATOM 4048  N N   . GLN D 1 143 ? 17.138  7.671   -28.368 1.00 42.89 ? 143 GLN D N   1 
ATOM 4049  C CA  . GLN D 1 143 ? 17.417  6.856   -29.543 1.00 40.72 ? 143 GLN D CA  1 
ATOM 4050  C C   . GLN D 1 143 ? 17.043  5.386   -29.402 1.00 39.72 ? 143 GLN D C   1 
ATOM 4051  O O   . GLN D 1 143 ? 16.841  4.870   -28.302 1.00 39.94 ? 143 GLN D O   1 
ATOM 4052  C CB  . GLN D 1 143 ? 18.888  7.006   -29.937 1.00 40.58 ? 143 GLN D CB  1 
ATOM 4053  C CG  . GLN D 1 143 ? 19.184  8.355   -30.572 1.00 40.77 ? 143 GLN D CG  1 
ATOM 4054  C CD  . GLN D 1 143 ? 20.649  8.574   -30.867 1.00 40.89 ? 143 GLN D CD  1 
ATOM 4055  O OE1 . GLN D 1 143 ? 21.301  7.737   -31.477 1.00 40.00 ? 143 GLN D OE1 1 
ATOM 4056  N NE2 . GLN D 1 143 ? 21.171  9.717   -30.447 1.00 41.76 ? 143 GLN D NE2 1 
ATOM 4057  N N   . LYS D 1 144 ? 16.941  4.733   -30.549 1.00 38.20 ? 144 LYS D N   1 
ATOM 4058  C CA  . LYS D 1 144 ? 16.578  3.326   -30.642 1.00 36.75 ? 144 LYS D CA  1 
ATOM 4059  C C   . LYS D 1 144 ? 17.815  2.470   -30.903 1.00 35.52 ? 144 LYS D C   1 
ATOM 4060  O O   . LYS D 1 144 ? 17.772  1.247   -30.777 1.00 35.64 ? 144 LYS D O   1 
ATOM 4061  C CB  . LYS D 1 144 ? 15.586  3.141   -31.788 1.00 35.88 ? 144 LYS D CB  1 
ATOM 4062  C CG  . LYS D 1 144 ? 15.291  1.712   -32.123 1.00 37.25 ? 144 LYS D CG  1 
ATOM 4063  C CD  . LYS D 1 144 ? 14.404  1.642   -33.321 1.00 37.61 ? 144 LYS D CD  1 
ATOM 4064  C CE  . LYS D 1 144 ? 13.999  0.224   -33.613 1.00 37.70 ? 144 LYS D CE  1 
ATOM 4065  N NZ  . LYS D 1 144 ? 13.170  0.212   -34.853 1.00 38.28 ? 144 LYS D NZ  1 
ATOM 4066  N N   . ALA D 1 145 ? 18.909  3.125   -31.278 1.00 34.02 ? 145 ALA D N   1 
ATOM 4067  C CA  . ALA D 1 145 ? 20.158  2.441   -31.571 1.00 32.77 ? 145 ALA D CA  1 
ATOM 4068  C C   . ALA D 1 145 ? 20.861  1.991   -30.298 1.00 31.61 ? 145 ALA D C   1 
ATOM 4069  O O   . ALA D 1 145 ? 21.710  1.109   -30.333 1.00 31.53 ? 145 ALA D O   1 
ATOM 4070  C CB  . ALA D 1 145 ? 21.076  3.355   -32.379 1.00 32.71 ? 145 ALA D CB  1 
ATOM 4071  N N   . ILE D 1 146 ? 20.492  2.592   -29.174 1.00 30.68 ? 146 ILE D N   1 
ATOM 4072  C CA  . ILE D 1 146 ? 21.104  2.256   -27.892 1.00 29.67 ? 146 ILE D CA  1 
ATOM 4073  C C   . ILE D 1 146 ? 20.334  1.221   -27.069 1.00 28.93 ? 146 ILE D C   1 
ATOM 4074  O O   . ILE D 1 146 ? 20.731  0.918   -25.945 1.00 29.18 ? 146 ILE D O   1 
ATOM 4075  C CB  . ILE D 1 146 ? 21.230  3.498   -27.008 1.00 29.85 ? 146 ILE D CB  1 
ATOM 4076  C CG1 . ILE D 1 146 ? 19.830  4.033   -26.688 1.00 29.04 ? 146 ILE D CG1 1 
ATOM 4077  C CG2 . ILE D 1 146 ? 22.053  4.565   -27.715 1.00 29.94 ? 146 ILE D CG2 1 
ATOM 4078  C CD1 . ILE D 1 146 ? 19.778  4.906   -25.447 1.00 29.08 ? 146 ILE D CD1 1 
ATOM 4079  N N   . LEU D 1 147 ? 19.239  0.686   -27.604 1.00 27.52 ? 147 LEU D N   1 
ATOM 4080  C CA  . LEU D 1 147 ? 18.449  -0.289  -26.854 1.00 27.31 ? 147 LEU D CA  1 
ATOM 4081  C C   . LEU D 1 147 ? 18.813  -1.749  -27.108 1.00 26.84 ? 147 LEU D C   1 
ATOM 4082  O O   . LEU D 1 147 ? 18.689  -2.254  -28.221 1.00 25.85 ? 147 LEU D O   1 
ATOM 4083  C CB  . LEU D 1 147 ? 16.961  -0.087  -27.125 1.00 27.48 ? 147 LEU D CB  1 
ATOM 4084  C CG  . LEU D 1 147 ? 16.335  1.236   -26.653 1.00 27.70 ? 147 LEU D CG  1 
ATOM 4085  C CD1 . LEU D 1 147 ? 14.959  1.389   -27.307 1.00 26.35 ? 147 LEU D CD1 1 
ATOM 4086  C CD2 . LEU D 1 147 ? 16.249  1.270   -25.122 1.00 25.79 ? 147 LEU D CD2 1 
ATOM 4087  N N   . PHE D 1 148 ? 19.247  -2.421  -26.047 1.00 26.21 ? 148 PHE D N   1 
ATOM 4088  C CA  . PHE D 1 148 ? 19.644  -3.818  -26.108 1.00 25.79 ? 148 PHE D CA  1 
ATOM 4089  C C   . PHE D 1 148 ? 18.845  -4.706  -25.173 1.00 26.42 ? 148 PHE D C   1 
ATOM 4090  O O   . PHE D 1 148 ? 18.549  -4.342  -24.035 1.00 27.11 ? 148 PHE D O   1 
ATOM 4091  C CB  . PHE D 1 148 ? 21.106  -3.964  -25.723 1.00 26.10 ? 148 PHE D CB  1 
ATOM 4092  C CG  . PHE D 1 148 ? 22.060  -3.369  -26.708 1.00 24.70 ? 148 PHE D CG  1 
ATOM 4093  C CD1 . PHE D 1 148 ? 22.405  -2.021  -26.640 1.00 23.22 ? 148 PHE D CD1 1 
ATOM 4094  C CD2 . PHE D 1 148 ? 22.623  -4.165  -27.700 1.00 23.48 ? 148 PHE D CD2 1 
ATOM 4095  C CE1 . PHE D 1 148 ? 23.300  -1.472  -27.548 1.00 23.30 ? 148 PHE D CE1 1 
ATOM 4096  C CE2 . PHE D 1 148 ? 23.519  -3.630  -28.619 1.00 23.49 ? 148 PHE D CE2 1 
ATOM 4097  C CZ  . PHE D 1 148 ? 23.859  -2.276  -28.541 1.00 25.33 ? 148 PHE D CZ  1 
ATOM 4098  N N   . LEU D 1 149 ? 18.523  -5.896  -25.642 1.00 26.23 ? 149 LEU D N   1 
ATOM 4099  C CA  . LEU D 1 149 ? 17.785  -6.841  -24.829 1.00 25.70 ? 149 LEU D CA  1 
ATOM 4100  C C   . LEU D 1 149 ? 18.744  -8.023  -24.638 1.00 25.46 ? 149 LEU D C   1 
ATOM 4101  O O   . LEU D 1 149 ? 19.139  -8.674  -25.611 1.00 24.91 ? 149 LEU D O   1 
ATOM 4102  C CB  . LEU D 1 149 ? 16.536  -7.261  -25.583 1.00 28.03 ? 149 LEU D CB  1 
ATOM 4103  C CG  . LEU D 1 149 ? 15.457  -8.101  -24.919 1.00 30.56 ? 149 LEU D CG  1 
ATOM 4104  C CD1 . LEU D 1 149 ? 14.755  -7.304  -23.826 1.00 32.23 ? 149 LEU D CD1 1 
ATOM 4105  C CD2 . LEU D 1 149 ? 14.459  -8.526  -25.998 1.00 30.78 ? 149 LEU D CD2 1 
ATOM 4106  N N   . PRO D 1 150 ? 19.174  -8.286  -23.387 1.00 25.21 ? 150 PRO D N   1 
ATOM 4107  C CA  . PRO D 1 150 ? 20.090  -9.415  -23.188 1.00 25.80 ? 150 PRO D CA  1 
ATOM 4108  C C   . PRO D 1 150 ? 19.356  -10.732 -23.391 1.00 27.87 ? 150 PRO D C   1 
ATOM 4109  O O   . PRO D 1 150 ? 18.198  -10.886 -22.978 1.00 28.10 ? 150 PRO D O   1 
ATOM 4110  C CB  . PRO D 1 150 ? 20.591  -9.216  -21.758 1.00 24.20 ? 150 PRO D CB  1 
ATOM 4111  C CG  . PRO D 1 150 ? 19.445  -8.547  -21.088 1.00 24.68 ? 150 PRO D CG  1 
ATOM 4112  C CD  . PRO D 1 150 ? 18.960  -7.557  -22.124 1.00 24.97 ? 150 PRO D CD  1 
ATOM 4113  N N   . MET D 1 151 ? 20.016  -11.670 -24.058 1.00 29.51 ? 151 MET D N   1 
ATOM 4114  C CA  . MET D 1 151 ? 19.421  -12.973 -24.338 1.00 31.01 ? 151 MET D CA  1 
ATOM 4115  C C   . MET D 1 151 ? 20.397  -14.108 -24.025 1.00 32.70 ? 151 MET D C   1 
ATOM 4116  O O   . MET D 1 151 ? 21.616  -13.903 -23.964 1.00 33.62 ? 151 MET D O   1 
ATOM 4117  C CB  . MET D 1 151 ? 18.999  -13.050 -25.810 1.00 29.78 ? 151 MET D CB  1 
ATOM 4118  C CG  . MET D 1 151 ? 17.907  -12.065 -26.210 1.00 30.15 ? 151 MET D CG  1 
ATOM 4119  S SD  . MET D 1 151 ? 17.515  -12.061 -28.006 1.00 31.72 ? 151 MET D SD  1 
ATOM 4120  C CE  . MET D 1 151 ? 16.152  -13.249 -28.046 1.00 29.38 ? 151 MET D CE  1 
ATOM 4121  N N   . SER D 1 152 ? 19.855  -15.302 -23.818 1.00 34.55 ? 152 SER D N   1 
ATOM 4122  C CA  . SER D 1 152 ? 20.677  -16.473 -23.531 1.00 37.11 ? 152 SER D CA  1 
ATOM 4123  C C   . SER D 1 152 ? 21.553  -16.869 -24.721 1.00 39.12 ? 152 SER D C   1 
ATOM 4124  O O   . SER D 1 152 ? 21.224  -16.587 -25.878 1.00 38.29 ? 152 SER D O   1 
ATOM 4125  C CB  . SER D 1 152 ? 19.804  -17.669 -23.179 1.00 36.88 ? 152 SER D CB  1 
ATOM 4126  O OG  . SER D 1 152 ? 20.373  -18.845 -23.743 1.00 38.91 ? 152 SER D OG  1 
ATOM 4127  N N   . ALA D 1 153 ? 22.666  -17.536 -24.428 1.00 41.57 ? 153 ALA D N   1 
ATOM 4128  C CA  . ALA D 1 153 ? 23.576  -17.990 -25.473 1.00 43.24 ? 153 ALA D CA  1 
ATOM 4129  C C   . ALA D 1 153 ? 23.199  -19.422 -25.900 1.00 44.40 ? 153 ALA D C   1 
ATOM 4130  O O   . ALA D 1 153 ? 24.052  -20.303 -26.008 1.00 44.50 ? 153 ALA D O   1 
ATOM 4131  C CB  . ALA D 1 153 ? 25.005  -17.941 -24.963 1.00 43.64 ? 153 ALA D CB  1 
ATOM 4132  N N   . LYS D 1 154 ? 21.906  -19.632 -26.148 1.00 46.30 ? 154 LYS D N   1 
ATOM 4133  C CA  . LYS D 1 154 ? 21.367  -20.932 -26.554 1.00 46.28 ? 154 LYS D CA  1 
ATOM 4134  C C   . LYS D 1 154 ? 21.815  -22.009 -25.574 1.00 46.28 ? 154 LYS D C   1 
ATOM 4135  O O   . LYS D 1 154 ? 22.176  -21.612 -24.444 1.00 46.42 ? 154 LYS D O   1 
ATOM 4136  C CB  . LYS D 1 154 ? 21.822  -21.286 -27.975 1.00 47.18 ? 154 LYS D CB  1 
ATOM 4137  N N   . ASN E 2 4   ? 20.635  -9.213  43.097  1.00 49.33 ? 150 ASN E N   1 
ATOM 4138  C CA  . ASN E 2 4   ? 19.178  -8.867  42.955  1.00 49.90 ? 150 ASN E CA  1 
ATOM 4139  C C   . ASN E 2 4   ? 18.481  -9.702  41.857  1.00 49.10 ? 150 ASN E C   1 
ATOM 4140  O O   . ASN E 2 4   ? 18.397  -9.294  40.689  1.00 49.15 ? 150 ASN E O   1 
ATOM 4141  C CB  . ASN E 2 4   ? 19.017  -7.363  42.679  1.00 49.23 ? 150 ASN E CB  1 
ATOM 4142  N N   . LYS E 2 5   ? 17.991  -10.876 42.262  1.00 47.95 ? 151 LYS E N   1 
ATOM 4143  C CA  . LYS E 2 5   ? 17.306  -11.812 41.373  1.00 45.93 ? 151 LYS E CA  1 
ATOM 4144  C C   . LYS E 2 5   ? 15.874  -11.358 41.099  1.00 44.58 ? 151 LYS E C   1 
ATOM 4145  O O   . LYS E 2 5   ? 15.118  -11.085 42.022  1.00 44.73 ? 151 LYS E O   1 
ATOM 4146  C CB  . LYS E 2 5   ? 17.312  -13.206 42.002  1.00 45.46 ? 151 LYS E CB  1 
ATOM 4147  N N   . ARG E 2 6   ? 15.505  -11.280 39.824  1.00 43.51 ? 152 ARG E N   1 
ATOM 4148  C CA  . ARG E 2 6   ? 14.162  -10.840 39.450  1.00 41.14 ? 152 ARG E CA  1 
ATOM 4149  C C   . ARG E 2 6   ? 13.632  -11.511 38.185  1.00 39.56 ? 152 ARG E C   1 
ATOM 4150  O O   . ARG E 2 6   ? 14.395  -12.006 37.352  1.00 38.91 ? 152 ARG E O   1 
ATOM 4151  C CB  . ARG E 2 6   ? 14.144  -9.325  39.262  1.00 40.25 ? 152 ARG E CB  1 
ATOM 4152  C CG  . ARG E 2 6   ? 15.157  -8.839  38.257  1.00 39.95 ? 152 ARG E CG  1 
ATOM 4153  C CD  . ARG E 2 6   ? 15.178  -7.324  38.183  1.00 40.23 ? 152 ARG E CD  1 
ATOM 4154  N NE  . ARG E 2 6   ? 13.881  -6.781  37.808  1.00 39.54 ? 152 ARG E NE  1 
ATOM 4155  C CZ  . ARG E 2 6   ? 13.700  -5.564  37.314  1.00 39.85 ? 152 ARG E CZ  1 
ATOM 4156  N NH1 . ARG E 2 6   ? 14.732  -4.746  37.130  1.00 38.96 ? 152 ARG E NH1 1 
ATOM 4157  N NH2 . ARG E 2 6   ? 12.483  -5.172  36.979  1.00 41.40 ? 152 ARG E NH2 1 
ATOM 4158  N N   . ALA E 2 7   ? 12.310  -11.514 38.052  1.00 38.38 ? 153 ALA E N   1 
ATOM 4159  C CA  . ALA E 2 7   ? 11.666  -12.115 36.898  1.00 36.32 ? 153 ALA E CA  1 
ATOM 4160  C C   . ALA E 2 7   ? 11.965  -11.312 35.637  1.00 35.72 ? 153 ALA E C   1 
ATOM 4161  O O   . ALA E 2 7   ? 12.372  -10.154 35.713  1.00 35.06 ? 153 ALA E O   1 
ATOM 4162  C CB  . ALA E 2 7   ? 10.179  -12.205 37.120  1.00 36.58 ? 153 ALA E CB  1 
ATOM 4163  N N   . PRO E 2 8   ? 11.759  -11.926 34.456  1.00 35.23 ? 154 PRO E N   1 
ATOM 4164  C CA  . PRO E 2 8   ? 12.016  -11.260 33.181  1.00 33.70 ? 154 PRO E CA  1 
ATOM 4165  C C   . PRO E 2 8   ? 11.157  -10.042 32.922  1.00 33.40 ? 154 PRO E C   1 
ATOM 4166  O O   . PRO E 2 8   ? 9.992   -9.974  33.324  1.00 32.64 ? 154 PRO E O   1 
ATOM 4167  C CB  . PRO E 2 8   ? 11.816  -12.376 32.157  1.00 33.56 ? 154 PRO E CB  1 
ATOM 4168  C CG  . PRO E 2 8   ? 10.841  -13.282 32.810  1.00 34.80 ? 154 PRO E CG  1 
ATOM 4169  C CD  . PRO E 2 8   ? 11.304  -13.316 34.240  1.00 34.99 ? 154 PRO E CD  1 
ATOM 4170  N N   . TYR E 2 9   ? 11.757  -9.062  32.258  1.00 33.62 ? 155 TYR E N   1 
ATOM 4171  C CA  . TYR E 2 9   ? 11.051  -7.840  31.932  1.00 34.75 ? 155 TYR E CA  1 
ATOM 4172  C C   . TYR E 2 9   ? 11.604  -7.244  30.639  1.00 34.46 ? 155 TYR E C   1 
ATOM 4173  O O   . TYR E 2 9   ? 12.747  -7.502  30.260  1.00 34.07 ? 155 TYR E O   1 
ATOM 4174  C CB  . TYR E 2 9   ? 11.168  -6.858  33.096  1.00 36.49 ? 155 TYR E CB  1 
ATOM 4175  C CG  . TYR E 2 9   ? 12.585  -6.446  33.403  1.00 39.18 ? 155 TYR E CG  1 
ATOM 4176  C CD1 . TYR E 2 9   ? 13.509  -7.361  33.922  1.00 39.54 ? 155 TYR E CD1 1 
ATOM 4177  C CD2 . TYR E 2 9   ? 13.021  -5.149  33.122  1.00 39.36 ? 155 TYR E CD2 1 
ATOM 4178  C CE1 . TYR E 2 9   ? 14.832  -6.991  34.146  1.00 39.47 ? 155 TYR E CE1 1 
ATOM 4179  C CE2 . TYR E 2 9   ? 14.332  -4.772  33.340  1.00 39.57 ? 155 TYR E CE2 1 
ATOM 4180  C CZ  . TYR E 2 9   ? 15.232  -5.694  33.848  1.00 40.19 ? 155 TYR E CZ  1 
ATOM 4181  O OH  . TYR E 2 9   ? 16.535  -5.305  34.036  1.00 41.30 ? 155 TYR E OH  1 
ATOM 4182  N N   . TRP E 2 10  ? 10.774  -6.467  29.954  1.00 34.17 ? 156 TRP E N   1 
ATOM 4183  C CA  . TRP E 2 10  ? 11.167  -5.842  28.701  1.00 34.39 ? 156 TRP E CA  1 
ATOM 4184  C C   . TRP E 2 10  ? 12.033  -4.640  29.036  1.00 35.61 ? 156 TRP E C   1 
ATOM 4185  O O   . TRP E 2 10  ? 11.627  -3.798  29.840  1.00 36.36 ? 156 TRP E O   1 
ATOM 4186  C CB  . TRP E 2 10  ? 9.909   -5.416  27.929  1.00 32.25 ? 156 TRP E CB  1 
ATOM 4187  C CG  . TRP E 2 10  ? 8.995   -6.584  27.629  1.00 30.90 ? 156 TRP E CG  1 
ATOM 4188  C CD1 . TRP E 2 10  ? 7.651   -6.661  27.859  1.00 28.69 ? 156 TRP E CD1 1 
ATOM 4189  C CD2 . TRP E 2 10  ? 9.371   -7.842  27.044  1.00 30.67 ? 156 TRP E CD2 1 
ATOM 4190  N NE1 . TRP E 2 10  ? 7.165   -7.882  27.455  1.00 27.96 ? 156 TRP E NE1 1 
ATOM 4191  C CE2 . TRP E 2 10  ? 8.198   -8.626  26.948  1.00 29.72 ? 156 TRP E CE2 1 
ATOM 4192  C CE3 . TRP E 2 10  ? 10.586  -8.383  26.590  1.00 29.69 ? 156 TRP E CE3 1 
ATOM 4193  C CZ2 . TRP E 2 10  ? 8.204   -9.921  26.418  1.00 28.62 ? 156 TRP E CZ2 1 
ATOM 4194  C CZ3 . TRP E 2 10  ? 10.589  -9.672  26.063  1.00 27.96 ? 156 TRP E CZ3 1 
ATOM 4195  C CH2 . TRP E 2 10  ? 9.403   -10.422 25.982  1.00 28.13 ? 156 TRP E CH2 1 
ATOM 4196  N N   . THR E 2 11  ? 13.220  -4.561  28.435  1.00 36.25 ? 157 THR E N   1 
ATOM 4197  C CA  . THR E 2 11  ? 14.120  -3.448  28.706  1.00 36.24 ? 157 THR E CA  1 
ATOM 4198  C C   . THR E 2 11  ? 13.939  -2.291  27.731  1.00 37.78 ? 157 THR E C   1 
ATOM 4199  O O   . THR E 2 11  ? 14.389  -1.179  27.982  1.00 38.75 ? 157 THR E O   1 
ATOM 4200  C CB  . THR E 2 11  ? 15.601  -3.914  28.745  1.00 35.58 ? 157 THR E CB  1 
ATOM 4201  O OG1 . THR E 2 11  ? 15.988  -4.475  27.479  1.00 35.53 ? 157 THR E OG1 1 
ATOM 4202  C CG2 . THR E 2 11  ? 15.788  -4.938  29.857  1.00 32.42 ? 157 THR E CG2 1 
ATOM 4203  N N   . ASN E 2 12  ? 13.276  -2.542  26.615  1.00 39.64 ? 158 ASN E N   1 
ATOM 4204  C CA  . ASN E 2 12  ? 13.014  -1.457  25.680  1.00 41.90 ? 158 ASN E CA  1 
ATOM 4205  C C   . ASN E 2 12  ? 11.688  -1.666  24.965  1.00 41.75 ? 158 ASN E C   1 
ATOM 4206  O O   . ASN E 2 12  ? 11.637  -2.120  23.821  1.00 42.44 ? 158 ASN E O   1 
ATOM 4207  C CB  . ASN E 2 12  ? 14.143  -1.281  24.665  1.00 43.97 ? 158 ASN E CB  1 
ATOM 4208  C CG  . ASN E 2 12  ? 14.122  0.100   24.025  1.00 45.77 ? 158 ASN E CG  1 
ATOM 4209  O OD1 . ASN E 2 12  ? 13.141  0.493   23.377  1.00 45.90 ? 158 ASN E OD1 1 
ATOM 4210  N ND2 . ASN E 2 12  ? 15.196  0.854   24.223  1.00 46.98 ? 158 ASN E ND2 1 
ATOM 4211  N N   . THR E 2 13  ? 10.615  -1.314  25.664  1.00 41.20 ? 159 THR E N   1 
ATOM 4212  C CA  . THR E 2 13  ? 9.271   -1.458  25.141  1.00 40.66 ? 159 THR E CA  1 
ATOM 4213  C C   . THR E 2 13  ? 9.032   -0.574  23.929  1.00 40.92 ? 159 THR E C   1 
ATOM 4214  O O   . THR E 2 13  ? 8.112   -0.826  23.148  1.00 41.66 ? 159 THR E O   1 
ATOM 4215  C CB  . THR E 2 13  ? 8.229   -1.132  26.231  1.00 40.79 ? 159 THR E CB  1 
ATOM 4216  O OG1 . THR E 2 13  ? 8.400   0.216   26.672  1.00 42.16 ? 159 THR E OG1 1 
ATOM 4217  C CG2 . THR E 2 13  ? 8.407   -2.048  27.425  1.00 40.23 ? 159 THR E CG2 1 
ATOM 4218  N N   . GLU E 2 14  ? 9.858   0.460   23.776  1.00 40.92 ? 160 GLU E N   1 
ATOM 4219  C CA  . GLU E 2 14  ? 9.744   1.377   22.645  1.00 41.09 ? 160 GLU E CA  1 
ATOM 4220  C C   . GLU E 2 14  ? 9.897   0.587   21.339  1.00 41.45 ? 160 GLU E C   1 
ATOM 4221  O O   . GLU E 2 14  ? 9.056   0.673   20.434  1.00 41.56 ? 160 GLU E O   1 
ATOM 4222  C CB  . GLU E 2 14  ? 10.825  2.456   22.738  1.00 41.17 ? 160 GLU E CB  1 
ATOM 4223  N N   . LYS E 2 15  ? 10.959  -0.208  21.263  1.00 41.46 ? 161 LYS E N   1 
ATOM 4224  C CA  . LYS E 2 15  ? 11.224  -1.018  20.076  1.00 41.92 ? 161 LYS E CA  1 
ATOM 4225  C C   . LYS E 2 15  ? 10.191  -2.133  19.839  1.00 41.87 ? 161 LYS E C   1 
ATOM 4226  O O   . LYS E 2 15  ? 10.286  -2.862  18.849  1.00 41.55 ? 161 LYS E O   1 
ATOM 4227  C CB  . LYS E 2 15  ? 12.633  -1.625  20.166  1.00 40.92 ? 161 LYS E CB  1 
ATOM 4228  N N   . MET E 2 16  ? 9.204   -2.250  20.732  1.00 41.54 ? 162 MET E N   1 
ATOM 4229  C CA  . MET E 2 16  ? 8.170   -3.290  20.636  1.00 41.05 ? 162 MET E CA  1 
ATOM 4230  C C   . MET E 2 16  ? 6.748   -2.785  20.355  1.00 40.89 ? 162 MET E C   1 
ATOM 4231  O O   . MET E 2 16  ? 5.842   -3.580  20.076  1.00 40.45 ? 162 MET E O   1 
ATOM 4232  C CB  . MET E 2 16  ? 8.136   -4.107  21.937  1.00 40.63 ? 162 MET E CB  1 
ATOM 4233  C CG  . MET E 2 16  ? 9.374   -4.939  22.221  1.00 40.58 ? 162 MET E CG  1 
ATOM 4234  S SD  . MET E 2 16  ? 9.340   -5.665  23.883  1.00 41.54 ? 162 MET E SD  1 
ATOM 4235  C CE  . MET E 2 16  ? 8.423   -7.157  23.645  1.00 41.86 ? 162 MET E CE  1 
ATOM 4236  N N   . GLU E 2 17  ? 6.552   -1.473  20.439  1.00 40.62 ? 163 GLU E N   1 
ATOM 4237  C CA  . GLU E 2 17  ? 5.235   -0.870  20.224  1.00 39.48 ? 163 GLU E CA  1 
ATOM 4238  C C   . GLU E 2 17  ? 4.568   -1.252  18.894  1.00 38.70 ? 163 GLU E C   1 
ATOM 4239  O O   . GLU E 2 17  ? 3.362   -1.500  18.842  1.00 38.71 ? 163 GLU E O   1 
ATOM 4240  C CB  . GLU E 2 17  ? 5.348   0.656   20.324  1.00 40.39 ? 163 GLU E CB  1 
ATOM 4241  N N   . LYS E 2 18  ? 5.356   -1.292  17.824  1.00 37.64 ? 164 LYS E N   1 
ATOM 4242  C CA  . LYS E 2 18  ? 4.868   -1.637  16.489  1.00 36.21 ? 164 LYS E CA  1 
ATOM 4243  C C   . LYS E 2 18  ? 4.608   -3.150  16.414  1.00 36.46 ? 164 LYS E C   1 
ATOM 4244  O O   . LYS E 2 18  ? 5.520   -3.933  16.130  1.00 35.70 ? 164 LYS E O   1 
ATOM 4245  C CB  . LYS E 2 18  ? 5.920   -1.189  15.462  1.00 34.99 ? 164 LYS E CB  1 
ATOM 4246  C CG  . LYS E 2 18  ? 5.695   -1.591  14.014  1.00 35.69 ? 164 LYS E CG  1 
ATOM 4247  C CD  . LYS E 2 18  ? 6.832   -1.082  13.140  1.00 34.78 ? 164 LYS E CD  1 
ATOM 4248  C CE  . LYS E 2 18  ? 6.884   -1.778  11.789  1.00 36.01 ? 164 LYS E CE  1 
ATOM 4249  N NZ  . LYS E 2 18  ? 7.988   -1.269  10.905  1.00 35.41 ? 164 LYS E NZ  1 
ATOM 4250  N N   . ARG E 2 19  ? 3.358   -3.549  16.664  1.00 36.68 ? 165 ARG E N   1 
ATOM 4251  C CA  . ARG E 2 19  ? 2.975   -4.963  16.680  1.00 37.20 ? 165 ARG E CA  1 
ATOM 4252  C C   . ARG E 2 19  ? 2.812   -5.614  15.315  1.00 36.66 ? 165 ARG E C   1 
ATOM 4253  O O   . ARG E 2 19  ? 3.229   -6.758  15.110  1.00 36.75 ? 165 ARG E O   1 
ATOM 4254  C CB  . ARG E 2 19  ? 1.703   -5.139  17.514  1.00 38.15 ? 165 ARG E CB  1 
ATOM 4255  C CG  . ARG E 2 19  ? 1.905   -4.753  18.982  1.00 40.58 ? 165 ARG E CG  1 
ATOM 4256  C CD  . ARG E 2 19  ? 0.594   -4.360  19.653  1.00 41.92 ? 165 ARG E CD  1 
ATOM 4257  N NE  . ARG E 2 19  ? 0.779   -3.779  20.987  1.00 43.47 ? 165 ARG E NE  1 
ATOM 4258  C CZ  . ARG E 2 19  ? 1.078   -4.468  22.090  1.00 43.35 ? 165 ARG E CZ  1 
ATOM 4259  N NH1 . ARG E 2 19  ? 1.235   -5.784  22.041  1.00 43.39 ? 165 ARG E NH1 1 
ATOM 4260  N NH2 . ARG E 2 19  ? 1.202   -3.835  23.252  1.00 42.93 ? 165 ARG E NH2 1 
ATOM 4261  N N   . LEU E 2 20  ? 2.211   -4.881  14.386  1.00 36.34 ? 166 LEU E N   1 
ATOM 4262  C CA  . LEU E 2 20  ? 2.005   -5.370  13.027  1.00 34.36 ? 166 LEU E CA  1 
ATOM 4263  C C   . LEU E 2 20  ? 3.154   -4.915  12.145  1.00 34.36 ? 166 LEU E C   1 
ATOM 4264  O O   . LEU E 2 20  ? 3.392   -3.715  12.010  1.00 34.81 ? 166 LEU E O   1 
ATOM 4265  C CB  . LEU E 2 20  ? 0.711   -4.802  12.445  1.00 31.55 ? 166 LEU E CB  1 
ATOM 4266  C CG  . LEU E 2 20  ? 0.540   -5.129  10.966  1.00 29.59 ? 166 LEU E CG  1 
ATOM 4267  C CD1 . LEU E 2 20  ? 0.431   -6.635  10.820  1.00 28.56 ? 166 LEU E CD1 1 
ATOM 4268  C CD2 . LEU E 2 20  ? -0.698  -4.446  10.410  1.00 28.73 ? 166 LEU E CD2 1 
ATOM 4269  N N   . HIS E 2 21  ? 3.868   -5.870  11.558  1.00 34.04 ? 167 HIS E N   1 
ATOM 4270  C CA  . HIS E 2 21  ? 4.984   -5.579  10.653  1.00 33.40 ? 167 HIS E CA  1 
ATOM 4271  C C   . HIS E 2 21  ? 4.572   -5.986  9.245   1.00 33.35 ? 167 HIS E C   1 
ATOM 4272  O O   . HIS E 2 21  ? 4.509   -7.182  8.927   1.00 34.14 ? 167 HIS E O   1 
ATOM 4273  C CB  . HIS E 2 21  ? 6.232   -6.383  11.015  1.00 33.90 ? 167 HIS E CB  1 
ATOM 4274  C CG  . HIS E 2 21  ? 7.090   -5.756  12.065  1.00 35.97 ? 167 HIS E CG  1 
ATOM 4275  N ND1 . HIS E 2 21  ? 6.618   -5.435  13.321  1.00 37.64 ? 167 HIS E ND1 1 
ATOM 4276  C CD2 . HIS E 2 21  ? 8.408   -5.447  12.067  1.00 36.71 ? 167 HIS E CD2 1 
ATOM 4277  C CE1 . HIS E 2 21  ? 7.608   -4.960  14.054  1.00 37.13 ? 167 HIS E CE1 1 
ATOM 4278  N NE2 . HIS E 2 21  ? 8.706   -4.958  13.319  1.00 38.14 ? 167 HIS E NE2 1 
ATOM 4279  N N   . ALA E 2 22  ? 4.282   -4.999  8.407   1.00 31.83 ? 168 ALA E N   1 
ATOM 4280  C CA  . ALA E 2 22  ? 3.906   -5.275  7.036   1.00 30.30 ? 168 ALA E CA  1 
ATOM 4281  C C   . ALA E 2 22  ? 5.069   -4.791  6.194   1.00 30.22 ? 168 ALA E C   1 
ATOM 4282  O O   . ALA E 2 22  ? 5.407   -3.608  6.231   1.00 30.79 ? 168 ALA E O   1 
ATOM 4283  C CB  . ALA E 2 22  ? 2.641   -4.520  6.679   1.00 30.42 ? 168 ALA E CB  1 
ATOM 4284  N N   . VAL E 2 23  ? 5.698   -5.693  5.450   1.00 28.82 ? 169 VAL E N   1 
ATOM 4285  C CA  . VAL E 2 23  ? 6.833   -5.307  4.624   1.00 28.87 ? 169 VAL E CA  1 
ATOM 4286  C C   . VAL E 2 23  ? 6.735   -5.852  3.200   1.00 29.13 ? 169 VAL E C   1 
ATOM 4287  O O   . VAL E 2 23  ? 6.094   -6.879  2.955   1.00 28.32 ? 169 VAL E O   1 
ATOM 4288  C CB  . VAL E 2 23  ? 8.171   -5.805  5.232   1.00 28.78 ? 169 VAL E CB  1 
ATOM 4289  C CG1 . VAL E 2 23  ? 8.285   -5.372  6.671   1.00 27.95 ? 169 VAL E CG1 1 
ATOM 4290  C CG2 . VAL E 2 23  ? 8.275   -7.332  5.119   1.00 29.60 ? 169 VAL E CG2 1 
ATOM 4291  N N   . PRO E 2 24  ? 7.380   -5.169  2.241   1.00 28.51 ? 170 PRO E N   1 
ATOM 4292  C CA  . PRO E 2 24  ? 7.353   -5.610  0.849   1.00 29.10 ? 170 PRO E CA  1 
ATOM 4293  C C   . PRO E 2 24  ? 8.126   -6.914  0.794   1.00 29.61 ? 170 PRO E C   1 
ATOM 4294  O O   . PRO E 2 24  ? 9.136   -7.048  1.477   1.00 30.89 ? 170 PRO E O   1 
ATOM 4295  C CB  . PRO E 2 24  ? 8.070   -4.482  0.133   1.00 28.65 ? 170 PRO E CB  1 
ATOM 4296  C CG  . PRO E 2 24  ? 9.097   -4.093  1.141   1.00 27.45 ? 170 PRO E CG  1 
ATOM 4297  C CD  . PRO E 2 24  ? 8.290   -4.026  2.399   1.00 26.86 ? 170 PRO E CD  1 
ATOM 4298  N N   . ALA E 2 25  ? 7.662   -7.879  0.007   1.00 29.60 ? 171 ALA E N   1 
ATOM 4299  C CA  . ALA E 2 25  ? 8.361   -9.164  -0.076  1.00 29.28 ? 171 ALA E CA  1 
ATOM 4300  C C   . ALA E 2 25  ? 9.836   -8.991  -0.422  1.00 28.94 ? 171 ALA E C   1 
ATOM 4301  O O   . ALA E 2 25  ? 10.257  -7.956  -0.955  1.00 29.27 ? 171 ALA E O   1 
ATOM 4302  C CB  . ALA E 2 25  ? 7.690   -10.080 -1.091  1.00 28.71 ? 171 ALA E CB  1 
ATOM 4303  N N   . ALA E 2 26  ? 10.617  -10.011 -0.091  1.00 28.64 ? 172 ALA E N   1 
ATOM 4304  C CA  . ALA E 2 26  ? 12.053  -10.020 -0.351  1.00 27.48 ? 172 ALA E CA  1 
ATOM 4305  C C   . ALA E 2 26  ? 12.872  -9.201  0.632   1.00 26.80 ? 172 ALA E C   1 
ATOM 4306  O O   . ALA E 2 26  ? 14.077  -9.069  0.483   1.00 27.02 ? 172 ALA E O   1 
ATOM 4307  C CB  . ALA E 2 26  ? 12.321  -9.536  -1.753  1.00 27.62 ? 172 ALA E CB  1 
ATOM 4308  N N   . ASN E 2 27  ? 12.229  -8.641  1.640   1.00 27.49 ? 173 ASN E N   1 
ATOM 4309  C CA  . ASN E 2 27  ? 12.970  -7.849  2.605   1.00 27.77 ? 173 ASN E CA  1 
ATOM 4310  C C   . ASN E 2 27  ? 13.276  -8.696  3.831   1.00 27.38 ? 173 ASN E C   1 
ATOM 4311  O O   . ASN E 2 27  ? 12.722  -9.784  3.999   1.00 27.39 ? 173 ASN E O   1 
ATOM 4312  C CB  . ASN E 2 27  ? 12.178  -6.583  2.975   1.00 28.70 ? 173 ASN E CB  1 
ATOM 4313  C CG  . ASN E 2 27  ? 12.210  -5.523  1.863   1.00 31.21 ? 173 ASN E CG  1 
ATOM 4314  O OD1 . ASN E 2 27  ? 12.144  -5.845  0.664   1.00 33.06 ? 173 ASN E OD1 1 
ATOM 4315  N ND2 . ASN E 2 27  ? 12.298  -4.252  2.258   1.00 31.64 ? 173 ASN E ND2 1 
ATOM 4316  N N   . THR E 2 28  ? 14.197  -8.214  4.658   1.00 27.00 ? 174 THR E N   1 
ATOM 4317  C CA  . THR E 2 28  ? 14.553  -8.907  5.882   1.00 25.94 ? 174 THR E CA  1 
ATOM 4318  C C   . THR E 2 28  ? 13.705  -8.342  7.014   1.00 26.77 ? 174 THR E C   1 
ATOM 4319  O O   . THR E 2 28  ? 13.478  -7.129  7.087   1.00 25.27 ? 174 THR E O   1 
ATOM 4320  C CB  . THR E 2 28  ? 16.011  -8.709  6.232   1.00 24.13 ? 174 THR E CB  1 
ATOM 4321  O OG1 . THR E 2 28  ? 16.803  -9.283  5.198   1.00 24.64 ? 174 THR E OG1 1 
ATOM 4322  C CG2 . THR E 2 28  ? 16.346  -9.380  7.554   1.00 22.39 ? 174 THR E CG2 1 
ATOM 4323  N N   . VAL E 2 29  ? 13.219  -9.229  7.879   1.00 27.43 ? 175 VAL E N   1 
ATOM 4324  C CA  . VAL E 2 29  ? 12.418  -8.810  9.013   1.00 27.46 ? 175 VAL E CA  1 
ATOM 4325  C C   . VAL E 2 29  ? 13.180  -9.230  10.262  1.00 28.25 ? 175 VAL E C   1 
ATOM 4326  O O   . VAL E 2 29  ? 13.727  -10.327 10.320  1.00 28.67 ? 175 VAL E O   1 
ATOM 4327  C CB  . VAL E 2 29  ? 11.031  -9.473  8.970   1.00 27.48 ? 175 VAL E CB  1 
ATOM 4328  C CG1 . VAL E 2 29  ? 10.110  -8.858  10.002  1.00 26.85 ? 175 VAL E CG1 1 
ATOM 4329  C CG2 . VAL E 2 29  ? 10.434  -9.290  7.604   1.00 28.62 ? 175 VAL E CG2 1 
ATOM 4330  N N   . LYS E 2 30  ? 13.241  -8.332  11.236  1.00 29.25 ? 176 LYS E N   1 
ATOM 4331  C CA  . LYS E 2 30  ? 13.934  -8.575  12.497  1.00 30.56 ? 176 LYS E CA  1 
ATOM 4332  C C   . LYS E 2 30  ? 12.974  -8.242  13.638  1.00 31.64 ? 176 LYS E C   1 
ATOM 4333  O O   . LYS E 2 30  ? 12.595  -7.086  13.835  1.00 32.09 ? 176 LYS E O   1 
ATOM 4334  C CB  . LYS E 2 30  ? 15.202  -7.692  12.579  1.00 30.40 ? 176 LYS E CB  1 
ATOM 4335  C CG  . LYS E 2 30  ? 15.917  -7.608  13.967  1.00 31.97 ? 176 LYS E CG  1 
ATOM 4336  C CD  . LYS E 2 30  ? 17.396  -7.040  13.869  1.00 31.24 ? 176 LYS E CD  1 
ATOM 4337  C CE  . LYS E 2 30  ? 18.134  -7.079  15.233  1.00 29.98 ? 176 LYS E CE  1 
ATOM 4338  N NZ  . LYS E 2 30  ? 19.635  -6.988  15.207  1.00 24.95 ? 176 LYS E NZ  1 
ATOM 4339  N N   . PHE E 2 31  ? 12.557  -9.263  14.372  1.00 31.55 ? 177 PHE E N   1 
ATOM 4340  C CA  . PHE E 2 31  ? 11.661  -9.050  15.487  1.00 31.05 ? 177 PHE E CA  1 
ATOM 4341  C C   . PHE E 2 31  ? 12.475  -9.019  16.752  1.00 31.31 ? 177 PHE E C   1 
ATOM 4342  O O   . PHE E 2 31  ? 13.286  -9.914  16.984  1.00 31.40 ? 177 PHE E O   1 
ATOM 4343  C CB  . PHE E 2 31  ? 10.634  -10.165 15.550  1.00 30.97 ? 177 PHE E CB  1 
ATOM 4344  C CG  . PHE E 2 31  ? 9.617   -10.089 14.469  1.00 30.69 ? 177 PHE E CG  1 
ATOM 4345  C CD1 . PHE E 2 31  ? 8.825   -8.955  14.326  1.00 30.99 ? 177 PHE E CD1 1 
ATOM 4346  C CD2 . PHE E 2 31  ? 9.441   -11.144 13.595  1.00 30.87 ? 177 PHE E CD2 1 
ATOM 4347  C CE1 . PHE E 2 31  ? 7.868   -8.872  13.324  1.00 30.92 ? 177 PHE E CE1 1 
ATOM 4348  C CE2 . PHE E 2 31  ? 8.486   -11.071 12.590  1.00 32.91 ? 177 PHE E CE2 1 
ATOM 4349  C CZ  . PHE E 2 31  ? 7.696   -9.927  12.454  1.00 31.10 ? 177 PHE E CZ  1 
ATOM 4350  N N   . ARG E 2 32  ? 12.262  -7.990  17.567  1.00 32.12 ? 178 ARG E N   1 
ATOM 4351  C CA  . ARG E 2 32  ? 13.009  -7.861  18.812  1.00 33.45 ? 178 ARG E CA  1 
ATOM 4352  C C   . ARG E 2 32  ? 12.164  -7.794  20.074  1.00 33.11 ? 178 ARG E C   1 
ATOM 4353  O O   . ARG E 2 32  ? 11.061  -7.249  20.090  1.00 32.07 ? 178 ARG E O   1 
ATOM 4354  C CB  . ARG E 2 32  ? 13.917  -6.640  18.763  1.00 35.14 ? 178 ARG E CB  1 
ATOM 4355  C CG  . ARG E 2 32  ? 14.853  -6.640  17.589  1.00 38.47 ? 178 ARG E CG  1 
ATOM 4356  C CD  . ARG E 2 32  ? 15.855  -5.540  17.726  1.00 41.70 ? 178 ARG E CD  1 
ATOM 4357  N NE  . ARG E 2 32  ? 16.638  -5.718  18.943  1.00 45.56 ? 178 ARG E NE  1 
ATOM 4358  C CZ  . ARG E 2 32  ? 17.756  -5.053  19.219  1.00 46.86 ? 178 ARG E CZ  1 
ATOM 4359  N NH1 . ARG E 2 32  ? 18.236  -4.155  18.355  1.00 47.08 ? 178 ARG E NH1 1 
ATOM 4360  N NH2 . ARG E 2 32  ? 18.393  -5.292  20.360  1.00 46.68 ? 178 ARG E NH2 1 
ATOM 4361  N N   . CYS E 2 33  ? 12.714  -8.355  21.138  1.00 33.71 ? 179 CYS E N   1 
ATOM 4362  C CA  . CYS E 2 33  ? 12.076  -8.386  22.444  1.00 34.75 ? 179 CYS E CA  1 
ATOM 4363  C C   . CYS E 2 33  ? 13.153  -8.241  23.512  1.00 35.51 ? 179 CYS E C   1 
ATOM 4364  O O   . CYS E 2 33  ? 13.386  -9.163  24.306  1.00 35.65 ? 179 CYS E O   1 
ATOM 4365  C CB  . CYS E 2 33  ? 11.352  -9.710  22.632  1.00 35.30 ? 179 CYS E CB  1 
ATOM 4366  S SG  . CYS E 2 33  ? 9.883   -9.844  21.654  1.00 35.24 ? 179 CYS E SG  1 
ATOM 4367  N N   . PRO E 2 34  ? 13.830  -7.078  23.540  1.00 36.09 ? 180 PRO E N   1 
ATOM 4368  C CA  . PRO E 2 34  ? 14.894  -6.813  24.511  1.00 35.69 ? 180 PRO E CA  1 
ATOM 4369  C C   . PRO E 2 34  ? 14.422  -7.126  25.917  1.00 36.45 ? 180 PRO E C   1 
ATOM 4370  O O   . PRO E 2 34  ? 13.422  -6.574  26.392  1.00 36.01 ? 180 PRO E O   1 
ATOM 4371  C CB  . PRO E 2 34  ? 15.185  -5.339  24.300  1.00 35.76 ? 180 PRO E CB  1 
ATOM 4372  C CG  . PRO E 2 34  ? 14.859  -5.147  22.851  1.00 36.31 ? 180 PRO E CG  1 
ATOM 4373  C CD  . PRO E 2 34  ? 13.572  -5.887  22.715  1.00 35.61 ? 180 PRO E CD  1 
ATOM 4374  N N   . ALA E 2 35  ? 15.147  -8.018  26.581  1.00 37.40 ? 181 ALA E N   1 
ATOM 4375  C CA  . ALA E 2 35  ? 14.781  -8.418  27.922  1.00 38.92 ? 181 ALA E CA  1 
ATOM 4376  C C   . ALA E 2 35  ? 15.898  -8.264  28.952  1.00 40.38 ? 181 ALA E C   1 
ATOM 4377  O O   . ALA E 2 35  ? 17.045  -7.945  28.618  1.00 40.28 ? 181 ALA E O   1 
ATOM 4378  C CB  . ALA E 2 35  ? 14.290  -9.857  27.896  1.00 38.10 ? 181 ALA E CB  1 
ATOM 4379  N N   . GLY E 2 36  ? 15.526  -8.496  30.211  1.00 41.72 ? 182 GLY E N   1 
ATOM 4380  C CA  . GLY E 2 36  ? 16.442  -8.414  31.334  1.00 42.06 ? 182 GLY E CA  1 
ATOM 4381  C C   . GLY E 2 36  ? 15.879  -9.299  32.426  1.00 42.63 ? 182 GLY E C   1 
ATOM 4382  O O   . GLY E 2 36  ? 14.787  -9.843  32.267  1.00 43.27 ? 182 GLY E O   1 
ATOM 4383  N N   . GLY E 2 37  ? 16.604  -9.447  33.531  1.00 43.15 ? 183 GLY E N   1 
ATOM 4384  C CA  . GLY E 2 37  ? 16.132  -10.286 34.623  1.00 42.83 ? 183 GLY E CA  1 
ATOM 4385  C C   . GLY E 2 37  ? 17.251  -11.163 35.144  1.00 42.74 ? 183 GLY E C   1 
ATOM 4386  O O   . GLY E 2 37  ? 18.118  -11.571 34.383  1.00 43.04 ? 183 GLY E O   1 
ATOM 4387  N N   . ASN E 2 38  ? 17.241  -11.450 36.439  1.00 42.86 ? 184 ASN E N   1 
ATOM 4388  C CA  . ASN E 2 38  ? 18.283  -12.274 37.037  1.00 42.60 ? 184 ASN E CA  1 
ATOM 4389  C C   . ASN E 2 38  ? 17.730  -13.491 37.765  1.00 41.97 ? 184 ASN E C   1 
ATOM 4390  O O   . ASN E 2 38  ? 16.944  -13.363 38.700  1.00 42.80 ? 184 ASN E O   1 
ATOM 4391  C CB  . ASN E 2 38  ? 19.121  -11.442 38.011  1.00 43.61 ? 184 ASN E CB  1 
ATOM 4392  C CG  . ASN E 2 38  ? 20.103  -12.289 38.787  1.00 43.60 ? 184 ASN E CG  1 
ATOM 4393  O OD1 . ASN E 2 38  ? 20.850  -13.078 38.203  1.00 43.54 ? 184 ASN E OD1 1 
ATOM 4394  N ND2 . ASN E 2 38  ? 20.108  -12.137 40.106  1.00 43.33 ? 184 ASN E ND2 1 
ATOM 4395  N N   . PRO E 2 39  ? 18.166  -14.692 37.370  1.00 41.12 ? 185 PRO E N   1 
ATOM 4396  C CA  . PRO E 2 39  ? 19.134  -14.967 36.302  1.00 41.51 ? 185 PRO E CA  1 
ATOM 4397  C C   . PRO E 2 39  ? 18.683  -14.580 34.887  1.00 41.77 ? 185 PRO E C   1 
ATOM 4398  O O   . PRO E 2 39  ? 17.502  -14.305 34.644  1.00 42.08 ? 185 PRO E O   1 
ATOM 4399  C CB  . PRO E 2 39  ? 19.372  -16.471 36.446  1.00 41.54 ? 185 PRO E CB  1 
ATOM 4400  C CG  . PRO E 2 39  ? 18.040  -16.966 36.904  1.00 40.75 ? 185 PRO E CG  1 
ATOM 4401  C CD  . PRO E 2 39  ? 17.664  -15.946 37.953  1.00 40.45 ? 185 PRO E CD  1 
ATOM 4402  N N   . MET E 2 40  ? 19.647  -14.546 33.968  1.00 41.41 ? 186 MET E N   1 
ATOM 4403  C CA  . MET E 2 40  ? 19.414  -14.220 32.563  1.00 41.91 ? 186 MET E CA  1 
ATOM 4404  C C   . MET E 2 40  ? 18.276  -15.061 32.021  1.00 42.15 ? 186 MET E C   1 
ATOM 4405  O O   . MET E 2 40  ? 18.396  -16.286 31.932  1.00 42.70 ? 186 MET E O   1 
ATOM 4406  C CB  . MET E 2 40  ? 20.651  -14.576 31.743  1.00 43.20 ? 186 MET E CB  1 
ATOM 4407  C CG  . MET E 2 40  ? 21.372  -13.425 31.096  1.00 45.07 ? 186 MET E CG  1 
ATOM 4408  S SD  . MET E 2 40  ? 20.379  -12.598 29.887  1.00 45.10 ? 186 MET E SD  1 
ATOM 4409  C CE  . MET E 2 40  ? 19.832  -11.168 30.856  1.00 46.43 ? 186 MET E CE  1 
ATOM 4410  N N   . PRO E 2 41  ? 17.163  -14.434 31.641  1.00 41.90 ? 187 PRO E N   1 
ATOM 4411  C CA  . PRO E 2 41  ? 16.062  -15.244 31.110  1.00 41.76 ? 187 PRO E CA  1 
ATOM 4412  C C   . PRO E 2 41  ? 16.389  -15.861 29.750  1.00 41.90 ? 187 PRO E C   1 
ATOM 4413  O O   . PRO E 2 41  ? 17.274  -15.379 29.037  1.00 41.92 ? 187 PRO E O   1 
ATOM 4414  C CB  . PRO E 2 41  ? 14.894  -14.253 31.054  1.00 42.70 ? 187 PRO E CB  1 
ATOM 4415  C CG  . PRO E 2 41  ? 15.571  -12.910 30.915  1.00 42.76 ? 187 PRO E CG  1 
ATOM 4416  C CD  . PRO E 2 41  ? 16.751  -13.035 31.849  1.00 43.15 ? 187 PRO E CD  1 
ATOM 4417  N N   . THR E 2 42  ? 15.701  -16.947 29.405  1.00 41.50 ? 188 THR E N   1 
ATOM 4418  C CA  . THR E 2 42  ? 15.929  -17.594 28.112  1.00 42.12 ? 188 THR E CA  1 
ATOM 4419  C C   . THR E 2 42  ? 14.879  -17.098 27.136  1.00 42.25 ? 188 THR E C   1 
ATOM 4420  O O   . THR E 2 42  ? 13.904  -16.459 27.527  1.00 42.87 ? 188 THR E O   1 
ATOM 4421  C CB  . THR E 2 42  ? 15.771  -19.123 28.147  1.00 41.95 ? 188 THR E CB  1 
ATOM 4422  O OG1 . THR E 2 42  ? 14.409  -19.452 28.463  1.00 43.19 ? 188 THR E OG1 1 
ATOM 4423  C CG2 . THR E 2 42  ? 16.709  -19.742 29.144  1.00 41.13 ? 188 THR E CG2 1 
ATOM 4424  N N   . MET E 2 43  ? 15.063  -17.419 25.864  1.00 42.08 ? 189 MET E N   1 
ATOM 4425  C CA  . MET E 2 43  ? 14.115  -16.982 24.859  1.00 42.14 ? 189 MET E CA  1 
ATOM 4426  C C   . MET E 2 43  ? 13.746  -18.015 23.809  1.00 41.28 ? 189 MET E C   1 
ATOM 4427  O O   . MET E 2 43  ? 14.593  -18.722 23.275  1.00 41.45 ? 189 MET E O   1 
ATOM 4428  C CB  . MET E 2 43  ? 14.631  -15.738 24.159  1.00 43.63 ? 189 MET E CB  1 
ATOM 4429  C CG  . MET E 2 43  ? 13.741  -15.284 23.032  1.00 47.78 ? 189 MET E CG  1 
ATOM 4430  S SD  . MET E 2 43  ? 14.263  -13.686 22.416  1.00 52.69 ? 189 MET E SD  1 
ATOM 4431  C CE  . MET E 2 43  ? 12.954  -12.620 23.105  1.00 51.78 ? 189 MET E CE  1 
ATOM 4432  N N   . ARG E 2 44  ? 12.461  -18.080 23.510  1.00 40.30 ? 190 ARG E N   1 
ATOM 4433  C CA  . ARG E 2 44  ? 11.942  -18.998 22.516  1.00 39.67 ? 190 ARG E CA  1 
ATOM 4434  C C   . ARG E 2 44  ? 11.068  -18.196 21.571  1.00 38.19 ? 190 ARG E C   1 
ATOM 4435  O O   . ARG E 2 44  ? 10.537  -17.161 21.954  1.00 39.17 ? 190 ARG E O   1 
ATOM 4436  C CB  . ARG E 2 44  ? 11.109  -20.067 23.201  1.00 40.68 ? 190 ARG E CB  1 
ATOM 4437  C CG  . ARG E 2 44  ? 11.930  -21.012 24.049  1.00 42.77 ? 190 ARG E CG  1 
ATOM 4438  C CD  . ARG E 2 44  ? 11.069  -21.614 25.142  1.00 44.06 ? 190 ARG E CD  1 
ATOM 4439  N NE  . ARG E 2 44  ? 9.693   -21.819 24.704  1.00 44.26 ? 190 ARG E NE  1 
ATOM 4440  C CZ  . ARG E 2 44  ? 8.672   -21.939 25.543  1.00 44.82 ? 190 ARG E CZ  1 
ATOM 4441  N NH1 . ARG E 2 44  ? 8.890   -21.875 26.855  1.00 44.77 ? 190 ARG E NH1 1 
ATOM 4442  N NH2 . ARG E 2 44  ? 7.439   -22.105 25.076  1.00 45.05 ? 190 ARG E NH2 1 
ATOM 4443  N N   . TRP E 2 45  ? 10.935  -18.652 20.332  1.00 36.08 ? 191 TRP E N   1 
ATOM 4444  C CA  . TRP E 2 45  ? 10.076  -17.962 19.376  1.00 34.13 ? 191 TRP E CA  1 
ATOM 4445  C C   . TRP E 2 45  ? 9.018   -18.903 18.843  1.00 34.03 ? 191 TRP E C   1 
ATOM 4446  O O   . TRP E 2 45  ? 9.299   -20.048 18.499  1.00 35.27 ? 191 TRP E O   1 
ATOM 4447  C CB  . TRP E 2 45  ? 10.869  -17.395 18.198  1.00 30.64 ? 191 TRP E CB  1 
ATOM 4448  C CG  . TRP E 2 45  ? 11.673  -16.210 18.549  1.00 28.26 ? 191 TRP E CG  1 
ATOM 4449  C CD1 . TRP E 2 45  ? 12.960  -16.201 18.987  1.00 27.57 ? 191 TRP E CD1 1 
ATOM 4450  C CD2 . TRP E 2 45  ? 11.256  -14.843 18.496  1.00 27.12 ? 191 TRP E CD2 1 
ATOM 4451  N NE1 . TRP E 2 45  ? 13.379  -14.912 19.204  1.00 27.26 ? 191 TRP E NE1 1 
ATOM 4452  C CE2 . TRP E 2 45  ? 12.353  -14.057 18.911  1.00 26.31 ? 191 TRP E CE2 1 
ATOM 4453  C CE3 . TRP E 2 45  ? 10.065  -14.206 18.136  1.00 28.21 ? 191 TRP E CE3 1 
ATOM 4454  C CZ2 . TRP E 2 45  ? 12.297  -12.665 18.977  1.00 26.24 ? 191 TRP E CZ2 1 
ATOM 4455  C CZ3 . TRP E 2 45  ? 10.003  -12.815 18.203  1.00 29.38 ? 191 TRP E CZ3 1 
ATOM 4456  C CH2 . TRP E 2 45  ? 11.120  -12.060 18.619  1.00 28.11 ? 191 TRP E CH2 1 
ATOM 4457  N N   . LEU E 2 46  ? 7.790   -18.418 18.773  1.00 33.13 ? 192 LEU E N   1 
ATOM 4458  C CA  . LEU E 2 46  ? 6.718   -19.242 18.265  1.00 32.35 ? 192 LEU E CA  1 
ATOM 4459  C C   . LEU E 2 46  ? 6.122   -18.643 16.993  1.00 32.97 ? 192 LEU E C   1 
ATOM 4460  O O   . LEU E 2 46  ? 6.104   -17.428 16.803  1.00 33.88 ? 192 LEU E O   1 
ATOM 4461  C CB  . LEU E 2 46  ? 5.633   -19.397 19.331  1.00 30.72 ? 192 LEU E CB  1 
ATOM 4462  C CG  . LEU E 2 46  ? 6.092   -19.862 20.712  1.00 30.05 ? 192 LEU E CG  1 
ATOM 4463  C CD1 . LEU E 2 46  ? 4.867   -20.066 21.570  1.00 29.67 ? 192 LEU E CD1 1 
ATOM 4464  C CD2 . LEU E 2 46  ? 6.910   -21.151 20.620  1.00 27.56 ? 192 LEU E CD2 1 
ATOM 4465  N N   . LYS E 2 47  ? 5.677   -19.509 16.100  1.00 32.25 ? 193 LYS E N   1 
ATOM 4466  C CA  . LYS E 2 47  ? 5.029   -19.054 14.893  1.00 32.93 ? 193 LYS E CA  1 
ATOM 4467  C C   . LYS E 2 47  ? 3.633   -19.619 15.058  1.00 33.87 ? 193 LYS E C   1 
ATOM 4468  O O   . LYS E 2 47  ? 3.441   -20.837 15.089  1.00 34.53 ? 193 LYS E O   1 
ATOM 4469  C CB  . LYS E 2 47  ? 5.677   -19.622 13.620  1.00 32.55 ? 193 LYS E CB  1 
ATOM 4470  C CG  . LYS E 2 47  ? 4.962   -19.179 12.340  1.00 31.45 ? 193 LYS E CG  1 
ATOM 4471  C CD  . LYS E 2 47  ? 5.509   -19.848 11.095  1.00 32.69 ? 193 LYS E CD  1 
ATOM 4472  C CE  . LYS E 2 47  ? 4.719   -19.465 9.837   1.00 32.00 ? 193 LYS E CE  1 
ATOM 4473  N NZ  . LYS E 2 47  ? 5.302   -20.108 8.613   1.00 31.32 ? 193 LYS E NZ  1 
ATOM 4474  N N   . ASN E 2 48  ? 2.663   -18.728 15.187  1.00 34.24 ? 194 ASN E N   1 
ATOM 4475  C CA  . ASN E 2 48  ? 1.281   -19.129 15.373  1.00 33.97 ? 194 ASN E CA  1 
ATOM 4476  C C   . ASN E 2 48  ? 1.128   -20.038 16.588  1.00 33.15 ? 194 ASN E C   1 
ATOM 4477  O O   . ASN E 2 48  ? 0.497   -21.083 16.501  1.00 33.16 ? 194 ASN E O   1 
ATOM 4478  C CB  . ASN E 2 48  ? 0.732   -19.837 14.126  1.00 33.72 ? 194 ASN E CB  1 
ATOM 4479  C CG  . ASN E 2 48  ? 0.770   -18.958 12.878  1.00 34.88 ? 194 ASN E CG  1 
ATOM 4480  O OD1 . ASN E 2 48  ? 0.565   -17.744 12.944  1.00 35.44 ? 194 ASN E OD1 1 
ATOM 4481  N ND2 . ASN E 2 48  ? 1.011   -19.582 11.726  1.00 35.42 ? 194 ASN E ND2 1 
ATOM 4482  N N   . GLY E 2 49  ? 1.716   -19.636 17.711  1.00 32.76 ? 195 GLY E N   1 
ATOM 4483  C CA  . GLY E 2 49  ? 1.593   -20.399 18.940  1.00 32.75 ? 195 GLY E CA  1 
ATOM 4484  C C   . GLY E 2 49  ? 2.295   -21.735 19.023  1.00 34.03 ? 195 GLY E C   1 
ATOM 4485  O O   . GLY E 2 49  ? 2.222   -22.403 20.056  1.00 34.39 ? 195 GLY E O   1 
ATOM 4486  N N   . LYS E 2 50  ? 2.974   -22.135 17.953  1.00 34.93 ? 196 LYS E N   1 
ATOM 4487  C CA  . LYS E 2 50  ? 3.682   -23.407 17.937  1.00 35.41 ? 196 LYS E CA  1 
ATOM 4488  C C   . LYS E 2 50  ? 5.169   -23.139 17.749  1.00 35.96 ? 196 LYS E C   1 
ATOM 4489  O O   . LYS E 2 50  ? 5.559   -22.070 17.293  1.00 36.19 ? 196 LYS E O   1 
ATOM 4490  C CB  . LYS E 2 50  ? 3.146   -24.298 16.803  1.00 34.53 ? 196 LYS E CB  1 
ATOM 4491  N N   . GLU E 2 51  ? 5.993   -24.108 18.127  1.00 37.37 ? 197 GLU E N   1 
ATOM 4492  C CA  . GLU E 2 51  ? 7.442   -24.016 17.990  1.00 38.58 ? 197 GLU E CA  1 
ATOM 4493  C C   . GLU E 2 51  ? 7.799   -23.595 16.564  1.00 39.03 ? 197 GLU E C   1 
ATOM 4494  O O   . GLU E 2 51  ? 7.212   -24.093 15.605  1.00 40.30 ? 197 GLU E O   1 
ATOM 4495  C CB  . GLU E 2 51  ? 8.017   -25.388 18.287  1.00 39.37 ? 197 GLU E CB  1 
ATOM 4496  C CG  . GLU E 2 51  ? 9.498   -25.533 18.146  1.00 41.75 ? 197 GLU E CG  1 
ATOM 4497  C CD  . GLU E 2 51  ? 9.951   -26.880 18.675  1.00 43.45 ? 197 GLU E CD  1 
ATOM 4498  O OE1 . GLU E 2 51  ? 9.443   -27.274 19.754  1.00 43.22 ? 197 GLU E OE1 1 
ATOM 4499  O OE2 . GLU E 2 51  ? 10.802  -27.537 18.031  1.00 43.30 ? 197 GLU E OE2 1 
ATOM 4500  N N   . PHE E 2 52  ? 8.750   -22.677 16.426  1.00 38.00 ? 198 PHE E N   1 
ATOM 4501  C CA  . PHE E 2 52  ? 9.189   -22.197 15.118  1.00 36.96 ? 198 PHE E CA  1 
ATOM 4502  C C   . PHE E 2 52  ? 10.516  -22.905 14.799  1.00 37.73 ? 198 PHE E C   1 
ATOM 4503  O O   . PHE E 2 52  ? 11.548  -22.628 15.420  1.00 35.49 ? 198 PHE E O   1 
ATOM 4504  C CB  . PHE E 2 52  ? 9.390   -20.671 15.184  1.00 36.35 ? 198 PHE E CB  1 
ATOM 4505  C CG  . PHE E 2 52  ? 9.613   -20.000 13.844  1.00 34.03 ? 198 PHE E CG  1 
ATOM 4506  C CD1 . PHE E 2 52  ? 10.235  -18.751 13.783  1.00 33.65 ? 198 PHE E CD1 1 
ATOM 4507  C CD2 . PHE E 2 52  ? 9.169   -20.577 12.658  1.00 33.30 ? 198 PHE E CD2 1 
ATOM 4508  C CE1 . PHE E 2 52  ? 10.412  -18.086 12.555  1.00 33.27 ? 198 PHE E CE1 1 
ATOM 4509  C CE2 . PHE E 2 52  ? 9.342   -19.920 11.431  1.00 31.64 ? 198 PHE E CE2 1 
ATOM 4510  C CZ  . PHE E 2 52  ? 9.965   -18.669 11.384  1.00 31.61 ? 198 PHE E CZ  1 
ATOM 4511  N N   . LYS E 2 53  ? 10.463  -23.830 13.843  1.00 38.92 ? 199 LYS E N   1 
ATOM 4512  C CA  . LYS E 2 53  ? 11.620  -24.615 13.414  1.00 40.31 ? 199 LYS E CA  1 
ATOM 4513  C C   . LYS E 2 53  ? 12.195  -24.117 12.100  1.00 39.77 ? 199 LYS E C   1 
ATOM 4514  O O   . LYS E 2 53  ? 11.486  -23.562 11.271  1.00 40.28 ? 199 LYS E O   1 
ATOM 4515  C CB  . LYS E 2 53  ? 11.237  -26.086 13.235  1.00 42.04 ? 199 LYS E CB  1 
ATOM 4516  C CG  . LYS E 2 53  ? 10.920  -26.830 14.510  1.00 44.03 ? 199 LYS E CG  1 
ATOM 4517  C CD  . LYS E 2 53  ? 10.432  -28.234 14.188  1.00 44.64 ? 199 LYS E CD  1 
ATOM 4518  C CE  . LYS E 2 53  ? 10.185  -29.012 15.463  1.00 45.49 ? 199 LYS E CE  1 
ATOM 4519  N NZ  . LYS E 2 53  ? 9.235   -28.297 16.362  1.00 44.83 ? 199 LYS E NZ  1 
ATOM 4520  N N   . GLN E 2 54  ? 13.486  -24.357 11.914  1.00 39.18 ? 200 GLN E N   1 
ATOM 4521  C CA  . GLN E 2 54  ? 14.201  -23.944 10.718  1.00 38.18 ? 200 GLN E CA  1 
ATOM 4522  C C   . GLN E 2 54  ? 13.594  -24.458 9.423   1.00 39.03 ? 200 GLN E C   1 
ATOM 4523  O O   . GLN E 2 54  ? 13.819  -23.882 8.361   1.00 40.22 ? 200 GLN E O   1 
ATOM 4524  C CB  . GLN E 2 54  ? 15.656  -24.389 10.812  1.00 35.98 ? 200 GLN E CB  1 
ATOM 4525  C CG  . GLN E 2 54  ? 16.443  -23.703 11.915  1.00 33.91 ? 200 GLN E CG  1 
ATOM 4526  C CD  . GLN E 2 54  ? 16.696  -22.235 11.628  1.00 33.70 ? 200 GLN E CD  1 
ATOM 4527  O OE1 . GLN E 2 54  ? 16.647  -21.789 10.480  1.00 33.68 ? 200 GLN E OE1 1 
ATOM 4528  N NE2 . GLN E 2 54  ? 16.985  -21.482 12.667  1.00 32.64 ? 200 GLN E NE2 1 
ATOM 4529  N N   . GLU E 2 55  ? 12.824  -25.538 9.502   1.00 39.15 ? 201 GLU E N   1 
ATOM 4530  C CA  . GLU E 2 55  ? 12.212  -26.109 8.308   1.00 39.52 ? 201 GLU E CA  1 
ATOM 4531  C C   . GLU E 2 55  ? 10.850  -25.521 7.995   1.00 38.86 ? 201 GLU E C   1 
ATOM 4532  O O   . GLU E 2 55  ? 10.252  -25.880 6.981   1.00 39.45 ? 201 GLU E O   1 
ATOM 4533  C CB  . GLU E 2 55  ? 12.076  -27.630 8.444   1.00 40.96 ? 201 GLU E CB  1 
ATOM 4534  C CG  . GLU E 2 55  ? 11.360  -28.082 9.711   1.00 44.42 ? 201 GLU E CG  1 
ATOM 4535  C CD  . GLU E 2 55  ? 12.309  -28.236 10.891  1.00 45.97 ? 201 GLU E CD  1 
ATOM 4536  O OE1 . GLU E 2 55  ? 13.133  -27.330 11.132  1.00 46.18 ? 201 GLU E OE1 1 
ATOM 4537  O OE2 . GLU E 2 55  ? 12.227  -29.269 11.588  1.00 48.29 ? 201 GLU E OE2 1 
ATOM 4538  N N   . HIS E 2 56  ? 10.360  -24.627 8.856   1.00 37.83 ? 202 HIS E N   1 
ATOM 4539  C CA  . HIS E 2 56  ? 9.047   -24.014 8.651   1.00 36.10 ? 202 HIS E CA  1 
ATOM 4540  C C   . HIS E 2 56  ? 9.046   -22.990 7.528   1.00 35.35 ? 202 HIS E C   1 
ATOM 4541  O O   . HIS E 2 56  ? 7.994   -22.500 7.115   1.00 36.30 ? 202 HIS E O   1 
ATOM 4542  C CB  . HIS E 2 56  ? 8.537   -23.380 9.942   1.00 35.85 ? 202 HIS E CB  1 
ATOM 4543  C CG  . HIS E 2 56  ? 8.250   -24.373 11.029  1.00 36.34 ? 202 HIS E CG  1 
ATOM 4544  N ND1 . HIS E 2 56  ? 7.619   -25.577 10.793  1.00 36.06 ? 202 HIS E ND1 1 
ATOM 4545  C CD2 . HIS E 2 56  ? 8.513   -24.341 12.356  1.00 35.04 ? 202 HIS E CD2 1 
ATOM 4546  C CE1 . HIS E 2 56  ? 7.514   -26.244 11.930  1.00 35.57 ? 202 HIS E CE1 1 
ATOM 4547  N NE2 . HIS E 2 56  ? 8.050   -25.515 12.892  1.00 34.31 ? 202 HIS E NE2 1 
ATOM 4548  N N   . ARG E 2 57  ? 10.232  -22.669 7.030   1.00 34.53 ? 203 ARG E N   1 
ATOM 4549  C CA  . ARG E 2 57  ? 10.362  -21.730 5.918   1.00 33.96 ? 203 ARG E CA  1 
ATOM 4550  C C   . ARG E 2 57  ? 11.696  -21.986 5.218   1.00 33.74 ? 203 ARG E C   1 
ATOM 4551  O O   . ARG E 2 57  ? 12.709  -22.251 5.872   1.00 32.98 ? 203 ARG E O   1 
ATOM 4552  C CB  . ARG E 2 57  ? 10.331  -20.281 6.413   1.00 32.08 ? 203 ARG E CB  1 
ATOM 4553  C CG  . ARG E 2 57  ? 11.634  -19.829 7.013   1.00 31.02 ? 203 ARG E CG  1 
ATOM 4554  C CD  . ARG E 2 57  ? 11.539  -18.415 7.506   1.00 32.78 ? 203 ARG E CD  1 
ATOM 4555  N NE  . ARG E 2 57  ? 11.191  -17.479 6.442   1.00 34.00 ? 203 ARG E NE  1 
ATOM 4556  C CZ  . ARG E 2 57  ? 12.038  -16.602 5.908   1.00 33.99 ? 203 ARG E CZ  1 
ATOM 4557  N NH1 . ARG E 2 57  ? 13.293  -16.539 6.340   1.00 33.62 ? 203 ARG E NH1 1 
ATOM 4558  N NH2 . ARG E 2 57  ? 11.626  -15.779 4.943   1.00 34.25 ? 203 ARG E NH2 1 
ATOM 4559  N N   . ILE E 2 58  ? 11.697  -21.914 3.894   1.00 33.18 ? 204 ILE E N   1 
ATOM 4560  C CA  . ILE E 2 58  ? 12.923  -22.114 3.148   1.00 33.76 ? 204 ILE E CA  1 
ATOM 4561  C C   . ILE E 2 58  ? 13.998  -21.151 3.660   1.00 34.31 ? 204 ILE E C   1 
ATOM 4562  O O   . ILE E 2 58  ? 13.763  -19.945 3.793   1.00 34.91 ? 204 ILE E O   1 
ATOM 4563  C CB  . ILE E 2 58  ? 12.711  -21.848 1.652   1.00 34.32 ? 204 ILE E CB  1 
ATOM 4564  C CG1 . ILE E 2 58  ? 11.548  -22.700 1.125   1.00 34.24 ? 204 ILE E CG1 1 
ATOM 4565  C CG2 . ILE E 2 58  ? 14.000  -22.117 0.898   1.00 32.89 ? 204 ILE E CG2 1 
ATOM 4566  C CD1 . ILE E 2 58  ? 11.664  -24.186 1.439   1.00 34.69 ? 204 ILE E CD1 1 
ATOM 4567  N N   . GLY E 2 59  ? 15.178  -21.681 3.952   1.00 34.62 ? 205 GLY E N   1 
ATOM 4568  C CA  . GLY E 2 59  ? 16.247  -20.828 4.430   1.00 34.52 ? 205 GLY E CA  1 
ATOM 4569  C C   . GLY E 2 59  ? 16.222  -20.653 5.930   1.00 34.38 ? 205 GLY E C   1 
ATOM 4570  O O   . GLY E 2 59  ? 17.171  -20.142 6.513   1.00 35.00 ? 205 GLY E O   1 
ATOM 4571  N N   . GLY E 2 60  ? 15.135  -21.079 6.561   1.00 34.31 ? 206 GLY E N   1 
ATOM 4572  C CA  . GLY E 2 60  ? 15.023  -20.954 8.005   1.00 33.65 ? 206 GLY E CA  1 
ATOM 4573  C C   . GLY E 2 60  ? 15.105  -19.517 8.486   1.00 33.27 ? 206 GLY E C   1 
ATOM 4574  O O   . GLY E 2 60  ? 14.717  -18.585 7.793   1.00 33.78 ? 206 GLY E O   1 
ATOM 4575  N N   . TYR E 2 61  ? 15.604  -19.335 9.694   1.00 33.05 ? 207 TYR E N   1 
ATOM 4576  C CA  . TYR E 2 61  ? 15.751  -18.005 10.251  1.00 33.68 ? 207 TYR E CA  1 
ATOM 4577  C C   . TYR E 2 61  ? 16.990  -17.977 11.142  1.00 34.21 ? 207 TYR E C   1 
ATOM 4578  O O   . TYR E 2 61  ? 17.598  -19.015 11.405  1.00 34.13 ? 207 TYR E O   1 
ATOM 4579  C CB  . TYR E 2 61  ? 14.520  -17.613 11.064  1.00 34.65 ? 207 TYR E CB  1 
ATOM 4580  C CG  . TYR E 2 61  ? 14.221  -18.563 12.203  1.00 36.11 ? 207 TYR E CG  1 
ATOM 4581  C CD1 . TYR E 2 61  ? 13.516  -19.754 11.983  1.00 35.75 ? 207 TYR E CD1 1 
ATOM 4582  C CD2 . TYR E 2 61  ? 14.674  -18.291 13.491  1.00 36.09 ? 207 TYR E CD2 1 
ATOM 4583  C CE1 . TYR E 2 61  ? 13.273  -20.647 13.021  1.00 36.72 ? 207 TYR E CE1 1 
ATOM 4584  C CE2 . TYR E 2 61  ? 14.437  -19.171 14.538  1.00 37.88 ? 207 TYR E CE2 1 
ATOM 4585  C CZ  . TYR E 2 61  ? 13.733  -20.346 14.297  1.00 38.57 ? 207 TYR E CZ  1 
ATOM 4586  O OH  . TYR E 2 61  ? 13.460  -21.199 15.341  1.00 39.47 ? 207 TYR E OH  1 
ATOM 4587  N N   . LYS E 2 62  ? 17.362  -16.784 11.594  1.00 34.23 ? 208 LYS E N   1 
ATOM 4588  C CA  . LYS E 2 62  ? 18.527  -16.621 12.448  1.00 34.86 ? 208 LYS E CA  1 
ATOM 4589  C C   . LYS E 2 62  ? 18.108  -15.906 13.719  1.00 37.65 ? 208 LYS E C   1 
ATOM 4590  O O   . LYS E 2 62  ? 17.144  -15.142 13.727  1.00 38.25 ? 208 LYS E O   1 
ATOM 4591  C CB  . LYS E 2 62  ? 19.601  -15.798 11.745  1.00 31.64 ? 208 LYS E CB  1 
ATOM 4592  C CG  . LYS E 2 62  ? 20.026  -16.338 10.417  1.00 28.70 ? 208 LYS E CG  1 
ATOM 4593  C CD  . LYS E 2 62  ? 20.962  -15.403 9.734   1.00 26.90 ? 208 LYS E CD  1 
ATOM 4594  C CE  . LYS E 2 62  ? 21.152  -15.822 8.302   1.00 28.11 ? 208 LYS E CE  1 
ATOM 4595  N NZ  . LYS E 2 62  ? 22.124  -14.915 7.648   1.00 29.25 ? 208 LYS E NZ  1 
ATOM 4596  N N   . VAL E 2 63  ? 18.836  -16.154 14.798  1.00 40.98 ? 209 VAL E N   1 
ATOM 4597  C CA  . VAL E 2 63  ? 18.523  -15.524 16.065  1.00 43.55 ? 209 VAL E CA  1 
ATOM 4598  C C   . VAL E 2 63  ? 19.791  -15.010 16.715  1.00 45.35 ? 209 VAL E C   1 
ATOM 4599  O O   . VAL E 2 63  ? 20.751  -15.746 16.899  1.00 45.59 ? 209 VAL E O   1 
ATOM 4600  C CB  . VAL E 2 63  ? 17.794  -16.508 17.005  1.00 43.17 ? 209 VAL E CB  1 
ATOM 4601  C CG1 . VAL E 2 63  ? 17.569  -15.878 18.363  1.00 43.46 ? 209 VAL E CG1 1 
ATOM 4602  C CG2 . VAL E 2 63  ? 16.456  -16.880 16.403  1.00 43.39 ? 209 VAL E CG2 1 
ATOM 4603  N N   . ARG E 2 64  ? 19.791  -13.726 17.040  1.00 48.15 ? 210 ARG E N   1 
ATOM 4604  C CA  . ARG E 2 64  ? 20.936  -13.106 17.682  1.00 51.23 ? 210 ARG E CA  1 
ATOM 4605  C C   . ARG E 2 64  ? 20.562  -12.898 19.153  1.00 52.65 ? 210 ARG E C   1 
ATOM 4606  O O   . ARG E 2 64  ? 20.025  -11.854 19.520  1.00 53.16 ? 210 ARG E O   1 
ATOM 4607  C CB  . ARG E 2 64  ? 21.254  -11.767 17.001  1.00 52.27 ? 210 ARG E CB  1 
ATOM 4608  C CG  . ARG E 2 64  ? 22.605  -11.168 17.387  1.00 55.23 ? 210 ARG E CG  1 
ATOM 4609  C CD  . ARG E 2 64  ? 23.745  -12.163 17.152  1.00 56.26 ? 210 ARG E CD  1 
ATOM 4610  N NE  . ARG E 2 64  ? 25.022  -11.710 17.705  1.00 56.02 ? 210 ARG E NE  1 
ATOM 4611  C CZ  . ARG E 2 64  ? 26.077  -12.504 17.881  1.00 56.45 ? 210 ARG E CZ  1 
ATOM 4612  N NH1 . ARG E 2 64  ? 25.998  -13.790 17.548  1.00 55.50 ? 210 ARG E NH1 1 
ATOM 4613  N NH2 . ARG E 2 64  ? 27.203  -12.021 18.402  1.00 55.55 ? 210 ARG E NH2 1 
ATOM 4614  N N   . ASN E 2 65  ? 20.839  -13.908 19.978  1.00 53.70 ? 211 ASN E N   1 
ATOM 4615  C CA  . ASN E 2 65  ? 20.527  -13.878 21.407  1.00 54.29 ? 211 ASN E CA  1 
ATOM 4616  C C   . ASN E 2 65  ? 20.917  -12.572 22.082  1.00 54.30 ? 211 ASN E C   1 
ATOM 4617  O O   . ASN E 2 65  ? 20.162  -12.017 22.884  1.00 53.79 ? 211 ASN E O   1 
ATOM 4618  C CB  . ASN E 2 65  ? 21.231  -15.038 22.083  1.00 55.48 ? 211 ASN E CB  1 
ATOM 4619  C CG  . ASN E 2 65  ? 20.972  -16.345 21.374  1.00 57.11 ? 211 ASN E CG  1 
ATOM 4620  O OD1 . ASN E 2 65  ? 19.858  -16.882 21.413  1.00 56.35 ? 211 ASN E OD1 1 
ATOM 4621  N ND2 . ASN E 2 65  ? 21.998  -16.859 20.697  1.00 58.31 ? 211 ASN E ND2 1 
ATOM 4622  N N   . GLN E 2 66  ? 22.108  -12.093 21.747  1.00 54.57 ? 212 GLN E N   1 
ATOM 4623  C CA  . GLN E 2 66  ? 22.628  -10.847 22.292  1.00 54.83 ? 212 GLN E CA  1 
ATOM 4624  C C   . GLN E 2 66  ? 21.630  -9.692  22.140  1.00 54.08 ? 212 GLN E C   1 
ATOM 4625  O O   . GLN E 2 66  ? 21.558  -8.818  23.003  1.00 54.13 ? 212 GLN E O   1 
ATOM 4626  C CB  . GLN E 2 66  ? 23.945  -10.475 21.602  1.00 56.42 ? 212 GLN E CB  1 
ATOM 4627  C CG  . GLN E 2 66  ? 25.071  -11.493 21.780  1.00 58.47 ? 212 GLN E CG  1 
ATOM 4628  C CD  . GLN E 2 66  ? 24.891  -12.775 20.956  1.00 59.66 ? 212 GLN E CD  1 
ATOM 4629  O OE1 . GLN E 2 66  ? 25.707  -13.699 21.053  1.00 60.66 ? 212 GLN E OE1 1 
ATOM 4630  N NE2 . GLN E 2 66  ? 23.834  -12.834 20.143  1.00 59.37 ? 212 GLN E NE2 1 
ATOM 4631  N N   . HIS E 2 67  ? 20.859  -9.679  21.056  1.00 52.71 ? 213 HIS E N   1 
ATOM 4632  C CA  . HIS E 2 67  ? 19.900  -8.595  20.870  1.00 51.33 ? 213 HIS E CA  1 
ATOM 4633  C C   . HIS E 2 67  ? 18.445  -9.035  20.985  1.00 49.18 ? 213 HIS E C   1 
ATOM 4634  O O   . HIS E 2 67  ? 17.529  -8.291  20.610  1.00 49.20 ? 213 HIS E O   1 
ATOM 4635  C CB  . HIS E 2 67  ? 20.134  -7.898  19.524  1.00 53.82 ? 213 HIS E CB  1 
ATOM 4636  C CG  . HIS E 2 67  ? 21.558  -7.497  19.301  1.00 56.19 ? 213 HIS E CG  1 
ATOM 4637  N ND1 . HIS E 2 67  ? 22.371  -7.041  20.317  1.00 57.07 ? 213 HIS E ND1 1 
ATOM 4638  C CD2 . HIS E 2 67  ? 22.319  -7.490  18.179  1.00 57.10 ? 213 HIS E CD2 1 
ATOM 4639  C CE1 . HIS E 2 67  ? 23.571  -6.774  19.835  1.00 57.45 ? 213 HIS E CE1 1 
ATOM 4640  N NE2 . HIS E 2 67  ? 23.566  -7.038  18.539  1.00 58.25 ? 213 HIS E NE2 1 
ATOM 4641  N N   . TRP E 2 68  ? 18.229  -10.234 21.516  1.00 45.90 ? 214 TRP E N   1 
ATOM 4642  C CA  . TRP E 2 68  ? 16.873  -10.757 21.684  1.00 43.54 ? 214 TRP E CA  1 
ATOM 4643  C C   . TRP E 2 68  ? 16.069  -10.603 20.407  1.00 41.81 ? 214 TRP E C   1 
ATOM 4644  O O   . TRP E 2 68  ? 14.903  -10.214 20.444  1.00 41.69 ? 214 TRP E O   1 
ATOM 4645  C CB  . TRP E 2 68  ? 16.150  -10.005 22.797  1.00 43.46 ? 214 TRP E CB  1 
ATOM 4646  C CG  . TRP E 2 68  ? 16.924  -9.961  24.053  1.00 44.68 ? 214 TRP E CG  1 
ATOM 4647  C CD1 . TRP E 2 68  ? 17.817  -9.007  24.429  1.00 44.01 ? 214 TRP E CD1 1 
ATOM 4648  C CD2 . TRP E 2 68  ? 16.932  -10.953 25.086  1.00 45.98 ? 214 TRP E CD2 1 
ATOM 4649  N NE1 . TRP E 2 68  ? 18.386  -9.339  25.631  1.00 44.50 ? 214 TRP E NE1 1 
ATOM 4650  C CE2 . TRP E 2 68  ? 17.862  -10.530 26.060  1.00 45.61 ? 214 TRP E CE2 1 
ATOM 4651  C CE3 . TRP E 2 68  ? 16.248  -12.163 25.280  1.00 45.65 ? 214 TRP E CE3 1 
ATOM 4652  C CZ2 . TRP E 2 68  ? 18.127  -11.273 27.222  1.00 45.95 ? 214 TRP E CZ2 1 
ATOM 4653  C CZ3 . TRP E 2 68  ? 16.515  -12.904 26.436  1.00 46.39 ? 214 TRP E CZ3 1 
ATOM 4654  C CH2 . TRP E 2 68  ? 17.446  -12.454 27.389  1.00 45.75 ? 214 TRP E CH2 1 
ATOM 4655  N N   . SER E 2 69  ? 16.679  -10.917 19.273  1.00 39.62 ? 215 SER E N   1 
ATOM 4656  C CA  . SER E 2 69  ? 15.989  -10.749 18.010  1.00 37.01 ? 215 SER E CA  1 
ATOM 4657  C C   . SER E 2 69  ? 15.800  -12.016 17.195  1.00 35.31 ? 215 SER E C   1 
ATOM 4658  O O   . SER E 2 69  ? 16.512  -13.005 17.373  1.00 35.27 ? 215 SER E O   1 
ATOM 4659  C CB  . SER E 2 69  ? 16.738  -9.714  17.172  1.00 37.52 ? 215 SER E CB  1 
ATOM 4660  O OG  . SER E 2 69  ? 18.018  -10.203 16.810  1.00 38.46 ? 215 SER E OG  1 
ATOM 4661  N N   . LEU E 2 70  ? 14.822  -11.963 16.297  1.00 33.61 ? 216 LEU E N   1 
ATOM 4662  C CA  . LEU E 2 70  ? 14.503  -13.063 15.394  1.00 32.05 ? 216 LEU E CA  1 
ATOM 4663  C C   . LEU E 2 70  ? 14.678  -12.476 14.005  1.00 30.98 ? 216 LEU E C   1 
ATOM 4664  O O   . LEU E 2 70  ? 14.104  -11.436 13.691  1.00 29.85 ? 216 LEU E O   1 
ATOM 4665  C CB  . LEU E 2 70  ? 13.050  -13.518 15.586  1.00 32.06 ? 216 LEU E CB  1 
ATOM 4666  C CG  . LEU E 2 70  ? 12.478  -14.463 14.524  1.00 32.02 ? 216 LEU E CG  1 
ATOM 4667  C CD1 . LEU E 2 70  ? 13.183  -15.772 14.602  1.00 32.67 ? 216 LEU E CD1 1 
ATOM 4668  C CD2 . LEU E 2 70  ? 10.989  -14.664 14.739  1.00 32.61 ? 216 LEU E CD2 1 
ATOM 4669  N N   . ILE E 2 71  ? 15.473  -13.134 13.171  1.00 30.61 ? 217 ILE E N   1 
ATOM 4670  C CA  . ILE E 2 71  ? 15.712  -12.630 11.831  1.00 29.66 ? 217 ILE E CA  1 
ATOM 4671  C C   . ILE E 2 71  ? 15.300  -13.568 10.701  1.00 30.04 ? 217 ILE E C   1 
ATOM 4672  O O   . ILE E 2 71  ? 15.728  -14.720 10.642  1.00 30.02 ? 217 ILE E O   1 
ATOM 4673  C CB  . ILE E 2 71  ? 17.183  -12.268 11.671  1.00 29.57 ? 217 ILE E CB  1 
ATOM 4674  C CG1 . ILE E 2 71  ? 17.485  -11.031 12.509  1.00 30.29 ? 217 ILE E CG1 1 
ATOM 4675  C CG2 . ILE E 2 71  ? 17.508  -11.996 10.223  1.00 30.55 ? 217 ILE E CG2 1 
ATOM 4676  C CD1 . ILE E 2 71  ? 18.941  -10.899 12.876  1.00 32.44 ? 217 ILE E CD1 1 
ATOM 4677  N N   . MET E 2 72  ? 14.454  -13.053 9.812   1.00 29.96 ? 218 MET E N   1 
ATOM 4678  C CA  . MET E 2 72  ? 13.979  -13.800 8.655   1.00 29.85 ? 218 MET E CA  1 
ATOM 4679  C C   . MET E 2 72  ? 14.369  -12.994 7.416   1.00 29.83 ? 218 MET E C   1 
ATOM 4680  O O   . MET E 2 72  ? 13.976  -11.833 7.258   1.00 30.46 ? 218 MET E O   1 
ATOM 4681  C CB  . MET E 2 72  ? 12.457  -13.992 8.728   1.00 29.92 ? 218 MET E CB  1 
ATOM 4682  C CG  . MET E 2 72  ? 12.004  -14.849 9.899   1.00 30.17 ? 218 MET E CG  1 
ATOM 4683  S SD  . MET E 2 72  ? 10.209  -14.857 10.160  1.00 29.43 ? 218 MET E SD  1 
ATOM 4684  C CE  . MET E 2 72  ? 9.751   -15.959 8.874   1.00 33.92 ? 218 MET E CE  1 
ATOM 4685  N N   . GLU E 2 73  ? 15.154  -13.620 6.545   1.00 29.48 ? 219 GLU E N   1 
ATOM 4686  C CA  . GLU E 2 73  ? 15.636  -12.973 5.335   1.00 28.41 ? 219 GLU E CA  1 
ATOM 4687  C C   . GLU E 2 73  ? 14.770  -13.288 4.129   1.00 28.66 ? 219 GLU E C   1 
ATOM 4688  O O   . GLU E 2 73  ? 14.167  -14.364 4.039   1.00 27.94 ? 219 GLU E O   1 
ATOM 4689  C CB  . GLU E 2 73  ? 17.092  -13.394 5.068   1.00 27.30 ? 219 GLU E CB  1 
ATOM 4690  C CG  . GLU E 2 73  ? 18.033  -13.008 6.198   1.00 26.50 ? 219 GLU E CG  1 
ATOM 4691  C CD  . GLU E 2 73  ? 19.265  -13.892 6.295   1.00 27.30 ? 219 GLU E CD  1 
ATOM 4692  O OE1 . GLU E 2 73  ? 19.156  -15.124 6.119   1.00 27.20 ? 219 GLU E OE1 1 
ATOM 4693  O OE2 . GLU E 2 73  ? 20.350  -13.352 6.576   1.00 29.03 ? 219 GLU E OE2 1 
ATOM 4694  N N   . SER E 2 74  ? 14.702  -12.320 3.217   1.00 28.89 ? 220 SER E N   1 
ATOM 4695  C CA  . SER E 2 74  ? 13.948  -12.468 1.987   1.00 28.91 ? 220 SER E CA  1 
ATOM 4696  C C   . SER E 2 74  ? 12.547  -13.037 2.241   1.00 28.54 ? 220 SER E C   1 
ATOM 4697  O O   . SER E 2 74  ? 12.178  -14.092 1.713   1.00 29.60 ? 220 SER E O   1 
ATOM 4698  C CB  . SER E 2 74  ? 14.755  -13.370 1.058   1.00 28.34 ? 220 SER E CB  1 
ATOM 4699  O OG  . SER E 2 74  ? 14.143  -13.450 -0.213  1.00 35.13 ? 220 SER E OG  1 
ATOM 4700  N N   . VAL E 2 75  ? 11.762  -12.334 3.047   1.00 27.30 ? 221 VAL E N   1 
ATOM 4701  C CA  . VAL E 2 75  ? 10.419  -12.803 3.368   1.00 27.00 ? 221 VAL E CA  1 
ATOM 4702  C C   . VAL E 2 75  ? 9.501   -12.934 2.157   1.00 27.20 ? 221 VAL E C   1 
ATOM 4703  O O   . VAL E 2 75  ? 9.662   -12.247 1.144   1.00 27.60 ? 221 VAL E O   1 
ATOM 4704  C CB  . VAL E 2 75  ? 9.747   -11.889 4.392   1.00 25.81 ? 221 VAL E CB  1 
ATOM 4705  C CG1 . VAL E 2 75  ? 10.475  -11.986 5.724   1.00 25.47 ? 221 VAL E CG1 1 
ATOM 4706  C CG2 . VAL E 2 75  ? 9.760   -10.465 3.889   1.00 25.59 ? 221 VAL E CG2 1 
ATOM 4707  N N   . VAL E 2 76  ? 8.535   -13.834 2.276   1.00 27.02 ? 222 VAL E N   1 
ATOM 4708  C CA  . VAL E 2 76  ? 7.565   -14.096 1.215   1.00 26.84 ? 222 VAL E CA  1 
ATOM 4709  C C   . VAL E 2 76  ? 6.191   -14.172 1.851   1.00 27.53 ? 222 VAL E C   1 
ATOM 4710  O O   . VAL E 2 76  ? 6.071   -14.319 3.069   1.00 27.62 ? 222 VAL E O   1 
ATOM 4711  C CB  . VAL E 2 76  ? 7.827   -15.464 0.501   1.00 27.30 ? 222 VAL E CB  1 
ATOM 4712  C CG1 . VAL E 2 76  ? 9.157   -15.441 -0.237  1.00 24.87 ? 222 VAL E CG1 1 
ATOM 4713  C CG2 . VAL E 2 76  ? 7.804   -16.612 1.527   1.00 26.16 ? 222 VAL E CG2 1 
ATOM 4714  N N   . PRO E 2 77  ? 5.131   -14.113 1.033   1.00 28.52 ? 223 PRO E N   1 
ATOM 4715  C CA  . PRO E 2 77  ? 3.751   -14.176 1.536   1.00 28.50 ? 223 PRO E CA  1 
ATOM 4716  C C   . PRO E 2 77  ? 3.466   -15.292 2.550   1.00 28.21 ? 223 PRO E C   1 
ATOM 4717  O O   . PRO E 2 77  ? 2.781   -15.066 3.551   1.00 29.07 ? 223 PRO E O   1 
ATOM 4718  C CB  . PRO E 2 77  ? 2.926   -14.336 0.263   1.00 26.56 ? 223 PRO E CB  1 
ATOM 4719  C CG  . PRO E 2 77  ? 3.717   -13.561 -0.730  1.00 27.16 ? 223 PRO E CG  1 
ATOM 4720  C CD  . PRO E 2 77  ? 5.135   -14.030 -0.437  1.00 27.60 ? 223 PRO E CD  1 
ATOM 4721  N N   . SER E 2 78  ? 3.991   -16.487 2.309   1.00 27.38 ? 224 SER E N   1 
ATOM 4722  C CA  . SER E 2 78  ? 3.737   -17.585 3.236   1.00 27.66 ? 224 SER E CA  1 
ATOM 4723  C C   . SER E 2 78  ? 4.299   -17.363 4.635   1.00 27.80 ? 224 SER E C   1 
ATOM 4724  O O   . SER E 2 78  ? 3.990   -18.128 5.546   1.00 29.07 ? 224 SER E O   1 
ATOM 4725  C CB  . SER E 2 78  ? 4.269   -18.903 2.673   1.00 27.16 ? 224 SER E CB  1 
ATOM 4726  O OG  . SER E 2 78  ? 5.581   -18.751 2.155   1.00 28.64 ? 224 SER E OG  1 
ATOM 4727  N N   . ASP E 2 79  ? 5.124   -16.332 4.818   1.00 28.23 ? 225 ASP E N   1 
ATOM 4728  C CA  . ASP E 2 79  ? 5.695   -16.049 6.145   1.00 27.58 ? 225 ASP E CA  1 
ATOM 4729  C C   . ASP E 2 79  ? 4.679   -15.322 7.015   1.00 27.47 ? 225 ASP E C   1 
ATOM 4730  O O   . ASP E 2 79  ? 4.875   -15.151 8.219   1.00 26.44 ? 225 ASP E O   1 
ATOM 4731  C CB  . ASP E 2 79  ? 6.962   -15.194 6.040   1.00 26.99 ? 225 ASP E CB  1 
ATOM 4732  C CG  . ASP E 2 79  ? 8.143   -15.971 5.496   1.00 28.32 ? 225 ASP E CG  1 
ATOM 4733  O OD1 . ASP E 2 79  ? 8.409   -17.089 6.012   1.00 27.88 ? 225 ASP E OD1 1 
ATOM 4734  O OD2 . ASP E 2 79  ? 8.804   -15.463 4.559   1.00 26.66 ? 225 ASP E OD2 1 
ATOM 4735  N N   . LYS E 2 80  ? 3.591   -14.891 6.389   1.00 27.24 ? 226 LYS E N   1 
ATOM 4736  C CA  . LYS E 2 80  ? 2.541   -14.199 7.108   1.00 27.92 ? 226 LYS E CA  1 
ATOM 4737  C C   . LYS E 2 80  ? 2.137   -15.045 8.317   1.00 26.76 ? 226 LYS E C   1 
ATOM 4738  O O   . LYS E 2 80  ? 2.090   -16.269 8.235   1.00 25.74 ? 226 LYS E O   1 
ATOM 4739  C CB  . LYS E 2 80  ? 1.324   -13.983 6.196   1.00 30.37 ? 226 LYS E CB  1 
ATOM 4740  C CG  . LYS E 2 80  ? 0.234   -13.144 6.854   1.00 31.65 ? 226 LYS E CG  1 
ATOM 4741  C CD  . LYS E 2 80  ? -0.952  -12.910 5.938   1.00 32.97 ? 226 LYS E CD  1 
ATOM 4742  C CE  . LYS E 2 80  ? -1.944  -11.906 6.547   1.00 33.89 ? 226 LYS E CE  1 
ATOM 4743  N NZ  . LYS E 2 80  ? -3.212  -11.781 5.755   1.00 33.59 ? 226 LYS E NZ  1 
ATOM 4744  N N   . GLY E 2 81  ? 1.851   -14.388 9.435   1.00 25.68 ? 227 GLY E N   1 
ATOM 4745  C CA  . GLY E 2 81  ? 1.453   -15.122 10.619  1.00 25.85 ? 227 GLY E CA  1 
ATOM 4746  C C   . GLY E 2 81  ? 1.881   -14.428 11.888  1.00 25.95 ? 227 GLY E C   1 
ATOM 4747  O O   . GLY E 2 81  ? 2.428   -13.329 11.835  1.00 25.90 ? 227 GLY E O   1 
ATOM 4748  N N   . ASN E 2 82  ? 1.638   -15.061 13.033  1.00 26.48 ? 228 ASN E N   1 
ATOM 4749  C CA  . ASN E 2 82  ? 2.024   -14.460 14.302  1.00 27.86 ? 228 ASN E CA  1 
ATOM 4750  C C   . ASN E 2 82  ? 3.318   -15.027 14.851  1.00 28.19 ? 228 ASN E C   1 
ATOM 4751  O O   . ASN E 2 82  ? 3.516   -16.248 14.866  1.00 29.39 ? 228 ASN E O   1 
ATOM 4752  C CB  . ASN E 2 82  ? 0.922   -14.634 15.350  1.00 28.72 ? 228 ASN E CB  1 
ATOM 4753  C CG  . ASN E 2 82  ? -0.373  -13.973 14.946  1.00 28.73 ? 228 ASN E CG  1 
ATOM 4754  O OD1 . ASN E 2 82  ? -0.389  -12.837 14.461  1.00 30.16 ? 228 ASN E OD1 1 
ATOM 4755  N ND2 . ASN E 2 82  ? -1.476  -14.675 15.148  1.00 29.57 ? 228 ASN E ND2 1 
ATOM 4756  N N   . TYR E 2 83  ? 4.204   -14.136 15.288  1.00 27.23 ? 229 TYR E N   1 
ATOM 4757  C CA  . TYR E 2 83  ? 5.473   -14.558 15.861  1.00 26.62 ? 229 TYR E CA  1 
ATOM 4758  C C   . TYR E 2 83  ? 5.513   -14.094 17.300  1.00 27.58 ? 229 TYR E C   1 
ATOM 4759  O O   . TYR E 2 83  ? 5.350   -12.905 17.598  1.00 27.79 ? 229 TYR E O   1 
ATOM 4760  C CB  . TYR E 2 83  ? 6.639   -13.993 15.063  1.00 26.21 ? 229 TYR E CB  1 
ATOM 4761  C CG  . TYR E 2 83  ? 6.645   -14.539 13.660  1.00 25.40 ? 229 TYR E CG  1 
ATOM 4762  C CD1 . TYR E 2 83  ? 5.873   -13.942 12.661  1.00 23.89 ? 229 TYR E CD1 1 
ATOM 4763  C CD2 . TYR E 2 83  ? 7.348   -15.707 13.348  1.00 24.37 ? 229 TYR E CD2 1 
ATOM 4764  C CE1 . TYR E 2 83  ? 5.797   -14.488 11.400  1.00 24.15 ? 229 TYR E CE1 1 
ATOM 4765  C CE2 . TYR E 2 83  ? 7.272   -16.262 12.081  1.00 24.41 ? 229 TYR E CE2 1 
ATOM 4766  C CZ  . TYR E 2 83  ? 6.493   -15.645 11.119  1.00 24.53 ? 229 TYR E CZ  1 
ATOM 4767  O OH  . TYR E 2 83  ? 6.393   -16.205 9.876   1.00 26.42 ? 229 TYR E OH  1 
ATOM 4768  N N   . THR E 2 84  ? 5.717   -15.047 18.202  1.00 27.41 ? 230 THR E N   1 
ATOM 4769  C CA  . THR E 2 84  ? 5.722   -14.750 19.622  1.00 25.93 ? 230 THR E CA  1 
ATOM 4770  C C   . THR E 2 84  ? 7.033   -15.086 20.278  1.00 25.94 ? 230 THR E C   1 
ATOM 4771  O O   . THR E 2 84  ? 7.603   -16.158 20.083  1.00 27.13 ? 230 THR E O   1 
ATOM 4772  C CB  . THR E 2 84  ? 4.595   -15.522 20.347  1.00 26.02 ? 230 THR E CB  1 
ATOM 4773  O OG1 . THR E 2 84  ? 3.333   -15.178 19.767  1.00 27.25 ? 230 THR E OG1 1 
ATOM 4774  C CG2 . THR E 2 84  ? 4.564   -15.177 21.810  1.00 25.95 ? 230 THR E CG2 1 
ATOM 4775  N N   . CYS E 2 85  ? 7.511   -14.151 21.070  1.00 25.82 ? 231 CYS E N   1 
ATOM 4776  C CA  . CYS E 2 85  ? 8.751   -14.351 21.775  1.00 26.28 ? 231 CYS E CA  1 
ATOM 4777  C C   . CYS E 2 85  ? 8.347   -14.702 23.199  1.00 26.14 ? 231 CYS E C   1 
ATOM 4778  O O   . CYS E 2 85  ? 7.487   -14.042 23.788  1.00 24.63 ? 231 CYS E O   1 
ATOM 4779  C CB  . CYS E 2 85  ? 9.569   -13.063 21.761  1.00 25.46 ? 231 CYS E CB  1 
ATOM 4780  S SG  . CYS E 2 85  ? 8.732   -11.760 22.663  1.00 25.04 ? 231 CYS E SG  1 
ATOM 4781  N N   . VAL E 2 86  ? 8.954   -15.752 23.734  1.00 27.05 ? 232 VAL E N   1 
ATOM 4782  C CA  . VAL E 2 86  ? 8.671   -16.181 25.087  1.00 28.99 ? 232 VAL E CA  1 
ATOM 4783  C C   . VAL E 2 86  ? 9.955   -16.142 25.909  1.00 29.94 ? 232 VAL E C   1 
ATOM 4784  O O   . VAL E 2 86  ? 10.869  -16.935 25.690  1.00 30.61 ? 232 VAL E O   1 
ATOM 4785  C CB  . VAL E 2 86  ? 8.087   -17.600 25.089  1.00 29.34 ? 232 VAL E CB  1 
ATOM 4786  C CG1 . VAL E 2 86  ? 7.889   -18.077 26.518  1.00 28.41 ? 232 VAL E CG1 1 
ATOM 4787  C CG2 . VAL E 2 86  ? 6.757   -17.603 24.318  1.00 27.83 ? 232 VAL E CG2 1 
ATOM 4788  N N   . VAL E 2 87  ? 10.012  -15.200 26.844  1.00 31.17 ? 233 VAL E N   1 
ATOM 4789  C CA  . VAL E 2 87  ? 11.165  -15.017 27.721  1.00 31.72 ? 233 VAL E CA  1 
ATOM 4790  C C   . VAL E 2 87  ? 10.854  -15.495 29.136  1.00 33.50 ? 233 VAL E C   1 
ATOM 4791  O O   . VAL E 2 87  ? 9.759   -15.256 29.655  1.00 34.01 ? 233 VAL E O   1 
ATOM 4792  C CB  . VAL E 2 87  ? 11.551  -13.536 27.789  1.00 30.18 ? 233 VAL E CB  1 
ATOM 4793  C CG1 . VAL E 2 87  ? 12.849  -13.372 28.533  1.00 28.08 ? 233 VAL E CG1 1 
ATOM 4794  C CG2 . VAL E 2 87  ? 11.659  -12.979 26.391  1.00 30.85 ? 233 VAL E CG2 1 
ATOM 4795  N N   . GLU E 2 88  ? 11.811  -16.163 29.769  1.00 36.13 ? 234 GLU E N   1 
ATOM 4796  C CA  . GLU E 2 88  ? 11.576  -16.640 31.127  1.00 38.67 ? 234 GLU E CA  1 
ATOM 4797  C C   . GLU E 2 88  ? 12.791  -17.030 31.973  1.00 38.42 ? 234 GLU E C   1 
ATOM 4798  O O   . GLU E 2 88  ? 13.899  -17.217 31.467  1.00 38.61 ? 234 GLU E O   1 
ATOM 4799  C CB  . GLU E 2 88  ? 10.604  -17.824 31.078  1.00 40.80 ? 234 GLU E CB  1 
ATOM 4800  C CG  . GLU E 2 88  ? 11.046  -18.982 30.190  1.00 44.10 ? 234 GLU E CG  1 
ATOM 4801  C CD  . GLU E 2 88  ? 9.948   -20.047 30.018  1.00 47.19 ? 234 GLU E CD  1 
ATOM 4802  O OE1 . GLU E 2 88  ? 8.981   -19.815 29.242  1.00 46.05 ? 234 GLU E OE1 1 
ATOM 4803  O OE2 . GLU E 2 88  ? 10.053  -21.115 30.673  1.00 48.33 ? 234 GLU E OE2 1 
ATOM 4804  N N   . ASN E 2 89  ? 12.548  -17.111 33.279  1.00 38.32 ? 235 ASN E N   1 
ATOM 4805  C CA  . ASN E 2 89  ? 13.522  -17.545 34.275  1.00 36.95 ? 235 ASN E CA  1 
ATOM 4806  C C   . ASN E 2 89  ? 12.680  -18.104 35.426  1.00 37.30 ? 235 ASN E C   1 
ATOM 4807  O O   . ASN E 2 89  ? 11.452  -18.129 35.334  1.00 36.33 ? 235 ASN E O   1 
ATOM 4808  C CB  . ASN E 2 89  ? 14.460  -16.404 34.732  1.00 34.90 ? 235 ASN E CB  1 
ATOM 4809  C CG  . ASN E 2 89  ? 13.754  -15.294 35.519  1.00 35.36 ? 235 ASN E CG  1 
ATOM 4810  O OD1 . ASN E 2 89  ? 12.722  -15.504 36.160  1.00 34.40 ? 235 ASN E OD1 1 
ATOM 4811  N ND2 . ASN E 2 89  ? 14.347  -14.100 35.495  1.00 33.95 ? 235 ASN E ND2 1 
ATOM 4812  N N   . GLU E 2 90  ? 13.312  -18.554 36.503  1.00 38.39 ? 236 GLU E N   1 
ATOM 4813  C CA  . GLU E 2 90  ? 12.559  -19.141 37.603  1.00 39.72 ? 236 GLU E CA  1 
ATOM 4814  C C   . GLU E 2 90  ? 11.573  -18.231 38.337  1.00 39.81 ? 236 GLU E C   1 
ATOM 4815  O O   . GLU E 2 90  ? 10.772  -18.700 39.144  1.00 40.53 ? 236 GLU E O   1 
ATOM 4816  C CB  . GLU E 2 90  ? 13.524  -19.772 38.605  1.00 41.45 ? 236 GLU E CB  1 
ATOM 4817  C CG  . GLU E 2 90  ? 14.536  -18.820 39.212  1.00 44.12 ? 236 GLU E CG  1 
ATOM 4818  C CD  . GLU E 2 90  ? 15.319  -19.463 40.357  1.00 45.90 ? 236 GLU E CD  1 
ATOM 4819  O OE1 . GLU E 2 90  ? 14.695  -20.161 41.193  1.00 46.68 ? 236 GLU E OE1 1 
ATOM 4820  O OE2 . GLU E 2 90  ? 16.551  -19.261 40.432  1.00 47.20 ? 236 GLU E OE2 1 
ATOM 4821  N N   . TYR E 2 91  ? 11.606  -16.940 38.044  1.00 40.04 ? 237 TYR E N   1 
ATOM 4822  C CA  . TYR E 2 91  ? 10.718  -16.003 38.714  1.00 40.09 ? 237 TYR E CA  1 
ATOM 4823  C C   . TYR E 2 91  ? 9.583   -15.495 37.821  1.00 38.43 ? 237 TYR E C   1 
ATOM 4824  O O   . TYR E 2 91  ? 8.792   -14.642 38.227  1.00 38.21 ? 237 TYR E O   1 
ATOM 4825  C CB  . TYR E 2 91  ? 11.573  -14.857 39.253  1.00 41.98 ? 237 TYR E CB  1 
ATOM 4826  C CG  . TYR E 2 91  ? 12.689  -15.352 40.152  1.00 44.68 ? 237 TYR E CG  1 
ATOM 4827  C CD1 . TYR E 2 91  ? 13.931  -14.717 40.180  1.00 46.09 ? 237 TYR E CD1 1 
ATOM 4828  C CD2 . TYR E 2 91  ? 12.497  -16.453 40.992  1.00 46.25 ? 237 TYR E CD2 1 
ATOM 4829  C CE1 . TYR E 2 91  ? 14.959  -15.167 41.023  1.00 47.58 ? 237 TYR E CE1 1 
ATOM 4830  C CE2 . TYR E 2 91  ? 13.515  -16.909 41.840  1.00 47.40 ? 237 TYR E CE2 1 
ATOM 4831  C CZ  . TYR E 2 91  ? 14.744  -16.262 41.852  1.00 48.17 ? 237 TYR E CZ  1 
ATOM 4832  O OH  . TYR E 2 91  ? 15.753  -16.708 42.690  1.00 48.83 ? 237 TYR E OH  1 
ATOM 4833  N N   . GLY E 2 92  ? 9.491   -16.032 36.609  1.00 36.99 ? 238 GLY E N   1 
ATOM 4834  C CA  . GLY E 2 92  ? 8.430   -15.607 35.713  1.00 35.35 ? 238 GLY E CA  1 
ATOM 4835  C C   . GLY E 2 92  ? 8.595   -15.915 34.234  1.00 33.34 ? 238 GLY E C   1 
ATOM 4836  O O   . GLY E 2 92  ? 9.648   -16.368 33.771  1.00 32.08 ? 238 GLY E O   1 
ATOM 4837  N N   . SER E 2 93  ? 7.528   -15.658 33.486  1.00 31.92 ? 239 SER E N   1 
ATOM 4838  C CA  . SER E 2 93  ? 7.525   -15.887 32.051  1.00 30.87 ? 239 SER E CA  1 
ATOM 4839  C C   . SER E 2 93  ? 6.618   -14.873 31.382  1.00 30.18 ? 239 SER E C   1 
ATOM 4840  O O   . SER E 2 93  ? 5.443   -14.756 31.736  1.00 29.90 ? 239 SER E O   1 
ATOM 4841  C CB  . SER E 2 93  ? 7.022   -17.285 31.735  1.00 30.60 ? 239 SER E CB  1 
ATOM 4842  O OG  . SER E 2 93  ? 7.186   -17.552 30.359  1.00 31.14 ? 239 SER E OG  1 
ATOM 4843  N N   . ILE E 2 94  ? 7.161   -14.142 30.414  1.00 29.30 ? 240 ILE E N   1 
ATOM 4844  C CA  . ILE E 2 94  ? 6.384   -13.139 29.710  1.00 28.64 ? 240 ILE E CA  1 
ATOM 4845  C C   . ILE E 2 94  ? 6.562   -13.319 28.210  1.00 28.38 ? 240 ILE E C   1 
ATOM 4846  O O   . ILE E 2 94  ? 7.587   -13.837 27.754  1.00 27.23 ? 240 ILE E O   1 
ATOM 4847  C CB  . ILE E 2 94  ? 6.807   -11.714 30.147  1.00 29.53 ? 240 ILE E CB  1 
ATOM 4848  C CG1 . ILE E 2 94  ? 8.286   -11.486 29.840  1.00 29.58 ? 240 ILE E CG1 1 
ATOM 4849  C CG2 . ILE E 2 94  ? 6.591   -11.542 31.640  1.00 28.53 ? 240 ILE E CG2 1 
ATOM 4850  C CD1 . ILE E 2 94  ? 8.771   -10.112 30.198  1.00 29.11 ? 240 ILE E CD1 1 
ATOM 4851  N N   . ASN E 2 95  ? 5.550   -12.906 27.450  1.00 27.95 ? 241 ASN E N   1 
ATOM 4852  C CA  . ASN E 2 95  ? 5.578   -13.041 25.999  1.00 27.14 ? 241 ASN E CA  1 
ATOM 4853  C C   . ASN E 2 95  ? 5.021   -11.805 25.316  1.00 26.85 ? 241 ASN E C   1 
ATOM 4854  O O   . ASN E 2 95  ? 4.321   -11.003 25.937  1.00 26.14 ? 241 ASN E O   1 
ATOM 4855  C CB  . ASN E 2 95  ? 4.769   -14.276 25.548  1.00 26.31 ? 241 ASN E CB  1 
ATOM 4856  C CG  . ASN E 2 95  ? 3.278   -14.166 25.871  1.00 24.42 ? 241 ASN E CG  1 
ATOM 4857  O OD1 . ASN E 2 95  ? 2.847   -14.569 26.932  1.00 24.16 ? 241 ASN E OD1 1 
ATOM 4858  N ND2 . ASN E 2 95  ? 2.497   -13.615 24.945  1.00 24.74 ? 241 ASN E ND2 1 
ATOM 4859  N N   . HIS E 2 96  ? 5.343   -11.675 24.031  1.00 27.47 ? 242 HIS E N   1 
ATOM 4860  C CA  . HIS E 2 96  ? 4.898   -10.563 23.197  1.00 27.67 ? 242 HIS E CA  1 
ATOM 4861  C C   . HIS E 2 96  ? 4.701   -11.134 21.807  1.00 27.35 ? 242 HIS E C   1 
ATOM 4862  O O   . HIS E 2 96  ? 5.486   -11.960 21.366  1.00 28.46 ? 242 HIS E O   1 
ATOM 4863  C CB  . HIS E 2 96  ? 5.957   -9.466  23.170  1.00 28.96 ? 242 HIS E CB  1 
ATOM 4864  C CG  . HIS E 2 96  ? 5.632   -8.332  22.252  1.00 30.94 ? 242 HIS E CG  1 
ATOM 4865  N ND1 . HIS E 2 96  ? 4.540   -7.512  22.443  1.00 31.30 ? 242 HIS E ND1 1 
ATOM 4866  C CD2 . HIS E 2 96  ? 6.257   -7.878  21.138  1.00 31.86 ? 242 HIS E CD2 1 
ATOM 4867  C CE1 . HIS E 2 96  ? 4.506   -6.602  21.483  1.00 31.92 ? 242 HIS E CE1 1 
ATOM 4868  N NE2 . HIS E 2 96  ? 5.534   -6.800  20.679  1.00 32.50 ? 242 HIS E NE2 1 
ATOM 4869  N N   . THR E 2 97  ? 3.655   -10.709 21.113  1.00 26.95 ? 243 THR E N   1 
ATOM 4870  C CA  . THR E 2 97  ? 3.396   -11.237 19.773  1.00 27.20 ? 243 THR E CA  1 
ATOM 4871  C C   . THR E 2 97  ? 3.404   -10.176 18.694  1.00 27.17 ? 243 THR E C   1 
ATOM 4872  O O   . THR E 2 97  ? 2.849   -9.098  18.872  1.00 28.77 ? 243 THR E O   1 
ATOM 4873  C CB  . THR E 2 97  ? 2.024   -11.982 19.685  1.00 25.75 ? 243 THR E CB  1 
ATOM 4874  O OG1 . THR E 2 97  ? 1.986   -13.039 20.642  1.00 26.00 ? 243 THR E OG1 1 
ATOM 4875  C CG2 . THR E 2 97  ? 1.822   -12.583 18.303  1.00 24.92 ? 243 THR E CG2 1 
ATOM 4876  N N   . TYR E 2 98  ? 4.030   -10.503 17.571  1.00 26.62 ? 244 TYR E N   1 
ATOM 4877  C CA  . TYR E 2 98  ? 4.095   -9.610  16.429  1.00 27.16 ? 244 TYR E CA  1 
ATOM 4878  C C   . TYR E 2 98  ? 3.343   -10.286 15.312  1.00 27.82 ? 244 TYR E C   1 
ATOM 4879  O O   . TYR E 2 98  ? 3.309   -11.514 15.236  1.00 30.13 ? 244 TYR E O   1 
ATOM 4880  C CB  . TYR E 2 98  ? 5.532   -9.418  15.951  1.00 26.14 ? 244 TYR E CB  1 
ATOM 4881  C CG  . TYR E 2 98  ? 6.410   -8.600  16.848  1.00 25.42 ? 244 TYR E CG  1 
ATOM 4882  C CD1 . TYR E 2 98  ? 7.475   -9.182  17.534  1.00 24.35 ? 244 TYR E CD1 1 
ATOM 4883  C CD2 . TYR E 2 98  ? 6.215   -7.220  16.969  1.00 25.53 ? 244 TYR E CD2 1 
ATOM 4884  C CE1 . TYR E 2 98  ? 8.338   -8.402  18.319  1.00 23.90 ? 244 TYR E CE1 1 
ATOM 4885  C CE2 . TYR E 2 98  ? 7.074   -6.433  17.754  1.00 24.51 ? 244 TYR E CE2 1 
ATOM 4886  C CZ  . TYR E 2 98  ? 8.130   -7.031  18.417  1.00 22.90 ? 244 TYR E CZ  1 
ATOM 4887  O OH  . TYR E 2 98  ? 9.000   -6.261  19.144  1.00 23.18 ? 244 TYR E OH  1 
ATOM 4888  N N   . HIS E 2 99  ? 2.737   -9.501  14.436  1.00 28.22 ? 245 HIS E N   1 
ATOM 4889  C CA  . HIS E 2 99  ? 2.047   -10.082 13.290  1.00 28.73 ? 245 HIS E CA  1 
ATOM 4890  C C   . HIS E 2 99  ? 2.858   -9.686  12.055  1.00 29.34 ? 245 HIS E C   1 
ATOM 4891  O O   . HIS E 2 99  ? 3.218   -8.526  11.883  1.00 30.40 ? 245 HIS E O   1 
ATOM 4892  C CB  . HIS E 2 99  ? 0.618   -9.550  13.182  1.00 26.98 ? 245 HIS E CB  1 
ATOM 4893  N N   . LEU E 2 100 ? 3.180   -10.651 11.209  1.00 30.07 ? 246 LEU E N   1 
ATOM 4894  C CA  . LEU E 2 100 ? 3.930   -10.352 10.011  1.00 29.81 ? 246 LEU E CA  1 
ATOM 4895  C C   . LEU E 2 100 ? 3.018   -10.460 8.799   1.00 30.99 ? 246 LEU E C   1 
ATOM 4896  O O   . LEU E 2 100 ? 2.198   -11.380 8.691   1.00 30.34 ? 246 LEU E O   1 
ATOM 4897  C CB  . LEU E 2 100 ? 5.105   -11.315 9.870   1.00 29.45 ? 246 LEU E CB  1 
ATOM 4898  C CG  . LEU E 2 100 ? 5.833   -11.280 8.520   1.00 29.89 ? 246 LEU E CG  1 
ATOM 4899  C CD1 . LEU E 2 100 ? 6.362   -9.850  8.256   1.00 29.85 ? 246 LEU E CD1 1 
ATOM 4900  C CD2 . LEU E 2 100 ? 6.959   -12.300 8.509   1.00 26.70 ? 246 LEU E CD2 1 
ATOM 4901  N N   . ASP E 2 101 ? 3.154   -9.503  7.890   1.00 32.37 ? 247 ASP E N   1 
ATOM 4902  C CA  . ASP E 2 101 ? 2.356   -9.499  6.675   1.00 33.29 ? 247 ASP E CA  1 
ATOM 4903  C C   . ASP E 2 101 ? 3.282   -9.111  5.526   1.00 32.98 ? 247 ASP E C   1 
ATOM 4904  O O   . ASP E 2 101 ? 3.994   -8.118  5.618   1.00 33.30 ? 247 ASP E O   1 
ATOM 4905  C CB  . ASP E 2 101 ? 1.211   -8.499  6.815   1.00 33.66 ? 247 ASP E CB  1 
ATOM 4906  C CG  . ASP E 2 101 ? -0.028  -8.926  6.049   1.00 35.94 ? 247 ASP E CG  1 
ATOM 4907  O OD1 . ASP E 2 101 ? -1.138  -8.433  6.372   1.00 36.85 ? 247 ASP E OD1 1 
ATOM 4908  O OD2 . ASP E 2 101 ? 0.110   -9.759  5.124   1.00 36.81 ? 247 ASP E OD2 1 
ATOM 4909  N N   . VAL E 2 102 ? 3.289   -9.902  4.457   1.00 32.99 ? 248 VAL E N   1 
ATOM 4910  C CA  . VAL E 2 102 ? 4.154   -9.627  3.305   1.00 32.58 ? 248 VAL E CA  1 
ATOM 4911  C C   . VAL E 2 102 ? 3.345   -9.181  2.095   1.00 32.95 ? 248 VAL E C   1 
ATOM 4912  O O   . VAL E 2 102 ? 2.327   -9.785  1.762   1.00 33.47 ? 248 VAL E O   1 
ATOM 4913  C CB  . VAL E 2 102 ? 4.973   -10.892 2.890   1.00 32.23 ? 248 VAL E CB  1 
ATOM 4914  C CG1 . VAL E 2 102 ? 5.975   -10.546 1.790   1.00 30.34 ? 248 VAL E CG1 1 
ATOM 4915  C CG2 . VAL E 2 102 ? 5.689   -11.461 4.093   1.00 32.02 ? 248 VAL E CG2 1 
ATOM 4916  N N   . VAL E 2 103 ? 3.820   -8.132  1.435   1.00 33.42 ? 249 VAL E N   1 
ATOM 4917  C CA  . VAL E 2 103 ? 3.167   -7.587  0.252   1.00 32.49 ? 249 VAL E CA  1 
ATOM 4918  C C   . VAL E 2 103 ? 4.127   -7.603  -0.931  1.00 32.79 ? 249 VAL E C   1 
ATOM 4919  O O   . VAL E 2 103 ? 5.251   -7.105  -0.844  1.00 33.11 ? 249 VAL E O   1 
ATOM 4920  C CB  . VAL E 2 103 ? 2.715   -6.137  0.498   1.00 32.08 ? 249 VAL E CB  1 
ATOM 4921  C CG1 . VAL E 2 103 ? 2.079   -5.572  -0.753  1.00 31.24 ? 249 VAL E CG1 1 
ATOM 4922  C CG2 . VAL E 2 103 ? 1.747   -6.092  1.664   1.00 30.71 ? 249 VAL E CG2 1 
ATOM 4923  N N   . GLU E 2 104 ? 3.686   -8.176  -2.041  1.00 32.51 ? 250 GLU E N   1 
ATOM 4924  C CA  . GLU E 2 104 ? 4.521   -8.232  -3.226  1.00 32.72 ? 250 GLU E CA  1 
ATOM 4925  C C   . GLU E 2 104 ? 4.327   -7.011  -4.094  1.00 31.62 ? 250 GLU E C   1 
ATOM 4926  O O   . GLU E 2 104 ? 3.200   -6.674  -4.463  1.00 32.35 ? 250 GLU E O   1 
ATOM 4927  C CB  . GLU E 2 104 ? 4.180   -9.469  -4.062  1.00 33.60 ? 250 GLU E CB  1 
ATOM 4928  C CG  . GLU E 2 104 ? 4.612   -10.799 -3.469  1.00 35.29 ? 250 GLU E CG  1 
ATOM 4929  C CD  . GLU E 2 104 ? 3.905   -11.995 -4.111  1.00 36.09 ? 250 GLU E CD  1 
ATOM 4930  O OE1 . GLU E 2 104 ? 2.685   -12.182 -3.875  1.00 35.86 ? 250 GLU E OE1 1 
ATOM 4931  O OE2 . GLU E 2 104 ? 4.573   -12.745 -4.851  1.00 36.95 ? 250 GLU E OE2 1 
ATOM 4932  N N   . ARG E 2 105 ? 5.424   -6.353  -4.442  1.00 30.09 ? 251 ARG E N   1 
ATOM 4933  C CA  . ARG E 2 105 ? 5.293   -5.208  -5.318  1.00 28.43 ? 251 ARG E CA  1 
ATOM 4934  C C   . ARG E 2 105 ? 5.428   -5.721  -6.749  1.00 28.26 ? 251 ARG E C   1 
ATOM 4935  O O   . ARG E 2 105 ? 5.940   -6.812  -6.978  1.00 27.05 ? 251 ARG E O   1 
ATOM 4936  C CB  . ARG E 2 105 ? 6.339   -4.137  -4.991  1.00 26.03 ? 251 ARG E CB  1 
ATOM 4937  C CG  . ARG E 2 105 ? 6.234   -3.569  -3.561  1.00 23.15 ? 251 ARG E CG  1 
ATOM 4938  C CD  . ARG E 2 105 ? 4.793   -3.450  -3.073  1.00 20.04 ? 251 ARG E CD  1 
ATOM 4939  N NE  . ARG E 2 105 ? 3.989   -2.555  -3.888  1.00 18.43 ? 251 ARG E NE  1 
ATOM 4940  C CZ  . ARG E 2 105 ? 4.030   -1.221  -3.828  1.00 20.00 ? 251 ARG E CZ  1 
ATOM 4941  N NH1 . ARG E 2 105 ? 4.846   -0.585  -2.986  1.00 18.60 ? 251 ARG E NH1 1 
ATOM 4942  N NH2 . ARG E 2 105 ? 3.235   -0.510  -4.614  1.00 21.23 ? 251 ARG E NH2 1 
ATOM 4943  N N   . TRP E 2 106 ? 4.911   -4.950  -7.696  1.00 29.16 ? 252 TRP E N   1 
ATOM 4944  C CA  . TRP E 2 106 ? 4.952   -5.319  -9.098  1.00 29.76 ? 252 TRP E CA  1 
ATOM 4945  C C   . TRP E 2 106 ? 5.365   -4.070  -9.879  1.00 29.70 ? 252 TRP E C   1 
ATOM 4946  O O   . TRP E 2 106 ? 4.559   -3.434  -10.539 1.00 31.78 ? 252 TRP E O   1 
ATOM 4947  C CB  . TRP E 2 106 ? 3.570   -5.806  -9.531  1.00 30.10 ? 252 TRP E CB  1 
ATOM 4948  C CG  . TRP E 2 106 ? 3.537   -6.288  -10.934 1.00 32.29 ? 252 TRP E CG  1 
ATOM 4949  C CD1 . TRP E 2 106 ? 4.128   -7.422  -11.434 1.00 32.08 ? 252 TRP E CD1 1 
ATOM 4950  C CD2 . TRP E 2 106 ? 2.963   -5.607  -12.054 1.00 32.45 ? 252 TRP E CD2 1 
ATOM 4951  N NE1 . TRP E 2 106 ? 3.963   -7.479  -12.799 1.00 32.68 ? 252 TRP E NE1 1 
ATOM 4952  C CE2 . TRP E 2 106 ? 3.250   -6.380  -13.206 1.00 33.25 ? 252 TRP E CE2 1 
ATOM 4953  C CE3 . TRP E 2 106 ? 2.239   -4.414  -12.199 1.00 32.34 ? 252 TRP E CE3 1 
ATOM 4954  C CZ2 . TRP E 2 106 ? 2.836   -5.995  -14.492 1.00 33.18 ? 252 TRP E CZ2 1 
ATOM 4955  C CZ3 . TRP E 2 106 ? 1.828   -4.028  -13.480 1.00 33.02 ? 252 TRP E CZ3 1 
ATOM 4956  C CH2 . TRP E 2 106 ? 2.128   -4.820  -14.608 1.00 33.37 ? 252 TRP E CH2 1 
ATOM 4957  N N   . PRO E 2 107 ? 6.653   -3.719  -9.828  1.00 29.58 ? 253 PRO E N   1 
ATOM 4958  C CA  . PRO E 2 107 ? 7.159   -2.530  -10.525 1.00 28.59 ? 253 PRO E CA  1 
ATOM 4959  C C   . PRO E 2 107 ? 7.155   -2.524  -12.055 1.00 28.35 ? 253 PRO E C   1 
ATOM 4960  O O   . PRO E 2 107 ? 8.217   -2.541  -12.673 1.00 28.11 ? 253 PRO E O   1 
ATOM 4961  C CB  . PRO E 2 107 ? 8.562   -2.384  -9.951  1.00 26.92 ? 253 PRO E CB  1 
ATOM 4962  C CG  . PRO E 2 107 ? 8.984   -3.804  -9.788  1.00 28.14 ? 253 PRO E CG  1 
ATOM 4963  C CD  . PRO E 2 107 ? 7.755   -4.454  -9.173  1.00 28.32 ? 253 PRO E CD  1 
ATOM 4964  N N   . HIS E 2 108 ? 5.970   -2.478  -12.662 1.00 28.43 ? 254 HIS E N   1 
ATOM 4965  C CA  . HIS E 2 108 ? 5.863   -2.433  -14.125 1.00 29.53 ? 254 HIS E CA  1 
ATOM 4966  C C   . HIS E 2 108 ? 4.940   -1.336  -14.615 1.00 29.17 ? 254 HIS E C   1 
ATOM 4967  O O   . HIS E 2 108 ? 4.089   -0.871  -13.862 1.00 28.65 ? 254 HIS E O   1 
ATOM 4968  C CB  . HIS E 2 108 ? 5.321   -3.749  -14.684 1.00 30.10 ? 254 HIS E CB  1 
ATOM 4969  C CG  . HIS E 2 108 ? 6.283   -4.885  -14.591 1.00 32.17 ? 254 HIS E CG  1 
ATOM 4970  N ND1 . HIS E 2 108 ? 6.340   -5.722  -13.496 1.00 32.42 ? 254 HIS E ND1 1 
ATOM 4971  C CD2 . HIS E 2 108 ? 7.257   -5.293  -15.435 1.00 33.43 ? 254 HIS E CD2 1 
ATOM 4972  C CE1 . HIS E 2 108 ? 7.314   -6.598  -13.671 1.00 33.65 ? 254 HIS E CE1 1 
ATOM 4973  N NE2 . HIS E 2 108 ? 7.888   -6.360  -14.838 1.00 35.32 ? 254 HIS E NE2 1 
ATOM 4974  N N   . ARG E 2 109 ? 5.110   -0.912  -15.869 1.00 29.92 ? 255 ARG E N   1 
ATOM 4975  C CA  . ARG E 2 109 ? 4.189   0.071   -16.419 1.00 29.83 ? 255 ARG E CA  1 
ATOM 4976  C C   . ARG E 2 109 ? 2.882   -0.717  -16.516 1.00 28.53 ? 255 ARG E C   1 
ATOM 4977  O O   . ARG E 2 109 ? 2.901   -1.938  -16.445 1.00 29.15 ? 255 ARG E O   1 
ATOM 4978  C CB  . ARG E 2 109 ? 4.668   0.556   -17.790 1.00 31.99 ? 255 ARG E CB  1 
ATOM 4979  C CG  . ARG E 2 109 ? 4.749   -0.463  -18.905 1.00 33.45 ? 255 ARG E CG  1 
ATOM 4980  C CD  . ARG E 2 109 ? 5.224   0.285   -20.152 1.00 37.85 ? 255 ARG E CD  1 
ATOM 4981  N NE  . ARG E 2 109 ? 4.794   -0.306  -21.422 1.00 39.93 ? 255 ARG E NE  1 
ATOM 4982  C CZ  . ARG E 2 109 ? 5.341   -1.387  -21.969 1.00 41.18 ? 255 ARG E CZ  1 
ATOM 4983  N NH1 . ARG E 2 109 ? 6.348   -2.011  -21.364 1.00 41.59 ? 255 ARG E NH1 1 
ATOM 4984  N NH2 . ARG E 2 109 ? 4.885   -1.845  -23.124 1.00 41.39 ? 255 ARG E NH2 1 
ATOM 4985  N N   . PRO E 2 110 ? 1.738   -0.042  -16.656 1.00 27.53 ? 256 PRO E N   1 
ATOM 4986  C CA  . PRO E 2 110 ? 0.446   -0.739  -16.748 1.00 25.96 ? 256 PRO E CA  1 
ATOM 4987  C C   . PRO E 2 110 ? 0.417   -1.811  -17.830 1.00 25.15 ? 256 PRO E C   1 
ATOM 4988  O O   . PRO E 2 110 ? 1.022   -1.647  -18.885 1.00 24.03 ? 256 PRO E O   1 
ATOM 4989  C CB  . PRO E 2 110 ? -0.532  0.387   -17.078 1.00 25.82 ? 256 PRO E CB  1 
ATOM 4990  C CG  . PRO E 2 110 ? 0.137   1.613   -16.529 1.00 26.25 ? 256 PRO E CG  1 
ATOM 4991  C CD  . PRO E 2 110 ? 1.575   1.401   -16.889 1.00 27.24 ? 256 PRO E CD  1 
ATOM 4992  N N   . ILE E 2 111 ? -0.298  -2.900  -17.566 1.00 25.02 ? 257 ILE E N   1 
ATOM 4993  C CA  . ILE E 2 111 ? -0.453  -3.994  -18.525 1.00 24.77 ? 257 ILE E CA  1 
ATOM 4994  C C   . ILE E 2 111 ? -1.939  -4.215  -18.846 1.00 24.24 ? 257 ILE E C   1 
ATOM 4995  O O   . ILE E 2 111 ? -2.758  -4.375  -17.947 1.00 23.98 ? 257 ILE E O   1 
ATOM 4996  C CB  . ILE E 2 111 ? 0.128   -5.289  -17.968 1.00 25.33 ? 257 ILE E CB  1 
ATOM 4997  C CG1 . ILE E 2 111 ? -0.207  -6.457  -18.898 1.00 26.25 ? 257 ILE E CG1 1 
ATOM 4998  C CG2 . ILE E 2 111 ? -0.438  -5.551  -16.590 1.00 27.30 ? 257 ILE E CG2 1 
ATOM 4999  C CD1 . ILE E 2 111 ? 0.435   -7.756  -18.469 1.00 25.54 ? 257 ILE E CD1 1 
ATOM 5000  N N   . LEU E 2 112 ? -2.285  -4.212  -20.127 1.00 24.70 ? 258 LEU E N   1 
ATOM 5001  C CA  . LEU E 2 112 ? -3.675  -4.415  -20.544 1.00 25.79 ? 258 LEU E CA  1 
ATOM 5002  C C   . LEU E 2 112 ? -3.896  -5.842  -21.041 1.00 26.29 ? 258 LEU E C   1 
ATOM 5003  O O   . LEU E 2 112 ? -2.970  -6.503  -21.498 1.00 25.36 ? 258 LEU E O   1 
ATOM 5004  C CB  . LEU E 2 112 ? -4.058  -3.484  -21.692 1.00 25.42 ? 258 LEU E CB  1 
ATOM 5005  C CG  . LEU E 2 112 ? -3.570  -2.049  -21.758 1.00 25.56 ? 258 LEU E CG  1 
ATOM 5006  C CD1 . LEU E 2 112 ? -4.272  -1.358  -22.914 1.00 26.45 ? 258 LEU E CD1 1 
ATOM 5007  C CD2 . LEU E 2 112 ? -3.849  -1.338  -20.460 1.00 26.83 ? 258 LEU E CD2 1 
ATOM 5008  N N   . GLN E 2 113 ? -5.138  -6.299  -20.967 1.00 27.89 ? 259 GLN E N   1 
ATOM 5009  C CA  . GLN E 2 113 ? -5.485  -7.637  -21.427 1.00 29.96 ? 259 GLN E CA  1 
ATOM 5010  C C   . GLN E 2 113 ? -5.493  -7.720  -22.954 1.00 29.93 ? 259 GLN E C   1 
ATOM 5011  O O   . GLN E 2 113 ? -6.103  -6.884  -23.624 1.00 29.55 ? 259 GLN E O   1 
ATOM 5012  C CB  . GLN E 2 113 ? -6.862  -8.037  -20.909 1.00 31.30 ? 259 GLN E CB  1 
ATOM 5013  C CG  . GLN E 2 113 ? -7.425  -9.256  -21.587 1.00 33.83 ? 259 GLN E CG  1 
ATOM 5014  C CD  . GLN E 2 113 ? -8.657  -9.776  -20.886 1.00 36.75 ? 259 GLN E CD  1 
ATOM 5015  O OE1 . GLN E 2 113 ? -8.606  -10.120 -19.702 1.00 38.66 ? 259 GLN E OE1 1 
ATOM 5016  N NE2 . GLN E 2 113 ? -9.776  -9.834  -21.604 1.00 37.10 ? 259 GLN E NE2 1 
ATOM 5017  N N   . ALA E 2 114 ? -4.821  -8.731  -23.501 1.00 29.78 ? 260 ALA E N   1 
ATOM 5018  C CA  . ALA E 2 114 ? -4.773  -8.895  -24.951 1.00 29.92 ? 260 ALA E CA  1 
ATOM 5019  C C   . ALA E 2 114 ? -6.173  -9.038  -25.529 1.00 30.07 ? 260 ALA E C   1 
ATOM 5020  O O   . ALA E 2 114 ? -7.013  -9.740  -24.964 1.00 30.73 ? 260 ALA E O   1 
ATOM 5021  C CB  . ALA E 2 114 ? -3.934  -10.109 -25.324 1.00 28.82 ? 260 ALA E CB  1 
ATOM 5022  N N   . GLY E 2 115 ? -6.421  -8.367  -26.652 1.00 29.56 ? 261 GLY E N   1 
ATOM 5023  C CA  . GLY E 2 115 ? -7.723  -8.450  -27.281 1.00 31.25 ? 261 GLY E CA  1 
ATOM 5024  C C   . GLY E 2 115 ? -8.700  -7.341  -26.916 1.00 32.65 ? 261 GLY E C   1 
ATOM 5025  O O   . GLY E 2 115 ? -9.706  -7.153  -27.611 1.00 34.36 ? 261 GLY E O   1 
ATOM 5026  N N   . LEU E 2 116 ? -8.433  -6.613  -25.835 1.00 31.79 ? 262 LEU E N   1 
ATOM 5027  C CA  . LEU E 2 116 ? -9.318  -5.534  -25.446 1.00 31.42 ? 262 LEU E CA  1 
ATOM 5028  C C   . LEU E 2 116 ? -8.546  -4.240  -25.526 1.00 31.93 ? 262 LEU E C   1 
ATOM 5029  O O   . LEU E 2 116 ? -7.383  -4.178  -25.136 1.00 32.41 ? 262 LEU E O   1 
ATOM 5030  C CB  . LEU E 2 116 ? -9.847  -5.746  -24.031 1.00 30.45 ? 262 LEU E CB  1 
ATOM 5031  C CG  . LEU E 2 116 ? -10.425 -7.135  -23.785 1.00 30.34 ? 262 LEU E CG  1 
ATOM 5032  C CD1 . LEU E 2 116 ? -11.190 -7.141  -22.448 1.00 30.00 ? 262 LEU E CD1 1 
ATOM 5033  C CD2 . LEU E 2 116 ? -11.341 -7.520  -24.943 1.00 29.04 ? 262 LEU E CD2 1 
ATOM 5034  N N   . PRO E 2 117 ? -9.184  -3.181  -26.045 1.00 32.58 ? 263 PRO E N   1 
ATOM 5035  C CA  . PRO E 2 117 ? -10.571 -3.243  -26.522 1.00 33.19 ? 263 PRO E CA  1 
ATOM 5036  C C   . PRO E 2 117 ? -10.707 -4.022  -27.841 1.00 33.92 ? 263 PRO E C   1 
ATOM 5037  O O   . PRO E 2 117 ? -9.775  -4.093  -28.639 1.00 32.92 ? 263 PRO E O   1 
ATOM 5038  C CB  . PRO E 2 117 ? -10.945 -1.762  -26.647 1.00 32.71 ? 263 PRO E CB  1 
ATOM 5039  C CG  . PRO E 2 117 ? -9.642  -1.123  -27.034 1.00 32.29 ? 263 PRO E CG  1 
ATOM 5040  C CD  . PRO E 2 117 ? -8.633  -1.817  -26.162 1.00 31.85 ? 263 PRO E CD  1 
ATOM 5041  N N   . ALA E 2 118 ? -11.869 -4.624  -28.059 1.00 36.07 ? 264 ALA E N   1 
ATOM 5042  C CA  . ALA E 2 118 ? -12.108 -5.400  -29.276 1.00 37.68 ? 264 ALA E CA  1 
ATOM 5043  C C   . ALA E 2 118 ? -12.711 -4.543  -30.395 1.00 39.51 ? 264 ALA E C   1 
ATOM 5044  O O   . ALA E 2 118 ? -13.389 -3.535  -30.135 1.00 39.38 ? 264 ALA E O   1 
ATOM 5045  C CB  . ALA E 2 118 ? -13.031 -6.571  -28.967 1.00 35.69 ? 264 ALA E CB  1 
ATOM 5046  N N   . ASN E 2 119 ? -12.461 -4.941  -31.642 1.00 41.60 ? 265 ASN E N   1 
ATOM 5047  C CA  . ASN E 2 119 ? -13.015 -4.213  -32.777 1.00 43.67 ? 265 ASN E CA  1 
ATOM 5048  C C   . ASN E 2 119 ? -14.523 -4.305  -32.666 1.00 45.16 ? 265 ASN E C   1 
ATOM 5049  O O   . ASN E 2 119 ? -15.050 -5.268  -32.109 1.00 45.92 ? 265 ASN E O   1 
ATOM 5050  C CB  . ASN E 2 119 ? -12.552 -4.818  -34.102 1.00 43.78 ? 265 ASN E CB  1 
ATOM 5051  C CG  . ASN E 2 119 ? -11.127 -4.436  -34.446 1.00 44.88 ? 265 ASN E CG  1 
ATOM 5052  O OD1 . ASN E 2 119 ? -10.755 -3.276  -34.354 1.00 47.43 ? 265 ASN E OD1 1 
ATOM 5053  N ND2 . ASN E 2 119 ? -10.325 -5.409  -34.851 1.00 45.74 ? 265 ASN E ND2 1 
ATOM 5054  N N   . ALA E 2 120 ? -15.217 -3.298  -33.180 1.00 46.89 ? 266 ALA E N   1 
ATOM 5055  C CA  . ALA E 2 120 ? -16.671 -3.279  -33.113 1.00 48.34 ? 266 ALA E CA  1 
ATOM 5056  C C   . ALA E 2 120 ? -17.278 -2.820  -34.427 1.00 49.84 ? 266 ALA E C   1 
ATOM 5057  O O   . ALA E 2 120 ? -16.697 -2.012  -35.158 1.00 49.04 ? 266 ALA E O   1 
ATOM 5058  C CB  . ALA E 2 120 ? -17.132 -2.377  -31.976 1.00 48.41 ? 266 ALA E CB  1 
ATOM 5059  N N   . SER E 2 121 ? -18.457 -3.356  -34.715 1.00 52.27 ? 267 SER E N   1 
ATOM 5060  C CA  . SER E 2 121 ? -19.182 -3.032  -35.934 1.00 54.35 ? 267 SER E CA  1 
ATOM 5061  C C   . SER E 2 121 ? -20.639 -2.726  -35.602 1.00 54.89 ? 267 SER E C   1 
ATOM 5062  O O   . SER E 2 121 ? -21.202 -3.293  -34.662 1.00 54.09 ? 267 SER E O   1 
ATOM 5063  C CB  . SER E 2 121 ? -19.117 -4.214  -36.904 1.00 55.15 ? 267 SER E CB  1 
ATOM 5064  O OG  . SER E 2 121 ? -19.945 -3.990  -38.035 1.00 56.93 ? 267 SER E OG  1 
ATOM 5065  N N   . THR E 2 122 ? -21.240 -1.816  -36.363 1.00 56.41 ? 268 THR E N   1 
ATOM 5066  C CA  . THR E 2 122 ? -22.647 -1.463  -36.164 1.00 57.93 ? 268 THR E CA  1 
ATOM 5067  C C   . THR E 2 122 ? -23.170 -0.528  -37.248 1.00 58.04 ? 268 THR E C   1 
ATOM 5068  O O   . THR E 2 122 ? -22.411 0.226   -37.865 1.00 57.56 ? 268 THR E O   1 
ATOM 5069  C CB  . THR E 2 122 ? -22.906 -0.780  -34.796 1.00 59.12 ? 268 THR E CB  1 
ATOM 5070  O OG1 . THR E 2 122 ? -24.324 -0.613  -34.610 1.00 59.45 ? 268 THR E OG1 1 
ATOM 5071  C CG2 . THR E 2 122 ? -22.219 0.600   -34.744 1.00 59.23 ? 268 THR E CG2 1 
ATOM 5072  N N   . VAL E 2 123 ? -24.480 -0.592  -37.470 1.00 58.57 ? 269 VAL E N   1 
ATOM 5073  C CA  . VAL E 2 123 ? -25.134 0.251   -38.461 1.00 58.65 ? 269 VAL E CA  1 
ATOM 5074  C C   . VAL E 2 123 ? -25.429 1.562   -37.751 1.00 58.54 ? 269 VAL E C   1 
ATOM 5075  O O   . VAL E 2 123 ? -25.675 1.567   -36.543 1.00 58.18 ? 269 VAL E O   1 
ATOM 5076  C CB  . VAL E 2 123 ? -26.459 -0.377  -38.944 1.00 58.70 ? 269 VAL E CB  1 
ATOM 5077  N N   . VAL E 2 124 ? -25.400 2.667   -38.489 1.00 58.73 ? 270 VAL E N   1 
ATOM 5078  C CA  . VAL E 2 124 ? -25.660 3.969   -37.890 1.00 59.21 ? 270 VAL E CA  1 
ATOM 5079  C C   . VAL E 2 124 ? -26.841 3.894   -36.932 1.00 60.09 ? 270 VAL E C   1 
ATOM 5080  O O   . VAL E 2 124 ? -27.746 3.074   -37.112 1.00 61.08 ? 270 VAL E O   1 
ATOM 5081  C CB  . VAL E 2 124 ? -25.955 5.038   -38.957 1.00 58.65 ? 270 VAL E CB  1 
ATOM 5082  C CG1 . VAL E 2 124 ? -26.146 6.384   -38.289 1.00 58.28 ? 270 VAL E CG1 1 
ATOM 5083  C CG2 . VAL E 2 124 ? -24.814 5.100   -39.974 1.00 58.85 ? 270 VAL E CG2 1 
ATOM 5084  N N   . GLY E 2 125 ? -26.815 4.738   -35.904 1.00 60.38 ? 271 GLY E N   1 
ATOM 5085  C CA  . GLY E 2 125 ? -27.890 4.766   -34.927 1.00 60.89 ? 271 GLY E CA  1 
ATOM 5086  C C   . GLY E 2 125 ? -27.758 3.710   -33.849 1.00 61.37 ? 271 GLY E C   1 
ATOM 5087  O O   . GLY E 2 125 ? -28.438 3.768   -32.819 1.00 61.33 ? 271 GLY E O   1 
ATOM 5088  N N   . GLY E 2 126 ? -26.878 2.740   -34.087 1.00 61.70 ? 272 GLY E N   1 
ATOM 5089  C CA  . GLY E 2 126 ? -26.668 1.676   -33.120 1.00 61.55 ? 272 GLY E CA  1 
ATOM 5090  C C   . GLY E 2 126 ? -25.786 2.067   -31.937 1.00 61.70 ? 272 GLY E C   1 
ATOM 5091  O O   . GLY E 2 126 ? -25.088 3.094   -31.950 1.00 61.18 ? 272 GLY E O   1 
ATOM 5092  N N   . ASP E 2 127 ? -25.837 1.241   -30.897 1.00 60.99 ? 273 ASP E N   1 
ATOM 5093  C CA  . ASP E 2 127 ? -25.039 1.453   -29.698 1.00 60.30 ? 273 ASP E CA  1 
ATOM 5094  C C   . ASP E 2 127 ? -23.825 0.537   -29.745 1.00 59.64 ? 273 ASP E C   1 
ATOM 5095  O O   . ASP E 2 127 ? -23.845 -0.493  -30.423 1.00 60.04 ? 273 ASP E O   1 
ATOM 5096  C CB  . ASP E 2 127 ? -25.874 1.174   -28.453 1.00 61.15 ? 273 ASP E CB  1 
ATOM 5097  C CG  . ASP E 2 127 ? -26.498 2.428   -27.903 1.00 62.73 ? 273 ASP E CG  1 
ATOM 5098  O OD1 . ASP E 2 127 ? -26.800 3.321   -28.724 1.00 63.08 ? 273 ASP E OD1 1 
ATOM 5099  O OD2 . ASP E 2 127 ? -26.683 2.526   -26.669 1.00 63.36 ? 273 ASP E OD2 1 
ATOM 5100  N N   . VAL E 2 128 ? -22.774 0.904   -29.019 1.00 58.02 ? 274 VAL E N   1 
ATOM 5101  C CA  . VAL E 2 128 ? -21.542 0.126   -29.040 1.00 56.27 ? 274 VAL E CA  1 
ATOM 5102  C C   . VAL E 2 128 ? -20.677 0.434   -27.820 1.00 55.15 ? 274 VAL E C   1 
ATOM 5103  O O   . VAL E 2 128 ? -20.770 1.518   -27.251 1.00 55.21 ? 274 VAL E O   1 
ATOM 5104  C CB  . VAL E 2 128 ? -20.731 0.489   -30.303 1.00 56.16 ? 274 VAL E CB  1 
ATOM 5105  C CG1 . VAL E 2 128 ? -20.223 1.915   -30.187 1.00 55.86 ? 274 VAL E CG1 1 
ATOM 5106  C CG2 . VAL E 2 128 ? -19.580 -0.459  -30.490 1.00 56.87 ? 274 VAL E CG2 1 
ATOM 5107  N N   . GLU E 2 129 ? -19.825 -0.512  -27.429 1.00 54.21 ? 275 GLU E N   1 
ATOM 5108  C CA  . GLU E 2 129 ? -18.937 -0.304  -26.288 1.00 52.09 ? 275 GLU E CA  1 
ATOM 5109  C C   . GLU E 2 129 ? -17.572 -0.937  -26.475 1.00 50.07 ? 275 GLU E C   1 
ATOM 5110  O O   . GLU E 2 129 ? -17.396 -1.851  -27.273 1.00 49.47 ? 275 GLU E O   1 
ATOM 5111  C CB  . GLU E 2 129 ? -19.549 -0.863  -25.002 1.00 53.40 ? 275 GLU E CB  1 
ATOM 5112  C CG  . GLU E 2 129 ? -19.835 -2.343  -25.063 1.00 54.94 ? 275 GLU E CG  1 
ATOM 5113  C CD  . GLU E 2 129 ? -19.986 -2.971  -23.694 1.00 56.49 ? 275 GLU E CD  1 
ATOM 5114  O OE1 . GLU E 2 129 ? -20.607 -2.336  -22.811 1.00 56.71 ? 275 GLU E OE1 1 
ATOM 5115  O OE2 . GLU E 2 129 ? -19.489 -4.108  -23.504 1.00 57.13 ? 275 GLU E OE2 1 
ATOM 5116  N N   . PHE E 2 130 ? -16.608 -0.428  -25.717 1.00 48.88 ? 276 PHE E N   1 
ATOM 5117  C CA  . PHE E 2 130 ? -15.244 -0.929  -25.738 1.00 46.37 ? 276 PHE E CA  1 
ATOM 5118  C C   . PHE E 2 130 ? -14.827 -1.140  -24.301 1.00 44.84 ? 276 PHE E C   1 
ATOM 5119  O O   . PHE E 2 130 ? -14.911 -0.217  -23.491 1.00 45.63 ? 276 PHE E O   1 
ATOM 5120  C CB  . PHE E 2 130 ? -14.302 0.072   -26.384 1.00 47.39 ? 276 PHE E CB  1 
ATOM 5121  C CG  . PHE E 2 130 ? -14.477 0.186   -27.853 1.00 49.54 ? 276 PHE E CG  1 
ATOM 5122  C CD1 . PHE E 2 130 ? -14.421 -0.947  -28.657 1.00 50.90 ? 276 PHE E CD1 1 
ATOM 5123  C CD2 . PHE E 2 130 ? -14.701 1.421   -28.444 1.00 50.83 ? 276 PHE E CD2 1 
ATOM 5124  C CE1 . PHE E 2 130 ? -14.587 -0.851  -30.040 1.00 53.28 ? 276 PHE E CE1 1 
ATOM 5125  C CE2 . PHE E 2 130 ? -14.870 1.536   -29.828 1.00 51.86 ? 276 PHE E CE2 1 
ATOM 5126  C CZ  . PHE E 2 130 ? -14.814 0.400   -30.630 1.00 52.90 ? 276 PHE E CZ  1 
ATOM 5127  N N   . VAL E 2 131 ? -14.393 -2.357  -23.988 1.00 41.85 ? 277 VAL E N   1 
ATOM 5128  C CA  . VAL E 2 131 ? -13.949 -2.701  -22.645 1.00 39.00 ? 277 VAL E CA  1 
ATOM 5129  C C   . VAL E 2 131 ? -12.426 -2.723  -22.584 1.00 37.91 ? 277 VAL E C   1 
ATOM 5130  O O   . VAL E 2 131 ? -11.750 -3.035  -23.565 1.00 38.56 ? 277 VAL E O   1 
ATOM 5131  C CB  . VAL E 2 131 ? -14.500 -4.088  -22.219 1.00 38.52 ? 277 VAL E CB  1 
ATOM 5132  C CG1 . VAL E 2 131 ? -13.879 -4.540  -20.901 1.00 38.34 ? 277 VAL E CG1 1 
ATOM 5133  C CG2 . VAL E 2 131 ? -15.994 -4.018  -22.077 1.00 37.36 ? 277 VAL E CG2 1 
ATOM 5134  N N   . CYS E 2 132 ? -11.882 -2.391  -21.425 1.00 36.91 ? 278 CYS E N   1 
ATOM 5135  C CA  . CYS E 2 132 ? -10.445 -2.388  -21.267 1.00 36.14 ? 278 CYS E CA  1 
ATOM 5136  C C   . CYS E 2 132 ? -10.065 -2.837  -19.865 1.00 36.09 ? 278 CYS E C   1 
ATOM 5137  O O   . CYS E 2 132 ? -10.419 -2.189  -18.876 1.00 37.35 ? 278 CYS E O   1 
ATOM 5138  C CB  . CYS E 2 132 ? -9.892  -0.987  -21.551 1.00 34.89 ? 278 CYS E CB  1 
ATOM 5139  S SG  . CYS E 2 132 ? -8.103  -0.864  -21.357 1.00 34.27 ? 278 CYS E SG  1 
ATOM 5140  N N   . LYS E 2 133 ? -9.344  -3.950  -19.785 1.00 35.33 ? 279 LYS E N   1 
ATOM 5141  C CA  . LYS E 2 133 ? -8.912  -4.491  -18.502 1.00 34.52 ? 279 LYS E CA  1 
ATOM 5142  C C   . LYS E 2 133 ? -7.451  -4.151  -18.218 1.00 33.44 ? 279 LYS E C   1 
ATOM 5143  O O   . LYS E 2 133 ? -6.547  -4.561  -18.953 1.00 33.34 ? 279 LYS E O   1 
ATOM 5144  C CB  . LYS E 2 133 ? -9.118  -6.000  -18.489 1.00 35.17 ? 279 LYS E CB  1 
ATOM 5145  C CG  . LYS E 2 133 ? -10.570 -6.402  -18.425 1.00 37.44 ? 279 LYS E CG  1 
ATOM 5146  C CD  . LYS E 2 133 ? -11.211 -5.938  -17.108 1.00 40.55 ? 279 LYS E CD  1 
ATOM 5147  C CE  . LYS E 2 133 ? -10.437 -6.422  -15.860 1.00 41.04 ? 279 LYS E CE  1 
ATOM 5148  N NZ  . LYS E 2 133 ? -9.111  -5.756  -15.668 1.00 40.17 ? 279 LYS E NZ  1 
ATOM 5149  N N   . VAL E 2 134 ? -7.229  -3.404  -17.143 1.00 31.51 ? 280 VAL E N   1 
ATOM 5150  C CA  . VAL E 2 134 ? -5.887  -2.988  -16.773 1.00 29.71 ? 280 VAL E CA  1 
ATOM 5151  C C   . VAL E 2 134 ? -5.422  -3.551  -15.446 1.00 29.34 ? 280 VAL E C   1 
ATOM 5152  O O   . VAL E 2 134 ? -6.208  -3.742  -14.517 1.00 30.18 ? 280 VAL E O   1 
ATOM 5153  C CB  . VAL E 2 134 ? -5.785  -1.439  -16.688 1.00 29.38 ? 280 VAL E CB  1 
ATOM 5154  C CG1 . VAL E 2 134 ? -4.430  -1.032  -16.134 1.00 29.92 ? 280 VAL E CG1 1 
ATOM 5155  C CG2 . VAL E 2 134 ? -6.006  -0.814  -18.065 1.00 28.26 ? 280 VAL E CG2 1 
ATOM 5156  N N   . TYR E 2 135 ? -4.130  -3.831  -15.368 1.00 29.26 ? 281 TYR E N   1 
ATOM 5157  C CA  . TYR E 2 135 ? -3.538  -4.316  -14.133 1.00 29.68 ? 281 TYR E CA  1 
ATOM 5158  C C   . TYR E 2 135 ? -2.276  -3.486  -13.878 1.00 29.27 ? 281 TYR E C   1 
ATOM 5159  O O   . TYR E 2 135 ? -1.477  -3.272  -14.795 1.00 29.69 ? 281 TYR E O   1 
ATOM 5160  C CB  . TYR E 2 135 ? -3.176  -5.795  -14.232 1.00 29.84 ? 281 TYR E CB  1 
ATOM 5161  C CG  . TYR E 2 135 ? -2.550  -6.282  -12.944 1.00 32.13 ? 281 TYR E CG  1 
ATOM 5162  C CD1 . TYR E 2 135 ? -3.345  -6.751  -11.896 1.00 31.82 ? 281 TYR E CD1 1 
ATOM 5163  C CD2 . TYR E 2 135 ? -1.163  -6.190  -12.734 1.00 31.66 ? 281 TYR E CD2 1 
ATOM 5164  C CE1 . TYR E 2 135 ? -2.783  -7.110  -10.672 1.00 32.21 ? 281 TYR E CE1 1 
ATOM 5165  C CE2 . TYR E 2 135 ? -0.597  -6.544  -11.509 1.00 32.41 ? 281 TYR E CE2 1 
ATOM 5166  C CZ  . TYR E 2 135 ? -1.416  -6.999  -10.484 1.00 32.14 ? 281 TYR E CZ  1 
ATOM 5167  O OH  . TYR E 2 135 ? -0.868  -7.300  -9.261  1.00 33.08 ? 281 TYR E OH  1 
ATOM 5168  N N   . SER E 2 136 ? -2.102  -3.025  -12.642 1.00 27.75 ? 282 SER E N   1 
ATOM 5169  C CA  . SER E 2 136 ? -0.951  -2.203  -12.283 1.00 26.76 ? 282 SER E CA  1 
ATOM 5170  C C   . SER E 2 136 ? -0.818  -2.101  -10.778 1.00 26.28 ? 282 SER E C   1 
ATOM 5171  O O   . SER E 2 136 ? -1.816  -2.119  -10.076 1.00 26.05 ? 282 SER E O   1 
ATOM 5172  C CB  . SER E 2 136 ? -1.125  -0.801  -12.867 1.00 27.13 ? 282 SER E CB  1 
ATOM 5173  O OG  . SER E 2 136 ? -0.175  0.107   -12.342 1.00 26.53 ? 282 SER E OG  1 
ATOM 5174  N N   . ASP E 2 137 ? 0.411   -2.007  -10.279 1.00 26.54 ? 283 ASP E N   1 
ATOM 5175  C CA  . ASP E 2 137 ? 0.602   -1.871  -8.840  1.00 25.80 ? 283 ASP E CA  1 
ATOM 5176  C C   . ASP E 2 137 ? 0.511   -0.376  -8.558  1.00 25.98 ? 283 ASP E C   1 
ATOM 5177  O O   . ASP E 2 137 ? -0.420  0.077   -7.907  1.00 25.18 ? 283 ASP E O   1 
ATOM 5178  C CB  . ASP E 2 137 ? 1.951   -2.433  -8.401  1.00 25.37 ? 283 ASP E CB  1 
ATOM 5179  C CG  . ASP E 2 137 ? 2.098   -2.473  -6.895  1.00 24.97 ? 283 ASP E CG  1 
ATOM 5180  O OD1 . ASP E 2 137 ? 3.012   -3.170  -6.416  1.00 25.50 ? 283 ASP E OD1 1 
ATOM 5181  O OD2 . ASP E 2 137 ? 1.307   -1.810  -6.188  1.00 25.27 ? 283 ASP E OD2 1 
ATOM 5182  N N   . ALA E 2 138 ? 1.475   0.385   -9.059  1.00 26.14 ? 284 ALA E N   1 
ATOM 5183  C CA  . ALA E 2 138 ? 1.446   1.820   -8.894  1.00 26.95 ? 284 ALA E CA  1 
ATOM 5184  C C   . ALA E 2 138 ? 0.082   2.218   -9.467  1.00 27.61 ? 284 ALA E C   1 
ATOM 5185  O O   . ALA E 2 138 ? -0.377  1.601   -10.423 1.00 29.42 ? 284 ALA E O   1 
ATOM 5186  C CB  . ALA E 2 138 ? 2.573   2.441   -9.707  1.00 26.16 ? 284 ALA E CB  1 
ATOM 5187  N N   . GLN E 2 139 ? -0.571  3.226   -8.895  1.00 27.27 ? 285 GLN E N   1 
ATOM 5188  C CA  . GLN E 2 139 ? -1.886  3.661   -9.383  1.00 26.97 ? 285 GLN E CA  1 
ATOM 5189  C C   . GLN E 2 139 ? -1.829  4.054   -10.865 1.00 27.07 ? 285 GLN E C   1 
ATOM 5190  O O   . GLN E 2 139 ? -1.027  4.899   -11.270 1.00 28.78 ? 285 GLN E O   1 
ATOM 5191  C CB  . GLN E 2 139 ? -2.394  4.827   -8.526  1.00 25.97 ? 285 GLN E CB  1 
ATOM 5192  C CG  . GLN E 2 139 ? -3.916  4.938   -8.361  1.00 27.21 ? 285 GLN E CG  1 
ATOM 5193  C CD  . GLN E 2 139 ? -4.593  3.699   -7.730  1.00 27.90 ? 285 GLN E CD  1 
ATOM 5194  O OE1 . GLN E 2 139 ? -4.232  3.251   -6.639  1.00 26.17 ? 285 GLN E OE1 1 
ATOM 5195  N NE2 . GLN E 2 139 ? -5.597  3.160   -8.425  1.00 27.79 ? 285 GLN E NE2 1 
ATOM 5196  N N   . PRO E 2 140 ? -2.672  3.428   -11.698 1.00 26.31 ? 286 PRO E N   1 
ATOM 5197  C CA  . PRO E 2 140 ? -2.709  3.707   -13.134 1.00 27.08 ? 286 PRO E CA  1 
ATOM 5198  C C   . PRO E 2 140 ? -3.673  4.826   -13.517 1.00 26.92 ? 286 PRO E C   1 
ATOM 5199  O O   . PRO E 2 140 ? -4.662  5.059   -12.831 1.00 27.48 ? 286 PRO E O   1 
ATOM 5200  C CB  . PRO E 2 140 ? -3.180  2.380   -13.713 1.00 26.21 ? 286 PRO E CB  1 
ATOM 5201  C CG  . PRO E 2 140 ? -4.213  1.971   -12.718 1.00 24.32 ? 286 PRO E CG  1 
ATOM 5202  C CD  . PRO E 2 140 ? -3.526  2.266   -11.380 1.00 25.21 ? 286 PRO E CD  1 
ATOM 5203  N N   . HIS E 2 141 ? -3.384  5.513   -14.613 1.00 27.98 ? 287 HIS E N   1 
ATOM 5204  C CA  . HIS E 2 141 ? -4.289  6.539   -15.093 1.00 28.80 ? 287 HIS E CA  1 
ATOM 5205  C C   . HIS E 2 141 ? -4.791  6.108   -16.465 1.00 29.22 ? 287 HIS E C   1 
ATOM 5206  O O   . HIS E 2 141 ? -4.015  5.965   -17.413 1.00 29.21 ? 287 HIS E O   1 
ATOM 5207  C CB  . HIS E 2 141 ? -3.608  7.897   -15.197 1.00 30.06 ? 287 HIS E CB  1 
ATOM 5208  C CG  . HIS E 2 141 ? -4.531  8.977   -15.668 1.00 32.12 ? 287 HIS E CG  1 
ATOM 5209  N ND1 . HIS E 2 141 ? -4.600  9.371   -16.987 1.00 32.49 ? 287 HIS E ND1 1 
ATOM 5210  C CD2 . HIS E 2 141 ? -5.494  9.672   -15.015 1.00 31.72 ? 287 HIS E CD2 1 
ATOM 5211  C CE1 . HIS E 2 141 ? -5.569  10.258  -17.127 1.00 32.79 ? 287 HIS E CE1 1 
ATOM 5212  N NE2 . HIS E 2 141 ? -6.127  10.457  -15.946 1.00 32.26 ? 287 HIS E NE2 1 
ATOM 5213  N N   . ILE E 2 142 ? -6.099  5.892   -16.566 1.00 29.58 ? 288 ILE E N   1 
ATOM 5214  C CA  . ILE E 2 142 ? -6.689  5.439   -17.819 1.00 28.61 ? 288 ILE E CA  1 
ATOM 5215  C C   . ILE E 2 142 ? -7.540  6.499   -18.495 1.00 30.10 ? 288 ILE E C   1 
ATOM 5216  O O   . ILE E 2 142 ? -8.281  7.243   -17.844 1.00 30.21 ? 288 ILE E O   1 
ATOM 5217  C CB  . ILE E 2 142 ? -7.548  4.178   -17.576 1.00 27.08 ? 288 ILE E CB  1 
ATOM 5218  C CG1 . ILE E 2 142 ? -6.693  3.111   -16.893 1.00 25.86 ? 288 ILE E CG1 1 
ATOM 5219  C CG2 . ILE E 2 142 ? -8.102  3.650   -18.891 1.00 25.92 ? 288 ILE E CG2 1 
ATOM 5220  C CD1 . ILE E 2 142 ? -7.478  2.029   -16.270 1.00 25.92 ? 288 ILE E CD1 1 
ATOM 5221  N N   . GLN E 2 143 ? -7.421  6.564   -19.814 1.00 31.92 ? 289 GLN E N   1 
ATOM 5222  C CA  . GLN E 2 143 ? -8.177  7.509   -20.616 1.00 33.20 ? 289 GLN E CA  1 
ATOM 5223  C C   . GLN E 2 143 ? -8.464  6.841   -21.947 1.00 34.12 ? 289 GLN E C   1 
ATOM 5224  O O   . GLN E 2 143 ? -7.695  5.991   -22.406 1.00 33.74 ? 289 GLN E O   1 
ATOM 5225  C CB  . GLN E 2 143 ? -7.352  8.767   -20.860 1.00 33.90 ? 289 GLN E CB  1 
ATOM 5226  C CG  . GLN E 2 143 ? -5.995  8.470   -21.484 1.00 35.25 ? 289 GLN E CG  1 
ATOM 5227  C CD  . GLN E 2 143 ? -5.139  9.714   -21.693 1.00 36.39 ? 289 GLN E CD  1 
ATOM 5228  O OE1 . GLN E 2 143 ? -5.415  10.540  -22.577 1.00 38.19 ? 289 GLN E OE1 1 
ATOM 5229  N NE2 . GLN E 2 143 ? -4.096  9.856   -20.875 1.00 34.42 ? 289 GLN E NE2 1 
ATOM 5230  N N   . TRP E 2 144 ? -9.582  7.215   -22.558 1.00 35.61 ? 290 TRP E N   1 
ATOM 5231  C CA  . TRP E 2 144 ? -9.948  6.669   -23.854 1.00 35.92 ? 290 TRP E CA  1 
ATOM 5232  C C   . TRP E 2 144 ? -9.695  7.746   -24.879 1.00 37.51 ? 290 TRP E C   1 
ATOM 5233  O O   . TRP E 2 144 ? -10.021 8.916   -24.660 1.00 38.84 ? 290 TRP E O   1 
ATOM 5234  C CB  . TRP E 2 144 ? -11.404 6.256   -23.872 1.00 34.63 ? 290 TRP E CB  1 
ATOM 5235  C CG  . TRP E 2 144 ? -11.643 4.993   -23.138 1.00 33.08 ? 290 TRP E CG  1 
ATOM 5236  C CD1 . TRP E 2 144 ? -12.026 4.866   -21.842 1.00 31.92 ? 290 TRP E CD1 1 
ATOM 5237  C CD2 . TRP E 2 144 ? -11.579 3.667   -23.678 1.00 33.13 ? 290 TRP E CD2 1 
ATOM 5238  N NE1 . TRP E 2 144 ? -12.222 3.540   -21.536 1.00 33.25 ? 290 TRP E NE1 1 
ATOM 5239  C CE2 . TRP E 2 144 ? -11.956 2.779   -22.646 1.00 33.23 ? 290 TRP E CE2 1 
ATOM 5240  C CE3 . TRP E 2 144 ? -11.240 3.142   -24.936 1.00 33.58 ? 290 TRP E CE3 1 
ATOM 5241  C CZ2 . TRP E 2 144 ? -12.017 1.388   -22.827 1.00 33.40 ? 290 TRP E CZ2 1 
ATOM 5242  C CZ3 . TRP E 2 144 ? -11.296 1.758   -25.120 1.00 34.92 ? 290 TRP E CZ3 1 
ATOM 5243  C CH2 . TRP E 2 144 ? -11.686 0.895   -24.064 1.00 34.80 ? 290 TRP E CH2 1 
ATOM 5244  N N   . ILE E 2 145 ? -9.093  7.354   -25.991 1.00 38.08 ? 291 ILE E N   1 
ATOM 5245  C CA  . ILE E 2 145 ? -8.771  8.305   -27.031 1.00 40.06 ? 291 ILE E CA  1 
ATOM 5246  C C   . ILE E 2 145 ? -9.243  7.831   -28.399 1.00 42.63 ? 291 ILE E C   1 
ATOM 5247  O O   . ILE E 2 145 ? -9.099  6.654   -28.746 1.00 43.03 ? 291 ILE E O   1 
ATOM 5248  C CB  . ILE E 2 145 ? -7.257  8.522   -27.107 1.00 39.30 ? 291 ILE E CB  1 
ATOM 5249  C CG1 . ILE E 2 145 ? -6.731  8.982   -25.751 1.00 39.23 ? 291 ILE E CG1 1 
ATOM 5250  C CG2 . ILE E 2 145 ? -6.927  9.536   -28.193 1.00 39.12 ? 291 ILE E CG2 1 
ATOM 5251  C CD1 . ILE E 2 145 ? -5.237  8.799   -25.606 1.00 38.52 ? 291 ILE E CD1 1 
ATOM 5252  N N   . LYS E 2 146 ? -9.811  8.753   -29.173 1.00 45.20 ? 292 LYS E N   1 
ATOM 5253  C CA  . LYS E 2 146 ? -10.261 8.440   -30.527 1.00 46.94 ? 292 LYS E CA  1 
ATOM 5254  C C   . LYS E 2 146 ? -9.284  9.136   -31.457 1.00 47.56 ? 292 LYS E C   1 
ATOM 5255  O O   . LYS E 2 146 ? -8.855  10.256  -31.176 1.00 46.84 ? 292 LYS E O   1 
ATOM 5256  C CB  . LYS E 2 146 ? -11.680 8.971   -30.772 1.00 47.31 ? 292 LYS E CB  1 
ATOM 5257  N N   . HIS E 2 147 ? -8.907  8.465   -32.537 1.00 49.57 ? 293 HIS E N   1 
ATOM 5258  C CA  . HIS E 2 147 ? -7.993  9.055   -33.502 1.00 52.93 ? 293 HIS E CA  1 
ATOM 5259  C C   . HIS E 2 147 ? -8.837  9.898   -34.458 1.00 54.22 ? 293 HIS E C   1 
ATOM 5260  O O   . HIS E 2 147 ? -9.840  9.422   -35.008 1.00 53.25 ? 293 HIS E O   1 
ATOM 5261  C CB  . HIS E 2 147 ? -7.252  7.951   -34.239 1.00 55.27 ? 293 HIS E CB  1 
ATOM 5262  C CG  . HIS E 2 147 ? -6.428  7.090   -33.332 1.00 58.94 ? 293 HIS E CG  1 
ATOM 5263  N ND1 . HIS E 2 147 ? -5.108  7.364   -33.037 1.00 60.29 ? 293 HIS E ND1 1 
ATOM 5264  C CD2 . HIS E 2 147 ? -6.757  6.001   -32.596 1.00 59.40 ? 293 HIS E CD2 1 
ATOM 5265  C CE1 . HIS E 2 147 ? -4.659  6.482   -32.160 1.00 60.20 ? 293 HIS E CE1 1 
ATOM 5266  N NE2 . HIS E 2 147 ? -5.642  5.645   -31.875 1.00 60.82 ? 293 HIS E NE2 1 
ATOM 5267  N N   . VAL E 2 148 ? -8.460  11.165  -34.619 1.00 55.39 ? 294 VAL E N   1 
ATOM 5268  C CA  . VAL E 2 148 ? -9.209  12.058  -35.496 1.00 56.15 ? 294 VAL E CA  1 
ATOM 5269  C C   . VAL E 2 148 ? -8.290  12.836  -36.427 1.00 56.68 ? 294 VAL E C   1 
ATOM 5270  O O   . VAL E 2 148 ? -8.737  13.344  -37.459 1.00 57.36 ? 294 VAL E O   1 
ATOM 5271  C CB  . VAL E 2 148 ? -10.094 13.069  -34.695 1.00 56.22 ? 294 VAL E CB  1 
ATOM 5272  C CG1 . VAL E 2 148 ? -10.960 13.867  -35.660 1.00 56.44 ? 294 VAL E CG1 1 
ATOM 5273  C CG2 . VAL E 2 148 ? -10.990 12.333  -33.708 1.00 54.83 ? 294 VAL E CG2 1 
ATOM 5274  N N   . PRO E 2 161 ? -0.424  12.907  -35.332 1.00 62.57 ? 307 PRO E N   1 
ATOM 5275  C CA  . PRO E 2 161 ? -1.561  12.064  -34.939 1.00 61.87 ? 307 PRO E CA  1 
ATOM 5276  C C   . PRO E 2 161 ? -2.646  12.858  -34.197 1.00 61.43 ? 307 PRO E C   1 
ATOM 5277  O O   . PRO E 2 161 ? -2.492  13.199  -33.014 1.00 61.62 ? 307 PRO E O   1 
ATOM 5278  C CB  . PRO E 2 161 ? -0.907  11.023  -34.041 1.00 62.56 ? 307 PRO E CB  1 
ATOM 5279  C CG  . PRO E 2 161 ? 0.125   11.862  -33.297 1.00 62.30 ? 307 PRO E CG  1 
ATOM 5280  C CD  . PRO E 2 161 ? 0.725   12.712  -34.423 1.00 62.65 ? 307 PRO E CD  1 
ATOM 5281  N N   . TYR E 2 162 ? -3.738  13.149  -34.895 1.00 59.92 ? 308 TYR E N   1 
ATOM 5282  C CA  . TYR E 2 162 ? -4.850  13.899  -34.311 1.00 58.84 ? 308 TYR E CA  1 
ATOM 5283  C C   . TYR E 2 162 ? -5.614  13.030  -33.307 1.00 57.96 ? 308 TYR E C   1 
ATOM 5284  O O   . TYR E 2 162 ? -6.344  12.117  -33.704 1.00 58.12 ? 308 TYR E O   1 
ATOM 5285  C CB  . TYR E 2 162 ? -5.804  14.365  -35.420 1.00 58.46 ? 308 TYR E CB  1 
ATOM 5286  N N   . LEU E 2 163 ? -5.463  13.327  -32.016 1.00 56.41 ? 309 LEU E N   1 
ATOM 5287  C CA  . LEU E 2 163 ? -6.115  12.550  -30.960 1.00 54.74 ? 309 LEU E CA  1 
ATOM 5288  C C   . LEU E 2 163 ? -7.146  13.352  -30.166 1.00 53.22 ? 309 LEU E C   1 
ATOM 5289  O O   . LEU E 2 163 ? -6.994  14.552  -29.971 1.00 52.76 ? 309 LEU E O   1 
ATOM 5290  C CB  . LEU E 2 163 ? -5.059  12.020  -29.983 1.00 55.66 ? 309 LEU E CB  1 
ATOM 5291  C CG  . LEU E 2 163 ? -3.610  12.005  -30.477 1.00 56.81 ? 309 LEU E CG  1 
ATOM 5292  C CD1 . LEU E 2 163 ? -2.653  12.129  -29.295 1.00 57.60 ? 309 LEU E CD1 1 
ATOM 5293  C CD2 . LEU E 2 163 ? -3.361  10.744  -31.272 1.00 56.58 ? 309 LEU E CD2 1 
ATOM 5294  N N   . LYS E 2 164 ? -8.189  12.677  -29.692 1.00 51.78 ? 310 LYS E N   1 
ATOM 5295  C CA  . LYS E 2 164 ? -9.224  13.334  -28.898 1.00 50.04 ? 310 LYS E CA  1 
ATOM 5296  C C   . LYS E 2 164 ? -9.552  12.532  -27.640 1.00 48.31 ? 310 LYS E C   1 
ATOM 5297  O O   . LYS E 2 164 ? -9.961  11.369  -27.715 1.00 49.23 ? 310 LYS E O   1 
ATOM 5298  C CB  . LYS E 2 164 ? -10.503 13.519  -29.717 1.00 50.84 ? 310 LYS E CB  1 
ATOM 5299  C CG  . LYS E 2 164 ? -11.643 14.182  -28.932 1.00 52.26 ? 310 LYS E CG  1 
ATOM 5300  C CD  . LYS E 2 164 ? -12.986 14.070  -29.656 1.00 54.89 ? 310 LYS E CD  1 
ATOM 5301  C CE  . LYS E 2 164 ? -14.155 14.621  -28.820 1.00 56.23 ? 310 LYS E CE  1 
ATOM 5302  N NZ  . LYS E 2 164 ? -14.176 16.118  -28.735 1.00 58.61 ? 310 LYS E NZ  1 
ATOM 5303  N N   . VAL E 2 165 ? -9.380  13.154  -26.483 1.00 45.71 ? 311 VAL E N   1 
ATOM 5304  C CA  . VAL E 2 165 ? -9.676  12.483  -25.230 1.00 44.15 ? 311 VAL E CA  1 
ATOM 5305  C C   . VAL E 2 165 ? -11.183 12.446  -25.015 1.00 43.85 ? 311 VAL E C   1 
ATOM 5306  O O   . VAL E 2 165 ? -11.819 13.480  -24.819 1.00 44.06 ? 311 VAL E O   1 
ATOM 5307  C CB  . VAL E 2 165 ? -9.029  13.202  -24.045 1.00 42.70 ? 311 VAL E CB  1 
ATOM 5308  C CG1 . VAL E 2 165 ? -9.329  12.446  -22.768 1.00 41.91 ? 311 VAL E CG1 1 
ATOM 5309  C CG2 . VAL E 2 165 ? -7.535  13.316  -24.265 1.00 41.56 ? 311 VAL E CG2 1 
ATOM 5310  N N   . LEU E 2 166 ? -11.749 11.247  -25.049 1.00 42.19 ? 312 LEU E N   1 
ATOM 5311  C CA  . LEU E 2 166 ? -13.176 11.075  -24.860 1.00 40.70 ? 312 LEU E CA  1 
ATOM 5312  C C   . LEU E 2 166 ? -13.529 10.875  -23.389 1.00 40.42 ? 312 LEU E C   1 
ATOM 5313  O O   . LEU E 2 166 ? -14.635 11.190  -22.946 1.00 40.37 ? 312 LEU E O   1 
ATOM 5314  C CB  . LEU E 2 166 ? -13.647 9.850   -25.646 1.00 40.89 ? 312 LEU E CB  1 
ATOM 5315  C CG  . LEU E 2 166 ? -13.268 9.842   -27.122 1.00 42.21 ? 312 LEU E CG  1 
ATOM 5316  C CD1 . LEU E 2 166 ? -13.814 8.606   -27.809 1.00 40.46 ? 312 LEU E CD1 1 
ATOM 5317  C CD2 . LEU E 2 166 ? -13.831 11.108  -27.770 1.00 44.24 ? 312 LEU E CD2 1 
ATOM 5318  N N   . LYS E 2 167 ? -12.579 10.356  -22.625 1.00 40.45 ? 313 LYS E N   1 
ATOM 5319  C CA  . LYS E 2 167 ? -12.837 10.049  -21.225 1.00 39.70 ? 313 LYS E CA  1 
ATOM 5320  C C   . LYS E 2 167 ? -11.491 9.895   -20.539 1.00 39.23 ? 313 LYS E C   1 
ATOM 5321  O O   . LYS E 2 167 ? -10.569 9.309   -21.105 1.00 39.49 ? 313 LYS E O   1 
ATOM 5322  C CB  . LYS E 2 167 ? -13.612 8.730   -21.163 1.00 39.40 ? 313 LYS E CB  1 
ATOM 5323  C CG  . LYS E 2 167 ? -14.585 8.559   -20.027 1.00 39.03 ? 313 LYS E CG  1 
ATOM 5324  C CD  . LYS E 2 167 ? -15.244 7.177   -20.125 1.00 38.76 ? 313 LYS E CD  1 
ATOM 5325  C CE  . LYS E 2 167 ? -16.160 6.896   -18.941 1.00 38.92 ? 313 LYS E CE  1 
ATOM 5326  N NZ  . LYS E 2 167 ? -16.630 5.480   -18.926 1.00 39.95 ? 313 LYS E NZ  1 
ATOM 5327  N N   . ALA E 2 168 ? -11.374 10.428  -19.327 1.00 38.78 ? 314 ALA E N   1 
ATOM 5328  C CA  . ALA E 2 168 ? -10.122 10.336  -18.580 1.00 37.70 ? 314 ALA E CA  1 
ATOM 5329  C C   . ALA E 2 168 ? -10.406 10.214  -17.093 1.00 37.35 ? 314 ALA E C   1 
ATOM 5330  O O   . ALA E 2 168 ? -11.165 11.004  -16.525 1.00 36.92 ? 314 ALA E O   1 
ATOM 5331  C CB  . ALA E 2 168 ? -9.248  11.553  -18.858 1.00 35.26 ? 314 ALA E CB  1 
ATOM 5332  N N   . ALA E 2 169 ? -9.788  9.205   -16.480 1.00 38.03 ? 315 ALA E N   1 
ATOM 5333  C CA  . ALA E 2 169 ? -9.942  8.927   -15.058 1.00 37.69 ? 315 ALA E CA  1 
ATOM 5334  C C   . ALA E 2 169 ? -9.609  10.157  -14.221 1.00 37.13 ? 315 ALA E C   1 
ATOM 5335  O O   . ALA E 2 169 ? -8.825  11.003  -14.629 1.00 36.47 ? 315 ALA E O   1 
ATOM 5336  C CB  . ALA E 2 169 ? -9.034  7.760   -14.666 1.00 37.89 ? 315 ALA E CB  1 
ATOM 5337  N N   . GLY E 2 170 ? -10.219 10.243  -13.048 1.00 37.01 ? 316 GLY E N   1 
ATOM 5338  C CA  . GLY E 2 170 ? -9.981  11.356  -12.158 1.00 37.95 ? 316 GLY E CA  1 
ATOM 5339  C C   . GLY E 2 170 ? -11.023 11.338  -11.063 1.00 39.58 ? 316 GLY E C   1 
ATOM 5340  O O   . GLY E 2 170 ? -11.856 10.433  -10.998 1.00 39.00 ? 316 GLY E O   1 
ATOM 5341  N N   . VAL E 2 171 ? -10.972 12.338  -10.191 1.00 41.11 ? 317 VAL E N   1 
ATOM 5342  C CA  . VAL E 2 171 ? -11.916 12.468  -9.082  1.00 41.60 ? 317 VAL E CA  1 
ATOM 5343  C C   . VAL E 2 171 ? -13.356 12.471  -9.597  1.00 41.21 ? 317 VAL E C   1 
ATOM 5344  O O   . VAL E 2 171 ? -14.265 11.987  -8.934  1.00 41.12 ? 317 VAL E O   1 
ATOM 5345  C CB  . VAL E 2 171 ? -11.644 13.791  -8.299  1.00 41.12 ? 317 VAL E CB  1 
ATOM 5346  C CG1 . VAL E 2 171 ? -12.692 14.013  -7.238  1.00 43.31 ? 317 VAL E CG1 1 
ATOM 5347  C CG2 . VAL E 2 171 ? -10.291 13.726  -7.641  1.00 41.31 ? 317 VAL E CG2 1 
ATOM 5348  N N   . ASN E 2 172 ? -13.545 13.017  -10.790 1.00 42.19 ? 318 ASN E N   1 
ATOM 5349  C CA  . ASN E 2 172 ? -14.868 13.108  -11.394 1.00 44.10 ? 318 ASN E CA  1 
ATOM 5350  C C   . ASN E 2 172 ? -15.210 11.932  -12.314 1.00 44.51 ? 318 ASN E C   1 
ATOM 5351  O O   . ASN E 2 172 ? -16.368 11.715  -12.649 1.00 44.88 ? 318 ASN E O   1 
ATOM 5352  C CB  . ASN E 2 172 ? -14.997 14.443  -12.145 1.00 44.10 ? 318 ASN E CB  1 
ATOM 5353  C CG  . ASN E 2 172 ? -15.285 15.621  -11.200 1.00 46.40 ? 318 ASN E CG  1 
ATOM 5354  O OD1 . ASN E 2 172 ? -14.983 16.775  -11.514 1.00 47.88 ? 318 ASN E OD1 1 
ATOM 5355  N ND2 . ASN E 2 172 ? -15.881 15.330  -10.040 1.00 45.47 ? 318 ASN E ND2 1 
ATOM 5356  N N   . THR E 2 173 ? -14.204 11.170  -12.720 1.00 45.10 ? 319 THR E N   1 
ATOM 5357  C CA  . THR E 2 173 ? -14.439 10.010  -13.569 1.00 44.55 ? 319 THR E CA  1 
ATOM 5358  C C   . THR E 2 173 ? -13.675 8.832   -12.983 1.00 44.73 ? 319 THR E C   1 
ATOM 5359  O O   . THR E 2 173 ? -12.642 8.409   -13.504 1.00 45.32 ? 319 THR E O   1 
ATOM 5360  C CB  . THR E 2 173 ? -13.958 10.258  -14.990 1.00 44.77 ? 319 THR E CB  1 
ATOM 5361  O OG1 . THR E 2 173 ? -14.400 11.552  -15.421 1.00 44.79 ? 319 THR E OG1 1 
ATOM 5362  C CG2 . THR E 2 173 ? -14.523 9.194   -15.921 1.00 44.21 ? 319 THR E CG2 1 
ATOM 5363  N N   . THR E 2 174 ? -14.210 8.319   -11.880 1.00 44.08 ? 320 THR E N   1 
ATOM 5364  C CA  . THR E 2 174 ? -13.641 7.207   -11.128 1.00 42.88 ? 320 THR E CA  1 
ATOM 5365  C C   . THR E 2 174 ? -13.270 5.980   -11.954 1.00 41.90 ? 320 THR E C   1 
ATOM 5366  O O   . THR E 2 174 ? -13.873 5.713   -12.985 1.00 41.38 ? 320 THR E O   1 
ATOM 5367  C CB  . THR E 2 174 ? -14.634 6.780   -10.011 1.00 42.01 ? 320 THR E CB  1 
ATOM 5368  O OG1 . THR E 2 174 ? -14.947 7.922   -9.207  1.00 41.53 ? 320 THR E OG1 1 
ATOM 5369  C CG2 . THR E 2 174 ? -14.028 5.707   -9.112  1.00 43.14 ? 320 THR E CG2 1 
ATOM 5370  N N   . ASP E 2 175 ? -12.271 5.235   -11.486 1.00 41.88 ? 321 ASP E N   1 
ATOM 5371  C CA  . ASP E 2 175 ? -11.846 4.008   -12.154 1.00 42.00 ? 321 ASP E CA  1 
ATOM 5372  C C   . ASP E 2 175 ? -13.009 3.024   -12.191 1.00 43.19 ? 321 ASP E C   1 
ATOM 5373  O O   . ASP E 2 175 ? -13.068 2.141   -13.063 1.00 43.78 ? 321 ASP E O   1 
ATOM 5374  C CB  . ASP E 2 175 ? -10.693 3.352   -11.403 1.00 40.26 ? 321 ASP E CB  1 
ATOM 5375  C CG  . ASP E 2 175 ? -9.449  4.196   -11.398 1.00 39.51 ? 321 ASP E CG  1 
ATOM 5376  O OD1 . ASP E 2 175 ? -9.178  4.862   -12.426 1.00 38.07 ? 321 ASP E OD1 1 
ATOM 5377  O OD2 . ASP E 2 175 ? -8.739  4.177   -10.365 1.00 40.67 ? 321 ASP E OD2 1 
ATOM 5378  N N   . LYS E 2 176 ? -13.923 3.178   -11.231 1.00 43.31 ? 322 LYS E N   1 
ATOM 5379  C CA  . LYS E 2 176 ? -15.094 2.320   -11.119 1.00 43.61 ? 322 LYS E CA  1 
ATOM 5380  C C   . LYS E 2 176 ? -15.793 2.114   -12.463 1.00 43.83 ? 322 LYS E C   1 
ATOM 5381  O O   . LYS E 2 176 ? -16.276 1.014   -12.750 1.00 43.80 ? 322 LYS E O   1 
ATOM 5382  C CB  . LYS E 2 176 ? -16.078 2.900   -10.097 1.00 44.11 ? 322 LYS E CB  1 
ATOM 5383  N N   . GLU E 2 177 ? -15.844 3.149   -13.297 1.00 43.50 ? 323 GLU E N   1 
ATOM 5384  C CA  . GLU E 2 177 ? -16.494 2.975   -14.585 1.00 45.10 ? 323 GLU E CA  1 
ATOM 5385  C C   . GLU E 2 177 ? -15.687 3.472   -15.791 1.00 45.48 ? 323 GLU E C   1 
ATOM 5386  O O   . GLU E 2 177 ? -16.213 3.594   -16.902 1.00 46.32 ? 323 GLU E O   1 
ATOM 5387  C CB  . GLU E 2 177 ? -17.899 3.607   -14.546 1.00 46.10 ? 323 GLU E CB  1 
ATOM 5388  C CG  . GLU E 2 177 ? -18.093 4.942   -15.261 1.00 48.03 ? 323 GLU E CG  1 
ATOM 5389  C CD  . GLU E 2 177 ? -17.274 6.063   -14.662 1.00 49.07 ? 323 GLU E CD  1 
ATOM 5390  O OE1 . GLU E 2 177 ? -16.028 5.950   -14.681 1.00 50.02 ? 323 GLU E OE1 1 
ATOM 5391  O OE2 . GLU E 2 177 ? -17.874 7.053   -14.175 1.00 48.48 ? 323 GLU E OE2 1 
ATOM 5392  N N   . ILE E 2 178 ? -14.399 3.726   -15.578 1.00 45.02 ? 324 ILE E N   1 
ATOM 5393  C CA  . ILE E 2 178 ? -13.515 4.206   -16.644 1.00 43.85 ? 324 ILE E CA  1 
ATOM 5394  C C   . ILE E 2 178 ? -13.075 3.091   -17.598 1.00 43.13 ? 324 ILE E C   1 
ATOM 5395  O O   . ILE E 2 178 ? -12.683 3.353   -18.734 1.00 40.64 ? 324 ILE E O   1 
ATOM 5396  C CB  . ILE E 2 178 ? -12.224 4.833   -16.053 1.00 44.34 ? 324 ILE E CB  1 
ATOM 5397  C CG1 . ILE E 2 178 ? -11.419 5.532   -17.147 1.00 44.11 ? 324 ILE E CG1 1 
ATOM 5398  C CG2 . ILE E 2 178 ? -11.359 3.744   -15.414 1.00 43.65 ? 324 ILE E CG2 1 
ATOM 5399  C CD1 . ILE E 2 178 ? -12.116 6.726   -17.753 1.00 44.38 ? 324 ILE E CD1 1 
ATOM 5400  N N   . GLU E 2 179 ? -13.126 1.849   -17.121 1.00 43.66 ? 325 GLU E N   1 
ATOM 5401  C CA  . GLU E 2 179 ? -12.701 0.704   -17.919 1.00 44.36 ? 325 GLU E CA  1 
ATOM 5402  C C   . GLU E 2 179 ? -13.609 0.349   -19.089 1.00 44.51 ? 325 GLU E C   1 
ATOM 5403  O O   . GLU E 2 179 ? -13.206 -0.376  -19.994 1.00 44.44 ? 325 GLU E O   1 
ATOM 5404  C CB  . GLU E 2 179 ? -12.540 -0.534  -17.040 1.00 45.63 ? 325 GLU E CB  1 
ATOM 5405  C CG  . GLU E 2 179 ? -11.369 -0.497  -16.072 1.00 47.56 ? 325 GLU E CG  1 
ATOM 5406  C CD  . GLU E 2 179 ? -10.972 -1.897  -15.609 1.00 49.18 ? 325 GLU E CD  1 
ATOM 5407  O OE1 . GLU E 2 179 ? -11.884 -2.722  -15.346 1.00 50.04 ? 325 GLU E OE1 1 
ATOM 5408  O OE2 . GLU E 2 179 ? -9.754  -2.171  -15.505 1.00 49.47 ? 325 GLU E OE2 1 
ATOM 5409  N N   . VAL E 2 180 ? -14.835 0.847   -19.077 1.00 44.38 ? 326 VAL E N   1 
ATOM 5410  C CA  . VAL E 2 180 ? -15.752 0.560   -20.169 1.00 43.90 ? 326 VAL E CA  1 
ATOM 5411  C C   . VAL E 2 180 ? -16.189 1.879   -20.830 1.00 44.35 ? 326 VAL E C   1 
ATOM 5412  O O   . VAL E 2 180 ? -16.501 2.857   -20.145 1.00 44.77 ? 326 VAL E O   1 
ATOM 5413  C CB  . VAL E 2 180 ? -16.962 -0.246  -19.644 1.00 43.43 ? 326 VAL E CB  1 
ATOM 5414  C CG1 . VAL E 2 180 ? -17.649 0.515   -18.517 1.00 44.52 ? 326 VAL E CG1 1 
ATOM 5415  C CG2 . VAL E 2 180 ? -17.919 -0.547  -20.776 1.00 43.58 ? 326 VAL E CG2 1 
ATOM 5416  N N   . LEU E 2 181 ? -16.172 1.912   -22.161 1.00 44.57 ? 327 LEU E N   1 
ATOM 5417  C CA  . LEU E 2 181 ? -16.554 3.107   -22.915 1.00 45.58 ? 327 LEU E CA  1 
ATOM 5418  C C   . LEU E 2 181 ? -17.792 2.851   -23.769 1.00 46.90 ? 327 LEU E C   1 
ATOM 5419  O O   . LEU E 2 181 ? -17.795 1.951   -24.610 1.00 45.91 ? 327 LEU E O   1 
ATOM 5420  C CB  . LEU E 2 181 ? -15.402 3.547   -23.831 1.00 45.16 ? 327 LEU E CB  1 
ATOM 5421  C CG  . LEU E 2 181 ? -15.689 4.660   -24.855 1.00 44.90 ? 327 LEU E CG  1 
ATOM 5422  C CD1 . LEU E 2 181 ? -15.919 5.979   -24.143 1.00 44.92 ? 327 LEU E CD1 1 
ATOM 5423  C CD2 . LEU E 2 181 ? -14.517 4.802   -25.814 1.00 44.40 ? 327 LEU E CD2 1 
ATOM 5424  N N   . TYR E 2 182 ? -18.838 3.647   -23.564 1.00 49.33 ? 328 TYR E N   1 
ATOM 5425  C CA  . TYR E 2 182 ? -20.064 3.478   -24.344 1.00 51.65 ? 328 TYR E CA  1 
ATOM 5426  C C   . TYR E 2 182 ? -20.252 4.586   -25.357 1.00 52.48 ? 328 TYR E C   1 
ATOM 5427  O O   . TYR E 2 182 ? -19.801 5.717   -25.162 1.00 52.07 ? 328 TYR E O   1 
ATOM 5428  C CB  . TYR E 2 182 ? -21.290 3.436   -23.439 1.00 53.43 ? 328 TYR E CB  1 
ATOM 5429  C CG  . TYR E 2 182 ? -21.126 2.526   -22.256 1.00 56.18 ? 328 TYR E CG  1 
ATOM 5430  C CD1 . TYR E 2 182 ? -20.381 2.931   -21.142 1.00 57.59 ? 328 TYR E CD1 1 
ATOM 5431  C CD2 . TYR E 2 182 ? -21.695 1.254   -22.250 1.00 57.12 ? 328 TYR E CD2 1 
ATOM 5432  C CE1 . TYR E 2 182 ? -20.208 2.089   -20.044 1.00 59.08 ? 328 TYR E CE1 1 
ATOM 5433  C CE2 . TYR E 2 182 ? -21.528 0.397   -21.158 1.00 58.79 ? 328 TYR E CE2 1 
ATOM 5434  C CZ  . TYR E 2 182 ? -20.784 0.821   -20.059 1.00 59.00 ? 328 TYR E CZ  1 
ATOM 5435  O OH  . TYR E 2 182 ? -20.619 -0.019  -18.980 1.00 59.97 ? 328 TYR E OH  1 
ATOM 5436  N N   . ILE E 2 183 ? -20.909 4.243   -26.455 1.00 54.23 ? 329 ILE E N   1 
ATOM 5437  C CA  . ILE E 2 183 ? -21.199 5.212   -27.503 1.00 56.52 ? 329 ILE E CA  1 
ATOM 5438  C C   . ILE E 2 183 ? -22.606 4.890   -28.008 1.00 57.74 ? 329 ILE E C   1 
ATOM 5439  O O   . ILE E 2 183 ? -22.807 3.919   -28.757 1.00 57.75 ? 329 ILE E O   1 
ATOM 5440  C CB  . ILE E 2 183 ? -20.193 5.138   -28.686 1.00 57.03 ? 329 ILE E CB  1 
ATOM 5441  C CG1 . ILE E 2 183 ? -18.760 5.002   -28.167 1.00 57.97 ? 329 ILE E CG1 1 
ATOM 5442  C CG2 . ILE E 2 183 ? -20.283 6.404   -29.517 1.00 56.26 ? 329 ILE E CG2 1 
ATOM 5443  C CD1 . ILE E 2 183 ? -18.394 3.593   -27.753 1.00 59.40 ? 329 ILE E CD1 1 
ATOM 5444  N N   . ARG E 2 184 ? -23.572 5.701   -27.566 1.00 58.94 ? 330 ARG E N   1 
ATOM 5445  C CA  . ARG E 2 184 ? -24.974 5.541   -27.947 1.00 59.38 ? 330 ARG E CA  1 
ATOM 5446  C C   . ARG E 2 184 ? -25.286 6.259   -29.265 1.00 60.05 ? 330 ARG E C   1 
ATOM 5447  O O   . ARG E 2 184 ? -24.653 7.271   -29.607 1.00 59.34 ? 330 ARG E O   1 
ATOM 5448  C CB  . ARG E 2 184 ? -25.885 6.064   -26.830 1.00 58.40 ? 330 ARG E CB  1 
ATOM 5449  N N   . ASN E 2 185 ? -26.259 5.718   -30.000 1.00 60.77 ? 331 ASN E N   1 
ATOM 5450  C CA  . ASN E 2 185 ? -26.672 6.280   -31.285 1.00 61.66 ? 331 ASN E CA  1 
ATOM 5451  C C   . ASN E 2 185 ? -25.428 6.702   -32.065 1.00 61.30 ? 331 ASN E C   1 
ATOM 5452  O O   . ASN E 2 185 ? -25.234 7.880   -32.369 1.00 61.21 ? 331 ASN E O   1 
ATOM 5453  C CB  . ASN E 2 185 ? -27.600 7.487   -31.061 1.00 62.71 ? 331 ASN E CB  1 
ATOM 5454  N N   . VAL E 2 186 ? -24.582 5.729   -32.375 1.00 60.95 ? 332 VAL E N   1 
ATOM 5455  C CA  . VAL E 2 186 ? -23.359 6.017   -33.095 1.00 61.92 ? 332 VAL E CA  1 
ATOM 5456  C C   . VAL E 2 186 ? -23.681 6.554   -34.482 1.00 62.39 ? 332 VAL E C   1 
ATOM 5457  O O   . VAL E 2 186 ? -24.726 6.235   -35.051 1.00 63.37 ? 332 VAL E O   1 
ATOM 5458  C CB  . VAL E 2 186 ? -22.474 4.757   -33.195 1.00 61.95 ? 332 VAL E CB  1 
ATOM 5459  C CG1 . VAL E 2 186 ? -22.277 4.165   -31.800 1.00 62.17 ? 332 VAL E CG1 1 
ATOM 5460  C CG2 . VAL E 2 186 ? -23.110 3.736   -34.116 1.00 62.26 ? 332 VAL E CG2 1 
ATOM 5461  N N   . THR E 2 187 ? -22.786 7.379   -35.015 1.00 62.28 ? 333 THR E N   1 
ATOM 5462  C CA  . THR E 2 187 ? -22.975 7.966   -36.333 1.00 62.56 ? 333 THR E CA  1 
ATOM 5463  C C   . THR E 2 187 ? -21.750 7.651   -37.183 1.00 62.89 ? 333 THR E C   1 
ATOM 5464  O O   . THR E 2 187 ? -20.766 7.123   -36.668 1.00 63.29 ? 333 THR E O   1 
ATOM 5465  C CB  . THR E 2 187 ? -23.137 9.479   -36.210 1.00 63.07 ? 333 THR E CB  1 
ATOM 5466  O OG1 . THR E 2 187 ? -21.921 10.045  -35.709 1.00 62.82 ? 333 THR E OG1 1 
ATOM 5467  C CG2 . THR E 2 187 ? -24.271 9.806   -35.246 1.00 62.57 ? 333 THR E CG2 1 
ATOM 5468  N N   . PHE E 2 188 ? -21.804 7.961   -38.477 1.00 63.14 ? 334 PHE E N   1 
ATOM 5469  C CA  . PHE E 2 188 ? -20.663 7.696   -39.357 1.00 63.99 ? 334 PHE E CA  1 
ATOM 5470  C C   . PHE E 2 188 ? -19.456 8.489   -38.861 1.00 63.47 ? 334 PHE E C   1 
ATOM 5471  O O   . PHE E 2 188 ? -18.306 8.198   -39.212 1.00 63.40 ? 334 PHE E O   1 
ATOM 5472  C CB  . PHE E 2 188 ? -20.980 8.090   -40.812 1.00 66.21 ? 334 PHE E CB  1 
ATOM 5473  C CG  . PHE E 2 188 ? -21.151 6.906   -41.751 1.00 67.78 ? 334 PHE E CG  1 
ATOM 5474  C CD1 . PHE E 2 188 ? -22.154 5.952   -41.524 1.00 68.48 ? 334 PHE E CD1 1 
ATOM 5475  C CD2 . PHE E 2 188 ? -20.315 6.752   -42.868 1.00 67.14 ? 334 PHE E CD2 1 
ATOM 5476  C CE1 . PHE E 2 188 ? -22.325 4.862   -42.397 1.00 68.67 ? 334 PHE E CE1 1 
ATOM 5477  C CE2 . PHE E 2 188 ? -20.474 5.667   -43.747 1.00 67.28 ? 334 PHE E CE2 1 
ATOM 5478  C CZ  . PHE E 2 188 ? -21.479 4.722   -43.513 1.00 68.09 ? 334 PHE E CZ  1 
ATOM 5479  N N   . GLU E 2 189 ? -19.728 9.500   -38.043 1.00 62.60 ? 335 GLU E N   1 
ATOM 5480  C CA  . GLU E 2 189 ? -18.672 10.334  -37.488 1.00 61.87 ? 335 GLU E CA  1 
ATOM 5481  C C   . GLU E 2 189 ? -17.886 9.505   -36.462 1.00 60.95 ? 335 GLU E C   1 
ATOM 5482  O O   . GLU E 2 189 ? -16.646 9.536   -36.423 1.00 60.78 ? 335 GLU E O   1 
ATOM 5483  C CB  . GLU E 2 189 ? -19.288 11.575  -36.817 1.00 61.32 ? 335 GLU E CB  1 
ATOM 5484  N N   . ASP E 2 190 ? -18.628 8.755   -35.648 1.00 59.50 ? 336 ASP E N   1 
ATOM 5485  C CA  . ASP E 2 190 ? -18.061 7.918   -34.594 1.00 57.74 ? 336 ASP E CA  1 
ATOM 5486  C C   . ASP E 2 190 ? -17.091 6.833   -35.070 1.00 56.64 ? 336 ASP E C   1 
ATOM 5487  O O   . ASP E 2 190 ? -16.214 6.408   -34.314 1.00 56.92 ? 336 ASP E O   1 
ATOM 5488  C CB  . ASP E 2 190 ? -19.186 7.259   -33.770 1.00 58.29 ? 336 ASP E CB  1 
ATOM 5489  C CG  . ASP E 2 190 ? -19.974 8.266   -32.927 1.00 58.87 ? 336 ASP E CG  1 
ATOM 5490  O OD1 . ASP E 2 190 ? -19.397 9.311   -32.551 1.00 58.11 ? 336 ASP E OD1 1 
ATOM 5491  O OD2 . ASP E 2 190 ? -21.161 8.005   -32.625 1.00 58.48 ? 336 ASP E OD2 1 
ATOM 5492  N N   . ALA E 2 191 ? -17.237 6.382   -36.312 1.00 55.04 ? 337 ALA E N   1 
ATOM 5493  C CA  . ALA E 2 191 ? -16.350 5.343   -36.831 1.00 52.81 ? 337 ALA E CA  1 
ATOM 5494  C C   . ALA E 2 191 ? -14.893 5.752   -36.642 1.00 51.48 ? 337 ALA E C   1 
ATOM 5495  O O   . ALA E 2 191 ? -14.592 6.931   -36.442 1.00 50.20 ? 337 ALA E O   1 
ATOM 5496  C CB  . ALA E 2 191 ? -16.640 5.082   -38.302 1.00 52.77 ? 337 ALA E CB  1 
ATOM 5497  N N   . GLY E 2 192 ? -13.991 4.774   -36.690 1.00 50.79 ? 338 GLY E N   1 
ATOM 5498  C CA  . GLY E 2 192 ? -12.581 5.073   -36.508 1.00 49.87 ? 338 GLY E CA  1 
ATOM 5499  C C   . GLY E 2 192 ? -11.890 4.228   -35.446 1.00 48.71 ? 338 GLY E C   1 
ATOM 5500  O O   . GLY E 2 192 ? -12.467 3.273   -34.914 1.00 47.93 ? 338 GLY E O   1 
ATOM 5501  N N   . GLU E 2 193 ? -10.651 4.607   -35.127 1.00 47.69 ? 339 GLU E N   1 
ATOM 5502  C CA  . GLU E 2 193 ? -9.829  3.886   -34.157 1.00 46.39 ? 339 GLU E CA  1 
ATOM 5503  C C   . GLU E 2 193 ? -9.859  4.423   -32.722 1.00 44.63 ? 339 GLU E C   1 
ATOM 5504  O O   . GLU E 2 193 ? -9.433  5.545   -32.450 1.00 43.79 ? 339 GLU E O   1 
ATOM 5505  C CB  . GLU E 2 193 ? -8.384  3.850   -34.665 1.00 46.60 ? 339 GLU E CB  1 
ATOM 5506  C CG  . GLU E 2 193 ? -7.429  3.028   -33.831 1.00 47.02 ? 339 GLU E CG  1 
ATOM 5507  C CD  . GLU E 2 193 ? -6.037  3.051   -34.407 1.00 47.98 ? 339 GLU E CD  1 
ATOM 5508  O OE1 . GLU E 2 193 ? -5.555  4.157   -34.727 1.00 49.14 ? 339 GLU E OE1 1 
ATOM 5509  O OE2 . GLU E 2 193 ? -5.420  1.975   -34.541 1.00 48.60 ? 339 GLU E OE2 1 
ATOM 5510  N N   . TYR E 2 194 ? -10.360 3.595   -31.813 1.00 43.26 ? 340 TYR E N   1 
ATOM 5511  C CA  . TYR E 2 194 ? -10.446 3.935   -30.401 1.00 42.66 ? 340 TYR E CA  1 
ATOM 5512  C C   . TYR E 2 194 ? -9.276  3.309   -29.644 1.00 41.44 ? 340 TYR E C   1 
ATOM 5513  O O   . TYR E 2 194 ? -8.892  2.174   -29.914 1.00 41.84 ? 340 TYR E O   1 
ATOM 5514  C CB  . TYR E 2 194 ? -11.742 3.400   -29.806 1.00 45.04 ? 340 TYR E CB  1 
ATOM 5515  C CG  . TYR E 2 194 ? -13.004 4.100   -30.261 1.00 47.61 ? 340 TYR E CG  1 
ATOM 5516  C CD1 . TYR E 2 194 ? -13.396 4.086   -31.598 1.00 48.51 ? 340 TYR E CD1 1 
ATOM 5517  C CD2 . TYR E 2 194 ? -13.838 4.736   -29.335 1.00 48.33 ? 340 TYR E CD2 1 
ATOM 5518  C CE1 . TYR E 2 194 ? -14.587 4.681   -32.004 1.00 48.99 ? 340 TYR E CE1 1 
ATOM 5519  C CE2 . TYR E 2 194 ? -15.030 5.328   -29.728 1.00 48.78 ? 340 TYR E CE2 1 
ATOM 5520  C CZ  . TYR E 2 194 ? -15.400 5.298   -31.060 1.00 49.29 ? 340 TYR E CZ  1 
ATOM 5521  O OH  . TYR E 2 194 ? -16.590 5.879   -31.439 1.00 50.03 ? 340 TYR E OH  1 
ATOM 5522  N N   . THR E 2 195 ? -8.719  4.039   -28.685 1.00 39.21 ? 341 THR E N   1 
ATOM 5523  C CA  . THR E 2 195 ? -7.605  3.525   -27.911 1.00 36.59 ? 341 THR E CA  1 
ATOM 5524  C C   . THR E 2 195 ? -7.753  3.670   -26.412 1.00 35.55 ? 341 THR E C   1 
ATOM 5525  O O   . THR E 2 195 ? -8.210  4.700   -25.924 1.00 35.86 ? 341 THR E O   1 
ATOM 5526  C CB  . THR E 2 195 ? -6.317  4.219   -28.303 1.00 36.00 ? 341 THR E CB  1 
ATOM 5527  O OG1 . THR E 2 195 ? -5.969  3.831   -29.634 1.00 37.13 ? 341 THR E OG1 1 
ATOM 5528  C CG2 . THR E 2 195 ? -5.192  3.837   -27.353 1.00 35.57 ? 341 THR E CG2 1 
ATOM 5529  N N   . CYS E 2 196 ? -7.382  2.624   -25.681 1.00 34.42 ? 342 CYS E N   1 
ATOM 5530  C CA  . CYS E 2 196 ? -7.403  2.693   -24.232 1.00 33.08 ? 342 CYS E CA  1 
ATOM 5531  C C   . CYS E 2 196 ? -5.961  2.846   -23.813 1.00 31.35 ? 342 CYS E C   1 
ATOM 5532  O O   . CYS E 2 196 ? -5.141  1.958   -24.054 1.00 30.20 ? 342 CYS E O   1 
ATOM 5533  C CB  . CYS E 2 196 ? -7.930  1.435   -23.585 1.00 34.79 ? 342 CYS E CB  1 
ATOM 5534  S SG  . CYS E 2 196 ? -7.465  1.450   -21.845 1.00 37.72 ? 342 CYS E SG  1 
ATOM 5535  N N   . LEU E 2 197 ? -5.648  3.973   -23.187 1.00 31.00 ? 343 LEU E N   1 
ATOM 5536  C CA  . LEU E 2 197 ? -4.280  4.224   -22.747 1.00 29.51 ? 343 LEU E CA  1 
ATOM 5537  C C   . LEU E 2 197 ? -4.181  4.282   -21.234 1.00 28.64 ? 343 LEU E C   1 
ATOM 5538  O O   . LEU E 2 197 ? -4.923  5.005   -20.568 1.00 29.41 ? 343 LEU E O   1 
ATOM 5539  C CB  . LEU E 2 197 ? -3.743  5.508   -23.383 1.00 29.22 ? 343 LEU E CB  1 
ATOM 5540  C CG  . LEU E 2 197 ? -2.288  5.863   -23.083 1.00 30.38 ? 343 LEU E CG  1 
ATOM 5541  C CD1 . LEU E 2 197 ? -1.695  6.619   -24.237 1.00 30.74 ? 343 LEU E CD1 1 
ATOM 5542  C CD2 . LEU E 2 197 ? -2.213  6.695   -21.821 1.00 31.74 ? 343 LEU E CD2 1 
ATOM 5543  N N   . ALA E 2 198 ? -3.263  3.485   -20.698 1.00 27.94 ? 344 ALA E N   1 
ATOM 5544  C CA  . ALA E 2 198 ? -3.029  3.401   -19.260 1.00 26.26 ? 344 ALA E CA  1 
ATOM 5545  C C   . ALA E 2 198 ? -1.599  3.755   -18.974 1.00 25.65 ? 344 ALA E C   1 
ATOM 5546  O O   . ALA E 2 198 ? -0.699  3.288   -19.659 1.00 26.43 ? 344 ALA E O   1 
ATOM 5547  C CB  . ALA E 2 198 ? -3.289  2.007   -18.771 1.00 26.84 ? 344 ALA E CB  1 
ATOM 5548  N N   . GLY E 2 199 ? -1.383  4.569   -17.952 1.00 25.61 ? 345 GLY E N   1 
ATOM 5549  C CA  . GLY E 2 199 ? -0.030  4.945   -17.614 1.00 25.74 ? 345 GLY E CA  1 
ATOM 5550  C C   . GLY E 2 199 ? 0.175   5.160   -16.130 1.00 27.20 ? 345 GLY E C   1 
ATOM 5551  O O   . GLY E 2 199 ? -0.764  5.519   -15.411 1.00 27.08 ? 345 GLY E O   1 
ATOM 5552  N N   . ASN E 2 200 ? 1.395   4.892   -15.665 1.00 27.98 ? 346 ASN E N   1 
ATOM 5553  C CA  . ASN E 2 200 ? 1.758   5.123   -14.270 1.00 28.44 ? 346 ASN E CA  1 
ATOM 5554  C C   . ASN E 2 200 ? 3.131   5.769   -14.225 1.00 28.96 ? 346 ASN E C   1 
ATOM 5555  O O   . ASN E 2 200 ? 3.689   6.110   -15.268 1.00 29.85 ? 346 ASN E O   1 
ATOM 5556  C CB  . ASN E 2 200 ? 1.745   3.837   -13.440 1.00 27.57 ? 346 ASN E CB  1 
ATOM 5557  C CG  . ASN E 2 200 ? 2.717   2.806   -13.931 1.00 26.53 ? 346 ASN E CG  1 
ATOM 5558  O OD1 . ASN E 2 200 ? 3.849   3.120   -14.286 1.00 26.23 ? 346 ASN E OD1 1 
ATOM 5559  N ND2 . ASN E 2 200 ? 2.286   1.550   -13.933 1.00 25.86 ? 346 ASN E ND2 1 
ATOM 5560  N N   . SER E 2 201 ? 3.675   5.956   -13.031 1.00 29.41 ? 347 SER E N   1 
ATOM 5561  C CA  . SER E 2 201 ? 4.985   6.585   -12.913 1.00 30.96 ? 347 SER E CA  1 
ATOM 5562  C C   . SER E 2 201 ? 6.055   5.864   -13.722 1.00 30.60 ? 347 SER E C   1 
ATOM 5563  O O   . SER E 2 201 ? 6.947   6.504   -14.272 1.00 31.58 ? 347 SER E O   1 
ATOM 5564  C CB  . SER E 2 201 ? 5.418   6.661   -11.449 1.00 32.00 ? 347 SER E CB  1 
ATOM 5565  O OG  . SER E 2 201 ? 5.373   5.385   -10.841 1.00 35.29 ? 347 SER E OG  1 
ATOM 5566  N N   . ILE E 2 202 ? 5.962   4.541   -13.811 1.00 29.99 ? 348 ILE E N   1 
ATOM 5567  C CA  . ILE E 2 202 ? 6.946   3.777   -14.562 1.00 28.55 ? 348 ILE E CA  1 
ATOM 5568  C C   . ILE E 2 202 ? 6.819   3.927   -16.076 1.00 28.74 ? 348 ILE E C   1 
ATOM 5569  O O   . ILE E 2 202 ? 7.819   4.126   -16.758 1.00 29.59 ? 348 ILE E O   1 
ATOM 5570  C CB  . ILE E 2 202 ? 6.892   2.262   -14.207 1.00 28.39 ? 348 ILE E CB  1 
ATOM 5571  C CG1 . ILE E 2 202 ? 7.255   2.042   -12.734 1.00 27.63 ? 348 ILE E CG1 1 
ATOM 5572  C CG2 . ILE E 2 202 ? 7.845   1.483   -15.090 1.00 27.09 ? 348 ILE E CG2 1 
ATOM 5573  C CD1 . ILE E 2 202 ? 6.059   1.772   -11.826 1.00 25.47 ? 348 ILE E CD1 1 
ATOM 5574  N N   . GLY E 2 203 ? 5.606   3.837   -16.613 1.00 28.62 ? 349 GLY E N   1 
ATOM 5575  C CA  . GLY E 2 203 ? 5.468   3.956   -18.053 1.00 27.88 ? 349 GLY E CA  1 
ATOM 5576  C C   . GLY E 2 203 ? 4.046   3.947   -18.556 1.00 28.42 ? 349 GLY E C   1 
ATOM 5577  O O   . GLY E 2 203 ? 3.109   3.906   -17.767 1.00 29.09 ? 349 GLY E O   1 
ATOM 5578  N N   . ILE E 2 204 ? 3.895   3.959   -19.878 1.00 27.95 ? 350 ILE E N   1 
ATOM 5579  C CA  . ILE E 2 204 ? 2.589   3.978   -20.519 1.00 27.52 ? 350 ILE E CA  1 
ATOM 5580  C C   . ILE E 2 204 ? 2.351   2.782   -21.429 1.00 28.08 ? 350 ILE E C   1 
ATOM 5581  O O   . ILE E 2 204 ? 3.288   2.243   -22.010 1.00 29.52 ? 350 ILE E O   1 
ATOM 5582  C CB  . ILE E 2 204 ? 2.422   5.271   -21.342 1.00 27.92 ? 350 ILE E CB  1 
ATOM 5583  C CG1 . ILE E 2 204 ? 2.524   6.480   -20.397 1.00 27.80 ? 350 ILE E CG1 1 
ATOM 5584  C CG2 . ILE E 2 204 ? 1.082   5.244   -22.114 1.00 27.63 ? 350 ILE E CG2 1 
ATOM 5585  C CD1 . ILE E 2 204 ? 2.783   7.796   -21.086 1.00 27.36 ? 350 ILE E CD1 1 
ATOM 5586  N N   . SER E 2 205 ? 1.090   2.373   -21.547 1.00 28.13 ? 351 SER E N   1 
ATOM 5587  C CA  . SER E 2 205 ? 0.696   1.249   -22.401 1.00 28.58 ? 351 SER E CA  1 
ATOM 5588  C C   . SER E 2 205 ? -0.683  1.515   -22.981 1.00 28.99 ? 351 SER E C   1 
ATOM 5589  O O   . SER E 2 205 ? -1.505  2.184   -22.357 1.00 29.70 ? 351 SER E O   1 
ATOM 5590  C CB  . SER E 2 205 ? 0.635   -0.066  -21.609 1.00 28.79 ? 351 SER E CB  1 
ATOM 5591  O OG  . SER E 2 205 ? 1.903   -0.430  -21.105 1.00 30.81 ? 351 SER E OG  1 
ATOM 5592  N N   . PHE E 2 206 ? -0.958  0.973   -24.163 1.00 29.93 ? 352 PHE E N   1 
ATOM 5593  C CA  . PHE E 2 206 ? -2.271  1.176   -24.790 1.00 29.85 ? 352 PHE E CA  1 
ATOM 5594  C C   . PHE E 2 206 ? -2.639  0.121   -25.839 1.00 29.56 ? 352 PHE E C   1 
ATOM 5595  O O   . PHE E 2 206 ? -1.773  -0.452  -26.502 1.00 28.13 ? 352 PHE E O   1 
ATOM 5596  C CB  . PHE E 2 206 ? -2.313  2.569   -25.434 1.00 29.32 ? 352 PHE E CB  1 
ATOM 5597  C CG  . PHE E 2 206 ? -1.188  2.809   -26.385 1.00 29.14 ? 352 PHE E CG  1 
ATOM 5598  C CD1 . PHE E 2 206 ? -1.274  2.388   -27.710 1.00 30.43 ? 352 PHE E CD1 1 
ATOM 5599  C CD2 . PHE E 2 206 ? -0.001  3.368   -25.938 1.00 28.92 ? 352 PHE E CD2 1 
ATOM 5600  C CE1 . PHE E 2 206 ? -0.193  2.513   -28.574 1.00 29.80 ? 352 PHE E CE1 1 
ATOM 5601  C CE2 . PHE E 2 206 ? 1.092   3.502   -26.794 1.00 28.35 ? 352 PHE E CE2 1 
ATOM 5602  C CZ  . PHE E 2 206 ? 0.996   3.072   -28.110 1.00 29.72 ? 352 PHE E CZ  1 
ATOM 5603  N N   . HIS E 2 207 ? -3.936  -0.120  -25.975 1.00 30.61 ? 353 HIS E N   1 
ATOM 5604  C CA  . HIS E 2 207 ? -4.447  -1.068  -26.953 1.00 32.42 ? 353 HIS E CA  1 
ATOM 5605  C C   . HIS E 2 207 ? -5.520  -0.348  -27.771 1.00 34.31 ? 353 HIS E C   1 
ATOM 5606  O O   . HIS E 2 207 ? -6.374  0.339   -27.213 1.00 35.79 ? 353 HIS E O   1 
ATOM 5607  C CB  . HIS E 2 207 ? -5.051  -2.304  -26.261 1.00 31.93 ? 353 HIS E CB  1 
ATOM 5608  C CG  . HIS E 2 207 ? -4.031  -3.276  -25.743 1.00 32.20 ? 353 HIS E CG  1 
ATOM 5609  N ND1 . HIS E 2 207 ? -4.371  -4.365  -24.967 1.00 32.44 ? 353 HIS E ND1 1 
ATOM 5610  C CD2 . HIS E 2 207 ? -2.683  -3.313  -25.868 1.00 31.54 ? 353 HIS E CD2 1 
ATOM 5611  C CE1 . HIS E 2 207 ? -3.276  -5.027  -24.635 1.00 31.21 ? 353 HIS E CE1 1 
ATOM 5612  N NE2 . HIS E 2 207 ? -2.239  -4.409  -25.169 1.00 30.50 ? 353 HIS E NE2 1 
ATOM 5613  N N   . SER E 2 208 ? -5.471  -0.499  -29.093 1.00 36.28 ? 354 SER E N   1 
ATOM 5614  C CA  . SER E 2 208 ? -6.442  0.143   -29.983 1.00 36.53 ? 354 SER E CA  1 
ATOM 5615  C C   . SER E 2 208 ? -7.416  -0.860  -30.594 1.00 37.15 ? 354 SER E C   1 
ATOM 5616  O O   . SER E 2 208 ? -7.078  -2.021  -30.812 1.00 36.46 ? 354 SER E O   1 
ATOM 5617  C CB  . SER E 2 208 ? -5.728  0.879   -31.119 1.00 36.14 ? 354 SER E CB  1 
ATOM 5618  O OG  . SER E 2 208 ? -4.696  1.730   -30.640 1.00 38.25 ? 354 SER E OG  1 
ATOM 5619  N N   . ALA E 2 209 ? -8.632  -0.389  -30.855 1.00 39.33 ? 355 ALA E N   1 
ATOM 5620  C CA  . ALA E 2 209 ? -9.688  -1.192  -31.464 1.00 41.47 ? 355 ALA E CA  1 
ATOM 5621  C C   . ALA E 2 209 ? -10.288 -0.328  -32.550 1.00 43.74 ? 355 ALA E C   1 
ATOM 5622  O O   . ALA E 2 209 ? -10.081 0.886   -32.565 1.00 44.21 ? 355 ALA E O   1 
ATOM 5623  C CB  . ALA E 2 209 ? -10.756 -1.560  -30.447 1.00 40.30 ? 355 ALA E CB  1 
ATOM 5624  N N   . TRP E 2 210 ? -11.036 -0.944  -33.454 1.00 46.54 ? 356 TRP E N   1 
ATOM 5625  C CA  . TRP E 2 210 ? -11.628 -0.202  -34.550 1.00 50.02 ? 356 TRP E CA  1 
ATOM 5626  C C   . TRP E 2 210 ? -13.143 -0.313  -34.620 1.00 51.79 ? 356 TRP E C   1 
ATOM 5627  O O   . TRP E 2 210 ? -13.694 -1.415  -34.653 1.00 51.95 ? 356 TRP E O   1 
ATOM 5628  C CB  . TRP E 2 210 ? -11.023 -0.666  -35.871 1.00 51.19 ? 356 TRP E CB  1 
ATOM 5629  C CG  . TRP E 2 210 ? -11.295 0.284   -36.974 1.00 53.08 ? 356 TRP E CG  1 
ATOM 5630  C CD1 . TRP E 2 210 ? -12.491 0.497   -37.613 1.00 52.63 ? 356 TRP E CD1 1 
ATOM 5631  C CD2 . TRP E 2 210 ? -10.363 1.205   -37.539 1.00 53.89 ? 356 TRP E CD2 1 
ATOM 5632  N NE1 . TRP E 2 210 ? -12.353 1.502   -38.542 1.00 53.57 ? 356 TRP E NE1 1 
ATOM 5633  C CE2 . TRP E 2 210 ? -11.059 1.955   -38.520 1.00 54.62 ? 356 TRP E CE2 1 
ATOM 5634  C CE3 . TRP E 2 210 ? -9.005  1.472   -37.314 1.00 53.96 ? 356 TRP E CE3 1 
ATOM 5635  C CZ2 . TRP E 2 210 ? -10.437 2.963   -39.275 1.00 55.03 ? 356 TRP E CZ2 1 
ATOM 5636  C CZ3 . TRP E 2 210 ? -8.387  2.472   -38.065 1.00 55.34 ? 356 TRP E CZ3 1 
ATOM 5637  C CH2 . TRP E 2 210 ? -9.105  3.205   -39.035 1.00 55.37 ? 356 TRP E CH2 1 
ATOM 5638  N N   . LEU E 2 211 ? -13.810 0.838   -34.643 1.00 53.37 ? 357 LEU E N   1 
ATOM 5639  C CA  . LEU E 2 211 ? -15.262 0.863   -34.735 1.00 55.10 ? 357 LEU E CA  1 
ATOM 5640  C C   . LEU E 2 211 ? -15.677 1.090   -36.188 1.00 56.41 ? 357 LEU E C   1 
ATOM 5641  O O   . LEU E 2 211 ? -15.274 2.079   -36.815 1.00 56.62 ? 357 LEU E O   1 
ATOM 5642  C CB  . LEU E 2 211 ? -15.843 1.970   -33.853 1.00 55.25 ? 357 LEU E CB  1 
ATOM 5643  C CG  . LEU E 2 211 ? -17.373 2.064   -33.897 1.00 55.14 ? 357 LEU E CG  1 
ATOM 5644  C CD1 . LEU E 2 211 ? -17.993 0.739   -33.478 1.00 55.44 ? 357 LEU E CD1 1 
ATOM 5645  C CD2 . LEU E 2 211 ? -17.840 3.169   -32.976 1.00 55.26 ? 357 LEU E CD2 1 
ATOM 5646  N N   . THR E 2 212 ? -16.468 0.162   -36.724 1.00 57.40 ? 358 THR E N   1 
ATOM 5647  C CA  . THR E 2 212 ? -16.934 0.277   -38.101 1.00 58.81 ? 358 THR E CA  1 
ATOM 5648  C C   . THR E 2 212 ? -18.441 0.508   -38.117 1.00 60.05 ? 358 THR E C   1 
ATOM 5649  O O   . THR E 2 212 ? -19.219 -0.294  -37.583 1.00 59.61 ? 358 THR E O   1 
ATOM 5650  C CB  . THR E 2 212 ? -16.610 -0.984  -38.924 1.00 59.19 ? 358 THR E CB  1 
ATOM 5651  O OG1 . THR E 2 212 ? -17.572 -2.009  -38.630 1.00 59.80 ? 358 THR E OG1 1 
ATOM 5652  C CG2 . THR E 2 212 ? -15.206 -1.486  -38.586 1.00 58.72 ? 358 THR E CG2 1 
ATOM 5653  N N   . VAL E 2 213 ? -18.841 1.624   -38.721 1.00 61.71 ? 359 VAL E N   1 
ATOM 5654  C CA  . VAL E 2 213 ? -20.248 1.987   -38.819 1.00 63.77 ? 359 VAL E CA  1 
ATOM 5655  C C   . VAL E 2 213 ? -20.763 1.707   -40.237 1.00 64.55 ? 359 VAL E C   1 
ATOM 5656  O O   . VAL E 2 213 ? -20.197 2.187   -41.228 1.00 64.84 ? 359 VAL E O   1 
ATOM 5657  C CB  . VAL E 2 213 ? -20.461 3.488   -38.451 1.00 65.57 ? 359 VAL E CB  1 
ATOM 5658  C CG1 . VAL E 2 213 ? -21.926 3.904   -38.708 1.00 65.97 ? 359 VAL E CG1 1 
ATOM 5659  C CG2 . VAL E 2 213 ? -20.090 3.714   -36.975 1.00 65.02 ? 359 VAL E CG2 1 
ATOM 5660  N N   . LEU E 2 214 ? -21.839 0.925   -40.311 1.00 64.87 ? 360 LEU E N   1 
ATOM 5661  C CA  . LEU E 2 214 ? -22.456 0.530   -41.577 1.00 65.34 ? 360 LEU E CA  1 
ATOM 5662  C C   . LEU E 2 214 ? -23.769 1.264   -41.841 1.00 66.00 ? 360 LEU E C   1 
ATOM 5663  O O   . LEU E 2 214 ? -24.448 1.702   -40.904 1.00 65.90 ? 360 LEU E O   1 
ATOM 5664  C CB  . LEU E 2 214 ? -22.729 -0.972  -41.550 1.00 64.88 ? 360 LEU E CB  1 
ATOM 5665  C CG  . LEU E 2 214 ? -21.500 -1.798  -41.171 1.00 64.95 ? 360 LEU E CG  1 
ATOM 5666  C CD1 . LEU E 2 214 ? -21.918 -3.202  -40.807 1.00 64.92 ? 360 LEU E CD1 1 
ATOM 5667  C CD2 . LEU E 2 214 ? -20.508 -1.788  -42.320 1.00 64.28 ? 360 LEU E CD2 1 
ATOM 5668  N N   . PRO E 2 215 ? -24.128 1.380   -43.119 1.00 66.35 ? 361 PRO E N   1 
ATOM 5669  C CA  . PRO E 2 215 ? -25.364 2.050   -43.508 1.00 66.25 ? 361 PRO E CA  1 
ATOM 5670  C C   . PRO E 2 215 ? -26.575 1.200   -43.130 1.00 66.07 ? 361 PRO E C   1 
ATOM 5671  O O   . PRO E 2 215 ? -27.590 1.800   -42.716 1.00 66.36 ? 361 PRO E O   1 
ATOM 5672  C CB  . PRO E 2 215 ? -25.369 2.312   -45.017 1.00 66.32 ? 361 PRO E CB  1 
ATOM 5673  N N   . ASN F 2 4   ? 33.254  27.069  -45.373 1.00 49.11 ? 150 ASN F N   1 
ATOM 5674  C CA  . ASN F 2 4   ? 34.699  27.430  -45.211 1.00 49.21 ? 150 ASN F CA  1 
ATOM 5675  C C   . ASN F 2 4   ? 35.400  26.587  -44.126 1.00 48.48 ? 150 ASN F C   1 
ATOM 5676  O O   . ASN F 2 4   ? 35.489  26.991  -42.961 1.00 48.60 ? 150 ASN F O   1 
ATOM 5677  C CB  . ASN F 2 4   ? 34.832  28.923  -44.886 1.00 49.32 ? 150 ASN F CB  1 
ATOM 5678  N N   . LYS F 2 5   ? 35.889  25.415  -44.536 1.00 47.04 ? 151 LYS F N   1 
ATOM 5679  C CA  . LYS F 2 5   ? 36.586  24.475  -43.668 1.00 44.83 ? 151 LYS F CA  1 
ATOM 5680  C C   . LYS F 2 5   ? 38.012  24.944  -43.377 1.00 43.63 ? 151 LYS F C   1 
ATOM 5681  O O   . LYS F 2 5   ? 38.774  25.221  -44.292 1.00 44.03 ? 151 LYS F O   1 
ATOM 5682  C CB  . LYS F 2 5   ? 36.608  23.102  -44.340 1.00 44.78 ? 151 LYS F CB  1 
ATOM 5683  N N   . ARG F 2 6   ? 38.376  25.018  -42.101 1.00 42.87 ? 152 ARG F N   1 
ATOM 5684  C CA  . ARG F 2 6   ? 39.710  25.477  -41.716 1.00 40.40 ? 152 ARG F CA  1 
ATOM 5685  C C   . ARG F 2 6   ? 40.246  24.797  -40.461 1.00 38.91 ? 152 ARG F C   1 
ATOM 5686  O O   . ARG F 2 6   ? 39.484  24.295  -39.629 1.00 37.87 ? 152 ARG F O   1 
ATOM 5687  C CB  . ARG F 2 6   ? 39.677  26.982  -41.478 1.00 40.23 ? 152 ARG F CB  1 
ATOM 5688  C CG  . ARG F 2 6   ? 38.671  27.389  -40.416 1.00 40.00 ? 152 ARG F CG  1 
ATOM 5689  C CD  . ARG F 2 6   ? 38.635  28.892  -40.253 1.00 39.64 ? 152 ARG F CD  1 
ATOM 5690  N NE  . ARG F 2 6   ? 39.957  29.426  -39.947 1.00 38.88 ? 152 ARG F NE  1 
ATOM 5691  C CZ  . ARG F 2 6   ? 40.181  30.667  -39.537 1.00 38.15 ? 152 ARG F CZ  1 
ATOM 5692  N NH1 . ARG F 2 6   ? 39.175  31.518  -39.382 1.00 37.16 ? 152 ARG F NH1 1 
ATOM 5693  N NH2 . ARG F 2 6   ? 41.415  31.051  -39.267 1.00 40.14 ? 152 ARG F NH2 1 
ATOM 5694  N N   . ALA F 2 7   ? 41.570  24.802  -40.328 1.00 38.01 ? 153 ALA F N   1 
ATOM 5695  C CA  . ALA F 2 7   ? 42.226  24.201  -39.176 1.00 36.35 ? 153 ALA F CA  1 
ATOM 5696  C C   . ALA F 2 7   ? 41.926  25.001  -37.905 1.00 35.69 ? 153 ALA F C   1 
ATOM 5697  O O   . ALA F 2 7   ? 41.506  26.156  -37.968 1.00 35.14 ? 153 ALA F O   1 
ATOM 5698  C CB  . ALA F 2 7   ? 43.717  24.122  -39.410 1.00 36.42 ? 153 ALA F CB  1 
ATOM 5699  N N   . PRO F 2 8   ? 42.154  24.388  -36.727 1.00 35.11 ? 154 PRO F N   1 
ATOM 5700  C CA  . PRO F 2 8   ? 41.906  25.030  -35.436 1.00 33.29 ? 154 PRO F CA  1 
ATOM 5701  C C   . PRO F 2 8   ? 42.730  26.284  -35.208 1.00 32.92 ? 154 PRO F C   1 
ATOM 5702  O O   . PRO F 2 8   ? 43.886  26.378  -35.631 1.00 31.87 ? 154 PRO F O   1 
ATOM 5703  C CB  . PRO F 2 8   ? 42.269  23.941  -34.425 1.00 33.15 ? 154 PRO F CB  1 
ATOM 5704  C CG  . PRO F 2 8   ? 42.122  22.660  -35.195 1.00 34.16 ? 154 PRO F CG  1 
ATOM 5705  C CD  . PRO F 2 8   ? 42.710  23.035  -36.527 1.00 34.76 ? 154 PRO F CD  1 
ATOM 5706  N N   . TYR F 2 9   ? 42.131  27.247  -34.524 1.00 33.08 ? 155 TYR F N   1 
ATOM 5707  C CA  . TYR F 2 9   ? 42.829  28.477  -34.216 1.00 33.95 ? 155 TYR F CA  1 
ATOM 5708  C C   . TYR F 2 9   ? 42.280  29.074  -32.926 1.00 33.83 ? 155 TYR F C   1 
ATOM 5709  O O   . TYR F 2 9   ? 41.138  28.814  -32.546 1.00 33.92 ? 155 TYR F O   1 
ATOM 5710  C CB  . TYR F 2 9   ? 42.711  29.448  -35.389 1.00 35.08 ? 155 TYR F CB  1 
ATOM 5711  C CG  . TYR F 2 9   ? 41.307  29.884  -35.704 1.00 37.09 ? 155 TYR F CG  1 
ATOM 5712  C CD1 . TYR F 2 9   ? 40.389  29.011  -36.295 1.00 36.93 ? 155 TYR F CD1 1 
ATOM 5713  C CD2 . TYR F 2 9   ? 40.881  31.170  -35.369 1.00 38.02 ? 155 TYR F CD2 1 
ATOM 5714  C CE1 . TYR F 2 9   ? 39.079  29.415  -36.536 1.00 37.50 ? 155 TYR F CE1 1 
ATOM 5715  C CE2 . TYR F 2 9   ? 39.585  31.583  -35.602 1.00 37.62 ? 155 TYR F CE2 1 
ATOM 5716  C CZ  . TYR F 2 9   ? 38.686  30.709  -36.181 1.00 38.53 ? 155 TYR F CZ  1 
ATOM 5717  O OH  . TYR F 2 9   ? 37.396  31.145  -36.379 1.00 38.86 ? 155 TYR F OH  1 
ATOM 5718  N N   . TRP F 2 10  ? 43.114  29.842  -32.236 1.00 33.62 ? 156 TRP F N   1 
ATOM 5719  C CA  . TRP F 2 10  ? 42.723  30.466  -30.981 1.00 33.54 ? 156 TRP F CA  1 
ATOM 5720  C C   . TRP F 2 10  ? 41.853  31.662  -31.316 1.00 35.17 ? 156 TRP F C   1 
ATOM 5721  O O   . TRP F 2 10  ? 42.253  32.496  -32.126 1.00 35.75 ? 156 TRP F O   1 
ATOM 5722  C CB  . TRP F 2 10  ? 43.980  30.901  -30.221 1.00 30.63 ? 156 TRP F CB  1 
ATOM 5723  C CG  . TRP F 2 10  ? 44.887  29.735  -29.914 1.00 28.85 ? 156 TRP F CG  1 
ATOM 5724  C CD1 . TRP F 2 10  ? 46.237  29.670  -30.096 1.00 26.38 ? 156 TRP F CD1 1 
ATOM 5725  C CD2 . TRP F 2 10  ? 44.493  28.461  -29.376 1.00 28.35 ? 156 TRP F CD2 1 
ATOM 5726  N NE1 . TRP F 2 10  ? 46.708  28.438  -29.710 1.00 26.17 ? 156 TRP F NE1 1 
ATOM 5727  C CE2 . TRP F 2 10  ? 45.661  27.678  -29.264 1.00 27.20 ? 156 TRP F CE2 1 
ATOM 5728  C CE3 . TRP F 2 10  ? 43.262  27.908  -28.979 1.00 27.01 ? 156 TRP F CE3 1 
ATOM 5729  C CZ2 . TRP F 2 10  ? 45.638  26.373  -28.768 1.00 26.30 ? 156 TRP F CZ2 1 
ATOM 5730  C CZ3 . TRP F 2 10  ? 43.241  26.613  -28.491 1.00 25.16 ? 156 TRP F CZ3 1 
ATOM 5731  C CH2 . TRP F 2 10  ? 44.423  25.860  -28.389 1.00 26.25 ? 156 TRP F CH2 1 
ATOM 5732  N N   . THR F 2 11  ? 40.665  31.746  -30.714 1.00 36.51 ? 157 THR F N   1 
ATOM 5733  C CA  . THR F 2 11  ? 39.775  32.856  -31.003 1.00 36.56 ? 157 THR F CA  1 
ATOM 5734  C C   . THR F 2 11  ? 39.930  34.007  -30.024 1.00 38.23 ? 157 THR F C   1 
ATOM 5735  O O   . THR F 2 11  ? 39.462  35.109  -30.281 1.00 39.99 ? 157 THR F O   1 
ATOM 5736  C CB  . THR F 2 11  ? 38.298  32.375  -31.129 1.00 35.72 ? 157 THR F CB  1 
ATOM 5737  O OG1 . THR F 2 11  ? 37.917  31.591  -29.992 1.00 35.39 ? 157 THR F OG1 1 
ATOM 5738  C CG2 . THR F 2 11  ? 38.151  31.528  -32.378 1.00 33.54 ? 157 THR F CG2 1 
ATOM 5739  N N   . ASN F 2 12  ? 40.616  33.769  -28.914 1.00 40.43 ? 158 ASN F N   1 
ATOM 5740  C CA  . ASN F 2 12  ? 40.843  34.838  -27.945 1.00 42.59 ? 158 ASN F CA  1 
ATOM 5741  C C   . ASN F 2 12  ? 42.180  34.640  -27.237 1.00 42.20 ? 158 ASN F C   1 
ATOM 5742  O O   . ASN F 2 12  ? 42.243  34.185  -26.096 1.00 42.60 ? 158 ASN F O   1 
ATOM 5743  C CB  . ASN F 2 12  ? 39.694  34.902  -26.934 1.00 44.89 ? 158 ASN F CB  1 
ATOM 5744  C CG  . ASN F 2 12  ? 39.654  36.222  -26.176 1.00 46.57 ? 158 ASN F CG  1 
ATOM 5745  O OD1 . ASN F 2 12  ? 38.736  36.467  -25.391 1.00 49.02 ? 158 ASN F OD1 1 
ATOM 5746  N ND2 . ASN F 2 12  ? 40.648  37.080  -26.410 1.00 47.33 ? 158 ASN F ND2 1 
ATOM 5747  N N   . THR F 2 13  ? 43.244  34.997  -27.940 1.00 41.62 ? 159 THR F N   1 
ATOM 5748  C CA  . THR F 2 13  ? 44.596  34.867  -27.432 1.00 41.51 ? 159 THR F CA  1 
ATOM 5749  C C   . THR F 2 13  ? 44.845  35.746  -26.210 1.00 41.92 ? 159 THR F C   1 
ATOM 5750  O O   . THR F 2 13  ? 45.767  35.487  -25.430 1.00 42.77 ? 159 THR F O   1 
ATOM 5751  C CB  . THR F 2 13  ? 45.612  35.209  -28.552 1.00 42.02 ? 159 THR F CB  1 
ATOM 5752  O OG1 . THR F 2 13  ? 45.305  36.493  -29.107 1.00 42.69 ? 159 THR F OG1 1 
ATOM 5753  C CG2 . THR F 2 13  ? 45.530  34.179  -29.678 1.00 41.45 ? 159 THR F CG2 1 
ATOM 5754  N N   . GLU F 2 14  ? 44.021  36.782  -26.044 1.00 41.66 ? 160 GLU F N   1 
ATOM 5755  C CA  . GLU F 2 14  ? 44.139  37.698  -24.910 1.00 41.11 ? 160 GLU F CA  1 
ATOM 5756  C C   . GLU F 2 14  ? 43.982  36.904  -23.617 1.00 40.93 ? 160 GLU F C   1 
ATOM 5757  O O   . GLU F 2 14  ? 44.815  36.988  -22.706 1.00 40.87 ? 160 GLU F O   1 
ATOM 5758  C CB  . GLU F 2 14  ? 43.058  38.779  -24.981 1.00 41.69 ? 160 GLU F CB  1 
ATOM 5759  N N   . LYS F 2 15  ? 42.918  36.111  -23.550 1.00 40.94 ? 161 LYS F N   1 
ATOM 5760  C CA  . LYS F 2 15  ? 42.643  35.289  -22.373 1.00 41.20 ? 161 LYS F CA  1 
ATOM 5761  C C   . LYS F 2 15  ? 43.689  34.184  -22.129 1.00 41.35 ? 161 LYS F C   1 
ATOM 5762  O O   . LYS F 2 15  ? 43.598  33.457  -21.136 1.00 41.31 ? 161 LYS F O   1 
ATOM 5763  C CB  . LYS F 2 15  ? 41.251  34.661  -22.508 1.00 39.50 ? 161 LYS F CB  1 
ATOM 5764  N N   . MET F 2 16  ? 44.676  34.068  -23.022 1.00 40.92 ? 162 MET F N   1 
ATOM 5765  C CA  . MET F 2 16  ? 45.711  33.034  -22.908 1.00 40.87 ? 162 MET F CA  1 
ATOM 5766  C C   . MET F 2 16  ? 47.127  33.540  -22.633 1.00 40.64 ? 162 MET F C   1 
ATOM 5767  O O   . MET F 2 16  ? 48.029  32.745  -22.339 1.00 40.25 ? 162 MET F O   1 
ATOM 5768  C CB  . MET F 2 16  ? 45.749  32.190  -24.188 1.00 40.84 ? 162 MET F CB  1 
ATOM 5769  C CG  . MET F 2 16  ? 44.491  31.397  -24.486 1.00 40.80 ? 162 MET F CG  1 
ATOM 5770  S SD  . MET F 2 16  ? 44.544  30.702  -26.153 1.00 39.81 ? 162 MET F SD  1 
ATOM 5771  C CE  . MET F 2 16  ? 45.281  29.093  -25.880 1.00 42.64 ? 162 MET F CE  1 
ATOM 5772  N N   . GLU F 2 17  ? 47.329  34.852  -22.737 1.00 40.42 ? 163 GLU F N   1 
ATOM 5773  C CA  . GLU F 2 17  ? 48.650  35.446  -22.528 1.00 38.78 ? 163 GLU F CA  1 
ATOM 5774  C C   . GLU F 2 17  ? 49.307  35.079  -21.189 1.00 38.00 ? 163 GLU F C   1 
ATOM 5775  O O   . GLU F 2 17  ? 50.514  34.842  -21.129 1.00 38.48 ? 163 GLU F O   1 
ATOM 5776  C CB  . GLU F 2 17  ? 48.559  36.969  -22.678 1.00 38.92 ? 163 GLU F CB  1 
ATOM 5777  N N   . LYS F 2 18  ? 48.517  35.031  -20.121 1.00 37.11 ? 164 LYS F N   1 
ATOM 5778  C CA  . LYS F 2 18  ? 49.021  34.687  -18.792 1.00 36.33 ? 164 LYS F CA  1 
ATOM 5779  C C   . LYS F 2 18  ? 49.285  33.174  -18.706 1.00 36.44 ? 164 LYS F C   1 
ATOM 5780  O O   . LYS F 2 18  ? 48.374  32.386  -18.411 1.00 35.79 ? 164 LYS F O   1 
ATOM 5781  C CB  . LYS F 2 18  ? 47.998  35.117  -17.732 1.00 35.86 ? 164 LYS F CB  1 
ATOM 5782  C CG  . LYS F 2 18  ? 48.494  35.001  -16.306 1.00 37.24 ? 164 LYS F CG  1 
ATOM 5783  C CD  . LYS F 2 18  ? 47.521  35.578  -15.297 1.00 36.74 ? 164 LYS F CD  1 
ATOM 5784  C CE  . LYS F 2 18  ? 46.694  34.489  -14.630 1.00 37.20 ? 164 LYS F CE  1 
ATOM 5785  N NZ  . LYS F 2 18  ? 45.999  34.967  -13.383 1.00 36.65 ? 164 LYS F NZ  1 
ATOM 5786  N N   . ARG F 2 19  ? 50.535  32.781  -18.955 1.00 36.03 ? 165 ARG F N   1 
ATOM 5787  C CA  . ARG F 2 19  ? 50.930  31.371  -18.957 1.00 36.45 ? 165 ARG F CA  1 
ATOM 5788  C C   . ARG F 2 19  ? 51.078  30.723  -17.588 1.00 35.92 ? 165 ARG F C   1 
ATOM 5789  O O   . ARG F 2 19  ? 50.646  29.579  -17.376 1.00 35.38 ? 165 ARG F O   1 
ATOM 5790  C CB  . ARG F 2 19  ? 52.221  31.214  -19.752 1.00 36.31 ? 165 ARG F CB  1 
ATOM 5791  C CG  . ARG F 2 19  ? 52.064  31.683  -21.185 1.00 37.57 ? 165 ARG F CG  1 
ATOM 5792  C CD  . ARG F 2 19  ? 53.392  32.068  -21.794 1.00 39.28 ? 165 ARG F CD  1 
ATOM 5793  N NE  . ARG F 2 19  ? 53.249  32.519  -23.179 1.00 41.07 ? 165 ARG F NE  1 
ATOM 5794  C CZ  . ARG F 2 19  ? 52.981  31.721  -24.212 1.00 40.96 ? 165 ARG F CZ  1 
ATOM 5795  N NH1 . ARG F 2 19  ? 52.822  30.412  -24.028 1.00 40.46 ? 165 ARG F NH1 1 
ATOM 5796  N NH2 . ARG F 2 19  ? 52.878  32.237  -25.434 1.00 40.95 ? 165 ARG F NH2 1 
ATOM 5797  N N   . LEU F 2 20  ? 51.687  31.452  -16.661 1.00 35.88 ? 166 LEU F N   1 
ATOM 5798  C CA  . LEU F 2 20  ? 51.882  30.953  -15.308 1.00 34.42 ? 166 LEU F CA  1 
ATOM 5799  C C   . LEU F 2 20  ? 50.732  31.408  -14.427 1.00 34.65 ? 166 LEU F C   1 
ATOM 5800  O O   . LEU F 2 20  ? 50.488  32.607  -14.296 1.00 35.47 ? 166 LEU F O   1 
ATOM 5801  C CB  . LEU F 2 20  ? 53.183  31.491  -14.721 1.00 32.60 ? 166 LEU F CB  1 
ATOM 5802  C CG  . LEU F 2 20  ? 53.311  31.180  -13.230 1.00 31.51 ? 166 LEU F CG  1 
ATOM 5803  C CD1 . LEU F 2 20  ? 53.360  29.677  -13.063 1.00 30.55 ? 166 LEU F CD1 1 
ATOM 5804  C CD2 . LEU F 2 20  ? 54.553  31.837  -12.636 1.00 29.96 ? 166 LEU F CD2 1 
ATOM 5805  N N   . HIS F 2 21  ? 50.023  30.451  -13.836 1.00 34.28 ? 167 HIS F N   1 
ATOM 5806  C CA  . HIS F 2 21  ? 48.911  30.749  -12.942 1.00 33.26 ? 167 HIS F CA  1 
ATOM 5807  C C   . HIS F 2 21  ? 49.316  30.337  -11.538 1.00 33.01 ? 167 HIS F C   1 
ATOM 5808  O O   . HIS F 2 21  ? 49.391  29.139  -11.227 1.00 33.64 ? 167 HIS F O   1 
ATOM 5809  C CB  . HIS F 2 21  ? 47.659  29.965  -13.345 1.00 33.85 ? 167 HIS F CB  1 
ATOM 5810  C CG  . HIS F 2 21  ? 46.808  30.648  -14.369 1.00 34.78 ? 167 HIS F CG  1 
ATOM 5811  N ND1 . HIS F 2 21  ? 47.262  30.958  -15.634 1.00 36.44 ? 167 HIS F ND1 1 
ATOM 5812  C CD2 . HIS F 2 21  ? 45.518  31.056  -14.324 1.00 34.94 ? 167 HIS F CD2 1 
ATOM 5813  C CE1 . HIS F 2 21  ? 46.289  31.525  -16.325 1.00 35.63 ? 167 HIS F CE1 1 
ATOM 5814  N NE2 . HIS F 2 21  ? 45.220  31.597  -15.553 1.00 35.71 ? 167 HIS F NE2 1 
ATOM 5815  N N   . ALA F 2 22  ? 49.603  31.326  -10.700 1.00 31.83 ? 168 ALA F N   1 
ATOM 5816  C CA  . ALA F 2 22  ? 49.982  31.060  -9.321  1.00 30.55 ? 168 ALA F CA  1 
ATOM 5817  C C   . ALA F 2 22  ? 48.819  31.537  -8.481  1.00 29.89 ? 168 ALA F C   1 
ATOM 5818  O O   . ALA F 2 22  ? 48.481  32.716  -8.522  1.00 30.39 ? 168 ALA F O   1 
ATOM 5819  C CB  . ALA F 2 22  ? 51.231  31.834  -8.963  1.00 30.55 ? 168 ALA F CB  1 
ATOM 5820  N N   . VAL F 2 23  ? 48.194  30.634  -7.736  1.00 28.71 ? 169 VAL F N   1 
ATOM 5821  C CA  . VAL F 2 23  ? 47.062  31.027  -6.908  1.00 28.45 ? 169 VAL F CA  1 
ATOM 5822  C C   . VAL F 2 23  ? 47.158  30.479  -5.487  1.00 28.76 ? 169 VAL F C   1 
ATOM 5823  O O   . VAL F 2 23  ? 47.806  29.455  -5.245  1.00 28.62 ? 169 VAL F O   1 
ATOM 5824  C CB  . VAL F 2 23  ? 45.715  30.563  -7.534  1.00 27.80 ? 169 VAL F CB  1 
ATOM 5825  C CG1 . VAL F 2 23  ? 45.595  31.083  -8.940  1.00 26.69 ? 169 VAL F CG1 1 
ATOM 5826  C CG2 . VAL F 2 23  ? 45.605  29.039  -7.510  1.00 27.29 ? 169 VAL F CG2 1 
ATOM 5827  N N   . PRO F 2 24  ? 46.511  31.164  -4.526  1.00 27.93 ? 170 PRO F N   1 
ATOM 5828  C CA  . PRO F 2 24  ? 46.542  30.715  -3.135  1.00 28.44 ? 170 PRO F CA  1 
ATOM 5829  C C   . PRO F 2 24  ? 45.766  29.410  -3.069  1.00 28.90 ? 170 PRO F C   1 
ATOM 5830  O O   . PRO F 2 24  ? 44.745  29.272  -3.734  1.00 29.32 ? 170 PRO F O   1 
ATOM 5831  C CB  . PRO F 2 24  ? 45.828  31.842  -2.412  1.00 27.43 ? 170 PRO F CB  1 
ATOM 5832  C CG  . PRO F 2 24  ? 44.774  32.199  -3.404  1.00 26.49 ? 170 PRO F CG  1 
ATOM 5833  C CD  . PRO F 2 24  ? 45.552  32.267  -4.687  1.00 26.17 ? 170 PRO F CD  1 
ATOM 5834  N N   . ALA F 2 25  ? 46.245  28.450  -2.289  1.00 29.47 ? 171 ALA F N   1 
ATOM 5835  C CA  . ALA F 2 25  ? 45.549  27.166  -2.183  1.00 30.06 ? 171 ALA F CA  1 
ATOM 5836  C C   . ALA F 2 25  ? 44.066  27.334  -1.851  1.00 30.03 ? 171 ALA F C   1 
ATOM 5837  O O   . ALA F 2 25  ? 43.634  28.369  -1.325  1.00 30.06 ? 171 ALA F O   1 
ATOM 5838  C CB  . ALA F 2 25  ? 46.211  26.284  -1.140  1.00 29.77 ? 171 ALA F CB  1 
ATOM 5839  N N   . ALA F 2 26  ? 43.296  26.302  -2.184  1.00 29.82 ? 172 ALA F N   1 
ATOM 5840  C CA  . ALA F 2 26  ? 41.855  26.260  -1.945  1.00 28.72 ? 172 ALA F CA  1 
ATOM 5841  C C   . ALA F 2 26  ? 41.033  27.106  -2.910  1.00 27.66 ? 172 ALA F C   1 
ATOM 5842  O O   . ALA F 2 26  ? 39.824  27.243  -2.752  1.00 28.58 ? 172 ALA F O   1 
ATOM 5843  C CB  . ALA F 2 26  ? 41.555  26.650  -0.509  1.00 28.47 ? 172 ALA F CB  1 
ATOM 5844  N N   . ASN F 2 27  ? 41.674  27.672  -3.918  1.00 27.03 ? 173 ASN F N   1 
ATOM 5845  C CA  . ASN F 2 27  ? 40.931  28.468  -4.876  1.00 27.10 ? 173 ASN F CA  1 
ATOM 5846  C C   . ASN F 2 27  ? 40.624  27.614  -6.100  1.00 27.00 ? 173 ASN F C   1 
ATOM 5847  O O   . ASN F 2 27  ? 41.180  26.523  -6.262  1.00 27.61 ? 173 ASN F O   1 
ATOM 5848  C CB  . ASN F 2 27  ? 41.726  29.725  -5.256  1.00 27.83 ? 173 ASN F CB  1 
ATOM 5849  C CG  . ASN F 2 27  ? 41.682  30.804  -4.167  1.00 29.94 ? 173 ASN F CG  1 
ATOM 5850  O OD1 . ASN F 2 27  ? 41.780  30.519  -2.963  1.00 32.09 ? 173 ASN F OD1 1 
ATOM 5851  N ND2 . ASN F 2 27  ? 41.551  32.055  -4.592  1.00 31.56 ? 173 ASN F ND2 1 
ATOM 5852  N N   . THR F 2 28  ? 39.701  28.090  -6.927  1.00 26.63 ? 174 THR F N   1 
ATOM 5853  C CA  . THR F 2 28  ? 39.341  27.399  -8.150  1.00 25.52 ? 174 THR F CA  1 
ATOM 5854  C C   . THR F 2 28  ? 40.178  27.969  -9.293  1.00 26.59 ? 174 THR F C   1 
ATOM 5855  O O   . THR F 2 28  ? 40.393  29.187  -9.371  1.00 24.87 ? 174 THR F O   1 
ATOM 5856  C CB  . THR F 2 28  ? 37.880  27.592  -8.471  1.00 23.91 ? 174 THR F CB  1 
ATOM 5857  O OG1 . THR F 2 28  ? 37.107  26.957  -7.456  1.00 25.89 ? 174 THR F OG1 1 
ATOM 5858  C CG2 . THR F 2 28  ? 37.541  26.983  -9.808  1.00 22.84 ? 174 THR F CG2 1 
ATOM 5859  N N   . VAL F 2 29  ? 40.673  27.080  -10.155 1.00 26.94 ? 175 VAL F N   1 
ATOM 5860  C CA  . VAL F 2 29  ? 41.469  27.498  -11.297 1.00 27.22 ? 175 VAL F CA  1 
ATOM 5861  C C   . VAL F 2 29  ? 40.710  27.078  -12.543 1.00 27.89 ? 175 VAL F C   1 
ATOM 5862  O O   . VAL F 2 29  ? 40.170  25.980  -12.605 1.00 28.46 ? 175 VAL F O   1 
ATOM 5863  C CB  . VAL F 2 29  ? 42.869  26.849  -11.267 1.00 26.93 ? 175 VAL F CB  1 
ATOM 5864  C CG1 . VAL F 2 29  ? 43.688  27.276  -12.470 1.00 26.30 ? 175 VAL F CG1 1 
ATOM 5865  C CG2 . VAL F 2 29  ? 43.586  27.270  -10.015 1.00 27.71 ? 175 VAL F CG2 1 
ATOM 5866  N N   . LYS F 2 30  ? 40.650  27.975  -13.515 1.00 28.82 ? 176 LYS F N   1 
ATOM 5867  C CA  . LYS F 2 30  ? 39.955  27.733  -14.768 1.00 30.42 ? 176 LYS F CA  1 
ATOM 5868  C C   . LYS F 2 30  ? 40.914  28.068  -15.907 1.00 31.51 ? 176 LYS F C   1 
ATOM 5869  O O   . LYS F 2 30  ? 41.295  29.228  -16.089 1.00 32.64 ? 176 LYS F O   1 
ATOM 5870  C CB  . LYS F 2 30  ? 38.689  28.619  -14.835 1.00 31.39 ? 176 LYS F CB  1 
ATOM 5871  C CG  . LYS F 2 30  ? 37.926  28.656  -16.195 1.00 34.25 ? 176 LYS F CG  1 
ATOM 5872  C CD  . LYS F 2 30  ? 36.432  29.187  -16.071 1.00 33.74 ? 176 LYS F CD  1 
ATOM 5873  C CE  . LYS F 2 30  ? 35.673  29.105  -17.435 1.00 32.81 ? 176 LYS F CE  1 
ATOM 5874  N NZ  . LYS F 2 30  ? 34.186  29.337  -17.432 1.00 28.00 ? 176 LYS F NZ  1 
ATOM 5875  N N   . PHE F 2 31  ? 41.331  27.047  -16.650 1.00 31.19 ? 177 PHE F N   1 
ATOM 5876  C CA  . PHE F 2 31  ? 42.224  27.253  -17.776 1.00 30.43 ? 177 PHE F CA  1 
ATOM 5877  C C   . PHE F 2 31  ? 41.412  27.283  -19.038 1.00 30.83 ? 177 PHE F C   1 
ATOM 5878  O O   . PHE F 2 31  ? 40.612  26.388  -19.280 1.00 30.39 ? 177 PHE F O   1 
ATOM 5879  C CB  . PHE F 2 31  ? 43.248  26.140  -17.858 1.00 30.28 ? 177 PHE F CB  1 
ATOM 5880  C CG  . PHE F 2 31  ? 44.281  26.219  -16.799 1.00 30.45 ? 177 PHE F CG  1 
ATOM 5881  C CD1 . PHE F 2 31  ? 44.954  27.422  -16.571 1.00 30.22 ? 177 PHE F CD1 1 
ATOM 5882  C CD2 . PHE F 2 31  ? 44.588  25.111  -16.025 1.00 29.77 ? 177 PHE F CD2 1 
ATOM 5883  C CE1 . PHE F 2 31  ? 45.921  27.525  -15.585 1.00 30.36 ? 177 PHE F CE1 1 
ATOM 5884  C CE2 . PHE F 2 31  ? 45.554  25.200  -15.036 1.00 31.60 ? 177 PHE F CE2 1 
ATOM 5885  C CZ  . PHE F 2 31  ? 46.226  26.415  -14.812 1.00 30.91 ? 177 PHE F CZ  1 
ATOM 5886  N N   . ARG F 2 32  ? 41.620  28.317  -19.847 1.00 32.56 ? 178 ARG F N   1 
ATOM 5887  C CA  . ARG F 2 32  ? 40.869  28.461  -21.089 1.00 33.36 ? 178 ARG F CA  1 
ATOM 5888  C C   . ARG F 2 32  ? 41.717  28.518  -22.348 1.00 33.18 ? 178 ARG F C   1 
ATOM 5889  O O   . ARG F 2 32  ? 42.819  29.063  -22.359 1.00 32.27 ? 178 ARG F O   1 
ATOM 5890  C CB  . ARG F 2 32  ? 39.999  29.714  -21.036 1.00 34.65 ? 178 ARG F CB  1 
ATOM 5891  C CG  . ARG F 2 32  ? 39.128  29.823  -19.804 1.00 38.06 ? 178 ARG F CG  1 
ATOM 5892  C CD  . ARG F 2 32  ? 38.084  30.883  -20.022 1.00 40.15 ? 178 ARG F CD  1 
ATOM 5893  N NE  . ARG F 2 32  ? 37.256  30.546  -21.179 1.00 42.52 ? 178 ARG F NE  1 
ATOM 5894  C CZ  . ARG F 2 32  ? 36.283  31.314  -21.663 1.00 42.37 ? 178 ARG F CZ  1 
ATOM 5895  N NH1 . ARG F 2 32  ? 36.000  32.479  -21.093 1.00 41.61 ? 178 ARG F NH1 1 
ATOM 5896  N NH2 . ARG F 2 32  ? 35.591  30.906  -22.720 1.00 42.44 ? 178 ARG F NH2 1 
ATOM 5897  N N   . CYS F 2 33  ? 41.175  27.949  -23.415 1.00 34.45 ? 179 CYS F N   1 
ATOM 5898  C CA  . CYS F 2 33  ? 41.817  27.922  -24.724 1.00 35.43 ? 179 CYS F CA  1 
ATOM 5899  C C   . CYS F 2 33  ? 40.738  28.066  -25.788 1.00 36.11 ? 179 CYS F C   1 
ATOM 5900  O O   . CYS F 2 33  ? 40.497  27.145  -26.577 1.00 36.42 ? 179 CYS F O   1 
ATOM 5901  C CB  . CYS F 2 33  ? 42.567  26.612  -24.920 1.00 35.64 ? 179 CYS F CB  1 
ATOM 5902  S SG  . CYS F 2 33  ? 43.990  26.487  -23.855 1.00 38.34 ? 179 CYS F SG  1 
ATOM 5903  N N   . PRO F 2 34  ? 40.063  29.232  -25.812 1.00 36.65 ? 180 PRO F N   1 
ATOM 5904  C CA  . PRO F 2 34  ? 38.999  29.489  -26.784 1.00 36.33 ? 180 PRO F CA  1 
ATOM 5905  C C   . PRO F 2 34  ? 39.468  29.185  -28.194 1.00 37.06 ? 180 PRO F C   1 
ATOM 5906  O O   . PRO F 2 34  ? 40.462  29.739  -28.671 1.00 36.23 ? 180 PRO F O   1 
ATOM 5907  C CB  . PRO F 2 34  ? 38.683  30.954  -26.555 1.00 36.29 ? 180 PRO F CB  1 
ATOM 5908  C CG  . PRO F 2 34  ? 38.932  31.096  -25.069 1.00 36.51 ? 180 PRO F CG  1 
ATOM 5909  C CD  . PRO F 2 34  ? 40.234  30.382  -24.904 1.00 35.77 ? 180 PRO F CD  1 
ATOM 5910  N N   . ALA F 2 35  ? 38.747  28.288  -28.855 1.00 38.23 ? 181 ALA F N   1 
ATOM 5911  C CA  . ALA F 2 35  ? 39.112  27.899  -30.199 1.00 39.90 ? 181 ALA F CA  1 
ATOM 5912  C C   . ALA F 2 35  ? 37.989  28.037  -31.229 1.00 41.32 ? 181 ALA F C   1 
ATOM 5913  O O   . ALA F 2 35  ? 36.835  28.340  -30.893 1.00 41.53 ? 181 ALA F O   1 
ATOM 5914  C CB  . ALA F 2 35  ? 39.637  26.474  -30.173 1.00 39.98 ? 181 ALA F CB  1 
ATOM 5915  N N   . GLY F 2 36  ? 38.363  27.817  -32.491 1.00 42.28 ? 182 GLY F N   1 
ATOM 5916  C CA  . GLY F 2 36  ? 37.439  27.889  -33.609 1.00 42.60 ? 182 GLY F CA  1 
ATOM 5917  C C   . GLY F 2 36  ? 38.002  27.007  -34.701 1.00 43.34 ? 182 GLY F C   1 
ATOM 5918  O O   . GLY F 2 36  ? 39.094  26.470  -34.543 1.00 44.48 ? 182 GLY F O   1 
ATOM 5919  N N   . GLY F 2 37  ? 37.275  26.853  -35.803 1.00 43.65 ? 183 GLY F N   1 
ATOM 5920  C CA  . GLY F 2 37  ? 37.750  26.016  -36.894 1.00 43.13 ? 183 GLY F CA  1 
ATOM 5921  C C   . GLY F 2 37  ? 36.640  25.134  -37.411 1.00 42.92 ? 183 GLY F C   1 
ATOM 5922  O O   . GLY F 2 37  ? 35.784  24.712  -36.648 1.00 43.48 ? 183 GLY F O   1 
ATOM 5923  N N   . ASN F 2 38  ? 36.647  24.855  -38.709 1.00 43.16 ? 184 ASN F N   1 
ATOM 5924  C CA  . ASN F 2 38  ? 35.608  24.018  -39.304 1.00 42.31 ? 184 ASN F CA  1 
ATOM 5925  C C   . ASN F 2 38  ? 36.164  22.805  -40.043 1.00 41.35 ? 184 ASN F C   1 
ATOM 5926  O O   . ASN F 2 38  ? 36.949  22.932  -40.980 1.00 41.36 ? 184 ASN F O   1 
ATOM 5927  C CB  . ASN F 2 38  ? 34.745  24.855  -40.249 1.00 42.69 ? 184 ASN F CB  1 
ATOM 5928  C CG  . ASN F 2 38  ? 33.768  24.011  -41.035 1.00 43.10 ? 184 ASN F CG  1 
ATOM 5929  O OD1 . ASN F 2 38  ? 32.976  23.256  -40.462 1.00 42.28 ? 184 ASN F OD1 1 
ATOM 5930  N ND2 . ASN F 2 38  ? 33.819  24.131  -42.356 1.00 43.06 ? 184 ASN F ND2 1 
ATOM 5931  N N   . PRO F 2 39  ? 35.731  21.604  -39.651 1.00 40.62 ? 185 PRO F N   1 
ATOM 5932  C CA  . PRO F 2 39  ? 34.778  21.308  -38.576 1.00 41.23 ? 185 PRO F CA  1 
ATOM 5933  C C   . PRO F 2 39  ? 35.218  21.712  -37.158 1.00 41.35 ? 185 PRO F C   1 
ATOM 5934  O O   . PRO F 2 39  ? 36.395  21.998  -36.913 1.00 41.20 ? 185 PRO F O   1 
ATOM 5935  C CB  . PRO F 2 39  ? 34.582  19.799  -38.712 1.00 41.17 ? 185 PRO F CB  1 
ATOM 5936  C CG  . PRO F 2 39  ? 35.927  19.336  -39.188 1.00 40.24 ? 185 PRO F CG  1 
ATOM 5937  C CD  . PRO F 2 39  ? 36.247  20.361  -40.250 1.00 40.38 ? 185 PRO F CD  1 
ATOM 5938  N N   . MET F 2 40  ? 34.252  21.736  -36.240 1.00 41.28 ? 186 MET F N   1 
ATOM 5939  C CA  . MET F 2 40  ? 34.484  22.068  -34.834 1.00 41.82 ? 186 MET F CA  1 
ATOM 5940  C C   . MET F 2 40  ? 35.627  21.234  -34.288 1.00 41.93 ? 186 MET F C   1 
ATOM 5941  O O   . MET F 2 40  ? 35.514  20.007  -34.192 1.00 42.53 ? 186 MET F O   1 
ATOM 5942  C CB  . MET F 2 40  ? 33.250  21.720  -34.001 1.00 42.24 ? 186 MET F CB  1 
ATOM 5943  C CG  . MET F 2 40  ? 32.486  22.894  -33.450 1.00 44.29 ? 186 MET F CG  1 
ATOM 5944  S SD  . MET F 2 40  ? 33.427  23.825  -32.269 1.00 45.75 ? 186 MET F SD  1 
ATOM 5945  C CE  . MET F 2 40  ? 33.823  25.286  -33.247 1.00 45.40 ? 186 MET F CE  1 
ATOM 5946  N N   . PRO F 2 41  ? 36.739  21.874  -33.910 1.00 41.40 ? 187 PRO F N   1 
ATOM 5947  C CA  . PRO F 2 41  ? 37.845  21.075  -33.377 1.00 41.18 ? 187 PRO F CA  1 
ATOM 5948  C C   . PRO F 2 41  ? 37.511  20.446  -32.023 1.00 41.20 ? 187 PRO F C   1 
ATOM 5949  O O   . PRO F 2 41  ? 36.613  20.903  -31.320 1.00 40.81 ? 187 PRO F O   1 
ATOM 5950  C CB  . PRO F 2 41  ? 38.994  22.086  -33.306 1.00 41.29 ? 187 PRO F CB  1 
ATOM 5951  C CG  . PRO F 2 41  ? 38.290  23.413  -33.133 1.00 40.89 ? 187 PRO F CG  1 
ATOM 5952  C CD  . PRO F 2 41  ? 37.123  23.287  -34.077 1.00 41.69 ? 187 PRO F CD  1 
ATOM 5953  N N   . THR F 2 42  ? 38.209  19.373  -31.678 1.00 41.32 ? 188 THR F N   1 
ATOM 5954  C CA  . THR F 2 42  ? 37.986  18.711  -30.398 1.00 42.47 ? 188 THR F CA  1 
ATOM 5955  C C   . THR F 2 42  ? 39.029  19.211  -29.417 1.00 42.74 ? 188 THR F C   1 
ATOM 5956  O O   . THR F 2 42  ? 40.002  19.855  -29.810 1.00 43.19 ? 188 THR F O   1 
ATOM 5957  C CB  . THR F 2 42  ? 38.142  17.187  -30.483 1.00 42.55 ? 188 THR F CB  1 
ATOM 5958  O OG1 . THR F 2 42  ? 39.272  16.870  -31.311 1.00 44.17 ? 188 THR F OG1 1 
ATOM 5959  C CG2 . THR F 2 42  ? 36.886  16.548  -31.024 1.00 41.82 ? 188 THR F CG2 1 
ATOM 5960  N N   . MET F 2 43  ? 38.846  18.890  -28.145 1.00 42.63 ? 189 MET F N   1 
ATOM 5961  C CA  . MET F 2 43  ? 39.776  19.345  -27.131 1.00 42.77 ? 189 MET F CA  1 
ATOM 5962  C C   . MET F 2 43  ? 40.157  18.301  -26.090 1.00 41.75 ? 189 MET F C   1 
ATOM 5963  O O   . MET F 2 43  ? 39.310  17.587  -25.557 1.00 41.82 ? 189 MET F O   1 
ATOM 5964  C CB  . MET F 2 43  ? 39.190  20.570  -26.434 1.00 44.65 ? 189 MET F CB  1 
ATOM 5965  C CG  . MET F 2 43  ? 39.904  20.956  -25.157 1.00 48.93 ? 189 MET F CG  1 
ATOM 5966  S SD  . MET F 2 43  ? 39.172  22.417  -24.360 1.00 55.08 ? 189 MET F SD  1 
ATOM 5967  C CE  . MET F 2 43  ? 40.403  23.685  -24.886 1.00 52.55 ? 189 MET F CE  1 
ATOM 5968  N N   . ARG F 2 44  ? 41.448  18.228  -25.799 1.00 40.80 ? 190 ARG F N   1 
ATOM 5969  C CA  . ARG F 2 44  ? 41.975  17.307  -24.806 1.00 39.98 ? 190 ARG F CA  1 
ATOM 5970  C C   . ARG F 2 44  ? 42.837  18.118  -23.854 1.00 38.56 ? 190 ARG F C   1 
ATOM 5971  O O   . ARG F 2 44  ? 43.370  19.154  -24.236 1.00 39.54 ? 190 ARG F O   1 
ATOM 5972  C CB  . ARG F 2 44  ? 42.846  16.259  -25.485 1.00 41.49 ? 190 ARG F CB  1 
ATOM 5973  C CG  . ARG F 2 44  ? 42.083  15.292  -26.368 1.00 44.61 ? 190 ARG F CG  1 
ATOM 5974  C CD  . ARG F 2 44  ? 42.950  14.836  -27.525 1.00 46.05 ? 190 ARG F CD  1 
ATOM 5975  N NE  . ARG F 2 44  ? 44.340  14.637  -27.128 1.00 47.48 ? 190 ARG F NE  1 
ATOM 5976  C CZ  . ARG F 2 44  ? 45.331  14.448  -27.992 1.00 47.95 ? 190 ARG F CZ  1 
ATOM 5977  N NH1 . ARG F 2 44  ? 45.075  14.432  -29.297 1.00 47.93 ? 190 ARG F NH1 1 
ATOM 5978  N NH2 . ARG F 2 44  ? 46.576  14.295  -27.553 1.00 48.05 ? 190 ARG F NH2 1 
ATOM 5979  N N   . TRP F 2 45  ? 42.969  17.665  -22.615 1.00 36.52 ? 191 TRP F N   1 
ATOM 5980  C CA  . TRP F 2 45  ? 43.821  18.361  -21.657 1.00 34.91 ? 191 TRP F CA  1 
ATOM 5981  C C   . TRP F 2 45  ? 44.889  17.421  -21.121 1.00 34.57 ? 191 TRP F C   1 
ATOM 5982  O O   . TRP F 2 45  ? 44.608  16.278  -20.770 1.00 35.96 ? 191 TRP F O   1 
ATOM 5983  C CB  . TRP F 2 45  ? 43.017  18.926  -20.486 1.00 32.65 ? 191 TRP F CB  1 
ATOM 5984  C CG  . TRP F 2 45  ? 42.262  20.149  -20.835 1.00 32.33 ? 191 TRP F CG  1 
ATOM 5985  C CD1 . TRP F 2 45  ? 40.978  20.219  -21.287 1.00 32.06 ? 191 TRP F CD1 1 
ATOM 5986  C CD2 . TRP F 2 45  ? 42.741  21.499  -20.778 1.00 32.18 ? 191 TRP F CD2 1 
ATOM 5987  N NE1 . TRP F 2 45  ? 40.621  21.530  -21.509 1.00 32.22 ? 191 TRP F NE1 1 
ATOM 5988  C CE2 . TRP F 2 45  ? 41.687  22.337  -21.202 1.00 31.67 ? 191 TRP F CE2 1 
ATOM 5989  C CE3 . TRP F 2 45  ? 43.957  22.084  -20.406 1.00 32.55 ? 191 TRP F CE3 1 
ATOM 5990  C CZ2 . TRP F 2 45  ? 41.810  23.722  -21.269 1.00 32.59 ? 191 TRP F CZ2 1 
ATOM 5991  C CZ3 . TRP F 2 45  ? 44.083  23.466  -20.473 1.00 33.47 ? 191 TRP F CZ3 1 
ATOM 5992  C CH2 . TRP F 2 45  ? 43.013  24.270  -20.900 1.00 33.49 ? 191 TRP F CH2 1 
ATOM 5993  N N   . LEU F 2 46  ? 46.118  17.905  -21.060 1.00 33.25 ? 192 LEU F N   1 
ATOM 5994  C CA  . LEU F 2 46  ? 47.205  17.097  -20.557 1.00 32.36 ? 192 LEU F CA  1 
ATOM 5995  C C   . LEU F 2 46  ? 47.795  17.682  -19.270 1.00 32.88 ? 192 LEU F C   1 
ATOM 5996  O O   . LEU F 2 46  ? 47.811  18.901  -19.067 1.00 33.63 ? 192 LEU F O   1 
ATOM 5997  C CB  . LEU F 2 46  ? 48.297  16.988  -21.626 1.00 30.43 ? 192 LEU F CB  1 
ATOM 5998  C CG  . LEU F 2 46  ? 47.838  16.473  -22.992 1.00 30.13 ? 192 LEU F CG  1 
ATOM 5999  C CD1 . LEU F 2 46  ? 49.031  16.358  -23.911 1.00 30.22 ? 192 LEU F CD1 1 
ATOM 6000  C CD2 . LEU F 2 46  ? 47.150  15.126  -22.853 1.00 27.91 ? 192 LEU F CD2 1 
ATOM 6001  N N   . LYS F 2 47  ? 48.241  16.810  -18.381 1.00 31.86 ? 193 LYS F N   1 
ATOM 6002  C CA  . LYS F 2 47  ? 48.887  17.259  -17.170 1.00 32.61 ? 193 LYS F CA  1 
ATOM 6003  C C   . LYS F 2 47  ? 50.284  16.710  -17.349 1.00 33.35 ? 193 LYS F C   1 
ATOM 6004  O O   . LYS F 2 47  ? 50.479  15.494  -17.390 1.00 33.96 ? 193 LYS F O   1 
ATOM 6005  C CB  . LYS F 2 47  ? 48.264  16.668  -15.895 1.00 32.48 ? 193 LYS F CB  1 
ATOM 6006  C CG  . LYS F 2 47  ? 49.052  17.062  -14.632 1.00 31.70 ? 193 LYS F CG  1 
ATOM 6007  C CD  . LYS F 2 47  ? 48.428  16.562  -13.336 1.00 32.93 ? 193 LYS F CD  1 
ATOM 6008  C CE  . LYS F 2 47  ? 49.283  16.914  -12.108 1.00 31.43 ? 193 LYS F CE  1 
ATOM 6009  N NZ  . LYS F 2 47  ? 48.762  16.274  -10.859 1.00 30.68 ? 193 LYS F NZ  1 
ATOM 6010  N N   . ASN F 2 48  ? 51.250  17.609  -17.479 1.00 33.64 ? 194 ASN F N   1 
ATOM 6011  C CA  . ASN F 2 48  ? 52.632  17.219  -17.675 1.00 33.44 ? 194 ASN F CA  1 
ATOM 6012  C C   . ASN F 2 48  ? 52.780  16.299  -18.883 1.00 32.74 ? 194 ASN F C   1 
ATOM 6013  O O   . ASN F 2 48  ? 53.410  15.252  -18.799 1.00 32.99 ? 194 ASN F O   1 
ATOM 6014  C CB  . ASN F 2 48  ? 53.194  16.517  -16.436 1.00 33.12 ? 194 ASN F CB  1 
ATOM 6015  C CG  . ASN F 2 48  ? 53.082  17.356  -15.182 1.00 33.62 ? 194 ASN F CG  1 
ATOM 6016  O OD1 . ASN F 2 48  ? 53.358  18.558  -15.190 1.00 34.28 ? 194 ASN F OD1 1 
ATOM 6017  N ND2 . ASN F 2 48  ? 52.693  16.718  -14.081 1.00 34.09 ? 194 ASN F ND2 1 
ATOM 6018  N N   . GLY F 2 49  ? 52.188  16.697  -20.001 1.00 32.64 ? 195 GLY F N   1 
ATOM 6019  C CA  . GLY F 2 49  ? 52.302  15.930  -21.229 1.00 32.56 ? 195 GLY F CA  1 
ATOM 6020  C C   . GLY F 2 49  ? 51.599  14.595  -21.307 1.00 33.59 ? 195 GLY F C   1 
ATOM 6021  O O   . GLY F 2 49  ? 51.656  13.926  -22.340 1.00 34.29 ? 195 GLY F O   1 
ATOM 6022  N N   . LYS F 2 50  ? 50.931  14.198  -20.234 1.00 34.26 ? 196 LYS F N   1 
ATOM 6023  C CA  . LYS F 2 50  ? 50.228  12.927  -20.217 1.00 34.83 ? 196 LYS F CA  1 
ATOM 6024  C C   . LYS F 2 50  ? 48.739  13.186  -20.034 1.00 35.48 ? 196 LYS F C   1 
ATOM 6025  O O   . LYS F 2 50  ? 48.343  14.251  -19.583 1.00 35.13 ? 196 LYS F O   1 
ATOM 6026  C CB  . LYS F 2 50  ? 50.766  12.050  -19.076 1.00 33.94 ? 196 LYS F CB  1 
ATOM 6027  N N   . GLU F 2 51  ? 47.923  12.210  -20.410 1.00 36.70 ? 197 GLU F N   1 
ATOM 6028  C CA  . GLU F 2 51  ? 46.475  12.292  -20.276 1.00 37.93 ? 197 GLU F CA  1 
ATOM 6029  C C   . GLU F 2 51  ? 46.115  12.719  -18.848 1.00 38.45 ? 197 GLU F C   1 
ATOM 6030  O O   . GLU F 2 51  ? 46.703  12.229  -17.884 1.00 40.20 ? 197 GLU F O   1 
ATOM 6031  C CB  . GLU F 2 51  ? 45.919  10.908  -20.585 1.00 38.33 ? 197 GLU F CB  1 
ATOM 6032  C CG  . GLU F 2 51  ? 44.426  10.727  -20.506 1.00 40.33 ? 197 GLU F CG  1 
ATOM 6033  C CD  . GLU F 2 51  ? 44.019  9.393   -21.115 1.00 42.26 ? 197 GLU F CD  1 
ATOM 6034  O OE1 . GLU F 2 51  ? 44.417  9.145   -22.277 1.00 43.53 ? 197 GLU F OE1 1 
ATOM 6035  O OE2 . GLU F 2 51  ? 43.322  8.592   -20.451 1.00 42.39 ? 197 GLU F OE2 1 
ATOM 6036  N N   . PHE F 2 52  ? 45.160  13.633  -18.714 1.00 37.73 ? 198 PHE F N   1 
ATOM 6037  C CA  . PHE F 2 52  ? 44.728  14.114  -17.403 1.00 36.87 ? 198 PHE F CA  1 
ATOM 6038  C C   . PHE F 2 52  ? 43.405  13.409  -17.072 1.00 37.66 ? 198 PHE F C   1 
ATOM 6039  O O   . PHE F 2 52  ? 42.369  13.690  -17.681 1.00 35.49 ? 198 PHE F O   1 
ATOM 6040  C CB  . PHE F 2 52  ? 44.533  15.640  -17.461 1.00 35.40 ? 198 PHE F CB  1 
ATOM 6041  C CG  . PHE F 2 52  ? 44.304  16.296  -16.120 1.00 32.75 ? 198 PHE F CG  1 
ATOM 6042  C CD1 . PHE F 2 52  ? 43.595  17.498  -16.039 1.00 32.27 ? 198 PHE F CD1 1 
ATOM 6043  C CD2 . PHE F 2 52  ? 44.807  15.741  -14.948 1.00 32.00 ? 198 PHE F CD2 1 
ATOM 6044  C CE1 . PHE F 2 52  ? 43.390  18.137  -14.810 1.00 31.75 ? 198 PHE F CE1 1 
ATOM 6045  C CE2 . PHE F 2 52  ? 44.607  16.374  -13.714 1.00 30.57 ? 198 PHE F CE2 1 
ATOM 6046  C CZ  . PHE F 2 52  ? 43.895  17.576  -13.648 1.00 30.78 ? 198 PHE F CZ  1 
ATOM 6047  N N   . LYS F 2 53  ? 43.464  12.480  -16.122 1.00 38.98 ? 199 LYS F N   1 
ATOM 6048  C CA  . LYS F 2 53  ? 42.301  11.705  -15.694 1.00 40.49 ? 199 LYS F CA  1 
ATOM 6049  C C   . LYS F 2 53  ? 41.724  12.206  -14.379 1.00 40.53 ? 199 LYS F C   1 
ATOM 6050  O O   . LYS F 2 53  ? 42.432  12.769  -13.546 1.00 40.62 ? 199 LYS F O   1 
ATOM 6051  C CB  . LYS F 2 53  ? 42.664  10.227  -15.518 1.00 41.76 ? 199 LYS F CB  1 
ATOM 6052  C CG  . LYS F 2 53  ? 42.996  9.504   -16.797 1.00 43.20 ? 199 LYS F CG  1 
ATOM 6053  C CD  . LYS F 2 53  ? 43.370  8.061   -16.525 1.00 43.57 ? 199 LYS F CD  1 
ATOM 6054  C CE  . LYS F 2 53  ? 43.806  7.401   -17.814 1.00 44.96 ? 199 LYS F CE  1 
ATOM 6055  N NZ  . LYS F 2 53  ? 44.861  8.221   -18.485 1.00 44.21 ? 199 LYS F NZ  1 
ATOM 6056  N N   . GLN F 2 54  ? 40.432  11.962  -14.200 1.00 39.90 ? 200 GLN F N   1 
ATOM 6057  C CA  . GLN F 2 54  ? 39.718  12.372  -13.002 1.00 38.63 ? 200 GLN F CA  1 
ATOM 6058  C C   . GLN F 2 54  ? 40.330  11.856  -11.701 1.00 38.89 ? 200 GLN F C   1 
ATOM 6059  O O   . GLN F 2 54  ? 40.106  12.438  -10.636 1.00 39.86 ? 200 GLN F O   1 
ATOM 6060  C CB  . GLN F 2 54  ? 38.261  11.924  -13.105 1.00 36.40 ? 200 GLN F CB  1 
ATOM 6061  C CG  . GLN F 2 54  ? 37.475  12.645  -14.173 1.00 33.92 ? 200 GLN F CG  1 
ATOM 6062  C CD  . GLN F 2 54  ? 37.235  14.092  -13.817 1.00 34.48 ? 200 GLN F CD  1 
ATOM 6063  O OE1 . GLN F 2 54  ? 37.329  14.478  -12.650 1.00 35.28 ? 200 GLN F OE1 1 
ATOM 6064  N NE2 . GLN F 2 54  ? 36.910  14.901  -14.811 1.00 33.14 ? 200 GLN F NE2 1 
ATOM 6065  N N   . GLU F 2 55  ? 41.102  10.777  -11.782 1.00 38.94 ? 201 GLU F N   1 
ATOM 6066  C CA  . GLU F 2 55  ? 41.710  10.202  -10.586 1.00 39.21 ? 201 GLU F CA  1 
ATOM 6067  C C   . GLU F 2 55  ? 43.073  10.789  -10.269 1.00 38.53 ? 201 GLU F C   1 
ATOM 6068  O O   . GLU F 2 55  ? 43.670  10.435  -9.250  1.00 39.19 ? 201 GLU F O   1 
ATOM 6069  C CB  . GLU F 2 55  ? 41.838  8.684   -10.734 1.00 40.31 ? 201 GLU F CB  1 
ATOM 6070  C CG  . GLU F 2 55  ? 42.737  8.248   -11.879 1.00 43.53 ? 201 GLU F CG  1 
ATOM 6071  C CD  . GLU F 2 55  ? 41.974  7.978   -13.169 1.00 46.07 ? 201 GLU F CD  1 
ATOM 6072  O OE1 . GLU F 2 55  ? 41.010  8.721   -13.483 1.00 45.24 ? 201 GLU F OE1 1 
ATOM 6073  O OE2 . GLU F 2 55  ? 42.355  7.016   -13.879 1.00 48.22 ? 201 GLU F OE2 1 
ATOM 6074  N N   . HIS F 2 56  ? 43.560  11.684  -11.130 1.00 37.74 ? 202 HIS F N   1 
ATOM 6075  C CA  . HIS F 2 56  ? 44.866  12.305  -10.937 1.00 35.92 ? 202 HIS F CA  1 
ATOM 6076  C C   . HIS F 2 56  ? 44.873  13.330  -9.816  1.00 35.37 ? 202 HIS F C   1 
ATOM 6077  O O   . HIS F 2 56  ? 45.929  13.819  -9.411  1.00 36.65 ? 202 HIS F O   1 
ATOM 6078  C CB  . HIS F 2 56  ? 45.352  12.933  -12.240 1.00 36.27 ? 202 HIS F CB  1 
ATOM 6079  C CG  . HIS F 2 56  ? 45.661  11.927  -13.310 1.00 36.77 ? 202 HIS F CG  1 
ATOM 6080  N ND1 . HIS F 2 56  ? 46.229  10.701  -13.043 1.00 36.93 ? 202 HIS F ND1 1 
ATOM 6081  C CD2 . HIS F 2 56  ? 45.487  11.972  -14.652 1.00 36.40 ? 202 HIS F CD2 1 
ATOM 6082  C CE1 . HIS F 2 56  ? 46.383  10.030  -14.171 1.00 36.49 ? 202 HIS F CE1 1 
ATOM 6083  N NE2 . HIS F 2 56  ? 45.937  10.781  -15.163 1.00 35.56 ? 202 HIS F NE2 1 
ATOM 6084  N N   . ARG F 2 57  ? 43.689  13.656  -9.315  1.00 34.48 ? 203 ARG F N   1 
ATOM 6085  C CA  . ARG F 2 57  ? 43.559  14.595  -8.203  1.00 34.03 ? 203 ARG F CA  1 
ATOM 6086  C C   . ARG F 2 57  ? 42.225  14.334  -7.507  1.00 33.75 ? 203 ARG F C   1 
ATOM 6087  O O   . ARG F 2 57  ? 41.217  14.064  -8.164  1.00 33.25 ? 203 ARG F O   1 
ATOM 6088  C CB  . ARG F 2 57  ? 43.604  16.052  -8.693  1.00 31.90 ? 203 ARG F CB  1 
ATOM 6089  C CG  . ARG F 2 57  ? 42.310  16.551  -9.300  1.00 32.32 ? 203 ARG F CG  1 
ATOM 6090  C CD  . ARG F 2 57  ? 42.449  17.979  -9.797  1.00 33.74 ? 203 ARG F CD  1 
ATOM 6091  N NE  . ARG F 2 57  ? 42.802  18.901  -8.721  1.00 34.33 ? 203 ARG F NE  1 
ATOM 6092  C CZ  . ARG F 2 57  ? 41.955  19.758  -8.157  1.00 34.99 ? 203 ARG F CZ  1 
ATOM 6093  N NH1 . ARG F 2 57  ? 40.695  19.822  -8.567  1.00 34.87 ? 203 ARG F NH1 1 
ATOM 6094  N NH2 . ARG F 2 57  ? 42.364  20.549  -7.171  1.00 34.74 ? 203 ARG F NH2 1 
ATOM 6095  N N   . ILE F 2 58  ? 42.222  14.398  -6.182  1.00 33.00 ? 204 ILE F N   1 
ATOM 6096  C CA  . ILE F 2 58  ? 41.000  14.190  -5.437  1.00 33.58 ? 204 ILE F CA  1 
ATOM 6097  C C   . ILE F 2 58  ? 39.925  15.156  -5.947  1.00 34.51 ? 204 ILE F C   1 
ATOM 6098  O O   . ILE F 2 58  ? 40.164  16.363  -6.085  1.00 35.47 ? 204 ILE F O   1 
ATOM 6099  C CB  . ILE F 2 58  ? 41.222  14.431  -3.933  1.00 34.20 ? 204 ILE F CB  1 
ATOM 6100  C CG1 . ILE F 2 58  ? 42.311  13.488  -3.406  1.00 34.05 ? 204 ILE F CG1 1 
ATOM 6101  C CG2 . ILE F 2 58  ? 39.911  14.260  -3.182  1.00 33.28 ? 204 ILE F CG2 1 
ATOM 6102  C CD1 . ILE F 2 58  ? 42.036  12.020  -3.660  1.00 34.37 ? 204 ILE F CD1 1 
ATOM 6103  N N   . GLY F 2 59  ? 38.742  14.624  -6.239  1.00 34.35 ? 205 GLY F N   1 
ATOM 6104  C CA  . GLY F 2 59  ? 37.665  15.471  -6.710  1.00 34.12 ? 205 GLY F CA  1 
ATOM 6105  C C   . GLY F 2 59  ? 37.685  15.649  -8.204  1.00 33.76 ? 205 GLY F C   1 
ATOM 6106  O O   . GLY F 2 59  ? 36.735  16.160  -8.777  1.00 33.86 ? 205 GLY F O   1 
ATOM 6107  N N   . GLY F 2 60  ? 38.772  15.224  -8.834  1.00 34.47 ? 206 GLY F N   1 
ATOM 6108  C CA  . GLY F 2 60  ? 38.892  15.344  -10.279 1.00 34.06 ? 206 GLY F CA  1 
ATOM 6109  C C   . GLY F 2 60  ? 38.806  16.777  -10.762 1.00 33.74 ? 206 GLY F C   1 
ATOM 6110  O O   . GLY F 2 60  ? 39.199  17.705  -10.063 1.00 34.71 ? 206 GLY F O   1 
ATOM 6111  N N   . TYR F 2 61  ? 38.290  16.962  -11.966 1.00 32.95 ? 207 TYR F N   1 
ATOM 6112  C CA  . TYR F 2 61  ? 38.154  18.293  -12.521 1.00 33.25 ? 207 TYR F CA  1 
ATOM 6113  C C   . TYR F 2 61  ? 36.912  18.329  -13.389 1.00 34.14 ? 207 TYR F C   1 
ATOM 6114  O O   . TYR F 2 61  ? 36.296  17.289  -13.635 1.00 34.65 ? 207 TYR F O   1 
ATOM 6115  C CB  . TYR F 2 61  ? 39.378  18.649  -13.367 1.00 34.23 ? 207 TYR F CB  1 
ATOM 6116  C CG  . TYR F 2 61  ? 39.641  17.670  -14.496 1.00 34.77 ? 207 TYR F CG  1 
ATOM 6117  C CD1 . TYR F 2 61  ? 40.323  16.468  -14.268 1.00 34.99 ? 207 TYR F CD1 1 
ATOM 6118  C CD2 . TYR F 2 61  ? 39.182  17.935  -15.785 1.00 34.36 ? 207 TYR F CD2 1 
ATOM 6119  C CE1 . TYR F 2 61  ? 40.540  15.557  -15.303 1.00 36.09 ? 207 TYR F CE1 1 
ATOM 6120  C CE2 . TYR F 2 61  ? 39.391  17.044  -16.823 1.00 36.06 ? 207 TYR F CE2 1 
ATOM 6121  C CZ  . TYR F 2 61  ? 40.073  15.856  -16.580 1.00 37.37 ? 207 TYR F CZ  1 
ATOM 6122  O OH  . TYR F 2 61  ? 40.318  14.992  -17.620 1.00 38.66 ? 207 TYR F OH  1 
ATOM 6123  N N   . LYS F 2 62  ? 36.549  19.524  -13.850 1.00 34.14 ? 208 LYS F N   1 
ATOM 6124  C CA  . LYS F 2 62  ? 35.379  19.698  -14.700 1.00 35.13 ? 208 LYS F CA  1 
ATOM 6125  C C   . LYS F 2 62  ? 35.800  20.394  -15.991 1.00 37.88 ? 208 LYS F C   1 
ATOM 6126  O O   . LYS F 2 62  ? 36.764  21.153  -16.013 1.00 38.76 ? 208 LYS F O   1 
ATOM 6127  C CB  . LYS F 2 62  ? 34.319  20.556  -14.005 1.00 32.63 ? 208 LYS F CB  1 
ATOM 6128  C CG  . LYS F 2 62  ? 34.024  20.231  -12.559 1.00 29.45 ? 208 LYS F CG  1 
ATOM 6129  C CD  . LYS F 2 62  ? 32.597  20.588  -12.277 1.00 29.04 ? 208 LYS F CD  1 
ATOM 6130  C CE  . LYS F 2 62  ? 32.385  21.266  -10.941 1.00 29.38 ? 208 LYS F CE  1 
ATOM 6131  N NZ  . LYS F 2 62  ? 32.815  20.449  -9.789  1.00 30.98 ? 208 LYS F NZ  1 
ATOM 6132  N N   . VAL F 2 63  ? 35.066  20.144  -17.067 1.00 41.26 ? 209 VAL F N   1 
ATOM 6133  C CA  . VAL F 2 63  ? 35.376  20.750  -18.352 1.00 43.96 ? 209 VAL F CA  1 
ATOM 6134  C C   . VAL F 2 63  ? 34.112  21.290  -18.996 1.00 45.59 ? 209 VAL F C   1 
ATOM 6135  O O   . VAL F 2 63  ? 33.152  20.555  -19.192 1.00 46.00 ? 209 VAL F O   1 
ATOM 6136  C CB  . VAL F 2 63  ? 36.017  19.718  -19.313 1.00 43.85 ? 209 VAL F CB  1 
ATOM 6137  C CG1 . VAL F 2 63  ? 36.157  20.301  -20.694 1.00 44.22 ? 209 VAL F CG1 1 
ATOM 6138  C CG2 . VAL F 2 63  ? 37.379  19.303  -18.794 1.00 44.33 ? 209 VAL F CG2 1 
ATOM 6139  N N   . ARG F 2 64  ? 34.109  22.579  -19.312 1.00 48.02 ? 210 ARG F N   1 
ATOM 6140  C CA  . ARG F 2 64  ? 32.954  23.183  -19.961 1.00 50.94 ? 210 ARG F CA  1 
ATOM 6141  C C   . ARG F 2 64  ? 33.339  23.388  -21.426 1.00 52.30 ? 210 ARG F C   1 
ATOM 6142  O O   . ARG F 2 64  ? 33.876  24.433  -21.791 1.00 52.45 ? 210 ARG F O   1 
ATOM 6143  C CB  . ARG F 2 64  ? 32.598  24.526  -19.306 1.00 52.12 ? 210 ARG F CB  1 
ATOM 6144  C CG  . ARG F 2 64  ? 31.082  24.767  -19.141 1.00 54.58 ? 210 ARG F CG  1 
ATOM 6145  C CD  . ARG F 2 64  ? 30.362  24.839  -20.491 1.00 56.10 ? 210 ARG F CD  1 
ATOM 6146  N NE  . ARG F 2 64  ? 28.902  24.718  -20.403 1.00 56.87 ? 210 ARG F NE  1 
ATOM 6147  C CZ  . ARG F 2 64  ? 28.254  23.608  -20.049 1.00 57.35 ? 210 ARG F CZ  1 
ATOM 6148  N NH1 . ARG F 2 64  ? 28.926  22.506  -19.735 1.00 57.52 ? 210 ARG F NH1 1 
ATOM 6149  N NH2 . ARG F 2 64  ? 26.926  23.585  -20.045 1.00 56.83 ? 210 ARG F NH2 1 
ATOM 6150  N N   . ASN F 2 65  ? 33.070  22.380  -22.258 1.00 53.64 ? 211 ASN F N   1 
ATOM 6151  C CA  . ASN F 2 65  ? 33.415  22.437  -23.676 1.00 54.02 ? 211 ASN F CA  1 
ATOM 6152  C C   . ASN F 2 65  ? 32.987  23.721  -24.356 1.00 53.95 ? 211 ASN F C   1 
ATOM 6153  O O   . ASN F 2 65  ? 33.727  24.278  -25.167 1.00 53.77 ? 211 ASN F O   1 
ATOM 6154  C CB  . ASN F 2 65  ? 32.838  21.231  -24.401 1.00 54.66 ? 211 ASN F CB  1 
ATOM 6155  C CG  . ASN F 2 65  ? 33.456  19.929  -23.922 1.00 55.79 ? 211 ASN F CG  1 
ATOM 6156  O OD1 . ASN F 2 65  ? 34.682  19.757  -23.952 1.00 54.77 ? 211 ASN F OD1 1 
ATOM 6157  N ND2 . ASN F 2 65  ? 32.612  19.003  -23.471 1.00 56.35 ? 211 ASN F ND2 1 
ATOM 6158  N N   . GLN F 2 66  ? 31.797  24.195  -24.009 1.00 54.17 ? 212 GLN F N   1 
ATOM 6159  C CA  . GLN F 2 66  ? 31.265  25.430  -24.566 1.00 54.71 ? 212 GLN F CA  1 
ATOM 6160  C C   . GLN F 2 66  ? 32.257  26.593  -24.421 1.00 53.80 ? 212 GLN F C   1 
ATOM 6161  O O   . GLN F 2 66  ? 32.332  27.463  -25.287 1.00 53.62 ? 212 GLN F O   1 
ATOM 6162  C CB  . GLN F 2 66  ? 29.941  25.791  -23.880 1.00 56.61 ? 212 GLN F CB  1 
ATOM 6163  C CG  . GLN F 2 66  ? 28.782  24.845  -24.182 1.00 59.44 ? 212 GLN F CG  1 
ATOM 6164  C CD  . GLN F 2 66  ? 28.902  23.463  -23.519 1.00 61.31 ? 212 GLN F CD  1 
ATOM 6165  O OE1 . GLN F 2 66  ? 27.996  22.629  -23.645 1.00 61.84 ? 212 GLN F OE1 1 
ATOM 6166  N NE2 . GLN F 2 66  ? 30.010  23.218  -22.814 1.00 61.40 ? 212 GLN F NE2 1 
ATOM 6167  N N   . HIS F 2 67  ? 33.026  26.613  -23.338 1.00 52.38 ? 213 HIS F N   1 
ATOM 6168  C CA  . HIS F 2 67  ? 33.974  27.699  -23.150 1.00 51.18 ? 213 HIS F CA  1 
ATOM 6169  C C   . HIS F 2 67  ? 35.440  27.269  -23.261 1.00 48.98 ? 213 HIS F C   1 
ATOM 6170  O O   . HIS F 2 67  ? 36.347  28.026  -22.889 1.00 49.03 ? 213 HIS F O   1 
ATOM 6171  C CB  . HIS F 2 67  ? 33.702  28.390  -21.810 1.00 54.09 ? 213 HIS F CB  1 
ATOM 6172  C CG  . HIS F 2 67  ? 32.247  28.660  -21.562 1.00 57.13 ? 213 HIS F CG  1 
ATOM 6173  N ND1 . HIS F 2 67  ? 31.402  29.150  -22.536 1.00 57.70 ? 213 HIS F ND1 1 
ATOM 6174  C CD2 . HIS F 2 67  ? 31.483  28.488  -20.456 1.00 58.42 ? 213 HIS F CD2 1 
ATOM 6175  C CE1 . HIS F 2 67  ? 30.182  29.266  -22.043 1.00 58.11 ? 213 HIS F CE1 1 
ATOM 6176  N NE2 . HIS F 2 67  ? 30.203  28.871  -20.782 1.00 59.39 ? 213 HIS F NE2 1 
ATOM 6177  N N   . TRP F 2 68  ? 35.672  26.068  -23.792 1.00 45.43 ? 214 TRP F N   1 
ATOM 6178  C CA  . TRP F 2 68  ? 37.039  25.556  -23.962 1.00 42.86 ? 214 TRP F CA  1 
ATOM 6179  C C   . TRP F 2 68  ? 37.835  25.705  -22.682 1.00 40.90 ? 214 TRP F C   1 
ATOM 6180  O O   . TRP F 2 68  ? 39.002  26.092  -22.714 1.00 40.09 ? 214 TRP F O   1 
ATOM 6181  C CB  . TRP F 2 68  ? 37.768  26.330  -25.063 1.00 42.68 ? 214 TRP F CB  1 
ATOM 6182  C CG  . TRP F 2 68  ? 36.996  26.382  -26.313 1.00 43.99 ? 214 TRP F CG  1 
ATOM 6183  C CD1 . TRP F 2 68  ? 36.078  27.324  -26.672 1.00 43.53 ? 214 TRP F CD1 1 
ATOM 6184  C CD2 . TRP F 2 68  ? 36.963  25.376  -27.334 1.00 44.64 ? 214 TRP F CD2 1 
ATOM 6185  N NE1 . TRP F 2 68  ? 35.466  26.965  -27.851 1.00 44.23 ? 214 TRP F NE1 1 
ATOM 6186  C CE2 . TRP F 2 68  ? 35.991  25.773  -28.279 1.00 44.38 ? 214 TRP F CE2 1 
ATOM 6187  C CE3 . TRP F 2 68  ? 37.655  24.175  -27.537 1.00 43.58 ? 214 TRP F CE3 1 
ATOM 6188  C CZ2 . TRP F 2 68  ? 35.694  25.010  -29.412 1.00 44.41 ? 214 TRP F CZ2 1 
ATOM 6189  C CZ3 . TRP F 2 68  ? 37.358  23.418  -28.662 1.00 43.95 ? 214 TRP F CZ3 1 
ATOM 6190  C CH2 . TRP F 2 68  ? 36.386  23.839  -29.585 1.00 43.36 ? 214 TRP F CH2 1 
ATOM 6191  N N   . SER F 2 69  ? 37.215  25.390  -21.555 1.00 38.49 ? 215 SER F N   1 
ATOM 6192  C CA  . SER F 2 69  ? 37.892  25.554  -20.290 1.00 35.70 ? 215 SER F CA  1 
ATOM 6193  C C   . SER F 2 69  ? 38.089  24.286  -19.477 1.00 33.96 ? 215 SER F C   1 
ATOM 6194  O O   . SER F 2 69  ? 37.384  23.295  -19.651 1.00 33.57 ? 215 SER F O   1 
ATOM 6195  C CB  . SER F 2 69  ? 37.122  26.579  -19.460 1.00 36.51 ? 215 SER F CB  1 
ATOM 6196  O OG  . SER F 2 69  ? 35.792  26.143  -19.232 1.00 37.05 ? 215 SER F OG  1 
ATOM 6197  N N   . LEU F 2 70  ? 39.074  24.340  -18.587 1.00 32.41 ? 216 LEU F N   1 
ATOM 6198  C CA  . LEU F 2 70  ? 39.395  23.247  -17.680 1.00 30.93 ? 216 LEU F CA  1 
ATOM 6199  C C   . LEU F 2 70  ? 39.214  23.833  -16.286 1.00 29.56 ? 216 LEU F C   1 
ATOM 6200  O O   . LEU F 2 70  ? 39.777  24.870  -15.973 1.00 28.11 ? 216 LEU F O   1 
ATOM 6201  C CB  . LEU F 2 70  ? 40.846  22.795  -17.869 1.00 30.79 ? 216 LEU F CB  1 
ATOM 6202  C CG  . LEU F 2 70  ? 41.389  21.930  -16.724 1.00 31.07 ? 216 LEU F CG  1 
ATOM 6203  C CD1 . LEU F 2 70  ? 40.521  20.725  -16.584 1.00 31.79 ? 216 LEU F CD1 1 
ATOM 6204  C CD2 . LEU F 2 70  ? 42.824  21.506  -16.981 1.00 31.28 ? 216 LEU F CD2 1 
ATOM 6205  N N   . ILE F 2 71  ? 38.422  23.179  -15.449 1.00 29.13 ? 217 ILE F N   1 
ATOM 6206  C CA  . ILE F 2 71  ? 38.195  23.685  -14.106 1.00 28.06 ? 217 ILE F CA  1 
ATOM 6207  C C   . ILE F 2 71  ? 38.608  22.753  -12.978 1.00 28.30 ? 217 ILE F C   1 
ATOM 6208  O O   . ILE F 2 71  ? 38.172  21.603  -12.913 1.00 28.67 ? 217 ILE F O   1 
ATOM 6209  C CB  . ILE F 2 71  ? 36.728  24.052  -13.921 1.00 27.78 ? 217 ILE F CB  1 
ATOM 6210  C CG1 . ILE F 2 71  ? 36.400  25.261  -14.791 1.00 27.79 ? 217 ILE F CG1 1 
ATOM 6211  C CG2 . ILE F 2 71  ? 36.442  24.369  -12.460 1.00 27.95 ? 217 ILE F CG2 1 
ATOM 6212  C CD1 . ILE F 2 71  ? 34.952  25.352  -15.149 1.00 28.13 ? 217 ILE F CD1 1 
ATOM 6213  N N   . MET F 2 72  ? 39.458  23.267  -12.092 1.00 28.15 ? 218 MET F N   1 
ATOM 6214  C CA  . MET F 2 72  ? 39.923  22.518  -10.934 1.00 28.59 ? 218 MET F CA  1 
ATOM 6215  C C   . MET F 2 72  ? 39.527  23.318  -9.689  1.00 28.76 ? 218 MET F C   1 
ATOM 6216  O O   . MET F 2 72  ? 39.914  24.476  -9.532  1.00 29.46 ? 218 MET F O   1 
ATOM 6217  C CB  . MET F 2 72  ? 41.444  22.315  -10.997 1.00 28.34 ? 218 MET F CB  1 
ATOM 6218  C CG  . MET F 2 72  ? 41.898  21.555  -12.229 1.00 28.65 ? 218 MET F CG  1 
ATOM 6219  S SD  . MET F 2 72  ? 43.652  21.105  -12.267 1.00 27.22 ? 218 MET F SD  1 
ATOM 6220  C CE  . MET F 2 72  ? 44.405  22.539  -12.946 1.00 27.12 ? 218 MET F CE  1 
ATOM 6221  N N   . GLU F 2 73  ? 38.744  22.696  -8.815  1.00 28.80 ? 219 GLU F N   1 
ATOM 6222  C CA  . GLU F 2 73  ? 38.277  23.348  -7.601  1.00 28.59 ? 219 GLU F CA  1 
ATOM 6223  C C   . GLU F 2 73  ? 39.149  23.026  -6.396  1.00 28.42 ? 219 GLU F C   1 
ATOM 6224  O O   . GLU F 2 73  ? 39.743  21.951  -6.309  1.00 27.52 ? 219 GLU F O   1 
ATOM 6225  C CB  . GLU F 2 73  ? 36.822  22.941  -7.313  1.00 28.10 ? 219 GLU F CB  1 
ATOM 6226  C CG  . GLU F 2 73  ? 35.869  23.337  -8.416  1.00 28.14 ? 219 GLU F CG  1 
ATOM 6227  C CD  . GLU F 2 73  ? 34.634  22.459  -8.482  1.00 27.81 ? 219 GLU F CD  1 
ATOM 6228  O OE1 . GLU F 2 73  ? 34.737  21.238  -8.228  1.00 27.56 ? 219 GLU F OE1 1 
ATOM 6229  O OE2 . GLU F 2 73  ? 33.561  22.995  -8.813  1.00 29.19 ? 219 GLU F OE2 1 
ATOM 6230  N N   . SER F 2 74  ? 39.218  23.981  -5.471  1.00 28.60 ? 220 SER F N   1 
ATOM 6231  C CA  . SER F 2 74  ? 39.996  23.826  -4.242  1.00 28.66 ? 220 SER F CA  1 
ATOM 6232  C C   . SER F 2 74  ? 41.386  23.280  -4.525  1.00 28.31 ? 220 SER F C   1 
ATOM 6233  O O   . SER F 2 74  ? 41.761  22.224  -4.012  1.00 29.13 ? 220 SER F O   1 
ATOM 6234  C CB  . SER F 2 74  ? 39.288  22.866  -3.292  1.00 28.41 ? 220 SER F CB  1 
ATOM 6235  O OG  . SER F 2 74  ? 37.886  23.018  -3.392  1.00 31.60 ? 220 SER F OG  1 
ATOM 6236  N N   . VAL F 2 75  ? 42.155  23.995  -5.332  1.00 26.89 ? 221 VAL F N   1 
ATOM 6237  C CA  . VAL F 2 75  ? 43.493  23.532  -5.657  1.00 26.72 ? 221 VAL F CA  1 
ATOM 6238  C C   . VAL F 2 75  ? 44.395  23.390  -4.438  1.00 26.85 ? 221 VAL F C   1 
ATOM 6239  O O   . VAL F 2 75  ? 44.212  24.053  -3.412  1.00 27.31 ? 221 VAL F O   1 
ATOM 6240  C CB  . VAL F 2 75  ? 44.180  24.469  -6.662  1.00 26.24 ? 221 VAL F CB  1 
ATOM 6241  C CG1 . VAL F 2 75  ? 43.446  24.425  -7.991  1.00 25.68 ? 221 VAL F CG1 1 
ATOM 6242  C CG2 . VAL F 2 75  ? 44.213  25.887  -6.113  1.00 25.21 ? 221 VAL F CG2 1 
ATOM 6243  N N   . VAL F 2 76  ? 45.382  22.518  -4.567  1.00 26.86 ? 222 VAL F N   1 
ATOM 6244  C CA  . VAL F 2 76  ? 46.338  22.248  -3.495  1.00 26.75 ? 222 VAL F CA  1 
ATOM 6245  C C   . VAL F 2 76  ? 47.714  22.165  -4.129  1.00 27.28 ? 222 VAL F C   1 
ATOM 6246  O O   . VAL F 2 76  ? 47.835  22.029  -5.348  1.00 27.94 ? 222 VAL F O   1 
ATOM 6247  C CB  . VAL F 2 76  ? 46.029  20.895  -2.796  1.00 26.92 ? 222 VAL F CB  1 
ATOM 6248  C CG1 . VAL F 2 76  ? 44.663  20.941  -2.132  1.00 24.74 ? 222 VAL F CG1 1 
ATOM 6249  C CG2 . VAL F 2 76  ? 46.061  19.752  -3.818  1.00 26.72 ? 222 VAL F CG2 1 
ATOM 6250  N N   . PRO F 2 77  ? 48.775  22.223  -3.314  1.00 28.05 ? 223 PRO F N   1 
ATOM 6251  C CA  . PRO F 2 77  ? 50.150  22.158  -3.831  1.00 28.11 ? 223 PRO F CA  1 
ATOM 6252  C C   . PRO F 2 77  ? 50.430  21.042  -4.844  1.00 27.60 ? 223 PRO F C   1 
ATOM 6253  O O   . PRO F 2 77  ? 51.111  21.271  -5.847  1.00 27.98 ? 223 PRO F O   1 
ATOM 6254  C CB  . PRO F 2 77  ? 50.991  21.999  -2.567  1.00 26.17 ? 223 PRO F CB  1 
ATOM 6255  C CG  . PRO F 2 77  ? 50.204  22.741  -1.562  1.00 27.02 ? 223 PRO F CG  1 
ATOM 6256  C CD  . PRO F 2 77  ? 48.789  22.267  -1.845  1.00 27.64 ? 223 PRO F CD  1 
ATOM 6257  N N   . SER F 2 78  ? 49.912  19.842  -4.599  1.00 26.46 ? 224 SER F N   1 
ATOM 6258  C CA  . SER F 2 78  ? 50.175  18.741  -5.520  1.00 26.03 ? 224 SER F CA  1 
ATOM 6259  C C   . SER F 2 78  ? 49.603  18.960  -6.917  1.00 26.25 ? 224 SER F C   1 
ATOM 6260  O O   . SER F 2 78  ? 49.899  18.193  -7.827  1.00 27.16 ? 224 SER F O   1 
ATOM 6261  C CB  . SER F 2 78  ? 49.661  17.410  -4.958  1.00 25.24 ? 224 SER F CB  1 
ATOM 6262  O OG  . SER F 2 78  ? 48.245  17.363  -4.897  1.00 25.39 ? 224 SER F OG  1 
ATOM 6263  N N   . ASP F 2 79  ? 48.784  19.992  -7.099  1.00 26.88 ? 225 ASP F N   1 
ATOM 6264  C CA  . ASP F 2 79  ? 48.217  20.267  -8.423  1.00 27.02 ? 225 ASP F CA  1 
ATOM 6265  C C   . ASP F 2 79  ? 49.223  20.996  -9.293  1.00 27.03 ? 225 ASP F C   1 
ATOM 6266  O O   . ASP F 2 79  ? 49.013  21.161  -10.495 1.00 26.12 ? 225 ASP F O   1 
ATOM 6267  C CB  . ASP F 2 79  ? 46.948  21.113  -8.329  1.00 28.02 ? 225 ASP F CB  1 
ATOM 6268  C CG  . ASP F 2 79  ? 45.776  20.323  -7.820  1.00 30.22 ? 225 ASP F CG  1 
ATOM 6269  O OD1 . ASP F 2 79  ? 45.551  19.203  -8.341  1.00 31.25 ? 225 ASP F OD1 1 
ATOM 6270  O OD2 . ASP F 2 79  ? 45.082  20.818  -6.905  1.00 30.39 ? 225 ASP F OD2 1 
ATOM 6271  N N   . LYS F 2 80  ? 50.311  21.443  -8.675  1.00 27.00 ? 226 LYS F N   1 
ATOM 6272  C CA  . LYS F 2 80  ? 51.354  22.139  -9.399  1.00 26.96 ? 226 LYS F CA  1 
ATOM 6273  C C   . LYS F 2 80  ? 51.773  21.284  -10.600 1.00 25.94 ? 226 LYS F C   1 
ATOM 6274  O O   . LYS F 2 80  ? 51.814  20.059  -10.515 1.00 24.54 ? 226 LYS F O   1 
ATOM 6275  C CB  . LYS F 2 80  ? 52.551  22.390  -8.473  1.00 30.15 ? 226 LYS F CB  1 
ATOM 6276  C CG  . LYS F 2 80  ? 53.721  23.071  -9.162  1.00 32.00 ? 226 LYS F CG  1 
ATOM 6277  C CD  . LYS F 2 80  ? 54.803  23.462  -8.186  1.00 34.33 ? 226 LYS F CD  1 
ATOM 6278  C CE  . LYS F 2 80  ? 55.821  24.423  -8.827  1.00 36.65 ? 226 LYS F CE  1 
ATOM 6279  N NZ  . LYS F 2 80  ? 56.873  24.873  -7.855  1.00 37.95 ? 226 LYS F NZ  1 
ATOM 6280  N N   . GLY F 2 81  ? 52.062  21.937  -11.719 1.00 24.99 ? 227 GLY F N   1 
ATOM 6281  C CA  . GLY F 2 81  ? 52.467  21.212  -12.903 1.00 24.82 ? 227 GLY F CA  1 
ATOM 6282  C C   . GLY F 2 81  ? 52.014  21.908  -14.163 1.00 25.51 ? 227 GLY F C   1 
ATOM 6283  O O   . GLY F 2 81  ? 51.452  22.999  -14.100 1.00 24.86 ? 227 GLY F O   1 
ATOM 6284  N N   . ASN F 2 82  ? 52.252  21.275  -15.309 1.00 26.19 ? 228 ASN F N   1 
ATOM 6285  C CA  . ASN F 2 82  ? 51.868  21.853  -16.592 1.00 27.23 ? 228 ASN F CA  1 
ATOM 6286  C C   . ASN F 2 82  ? 50.569  21.302  -17.128 1.00 27.49 ? 228 ASN F C   1 
ATOM 6287  O O   . ASN F 2 82  ? 50.360  20.083  -17.144 1.00 29.18 ? 228 ASN F O   1 
ATOM 6288  C CB  . ASN F 2 82  ? 52.954  21.609  -17.629 1.00 27.42 ? 228 ASN F CB  1 
ATOM 6289  C CG  . ASN F 2 82  ? 54.215  22.365  -17.333 1.00 28.16 ? 228 ASN F CG  1 
ATOM 6290  O OD1 . ASN F 2 82  ? 55.287  21.966  -17.770 1.00 29.41 ? 228 ASN F OD1 1 
ATOM 6291  N ND2 . ASN F 2 82  ? 54.100  23.475  -16.598 1.00 28.02 ? 228 ASN F ND2 1 
ATOM 6292  N N   . TYR F 2 83  ? 49.693  22.196  -17.571 1.00 26.44 ? 229 TYR F N   1 
ATOM 6293  C CA  . TYR F 2 83  ? 48.421  21.769  -18.138 1.00 25.78 ? 229 TYR F CA  1 
ATOM 6294  C C   . TYR F 2 83  ? 48.377  22.235  -19.577 1.00 27.11 ? 229 TYR F C   1 
ATOM 6295  O O   . TYR F 2 83  ? 48.531  23.429  -19.873 1.00 26.98 ? 229 TYR F O   1 
ATOM 6296  C CB  . TYR F 2 83  ? 47.257  22.333  -17.338 1.00 24.26 ? 229 TYR F CB  1 
ATOM 6297  C CG  . TYR F 2 83  ? 47.284  21.832  -15.924 1.00 23.05 ? 229 TYR F CG  1 
ATOM 6298  C CD1 . TYR F 2 83  ? 48.136  22.404  -14.980 1.00 21.27 ? 229 TYR F CD1 1 
ATOM 6299  C CD2 . TYR F 2 83  ? 46.548  20.707  -15.555 1.00 22.66 ? 229 TYR F CD2 1 
ATOM 6300  C CE1 . TYR F 2 83  ? 48.263  21.867  -13.712 1.00 21.33 ? 229 TYR F CE1 1 
ATOM 6301  C CE2 . TYR F 2 83  ? 46.672  20.156  -14.279 1.00 22.25 ? 229 TYR F CE2 1 
ATOM 6302  C CZ  . TYR F 2 83  ? 47.537  20.743  -13.368 1.00 21.42 ? 229 TYR F CZ  1 
ATOM 6303  O OH  . TYR F 2 83  ? 47.709  20.177  -12.133 1.00 21.68 ? 229 TYR F OH  1 
ATOM 6304  N N   . THR F 2 84  ? 48.184  21.277  -20.477 1.00 27.00 ? 230 THR F N   1 
ATOM 6305  C CA  . THR F 2 84  ? 48.178  21.571  -21.894 1.00 25.93 ? 230 THR F CA  1 
ATOM 6306  C C   . THR F 2 84  ? 46.869  21.234  -22.559 1.00 26.18 ? 230 THR F C   1 
ATOM 6307  O O   . THR F 2 84  ? 46.297  20.163  -22.368 1.00 27.34 ? 230 THR F O   1 
ATOM 6308  C CB  . THR F 2 84  ? 49.297  20.808  -22.590 1.00 26.17 ? 230 THR F CB  1 
ATOM 6309  O OG1 . THR F 2 84  ? 50.518  21.028  -21.874 1.00 26.42 ? 230 THR F OG1 1 
ATOM 6310  C CG2 . THR F 2 84  ? 49.460  21.279  -24.029 1.00 26.77 ? 230 THR F CG2 1 
ATOM 6311  N N   . CYS F 2 85  ? 46.393  22.174  -23.347 1.00 26.13 ? 231 CYS F N   1 
ATOM 6312  C CA  . CYS F 2 85  ? 45.152  21.989  -24.054 1.00 26.80 ? 231 CYS F CA  1 
ATOM 6313  C C   . CYS F 2 85  ? 45.543  21.623  -25.483 1.00 26.86 ? 231 CYS F C   1 
ATOM 6314  O O   . CYS F 2 85  ? 46.392  22.282  -26.096 1.00 24.71 ? 231 CYS F O   1 
ATOM 6315  C CB  . CYS F 2 85  ? 44.368  23.297  -24.050 1.00 26.13 ? 231 CYS F CB  1 
ATOM 6316  S SG  . CYS F 2 85  ? 45.239  24.561  -24.996 1.00 28.13 ? 231 CYS F SG  1 
ATOM 6317  N N   . VAL F 2 86  ? 44.933  20.568  -26.006 1.00 27.55 ? 232 VAL F N   1 
ATOM 6318  C CA  . VAL F 2 86  ? 45.230  20.158  -27.357 1.00 29.82 ? 232 VAL F CA  1 
ATOM 6319  C C   . VAL F 2 86  ? 43.946  20.177  -28.186 1.00 30.98 ? 232 VAL F C   1 
ATOM 6320  O O   . VAL F 2 86  ? 43.031  19.382  -27.964 1.00 31.77 ? 232 VAL F O   1 
ATOM 6321  C CB  . VAL F 2 86  ? 45.881  18.771  -27.351 1.00 29.52 ? 232 VAL F CB  1 
ATOM 6322  C CG1 . VAL F 2 86  ? 46.187  18.332  -28.767 1.00 29.03 ? 232 VAL F CG1 1 
ATOM 6323  C CG2 . VAL F 2 86  ? 47.161  18.819  -26.516 1.00 27.10 ? 232 VAL F CG2 1 
ATOM 6324  N N   . VAL F 2 87  ? 43.887  21.115  -29.127 1.00 32.00 ? 233 VAL F N   1 
ATOM 6325  C CA  . VAL F 2 87  ? 42.730  21.279  -30.005 1.00 32.94 ? 233 VAL F CA  1 
ATOM 6326  C C   . VAL F 2 87  ? 43.046  20.806  -31.418 1.00 33.84 ? 233 VAL F C   1 
ATOM 6327  O O   . VAL F 2 87  ? 44.140  21.039  -31.928 1.00 34.11 ? 233 VAL F O   1 
ATOM 6328  C CB  . VAL F 2 87  ? 42.298  22.749  -30.071 1.00 32.03 ? 233 VAL F CB  1 
ATOM 6329  C CG1 . VAL F 2 87  ? 40.982  22.863  -30.797 1.00 31.02 ? 233 VAL F CG1 1 
ATOM 6330  C CG2 . VAL F 2 87  ? 42.189  23.312  -28.672 1.00 32.59 ? 233 VAL F CG2 1 
ATOM 6331  N N   . GLU F 2 88  ? 42.087  20.154  -32.059 1.00 36.07 ? 234 GLU F N   1 
ATOM 6332  C CA  . GLU F 2 88  ? 42.329  19.662  -33.408 1.00 38.51 ? 234 GLU F CA  1 
ATOM 6333  C C   . GLU F 2 88  ? 41.113  19.277  -34.249 1.00 38.01 ? 234 GLU F C   1 
ATOM 6334  O O   . GLU F 2 88  ? 40.007  19.104  -33.737 1.00 38.34 ? 234 GLU F O   1 
ATOM 6335  C CB  . GLU F 2 88  ? 43.267  18.458  -33.325 1.00 41.39 ? 234 GLU F CB  1 
ATOM 6336  C CG  . GLU F 2 88  ? 42.897  17.474  -32.216 1.00 46.22 ? 234 GLU F CG  1 
ATOM 6337  C CD  . GLU F 2 88  ? 43.996  16.430  -31.945 1.00 49.33 ? 234 GLU F CD  1 
ATOM 6338  O OE1 . GLU F 2 88  ? 45.121  16.812  -31.530 1.00 48.42 ? 234 GLU F OE1 1 
ATOM 6339  O OE2 . GLU F 2 88  ? 43.727  15.220  -32.148 1.00 51.57 ? 234 GLU F OE2 1 
ATOM 6340  N N   . ASN F 2 89  ? 41.354  19.179  -35.554 1.00 37.62 ? 235 ASN F N   1 
ATOM 6341  C CA  . ASN F 2 89  ? 40.379  18.738  -36.546 1.00 36.58 ? 235 ASN F CA  1 
ATOM 6342  C C   . ASN F 2 89  ? 41.220  18.193  -37.698 1.00 36.42 ? 235 ASN F C   1 
ATOM 6343  O O   . ASN F 2 89  ? 42.445  18.177  -37.603 1.00 35.07 ? 235 ASN F O   1 
ATOM 6344  C CB  . ASN F 2 89  ? 39.417  19.859  -37.002 1.00 34.94 ? 235 ASN F CB  1 
ATOM 6345  C CG  . ASN F 2 89  ? 40.103  20.984  -37.764 1.00 35.29 ? 235 ASN F CG  1 
ATOM 6346  O OD1 . ASN F 2 89  ? 41.137  20.793  -38.412 1.00 33.55 ? 235 ASN F OD1 1 
ATOM 6347  N ND2 . ASN F 2 89  ? 39.500  22.172  -37.711 1.00 34.35 ? 235 ASN F ND2 1 
ATOM 6348  N N   . GLU F 2 90  ? 40.594  17.746  -38.778 1.00 37.59 ? 236 GLU F N   1 
ATOM 6349  C CA  . GLU F 2 90  ? 41.361  17.165  -39.873 1.00 38.66 ? 236 GLU F CA  1 
ATOM 6350  C C   . GLU F 2 90  ? 42.337  18.078  -40.610 1.00 38.76 ? 236 GLU F C   1 
ATOM 6351  O O   . GLU F 2 90  ? 43.149  17.604  -41.401 1.00 38.23 ? 236 GLU F O   1 
ATOM 6352  C CB  . GLU F 2 90  ? 40.419  16.506  -40.870 1.00 40.53 ? 236 GLU F CB  1 
ATOM 6353  C CG  . GLU F 2 90  ? 39.315  17.403  -41.392 1.00 42.94 ? 236 GLU F CG  1 
ATOM 6354  C CD  . GLU F 2 90  ? 38.509  16.734  -42.494 1.00 44.31 ? 236 GLU F CD  1 
ATOM 6355  O OE1 . GLU F 2 90  ? 39.111  16.327  -43.513 1.00 45.20 ? 236 GLU F OE1 1 
ATOM 6356  O OE2 . GLU F 2 90  ? 37.277  16.615  -42.342 1.00 45.56 ? 236 GLU F OE2 1 
ATOM 6357  N N   . TYR F 2 91  ? 42.285  19.377  -40.340 1.00 39.38 ? 237 TYR F N   1 
ATOM 6358  C CA  . TYR F 2 91  ? 43.185  20.307  -41.007 1.00 39.63 ? 237 TYR F CA  1 
ATOM 6359  C C   . TYR F 2 91  ? 44.322  20.812  -40.108 1.00 38.39 ? 237 TYR F C   1 
ATOM 6360  O O   . TYR F 2 91  ? 45.122  21.661  -40.518 1.00 38.13 ? 237 TYR F O   1 
ATOM 6361  C CB  . TYR F 2 91  ? 42.380  21.479  -41.565 1.00 41.41 ? 237 TYR F CB  1 
ATOM 6362  C CG  . TYR F 2 91  ? 41.259  21.046  -42.481 1.00 45.11 ? 237 TYR F CG  1 
ATOM 6363  C CD1 . TYR F 2 91  ? 39.980  20.791  -41.985 1.00 46.83 ? 237 TYR F CD1 1 
ATOM 6364  C CD2 . TYR F 2 91  ? 41.481  20.868  -43.845 1.00 47.11 ? 237 TYR F CD2 1 
ATOM 6365  C CE1 . TYR F 2 91  ? 38.939  20.368  -42.834 1.00 48.29 ? 237 TYR F CE1 1 
ATOM 6366  C CE2 . TYR F 2 91  ? 40.458  20.444  -44.697 1.00 48.55 ? 237 TYR F CE2 1 
ATOM 6367  C CZ  . TYR F 2 91  ? 39.189  20.195  -44.191 1.00 48.73 ? 237 TYR F CZ  1 
ATOM 6368  O OH  . TYR F 2 91  ? 38.176  19.783  -45.041 1.00 49.14 ? 237 TYR F OH  1 
ATOM 6369  N N   . GLY F 2 92  ? 44.405  20.281  -38.890 1.00 36.57 ? 238 GLY F N   1 
ATOM 6370  C CA  . GLY F 2 92  ? 45.463  20.707  -37.991 1.00 34.81 ? 238 GLY F CA  1 
ATOM 6371  C C   . GLY F 2 92  ? 45.303  20.398  -36.512 1.00 32.94 ? 238 GLY F C   1 
ATOM 6372  O O   . GLY F 2 92  ? 44.258  19.946  -36.048 1.00 32.11 ? 238 GLY F O   1 
ATOM 6373  N N   . SER F 2 93  ? 46.369  20.660  -35.766 1.00 31.34 ? 239 SER F N   1 
ATOM 6374  C CA  . SER F 2 93  ? 46.380  20.425  -34.334 1.00 30.65 ? 239 SER F CA  1 
ATOM 6375  C C   . SER F 2 93  ? 47.279  21.451  -33.659 1.00 29.88 ? 239 SER F C   1 
ATOM 6376  O O   . SER F 2 93  ? 48.444  21.592  -34.027 1.00 30.23 ? 239 SER F O   1 
ATOM 6377  C CB  . SER F 2 93  ? 46.900  19.020  -34.048 1.00 30.70 ? 239 SER F CB  1 
ATOM 6378  O OG  . SER F 2 93  ? 46.796  18.718  -32.670 1.00 31.76 ? 239 SER F OG  1 
ATOM 6379  N N   . ILE F 2 94  ? 46.736  22.173  -32.685 1.00 28.70 ? 240 ILE F N   1 
ATOM 6380  C CA  . ILE F 2 94  ? 47.514  23.173  -31.972 1.00 28.28 ? 240 ILE F CA  1 
ATOM 6381  C C   . ILE F 2 94  ? 47.338  22.997  -30.474 1.00 27.97 ? 240 ILE F C   1 
ATOM 6382  O O   . ILE F 2 94  ? 46.309  22.503  -30.011 1.00 27.59 ? 240 ILE F O   1 
ATOM 6383  C CB  . ILE F 2 94  ? 47.092  24.588  -32.363 1.00 28.70 ? 240 ILE F CB  1 
ATOM 6384  C CG1 . ILE F 2 94  ? 45.591  24.757  -32.143 1.00 29.49 ? 240 ILE F CG1 1 
ATOM 6385  C CG2 . ILE F 2 94  ? 47.438  24.850  -33.806 1.00 28.51 ? 240 ILE F CG2 1 
ATOM 6386  C CD1 . ILE F 2 94  ? 45.089  26.163  -32.412 1.00 30.13 ? 240 ILE F CD1 1 
ATOM 6387  N N   . ASN F 2 95  ? 48.354  23.393  -29.718 1.00 27.31 ? 241 ASN F N   1 
ATOM 6388  C CA  . ASN F 2 95  ? 48.312  23.265  -28.271 1.00 26.61 ? 241 ASN F CA  1 
ATOM 6389  C C   . ASN F 2 95  ? 48.865  24.511  -27.594 1.00 26.71 ? 241 ASN F C   1 
ATOM 6390  O O   . ASN F 2 95  ? 49.552  25.316  -28.224 1.00 25.95 ? 241 ASN F O   1 
ATOM 6391  C CB  . ASN F 2 95  ? 49.114  22.031  -27.803 1.00 25.91 ? 241 ASN F CB  1 
ATOM 6392  C CG  . ASN F 2 95  ? 50.587  22.073  -28.223 1.00 23.91 ? 241 ASN F CG  1 
ATOM 6393  O OD1 . ASN F 2 95  ? 50.926  21.726  -29.340 1.00 24.13 ? 241 ASN F OD1 1 
ATOM 6394  N ND2 . ASN F 2 95  ? 51.456  22.507  -27.320 1.00 23.40 ? 241 ASN F ND2 1 
ATOM 6395  N N   . HIS F 2 96  ? 48.544  24.647  -26.308 1.00 26.76 ? 242 HIS F N   1 
ATOM 6396  C CA  . HIS F 2 96  ? 48.989  25.758  -25.480 1.00 27.14 ? 242 HIS F CA  1 
ATOM 6397  C C   . HIS F 2 96  ? 49.193  25.191  -24.080 1.00 27.42 ? 242 HIS F C   1 
ATOM 6398  O O   . HIS F 2 96  ? 48.418  24.347  -23.627 1.00 28.14 ? 242 HIS F O   1 
ATOM 6399  C CB  . HIS F 2 96  ? 47.933  26.858  -25.467 1.00 29.01 ? 242 HIS F CB  1 
ATOM 6400  C CG  . HIS F 2 96  ? 48.280  28.011  -24.587 1.00 30.56 ? 242 HIS F CG  1 
ATOM 6401  N ND1 . HIS F 2 96  ? 49.389  28.801  -24.799 1.00 30.33 ? 242 HIS F ND1 1 
ATOM 6402  C CD2 . HIS F 2 96  ? 47.665  28.512  -23.485 1.00 31.09 ? 242 HIS F CD2 1 
ATOM 6403  C CE1 . HIS F 2 96  ? 49.442  29.742  -23.868 1.00 30.97 ? 242 HIS F CE1 1 
ATOM 6404  N NE2 . HIS F 2 96  ? 48.408  29.586  -23.059 1.00 31.52 ? 242 HIS F NE2 1 
ATOM 6405  N N   . THR F 2 97  ? 50.233  25.639  -23.392 1.00 27.25 ? 243 THR F N   1 
ATOM 6406  C CA  . THR F 2 97  ? 50.523  25.110  -22.063 1.00 28.04 ? 243 THR F CA  1 
ATOM 6407  C C   . THR F 2 97  ? 50.500  26.161  -20.973 1.00 28.56 ? 243 THR F C   1 
ATOM 6408  O O   . THR F 2 97  ? 51.065  27.239  -21.134 1.00 29.84 ? 243 THR F O   1 
ATOM 6409  C CB  . THR F 2 97  ? 51.924  24.441  -22.009 1.00 26.62 ? 243 THR F CB  1 
ATOM 6410  O OG1 . THR F 2 97  ? 51.949  23.299  -22.866 1.00 26.05 ? 243 THR F OG1 1 
ATOM 6411  C CG2 . THR F 2 97  ? 52.261  24.000  -20.583 1.00 26.48 ? 243 THR F CG2 1 
ATOM 6412  N N   . TYR F 2 98  ? 49.858  25.831  -19.860 1.00 28.20 ? 244 TYR F N   1 
ATOM 6413  C CA  . TYR F 2 98  ? 49.793  26.725  -18.717 1.00 28.34 ? 244 TYR F CA  1 
ATOM 6414  C C   . TYR F 2 98  ? 50.548  26.047  -17.590 1.00 28.19 ? 244 TYR F C   1 
ATOM 6415  O O   . TYR F 2 98  ? 50.599  24.822  -17.516 1.00 30.47 ? 244 TYR F O   1 
ATOM 6416  C CB  . TYR F 2 98  ? 48.351  26.939  -18.256 1.00 27.77 ? 244 TYR F CB  1 
ATOM 6417  C CG  . TYR F 2 98  ? 47.472  27.769  -19.163 1.00 27.00 ? 244 TYR F CG  1 
ATOM 6418  C CD1 . TYR F 2 98  ? 46.392  27.197  -19.828 1.00 25.84 ? 244 TYR F CD1 1 
ATOM 6419  C CD2 . TYR F 2 98  ? 47.668  29.144  -19.296 1.00 26.93 ? 244 TYR F CD2 1 
ATOM 6420  C CE1 . TYR F 2 98  ? 45.521  27.977  -20.593 1.00 25.10 ? 244 TYR F CE1 1 
ATOM 6421  C CE2 . TYR F 2 98  ? 46.799  29.928  -20.068 1.00 25.96 ? 244 TYR F CE2 1 
ATOM 6422  C CZ  . TYR F 2 98  ? 45.727  29.337  -20.707 1.00 24.13 ? 244 TYR F CZ  1 
ATOM 6423  O OH  . TYR F 2 98  ? 44.845  30.102  -21.435 1.00 24.08 ? 244 TYR F OH  1 
ATOM 6424  N N   . HIS F 2 99  ? 51.142  26.832  -16.708 1.00 28.05 ? 245 HIS F N   1 
ATOM 6425  C CA  . HIS F 2 99  ? 51.845  26.260  -15.567 1.00 28.71 ? 245 HIS F CA  1 
ATOM 6426  C C   . HIS F 2 99  ? 51.029  26.636  -14.336 1.00 29.22 ? 245 HIS F C   1 
ATOM 6427  O O   . HIS F 2 99  ? 50.649  27.792  -14.171 1.00 31.06 ? 245 HIS F O   1 
ATOM 6428  C CB  . HIS F 2 99  ? 53.261  26.837  -15.448 1.00 26.96 ? 245 HIS F CB  1 
ATOM 6429  N N   . LEU F 2 100 ? 50.724  25.673  -13.482 1.00 29.13 ? 246 LEU F N   1 
ATOM 6430  C CA  . LEU F 2 100 ? 49.972  25.986  -12.285 1.00 28.47 ? 246 LEU F CA  1 
ATOM 6431  C C   . LEU F 2 100 ? 50.883  25.882  -11.079 1.00 30.00 ? 246 LEU F C   1 
ATOM 6432  O O   . LEU F 2 100 ? 51.705  24.964  -10.978 1.00 29.65 ? 246 LEU F O   1 
ATOM 6433  C CB  . LEU F 2 100 ? 48.798  25.029  -12.120 1.00 26.91 ? 246 LEU F CB  1 
ATOM 6434  C CG  . LEU F 2 100 ? 48.050  25.068  -10.778 1.00 26.58 ? 246 LEU F CG  1 
ATOM 6435  C CD1 . LEU F 2 100 ? 47.404  26.448  -10.555 1.00 25.85 ? 246 LEU F CD1 1 
ATOM 6436  C CD2 . LEU F 2 100 ? 47.003  23.967  -10.764 1.00 24.04 ? 246 LEU F CD2 1 
ATOM 6437  N N   . ASP F 2 101 ? 50.750  26.836  -10.167 1.00 31.54 ? 247 ASP F N   1 
ATOM 6438  C CA  . ASP F 2 101 ? 51.542  26.814  -8.947  1.00 32.84 ? 247 ASP F CA  1 
ATOM 6439  C C   . ASP F 2 101 ? 50.623  27.214  -7.804  1.00 32.01 ? 247 ASP F C   1 
ATOM 6440  O O   . ASP F 2 101 ? 49.911  28.210  -7.899  1.00 32.98 ? 247 ASP F O   1 
ATOM 6441  C CB  . ASP F 2 101 ? 52.729  27.772  -9.059  1.00 34.84 ? 247 ASP F CB  1 
ATOM 6442  C CG  . ASP F 2 101 ? 53.916  27.325  -8.216  1.00 37.66 ? 247 ASP F CG  1 
ATOM 6443  O OD1 . ASP F 2 101 ? 55.061  27.753  -8.503  1.00 39.27 ? 247 ASP F OD1 1 
ATOM 6444  O OD2 . ASP F 2 101 ? 53.701  26.537  -7.263  1.00 39.59 ? 247 ASP F OD2 1 
ATOM 6445  N N   . VAL F 2 102 ? 50.614  26.427  -6.735  1.00 31.51 ? 248 VAL F N   1 
ATOM 6446  C CA  . VAL F 2 102 ? 49.752  26.725  -5.589  1.00 31.54 ? 248 VAL F CA  1 
ATOM 6447  C C   . VAL F 2 102 ? 50.555  27.145  -4.362  1.00 31.72 ? 248 VAL F C   1 
ATOM 6448  O O   . VAL F 2 102 ? 51.563  26.528  -4.014  1.00 32.21 ? 248 VAL F O   1 
ATOM 6449  C CB  . VAL F 2 102 ? 48.841  25.505  -5.216  1.00 31.14 ? 248 VAL F CB  1 
ATOM 6450  C CG1 . VAL F 2 102 ? 47.955  25.838  -4.006  1.00 29.69 ? 248 VAL F CG1 1 
ATOM 6451  C CG2 . VAL F 2 102 ? 47.973  25.141  -6.407  1.00 31.04 ? 248 VAL F CG2 1 
ATOM 6452  N N   . VAL F 2 103 ? 50.090  28.207  -3.718  1.00 32.11 ? 249 VAL F N   1 
ATOM 6453  C CA  . VAL F 2 103 ? 50.728  28.758  -2.532  1.00 31.86 ? 249 VAL F CA  1 
ATOM 6454  C C   . VAL F 2 103 ? 49.768  28.720  -1.350  1.00 32.24 ? 249 VAL F C   1 
ATOM 6455  O O   . VAL F 2 103 ? 48.635  29.202  -1.440  1.00 32.60 ? 249 VAL F O   1 
ATOM 6456  C CB  . VAL F 2 103 ? 51.138  30.234  -2.765  1.00 31.24 ? 249 VAL F CB  1 
ATOM 6457  C CG1 . VAL F 2 103 ? 51.715  30.817  -1.500  1.00 30.38 ? 249 VAL F CG1 1 
ATOM 6458  C CG2 . VAL F 2 103 ? 52.131  30.330  -3.888  1.00 28.57 ? 249 VAL F CG2 1 
ATOM 6459  N N   . GLU F 2 104 ? 50.218  28.158  -0.238  1.00 32.14 ? 250 GLU F N   1 
ATOM 6460  C CA  . GLU F 2 104 ? 49.372  28.098  0.945   1.00 32.48 ? 250 GLU F CA  1 
ATOM 6461  C C   . GLU F 2 104 ? 49.573  29.307  1.818   1.00 31.25 ? 250 GLU F C   1 
ATOM 6462  O O   . GLU F 2 104 ? 50.698  29.644  2.173   1.00 32.00 ? 250 GLU F O   1 
ATOM 6463  C CB  . GLU F 2 104 ? 49.696  26.864  1.793   1.00 33.63 ? 250 GLU F CB  1 
ATOM 6464  C CG  . GLU F 2 104 ? 49.216  25.544  1.244   1.00 35.23 ? 250 GLU F CG  1 
ATOM 6465  C CD  . GLU F 2 104 ? 50.045  24.384  1.755   1.00 36.23 ? 250 GLU F CD  1 
ATOM 6466  O OE1 . GLU F 2 104 ? 51.239  24.289  1.389   1.00 36.43 ? 250 GLU F OE1 1 
ATOM 6467  O OE2 . GLU F 2 104 ? 49.502  23.572  2.524   1.00 36.76 ? 250 GLU F OE2 1 
ATOM 6468  N N   . ARG F 2 105 ? 48.482  29.946  2.198   1.00 29.90 ? 251 ARG F N   1 
ATOM 6469  C CA  . ARG F 2 105 ? 48.634  31.077  3.073   1.00 28.19 ? 251 ARG F CA  1 
ATOM 6470  C C   . ARG F 2 105 ? 48.466  30.574  4.492   1.00 27.30 ? 251 ARG F C   1 
ATOM 6471  O O   . ARG F 2 105 ? 47.916  29.502  4.732   1.00 25.30 ? 251 ARG F O   1 
ATOM 6472  C CB  . ARG F 2 105 ? 47.629  32.183  2.728   1.00 27.19 ? 251 ARG F CB  1 
ATOM 6473  C CG  . ARG F 2 105 ? 47.772  32.700  1.286   1.00 25.43 ? 251 ARG F CG  1 
ATOM 6474  C CD  . ARG F 2 105 ? 49.231  32.883  0.893   1.00 23.76 ? 251 ARG F CD  1 
ATOM 6475  N NE  . ARG F 2 105 ? 49.912  33.813  1.781   1.00 24.41 ? 251 ARG F NE  1 
ATOM 6476  C CZ  . ARG F 2 105 ? 49.865  35.144  1.686   1.00 26.23 ? 251 ARG F CZ  1 
ATOM 6477  N NH1 . ARG F 2 105 ? 49.167  35.747  0.725   1.00 25.36 ? 251 ARG F NH1 1 
ATOM 6478  N NH2 . ARG F 2 105 ? 50.516  35.880  2.577   1.00 27.99 ? 251 ARG F NH2 1 
ATOM 6479  N N   . TRP F 2 106 ? 49.001  31.337  5.428   1.00 28.11 ? 252 TRP F N   1 
ATOM 6480  C CA  . TRP F 2 106 ? 48.926  30.990  6.827   1.00 28.59 ? 252 TRP F CA  1 
ATOM 6481  C C   . TRP F 2 106 ? 48.551  32.291  7.526   1.00 28.64 ? 252 TRP F C   1 
ATOM 6482  O O   . TRP F 2 106 ? 49.406  33.026  7.987   1.00 31.79 ? 252 TRP F O   1 
ATOM 6483  C CB  . TRP F 2 106 ? 50.290  30.465  7.291   1.00 28.16 ? 252 TRP F CB  1 
ATOM 6484  C CG  . TRP F 2 106 ? 50.299  30.001  8.703   1.00 29.56 ? 252 TRP F CG  1 
ATOM 6485  C CD1 . TRP F 2 106 ? 49.645  28.913  9.223   1.00 29.05 ? 252 TRP F CD1 1 
ATOM 6486  C CD2 . TRP F 2 106 ? 50.916  30.666  9.809   1.00 29.86 ? 252 TRP F CD2 1 
ATOM 6487  N NE1 . TRP F 2 106 ? 49.812  28.868  10.590  1.00 28.58 ? 252 TRP F NE1 1 
ATOM 6488  C CE2 . TRP F 2 106 ? 50.587  29.933  10.975  1.00 29.84 ? 252 TRP F CE2 1 
ATOM 6489  C CE3 . TRP F 2 106 ? 51.708  31.820  9.930   1.00 29.44 ? 252 TRP F CE3 1 
ATOM 6490  C CZ2 . TRP F 2 106 ? 51.027  30.316  12.247  1.00 30.09 ? 252 TRP F CZ2 1 
ATOM 6491  C CZ3 . TRP F 2 106 ? 52.142  32.202  11.191  1.00 29.10 ? 252 TRP F CZ3 1 
ATOM 6492  C CH2 . TRP F 2 106 ? 51.800  31.453  12.335  1.00 30.38 ? 252 TRP F CH2 1 
ATOM 6493  N N   . PRO F 2 107 ? 47.254  32.605  7.584   1.00 28.10 ? 253 PRO F N   1 
ATOM 6494  C CA  . PRO F 2 107 ? 46.801  33.842  8.228   1.00 27.04 ? 253 PRO F CA  1 
ATOM 6495  C C   . PRO F 2 107 ? 46.758  33.823  9.762   1.00 26.79 ? 253 PRO F C   1 
ATOM 6496  O O   . PRO F 2 107 ? 45.682  33.792  10.356  1.00 25.89 ? 253 PRO F O   1 
ATOM 6497  C CB  . PRO F 2 107 ? 45.424  34.053  7.612   1.00 26.19 ? 253 PRO F CB  1 
ATOM 6498  C CG  . PRO F 2 107 ? 44.919  32.633  7.485   1.00 26.28 ? 253 PRO F CG  1 
ATOM 6499  C CD  . PRO F 2 107 ? 46.128  31.904  6.932   1.00 26.99 ? 253 PRO F CD  1 
ATOM 6500  N N   . HIS F 2 108 ? 47.927  33.850  10.395  1.00 27.70 ? 254 HIS F N   1 
ATOM 6501  C CA  . HIS F 2 108 ? 48.013  33.864  11.858  1.00 28.70 ? 254 HIS F CA  1 
ATOM 6502  C C   . HIS F 2 108 ? 48.956  34.954  12.340  1.00 28.45 ? 254 HIS F C   1 
ATOM 6503  O O   . HIS F 2 108 ? 49.804  35.399  11.575  1.00 27.45 ? 254 HIS F O   1 
ATOM 6504  C CB  . HIS F 2 108 ? 48.537  32.525  12.385  1.00 28.87 ? 254 HIS F CB  1 
ATOM 6505  C CG  . HIS F 2 108 ? 47.606  31.379  12.155  1.00 30.40 ? 254 HIS F CG  1 
ATOM 6506  N ND1 . HIS F 2 108 ? 47.599  30.646  10.987  1.00 30.86 ? 254 HIS F ND1 1 
ATOM 6507  C CD2 . HIS F 2 108 ? 46.608  30.881  12.922  1.00 31.23 ? 254 HIS F CD2 1 
ATOM 6508  C CE1 . HIS F 2 108 ? 46.637  29.744  11.042  1.00 31.10 ? 254 HIS F CE1 1 
ATOM 6509  N NE2 . HIS F 2 108 ? 46.020  29.866  12.206  1.00 33.68 ? 254 HIS F NE2 1 
ATOM 6510  N N   . ARG F 2 109 ? 48.807  35.393  13.594  1.00 29.73 ? 255 ARG F N   1 
ATOM 6511  C CA  . ARG F 2 109 ? 49.731  36.382  14.130  1.00 30.16 ? 255 ARG F CA  1 
ATOM 6512  C C   . ARG F 2 109 ? 51.032  35.598  14.227  1.00 29.15 ? 255 ARG F C   1 
ATOM 6513  O O   . ARG F 2 109 ? 51.008  34.376  14.174  1.00 30.37 ? 255 ARG F O   1 
ATOM 6514  C CB  . ARG F 2 109 ? 49.264  36.882  15.502  1.00 33.06 ? 255 ARG F CB  1 
ATOM 6515  C CG  . ARG F 2 109 ? 49.243  35.886  16.644  1.00 35.69 ? 255 ARG F CG  1 
ATOM 6516  C CD  . ARG F 2 109 ? 48.681  36.612  17.862  1.00 38.99 ? 255 ARG F CD  1 
ATOM 6517  N NE  . ARG F 2 109 ? 49.189  36.130  19.152  1.00 41.59 ? 255 ARG F NE  1 
ATOM 6518  C CZ  . ARG F 2 109 ? 48.728  35.061  19.791  1.00 42.01 ? 255 ARG F CZ  1 
ATOM 6519  N NH1 . ARG F 2 109 ? 47.742  34.341  19.270  1.00 42.69 ? 255 ARG F NH1 1 
ATOM 6520  N NH2 . ARG F 2 109 ? 49.245  34.716  20.957  1.00 42.50 ? 255 ARG F NH2 1 
ATOM 6521  N N   . PRO F 2 110 ? 52.178  36.272  14.352  1.00 28.03 ? 256 PRO F N   1 
ATOM 6522  C CA  . PRO F 2 110 ? 53.460  35.564  14.439  1.00 26.70 ? 256 PRO F CA  1 
ATOM 6523  C C   . PRO F 2 110 ? 53.500  34.503  15.530  1.00 25.95 ? 256 PRO F C   1 
ATOM 6524  O O   . PRO F 2 110 ? 52.893  34.667  16.590  1.00 25.32 ? 256 PRO F O   1 
ATOM 6525  C CB  . PRO F 2 110 ? 54.456  36.690  14.708  1.00 26.42 ? 256 PRO F CB  1 
ATOM 6526  C CG  . PRO F 2 110 ? 53.815  37.871  14.051  1.00 26.36 ? 256 PRO F CG  1 
ATOM 6527  C CD  . PRO F 2 110 ? 52.375  37.725  14.460  1.00 27.87 ? 256 PRO F CD  1 
ATOM 6528  N N   . ILE F 2 111 ? 54.216  33.417  15.261  1.00 25.79 ? 257 ILE F N   1 
ATOM 6529  C CA  . ILE F 2 111 ? 54.380  32.318  16.214  1.00 25.29 ? 257 ILE F CA  1 
ATOM 6530  C C   . ILE F 2 111 ? 55.870  32.114  16.546  1.00 24.35 ? 257 ILE F C   1 
ATOM 6531  O O   . ILE F 2 111 ? 56.692  31.964  15.646  1.00 22.88 ? 257 ILE F O   1 
ATOM 6532  C CB  . ILE F 2 111 ? 53.823  31.016  15.630  1.00 25.61 ? 257 ILE F CB  1 
ATOM 6533  C CG1 . ILE F 2 111 ? 54.091  29.852  16.584  1.00 26.29 ? 257 ILE F CG1 1 
ATOM 6534  C CG2 . ILE F 2 111 ? 54.479  30.731  14.293  1.00 26.65 ? 257 ILE F CG2 1 
ATOM 6535  C CD1 . ILE F 2 111 ? 53.370  28.586  16.171  1.00 26.33 ? 257 ILE F CD1 1 
ATOM 6536  N N   . LEU F 2 112 ? 56.211  32.121  17.832  1.00 24.73 ? 258 LEU F N   1 
ATOM 6537  C CA  . LEU F 2 112 ? 57.597  31.930  18.261  1.00 24.98 ? 258 LEU F CA  1 
ATOM 6538  C C   . LEU F 2 112 ? 57.821  30.505  18.759  1.00 25.83 ? 258 LEU F C   1 
ATOM 6539  O O   . LEU F 2 112 ? 56.894  29.840  19.212  1.00 24.70 ? 258 LEU F O   1 
ATOM 6540  C CB  . LEU F 2 112 ? 57.969  32.884  19.398  1.00 23.25 ? 258 LEU F CB  1 
ATOM 6541  C CG  . LEU F 2 112 ? 57.469  34.326  19.417  1.00 25.24 ? 258 LEU F CG  1 
ATOM 6542  C CD1 . LEU F 2 112 ? 58.319  35.106  20.406  1.00 26.27 ? 258 LEU F CD1 1 
ATOM 6543  C CD2 . LEU F 2 112 ? 57.554  34.963  18.058  1.00 26.42 ? 258 LEU F CD2 1 
ATOM 6544  N N   . GLN F 2 113 ? 59.066  30.051  18.689  1.00 27.57 ? 259 GLN F N   1 
ATOM 6545  C CA  . GLN F 2 113 ? 59.423  28.716  19.142  1.00 29.38 ? 259 GLN F CA  1 
ATOM 6546  C C   . GLN F 2 113 ? 59.418  28.628  20.662  1.00 29.66 ? 259 GLN F C   1 
ATOM 6547  O O   . GLN F 2 113 ? 60.000  29.474  21.333  1.00 29.26 ? 259 GLN F O   1 
ATOM 6548  C CB  . GLN F 2 113 ? 60.807  28.357  18.626  1.00 30.50 ? 259 GLN F CB  1 
ATOM 6549  C CG  . GLN F 2 113 ? 61.366  27.078  19.185  1.00 31.72 ? 259 GLN F CG  1 
ATOM 6550  C CD  . GLN F 2 113 ? 62.536  26.600  18.363  1.00 33.80 ? 259 GLN F CD  1 
ATOM 6551  O OE1 . GLN F 2 113 ? 62.385  26.321  17.167  1.00 35.90 ? 259 GLN F OE1 1 
ATOM 6552  N NE2 . GLN F 2 113 ? 63.711  26.515  18.981  1.00 33.26 ? 259 GLN F NE2 1 
ATOM 6553  N N   . ALA F 2 114 ? 58.766  27.599  21.207  1.00 30.21 ? 260 ALA F N   1 
ATOM 6554  C CA  . ALA F 2 114 ? 58.713  27.432  22.659  1.00 30.23 ? 260 ALA F CA  1 
ATOM 6555  C C   . ALA F 2 114 ? 60.110  27.291  23.246  1.00 30.76 ? 260 ALA F C   1 
ATOM 6556  O O   . ALA F 2 114 ? 60.952  26.587  22.687  1.00 31.88 ? 260 ALA F O   1 
ATOM 6557  C CB  . ALA F 2 114 ? 57.873  26.223  23.032  1.00 28.96 ? 260 ALA F CB  1 
ATOM 6558  N N   . GLY F 2 115 ? 60.357  27.979  24.361  1.00 30.33 ? 261 GLY F N   1 
ATOM 6559  C CA  . GLY F 2 115 ? 61.656  27.900  24.995  1.00 31.77 ? 261 GLY F CA  1 
ATOM 6560  C C   . GLY F 2 115 ? 62.633  29.002  24.626  1.00 33.26 ? 261 GLY F C   1 
ATOM 6561  O O   . GLY F 2 115 ? 63.652  29.181  25.307  1.00 35.37 ? 261 GLY F O   1 
ATOM 6562  N N   . LEU F 2 116 ? 62.357  29.731  23.550  1.00 32.64 ? 262 LEU F N   1 
ATOM 6563  C CA  . LEU F 2 116 ? 63.239  30.812  23.145  1.00 31.47 ? 262 LEU F CA  1 
ATOM 6564  C C   . LEU F 2 116 ? 62.469  32.108  23.232  1.00 31.84 ? 262 LEU F C   1 
ATOM 6565  O O   . LEU F 2 116 ? 61.300  32.166  22.857  1.00 31.80 ? 262 LEU F O   1 
ATOM 6566  C CB  . LEU F 2 116 ? 63.741  30.614  21.713  1.00 29.83 ? 262 LEU F CB  1 
ATOM 6567  C CG  . LEU F 2 116 ? 64.413  29.285  21.396  1.00 28.38 ? 262 LEU F CG  1 
ATOM 6568  C CD1 . LEU F 2 116 ? 65.242  29.422  20.118  1.00 27.59 ? 262 LEU F CD1 1 
ATOM 6569  C CD2 . LEU F 2 116 ? 65.286  28.876  22.562  1.00 26.43 ? 262 LEU F CD2 1 
ATOM 6570  N N   . PRO F 2 117 ? 63.111  33.164  23.748  1.00 32.97 ? 263 PRO F N   1 
ATOM 6571  C CA  . PRO F 2 117 ? 64.502  33.068  24.208  1.00 33.78 ? 263 PRO F CA  1 
ATOM 6572  C C   . PRO F 2 117 ? 64.632  32.304  25.545  1.00 34.25 ? 263 PRO F C   1 
ATOM 6573  O O   . PRO F 2 117 ? 63.697  32.232  26.345  1.00 32.40 ? 263 PRO F O   1 
ATOM 6574  C CB  . PRO F 2 117 ? 64.944  34.537  24.281  1.00 33.62 ? 263 PRO F CB  1 
ATOM 6575  C CG  . PRO F 2 117 ? 63.671  35.270  24.589  1.00 33.78 ? 263 PRO F CG  1 
ATOM 6576  C CD  . PRO F 2 117 ? 62.642  34.565  23.737  1.00 32.96 ? 263 PRO F CD  1 
ATOM 6577  N N   . ALA F 2 118 ? 65.795  31.705  25.765  1.00 36.17 ? 264 ALA F N   1 
ATOM 6578  C CA  . ALA F 2 118 ? 66.036  30.947  26.990  1.00 38.06 ? 264 ALA F CA  1 
ATOM 6579  C C   . ALA F 2 118 ? 66.647  31.801  28.104  1.00 39.44 ? 264 ALA F C   1 
ATOM 6580  O O   . ALA F 2 118 ? 67.334  32.798  27.843  1.00 38.90 ? 264 ALA F O   1 
ATOM 6581  C CB  . ALA F 2 118 ? 66.943  29.762  26.696  1.00 36.82 ? 264 ALA F CB  1 
ATOM 6582  N N   . ASN F 2 119 ? 66.389  31.408  29.349  1.00 41.70 ? 265 ASN F N   1 
ATOM 6583  C CA  . ASN F 2 119 ? 66.950  32.129  30.482  1.00 43.92 ? 265 ASN F CA  1 
ATOM 6584  C C   . ASN F 2 119 ? 68.459  32.049  30.370  1.00 45.41 ? 265 ASN F C   1 
ATOM 6585  O O   . ASN F 2 119 ? 68.998  31.086  29.815  1.00 46.00 ? 265 ASN F O   1 
ATOM 6586  C CB  . ASN F 2 119 ? 66.496  31.517  31.805  1.00 43.56 ? 265 ASN F CB  1 
ATOM 6587  C CG  . ASN F 2 119 ? 65.074  31.881  32.141  1.00 44.76 ? 265 ASN F CG  1 
ATOM 6588  O OD1 . ASN F 2 119 ? 64.678  33.029  31.994  1.00 46.96 ? 265 ASN F OD1 1 
ATOM 6589  N ND2 . ASN F 2 119 ? 64.296  30.910  32.595  1.00 46.01 ? 265 ASN F ND2 1 
ATOM 6590  N N   . ALA F 2 120 ? 69.145  33.064  30.879  1.00 46.99 ? 266 ALA F N   1 
ATOM 6591  C CA  . ALA F 2 120 ? 70.596  33.086  30.812  1.00 48.65 ? 266 ALA F CA  1 
ATOM 6592  C C   . ALA F 2 120 ? 71.197  33.536  32.133  1.00 50.01 ? 266 ALA F C   1 
ATOM 6593  O O   . ALA F 2 120 ? 70.606  34.328  32.873  1.00 49.86 ? 266 ALA F O   1 
ATOM 6594  C CB  . ALA F 2 120 ? 71.050  33.999  29.682  1.00 49.07 ? 266 ALA F CB  1 
ATOM 6595  N N   . SER F 2 121 ? 72.380  33.011  32.417  1.00 52.07 ? 267 SER F N   1 
ATOM 6596  C CA  . SER F 2 121 ? 73.108  33.319  33.638  1.00 53.92 ? 267 SER F CA  1 
ATOM 6597  C C   . SER F 2 121 ? 74.565  33.644  33.306  1.00 54.57 ? 267 SER F C   1 
ATOM 6598  O O   . SER F 2 121 ? 75.133  33.089  32.360  1.00 54.14 ? 267 SER F O   1 
ATOM 6599  C CB  . SER F 2 121 ? 73.060  32.115  34.579  1.00 54.14 ? 267 SER F CB  1 
ATOM 6600  O OG  . SER F 2 121 ? 74.192  32.089  35.435  1.00 55.34 ? 267 SER F OG  1 
ATOM 6601  N N   . THR F 2 122 ? 75.160  34.551  34.076  1.00 56.07 ? 268 THR F N   1 
ATOM 6602  C CA  . THR F 2 122 ? 76.561  34.922  33.874  1.00 57.98 ? 268 THR F CA  1 
ATOM 6603  C C   . THR F 2 122 ? 77.084  35.852  34.962  1.00 58.64 ? 268 THR F C   1 
ATOM 6604  O O   . THR F 2 122 ? 76.324  36.602  35.583  1.00 58.35 ? 268 THR F O   1 
ATOM 6605  C CB  . THR F 2 122 ? 76.795  35.636  32.525  1.00 59.56 ? 268 THR F CB  1 
ATOM 6606  O OG1 . THR F 2 122 ? 78.212  35.767  32.297  1.00 59.96 ? 268 THR F OG1 1 
ATOM 6607  C CG2 . THR F 2 122 ? 76.148  37.042  32.542  1.00 59.13 ? 268 THR F CG2 1 
ATOM 6608  N N   . VAL F 2 123 ? 78.395  35.795  35.179  1.00 59.18 ? 269 VAL F N   1 
ATOM 6609  C CA  . VAL F 2 123 ? 79.052  36.636  36.169  1.00 59.12 ? 269 VAL F CA  1 
ATOM 6610  C C   . VAL F 2 123 ? 79.337  37.946  35.456  1.00 59.20 ? 269 VAL F C   1 
ATOM 6611  O O   . VAL F 2 123 ? 79.579  37.952  34.243  1.00 58.66 ? 269 VAL F O   1 
ATOM 6612  C CB  . VAL F 2 123 ? 80.389  36.022  36.624  1.00 59.99 ? 269 VAL F CB  1 
ATOM 6613  N N   . VAL F 2 124 ? 79.312  39.050  36.197  1.00 59.22 ? 270 VAL F N   1 
ATOM 6614  C CA  . VAL F 2 124 ? 79.563  40.354  35.602  1.00 59.45 ? 270 VAL F CA  1 
ATOM 6615  C C   . VAL F 2 124 ? 80.743  40.283  34.642  1.00 60.11 ? 270 VAL F C   1 
ATOM 6616  O O   . VAL F 2 124 ? 81.650  39.463  34.817  1.00 60.93 ? 270 VAL F O   1 
ATOM 6617  C CB  . VAL F 2 124 ? 79.857  41.421  36.671  1.00 59.18 ? 270 VAL F CB  1 
ATOM 6618  C CG1 . VAL F 2 124 ? 79.926  42.787  36.017  1.00 59.17 ? 270 VAL F CG1 1 
ATOM 6619  C CG2 . VAL F 2 124 ? 78.782  41.402  37.752  1.00 59.76 ? 270 VAL F CG2 1 
ATOM 6620  N N   . GLY F 2 125 ? 80.714  41.130  33.617  1.00 60.28 ? 271 GLY F N   1 
ATOM 6621  C CA  . GLY F 2 125 ? 81.788  41.160  32.641  1.00 60.71 ? 271 GLY F CA  1 
ATOM 6622  C C   . GLY F 2 125 ? 81.655  40.105  31.564  1.00 61.39 ? 271 GLY F C   1 
ATOM 6623  O O   . GLY F 2 125 ? 82.332  40.164  30.532  1.00 61.33 ? 271 GLY F O   1 
ATOM 6624  N N   . GLY F 2 126 ? 80.778  39.133  31.804  1.00 61.97 ? 272 GLY F N   1 
ATOM 6625  C CA  . GLY F 2 126 ? 80.573  38.069  30.835  1.00 61.70 ? 272 GLY F CA  1 
ATOM 6626  C C   . GLY F 2 126 ? 79.694  38.458  29.652  1.00 61.62 ? 272 GLY F C   1 
ATOM 6627  O O   . GLY F 2 126 ? 78.996  39.483  29.666  1.00 61.22 ? 272 GLY F O   1 
ATOM 6628  N N   . ASP F 2 127 ? 79.746  37.634  28.612  1.00 60.92 ? 273 ASP F N   1 
ATOM 6629  C CA  . ASP F 2 127 ? 78.954  37.845  27.410  1.00 60.03 ? 273 ASP F CA  1 
ATOM 6630  C C   . ASP F 2 127 ? 77.741  36.928  27.465  1.00 59.50 ? 273 ASP F C   1 
ATOM 6631  O O   . ASP F 2 127 ? 77.763  35.905  28.156  1.00 59.98 ? 273 ASP F O   1 
ATOM 6632  C CB  . ASP F 2 127 ? 79.792  37.531  26.176  1.00 60.52 ? 273 ASP F CB  1 
ATOM 6633  C CG  . ASP F 2 127 ? 80.335  38.772  25.523  1.00 61.93 ? 273 ASP F CG  1 
ATOM 6634  O OD1 . ASP F 2 127 ? 80.543  39.773  26.250  1.00 61.07 ? 273 ASP F OD1 1 
ATOM 6635  O OD2 . ASP F 2 127 ? 80.554  38.742  24.289  1.00 62.50 ? 273 ASP F OD2 1 
ATOM 6636  N N   . VAL F 2 128 ? 76.686  37.284  26.735  1.00 58.28 ? 274 VAL F N   1 
ATOM 6637  C CA  . VAL F 2 128 ? 75.464  36.487  26.748  1.00 56.32 ? 274 VAL F CA  1 
ATOM 6638  C C   . VAL F 2 128 ? 74.593  36.802  25.533  1.00 54.94 ? 274 VAL F C   1 
ATOM 6639  O O   . VAL F 2 128 ? 74.685  37.890  24.966  1.00 54.92 ? 274 VAL F O   1 
ATOM 6640  C CB  . VAL F 2 128 ? 74.651  36.790  28.035  1.00 56.61 ? 274 VAL F CB  1 
ATOM 6641  C CG1 . VAL F 2 128 ? 73.844  38.073  27.859  1.00 56.07 ? 274 VAL F CG1 1 
ATOM 6642  C CG2 . VAL F 2 128 ? 73.756  35.630  28.379  1.00 57.08 ? 274 VAL F CG2 1 
ATOM 6643  N N   . GLU F 2 129 ? 73.743  35.856  25.139  1.00 53.72 ? 275 GLU F N   1 
ATOM 6644  C CA  . GLU F 2 129 ? 72.849  36.071  24.003  1.00 51.51 ? 275 GLU F CA  1 
ATOM 6645  C C   . GLU F 2 129 ? 71.486  35.436  24.190  1.00 49.57 ? 275 GLU F C   1 
ATOM 6646  O O   . GLU F 2 129 ? 71.311  34.525  24.992  1.00 48.90 ? 275 GLU F O   1 
ATOM 6647  C CB  . GLU F 2 129 ? 73.456  35.528  22.710  1.00 52.26 ? 275 GLU F CB  1 
ATOM 6648  C CG  . GLU F 2 129 ? 73.754  34.051  22.765  1.00 52.85 ? 275 GLU F CG  1 
ATOM 6649  C CD  . GLU F 2 129 ? 73.773  33.416  21.399  1.00 53.31 ? 275 GLU F CD  1 
ATOM 6650  O OE1 . GLU F 2 129 ? 74.274  34.062  20.452  1.00 53.13 ? 275 GLU F OE1 1 
ATOM 6651  O OE2 . GLU F 2 129 ? 73.289  32.265  21.281  1.00 53.45 ? 275 GLU F OE2 1 
ATOM 6652  N N   . PHE F 2 130 ? 70.525  35.939  23.429  1.00 48.45 ? 276 PHE F N   1 
ATOM 6653  C CA  . PHE F 2 130 ? 69.159  35.443  23.447  1.00 46.55 ? 276 PHE F CA  1 
ATOM 6654  C C   . PHE F 2 130 ? 68.748  35.219  22.011  1.00 44.81 ? 276 PHE F C   1 
ATOM 6655  O O   . PHE F 2 130 ? 68.837  36.138  21.194  1.00 46.04 ? 276 PHE F O   1 
ATOM 6656  C CB  . PHE F 2 130 ? 68.217  36.464  24.070  1.00 47.80 ? 276 PHE F CB  1 
ATOM 6657  C CG  . PHE F 2 130 ? 68.364  36.590  25.545  1.00 49.79 ? 276 PHE F CG  1 
ATOM 6658  C CD1 . PHE F 2 130 ? 68.229  35.476  26.362  1.00 50.66 ? 276 PHE F CD1 1 
ATOM 6659  C CD2 . PHE F 2 130 ? 68.636  37.824  26.126  1.00 51.39 ? 276 PHE F CD2 1 
ATOM 6660  C CE1 . PHE F 2 130 ? 68.365  35.587  27.748  1.00 53.09 ? 276 PHE F CE1 1 
ATOM 6661  C CE2 . PHE F 2 130 ? 68.776  37.953  27.513  1.00 52.39 ? 276 PHE F CE2 1 
ATOM 6662  C CZ  . PHE F 2 130 ? 68.640  36.833  28.329  1.00 52.84 ? 276 PHE F CZ  1 
ATOM 6663  N N   . VAL F 2 131 ? 68.308  34.003  21.705  1.00 41.79 ? 277 VAL F N   1 
ATOM 6664  C CA  . VAL F 2 131 ? 67.869  33.663  20.361  1.00 38.86 ? 277 VAL F CA  1 
ATOM 6665  C C   . VAL F 2 131 ? 66.353  33.626  20.299  1.00 37.68 ? 277 VAL F C   1 
ATOM 6666  O O   . VAL F 2 131 ? 65.681  33.291  21.275  1.00 37.62 ? 277 VAL F O   1 
ATOM 6667  C CB  . VAL F 2 131 ? 68.408  32.293  19.937  1.00 38.55 ? 277 VAL F CB  1 
ATOM 6668  C CG1 . VAL F 2 131 ? 67.937  31.947  18.535  1.00 38.49 ? 277 VAL F CG1 1 
ATOM 6669  C CG2 . VAL F 2 131 ? 69.906  32.301  19.995  1.00 38.17 ? 277 VAL F CG2 1 
ATOM 6670  N N   . CYS F 2 132 ? 65.810  33.972  19.144  1.00 37.27 ? 278 CYS F N   1 
ATOM 6671  C CA  . CYS F 2 132 ? 64.369  33.956  18.972  1.00 36.91 ? 278 CYS F CA  1 
ATOM 6672  C C   . CYS F 2 132 ? 63.991  33.501  17.571  1.00 36.42 ? 278 CYS F C   1 
ATOM 6673  O O   . CYS F 2 132 ? 64.340  34.152  16.583  1.00 37.37 ? 278 CYS F O   1 
ATOM 6674  C CB  . CYS F 2 132 ? 63.775  35.341  19.232  1.00 36.34 ? 278 CYS F CB  1 
ATOM 6675  S SG  . CYS F 2 132 ? 61.987  35.317  19.091  1.00 38.33 ? 278 CYS F SG  1 
ATOM 6676  N N   . LYS F 2 133 ? 63.270  32.389  17.493  1.00 35.26 ? 279 LYS F N   1 
ATOM 6677  C CA  . LYS F 2 133 ? 62.845  31.842  16.210  1.00 34.25 ? 279 LYS F CA  1 
ATOM 6678  C C   . LYS F 2 133 ? 61.385  32.188  15.927  1.00 32.99 ? 279 LYS F C   1 
ATOM 6679  O O   . LYS F 2 133 ? 60.479  31.783  16.663  1.00 32.72 ? 279 LYS F O   1 
ATOM 6680  C CB  . LYS F 2 133 ? 63.026  30.326  16.215  1.00 34.89 ? 279 LYS F CB  1 
ATOM 6681  C CG  . LYS F 2 133 ? 64.461  29.873  16.358  1.00 37.07 ? 279 LYS F CG  1 
ATOM 6682  C CD  . LYS F 2 133 ? 65.278  30.239  15.127  1.00 41.00 ? 279 LYS F CD  1 
ATOM 6683  C CE  . LYS F 2 133 ? 64.695  29.618  13.839  1.00 43.05 ? 279 LYS F CE  1 
ATOM 6684  N NZ  . LYS F 2 133 ? 63.368  30.179  13.400  1.00 42.95 ? 279 LYS F NZ  1 
ATOM 6685  N N   . VAL F 2 134 ? 61.159  32.922  14.848  1.00 31.28 ? 280 VAL F N   1 
ATOM 6686  C CA  . VAL F 2 134 ? 59.814  33.332  14.489  1.00 29.81 ? 280 VAL F CA  1 
ATOM 6687  C C   . VAL F 2 134 ? 59.348  32.789  13.151  1.00 29.59 ? 280 VAL F C   1 
ATOM 6688  O O   . VAL F 2 134 ? 60.135  32.603  12.218  1.00 30.32 ? 280 VAL F O   1 
ATOM 6689  C CB  . VAL F 2 134 ? 59.707  34.878  14.455  1.00 30.04 ? 280 VAL F CB  1 
ATOM 6690  C CG1 . VAL F 2 134 ? 58.405  35.297  13.797  1.00 29.74 ? 280 VAL F CG1 1 
ATOM 6691  C CG2 . VAL F 2 134 ? 59.820  35.450  15.888  1.00 28.07 ? 280 VAL F CG2 1 
ATOM 6692  N N   . TYR F 2 135 ? 58.058  32.507  13.069  1.00 29.86 ? 281 TYR F N   1 
ATOM 6693  C CA  . TYR F 2 135 ? 57.470  32.041  11.823  1.00 29.99 ? 281 TYR F CA  1 
ATOM 6694  C C   . TYR F 2 135 ? 56.193  32.852  11.584  1.00 28.86 ? 281 TYR F C   1 
ATOM 6695  O O   . TYR F 2 135 ? 55.395  33.050  12.503  1.00 28.87 ? 281 TYR F O   1 
ATOM 6696  C CB  . TYR F 2 135 ? 57.123  30.559  11.867  1.00 30.21 ? 281 TYR F CB  1 
ATOM 6697  C CG  . TYR F 2 135 ? 56.485  30.118  10.565  1.00 33.49 ? 281 TYR F CG  1 
ATOM 6698  C CD1 . TYR F 2 135 ? 57.268  29.752  9.467   1.00 34.09 ? 281 TYR F CD1 1 
ATOM 6699  C CD2 . TYR F 2 135 ? 55.091  30.123  10.409  1.00 33.81 ? 281 TYR F CD2 1 
ATOM 6700  C CE1 . TYR F 2 135 ? 56.684  29.404  8.254   1.00 34.04 ? 281 TYR F CE1 1 
ATOM 6701  C CE2 . TYR F 2 135 ? 54.506  29.780  9.191   1.00 34.40 ? 281 TYR F CE2 1 
ATOM 6702  C CZ  . TYR F 2 135 ? 55.309  29.424  8.124   1.00 33.72 ? 281 TYR F CZ  1 
ATOM 6703  O OH  . TYR F 2 135 ? 54.729  29.103  6.920   1.00 34.98 ? 281 TYR F OH  1 
ATOM 6704  N N   . SER F 2 136 ? 56.014  33.318  10.350  1.00 27.19 ? 282 SER F N   1 
ATOM 6705  C CA  . SER F 2 136 ? 54.856  34.119  9.992   1.00 25.88 ? 282 SER F CA  1 
ATOM 6706  C C   . SER F 2 136 ? 54.726  34.217  8.495   1.00 25.11 ? 282 SER F C   1 
ATOM 6707  O O   . SER F 2 136 ? 55.730  34.193  7.798   1.00 25.10 ? 282 SER F O   1 
ATOM 6708  C CB  . SER F 2 136 ? 55.004  35.530  10.554  1.00 26.62 ? 282 SER F CB  1 
ATOM 6709  O OG  . SER F 2 136 ? 54.069  36.402  9.944   1.00 27.54 ? 282 SER F OG  1 
ATOM 6710  N N   . ASP F 2 137 ? 53.497  34.315  7.993   1.00 25.45 ? 283 ASP F N   1 
ATOM 6711  C CA  . ASP F 2 137 ? 53.310  34.455  6.557   1.00 24.86 ? 283 ASP F CA  1 
ATOM 6712  C C   . ASP F 2 137 ? 53.403  35.941  6.279   1.00 25.55 ? 283 ASP F C   1 
ATOM 6713  O O   . ASP F 2 137 ? 54.341  36.391  5.634   1.00 25.61 ? 283 ASP F O   1 
ATOM 6714  C CB  . ASP F 2 137 ? 51.960  33.915  6.094   1.00 24.46 ? 283 ASP F CB  1 
ATOM 6715  C CG  . ASP F 2 137 ? 51.851  33.861  4.566   1.00 24.23 ? 283 ASP F CG  1 
ATOM 6716  O OD1 . ASP F 2 137 ? 50.894  33.245  4.068   1.00 24.13 ? 283 ASP F OD1 1 
ATOM 6717  O OD2 . ASP F 2 137 ? 52.720  34.430  3.861   1.00 23.99 ? 283 ASP F OD2 1 
ATOM 6718  N N   . ALA F 2 138 ? 52.433  36.705  6.767   1.00 26.31 ? 284 ALA F N   1 
ATOM 6719  C CA  . ALA F 2 138 ? 52.470  38.143  6.592   1.00 26.58 ? 284 ALA F CA  1 
ATOM 6720  C C   . ALA F 2 138 ? 53.827  38.534  7.177   1.00 27.29 ? 284 ALA F C   1 
ATOM 6721  O O   . ALA F 2 138 ? 54.281  37.903  8.129   1.00 27.78 ? 284 ALA F O   1 
ATOM 6722  C CB  . ALA F 2 138 ? 51.342  38.783  7.378   1.00 25.97 ? 284 ALA F CB  1 
ATOM 6723  N N   . GLN F 2 139 ? 54.480  39.548  6.613   1.00 27.75 ? 285 GLN F N   1 
ATOM 6724  C CA  . GLN F 2 139 ? 55.795  39.989  7.103   1.00 27.02 ? 285 GLN F CA  1 
ATOM 6725  C C   . GLN F 2 139 ? 55.730  40.384  8.578   1.00 26.98 ? 285 GLN F C   1 
ATOM 6726  O O   . GLN F 2 139 ? 54.924  41.233  8.973   1.00 28.20 ? 285 GLN F O   1 
ATOM 6727  C CB  . GLN F 2 139 ? 56.297  41.169  6.276   1.00 26.58 ? 285 GLN F CB  1 
ATOM 6728  C CG  . GLN F 2 139 ? 57.807  41.266  6.167   1.00 27.51 ? 285 GLN F CG  1 
ATOM 6729  C CD  . GLN F 2 139 ? 58.438  40.065  5.451   1.00 28.65 ? 285 GLN F CD  1 
ATOM 6730  O OE1 . GLN F 2 139 ? 58.017  39.680  4.358   1.00 26.94 ? 285 GLN F OE1 1 
ATOM 6731  N NE2 . GLN F 2 139 ? 59.466  39.481  6.067   1.00 29.15 ? 285 GLN F NE2 1 
ATOM 6732  N N   . PRO F 2 140 ? 56.572  39.761  9.413   1.00 25.92 ? 286 PRO F N   1 
ATOM 6733  C CA  . PRO F 2 140 ? 56.606  40.043  10.848  1.00 26.40 ? 286 PRO F CA  1 
ATOM 6734  C C   . PRO F 2 140 ? 57.578  41.158  11.228  1.00 26.53 ? 286 PRO F C   1 
ATOM 6735  O O   . PRO F 2 140 ? 58.565  41.396  10.534  1.00 27.22 ? 286 PRO F O   1 
ATOM 6736  C CB  . PRO F 2 140 ? 57.049  38.712  11.435  1.00 25.94 ? 286 PRO F CB  1 
ATOM 6737  C CG  . PRO F 2 140 ? 58.080  38.274  10.435  1.00 25.27 ? 286 PRO F CG  1 
ATOM 6738  C CD  . PRO F 2 140 ? 57.409  38.588  9.096   1.00 25.78 ? 286 PRO F CD  1 
ATOM 6739  N N   . HIS F 2 141 ? 57.294  41.837  12.334  1.00 27.34 ? 287 HIS F N   1 
ATOM 6740  C CA  . HIS F 2 141 ? 58.178  42.878  12.821  1.00 27.55 ? 287 HIS F CA  1 
ATOM 6741  C C   . HIS F 2 141 ? 58.689  42.443  14.190  1.00 27.97 ? 287 HIS F C   1 
ATOM 6742  O O   . HIS F 2 141 ? 57.923  42.293  15.137  1.00 28.03 ? 287 HIS F O   1 
ATOM 6743  C CB  . HIS F 2 141 ? 57.456  44.214  12.942  1.00 28.46 ? 287 HIS F CB  1 
ATOM 6744  C CG  . HIS F 2 141 ? 58.346  45.319  13.409  1.00 30.80 ? 287 HIS F CG  1 
ATOM 6745  N ND1 . HIS F 2 141 ? 58.435  45.693  14.733  1.00 31.61 ? 287 HIS F ND1 1 
ATOM 6746  C CD2 . HIS F 2 141 ? 59.283  46.041  12.751  1.00 31.30 ? 287 HIS F CD2 1 
ATOM 6747  C CE1 . HIS F 2 141 ? 59.393  46.593  14.870  1.00 32.16 ? 287 HIS F CE1 1 
ATOM 6748  N NE2 . HIS F 2 141 ? 59.924  46.820  13.683  1.00 32.07 ? 287 HIS F NE2 1 
ATOM 6749  N N   . ILE F 2 142 ? 59.993  42.237  14.287  1.00 28.35 ? 288 ILE F N   1 
ATOM 6750  C CA  . ILE F 2 142 ? 60.592  41.776  15.533  1.00 27.53 ? 288 ILE F CA  1 
ATOM 6751  C C   . ILE F 2 142 ? 61.441  42.842  16.208  1.00 29.32 ? 288 ILE F C   1 
ATOM 6752  O O   . ILE F 2 142 ? 62.178  43.588  15.554  1.00 28.83 ? 288 ILE F O   1 
ATOM 6753  C CB  . ILE F 2 142 ? 61.458  40.508  15.273  1.00 25.32 ? 288 ILE F CB  1 
ATOM 6754  C CG1 . ILE F 2 142 ? 60.560  39.384  14.749  1.00 24.49 ? 288 ILE F CG1 1 
ATOM 6755  C CG2 . ILE F 2 142 ? 62.163  40.069  16.540  1.00 22.64 ? 288 ILE F CG2 1 
ATOM 6756  C CD1 . ILE F 2 142 ? 61.214  38.488  13.745  1.00 23.84 ? 288 ILE F CD1 1 
ATOM 6757  N N   . GLN F 2 143 ? 61.321  42.908  17.528  1.00 31.34 ? 289 GLN F N   1 
ATOM 6758  C CA  . GLN F 2 143 ? 62.078  43.850  18.334  1.00 32.38 ? 289 GLN F CA  1 
ATOM 6759  C C   . GLN F 2 143 ? 62.364  43.178  19.663  1.00 33.82 ? 289 GLN F C   1 
ATOM 6760  O O   . GLN F 2 143 ? 61.602  42.305  20.115  1.00 33.65 ? 289 GLN F O   1 
ATOM 6761  C CB  . GLN F 2 143 ? 61.274  45.125  18.575  1.00 31.50 ? 289 GLN F CB  1 
ATOM 6762  C CG  . GLN F 2 143 ? 59.920  44.870  19.221  1.00 31.81 ? 289 GLN F CG  1 
ATOM 6763  C CD  . GLN F 2 143 ? 59.099  46.149  19.428  1.00 33.20 ? 289 GLN F CD  1 
ATOM 6764  O OE1 . GLN F 2 143 ? 59.514  47.067  20.160  1.00 34.00 ? 289 GLN F OE1 1 
ATOM 6765  N NE2 . GLN F 2 143 ? 57.926  46.210  18.792  1.00 29.65 ? 289 GLN F NE2 1 
ATOM 6766  N N   . TRP F 2 144 ? 63.475  43.569  20.278  1.00 35.24 ? 290 TRP F N   1 
ATOM 6767  C CA  . TRP F 2 144 ? 63.858  43.031  21.571  1.00 35.46 ? 290 TRP F CA  1 
ATOM 6768  C C   . TRP F 2 144 ? 63.591  44.101  22.597  1.00 37.41 ? 290 TRP F C   1 
ATOM 6769  O O   . TRP F 2 144 ? 63.909  45.275  22.381  1.00 38.30 ? 290 TRP F O   1 
ATOM 6770  C CB  . TRP F 2 144 ? 65.321  42.650  21.575  1.00 33.67 ? 290 TRP F CB  1 
ATOM 6771  C CG  . TRP F 2 144 ? 65.564  41.385  20.868  1.00 31.88 ? 290 TRP F CG  1 
ATOM 6772  C CD1 . TRP F 2 144 ? 65.958  41.237  19.587  1.00 30.73 ? 290 TRP F CD1 1 
ATOM 6773  C CD2 . TRP F 2 144 ? 65.480  40.071  21.427  1.00 32.14 ? 290 TRP F CD2 1 
ATOM 6774  N NE1 . TRP F 2 144 ? 66.145  39.907  19.300  1.00 32.81 ? 290 TRP F NE1 1 
ATOM 6775  C CE2 . TRP F 2 144 ? 65.861  39.165  20.417  1.00 32.04 ? 290 TRP F CE2 1 
ATOM 6776  C CE3 . TRP F 2 144 ? 65.124  39.571  22.689  1.00 32.22 ? 290 TRP F CE3 1 
ATOM 6777  C CZ2 . TRP F 2 144 ? 65.903  37.780  20.619  1.00 32.60 ? 290 TRP F CZ2 1 
ATOM 6778  C CZ3 . TRP F 2 144 ? 65.165  38.193  22.896  1.00 33.95 ? 290 TRP F CZ3 1 
ATOM 6779  C CH2 . TRP F 2 144 ? 65.555  37.311  21.861  1.00 33.73 ? 290 TRP F CH2 1 
ATOM 6780  N N   . ILE F 2 145 ? 62.995  43.699  23.709  1.00 38.27 ? 291 ILE F N   1 
ATOM 6781  C CA  . ILE F 2 145 ? 62.653  44.639  24.750  1.00 40.38 ? 291 ILE F CA  1 
ATOM 6782  C C   . ILE F 2 145 ? 63.137  44.172  26.118  1.00 42.85 ? 291 ILE F C   1 
ATOM 6783  O O   . ILE F 2 145 ? 63.001  42.994  26.467  1.00 42.68 ? 291 ILE F O   1 
ATOM 6784  C CB  . ILE F 2 145 ? 61.129  44.809  24.831  1.00 39.98 ? 291 ILE F CB  1 
ATOM 6785  C CG1 . ILE F 2 145 ? 60.582  45.228  23.474  1.00 40.44 ? 291 ILE F CG1 1 
ATOM 6786  C CG2 . ILE F 2 145 ? 60.768  45.829  25.902  1.00 40.64 ? 291 ILE F CG2 1 
ATOM 6787  C CD1 . ILE F 2 145 ? 59.069  45.096  23.382  1.00 39.85 ? 291 ILE F CD1 1 
ATOM 6788  N N   . LYS F 2 146 ? 63.691  45.104  26.894  1.00 45.02 ? 292 LYS F N   1 
ATOM 6789  C CA  . LYS F 2 146 ? 64.152  44.799  28.245  1.00 46.73 ? 292 LYS F CA  1 
ATOM 6790  C C   . LYS F 2 146 ? 63.165  45.477  29.181  1.00 47.33 ? 292 LYS F C   1 
ATOM 6791  O O   . LYS F 2 146 ? 62.729  46.596  28.907  1.00 46.44 ? 292 LYS F O   1 
ATOM 6792  C CB  . LYS F 2 146 ? 65.560  45.363  28.486  1.00 47.17 ? 292 LYS F CB  1 
ATOM 6793  N N   . HIS F 2 147 ? 62.790  44.795  30.258  1.00 49.27 ? 293 HIS F N   1 
ATOM 6794  C CA  . HIS F 2 147 ? 61.876  45.378  31.231  1.00 52.59 ? 293 HIS F CA  1 
ATOM 6795  C C   . HIS F 2 147 ? 62.721  46.234  32.176  1.00 53.98 ? 293 HIS F C   1 
ATOM 6796  O O   . HIS F 2 147 ? 63.731  45.773  32.724  1.00 53.12 ? 293 HIS F O   1 
ATOM 6797  C CB  . HIS F 2 147 ? 61.150  44.286  32.008  1.00 54.51 ? 293 HIS F CB  1 
ATOM 6798  C CG  . HIS F 2 147 ? 60.191  43.496  31.171  1.00 58.34 ? 293 HIS F CG  1 
ATOM 6799  N ND1 . HIS F 2 147 ? 60.602  42.663  30.151  1.00 58.93 ? 293 HIS F ND1 1 
ATOM 6800  C CD2 . HIS F 2 147 ? 58.836  43.434  31.186  1.00 58.53 ? 293 HIS F CD2 1 
ATOM 6801  C CE1 . HIS F 2 147 ? 59.540  42.126  29.574  1.00 59.58 ? 293 HIS F CE1 1 
ATOM 6802  N NE2 . HIS F 2 147 ? 58.457  42.576  30.182  1.00 58.62 ? 293 HIS F NE2 1 
ATOM 6803  N N   . VAL F 2 148 ? 62.323  47.491  32.343  1.00 54.89 ? 294 VAL F N   1 
ATOM 6804  C CA  . VAL F 2 148 ? 63.072  48.400  33.196  1.00 55.83 ? 294 VAL F CA  1 
ATOM 6805  C C   . VAL F 2 148 ? 62.155  49.160  34.147  1.00 56.64 ? 294 VAL F C   1 
ATOM 6806  O O   . VAL F 2 148 ? 62.605  49.674  35.177  1.00 57.68 ? 294 VAL F O   1 
ATOM 6807  C CB  . VAL F 2 148 ? 63.898  49.409  32.346  1.00 55.35 ? 294 VAL F CB  1 
ATOM 6808  C CG1 . VAL F 2 148 ? 64.677  50.335  33.260  1.00 55.17 ? 294 VAL F CG1 1 
ATOM 6809  C CG2 . VAL F 2 148 ? 64.855  48.657  31.423  1.00 54.08 ? 294 VAL F CG2 1 
ATOM 6810  N N   . PRO F 2 161 ? 54.295  49.207  33.074  1.00 62.47 ? 307 PRO F N   1 
ATOM 6811  C CA  . PRO F 2 161 ? 55.440  48.376  32.676  1.00 62.15 ? 307 PRO F CA  1 
ATOM 6812  C C   . PRO F 2 161 ? 56.517  49.175  31.924  1.00 61.81 ? 307 PRO F C   1 
ATOM 6813  O O   . PRO F 2 161 ? 56.356  49.514  30.739  1.00 61.79 ? 307 PRO F O   1 
ATOM 6814  C CB  . PRO F 2 161 ? 54.792  47.308  31.801  1.00 62.71 ? 307 PRO F CB  1 
ATOM 6815  C CG  . PRO F 2 161 ? 53.698  48.093  31.101  1.00 62.76 ? 307 PRO F CG  1 
ATOM 6816  C CD  . PRO F 2 161 ? 53.109  48.921  32.242  1.00 62.62 ? 307 PRO F CD  1 
ATOM 6817  N N   . TYR F 2 162 ? 57.610  49.475  32.619  1.00 60.26 ? 308 TYR F N   1 
ATOM 6818  C CA  . TYR F 2 162 ? 58.714  50.230  32.028  1.00 59.02 ? 308 TYR F CA  1 
ATOM 6819  C C   . TYR F 2 162 ? 59.484  49.359  31.032  1.00 58.03 ? 308 TYR F C   1 
ATOM 6820  O O   . TYR F 2 162 ? 60.210  48.447  31.431  1.00 58.35 ? 308 TYR F O   1 
ATOM 6821  C CB  . TYR F 2 162 ? 59.664  50.723  33.133  1.00 58.68 ? 308 TYR F CB  1 
ATOM 6822  N N   . LEU F 2 163 ? 59.336  49.653  29.741  1.00 56.30 ? 309 LEU F N   1 
ATOM 6823  C CA  . LEU F 2 163 ? 59.997  48.873  28.699  1.00 54.46 ? 309 LEU F CA  1 
ATOM 6824  C C   . LEU F 2 163 ? 61.012  49.682  27.890  1.00 53.13 ? 309 LEU F C   1 
ATOM 6825  O O   . LEU F 2 163 ? 60.854  50.882  27.698  1.00 53.26 ? 309 LEU F O   1 
ATOM 6826  C CB  . LEU F 2 163 ? 58.936  48.281  27.763  1.00 54.74 ? 309 LEU F CB  1 
ATOM 6827  C CG  . LEU F 2 163 ? 57.490  48.471  28.231  1.00 54.77 ? 309 LEU F CG  1 
ATOM 6828  C CD1 . LEU F 2 163 ? 56.709  49.346  27.235  1.00 54.19 ? 309 LEU F CD1 1 
ATOM 6829  C CD2 . LEU F 2 163 ? 56.847  47.116  28.400  1.00 54.70 ? 309 LEU F CD2 1 
ATOM 6830  N N   . LYS F 2 164 ? 62.057  49.014  27.414  1.00 51.84 ? 310 LYS F N   1 
ATOM 6831  C CA  . LYS F 2 164 ? 63.088  49.670  26.619  1.00 49.90 ? 310 LYS F CA  1 
ATOM 6832  C C   . LYS F 2 164 ? 63.425  48.868  25.364  1.00 48.41 ? 310 LYS F C   1 
ATOM 6833  O O   . LYS F 2 164 ? 63.834  47.710  25.442  1.00 49.13 ? 310 LYS F O   1 
ATOM 6834  C CB  . LYS F 2 164 ? 64.360  49.856  27.447  1.00 50.79 ? 310 LYS F CB  1 
ATOM 6835  C CG  . LYS F 2 164 ? 65.560  50.368  26.641  1.00 52.25 ? 310 LYS F CG  1 
ATOM 6836  C CD  . LYS F 2 164 ? 66.839  50.432  27.492  1.00 54.13 ? 310 LYS F CD  1 
ATOM 6837  C CE  . LYS F 2 164 ? 68.103  50.733  26.660  1.00 54.14 ? 310 LYS F CE  1 
ATOM 6838  N NZ  . LYS F 2 164 ? 68.172  52.132  26.141  1.00 55.11 ? 310 LYS F NZ  1 
ATOM 6839  N N   . VAL F 2 165 ? 63.257  49.487  24.203  1.00 46.26 ? 311 VAL F N   1 
ATOM 6840  C CA  . VAL F 2 165 ? 63.562  48.814  22.952  1.00 43.98 ? 311 VAL F CA  1 
ATOM 6841  C C   . VAL F 2 165 ? 65.063  48.788  22.738  1.00 43.37 ? 311 VAL F C   1 
ATOM 6842  O O   . VAL F 2 165 ? 65.688  49.825  22.526  1.00 43.37 ? 311 VAL F O   1 
ATOM 6843  C CB  . VAL F 2 165 ? 62.942  49.528  21.755  1.00 42.77 ? 311 VAL F CB  1 
ATOM 6844  C CG1 . VAL F 2 165 ? 63.242  48.739  20.493  1.00 42.19 ? 311 VAL F CG1 1 
ATOM 6845  C CG2 . VAL F 2 165 ? 61.454  49.697  21.964  1.00 42.41 ? 311 VAL F CG2 1 
ATOM 6846  N N   . LEU F 2 166 ? 65.641  47.596  22.782  1.00 42.31 ? 312 LEU F N   1 
ATOM 6847  C CA  . LEU F 2 166 ? 67.073  47.450  22.581  1.00 40.66 ? 312 LEU F CA  1 
ATOM 6848  C C   . LEU F 2 166 ? 67.422  47.234  21.115  1.00 40.17 ? 312 LEU F C   1 
ATOM 6849  O O   . LEU F 2 166 ? 68.530  47.531  20.676  1.00 40.28 ? 312 LEU F O   1 
ATOM 6850  C CB  . LEU F 2 166 ? 67.610  46.260  23.381  1.00 40.23 ? 312 LEU F CB  1 
ATOM 6851  C CG  . LEU F 2 166 ? 67.449  46.270  24.899  1.00 41.19 ? 312 LEU F CG  1 
ATOM 6852  C CD1 . LEU F 2 166 ? 66.001  45.996  25.265  1.00 41.36 ? 312 LEU F CD1 1 
ATOM 6853  C CD2 . LEU F 2 166 ? 68.341  45.214  25.507  1.00 40.12 ? 312 LEU F CD2 1 
ATOM 6854  N N   . LYS F 2 167 ? 66.465  46.729  20.349  1.00 40.50 ? 313 LYS F N   1 
ATOM 6855  C CA  . LYS F 2 167 ? 66.718  46.411  18.949  1.00 39.57 ? 313 LYS F CA  1 
ATOM 6856  C C   . LYS F 2 167 ? 65.370  46.259  18.257  1.00 39.15 ? 313 LYS F C   1 
ATOM 6857  O O   . LYS F 2 167 ? 64.448  45.660  18.813  1.00 39.66 ? 313 LYS F O   1 
ATOM 6858  C CB  . LYS F 2 167 ? 67.482  45.086  18.901  1.00 39.14 ? 313 LYS F CB  1 
ATOM 6859  C CG  . LYS F 2 167 ? 68.422  44.902  17.753  1.00 39.50 ? 313 LYS F CG  1 
ATOM 6860  C CD  . LYS F 2 167 ? 69.068  43.528  17.835  1.00 40.69 ? 313 LYS F CD  1 
ATOM 6861  C CE  . LYS F 2 167 ? 69.989  43.279  16.646  1.00 41.89 ? 313 LYS F CE  1 
ATOM 6862  N NZ  . LYS F 2 167 ? 70.472  41.866  16.611  1.00 42.69 ? 313 LYS F NZ  1 
ATOM 6863  N N   . ALA F 2 168 ? 65.253  46.800  17.051  1.00 38.29 ? 314 ALA F N   1 
ATOM 6864  C CA  . ALA F 2 168 ? 64.001  46.706  16.309  1.00 37.44 ? 314 ALA F CA  1 
ATOM 6865  C C   . ALA F 2 168 ? 64.284  46.569  14.820  1.00 37.24 ? 314 ALA F C   1 
ATOM 6866  O O   . ALA F 2 168 ? 65.050  47.351  14.250  1.00 37.52 ? 314 ALA F O   1 
ATOM 6867  C CB  . ALA F 2 168 ? 63.133  47.931  16.582  1.00 35.12 ? 314 ALA F CB  1 
ATOM 6868  N N   . ALA F 2 169 ? 63.663  45.564  14.203  1.00 37.48 ? 315 ALA F N   1 
ATOM 6869  C CA  . ALA F 2 169 ? 63.836  45.288  12.784  1.00 36.72 ? 315 ALA F CA  1 
ATOM 6870  C C   . ALA F 2 169 ? 63.487  46.510  11.944  1.00 36.55 ? 315 ALA F C   1 
ATOM 6871  O O   . ALA F 2 169 ? 62.693  47.347  12.352  1.00 35.84 ? 315 ALA F O   1 
ATOM 6872  C CB  . ALA F 2 169 ? 62.969  44.113  12.388  1.00 35.95 ? 315 ALA F CB  1 
ATOM 6873  N N   . GLY F 2 170 ? 64.104  46.605  10.774  1.00 36.79 ? 316 GLY F N   1 
ATOM 6874  C CA  . GLY F 2 170 ? 63.855  47.711  9.878   1.00 37.91 ? 316 GLY F CA  1 
ATOM 6875  C C   . GLY F 2 170 ? 64.896  47.690  8.778   1.00 39.71 ? 316 GLY F C   1 
ATOM 6876  O O   . GLY F 2 170 ? 65.734  46.785  8.716   1.00 39.04 ? 316 GLY F O   1 
ATOM 6877  N N   . VAL F 2 171 ? 64.842  48.689  7.904   1.00 41.23 ? 317 VAL F N   1 
ATOM 6878  C CA  . VAL F 2 171 ? 65.790  48.800  6.796   1.00 42.24 ? 317 VAL F CA  1 
ATOM 6879  C C   . VAL F 2 171 ? 67.230  48.833  7.316   1.00 41.84 ? 317 VAL F C   1 
ATOM 6880  O O   . VAL F 2 171 ? 68.149  48.360  6.652   1.00 41.72 ? 317 VAL F O   1 
ATOM 6881  C CB  . VAL F 2 171 ? 65.512  50.085  5.957   1.00 42.10 ? 317 VAL F CB  1 
ATOM 6882  C CG1 . VAL F 2 171 ? 66.451  50.161  4.782   1.00 44.22 ? 317 VAL F CG1 1 
ATOM 6883  C CG2 . VAL F 2 171 ? 64.098  50.072  5.438   1.00 42.79 ? 317 VAL F CG2 1 
ATOM 6884  N N   . ASN F 2 172 ? 67.417  49.383  8.511   1.00 42.65 ? 318 ASN F N   1 
ATOM 6885  C CA  . ASN F 2 172 ? 68.746  49.482  9.107   1.00 44.00 ? 318 ASN F CA  1 
ATOM 6886  C C   . ASN F 2 172 ? 69.085  48.310  10.031  1.00 44.59 ? 318 ASN F C   1 
ATOM 6887  O O   . ASN F 2 172 ? 70.241  48.101  10.372  1.00 45.14 ? 318 ASN F O   1 
ATOM 6888  C CB  . ASN F 2 172 ? 68.890  50.823  9.850   1.00 43.45 ? 318 ASN F CB  1 
ATOM 6889  C CG  . ASN F 2 172 ? 69.151  52.001  8.896   1.00 45.19 ? 318 ASN F CG  1 
ATOM 6890  O OD1 . ASN F 2 172 ? 68.876  53.155  9.222   1.00 45.29 ? 318 ASN F OD1 1 
ATOM 6891  N ND2 . ASN F 2 172 ? 69.690  51.705  7.717   1.00 45.38 ? 318 ASN F ND2 1 
ATOM 6892  N N   . THR F 2 173 ? 68.080  47.542  10.433  1.00 45.09 ? 319 THR F N   1 
ATOM 6893  C CA  . THR F 2 173 ? 68.317  46.386  11.288  1.00 44.68 ? 319 THR F CA  1 
ATOM 6894  C C   . THR F 2 173 ? 67.558  45.194  10.713  1.00 44.82 ? 319 THR F C   1 
ATOM 6895  O O   . THR F 2 173 ? 66.529  44.770  11.237  1.00 44.80 ? 319 THR F O   1 
ATOM 6896  C CB  . THR F 2 173 ? 67.859  46.646  12.721  1.00 45.12 ? 319 THR F CB  1 
ATOM 6897  O OG1 . THR F 2 173 ? 68.391  47.902  13.164  1.00 45.96 ? 319 THR F OG1 1 
ATOM 6898  C CG2 . THR F 2 173 ? 68.358  45.536  13.644  1.00 44.44 ? 319 THR F CG2 1 
ATOM 6899  N N   . THR F 2 174 ? 68.095  44.684  9.611   1.00 44.36 ? 320 THR F N   1 
ATOM 6900  C CA  . THR F 2 174 ? 67.564  43.556  8.855   1.00 43.10 ? 320 THR F CA  1 
ATOM 6901  C C   . THR F 2 174 ? 67.174  42.324  9.673   1.00 42.44 ? 320 THR F C   1 
ATOM 6902  O O   . THR F 2 174 ? 67.770  42.050  10.709  1.00 41.28 ? 320 THR F O   1 
ATOM 6903  C CB  . THR F 2 174 ? 68.620  43.130  7.804   1.00 41.96 ? 320 THR F CB  1 
ATOM 6904  O OG1 . THR F 2 174 ? 68.807  44.206  6.885   1.00 41.27 ? 320 THR F OG1 1 
ATOM 6905  C CG2 . THR F 2 174 ? 68.188  41.890  7.040   1.00 43.03 ? 320 THR F CG2 1 
ATOM 6906  N N   . ASP F 2 175 ? 66.172  41.584  9.187   1.00 42.39 ? 321 ASP F N   1 
ATOM 6907  C CA  . ASP F 2 175 ? 65.727  40.340  9.820   1.00 42.72 ? 321 ASP F CA  1 
ATOM 6908  C C   . ASP F 2 175 ? 66.914  39.375  9.892   1.00 43.21 ? 321 ASP F C   1 
ATOM 6909  O O   . ASP F 2 175 ? 66.976  38.496  10.770  1.00 42.85 ? 321 ASP F O   1 
ATOM 6910  C CB  . ASP F 2 175 ? 64.657  39.637  8.973   1.00 41.70 ? 321 ASP F CB  1 
ATOM 6911  C CG  . ASP F 2 175 ? 63.364  40.400  8.893   1.00 41.51 ? 321 ASP F CG  1 
ATOM 6912  O OD1 . ASP F 2 175 ? 62.957  40.993  9.918   1.00 42.07 ? 321 ASP F OD1 1 
ATOM 6913  O OD2 . ASP F 2 175 ? 62.742  40.387  7.804   1.00 42.88 ? 321 ASP F OD2 1 
ATOM 6914  N N   . LYS F 2 176 ? 67.826  39.529  8.932   1.00 42.94 ? 322 LYS F N   1 
ATOM 6915  C CA  . LYS F 2 176 ? 69.016  38.694  8.832   1.00 43.44 ? 322 LYS F CA  1 
ATOM 6916  C C   . LYS F 2 176 ? 69.714  38.491  10.172  1.00 43.73 ? 322 LYS F C   1 
ATOM 6917  O O   . LYS F 2 176 ? 70.211  37.402  10.448  1.00 43.75 ? 322 LYS F O   1 
ATOM 6918  C CB  . LYS F 2 176 ? 70.000  39.289  7.820   1.00 43.03 ? 322 LYS F CB  1 
ATOM 6919  N N   . GLU F 2 177 ? 69.750  39.520  11.014  1.00 44.01 ? 323 GLU F N   1 
ATOM 6920  C CA  . GLU F 2 177 ? 70.404  39.347  12.297  1.00 45.53 ? 323 GLU F CA  1 
ATOM 6921  C C   . GLU F 2 177 ? 69.598  39.841  13.501  1.00 45.84 ? 323 GLU F C   1 
ATOM 6922  O O   . GLU F 2 177 ? 70.129  39.958  14.610  1.00 46.46 ? 323 GLU F O   1 
ATOM 6923  C CB  . GLU F 2 177 ? 71.800  39.994  12.261  1.00 47.16 ? 323 GLU F CB  1 
ATOM 6924  C CG  . GLU F 2 177 ? 71.940  41.350  12.951  1.00 49.15 ? 323 GLU F CG  1 
ATOM 6925  C CD  . GLU F 2 177 ? 71.174  42.448  12.251  1.00 49.67 ? 323 GLU F CD  1 
ATOM 6926  O OE1 . GLU F 2 177 ? 71.737  43.099  11.338  1.00 48.96 ? 323 GLU F OE1 1 
ATOM 6927  O OE2 . GLU F 2 177 ? 69.997  42.650  12.616  1.00 51.24 ? 323 GLU F OE2 1 
ATOM 6928  N N   . ILE F 2 178 ? 68.308  40.089  13.293  1.00 45.51 ? 324 ILE F N   1 
ATOM 6929  C CA  . ILE F 2 178 ? 67.427  40.571  14.361  1.00 44.21 ? 324 ILE F CA  1 
ATOM 6930  C C   . ILE F 2 178 ? 66.974  39.460  15.307  1.00 43.59 ? 324 ILE F C   1 
ATOM 6931  O O   . ILE F 2 178 ? 66.571  39.728  16.440  1.00 41.39 ? 324 ILE F O   1 
ATOM 6932  C CB  . ILE F 2 178 ? 66.156  41.233  13.771  1.00 44.87 ? 324 ILE F CB  1 
ATOM 6933  C CG1 . ILE F 2 178 ? 65.365  41.938  14.872  1.00 44.15 ? 324 ILE F CG1 1 
ATOM 6934  C CG2 . ILE F 2 178 ? 65.280  40.173  13.093  1.00 44.32 ? 324 ILE F CG2 1 
ATOM 6935  C CD1 . ILE F 2 178 ? 66.086  43.106  15.488  1.00 43.91 ? 324 ILE F CD1 1 
ATOM 6936  N N   . GLU F 2 179 ? 67.032  38.215  14.838  1.00 44.11 ? 325 GLU F N   1 
ATOM 6937  C CA  . GLU F 2 179 ? 66.594  37.082  15.653  1.00 44.74 ? 325 GLU F CA  1 
ATOM 6938  C C   . GLU F 2 179 ? 67.514  36.713  16.811  1.00 44.59 ? 325 GLU F C   1 
ATOM 6939  O O   . GLU F 2 179 ? 67.114  35.992  17.721  1.00 44.70 ? 325 GLU F O   1 
ATOM 6940  C CB  . GLU F 2 179 ? 66.357  35.849  14.785  1.00 45.68 ? 325 GLU F CB  1 
ATOM 6941  C CG  . GLU F 2 179 ? 65.119  35.934  13.906  1.00 47.89 ? 325 GLU F CG  1 
ATOM 6942  C CD  . GLU F 2 179 ? 64.759  34.592  13.298  1.00 49.70 ? 325 GLU F CD  1 
ATOM 6943  O OE1 . GLU F 2 179 ? 65.635  33.976  12.652  1.00 50.86 ? 325 GLU F OE1 1 
ATOM 6944  O OE2 . GLU F 2 179 ? 63.601  34.151  13.467  1.00 50.55 ? 325 GLU F OE2 1 
ATOM 6945  N N   . VAL F 2 180 ? 68.742  37.209  16.791  1.00 44.27 ? 326 VAL F N   1 
ATOM 6946  C CA  . VAL F 2 180 ? 69.671  36.916  17.871  1.00 43.56 ? 326 VAL F CA  1 
ATOM 6947  C C   . VAL F 2 180 ? 70.099  38.234  18.541  1.00 43.62 ? 326 VAL F C   1 
ATOM 6948  O O   . VAL F 2 180 ? 70.407  39.217  17.863  1.00 43.71 ? 326 VAL F O   1 
ATOM 6949  C CB  . VAL F 2 180 ? 70.878  36.130  17.312  1.00 43.22 ? 326 VAL F CB  1 
ATOM 6950  C CG1 . VAL F 2 180 ? 71.588  36.946  16.249  1.00 44.46 ? 326 VAL F CG1 1 
ATOM 6951  C CG2 . VAL F 2 180 ? 71.814  35.756  18.421  1.00 44.23 ? 326 VAL F CG2 1 
ATOM 6952  N N   . LEU F 2 181 ? 70.083  38.262  19.870  1.00 43.75 ? 327 LEU F N   1 
ATOM 6953  C CA  . LEU F 2 181 ? 70.459  39.463  20.616  1.00 45.13 ? 327 LEU F CA  1 
ATOM 6954  C C   . LEU F 2 181 ? 71.695  39.220  21.482  1.00 46.66 ? 327 LEU F C   1 
ATOM 6955  O O   . LEU F 2 181 ? 71.697  38.320  22.324  1.00 45.79 ? 327 LEU F O   1 
ATOM 6956  C CB  . LEU F 2 181 ? 69.302  39.906  21.515  1.00 44.15 ? 327 LEU F CB  1 
ATOM 6957  C CG  . LEU F 2 181 ? 69.604  41.080  22.454  1.00 43.70 ? 327 LEU F CG  1 
ATOM 6958  C CD1 . LEU F 2 181 ? 69.845  42.326  21.624  1.00 43.29 ? 327 LEU F CD1 1 
ATOM 6959  C CD2 . LEU F 2 181 ? 68.448  41.298  23.423  1.00 42.76 ? 327 LEU F CD2 1 
ATOM 6960  N N   . TYR F 2 182 ? 72.743  40.016  21.283  1.00 49.60 ? 328 TYR F N   1 
ATOM 6961  C CA  . TYR F 2 182 ? 73.958  39.845  22.082  1.00 52.28 ? 328 TYR F CA  1 
ATOM 6962  C C   . TYR F 2 182 ? 74.155  40.967  23.079  1.00 53.21 ? 328 TYR F C   1 
ATOM 6963  O O   . TYR F 2 182 ? 73.713  42.103  22.876  1.00 52.82 ? 328 TYR F O   1 
ATOM 6964  C CB  . TYR F 2 182 ? 75.201  39.763  21.205  1.00 54.50 ? 328 TYR F CB  1 
ATOM 6965  C CG  . TYR F 2 182 ? 75.031  38.889  20.002  1.00 57.62 ? 328 TYR F CG  1 
ATOM 6966  C CD1 . TYR F 2 182 ? 74.231  39.303  18.931  1.00 58.77 ? 328 TYR F CD1 1 
ATOM 6967  C CD2 . TYR F 2 182 ? 75.666  37.651  19.922  1.00 58.91 ? 328 TYR F CD2 1 
ATOM 6968  C CE1 . TYR F 2 182 ? 74.070  38.511  17.813  1.00 60.53 ? 328 TYR F CE1 1 
ATOM 6969  C CE2 . TYR F 2 182 ? 75.511  36.842  18.802  1.00 60.61 ? 328 TYR F CE2 1 
ATOM 6970  C CZ  . TYR F 2 182 ? 74.712  37.281  17.752  1.00 60.77 ? 328 TYR F CZ  1 
ATOM 6971  O OH  . TYR F 2 182 ? 74.541  36.489  16.640  1.00 62.67 ? 328 TYR F OH  1 
ATOM 6972  N N   . ILE F 2 183 ? 74.806  40.627  24.180  1.00 54.61 ? 329 ILE F N   1 
ATOM 6973  C CA  . ILE F 2 183 ? 75.106  41.603  25.211  1.00 56.53 ? 329 ILE F CA  1 
ATOM 6974  C C   . ILE F 2 183 ? 76.507  41.281  25.715  1.00 57.67 ? 329 ILE F C   1 
ATOM 6975  O O   . ILE F 2 183 ? 76.711  40.303  26.451  1.00 57.71 ? 329 ILE F O   1 
ATOM 6976  C CB  . ILE F 2 183 ? 74.109  41.560  26.398  1.00 56.93 ? 329 ILE F CB  1 
ATOM 6977  C CG1 . ILE F 2 183 ? 72.666  41.508  25.888  1.00 57.48 ? 329 ILE F CG1 1 
ATOM 6978  C CG2 . ILE F 2 183 ? 74.273  42.808  27.241  1.00 55.66 ? 329 ILE F CG2 1 
ATOM 6979  C CD1 . ILE F 2 183 ? 72.233  40.144  25.393  1.00 58.85 ? 329 ILE F CD1 1 
ATOM 6980  N N   . ARG F 2 184 ? 77.464  42.104  25.282  1.00 58.57 ? 330 ARG F N   1 
ATOM 6981  C CA  . ARG F 2 184 ? 78.870  41.959  25.654  1.00 59.43 ? 330 ARG F CA  1 
ATOM 6982  C C   . ARG F 2 184 ? 79.177  42.656  26.985  1.00 60.04 ? 330 ARG F C   1 
ATOM 6983  O O   . ARG F 2 184 ? 78.541  43.660  27.336  1.00 59.41 ? 330 ARG F O   1 
ATOM 6984  C CB  . ARG F 2 184 ? 79.757  42.542  24.551  1.00 58.76 ? 330 ARG F CB  1 
ATOM 6985  N N   . ASN F 2 185 ? 80.157  42.113  27.713  1.00 60.66 ? 331 ASN F N   1 
ATOM 6986  C CA  . ASN F 2 185 ? 80.565  42.657  29.010  1.00 61.10 ? 331 ASN F CA  1 
ATOM 6987  C C   . ASN F 2 185 ? 79.324  43.086  29.784  1.00 60.97 ? 331 ASN F C   1 
ATOM 6988  O O   . ASN F 2 185 ? 79.134  44.265  30.086  1.00 61.32 ? 331 ASN F O   1 
ATOM 6989  C CB  . ASN F 2 185 ? 81.511  43.851  28.818  1.00 61.56 ? 331 ASN F CB  1 
ATOM 6990  N N   . VAL F 2 186 ? 78.473  42.115  30.089  1.00 60.70 ? 332 VAL F N   1 
ATOM 6991  C CA  . VAL F 2 186 ? 77.248  42.403  30.809  1.00 61.44 ? 332 VAL F CA  1 
ATOM 6992  C C   . VAL F 2 186 ? 77.577  42.933  32.192  1.00 61.77 ? 332 VAL F C   1 
ATOM 6993  O O   . VAL F 2 186 ? 78.625  42.610  32.756  1.00 62.32 ? 332 VAL F O   1 
ATOM 6994  C CB  . VAL F 2 186 ? 76.357  41.144  30.926  1.00 61.77 ? 332 VAL F CB  1 
ATOM 6995  C CG1 . VAL F 2 186 ? 76.230  40.488  29.557  1.00 61.54 ? 332 VAL F CG1 1 
ATOM 6996  C CG2 . VAL F 2 186 ? 76.935  40.168  31.945  1.00 61.89 ? 332 VAL F CG2 1 
ATOM 6997  N N   . THR F 2 187 ? 76.680  43.749  32.732  1.00 61.60 ? 333 THR F N   1 
ATOM 6998  C CA  . THR F 2 187 ? 76.874  44.333  34.046  1.00 62.10 ? 333 THR F CA  1 
ATOM 6999  C C   . THR F 2 187 ? 75.646  44.026  34.896  1.00 62.78 ? 333 THR F C   1 
ATOM 7000  O O   . THR F 2 187 ? 74.659  43.505  34.377  1.00 63.46 ? 333 THR F O   1 
ATOM 7001  C CB  . THR F 2 187 ? 77.062  45.835  33.909  1.00 62.55 ? 333 THR F CB  1 
ATOM 7002  O OG1 . THR F 2 187 ? 75.836  46.423  33.459  1.00 62.76 ? 333 THR F OG1 1 
ATOM 7003  C CG2 . THR F 2 187 ? 78.161  46.132  32.888  1.00 61.42 ? 333 THR F CG2 1 
ATOM 7004  N N   . PHE F 2 188 ? 75.702  44.326  36.192  1.00 63.11 ? 334 PHE F N   1 
ATOM 7005  C CA  . PHE F 2 188 ? 74.564  44.065  37.074  1.00 64.16 ? 334 PHE F CA  1 
ATOM 7006  C C   . PHE F 2 188 ? 73.349  44.847  36.578  1.00 63.70 ? 334 PHE F C   1 
ATOM 7007  O O   . PHE F 2 188 ? 72.203  44.543  36.927  1.00 63.51 ? 334 PHE F O   1 
ATOM 7008  C CB  . PHE F 2 188 ? 74.887  44.483  38.519  1.00 67.04 ? 334 PHE F CB  1 
ATOM 7009  C CG  . PHE F 2 188 ? 75.091  43.321  39.471  1.00 69.00 ? 334 PHE F CG  1 
ATOM 7010  C CD1 . PHE F 2 188 ? 76.143  42.416  39.283  1.00 69.53 ? 334 PHE F CD1 1 
ATOM 7011  C CD2 . PHE F 2 188 ? 74.237  43.146  40.567  1.00 68.70 ? 334 PHE F CD2 1 
ATOM 7012  C CE1 . PHE F 2 188 ? 76.343  41.353  40.171  1.00 70.27 ? 334 PHE F CE1 1 
ATOM 7013  C CE2 . PHE F 2 188 ? 74.426  42.085  41.464  1.00 69.48 ? 334 PHE F CE2 1 
ATOM 7014  C CZ  . PHE F 2 188 ? 75.481  41.187  41.267  1.00 70.11 ? 334 PHE F CZ  1 
ATOM 7015  N N   . GLU F 2 189 ? 73.611  45.870  35.769  1.00 63.01 ? 335 GLU F N   1 
ATOM 7016  C CA  . GLU F 2 189 ? 72.542  46.693  35.220  1.00 62.20 ? 335 GLU F CA  1 
ATOM 7017  C C   . GLU F 2 189 ? 71.770  45.873  34.177  1.00 61.15 ? 335 GLU F C   1 
ATOM 7018  O O   . GLU F 2 189 ? 70.537  45.906  34.126  1.00 61.37 ? 335 GLU F O   1 
ATOM 7019  C CB  . GLU F 2 189 ? 73.130  47.962  34.579  1.00 61.61 ? 335 GLU F CB  1 
ATOM 7020  N N   . ASP F 2 190 ? 72.514  45.121  33.369  1.00 59.58 ? 336 ASP F N   1 
ATOM 7021  C CA  . ASP F 2 190 ? 71.947  44.295  32.310  1.00 57.79 ? 336 ASP F CA  1 
ATOM 7022  C C   . ASP F 2 190 ? 70.988  43.200  32.780  1.00 56.36 ? 336 ASP F C   1 
ATOM 7023  O O   . ASP F 2 190 ? 70.123  42.770  32.016  1.00 56.48 ? 336 ASP F O   1 
ATOM 7024  C CB  . ASP F 2 190 ? 73.077  43.677  31.470  1.00 58.94 ? 336 ASP F CB  1 
ATOM 7025  C CG  . ASP F 2 190 ? 73.933  44.738  30.761  1.00 60.32 ? 336 ASP F CG  1 
ATOM 7026  O OD1 . ASP F 2 190 ? 73.424  45.863  30.541  1.00 59.71 ? 336 ASP F OD1 1 
ATOM 7027  O OD2 . ASP F 2 190 ? 75.104  44.445  30.411  1.00 60.38 ? 336 ASP F OD2 1 
ATOM 7028  N N   . ALA F 2 191 ? 71.124  42.754  34.026  1.00 54.50 ? 337 ALA F N   1 
ATOM 7029  C CA  . ALA F 2 191 ? 70.244  41.709  34.551  1.00 52.24 ? 337 ALA F CA  1 
ATOM 7030  C C   . ALA F 2 191 ? 68.784  42.109  34.359  1.00 50.79 ? 337 ALA F C   1 
ATOM 7031  O O   . ALA F 2 191 ? 68.473  43.282  34.166  1.00 49.51 ? 337 ALA F O   1 
ATOM 7032  C CB  . ALA F 2 191 ? 70.530  41.462  36.029  1.00 52.03 ? 337 ALA F CB  1 
ATOM 7033  N N   . GLY F 2 192 ? 67.889  41.128  34.402  1.00 50.19 ? 338 GLY F N   1 
ATOM 7034  C CA  . GLY F 2 192 ? 66.482  41.423  34.217  1.00 49.61 ? 338 GLY F CA  1 
ATOM 7035  C C   . GLY F 2 192 ? 65.794  40.570  33.158  1.00 48.59 ? 338 GLY F C   1 
ATOM 7036  O O   . GLY F 2 192 ? 66.380  39.612  32.632  1.00 47.89 ? 338 GLY F O   1 
ATOM 7037  N N   . GLU F 2 193 ? 64.552  40.946  32.838  1.00 47.41 ? 339 GLU F N   1 
ATOM 7038  C CA  . GLU F 2 193 ? 63.722  40.223  31.873  1.00 46.25 ? 339 GLU F CA  1 
ATOM 7039  C C   . GLU F 2 193 ? 63.755  40.757  30.445  1.00 44.89 ? 339 GLU F C   1 
ATOM 7040  O O   . GLU F 2 193 ? 63.311  41.875  30.183  1.00 44.60 ? 339 GLU F O   1 
ATOM 7041  C CB  . GLU F 2 193 ? 62.270  40.219  32.352  1.00 45.91 ? 339 GLU F CB  1 
ATOM 7042  C CG  . GLU F 2 193 ? 61.412  39.165  31.697  1.00 46.12 ? 339 GLU F CG  1 
ATOM 7043  C CD  . GLU F 2 193 ? 59.952  39.384  31.978  1.00 47.16 ? 339 GLU F CD  1 
ATOM 7044  O OE1 . GLU F 2 193 ? 59.155  38.430  31.836  1.00 46.69 ? 339 GLU F OE1 1 
ATOM 7045  O OE2 . GLU F 2 193 ? 59.600  40.527  32.334  1.00 48.31 ? 339 GLU F OE2 1 
ATOM 7046  N N   . TYR F 2 194 ? 64.264  39.931  29.535  1.00 43.88 ? 340 TYR F N   1 
ATOM 7047  C CA  . TYR F 2 194 ? 64.361  40.261  28.119  1.00 43.27 ? 340 TYR F CA  1 
ATOM 7048  C C   . TYR F 2 194 ? 63.189  39.635  27.352  1.00 41.75 ? 340 TYR F C   1 
ATOM 7049  O O   . TYR F 2 194 ? 62.806  38.496  27.617  1.00 41.55 ? 340 TYR F O   1 
ATOM 7050  C CB  . TYR F 2 194 ? 65.673  39.721  27.557  1.00 46.75 ? 340 TYR F CB  1 
ATOM 7051  C CG  . TYR F 2 194 ? 66.904  40.461  28.038  1.00 50.51 ? 340 TYR F CG  1 
ATOM 7052  C CD1 . TYR F 2 194 ? 67.245  40.489  29.391  1.00 51.90 ? 340 TYR F CD1 1 
ATOM 7053  C CD2 . TYR F 2 194 ? 67.720  41.152  27.136  1.00 51.96 ? 340 TYR F CD2 1 
ATOM 7054  C CE1 . TYR F 2 194 ? 68.364  41.193  29.835  1.00 53.33 ? 340 TYR F CE1 1 
ATOM 7055  C CE2 . TYR F 2 194 ? 68.836  41.855  27.566  1.00 52.84 ? 340 TYR F CE2 1 
ATOM 7056  C CZ  . TYR F 2 194 ? 69.155  41.876  28.914  1.00 54.05 ? 340 TYR F CZ  1 
ATOM 7057  O OH  . TYR F 2 194 ? 70.256  42.597  29.344  1.00 55.27 ? 340 TYR F OH  1 
ATOM 7058  N N   . THR F 2 195 ? 62.625  40.371  26.400  1.00 38.88 ? 341 THR F N   1 
ATOM 7059  C CA  . THR F 2 195 ? 61.506  39.863  25.620  1.00 35.85 ? 341 THR F CA  1 
ATOM 7060  C C   . THR F 2 195 ? 61.665  39.996  24.120  1.00 35.10 ? 341 THR F C   1 
ATOM 7061  O O   . THR F 2 195 ? 62.130  41.024  23.625  1.00 35.40 ? 341 THR F O   1 
ATOM 7062  C CB  . THR F 2 195 ? 60.215  40.581  25.993  1.00 34.18 ? 341 THR F CB  1 
ATOM 7063  O OG1 . THR F 2 195 ? 59.854  40.217  27.322  1.00 34.42 ? 341 THR F OG1 1 
ATOM 7064  C CG2 . THR F 2 195 ? 59.088  40.202  25.054  1.00 32.62 ? 341 THR F CG2 1 
ATOM 7065  N N   . CYS F 2 196 ? 61.287  38.946  23.397  1.00 33.80 ? 342 CYS F N   1 
ATOM 7066  C CA  . CYS F 2 196 ? 61.311  38.999  21.946  1.00 31.89 ? 342 CYS F CA  1 
ATOM 7067  C C   . CYS F 2 196 ? 59.867  39.176  21.528  1.00 30.73 ? 342 CYS F C   1 
ATOM 7068  O O   . CYS F 2 196 ? 59.034  38.301  21.769  1.00 29.19 ? 342 CYS F O   1 
ATOM 7069  C CB  . CYS F 2 196 ? 61.805  37.713  21.325  1.00 32.92 ? 342 CYS F CB  1 
ATOM 7070  S SG  . CYS F 2 196 ? 61.478  37.715  19.537  1.00 33.42 ? 342 CYS F SG  1 
ATOM 7071  N N   . LEU F 2 197 ? 59.567  40.308  20.901  1.00 30.63 ? 343 LEU F N   1 
ATOM 7072  C CA  . LEU F 2 197 ? 58.202  40.576  20.464  1.00 29.52 ? 343 LEU F CA  1 
ATOM 7073  C C   . LEU F 2 197 ? 58.093  40.610  18.948  1.00 28.42 ? 343 LEU F C   1 
ATOM 7074  O O   . LEU F 2 197 ? 58.833  41.318  18.273  1.00 28.61 ? 343 LEU F O   1 
ATOM 7075  C CB  . LEU F 2 197 ? 57.697  41.887  21.061  1.00 29.06 ? 343 LEU F CB  1 
ATOM 7076  C CG  . LEU F 2 197 ? 56.266  42.216  20.653  1.00 30.32 ? 343 LEU F CG  1 
ATOM 7077  C CD1 . LEU F 2 197 ? 55.528  42.910  21.784  1.00 29.73 ? 343 LEU F CD1 1 
ATOM 7078  C CD2 . LEU F 2 197 ? 56.305  43.076  19.404  1.00 31.29 ? 343 LEU F CD2 1 
ATOM 7079  N N   . ALA F 2 198 ? 57.161  39.821  18.428  1.00 27.72 ? 344 ALA F N   1 
ATOM 7080  C CA  . ALA F 2 198 ? 56.918  39.715  16.994  1.00 26.40 ? 344 ALA F CA  1 
ATOM 7081  C C   . ALA F 2 198 ? 55.487  40.085  16.689  1.00 25.94 ? 344 ALA F C   1 
ATOM 7082  O O   . ALA F 2 198 ? 54.567  39.615  17.351  1.00 26.46 ? 344 ALA F O   1 
ATOM 7083  C CB  . ALA F 2 198 ? 57.165  38.301  16.539  1.00 26.35 ? 344 ALA F CB  1 
ATOM 7084  N N   . GLY F 2 199 ? 55.285  40.915  15.676  1.00 25.79 ? 345 GLY F N   1 
ATOM 7085  C CA  . GLY F 2 199 ? 53.932  41.291  15.328  1.00 26.02 ? 345 GLY F CA  1 
ATOM 7086  C C   . GLY F 2 199 ? 53.720  41.492  13.842  1.00 27.18 ? 345 GLY F C   1 
ATOM 7087  O O   . GLY F 2 199 ? 54.656  41.850  13.119  1.00 26.05 ? 345 GLY F O   1 
ATOM 7088  N N   . ASN F 2 200 ? 52.500  41.212  13.380  1.00 27.80 ? 346 ASN F N   1 
ATOM 7089  C CA  . ASN F 2 200 ? 52.136  41.437  11.984  1.00 27.97 ? 346 ASN F CA  1 
ATOM 7090  C C   . ASN F 2 200 ? 50.762  42.085  11.943  1.00 28.55 ? 346 ASN F C   1 
ATOM 7091  O O   . ASN F 2 200 ? 50.206  42.433  12.985  1.00 29.72 ? 346 ASN F O   1 
ATOM 7092  C CB  . ASN F 2 200 ? 52.160  40.151  11.132  1.00 26.48 ? 346 ASN F CB  1 
ATOM 7093  C CG  . ASN F 2 200 ? 51.250  39.061  11.654  1.00 26.92 ? 346 ASN F CG  1 
ATOM 7094  O OD1 . ASN F 2 200 ? 50.112  39.315  12.045  1.00 26.73 ? 346 ASN F OD1 1 
ATOM 7095  N ND2 . ASN F 2 200 ? 51.745  37.827  11.640  1.00 25.68 ? 346 ASN F ND2 1 
ATOM 7096  N N   . SER F 2 201 ? 50.216  42.266  10.748  1.00 29.62 ? 347 SER F N   1 
ATOM 7097  C CA  . SER F 2 201 ? 48.901  42.892  10.628  1.00 30.86 ? 347 SER F CA  1 
ATOM 7098  C C   . SER F 2 201 ? 47.839  42.153  11.439  1.00 30.09 ? 347 SER F C   1 
ATOM 7099  O O   . SER F 2 201 ? 46.937  42.774  11.995  1.00 31.21 ? 347 SER F O   1 
ATOM 7100  C CB  . SER F 2 201 ? 48.469  42.956  9.165   1.00 31.69 ? 347 SER F CB  1 
ATOM 7101  O OG  . SER F 2 201 ? 48.357  41.657  8.613   1.00 33.85 ? 347 SER F OG  1 
ATOM 7102  N N   . ILE F 2 202 ? 47.948  40.833  11.521  1.00 29.04 ? 348 ILE F N   1 
ATOM 7103  C CA  . ILE F 2 202 ? 46.967  40.065  12.269  1.00 28.50 ? 348 ILE F CA  1 
ATOM 7104  C C   . ILE F 2 202 ? 47.088  40.211  13.788  1.00 28.94 ? 348 ILE F C   1 
ATOM 7105  O O   . ILE F 2 202 ? 46.084  40.398  14.471  1.00 30.09 ? 348 ILE F O   1 
ATOM 7106  C CB  . ILE F 2 202 ? 47.007  38.546  11.911  1.00 27.45 ? 348 ILE F CB  1 
ATOM 7107  C CG1 . ILE F 2 202 ? 46.643  38.312  10.438  1.00 26.26 ? 348 ILE F CG1 1 
ATOM 7108  C CG2 . ILE F 2 202 ? 45.993  37.803  12.750  1.00 26.16 ? 348 ILE F CG2 1 
ATOM 7109  C CD1 . ILE F 2 202 ? 47.823  38.261  9.475   1.00 26.11 ? 348 ILE F CD1 1 
ATOM 7110  N N   . GLY F 2 203 ? 48.298  40.128  14.327  1.00 28.79 ? 349 GLY F N   1 
ATOM 7111  C CA  . GLY F 2 203 ? 48.432  40.251  15.767  1.00 28.52 ? 349 GLY F CA  1 
ATOM 7112  C C   . GLY F 2 203 ? 49.858  40.259  16.270  1.00 28.72 ? 349 GLY F C   1 
ATOM 7113  O O   . GLY F 2 203 ? 50.798  40.219  15.476  1.00 29.12 ? 349 GLY F O   1 
ATOM 7114  N N   . ILE F 2 204 ? 50.004  40.279  17.594  1.00 27.92 ? 350 ILE F N   1 
ATOM 7115  C CA  . ILE F 2 204 ? 51.300  40.323  18.259  1.00 27.47 ? 350 ILE F CA  1 
ATOM 7116  C C   . ILE F 2 204 ? 51.547  39.115  19.142  1.00 27.75 ? 350 ILE F C   1 
ATOM 7117  O O   . ILE F 2 204 ? 50.620  38.553  19.717  1.00 29.28 ? 350 ILE F O   1 
ATOM 7118  C CB  . ILE F 2 204 ? 51.402  41.594  19.130  1.00 27.65 ? 350 ILE F CB  1 
ATOM 7119  C CG1 . ILE F 2 204 ? 51.208  42.829  18.240  1.00 27.07 ? 350 ILE F CG1 1 
ATOM 7120  C CG2 . ILE F 2 204 ? 52.750  41.631  19.869  1.00 27.88 ? 350 ILE F CG2 1 
ATOM 7121  C CD1 . ILE F 2 204 ? 51.023  44.103  18.997  1.00 25.93 ? 350 ILE F CD1 1 
ATOM 7122  N N   . SER F 2 205 ? 52.811  38.738  19.278  1.00 27.95 ? 351 SER F N   1 
ATOM 7123  C CA  . SER F 2 205 ? 53.185  37.590  20.085  1.00 27.75 ? 351 SER F CA  1 
ATOM 7124  C C   . SER F 2 205 ? 54.582  37.830  20.679  1.00 28.13 ? 351 SER F C   1 
ATOM 7125  O O   . SER F 2 205 ? 55.404  38.509  20.072  1.00 28.65 ? 351 SER F O   1 
ATOM 7126  C CB  . SER F 2 205 ? 53.156  36.356  19.182  1.00 27.10 ? 351 SER F CB  1 
ATOM 7127  O OG  . SER F 2 205 ? 53.175  35.172  19.937  1.00 29.33 ? 351 SER F OG  1 
ATOM 7128  N N   . PHE F 2 206 ? 54.860  37.285  21.860  1.00 29.66 ? 352 PHE F N   1 
ATOM 7129  C CA  . PHE F 2 206 ? 56.177  37.488  22.485  1.00 29.85 ? 352 PHE F CA  1 
ATOM 7130  C C   . PHE F 2 206 ? 56.553  36.444  23.534  1.00 30.07 ? 352 PHE F C   1 
ATOM 7131  O O   . PHE F 2 206 ? 55.690  35.872  24.209  1.00 29.15 ? 352 PHE F O   1 
ATOM 7132  C CB  . PHE F 2 206 ? 56.214  38.882  23.122  1.00 30.11 ? 352 PHE F CB  1 
ATOM 7133  C CG  . PHE F 2 206 ? 55.035  39.153  24.001  1.00 29.54 ? 352 PHE F CG  1 
ATOM 7134  C CD1 . PHE F 2 206 ? 55.025  38.730  25.323  1.00 30.73 ? 352 PHE F CD1 1 
ATOM 7135  C CD2 . PHE F 2 206 ? 53.893  39.746  23.478  1.00 29.41 ? 352 PHE F CD2 1 
ATOM 7136  C CE1 . PHE F 2 206 ? 53.898  38.882  26.115  1.00 31.16 ? 352 PHE F CE1 1 
ATOM 7137  C CE2 . PHE F 2 206 ? 52.754  39.908  24.259  1.00 30.21 ? 352 PHE F CE2 1 
ATOM 7138  C CZ  . PHE F 2 206 ? 52.755  39.474  25.581  1.00 30.90 ? 352 PHE F CZ  1 
ATOM 7139  N N   . HIS F 2 207 ? 57.852  36.210  23.668  1.00 31.50 ? 353 HIS F N   1 
ATOM 7140  C CA  . HIS F 2 207 ? 58.364  35.266  24.651  1.00 33.88 ? 353 HIS F CA  1 
ATOM 7141  C C   . HIS F 2 207 ? 59.439  35.979  25.476  1.00 35.48 ? 353 HIS F C   1 
ATOM 7142  O O   . HIS F 2 207 ? 60.300  36.664  24.926  1.00 36.59 ? 353 HIS F O   1 
ATOM 7143  C CB  . HIS F 2 207 ? 58.944  34.027  23.950  1.00 33.98 ? 353 HIS F CB  1 
ATOM 7144  C CG  . HIS F 2 207 ? 57.905  33.102  23.390  1.00 34.42 ? 353 HIS F CG  1 
ATOM 7145  N ND1 . HIS F 2 207 ? 58.223  31.995  22.631  1.00 35.00 ? 353 HIS F ND1 1 
ATOM 7146  C CD2 . HIS F 2 207 ? 56.555  33.111  23.491  1.00 33.92 ? 353 HIS F CD2 1 
ATOM 7147  C CE1 . HIS F 2 207 ? 57.114  31.362  22.292  1.00 34.49 ? 353 HIS F CE1 1 
ATOM 7148  N NE2 . HIS F 2 207 ? 56.088  32.018  22.802  1.00 32.83 ? 353 HIS F NE2 1 
ATOM 7149  N N   . SER F 2 208 ? 59.385  35.822  26.795  1.00 37.28 ? 354 SER F N   1 
ATOM 7150  C CA  . SER F 2 208 ? 60.349  36.463  27.691  1.00 37.95 ? 354 SER F CA  1 
ATOM 7151  C C   . SER F 2 208 ? 61.330  35.466  28.307  1.00 38.93 ? 354 SER F C   1 
ATOM 7152  O O   . SER F 2 208 ? 60.999  34.303  28.534  1.00 38.48 ? 354 SER F O   1 
ATOM 7153  C CB  . SER F 2 208 ? 59.616  37.194  28.820  1.00 37.59 ? 354 SER F CB  1 
ATOM 7154  O OG  . SER F 2 208 ? 58.569  38.021  28.328  1.00 38.08 ? 354 SER F OG  1 
ATOM 7155  N N   . ALA F 2 209 ? 62.539  35.947  28.577  1.00 41.25 ? 355 ALA F N   1 
ATOM 7156  C CA  . ALA F 2 209 ? 63.602  35.149  29.176  1.00 43.19 ? 355 ALA F CA  1 
ATOM 7157  C C   . ALA F 2 209 ? 64.204  36.014  30.263  1.00 45.34 ? 355 ALA F C   1 
ATOM 7158  O O   . ALA F 2 209 ? 64.005  37.233  30.277  1.00 45.71 ? 355 ALA F O   1 
ATOM 7159  C CB  . ALA F 2 209 ? 64.666  34.790  28.136  1.00 42.58 ? 355 ALA F CB  1 
ATOM 7160  N N   . TRP F 2 210 ? 64.946  35.395  31.170  1.00 47.83 ? 356 TRP F N   1 
ATOM 7161  C CA  . TRP F 2 210 ? 65.535  36.140  32.264  1.00 50.53 ? 356 TRP F CA  1 
ATOM 7162  C C   . TRP F 2 210 ? 67.051  36.030  32.336  1.00 52.25 ? 356 TRP F C   1 
ATOM 7163  O O   . TRP F 2 210 ? 67.603  34.929  32.374  1.00 51.85 ? 356 TRP F O   1 
ATOM 7164  C CB  . TRP F 2 210 ? 64.919  35.674  33.579  1.00 51.28 ? 356 TRP F CB  1 
ATOM 7165  C CG  . TRP F 2 210 ? 65.226  36.586  34.702  1.00 53.42 ? 356 TRP F CG  1 
ATOM 7166  C CD1 . TRP F 2 210 ? 66.436  36.755  35.328  1.00 53.27 ? 356 TRP F CD1 1 
ATOM 7167  C CD2 . TRP F 2 210 ? 64.330  37.522  35.297  1.00 54.26 ? 356 TRP F CD2 1 
ATOM 7168  N NE1 . TRP F 2 210 ? 66.341  37.744  36.276  1.00 53.99 ? 356 TRP F NE1 1 
ATOM 7169  C CE2 . TRP F 2 210 ? 65.060  38.234  36.280  1.00 55.11 ? 356 TRP F CE2 1 
ATOM 7170  C CE3 . TRP F 2 210 ? 62.979  37.833  35.098  1.00 54.38 ? 356 TRP F CE3 1 
ATOM 7171  C CZ2 . TRP F 2 210 ? 64.479  39.244  37.062  1.00 55.49 ? 356 TRP F CZ2 1 
ATOM 7172  C CZ3 . TRP F 2 210 ? 62.401  38.836  35.875  1.00 56.19 ? 356 TRP F CZ3 1 
ATOM 7173  C CH2 . TRP F 2 210 ? 63.153  39.530  36.845  1.00 56.10 ? 356 TRP F CH2 1 
ATOM 7174  N N   . LEU F 2 211 ? 67.722  37.182  32.352  1.00 54.15 ? 357 LEU F N   1 
ATOM 7175  C CA  . LEU F 2 211 ? 69.174  37.194  32.446  1.00 55.91 ? 357 LEU F CA  1 
ATOM 7176  C C   . LEU F 2 211 ? 69.591  37.439  33.889  1.00 57.06 ? 357 LEU F C   1 
ATOM 7177  O O   . LEU F 2 211 ? 69.186  38.433  34.504  1.00 57.72 ? 357 LEU F O   1 
ATOM 7178  C CB  . LEU F 2 211 ? 69.777  38.263  31.535  1.00 56.62 ? 357 LEU F CB  1 
ATOM 7179  C CG  . LEU F 2 211 ? 71.313  38.284  31.564  1.00 57.21 ? 357 LEU F CG  1 
ATOM 7180  C CD1 . LEU F 2 211 ? 71.865  36.866  31.438  1.00 57.37 ? 357 LEU F CD1 1 
ATOM 7181  C CD2 . LEU F 2 211 ? 71.829  39.154  30.428  1.00 57.05 ? 357 LEU F CD2 1 
ATOM 7182  N N   . THR F 2 212 ? 70.380  36.514  34.432  1.00 57.98 ? 358 THR F N   1 
ATOM 7183  C CA  . THR F 2 212 ? 70.850  36.631  35.810  1.00 59.65 ? 358 THR F CA  1 
ATOM 7184  C C   . THR F 2 212 ? 72.356  36.863  35.832  1.00 60.64 ? 358 THR F C   1 
ATOM 7185  O O   . THR F 2 212 ? 73.135  36.057  35.301  1.00 60.07 ? 358 THR F O   1 
ATOM 7186  C CB  . THR F 2 212 ? 70.529  35.367  36.642  1.00 60.26 ? 358 THR F CB  1 
ATOM 7187  O OG1 . THR F 2 212 ? 71.393  34.294  36.240  1.00 60.31 ? 358 THR F OG1 1 
ATOM 7188  C CG2 . THR F 2 212 ? 69.067  34.960  36.447  1.00 59.89 ? 358 THR F CG2 1 
ATOM 7189  N N   . VAL F 2 213 ? 72.754  37.981  36.436  1.00 61.81 ? 359 VAL F N   1 
ATOM 7190  C CA  . VAL F 2 213 ? 74.161  38.337  36.537  1.00 63.51 ? 359 VAL F CA  1 
ATOM 7191  C C   . VAL F 2 213 ? 74.673  38.068  37.953  1.00 64.37 ? 359 VAL F C   1 
ATOM 7192  O O   . VAL F 2 213 ? 74.106  38.550  38.941  1.00 64.55 ? 359 VAL F O   1 
ATOM 7193  C CB  . VAL F 2 213 ? 74.390  39.823  36.148  1.00 65.10 ? 359 VAL F CB  1 
ATOM 7194  C CG1 . VAL F 2 213 ? 75.839  40.250  36.479  1.00 65.48 ? 359 VAL F CG1 1 
ATOM 7195  C CG2 . VAL F 2 213 ? 74.110  40.007  34.650  1.00 64.92 ? 359 VAL F CG2 1 
ATOM 7196  N N   . LEU F 2 214 ? 75.751  37.289  38.026  1.00 64.97 ? 360 LEU F N   1 
ATOM 7197  C CA  . LEU F 2 214 ? 76.377  36.890  39.285  1.00 65.49 ? 360 LEU F CA  1 
ATOM 7198  C C   . LEU F 2 214 ? 77.678  37.640  39.551  1.00 66.23 ? 360 LEU F C   1 
ATOM 7199  O O   . LEU F 2 214 ? 78.350  38.092  38.618  1.00 66.06 ? 360 LEU F O   1 
ATOM 7200  C CB  . LEU F 2 214 ? 76.682  35.393  39.234  1.00 65.42 ? 360 LEU F CB  1 
ATOM 7201  C CG  . LEU F 2 214 ? 75.519  34.537  38.734  1.00 65.94 ? 360 LEU F CG  1 
ATOM 7202  C CD1 . LEU F 2 214 ? 75.995  33.118  38.465  1.00 65.85 ? 360 LEU F CD1 1 
ATOM 7203  C CD2 . LEU F 2 214 ? 74.387  34.578  39.758  1.00 65.09 ? 360 LEU F CD2 1 
ATOM 7204  N N   . PRO F 2 215 ? 78.039  37.746  40.828  1.00 66.83 ? 361 PRO F N   1 
ATOM 7205  C CA  . PRO F 2 215 ? 79.268  38.426  41.224  1.00 66.89 ? 361 PRO F CA  1 
ATOM 7206  C C   . PRO F 2 215 ? 80.487  37.577  40.855  1.00 66.71 ? 361 PRO F C   1 
ATOM 7207  O O   . PRO F 2 215 ? 81.505  38.182  40.447  1.00 66.99 ? 361 PRO F O   1 
ATOM 7208  C CB  . PRO F 2 215 ? 79.255  38.693  42.733  1.00 67.27 ? 361 PRO F CB  1 
ATOM 7209  N N   . ASN G 2 4   ? 56.549  35.807  63.075  1.00 47.91 ? 150 ASN G N   1 
ATOM 7210  C CA  . ASN G 2 4   ? 55.223  35.124  62.927  1.00 48.86 ? 150 ASN G CA  1 
ATOM 7211  C C   . ASN G 2 4   ? 55.268  33.991  61.883  1.00 48.11 ? 150 ASN G C   1 
ATOM 7212  O O   . ASN G 2 4   ? 54.901  34.187  60.716  1.00 48.65 ? 150 ASN G O   1 
ATOM 7213  C CB  . ASN G 2 4   ? 54.146  36.149  62.534  1.00 48.24 ? 150 ASN G CB  1 
ATOM 7214  N N   . LYS G 2 5   ? 55.713  32.812  62.318  1.00 46.31 ? 151 LYS G N   1 
ATOM 7215  C CA  . LYS G 2 5   ? 55.815  31.635  61.459  1.00 45.53 ? 151 LYS G CA  1 
ATOM 7216  C C   . LYS G 2 5   ? 54.447  31.002  61.200  1.00 44.84 ? 151 LYS G C   1 
ATOM 7217  O O   . LYS G 2 5   ? 53.724  30.677  62.148  1.00 45.91 ? 151 LYS G O   1 
ATOM 7218  C CB  . LYS G 2 5   ? 56.721  30.587  62.113  1.00 45.91 ? 151 LYS G CB  1 
ATOM 7219  N N   . ARG G 2 6   ? 54.094  30.816  59.929  1.00 42.45 ? 152 ARG G N   1 
ATOM 7220  C CA  . ARG G 2 6   ? 52.810  30.206  59.585  1.00 40.26 ? 152 ARG G CA  1 
ATOM 7221  C C   . ARG G 2 6   ? 52.858  29.318  58.342  1.00 38.74 ? 152 ARG G C   1 
ATOM 7222  O O   . ARG G 2 6   ? 53.747  29.442  57.492  1.00 37.78 ? 152 ARG G O   1 
ATOM 7223  C CB  . ARG G 2 6   ? 51.735  31.280  59.391  1.00 40.21 ? 152 ARG G CB  1 
ATOM 7224  C CG  . ARG G 2 6   ? 51.929  32.142  58.154  1.00 41.37 ? 152 ARG G CG  1 
ATOM 7225  C CD  . ARG G 2 6   ? 50.946  33.317  58.077  1.00 41.08 ? 152 ARG G CD  1 
ATOM 7226  N NE  . ARG G 2 6   ? 49.609  32.936  57.634  1.00 41.53 ? 152 ARG G NE  1 
ATOM 7227  C CZ  . ARG G 2 6   ? 48.683  33.812  57.255  1.00 41.81 ? 152 ARG G CZ  1 
ATOM 7228  N NH1 . ARG G 2 6   ? 48.958  35.105  57.269  1.00 42.16 ? 152 ARG G NH1 1 
ATOM 7229  N NH2 . ARG G 2 6   ? 47.485  33.406  56.858  1.00 42.10 ? 152 ARG G NH2 1 
ATOM 7230  N N   . ALA G 2 7   ? 51.883  28.421  58.254  1.00 37.39 ? 153 ALA G N   1 
ATOM 7231  C CA  . ALA G 2 7   ? 51.760  27.503  57.131  1.00 36.23 ? 153 ALA G CA  1 
ATOM 7232  C C   . ALA G 2 7   ? 51.438  28.271  55.845  1.00 35.77 ? 153 ALA G C   1 
ATOM 7233  O O   . ALA G 2 7   ? 50.964  29.413  55.886  1.00 36.42 ? 153 ALA G O   1 
ATOM 7234  C CB  . ALA G 2 7   ? 50.666  26.496  57.418  1.00 35.76 ? 153 ALA G CB  1 
ATOM 7235  N N   . PRO G 2 8   ? 51.671  27.641  54.684  1.00 34.69 ? 154 PRO G N   1 
ATOM 7236  C CA  . PRO G 2 8   ? 51.411  28.256  53.377  1.00 33.73 ? 154 PRO G CA  1 
ATOM 7237  C C   . PRO G 2 8   ? 49.944  28.611  53.172  1.00 32.79 ? 154 PRO G C   1 
ATOM 7238  O O   . PRO G 2 8   ? 49.047  27.889  53.619  1.00 32.25 ? 154 PRO G O   1 
ATOM 7239  C CB  . PRO G 2 8   ? 51.856  27.178  52.384  1.00 33.74 ? 154 PRO G CB  1 
ATOM 7240  C CG  . PRO G 2 8   ? 52.805  26.332  53.164  1.00 34.92 ? 154 PRO G CG  1 
ATOM 7241  C CD  . PRO G 2 8   ? 52.155  26.261  54.519  1.00 35.06 ? 154 PRO G CD  1 
ATOM 7242  N N   . TYR G 2 9   ? 49.706  29.723  52.491  1.00 31.64 ? 155 TYR G N   1 
ATOM 7243  C CA  . TYR G 2 9   ? 48.350  30.161  52.188  1.00 31.87 ? 155 TYR G CA  1 
ATOM 7244  C C   . TYR G 2 9   ? 48.328  30.928  50.855  1.00 31.50 ? 155 TYR G C   1 
ATOM 7245  O O   . TYR G 2 9   ? 49.337  31.515  50.437  1.00 30.58 ? 155 TYR G O   1 
ATOM 7246  C CB  . TYR G 2 9   ? 47.781  31.038  53.320  1.00 30.60 ? 155 TYR G CB  1 
ATOM 7247  C CG  . TYR G 2 9   ? 48.490  32.355  53.512  1.00 31.70 ? 155 TYR G CG  1 
ATOM 7248  C CD1 . TYR G 2 9   ? 49.796  32.393  54.013  1.00 32.93 ? 155 TYR G CD1 1 
ATOM 7249  C CD2 . TYR G 2 9   ? 47.885  33.565  53.143  1.00 31.56 ? 155 TYR G CD2 1 
ATOM 7250  C CE1 . TYR G 2 9   ? 50.491  33.598  54.142  1.00 32.18 ? 155 TYR G CE1 1 
ATOM 7251  C CE2 . TYR G 2 9   ? 48.573  34.785  53.266  1.00 30.98 ? 155 TYR G CE2 1 
ATOM 7252  C CZ  . TYR G 2 9   ? 49.879  34.789  53.766  1.00 32.54 ? 155 TYR G CZ  1 
ATOM 7253  O OH  . TYR G 2 9   ? 50.589  35.964  53.893  1.00 32.17 ? 155 TYR G OH  1 
ATOM 7254  N N   . TRP G 2 10  ? 47.182  30.903  50.181  1.00 30.89 ? 156 TRP G N   1 
ATOM 7255  C CA  . TRP G 2 10  ? 47.043  31.597  48.908  1.00 31.20 ? 156 TRP G CA  1 
ATOM 7256  C C   . TRP G 2 10  ? 46.850  33.074  49.209  1.00 32.21 ? 156 TRP G C   1 
ATOM 7257  O O   . TRP G 2 10  ? 45.984  33.436  49.997  1.00 33.33 ? 156 TRP G O   1 
ATOM 7258  C CB  . TRP G 2 10  ? 45.850  31.043  48.123  1.00 28.76 ? 156 TRP G CB  1 
ATOM 7259  C CG  . TRP G 2 10  ? 45.947  29.560  47.843  1.00 26.86 ? 156 TRP G CG  1 
ATOM 7260  C CD1 . TRP G 2 10  ? 44.992  28.613  48.095  1.00 26.23 ? 156 TRP G CD1 1 
ATOM 7261  C CD2 . TRP G 2 10  ? 47.072  28.854  47.298  1.00 25.16 ? 156 TRP G CD2 1 
ATOM 7262  N NE1 . TRP G 2 10  ? 45.454  27.362  47.748  1.00 24.79 ? 156 TRP G NE1 1 
ATOM 7263  C CE2 . TRP G 2 10  ? 46.726  27.481  47.256  1.00 24.40 ? 156 TRP G CE2 1 
ATOM 7264  C CE3 . TRP G 2 10  ? 48.339  29.247  46.847  1.00 24.68 ? 156 TRP G CE3 1 
ATOM 7265  C CZ2 . TRP G 2 10  ? 47.601  26.500  46.782  1.00 24.17 ? 156 TRP G CZ2 1 
ATOM 7266  C CZ3 . TRP G 2 10  ? 49.214  28.272  46.378  1.00 25.39 ? 156 TRP G CZ3 1 
ATOM 7267  C CH2 . TRP G 2 10  ? 48.838  26.909  46.349  1.00 25.26 ? 156 TRP G CH2 1 
ATOM 7268  N N   . THR G 2 11  ? 47.663  33.927  48.593  1.00 33.05 ? 157 THR G N   1 
ATOM 7269  C CA  . THR G 2 11  ? 47.566  35.361  48.832  1.00 33.84 ? 157 THR G CA  1 
ATOM 7270  C C   . THR G 2 11  ? 46.604  36.048  47.883  1.00 36.31 ? 157 THR G C   1 
ATOM 7271  O O   . THR G 2 11  ? 46.155  37.168  48.144  1.00 36.39 ? 157 THR G O   1 
ATOM 7272  C CB  . THR G 2 11  ? 48.922  36.071  48.671  1.00 32.34 ? 157 THR G CB  1 
ATOM 7273  O OG1 . THR G 2 11  ? 49.426  35.838  47.354  1.00 30.88 ? 157 THR G OG1 1 
ATOM 7274  C CG2 . THR G 2 11  ? 49.925  35.584  49.701  1.00 32.09 ? 157 THR G CG2 1 
ATOM 7275  N N   . ASN G 2 12  ? 46.282  35.383  46.782  1.00 38.64 ? 158 ASN G N   1 
ATOM 7276  C CA  . ASN G 2 12  ? 45.393  35.965  45.787  1.00 40.27 ? 158 ASN G CA  1 
ATOM 7277  C C   . ASN G 2 12  ? 44.505  34.898  45.162  1.00 40.14 ? 158 ASN G C   1 
ATOM 7278  O O   . ASN G 2 12  ? 44.727  34.497  44.021  1.00 39.84 ? 158 ASN G O   1 
ATOM 7279  C CB  . ASN G 2 12  ? 46.238  36.624  44.694  1.00 42.00 ? 158 ASN G CB  1 
ATOM 7280  C CG  . ASN G 2 12  ? 45.396  37.216  43.580  1.00 45.98 ? 158 ASN G CG  1 
ATOM 7281  O OD1 . ASN G 2 12  ? 45.813  37.233  42.416  1.00 50.20 ? 158 ASN G OD1 1 
ATOM 7282  N ND2 . ASN G 2 12  ? 44.206  37.716  43.926  1.00 46.10 ? 158 ASN G ND2 1 
ATOM 7283  N N   . THR G 2 13  ? 43.490  34.454  45.895  1.00 40.16 ? 159 THR G N   1 
ATOM 7284  C CA  . THR G 2 13  ? 42.612  33.417  45.373  1.00 40.14 ? 159 THR G CA  1 
ATOM 7285  C C   . THR G 2 13  ? 41.799  33.883  44.178  1.00 39.90 ? 159 THR G C   1 
ATOM 7286  O O   . THR G 2 13  ? 41.289  33.063  43.415  1.00 39.86 ? 159 THR G O   1 
ATOM 7287  C CB  . THR G 2 13  ? 41.643  32.881  46.440  1.00 40.34 ? 159 THR G CB  1 
ATOM 7288  O OG1 . THR G 2 13  ? 40.640  33.866  46.720  1.00 41.68 ? 159 THR G OG1 1 
ATOM 7289  C CG2 . THR G 2 13  ? 42.400  32.525  47.707  1.00 38.95 ? 159 THR G CG2 1 
ATOM 7290  N N   . GLU G 2 14  ? 41.677  35.196  44.013  1.00 40.12 ? 160 GLU G N   1 
ATOM 7291  C CA  . GLU G 2 14  ? 40.927  35.742  42.887  1.00 40.04 ? 160 GLU G CA  1 
ATOM 7292  C C   . GLU G 2 14  ? 41.566  35.258  41.585  1.00 40.27 ? 160 GLU G C   1 
ATOM 7293  O O   . GLU G 2 14  ? 40.881  34.750  40.701  1.00 41.08 ? 160 GLU G O   1 
ATOM 7294  C CB  . GLU G 2 14  ? 40.926  37.270  42.935  1.00 39.49 ? 160 GLU G CB  1 
ATOM 7295  N N   . LYS G 2 15  ? 42.885  35.391  41.486  1.00 39.85 ? 161 LYS G N   1 
ATOM 7296  C CA  . LYS G 2 15  ? 43.617  34.964  40.297  1.00 39.57 ? 161 LYS G CA  1 
ATOM 7297  C C   . LYS G 2 15  ? 43.614  33.436  40.089  1.00 39.41 ? 161 LYS G C   1 
ATOM 7298  O O   . LYS G 2 15  ? 44.155  32.943  39.099  1.00 39.09 ? 161 LYS G O   1 
ATOM 7299  C CB  . LYS G 2 15  ? 45.066  35.469  40.379  1.00 38.71 ? 161 LYS G CB  1 
ATOM 7300  N N   . MET G 2 16  ? 43.003  32.696  41.013  1.00 39.21 ? 162 MET G N   1 
ATOM 7301  C CA  . MET G 2 16  ? 42.954  31.228  40.939  1.00 38.72 ? 162 MET G CA  1 
ATOM 7302  C C   . MET G 2 16  ? 41.568  30.633  40.690  1.00 38.89 ? 162 MET G C   1 
ATOM 7303  O O   . MET G 2 16  ? 41.447  29.429  40.418  1.00 38.03 ? 162 MET G O   1 
ATOM 7304  C CB  . MET G 2 16  ? 43.502  30.615  42.233  1.00 37.63 ? 162 MET G CB  1 
ATOM 7305  C CG  . MET G 2 16  ? 44.949  30.962  42.544  1.00 37.47 ? 162 MET G CG  1 
ATOM 7306  S SD  . MET G 2 16  ? 45.390  30.550  44.248  1.00 35.49 ? 162 MET G SD  1 
ATOM 7307  C CE  . MET G 2 16  ? 46.085  28.909  44.042  1.00 36.42 ? 162 MET G CE  1 
ATOM 7308  N N   . GLU G 2 17  ? 40.531  31.467  40.791  1.00 39.08 ? 163 GLU G N   1 
ATOM 7309  C CA  . GLU G 2 17  ? 39.147  31.019  40.612  1.00 38.90 ? 163 GLU G CA  1 
ATOM 7310  C C   . GLU G 2 17  ? 38.886  30.253  39.302  1.00 38.61 ? 163 GLU G C   1 
ATOM 7311  O O   . GLU G 2 17  ? 38.165  29.256  39.292  1.00 39.77 ? 163 GLU G O   1 
ATOM 7312  C CB  . GLU G 2 17  ? 38.201  32.223  40.735  1.00 38.99 ? 163 GLU G CB  1 
ATOM 7313  N N   . LYS G 2 18  ? 39.480  30.719  38.209  1.00 38.37 ? 164 LYS G N   1 
ATOM 7314  C CA  . LYS G 2 18  ? 39.339  30.099  36.889  1.00 37.79 ? 164 LYS G CA  1 
ATOM 7315  C C   . LYS G 2 18  ? 40.168  28.808  36.827  1.00 38.29 ? 164 LYS G C   1 
ATOM 7316  O O   . LYS G 2 18  ? 41.356  28.846  36.507  1.00 37.99 ? 164 LYS G O   1 
ATOM 7317  C CB  . LYS G 2 18  ? 39.828  31.086  35.816  1.00 37.09 ? 164 LYS G CB  1 
ATOM 7318  C CG  . LYS G 2 18  ? 39.790  30.572  34.386  1.00 37.03 ? 164 LYS G CG  1 
ATOM 7319  C CD  . LYS G 2 18  ? 40.460  31.547  33.416  1.00 36.57 ? 164 LYS G CD  1 
ATOM 7320  C CE  . LYS G 2 18  ? 40.347  31.030  31.988  1.00 37.53 ? 164 LYS G CE  1 
ATOM 7321  N NZ  . LYS G 2 18  ? 40.880  31.960  30.954  1.00 36.68 ? 164 LYS G NZ  1 
ATOM 7322  N N   . ARG G 2 19  ? 39.533  27.673  37.122  1.00 38.57 ? 165 ARG G N   1 
ATOM 7323  C CA  . ARG G 2 19  ? 40.204  26.363  37.133  1.00 39.13 ? 165 ARG G CA  1 
ATOM 7324  C C   . ARG G 2 19  ? 40.525  25.775  35.758  1.00 38.02 ? 165 ARG G C   1 
ATOM 7325  O O   . ARG G 2 19  ? 41.614  25.231  35.541  1.00 37.10 ? 165 ARG G O   1 
ATOM 7326  C CB  . ARG G 2 19  ? 39.354  25.344  37.887  1.00 42.29 ? 165 ARG G CB  1 
ATOM 7327  C CG  . ARG G 2 19  ? 39.125  25.680  39.325  1.00 47.27 ? 165 ARG G CG  1 
ATOM 7328  C CD  . ARG G 2 19  ? 37.938  24.904  39.881  1.00 52.43 ? 165 ARG G CD  1 
ATOM 7329  N NE  . ARG G 2 19  ? 37.500  25.446  41.172  1.00 56.56 ? 165 ARG G NE  1 
ATOM 7330  C CZ  . ARG G 2 19  ? 38.279  25.535  42.249  1.00 57.86 ? 165 ARG G CZ  1 
ATOM 7331  N NH1 . ARG G 2 19  ? 39.545  25.115  42.202  1.00 57.79 ? 165 ARG G NH1 1 
ATOM 7332  N NH2 . ARG G 2 19  ? 37.799  26.058  43.367  1.00 58.54 ? 165 ARG G NH2 1 
ATOM 7333  N N   . LEU G 2 20  ? 39.559  25.845  34.846  1.00 36.70 ? 166 LEU G N   1 
ATOM 7334  C CA  . LEU G 2 20  ? 39.756  25.328  33.504  1.00 33.97 ? 166 LEU G CA  1 
ATOM 7335  C C   . LEU G 2 20  ? 40.231  26.434  32.578  1.00 34.71 ? 166 LEU G C   1 
ATOM 7336  O O   . LEU G 2 20  ? 39.575  27.469  32.425  1.00 35.19 ? 166 LEU G O   1 
ATOM 7337  C CB  . LEU G 2 20  ? 38.465  24.722  32.961  1.00 31.95 ? 166 LEU G CB  1 
ATOM 7338  C CG  . LEU G 2 20  ? 38.473  24.400  31.462  1.00 32.04 ? 166 LEU G CG  1 
ATOM 7339  C CD1 . LEU G 2 20  ? 39.757  23.678  31.085  1.00 30.91 ? 166 LEU G CD1 1 
ATOM 7340  C CD2 . LEU G 2 20  ? 37.250  23.567  31.107  1.00 30.60 ? 166 LEU G CD2 1 
ATOM 7341  N N   . HIS G 2 21  ? 41.390  26.212  31.975  1.00 34.96 ? 167 HIS G N   1 
ATOM 7342  C CA  . HIS G 2 21  ? 41.971  27.157  31.044  1.00 34.73 ? 167 HIS G CA  1 
ATOM 7343  C C   . HIS G 2 21  ? 41.932  26.559  29.650  1.00 34.07 ? 167 HIS G C   1 
ATOM 7344  O O   . HIS G 2 21  ? 42.704  25.646  29.346  1.00 34.46 ? 167 HIS G O   1 
ATOM 7345  C CB  . HIS G 2 21  ? 43.421  27.445  31.408  1.00 35.45 ? 167 HIS G CB  1 
ATOM 7346  C CG  . HIS G 2 21  ? 43.582  28.465  32.479  1.00 37.66 ? 167 HIS G CG  1 
ATOM 7347  N ND1 . HIS G 2 21  ? 42.980  28.348  33.714  1.00 39.39 ? 167 HIS G ND1 1 
ATOM 7348  C CD2 . HIS G 2 21  ? 44.286  29.621  32.511  1.00 38.76 ? 167 HIS G CD2 1 
ATOM 7349  C CE1 . HIS G 2 21  ? 43.307  29.390  34.462  1.00 39.10 ? 167 HIS G CE1 1 
ATOM 7350  N NE2 . HIS G 2 21  ? 44.100  30.176  33.754  1.00 39.88 ? 167 HIS G NE2 1 
ATOM 7351  N N   . ALA G 2 22  ? 41.026  27.051  28.816  1.00 31.94 ? 168 ALA G N   1 
ATOM 7352  C CA  . ALA G 2 22  ? 40.942  26.580  27.443  1.00 30.84 ? 168 ALA G CA  1 
ATOM 7353  C C   . ALA G 2 22  ? 41.437  27.722  26.566  1.00 30.68 ? 168 ALA G C   1 
ATOM 7354  O O   . ALA G 2 22  ? 40.875  28.822  26.583  1.00 31.67 ? 168 ALA G O   1 
ATOM 7355  C CB  . ALA G 2 22  ? 39.516  26.224  27.083  1.00 29.50 ? 168 ALA G CB  1 
ATOM 7356  N N   . VAL G 2 23  ? 42.506  27.485  25.818  1.00 29.46 ? 169 VAL G N   1 
ATOM 7357  C CA  . VAL G 2 23  ? 43.023  28.532  24.952  1.00 29.12 ? 169 VAL G CA  1 
ATOM 7358  C C   . VAL G 2 23  ? 43.294  28.043  23.541  1.00 29.21 ? 169 VAL G C   1 
ATOM 7359  O O   . VAL G 2 23  ? 43.501  26.849  23.306  1.00 28.90 ? 169 VAL G O   1 
ATOM 7360  C CB  . VAL G 2 23  ? 44.358  29.155  25.488  1.00 29.01 ? 169 VAL G CB  1 
ATOM 7361  C CG1 . VAL G 2 23  ? 44.109  29.901  26.764  1.00 28.37 ? 169 VAL G CG1 1 
ATOM 7362  C CG2 . VAL G 2 23  ? 45.413  28.081  25.682  1.00 27.63 ? 169 VAL G CG2 1 
ATOM 7363  N N   . PRO G 2 24  ? 43.281  28.969  22.576  1.00 28.93 ? 170 PRO G N   1 
ATOM 7364  C CA  . PRO G 2 24  ? 43.548  28.594  21.190  1.00 29.15 ? 170 PRO G CA  1 
ATOM 7365  C C   . PRO G 2 24  ? 45.016  28.193  21.105  1.00 29.51 ? 170 PRO G C   1 
ATOM 7366  O O   . PRO G 2 24  ? 45.865  28.794  21.767  1.00 29.66 ? 170 PRO G O   1 
ATOM 7367  C CB  . PRO G 2 24  ? 43.230  29.876  20.417  1.00 29.86 ? 170 PRO G CB  1 
ATOM 7368  C CG  . PRO G 2 24  ? 43.491  30.966  21.411  1.00 29.09 ? 170 PRO G CG  1 
ATOM 7369  C CD  . PRO G 2 24  ? 42.880  30.383  22.667  1.00 29.19 ? 170 PRO G CD  1 
ATOM 7370  N N   . ALA G 2 25  ? 45.306  27.168  20.308  1.00 29.25 ? 171 ALA G N   1 
ATOM 7371  C CA  . ALA G 2 25  ? 46.669  26.679  20.129  1.00 28.49 ? 171 ALA G CA  1 
ATOM 7372  C C   . ALA G 2 25  ? 47.648  27.808  19.832  1.00 28.28 ? 171 ALA G C   1 
ATOM 7373  O O   . ALA G 2 25  ? 47.259  28.855  19.328  1.00 29.89 ? 171 ALA G O   1 
ATOM 7374  C CB  . ALA G 2 25  ? 46.685  25.684  18.999  1.00 26.12 ? 171 ALA G CB  1 
ATOM 7375  N N   . ALA G 2 26  ? 48.917  27.596  20.156  1.00 28.65 ? 172 ALA G N   1 
ATOM 7376  C CA  . ALA G 2 26  ? 49.977  28.582  19.891  1.00 29.20 ? 172 ALA G CA  1 
ATOM 7377  C C   . ALA G 2 26  ? 50.045  29.734  20.869  1.00 28.65 ? 172 ALA G C   1 
ATOM 7378  O O   . ALA G 2 26  ? 50.869  30.627  20.724  1.00 29.40 ? 172 ALA G O   1 
ATOM 7379  C CB  . ALA G 2 26  ? 49.856  29.139  18.467  1.00 29.04 ? 172 ALA G CB  1 
ATOM 7380  N N   . ASN G 2 27  ? 49.180  29.723  21.866  1.00 28.60 ? 173 ASN G N   1 
ATOM 7381  C CA  . ASN G 2 27  ? 49.173  30.785  22.868  1.00 29.54 ? 173 ASN G CA  1 
ATOM 7382  C C   . ASN G 2 27  ? 50.062  30.432  24.047  1.00 28.60 ? 173 ASN G C   1 
ATOM 7383  O O   . ASN G 2 27  ? 50.415  29.274  24.254  1.00 29.09 ? 173 ASN G O   1 
ATOM 7384  C CB  . ASN G 2 27  ? 47.759  30.993  23.426  1.00 31.96 ? 173 ASN G CB  1 
ATOM 7385  C CG  . ASN G 2 27  ? 46.898  31.824  22.530  1.00 34.33 ? 173 ASN G CG  1 
ATOM 7386  O OD1 . ASN G 2 27  ? 46.930  31.676  21.309  1.00 37.48 ? 173 ASN G OD1 1 
ATOM 7387  N ND2 . ASN G 2 27  ? 46.102  32.701  23.126  1.00 35.51 ? 173 ASN G ND2 1 
ATOM 7388  N N   . THR G 2 28  ? 50.407  31.443  24.829  1.00 27.15 ? 174 THR G N   1 
ATOM 7389  C CA  . THR G 2 28  ? 51.194  31.225  26.030  1.00 27.54 ? 174 THR G CA  1 
ATOM 7390  C C   . THR G 2 28  ? 50.205  31.053  27.195  1.00 28.30 ? 174 THR G C   1 
ATOM 7391  O O   . THR G 2 28  ? 49.201  31.785  27.284  1.00 28.98 ? 174 THR G O   1 
ATOM 7392  C CB  . THR G 2 28  ? 52.086  32.435  26.367  1.00 26.68 ? 174 THR G CB  1 
ATOM 7393  O OG1 . THR G 2 28  ? 53.111  32.583  25.374  1.00 26.96 ? 174 THR G OG1 1 
ATOM 7394  C CG2 . THR G 2 28  ? 52.709  32.248  27.741  1.00 25.54 ? 174 THR G CG2 1 
ATOM 7395  N N   . VAL G 2 29  ? 50.470  30.083  28.068  1.00 26.97 ? 175 VAL G N   1 
ATOM 7396  C CA  . VAL G 2 29  ? 49.616  29.861  29.220  1.00 27.75 ? 175 VAL G CA  1 
ATOM 7397  C C   . VAL G 2 29  ? 50.465  30.088  30.446  1.00 29.30 ? 175 VAL G C   1 
ATOM 7398  O O   . VAL G 2 29  ? 51.616  29.655  30.490  1.00 29.96 ? 175 VAL G O   1 
ATOM 7399  C CB  . VAL G 2 29  ? 49.033  28.437  29.259  1.00 27.72 ? 175 VAL G CB  1 
ATOM 7400  C CG1 . VAL G 2 29  ? 48.336  28.190  30.588  1.00 26.01 ? 175 VAL G CG1 1 
ATOM 7401  C CG2 . VAL G 2 29  ? 48.035  28.271  28.130  1.00 28.79 ? 175 VAL G CG2 1 
ATOM 7402  N N   . LYS G 2 30  ? 49.906  30.801  31.424  1.00 30.73 ? 176 LYS G N   1 
ATOM 7403  C CA  . LYS G 2 30  ? 50.615  31.110  32.661  1.00 32.51 ? 176 LYS G CA  1 
ATOM 7404  C C   . LYS G 2 30  ? 49.714  30.736  33.826  1.00 32.81 ? 176 LYS G C   1 
ATOM 7405  O O   . LYS G 2 30  ? 48.662  31.347  34.033  1.00 34.29 ? 176 LYS G O   1 
ATOM 7406  C CB  . LYS G 2 30  ? 50.965  32.612  32.731  1.00 34.68 ? 176 LYS G CB  1 
ATOM 7407  C CG  . LYS G 2 30  ? 51.998  32.983  33.807  1.00 38.52 ? 176 LYS G CG  1 
ATOM 7408  C CD  . LYS G 2 30  ? 52.218  34.516  33.938  1.00 41.77 ? 176 LYS G CD  1 
ATOM 7409  C CE  . LYS G 2 30  ? 53.225  34.866  35.079  1.00 43.16 ? 176 LYS G CE  1 
ATOM 7410  N NZ  . LYS G 2 30  ? 53.506  36.334  35.307  1.00 42.97 ? 176 LYS G NZ  1 
ATOM 7411  N N   . PHE G 2 31  ? 50.113  29.714  34.572  1.00 32.06 ? 177 PHE G N   1 
ATOM 7412  C CA  . PHE G 2 31  ? 49.338  29.283  35.723  1.00 31.38 ? 177 PHE G CA  1 
ATOM 7413  C C   . PHE G 2 31  ? 49.948  29.906  36.968  1.00 32.03 ? 177 PHE G C   1 
ATOM 7414  O O   . PHE G 2 31  ? 51.163  29.809  37.193  1.00 30.60 ? 177 PHE G O   1 
ATOM 7415  C CB  . PHE G 2 31  ? 49.357  27.764  35.855  1.00 30.35 ? 177 PHE G CB  1 
ATOM 7416  C CG  . PHE G 2 31  ? 48.538  27.057  34.826  1.00 29.44 ? 177 PHE G CG  1 
ATOM 7417  C CD1 . PHE G 2 31  ? 47.231  27.450  34.569  1.00 28.88 ? 177 PHE G CD1 1 
ATOM 7418  C CD2 . PHE G 2 31  ? 49.057  25.962  34.139  1.00 28.35 ? 177 PHE G CD2 1 
ATOM 7419  C CE1 . PHE G 2 31  ? 46.454  26.761  33.647  1.00 27.02 ? 177 PHE G CE1 1 
ATOM 7420  C CE2 . PHE G 2 31  ? 48.284  25.272  33.219  1.00 26.21 ? 177 PHE G CE2 1 
ATOM 7421  C CZ  . PHE G 2 31  ? 46.982  25.672  32.974  1.00 25.91 ? 177 PHE G CZ  1 
ATOM 7422  N N   . ARG G 2 32  ? 49.099  30.530  37.781  1.00 32.48 ? 178 ARG G N   1 
ATOM 7423  C CA  . ARG G 2 32  ? 49.563  31.188  38.987  1.00 33.31 ? 178 ARG G CA  1 
ATOM 7424  C C   . ARG G 2 32  ? 48.949  30.655  40.269  1.00 33.10 ? 178 ARG G C   1 
ATOM 7425  O O   . ARG G 2 32  ? 47.789  30.241  40.304  1.00 31.86 ? 178 ARG G O   1 
ATOM 7426  C CB  . ARG G 2 32  ? 49.301  32.690  38.885  1.00 35.01 ? 178 ARG G CB  1 
ATOM 7427  C CG  . ARG G 2 32  ? 49.897  33.332  37.640  1.00 37.98 ? 178 ARG G CG  1 
ATOM 7428  C CD  . ARG G 2 32  ? 49.893  34.853  37.756  1.00 41.24 ? 178 ARG G CD  1 
ATOM 7429  N NE  . ARG G 2 32  ? 50.547  35.306  38.991  1.00 43.31 ? 178 ARG G NE  1 
ATOM 7430  C CZ  . ARG G 2 32  ? 50.814  36.575  39.292  1.00 42.66 ? 178 ARG G CZ  1 
ATOM 7431  N NH1 . ARG G 2 32  ? 50.493  37.547  38.440  1.00 41.68 ? 178 ARG G NH1 1 
ATOM 7432  N NH2 . ARG G 2 32  ? 51.398  36.862  40.454  1.00 41.89 ? 178 ARG G NH2 1 
ATOM 7433  N N   . CYS G 2 33  ? 49.760  30.683  41.323  1.00 33.77 ? 179 CYS G N   1 
ATOM 7434  C CA  . CYS G 2 33  ? 49.376  30.227  42.648  1.00 35.30 ? 179 CYS G CA  1 
ATOM 7435  C C   . CYS G 2 33  ? 50.055  31.084  43.691  1.00 36.00 ? 179 CYS G C   1 
ATOM 7436  O O   . CYS G 2 33  ? 50.846  30.591  44.503  1.00 35.73 ? 179 CYS G O   1 
ATOM 7437  C CB  . CYS G 2 33  ? 49.790  28.782  42.831  1.00 34.86 ? 179 CYS G CB  1 
ATOM 7438  S SG  . CYS G 2 33  ? 48.758  27.755  41.864  1.00 37.95 ? 179 CYS G SG  1 
ATOM 7439  N N   . PRO G 2 34  ? 49.751  32.389  43.690  1.00 36.77 ? 180 PRO G N   1 
ATOM 7440  C CA  . PRO G 2 34  ? 50.330  33.345  44.636  1.00 37.02 ? 180 PRO G CA  1 
ATOM 7441  C C   . PRO G 2 34  ? 50.243  32.811  46.059  1.00 38.03 ? 180 PRO G C   1 
ATOM 7442  O O   . PRO G 2 34  ? 49.145  32.551  46.573  1.00 37.74 ? 180 PRO G O   1 
ATOM 7443  C CB  . PRO G 2 34  ? 49.470  34.586  44.431  1.00 36.39 ? 180 PRO G CB  1 
ATOM 7444  C CG  . PRO G 2 34  ? 49.064  34.479  42.998  1.00 36.01 ? 180 PRO G CG  1 
ATOM 7445  C CD  . PRO G 2 34  ? 48.706  33.030  42.876  1.00 35.85 ? 180 PRO G CD  1 
ATOM 7446  N N   . ALA G 2 35  ? 51.401  32.659  46.693  1.00 38.98 ? 181 ALA G N   1 
ATOM 7447  C CA  . ALA G 2 35  ? 51.448  32.140  48.054  1.00 40.50 ? 181 ALA G CA  1 
ATOM 7448  C C   . ALA G 2 35  ? 52.159  33.047  49.053  1.00 41.86 ? 181 ALA G C   1 
ATOM 7449  O O   . ALA G 2 35  ? 52.779  34.054  48.691  1.00 41.61 ? 181 ALA G O   1 
ATOM 7450  C CB  . ALA G 2 35  ? 52.121  30.768  48.056  1.00 39.07 ? 181 ALA G CB  1 
ATOM 7451  N N   . GLY G 2 36  ? 52.051  32.653  50.321  1.00 42.99 ? 182 GLY G N   1 
ATOM 7452  C CA  . GLY G 2 36  ? 52.684  33.351  51.424  1.00 42.49 ? 182 GLY G CA  1 
ATOM 7453  C C   . GLY G 2 36  ? 52.910  32.336  52.539  1.00 42.34 ? 182 GLY G C   1 
ATOM 7454  O O   . GLY G 2 36  ? 52.498  31.182  52.420  1.00 42.26 ? 182 GLY G O   1 
ATOM 7455  N N   . GLY G 2 37  ? 53.560  32.751  53.620  1.00 42.28 ? 183 GLY G N   1 
ATOM 7456  C CA  . GLY G 2 37  ? 53.804  31.839  54.722  1.00 41.83 ? 183 GLY G CA  1 
ATOM 7457  C C   . GLY G 2 37  ? 55.231  31.956  55.210  1.00 41.72 ? 183 GLY G C   1 
ATOM 7458  O O   . GLY G 2 37  ? 56.135  32.205  54.421  1.00 41.87 ? 183 GLY G O   1 
ATOM 7459  N N   . ASN G 2 38  ? 55.442  31.780  56.510  1.00 42.13 ? 184 ASN G N   1 
ATOM 7460  C CA  . ASN G 2 38  ? 56.778  31.877  57.080  1.00 41.78 ? 184 ASN G CA  1 
ATOM 7461  C C   . ASN G 2 38  ? 57.206  30.617  57.810  1.00 41.52 ? 184 ASN G C   1 
ATOM 7462  O O   . ASN G 2 38  ? 56.566  30.198  58.763  1.00 41.36 ? 184 ASN G O   1 
ATOM 7463  C CB  . ASN G 2 38  ? 56.877  33.035  58.056  1.00 43.27 ? 184 ASN G CB  1 
ATOM 7464  C CG  . ASN G 2 38  ? 58.233  33.090  58.721  1.00 45.20 ? 184 ASN G CG  1 
ATOM 7465  O OD1 . ASN G 2 38  ? 59.248  33.272  58.051  1.00 47.55 ? 184 ASN G OD1 1 
ATOM 7466  N ND2 . ASN G 2 38  ? 58.264  32.905  60.036  1.00 44.90 ? 184 ASN G ND2 1 
ATOM 7467  N N   . PRO G 2 39  ? 58.345  30.033  57.410  1.00 41.54 ? 185 PRO G N   1 
ATOM 7468  C CA  . PRO G 2 39  ? 59.230  30.484  56.326  1.00 41.48 ? 185 PRO G CA  1 
ATOM 7469  C C   . PRO G 2 39  ? 58.606  30.450  54.921  1.00 41.83 ? 185 PRO G C   1 
ATOM 7470  O O   . PRO G 2 39  ? 57.558  29.831  54.710  1.00 42.17 ? 185 PRO G O   1 
ATOM 7471  C CB  . PRO G 2 39  ? 60.424  29.536  56.453  1.00 41.00 ? 185 PRO G CB  1 
ATOM 7472  C CG  . PRO G 2 39  ? 59.772  28.263  56.896  1.00 41.27 ? 185 PRO G CG  1 
ATOM 7473  C CD  . PRO G 2 39  ? 58.821  28.755  57.972  1.00 40.66 ? 185 PRO G CD  1 
ATOM 7474  N N   . MET G 2 40  ? 59.255  31.124  53.969  1.00 41.76 ? 186 MET G N   1 
ATOM 7475  C CA  . MET G 2 40  ? 58.774  31.164  52.586  1.00 41.25 ? 186 MET G CA  1 
ATOM 7476  C C   . MET G 2 40  ? 58.564  29.760  52.055  1.00 40.76 ? 186 MET G C   1 
ATOM 7477  O O   . MET G 2 40  ? 59.507  28.970  51.941  1.00 40.33 ? 186 MET G O   1 
ATOM 7478  C CB  . MET G 2 40  ? 59.758  31.885  51.672  1.00 42.61 ? 186 MET G CB  1 
ATOM 7479  C CG  . MET G 2 40  ? 59.390  33.322  51.391  1.00 46.44 ? 186 MET G CG  1 
ATOM 7480  S SD  . MET G 2 40  ? 57.849  33.499  50.466  1.00 50.42 ? 186 MET G SD  1 
ATOM 7481  C CE  . MET G 2 40  ? 56.662  34.075  51.765  1.00 47.64 ? 186 MET G CE  1 
ATOM 7482  N N   . PRO G 2 41  ? 57.314  29.430  51.719  1.00 39.69 ? 187 PRO G N   1 
ATOM 7483  C CA  . PRO G 2 41  ? 57.047  28.093  51.201  1.00 39.18 ? 187 PRO G CA  1 
ATOM 7484  C C   . PRO G 2 41  ? 57.703  27.856  49.850  1.00 39.49 ? 187 PRO G C   1 
ATOM 7485  O O   . PRO G 2 41  ? 58.018  28.796  49.114  1.00 39.73 ? 187 PRO G O   1 
ATOM 7486  C CB  . PRO G 2 41  ? 55.524  28.055  51.141  1.00 37.89 ? 187 PRO G CB  1 
ATOM 7487  C CG  . PRO G 2 41  ? 55.175  29.458  50.852  1.00 37.94 ? 187 PRO G CG  1 
ATOM 7488  C CD  . PRO G 2 41  ? 56.075  30.221  51.780  1.00 39.03 ? 187 PRO G CD  1 
ATOM 7489  N N   . THR G 2 42  ? 57.914  26.588  49.534  1.00 39.55 ? 188 THR G N   1 
ATOM 7490  C CA  . THR G 2 42  ? 58.517  26.214  48.278  1.00 40.49 ? 188 THR G CA  1 
ATOM 7491  C C   . THR G 2 42  ? 57.397  25.852  47.311  1.00 41.31 ? 188 THR G C   1 
ATOM 7492  O O   . THR G 2 42  ? 56.249  25.694  47.722  1.00 41.29 ? 188 THR G O   1 
ATOM 7493  C CB  . THR G 2 42  ? 59.472  25.025  48.495  1.00 40.53 ? 188 THR G CB  1 
ATOM 7494  O OG1 . THR G 2 42  ? 58.783  23.976  49.188  1.00 41.08 ? 188 THR G OG1 1 
ATOM 7495  C CG2 . THR G 2 42  ? 60.673  25.465  49.319  1.00 38.72 ? 188 THR G CG2 1 
ATOM 7496  N N   . MET G 2 43  ? 57.729  25.715  46.031  1.00 42.41 ? 189 MET G N   1 
ATOM 7497  C CA  . MET G 2 43  ? 56.724  25.389  45.029  1.00 42.29 ? 189 MET G CA  1 
ATOM 7498  C C   . MET G 2 43  ? 57.135  24.342  44.004  1.00 41.55 ? 189 MET G C   1 
ATOM 7499  O O   . MET G 2 43  ? 58.229  24.400  43.450  1.00 42.67 ? 189 MET G O   1 
ATOM 7500  C CB  . MET G 2 43  ? 56.309  26.665  44.304  1.00 43.05 ? 189 MET G CB  1 
ATOM 7501  C CG  . MET G 2 43  ? 55.535  26.409  43.038  1.00 45.53 ? 189 MET G CG  1 
ATOM 7502  S SD  . MET G 2 43  ? 54.852  27.910  42.398  1.00 46.89 ? 189 MET G SD  1 
ATOM 7503  C CE  . MET G 2 43  ? 53.228  27.810  43.128  1.00 47.28 ? 189 MET G CE  1 
ATOM 7504  N N   . ARG G 2 44  ? 56.240  23.393  43.754  1.00 40.78 ? 190 ARG G N   1 
ATOM 7505  C CA  . ARG G 2 44  ? 56.464  22.342  42.766  1.00 40.48 ? 190 ARG G CA  1 
ATOM 7506  C C   . ARG G 2 44  ? 55.256  22.345  41.833  1.00 39.72 ? 190 ARG G C   1 
ATOM 7507  O O   . ARG G 2 44  ? 54.171  22.760  42.233  1.00 39.84 ? 190 ARG G O   1 
ATOM 7508  C CB  . ARG G 2 44  ? 56.522  20.953  43.407  1.00 40.94 ? 190 ARG G CB  1 
ATOM 7509  C CG  . ARG G 2 44  ? 57.470  20.772  44.547  1.00 41.71 ? 190 ARG G CG  1 
ATOM 7510  C CD  . ARG G 2 44  ? 57.767  19.279  44.731  1.00 42.52 ? 190 ARG G CD  1 
ATOM 7511  N NE  . ARG G 2 44  ? 56.601  18.421  44.993  1.00 43.68 ? 190 ARG G NE  1 
ATOM 7512  C CZ  . ARG G 2 44  ? 55.926  18.362  46.146  1.00 45.55 ? 190 ARG G CZ  1 
ATOM 7513  N NH1 . ARG G 2 44  ? 56.268  19.124  47.188  1.00 45.00 ? 190 ARG G NH1 1 
ATOM 7514  N NH2 . ARG G 2 44  ? 54.923  17.498  46.275  1.00 44.67 ? 190 ARG G NH2 1 
ATOM 7515  N N   . TRP G 2 45  ? 55.445  21.876  40.601  1.00 38.33 ? 191 TRP G N   1 
ATOM 7516  C CA  . TRP G 2 45  ? 54.349  21.792  39.644  1.00 36.96 ? 191 TRP G CA  1 
ATOM 7517  C C   . TRP G 2 45  ? 54.193  20.367  39.152  1.00 36.34 ? 191 TRP G C   1 
ATOM 7518  O O   . TRP G 2 45  ? 55.166  19.716  38.791  1.00 36.84 ? 191 TRP G O   1 
ATOM 7519  C CB  . TRP G 2 45  ? 54.594  22.705  38.444  1.00 36.66 ? 191 TRP G CB  1 
ATOM 7520  C CG  . TRP G 2 45  ? 54.310  24.126  38.737  1.00 35.94 ? 191 TRP G CG  1 
ATOM 7521  C CD1 . TRP G 2 45  ? 55.190  25.068  39.193  1.00 35.07 ? 191 TRP G CD1 1 
ATOM 7522  C CD2 . TRP G 2 45  ? 53.035  24.763  38.664  1.00 35.88 ? 191 TRP G CD2 1 
ATOM 7523  N NE1 . TRP G 2 45  ? 54.537  26.257  39.412  1.00 36.05 ? 191 TRP G NE1 1 
ATOM 7524  C CE2 . TRP G 2 45  ? 53.211  26.099  39.094  1.00 35.70 ? 191 TRP G CE2 1 
ATOM 7525  C CE3 . TRP G 2 45  ? 51.755  24.337  38.277  1.00 34.77 ? 191 TRP G CE3 1 
ATOM 7526  C CZ2 . TRP G 2 45  ? 52.153  27.012  39.150  1.00 35.23 ? 191 TRP G CZ2 1 
ATOM 7527  C CZ3 . TRP G 2 45  ? 50.703  25.245  38.330  1.00 35.13 ? 191 TRP G CZ3 1 
ATOM 7528  C CH2 . TRP G 2 45  ? 50.909  26.570  38.763  1.00 34.58 ? 191 TRP G CH2 1 
ATOM 7529  N N   . LEU G 2 46  ? 52.964  19.881  39.129  1.00 35.82 ? 192 LEU G N   1 
ATOM 7530  C CA  . LEU G 2 46  ? 52.720  18.530  38.660  1.00 35.67 ? 192 LEU G CA  1 
ATOM 7531  C C   . LEU G 2 46  ? 51.872  18.546  37.392  1.00 36.63 ? 192 LEU G C   1 
ATOM 7532  O O   . LEU G 2 46  ? 51.015  19.426  37.201  1.00 36.96 ? 192 LEU G O   1 
ATOM 7533  C CB  . LEU G 2 46  ? 51.967  17.720  39.719  1.00 35.50 ? 192 LEU G CB  1 
ATOM 7534  C CG  . LEU G 2 46  ? 52.455  17.744  41.165  1.00 36.76 ? 192 LEU G CG  1 
ATOM 7535  C CD1 . LEU G 2 46  ? 51.565  16.836  42.002  1.00 34.80 ? 192 LEU G CD1 1 
ATOM 7536  C CD2 . LEU G 2 46  ? 53.921  17.300  41.230  1.00 36.55 ? 192 LEU G CD2 1 
ATOM 7537  N N   . LYS G 2 47  ? 52.129  17.583  36.514  1.00 36.20 ? 193 LYS G N   1 
ATOM 7538  C CA  . LYS G 2 47  ? 51.330  17.452  35.317  1.00 35.85 ? 193 LYS G CA  1 
ATOM 7539  C C   . LYS G 2 47  ? 50.685  16.102  35.531  1.00 36.59 ? 193 LYS G C   1 
ATOM 7540  O O   . LYS G 2 47  ? 51.375  15.084  35.574  1.00 37.21 ? 193 LYS G O   1 
ATOM 7541  C CB  . LYS G 2 47  ? 52.183  17.411  34.053  1.00 35.50 ? 193 LYS G CB  1 
ATOM 7542  C CG  . LYS G 2 47  ? 51.309  17.295  32.806  1.00 34.29 ? 193 LYS G CG  1 
ATOM 7543  C CD  . LYS G 2 47  ? 52.106  17.189  31.527  1.00 33.74 ? 193 LYS G CD  1 
ATOM 7544  C CE  . LYS G 2 47  ? 51.179  17.083  30.326  1.00 32.87 ? 193 LYS G CE  1 
ATOM 7545  N NZ  . LYS G 2 47  ? 51.954  17.074  29.071  1.00 32.69 ? 193 LYS G NZ  1 
ATOM 7546  N N   . ASN G 2 48  ? 49.373  16.098  35.704  1.00 37.01 ? 194 ASN G N   1 
ATOM 7547  C CA  . ASN G 2 48  ? 48.652  14.857  35.916  1.00 37.42 ? 194 ASN G CA  1 
ATOM 7548  C C   . ASN G 2 48  ? 49.181  14.113  37.128  1.00 36.94 ? 194 ASN G C   1 
ATOM 7549  O O   . ASN G 2 48  ? 49.447  12.915  37.059  1.00 35.79 ? 194 ASN G O   1 
ATOM 7550  C CB  . ASN G 2 48  ? 48.764  13.983  34.678  1.00 38.22 ? 194 ASN G CB  1 
ATOM 7551  C CG  . ASN G 2 48  ? 48.271  14.689  33.453  1.00 39.71 ? 194 ASN G CG  1 
ATOM 7552  O OD1 . ASN G 2 48  ? 47.144  15.179  33.430  1.00 40.04 ? 194 ASN G OD1 1 
ATOM 7553  N ND2 . ASN G 2 48  ? 49.113  14.765  32.426  1.00 40.29 ? 194 ASN G ND2 1 
ATOM 7554  N N   . GLY G 2 49  ? 49.336  14.842  38.231  1.00 36.42 ? 195 GLY G N   1 
ATOM 7555  C CA  . GLY G 2 49  ? 49.803  14.244  39.469  1.00 37.31 ? 195 GLY G CA  1 
ATOM 7556  C C   . GLY G 2 49  ? 51.245  13.752  39.536  1.00 37.56 ? 195 GLY G C   1 
ATOM 7557  O O   . GLY G 2 49  ? 51.682  13.261  40.581  1.00 37.14 ? 195 GLY G O   1 
ATOM 7558  N N   . LYS G 2 50  ? 51.988  13.872  38.440  1.00 37.80 ? 196 LYS G N   1 
ATOM 7559  C CA  . LYS G 2 50  ? 53.382  13.424  38.421  1.00 38.02 ? 196 LYS G CA  1 
ATOM 7560  C C   . LYS G 2 50  ? 54.281  14.622  38.185  1.00 38.48 ? 196 LYS G C   1 
ATOM 7561  O O   . LYS G 2 50  ? 53.819  15.651  37.692  1.00 39.79 ? 196 LYS G O   1 
ATOM 7562  C CB  . LYS G 2 50  ? 53.606  12.376  37.317  1.00 36.70 ? 196 LYS G CB  1 
ATOM 7563  N N   . GLU G 2 51  ? 55.560  14.491  38.533  1.00 38.90 ? 197 GLU G N   1 
ATOM 7564  C CA  . GLU G 2 51  ? 56.507  15.589  38.356  1.00 39.50 ? 197 GLU G CA  1 
ATOM 7565  C C   . GLU G 2 51  ? 56.485  16.077  36.921  1.00 39.52 ? 197 GLU G C   1 
ATOM 7566  O O   . GLU G 2 51  ? 56.403  15.287  35.981  1.00 39.93 ? 197 GLU G O   1 
ATOM 7567  C CB  . GLU G 2 51  ? 57.943  15.181  38.716  1.00 40.81 ? 197 GLU G CB  1 
ATOM 7568  C CG  . GLU G 2 51  ? 58.920  16.369  38.659  1.00 43.35 ? 197 GLU G CG  1 
ATOM 7569  C CD  . GLU G 2 51  ? 60.388  15.988  38.847  1.00 44.35 ? 197 GLU G CD  1 
ATOM 7570  O OE1 . GLU G 2 51  ? 60.706  15.305  39.835  1.00 44.61 ? 197 GLU G OE1 1 
ATOM 7571  O OE2 . GLU G 2 51  ? 61.233  16.386  38.012  1.00 46.10 ? 197 GLU G OE2 1 
ATOM 7572  N N   . PHE G 2 52  ? 56.553  17.389  36.757  1.00 39.71 ? 198 PHE G N   1 
ATOM 7573  C CA  . PHE G 2 52  ? 56.534  17.978  35.432  1.00 39.72 ? 198 PHE G CA  1 
ATOM 7574  C C   . PHE G 2 52  ? 57.960  18.362  35.067  1.00 40.42 ? 198 PHE G C   1 
ATOM 7575  O O   . PHE G 2 52  ? 58.529  19.302  35.629  1.00 40.31 ? 198 PHE G O   1 
ATOM 7576  C CB  . PHE G 2 52  ? 55.633  19.206  35.419  1.00 39.93 ? 198 PHE G CB  1 
ATOM 7577  C CG  . PHE G 2 52  ? 55.399  19.778  34.050  1.00 41.40 ? 198 PHE G CG  1 
ATOM 7578  C CD1 . PHE G 2 52  ? 54.931  21.085  33.899  1.00 41.54 ? 198 PHE G CD1 1 
ATOM 7579  C CD2 . PHE G 2 52  ? 55.610  19.009  32.910  1.00 41.18 ? 198 PHE G CD2 1 
ATOM 7580  C CE1 . PHE G 2 52  ? 54.680  21.610  32.633  1.00 40.65 ? 198 PHE G CE1 1 
ATOM 7581  C CE2 . PHE G 2 52  ? 55.360  19.529  31.642  1.00 40.08 ? 198 PHE G CE2 1 
ATOM 7582  C CZ  . PHE G 2 52  ? 54.894  20.830  31.507  1.00 40.35 ? 198 PHE G CZ  1 
ATOM 7583  N N   . LYS G 2 53  ? 58.528  17.621  34.124  1.00 40.58 ? 199 LYS G N   1 
ATOM 7584  C CA  . LYS G 2 53  ? 59.890  17.838  33.667  1.00 40.44 ? 199 LYS G CA  1 
ATOM 7585  C C   . LYS G 2 53  ? 59.951  18.576  32.334  1.00 40.04 ? 199 LYS G C   1 
ATOM 7586  O O   . LYS G 2 53  ? 59.036  18.488  31.514  1.00 40.30 ? 199 LYS G O   1 
ATOM 7587  C CB  . LYS G 2 53  ? 60.591  16.490  33.512  1.00 42.45 ? 199 LYS G CB  1 
ATOM 7588  C CG  . LYS G 2 53  ? 60.472  15.554  34.713  1.00 44.17 ? 199 LYS G CG  1 
ATOM 7589  C CD  . LYS G 2 53  ? 61.183  14.242  34.412  1.00 45.56 ? 199 LYS G CD  1 
ATOM 7590  C CE  . LYS G 2 53  ? 61.090  13.260  35.572  1.00 47.30 ? 199 LYS G CE  1 
ATOM 7591  N NZ  . LYS G 2 53  ? 61.774  11.962  35.240  1.00 48.02 ? 199 LYS G NZ  1 
ATOM 7592  N N   . GLN G 2 54  ? 61.054  19.287  32.124  1.00 39.37 ? 200 GLN G N   1 
ATOM 7593  C CA  . GLN G 2 54  ? 61.298  20.046  30.902  1.00 38.58 ? 200 GLN G CA  1 
ATOM 7594  C C   . GLN G 2 54  ? 61.143  19.235  29.619  1.00 39.02 ? 200 GLN G C   1 
ATOM 7595  O O   . GLN G 2 54  ? 60.880  19.792  28.551  1.00 39.32 ? 200 GLN G O   1 
ATOM 7596  C CB  . GLN G 2 54  ? 62.714  20.607  30.926  1.00 37.37 ? 200 GLN G CB  1 
ATOM 7597  C CG  . GLN G 2 54  ? 62.925  21.712  31.912  1.00 37.73 ? 200 GLN G CG  1 
ATOM 7598  C CD  . GLN G 2 54  ? 61.980  22.856  31.673  1.00 38.63 ? 200 GLN G CD  1 
ATOM 7599  O OE1 . GLN G 2 54  ? 61.692  23.206  30.519  1.00 39.23 ? 200 GLN G OE1 1 
ATOM 7600  N NE2 . GLN G 2 54  ? 61.490  23.457  32.752  1.00 36.66 ? 200 GLN G NE2 1 
ATOM 7601  N N   . GLU G 2 55  ? 61.332  17.923  29.713  1.00 39.52 ? 201 GLU G N   1 
ATOM 7602  C CA  . GLU G 2 55  ? 61.240  17.072  28.530  1.00 39.69 ? 201 GLU G CA  1 
ATOM 7603  C C   . GLU G 2 55  ? 59.832  16.576  28.256  1.00 38.40 ? 201 GLU G C   1 
ATOM 7604  O O   . GLU G 2 55  ? 59.605  15.917  27.246  1.00 38.61 ? 201 GLU G O   1 
ATOM 7605  C CB  . GLU G 2 55  ? 62.179  15.859  28.651  1.00 41.68 ? 201 GLU G CB  1 
ATOM 7606  C CG  . GLU G 2 55  ? 61.821  14.893  29.778  1.00 45.02 ? 201 GLU G CG  1 
ATOM 7607  C CD  . GLU G 2 55  ? 62.871  14.863  30.895  1.00 48.52 ? 201 GLU G CD  1 
ATOM 7608  O OE1 . GLU G 2 55  ? 63.290  15.956  31.368  1.00 48.34 ? 201 GLU G OE1 1 
ATOM 7609  O OE2 . GLU G 2 55  ? 63.273  13.741  31.302  1.00 49.61 ? 201 GLU G OE2 1 
ATOM 7610  N N   . HIS G 2 56  ? 58.891  16.894  29.142  1.00 37.11 ? 202 HIS G N   1 
ATOM 7611  C CA  . HIS G 2 56  ? 57.511  16.447  28.973  1.00 36.09 ? 202 HIS G CA  1 
ATOM 7612  C C   . HIS G 2 56  ? 56.781  17.168  27.839  1.00 35.03 ? 202 HIS G C   1 
ATOM 7613  O O   . HIS G 2 56  ? 55.653  16.815  27.482  1.00 35.55 ? 202 HIS G O   1 
ATOM 7614  C CB  . HIS G 2 56  ? 56.729  16.591  30.292  1.00 36.80 ? 202 HIS G CB  1 
ATOM 7615  C CG  . HIS G 2 56  ? 57.169  15.644  31.372  1.00 37.31 ? 202 HIS G CG  1 
ATOM 7616  N ND1 . HIS G 2 56  ? 57.864  14.482  31.110  1.00 37.29 ? 202 HIS G ND1 1 
ATOM 7617  C CD2 . HIS G 2 56  ? 56.990  15.679  32.715  1.00 37.76 ? 202 HIS G CD2 1 
ATOM 7618  C CE1 . HIS G 2 56  ? 58.096  13.845  32.245  1.00 37.26 ? 202 HIS G CE1 1 
ATOM 7619  N NE2 . HIS G 2 56  ? 57.576  14.550  33.233  1.00 37.59 ? 202 HIS G NE2 1 
ATOM 7620  N N   . ARG G 2 57  ? 57.420  18.188  27.284  1.00 33.82 ? 203 ARG G N   1 
ATOM 7621  C CA  . ARG G 2 57  ? 56.847  18.931  26.170  1.00 33.12 ? 203 ARG G CA  1 
ATOM 7622  C C   . ARG G 2 57  ? 57.967  19.663  25.461  1.00 33.27 ? 203 ARG G C   1 
ATOM 7623  O O   . ARG G 2 57  ? 58.895  20.155  26.101  1.00 34.21 ? 203 ARG G O   1 
ATOM 7624  C CB  . ARG G 2 57  ? 55.775  19.929  26.651  1.00 32.66 ? 203 ARG G CB  1 
ATOM 7625  C CG  . ARG G 2 57  ? 56.291  21.284  27.129  1.00 31.59 ? 203 ARG G CG  1 
ATOM 7626  C CD  . ARG G 2 57  ? 55.182  22.097  27.759  1.00 29.76 ? 203 ARG G CD  1 
ATOM 7627  N NE  . ARG G 2 57  ? 54.189  22.587  26.804  1.00 29.87 ? 203 ARG G NE  1 
ATOM 7628  C CZ  . ARG G 2 57  ? 54.352  23.652  26.023  1.00 28.84 ? 203 ARG G CZ  1 
ATOM 7629  N NH1 . ARG G 2 57  ? 55.478  24.346  26.075  1.00 28.80 ? 203 ARG G NH1 1 
ATOM 7630  N NH2 . ARG G 2 57  ? 53.383  24.038  25.206  1.00 27.52 ? 203 ARG G NH2 1 
ATOM 7631  N N   . ILE G 2 58  ? 57.890  19.712  24.137  1.00 32.92 ? 204 ILE G N   1 
ATOM 7632  C CA  . ILE G 2 58  ? 58.901  20.390  23.334  1.00 33.80 ? 204 ILE G CA  1 
ATOM 7633  C C   . ILE G 2 58  ? 59.066  21.826  23.838  1.00 33.96 ? 204 ILE G C   1 
ATOM 7634  O O   . ILE G 2 58  ? 58.085  22.547  24.003  1.00 34.02 ? 204 ILE G O   1 
ATOM 7635  C CB  . ILE G 2 58  ? 58.470  20.461  21.844  1.00 34.37 ? 204 ILE G CB  1 
ATOM 7636  C CG1 . ILE G 2 58  ? 57.903  19.115  21.387  1.00 34.50 ? 204 ILE G CG1 1 
ATOM 7637  C CG2 . ILE G 2 58  ? 59.644  20.861  20.983  1.00 34.15 ? 204 ILE G CG2 1 
ATOM 7638  C CD1 . ILE G 2 58  ? 58.877  17.951  21.502  1.00 35.54 ? 204 ILE G CD1 1 
ATOM 7639  N N   . GLY G 2 59  ? 60.299  22.247  24.079  1.00 34.93 ? 205 GLY G N   1 
ATOM 7640  C CA  . GLY G 2 59  ? 60.514  23.606  24.548  1.00 35.54 ? 205 GLY G CA  1 
ATOM 7641  C C   . GLY G 2 59  ? 60.405  23.747  26.051  1.00 35.40 ? 205 GLY G C   1 
ATOM 7642  O O   . GLY G 2 59  ? 60.791  24.777  26.618  1.00 35.86 ? 205 GLY G O   1 
ATOM 7643  N N   . GLY G 2 60  ? 59.878  22.713  26.698  1.00 34.87 ? 206 GLY G N   1 
ATOM 7644  C CA  . GLY G 2 60  ? 59.752  22.736  28.143  1.00 35.42 ? 206 GLY G CA  1 
ATOM 7645  C C   . GLY G 2 60  ? 58.845  23.839  28.632  1.00 36.04 ? 206 GLY G C   1 
ATOM 7646  O O   . GLY G 2 60  ? 57.902  24.226  27.942  1.00 35.59 ? 206 GLY G O   1 
ATOM 7647  N N   . TYR G 2 61  ? 59.131  24.339  29.828  1.00 36.98 ? 207 TYR G N   1 
ATOM 7648  C CA  . TYR G 2 61  ? 58.343  25.410  30.428  1.00 38.27 ? 207 TYR G CA  1 
ATOM 7649  C C   . TYR G 2 61  ? 59.247  26.329  31.254  1.00 38.63 ? 207 TYR G C   1 
ATOM 7650  O O   . TYR G 2 61  ? 60.419  26.019  31.491  1.00 38.35 ? 207 TYR G O   1 
ATOM 7651  C CB  . TYR G 2 61  ? 57.263  24.823  31.334  1.00 39.59 ? 207 TYR G CB  1 
ATOM 7652  C CG  . TYR G 2 61  ? 57.813  23.931  32.414  1.00 41.35 ? 207 TYR G CG  1 
ATOM 7653  C CD1 . TYR G 2 61  ? 57.933  22.552  32.224  1.00 42.06 ? 207 TYR G CD1 1 
ATOM 7654  C CD2 . TYR G 2 61  ? 58.264  24.470  33.617  1.00 42.58 ? 207 TYR G CD2 1 
ATOM 7655  C CE1 . TYR G 2 61  ? 58.491  21.734  33.207  1.00 42.07 ? 207 TYR G CE1 1 
ATOM 7656  C CE2 . TYR G 2 61  ? 58.828  23.659  34.606  1.00 42.40 ? 207 TYR G CE2 1 
ATOM 7657  C CZ  . TYR G 2 61  ? 58.938  22.298  34.392  1.00 42.40 ? 207 TYR G CZ  1 
ATOM 7658  O OH  . TYR G 2 61  ? 59.508  21.517  35.365  1.00 44.07 ? 207 TYR G OH  1 
ATOM 7659  N N   . LYS G 2 62  ? 58.703  27.460  31.691  1.00 38.77 ? 208 LYS G N   1 
ATOM 7660  C CA  . LYS G 2 62  ? 59.475  28.396  32.499  1.00 39.53 ? 208 LYS G CA  1 
ATOM 7661  C C   . LYS G 2 62  ? 58.706  28.665  33.779  1.00 41.53 ? 208 LYS G C   1 
ATOM 7662  O O   . LYS G 2 62  ? 57.468  28.585  33.809  1.00 41.94 ? 208 LYS G O   1 
ATOM 7663  C CB  . LYS G 2 62  ? 59.708  29.704  31.739  1.00 38.14 ? 208 LYS G CB  1 
ATOM 7664  C CG  . LYS G 2 62  ? 60.324  29.513  30.359  1.00 36.98 ? 208 LYS G CG  1 
ATOM 7665  C CD  . LYS G 2 62  ? 60.542  30.838  29.646  1.00 35.63 ? 208 LYS G CD  1 
ATOM 7666  C CE  . LYS G 2 62  ? 61.025  30.623  28.210  1.00 34.22 ? 208 LYS G CE  1 
ATOM 7667  N NZ  . LYS G 2 62  ? 61.170  31.906  27.468  1.00 31.98 ? 208 LYS G NZ  1 
ATOM 7668  N N   . VAL G 2 63  ? 59.438  28.967  34.843  1.00 43.13 ? 209 VAL G N   1 
ATOM 7669  C CA  . VAL G 2 63  ? 58.813  29.237  36.125  1.00 45.27 ? 209 VAL G CA  1 
ATOM 7670  C C   . VAL G 2 63  ? 59.370  30.508  36.730  1.00 47.46 ? 209 VAL G C   1 
ATOM 7671  O O   . VAL G 2 63  ? 60.578  30.648  36.879  1.00 48.66 ? 209 VAL G O   1 
ATOM 7672  C CB  . VAL G 2 63  ? 59.054  28.084  37.107  1.00 44.37 ? 209 VAL G CB  1 
ATOM 7673  C CG1 . VAL G 2 63  ? 58.384  28.386  38.421  1.00 45.95 ? 209 VAL G CG1 1 
ATOM 7674  C CG2 . VAL G 2 63  ? 58.507  26.802  36.543  1.00 44.68 ? 209 VAL G CG2 1 
ATOM 7675  N N   . ARG G 2 64  ? 58.491  31.443  37.069  1.00 50.56 ? 210 ARG G N   1 
ATOM 7676  C CA  . ARG G 2 64  ? 58.927  32.696  37.675  1.00 53.30 ? 210 ARG G CA  1 
ATOM 7677  C C   . ARG G 2 64  ? 58.555  32.612  39.154  1.00 53.89 ? 210 ARG G C   1 
ATOM 7678  O O   . ARG G 2 64  ? 57.454  33.002  39.542  1.00 55.06 ? 210 ARG G O   1 
ATOM 7679  C CB  . ARG G 2 64  ? 58.219  33.885  37.004  1.00 55.24 ? 210 ARG G CB  1 
ATOM 7680  C CG  . ARG G 2 64  ? 59.089  35.136  36.855  1.00 58.06 ? 210 ARG G CG  1 
ATOM 7681  C CD  . ARG G 2 64  ? 59.391  35.789  38.198  1.00 59.87 ? 210 ARG G CD  1 
ATOM 7682  N NE  . ARG G 2 64  ? 60.746  36.337  38.256  1.00 61.28 ? 210 ARG G NE  1 
ATOM 7683  C CZ  . ARG G 2 64  ? 61.854  35.600  38.176  1.00 61.73 ? 210 ARG G CZ  1 
ATOM 7684  N NH1 . ARG G 2 64  ? 61.775  34.280  38.027  1.00 61.38 ? 210 ARG G NH1 1 
ATOM 7685  N NH2 . ARG G 2 64  ? 63.045  36.181  38.277  1.00 62.04 ? 210 ARG G NH2 1 
ATOM 7686  N N   . ASN G 2 65  ? 59.470  32.097  39.975  1.00 54.35 ? 211 ASN G N   1 
ATOM 7687  C CA  . ASN G 2 65  ? 59.210  31.949  41.411  1.00 55.25 ? 211 ASN G CA  1 
ATOM 7688  C C   . ASN G 2 65  ? 58.602  33.179  42.054  1.00 53.99 ? 211 ASN G C   1 
ATOM 7689  O O   . ASN G 2 65  ? 57.688  33.091  42.863  1.00 53.47 ? 211 ASN G O   1 
ATOM 7690  C CB  . ASN G 2 65  ? 60.484  31.626  42.180  1.00 57.73 ? 211 ASN G CB  1 
ATOM 7691  C CG  . ASN G 2 65  ? 60.194  31.260  43.630  1.00 60.84 ? 211 ASN G CG  1 
ATOM 7692  O OD1 . ASN G 2 65  ? 61.008  31.500  44.529  1.00 62.03 ? 211 ASN G OD1 1 
ATOM 7693  N ND2 . ASN G 2 65  ? 59.020  30.662  43.863  1.00 61.73 ? 211 ASN G ND2 1 
ATOM 7694  N N   . GLN G 2 66  ? 59.147  34.327  41.696  1.00 54.18 ? 212 GLN G N   1 
ATOM 7695  C CA  . GLN G 2 66  ? 58.695  35.607  42.200  1.00 53.88 ? 212 GLN G CA  1 
ATOM 7696  C C   . GLN G 2 66  ? 57.182  35.774  42.077  1.00 52.59 ? 212 GLN G C   1 
ATOM 7697  O O   . GLN G 2 66  ? 56.550  36.373  42.946  1.00 52.32 ? 212 GLN G O   1 
ATOM 7698  C CB  . GLN G 2 66  ? 59.421  36.730  41.446  1.00 55.90 ? 212 GLN G CB  1 
ATOM 7699  C CG  . GLN G 2 66  ? 60.919  36.840  41.779  1.00 58.83 ? 212 GLN G CG  1 
ATOM 7700  C CD  . GLN G 2 66  ? 61.721  35.574  41.450  1.00 60.72 ? 212 GLN G CD  1 
ATOM 7701  O OE1 . GLN G 2 66  ? 62.853  35.412  41.909  1.00 62.55 ? 212 GLN G OE1 1 
ATOM 7702  N NE2 . GLN G 2 66  ? 61.144  34.686  40.647  1.00 61.25 ? 212 GLN G NE2 1 
ATOM 7703  N N   . HIS G 2 67  ? 56.598  35.241  41.007  1.00 51.16 ? 213 HIS G N   1 
ATOM 7704  C CA  . HIS G 2 67  ? 55.156  35.359  40.800  1.00 49.22 ? 213 HIS G CA  1 
ATOM 7705  C C   . HIS G 2 67  ? 54.391  34.050  41.012  1.00 47.48 ? 213 HIS G C   1 
ATOM 7706  O O   . HIS G 2 67  ? 53.196  33.973  40.696  1.00 48.15 ? 213 HIS G O   1 
ATOM 7707  C CB  . HIS G 2 67  ? 54.847  35.855  39.384  1.00 50.84 ? 213 HIS G CB  1 
ATOM 7708  C CG  . HIS G 2 67  ? 55.603  37.083  38.982  1.00 52.56 ? 213 HIS G CG  1 
ATOM 7709  N ND1 . HIS G 2 67  ? 55.990  38.052  39.882  1.00 53.12 ? 213 HIS G ND1 1 
ATOM 7710  C CD2 . HIS G 2 67  ? 56.015  37.512  37.765  1.00 52.78 ? 213 HIS G CD2 1 
ATOM 7711  C CE1 . HIS G 2 67  ? 56.611  39.024  39.237  1.00 52.87 ? 213 HIS G CE1 1 
ATOM 7712  N NE2 . HIS G 2 67  ? 56.639  38.722  37.952  1.00 51.98 ? 213 HIS G NE2 1 
ATOM 7713  N N   . TRP G 2 68  ? 55.072  33.036  41.546  1.00 44.34 ? 214 TRP G N   1 
ATOM 7714  C CA  . TRP G 2 68  ? 54.472  31.723  41.787  1.00 41.36 ? 214 TRP G CA  1 
ATOM 7715  C C   . TRP G 2 68  ? 53.726  31.251  40.540  1.00 39.62 ? 214 TRP G C   1 
ATOM 7716  O O   . TRP G 2 68  ? 52.617  30.726  40.624  1.00 38.99 ? 214 TRP G O   1 
ATOM 7717  C CB  . TRP G 2 68  ? 53.517  31.773  42.989  1.00 41.79 ? 214 TRP G CB  1 
ATOM 7718  C CG  . TRP G 2 68  ? 54.129  32.350  44.255  1.00 41.72 ? 214 TRP G CG  1 
ATOM 7719  C CD1 . TRP G 2 68  ? 54.151  33.662  44.631  1.00 41.41 ? 214 TRP G CD1 1 
ATOM 7720  C CD2 . TRP G 2 68  ? 54.848  31.632  45.275  1.00 40.87 ? 214 TRP G CD2 1 
ATOM 7721  N NE1 . TRP G 2 68  ? 54.836  33.806  45.816  1.00 40.82 ? 214 TRP G NE1 1 
ATOM 7722  C CE2 . TRP G 2 68  ? 55.275  32.580  46.231  1.00 40.05 ? 214 TRP G CE2 1 
ATOM 7723  C CE3 . TRP G 2 68  ? 55.171  30.283  45.470  1.00 40.13 ? 214 TRP G CE3 1 
ATOM 7724  C CZ2 . TRP G 2 68  ? 56.007  32.226  47.362  1.00 39.97 ? 214 TRP G CZ2 1 
ATOM 7725  C CZ3 . TRP G 2 68  ? 55.902  29.926  46.597  1.00 39.98 ? 214 TRP G CZ3 1 
ATOM 7726  C CH2 . TRP G 2 68  ? 56.314  30.896  47.530  1.00 40.37 ? 214 TRP G CH2 1 
ATOM 7727  N N   . SER G 2 69  ? 54.348  31.425  39.379  1.00 37.39 ? 215 SER G N   1 
ATOM 7728  C CA  . SER G 2 69  ? 53.699  31.043  38.140  1.00 35.90 ? 215 SER G CA  1 
ATOM 7729  C C   . SER G 2 69  ? 54.430  29.992  37.323  1.00 34.62 ? 215 SER G C   1 
ATOM 7730  O O   . SER G 2 69  ? 55.628  29.785  37.478  1.00 33.24 ? 215 SER G O   1 
ATOM 7731  C CB  . SER G 2 69  ? 53.469  32.288  37.292  1.00 35.05 ? 215 SER G CB  1 
ATOM 7732  O OG  . SER G 2 69  ? 54.703  32.894  36.989  1.00 36.11 ? 215 SER G OG  1 
ATOM 7733  N N   . LEU G 2 70  ? 53.670  29.326  36.458  1.00 34.15 ? 216 LEU G N   1 
ATOM 7734  C CA  . LEU G 2 70  ? 54.189  28.296  35.556  1.00 33.04 ? 216 LEU G CA  1 
ATOM 7735  C C   . LEU G 2 70  ? 53.879  28.808  34.156  1.00 31.88 ? 216 LEU G C   1 
ATOM 7736  O O   . LEU G 2 70  ? 52.735  29.153  33.859  1.00 32.30 ? 216 LEU G O   1 
ATOM 7737  C CB  . LEU G 2 70  ? 53.467  26.968  35.798  1.00 33.60 ? 216 LEU G CB  1 
ATOM 7738  C CG  . LEU G 2 70  ? 53.760  25.814  34.832  1.00 35.14 ? 216 LEU G CG  1 
ATOM 7739  C CD1 . LEU G 2 70  ? 55.232  25.431  34.931  1.00 35.74 ? 216 LEU G CD1 1 
ATOM 7740  C CD2 . LEU G 2 70  ? 52.856  24.608  35.150  1.00 33.45 ? 216 LEU G CD2 1 
ATOM 7741  N N   . ILE G 2 71  ? 54.887  28.884  33.300  1.00 30.54 ? 217 ILE G N   1 
ATOM 7742  C CA  . ILE G 2 71  ? 54.664  29.401  31.945  1.00 29.43 ? 217 ILE G CA  1 
ATOM 7743  C C   . ILE G 2 71  ? 54.974  28.397  30.830  1.00 28.85 ? 217 ILE G C   1 
ATOM 7744  O O   . ILE G 2 71  ? 56.077  27.835  30.770  1.00 27.66 ? 217 ILE G O   1 
ATOM 7745  C CB  . ILE G 2 71  ? 55.507  30.708  31.683  1.00 29.22 ? 217 ILE G CB  1 
ATOM 7746  C CG1 . ILE G 2 71  ? 55.016  31.842  32.582  1.00 28.89 ? 217 ILE G CG1 1 
ATOM 7747  C CG2 . ILE G 2 71  ? 55.382  31.152  30.242  1.00 27.39 ? 217 ILE G CG2 1 
ATOM 7748  C CD1 . ILE G 2 71  ? 55.387  31.679  34.036  1.00 30.60 ? 217 ILE G CD1 1 
ATOM 7749  N N   . MET G 2 72  ? 53.989  28.180  29.960  1.00 27.90 ? 218 MET G N   1 
ATOM 7750  C CA  . MET G 2 72  ? 54.134  27.279  28.820  1.00 27.86 ? 218 MET G CA  1 
ATOM 7751  C C   . MET G 2 72  ? 53.853  28.100  27.567  1.00 28.61 ? 218 MET G C   1 
ATOM 7752  O O   . MET G 2 72  ? 52.763  28.646  27.400  1.00 29.27 ? 218 MET G O   1 
ATOM 7753  C CB  . MET G 2 72  ? 53.152  26.107  28.918  1.00 26.88 ? 218 MET G CB  1 
ATOM 7754  C CG  . MET G 2 72  ? 53.487  25.136  30.032  1.00 27.32 ? 218 MET G CG  1 
ATOM 7755  S SD  . MET G 2 72  ? 52.373  23.720  30.143  1.00 28.55 ? 218 MET G SD  1 
ATOM 7756  C CE  . MET G 2 72  ? 51.126  24.313  31.325  1.00 26.98 ? 218 MET G CE  1 
ATOM 7757  N N   . GLU G 2 73  ? 54.849  28.182  26.690  1.00 28.96 ? 219 GLU G N   1 
ATOM 7758  C CA  . GLU G 2 73  ? 54.758  28.950  25.454  1.00 27.65 ? 219 GLU G CA  1 
ATOM 7759  C C   . GLU G 2 73  ? 54.285  28.106  24.262  1.00 27.70 ? 219 GLU G C   1 
ATOM 7760  O O   . GLU G 2 73  ? 54.549  26.901  24.193  1.00 26.41 ? 219 GLU G O   1 
ATOM 7761  C CB  . GLU G 2 73  ? 56.131  29.577  25.176  1.00 26.47 ? 219 GLU G CB  1 
ATOM 7762  C CG  . GLU G 2 73  ? 56.621  30.393  26.374  1.00 27.96 ? 219 GLU G CG  1 
ATOM 7763  C CD  . GLU G 2 73  ? 58.106  30.688  26.355  1.00 29.38 ? 219 GLU G CD  1 
ATOM 7764  O OE1 . GLU G 2 73  ? 58.897  29.723  26.258  1.00 31.91 ? 219 GLU G OE1 1 
ATOM 7765  O OE2 . GLU G 2 73  ? 58.488  31.879  26.451  1.00 30.23 ? 219 GLU G OE2 1 
ATOM 7766  N N   . SER G 2 74  ? 53.567  28.752  23.343  1.00 28.04 ? 220 SER G N   1 
ATOM 7767  C CA  . SER G 2 74  ? 53.045  28.108  22.143  1.00 28.81 ? 220 SER G CA  1 
ATOM 7768  C C   . SER G 2 74  ? 52.424  26.744  22.437  1.00 29.11 ? 220 SER G C   1 
ATOM 7769  O O   . SER G 2 74  ? 52.843  25.720  21.879  1.00 29.90 ? 220 SER G O   1 
ATOM 7770  C CB  . SER G 2 74  ? 54.158  27.941  21.109  1.00 30.27 ? 220 SER G CB  1 
ATOM 7771  O OG  . SER G 2 74  ? 54.780  29.182  20.827  1.00 32.80 ? 220 SER G OG  1 
ATOM 7772  N N   . VAL G 2 75  ? 51.420  26.731  23.301  1.00 27.21 ? 221 VAL G N   1 
ATOM 7773  C CA  . VAL G 2 75  ? 50.781  25.488  23.662  1.00 27.14 ? 221 VAL G CA  1 
ATOM 7774  C C   . VAL G 2 75  ? 50.168  24.751  22.468  1.00 28.08 ? 221 VAL G C   1 
ATOM 7775  O O   . VAL G 2 75  ? 49.811  25.352  21.440  1.00 26.26 ? 221 VAL G O   1 
ATOM 7776  C CB  . VAL G 2 75  ? 49.706  25.723  24.748  1.00 26.77 ? 221 VAL G CB  1 
ATOM 7777  C CG1 . VAL G 2 75  ? 50.369  26.248  26.005  1.00 26.35 ? 221 VAL G CG1 1 
ATOM 7778  C CG2 . VAL G 2 75  ? 48.655  26.708  24.261  1.00 26.28 ? 221 VAL G CG2 1 
ATOM 7779  N N   . VAL G 2 76  ? 50.058  23.435  22.620  1.00 28.29 ? 222 VAL G N   1 
ATOM 7780  C CA  . VAL G 2 76  ? 49.498  22.584  21.582  1.00 28.03 ? 222 VAL G CA  1 
ATOM 7781  C C   . VAL G 2 76  ? 48.573  21.598  22.254  1.00 29.38 ? 222 VAL G C   1 
ATOM 7782  O O   . VAL G 2 76  ? 48.611  21.440  23.480  1.00 29.61 ? 222 VAL G O   1 
ATOM 7783  C CB  . VAL G 2 76  ? 50.602  21.807  20.836  1.00 26.94 ? 222 VAL G CB  1 
ATOM 7784  C CG1 . VAL G 2 76  ? 51.450  22.761  20.053  1.00 24.01 ? 222 VAL G CG1 1 
ATOM 7785  C CG2 . VAL G 2 76  ? 51.451  21.027  21.823  1.00 25.23 ? 222 VAL G CG2 1 
ATOM 7786  N N   . PRO G 2 77  ? 47.736  20.906  21.461  1.00 30.08 ? 223 PRO G N   1 
ATOM 7787  C CA  . PRO G 2 77  ? 46.785  19.918  21.992  1.00 29.61 ? 223 PRO G CA  1 
ATOM 7788  C C   . PRO G 2 77  ? 47.364  18.933  23.016  1.00 29.36 ? 223 PRO G C   1 
ATOM 7789  O O   . PRO G 2 77  ? 46.735  18.663  24.042  1.00 29.16 ? 223 PRO G O   1 
ATOM 7790  C CB  . PRO G 2 77  ? 46.282  19.214  20.730  1.00 29.86 ? 223 PRO G CB  1 
ATOM 7791  C CG  . PRO G 2 77  ? 46.289  20.330  19.713  1.00 29.64 ? 223 PRO G CG  1 
ATOM 7792  C CD  . PRO G 2 77  ? 47.606  21.035  19.995  1.00 29.56 ? 223 PRO G CD  1 
ATOM 7793  N N   . SER G 2 78  ? 48.555  18.402  22.747  1.00 29.22 ? 224 SER G N   1 
ATOM 7794  C CA  . SER G 2 78  ? 49.160  17.442  23.662  1.00 29.39 ? 224 SER G CA  1 
ATOM 7795  C C   . SER G 2 78  ? 49.448  17.996  25.065  1.00 28.71 ? 224 SER G C   1 
ATOM 7796  O O   . SER G 2 78  ? 49.746  17.222  25.989  1.00 28.27 ? 224 SER G O   1 
ATOM 7797  C CB  . SER G 2 78  ? 50.433  16.861  23.040  1.00 30.86 ? 224 SER G CB  1 
ATOM 7798  O OG  . SER G 2 78  ? 51.268  17.867  22.488  1.00 33.77 ? 224 SER G OG  1 
ATOM 7799  N N   . ASP G 2 79  ? 49.348  19.320  25.224  1.00 27.71 ? 225 ASP G N   1 
ATOM 7800  C CA  . ASP G 2 79  ? 49.590  19.956  26.521  1.00 26.47 ? 225 ASP G CA  1 
ATOM 7801  C C   . ASP G 2 79  ? 48.371  19.801  27.413  1.00 26.53 ? 225 ASP G C   1 
ATOM 7802  O O   . ASP G 2 79  ? 48.424  20.102  28.603  1.00 26.42 ? 225 ASP G O   1 
ATOM 7803  C CB  . ASP G 2 79  ? 49.898  21.443  26.357  1.00 25.97 ? 225 ASP G CB  1 
ATOM 7804  C CG  . ASP G 2 79  ? 51.227  21.694  25.675  1.00 26.60 ? 225 ASP G CG  1 
ATOM 7805  O OD1 . ASP G 2 79  ? 52.233  21.122  26.128  1.00 25.76 ? 225 ASP G OD1 1 
ATOM 7806  O OD2 . ASP G 2 79  ? 51.275  22.468  24.690  1.00 27.11 ? 225 ASP G OD2 1 
ATOM 7807  N N   . LYS G 2 80  ? 47.271  19.329  26.832  1.00 26.86 ? 226 LYS G N   1 
ATOM 7808  C CA  . LYS G 2 80  ? 46.039  19.131  27.591  1.00 28.08 ? 226 LYS G CA  1 
ATOM 7809  C C   . LYS G 2 80  ? 46.331  18.282  28.813  1.00 27.91 ? 226 LYS G C   1 
ATOM 7810  O O   . LYS G 2 80  ? 47.139  17.359  28.743  1.00 29.05 ? 226 LYS G O   1 
ATOM 7811  C CB  . LYS G 2 80  ? 44.983  18.422  26.746  1.00 28.21 ? 226 LYS G CB  1 
ATOM 7812  C CG  . LYS G 2 80  ? 43.768  18.017  27.554  1.00 29.21 ? 226 LYS G CG  1 
ATOM 7813  C CD  . LYS G 2 80  ? 42.705  17.361  26.695  1.00 29.85 ? 226 LYS G CD  1 
ATOM 7814  C CE  . LYS G 2 80  ? 41.448  17.091  27.492  1.00 30.21 ? 226 LYS G CE  1 
ATOM 7815  N NZ  . LYS G 2 80  ? 40.401  16.452  26.647  1.00 33.74 ? 226 LYS G NZ  1 
ATOM 7816  N N   . GLY G 2 81  ? 45.680  18.588  29.926  1.00 27.02 ? 227 GLY G N   1 
ATOM 7817  C CA  . GLY G 2 81  ? 45.917  17.816  31.127  1.00 27.89 ? 227 GLY G CA  1 
ATOM 7818  C C   . GLY G 2 81  ? 45.797  18.643  32.393  1.00 28.30 ? 227 GLY G C   1 
ATOM 7819  O O   . GLY G 2 81  ? 45.447  19.818  32.343  1.00 29.14 ? 227 GLY G O   1 
ATOM 7820  N N   . ASN G 2 82  ? 46.090  18.031  33.535  1.00 28.91 ? 228 ASN G N   1 
ATOM 7821  C CA  . ASN G 2 82  ? 45.996  18.727  34.811  1.00 29.65 ? 228 ASN G CA  1 
ATOM 7822  C C   . ASN G 2 82  ? 47.330  19.243  35.302  1.00 29.16 ? 228 ASN G C   1 
ATOM 7823  O O   . ASN G 2 82  ? 48.319  18.508  35.318  1.00 30.87 ? 228 ASN G O   1 
ATOM 7824  C CB  . ASN G 2 82  ? 45.430  17.801  35.876  1.00 30.79 ? 228 ASN G CB  1 
ATOM 7825  C CG  . ASN G 2 82  ? 43.997  17.426  35.608  1.00 33.33 ? 228 ASN G CG  1 
ATOM 7826  O OD1 . ASN G 2 82  ? 43.421  16.603  36.308  1.00 34.82 ? 228 ASN G OD1 1 
ATOM 7827  N ND2 . ASN G 2 82  ? 43.405  18.037  34.589  1.00 36.76 ? 228 ASN G ND2 1 
ATOM 7828  N N   . TYR G 2 83  ? 47.365  20.504  35.706  1.00 27.04 ? 229 TYR G N   1 
ATOM 7829  C CA  . TYR G 2 83  ? 48.591  21.066  36.233  1.00 26.18 ? 229 TYR G CA  1 
ATOM 7830  C C   . TYR G 2 83  ? 48.317  21.471  37.674  1.00 27.41 ? 229 TYR G C   1 
ATOM 7831  O O   . TYR G 2 83  ? 47.362  22.215  37.978  1.00 27.67 ? 229 TYR G O   1 
ATOM 7832  C CB  . TYR G 2 83  ? 49.064  22.226  35.364  1.00 25.15 ? 229 TYR G CB  1 
ATOM 7833  C CG  . TYR G 2 83  ? 49.417  21.747  33.976  1.00 23.53 ? 229 TYR G CG  1 
ATOM 7834  C CD1 . TYR G 2 83  ? 48.420  21.477  33.040  1.00 22.54 ? 229 TYR G CD1 1 
ATOM 7835  C CD2 . TYR G 2 83  ? 50.741  21.464  33.630  1.00 22.27 ? 229 TYR G CD2 1 
ATOM 7836  C CE1 . TYR G 2 83  ? 48.728  20.935  31.796  1.00 22.87 ? 229 TYR G CE1 1 
ATOM 7837  C CE2 . TYR G 2 83  ? 51.061  20.916  32.396  1.00 21.02 ? 229 TYR G CE2 1 
ATOM 7838  C CZ  . TYR G 2 83  ? 50.056  20.655  31.486  1.00 22.79 ? 229 TYR G CZ  1 
ATOM 7839  O OH  . TYR G 2 83  ? 50.381  20.116  30.263  1.00 25.33 ? 229 TYR G OH  1 
ATOM 7840  N N   . THR G 2 84  ? 49.146  20.937  38.570  1.00 26.76 ? 230 THR G N   1 
ATOM 7841  C CA  . THR G 2 84  ? 48.982  21.165  39.992  1.00 25.37 ? 230 THR G CA  1 
ATOM 7842  C C   . THR G 2 84  ? 50.175  21.824  40.637  1.00 26.13 ? 230 THR G C   1 
ATOM 7843  O O   . THR G 2 84  ? 51.311  21.404  40.448  1.00 27.63 ? 230 THR G O   1 
ATOM 7844  C CB  . THR G 2 84  ? 48.710  19.836  40.693  1.00 24.10 ? 230 THR G CB  1 
ATOM 7845  O OG1 . THR G 2 84  ? 47.437  19.323  40.259  1.00 21.85 ? 230 THR G OG1 1 
ATOM 7846  C CG2 . THR G 2 84  ? 48.746  20.010  42.196  1.00 21.14 ? 230 THR G CG2 1 
ATOM 7847  N N   . CYS G 2 85  ? 49.916  22.876  41.394  1.00 26.14 ? 231 CYS G N   1 
ATOM 7848  C CA  . CYS G 2 85  ? 50.987  23.571  42.083  1.00 25.73 ? 231 CYS G CA  1 
ATOM 7849  C C   . CYS G 2 85  ? 50.948  23.104  43.528  1.00 25.73 ? 231 CYS G C   1 
ATOM 7850  O O   . CYS G 2 85  ? 49.886  23.070  44.158  1.00 25.47 ? 231 CYS G O   1 
ATOM 7851  C CB  . CYS G 2 85  ? 50.793  25.082  42.019  1.00 25.88 ? 231 CYS G CB  1 
ATOM 7852  S SG  . CYS G 2 85  ? 49.404  25.653  42.976  1.00 27.34 ? 231 CYS G SG  1 
ATOM 7853  N N   . VAL G 2 86  ? 52.106  22.727  44.049  1.00 26.41 ? 232 VAL G N   1 
ATOM 7854  C CA  . VAL G 2 86  ? 52.179  22.256  45.414  1.00 28.75 ? 232 VAL G CA  1 
ATOM 7855  C C   . VAL G 2 86  ? 53.112  23.160  46.197  1.00 30.09 ? 232 VAL G C   1 
ATOM 7856  O O   . VAL G 2 86  ? 54.313  23.215  45.947  1.00 31.27 ? 232 VAL G O   1 
ATOM 7857  C CB  . VAL G 2 86  ? 52.650  20.783  45.464  1.00 29.34 ? 232 VAL G CB  1 
ATOM 7858  C CG1 . VAL G 2 86  ? 52.605  20.265  46.901  1.00 27.71 ? 232 VAL G CG1 1 
ATOM 7859  C CG2 . VAL G 2 86  ? 51.752  19.928  44.552  1.00 26.98 ? 232 VAL G CG2 1 
ATOM 7860  N N   . VAL G 2 87  ? 52.531  23.879  47.144  1.00 31.49 ? 233 VAL G N   1 
ATOM 7861  C CA  . VAL G 2 87  ? 53.255  24.837  47.972  1.00 33.69 ? 233 VAL G CA  1 
ATOM 7862  C C   . VAL G 2 87  ? 53.386  24.312  49.392  1.00 34.45 ? 233 VAL G C   1 
ATOM 7863  O O   . VAL G 2 87  ? 52.429  23.742  49.931  1.00 35.09 ? 233 VAL G O   1 
ATOM 7864  C CB  . VAL G 2 87  ? 52.485  26.184  48.006  1.00 34.19 ? 233 VAL G CB  1 
ATOM 7865  C CG1 . VAL G 2 87  ? 53.118  27.129  48.989  1.00 34.32 ? 233 VAL G CG1 1 
ATOM 7866  C CG2 . VAL G 2 87  ? 52.442  26.787  46.607  1.00 34.54 ? 233 VAL G CG2 1 
ATOM 7867  N N   . GLU G 2 88  ? 54.548  24.510  50.012  1.00 35.44 ? 234 GLU G N   1 
ATOM 7868  C CA  . GLU G 2 88  ? 54.719  24.030  51.380  1.00 37.32 ? 234 GLU G CA  1 
ATOM 7869  C C   . GLU G 2 88  ? 55.899  24.573  52.185  1.00 37.59 ? 234 GLU G C   1 
ATOM 7870  O O   . GLU G 2 88  ? 56.845  25.159  51.650  1.00 38.26 ? 234 GLU G O   1 
ATOM 7871  C CB  . GLU G 2 88  ? 54.838  22.515  51.379  1.00 38.48 ? 234 GLU G CB  1 
ATOM 7872  C CG  . GLU G 2 88  ? 56.205  22.041  50.930  1.00 41.19 ? 234 GLU G CG  1 
ATOM 7873  C CD  . GLU G 2 88  ? 56.377  20.554  51.108  1.00 43.30 ? 234 GLU G CD  1 
ATOM 7874  O OE1 . GLU G 2 88  ? 55.574  19.804  50.492  1.00 45.02 ? 234 GLU G OE1 1 
ATOM 7875  O OE2 . GLU G 2 88  ? 57.304  20.146  51.859  1.00 41.94 ? 234 GLU G OE2 1 
ATOM 7876  N N   . ASN G 2 89  ? 55.806  24.358  53.492  1.00 37.45 ? 235 ASN G N   1 
ATOM 7877  C CA  . ASN G 2 89  ? 56.842  24.704  54.451  1.00 37.55 ? 235 ASN G CA  1 
ATOM 7878  C C   . ASN G 2 89  ? 56.611  23.763  55.643  1.00 38.27 ? 235 ASN G C   1 
ATOM 7879  O O   . ASN G 2 89  ? 55.716  22.915  55.595  1.00 37.06 ? 235 ASN G O   1 
ATOM 7880  C CB  . ASN G 2 89  ? 56.806  26.186  54.862  1.00 36.26 ? 235 ASN G CB  1 
ATOM 7881  C CG  . ASN G 2 89  ? 55.586  26.555  55.650  1.00 35.36 ? 235 ASN G CG  1 
ATOM 7882  O OD1 . ASN G 2 89  ? 55.062  25.757  56.420  1.00 35.25 ? 235 ASN G OD1 1 
ATOM 7883  N ND2 . ASN G 2 89  ? 55.137  27.792  55.484  1.00 35.40 ? 235 ASN G ND2 1 
ATOM 7884  N N   . GLU G 2 90  ? 57.399  23.896  56.704  1.00 39.34 ? 236 GLU G N   1 
ATOM 7885  C CA  . GLU G 2 90  ? 57.267  22.989  57.836  1.00 40.23 ? 236 GLU G CA  1 
ATOM 7886  C C   . GLU G 2 90  ? 55.938  22.987  58.575  1.00 39.80 ? 236 GLU G C   1 
ATOM 7887  O O   . GLU G 2 90  ? 55.690  22.095  59.389  1.00 39.55 ? 236 GLU G O   1 
ATOM 7888  C CB  . GLU G 2 90  ? 58.395  23.231  58.836  1.00 42.43 ? 236 GLU G CB  1 
ATOM 7889  C CG  . GLU G 2 90  ? 58.532  24.664  59.283  1.00 47.36 ? 236 GLU G CG  1 
ATOM 7890  C CD  . GLU G 2 90  ? 59.491  24.811  60.461  1.00 50.54 ? 236 GLU G CD  1 
ATOM 7891  O OE1 . GLU G 2 90  ? 59.119  24.386  61.586  1.00 51.82 ? 236 GLU G OE1 1 
ATOM 7892  O OE2 . GLU G 2 90  ? 60.612  25.343  60.254  1.00 50.93 ? 236 GLU G OE2 1 
ATOM 7893  N N   . TYR G 2 91  ? 55.076  23.961  58.295  1.00 39.33 ? 237 TYR G N   1 
ATOM 7894  C CA  . TYR G 2 91  ? 53.779  24.028  58.976  1.00 38.23 ? 237 TYR G CA  1 
ATOM 7895  C C   . TYR G 2 91  ? 52.598  23.626  58.102  1.00 36.87 ? 237 TYR G C   1 
ATOM 7896  O O   . TYR G 2 91  ? 51.447  23.740  58.522  1.00 36.20 ? 237 TYR G O   1 
ATOM 7897  C CB  . TYR G 2 91  ? 53.532  25.429  59.540  1.00 38.62 ? 237 TYR G CB  1 
ATOM 7898  C CG  . TYR G 2 91  ? 54.707  25.948  60.315  1.00 40.67 ? 237 TYR G CG  1 
ATOM 7899  C CD1 . TYR G 2 91  ? 55.633  26.800  59.715  1.00 42.16 ? 237 TYR G CD1 1 
ATOM 7900  C CD2 . TYR G 2 91  ? 54.943  25.530  61.626  1.00 40.92 ? 237 TYR G CD2 1 
ATOM 7901  C CE1 . TYR G 2 91  ? 56.765  27.222  60.391  1.00 43.55 ? 237 TYR G CE1 1 
ATOM 7902  C CE2 . TYR G 2 91  ? 56.075  25.941  62.316  1.00 42.96 ? 237 TYR G CE2 1 
ATOM 7903  C CZ  . TYR G 2 91  ? 56.986  26.788  61.691  1.00 44.22 ? 237 TYR G CZ  1 
ATOM 7904  O OH  . TYR G 2 91  ? 58.133  27.196  62.345  1.00 46.21 ? 237 TYR G OH  1 
ATOM 7905  N N   . GLY G 2 92  ? 52.874  23.162  56.888  1.00 36.14 ? 238 GLY G N   1 
ATOM 7906  C CA  . GLY G 2 92  ? 51.788  22.749  56.020  1.00 34.56 ? 238 GLY G CA  1 
ATOM 7907  C C   . GLY G 2 92  ? 52.100  22.601  54.545  1.00 33.01 ? 238 GLY G C   1 
ATOM 7908  O O   . GLY G 2 92  ? 53.176  22.967  54.073  1.00 32.69 ? 238 GLY G O   1 
ATOM 7909  N N   . SER G 2 93  ? 51.139  22.053  53.815  1.00 31.46 ? 239 SER G N   1 
ATOM 7910  C CA  . SER G 2 93  ? 51.291  21.858  52.386  1.00 31.26 ? 239 SER G CA  1 
ATOM 7911  C C   . SER G 2 93  ? 49.917  21.952  51.735  1.00 30.54 ? 239 SER G C   1 
ATOM 7912  O O   . SER G 2 93  ? 48.981  21.253  52.129  1.00 30.32 ? 239 SER G O   1 
ATOM 7913  C CB  . SER G 2 93  ? 51.909  20.490  52.099  1.00 32.72 ? 239 SER G CB  1 
ATOM 7914  O OG  . SER G 2 93  ? 52.574  20.480  50.841  1.00 34.35 ? 239 SER G OG  1 
ATOM 7915  N N   . ILE G 2 94  ? 49.782  22.839  50.756  1.00 29.03 ? 240 ILE G N   1 
ATOM 7916  C CA  . ILE G 2 94  ? 48.503  22.988  50.054  1.00 28.20 ? 240 ILE G CA  1 
ATOM 7917  C C   . ILE G 2 94  ? 48.743  22.945  48.557  1.00 28.03 ? 240 ILE G C   1 
ATOM 7918  O O   . ILE G 2 94  ? 49.848  23.231  48.080  1.00 28.15 ? 240 ILE G O   1 
ATOM 7919  C CB  . ILE G 2 94  ? 47.762  24.301  50.398  1.00 25.93 ? 240 ILE G CB  1 
ATOM 7920  C CG1 . ILE G 2 94  ? 48.614  25.509  49.974  1.00 26.01 ? 240 ILE G CG1 1 
ATOM 7921  C CG2 . ILE G 2 94  ? 47.392  24.301  51.871  1.00 24.11 ? 240 ILE G CG2 1 
ATOM 7922  C CD1 . ILE G 2 94  ? 48.026  26.879  50.327  1.00 24.44 ? 240 ILE G CD1 1 
ATOM 7923  N N   . ASN G 2 95  ? 47.708  22.561  47.822  1.00 27.21 ? 241 ASN G N   1 
ATOM 7924  C CA  . ASN G 2 95  ? 47.813  22.455  46.377  1.00 27.08 ? 241 ASN G CA  1 
ATOM 7925  C C   . ASN G 2 95  ? 46.569  22.991  45.710  1.00 26.93 ? 241 ASN G C   1 
ATOM 7926  O O   . ASN G 2 95  ? 45.520  23.145  46.337  1.00 25.76 ? 241 ASN G O   1 
ATOM 7927  C CB  . ASN G 2 95  ? 48.005  20.993  45.950  1.00 26.97 ? 241 ASN G CB  1 
ATOM 7928  C CG  . ASN G 2 95  ? 46.891  20.090  46.464  1.00 27.12 ? 241 ASN G CG  1 
ATOM 7929  O OD1 . ASN G 2 95  ? 46.964  19.573  47.582  1.00 26.11 ? 241 ASN G OD1 1 
ATOM 7930  N ND2 . ASN G 2 95  ? 45.841  19.922  45.663  1.00 26.06 ? 241 ASN G ND2 1 
ATOM 7931  N N   . HIS G 2 96  ? 46.710  23.261  44.419  1.00 27.95 ? 242 HIS G N   1 
ATOM 7932  C CA  . HIS G 2 96  ? 45.625  23.772  43.598  1.00 28.21 ? 242 HIS G CA  1 
ATOM 7933  C C   . HIS G 2 96  ? 45.815  23.164  42.217  1.00 27.73 ? 242 HIS G C   1 
ATOM 7934  O O   . HIS G 2 96  ? 46.941  23.062  41.735  1.00 26.58 ? 242 HIS G O   1 
ATOM 7935  C CB  . HIS G 2 96  ? 45.719  25.294  43.507  1.00 29.53 ? 242 HIS G CB  1 
ATOM 7936  C CG  . HIS G 2 96  ? 44.657  25.898  42.654  1.00 31.10 ? 242 HIS G CG  1 
ATOM 7937  N ND1 . HIS G 2 96  ? 43.347  26.009  43.068  1.00 31.92 ? 242 HIS G ND1 1 
ATOM 7938  C CD2 . HIS G 2 96  ? 44.697  26.366  41.383  1.00 30.58 ? 242 HIS G CD2 1 
ATOM 7939  C CE1 . HIS G 2 96  ? 42.626  26.523  42.086  1.00 31.75 ? 242 HIS G CE1 1 
ATOM 7940  N NE2 . HIS G 2 96  ? 43.421  26.745  41.053  1.00 31.28 ? 242 HIS G NE2 1 
ATOM 7941  N N   . THR G 2 97  ? 44.730  22.775  41.565  1.00 28.29 ? 243 THR G N   1 
ATOM 7942  C CA  . THR G 2 97  ? 44.861  22.166  40.246  1.00 30.02 ? 243 THR G CA  1 
ATOM 7943  C C   . THR G 2 97  ? 44.136  22.927  39.139  1.00 30.36 ? 243 THR G C   1 
ATOM 7944  O O   . THR G 2 97  ? 42.991  23.352  39.308  1.00 31.01 ? 243 THR G O   1 
ATOM 7945  C CB  . THR G 2 97  ? 44.345  20.710  40.288  1.00 31.43 ? 243 THR G CB  1 
ATOM 7946  O OG1 . THR G 2 97  ? 45.015  20.013  41.352  1.00 32.31 ? 243 THR G OG1 1 
ATOM 7947  C CG2 . THR G 2 97  ? 44.590  20.002  38.953  1.00 29.58 ? 243 THR G CG2 1 
ATOM 7948  N N   . TYR G 2 98  ? 44.821  23.100  38.014  1.00 29.98 ? 244 TYR G N   1 
ATOM 7949  C CA  . TYR G 2 98  ? 44.262  23.779  36.854  1.00 31.37 ? 244 TYR G CA  1 
ATOM 7950  C C   . TYR G 2 98  ? 44.128  22.747  35.746  1.00 32.62 ? 244 TYR G C   1 
ATOM 7951  O O   . TYR G 2 98  ? 44.938  21.821  35.667  1.00 34.25 ? 244 TYR G O   1 
ATOM 7952  C CB  . TYR G 2 98  ? 45.213  24.869  36.356  1.00 32.95 ? 244 TYR G CB  1 
ATOM 7953  C CG  . TYR G 2 98  ? 45.317  26.098  37.228  1.00 35.64 ? 244 TYR G CG  1 
ATOM 7954  C CD1 . TYR G 2 98  ? 46.560  26.554  37.670  1.00 36.34 ? 244 TYR G CD1 1 
ATOM 7955  C CD2 . TYR G 2 98  ? 44.181  26.815  37.601  1.00 36.07 ? 244 TYR G CD2 1 
ATOM 7956  C CE1 . TYR G 2 98  ? 46.672  27.693  38.463  1.00 37.04 ? 244 TYR G CE1 1 
ATOM 7957  C CE2 . TYR G 2 98  ? 44.280  27.957  38.394  1.00 36.73 ? 244 TYR G CE2 1 
ATOM 7958  C CZ  . TYR G 2 98  ? 45.527  28.388  38.820  1.00 37.74 ? 244 TYR G CZ  1 
ATOM 7959  O OH  . TYR G 2 98  ? 45.634  29.514  39.602  1.00 38.49 ? 244 TYR G OH  1 
ATOM 7960  N N   . HIS G 2 99  ? 43.121  22.881  34.889  1.00 32.32 ? 245 HIS G N   1 
ATOM 7961  C CA  . HIS G 2 99  ? 42.997  21.947  33.771  1.00 31.61 ? 245 HIS G CA  1 
ATOM 7962  C C   . HIS G 2 99  ? 43.282  22.758  32.507  1.00 31.75 ? 245 HIS G C   1 
ATOM 7963  O O   . HIS G 2 99  ? 42.735  23.840  32.309  1.00 32.25 ? 245 HIS G O   1 
ATOM 7964  C CB  . HIS G 2 99  ? 41.599  21.317  33.721  1.00 29.91 ? 245 HIS G CB  1 
ATOM 7965  N N   . LEU G 2 100 ? 44.180  22.260  31.672  1.00 32.00 ? 246 LEU G N   1 
ATOM 7966  C CA  . LEU G 2 100 ? 44.507  22.954  30.438  1.00 33.30 ? 246 LEU G CA  1 
ATOM 7967  C C   . LEU G 2 100 ? 43.864  22.239  29.251  1.00 34.82 ? 246 LEU G C   1 
ATOM 7968  O O   . LEU G 2 100 ? 43.880  21.011  29.169  1.00 35.66 ? 246 LEU G O   1 
ATOM 7969  C CB  . LEU G 2 100 ? 46.029  23.007  30.241  1.00 32.10 ? 246 LEU G CB  1 
ATOM 7970  C CG  . LEU G 2 100 ? 46.542  23.508  28.882  1.00 30.47 ? 246 LEU G CG  1 
ATOM 7971  C CD1 . LEU G 2 100 ? 45.932  24.864  28.552  1.00 30.51 ? 246 LEU G CD1 1 
ATOM 7972  C CD2 . LEU G 2 100 ? 48.056  23.588  28.913  1.00 28.94 ? 246 LEU G CD2 1 
ATOM 7973  N N   . ASP G 2 101 ? 43.288  23.013  28.339  1.00 36.41 ? 247 ASP G N   1 
ATOM 7974  C CA  . ASP G 2 101 ? 42.666  22.455  27.147  1.00 37.44 ? 247 ASP G CA  1 
ATOM 7975  C C   . ASP G 2 101 ? 43.044  23.346  25.966  1.00 37.16 ? 247 ASP G C   1 
ATOM 7976  O O   . ASP G 2 101 ? 42.865  24.563  26.023  1.00 38.30 ? 247 ASP G O   1 
ATOM 7977  C CB  . ASP G 2 101 ? 41.151  22.396  27.333  1.00 39.64 ? 247 ASP G CB  1 
ATOM 7978  C CG  . ASP G 2 101 ? 40.582  21.004  27.054  1.00 42.42 ? 247 ASP G CG  1 
ATOM 7979  O OD1 . ASP G 2 101 ? 39.528  20.634  27.641  1.00 43.13 ? 247 ASP G OD1 1 
ATOM 7980  O OD2 . ASP G 2 101 ? 41.194  20.281  26.236  1.00 42.31 ? 247 ASP G OD2 1 
ATOM 7981  N N   . VAL G 2 102 ? 43.585  22.754  24.904  1.00 36.03 ? 248 VAL G N   1 
ATOM 7982  C CA  . VAL G 2 102 ? 43.989  23.540  23.744  1.00 34.88 ? 248 VAL G CA  1 
ATOM 7983  C C   . VAL G 2 102 ? 43.107  23.287  22.538  1.00 34.45 ? 248 VAL G C   1 
ATOM 7984  O O   . VAL G 2 102 ? 42.780  22.151  22.214  1.00 34.98 ? 248 VAL G O   1 
ATOM 7985  C CB  . VAL G 2 102 ? 45.455  23.264  23.372  1.00 35.33 ? 248 VAL G CB  1 
ATOM 7986  C CG1 . VAL G 2 102 ? 45.873  24.144  22.209  1.00 35.77 ? 248 VAL G CG1 1 
ATOM 7987  C CG2 . VAL G 2 102 ? 46.344  23.549  24.566  1.00 36.60 ? 248 VAL G CG2 1 
ATOM 7988  N N   . VAL G 2 103 ? 42.726  24.366  21.868  1.00 34.25 ? 249 VAL G N   1 
ATOM 7989  C CA  . VAL G 2 103 ? 41.860  24.276  20.701  1.00 32.93 ? 249 VAL G CA  1 
ATOM 7990  C C   . VAL G 2 103 ? 42.530  24.914  19.496  1.00 32.60 ? 249 VAL G C   1 
ATOM 7991  O O   . VAL G 2 103 ? 43.025  26.034  19.570  1.00 32.95 ? 249 VAL G O   1 
ATOM 7992  C CB  . VAL G 2 103 ? 40.502  24.974  20.985  1.00 31.92 ? 249 VAL G CB  1 
ATOM 7993  C CG1 . VAL G 2 103 ? 39.617  24.923  19.788  1.00 30.21 ? 249 VAL G CG1 1 
ATOM 7994  C CG2 . VAL G 2 103 ? 39.817  24.296  22.157  1.00 32.50 ? 249 VAL G CG2 1 
ATOM 7995  N N   . GLU G 2 104 ? 42.562  24.191  18.384  1.00 32.95 ? 250 GLU G N   1 
ATOM 7996  C CA  . GLU G 2 104 ? 43.172  24.730  17.174  1.00 33.03 ? 250 GLU G CA  1 
ATOM 7997  C C   . GLU G 2 104 ? 42.125  25.452  16.352  1.00 32.21 ? 250 GLU G C   1 
ATOM 7998  O O   . GLU G 2 104 ? 41.130  24.856  15.968  1.00 32.60 ? 250 GLU G O   1 
ATOM 7999  C CB  . GLU G 2 104 ? 43.773  23.621  16.326  1.00 34.07 ? 250 GLU G CB  1 
ATOM 8000  C CG  . GLU G 2 104 ? 45.060  23.058  16.861  1.00 36.93 ? 250 GLU G CG  1 
ATOM 8001  C CD  . GLU G 2 104 ? 45.630  22.015  15.941  1.00 39.31 ? 250 GLU G CD  1 
ATOM 8002  O OE1 . GLU G 2 104 ? 45.023  20.917  15.835  1.00 39.06 ? 250 GLU G OE1 1 
ATOM 8003  O OE2 . GLU G 2 104 ? 46.676  22.312  15.315  1.00 40.69 ? 250 GLU G OE2 1 
ATOM 8004  N N   . ARG G 2 105 ? 42.319  26.738  16.090  1.00 31.15 ? 251 ARG G N   1 
ATOM 8005  C CA  . ARG G 2 105 ? 41.332  27.450  15.288  1.00 30.18 ? 251 ARG G CA  1 
ATOM 8006  C C   . ARG G 2 105 ? 41.736  27.322  13.830  1.00 29.64 ? 251 ARG G C   1 
ATOM 8007  O O   . ARG G 2 105 ? 42.842  26.910  13.537  1.00 29.31 ? 251 ARG G O   1 
ATOM 8008  C CB  . ARG G 2 105 ? 41.245  28.935  15.682  1.00 28.96 ? 251 ARG G CB  1 
ATOM 8009  C CG  . ARG G 2 105 ? 40.921  29.209  17.152  1.00 27.95 ? 251 ARG G CG  1 
ATOM 8010  C CD  . ARG G 2 105 ? 39.747  28.383  17.643  1.00 27.62 ? 251 ARG G CD  1 
ATOM 8011  N NE  . ARG G 2 105 ? 38.537  28.618  16.861  1.00 27.91 ? 251 ARG G NE  1 
ATOM 8012  C CZ  . ARG G 2 105 ? 37.679  29.609  17.078  1.00 28.83 ? 251 ARG G CZ  1 
ATOM 8013  N NH1 . ARG G 2 105 ? 37.886  30.476  18.063  1.00 28.51 ? 251 ARG G NH1 1 
ATOM 8014  N NH2 . ARG G 2 105 ? 36.606  29.732  16.310  1.00 28.61 ? 251 ARG G NH2 1 
ATOM 8015  N N   . TRP G 2 106 ? 40.826  27.664  12.927  1.00 31.15 ? 252 TRP G N   1 
ATOM 8016  C CA  . TRP G 2 106 ? 41.063  27.610  11.486  1.00 31.78 ? 252 TRP G CA  1 
ATOM 8017  C C   . TRP G 2 106 ? 40.482  28.914  10.961  1.00 31.39 ? 252 TRP G C   1 
ATOM 8018  O O   . TRP G 2 106 ? 39.324  28.980  10.581  1.00 31.93 ? 252 TRP G O   1 
ATOM 8019  C CB  . TRP G 2 106 ? 40.331  26.413  10.866  1.00 32.90 ? 252 TRP G CB  1 
ATOM 8020  C CG  . TRP G 2 106 ? 40.666  26.195  9.422   1.00 36.52 ? 252 TRP G CG  1 
ATOM 8021  C CD1 . TRP G 2 106 ? 41.887  25.847  8.904   1.00 37.14 ? 252 TRP G CD1 1 
ATOM 8022  C CD2 . TRP G 2 106 ? 39.784  26.346  8.301   1.00 37.32 ? 252 TRP G CD2 1 
ATOM 8023  N NE1 . TRP G 2 106 ? 41.817  25.779  7.530   1.00 37.61 ? 252 TRP G NE1 1 
ATOM 8024  C CE2 . TRP G 2 106 ? 40.540  26.080  7.135   1.00 38.02 ? 252 TRP G CE2 1 
ATOM 8025  C CE3 . TRP G 2 106 ? 38.431  26.682  8.168   1.00 37.66 ? 252 TRP G CE3 1 
ATOM 8026  C CZ2 . TRP G 2 106 ? 39.984  26.138  5.853   1.00 39.80 ? 252 TRP G CZ2 1 
ATOM 8027  C CZ3 . TRP G 2 106 ? 37.880  26.738  6.896   1.00 38.40 ? 252 TRP G CZ3 1 
ATOM 8028  C CH2 . TRP G 2 106 ? 38.656  26.468  5.754   1.00 39.41 ? 252 TRP G CH2 1 
ATOM 8029  N N   . PRO G 2 107 ? 41.290  29.974  10.935  1.00 31.72 ? 253 PRO G N   1 
ATOM 8030  C CA  . PRO G 2 107 ? 40.803  31.266  10.460  1.00 31.87 ? 253 PRO G CA  1 
ATOM 8031  C C   . PRO G 2 107 ? 40.690  31.434  8.947   1.00 32.72 ? 253 PRO G C   1 
ATOM 8032  O O   . PRO G 2 107 ? 41.336  32.311  8.369   1.00 33.40 ? 253 PRO G O   1 
ATOM 8033  C CB  . PRO G 2 107 ? 41.798  32.234  11.080  1.00 30.87 ? 253 PRO G CB  1 
ATOM 8034  C CG  . PRO G 2 107 ? 43.082  31.477  10.933  1.00 31.75 ? 253 PRO G CG  1 
ATOM 8035  C CD  . PRO G 2 107 ? 42.702  30.061  11.350  1.00 31.70 ? 253 PRO G CD  1 
ATOM 8036  N N   . HIS G 2 108 ? 39.871  30.612  8.297   1.00 32.58 ? 254 HIS G N   1 
ATOM 8037  C CA  . HIS G 2 108 ? 39.699  30.737  6.849   1.00 33.49 ? 254 HIS G CA  1 
ATOM 8038  C C   . HIS G 2 108 ? 38.236  30.758  6.471   1.00 32.70 ? 254 HIS G C   1 
ATOM 8039  O O   . HIS G 2 108 ? 37.365  30.421  7.275   1.00 33.41 ? 254 HIS G O   1 
ATOM 8040  C CB  . HIS G 2 108 ? 40.345  29.579  6.083   1.00 34.60 ? 254 HIS G CB  1 
ATOM 8041  C CG  . HIS G 2 108 ? 41.787  29.348  6.402   1.00 36.01 ? 254 HIS G CG  1 
ATOM 8042  N ND1 . HIS G 2 108 ? 42.211  28.860  7.620   1.00 36.97 ? 254 HIS G ND1 1 
ATOM 8043  C CD2 . HIS G 2 108 ? 42.896  29.452  5.631   1.00 36.76 ? 254 HIS G CD2 1 
ATOM 8044  C CE1 . HIS G 2 108 ? 43.518  28.664  7.585   1.00 37.60 ? 254 HIS G CE1 1 
ATOM 8045  N NE2 . HIS G 2 108 ? 43.957  29.012  6.388   1.00 38.41 ? 254 HIS G NE2 1 
ATOM 8046  N N   . ARG G 2 109 ? 37.978  31.144  5.230   1.00 32.07 ? 255 ARG G N   1 
ATOM 8047  C CA  . ARG G 2 109 ? 36.620  31.190  4.705   1.00 31.00 ? 255 ARG G CA  1 
ATOM 8048  C C   . ARG G 2 109 ? 36.237  29.734  4.479   1.00 29.47 ? 255 ARG G C   1 
ATOM 8049  O O   . ARG G 2 109 ? 37.106  28.866  4.461   1.00 28.76 ? 255 ARG G O   1 
ATOM 8050  C CB  . ARG G 2 109 ? 36.574  31.979  3.392   1.00 31.76 ? 255 ARG G CB  1 
ATOM 8051  C CG  . ARG G 2 109 ? 37.323  31.353  2.236   1.00 34.63 ? 255 ARG G CG  1 
ATOM 8052  C CD  . ARG G 2 109 ? 37.284  32.261  1.007   1.00 38.49 ? 255 ARG G CD  1 
ATOM 8053  N NE  . ARG G 2 109 ? 37.671  31.557  -0.220  1.00 43.48 ? 255 ARG G NE  1 
ATOM 8054  C CZ  . ARG G 2 109 ? 38.907  31.155  -0.518  1.00 45.41 ? 255 ARG G CZ  1 
ATOM 8055  N NH1 . ARG G 2 109 ? 39.916  31.390  0.317   1.00 46.34 ? 255 ARG G NH1 1 
ATOM 8056  N NH2 . ARG G 2 109 ? 39.130  30.483  -1.645  1.00 45.21 ? 255 ARG G NH2 1 
ATOM 8057  N N   . PRO G 2 110 ? 34.937  29.441  4.307   1.00 28.77 ? 256 PRO G N   1 
ATOM 8058  C CA  . PRO G 2 110 ? 34.574  28.036  4.104   1.00 28.54 ? 256 PRO G CA  1 
ATOM 8059  C C   . PRO G 2 110 ? 35.257  27.391  2.907   1.00 27.91 ? 256 PRO G C   1 
ATOM 8060  O O   . PRO G 2 110 ? 35.561  28.050  1.913   1.00 28.03 ? 256 PRO G O   1 
ATOM 8061  C CB  . PRO G 2 110 ? 33.048  28.088  3.983   1.00 27.92 ? 256 PRO G CB  1 
ATOM 8062  C CG  . PRO G 2 110 ? 32.814  29.413  3.376   1.00 27.94 ? 256 PRO G CG  1 
ATOM 8063  C CD  . PRO G 2 110 ? 33.758  30.307  4.135   1.00 28.63 ? 256 PRO G CD  1 
ATOM 8064  N N   . ILE G 2 111 ? 35.510  26.096  3.025   1.00 26.97 ? 257 ILE G N   1 
ATOM 8065  C CA  . ILE G 2 111 ? 36.157  25.331  1.969   1.00 26.36 ? 257 ILE G CA  1 
ATOM 8066  C C   . ILE G 2 111 ? 35.224  24.191  1.509   1.00 26.46 ? 257 ILE G C   1 
ATOM 8067  O O   . ILE G 2 111 ? 34.705  23.420  2.325   1.00 26.04 ? 257 ILE G O   1 
ATOM 8068  C CB  . ILE G 2 111 ? 37.518  24.747  2.479   1.00 26.81 ? 257 ILE G CB  1 
ATOM 8069  C CG1 . ILE G 2 111 ? 38.281  24.084  1.339   1.00 27.41 ? 257 ILE G CG1 1 
ATOM 8070  C CG2 . ILE G 2 111 ? 37.288  23.685  3.557   1.00 26.13 ? 257 ILE G CG2 1 
ATOM 8071  C CD1 . ILE G 2 111 ? 39.657  23.620  1.753   1.00 28.55 ? 257 ILE G CD1 1 
ATOM 8072  N N   . LEU G 2 112 ? 34.982  24.103  0.207   1.00 26.03 ? 258 LEU G N   1 
ATOM 8073  C CA  . LEU G 2 112 ? 34.128  23.048  -0.332  1.00 25.78 ? 258 LEU G CA  1 
ATOM 8074  C C   . LEU G 2 112 ? 34.985  21.941  -0.943  1.00 26.33 ? 258 LEU G C   1 
ATOM 8075  O O   . LEU G 2 112 ? 36.127  22.171  -1.331  1.00 26.25 ? 258 LEU G O   1 
ATOM 8076  C CB  . LEU G 2 112 ? 33.197  23.602  -1.416  1.00 24.91 ? 258 LEU G CB  1 
ATOM 8077  C CG  . LEU G 2 112 ? 32.390  24.867  -1.145  1.00 25.50 ? 258 LEU G CG  1 
ATOM 8078  C CD1 . LEU G 2 112 ? 31.310  25.016  -2.211  1.00 24.51 ? 258 LEU G CD1 1 
ATOM 8079  C CD2 . LEU G 2 112 ? 31.763  24.779  0.218   1.00 26.07 ? 258 LEU G CD2 1 
ATOM 8080  N N   . GLN G 2 113 ? 34.417  20.745  -1.041  1.00 27.58 ? 259 GLN G N   1 
ATOM 8081  C CA  . GLN G 2 113 ? 35.111  19.598  -1.604  1.00 28.08 ? 259 GLN G CA  1 
ATOM 8082  C C   . GLN G 2 113 ? 35.167  19.689  -3.127  1.00 28.53 ? 259 GLN G C   1 
ATOM 8083  O O   . GLN G 2 113 ? 34.161  19.950  -3.782  1.00 28.85 ? 259 GLN G O   1 
ATOM 8084  C CB  . GLN G 2 113 ? 34.397  18.325  -1.166  1.00 28.74 ? 259 GLN G CB  1 
ATOM 8085  C CG  . GLN G 2 113 ? 35.014  17.050  -1.694  1.00 31.46 ? 259 GLN G CG  1 
ATOM 8086  C CD  . GLN G 2 113 ? 34.213  15.808  -1.314  1.00 31.71 ? 259 GLN G CD  1 
ATOM 8087  O OE1 . GLN G 2 113 ? 33.965  15.540  -0.129  1.00 30.36 ? 259 GLN G OE1 1 
ATOM 8088  N NE2 . GLN G 2 113 ? 33.805  15.039  -2.326  1.00 32.45 ? 259 GLN G NE2 1 
ATOM 8089  N N   . ALA G 2 114 ? 36.354  19.478  -3.689  1.00 29.19 ? 260 ALA G N   1 
ATOM 8090  C CA  . ALA G 2 114 ? 36.539  19.540  -5.139  1.00 29.32 ? 260 ALA G CA  1 
ATOM 8091  C C   . ALA G 2 114 ? 35.610  18.553  -5.860  1.00 29.14 ? 260 ALA G C   1 
ATOM 8092  O O   . ALA G 2 114 ? 35.460  17.414  -5.438  1.00 28.47 ? 260 ALA G O   1 
ATOM 8093  C CB  . ALA G 2 114 ? 38.003  19.237  -5.489  1.00 26.77 ? 260 ALA G CB  1 
ATOM 8094  N N   . GLY G 2 115 ? 34.987  18.998  -6.944  1.00 29.39 ? 261 GLY G N   1 
ATOM 8095  C CA  . GLY G 2 115 ? 34.114  18.118  -7.694  1.00 30.67 ? 261 GLY G CA  1 
ATOM 8096  C C   . GLY G 2 115 ? 32.640  18.188  -7.321  1.00 32.13 ? 261 GLY G C   1 
ATOM 8097  O O   . GLY G 2 115 ? 31.786  17.704  -8.071  1.00 33.37 ? 261 GLY G O   1 
ATOM 8098  N N   . LEU G 2 116 ? 32.326  18.756  -6.159  1.00 31.90 ? 262 LEU G N   1 
ATOM 8099  C CA  . LEU G 2 116 ? 30.931  18.891  -5.745  1.00 31.20 ? 262 LEU G CA  1 
ATOM 8100  C C   . LEU G 2 116 ? 30.558  20.364  -5.674  1.00 32.16 ? 262 LEU G C   1 
ATOM 8101  O O   . LEU G 2 116 ? 31.328  21.188  -5.172  1.00 32.39 ? 262 LEU G O   1 
ATOM 8102  C CB  . LEU G 2 116 ? 30.680  18.273  -4.370  1.00 29.81 ? 262 LEU G CB  1 
ATOM 8103  C CG  . LEU G 2 116 ? 30.837  16.773  -4.138  1.00 28.80 ? 262 LEU G CG  1 
ATOM 8104  C CD1 . LEU G 2 116 ? 30.569  16.454  -2.674  1.00 24.94 ? 262 LEU G CD1 1 
ATOM 8105  C CD2 . LEU G 2 116 ? 29.895  16.020  -5.048  1.00 27.29 ? 262 LEU G CD2 1 
ATOM 8106  N N   . PRO G 2 117 ? 29.370  20.715  -6.183  1.00 32.49 ? 263 PRO G N   1 
ATOM 8107  C CA  . PRO G 2 117 ? 28.447  19.759  -6.792  1.00 33.40 ? 263 PRO G CA  1 
ATOM 8108  C C   . PRO G 2 117 ? 28.927  19.282  -8.170  1.00 33.99 ? 263 PRO G C   1 
ATOM 8109  O O   . PRO G 2 117 ? 29.656  19.986  -8.869  1.00 34.16 ? 263 PRO G O   1 
ATOM 8110  C CB  . PRO G 2 117 ? 27.151  20.553  -6.873  1.00 32.83 ? 263 PRO G CB  1 
ATOM 8111  C CG  . PRO G 2 117 ? 27.632  21.885  -7.199  1.00 32.21 ? 263 PRO G CG  1 
ATOM 8112  C CD  . PRO G 2 117 ? 28.781  22.061  -6.208  1.00 32.90 ? 263 PRO G CD  1 
ATOM 8113  N N   . ALA G 2 118 ? 28.509  18.081  -8.550  1.00 34.20 ? 264 ALA G N   1 
ATOM 8114  C CA  . ALA G 2 118 ? 28.887  17.507  -9.827  1.00 34.77 ? 264 ALA G CA  1 
ATOM 8115  C C   . ALA G 2 118 ? 27.877  17.849  -10.921 1.00 35.98 ? 264 ALA G C   1 
ATOM 8116  O O   . ALA G 2 118 ? 26.699  18.083  -10.642 1.00 36.31 ? 264 ALA G O   1 
ATOM 8117  C CB  . ALA G 2 118 ? 28.997  16.006  -9.674  1.00 32.54 ? 264 ALA G CB  1 
ATOM 8118  N N   . ASN G 2 119 ? 28.340  17.883  -12.169 1.00 37.67 ? 265 ASN G N   1 
ATOM 8119  C CA  . ASN G 2 119 ? 27.446  18.154  -13.287 1.00 39.10 ? 265 ASN G CA  1 
ATOM 8120  C C   . ASN G 2 119 ? 26.420  17.029  -13.319 1.00 40.89 ? 265 ASN G C   1 
ATOM 8121  O O   . ASN G 2 119 ? 26.712  15.907  -12.892 1.00 40.65 ? 265 ASN G O   1 
ATOM 8122  C CB  . ASN G 2 119 ? 28.202  18.169  -14.608 1.00 37.26 ? 265 ASN G CB  1 
ATOM 8123  C CG  . ASN G 2 119 ? 29.133  19.334  -14.729 1.00 36.22 ? 265 ASN G CG  1 
ATOM 8124  O OD1 . ASN G 2 119 ? 28.790  20.455  -14.387 1.00 35.93 ? 265 ASN G OD1 1 
ATOM 8125  N ND2 . ASN G 2 119 ? 30.319  19.080  -15.241 1.00 37.93 ? 265 ASN G ND2 1 
ATOM 8126  N N   . ALA G 2 120 ? 25.224  17.327  -13.818 1.00 43.17 ? 266 ALA G N   1 
ATOM 8127  C CA  . ALA G 2 120 ? 24.162  16.331  -13.885 1.00 44.61 ? 266 ALA G CA  1 
ATOM 8128  C C   . ALA G 2 120 ? 23.435  16.383  -15.212 1.00 45.63 ? 266 ALA G C   1 
ATOM 8129  O O   . ALA G 2 120 ? 23.293  17.440  -15.818 1.00 44.94 ? 266 ALA G O   1 
ATOM 8130  C CB  . ALA G 2 120 ? 23.171  16.542  -12.743 1.00 42.79 ? 266 ALA G CB  1 
ATOM 8131  N N   . SER G 2 121 ? 22.972  15.223  -15.656 1.00 47.89 ? 267 SER G N   1 
ATOM 8132  C CA  . SER G 2 121 ? 22.243  15.126  -16.906 1.00 49.84 ? 267 SER G CA  1 
ATOM 8133  C C   . SER G 2 121 ? 20.987  14.283  -16.695 1.00 51.07 ? 267 SER G C   1 
ATOM 8134  O O   . SER G 2 121 ? 20.972  13.374  -15.861 1.00 50.93 ? 267 SER G O   1 
ATOM 8135  C CB  . SER G 2 121 ? 23.141  14.502  -17.967 1.00 50.25 ? 267 SER G CB  1 
ATOM 8136  O OG  . SER G 2 121 ? 22.599  14.690  -19.259 1.00 52.30 ? 267 SER G OG  1 
ATOM 8137  N N   . THR G 2 122 ? 19.930  14.599  -17.440 1.00 52.84 ? 268 THR G N   1 
ATOM 8138  C CA  . THR G 2 122 ? 18.669  13.872  -17.320 1.00 54.24 ? 268 THR G CA  1 
ATOM 8139  C C   . THR G 2 122 ? 17.655  14.283  -18.376 1.00 54.69 ? 268 THR G C   1 
ATOM 8140  O O   . THR G 2 122 ? 17.680  15.404  -18.866 1.00 54.75 ? 268 THR G O   1 
ATOM 8141  C CB  . THR G 2 122 ? 18.026  14.119  -15.954 1.00 53.79 ? 268 THR G CB  1 
ATOM 8142  O OG1 . THR G 2 122 ? 16.820  13.355  -15.849 1.00 54.82 ? 268 THR G OG1 1 
ATOM 8143  C CG2 . THR G 2 122 ? 17.696  15.588  -15.790 1.00 53.83 ? 268 THR G CG2 1 
ATOM 8144  N N   . VAL G 2 123 ? 16.759  13.363  -18.717 1.00 55.83 ? 269 VAL G N   1 
ATOM 8145  C CA  . VAL G 2 123 ? 15.712  13.634  -19.693 1.00 55.76 ? 269 VAL G CA  1 
ATOM 8146  C C   . VAL G 2 123 ? 14.566  14.259  -18.908 1.00 55.39 ? 269 VAL G C   1 
ATOM 8147  O O   . VAL G 2 123 ? 14.384  13.958  -17.729 1.00 54.66 ? 269 VAL G O   1 
ATOM 8148  C CB  . VAL G 2 123 ? 15.227  12.337  -20.384 1.00 55.01 ? 269 VAL G CB  1 
ATOM 8149  N N   . VAL G 2 124 ? 13.817  15.144  -19.556 1.00 56.10 ? 270 VAL G N   1 
ATOM 8150  C CA  . VAL G 2 124 ? 12.693  15.814  -18.915 1.00 57.36 ? 270 VAL G CA  1 
ATOM 8151  C C   . VAL G 2 124 ? 11.896  14.842  -18.051 1.00 57.93 ? 270 VAL G C   1 
ATOM 8152  O O   . VAL G 2 124 ? 11.813  13.653  -18.363 1.00 58.31 ? 270 VAL G O   1 
ATOM 8153  C CB  . VAL G 2 124 ? 11.743  16.419  -19.966 1.00 56.93 ? 270 VAL G CB  1 
ATOM 8154  C CG1 . VAL G 2 124 ? 12.394  17.608  -20.634 1.00 57.10 ? 270 VAL G CG1 1 
ATOM 8155  C CG2 . VAL G 2 124 ? 11.393  15.365  -21.004 1.00 57.37 ? 270 VAL G CG2 1 
ATOM 8156  N N   . GLY G 2 125 ? 11.323  15.347  -16.964 1.00 58.36 ? 271 GLY G N   1 
ATOM 8157  C CA  . GLY G 2 125 ? 10.537  14.504  -16.082 1.00 58.92 ? 271 GLY G CA  1 
ATOM 8158  C C   . GLY G 2 125 ? 11.365  13.718  -15.083 1.00 59.08 ? 271 GLY G C   1 
ATOM 8159  O O   . GLY G 2 125 ? 10.833  13.165  -14.115 1.00 59.80 ? 271 GLY G O   1 
ATOM 8160  N N   . GLY G 2 126 ? 12.674  13.668  -15.315 1.00 58.94 ? 272 GLY G N   1 
ATOM 8161  C CA  . GLY G 2 126 ? 13.559  12.946  -14.421 1.00 58.58 ? 272 GLY G CA  1 
ATOM 8162  C C   . GLY G 2 126 ? 13.897  13.694  -13.143 1.00 58.65 ? 272 GLY G C   1 
ATOM 8163  O O   . GLY G 2 126 ? 13.665  14.896  -13.014 1.00 58.29 ? 272 GLY G O   1 
ATOM 8164  N N   . ASP G 2 127 ? 14.441  12.962  -12.182 1.00 58.47 ? 273 ASP G N   1 
ATOM 8165  C CA  . ASP G 2 127 ? 14.828  13.540  -10.908 1.00 58.11 ? 273 ASP G CA  1 
ATOM 8166  C C   . ASP G 2 127 ? 16.346  13.701  -10.883 1.00 57.37 ? 273 ASP G C   1 
ATOM 8167  O O   . ASP G 2 127 ? 17.060  13.021  -11.624 1.00 57.06 ? 273 ASP G O   1 
ATOM 8168  C CB  . ASP G 2 127 ? 14.308  12.657  -9.775  1.00 58.52 ? 273 ASP G CB  1 
ATOM 8169  C CG  . ASP G 2 127 ? 12.829  12.893  -9.506  1.00 60.03 ? 273 ASP G CG  1 
ATOM 8170  O OD1 . ASP G 2 127 ? 12.142  13.362  -10.448 1.00 59.82 ? 273 ASP G OD1 1 
ATOM 8171  O OD2 . ASP G 2 127 ? 12.355  12.620  -8.373  1.00 60.96 ? 273 ASP G OD2 1 
ATOM 8172  N N   . VAL G 2 128 ? 16.842  14.616  -10.054 1.00 55.68 ? 274 VAL G N   1 
ATOM 8173  C CA  . VAL G 2 128 ? 18.277  14.858  -10.004 1.00 53.25 ? 274 VAL G CA  1 
ATOM 8174  C C   . VAL G 2 128 ? 18.678  15.576  -8.714  1.00 52.27 ? 274 VAL G C   1 
ATOM 8175  O O   . VAL G 2 128 ? 17.856  16.233  -8.077  1.00 53.10 ? 274 VAL G O   1 
ATOM 8176  C CB  . VAL G 2 128 ? 18.702  15.690  -11.229 1.00 52.16 ? 274 VAL G CB  1 
ATOM 8177  C CG1 . VAL G 2 128 ? 18.403  17.158  -10.997 1.00 51.32 ? 274 VAL G CG1 1 
ATOM 8178  C CG2 . VAL G 2 128 ? 20.146  15.449  -11.538 1.00 52.13 ? 274 VAL G CG2 1 
ATOM 8179  N N   . GLU G 2 129 ? 19.937  15.437  -8.318  1.00 50.41 ? 275 GLU G N   1 
ATOM 8180  C CA  . GLU G 2 129 ? 20.407  16.080  -7.102  1.00 48.99 ? 275 GLU G CA  1 
ATOM 8181  C C   . GLU G 2 129 ? 21.825  16.615  -7.215  1.00 47.33 ? 275 GLU G C   1 
ATOM 8182  O O   . GLU G 2 129 ? 22.599  16.205  -8.077  1.00 47.37 ? 275 GLU G O   1 
ATOM 8183  C CB  . GLU G 2 129 ? 20.351  15.105  -5.928  1.00 49.53 ? 275 GLU G CB  1 
ATOM 8184  C CG  . GLU G 2 129 ? 21.207  13.867  -6.127  1.00 50.88 ? 275 GLU G CG  1 
ATOM 8185  C CD  . GLU G 2 129 ? 21.392  13.075  -4.852  1.00 51.35 ? 275 GLU G CD  1 
ATOM 8186  O OE1 . GLU G 2 129 ? 20.393  12.856  -4.137  1.00 53.02 ? 275 GLU G OE1 1 
ATOM 8187  O OE2 . GLU G 2 129 ? 22.536  12.665  -4.569  1.00 51.04 ? 275 GLU G OE2 1 
ATOM 8188  N N   . PHE G 2 130 ? 22.153  17.533  -6.317  1.00 44.98 ? 276 PHE G N   1 
ATOM 8189  C CA  . PHE G 2 130 ? 23.468  18.140  -6.264  1.00 42.31 ? 276 PHE G CA  1 
ATOM 8190  C C   . PHE G 2 130 ? 23.917  18.106  -4.810  1.00 41.27 ? 276 PHE G C   1 
ATOM 8191  O O   . PHE G 2 130 ? 23.220  18.599  -3.931  1.00 41.42 ? 276 PHE G O   1 
ATOM 8192  C CB  . PHE G 2 130 ? 23.400  19.588  -6.745  1.00 40.26 ? 276 PHE G CB  1 
ATOM 8193  C CG  . PHE G 2 130 ? 23.088  19.735  -8.206  1.00 38.23 ? 276 PHE G CG  1 
ATOM 8194  C CD1 . PHE G 2 130 ? 24.057  19.472  -9.166  1.00 37.39 ? 276 PHE G CD1 1 
ATOM 8195  C CD2 . PHE G 2 130 ? 21.824  20.158  -8.624  1.00 37.53 ? 276 PHE G CD2 1 
ATOM 8196  C CE1 . PHE G 2 130 ? 23.773  19.632  -10.520 1.00 36.69 ? 276 PHE G CE1 1 
ATOM 8197  C CE2 . PHE G 2 130 ? 21.530  20.318  -9.974  1.00 35.98 ? 276 PHE G CE2 1 
ATOM 8198  C CZ  . PHE G 2 130 ? 22.504  20.056  -10.923 1.00 36.22 ? 276 PHE G CZ  1 
ATOM 8199  N N   . VAL G 2 131 ? 25.072  17.507  -4.557  1.00 39.69 ? 277 VAL G N   1 
ATOM 8200  C CA  . VAL G 2 131 ? 25.593  17.441  -3.202  1.00 37.45 ? 277 VAL G CA  1 
ATOM 8201  C C   . VAL G 2 131 ? 26.726  18.436  -3.014  1.00 37.12 ? 277 VAL G C   1 
ATOM 8202  O O   . VAL G 2 131 ? 27.460  18.776  -3.948  1.00 37.81 ? 277 VAL G O   1 
ATOM 8203  C CB  . VAL G 2 131 ? 26.096  16.035  -2.859  1.00 36.79 ? 277 VAL G CB  1 
ATOM 8204  C CG1 . VAL G 2 131 ? 26.687  16.029  -1.460  1.00 35.59 ? 277 VAL G CG1 1 
ATOM 8205  C CG2 . VAL G 2 131 ? 24.948  15.047  -2.944  1.00 35.70 ? 277 VAL G CG2 1 
ATOM 8206  N N   . CYS G 2 132 ? 26.870  18.908  -1.790  1.00 36.12 ? 278 CYS G N   1 
ATOM 8207  C CA  . CYS G 2 132 ? 27.899  19.875  -1.491  1.00 35.16 ? 278 CYS G CA  1 
ATOM 8208  C C   . CYS G 2 132 ? 28.473  19.663  -0.102  1.00 35.49 ? 278 CYS G C   1 
ATOM 8209  O O   . CYS G 2 132 ? 27.769  19.797  0.898   1.00 35.85 ? 278 CYS G O   1 
ATOM 8210  C CB  . CYS G 2 132 ? 27.322  21.279  -1.597  1.00 35.04 ? 278 CYS G CB  1 
ATOM 8211  S SG  . CYS G 2 132 ? 28.394  22.479  -0.865  1.00 33.07 ? 278 CYS G SG  1 
ATOM 8212  N N   . LYS G 2 133 ? 29.759  19.343  -0.045  1.00 35.23 ? 279 LYS G N   1 
ATOM 8213  C CA  . LYS G 2 133 ? 30.422  19.105  1.224   1.00 34.82 ? 279 LYS G CA  1 
ATOM 8214  C C   . LYS G 2 133 ? 31.233  20.335  1.657   1.00 33.53 ? 279 LYS G C   1 
ATOM 8215  O O   . LYS G 2 133 ? 32.167  20.770  0.972   1.00 32.79 ? 279 LYS G O   1 
ATOM 8216  C CB  . LYS G 2 133 ? 31.311  17.869  1.103   1.00 36.44 ? 279 LYS G CB  1 
ATOM 8217  C CG  . LYS G 2 133 ? 31.499  17.108  2.396   1.00 39.97 ? 279 LYS G CG  1 
ATOM 8218  C CD  . LYS G 2 133 ? 30.164  16.690  3.008   1.00 44.37 ? 279 LYS G CD  1 
ATOM 8219  C CE  . LYS G 2 133 ? 30.367  15.852  4.288   1.00 46.63 ? 279 LYS G CE  1 
ATOM 8220  N NZ  . LYS G 2 133 ? 31.269  16.530  5.280   1.00 46.85 ? 279 LYS G NZ  1 
ATOM 8221  N N   . VAL G 2 134 ? 30.859  20.885  2.807   1.00 31.64 ? 280 VAL G N   1 
ATOM 8222  C CA  . VAL G 2 134 ? 31.509  22.075  3.345   1.00 31.46 ? 280 VAL G CA  1 
ATOM 8223  C C   . VAL G 2 134 ? 32.254  21.858  4.663   1.00 30.69 ? 280 VAL G C   1 
ATOM 8224  O O   . VAL G 2 134 ? 31.809  21.089  5.528   1.00 30.46 ? 280 VAL G O   1 
ATOM 8225  C CB  . VAL G 2 134 ? 30.467  23.198  3.606   1.00 31.34 ? 280 VAL G CB  1 
ATOM 8226  C CG1 . VAL G 2 134 ? 31.151  24.419  4.189   1.00 29.82 ? 280 VAL G CG1 1 
ATOM 8227  C CG2 . VAL G 2 134 ? 29.746  23.545  2.327   1.00 30.92 ? 280 VAL G CG2 1 
ATOM 8228  N N   . TYR G 2 135 ? 33.391  22.532  4.806   1.00 29.98 ? 281 TYR G N   1 
ATOM 8229  C CA  . TYR G 2 135 ? 34.136  22.472  6.053   1.00 30.54 ? 281 TYR G CA  1 
ATOM 8230  C C   . TYR G 2 135 ? 34.470  23.904  6.462   1.00 28.80 ? 281 TYR G C   1 
ATOM 8231  O O   . TYR G 2 135 ? 34.923  24.699  5.641   1.00 28.20 ? 281 TYR G O   1 
ATOM 8232  C CB  . TYR G 2 135 ? 35.438  21.674  5.944   1.00 32.63 ? 281 TYR G CB  1 
ATOM 8233  C CG  . TYR G 2 135 ? 36.255  21.794  7.229   1.00 36.89 ? 281 TYR G CG  1 
ATOM 8234  C CD1 . TYR G 2 135 ? 35.874  21.122  8.406   1.00 38.26 ? 281 TYR G CD1 1 
ATOM 8235  C CD2 . TYR G 2 135 ? 37.361  22.654  7.298   1.00 38.34 ? 281 TYR G CD2 1 
ATOM 8236  C CE1 . TYR G 2 135 ? 36.580  21.312  9.616   1.00 38.28 ? 281 TYR G CE1 1 
ATOM 8237  C CE2 . TYR G 2 135 ? 38.061  22.852  8.499   1.00 37.99 ? 281 TYR G CE2 1 
ATOM 8238  C CZ  . TYR G 2 135 ? 37.674  22.181  9.643   1.00 37.72 ? 281 TYR G CZ  1 
ATOM 8239  O OH  . TYR G 2 135 ? 38.404  22.375  10.792  1.00 37.14 ? 281 TYR G OH  1 
ATOM 8240  N N   . SER G 2 136 ? 34.250  24.224  7.733   1.00 27.52 ? 282 SER G N   1 
ATOM 8241  C CA  . SER G 2 136 ? 34.511  25.563  8.254   1.00 26.83 ? 282 SER G CA  1 
ATOM 8242  C C   . SER G 2 136 ? 34.528  25.549  9.773   1.00 26.27 ? 282 SER G C   1 
ATOM 8243  O O   . SER G 2 136 ? 33.842  24.756  10.403  1.00 27.59 ? 282 SER G O   1 
ATOM 8244  C CB  . SER G 2 136 ? 33.423  26.541  7.777   1.00 26.61 ? 282 SER G CB  1 
ATOM 8245  O OG  . SER G 2 136 ? 33.634  27.863  8.264   1.00 23.62 ? 282 SER G OG  1 
ATOM 8246  N N   . ASP G 2 137 ? 35.328  26.422  10.356  1.00 26.21 ? 283 ASP G N   1 
ATOM 8247  C CA  . ASP G 2 137 ? 35.409  26.537  11.803  1.00 27.54 ? 283 ASP G CA  1 
ATOM 8248  C C   . ASP G 2 137 ? 34.253  27.446  12.205  1.00 28.00 ? 283 ASP G C   1 
ATOM 8249  O O   . ASP G 2 137 ? 33.268  27.014  12.819  1.00 28.94 ? 283 ASP G O   1 
ATOM 8250  C CB  . ASP G 2 137 ? 36.742  27.181  12.195  1.00 26.80 ? 283 ASP G CB  1 
ATOM 8251  C CG  . ASP G 2 137 ? 36.890  27.364  13.696  1.00 28.35 ? 283 ASP G CG  1 
ATOM 8252  O OD1 . ASP G 2 137 ? 38.050  27.534  14.139  1.00 27.81 ? 283 ASP G OD1 1 
ATOM 8253  O OD2 . ASP G 2 137 ? 35.864  27.345  14.427  1.00 29.22 ? 283 ASP G OD2 1 
ATOM 8254  N N   . ALA G 2 138 ? 34.390  28.718  11.859  1.00 28.68 ? 284 ALA G N   1 
ATOM 8255  C CA  . ALA G 2 138 ? 33.348  29.690  12.143  1.00 28.80 ? 284 ALA G CA  1 
ATOM 8256  C C   . ALA G 2 138 ? 32.113  29.112  11.461  1.00 28.75 ? 284 ALA G C   1 
ATOM 8257  O O   . ALA G 2 138 ? 32.225  28.477  10.421  1.00 30.39 ? 284 ALA G O   1 
ATOM 8258  C CB  . ALA G 2 138 ? 33.717  31.049  11.537  1.00 28.54 ? 284 ALA G CB  1 
ATOM 8259  N N   . GLN G 2 139 ? 30.944  29.319  12.045  1.00 28.31 ? 285 GLN G N   1 
ATOM 8260  C CA  . GLN G 2 139 ? 29.718  28.784  11.486  1.00 27.67 ? 285 GLN G CA  1 
ATOM 8261  C C   . GLN G 2 139 ? 29.544  29.252  10.051  1.00 27.42 ? 285 GLN G C   1 
ATOM 8262  O O   . GLN G 2 139 ? 29.586  30.449  9.782   1.00 28.39 ? 285 GLN G O   1 
ATOM 8263  C CB  . GLN G 2 139 ? 28.526  29.251  12.328  1.00 28.05 ? 285 GLN G CB  1 
ATOM 8264  C CG  . GLN G 2 139 ? 27.423  28.221  12.482  1.00 27.80 ? 285 GLN G CG  1 
ATOM 8265  C CD  . GLN G 2 139 ? 27.937  26.924  13.058  1.00 28.57 ? 285 GLN G CD  1 
ATOM 8266  O OE1 . GLN G 2 139 ? 28.794  26.912  13.937  1.00 30.78 ? 285 GLN G OE1 1 
ATOM 8267  N NE2 . GLN G 2 139 ? 27.408  25.822  12.572  1.00 30.76 ? 285 GLN G NE2 1 
ATOM 8268  N N   . PRO G 2 140 ? 29.346  28.319  9.105   1.00 26.67 ? 286 PRO G N   1 
ATOM 8269  C CA  . PRO G 2 140 ? 29.162  28.691  7.699   1.00 26.32 ? 286 PRO G CA  1 
ATOM 8270  C C   . PRO G 2 140 ? 27.682  28.820  7.329   1.00 26.97 ? 286 PRO G C   1 
ATOM 8271  O O   . PRO G 2 140 ? 26.814  28.190  7.953   1.00 26.56 ? 286 PRO G O   1 
ATOM 8272  C CB  . PRO G 2 140 ? 29.789  27.524  6.973   1.00 25.90 ? 286 PRO G CB  1 
ATOM 8273  C CG  . PRO G 2 140 ? 29.260  26.374  7.811   1.00 24.99 ? 286 PRO G CG  1 
ATOM 8274  C CD  . PRO G 2 140 ? 29.546  26.866  9.226   1.00 26.43 ? 286 PRO G CD  1 
ATOM 8275  N N   . HIS G 2 141 ? 27.391  29.652  6.331   1.00 27.21 ? 287 HIS G N   1 
ATOM 8276  C CA  . HIS G 2 141 ? 26.025  29.775  5.851   1.00 27.58 ? 287 HIS G CA  1 
ATOM 8277  C C   . HIS G 2 141 ? 25.999  29.281  4.410   1.00 27.55 ? 287 HIS G C   1 
ATOM 8278  O O   . HIS G 2 141 ? 26.683  29.801  3.537   1.00 27.91 ? 287 HIS G O   1 
ATOM 8279  C CB  . HIS G 2 141 ? 25.480  31.202  5.920   1.00 27.93 ? 287 HIS G CB  1 
ATOM 8280  C CG  . HIS G 2 141 ? 24.086  31.320  5.376   1.00 29.23 ? 287 HIS G CG  1 
ATOM 8281  N ND1 . HIS G 2 141 ? 23.818  31.778  4.102   1.00 29.28 ? 287 HIS G ND1 1 
ATOM 8282  C CD2 . HIS G 2 141 ? 22.893  30.919  5.888   1.00 28.80 ? 287 HIS G CD2 1 
ATOM 8283  C CE1 . HIS G 2 141 ? 22.527  31.646  3.848   1.00 28.88 ? 287 HIS G CE1 1 
ATOM 8284  N NE2 . HIS G 2 141 ? 21.944  31.127  4.915   1.00 29.57 ? 287 HIS G NE2 1 
ATOM 8285  N N   . ILE G 2 142 ? 25.202  28.254  4.175   1.00 28.47 ? 288 ILE G N   1 
ATOM 8286  C CA  . ILE G 2 142 ? 25.110  27.657  2.854   1.00 28.79 ? 288 ILE G CA  1 
ATOM 8287  C C   . ILE G 2 142 ? 23.765  27.898  2.169   1.00 30.10 ? 288 ILE G C   1 
ATOM 8288  O O   . ILE G 2 142 ? 22.707  27.835  2.800   1.00 30.14 ? 288 ILE G O   1 
ATOM 8289  C CB  . ILE G 2 142 ? 25.315  26.135  2.941   1.00 26.68 ? 288 ILE G CB  1 
ATOM 8290  C CG1 . ILE G 2 142 ? 26.495  25.828  3.867   1.00 26.32 ? 288 ILE G CG1 1 
ATOM 8291  C CG2 . ILE G 2 142 ? 25.520  25.575  1.553   1.00 26.08 ? 288 ILE G CG2 1 
ATOM 8292  C CD1 . ILE G 2 142 ? 26.875  24.350  3.961   1.00 24.57 ? 288 ILE G CD1 1 
ATOM 8293  N N   . GLN G 2 143 ? 23.815  28.174  0.877   1.00 30.83 ? 289 GLN G N   1 
ATOM 8294  C CA  . GLN G 2 143 ? 22.607  28.369  0.108   1.00 32.34 ? 289 GLN G CA  1 
ATOM 8295  C C   . GLN G 2 143 ? 22.876  27.878  -1.296  1.00 32.88 ? 289 GLN G C   1 
ATOM 8296  O O   . GLN G 2 143 ? 24.021  27.854  -1.742  1.00 33.23 ? 289 GLN G O   1 
ATOM 8297  C CB  . GLN G 2 143 ? 22.210  29.834  0.076   1.00 33.94 ? 289 GLN G CB  1 
ATOM 8298  C CG  . GLN G 2 143 ? 23.271  30.733  -0.508  1.00 35.93 ? 289 GLN G CG  1 
ATOM 8299  C CD  . GLN G 2 143 ? 22.856  32.178  -0.458  1.00 36.61 ? 289 GLN G CD  1 
ATOM 8300  O OE1 . GLN G 2 143 ? 21.882  32.571  -1.092  1.00 38.53 ? 289 GLN G OE1 1 
ATOM 8301  N NE2 . GLN G 2 143 ? 23.586  32.979  0.303   1.00 36.61 ? 289 GLN G NE2 1 
ATOM 8302  N N   . TRP G 2 144 ? 21.820  27.456  -1.978  1.00 33.45 ? 290 TRP G N   1 
ATOM 8303  C CA  . TRP G 2 144 ? 21.943  26.968  -3.341  1.00 33.35 ? 290 TRP G CA  1 
ATOM 8304  C C   . TRP G 2 144 ? 21.399  28.039  -4.256  1.00 34.66 ? 290 TRP G C   1 
ATOM 8305  O O   . TRP G 2 144 ? 20.344  28.601  -3.994  1.00 34.90 ? 290 TRP G O   1 
ATOM 8306  C CB  . TRP G 2 144 ? 21.150  25.679  -3.527  1.00 31.25 ? 290 TRP G CB  1 
ATOM 8307  C CG  . TRP G 2 144 ? 21.724  24.494  -2.807  1.00 28.48 ? 290 TRP G CG  1 
ATOM 8308  C CD1 . TRP G 2 144 ? 21.415  24.078  -1.550  1.00 27.98 ? 290 TRP G CD1 1 
ATOM 8309  C CD2 . TRP G 2 144 ? 22.672  23.545  -3.324  1.00 27.38 ? 290 TRP G CD2 1 
ATOM 8310  N NE1 . TRP G 2 144 ? 22.097  22.923  -1.248  1.00 27.67 ? 290 TRP G NE1 1 
ATOM 8311  C CE2 . TRP G 2 144 ? 22.874  22.568  -2.317  1.00 27.22 ? 290 TRP G CE2 1 
ATOM 8312  C CE3 . TRP G 2 144 ? 23.363  23.416  -4.543  1.00 25.65 ? 290 TRP G CE3 1 
ATOM 8313  C CZ2 . TRP G 2 144 ? 23.743  21.476  -2.485  1.00 25.36 ? 290 TRP G CZ2 1 
ATOM 8314  C CZ3 . TRP G 2 144 ? 24.228  22.321  -4.712  1.00 24.14 ? 290 TRP G CZ3 1 
ATOM 8315  C CH2 . TRP G 2 144 ? 24.404  21.371  -3.689  1.00 24.62 ? 290 TRP G CH2 1 
ATOM 8316  N N   . ILE G 2 145 ? 22.124  28.319  -5.332  1.00 36.57 ? 291 ILE G N   1 
ATOM 8317  C CA  . ILE G 2 145 ? 21.708  29.349  -6.269  1.00 37.73 ? 291 ILE G CA  1 
ATOM 8318  C C   . ILE G 2 145 ? 21.703  28.846  -7.711  1.00 39.07 ? 291 ILE G C   1 
ATOM 8319  O O   . ILE G 2 145 ? 22.613  28.136  -8.129  1.00 39.34 ? 291 ILE G O   1 
ATOM 8320  C CB  . ILE G 2 145 ? 22.657  30.572  -6.184  1.00 36.59 ? 291 ILE G CB  1 
ATOM 8321  C CG1 . ILE G 2 145 ? 22.901  30.939  -4.719  1.00 37.26 ? 291 ILE G CG1 1 
ATOM 8322  C CG2 . ILE G 2 145 ? 22.055  31.762  -6.919  1.00 35.98 ? 291 ILE G CG2 1 
ATOM 8323  C CD1 . ILE G 2 145 ? 23.862  32.120  -4.518  1.00 36.34 ? 291 ILE G CD1 1 
ATOM 8324  N N   . LYS G 2 146 ? 20.670  29.201  -8.466  1.00 40.69 ? 292 LYS G N   1 
ATOM 8325  C CA  . LYS G 2 146 ? 20.610  28.820  -9.870  1.00 42.24 ? 292 LYS G CA  1 
ATOM 8326  C C   . LYS G 2 146 ? 20.825  30.102  -10.649 1.00 44.17 ? 292 LYS G C   1 
ATOM 8327  O O   . LYS G 2 146 ? 20.336  31.160  -10.255 1.00 44.50 ? 292 LYS G O   1 
ATOM 8328  C CB  . LYS G 2 146 ? 19.256  28.216  -10.242 1.00 41.08 ? 292 LYS G CB  1 
ATOM 8329  N N   . HIS G 2 147 ? 21.584  30.023  -11.735 1.00 46.51 ? 293 HIS G N   1 
ATOM 8330  C CA  . HIS G 2 147 ? 21.825  31.197  -12.558 1.00 48.65 ? 293 HIS G CA  1 
ATOM 8331  C C   . HIS G 2 147 ? 20.635  31.323  -13.508 1.00 49.86 ? 293 HIS G C   1 
ATOM 8332  O O   . HIS G 2 147 ? 20.268  30.363  -14.195 1.00 49.91 ? 293 HIS G O   1 
ATOM 8333  C CB  . HIS G 2 147 ? 23.136  31.049  -13.339 1.00 50.50 ? 293 HIS G CB  1 
ATOM 8334  C CG  . HIS G 2 147 ? 24.365  31.083  -12.478 1.00 52.67 ? 293 HIS G CG  1 
ATOM 8335  N ND1 . HIS G 2 147 ? 24.581  30.198  -11.443 1.00 54.01 ? 293 HIS G ND1 1 
ATOM 8336  C CD2 . HIS G 2 147 ? 25.449  31.899  -12.502 1.00 53.37 ? 293 HIS G CD2 1 
ATOM 8337  C CE1 . HIS G 2 147 ? 25.741  30.466  -10.867 1.00 53.49 ? 293 HIS G CE1 1 
ATOM 8338  N NE2 . HIS G 2 147 ? 26.288  31.494  -11.490 1.00 52.72 ? 293 HIS G NE2 1 
ATOM 8339  N N   . VAL G 2 148 ? 20.022  32.504  -13.523 1.00 51.03 ? 294 VAL G N   1 
ATOM 8340  C CA  . VAL G 2 148 ? 18.855  32.766  -14.360 1.00 52.27 ? 294 VAL G CA  1 
ATOM 8341  C C   . VAL G 2 148 ? 19.051  33.996  -15.232 1.00 52.11 ? 294 VAL G C   1 
ATOM 8342  O O   . VAL G 2 148 ? 18.341  34.187  -16.219 1.00 53.21 ? 294 VAL G O   1 
ATOM 8343  C CB  . VAL G 2 148 ? 17.602  33.016  -13.506 1.00 53.32 ? 294 VAL G CB  1 
ATOM 8344  C CG1 . VAL G 2 148 ? 16.351  32.753  -14.341 1.00 54.62 ? 294 VAL G CG1 1 
ATOM 8345  C CG2 . VAL G 2 148 ? 17.624  32.143  -12.265 1.00 54.05 ? 294 VAL G CG2 1 
ATOM 8346  N N   . PRO G 2 161 ? 24.607  39.366  -13.394 1.00 60.62 ? 307 PRO G N   1 
ATOM 8347  C CA  . PRO G 2 161 ? 24.355  37.934  -13.180 1.00 60.36 ? 307 PRO G CA  1 
ATOM 8348  C C   . PRO G 2 161 ? 23.017  37.667  -12.473 1.00 59.98 ? 307 PRO G C   1 
ATOM 8349  O O   . PRO G 2 161 ? 22.887  37.872  -11.257 1.00 59.22 ? 307 PRO G O   1 
ATOM 8350  C CB  . PRO G 2 161 ? 25.564  37.496  -12.348 1.00 60.14 ? 307 PRO G CB  1 
ATOM 8351  C CG  . PRO G 2 161 ? 25.828  38.709  -11.508 1.00 60.67 ? 307 PRO G CG  1 
ATOM 8352  C CD  . PRO G 2 161 ? 25.673  39.858  -12.498 1.00 60.07 ? 307 PRO G CD  1 
ATOM 8353  N N   . TYR G 2 162 ? 22.024  37.217  -13.239 1.00 59.35 ? 308 TYR G N   1 
ATOM 8354  C CA  . TYR G 2 162 ? 20.708  36.933  -12.673 1.00 57.99 ? 308 TYR G CA  1 
ATOM 8355  C C   . TYR G 2 162 ? 20.769  35.651  -11.849 1.00 56.79 ? 308 TYR G C   1 
ATOM 8356  O O   . TYR G 2 162 ? 20.916  34.554  -12.391 1.00 57.23 ? 308 TYR G O   1 
ATOM 8357  C CB  . TYR G 2 162 ? 19.657  36.810  -13.785 1.00 58.46 ? 308 TYR G CB  1 
ATOM 8358  N N   . LEU G 2 163 ? 20.658  35.805  -10.531 1.00 55.31 ? 309 LEU G N   1 
ATOM 8359  C CA  . LEU G 2 163 ? 20.718  34.675  -9.602  1.00 53.00 ? 309 LEU G CA  1 
ATOM 8360  C C   . LEU G 2 163 ? 19.418  34.446  -8.824  1.00 51.30 ? 309 LEU G C   1 
ATOM 8361  O O   . LEU G 2 163 ? 18.691  35.386  -8.523  1.00 50.82 ? 309 LEU G O   1 
ATOM 8362  C CB  . LEU G 2 163 ? 21.869  34.893  -8.618  1.00 52.45 ? 309 LEU G CB  1 
ATOM 8363  C CG  . LEU G 2 163 ? 23.243  35.114  -9.256  1.00 52.48 ? 309 LEU G CG  1 
ATOM 8364  C CD1 . LEU G 2 163 ? 24.290  35.247  -8.165  1.00 51.97 ? 309 LEU G CD1 1 
ATOM 8365  C CD2 . LEU G 2 163 ? 23.582  33.945  -10.181 1.00 52.45 ? 309 LEU G CD2 1 
ATOM 8366  N N   . LYS G 2 164 ? 19.138  33.192  -8.493  1.00 49.41 ? 310 LYS G N   1 
ATOM 8367  C CA  . LYS G 2 164 ? 17.932  32.852  -7.754  1.00 48.02 ? 310 LYS G CA  1 
ATOM 8368  C C   . LYS G 2 164 ? 18.234  31.889  -6.603  1.00 46.89 ? 310 LYS G C   1 
ATOM 8369  O O   . LYS G 2 164 ? 18.751  30.786  -6.818  1.00 46.97 ? 310 LYS G O   1 
ATOM 8370  C CB  . LYS G 2 164 ? 16.908  32.220  -8.697  1.00 49.41 ? 310 LYS G CB  1 
ATOM 8371  C CG  . LYS G 2 164 ? 15.545  31.978  -8.081  1.00 49.97 ? 310 LYS G CG  1 
ATOM 8372  C CD  . LYS G 2 164 ? 14.674  31.172  -9.029  1.00 52.57 ? 310 LYS G CD  1 
ATOM 8373  C CE  . LYS G 2 164 ? 13.254  31.040  -8.509  1.00 53.36 ? 310 LYS G CE  1 
ATOM 8374  N NZ  . LYS G 2 164 ? 13.231  30.522  -7.115  1.00 54.38 ? 310 LYS G NZ  1 
ATOM 8375  N N   . VAL G 2 165 ? 17.910  32.307  -5.382  1.00 44.71 ? 311 VAL G N   1 
ATOM 8376  C CA  . VAL G 2 165 ? 18.150  31.471  -4.213  1.00 42.25 ? 311 VAL G CA  1 
ATOM 8377  C C   . VAL G 2 165 ? 17.088  30.401  -4.145  1.00 41.96 ? 311 VAL G C   1 
ATOM 8378  O O   . VAL G 2 165 ? 15.915  30.691  -3.927  1.00 42.63 ? 311 VAL G O   1 
ATOM 8379  C CB  . VAL G 2 165 ? 18.113  32.274  -2.873  1.00 41.28 ? 311 VAL G CB  1 
ATOM 8380  C CG1 . VAL G 2 165 ? 18.216  31.317  -1.683  1.00 38.25 ? 311 VAL G CG1 1 
ATOM 8381  C CG2 . VAL G 2 165 ? 19.250  33.289  -2.829  1.00 39.63 ? 311 VAL G CG2 1 
ATOM 8382  N N   . LEU G 2 166 ? 17.509  29.155  -4.314  1.00 40.61 ? 312 LEU G N   1 
ATOM 8383  C CA  . LEU G 2 166 ? 16.593  28.028  -4.281  1.00 39.24 ? 312 LEU G CA  1 
ATOM 8384  C C   . LEU G 2 166 ? 16.460  27.469  -2.877  1.00 38.85 ? 312 LEU G C   1 
ATOM 8385  O O   . LEU G 2 166 ? 15.446  26.864  -2.529  1.00 38.66 ? 312 LEU G O   1 
ATOM 8386  C CB  . LEU G 2 166 ? 17.104  26.911  -5.193  1.00 38.30 ? 312 LEU G CB  1 
ATOM 8387  C CG  . LEU G 2 166 ? 17.377  27.211  -6.663  1.00 37.33 ? 312 LEU G CG  1 
ATOM 8388  C CD1 . LEU G 2 166 ? 18.016  25.996  -7.299  1.00 36.74 ? 312 LEU G CD1 1 
ATOM 8389  C CD2 . LEU G 2 166 ? 16.087  27.586  -7.379  1.00 35.62 ? 312 LEU G CD2 1 
ATOM 8390  N N   . LYS G 2 167 ? 17.490  27.675  -2.070  1.00 38.67 ? 313 LYS G N   1 
ATOM 8391  C CA  . LYS G 2 167 ? 17.498  27.122  -0.726  1.00 38.74 ? 313 LYS G CA  1 
ATOM 8392  C C   . LYS G 2 167 ? 18.583  27.838  0.068   1.00 38.48 ? 313 LYS G C   1 
ATOM 8393  O O   . LYS G 2 167 ? 19.665  28.103  -0.453  1.00 39.17 ? 313 LYS G O   1 
ATOM 8394  C CB  . LYS G 2 167 ? 17.794  25.624  -0.847  1.00 39.59 ? 313 LYS G CB  1 
ATOM 8395  C CG  . LYS G 2 167 ? 17.624  24.748  0.378   1.00 39.78 ? 313 LYS G CG  1 
ATOM 8396  C CD  . LYS G 2 167 ? 17.991  23.316  -0.018  1.00 39.28 ? 313 LYS G CD  1 
ATOM 8397  C CE  . LYS G 2 167 ? 17.896  22.329  1.132   1.00 39.79 ? 313 LYS G CE  1 
ATOM 8398  N NZ  . LYS G 2 167 ? 18.176  20.950  0.629   1.00 37.51 ? 313 LYS G NZ  1 
ATOM 8399  N N   . ALA G 2 168 ? 18.282  28.164  1.320   1.00 37.77 ? 314 ALA G N   1 
ATOM 8400  C CA  . ALA G 2 168 ? 19.235  28.860  2.176   1.00 36.59 ? 314 ALA G CA  1 
ATOM 8401  C C   . ALA G 2 168 ? 19.101  28.390  3.611   1.00 36.12 ? 314 ALA G C   1 
ATOM 8402  O O   . ALA G 2 168 ? 18.005  28.346  4.165   1.00 35.24 ? 314 ALA G O   1 
ATOM 8403  C CB  . ALA G 2 168 ? 19.020  30.357  2.106   1.00 35.04 ? 314 ALA G CB  1 
ATOM 8404  N N   . ALA G 2 169 ? 20.235  28.034  4.200   1.00 36.84 ? 315 ALA G N   1 
ATOM 8405  C CA  . ALA G 2 169 ? 20.284  27.566  5.569   1.00 37.20 ? 315 ALA G CA  1 
ATOM 8406  C C   . ALA G 2 169 ? 19.673  28.588  6.516   1.00 37.74 ? 315 ALA G C   1 
ATOM 8407  O O   . ALA G 2 169 ? 19.646  29.788  6.230   1.00 38.36 ? 315 ALA G O   1 
ATOM 8408  C CB  . ALA G 2 169 ? 21.720  27.285  5.961   1.00 37.64 ? 315 ALA G CB  1 
ATOM 8409  N N   . GLY G 2 170 ? 19.180  28.097  7.646   1.00 38.10 ? 316 GLY G N   1 
ATOM 8410  C CA  . GLY G 2 170 ? 18.572  28.963  8.638   1.00 39.23 ? 316 GLY G CA  1 
ATOM 8411  C C   . GLY G 2 170 ? 17.848  28.097  9.644   1.00 40.59 ? 316 GLY G C   1 
ATOM 8412  O O   . GLY G 2 170 ? 17.916  26.865  9.562   1.00 40.97 ? 316 GLY G O   1 
ATOM 8413  N N   . VAL G 2 171 ? 17.159  28.726  10.592  1.00 41.50 ? 317 VAL G N   1 
ATOM 8414  C CA  . VAL G 2 171 ? 16.423  27.973  11.602  1.00 41.94 ? 317 VAL G CA  1 
ATOM 8415  C C   . VAL G 2 171 ? 15.358  27.088  10.969  1.00 42.60 ? 317 VAL G C   1 
ATOM 8416  O O   . VAL G 2 171 ? 15.020  26.052  11.516  1.00 41.65 ? 317 VAL G O   1 
ATOM 8417  C CB  . VAL G 2 171 ? 15.764  28.894  12.632  1.00 41.37 ? 317 VAL G CB  1 
ATOM 8418  C CG1 . VAL G 2 171 ? 16.820  29.443  13.570  1.00 41.78 ? 317 VAL G CG1 1 
ATOM 8419  C CG2 . VAL G 2 171 ? 15.048  30.028  11.930  1.00 40.53 ? 317 VAL G CG2 1 
ATOM 8420  N N   . ASN G 2 172 ? 14.859  27.487  9.803   1.00 43.94 ? 318 ASN G N   1 
ATOM 8421  C CA  . ASN G 2 172 ? 13.833  26.719  9.116   1.00 46.02 ? 318 ASN G CA  1 
ATOM 8422  C C   . ASN G 2 172 ? 14.417  25.762  8.082   1.00 46.43 ? 318 ASN G C   1 
ATOM 8423  O O   . ASN G 2 172 ? 13.734  24.855  7.614   1.00 47.27 ? 318 ASN G O   1 
ATOM 8424  C CB  . ASN G 2 172 ? 12.855  27.674  8.442   1.00 49.10 ? 318 ASN G CB  1 
ATOM 8425  C CG  . ASN G 2 172 ? 12.281  28.684  9.409   1.00 51.86 ? 318 ASN G CG  1 
ATOM 8426  O OD1 . ASN G 2 172 ? 11.875  29.783  9.016   1.00 53.76 ? 318 ASN G OD1 1 
ATOM 8427  N ND2 . ASN G 2 172 ? 12.234  28.316  10.687  1.00 53.15 ? 318 ASN G ND2 1 
ATOM 8428  N N   . THR G 2 173 ? 15.675  25.971  7.708   1.00 46.22 ? 319 THR G N   1 
ATOM 8429  C CA  . THR G 2 173 ? 16.322  25.088  6.743   1.00 45.99 ? 319 THR G CA  1 
ATOM 8430  C C   . THR G 2 173 ? 17.682  24.707  7.307   1.00 45.63 ? 319 THR G C   1 
ATOM 8431  O O   . THR G 2 173 ? 18.727  25.176  6.854   1.00 46.51 ? 319 THR G O   1 
ATOM 8432  C CB  . THR G 2 173 ? 16.508  25.774  5.394   1.00 46.37 ? 319 THR G CB  1 
ATOM 8433  O OG1 . THR G 2 173 ? 15.337  26.538  5.093   1.00 48.35 ? 319 THR G OG1 1 
ATOM 8434  C CG2 . THR G 2 173 ? 16.706  24.733  4.302   1.00 46.72 ? 319 THR G CG2 1 
ATOM 8435  N N   . THR G 2 174 ? 17.643  23.848  8.314   1.00 44.69 ? 320 THR G N   1 
ATOM 8436  C CA  . THR G 2 174 ? 18.824  23.366  9.019   1.00 43.41 ? 320 THR G CA  1 
ATOM 8437  C C   . THR G 2 174 ? 19.945  22.815  8.138   1.00 42.93 ? 320 THR G C   1 
ATOM 8438  O O   . THR G 2 174 ? 19.696  22.311  7.043   1.00 43.17 ? 320 THR G O   1 
ATOM 8439  C CB  . THR G 2 174 ? 18.388  22.310  10.049  1.00 42.84 ? 320 THR G CB  1 
ATOM 8440  O OG1 . THR G 2 174 ? 17.779  22.983  11.156  1.00 41.53 ? 320 THR G OG1 1 
ATOM 8441  C CG2 . THR G 2 174 ? 19.556  21.488  10.534  1.00 43.53 ? 320 THR G CG2 1 
ATOM 8442  N N   . ASP G 2 175 ? 21.186  22.926  8.616   1.00 42.26 ? 321 ASP G N   1 
ATOM 8443  C CA  . ASP G 2 175 ? 22.327  22.417  7.867   1.00 41.78 ? 321 ASP G CA  1 
ATOM 8444  C C   . ASP G 2 175 ? 22.187  20.911  7.682   1.00 43.22 ? 321 ASP G C   1 
ATOM 8445  O O   . ASP G 2 175 ? 22.757  20.335  6.754   1.00 44.51 ? 321 ASP G O   1 
ATOM 8446  C CB  . ASP G 2 175 ? 23.641  22.698  8.588   1.00 40.18 ? 321 ASP G CB  1 
ATOM 8447  C CG  . ASP G 2 175 ? 23.839  24.154  8.887   1.00 39.47 ? 321 ASP G CG  1 
ATOM 8448  O OD1 . ASP G 2 175 ? 23.312  24.986  8.120   1.00 38.87 ? 321 ASP G OD1 1 
ATOM 8449  O OD2 . ASP G 2 175 ? 24.530  24.461  9.885   1.00 39.72 ? 321 ASP G OD2 1 
ATOM 8450  N N   . LYS G 2 176 ? 21.422  20.277  8.568   1.00 43.84 ? 322 LYS G N   1 
ATOM 8451  C CA  . LYS G 2 176 ? 21.209  18.839  8.510   1.00 44.07 ? 322 LYS G CA  1 
ATOM 8452  C C   . LYS G 2 176 ? 20.869  18.371  7.096   1.00 45.01 ? 322 LYS G C   1 
ATOM 8453  O O   . LYS G 2 176 ? 21.306  17.298  6.678   1.00 43.96 ? 322 LYS G O   1 
ATOM 8454  C CB  . LYS G 2 176 ? 20.100  18.422  9.478   1.00 43.32 ? 322 LYS G CB  1 
ATOM 8455  N N   . GLU G 2 177 ? 20.106  19.168  6.350   1.00 45.90 ? 323 GLU G N   1 
ATOM 8456  C CA  . GLU G 2 177 ? 19.751  18.760  4.990   1.00 47.83 ? 323 GLU G CA  1 
ATOM 8457  C C   . GLU G 2 177 ? 20.003  19.812  3.917   1.00 46.47 ? 323 GLU G C   1 
ATOM 8458  O O   . GLU G 2 177 ? 19.547  19.658  2.787   1.00 46.88 ? 323 GLU G O   1 
ATOM 8459  C CB  . GLU G 2 177 ? 18.278  18.317  4.915   1.00 51.55 ? 323 GLU G CB  1 
ATOM 8460  C CG  . GLU G 2 177 ? 17.247  19.396  5.243   1.00 55.83 ? 323 GLU G CG  1 
ATOM 8461  C CD  . GLU G 2 177 ? 17.017  19.555  6.740   1.00 58.81 ? 323 GLU G CD  1 
ATOM 8462  O OE1 . GLU G 2 177 ? 16.724  18.532  7.408   1.00 59.69 ? 323 GLU G OE1 1 
ATOM 8463  O OE2 . GLU G 2 177 ? 17.119  20.699  7.245   1.00 61.01 ? 323 GLU G OE2 1 
ATOM 8464  N N   . ILE G 2 178 ? 20.738  20.865  4.260   1.00 44.86 ? 324 ILE G N   1 
ATOM 8465  C CA  . ILE G 2 178 ? 21.022  21.929  3.300   1.00 43.61 ? 324 ILE G CA  1 
ATOM 8466  C C   . ILE G 2 178 ? 22.127  21.548  2.323   1.00 42.50 ? 324 ILE G C   1 
ATOM 8467  O O   . ILE G 2 178 ? 22.223  22.126  1.246   1.00 41.21 ? 324 ILE G O   1 
ATOM 8468  C CB  . ILE G 2 178 ? 21.446  23.238  4.021   1.00 44.01 ? 324 ILE G CB  1 
ATOM 8469  C CG1 . ILE G 2 178 ? 21.543  24.402  3.026   1.00 43.26 ? 324 ILE G CG1 1 
ATOM 8470  C CG2 . ILE G 2 178 ? 22.811  23.047  4.678   1.00 43.92 ? 324 ILE G CG2 1 
ATOM 8471  C CD1 . ILE G 2 178 ? 20.235  24.795  2.377   1.00 42.67 ? 324 ILE G CD1 1 
ATOM 8472  N N   . GLU G 2 179 ? 22.952  20.575  2.698   1.00 42.11 ? 325 GLU G N   1 
ATOM 8473  C CA  . GLU G 2 179 ? 24.062  20.165  1.857   1.00 42.53 ? 325 GLU G CA  1 
ATOM 8474  C C   . GLU G 2 179 ? 23.693  19.400  0.589   1.00 42.38 ? 325 GLU G C   1 
ATOM 8475  O O   . GLU G 2 179 ? 24.502  19.284  -0.333  1.00 42.53 ? 325 GLU G O   1 
ATOM 8476  C CB  . GLU G 2 179 ? 25.078  19.411  2.708   1.00 43.02 ? 325 GLU G CB  1 
ATOM 8477  C CG  . GLU G 2 179 ? 25.894  20.390  3.554   1.00 45.25 ? 325 GLU G CG  1 
ATOM 8478  C CD  . GLU G 2 179 ? 26.959  19.734  4.419   1.00 46.10 ? 325 GLU G CD  1 
ATOM 8479  O OE1 . GLU G 2 179 ? 26.585  19.098  5.430   1.00 45.97 ? 325 GLU G OE1 1 
ATOM 8480  O OE2 . GLU G 2 179 ? 28.164  19.863  4.086   1.00 45.12 ? 325 GLU G OE2 1 
ATOM 8481  N N   . VAL G 2 180 ? 22.463  18.909  0.525   1.00 41.24 ? 326 VAL G N   1 
ATOM 8482  C CA  . VAL G 2 180 ? 22.011  18.190  -0.659  1.00 40.83 ? 326 VAL G CA  1 
ATOM 8483  C C   . VAL G 2 180 ? 20.793  18.912  -1.252  1.00 40.01 ? 326 VAL G C   1 
ATOM 8484  O O   . VAL G 2 180 ? 19.891  19.309  -0.522  1.00 39.95 ? 326 VAL G O   1 
ATOM 8485  C CB  . VAL G 2 180 ? 21.621  16.740  -0.313  1.00 40.83 ? 326 VAL G CB  1 
ATOM 8486  C CG1 . VAL G 2 180 ? 20.520  16.750  0.726   1.00 41.94 ? 326 VAL G CG1 1 
ATOM 8487  C CG2 . VAL G 2 180 ? 21.161  16.003  -1.565  1.00 40.45 ? 326 VAL G CG2 1 
ATOM 8488  N N   . LEU G 2 181 ? 20.779  19.097  -2.570  1.00 39.16 ? 327 LEU G N   1 
ATOM 8489  C CA  . LEU G 2 181 ? 19.662  19.768  -3.230  1.00 38.95 ? 327 LEU G CA  1 
ATOM 8490  C C   . LEU G 2 181 ? 18.980  18.842  -4.218  1.00 40.33 ? 327 LEU G C   1 
ATOM 8491  O O   . LEU G 2 181 ? 19.620  18.316  -5.131  1.00 41.51 ? 327 LEU G O   1 
ATOM 8492  C CB  . LEU G 2 181 ? 20.120  21.031  -3.973  1.00 36.25 ? 327 LEU G CB  1 
ATOM 8493  C CG  . LEU G 2 181 ? 19.061  21.661  -4.893  1.00 33.34 ? 327 LEU G CG  1 
ATOM 8494  C CD1 . LEU G 2 181 ? 17.981  22.308  -4.049  1.00 31.07 ? 327 LEU G CD1 1 
ATOM 8495  C CD2 . LEU G 2 181 ? 19.705  22.681  -5.830  1.00 30.64 ? 327 LEU G CD2 1 
ATOM 8496  N N   . TYR G 2 182 ? 17.676  18.653  -4.040  1.00 41.39 ? 328 TYR G N   1 
ATOM 8497  C CA  . TYR G 2 182 ? 16.902  17.787  -4.923  1.00 42.46 ? 328 TYR G CA  1 
ATOM 8498  C C   . TYR G 2 182 ? 16.023  18.570  -5.899  1.00 44.66 ? 328 TYR G C   1 
ATOM 8499  O O   . TYR G 2 182 ? 15.561  19.673  -5.609  1.00 44.62 ? 328 TYR G O   1 
ATOM 8500  C CB  . TYR G 2 182 ? 16.009  16.851  -4.112  1.00 38.46 ? 328 TYR G CB  1 
ATOM 8501  C CG  . TYR G 2 182 ? 16.728  15.992  -3.094  1.00 37.54 ? 328 TYR G CG  1 
ATOM 8502  C CD1 . TYR G 2 182 ? 16.745  16.341  -1.747  1.00 36.74 ? 328 TYR G CD1 1 
ATOM 8503  C CD2 . TYR G 2 182 ? 17.364  14.809  -3.471  1.00 36.60 ? 328 TYR G CD2 1 
ATOM 8504  C CE1 . TYR G 2 182 ? 17.368  15.528  -0.803  1.00 36.28 ? 328 TYR G CE1 1 
ATOM 8505  C CE2 . TYR G 2 182 ? 17.994  13.993  -2.537  1.00 34.59 ? 328 TYR G CE2 1 
ATOM 8506  C CZ  . TYR G 2 182 ? 17.990  14.353  -1.206  1.00 35.40 ? 328 TYR G CZ  1 
ATOM 8507  O OH  . TYR G 2 182 ? 18.579  13.529  -0.270  1.00 34.03 ? 328 TYR G OH  1 
ATOM 8508  N N   . ILE G 2 183 ? 15.801  17.985  -7.067  1.00 47.15 ? 329 ILE G N   1 
ATOM 8509  C CA  . ILE G 2 183 ? 14.963  18.594  -8.084  1.00 49.28 ? 329 ILE G CA  1 
ATOM 8510  C C   . ILE G 2 183 ? 14.175  17.462  -8.732  1.00 51.22 ? 329 ILE G C   1 
ATOM 8511  O O   . ILE G 2 183 ? 14.705  16.708  -9.553  1.00 50.69 ? 329 ILE G O   1 
ATOM 8512  C CB  . ILE G 2 183 ? 15.816  19.332  -9.136  1.00 48.54 ? 329 ILE G CB  1 
ATOM 8513  C CG1 . ILE G 2 183 ? 16.742  20.322  -8.430  1.00 47.67 ? 329 ILE G CG1 1 
ATOM 8514  C CG2 . ILE G 2 183 ? 14.919  20.078  -10.121 1.00 48.28 ? 329 ILE G CG2 1 
ATOM 8515  C CD1 . ILE G 2 183 ? 17.653  21.071  -9.364  1.00 47.12 ? 329 ILE G CD1 1 
ATOM 8516  N N   . ARG G 2 184 ? 12.912  17.338  -8.331  1.00 53.80 ? 330 ARG G N   1 
ATOM 8517  C CA  . ARG G 2 184 ? 12.031  16.293  -8.846  1.00 55.11 ? 330 ARG G CA  1 
ATOM 8518  C C   . ARG G 2 184 ? 11.313  16.741  -10.121 1.00 55.52 ? 330 ARG G C   1 
ATOM 8519  O O   . ARG G 2 184 ? 11.074  17.939  -10.327 1.00 54.72 ? 330 ARG G O   1 
ATOM 8520  C CB  . ARG G 2 184 ? 11.013  15.893  -7.768  1.00 55.01 ? 330 ARG G CB  1 
ATOM 8521  N N   . ASN G 2 185 ? 10.982  15.767  -10.969 1.00 56.42 ? 331 ASN G N   1 
ATOM 8522  C CA  . ASN G 2 185 ? 10.300  16.021  -12.236 1.00 57.27 ? 331 ASN G CA  1 
ATOM 8523  C C   . ASN G 2 185 ? 10.902  17.269  -12.877 1.00 57.85 ? 331 ASN G C   1 
ATOM 8524  O O   . ASN G 2 185 ? 10.217  18.272  -13.079 1.00 57.63 ? 331 ASN G O   1 
ATOM 8525  C CB  . ASN G 2 185 ? 8.787   16.199  -12.011 1.00 55.79 ? 331 ASN G CB  1 
ATOM 8526  N N   . VAL G 2 186 ? 12.196  17.198  -13.184 1.00 58.47 ? 332 VAL G N   1 
ATOM 8527  C CA  . VAL G 2 186 ? 12.902  18.323  -13.785 1.00 58.79 ? 332 VAL G CA  1 
ATOM 8528  C C   . VAL G 2 186 ? 12.302  18.656  -15.143 1.00 59.35 ? 332 VAL G C   1 
ATOM 8529  O O   . VAL G 2 186 ? 11.789  17.776  -15.834 1.00 59.16 ? 332 VAL G O   1 
ATOM 8530  C CB  . VAL G 2 186 ? 14.407  18.018  -13.979 1.00 58.05 ? 332 VAL G CB  1 
ATOM 8531  C CG1 . VAL G 2 186 ? 14.993  17.464  -12.694 1.00 57.89 ? 332 VAL G CG1 1 
ATOM 8532  C CG2 . VAL G 2 186 ? 14.604  17.048  -15.126 1.00 57.49 ? 332 VAL G CG2 1 
ATOM 8533  N N   . THR G 2 187 ? 12.374  19.932  -15.515 1.00 59.50 ? 333 THR G N   1 
ATOM 8534  C CA  . THR G 2 187 ? 11.846  20.411  -16.788 1.00 58.98 ? 333 THR G CA  1 
ATOM 8535  C C   . THR G 2 187 ? 12.967  21.106  -17.545 1.00 59.58 ? 333 THR G C   1 
ATOM 8536  O O   . THR G 2 187 ? 14.043  21.333  -16.997 1.00 59.80 ? 333 THR G O   1 
ATOM 8537  C CB  . THR G 2 187 ? 10.706  21.436  -16.578 1.00 57.62 ? 333 THR G CB  1 
ATOM 8538  O OG1 . THR G 2 187 ? 11.250  22.694  -16.169 1.00 55.74 ? 333 THR G OG1 1 
ATOM 8539  C CG2 . THR G 2 187 ? 9.759   20.955  -15.500 1.00 57.28 ? 333 THR G CG2 1 
ATOM 8540  N N   . PHE G 2 188 ? 12.718  21.443  -18.805 1.00 60.53 ? 334 PHE G N   1 
ATOM 8541  C CA  . PHE G 2 188 ? 13.717  22.138  -19.608 1.00 60.91 ? 334 PHE G CA  1 
ATOM 8542  C C   . PHE G 2 188 ? 14.034  23.476  -18.951 1.00 60.46 ? 334 PHE G C   1 
ATOM 8543  O O   . PHE G 2 188 ? 15.072  24.083  -19.213 1.00 60.60 ? 334 PHE G O   1 
ATOM 8544  C CB  . PHE G 2 188 ? 13.193  22.367  -21.030 1.00 61.79 ? 334 PHE G CB  1 
ATOM 8545  C CG  . PHE G 2 188 ? 13.392  21.190  -21.947 1.00 63.52 ? 334 PHE G CG  1 
ATOM 8546  C CD1 . PHE G 2 188 ? 12.418  20.846  -22.881 1.00 64.62 ? 334 PHE G CD1 1 
ATOM 8547  C CD2 . PHE G 2 188 ? 14.555  20.420  -21.880 1.00 64.38 ? 334 PHE G CD2 1 
ATOM 8548  C CE1 . PHE G 2 188 ? 12.594  19.748  -23.733 1.00 65.11 ? 334 PHE G CE1 1 
ATOM 8549  C CE2 . PHE G 2 188 ? 14.740  19.323  -22.726 1.00 64.72 ? 334 PHE G CE2 1 
ATOM 8550  C CZ  . PHE G 2 188 ? 13.758  18.987  -23.653 1.00 64.96 ? 334 PHE G CZ  1 
ATOM 8551  N N   . GLU G 2 189 ? 13.126  23.935  -18.097 1.00 59.78 ? 335 GLU G N   1 
ATOM 8552  C CA  . GLU G 2 189 ? 13.318  25.196  -17.394 1.00 59.10 ? 335 GLU G CA  1 
ATOM 8553  C C   . GLU G 2 189 ? 14.425  25.025  -16.348 1.00 58.81 ? 335 GLU G C   1 
ATOM 8554  O O   . GLU G 2 189 ? 15.266  25.907  -16.166 1.00 59.25 ? 335 GLU G O   1 
ATOM 8555  C CB  . GLU G 2 189 ? 12.015  25.628  -16.710 1.00 57.76 ? 335 GLU G CB  1 
ATOM 8556  N N   . ASP G 2 190 ? 14.424  23.871  -15.683 1.00 57.39 ? 336 ASP G N   1 
ATOM 8557  C CA  . ASP G 2 190 ? 15.393  23.557  -14.646 1.00 55.26 ? 336 ASP G CA  1 
ATOM 8558  C C   . ASP G 2 190 ? 16.848  23.500  -15.110 1.00 54.21 ? 336 ASP G C   1 
ATOM 8559  O O   . ASP G 2 190 ? 17.767  23.710  -14.311 1.00 53.62 ? 336 ASP G O   1 
ATOM 8560  C CB  . ASP G 2 190 ? 15.011  22.239  -13.984 1.00 55.88 ? 336 ASP G CB  1 
ATOM 8561  C CG  . ASP G 2 190 ? 13.628  22.282  -13.380 1.00 57.16 ? 336 ASP G CG  1 
ATOM 8562  O OD1 . ASP G 2 190 ? 13.318  23.274  -12.683 1.00 57.66 ? 336 ASP G OD1 1 
ATOM 8563  O OD2 . ASP G 2 190 ? 12.851  21.329  -13.595 1.00 57.85 ? 336 ASP G OD2 1 
ATOM 8564  N N   . ALA G 2 191 ? 17.068  23.216  -16.391 1.00 52.26 ? 337 ALA G N   1 
ATOM 8565  C CA  . ALA G 2 191 ? 18.430  23.145  -16.919 1.00 50.74 ? 337 ALA G CA  1 
ATOM 8566  C C   . ALA G 2 191 ? 19.201  24.420  -16.552 1.00 49.48 ? 337 ALA G C   1 
ATOM 8567  O O   . ALA G 2 191 ? 18.603  25.443  -16.224 1.00 49.71 ? 337 ALA G O   1 
ATOM 8568  C CB  . ALA G 2 191 ? 18.398  22.951  -18.441 1.00 49.55 ? 337 ALA G CB  1 
ATOM 8569  N N   . GLY G 2 192 ? 20.528  24.358  -16.593 1.00 47.86 ? 338 GLY G N   1 
ATOM 8570  C CA  . GLY G 2 192 ? 21.319  25.530  -16.251 1.00 46.54 ? 338 GLY G CA  1 
ATOM 8571  C C   . GLY G 2 192 ? 22.406  25.282  -15.210 1.00 45.99 ? 338 GLY G C   1 
ATOM 8572  O O   . GLY G 2 192 ? 22.668  24.135  -14.821 1.00 45.30 ? 338 GLY G O   1 
ATOM 8573  N N   . GLU G 2 193 ? 23.033  26.368  -14.753 1.00 44.64 ? 339 GLU G N   1 
ATOM 8574  C CA  . GLU G 2 193 ? 24.109  26.281  -13.771 1.00 43.67 ? 339 GLU G CA  1 
ATOM 8575  C C   . GLU G 2 193 ? 23.690  26.485  -12.321 1.00 42.94 ? 339 GLU G C   1 
ATOM 8576  O O   . GLU G 2 193 ? 23.209  27.550  -11.942 1.00 42.34 ? 339 GLU G O   1 
ATOM 8577  C CB  . GLU G 2 193 ? 25.221  27.275  -14.104 1.00 43.18 ? 339 GLU G CB  1 
ATOM 8578  C CG  . GLU G 2 193 ? 26.343  27.306  -13.069 1.00 43.92 ? 339 GLU G CG  1 
ATOM 8579  C CD  . GLU G 2 193 ? 27.480  28.222  -13.476 1.00 45.61 ? 339 GLU G CD  1 
ATOM 8580  O OE1 . GLU G 2 193 ? 27.205  29.404  -13.762 1.00 46.10 ? 339 GLU G OE1 1 
ATOM 8581  O OE2 . GLU G 2 193 ? 28.647  27.765  -13.512 1.00 46.48 ? 339 GLU G OE2 1 
ATOM 8582  N N   . TYR G 2 194 ? 23.906  25.448  -11.518 1.00 41.67 ? 340 TYR G N   1 
ATOM 8583  C CA  . TYR G 2 194 ? 23.581  25.472  -10.098 1.00 40.42 ? 340 TYR G CA  1 
ATOM 8584  C C   . TYR G 2 194 ? 24.840  25.709  -9.280  1.00 39.42 ? 340 TYR G C   1 
ATOM 8585  O O   . TYR G 2 194 ? 25.894  25.167  -9.598  1.00 40.31 ? 340 TYR G O   1 
ATOM 8586  C CB  . TYR G 2 194 ? 22.947  24.149  -9.685  1.00 40.11 ? 340 TYR G CB  1 
ATOM 8587  C CG  . TYR G 2 194 ? 21.563  23.960  -10.239 1.00 39.46 ? 340 TYR G CG  1 
ATOM 8588  C CD1 . TYR G 2 194 ? 21.349  23.862  -11.614 1.00 39.55 ? 340 TYR G CD1 1 
ATOM 8589  C CD2 . TYR G 2 194 ? 20.459  23.914  -9.391  1.00 39.51 ? 340 TYR G CD2 1 
ATOM 8590  C CE1 . TYR G 2 194 ? 20.067  23.726  -12.132 1.00 39.64 ? 340 TYR G CE1 1 
ATOM 8591  C CE2 . TYR G 2 194 ? 19.175  23.780  -9.895  1.00 39.62 ? 340 TYR G CE2 1 
ATOM 8592  C CZ  . TYR G 2 194 ? 18.984  23.690  -11.266 1.00 39.73 ? 340 TYR G CZ  1 
ATOM 8593  O OH  . TYR G 2 194 ? 17.707  23.603  -11.768 1.00 39.99 ? 340 TYR G OH  1 
ATOM 8594  N N   . THR G 2 195 ? 24.735  26.513  -8.227  1.00 37.18 ? 341 THR G N   1 
ATOM 8595  C CA  . THR G 2 195 ? 25.897  26.807  -7.404  1.00 34.84 ? 341 THR G CA  1 
ATOM 8596  C C   . THR G 2 195 ? 25.659  26.658  -5.918  1.00 33.28 ? 341 THR G C   1 
ATOM 8597  O O   . THR G 2 195 ? 24.618  27.043  -5.399  1.00 31.91 ? 341 THR G O   1 
ATOM 8598  C CB  . THR G 2 195 ? 26.423  28.243  -7.655  1.00 34.17 ? 341 THR G CB  1 
ATOM 8599  O OG1 . THR G 2 195 ? 26.810  28.375  -9.025  1.00 33.55 ? 341 THR G OG1 1 
ATOM 8600  C CG2 . THR G 2 195 ? 27.629  28.546  -6.770  1.00 33.39 ? 341 THR G CG2 1 
ATOM 8601  N N   . CYS G 2 196 ? 26.644  26.080  -5.241  1.00 32.90 ? 342 CYS G N   1 
ATOM 8602  C CA  . CYS G 2 196 ? 26.586  25.921  -3.798  1.00 32.00 ? 342 CYS G CA  1 
ATOM 8603  C C   . CYS G 2 196 ? 27.502  26.994  -3.235  1.00 30.95 ? 342 CYS G C   1 
ATOM 8604  O O   . CYS G 2 196 ? 28.707  26.978  -3.474  1.00 31.36 ? 342 CYS G O   1 
ATOM 8605  C CB  . CYS G 2 196 ? 27.085  24.546  -3.371  1.00 32.40 ? 342 CYS G CB  1 
ATOM 8606  S SG  . CYS G 2 196 ? 27.078  24.415  -1.588  1.00 32.52 ? 342 CYS G SG  1 
ATOM 8607  N N   . LEU G 2 197 ? 26.918  27.930  -2.500  1.00 29.80 ? 343 LEU G N   1 
ATOM 8608  C CA  . LEU G 2 197 ? 27.654  29.046  -1.932  1.00 28.75 ? 343 LEU G CA  1 
ATOM 8609  C C   . LEU G 2 197 ? 27.720  28.970  -0.413  1.00 27.98 ? 343 LEU G C   1 
ATOM 8610  O O   . LEU G 2 197 ? 26.694  28.898  0.255   1.00 28.62 ? 343 LEU G O   1 
ATOM 8611  C CB  . LEU G 2 197 ? 26.971  30.338  -2.364  1.00 28.24 ? 343 LEU G CB  1 
ATOM 8612  C CG  . LEU G 2 197 ? 27.304  31.601  -1.575  1.00 28.48 ? 343 LEU G CG  1 
ATOM 8613  C CD1 . LEU G 2 197 ? 28.774  31.879  -1.691  1.00 29.32 ? 343 LEU G CD1 1 
ATOM 8614  C CD2 . LEU G 2 197 ? 26.501  32.780  -2.121  1.00 28.21 ? 343 LEU G CD2 1 
ATOM 8615  N N   . ALA G 2 198 ? 28.932  28.977  0.126   1.00 27.46 ? 344 ALA G N   1 
ATOM 8616  C CA  . ALA G 2 198 ? 29.141  28.910  1.572   1.00 26.63 ? 344 ALA G CA  1 
ATOM 8617  C C   . ALA G 2 198 ? 29.931  30.131  2.022   1.00 25.28 ? 344 ALA G C   1 
ATOM 8618  O O   . ALA G 2 198 ? 30.917  30.503  1.391   1.00 24.97 ? 344 ALA G O   1 
ATOM 8619  C CB  . ALA G 2 198 ? 29.901  27.597  1.955   1.00 25.13 ? 344 ALA G CB  1 
ATOM 8620  N N   . GLY G 2 199 ? 29.495  30.753  3.111   1.00 25.04 ? 345 GLY G N   1 
ATOM 8621  C CA  . GLY G 2 199 ? 30.191  31.923  3.602   1.00 26.18 ? 345 GLY G CA  1 
ATOM 8622  C C   . GLY G 2 199 ? 30.202  32.047  5.104   1.00 26.75 ? 345 GLY G C   1 
ATOM 8623  O O   . GLY G 2 199 ? 29.289  31.580  5.776   1.00 29.08 ? 345 GLY G O   1 
ATOM 8624  N N   . ASN G 2 200 ? 31.258  32.648  5.633   1.00 26.68 ? 346 ASN G N   1 
ATOM 8625  C CA  . ASN G 2 200 ? 31.377  32.873  7.058   1.00 26.81 ? 346 ASN G CA  1 
ATOM 8626  C C   . ASN G 2 200 ? 31.880  34.300  7.273   1.00 28.33 ? 346 ASN G C   1 
ATOM 8627  O O   . ASN G 2 200 ? 32.029  35.072  6.317   1.00 28.22 ? 346 ASN G O   1 
ATOM 8628  C CB  . ASN G 2 200 ? 32.328  31.859  7.702   1.00 25.17 ? 346 ASN G CB  1 
ATOM 8629  C CG  . ASN G 2 200 ? 33.710  31.849  7.071   1.00 25.58 ? 346 ASN G CG  1 
ATOM 8630  O OD1 . ASN G 2 200 ? 34.240  32.885  6.669   1.00 24.38 ? 346 ASN G OD1 1 
ATOM 8631  N ND2 . ASN G 2 200 ? 34.317  30.666  7.007   1.00 25.00 ? 346 ASN G ND2 1 
ATOM 8632  N N   . SER G 2 201 ? 32.142  34.658  8.523   1.00 30.11 ? 347 SER G N   1 
ATOM 8633  C CA  . SER G 2 201 ? 32.618  35.997  8.826   1.00 30.62 ? 347 SER G CA  1 
ATOM 8634  C C   . SER G 2 201 ? 33.890  36.299  8.047   1.00 31.22 ? 347 SER G C   1 
ATOM 8635  O O   . SER G 2 201 ? 34.101  37.425  7.615   1.00 32.68 ? 347 SER G O   1 
ATOM 8636  C CB  . SER G 2 201 ? 32.888  36.132  10.322  1.00 31.35 ? 347 SER G CB  1 
ATOM 8637  O OG  . SER G 2 201 ? 33.988  35.324  10.712  1.00 33.86 ? 347 SER G OG  1 
ATOM 8638  N N   . ILE G 2 202 ? 34.739  35.297  7.854   1.00 30.70 ? 348 ILE G N   1 
ATOM 8639  C CA  . ILE G 2 202 ? 35.984  35.519  7.135   1.00 30.47 ? 348 ILE G CA  1 
ATOM 8640  C C   . ILE G 2 202 ? 35.804  35.729  5.634   1.00 30.76 ? 348 ILE G C   1 
ATOM 8641  O O   . ILE G 2 202 ? 36.356  36.666  5.061   1.00 31.82 ? 348 ILE G O   1 
ATOM 8642  C CB  . ILE G 2 202 ? 36.964  34.359  7.363   1.00 30.38 ? 348 ILE G CB  1 
ATOM 8643  C CG1 . ILE G 2 202 ? 37.322  34.300  8.847   1.00 28.88 ? 348 ILE G CG1 1 
ATOM 8644  C CG2 . ILE G 2 202 ? 38.217  34.549  6.504   1.00 28.54 ? 348 ILE G CG2 1 
ATOM 8645  C CD1 . ILE G 2 202 ? 38.120  33.099  9.234   1.00 30.35 ? 348 ILE G CD1 1 
ATOM 8646  N N   . GLY G 2 203 ? 35.029  34.872  4.988   1.00 30.44 ? 349 GLY G N   1 
ATOM 8647  C CA  . GLY G 2 203 ? 34.855  35.036  3.563   1.00 29.65 ? 349 GLY G CA  1 
ATOM 8648  C C   . GLY G 2 203 ? 33.839  34.108  2.939   1.00 30.35 ? 349 GLY G C   1 
ATOM 8649  O O   . GLY G 2 203 ? 33.179  33.338  3.634   1.00 30.35 ? 349 GLY G O   1 
ATOM 8650  N N   . ILE G 2 204 ? 33.745  34.177  1.612   1.00 30.11 ? 350 ILE G N   1 
ATOM 8651  C CA  . ILE G 2 204 ? 32.801  33.395  0.822   1.00 29.90 ? 350 ILE G CA  1 
ATOM 8652  C C   . ILE G 2 204 ? 33.477  32.446  -0.161  1.00 29.39 ? 350 ILE G C   1 
ATOM 8653  O O   . ILE G 2 204 ? 34.527  32.760  -0.697  1.00 30.48 ? 350 ILE G O   1 
ATOM 8654  C CB  . ILE G 2 204 ? 31.902  34.342  0.006   1.00 31.07 ? 350 ILE G CB  1 
ATOM 8655  C CG1 . ILE G 2 204 ? 30.845  34.959  0.921   1.00 30.81 ? 350 ILE G CG1 1 
ATOM 8656  C CG2 . ILE G 2 204 ? 31.298  33.604  -1.190  1.00 30.06 ? 350 ILE G CG2 1 
ATOM 8657  C CD1 . ILE G 2 204 ? 30.029  36.057  0.270   1.00 30.89 ? 350 ILE G CD1 1 
ATOM 8658  N N   . SER G 2 205 ? 32.850  31.303  -0.421  1.00 28.92 ? 351 SER G N   1 
ATOM 8659  C CA  . SER G 2 205 ? 33.388  30.311  -1.353  1.00 28.59 ? 351 SER G CA  1 
ATOM 8660  C C   . SER G 2 205 ? 32.228  29.605  -2.052  1.00 29.58 ? 351 SER G C   1 
ATOM 8661  O O   . SER G 2 205 ? 31.157  29.455  -1.470  1.00 30.97 ? 351 SER G O   1 
ATOM 8662  C CB  . SER G 2 205 ? 34.224  29.280  -0.599  1.00 27.83 ? 351 SER G CB  1 
ATOM 8663  O OG  . SER G 2 205 ? 35.305  29.885  0.082   1.00 26.17 ? 351 SER G OG  1 
ATOM 8664  N N   . PHE G 2 206 ? 32.432  29.154  -3.285  1.00 29.32 ? 352 PHE G N   1 
ATOM 8665  C CA  . PHE G 2 206 ? 31.353  28.487  -4.016  1.00 28.53 ? 352 PHE G CA  1 
ATOM 8666  C C   . PHE G 2 206 ? 31.812  27.583  -5.156  1.00 29.17 ? 352 PHE G C   1 
ATOM 8667  O O   . PHE G 2 206 ? 32.824  27.840  -5.801  1.00 29.72 ? 352 PHE G O   1 
ATOM 8668  C CB  . PHE G 2 206 ? 30.419  29.542  -4.589  1.00 26.85 ? 352 PHE G CB  1 
ATOM 8669  C CG  . PHE G 2 206 ? 31.047  30.387  -5.672  1.00 25.84 ? 352 PHE G CG  1 
ATOM 8670  C CD1 . PHE G 2 206 ? 31.181  29.895  -6.974  1.00 26.18 ? 352 PHE G CD1 1 
ATOM 8671  C CD2 . PHE G 2 206 ? 31.516  31.677  -5.394  1.00 23.90 ? 352 PHE G CD2 1 
ATOM 8672  C CE1 . PHE G 2 206 ? 31.778  30.680  -7.989  1.00 25.72 ? 352 PHE G CE1 1 
ATOM 8673  C CE2 . PHE G 2 206 ? 32.112  32.463  -6.394  1.00 22.29 ? 352 PHE G CE2 1 
ATOM 8674  C CZ  . PHE G 2 206 ? 32.243  31.966  -7.690  1.00 23.51 ? 352 PHE G CZ  1 
ATOM 8675  N N   . HIS G 2 207 ? 31.043  26.531  -5.412  1.00 30.46 ? 353 HIS G N   1 
ATOM 8676  C CA  . HIS G 2 207 ? 31.330  25.595  -6.500  1.00 31.07 ? 353 HIS G CA  1 
ATOM 8677  C C   . HIS G 2 207 ? 30.077  25.485  -7.349  1.00 32.14 ? 353 HIS G C   1 
ATOM 8678  O O   . HIS G 2 207 ? 28.979  25.343  -6.823  1.00 32.73 ? 353 HIS G O   1 
ATOM 8679  C CB  . HIS G 2 207 ? 31.703  24.208  -5.956  1.00 30.08 ? 353 HIS G CB  1 
ATOM 8680  C CG  . HIS G 2 207 ? 33.098  24.116  -5.413  1.00 30.33 ? 353 HIS G CG  1 
ATOM 8681  N ND1 . HIS G 2 207 ? 33.607  22.965  -4.853  1.00 30.78 ? 353 HIS G ND1 1 
ATOM 8682  C CD2 . HIS G 2 207 ? 34.092  25.038  -5.331  1.00 30.86 ? 353 HIS G CD2 1 
ATOM 8683  C CE1 . HIS G 2 207 ? 34.848  23.176  -4.447  1.00 30.52 ? 353 HIS G CE1 1 
ATOM 8684  N NE2 . HIS G 2 207 ? 35.165  24.428  -4.727  1.00 30.33 ? 353 HIS G NE2 1 
ATOM 8685  N N   . SER G 2 208 ? 30.242  25.550  -8.661  1.00 33.92 ? 354 SER G N   1 
ATOM 8686  C CA  . SER G 2 208 ? 29.115  25.462  -9.581  1.00 34.78 ? 354 SER G CA  1 
ATOM 8687  C C   . SER G 2 208 ? 29.108  24.159  -10.385 1.00 35.31 ? 354 SER G C   1 
ATOM 8688  O O   . SER G 2 208 ? 30.155  23.581  -10.677 1.00 34.25 ? 354 SER G O   1 
ATOM 8689  C CB  . SER G 2 208 ? 29.141  26.672  -10.517 1.00 34.75 ? 354 SER G CB  1 
ATOM 8690  O OG  . SER G 2 208 ? 29.276  27.863  -9.761  1.00 34.21 ? 354 SER G OG  1 
ATOM 8691  N N   . ALA G 2 209 ? 27.910  23.702  -10.723 1.00 37.54 ? 355 ALA G N   1 
ATOM 8692  C CA  . ALA G 2 209 ? 27.720  22.484  -11.494 1.00 40.32 ? 355 ALA G CA  1 
ATOM 8693  C C   . ALA G 2 209 ? 26.686  22.804  -12.556 1.00 42.28 ? 355 ALA G C   1 
ATOM 8694  O O   . ALA G 2 209 ? 25.975  23.797  -12.446 1.00 42.26 ? 355 ALA G O   1 
ATOM 8695  C CB  . ALA G 2 209 ? 27.227  21.353  -10.597 1.00 39.89 ? 355 ALA G CB  1 
ATOM 8696  N N   . TRP G 2 210 ? 26.596  21.963  -13.578 1.00 45.65 ? 356 TRP G N   1 
ATOM 8697  C CA  . TRP G 2 210 ? 25.651  22.187  -14.667 1.00 49.08 ? 356 TRP G CA  1 
ATOM 8698  C C   . TRP G 2 210 ? 24.634  21.068  -14.866 1.00 50.21 ? 356 TRP G C   1 
ATOM 8699  O O   . TRP G 2 210 ? 24.998  19.904  -15.024 1.00 51.01 ? 356 TRP G O   1 
ATOM 8700  C CB  . TRP G 2 210 ? 26.411  22.384  -15.971 1.00 51.23 ? 356 TRP G CB  1 
ATOM 8701  C CG  . TRP G 2 210 ? 26.348  23.770  -16.513 1.00 54.73 ? 356 TRP G CG  1 
ATOM 8702  C CD1 . TRP G 2 210 ? 25.285  24.369  -17.152 1.00 55.23 ? 356 TRP G CD1 1 
ATOM 8703  C CD2 . TRP G 2 210 ? 27.404  24.729  -16.504 1.00 56.38 ? 356 TRP G CD2 1 
ATOM 8704  N NE1 . TRP G 2 210 ? 25.628  25.642  -17.545 1.00 56.30 ? 356 TRP G NE1 1 
ATOM 8705  C CE2 . TRP G 2 210 ? 26.923  25.889  -17.162 1.00 57.76 ? 356 TRP G CE2 1 
ATOM 8706  C CE3 . TRP G 2 210 ? 28.719  24.723  -16.009 1.00 58.17 ? 356 TRP G CE3 1 
ATOM 8707  C CZ2 . TRP G 2 210 ? 27.718  27.038  -17.336 1.00 59.39 ? 356 TRP G CZ2 1 
ATOM 8708  C CZ3 . TRP G 2 210 ? 29.513  25.865  -16.180 1.00 59.59 ? 356 TRP G CZ3 1 
ATOM 8709  C CH2 . TRP G 2 210 ? 29.008  27.006  -16.842 1.00 60.08 ? 356 TRP G CH2 1 
ATOM 8710  N N   . LEU G 2 211 ? 23.356  21.431  -14.865 1.00 50.39 ? 357 LEU G N   1 
ATOM 8711  C CA  . LEU G 2 211 ? 22.287  20.469  -15.077 1.00 50.55 ? 357 LEU G CA  1 
ATOM 8712  C C   . LEU G 2 211 ? 21.874  20.507  -16.543 1.00 51.25 ? 357 LEU G C   1 
ATOM 8713  O O   . LEU G 2 211 ? 21.496  21.556  -17.063 1.00 50.91 ? 357 LEU G O   1 
ATOM 8714  C CB  . LEU G 2 211 ? 21.071  20.803  -14.211 1.00 49.65 ? 357 LEU G CB  1 
ATOM 8715  C CG  . LEU G 2 211 ? 19.770  20.038  -14.506 1.00 48.12 ? 357 LEU G CG  1 
ATOM 8716  C CD1 . LEU G 2 211 ? 19.932  18.564  -14.192 1.00 47.48 ? 357 LEU G CD1 1 
ATOM 8717  C CD2 . LEU G 2 211 ? 18.652  20.621  -13.670 1.00 47.84 ? 357 LEU G CD2 1 
ATOM 8718  N N   . THR G 2 212 ? 21.960  19.357  -17.205 1.00 52.36 ? 358 THR G N   1 
ATOM 8719  C CA  . THR G 2 212 ? 21.584  19.239  -18.608 1.00 52.94 ? 358 THR G CA  1 
ATOM 8720  C C   . THR G 2 212 ? 20.329  18.393  -18.731 1.00 54.04 ? 358 THR G C   1 
ATOM 8721  O O   . THR G 2 212 ? 20.318  17.233  -18.318 1.00 53.72 ? 358 THR G O   1 
ATOM 8722  C CB  . THR G 2 212 ? 22.684  18.559  -19.441 1.00 51.05 ? 358 THR G CB  1 
ATOM 8723  O OG1 . THR G 2 212 ? 23.878  19.338  -19.396 1.00 49.58 ? 358 THR G OG1 1 
ATOM 8724  C CG2 . THR G 2 212 ? 22.249  18.431  -20.877 1.00 50.57 ? 358 THR G CG2 1 
ATOM 8725  N N   . VAL G 2 213 ? 19.278  18.982  -19.298 1.00 55.65 ? 359 VAL G N   1 
ATOM 8726  C CA  . VAL G 2 213 ? 18.014  18.282  -19.491 1.00 57.75 ? 359 VAL G CA  1 
ATOM 8727  C C   . VAL G 2 213 ? 17.851  17.887  -20.953 1.00 59.01 ? 359 VAL G C   1 
ATOM 8728  O O   . VAL G 2 213 ? 17.914  18.736  -21.841 1.00 59.66 ? 359 VAL G O   1 
ATOM 8729  C CB  . VAL G 2 213 ? 16.810  19.159  -19.102 1.00 57.12 ? 359 VAL G CB  1 
ATOM 8730  C CG1 . VAL G 2 213 ? 15.537  18.323  -19.138 1.00 55.75 ? 359 VAL G CG1 1 
ATOM 8731  C CG2 . VAL G 2 213 ? 17.028  19.769  -17.729 1.00 56.59 ? 359 VAL G CG2 1 
ATOM 8732  N N   . LEU G 2 214 ? 17.634  16.597  -21.193 1.00 60.18 ? 360 LEU G N   1 
ATOM 8733  C CA  . LEU G 2 214 ? 17.459  16.073  -22.545 1.00 60.72 ? 360 LEU G CA  1 
ATOM 8734  C C   . LEU G 2 214 ? 16.008  15.700  -22.860 1.00 61.90 ? 360 LEU G C   1 
ATOM 8735  O O   . LEU G 2 214 ? 15.204  15.431  -21.961 1.00 62.43 ? 360 LEU G O   1 
ATOM 8736  C CB  . LEU G 2 214 ? 18.359  14.855  -22.746 1.00 59.15 ? 360 LEU G CB  1 
ATOM 8737  C CG  . LEU G 2 214 ? 19.843  15.132  -22.509 1.00 58.60 ? 360 LEU G CG  1 
ATOM 8738  C CD1 . LEU G 2 214 ? 20.652  13.862  -22.678 1.00 57.39 ? 360 LEU G CD1 1 
ATOM 8739  C CD2 . LEU G 2 214 ? 20.313  16.190  -23.482 1.00 58.71 ? 360 LEU G CD2 1 
ATOM 8740  N N   . PRO G 2 215 ? 15.681  15.683  -24.149 1.00 62.70 ? 361 PRO G N   1 
ATOM 8741  C CA  . PRO G 2 215 ? 14.337  15.341  -24.590 1.00 63.01 ? 361 PRO G CA  1 
ATOM 8742  C C   . PRO G 2 215 ? 14.039  13.856  -24.392 1.00 63.41 ? 361 PRO G C   1 
ATOM 8743  O O   . PRO G 2 215 ? 12.874  13.542  -24.056 1.00 63.91 ? 361 PRO G O   1 
ATOM 8744  C CB  . PRO G 2 215 ? 14.177  15.711  -26.059 1.00 62.90 ? 361 PRO G CB  1 
ATOM 8745  N N   . ASN H 2 4   ? -2.680  -0.544  -65.359 1.00 48.10 ? 150 ASN H N   1 
ATOM 8746  C CA  . ASN H 2 4   ? -1.360  -1.241  -65.236 1.00 49.05 ? 150 ASN H CA  1 
ATOM 8747  C C   . ASN H 2 4   ? -1.401  -2.356  -64.173 1.00 48.35 ? 150 ASN H C   1 
ATOM 8748  O O   . ASN H 2 4   ? -1.037  -2.147  -63.006 1.00 49.07 ? 150 ASN H O   1 
ATOM 8749  C CB  . ASN H 2 4   ? -0.248  -0.228  -64.902 1.00 48.11 ? 150 ASN H CB  1 
ATOM 8750  N N   . LYS H 2 5   ? -1.845  -3.539  -64.598 1.00 46.52 ? 151 LYS H N   1 
ATOM 8751  C CA  . LYS H 2 5   ? -1.949  -4.709  -63.731 1.00 45.04 ? 151 LYS H CA  1 
ATOM 8752  C C   . LYS H 2 5   ? -0.581  -5.338  -63.484 1.00 44.25 ? 151 LYS H C   1 
ATOM 8753  O O   . LYS H 2 5   ? 0.144   -5.647  -64.431 1.00 45.21 ? 151 LYS H O   1 
ATOM 8754  C CB  . LYS H 2 5   ? -2.871  -5.748  -64.371 1.00 45.24 ? 151 LYS H CB  1 
ATOM 8755  N N   . ARG H 2 6   ? -0.232  -5.537  -62.215 1.00 42.51 ? 152 ARG H N   1 
ATOM 8756  C CA  . ARG H 2 6   ? 1.059   -6.128  -61.866 1.00 40.48 ? 152 ARG H CA  1 
ATOM 8757  C C   . ARG H 2 6   ? 1.019   -7.026  -60.630 1.00 39.09 ? 152 ARG H C   1 
ATOM 8758  O O   . ARG H 2 6   ? 0.126   -6.914  -59.781 1.00 38.68 ? 152 ARG H O   1 
ATOM 8759  C CB  . ARG H 2 6   ? 2.091   -5.028  -61.640 1.00 40.89 ? 152 ARG H CB  1 
ATOM 8760  C CG  . ARG H 2 6   ? 1.871   -4.227  -60.365 1.00 41.19 ? 152 ARG H CG  1 
ATOM 8761  C CD  . ARG H 2 6   ? 2.854   -3.058  -60.238 1.00 41.23 ? 152 ARG H CD  1 
ATOM 8762  N NE  . ARG H 2 6   ? 4.227   -3.463  -59.942 1.00 40.09 ? 152 ARG H NE  1 
ATOM 8763  C CZ  . ARG H 2 6   ? 5.197   -2.602  -59.648 1.00 39.52 ? 152 ARG H CZ  1 
ATOM 8764  N NH1 . ARG H 2 6   ? 4.936   -1.304  -59.617 1.00 38.07 ? 152 ARG H NH1 1 
ATOM 8765  N NH2 . ARG H 2 6   ? 6.426   -3.028  -59.389 1.00 38.77 ? 152 ARG H NH2 1 
ATOM 8766  N N   . ALA H 2 7   ? 2.005   -7.915  -60.543 1.00 37.57 ? 153 ALA H N   1 
ATOM 8767  C CA  . ALA H 2 7   ? 2.124   -8.839  -59.419 1.00 36.74 ? 153 ALA H CA  1 
ATOM 8768  C C   . ALA H 2 7   ? 2.451   -8.080  -58.132 1.00 36.34 ? 153 ALA H C   1 
ATOM 8769  O O   . ALA H 2 7   ? 2.932   -6.942  -58.170 1.00 36.96 ? 153 ALA H O   1 
ATOM 8770  C CB  . ALA H 2 7   ? 3.215   -9.847  -59.699 1.00 36.14 ? 153 ALA H CB  1 
ATOM 8771  N N   . PRO H 2 8   ? 2.216   -8.711  -56.973 1.00 35.21 ? 154 PRO H N   1 
ATOM 8772  C CA  . PRO H 2 8   ? 2.477   -8.109  -55.661 1.00 34.57 ? 154 PRO H CA  1 
ATOM 8773  C C   . PRO H 2 8   ? 3.940   -7.745  -55.453 1.00 33.79 ? 154 PRO H C   1 
ATOM 8774  O O   . PRO H 2 8   ? 4.836   -8.459  -55.904 1.00 33.61 ? 154 PRO H O   1 
ATOM 8775  C CB  . PRO H 2 8   ? 2.055   -9.203  -54.682 1.00 34.55 ? 154 PRO H CB  1 
ATOM 8776  C CG  . PRO H 2 8   ? 1.056   -10.003 -55.461 1.00 36.66 ? 154 PRO H CG  1 
ATOM 8777  C CD  . PRO H 2 8   ? 1.693   -10.075 -56.823 1.00 35.41 ? 154 PRO H CD  1 
ATOM 8778  N N   . TYR H 2 9   ? 4.176   -6.636  -54.762 1.00 32.45 ? 155 TYR H N   1 
ATOM 8779  C CA  . TYR H 2 9   ? 5.535   -6.204  -54.464 1.00 32.33 ? 155 TYR H CA  1 
ATOM 8780  C C   . TYR H 2 9   ? 5.555   -5.430  -53.138 1.00 32.36 ? 155 TYR H C   1 
ATOM 8781  O O   . TYR H 2 9   ? 4.536   -4.852  -52.716 1.00 32.21 ? 155 TYR H O   1 
ATOM 8782  C CB  . TYR H 2 9   ? 6.107   -5.342  -55.601 1.00 30.46 ? 155 TYR H CB  1 
ATOM 8783  C CG  . TYR H 2 9   ? 5.405   -4.022  -55.777 1.00 32.64 ? 155 TYR H CG  1 
ATOM 8784  C CD1 . TYR H 2 9   ? 4.095   -3.976  -56.260 1.00 33.88 ? 155 TYR H CD1 1 
ATOM 8785  C CD2 . TYR H 2 9   ? 6.022   -2.819  -55.426 1.00 32.00 ? 155 TYR H CD2 1 
ATOM 8786  C CE1 . TYR H 2 9   ? 3.409   -2.774  -56.389 1.00 33.67 ? 155 TYR H CE1 1 
ATOM 8787  C CE2 . TYR H 2 9   ? 5.341   -1.604  -55.548 1.00 32.99 ? 155 TYR H CE2 1 
ATOM 8788  C CZ  . TYR H 2 9   ? 4.029   -1.593  -56.035 1.00 34.18 ? 155 TYR H CZ  1 
ATOM 8789  O OH  . TYR H 2 9   ? 3.321   -0.417  -56.183 1.00 34.30 ? 155 TYR H OH  1 
ATOM 8790  N N   . TRP H 2 10  ? 6.705   -5.443  -52.466 1.00 31.64 ? 156 TRP H N   1 
ATOM 8791  C CA  . TRP H 2 10  ? 6.837   -4.739  -51.194 1.00 31.54 ? 156 TRP H CA  1 
ATOM 8792  C C   . TRP H 2 10  ? 7.029   -3.267  -51.501 1.00 32.69 ? 156 TRP H C   1 
ATOM 8793  O O   . TRP H 2 10  ? 7.903   -2.914  -52.285 1.00 33.56 ? 156 TRP H O   1 
ATOM 8794  C CB  . TRP H 2 10  ? 8.036   -5.259  -50.392 1.00 28.65 ? 156 TRP H CB  1 
ATOM 8795  C CG  . TRP H 2 10  ? 7.990   -6.743  -50.149 1.00 26.26 ? 156 TRP H CG  1 
ATOM 8796  C CD1 . TRP H 2 10  ? 8.968   -7.659  -50.438 1.00 24.60 ? 156 TRP H CD1 1 
ATOM 8797  C CD2 . TRP H 2 10  ? 6.885   -7.488  -49.635 1.00 24.68 ? 156 TRP H CD2 1 
ATOM 8798  N NE1 . TRP H 2 10  ? 8.531   -8.930  -50.142 1.00 23.26 ? 156 TRP H NE1 1 
ATOM 8799  C CE2 . TRP H 2 10  ? 7.257   -8.853  -49.647 1.00 23.57 ? 156 TRP H CE2 1 
ATOM 8800  C CE3 . TRP H 2 10  ? 5.608   -7.139  -49.170 1.00 24.84 ? 156 TRP H CE3 1 
ATOM 8801  C CZ2 . TRP H 2 10  ? 6.400   -9.866  -49.217 1.00 23.56 ? 156 TRP H CZ2 1 
ATOM 8802  C CZ3 . TRP H 2 10  ? 4.751   -8.152  -48.745 1.00 25.18 ? 156 TRP H CZ3 1 
ATOM 8803  C CH2 . TRP H 2 10  ? 5.155   -9.499  -48.771 1.00 24.47 ? 156 TRP H CH2 1 
ATOM 8804  N N   . THR H 2 11  ? 6.211   -2.414  -50.887 1.00 33.57 ? 157 THR H N   1 
ATOM 8805  C CA  . THR H 2 11  ? 6.296   -0.976  -51.115 1.00 33.87 ? 157 THR H CA  1 
ATOM 8806  C C   . THR H 2 11  ? 7.270   -0.297  -50.171 1.00 36.64 ? 157 THR H C   1 
ATOM 8807  O O   . THR H 2 11  ? 7.719   0.820   -50.435 1.00 36.99 ? 157 THR H O   1 
ATOM 8808  C CB  . THR H 2 11  ? 4.941   -0.268  -50.917 1.00 32.27 ? 157 THR H CB  1 
ATOM 8809  O OG1 . THR H 2 11  ? 4.476   -0.487  -49.583 1.00 30.97 ? 157 THR H OG1 1 
ATOM 8810  C CG2 . THR H 2 11  ? 3.908   -0.777  -51.894 1.00 32.33 ? 157 THR H CG2 1 
ATOM 8811  N N   . ASN H 2 12  ? 7.588   -0.954  -49.060 1.00 38.77 ? 158 ASN H N   1 
ATOM 8812  C CA  . ASN H 2 12  ? 8.503   -0.374  -48.089 1.00 40.41 ? 158 ASN H CA  1 
ATOM 8813  C C   . ASN H 2 12  ? 9.380   -1.441  -47.454 1.00 41.16 ? 158 ASN H C   1 
ATOM 8814  O O   . ASN H 2 12  ? 9.152   -1.849  -46.311 1.00 41.97 ? 158 ASN H O   1 
ATOM 8815  C CB  . ASN H 2 12  ? 7.713   0.347   -46.998 1.00 42.15 ? 158 ASN H CB  1 
ATOM 8816  C CG  . ASN H 2 12  ? 8.609   0.873   -45.888 1.00 46.18 ? 158 ASN H CG  1 
ATOM 8817  O OD1 . ASN H 2 12  ? 8.253   0.798   -44.705 1.00 50.15 ? 158 ASN H OD1 1 
ATOM 8818  N ND2 . ASN H 2 12  ? 9.774   1.413   -46.256 1.00 46.19 ? 158 ASN H ND2 1 
ATOM 8819  N N   . THR H 2 13  ? 10.398  -1.882  -48.182 1.00 40.94 ? 159 THR H N   1 
ATOM 8820  C CA  . THR H 2 13  ? 11.280  -2.916  -47.673 1.00 40.81 ? 159 THR H CA  1 
ATOM 8821  C C   . THR H 2 13  ? 12.075  -2.456  -46.470 1.00 40.73 ? 159 THR H C   1 
ATOM 8822  O O   . THR H 2 13  ? 12.583  -3.277  -45.706 1.00 40.92 ? 159 THR H O   1 
ATOM 8823  C CB  . THR H 2 13  ? 12.263  -3.376  -48.734 1.00 41.03 ? 159 THR H CB  1 
ATOM 8824  O OG1 . THR H 2 13  ? 13.125  -2.287  -49.082 1.00 43.46 ? 159 THR H OG1 1 
ATOM 8825  C CG2 . THR H 2 13  ? 11.514  -3.867  -49.959 1.00 40.27 ? 159 THR H CG2 1 
ATOM 8826  N N   . GLU H 2 14  ? 12.196  -1.143  -46.307 1.00 40.65 ? 160 GLU H N   1 
ATOM 8827  C CA  . GLU H 2 14  ? 12.936  -0.594  -45.177 1.00 40.07 ? 160 GLU H CA  1 
ATOM 8828  C C   . GLU H 2 14  ? 12.300  -1.087  -43.876 1.00 40.38 ? 160 GLU H C   1 
ATOM 8829  O O   . GLU H 2 14  ? 12.984  -1.609  -42.994 1.00 40.60 ? 160 GLU H O   1 
ATOM 8830  C CB  . GLU H 2 14  ? 12.922  0.936   -45.224 1.00 39.20 ? 160 GLU H CB  1 
ATOM 8831  N N   . LYS H 2 15  ? 10.984  -0.946  -43.772 1.00 39.86 ? 161 LYS H N   1 
ATOM 8832  C CA  . LYS H 2 15  ? 10.270  -1.381  -42.574 1.00 39.84 ? 161 LYS H CA  1 
ATOM 8833  C C   . LYS H 2 15  ? 10.272  -2.910  -42.371 1.00 39.76 ? 161 LYS H C   1 
ATOM 8834  O O   . LYS H 2 15  ? 9.731   -3.402  -41.381 1.00 39.20 ? 161 LYS H O   1 
ATOM 8835  C CB  . LYS H 2 15  ? 8.822   -0.867  -42.614 1.00 39.13 ? 161 LYS H CB  1 
ATOM 8836  N N   . MET H 2 16  ? 10.887  -3.649  -43.296 1.00 39.56 ? 162 MET H N   1 
ATOM 8837  C CA  . MET H 2 16  ? 10.934  -5.115  -43.222 1.00 38.94 ? 162 MET H CA  1 
ATOM 8838  C C   . MET H 2 16  ? 12.320  -5.712  -42.984 1.00 38.53 ? 162 MET H C   1 
ATOM 8839  O O   . MET H 2 16  ? 12.435  -6.914  -42.715 1.00 37.56 ? 162 MET H O   1 
ATOM 8840  C CB  . MET H 2 16  ? 10.384  -5.733  -44.512 1.00 38.51 ? 162 MET H CB  1 
ATOM 8841  C CG  . MET H 2 16  ? 8.931   -5.423  -44.799 1.00 38.58 ? 162 MET H CG  1 
ATOM 8842  S SD  . MET H 2 16  ? 8.501   -5.844  -46.491 1.00 37.45 ? 162 MET H SD  1 
ATOM 8843  C CE  . MET H 2 16  ? 8.060   -7.595  -46.333 1.00 38.48 ? 162 MET H CE  1 
ATOM 8844  N N   . GLU H 2 17  ? 13.360  -4.883  -43.093 1.00 38.28 ? 163 GLU H N   1 
ATOM 8845  C CA  . GLU H 2 17  ? 14.740  -5.335  -42.922 1.00 37.89 ? 163 GLU H CA  1 
ATOM 8846  C C   . GLU H 2 17  ? 15.005  -6.090  -41.607 1.00 38.09 ? 163 GLU H C   1 
ATOM 8847  O O   . GLU H 2 17  ? 15.730  -7.083  -41.593 1.00 39.39 ? 163 GLU H O   1 
ATOM 8848  C CB  . GLU H 2 17  ? 15.691  -4.141  -43.069 1.00 37.09 ? 163 GLU H CB  1 
ATOM 8849  N N   . LYS H 2 18  ? 14.406  -5.625  -40.514 1.00 37.98 ? 164 LYS H N   1 
ATOM 8850  C CA  . LYS H 2 18  ? 14.548  -6.242  -39.193 1.00 37.12 ? 164 LYS H CA  1 
ATOM 8851  C C   . LYS H 2 18  ? 13.728  -7.532  -39.133 1.00 37.22 ? 164 LYS H C   1 
ATOM 8852  O O   . LYS H 2 18  ? 12.541  -7.500  -38.815 1.00 36.84 ? 164 LYS H O   1 
ATOM 8853  C CB  . LYS H 2 18  ? 14.049  -5.258  -38.121 1.00 36.63 ? 164 LYS H CB  1 
ATOM 8854  C CG  . LYS H 2 18  ? 14.096  -5.779  -36.696 1.00 36.31 ? 164 LYS H CG  1 
ATOM 8855  C CD  . LYS H 2 18  ? 13.490  -4.800  -35.706 1.00 35.96 ? 164 LYS H CD  1 
ATOM 8856  C CE  . LYS H 2 18  ? 13.754  -5.279  -34.279 1.00 37.19 ? 164 LYS H CE  1 
ATOM 8857  N NZ  . LYS H 2 18  ? 13.188  -4.411  -33.198 1.00 36.77 ? 164 LYS H NZ  1 
ATOM 8858  N N   . ARG H 2 19  ? 14.365  -8.665  -39.421 1.00 37.59 ? 165 ARG H N   1 
ATOM 8859  C CA  . ARG H 2 19  ? 13.670  -9.955  -39.426 1.00 37.97 ? 165 ARG H CA  1 
ATOM 8860  C C   . ARG H 2 19  ? 13.379  -10.576 -38.064 1.00 36.89 ? 165 ARG H C   1 
ATOM 8861  O O   . ARG H 2 19  ? 12.297  -11.134 -37.846 1.00 36.25 ? 165 ARG H O   1 
ATOM 8862  C CB  . ARG H 2 19  ? 14.425  -10.947 -40.305 1.00 40.43 ? 165 ARG H CB  1 
ATOM 8863  C CG  . ARG H 2 19  ? 13.886  -10.989 -41.729 1.00 46.13 ? 165 ARG H CG  1 
ATOM 8864  C CD  . ARG H 2 19  ? 14.743  -11.870 -42.630 1.00 51.23 ? 165 ARG H CD  1 
ATOM 8865  N NE  . ARG H 2 19  ? 16.053  -11.262 -42.894 1.00 56.23 ? 165 ARG H NE  1 
ATOM 8866  C CZ  . ARG H 2 19  ? 16.458  -10.832 -44.092 1.00 57.68 ? 165 ARG H CZ  1 
ATOM 8867  N NH1 . ARG H 2 19  ? 15.656  -10.942 -45.152 1.00 57.58 ? 165 ARG H NH1 1 
ATOM 8868  N NH2 . ARG H 2 19  ? 17.666  -10.293 -44.233 1.00 57.13 ? 165 ARG H NH2 1 
ATOM 8869  N N   . LEU H 2 20  ? 14.338  -10.492 -37.150 1.00 35.80 ? 166 LEU H N   1 
ATOM 8870  C CA  . LEU H 2 20  ? 14.136  -11.025 -35.816 1.00 33.65 ? 166 LEU H CA  1 
ATOM 8871  C C   . LEU H 2 20  ? 13.666  -9.919  -34.884 1.00 34.50 ? 166 LEU H C   1 
ATOM 8872  O O   . LEU H 2 20  ? 14.323  -8.891  -34.729 1.00 34.81 ? 166 LEU H O   1 
ATOM 8873  C CB  . LEU H 2 20  ? 15.413  -11.651 -35.269 1.00 31.43 ? 166 LEU H CB  1 
ATOM 8874  C CG  . LEU H 2 20  ? 15.318  -12.005 -33.777 1.00 31.68 ? 166 LEU H CG  1 
ATOM 8875  C CD1 . LEU H 2 20  ? 14.067  -12.824 -33.519 1.00 30.20 ? 166 LEU H CD1 1 
ATOM 8876  C CD2 . LEU H 2 20  ? 16.562  -12.759 -33.331 1.00 30.36 ? 166 LEU H CD2 1 
ATOM 8877  N N   . HIS H 2 21  ? 12.506  -10.138 -34.279 1.00 35.58 ? 167 HIS H N   1 
ATOM 8878  C CA  . HIS H 2 21  ? 11.928  -9.197  -33.338 1.00 35.57 ? 167 HIS H CA  1 
ATOM 8879  C C   . HIS H 2 21  ? 11.956  -9.801  -31.952 1.00 34.84 ? 167 HIS H C   1 
ATOM 8880  O O   . HIS H 2 21  ? 11.183  -10.713 -31.655 1.00 34.37 ? 167 HIS H O   1 
ATOM 8881  C CB  . HIS H 2 21  ? 10.487  -8.890  -33.701 1.00 37.61 ? 167 HIS H CB  1 
ATOM 8882  C CG  . HIS H 2 21  ? 10.347  -7.869  -34.776 1.00 40.83 ? 167 HIS H CG  1 
ATOM 8883  N ND1 . HIS H 2 21  ? 10.912  -8.026  -36.025 1.00 42.47 ? 167 HIS H ND1 1 
ATOM 8884  C CD2 . HIS H 2 21  ? 9.702   -6.680  -34.798 1.00 41.75 ? 167 HIS H CD2 1 
ATOM 8885  C CE1 . HIS H 2 21  ? 10.619  -6.976  -36.773 1.00 42.74 ? 167 HIS H CE1 1 
ATOM 8886  N NE2 . HIS H 2 21  ? 9.886   -6.146  -36.053 1.00 43.18 ? 167 HIS H NE2 1 
ATOM 8887  N N   . ALA H 2 22  ? 12.864  -9.314  -31.114 1.00 32.98 ? 168 ALA H N   1 
ATOM 8888  C CA  . ALA H 2 22  ? 12.950  -9.792  -29.745 1.00 31.53 ? 168 ALA H CA  1 
ATOM 8889  C C   . ALA H 2 22  ? 12.469  -8.642  -28.867 1.00 31.54 ? 168 ALA H C   1 
ATOM 8890  O O   . ALA H 2 22  ? 13.036  -7.543  -28.894 1.00 32.81 ? 168 ALA H O   1 
ATOM 8891  C CB  . ALA H 2 22  ? 14.370  -10.172 -29.399 1.00 30.35 ? 168 ALA H CB  1 
ATOM 8892  N N   . VAL H 2 23  ? 11.405  -8.877  -28.111 1.00 30.69 ? 169 VAL H N   1 
ATOM 8893  C CA  . VAL H 2 23  ? 10.880  -7.833  -27.250 1.00 30.26 ? 169 VAL H CA  1 
ATOM 8894  C C   . VAL H 2 23  ? 10.596  -8.320  -25.840 1.00 30.48 ? 169 VAL H C   1 
ATOM 8895  O O   . VAL H 2 23  ? 10.387  -9.512  -25.606 1.00 29.84 ? 169 VAL H O   1 
ATOM 8896  C CB  . VAL H 2 23  ? 9.573   -7.237  -27.817 1.00 30.17 ? 169 VAL H CB  1 
ATOM 8897  C CG1 . VAL H 2 23  ? 9.817   -6.691  -29.200 1.00 29.91 ? 169 VAL H CG1 1 
ATOM 8898  C CG2 . VAL H 2 23  ? 8.486   -8.288  -27.839 1.00 29.03 ? 169 VAL H CG2 1 
ATOM 8899  N N   . PRO H 2 24  ? 10.593  -7.390  -24.873 1.00 30.44 ? 170 PRO H N   1 
ATOM 8900  C CA  . PRO H 2 24  ? 10.324  -7.714  -23.472 1.00 30.38 ? 170 PRO H CA  1 
ATOM 8901  C C   . PRO H 2 24  ? 8.878   -8.178  -23.397 1.00 30.12 ? 170 PRO H C   1 
ATOM 8902  O O   . PRO H 2 24  ? 8.023   -7.601  -24.060 1.00 31.07 ? 170 PRO H O   1 
ATOM 8903  C CB  . PRO H 2 24  ? 10.482  -6.366  -22.764 1.00 30.92 ? 170 PRO H CB  1 
ATOM 8904  C CG  . PRO H 2 24  ? 11.260  -5.514  -23.726 1.00 30.88 ? 170 PRO H CG  1 
ATOM 8905  C CD  . PRO H 2 24  ? 10.755  -5.937  -25.054 1.00 30.40 ? 170 PRO H CD  1 
ATOM 8906  N N   . ALA H 2 25  ? 8.596   -9.192  -22.592 1.00 29.94 ? 171 ALA H N   1 
ATOM 8907  C CA  . ALA H 2 25  ? 7.228   -9.690  -22.448 1.00 29.91 ? 171 ALA H CA  1 
ATOM 8908  C C   . ALA H 2 25  ? 6.244   -8.563  -22.146 1.00 29.27 ? 171 ALA H C   1 
ATOM 8909  O O   . ALA H 2 25  ? 6.632   -7.515  -21.646 1.00 31.22 ? 171 ALA H O   1 
ATOM 8910  C CB  . ALA H 2 25  ? 7.182   -10.718 -21.333 1.00 28.92 ? 171 ALA H CB  1 
ATOM 8911  N N   . ALA H 2 26  ? 4.974   -8.779  -22.459 1.00 29.30 ? 172 ALA H N   1 
ATOM 8912  C CA  . ALA H 2 26  ? 3.915   -7.798  -22.176 1.00 29.95 ? 172 ALA H CA  1 
ATOM 8913  C C   . ALA H 2 26  ? 3.845   -6.639  -23.145 1.00 28.93 ? 172 ALA H C   1 
ATOM 8914  O O   . ALA H 2 26  ? 3.040   -5.729  -22.986 1.00 28.77 ? 172 ALA H O   1 
ATOM 8915  C CB  . ALA H 2 26  ? 4.054   -7.253  -20.746 1.00 29.96 ? 172 ALA H CB  1 
ATOM 8916  N N   . ASN H 2 27  ? 4.689   -6.674  -24.155 1.00 29.02 ? 173 ASN H N   1 
ATOM 8917  C CA  . ASN H 2 27  ? 4.715   -5.621  -25.151 1.00 29.35 ? 173 ASN H CA  1 
ATOM 8918  C C   . ASN H 2 27  ? 3.824   -5.945  -26.334 1.00 28.56 ? 173 ASN H C   1 
ATOM 8919  O O   . ASN H 2 27  ? 3.452   -7.096  -26.542 1.00 29.29 ? 173 ASN H O   1 
ATOM 8920  C CB  . ASN H 2 27  ? 6.132   -5.474  -25.663 1.00 31.30 ? 173 ASN H CB  1 
ATOM 8921  C CG  . ASN H 2 27  ? 6.664   -4.122  -25.440 1.00 33.61 ? 173 ASN H CG  1 
ATOM 8922  O OD1 . ASN H 2 27  ? 7.754   -3.967  -24.903 1.00 35.37 ? 173 ASN H OD1 1 
ATOM 8923  N ND2 . ASN H 2 27  ? 5.898   -3.104  -25.850 1.00 36.30 ? 173 ASN H ND2 1 
ATOM 8924  N N   . THR H 2 28  ? 3.497   -4.925  -27.114 1.00 27.56 ? 174 THR H N   1 
ATOM 8925  C CA  . THR H 2 28  ? 2.702   -5.112  -28.321 1.00 27.40 ? 174 THR H CA  1 
ATOM 8926  C C   . THR H 2 28  ? 3.684   -5.311  -29.479 1.00 27.89 ? 174 THR H C   1 
ATOM 8927  O O   . THR H 2 28  ? 4.698   -4.597  -29.564 1.00 28.53 ? 174 THR H O   1 
ATOM 8928  C CB  . THR H 2 28  ? 1.859   -3.862  -28.647 1.00 26.23 ? 174 THR H CB  1 
ATOM 8929  O OG1 . THR H 2 28  ? 0.862   -3.677  -27.639 1.00 27.39 ? 174 THR H OG1 1 
ATOM 8930  C CG2 . THR H 2 28  ? 1.192   -4.010  -29.995 1.00 25.88 ? 174 THR H CG2 1 
ATOM 8931  N N   . VAL H 2 29  ? 3.405   -6.276  -30.352 1.00 27.02 ? 175 VAL H N   1 
ATOM 8932  C CA  . VAL H 2 29  ? 4.262   -6.511  -31.512 1.00 28.39 ? 175 VAL H CA  1 
ATOM 8933  C C   . VAL H 2 29  ? 3.420   -6.269  -32.747 1.00 29.35 ? 175 VAL H C   1 
ATOM 8934  O O   . VAL H 2 29  ? 2.274   -6.705  -32.810 1.00 29.65 ? 175 VAL H O   1 
ATOM 8935  C CB  . VAL H 2 29  ? 4.817   -7.953  -31.558 1.00 27.86 ? 175 VAL H CB  1 
ATOM 8936  C CG1 . VAL H 2 29  ? 5.562   -8.179  -32.851 1.00 25.54 ? 175 VAL H CG1 1 
ATOM 8937  C CG2 . VAL H 2 29  ? 5.753   -8.176  -30.393 1.00 28.68 ? 175 VAL H CG2 1 
ATOM 8938  N N   . LYS H 2 30  ? 3.984   -5.548  -33.714 1.00 30.89 ? 176 LYS H N   1 
ATOM 8939  C CA  . LYS H 2 30  ? 3.273   -5.239  -34.952 1.00 33.25 ? 176 LYS H CA  1 
ATOM 8940  C C   . LYS H 2 30  ? 4.175   -5.616  -36.114 1.00 34.08 ? 176 LYS H C   1 
ATOM 8941  O O   . LYS H 2 30  ? 5.225   -5.000  -36.327 1.00 35.79 ? 176 LYS H O   1 
ATOM 8942  C CB  . LYS H 2 30  ? 2.918   -3.740  -35.038 1.00 34.69 ? 176 LYS H CB  1 
ATOM 8943  C CG  . LYS H 2 30  ? 1.968   -3.375  -36.194 1.00 38.56 ? 176 LYS H CG  1 
ATOM 8944  C CD  . LYS H 2 30  ? 1.681   -1.850  -36.316 1.00 41.29 ? 176 LYS H CD  1 
ATOM 8945  C CE  . LYS H 2 30  ? 0.689   -1.539  -37.483 1.00 43.10 ? 176 LYS H CE  1 
ATOM 8946  N NZ  . LYS H 2 30  ? 0.345   -0.088  -37.743 1.00 43.27 ? 176 LYS H NZ  1 
ATOM 8947  N N   . PHE H 2 31  ? 3.776   -6.644  -36.852 1.00 33.44 ? 177 PHE H N   1 
ATOM 8948  C CA  . PHE H 2 31  ? 4.548   -7.090  -37.997 1.00 32.73 ? 177 PHE H CA  1 
ATOM 8949  C C   . PHE H 2 31  ? 3.940   -6.460  -39.239 1.00 32.90 ? 177 PHE H C   1 
ATOM 8950  O O   . PHE H 2 31  ? 2.726   -6.545  -39.445 1.00 31.01 ? 177 PHE H O   1 
ATOM 8951  C CB  . PHE H 2 31  ? 4.493   -8.611  -38.100 1.00 32.22 ? 177 PHE H CB  1 
ATOM 8952  C CG  . PHE H 2 31  ? 5.369   -9.315  -37.117 1.00 31.41 ? 177 PHE H CG  1 
ATOM 8953  C CD1 . PHE H 2 31  ? 6.696   -8.928  -36.954 1.00 32.28 ? 177 PHE H CD1 1 
ATOM 8954  C CD2 . PHE H 2 31  ? 4.894   -10.401 -36.392 1.00 30.38 ? 177 PHE H CD2 1 
ATOM 8955  C CE1 . PHE H 2 31  ? 7.536   -9.615  -36.088 1.00 30.84 ? 177 PHE H CE1 1 
ATOM 8956  C CE2 . PHE H 2 31  ? 5.722   -11.091 -35.526 1.00 28.86 ? 177 PHE H CE2 1 
ATOM 8957  C CZ  . PHE H 2 31  ? 7.045   -10.700 -35.373 1.00 30.41 ? 177 PHE H CZ  1 
ATOM 8958  N N   . ARG H 2 32  ? 4.786   -5.843  -40.060 1.00 33.60 ? 178 ARG H N   1 
ATOM 8959  C CA  . ARG H 2 32  ? 4.320   -5.180  -41.267 1.00 34.20 ? 178 ARG H CA  1 
ATOM 8960  C C   . ARG H 2 32  ? 4.935   -5.703  -42.557 1.00 33.50 ? 178 ARG H C   1 
ATOM 8961  O O   . ARG H 2 32  ? 6.097   -6.099  -42.594 1.00 31.91 ? 178 ARG H O   1 
ATOM 8962  C CB  . ARG H 2 32  ? 4.579   -3.674  -41.148 1.00 36.04 ? 178 ARG H CB  1 
ATOM 8963  C CG  . ARG H 2 32  ? 4.016   -3.061  -39.862 1.00 39.84 ? 178 ARG H CG  1 
ATOM 8964  C CD  . ARG H 2 32  ? 3.938   -1.534  -39.944 1.00 42.53 ? 178 ARG H CD  1 
ATOM 8965  N NE  . ARG H 2 32  ? 3.232   -1.112  -41.160 1.00 44.44 ? 178 ARG H NE  1 
ATOM 8966  C CZ  . ARG H 2 32  ? 3.052   0.151   -41.535 1.00 44.24 ? 178 ARG H CZ  1 
ATOM 8967  N NH1 . ARG H 2 32  ? 3.518   1.152   -40.783 1.00 43.53 ? 178 ARG H NH1 1 
ATOM 8968  N NH2 . ARG H 2 32  ? 2.428   0.403   -42.685 1.00 43.38 ? 178 ARG H NH2 1 
ATOM 8969  N N   . CYS H 2 33  ? 4.125   -5.694  -43.611 1.00 34.12 ? 179 CYS H N   1 
ATOM 8970  C CA  . CYS H 2 33  ? 4.538   -6.132  -44.942 1.00 35.67 ? 179 CYS H CA  1 
ATOM 8971  C C   . CYS H 2 33  ? 3.837   -5.282  -45.986 1.00 36.18 ? 179 CYS H C   1 
ATOM 8972  O O   . CYS H 2 33  ? 3.046   -5.783  -46.788 1.00 35.51 ? 179 CYS H O   1 
ATOM 8973  C CB  . CYS H 2 33  ? 4.196   -7.599  -45.138 1.00 35.50 ? 179 CYS H CB  1 
ATOM 8974  S SG  . CYS H 2 33  ? 5.247   -8.608  -44.104 1.00 38.73 ? 179 CYS H SG  1 
ATOM 8975  N N   . PRO H 2 34  ? 4.136   -3.974  -45.993 1.00 37.32 ? 180 PRO H N   1 
ATOM 8976  C CA  . PRO H 2 34  ? 3.540   -3.017  -46.928 1.00 37.58 ? 180 PRO H CA  1 
ATOM 8977  C C   . PRO H 2 34  ? 3.636   -3.537  -48.350 1.00 38.55 ? 180 PRO H C   1 
ATOM 8978  O O   . PRO H 2 34  ? 4.735   -3.788  -48.859 1.00 38.27 ? 180 PRO H O   1 
ATOM 8979  C CB  . PRO H 2 34  ? 4.375   -1.761  -46.711 1.00 37.30 ? 180 PRO H CB  1 
ATOM 8980  C CG  . PRO H 2 34  ? 4.829   -1.900  -45.292 1.00 37.13 ? 180 PRO H CG  1 
ATOM 8981  C CD  . PRO H 2 34  ? 5.229   -3.339  -45.240 1.00 36.29 ? 180 PRO H CD  1 
ATOM 8982  N N   . ALA H 2 35  ? 2.482   -3.697  -48.989 1.00 39.87 ? 181 ALA H N   1 
ATOM 8983  C CA  . ALA H 2 35  ? 2.448   -4.206  -50.355 1.00 41.30 ? 181 ALA H CA  1 
ATOM 8984  C C   . ALA H 2 35  ? 1.725   -3.306  -51.347 1.00 42.10 ? 181 ALA H C   1 
ATOM 8985  O O   . ALA H 2 35  ? 1.093   -2.308  -50.983 1.00 41.78 ? 181 ALA H O   1 
ATOM 8986  C CB  . ALA H 2 35  ? 1.810   -5.603  -50.376 1.00 40.71 ? 181 ALA H CB  1 
ATOM 8987  N N   . GLY H 2 36  ? 1.842   -3.696  -52.614 1.00 43.21 ? 182 GLY H N   1 
ATOM 8988  C CA  . GLY H 2 36  ? 1.209   -3.000  -53.720 1.00 42.78 ? 182 GLY H CA  1 
ATOM 8989  C C   . GLY H 2 36  ? 0.982   -4.016  -54.831 1.00 41.97 ? 182 GLY H C   1 
ATOM 8990  O O   . GLY H 2 36  ? 1.405   -5.162  -54.715 1.00 41.69 ? 182 GLY H O   1 
ATOM 8991  N N   . GLY H 2 37  ? 0.317   -3.610  -55.904 1.00 41.74 ? 183 GLY H N   1 
ATOM 8992  C CA  . GLY H 2 37  ? 0.069   -4.526  -57.000 1.00 41.59 ? 183 GLY H CA  1 
ATOM 8993  C C   . GLY H 2 37  ? -1.359  -4.399  -57.492 1.00 41.63 ? 183 GLY H C   1 
ATOM 8994  O O   . GLY H 2 37  ? -2.268  -4.150  -56.705 1.00 41.32 ? 183 GLY H O   1 
ATOM 8995  N N   . ASN H 2 38  ? -1.561  -4.573  -58.794 1.00 41.76 ? 184 ASN H N   1 
ATOM 8996  C CA  . ASN H 2 38  ? -2.885  -4.462  -59.372 1.00 41.49 ? 184 ASN H CA  1 
ATOM 8997  C C   . ASN H 2 38  ? -3.322  -5.724  -60.108 1.00 41.32 ? 184 ASN H C   1 
ATOM 8998  O O   . ASN H 2 38  ? -2.676  -6.146  -61.057 1.00 41.08 ? 184 ASN H O   1 
ATOM 8999  C CB  . ASN H 2 38  ? -2.929  -3.289  -60.332 1.00 42.12 ? 184 ASN H CB  1 
ATOM 9000  C CG  . ASN H 2 38  ? -4.287  -3.123  -60.947 1.00 43.67 ? 184 ASN H CG  1 
ATOM 9001  O OD1 . ASN H 2 38  ? -5.270  -2.895  -60.238 1.00 45.42 ? 184 ASN H OD1 1 
ATOM 9002  N ND2 . ASN H 2 38  ? -4.367  -3.258  -62.266 1.00 43.83 ? 184 ASN H ND2 1 
ATOM 9003  N N   . PRO H 2 39  ? -4.461  -6.317  -59.708 1.00 41.33 ? 185 PRO H N   1 
ATOM 9004  C CA  . PRO H 2 39  ? -5.358  -5.882  -58.624 1.00 41.10 ? 185 PRO H CA  1 
ATOM 9005  C C   . PRO H 2 39  ? -4.731  -5.906  -57.219 1.00 41.48 ? 185 PRO H C   1 
ATOM 9006  O O   . PRO H 2 39  ? -3.674  -6.510  -57.006 1.00 42.02 ? 185 PRO H O   1 
ATOM 9007  C CB  . PRO H 2 39  ? -6.540  -6.842  -58.759 1.00 40.35 ? 185 PRO H CB  1 
ATOM 9008  C CG  . PRO H 2 39  ? -5.876  -8.112  -59.219 1.00 40.62 ? 185 PRO H CG  1 
ATOM 9009  C CD  . PRO H 2 39  ? -4.902  -7.611  -60.268 1.00 40.36 ? 185 PRO H CD  1 
ATOM 9010  N N   . MET H 2 40  ? -5.391  -5.246  -56.267 1.00 41.20 ? 186 MET H N   1 
ATOM 9011  C CA  . MET H 2 40  ? -4.892  -5.190  -54.900 1.00 40.94 ? 186 MET H CA  1 
ATOM 9012  C C   . MET H 2 40  ? -4.692  -6.595  -54.354 1.00 40.25 ? 186 MET H C   1 
ATOM 9013  O O   . MET H 2 40  ? -5.639  -7.378  -54.235 1.00 40.43 ? 186 MET H O   1 
ATOM 9014  C CB  . MET H 2 40  ? -5.848  -4.406  -53.997 1.00 42.76 ? 186 MET H CB  1 
ATOM 9015  C CG  . MET H 2 40  ? -5.190  -3.907  -52.719 1.00 44.59 ? 186 MET H CG  1 
ATOM 9016  S SD  . MET H 2 40  ? -3.637  -3.010  -53.100 1.00 49.72 ? 186 MET H SD  1 
ATOM 9017  C CE  . MET H 2 40  ? -4.147  -1.299  -52.930 1.00 49.10 ? 186 MET H CE  1 
ATOM 9018  N N   . PRO H 2 41  ? -3.442  -6.939  -54.025 1.00 38.88 ? 187 PRO H N   1 
ATOM 9019  C CA  . PRO H 2 41  ? -3.180  -8.271  -53.496 1.00 38.78 ? 187 PRO H CA  1 
ATOM 9020  C C   . PRO H 2 41  ? -3.831  -8.510  -52.141 1.00 39.34 ? 187 PRO H C   1 
ATOM 9021  O O   . PRO H 2 41  ? -4.152  -7.570  -51.409 1.00 39.52 ? 187 PRO H O   1 
ATOM 9022  C CB  . PRO H 2 41  ? -1.656  -8.321  -53.440 1.00 37.66 ? 187 PRO H CB  1 
ATOM 9023  C CG  . PRO H 2 41  ? -1.283  -6.911  -53.230 1.00 37.37 ? 187 PRO H CG  1 
ATOM 9024  C CD  . PRO H 2 41  ? -2.186  -6.192  -54.186 1.00 38.11 ? 187 PRO H CD  1 
ATOM 9025  N N   . THR H 2 42  ? -4.041  -9.777  -51.820 1.00 39.32 ? 188 THR H N   1 
ATOM 9026  C CA  . THR H 2 42  ? -4.631  -10.131 -50.554 1.00 40.07 ? 188 THR H CA  1 
ATOM 9027  C C   . THR H 2 42  ? -3.512  -10.512 -49.599 1.00 40.56 ? 188 THR H C   1 
ATOM 9028  O O   . THR H 2 42  ? -2.367  -10.689 -50.014 1.00 40.18 ? 188 THR H O   1 
ATOM 9029  C CB  . THR H 2 42  ? -5.618  -11.290 -50.732 1.00 40.27 ? 188 THR H CB  1 
ATOM 9030  O OG1 . THR H 2 42  ? -4.981  -12.346 -51.460 1.00 42.13 ? 188 THR H OG1 1 
ATOM 9031  C CG2 . THR H 2 42  ? -6.849  -10.821 -51.491 1.00 38.88 ? 188 THR H CG2 1 
ATOM 9032  N N   . MET H 2 43  ? -3.842  -10.645 -48.318 1.00 41.79 ? 189 MET H N   1 
ATOM 9033  C CA  . MET H 2 43  ? -2.837  -10.980 -47.323 1.00 41.54 ? 189 MET H CA  1 
ATOM 9034  C C   . MET H 2 43  ? -3.245  -12.022 -46.294 1.00 40.86 ? 189 MET H C   1 
ATOM 9035  O O   . MET H 2 43  ? -4.340  -11.965 -45.747 1.00 41.87 ? 189 MET H O   1 
ATOM 9036  C CB  . MET H 2 43  ? -2.417  -9.710  -46.599 1.00 42.38 ? 189 MET H CB  1 
ATOM 9037  C CG  . MET H 2 43  ? -1.574  -9.970  -45.378 1.00 45.08 ? 189 MET H CG  1 
ATOM 9038  S SD  . MET H 2 43  ? -0.843  -8.477  -44.773 1.00 47.30 ? 189 MET H SD  1 
ATOM 9039  C CE  . MET H 2 43  ? 0.693   -8.496  -45.716 1.00 46.97 ? 189 MET H CE  1 
ATOM 9040  N N   . ARG H 2 44  ? -2.352  -12.973 -46.037 1.00 40.20 ? 190 ARG H N   1 
ATOM 9041  C CA  . ARG H 2 44  ? -2.582  -14.013 -45.037 1.00 39.89 ? 190 ARG H CA  1 
ATOM 9042  C C   . ARG H 2 44  ? -1.366  -14.018 -44.126 1.00 38.91 ? 190 ARG H C   1 
ATOM 9043  O O   . ARG H 2 44  ? -0.281  -13.613 -44.536 1.00 39.33 ? 190 ARG H O   1 
ATOM 9044  C CB  . ARG H 2 44  ? -2.680  -15.413 -45.646 1.00 40.57 ? 190 ARG H CB  1 
ATOM 9045  C CG  . ARG H 2 44  ? -3.546  -15.556 -46.854 1.00 41.41 ? 190 ARG H CG  1 
ATOM 9046  C CD  . ARG H 2 44  ? -3.886  -17.030 -47.071 1.00 43.03 ? 190 ARG H CD  1 
ATOM 9047  N NE  . ARG H 2 44  ? -2.728  -17.929 -47.168 1.00 43.71 ? 190 ARG H NE  1 
ATOM 9048  C CZ  . ARG H 2 44  ? -1.931  -18.044 -48.231 1.00 44.49 ? 190 ARG H CZ  1 
ATOM 9049  N NH1 . ARG H 2 44  ? -2.139  -17.304 -49.318 1.00 44.36 ? 190 ARG H NH1 1 
ATOM 9050  N NH2 . ARG H 2 44  ? -0.942  -18.932 -48.219 1.00 43.25 ? 190 ARG H NH2 1 
ATOM 9051  N N   . TRP H 2 45  ? -1.545  -14.488 -42.897 1.00 37.33 ? 191 TRP H N   1 
ATOM 9052  C CA  . TRP H 2 45  ? -0.445  -14.570 -41.954 1.00 35.34 ? 191 TRP H CA  1 
ATOM 9053  C C   . TRP H 2 45  ? -0.297  -15.983 -41.448 1.00 34.58 ? 191 TRP H C   1 
ATOM 9054  O O   . TRP H 2 45  ? -1.274  -16.620 -41.077 1.00 35.01 ? 191 TRP H O   1 
ATOM 9055  C CB  . TRP H 2 45  ? -0.670  -13.620 -40.776 1.00 35.17 ? 191 TRP H CB  1 
ATOM 9056  C CG  . TRP H 2 45  ? -0.356  -12.206 -41.109 1.00 33.52 ? 191 TRP H CG  1 
ATOM 9057  C CD1 . TRP H 2 45  ? -1.214  -11.258 -41.597 1.00 32.39 ? 191 TRP H CD1 1 
ATOM 9058  C CD2 . TRP H 2 45  ? 0.930   -11.588 -41.035 1.00 33.15 ? 191 TRP H CD2 1 
ATOM 9059  N NE1 . TRP H 2 45  ? -0.535  -10.085 -41.830 1.00 32.65 ? 191 TRP H NE1 1 
ATOM 9060  C CE2 . TRP H 2 45  ? 0.783   -10.260 -41.494 1.00 32.34 ? 191 TRP H CE2 1 
ATOM 9061  C CE3 . TRP H 2 45  ? 2.197   -12.030 -40.626 1.00 32.52 ? 191 TRP H CE3 1 
ATOM 9062  C CZ2 . TRP H 2 45  ? 1.857   -9.370  -41.555 1.00 31.86 ? 191 TRP H CZ2 1 
ATOM 9063  C CZ3 . TRP H 2 45  ? 3.264   -11.144 -40.688 1.00 32.39 ? 191 TRP H CZ3 1 
ATOM 9064  C CH2 . TRP H 2 45  ? 3.086   -9.830  -41.148 1.00 31.96 ? 191 TRP H CH2 1 
ATOM 9065  N N   . LEU H 2 46  ? 0.929   -16.478 -41.432 1.00 34.58 ? 192 LEU H N   1 
ATOM 9066  C CA  . LEU H 2 46  ? 1.175   -17.830 -40.955 1.00 34.39 ? 192 LEU H CA  1 
ATOM 9067  C C   . LEU H 2 46  ? 2.023   -17.810 -39.689 1.00 35.35 ? 192 LEU H C   1 
ATOM 9068  O O   . LEU H 2 46  ? 2.872   -16.922 -39.498 1.00 35.65 ? 192 LEU H O   1 
ATOM 9069  C CB  . LEU H 2 46  ? 1.927   -18.648 -42.012 1.00 33.69 ? 192 LEU H CB  1 
ATOM 9070  C CG  . LEU H 2 46  ? 1.470   -18.636 -43.467 1.00 34.41 ? 192 LEU H CG  1 
ATOM 9071  C CD1 . LEU H 2 46  ? 2.352   -19.598 -44.260 1.00 32.96 ? 192 LEU H CD1 1 
ATOM 9072  C CD2 . LEU H 2 46  ? -0.003  -19.035 -43.565 1.00 34.00 ? 192 LEU H CD2 1 
ATOM 9073  N N   . LYS H 2 47  ? 1.778   -18.777 -38.814 1.00 34.81 ? 193 LYS H N   1 
ATOM 9074  C CA  . LYS H 2 47  ? 2.583   -18.904 -37.622 1.00 34.59 ? 193 LYS H CA  1 
ATOM 9075  C C   . LYS H 2 47  ? 3.221   -20.254 -37.827 1.00 35.59 ? 193 LYS H C   1 
ATOM 9076  O O   . LYS H 2 47  ? 2.528   -21.272 -37.861 1.00 36.58 ? 193 LYS H O   1 
ATOM 9077  C CB  . LYS H 2 47  ? 1.739   -18.919 -36.354 1.00 34.05 ? 193 LYS H CB  1 
ATOM 9078  C CG  . LYS H 2 47  ? 2.599   -19.022 -35.093 1.00 32.88 ? 193 LYS H CG  1 
ATOM 9079  C CD  . LYS H 2 47  ? 1.761   -18.993 -33.823 1.00 32.08 ? 193 LYS H CD  1 
ATOM 9080  C CE  . LYS H 2 47  ? 2.618   -19.165 -32.579 1.00 31.71 ? 193 LYS H CE  1 
ATOM 9081  N NZ  . LYS H 2 47  ? 1.764   -19.291 -31.374 1.00 31.79 ? 193 LYS H NZ  1 
ATOM 9082  N N   . ASN H 2 48  ? 4.534   -20.262 -38.002 1.00 36.38 ? 194 ASN H N   1 
ATOM 9083  C CA  . ASN H 2 48  ? 5.255   -21.507 -38.216 1.00 36.84 ? 194 ASN H CA  1 
ATOM 9084  C C   . ASN H 2 48  ? 4.741   -22.254 -39.440 1.00 36.30 ? 194 ASN H C   1 
ATOM 9085  O O   . ASN H 2 48  ? 4.494   -23.455 -39.384 1.00 35.62 ? 194 ASN H O   1 
ATOM 9086  C CB  . ASN H 2 48  ? 5.135   -22.384 -36.979 1.00 36.61 ? 194 ASN H CB  1 
ATOM 9087  C CG  . ASN H 2 48  ? 5.725   -21.727 -35.771 1.00 38.18 ? 194 ASN H CG  1 
ATOM 9088  O OD1 . ASN H 2 48  ? 6.825   -21.176 -35.839 1.00 39.15 ? 194 ASN H OD1 1 
ATOM 9089  N ND2 . ASN H 2 48  ? 5.005   -21.769 -34.655 1.00 38.86 ? 194 ASN H ND2 1 
ATOM 9090  N N   . GLY H 2 49  ? 4.569   -21.526 -40.539 1.00 36.10 ? 195 GLY H N   1 
ATOM 9091  C CA  . GLY H 2 49  ? 4.106   -22.134 -41.774 1.00 37.25 ? 195 GLY H CA  1 
ATOM 9092  C C   . GLY H 2 49  ? 2.658   -22.611 -41.834 1.00 38.09 ? 195 GLY H C   1 
ATOM 9093  O O   . GLY H 2 49  ? 2.206   -23.093 -42.879 1.00 37.87 ? 195 GLY H O   1 
ATOM 9094  N N   . LYS H 2 50  ? 1.922   -22.484 -40.734 1.00 37.76 ? 196 LYS H N   1 
ATOM 9095  C CA  . LYS H 2 50  ? 0.530   -22.927 -40.713 1.00 37.90 ? 196 LYS H CA  1 
ATOM 9096  C C   . LYS H 2 50  ? -0.376  -21.733 -40.489 1.00 38.21 ? 196 LYS H C   1 
ATOM 9097  O O   . LYS H 2 50  ? 0.081   -20.701 -40.014 1.00 39.41 ? 196 LYS H O   1 
ATOM 9098  C CB  . LYS H 2 50  ? 0.304   -23.978 -39.608 1.00 36.95 ? 196 LYS H CB  1 
ATOM 9099  N N   . GLU H 2 51  ? -1.654  -21.872 -40.835 1.00 38.63 ? 197 GLU H N   1 
ATOM 9100  C CA  . GLU H 2 51  ? -2.600  -20.778 -40.655 1.00 39.73 ? 197 GLU H CA  1 
ATOM 9101  C C   . GLU H 2 51  ? -2.575  -20.292 -39.221 1.00 39.77 ? 197 GLU H C   1 
ATOM 9102  O O   . GLU H 2 51  ? -2.480  -21.081 -38.283 1.00 40.44 ? 197 GLU H O   1 
ATOM 9103  C CB  . GLU H 2 51  ? -4.039  -21.175 -41.009 1.00 41.24 ? 197 GLU H CB  1 
ATOM 9104  C CG  . GLU H 2 51  ? -5.020  -19.990 -40.858 1.00 43.95 ? 197 GLU H CG  1 
ATOM 9105  C CD  . GLU H 2 51  ? -6.480  -20.325 -41.194 1.00 45.01 ? 197 GLU H CD  1 
ATOM 9106  O OE1 . GLU H 2 51  ? -6.723  -20.933 -42.256 1.00 45.10 ? 197 GLU H OE1 1 
ATOM 9107  O OE2 . GLU H 2 51  ? -7.388  -19.964 -40.405 1.00 45.42 ? 197 GLU H OE2 1 
ATOM 9108  N N   . PHE H 2 52  ? -2.653  -18.979 -39.057 1.00 40.10 ? 198 PHE H N   1 
ATOM 9109  C CA  . PHE H 2 52  ? -2.632  -18.377 -37.734 1.00 40.17 ? 198 PHE H CA  1 
ATOM 9110  C C   . PHE H 2 52  ? -4.062  -18.001 -37.366 1.00 40.58 ? 198 PHE H C   1 
ATOM 9111  O O   . PHE H 2 52  ? -4.641  -17.066 -37.928 1.00 40.14 ? 198 PHE H O   1 
ATOM 9112  C CB  . PHE H 2 52  ? -1.734  -17.137 -37.730 1.00 40.85 ? 198 PHE H CB  1 
ATOM 9113  C CG  . PHE H 2 52  ? -1.511  -16.547 -36.364 1.00 42.44 ? 198 PHE H CG  1 
ATOM 9114  C CD1 . PHE H 2 52  ? -1.065  -15.230 -36.227 1.00 42.50 ? 198 PHE H CD1 1 
ATOM 9115  C CD2 . PHE H 2 52  ? -1.717  -17.304 -35.212 1.00 42.79 ? 198 PHE H CD2 1 
ATOM 9116  C CE1 . PHE H 2 52  ? -0.831  -14.681 -34.966 1.00 41.39 ? 198 PHE H CE1 1 
ATOM 9117  C CE2 . PHE H 2 52  ? -1.485  -16.760 -33.948 1.00 41.52 ? 198 PHE H CE2 1 
ATOM 9118  C CZ  . PHE H 2 52  ? -1.039  -15.445 -33.829 1.00 41.18 ? 198 PHE H CZ  1 
ATOM 9119  N N   . LYS H 2 53  ? -4.619  -18.744 -36.418 1.00 40.62 ? 199 LYS H N   1 
ATOM 9120  C CA  . LYS H 2 53  ? -5.980  -18.546 -35.955 1.00 40.84 ? 199 LYS H CA  1 
ATOM 9121  C C   . LYS H 2 53  ? -6.051  -17.806 -34.624 1.00 40.50 ? 199 LYS H C   1 
ATOM 9122  O O   . LYS H 2 53  ? -5.143  -17.899 -33.801 1.00 40.69 ? 199 LYS H O   1 
ATOM 9123  C CB  . LYS H 2 53  ? -6.648  -19.909 -35.792 1.00 43.65 ? 199 LYS H CB  1 
ATOM 9124  C CG  . LYS H 2 53  ? -6.624  -20.796 -37.035 1.00 46.10 ? 199 LYS H CG  1 
ATOM 9125  C CD  . LYS H 2 53  ? -7.031  -22.228 -36.684 1.00 47.56 ? 199 LYS H CD  1 
ATOM 9126  C CE  . LYS H 2 53  ? -7.541  -22.976 -37.912 1.00 49.59 ? 199 LYS H CE  1 
ATOM 9127  N NZ  . LYS H 2 53  ? -6.588  -22.868 -39.060 1.00 51.57 ? 199 LYS H NZ  1 
ATOM 9128  N N   . GLN H 2 54  ? -7.155  -17.092 -34.422 1.00 39.63 ? 200 GLN H N   1 
ATOM 9129  C CA  . GLN H 2 54  ? -7.418  -16.338 -33.204 1.00 38.37 ? 200 GLN H CA  1 
ATOM 9130  C C   . GLN H 2 54  ? -7.246  -17.149 -31.928 1.00 39.08 ? 200 GLN H C   1 
ATOM 9131  O O   . GLN H 2 54  ? -6.972  -16.587 -30.860 1.00 39.49 ? 200 GLN H O   1 
ATOM 9132  C CB  . GLN H 2 54  ? -8.854  -15.821 -33.210 1.00 36.30 ? 200 GLN H CB  1 
ATOM 9133  C CG  . GLN H 2 54  ? -9.106  -14.640 -34.096 1.00 35.81 ? 200 GLN H CG  1 
ATOM 9134  C CD  . GLN H 2 54  ? -8.170  -13.489 -33.798 1.00 35.87 ? 200 GLN H CD  1 
ATOM 9135  O OE1 . GLN H 2 54  ? -7.859  -13.206 -32.630 1.00 35.62 ? 200 GLN H OE1 1 
ATOM 9136  N NE2 . GLN H 2 54  ? -7.717  -12.810 -34.851 1.00 32.32 ? 200 GLN H NE2 1 
ATOM 9137  N N   . GLU H 2 55  ? -7.436  -18.462 -32.011 1.00 39.23 ? 201 GLU H N   1 
ATOM 9138  C CA  . GLU H 2 55  ? -7.316  -19.266 -30.799 1.00 39.32 ? 201 GLU H CA  1 
ATOM 9139  C C   . GLU H 2 55  ? -5.916  -19.795 -30.548 1.00 37.80 ? 201 GLU H C   1 
ATOM 9140  O O   . GLU H 2 55  ? -5.685  -20.475 -29.555 1.00 38.22 ? 201 GLU H O   1 
ATOM 9141  C CB  . GLU H 2 55  ? -8.329  -20.425 -30.779 1.00 40.80 ? 201 GLU H CB  1 
ATOM 9142  C CG  . GLU H 2 55  ? -7.999  -21.601 -31.670 1.00 43.76 ? 201 GLU H CG  1 
ATOM 9143  C CD  . GLU H 2 55  ? -8.736  -21.554 -32.991 1.00 47.07 ? 201 GLU H CD  1 
ATOM 9144  O OE1 . GLU H 2 55  ? -8.726  -22.585 -33.703 1.00 48.65 ? 201 GLU H OE1 1 
ATOM 9145  O OE2 . GLU H 2 55  ? -9.323  -20.491 -33.318 1.00 48.16 ? 201 GLU H OE2 1 
ATOM 9146  N N   . HIS H 2 56  ? -4.979  -19.463 -31.429 1.00 36.66 ? 202 HIS H N   1 
ATOM 9147  C CA  . HIS H 2 56  ? -3.598  -19.920 -31.279 1.00 35.67 ? 202 HIS H CA  1 
ATOM 9148  C C   . HIS H 2 56  ? -2.870  -19.212 -30.138 1.00 34.83 ? 202 HIS H C   1 
ATOM 9149  O O   . HIS H 2 56  ? -1.744  -19.579 -29.777 1.00 34.26 ? 202 HIS H O   1 
ATOM 9150  C CB  . HIS H 2 56  ? -2.822  -19.725 -32.593 1.00 36.24 ? 202 HIS H CB  1 
ATOM 9151  C CG  . HIS H 2 56  ? -3.231  -20.663 -33.688 1.00 37.23 ? 202 HIS H CG  1 
ATOM 9152  N ND1 . HIS H 2 56  ? -3.983  -21.795 -33.458 1.00 36.84 ? 202 HIS H ND1 1 
ATOM 9153  C CD2 . HIS H 2 56  ? -2.969  -20.650 -35.016 1.00 38.09 ? 202 HIS H CD2 1 
ATOM 9154  C CE1 . HIS H 2 56  ? -4.171  -22.436 -34.596 1.00 37.51 ? 202 HIS H CE1 1 
ATOM 9155  N NE2 . HIS H 2 56  ? -3.567  -21.763 -35.558 1.00 37.80 ? 202 HIS H NE2 1 
ATOM 9156  N N   . ARG H 2 57  ? -3.509  -18.186 -29.586 1.00 34.23 ? 203 ARG H N   1 
ATOM 9157  C CA  . ARG H 2 57  ? -2.943  -17.438 -28.471 1.00 33.37 ? 203 ARG H CA  1 
ATOM 9158  C C   . ARG H 2 57  ? -4.063  -16.708 -27.754 1.00 33.55 ? 203 ARG H C   1 
ATOM 9159  O O   . ARG H 2 57  ? -4.990  -16.200 -28.388 1.00 33.82 ? 203 ARG H O   1 
ATOM 9160  C CB  . ARG H 2 57  ? -1.887  -16.434 -28.958 1.00 33.42 ? 203 ARG H CB  1 
ATOM 9161  C CG  . ARG H 2 57  ? -2.431  -15.090 -29.451 1.00 32.75 ? 203 ARG H CG  1 
ATOM 9162  C CD  . ARG H 2 57  ? -1.330  -14.206 -30.024 1.00 31.28 ? 203 ARG H CD  1 
ATOM 9163  N NE  . ARG H 2 57  ? -0.357  -13.724 -29.040 1.00 31.54 ? 203 ARG H NE  1 
ATOM 9164  C CZ  . ARG H 2 57  ? -0.528  -12.663 -28.252 1.00 31.02 ? 203 ARG H CZ  1 
ATOM 9165  N NH1 . ARG H 2 57  ? -1.647  -11.955 -28.308 1.00 31.62 ? 203 ARG H NH1 1 
ATOM 9166  N NH2 . ARG H 2 57  ? 0.440   -12.275 -27.435 1.00 29.95 ? 203 ARG H NH2 1 
ATOM 9167  N N   . ILE H 2 58  ? -3.982  -16.662 -26.430 1.00 33.61 ? 204 ILE H N   1 
ATOM 9168  C CA  . ILE H 2 58  ? -4.998  -15.980 -25.625 1.00 34.54 ? 204 ILE H CA  1 
ATOM 9169  C C   . ILE H 2 58  ? -5.160  -14.547 -26.137 1.00 34.27 ? 204 ILE H C   1 
ATOM 9170  O O   . ILE H 2 58  ? -4.173  -13.835 -26.313 1.00 33.92 ? 204 ILE H O   1 
ATOM 9171  C CB  . ILE H 2 58  ? -4.581  -15.867 -24.137 1.00 34.93 ? 204 ILE H CB  1 
ATOM 9172  C CG1 . ILE H 2 58  ? -3.941  -17.168 -23.658 1.00 34.81 ? 204 ILE H CG1 1 
ATOM 9173  C CG2 . ILE H 2 58  ? -5.767  -15.472 -23.306 1.00 34.49 ? 204 ILE H CG2 1 
ATOM 9174  C CD1 . ILE H 2 58  ? -2.499  -17.339 -24.183 1.00 38.15 ? 204 ILE H CD1 1 
ATOM 9175  N N   . GLY H 2 59  ? -6.398  -14.127 -26.367 1.00 34.79 ? 205 GLY H N   1 
ATOM 9176  C CA  . GLY H 2 59  ? -6.623  -12.774 -26.840 1.00 34.78 ? 205 GLY H CA  1 
ATOM 9177  C C   . GLY H 2 59  ? -6.503  -12.634 -28.339 1.00 34.66 ? 205 GLY H C   1 
ATOM 9178  O O   . GLY H 2 59  ? -6.872  -11.601 -28.903 1.00 34.85 ? 205 GLY H O   1 
ATOM 9179  N N   . GLY H 2 60  ? -5.981  -13.670 -28.986 1.00 34.44 ? 206 GLY H N   1 
ATOM 9180  C CA  . GLY H 2 60  ? -5.847  -13.647 -30.430 1.00 35.41 ? 206 GLY H CA  1 
ATOM 9181  C C   . GLY H 2 60  ? -4.950  -12.536 -30.921 1.00 35.85 ? 206 GLY H C   1 
ATOM 9182  O O   . GLY H 2 60  ? -4.008  -12.139 -30.233 1.00 35.06 ? 206 GLY H O   1 
ATOM 9183  N N   . TYR H 2 61  ? -5.248  -12.033 -32.114 1.00 36.53 ? 207 TYR H N   1 
ATOM 9184  C CA  . TYR H 2 61  ? -4.462  -10.961 -32.709 1.00 37.48 ? 207 TYR H CA  1 
ATOM 9185  C C   . TYR H 2 61  ? -5.362  -10.038 -33.533 1.00 37.96 ? 207 TYR H C   1 
ATOM 9186  O O   . TYR H 2 61  ? -6.536  -10.341 -33.763 1.00 37.68 ? 207 TYR H O   1 
ATOM 9187  C CB  . TYR H 2 61  ? -3.396  -11.559 -33.612 1.00 38.72 ? 207 TYR H CB  1 
ATOM 9188  C CG  . TYR H 2 61  ? -3.961  -12.426 -34.705 1.00 39.66 ? 207 TYR H CG  1 
ATOM 9189  C CD1 . TYR H 2 61  ? -4.168  -13.790 -34.507 1.00 41.53 ? 207 TYR H CD1 1 
ATOM 9190  C CD2 . TYR H 2 61  ? -4.300  -11.881 -35.937 1.00 40.56 ? 207 TYR H CD2 1 
ATOM 9191  C CE1 . TYR H 2 61  ? -4.697  -14.593 -35.519 1.00 42.52 ? 207 TYR H CE1 1 
ATOM 9192  C CE2 . TYR H 2 61  ? -4.833  -12.667 -36.952 1.00 41.57 ? 207 TYR H CE2 1 
ATOM 9193  C CZ  . TYR H 2 61  ? -5.027  -14.019 -36.741 1.00 42.61 ? 207 TYR H CZ  1 
ATOM 9194  O OH  . TYR H 2 61  ? -5.546  -14.791 -37.758 1.00 44.32 ? 207 TYR H OH  1 
ATOM 9195  N N   . LYS H 2 62  ? -4.810  -8.916  -33.979 1.00 37.85 ? 208 LYS H N   1 
ATOM 9196  C CA  . LYS H 2 62  ? -5.575  -7.976  -34.781 1.00 38.85 ? 208 LYS H CA  1 
ATOM 9197  C C   . LYS H 2 62  ? -4.813  -7.719  -36.066 1.00 41.24 ? 208 LYS H C   1 
ATOM 9198  O O   . LYS H 2 62  ? -3.581  -7.815  -36.101 1.00 41.91 ? 208 LYS H O   1 
ATOM 9199  C CB  . LYS H 2 62  ? -5.783  -6.666  -34.024 1.00 37.30 ? 208 LYS H CB  1 
ATOM 9200  C CG  . LYS H 2 62  ? -6.372  -6.845  -32.631 1.00 35.93 ? 208 LYS H CG  1 
ATOM 9201  C CD  . LYS H 2 62  ? -6.595  -5.506  -31.952 1.00 35.02 ? 208 LYS H CD  1 
ATOM 9202  C CE  . LYS H 2 62  ? -7.090  -5.662  -30.520 1.00 33.94 ? 208 LYS H CE  1 
ATOM 9203  N NZ  . LYS H 2 62  ? -7.222  -4.342  -29.850 1.00 32.64 ? 208 LYS H NZ  1 
ATOM 9204  N N   . VAL H 2 63  ? -5.547  -7.402  -37.128 1.00 43.26 ? 209 VAL H N   1 
ATOM 9205  C CA  . VAL H 2 63  ? -4.934  -7.142  -38.419 1.00 45.39 ? 209 VAL H CA  1 
ATOM 9206  C C   . VAL H 2 63  ? -5.490  -5.863  -39.013 1.00 47.38 ? 209 VAL H C   1 
ATOM 9207  O O   . VAL H 2 63  ? -6.697  -5.726  -39.164 1.00 48.32 ? 209 VAL H O   1 
ATOM 9208  C CB  . VAL H 2 63  ? -5.217  -8.296  -39.418 1.00 45.01 ? 209 VAL H CB  1 
ATOM 9209  C CG1 . VAL H 2 63  ? -4.325  -8.146  -40.645 1.00 46.43 ? 209 VAL H CG1 1 
ATOM 9210  C CG2 . VAL H 2 63  ? -4.991  -9.640  -38.757 1.00 44.36 ? 209 VAL H CG2 1 
ATOM 9211  N N   . ARG H 2 64  ? -4.612  -4.925  -39.344 1.00 50.47 ? 210 ARG H N   1 
ATOM 9212  C CA  . ARG H 2 64  ? -5.035  -3.667  -39.950 1.00 53.46 ? 210 ARG H CA  1 
ATOM 9213  C C   . ARG H 2 64  ? -4.666  -3.749  -41.438 1.00 54.25 ? 210 ARG H C   1 
ATOM 9214  O O   . ARG H 2 64  ? -3.567  -3.352  -41.829 1.00 55.60 ? 210 ARG H O   1 
ATOM 9215  C CB  . ARG H 2 64  ? -4.313  -2.490  -39.272 1.00 55.77 ? 210 ARG H CB  1 
ATOM 9216  C CG  . ARG H 2 64  ? -5.192  -1.258  -39.016 1.00 59.05 ? 210 ARG H CG  1 
ATOM 9217  C CD  . ARG H 2 64  ? -5.466  -0.474  -40.297 1.00 61.15 ? 210 ARG H CD  1 
ATOM 9218  N NE  . ARG H 2 64  ? -6.824  0.064   -40.345 1.00 61.93 ? 210 ARG H NE  1 
ATOM 9219  C CZ  . ARG H 2 64  ? -7.923  -0.685  -40.280 1.00 62.17 ? 210 ARG H CZ  1 
ATOM 9220  N NH1 . ARG H 2 64  ? -7.828  -2.006  -40.153 1.00 61.36 ? 210 ARG H NH1 1 
ATOM 9221  N NH2 . ARG H 2 64  ? -9.120  -0.121  -40.379 1.00 62.53 ? 210 ARG H NH2 1 
ATOM 9222  N N   . ASN H 2 65  ? -5.577  -4.275  -42.258 1.00 54.28 ? 211 ASN H N   1 
ATOM 9223  C CA  . ASN H 2 65  ? -5.338  -4.424  -43.700 1.00 54.79 ? 211 ASN H CA  1 
ATOM 9224  C C   . ASN H 2 65  ? -4.727  -3.196  -44.343 1.00 53.87 ? 211 ASN H C   1 
ATOM 9225  O O   . ASN H 2 65  ? -3.810  -3.284  -45.147 1.00 53.48 ? 211 ASN H O   1 
ATOM 9226  C CB  . ASN H 2 65  ? -6.638  -4.748  -44.430 1.00 56.57 ? 211 ASN H CB  1 
ATOM 9227  C CG  . ASN H 2 65  ? -7.209  -6.103  -44.037 1.00 59.09 ? 211 ASN H CG  1 
ATOM 9228  O OD1 . ASN H 2 65  ? -6.487  -7.113  -43.986 1.00 59.30 ? 211 ASN H OD1 1 
ATOM 9229  N ND2 . ASN H 2 65  ? -8.519  -6.139  -43.770 1.00 59.41 ? 211 ASN H ND2 1 
ATOM 9230  N N   . GLN H 2 66  ? -5.271  -2.049  -43.982 1.00 54.32 ? 212 GLN H N   1 
ATOM 9231  C CA  . GLN H 2 66  ? -4.826  -0.755  -44.467 1.00 53.92 ? 212 GLN H CA  1 
ATOM 9232  C C   . GLN H 2 66  ? -3.309  -0.590  -44.348 1.00 52.29 ? 212 GLN H C   1 
ATOM 9233  O O   . GLN H 2 66  ? -2.679  0.012   -45.215 1.00 51.77 ? 212 GLN H O   1 
ATOM 9234  C CB  . GLN H 2 66  ? -5.548  0.344   -43.669 1.00 55.79 ? 212 GLN H CB  1 
ATOM 9235  C CG  . GLN H 2 66  ? -7.067  0.384   -43.898 1.00 58.68 ? 212 GLN H CG  1 
ATOM 9236  C CD  . GLN H 2 66  ? -7.797  -0.915  -43.511 1.00 60.50 ? 212 GLN H CD  1 
ATOM 9237  O OE1 . GLN H 2 66  ? -8.932  -1.148  -43.931 1.00 61.77 ? 212 GLN H OE1 1 
ATOM 9238  N NE2 . GLN H 2 66  ? -7.156  -1.747  -42.699 1.00 61.75 ? 212 GLN H NE2 1 
ATOM 9239  N N   . HIS H 2 67  ? -2.722  -1.125  -43.279 1.00 50.51 ? 213 HIS H N   1 
ATOM 9240  C CA  . HIS H 2 67  ? -1.278  -1.008  -43.084 1.00 48.93 ? 213 HIS H CA  1 
ATOM 9241  C C   . HIS H 2 67  ? -0.514  -2.317  -43.294 1.00 47.01 ? 213 HIS H C   1 
ATOM 9242  O O   . HIS H 2 67  ? 0.680   -2.398  -42.980 1.00 47.47 ? 213 HIS H O   1 
ATOM 9243  C CB  . HIS H 2 67  ? -0.952  -0.490  -41.678 1.00 50.65 ? 213 HIS H CB  1 
ATOM 9244  C CG  . HIS H 2 67  ? -1.708  0.738   -41.285 1.00 52.56 ? 213 HIS H CG  1 
ATOM 9245  N ND1 . HIS H 2 67  ? -2.074  1.713   -42.190 1.00 53.33 ? 213 HIS H ND1 1 
ATOM 9246  C CD2 . HIS H 2 67  ? -2.146  1.165   -40.077 1.00 52.83 ? 213 HIS H CD2 1 
ATOM 9247  C CE1 . HIS H 2 67  ? -2.706  2.685   -41.556 1.00 52.94 ? 213 HIS H CE1 1 
ATOM 9248  N NE2 . HIS H 2 67  ? -2.761  2.376   -40.273 1.00 52.75 ? 213 HIS H NE2 1 
ATOM 9249  N N   . TRP H 2 68  ? -1.192  -3.331  -43.821 1.00 44.20 ? 214 TRP H N   1 
ATOM 9250  C CA  . TRP H 2 68  ? -0.580  -4.637  -44.064 1.00 41.82 ? 214 TRP H CA  1 
ATOM 9251  C C   . TRP H 2 68  ? 0.160   -5.109  -42.819 1.00 40.12 ? 214 TRP H C   1 
ATOM 9252  O O   . TRP H 2 68  ? 1.274   -5.639  -42.902 1.00 39.71 ? 214 TRP H O   1 
ATOM 9253  C CB  . TRP H 2 68  ? 0.397   -4.568  -45.246 1.00 42.59 ? 214 TRP H CB  1 
ATOM 9254  C CG  . TRP H 2 68  ? -0.201  -4.028  -46.519 1.00 43.00 ? 214 TRP H CG  1 
ATOM 9255  C CD1 . TRP H 2 68  ? -0.187  -2.731  -46.946 1.00 42.90 ? 214 TRP H CD1 1 
ATOM 9256  C CD2 . TRP H 2 68  ? -0.921  -4.770  -47.514 1.00 42.45 ? 214 TRP H CD2 1 
ATOM 9257  N NE1 . TRP H 2 68  ? -0.854  -2.620  -48.144 1.00 42.60 ? 214 TRP H NE1 1 
ATOM 9258  C CE2 . TRP H 2 68  ? -1.314  -3.853  -48.516 1.00 42.04 ? 214 TRP H CE2 1 
ATOM 9259  C CE3 . TRP H 2 68  ? -1.273  -6.119  -47.656 1.00 41.62 ? 214 TRP H CE3 1 
ATOM 9260  C CZ2 . TRP H 2 68  ? -2.040  -4.241  -49.644 1.00 41.83 ? 214 TRP H CZ2 1 
ATOM 9261  C CZ3 . TRP H 2 68  ? -1.995  -6.506  -48.782 1.00 41.75 ? 214 TRP H CZ3 1 
ATOM 9262  C CH2 . TRP H 2 68  ? -2.371  -5.567  -49.761 1.00 41.61 ? 214 TRP H CH2 1 
ATOM 9263  N N   . SER H 2 69  ? -0.467  -4.930  -41.661 1.00 37.82 ? 215 SER H N   1 
ATOM 9264  C CA  . SER H 2 69  ? 0.178   -5.308  -40.416 1.00 35.47 ? 215 SER H CA  1 
ATOM 9265  C C   . SER H 2 69  ? -0.544  -6.369  -39.606 1.00 33.92 ? 215 SER H C   1 
ATOM 9266  O O   . SER H 2 69  ? -1.741  -6.587  -39.765 1.00 33.49 ? 215 SER H O   1 
ATOM 9267  C CB  . SER H 2 69  ? 0.367   -4.065  -39.558 1.00 34.21 ? 215 SER H CB  1 
ATOM 9268  O OG  . SER H 2 69  ? -0.889  -3.511  -39.239 1.00 35.38 ? 215 SER H OG  1 
ATOM 9269  N N   . LEU H 2 70  ? 0.214   -7.030  -38.740 1.00 32.81 ? 216 LEU H N   1 
ATOM 9270  C CA  . LEU H 2 70  ? -0.308  -8.057  -37.849 1.00 31.85 ? 216 LEU H CA  1 
ATOM 9271  C C   . LEU H 2 70  ? 0.012   -7.553  -36.447 1.00 31.26 ? 216 LEU H C   1 
ATOM 9272  O O   . LEU H 2 70  ? 1.158   -7.217  -36.150 1.00 31.73 ? 216 LEU H O   1 
ATOM 9273  C CB  . LEU H 2 70  ? 0.391   -9.395  -38.113 1.00 31.34 ? 216 LEU H CB  1 
ATOM 9274  C CG  . LEU H 2 70  ? 0.125   -10.527 -37.121 1.00 31.90 ? 216 LEU H CG  1 
ATOM 9275  C CD1 . LEU H 2 70  ? -1.357  -10.834 -37.100 1.00 32.50 ? 216 LEU H CD1 1 
ATOM 9276  C CD2 . LEU H 2 70  ? 0.931   -11.775 -37.499 1.00 31.32 ? 216 LEU H CD2 1 
ATOM 9277  N N   . ILE H 2 71  ? -0.995  -7.472  -35.588 1.00 30.14 ? 217 ILE H N   1 
ATOM 9278  C CA  . ILE H 2 71  ? -0.779  -6.975  -34.224 1.00 28.74 ? 217 ILE H CA  1 
ATOM 9279  C C   . ILE H 2 71  ? -1.080  -7.993  -33.125 1.00 28.10 ? 217 ILE H C   1 
ATOM 9280  O O   . ILE H 2 71  ? -2.163  -8.568  -33.072 1.00 27.22 ? 217 ILE H O   1 
ATOM 9281  C CB  . ILE H 2 71  ? -1.642  -5.704  -33.925 1.00 28.44 ? 217 ILE H CB  1 
ATOM 9282  C CG1 . ILE H 2 71  ? -1.165  -4.522  -34.763 1.00 29.08 ? 217 ILE H CG1 1 
ATOM 9283  C CG2 . ILE H 2 71  ? -1.529  -5.321  -32.467 1.00 27.26 ? 217 ILE H CG2 1 
ATOM 9284  C CD1 . ILE H 2 71  ? -1.394  -4.697  -36.248 1.00 30.36 ? 217 ILE H CD1 1 
ATOM 9285  N N   . MET H 2 72  ? -0.103  -8.200  -32.252 1.00 27.30 ? 218 MET H N   1 
ATOM 9286  C CA  . MET H 2 72  ? -0.239  -9.098  -31.117 1.00 26.80 ? 218 MET H CA  1 
ATOM 9287  C C   . MET H 2 72  ? 0.040   -8.270  -29.864 1.00 27.50 ? 218 MET H C   1 
ATOM 9288  O O   . MET H 2 72  ? 1.121   -7.712  -29.703 1.00 28.71 ? 218 MET H O   1 
ATOM 9289  C CB  . MET H 2 72  ? 0.756   -10.255 -31.221 1.00 25.73 ? 218 MET H CB  1 
ATOM 9290  C CG  . MET H 2 72  ? 0.388   -11.268 -32.287 1.00 26.92 ? 218 MET H CG  1 
ATOM 9291  S SD  . MET H 2 72  ? 1.553   -12.650 -32.419 1.00 28.14 ? 218 MET H SD  1 
ATOM 9292  C CE  . MET H 2 72  ? 2.882   -11.889 -33.472 1.00 25.76 ? 218 MET H CE  1 
ATOM 9293  N N   . GLU H 2 73  ? -0.947  -8.190  -28.982 1.00 27.83 ? 219 GLU H N   1 
ATOM 9294  C CA  . GLU H 2 73  ? -0.838  -7.418  -27.757 1.00 27.35 ? 219 GLU H CA  1 
ATOM 9295  C C   . GLU H 2 73  ? -0.377  -8.264  -26.562 1.00 27.76 ? 219 GLU H C   1 
ATOM 9296  O O   . GLU H 2 73  ? -0.646  -9.471  -26.489 1.00 26.67 ? 219 GLU H O   1 
ATOM 9297  C CB  . GLU H 2 73  ? -2.197  -6.764  -27.494 1.00 26.98 ? 219 GLU H CB  1 
ATOM 9298  C CG  . GLU H 2 73  ? -2.689  -6.027  -28.736 1.00 29.72 ? 219 GLU H CG  1 
ATOM 9299  C CD  . GLU H 2 73  ? -4.171  -5.671  -28.717 1.00 32.00 ? 219 GLU H CD  1 
ATOM 9300  O OE1 . GLU H 2 73  ? -5.012  -6.586  -28.565 1.00 33.84 ? 219 GLU H OE1 1 
ATOM 9301  O OE2 . GLU H 2 73  ? -4.501  -4.469  -28.871 1.00 33.73 ? 219 GLU H OE2 1 
ATOM 9302  N N   . SER H 2 74  ? 0.341   -7.616  -25.643 1.00 28.19 ? 220 SER H N   1 
ATOM 9303  C CA  . SER H 2 74  ? 0.848   -8.264  -24.437 1.00 28.26 ? 220 SER H CA  1 
ATOM 9304  C C   . SER H 2 74  ? 1.465   -9.629  -24.737 1.00 28.36 ? 220 SER H C   1 
ATOM 9305  O O   . SER H 2 74  ? 1.034   -10.661 -24.202 1.00 28.77 ? 220 SER H O   1 
ATOM 9306  C CB  . SER H 2 74  ? -0.288  -8.411  -23.421 1.00 29.37 ? 220 SER H CB  1 
ATOM 9307  O OG  . SER H 2 74  ? -0.882  -7.154  -23.140 1.00 31.63 ? 220 SER H OG  1 
ATOM 9308  N N   . VAL H 2 75  ? 2.487   -9.629  -25.581 1.00 26.81 ? 221 VAL H N   1 
ATOM 9309  C CA  . VAL H 2 75  ? 3.131   -10.870 -25.954 1.00 26.56 ? 221 VAL H CA  1 
ATOM 9310  C C   . VAL H 2 75  ? 3.740   -11.619 -24.772 1.00 27.33 ? 221 VAL H C   1 
ATOM 9311  O O   . VAL H 2 75  ? 4.094   -11.026 -23.736 1.00 26.12 ? 221 VAL H O   1 
ATOM 9312  C CB  . VAL H 2 75  ? 4.195   -10.619 -27.044 1.00 25.68 ? 221 VAL H CB  1 
ATOM 9313  C CG1 . VAL H 2 75  ? 3.514   -10.118 -28.300 1.00 25.40 ? 221 VAL H CG1 1 
ATOM 9314  C CG2 . VAL H 2 75  ? 5.211   -9.599  -26.575 1.00 24.69 ? 221 VAL H CG2 1 
ATOM 9315  N N   . VAL H 2 76  ? 3.843   -12.936 -24.931 1.00 27.57 ? 222 VAL H N   1 
ATOM 9316  C CA  . VAL H 2 76  ? 4.403   -13.796 -23.895 1.00 27.70 ? 222 VAL H CA  1 
ATOM 9317  C C   . VAL H 2 76  ? 5.329   -14.784 -24.563 1.00 28.39 ? 222 VAL H C   1 
ATOM 9318  O O   . VAL H 2 76  ? 5.300   -14.941 -25.785 1.00 27.85 ? 222 VAL H O   1 
ATOM 9319  C CB  . VAL H 2 76  ? 3.295   -14.580 -23.133 1.00 26.72 ? 222 VAL H CB  1 
ATOM 9320  C CG1 . VAL H 2 76  ? 2.534   -13.647 -22.211 1.00 24.80 ? 222 VAL H CG1 1 
ATOM 9321  C CG2 . VAL H 2 76  ? 2.347   -15.236 -24.116 1.00 25.27 ? 222 VAL H CG2 1 
ATOM 9322  N N   . PRO H 2 77  ? 6.168   -15.465 -23.768 1.00 29.34 ? 223 PRO H N   1 
ATOM 9323  C CA  . PRO H 2 77  ? 7.120   -16.456 -24.285 1.00 29.11 ? 223 PRO H CA  1 
ATOM 9324  C C   . PRO H 2 77  ? 6.538   -17.429 -25.321 1.00 29.00 ? 223 PRO H C   1 
ATOM 9325  O O   . PRO H 2 77  ? 7.159   -17.685 -26.350 1.00 29.86 ? 223 PRO H O   1 
ATOM 9326  C CB  . PRO H 2 77  ? 7.587   -17.172 -23.014 1.00 29.46 ? 223 PRO H CB  1 
ATOM 9327  C CG  . PRO H 2 77  ? 7.598   -16.052 -22.006 1.00 29.86 ? 223 PRO H CG  1 
ATOM 9328  C CD  . PRO H 2 77  ? 6.300   -15.317 -22.302 1.00 29.58 ? 223 PRO H CD  1 
ATOM 9329  N N   . SER H 2 78  ? 5.353   -17.968 -25.049 1.00 28.72 ? 224 SER H N   1 
ATOM 9330  C CA  . SER H 2 78  ? 4.720   -18.922 -25.956 1.00 28.65 ? 224 SER H CA  1 
ATOM 9331  C C   . SER H 2 78  ? 4.473   -18.361 -27.365 1.00 28.69 ? 224 SER H C   1 
ATOM 9332  O O   . SER H 2 78  ? 4.201   -19.129 -28.305 1.00 28.45 ? 224 SER H O   1 
ATOM 9333  C CB  . SER H 2 78  ? 3.384   -19.379 -25.370 1.00 29.52 ? 224 SER H CB  1 
ATOM 9334  O OG  . SER H 2 78  ? 2.394   -18.358 -25.493 1.00 33.12 ? 224 SER H OG  1 
ATOM 9335  N N   . ASP H 2 79  ? 4.552   -17.036 -27.513 1.00 27.69 ? 225 ASP H N   1 
ATOM 9336  C CA  . ASP H 2 79  ? 4.326   -16.408 -28.817 1.00 27.36 ? 225 ASP H CA  1 
ATOM 9337  C C   . ASP H 2 79  ? 5.543   -16.567 -29.712 1.00 27.38 ? 225 ASP H C   1 
ATOM 9338  O O   . ASP H 2 79  ? 5.491   -16.272 -30.905 1.00 26.72 ? 225 ASP H O   1 
ATOM 9339  C CB  . ASP H 2 79  ? 4.005   -14.921 -28.662 1.00 26.91 ? 225 ASP H CB  1 
ATOM 9340  C CG  . ASP H 2 79  ? 2.644   -14.676 -28.055 1.00 27.64 ? 225 ASP H CG  1 
ATOM 9341  O OD1 . ASP H 2 79  ? 1.666   -15.276 -28.541 1.00 29.02 ? 225 ASP H OD1 1 
ATOM 9342  O OD2 . ASP H 2 79  ? 2.545   -13.882 -27.096 1.00 28.14 ? 225 ASP H OD2 1 
ATOM 9343  N N   . LYS H 2 80  ? 6.641   -17.037 -29.128 1.00 27.24 ? 226 LYS H N   1 
ATOM 9344  C CA  . LYS H 2 80  ? 7.868   -17.244 -29.891 1.00 28.53 ? 226 LYS H CA  1 
ATOM 9345  C C   . LYS H 2 80  ? 7.570   -18.079 -31.121 1.00 27.86 ? 226 LYS H C   1 
ATOM 9346  O O   . LYS H 2 80  ? 6.752   -18.986 -31.069 1.00 28.76 ? 226 LYS H O   1 
ATOM 9347  C CB  . LYS H 2 80  ? 8.919   -17.971 -29.051 1.00 28.70 ? 226 LYS H CB  1 
ATOM 9348  C CG  . LYS H 2 80  ? 10.134  -18.346 -29.869 1.00 29.40 ? 226 LYS H CG  1 
ATOM 9349  C CD  . LYS H 2 80  ? 11.256  -18.832 -29.000 1.00 30.14 ? 226 LYS H CD  1 
ATOM 9350  C CE  . LYS H 2 80  ? 12.469  -19.194 -29.825 1.00 30.14 ? 226 LYS H CE  1 
ATOM 9351  N NZ  . LYS H 2 80  ? 13.636  -19.453 -28.929 1.00 33.06 ? 226 LYS H NZ  1 
ATOM 9352  N N   . GLY H 2 81  ? 8.233   -17.781 -32.226 1.00 27.49 ? 227 GLY H N   1 
ATOM 9353  C CA  . GLY H 2 81  ? 7.987   -18.541 -33.433 1.00 28.30 ? 227 GLY H CA  1 
ATOM 9354  C C   . GLY H 2 81  ? 8.106   -17.708 -34.693 1.00 28.43 ? 227 GLY H C   1 
ATOM 9355  O O   . GLY H 2 81  ? 8.437   -16.533 -34.635 1.00 28.17 ? 227 GLY H O   1 
ATOM 9356  N N   . ASN H 2 82  ? 7.822   -18.321 -35.837 1.00 29.45 ? 228 ASN H N   1 
ATOM 9357  C CA  . ASN H 2 82  ? 7.908   -17.638 -37.123 1.00 29.50 ? 228 ASN H CA  1 
ATOM 9358  C C   . ASN H 2 82  ? 6.573   -17.123 -37.613 1.00 28.75 ? 228 ASN H C   1 
ATOM 9359  O O   . ASN H 2 82  ? 5.593   -17.862 -37.632 1.00 30.35 ? 228 ASN H O   1 
ATOM 9360  C CB  . ASN H 2 82  ? 8.460   -18.586 -38.175 1.00 30.10 ? 228 ASN H CB  1 
ATOM 9361  C CG  . ASN H 2 82  ? 9.892   -18.932 -37.926 1.00 31.72 ? 228 ASN H CG  1 
ATOM 9362  O OD1 . ASN H 2 82  ? 10.752  -18.057 -37.913 1.00 36.20 ? 228 ASN H OD1 1 
ATOM 9363  N ND2 . ASN H 2 82  ? 10.170  -20.211 -37.721 1.00 31.81 ? 228 ASN H ND2 1 
ATOM 9364  N N   . TYR H 2 83  ? 6.536   -15.860 -38.014 1.00 26.51 ? 229 TYR H N   1 
ATOM 9365  C CA  . TYR H 2 83  ? 5.313   -15.286 -38.534 1.00 25.84 ? 229 TYR H CA  1 
ATOM 9366  C C   . TYR H 2 83  ? 5.583   -14.886 -39.979 1.00 26.76 ? 229 TYR H C   1 
ATOM 9367  O O   . TYR H 2 83  ? 6.517   -14.127 -40.278 1.00 26.88 ? 229 TYR H O   1 
ATOM 9368  C CB  . TYR H 2 83  ? 4.874   -14.109 -37.658 1.00 24.61 ? 229 TYR H CB  1 
ATOM 9369  C CG  . TYR H 2 83  ? 4.506   -14.561 -36.252 1.00 23.26 ? 229 TYR H CG  1 
ATOM 9370  C CD1 . TYR H 2 83  ? 5.493   -14.882 -35.311 1.00 22.00 ? 229 TYR H CD1 1 
ATOM 9371  C CD2 . TYR H 2 83  ? 3.174   -14.773 -35.898 1.00 21.99 ? 229 TYR H CD2 1 
ATOM 9372  C CE1 . TYR H 2 83  ? 5.159   -15.408 -34.067 1.00 21.00 ? 229 TYR H CE1 1 
ATOM 9373  C CE2 . TYR H 2 83  ? 2.833   -15.302 -34.659 1.00 20.71 ? 229 TYR H CE2 1 
ATOM 9374  C CZ  . TYR H 2 83  ? 3.824   -15.620 -33.751 1.00 21.11 ? 229 TYR H CZ  1 
ATOM 9375  O OH  . TYR H 2 83  ? 3.469   -16.175 -32.539 1.00 21.43 ? 229 TYR H OH  1 
ATOM 9376  N N   . THR H 2 84  ? 4.762   -15.426 -40.877 1.00 26.83 ? 230 THR H N   1 
ATOM 9377  C CA  . THR H 2 84  ? 4.919   -15.192 -42.304 1.00 25.82 ? 230 THR H CA  1 
ATOM 9378  C C   . THR H 2 84  ? 3.726   -14.527 -42.936 1.00 26.54 ? 230 THR H C   1 
ATOM 9379  O O   . THR H 2 84  ? 2.590   -14.951 -42.743 1.00 27.92 ? 230 THR H O   1 
ATOM 9380  C CB  . THR H 2 84  ? 5.145   -16.514 -43.043 1.00 24.97 ? 230 THR H CB  1 
ATOM 9381  O OG1 . THR H 2 84  ? 6.355   -17.124 -42.573 1.00 22.87 ? 230 THR H OG1 1 
ATOM 9382  C CG2 . THR H 2 84  ? 5.219   -16.277 -44.537 1.00 22.79 ? 230 THR H CG2 1 
ATOM 9383  N N   . CYS H 2 85  ? 3.982   -13.478 -43.699 1.00 26.34 ? 231 CYS H N   1 
ATOM 9384  C CA  . CYS H 2 85  ? 2.896   -12.797 -44.369 1.00 25.69 ? 231 CYS H CA  1 
ATOM 9385  C C   . CYS H 2 85  ? 2.938   -13.262 -45.816 1.00 25.43 ? 231 CYS H C   1 
ATOM 9386  O O   . CYS H 2 85  ? 4.001   -13.315 -46.437 1.00 25.23 ? 231 CYS H O   1 
ATOM 9387  C CB  . CYS H 2 85  ? 3.057   -11.281 -44.271 1.00 25.86 ? 231 CYS H CB  1 
ATOM 9388  S SG  . CYS H 2 85  ? 4.413   -10.644 -45.227 1.00 27.69 ? 231 CYS H SG  1 
ATOM 9389  N N   . VAL H 2 86  ? 1.779   -13.620 -46.345 1.00 26.21 ? 232 VAL H N   1 
ATOM 9390  C CA  . VAL H 2 86  ? 1.698   -14.101 -47.711 1.00 28.28 ? 232 VAL H CA  1 
ATOM 9391  C C   . VAL H 2 86  ? 0.775   -13.192 -48.499 1.00 29.72 ? 232 VAL H C   1 
ATOM 9392  O O   . VAL H 2 86  ? -0.429  -13.140 -48.259 1.00 30.60 ? 232 VAL H O   1 
ATOM 9393  C CB  . VAL H 2 86  ? 1.185   -15.565 -47.751 1.00 28.51 ? 232 VAL H CB  1 
ATOM 9394  C CG1 . VAL H 2 86  ? 1.255   -16.115 -49.159 1.00 26.79 ? 232 VAL H CG1 1 
ATOM 9395  C CG2 . VAL H 2 86  ? 2.026   -16.427 -46.804 1.00 27.94 ? 232 VAL H CG2 1 
ATOM 9396  N N   . VAL H 2 87  ? 1.361   -12.465 -49.441 1.00 31.48 ? 233 VAL H N   1 
ATOM 9397  C CA  . VAL H 2 87  ? 0.628   -11.517 -50.274 1.00 33.33 ? 233 VAL H CA  1 
ATOM 9398  C C   . VAL H 2 87  ? 0.506   -12.051 -51.688 1.00 34.43 ? 233 VAL H C   1 
ATOM 9399  O O   . VAL H 2 87  ? 1.462   -12.624 -52.220 1.00 34.73 ? 233 VAL H O   1 
ATOM 9400  C CB  . VAL H 2 87  ? 1.372   -10.159 -50.348 1.00 33.39 ? 233 VAL H CB  1 
ATOM 9401  C CG1 . VAL H 2 87  ? 0.623   -9.213  -51.240 1.00 34.08 ? 233 VAL H CG1 1 
ATOM 9402  C CG2 . VAL H 2 87  ? 1.525   -9.566  -48.959 1.00 34.50 ? 233 VAL H CG2 1 
ATOM 9403  N N   . GLU H 2 88  ? -0.651  -11.850 -52.313 1.00 36.18 ? 234 GLU H N   1 
ATOM 9404  C CA  . GLU H 2 88  ? -0.825  -12.331 -53.679 1.00 37.80 ? 234 GLU H CA  1 
ATOM 9405  C C   . GLU H 2 88  ? -2.016  -11.797 -54.475 1.00 38.30 ? 234 GLU H C   1 
ATOM 9406  O O   . GLU H 2 88  ? -2.974  -11.237 -53.931 1.00 39.06 ? 234 GLU H O   1 
ATOM 9407  C CB  . GLU H 2 88  ? -0.922  -13.852 -53.678 1.00 38.58 ? 234 GLU H CB  1 
ATOM 9408  C CG  . GLU H 2 88  ? -2.236  -14.346 -53.111 1.00 41.41 ? 234 GLU H CG  1 
ATOM 9409  C CD  . GLU H 2 88  ? -2.464  -15.814 -53.375 1.00 43.12 ? 234 GLU H CD  1 
ATOM 9410  O OE1 . GLU H 2 88  ? -1.704  -16.632 -52.799 1.00 44.61 ? 234 GLU H OE1 1 
ATOM 9411  O OE2 . GLU H 2 88  ? -3.396  -16.137 -54.156 1.00 41.91 ? 234 GLU H OE2 1 
ATOM 9412  N N   . ASN H 2 89  ? -1.919  -11.989 -55.786 1.00 38.24 ? 235 ASN H N   1 
ATOM 9413  C CA  . ASN H 2 89  ? -2.968  -11.649 -56.738 1.00 38.21 ? 235 ASN H CA  1 
ATOM 9414  C C   . ASN H 2 89  ? -2.732  -12.585 -57.931 1.00 38.62 ? 235 ASN H C   1 
ATOM 9415  O O   . ASN H 2 89  ? -1.821  -13.419 -57.887 1.00 36.74 ? 235 ASN H O   1 
ATOM 9416  C CB  . ASN H 2 89  ? -2.953  -10.161 -57.146 1.00 37.30 ? 235 ASN H CB  1 
ATOM 9417  C CG  . ASN H 2 89  ? -1.694  -9.744  -57.851 1.00 36.98 ? 235 ASN H CG  1 
ATOM 9418  O OD1 . ASN H 2 89  ? -1.039  -10.543 -58.510 1.00 37.80 ? 235 ASN H OD1 1 
ATOM 9419  N ND2 . ASN H 2 89  ? -1.364  -8.464  -57.744 1.00 37.47 ? 235 ASN H ND2 1 
ATOM 9420  N N   . GLU H 2 90  ? -3.531  -12.469 -58.988 1.00 39.59 ? 236 GLU H N   1 
ATOM 9421  C CA  . GLU H 2 90  ? -3.375  -13.384 -60.111 1.00 40.67 ? 236 GLU H CA  1 
ATOM 9422  C C   . GLU H 2 90  ? -2.049  -13.363 -60.865 1.00 40.30 ? 236 GLU H C   1 
ATOM 9423  O O   . GLU H 2 90  ? -1.799  -14.243 -61.694 1.00 40.09 ? 236 GLU H O   1 
ATOM 9424  C CB  . GLU H 2 90  ? -4.535  -13.225 -61.096 1.00 42.91 ? 236 GLU H CB  1 
ATOM 9425  C CG  . GLU H 2 90  ? -4.891  -11.805 -61.433 1.00 47.61 ? 236 GLU H CG  1 
ATOM 9426  C CD  . GLU H 2 90  ? -5.901  -11.727 -62.568 1.00 50.41 ? 236 GLU H CD  1 
ATOM 9427  O OE1 . GLU H 2 90  ? -5.500  -11.943 -63.737 1.00 52.04 ? 236 GLU H OE1 1 
ATOM 9428  O OE2 . GLU H 2 90  ? -7.095  -11.462 -62.290 1.00 51.29 ? 236 GLU H OE2 1 
ATOM 9429  N N   . TYR H 2 91  ? -1.187  -12.389 -60.582 1.00 39.67 ? 237 TYR H N   1 
ATOM 9430  C CA  . TYR H 2 91  ? 0.100   -12.323 -61.276 1.00 38.58 ? 237 TYR H CA  1 
ATOM 9431  C C   . TYR H 2 91  ? 1.284   -12.724 -60.405 1.00 37.20 ? 237 TYR H C   1 
ATOM 9432  O O   . TYR H 2 91  ? 2.428   -12.615 -60.830 1.00 36.87 ? 237 TYR H O   1 
ATOM 9433  C CB  . TYR H 2 91  ? 0.353   -10.920 -61.830 1.00 39.71 ? 237 TYR H CB  1 
ATOM 9434  C CG  . TYR H 2 91  ? -0.794  -10.374 -62.637 1.00 41.89 ? 237 TYR H CG  1 
ATOM 9435  C CD1 . TYR H 2 91  ? -1.494  -9.257  -62.195 1.00 43.25 ? 237 TYR H CD1 1 
ATOM 9436  C CD2 . TYR H 2 91  ? -1.201  -10.989 -63.825 1.00 41.78 ? 237 TYR H CD2 1 
ATOM 9437  C CE1 . TYR H 2 91  ? -2.571  -8.758  -62.899 1.00 44.78 ? 237 TYR H CE1 1 
ATOM 9438  C CE2 . TYR H 2 91  ? -2.284  -10.498 -64.547 1.00 44.33 ? 237 TYR H CE2 1 
ATOM 9439  C CZ  . TYR H 2 91  ? -2.967  -9.376  -64.073 1.00 45.53 ? 237 TYR H CZ  1 
ATOM 9440  O OH  . TYR H 2 91  ? -4.051  -8.856  -64.749 1.00 47.41 ? 237 TYR H OH  1 
ATOM 9441  N N   . GLY H 2 92  ? 1.017   -13.187 -59.189 1.00 36.31 ? 238 GLY H N   1 
ATOM 9442  C CA  . GLY H 2 92  ? 2.108   -13.589 -58.319 1.00 34.17 ? 238 GLY H CA  1 
ATOM 9443  C C   . GLY H 2 92  ? 1.785   -13.753 -56.847 1.00 32.72 ? 238 GLY H C   1 
ATOM 9444  O O   . GLY H 2 92  ? 0.706   -13.398 -56.378 1.00 32.30 ? 238 GLY H O   1 
ATOM 9445  N N   . SER H 2 93  ? 2.748   -14.294 -56.117 1.00 31.49 ? 239 SER H N   1 
ATOM 9446  C CA  . SER H 2 93  ? 2.598   -14.525 -54.695 1.00 31.72 ? 239 SER H CA  1 
ATOM 9447  C C   . SER H 2 93  ? 3.969   -14.399 -54.038 1.00 31.46 ? 239 SER H C   1 
ATOM 9448  O O   . SER H 2 93  ? 4.915   -15.081 -54.438 1.00 31.56 ? 239 SER H O   1 
ATOM 9449  C CB  . SER H 2 93  ? 2.043   -15.932 -54.469 1.00 33.49 ? 239 SER H CB  1 
ATOM 9450  O OG  . SER H 2 93  ? 1.376   -16.045 -53.223 1.00 35.31 ? 239 SER H OG  1 
ATOM 9451  N N   . ILE H 2 94  ? 4.091   -13.521 -53.045 1.00 30.04 ? 240 ILE H N   1 
ATOM 9452  C CA  . ILE H 2 94  ? 5.371   -13.346 -52.349 1.00 28.51 ? 240 ILE H CA  1 
ATOM 9453  C C   . ILE H 2 94  ? 5.147   -13.398 -50.850 1.00 28.45 ? 240 ILE H C   1 
ATOM 9454  O O   . ILE H 2 94  ? 4.047   -13.118 -50.359 1.00 28.70 ? 240 ILE H O   1 
ATOM 9455  C CB  . ILE H 2 94  ? 6.059   -12.018 -52.697 1.00 26.55 ? 240 ILE H CB  1 
ATOM 9456  C CG1 . ILE H 2 94  ? 5.128   -10.849 -52.349 1.00 26.79 ? 240 ILE H CG1 1 
ATOM 9457  C CG2 . ILE H 2 94  ? 6.475   -12.031 -54.159 1.00 26.21 ? 240 ILE H CG2 1 
ATOM 9458  C CD1 . ILE H 2 94  ? 5.675   -9.443  -52.674 1.00 25.25 ? 240 ILE H CD1 1 
ATOM 9459  N N   . ASN H 2 95  ? 6.190   -13.772 -50.122 1.00 27.65 ? 241 ASN H N   1 
ATOM 9460  C CA  . ASN H 2 95  ? 6.087   -13.889 -48.677 1.00 27.34 ? 241 ASN H CA  1 
ATOM 9461  C C   . ASN H 2 95  ? 7.333   -13.351 -48.018 1.00 27.39 ? 241 ASN H C   1 
ATOM 9462  O O   . ASN H 2 95  ? 8.378   -13.192 -48.655 1.00 26.24 ? 241 ASN H O   1 
ATOM 9463  C CB  . ASN H 2 95  ? 5.914   -15.360 -48.260 1.00 26.63 ? 241 ASN H CB  1 
ATOM 9464  C CG  . ASN H 2 95  ? 7.080   -16.225 -48.702 1.00 26.48 ? 241 ASN H CG  1 
ATOM 9465  O OD1 . ASN H 2 95  ? 7.071   -16.786 -49.796 1.00 27.45 ? 241 ASN H OD1 1 
ATOM 9466  N ND2 . ASN H 2 95  ? 8.108   -16.310 -47.866 1.00 26.74 ? 241 ASN H ND2 1 
ATOM 9467  N N   . HIS H 2 96  ? 7.202   -13.092 -46.722 1.00 28.04 ? 242 HIS H N   1 
ATOM 9468  C CA  . HIS H 2 96  ? 8.282   -12.583 -45.894 1.00 28.06 ? 242 HIS H CA  1 
ATOM 9469  C C   . HIS H 2 96  ? 8.087   -13.174 -44.501 1.00 28.16 ? 242 HIS H C   1 
ATOM 9470  O O   . HIS H 2 96  ? 6.963   -13.237 -44.007 1.00 27.51 ? 242 HIS H O   1 
ATOM 9471  C CB  . HIS H 2 96  ? 8.196   -11.070 -45.810 1.00 28.83 ? 242 HIS H CB  1 
ATOM 9472  C CG  . HIS H 2 96  ? 9.254   -10.465 -44.952 1.00 30.51 ? 242 HIS H CG  1 
ATOM 9473  N ND1 . HIS H 2 96  ? 10.559  -10.324 -45.375 1.00 30.74 ? 242 HIS H ND1 1 
ATOM 9474  C CD2 . HIS H 2 96  ? 9.215   -10.013 -43.673 1.00 29.10 ? 242 HIS H CD2 1 
ATOM 9475  C CE1 . HIS H 2 96  ? 11.279  -9.810  -44.392 1.00 30.63 ? 242 HIS H CE1 1 
ATOM 9476  N NE2 . HIS H 2 96  ? 10.487  -9.614  -43.351 1.00 29.56 ? 242 HIS H NE2 1 
ATOM 9477  N N   . THR H 2 97  ? 9.164   -13.601 -43.855 1.00 28.44 ? 243 THR H N   1 
ATOM 9478  C CA  . THR H 2 97  ? 9.023   -14.183 -42.525 1.00 29.41 ? 243 THR H CA  1 
ATOM 9479  C C   . THR H 2 97  ? 9.759   -13.418 -41.439 1.00 29.32 ? 243 THR H C   1 
ATOM 9480  O O   . THR H 2 97  ? 10.908  -13.000 -41.616 1.00 29.00 ? 243 THR H O   1 
ATOM 9481  C CB  . THR H 2 97  ? 9.507   -15.657 -42.500 1.00 30.81 ? 243 THR H CB  1 
ATOM 9482  O OG1 . THR H 2 97  ? 8.764   -16.412 -43.465 1.00 32.76 ? 243 THR H OG1 1 
ATOM 9483  C CG2 . THR H 2 97  ? 9.304   -16.272 -41.125 1.00 29.12 ? 243 THR H CG2 1 
ATOM 9484  N N   . TYR H 2 98  ? 9.075   -13.243 -40.315 1.00 29.02 ? 244 TYR H N   1 
ATOM 9485  C CA  . TYR H 2 98  ? 9.635   -12.565 -39.155 1.00 31.06 ? 244 TYR H CA  1 
ATOM 9486  C C   . TYR H 2 98  ? 9.775   -13.596 -38.044 1.00 32.16 ? 244 TYR H C   1 
ATOM 9487  O O   . TYR H 2 98  ? 8.975   -14.525 -37.961 1.00 33.44 ? 244 TYR H O   1 
ATOM 9488  C CB  . TYR H 2 98  ? 8.682   -11.474 -38.666 1.00 32.47 ? 244 TYR H CB  1 
ATOM 9489  C CG  . TYR H 2 98  ? 8.579   -10.261 -39.558 1.00 35.10 ? 244 TYR H CG  1 
ATOM 9490  C CD1 . TYR H 2 98  ? 7.331   -9.787  -39.985 1.00 35.42 ? 244 TYR H CD1 1 
ATOM 9491  C CD2 . TYR H 2 98  ? 9.723   -9.559  -39.947 1.00 35.49 ? 244 TYR H CD2 1 
ATOM 9492  C CE1 . TYR H 2 98  ? 7.227   -8.640  -40.777 1.00 36.48 ? 244 TYR H CE1 1 
ATOM 9493  C CE2 . TYR H 2 98  ? 9.632   -8.412  -40.737 1.00 36.29 ? 244 TYR H CE2 1 
ATOM 9494  C CZ  . TYR H 2 98  ? 8.384   -7.957  -41.146 1.00 37.07 ? 244 TYR H CZ  1 
ATOM 9495  O OH  . TYR H 2 98  ? 8.301   -6.811  -41.900 1.00 36.55 ? 244 TYR H OH  1 
ATOM 9496  N N   . HIS H 2 99  ? 10.785  -13.464 -37.192 1.00 32.37 ? 245 HIS H N   1 
ATOM 9497  C CA  . HIS H 2 99  ? 10.893  -14.404 -36.077 1.00 32.41 ? 245 HIS H CA  1 
ATOM 9498  C C   . HIS H 2 99  ? 10.616  -13.592 -34.814 1.00 32.11 ? 245 HIS H C   1 
ATOM 9499  O O   . HIS H 2 99  ? 11.166  -12.511 -34.623 1.00 32.36 ? 245 HIS H O   1 
ATOM 9500  C CB  . HIS H 2 99  ? 12.278  -15.064 -36.018 1.00 31.65 ? 245 HIS H CB  1 
ATOM 9501  N N   . LEU H 2 100 ? 9.726   -14.093 -33.975 1.00 32.36 ? 246 LEU H N   1 
ATOM 9502  C CA  . LEU H 2 100 ? 9.388   -13.407 -32.738 1.00 33.42 ? 246 LEU H CA  1 
ATOM 9503  C C   . LEU H 2 100 ? 10.023  -14.113 -31.551 1.00 34.74 ? 246 LEU H C   1 
ATOM 9504  O O   . LEU H 2 100 ? 10.003  -15.340 -31.463 1.00 35.46 ? 246 LEU H O   1 
ATOM 9505  C CB  . LEU H 2 100 ? 7.868   -13.376 -32.545 1.00 32.52 ? 246 LEU H CB  1 
ATOM 9506  C CG  . LEU H 2 100 ? 7.351   -12.781 -31.233 1.00 31.30 ? 246 LEU H CG  1 
ATOM 9507  C CD1 . LEU H 2 100 ? 7.922   -11.392 -31.044 1.00 31.89 ? 246 LEU H CD1 1 
ATOM 9508  C CD2 . LEU H 2 100 ? 5.827   -12.734 -31.258 1.00 30.35 ? 246 LEU H CD2 1 
ATOM 9509  N N   . ASP H 2 101 ? 10.590  -13.336 -30.638 1.00 36.62 ? 247 ASP H N   1 
ATOM 9510  C CA  . ASP H 2 101 ? 11.198  -13.903 -29.450 1.00 37.52 ? 247 ASP H CA  1 
ATOM 9511  C C   . ASP H 2 101 ? 10.834  -13.008 -28.273 1.00 37.56 ? 247 ASP H C   1 
ATOM 9512  O O   . ASP H 2 101 ? 11.006  -11.792 -28.342 1.00 38.70 ? 247 ASP H O   1 
ATOM 9513  C CB  . ASP H 2 101 ? 12.706  -13.993 -29.637 1.00 39.37 ? 247 ASP H CB  1 
ATOM 9514  C CG  . ASP H 2 101 ? 13.260  -15.314 -29.150 1.00 41.49 ? 247 ASP H CG  1 
ATOM 9515  O OD1 . ASP H 2 101 ? 14.337  -15.736 -29.638 1.00 43.55 ? 247 ASP H OD1 1 
ATOM 9516  O OD2 . ASP H 2 101 ? 12.613  -15.927 -28.272 1.00 42.02 ? 247 ASP H OD2 1 
ATOM 9517  N N   . VAL H 2 102 ? 10.301  -13.599 -27.206 1.00 36.92 ? 248 VAL H N   1 
ATOM 9518  C CA  . VAL H 2 102 ? 9.902   -12.816 -26.041 1.00 35.79 ? 248 VAL H CA  1 
ATOM 9519  C C   . VAL H 2 102 ? 10.795  -13.071 -24.841 1.00 35.39 ? 248 VAL H C   1 
ATOM 9520  O O   . VAL H 2 102 ? 11.120  -14.210 -24.519 1.00 36.38 ? 248 VAL H O   1 
ATOM 9521  C CB  . VAL H 2 102 ? 8.434   -13.101 -25.648 1.00 36.42 ? 248 VAL H CB  1 
ATOM 9522  C CG1 . VAL H 2 102 ? 8.061   -12.318 -24.408 1.00 37.36 ? 248 VAL H CG1 1 
ATOM 9523  C CG2 . VAL H 2 102 ? 7.508   -12.702 -26.777 1.00 37.35 ? 248 VAL H CG2 1 
ATOM 9524  N N   . VAL H 2 103 ? 11.185  -11.996 -24.171 1.00 35.20 ? 249 VAL H N   1 
ATOM 9525  C CA  . VAL H 2 103 ? 12.048  -12.103 -23.006 1.00 34.27 ? 249 VAL H CA  1 
ATOM 9526  C C   . VAL H 2 103 ? 11.391  -11.443 -21.797 1.00 33.66 ? 249 VAL H C   1 
ATOM 9527  O O   . VAL H 2 103 ? 10.905  -10.319 -21.874 1.00 33.53 ? 249 VAL H O   1 
ATOM 9528  C CB  . VAL H 2 103 ? 13.438  -11.465 -23.293 1.00 34.28 ? 249 VAL H CB  1 
ATOM 9529  C CG1 . VAL H 2 103 ? 14.368  -11.688 -22.134 1.00 34.13 ? 249 VAL H CG1 1 
ATOM 9530  C CG2 . VAL H 2 103 ? 14.045  -12.088 -24.553 1.00 34.25 ? 249 VAL H CG2 1 
ATOM 9531  N N   . GLU H 2 104 ? 11.352  -12.161 -20.682 1.00 33.75 ? 250 GLU H N   1 
ATOM 9532  C CA  . GLU H 2 104 ? 10.744  -11.613 -19.480 1.00 33.74 ? 250 GLU H CA  1 
ATOM 9533  C C   . GLU H 2 104 ? 11.780  -10.885 -18.661 1.00 32.68 ? 250 GLU H C   1 
ATOM 9534  O O   . GLU H 2 104 ? 12.773  -11.474 -18.267 1.00 34.00 ? 250 GLU H O   1 
ATOM 9535  C CB  . GLU H 2 104 ? 10.143  -12.709 -18.623 1.00 34.37 ? 250 GLU H CB  1 
ATOM 9536  C CG  . GLU H 2 104 ? 8.945   -13.377 -19.225 1.00 37.28 ? 250 GLU H CG  1 
ATOM 9537  C CD  . GLU H 2 104 ? 8.284   -14.312 -18.238 1.00 39.49 ? 250 GLU H CD  1 
ATOM 9538  O OE1 . GLU H 2 104 ? 8.872   -15.387 -17.944 1.00 39.18 ? 250 GLU H OE1 1 
ATOM 9539  O OE2 . GLU H 2 104 ? 7.187   -13.951 -17.746 1.00 40.05 ? 250 GLU H OE2 1 
ATOM 9540  N N   . ARG H 2 105 ? 11.580  -9.598  -18.413 1.00 31.51 ? 251 ARG H N   1 
ATOM 9541  C CA  . ARG H 2 105 ? 12.543  -8.869  -17.602 1.00 30.09 ? 251 ARG H CA  1 
ATOM 9542  C C   . ARG H 2 105 ? 12.107  -8.893  -16.127 1.00 29.86 ? 251 ARG H C   1 
ATOM 9543  O O   . ARG H 2 105 ? 10.927  -8.973  -15.827 1.00 29.50 ? 251 ARG H O   1 
ATOM 9544  C CB  . ARG H 2 105 ? 12.686  -7.422  -18.094 1.00 28.36 ? 251 ARG H CB  1 
ATOM 9545  C CG  . ARG H 2 105 ? 13.064  -7.273  -19.569 1.00 28.21 ? 251 ARG H CG  1 
ATOM 9546  C CD  . ARG H 2 105 ? 14.247  -8.150  -19.961 1.00 26.08 ? 251 ARG H CD  1 
ATOM 9547  N NE  . ARG H 2 105 ? 15.478  -7.771  -19.279 1.00 26.18 ? 251 ARG H NE  1 
ATOM 9548  C CZ  . ARG H 2 105 ? 16.206  -6.693  -19.567 1.00 26.39 ? 251 ARG H CZ  1 
ATOM 9549  N NH1 . ARG H 2 105 ? 15.832  -5.867  -20.533 1.00 25.81 ? 251 ARG H NH1 1 
ATOM 9550  N NH2 . ARG H 2 105 ? 17.322  -6.446  -18.895 1.00 24.56 ? 251 ARG H NH2 1 
ATOM 9551  N N   . TRP H 2 106 ? 13.074  -8.835  -15.218 1.00 30.63 ? 252 TRP H N   1 
ATOM 9552  C CA  . TRP H 2 106 ? 12.821  -8.842  -13.783 1.00 30.88 ? 252 TRP H CA  1 
ATOM 9553  C C   . TRP H 2 106 ? 13.417  -7.544  -13.233 1.00 30.89 ? 252 TRP H C   1 
ATOM 9554  O O   . TRP H 2 106 ? 14.575  -7.506  -12.826 1.00 31.45 ? 252 TRP H O   1 
ATOM 9555  C CB  . TRP H 2 106 ? 13.512  -10.057 -13.163 1.00 31.85 ? 252 TRP H CB  1 
ATOM 9556  C CG  . TRP H 2 106 ? 13.202  -10.265 -11.727 1.00 34.31 ? 252 TRP H CG  1 
ATOM 9557  C CD1 . TRP H 2 106 ? 12.017  -10.684 -11.193 1.00 34.51 ? 252 TRP H CD1 1 
ATOM 9558  C CD2 . TRP H 2 106 ? 14.092  -10.065 -10.626 1.00 35.18 ? 252 TRP H CD2 1 
ATOM 9559  N NE1 . TRP H 2 106 ? 12.116  -10.759 -9.824  1.00 35.47 ? 252 TRP H NE1 1 
ATOM 9560  C CE2 . TRP H 2 106 ? 13.380  -10.385 -9.451  1.00 36.09 ? 252 TRP H CE2 1 
ATOM 9561  C CE3 . TRP H 2 106 ? 15.425  -9.649  -10.519 1.00 35.86 ? 252 TRP H CE3 1 
ATOM 9562  C CZ2 . TRP H 2 106 ? 13.959  -10.303 -8.180  1.00 38.41 ? 252 TRP H CZ2 1 
ATOM 9563  C CZ3 . TRP H 2 106 ? 15.999  -9.566  -9.260  1.00 36.81 ? 252 TRP H CZ3 1 
ATOM 9564  C CH2 . TRP H 2 106 ? 15.266  -9.892  -8.106  1.00 38.16 ? 252 TRP H CH2 1 
ATOM 9565  N N   . PRO H 2 107 ? 12.621  -6.466  -13.192 1.00 31.24 ? 253 PRO H N   1 
ATOM 9566  C CA  . PRO H 2 107 ? 13.098  -5.172  -12.703 1.00 31.88 ? 253 PRO H CA  1 
ATOM 9567  C C   . PRO H 2 107 ? 13.159  -5.027  -11.184 1.00 33.52 ? 253 PRO H C   1 
ATOM 9568  O O   . PRO H 2 107 ? 12.385  -4.274  -10.583 1.00 34.75 ? 253 PRO H O   1 
ATOM 9569  C CB  . PRO H 2 107 ? 12.117  -4.202  -13.349 1.00 30.52 ? 253 PRO H CB  1 
ATOM 9570  C CG  . PRO H 2 107 ? 10.829  -4.953  -13.210 1.00 30.61 ? 253 PRO H CG  1 
ATOM 9571  C CD  . PRO H 2 107 ? 11.192  -6.394  -13.550 1.00 30.67 ? 253 PRO H CD  1 
ATOM 9572  N N   . HIS H 2 108 ? 14.085  -5.742  -10.560 1.00 34.12 ? 254 HIS H N   1 
ATOM 9573  C CA  . HIS H 2 108 ? 14.228  -5.672  -9.112  1.00 34.76 ? 254 HIS H CA  1 
ATOM 9574  C C   . HIS H 2 108 ? 15.678  -5.627  -8.729  1.00 33.68 ? 254 HIS H C   1 
ATOM 9575  O O   . HIS H 2 108 ? 16.548  -5.996  -9.511  1.00 34.67 ? 254 HIS H O   1 
ATOM 9576  C CB  . HIS H 2 108 ? 13.628  -6.897  -8.415  1.00 36.53 ? 254 HIS H CB  1 
ATOM 9577  C CG  . HIS H 2 108 ? 12.153  -7.067  -8.606  1.00 38.21 ? 254 HIS H CG  1 
ATOM 9578  N ND1 . HIS H 2 108 ? 11.611  -7.684  -9.715  1.00 38.81 ? 254 HIS H ND1 1 
ATOM 9579  C CD2 . HIS H 2 108 ? 11.114  -6.770  -7.792  1.00 39.15 ? 254 HIS H CD2 1 
ATOM 9580  C CE1 . HIS H 2 108 ? 10.301  -7.767  -9.571  1.00 39.71 ? 254 HIS H CE1 1 
ATOM 9581  N NE2 . HIS H 2 108 ? 9.972   -7.222  -8.412  1.00 41.29 ? 254 HIS H NE2 1 
ATOM 9582  N N   . ARG H 2 109 ? 15.929  -5.191  -7.504  1.00 32.83 ? 255 ARG H N   1 
ATOM 9583  C CA  . ARG H 2 109 ? 17.286  -5.139  -6.986  1.00 32.06 ? 255 ARG H CA  1 
ATOM 9584  C C   . ARG H 2 109 ? 17.663  -6.602  -6.754  1.00 30.13 ? 255 ARG H C   1 
ATOM 9585  O O   . ARG H 2 109 ? 16.795  -7.465  -6.737  1.00 29.82 ? 255 ARG H O   1 
ATOM 9586  C CB  . ARG H 2 109 ? 17.346  -4.338  -5.671  1.00 34.02 ? 255 ARG H CB  1 
ATOM 9587  C CG  . ARG H 2 109 ? 16.511  -4.892  -4.537  1.00 36.78 ? 255 ARG H CG  1 
ATOM 9588  C CD  . ARG H 2 109 ? 16.739  -4.110  -3.247  1.00 40.75 ? 255 ARG H CD  1 
ATOM 9589  N NE  . ARG H 2 109 ? 16.273  -4.861  -2.078  1.00 45.47 ? 255 ARG H NE  1 
ATOM 9590  C CZ  . ARG H 2 109 ? 15.002  -4.949  -1.687  1.00 47.39 ? 255 ARG H CZ  1 
ATOM 9591  N NH1 . ARG H 2 109 ? 14.048  -4.314  -2.364  1.00 48.57 ? 255 ARG H NH1 1 
ATOM 9592  N NH2 . ARG H 2 109 ? 14.678  -5.711  -0.645  1.00 47.38 ? 255 ARG H NH2 1 
ATOM 9593  N N   . PRO H 2 110 ? 18.959  -6.902  -6.578  1.00 29.36 ? 256 PRO H N   1 
ATOM 9594  C CA  . PRO H 2 110 ? 19.345  -8.296  -6.363  1.00 28.90 ? 256 PRO H CA  1 
ATOM 9595  C C   . PRO H 2 110 ? 18.630  -8.939  -5.180  1.00 28.94 ? 256 PRO H C   1 
ATOM 9596  O O   . PRO H 2 110 ? 18.308  -8.274  -4.190  1.00 28.85 ? 256 PRO H O   1 
ATOM 9597  C CB  . PRO H 2 110 ? 20.858  -8.209  -6.139  1.00 28.55 ? 256 PRO H CB  1 
ATOM 9598  C CG  . PRO H 2 110 ? 21.249  -6.951  -6.831  1.00 27.65 ? 256 PRO H CG  1 
ATOM 9599  C CD  . PRO H 2 110 ? 20.136  -6.024  -6.444  1.00 29.32 ? 256 PRO H CD  1 
ATOM 9600  N N   . ILE H 2 111 ? 18.379  -10.238 -5.292  1.00 28.54 ? 257 ILE H N   1 
ATOM 9601  C CA  . ILE H 2 111 ? 17.733  -10.984 -4.222  1.00 27.80 ? 257 ILE H CA  1 
ATOM 9602  C C   . ILE H 2 111 ? 18.663  -12.126 -3.780  1.00 27.59 ? 257 ILE H C   1 
ATOM 9603  O O   . ILE H 2 111 ? 19.181  -12.875 -4.608  1.00 28.48 ? 257 ILE H O   1 
ATOM 9604  C CB  . ILE H 2 111 ? 16.341  -11.550 -4.677  1.00 28.07 ? 257 ILE H CB  1 
ATOM 9605  C CG1 . ILE H 2 111 ? 15.714  -12.377 -3.549  1.00 28.79 ? 257 ILE H CG1 1 
ATOM 9606  C CG2 . ILE H 2 111 ? 16.485  -12.429 -5.906  1.00 26.78 ? 257 ILE H CG2 1 
ATOM 9607  C CD1 . ILE H 2 111 ? 14.256  -12.700 -3.766  1.00 28.43 ? 257 ILE H CD1 1 
ATOM 9608  N N   . LEU H 2 112 ? 18.904  -12.239 -2.480  1.00 27.24 ? 258 LEU H N   1 
ATOM 9609  C CA  . LEU H 2 112 ? 19.763  -13.298 -1.967  1.00 26.74 ? 258 LEU H CA  1 
ATOM 9610  C C   . LEU H 2 112 ? 18.900  -14.388 -1.334  1.00 27.62 ? 258 LEU H C   1 
ATOM 9611  O O   . LEU H 2 112 ? 17.758  -14.139 -0.942  1.00 27.57 ? 258 LEU H O   1 
ATOM 9612  C CB  . LEU H 2 112 ? 20.746  -12.750 -0.926  1.00 26.18 ? 258 LEU H CB  1 
ATOM 9613  C CG  . LEU H 2 112 ? 21.392  -11.385 -1.178  1.00 25.86 ? 258 LEU H CG  1 
ATOM 9614  C CD1 . LEU H 2 112 ? 22.419  -11.124 -0.103  1.00 25.68 ? 258 LEU H CD1 1 
ATOM 9615  C CD2 . LEU H 2 112 ? 22.036  -11.341 -2.533  1.00 27.39 ? 258 LEU H CD2 1 
ATOM 9616  N N   . GLN H 2 113 ? 19.457  -15.592 -1.239  1.00 28.82 ? 259 GLN H N   1 
ATOM 9617  C CA  . GLN H 2 113 ? 18.768  -16.741 -0.673  1.00 28.64 ? 259 GLN H CA  1 
ATOM 9618  C C   . GLN H 2 113 ? 18.720  -16.654 0.849   1.00 28.96 ? 259 GLN H C   1 
ATOM 9619  O O   . GLN H 2 113 ? 19.735  -16.412 1.493   1.00 29.84 ? 259 GLN H O   1 
ATOM 9620  C CB  . GLN H 2 113 ? 19.499  -18.005 -1.113  1.00 30.27 ? 259 GLN H CB  1 
ATOM 9621  C CG  . GLN H 2 113 ? 18.873  -19.320 -0.680  1.00 33.63 ? 259 GLN H CG  1 
ATOM 9622  C CD  . GLN H 2 113 ? 19.718  -20.532 -1.076  1.00 33.47 ? 259 GLN H CD  1 
ATOM 9623  O OE1 . GLN H 2 113 ? 19.993  -20.762 -2.257  1.00 31.56 ? 259 GLN H OE1 1 
ATOM 9624  N NE2 . GLN H 2 113 ? 20.133  -21.311 -0.077  1.00 34.57 ? 259 GLN H NE2 1 
ATOM 9625  N N   . ALA H 2 114 ? 17.535  -16.854 1.420   1.00 29.02 ? 260 ALA H N   1 
ATOM 9626  C CA  . ALA H 2 114 ? 17.351  -16.793 2.869   1.00 28.54 ? 260 ALA H CA  1 
ATOM 9627  C C   . ALA H 2 114 ? 18.278  -17.775 3.586   1.00 28.78 ? 260 ALA H C   1 
ATOM 9628  O O   . ALA H 2 114 ? 18.428  -18.911 3.162   1.00 28.44 ? 260 ALA H O   1 
ATOM 9629  C CB  . ALA H 2 114 ? 15.893  -17.101 3.219   1.00 25.55 ? 260 ALA H CB  1 
ATOM 9630  N N   . GLY H 2 115 ? 18.898  -17.332 4.672   1.00 29.54 ? 261 GLY H N   1 
ATOM 9631  C CA  . GLY H 2 115 ? 19.773  -18.215 5.419   1.00 31.14 ? 261 GLY H CA  1 
ATOM 9632  C C   . GLY H 2 115 ? 21.250  -18.140 5.051   1.00 32.65 ? 261 GLY H C   1 
ATOM 9633  O O   . GLY H 2 115 ? 22.101  -18.618 5.809   1.00 34.09 ? 261 GLY H O   1 
ATOM 9634  N N   . LEU H 2 116 ? 21.569  -17.572 3.891   1.00 31.66 ? 262 LEU H N   1 
ATOM 9635  C CA  . LEU H 2 116 ? 22.963  -17.438 3.491   1.00 31.63 ? 262 LEU H CA  1 
ATOM 9636  C C   . LEU H 2 116 ? 23.331  -15.964 3.412   1.00 31.90 ? 262 LEU H C   1 
ATOM 9637  O O   . LEU H 2 116 ? 22.556  -15.146 2.915   1.00 32.04 ? 262 LEU H O   1 
ATOM 9638  C CB  . LEU H 2 116 ? 23.229  -18.074 2.122   1.00 31.96 ? 262 LEU H CB  1 
ATOM 9639  C CG  . LEU H 2 116 ? 23.068  -19.580 1.920   1.00 32.27 ? 262 LEU H CG  1 
ATOM 9640  C CD1 . LEU H 2 116 ? 23.336  -19.925 0.470   1.00 29.66 ? 262 LEU H CD1 1 
ATOM 9641  C CD2 . LEU H 2 116 ? 24.005  -20.329 2.836   1.00 32.37 ? 262 LEU H CD2 1 
ATOM 9642  N N   . PRO H 2 117 ? 24.524  -15.609 3.908   1.00 31.99 ? 263 PRO H N   1 
ATOM 9643  C CA  . PRO H 2 117 ? 25.436  -16.582 4.505   1.00 33.00 ? 263 PRO H CA  1 
ATOM 9644  C C   . PRO H 2 117 ? 24.973  -17.048 5.899   1.00 33.84 ? 263 PRO H C   1 
ATOM 9645  O O   . PRO H 2 117 ? 24.243  -16.345 6.593   1.00 33.95 ? 263 PRO H O   1 
ATOM 9646  C CB  . PRO H 2 117 ? 26.764  -15.826 4.526   1.00 32.29 ? 263 PRO H CB  1 
ATOM 9647  C CG  . PRO H 2 117 ? 26.346  -14.450 4.752   1.00 31.88 ? 263 PRO H CG  1 
ATOM 9648  C CD  . PRO H 2 117 ? 25.186  -14.305 3.781   1.00 32.23 ? 263 PRO H CD  1 
ATOM 9649  N N   . ALA H 2 118 ? 25.393  -18.247 6.287   1.00 34.63 ? 264 ALA H N   1 
ATOM 9650  C CA  . ALA H 2 118 ? 25.019  -18.813 7.573   1.00 35.34 ? 264 ALA H CA  1 
ATOM 9651  C C   . ALA H 2 118 ? 26.030  -18.469 8.657   1.00 36.65 ? 264 ALA H C   1 
ATOM 9652  O O   . ALA H 2 118 ? 27.209  -18.239 8.373   1.00 37.02 ? 264 ALA H O   1 
ATOM 9653  C CB  . ALA H 2 118 ? 24.898  -20.322 7.447   1.00 33.47 ? 264 ALA H CB  1 
ATOM 9654  N N   . ASN H 2 119 ? 25.567  -18.430 9.903   1.00 38.19 ? 265 ASN H N   1 
ATOM 9655  C CA  . ASN H 2 119 ? 26.461  -18.156 11.015  1.00 39.42 ? 265 ASN H CA  1 
ATOM 9656  C C   . ASN H 2 119 ? 27.478  -19.292 11.052  1.00 41.51 ? 265 ASN H C   1 
ATOM 9657  O O   . ASN H 2 119 ? 27.182  -20.415 10.630  1.00 41.37 ? 265 ASN H O   1 
ATOM 9658  C CB  . ASN H 2 119 ? 25.696  -18.110 12.332  1.00 37.07 ? 265 ASN H CB  1 
ATOM 9659  C CG  . ASN H 2 119 ? 24.841  -16.883 12.459  1.00 35.72 ? 265 ASN H CG  1 
ATOM 9660  O OD1 . ASN H 2 119 ? 25.302  -15.768 12.268  1.00 34.80 ? 265 ASN H OD1 1 
ATOM 9661  N ND2 . ASN H 2 119 ? 23.583  -17.081 12.796  1.00 37.30 ? 265 ASN H ND2 1 
ATOM 9662  N N   . ALA H 2 120 ? 28.677  -18.999 11.549  1.00 43.90 ? 266 ALA H N   1 
ATOM 9663  C CA  . ALA H 2 120 ? 29.734  -20.003 11.616  1.00 45.05 ? 266 ALA H CA  1 
ATOM 9664  C C   . ALA H 2 120 ? 30.470  -19.945 12.933  1.00 45.77 ? 266 ALA H C   1 
ATOM 9665  O O   . ALA H 2 120 ? 30.628  -18.883 13.524  1.00 45.16 ? 266 ALA H O   1 
ATOM 9666  C CB  . ALA H 2 120 ? 30.719  -19.806 10.468  1.00 43.65 ? 266 ALA H CB  1 
ATOM 9667  N N   . SER H 2 121 ? 30.930  -21.103 13.382  1.00 48.05 ? 267 SER H N   1 
ATOM 9668  C CA  . SER H 2 121 ? 31.665  -21.185 14.631  1.00 49.98 ? 267 SER H CA  1 
ATOM 9669  C C   . SER H 2 121 ? 32.916  -22.037 14.422  1.00 51.21 ? 267 SER H C   1 
ATOM 9670  O O   . SER H 2 121 ? 32.931  -22.949 13.587  1.00 51.15 ? 267 SER H O   1 
ATOM 9671  C CB  . SER H 2 121 ? 30.768  -21.779 15.717  1.00 49.69 ? 267 SER H CB  1 
ATOM 9672  O OG  . SER H 2 121 ? 31.293  -21.537 17.009  1.00 50.91 ? 267 SER H OG  1 
ATOM 9673  N N   . THR H 2 122 ? 33.972  -21.720 15.165  1.00 52.65 ? 268 THR H N   1 
ATOM 9674  C CA  . THR H 2 122 ? 35.220  -22.460 15.047  1.00 54.15 ? 268 THR H CA  1 
ATOM 9675  C C   . THR H 2 122 ? 36.240  -22.048 16.101  1.00 54.68 ? 268 THR H C   1 
ATOM 9676  O O   . THR H 2 122 ? 36.212  -20.927 16.593  1.00 55.03 ? 268 THR H O   1 
ATOM 9677  C CB  . THR H 2 122 ? 35.847  -22.248 13.659  1.00 53.74 ? 268 THR H CB  1 
ATOM 9678  O OG1 . THR H 2 122 ? 37.074  -22.979 13.577  1.00 54.65 ? 268 THR H OG1 1 
ATOM 9679  C CG2 . THR H 2 122 ? 36.133  -20.773 13.422  1.00 54.15 ? 268 THR H CG2 1 
ATOM 9680  N N   . VAL H 2 123 ? 37.139  -22.967 16.440  1.00 55.53 ? 269 VAL H N   1 
ATOM 9681  C CA  . VAL H 2 123 ? 38.194  -22.704 17.410  1.00 55.17 ? 269 VAL H CA  1 
ATOM 9682  C C   . VAL H 2 123 ? 39.335  -22.068 16.628  1.00 54.83 ? 269 VAL H C   1 
ATOM 9683  O O   . VAL H 2 123 ? 39.513  -22.360 15.448  1.00 53.87 ? 269 VAL H O   1 
ATOM 9684  C CB  . VAL H 2 123 ? 38.701  -24.010 18.065  1.00 53.85 ? 269 VAL H CB  1 
ATOM 9685  N N   . VAL H 2 124 ? 40.086  -21.188 17.279  1.00 55.50 ? 270 VAL H N   1 
ATOM 9686  C CA  . VAL H 2 124 ? 41.215  -20.518 16.641  1.00 56.93 ? 270 VAL H CA  1 
ATOM 9687  C C   . VAL H 2 124 ? 42.000  -21.492 15.763  1.00 57.86 ? 270 VAL H C   1 
ATOM 9688  O O   . VAL H 2 124 ? 42.081  -22.682 16.065  1.00 58.47 ? 270 VAL H O   1 
ATOM 9689  C CB  . VAL H 2 124 ? 42.193  -19.965 17.691  1.00 56.10 ? 270 VAL H CB  1 
ATOM 9690  C CG1 . VAL H 2 124 ? 41.595  -18.780 18.401  1.00 56.15 ? 270 VAL H CG1 1 
ATOM 9691  C CG2 . VAL H 2 124 ? 42.526  -21.057 18.686  1.00 56.18 ? 270 VAL H CG2 1 
ATOM 9692  N N   . GLY H 2 125 ? 42.579  -20.983 14.681  1.00 58.28 ? 271 GLY H N   1 
ATOM 9693  C CA  . GLY H 2 125 ? 43.358  -21.829 13.795  1.00 58.74 ? 271 GLY H CA  1 
ATOM 9694  C C   . GLY H 2 125 ? 42.529  -22.612 12.800  1.00 58.85 ? 271 GLY H C   1 
ATOM 9695  O O   . GLY H 2 125 ? 43.062  -23.164 11.834  1.00 59.51 ? 271 GLY H O   1 
ATOM 9696  N N   . GLY H 2 126 ? 41.221  -22.661 13.033  1.00 58.87 ? 272 GLY H N   1 
ATOM 9697  C CA  . GLY H 2 126 ? 40.333  -23.383 12.141  1.00 58.43 ? 272 GLY H CA  1 
ATOM 9698  C C   . GLY H 2 126 ? 39.995  -22.639 10.860  1.00 58.29 ? 272 GLY H C   1 
ATOM 9699  O O   . GLY H 2 126 ? 40.223  -21.436 10.730  1.00 57.82 ? 272 GLY H O   1 
ATOM 9700  N N   . ASP H 2 127 ? 39.458  -23.375 9.897   1.00 58.18 ? 273 ASP H N   1 
ATOM 9701  C CA  . ASP H 2 127 ? 39.071  -22.791 8.627   1.00 57.88 ? 273 ASP H CA  1 
ATOM 9702  C C   . ASP H 2 127 ? 37.550  -22.634 8.602   1.00 56.89 ? 273 ASP H C   1 
ATOM 9703  O O   . ASP H 2 127 ? 36.840  -23.307 9.349   1.00 56.44 ? 273 ASP H O   1 
ATOM 9704  C CB  . ASP H 2 127 ? 39.595  -23.659 7.478   1.00 58.62 ? 273 ASP H CB  1 
ATOM 9705  C CG  . ASP H 2 127 ? 41.033  -23.300 7.096   1.00 60.71 ? 273 ASP H CG  1 
ATOM 9706  O OD1 . ASP H 2 127 ? 41.743  -22.735 7.964   1.00 60.70 ? 273 ASP H OD1 1 
ATOM 9707  O OD2 . ASP H 2 127 ? 41.455  -23.578 5.943   1.00 61.50 ? 273 ASP H OD2 1 
ATOM 9708  N N   . VAL H 2 128 ? 37.050  -21.726 7.771   1.00 55.32 ? 274 VAL H N   1 
ATOM 9709  C CA  . VAL H 2 128 ? 35.615  -21.495 7.715   1.00 53.27 ? 274 VAL H CA  1 
ATOM 9710  C C   . VAL H 2 128 ? 35.215  -20.766 6.437   1.00 52.06 ? 274 VAL H C   1 
ATOM 9711  O O   . VAL H 2 128 ? 36.036  -20.114 5.803   1.00 53.13 ? 274 VAL H O   1 
ATOM 9712  C CB  . VAL H 2 128 ? 35.168  -20.694 8.946   1.00 52.84 ? 274 VAL H CB  1 
ATOM 9713  C CG1 . VAL H 2 128 ? 35.530  -19.234 8.783   1.00 52.01 ? 274 VAL H CG1 1 
ATOM 9714  C CG2 . VAL H 2 128 ? 33.703  -20.886 9.174   1.00 53.65 ? 274 VAL H CG2 1 
ATOM 9715  N N   . GLU H 2 129 ? 33.955  -20.893 6.045   1.00 50.25 ? 275 GLU H N   1 
ATOM 9716  C CA  . GLU H 2 129 ? 33.488  -20.237 4.832   1.00 48.56 ? 275 GLU H CA  1 
ATOM 9717  C C   . GLU H 2 129 ? 32.067  -19.713 4.942   1.00 47.11 ? 275 GLU H C   1 
ATOM 9718  O O   . GLU H 2 129 ? 31.289  -20.122 5.810   1.00 46.54 ? 275 GLU H O   1 
ATOM 9719  C CB  . GLU H 2 129 ? 33.559  -21.190 3.645   1.00 48.30 ? 275 GLU H CB  1 
ATOM 9720  C CG  . GLU H 2 129 ? 32.833  -22.492 3.894   1.00 48.50 ? 275 GLU H CG  1 
ATOM 9721  C CD  . GLU H 2 129 ? 32.458  -23.211 2.622   1.00 48.67 ? 275 GLU H CD  1 
ATOM 9722  O OE1 . GLU H 2 129 ? 33.275  -23.225 1.677   1.00 50.04 ? 275 GLU H OE1 1 
ATOM 9723  O OE2 . GLU H 2 129 ? 31.348  -23.777 2.575   1.00 47.63 ? 275 GLU H OE2 1 
ATOM 9724  N N   . PHE H 2 130 ? 31.742  -18.804 4.031   1.00 44.95 ? 276 PHE H N   1 
ATOM 9725  C CA  . PHE H 2 130 ? 30.429  -18.193 3.971   1.00 42.55 ? 276 PHE H CA  1 
ATOM 9726  C C   . PHE H 2 130 ? 29.979  -18.226 2.524   1.00 41.43 ? 276 PHE H C   1 
ATOM 9727  O O   . PHE H 2 130 ? 30.668  -17.726 1.647   1.00 41.55 ? 276 PHE H O   1 
ATOM 9728  C CB  . PHE H 2 130 ? 30.504  -16.750 4.464   1.00 40.54 ? 276 PHE H CB  1 
ATOM 9729  C CG  . PHE H 2 130 ? 30.806  -16.628 5.927   1.00 39.64 ? 276 PHE H CG  1 
ATOM 9730  C CD1 . PHE H 2 130 ? 29.865  -17.012 6.875   1.00 39.32 ? 276 PHE H CD1 1 
ATOM 9731  C CD2 . PHE H 2 130 ? 32.036  -16.132 6.364   1.00 39.56 ? 276 PHE H CD2 1 
ATOM 9732  C CE1 . PHE H 2 130 ? 30.141  -16.905 8.237   1.00 39.36 ? 276 PHE H CE1 1 
ATOM 9733  C CE2 . PHE H 2 130 ? 32.323  -16.021 7.723   1.00 39.20 ? 276 PHE H CE2 1 
ATOM 9734  C CZ  . PHE H 2 130 ? 31.374  -16.408 8.663   1.00 39.32 ? 276 PHE H CZ  1 
ATOM 9735  N N   . VAL H 2 131 ? 28.826  -18.831 2.275   1.00 39.88 ? 277 VAL H N   1 
ATOM 9736  C CA  . VAL H 2 131 ? 28.294  -18.909 0.926   1.00 38.07 ? 277 VAL H CA  1 
ATOM 9737  C C   . VAL H 2 131 ? 27.171  -17.907 0.740   1.00 37.61 ? 277 VAL H C   1 
ATOM 9738  O O   . VAL H 2 131 ? 26.451  -17.560 1.678   1.00 38.57 ? 277 VAL H O   1 
ATOM 9739  C CB  . VAL H 2 131 ? 27.771  -20.316 0.614   1.00 37.86 ? 277 VAL H CB  1 
ATOM 9740  C CG1 . VAL H 2 131 ? 27.193  -20.363 -0.780  1.00 37.45 ? 277 VAL H CG1 1 
ATOM 9741  C CG2 . VAL H 2 131 ? 28.905  -21.307 0.739   1.00 37.11 ? 277 VAL H CG2 1 
ATOM 9742  N N   . CYS H 2 132 ? 27.019  -17.441 -0.485  1.00 36.73 ? 278 CYS H N   1 
ATOM 9743  C CA  . CYS H 2 132 ? 25.990  -16.470 -0.780  1.00 36.08 ? 278 CYS H CA  1 
ATOM 9744  C C   . CYS H 2 132 ? 25.407  -16.676 -2.174  1.00 36.24 ? 278 CYS H C   1 
ATOM 9745  O O   . CYS H 2 132 ? 26.109  -16.542 -3.178  1.00 37.31 ? 278 CYS H O   1 
ATOM 9746  C CB  . CYS H 2 132 ? 26.574  -15.070 -0.665  1.00 35.64 ? 278 CYS H CB  1 
ATOM 9747  S SG  . CYS H 2 132 ? 25.527  -13.865 -1.416  1.00 35.91 ? 278 CYS H SG  1 
ATOM 9748  N N   . LYS H 2 133 ? 24.120  -17.002 -2.231  1.00 35.69 ? 279 LYS H N   1 
ATOM 9749  C CA  . LYS H 2 133 ? 23.438  -17.216 -3.504  1.00 34.85 ? 279 LYS H CA  1 
ATOM 9750  C C   . LYS H 2 133 ? 22.652  -15.982 -3.925  1.00 33.40 ? 279 LYS H C   1 
ATOM 9751  O O   . LYS H 2 133 ? 21.725  -15.542 -3.242  1.00 32.86 ? 279 LYS H O   1 
ATOM 9752  C CB  . LYS H 2 133 ? 22.491  -18.416 -3.425  1.00 35.49 ? 279 LYS H CB  1 
ATOM 9753  C CG  . LYS H 2 133 ? 23.136  -19.724 -3.809  1.00 38.12 ? 279 LYS H CG  1 
ATOM 9754  C CD  . LYS H 2 133 ? 23.306  -19.835 -5.322  1.00 41.17 ? 279 LYS H CD  1 
ATOM 9755  C CE  . LYS H 2 133 ? 21.963  -20.027 -6.040  1.00 42.15 ? 279 LYS H CE  1 
ATOM 9756  N NZ  . LYS H 2 133 ? 22.122  -20.149 -7.525  1.00 40.69 ? 279 LYS H NZ  1 
ATOM 9757  N N   . VAL H 2 134 ? 23.021  -15.446 -5.076  1.00 31.75 ? 280 VAL H N   1 
ATOM 9758  C CA  . VAL H 2 134 ? 22.384  -14.252 -5.606  1.00 31.11 ? 280 VAL H CA  1 
ATOM 9759  C C   . VAL H 2 134 ? 21.638  -14.461 -6.929  1.00 30.18 ? 280 VAL H C   1 
ATOM 9760  O O   . VAL H 2 134 ? 22.082  -15.229 -7.792  1.00 30.26 ? 280 VAL H O   1 
ATOM 9761  C CB  . VAL H 2 134 ? 23.457  -13.154 -5.834  1.00 31.20 ? 280 VAL H CB  1 
ATOM 9762  C CG1 . VAL H 2 134 ? 22.815  -11.905 -6.405  1.00 29.28 ? 280 VAL H CG1 1 
ATOM 9763  C CG2 . VAL H 2 134 ? 24.196  -12.868 -4.528  1.00 29.98 ? 280 VAL H CG2 1 
ATOM 9764  N N   . TYR H 2 135 ? 20.502  -13.790 -7.079  1.00 29.49 ? 281 TYR H N   1 
ATOM 9765  C CA  . TYR H 2 135 ? 19.759  -13.847 -8.335  1.00 30.51 ? 281 TYR H CA  1 
ATOM 9766  C C   . TYR H 2 135 ? 19.423  -12.422 -8.739  1.00 28.85 ? 281 TYR H C   1 
ATOM 9767  O O   . TYR H 2 135 ? 18.969  -11.632 -7.918  1.00 28.68 ? 281 TYR H O   1 
ATOM 9768  C CB  . TYR H 2 135 ? 18.440  -14.627 -8.253  1.00 32.41 ? 281 TYR H CB  1 
ATOM 9769  C CG  . TYR H 2 135 ? 17.664  -14.536 -9.573  1.00 35.96 ? 281 TYR H CG  1 
ATOM 9770  C CD1 . TYR H 2 135 ? 18.065  -15.263 -10.702 1.00 37.29 ? 281 TYR H CD1 1 
ATOM 9771  C CD2 . TYR H 2 135 ? 16.577  -13.659 -9.717  1.00 37.62 ? 281 TYR H CD2 1 
ATOM 9772  C CE1 . TYR H 2 135 ? 17.405  -15.120 -11.942 1.00 37.61 ? 281 TYR H CE1 1 
ATOM 9773  C CE2 . TYR H 2 135 ? 15.914  -13.507 -10.954 1.00 37.67 ? 281 TYR H CE2 1 
ATOM 9774  C CZ  . TYR H 2 135 ? 16.334  -14.240 -12.056 1.00 37.88 ? 281 TYR H CZ  1 
ATOM 9775  O OH  . TYR H 2 135 ? 15.683  -14.095 -13.264 1.00 38.54 ? 281 TYR H OH  1 
ATOM 9776  N N   . SER H 2 136 ? 19.634  -12.103 -10.008 1.00 27.76 ? 282 SER H N   1 
ATOM 9777  C CA  . SER H 2 136 ? 19.366  -10.766 -10.524 1.00 26.99 ? 282 SER H CA  1 
ATOM 9778  C C   . SER H 2 136 ? 19.356  -10.788 -12.041 1.00 26.91 ? 282 SER H C   1 
ATOM 9779  O O   . SER H 2 136 ? 20.049  -11.589 -12.658 1.00 28.13 ? 282 SER H O   1 
ATOM 9780  C CB  . SER H 2 136 ? 20.446  -9.781  -10.048 1.00 26.95 ? 282 SER H CB  1 
ATOM 9781  O OG  . SER H 2 136 ? 20.238  -8.472  -10.569 1.00 22.46 ? 282 SER H OG  1 
ATOM 9782  N N   . ASP H 2 137 ? 18.563  -9.910  -12.636 1.00 26.82 ? 283 ASP H N   1 
ATOM 9783  C CA  . ASP H 2 137 ? 18.486  -9.810  -14.083 1.00 27.79 ? 283 ASP H CA  1 
ATOM 9784  C C   . ASP H 2 137 ? 19.631  -8.894  -14.487 1.00 28.33 ? 283 ASP H C   1 
ATOM 9785  O O   . ASP H 2 137 ? 20.608  -9.316  -15.112 1.00 29.14 ? 283 ASP H O   1 
ATOM 9786  C CB  . ASP H 2 137 ? 17.148  -9.193  -14.486 1.00 27.58 ? 283 ASP H CB  1 
ATOM 9787  C CG  . ASP H 2 137 ? 17.017  -8.997  -15.986 1.00 28.73 ? 283 ASP H CG  1 
ATOM 9788  O OD1 . ASP H 2 137 ? 15.867  -8.874  -16.460 1.00 27.98 ? 283 ASP H OD1 1 
ATOM 9789  O OD2 . ASP H 2 137 ? 18.055  -8.953  -16.692 1.00 30.12 ? 283 ASP H OD2 1 
ATOM 9790  N N   . ALA H 2 138 ? 19.496  -7.625  -14.130 1.00 29.23 ? 284 ALA H N   1 
ATOM 9791  C CA  . ALA H 2 138 ? 20.532  -6.648  -14.414 1.00 28.85 ? 284 ALA H CA  1 
ATOM 9792  C C   . ALA H 2 138 ? 21.766  -7.219  -13.733 1.00 29.20 ? 284 ALA H C   1 
ATOM 9793  O O   . ALA H 2 138 ? 21.657  -7.848  -12.686 1.00 30.58 ? 284 ALA H O   1 
ATOM 9794  C CB  . ALA H 2 138 ? 20.161  -5.316  -13.797 1.00 28.05 ? 284 ALA H CB  1 
ATOM 9795  N N   . GLN H 2 139 ? 22.935  -7.020  -14.324 1.00 29.34 ? 285 GLN H N   1 
ATOM 9796  C CA  . GLN H 2 139 ? 24.168  -7.537  -13.755 1.00 28.43 ? 285 GLN H CA  1 
ATOM 9797  C C   . GLN H 2 139 ? 24.350  -7.075  -12.322 1.00 27.47 ? 285 GLN H C   1 
ATOM 9798  O O   . GLN H 2 139 ? 24.326  -5.878  -12.048 1.00 28.28 ? 285 GLN H O   1 
ATOM 9799  C CB  . GLN H 2 139 ? 25.357  -7.067  -14.593 1.00 28.85 ? 285 GLN H CB  1 
ATOM 9800  C CG  . GLN H 2 139 ? 25.531  -7.903  -15.823 1.00 32.05 ? 285 GLN H CG  1 
ATOM 9801  C CD  . GLN H 2 139 ? 25.753  -9.355  -15.469 1.00 31.64 ? 285 GLN H CD  1 
ATOM 9802  O OE1 . GLN H 2 139 ? 25.090  -10.250 -15.989 1.00 32.69 ? 285 GLN H OE1 1 
ATOM 9803  N NE2 . GLN H 2 139 ? 26.693  -9.594  -14.571 1.00 32.48 ? 285 GLN H NE2 1 
ATOM 9804  N N   . PRO H 2 140 ? 24.537  -8.017  -11.381 1.00 26.46 ? 286 PRO H N   1 
ATOM 9805  C CA  . PRO H 2 140 ? 24.727  -7.644  -9.978  1.00 26.23 ? 286 PRO H CA  1 
ATOM 9806  C C   . PRO H 2 140 ? 26.202  -7.534  -9.600  1.00 26.62 ? 286 PRO H C   1 
ATOM 9807  O O   . PRO H 2 140 ? 27.068  -8.179  -10.210 1.00 25.57 ? 286 PRO H O   1 
ATOM 9808  C CB  . PRO H 2 140 ? 24.069  -8.786  -9.244  1.00 25.49 ? 286 PRO H CB  1 
ATOM 9809  C CG  . PRO H 2 140 ? 24.552  -9.947  -10.061 1.00 24.84 ? 286 PRO H CG  1 
ATOM 9810  C CD  . PRO H 2 140 ? 24.315  -9.468  -11.491 1.00 26.03 ? 286 PRO H CD  1 
ATOM 9811  N N   . HIS H 2 141 ? 26.488  -6.700  -8.606  1.00 27.14 ? 287 HIS H N   1 
ATOM 9812  C CA  . HIS H 2 141 ? 27.851  -6.582  -8.130  1.00 27.30 ? 287 HIS H CA  1 
ATOM 9813  C C   . HIS H 2 141 ? 27.886  -7.074  -6.694  1.00 27.34 ? 287 HIS H C   1 
ATOM 9814  O O   . HIS H 2 141 ? 27.209  -6.551  -5.819  1.00 27.98 ? 287 HIS H O   1 
ATOM 9815  C CB  . HIS H 2 141 ? 28.400  -5.161  -8.202  1.00 26.05 ? 287 HIS H CB  1 
ATOM 9816  C CG  . HIS H 2 141 ? 29.788  -5.054  -7.645  1.00 27.66 ? 287 HIS H CG  1 
ATOM 9817  N ND1 . HIS H 2 141 ? 30.043  -4.620  -6.360  1.00 27.78 ? 287 HIS H ND1 1 
ATOM 9818  C CD2 . HIS H 2 141 ? 30.979  -5.459  -8.146  1.00 26.84 ? 287 HIS H CD2 1 
ATOM 9819  C CE1 . HIS H 2 141 ? 31.328  -4.767  -6.093  1.00 27.17 ? 287 HIS H CE1 1 
ATOM 9820  N NE2 . HIS H 2 141 ? 31.920  -5.275  -7.160  1.00 27.48 ? 287 HIS H NE2 1 
ATOM 9821  N N   . ILE H 2 142 ? 28.688  -8.097  -6.461  1.00 28.45 ? 288 ILE H N   1 
ATOM 9822  C CA  . ILE H 2 142 ? 28.790  -8.688  -5.140  1.00 28.96 ? 288 ILE H CA  1 
ATOM 9823  C C   . ILE H 2 142 ? 30.132  -8.445  -4.458  1.00 29.78 ? 288 ILE H C   1 
ATOM 9824  O O   . ILE H 2 142 ? 31.187  -8.503  -5.086  1.00 29.28 ? 288 ILE H O   1 
ATOM 9825  C CB  . ILE H 2 142 ? 28.578  -10.203 -5.226  1.00 27.49 ? 288 ILE H CB  1 
ATOM 9826  C CG1 . ILE H 2 142 ? 27.392  -10.494 -6.149  1.00 28.08 ? 288 ILE H CG1 1 
ATOM 9827  C CG2 . ILE H 2 142 ? 28.359  -10.764 -3.840  1.00 27.25 ? 288 ILE H CG2 1 
ATOM 9828  C CD1 . ILE H 2 142 ? 27.041  -11.967 -6.290  1.00 28.14 ? 288 ILE H CD1 1 
ATOM 9829  N N   . GLN H 2 143 ? 30.077  -8.175  -3.165  1.00 30.41 ? 289 GLN H N   1 
ATOM 9830  C CA  . GLN H 2 143 ? 31.279  -7.971  -2.392  1.00 31.71 ? 289 GLN H CA  1 
ATOM 9831  C C   . GLN H 2 143 ? 31.014  -8.471  -0.990  1.00 32.50 ? 289 GLN H C   1 
ATOM 9832  O O   . GLN H 2 143 ? 29.870  -8.507  -0.547  1.00 32.52 ? 289 GLN H O   1 
ATOM 9833  C CB  . GLN H 2 143 ? 31.659  -6.501  -2.355  1.00 32.00 ? 289 GLN H CB  1 
ATOM 9834  C CG  . GLN H 2 143 ? 30.666  -5.622  -1.657  1.00 32.03 ? 289 GLN H CG  1 
ATOM 9835  C CD  . GLN H 2 143 ? 31.046  -4.173  -1.777  1.00 33.31 ? 289 GLN H CD  1 
ATOM 9836  O OE1 . GLN H 2 143 ? 32.122  -3.765  -1.339  1.00 35.32 ? 289 GLN H OE1 1 
ATOM 9837  N NE2 . GLN H 2 143 ? 30.175  -3.383  -2.383  1.00 32.77 ? 289 GLN H NE2 1 
ATOM 9838  N N   . TRP H 2 144 ? 32.073  -8.891  -0.310  1.00 33.41 ? 290 TRP H N   1 
ATOM 9839  C CA  . TRP H 2 144 ? 31.965  -9.379  1.054   1.00 33.78 ? 290 TRP H CA  1 
ATOM 9840  C C   . TRP H 2 144 ? 32.503  -8.302  1.967   1.00 35.11 ? 290 TRP H C   1 
ATOM 9841  O O   . TRP H 2 144 ? 33.551  -7.730  1.702   1.00 35.26 ? 290 TRP H O   1 
ATOM 9842  C CB  . TRP H 2 144 ? 32.779  -10.654 1.235   1.00 31.73 ? 290 TRP H CB  1 
ATOM 9843  C CG  . TRP H 2 144 ? 32.199  -11.849 0.537   1.00 29.78 ? 290 TRP H CG  1 
ATOM 9844  C CD1 . TRP H 2 144 ? 32.475  -12.273 -0.724  1.00 29.30 ? 290 TRP H CD1 1 
ATOM 9845  C CD2 . TRP H 2 144 ? 31.241  -12.777 1.074   1.00 28.80 ? 290 TRP H CD2 1 
ATOM 9846  N NE1 . TRP H 2 144 ? 31.756  -13.411 -1.014  1.00 28.48 ? 290 TRP H NE1 1 
ATOM 9847  C CE2 . TRP H 2 144 ? 30.990  -13.745 0.071   1.00 28.23 ? 290 TRP H CE2 1 
ATOM 9848  C CE3 . TRP H 2 144 ? 30.575  -12.887 2.305   1.00 27.29 ? 290 TRP H CE3 1 
ATOM 9849  C CZ2 . TRP H 2 144 ? 30.099  -14.814 0.259   1.00 26.84 ? 290 TRP H CZ2 1 
ATOM 9850  C CZ3 . TRP H 2 144 ? 29.689  -13.953 2.493   1.00 25.84 ? 290 TRP H CZ3 1 
ATOM 9851  C CH2 . TRP H 2 144 ? 29.464  -14.899 1.474   1.00 26.46 ? 290 TRP H CH2 1 
ATOM 9852  N N   . ILE H 2 145 ? 31.785  -8.030  3.046   1.00 36.93 ? 291 ILE H N   1 
ATOM 9853  C CA  . ILE H 2 145 ? 32.196  -6.995  3.976   1.00 38.55 ? 291 ILE H CA  1 
ATOM 9854  C C   . ILE H 2 145 ? 32.195  -7.485  5.425   1.00 39.72 ? 291 ILE H C   1 
ATOM 9855  O O   . ILE H 2 145 ? 31.277  -8.188  5.851   1.00 40.18 ? 291 ILE H O   1 
ATOM 9856  C CB  . ILE H 2 145 ? 31.257  -5.764  3.840   1.00 37.60 ? 291 ILE H CB  1 
ATOM 9857  C CG1 . ILE H 2 145 ? 31.178  -5.335  2.372   1.00 37.42 ? 291 ILE H CG1 1 
ATOM 9858  C CG2 . ILE H 2 145 ? 31.765  -4.613  4.697   1.00 37.66 ? 291 ILE H CG2 1 
ATOM 9859  C CD1 . ILE H 2 145 ? 30.182  -4.209  2.094   1.00 36.77 ? 291 ILE H CD1 1 
ATOM 9860  N N   . LYS H 2 146 ? 33.236  -7.130  6.171   1.00 40.66 ? 292 LYS H N   1 
ATOM 9861  C CA  . LYS H 2 146 ? 33.312  -7.504  7.574   1.00 42.33 ? 292 LYS H CA  1 
ATOM 9862  C C   . LYS H 2 146 ? 33.084  -6.222  8.351   1.00 44.35 ? 292 LYS H C   1 
ATOM 9863  O O   . LYS H 2 146 ? 33.556  -5.159  7.947   1.00 44.58 ? 292 LYS H O   1 
ATOM 9864  C CB  . LYS H 2 146 ? 34.685  -8.080  7.928   1.00 40.50 ? 292 LYS H CB  1 
ATOM 9865  N N   . HIS H 2 147 ? 32.332  -6.305  9.444   1.00 46.59 ? 293 HIS H N   1 
ATOM 9866  C CA  . HIS H 2 147 ? 32.084  -5.131  10.265  1.00 48.64 ? 293 HIS H CA  1 
ATOM 9867  C C   . HIS H 2 147 ? 33.276  -5.005  11.215  1.00 49.78 ? 293 HIS H C   1 
ATOM 9868  O O   . HIS H 2 147 ? 33.644  -5.969  11.897  1.00 49.70 ? 293 HIS H O   1 
ATOM 9869  C CB  . HIS H 2 147 ? 30.781  -5.302  11.043  1.00 50.63 ? 293 HIS H CB  1 
ATOM 9870  C CG  . HIS H 2 147 ? 29.558  -5.385  10.177  1.00 53.00 ? 293 HIS H CG  1 
ATOM 9871  N ND1 . HIS H 2 147 ? 28.754  -4.297  9.913   1.00 54.59 ? 293 HIS H ND1 1 
ATOM 9872  C CD2 . HIS H 2 147 ? 28.988  -6.432  9.533   1.00 54.17 ? 293 HIS H CD2 1 
ATOM 9873  C CE1 . HIS H 2 147 ? 27.740  -4.668  9.149   1.00 53.99 ? 293 HIS H CE1 1 
ATOM 9874  N NE2 . HIS H 2 147 ? 27.859  -5.961  8.905   1.00 54.58 ? 293 HIS H NE2 1 
ATOM 9875  N N   . VAL H 2 148 ? 33.894  -3.826  11.233  1.00 50.80 ? 294 VAL H N   1 
ATOM 9876  C CA  . VAL H 2 148 ? 35.056  -3.570  12.077  1.00 51.81 ? 294 VAL H CA  1 
ATOM 9877  C C   . VAL H 2 148 ? 34.855  -2.339  12.946  1.00 52.00 ? 294 VAL H C   1 
ATOM 9878  O O   . VAL H 2 148 ? 35.576  -2.139  13.925  1.00 53.44 ? 294 VAL H O   1 
ATOM 9879  C CB  . VAL H 2 148 ? 36.320  -3.322  11.240  1.00 52.48 ? 294 VAL H CB  1 
ATOM 9880  C CG1 . VAL H 2 148 ? 37.561  -3.540  12.107  1.00 53.13 ? 294 VAL H CG1 1 
ATOM 9881  C CG2 . VAL H 2 148 ? 36.338  -4.233  10.025  1.00 52.80 ? 294 VAL H CG2 1 
ATOM 9882  N N   . PRO H 2 161 ? 29.303  3.026   11.096  1.00 60.43 ? 307 PRO H N   1 
ATOM 9883  C CA  . PRO H 2 161 ? 29.562  1.596   10.891  1.00 59.91 ? 307 PRO H CA  1 
ATOM 9884  C C   . PRO H 2 161 ? 30.898  1.331   10.186  1.00 59.44 ? 307 PRO H C   1 
ATOM 9885  O O   . PRO H 2 161 ? 31.025  1.537   8.970   1.00 58.66 ? 307 PRO H O   1 
ATOM 9886  C CB  . PRO H 2 161 ? 28.363  1.151   10.057  1.00 59.80 ? 307 PRO H CB  1 
ATOM 9887  C CG  . PRO H 2 161 ? 28.120  2.347   9.196   1.00 60.37 ? 307 PRO H CG  1 
ATOM 9888  C CD  . PRO H 2 161 ? 28.241  3.499   10.187  1.00 59.96 ? 307 PRO H CD  1 
ATOM 9889  N N   . TYR H 2 162 ? 31.890  0.878   10.949  1.00 58.72 ? 308 TYR H N   1 
ATOM 9890  C CA  . TYR H 2 162 ? 33.206  0.595   10.384  1.00 57.48 ? 308 TYR H CA  1 
ATOM 9891  C C   . TYR H 2 162 ? 33.141  -0.682  9.550   1.00 56.50 ? 308 TYR H C   1 
ATOM 9892  O O   . TYR H 2 162 ? 32.992  -1.784  10.086  1.00 56.75 ? 308 TYR H O   1 
ATOM 9893  C CB  . TYR H 2 162 ? 34.246  0.450   11.501  1.00 57.94 ? 308 TYR H CB  1 
ATOM 9894  N N   . LEU H 2 163 ? 33.252  -0.523  8.233   1.00 54.88 ? 309 LEU H N   1 
ATOM 9895  C CA  . LEU H 2 163 ? 33.185  -1.651  7.304   1.00 52.69 ? 309 LEU H CA  1 
ATOM 9896  C C   . LEU H 2 163 ? 34.489  -1.884  6.534   1.00 51.12 ? 309 LEU H C   1 
ATOM 9897  O O   . LEU H 2 163 ? 35.214  -0.943  6.236   1.00 50.58 ? 309 LEU H O   1 
ATOM 9898  C CB  . LEU H 2 163 ? 32.048  -1.423  6.306   1.00 52.17 ? 309 LEU H CB  1 
ATOM 9899  C CG  . LEU H 2 163 ? 30.652  -1.145  6.870   1.00 52.01 ? 309 LEU H CG  1 
ATOM 9900  C CD1 . LEU H 2 163 ? 29.666  -1.010  5.724   1.00 50.88 ? 309 LEU H CD1 1 
ATOM 9901  C CD2 . LEU H 2 163 ? 30.229  -2.277  7.804   1.00 52.32 ? 309 LEU H CD2 1 
ATOM 9902  N N   . LYS H 2 164 ? 34.770  -3.140  6.206   1.00 49.33 ? 310 LYS H N   1 
ATOM 9903  C CA  . LYS H 2 164 ? 35.981  -3.485  5.471   1.00 48.13 ? 310 LYS H CA  1 
ATOM 9904  C C   . LYS H 2 164 ? 35.674  -4.449  4.322   1.00 46.97 ? 310 LYS H C   1 
ATOM 9905  O O   . LYS H 2 164 ? 35.153  -5.548  4.539   1.00 46.96 ? 310 LYS H O   1 
ATOM 9906  C CB  . LYS H 2 164 ? 37.011  -4.113  6.420   1.00 49.84 ? 310 LYS H CB  1 
ATOM 9907  C CG  . LYS H 2 164 ? 38.293  -4.609  5.749   1.00 50.38 ? 310 LYS H CG  1 
ATOM 9908  C CD  . LYS H 2 164 ? 39.275  -5.167  6.779   1.00 52.47 ? 310 LYS H CD  1 
ATOM 9909  C CE  . LYS H 2 164 ? 40.448  -5.890  6.113   1.00 53.70 ? 310 LYS H CE  1 
ATOM 9910  N NZ  . LYS H 2 164 ? 41.181  -5.008  5.139   1.00 54.13 ? 310 LYS H NZ  1 
ATOM 9911  N N   . VAL H 2 165 ? 35.998  -4.031  3.099   1.00 44.85 ? 311 VAL H N   1 
ATOM 9912  C CA  . VAL H 2 165 ? 35.757  -4.854  1.920   1.00 42.19 ? 311 VAL H CA  1 
ATOM 9913  C C   . VAL H 2 165 ? 36.818  -5.935  1.838   1.00 41.51 ? 311 VAL H C   1 
ATOM 9914  O O   . VAL H 2 165 ? 37.988  -5.652  1.599   1.00 41.72 ? 311 VAL H O   1 
ATOM 9915  C CB  . VAL H 2 165 ? 35.797  -4.016  0.614   1.00 41.30 ? 311 VAL H CB  1 
ATOM 9916  C CG1 . VAL H 2 165 ? 35.629  -4.922  -0.603  1.00 39.61 ? 311 VAL H CG1 1 
ATOM 9917  C CG2 . VAL H 2 165 ? 34.705  -2.960  0.640   1.00 39.99 ? 311 VAL H CG2 1 
ATOM 9918  N N   . LEU H 2 166 ? 36.397  -7.179  2.028   1.00 39.93 ? 312 LEU H N   1 
ATOM 9919  C CA  . LEU H 2 166 ? 37.311  -8.308  1.989   1.00 38.40 ? 312 LEU H CA  1 
ATOM 9920  C C   . LEU H 2 166 ? 37.439  -8.875  0.589   1.00 38.33 ? 312 LEU H C   1 
ATOM 9921  O O   . LEU H 2 166 ? 38.457  -9.478  0.238   1.00 38.23 ? 312 LEU H O   1 
ATOM 9922  C CB  . LEU H 2 166 ? 36.801  -9.414  2.905   1.00 36.62 ? 312 LEU H CB  1 
ATOM 9923  C CG  . LEU H 2 166 ? 36.475  -9.037  4.340   1.00 33.90 ? 312 LEU H CG  1 
ATOM 9924  C CD1 . LEU H 2 166 ? 35.905  -10.236 5.046   1.00 33.03 ? 312 LEU H CD1 1 
ATOM 9925  C CD2 . LEU H 2 166 ? 37.732  -8.557  5.037   1.00 32.39 ? 312 LEU H CD2 1 
ATOM 9926  N N   . LYS H 2 167 ? 36.404  -8.668  -0.213  1.00 38.04 ? 313 LYS H N   1 
ATOM 9927  C CA  . LYS H 2 167 ? 36.386  -9.226  -1.550  1.00 38.18 ? 313 LYS H CA  1 
ATOM 9928  C C   . LYS H 2 167 ? 35.311  -8.504  -2.353  1.00 38.15 ? 313 LYS H C   1 
ATOM 9929  O O   . LYS H 2 167 ? 34.227  -8.232  -1.837  1.00 38.50 ? 313 LYS H O   1 
ATOM 9930  C CB  . LYS H 2 167 ? 36.060  -10.712 -1.405  1.00 38.73 ? 313 LYS H CB  1 
ATOM 9931  C CG  . LYS H 2 167 ? 36.339  -11.612 -2.580  1.00 39.56 ? 313 LYS H CG  1 
ATOM 9932  C CD  . LYS H 2 167 ? 36.037  -13.057 -2.173  1.00 39.43 ? 313 LYS H CD  1 
ATOM 9933  C CE  . LYS H 2 167 ? 36.188  -14.020 -3.338  1.00 40.05 ? 313 LYS H CE  1 
ATOM 9934  N NZ  . LYS H 2 167 ? 36.037  -15.431 -2.894  1.00 38.35 ? 313 LYS H NZ  1 
ATOM 9935  N N   . ALA H 2 168 ? 35.614  -8.179  -3.606  1.00 37.66 ? 314 ALA H N   1 
ATOM 9936  C CA  . ALA H 2 168 ? 34.659  -7.487  -4.468  1.00 36.64 ? 314 ALA H CA  1 
ATOM 9937  C C   . ALA H 2 168 ? 34.794  -7.963  -5.900  1.00 35.75 ? 314 ALA H C   1 
ATOM 9938  O O   . ALA H 2 168 ? 35.885  -8.013  -6.452  1.00 34.76 ? 314 ALA H O   1 
ATOM 9939  C CB  . ALA H 2 168 ? 34.863  -5.982  -4.407  1.00 35.52 ? 314 ALA H CB  1 
ATOM 9940  N N   . ALA H 2 169 ? 33.662  -8.319  -6.492  1.00 36.51 ? 315 ALA H N   1 
ATOM 9941  C CA  . ALA H 2 169 ? 33.628  -8.795  -7.859  1.00 36.60 ? 315 ALA H CA  1 
ATOM 9942  C C   . ALA H 2 169 ? 34.215  -7.760  -8.811  1.00 37.38 ? 315 ALA H C   1 
ATOM 9943  O O   . ALA H 2 169 ? 34.223  -6.559  -8.531  1.00 36.79 ? 315 ALA H O   1 
ATOM 9944  C CB  . ALA H 2 169 ? 32.202  -9.131  -8.257  1.00 36.33 ? 315 ALA H CB  1 
ATOM 9945  N N   . GLY H 2 170 ? 34.712  -8.247  -9.941  1.00 38.05 ? 316 GLY H N   1 
ATOM 9946  C CA  . GLY H 2 170 ? 35.303  -7.383  -10.941 1.00 38.67 ? 316 GLY H CA  1 
ATOM 9947  C C   . GLY H 2 170 ? 36.033  -8.249  -11.943 1.00 40.08 ? 316 GLY H C   1 
ATOM 9948  O O   . GLY H 2 170 ? 35.972  -9.484  -11.865 1.00 40.67 ? 316 GLY H O   1 
ATOM 9949  N N   . VAL H 2 171 ? 36.722  -7.619  -12.890 1.00 40.83 ? 317 VAL H N   1 
ATOM 9950  C CA  . VAL H 2 171 ? 37.467  -8.376  -13.892 1.00 41.23 ? 317 VAL H CA  1 
ATOM 9951  C C   . VAL H 2 171 ? 38.523  -9.263  -13.254 1.00 42.33 ? 317 VAL H C   1 
ATOM 9952  O O   . VAL H 2 171 ? 38.855  -10.304 -13.795 1.00 41.86 ? 317 VAL H O   1 
ATOM 9953  C CB  . VAL H 2 171 ? 38.146  -7.464  -14.915 1.00 39.53 ? 317 VAL H CB  1 
ATOM 9954  C CG1 . VAL H 2 171 ? 37.168  -7.134  -16.031 1.00 39.11 ? 317 VAL H CG1 1 
ATOM 9955  C CG2 . VAL H 2 171 ? 38.636  -6.202  -14.236 1.00 38.32 ? 317 VAL H CG2 1 
ATOM 9956  N N   . ASN H 2 172 ? 39.034  -8.860  -12.095 1.00 43.90 ? 318 ASN H N   1 
ATOM 9957  C CA  . ASN H 2 172 ? 40.043  -9.656  -11.423 1.00 45.96 ? 318 ASN H CA  1 
ATOM 9958  C C   . ASN H 2 172 ? 39.467  -10.592 -10.371 1.00 46.50 ? 318 ASN H C   1 
ATOM 9959  O O   . ASN H 2 172 ? 40.152  -11.494 -9.900  1.00 47.33 ? 318 ASN H O   1 
ATOM 9960  C CB  . ASN H 2 172 ? 41.102  -8.748  -10.812 1.00 48.73 ? 318 ASN H CB  1 
ATOM 9961  C CG  . ASN H 2 172 ? 41.789  -7.896  -11.853 1.00 50.67 ? 318 ASN H CG  1 
ATOM 9962  O OD1 . ASN H 2 172 ? 41.269  -6.852  -12.265 1.00 51.61 ? 318 ASN H OD1 1 
ATOM 9963  N ND2 . ASN H 2 172 ? 42.954  -8.350  -12.310 1.00 51.88 ? 318 ASN H ND2 1 
ATOM 9964  N N   . THR H 2 173 ? 38.212  -10.384 -9.995  1.00 46.56 ? 319 THR H N   1 
ATOM 9965  C CA  . THR H 2 173 ? 37.572  -11.264 -9.029  1.00 46.69 ? 319 THR H CA  1 
ATOM 9966  C C   . THR H 2 173 ? 36.204  -11.636 -9.592  1.00 46.61 ? 319 THR H C   1 
ATOM 9967  O O   . THR H 2 173 ? 35.162  -11.163 -9.133  1.00 47.13 ? 319 THR H O   1 
ATOM 9968  C CB  . THR H 2 173 ? 37.402  -10.584 -7.673  1.00 47.53 ? 319 THR H CB  1 
ATOM 9969  O OG1 . THR H 2 173 ? 38.635  -9.962  -7.303  1.00 49.60 ? 319 THR H OG1 1 
ATOM 9970  C CG2 . THR H 2 173 ? 37.042  -11.614 -6.613  1.00 48.11 ? 319 THR H CG2 1 
ATOM 9971  N N   . THR H 2 174 ? 36.240  -12.486 -10.609 1.00 45.92 ? 320 THR H N   1 
ATOM 9972  C CA  . THR H 2 174 ? 35.061  -12.975 -11.313 1.00 44.60 ? 320 THR H CA  1 
ATOM 9973  C C   . THR H 2 174 ? 33.940  -13.537 -10.427 1.00 44.20 ? 320 THR H C   1 
ATOM 9974  O O   . THR H 2 174 ? 34.191  -14.044 -9.329  1.00 43.89 ? 320 THR H O   1 
ATOM 9975  C CB  . THR H 2 174 ? 35.514  -14.026 -12.343 1.00 44.45 ? 320 THR H CB  1 
ATOM 9976  O OG1 . THR H 2 174 ? 36.093  -13.347 -13.462 1.00 43.16 ? 320 THR H OG1 1 
ATOM 9977  C CG2 . THR H 2 174 ? 34.361  -14.893 -12.801 1.00 44.73 ? 320 THR H CG2 1 
ATOM 9978  N N   . ASP H 2 175 ? 32.698  -13.425 -10.905 1.00 43.16 ? 321 ASP H N   1 
ATOM 9979  C CA  . ASP H 2 175 ? 31.547  -13.926 -10.163 1.00 42.60 ? 321 ASP H CA  1 
ATOM 9980  C C   . ASP H 2 175 ? 31.687  -15.431 -9.967  1.00 43.84 ? 321 ASP H C   1 
ATOM 9981  O O   . ASP H 2 175 ? 31.113  -16.008 -9.041  1.00 45.29 ? 321 ASP H O   1 
ATOM 9982  C CB  . ASP H 2 175 ? 30.247  -13.637 -10.912 1.00 40.64 ? 321 ASP H CB  1 
ATOM 9983  C CG  . ASP H 2 175 ? 30.049  -12.168 -11.199 1.00 39.44 ? 321 ASP H CG  1 
ATOM 9984  O OD1 . ASP H 2 175 ? 30.403  -11.349 -10.328 1.00 38.46 ? 321 ASP H OD1 1 
ATOM 9985  O OD2 . ASP H 2 175 ? 29.525  -11.828 -12.286 1.00 39.01 ? 321 ASP H OD2 1 
ATOM 9986  N N   . LYS H 2 176 ? 32.459  -16.065 -10.845 1.00 44.66 ? 322 LYS H N   1 
ATOM 9987  C CA  . LYS H 2 176 ? 32.673  -17.503 -10.784 1.00 44.57 ? 322 LYS H CA  1 
ATOM 9988  C C   . LYS H 2 176 ? 33.010  -17.969 -9.374  1.00 45.23 ? 322 LYS H C   1 
ATOM 9989  O O   . LYS H 2 176 ? 32.571  -19.040 -8.957  1.00 44.72 ? 322 LYS H O   1 
ATOM 9990  C CB  . LYS H 2 176 ? 33.785  -17.919 -11.751 1.00 43.86 ? 322 LYS H CB  1 
ATOM 9991  N N   . GLU H 2 177 ? 33.774  -17.177 -8.627  1.00 46.26 ? 323 GLU H N   1 
ATOM 9992  C CA  . GLU H 2 177 ? 34.128  -17.598 -7.272  1.00 48.35 ? 323 GLU H CA  1 
ATOM 9993  C C   . GLU H 2 177 ? 33.890  -16.536 -6.202  1.00 47.21 ? 323 GLU H C   1 
ATOM 9994  O O   . GLU H 2 177 ? 34.361  -16.679 -5.074  1.00 47.89 ? 323 GLU H O   1 
ATOM 9995  C CB  . GLU H 2 177 ? 35.597  -18.076 -7.221  1.00 52.18 ? 323 GLU H CB  1 
ATOM 9996  C CG  . GLU H 2 177 ? 36.646  -16.966 -7.087  1.00 57.06 ? 323 GLU H CG  1 
ATOM 9997  C CD  . GLU H 2 177 ? 36.347  -15.763 -7.982  1.00 60.32 ? 323 GLU H CD  1 
ATOM 9998  O OE1 . GLU H 2 177 ? 36.256  -15.944 -9.224  1.00 62.05 ? 323 GLU H OE1 1 
ATOM 9999  O OE2 . GLU H 2 177 ? 36.197  -14.636 -7.440  1.00 61.53 ? 323 GLU H OE2 1 
ATOM 10000 N N   . ILE H 2 178 ? 33.143  -15.488 -6.545  1.00 45.53 ? 324 ILE H N   1 
ATOM 10001 C CA  . ILE H 2 178 ? 32.867  -14.424 -5.587  1.00 44.36 ? 324 ILE H CA  1 
ATOM 10002 C C   . ILE H 2 178 ? 31.743  -14.788 -4.613  1.00 43.46 ? 324 ILE H C   1 
ATOM 10003 O O   . ILE H 2 178 ? 31.640  -14.196 -3.543  1.00 42.83 ? 324 ILE H O   1 
ATOM 10004 C CB  . ILE H 2 178 ? 32.522  -13.091 -6.325  1.00 45.00 ? 324 ILE H CB  1 
ATOM 10005 C CG1 . ILE H 2 178 ? 33.315  -11.929 -5.712  1.00 44.35 ? 324 ILE H CG1 1 
ATOM 10006 C CG2 . ILE H 2 178 ? 31.023  -12.820 -6.294  1.00 45.40 ? 324 ILE H CG2 1 
ATOM 10007 C CD1 . ILE H 2 178 ? 33.159  -11.762 -4.230  1.00 43.20 ? 324 ILE H CD1 1 
ATOM 10008 N N   . GLU H 2 179 ? 30.919  -15.769 -4.975  1.00 42.91 ? 325 GLU H N   1 
ATOM 10009 C CA  . GLU H 2 179 ? 29.807  -16.166 -4.127  1.00 42.88 ? 325 GLU H CA  1 
ATOM 10010 C C   . GLU H 2 179 ? 30.185  -16.942 -2.869  1.00 42.54 ? 325 GLU H C   1 
ATOM 10011 O O   . GLU H 2 179 ? 29.380  -17.072 -1.948  1.00 42.84 ? 325 GLU H O   1 
ATOM 10012 C CB  . GLU H 2 179 ? 28.769  -16.917 -4.958  1.00 43.71 ? 325 GLU H CB  1 
ATOM 10013 C CG  . GLU H 2 179 ? 28.016  -15.970 -5.897  1.00 45.86 ? 325 GLU H CG  1 
ATOM 10014 C CD  . GLU H 2 179 ? 26.901  -16.636 -6.717  1.00 46.47 ? 325 GLU H CD  1 
ATOM 10015 O OE1 . GLU H 2 179 ? 27.220  -17.308 -7.733  1.00 45.00 ? 325 GLU H OE1 1 
ATOM 10016 O OE2 . GLU H 2 179 ? 25.711  -16.471 -6.335  1.00 45.51 ? 325 GLU H OE2 1 
ATOM 10017 N N   . VAL H 2 180 ? 31.417  -17.432 -2.809  1.00 40.98 ? 326 VAL H N   1 
ATOM 10018 C CA  . VAL H 2 180 ? 31.874  -18.151 -1.625  1.00 40.32 ? 326 VAL H CA  1 
ATOM 10019 C C   . VAL H 2 180 ? 33.093  -17.429 -1.022  1.00 39.29 ? 326 VAL H C   1 
ATOM 10020 O O   . VAL H 2 180 ? 33.995  -17.026 -1.741  1.00 39.02 ? 326 VAL H O   1 
ATOM 10021 C CB  . VAL H 2 180 ? 32.244  -19.622 -1.973  1.00 39.94 ? 326 VAL H CB  1 
ATOM 10022 C CG1 . VAL H 2 180 ? 33.346  -19.647 -3.012  1.00 41.72 ? 326 VAL H CG1 1 
ATOM 10023 C CG2 . VAL H 2 180 ? 32.682  -20.364 -0.727  1.00 38.50 ? 326 VAL H CG2 1 
ATOM 10024 N N   . LEU H 2 181 ? 33.104  -17.246 0.293   1.00 38.44 ? 327 LEU H N   1 
ATOM 10025 C CA  . LEU H 2 181 ? 34.216  -16.579 0.962   1.00 38.88 ? 327 LEU H CA  1 
ATOM 10026 C C   . LEU H 2 181 ? 34.914  -17.507 1.948   1.00 40.62 ? 327 LEU H C   1 
ATOM 10027 O O   . LEU H 2 181 ? 34.288  -18.039 2.863   1.00 41.57 ? 327 LEU H O   1 
ATOM 10028 C CB  . LEU H 2 181 ? 33.742  -15.332 1.712   1.00 36.29 ? 327 LEU H CB  1 
ATOM 10029 C CG  . LEU H 2 181 ? 34.830  -14.687 2.577   1.00 34.03 ? 327 LEU H CG  1 
ATOM 10030 C CD1 . LEU H 2 181 ? 35.926  -14.196 1.677   1.00 32.33 ? 327 LEU H CD1 1 
ATOM 10031 C CD2 . LEU H 2 181 ? 34.279  -13.546 3.406   1.00 32.03 ? 327 LEU H CD2 1 
ATOM 10032 N N   . TYR H 2 182 ? 36.217  -17.695 1.763   1.00 41.51 ? 328 TYR H N   1 
ATOM 10033 C CA  . TYR H 2 182 ? 36.996  -18.558 2.644   1.00 42.46 ? 328 TYR H CA  1 
ATOM 10034 C C   . TYR H 2 182 ? 37.868  -17.777 3.618   1.00 44.30 ? 328 TYR H C   1 
ATOM 10035 O O   . TYR H 2 182 ? 38.324  -16.671 3.325   1.00 44.86 ? 328 TYR H O   1 
ATOM 10036 C CB  . TYR H 2 182 ? 37.906  -19.477 1.831   1.00 39.27 ? 328 TYR H CB  1 
ATOM 10037 C CG  . TYR H 2 182 ? 37.192  -20.358 0.840   1.00 38.53 ? 328 TYR H CG  1 
ATOM 10038 C CD1 . TYR H 2 182 ? 37.111  -20.006 -0.506  1.00 37.67 ? 328 TYR H CD1 1 
ATOM 10039 C CD2 . TYR H 2 182 ? 36.598  -21.552 1.245   1.00 38.10 ? 328 TYR H CD2 1 
ATOM 10040 C CE1 . TYR H 2 182 ? 36.460  -20.825 -1.420  1.00 36.43 ? 328 TYR H CE1 1 
ATOM 10041 C CE2 . TYR H 2 182 ? 35.942  -22.374 0.338   1.00 36.36 ? 328 TYR H CE2 1 
ATOM 10042 C CZ  . TYR H 2 182 ? 35.879  -22.007 -0.987  1.00 36.24 ? 328 TYR H CZ  1 
ATOM 10043 O OH  . TYR H 2 182 ? 35.236  -22.832 -1.874  1.00 36.34 ? 328 TYR H OH  1 
ATOM 10044 N N   . ILE H 2 183 ? 38.094  -18.360 4.786   1.00 45.95 ? 329 ILE H N   1 
ATOM 10045 C CA  . ILE H 2 183 ? 38.937  -17.750 5.791   1.00 47.82 ? 329 ILE H CA  1 
ATOM 10046 C C   . ILE H 2 183 ? 39.720  -18.875 6.447   1.00 50.23 ? 329 ILE H C   1 
ATOM 10047 O O   . ILE H 2 183 ? 39.191  -19.619 7.270   1.00 49.98 ? 329 ILE H O   1 
ATOM 10048 C CB  . ILE H 2 183 ? 38.104  -16.999 6.822   1.00 46.68 ? 329 ILE H CB  1 
ATOM 10049 C CG1 . ILE H 2 183 ? 37.166  -16.037 6.096   1.00 45.88 ? 329 ILE H CG1 1 
ATOM 10050 C CG2 . ILE H 2 183 ? 39.018  -16.201 7.757   1.00 45.71 ? 329 ILE H CG2 1 
ATOM 10051 C CD1 . ILE H 2 183 ? 36.268  -15.261 7.010   1.00 46.59 ? 329 ILE H CD1 1 
ATOM 10052 N N   . ARG H 2 184 ? 40.982  -19.007 6.046   1.00 53.20 ? 330 ARG H N   1 
ATOM 10053 C CA  . ARG H 2 184 ? 41.859  -20.051 6.569   1.00 54.64 ? 330 ARG H CA  1 
ATOM 10054 C C   . ARG H 2 184 ? 42.580  -19.597 7.839   1.00 55.47 ? 330 ARG H C   1 
ATOM 10055 O O   . ARG H 2 184 ? 42.824  -18.399 8.039   1.00 54.46 ? 330 ARG H O   1 
ATOM 10056 C CB  . ARG H 2 184 ? 42.877  -20.465 5.500   1.00 54.70 ? 330 ARG H CB  1 
ATOM 10057 N N   . ASN H 2 185 ? 42.911  -20.571 8.689   1.00 56.61 ? 331 ASN H N   1 
ATOM 10058 C CA  . ASN H 2 185 ? 43.592  -20.316 9.957   1.00 57.46 ? 331 ASN H CA  1 
ATOM 10059 C C   . ASN H 2 185 ? 42.994  -19.070 10.590  1.00 57.78 ? 331 ASN H C   1 
ATOM 10060 O O   . ASN H 2 185 ? 43.685  -18.067 10.783  1.00 57.69 ? 331 ASN H O   1 
ATOM 10061 C CB  . ASN H 2 185 ? 45.103  -20.124 9.735   1.00 56.14 ? 331 ASN H CB  1 
ATOM 10062 N N   . VAL H 2 186 ? 41.700  -19.137 10.902  1.00 58.15 ? 332 VAL H N   1 
ATOM 10063 C CA  . VAL H 2 186 ? 41.005  -18.001 11.500  1.00 58.33 ? 332 VAL H CA  1 
ATOM 10064 C C   . VAL H 2 186 ? 41.597  -17.672 12.861  1.00 58.64 ? 332 VAL H C   1 
ATOM 10065 O O   . VAL H 2 186 ? 42.096  -18.554 13.560  1.00 58.49 ? 332 VAL H O   1 
ATOM 10066 C CB  . VAL H 2 186 ? 39.489  -18.266 11.674  1.00 57.63 ? 332 VAL H CB  1 
ATOM 10067 C CG1 . VAL H 2 186 ? 38.899  -18.774 10.372  1.00 57.60 ? 332 VAL H CG1 1 
ATOM 10068 C CG2 . VAL H 2 186 ? 39.248  -19.250 12.800  1.00 57.44 ? 332 VAL H CG2 1 
ATOM 10069 N N   . THR H 2 187 ? 41.542  -16.395 13.224  1.00 58.44 ? 333 THR H N   1 
ATOM 10070 C CA  . THR H 2 187 ? 42.064  -15.925 14.501  1.00 57.70 ? 333 THR H CA  1 
ATOM 10071 C C   . THR H 2 187 ? 40.943  -15.231 15.258  1.00 58.66 ? 333 THR H C   1 
ATOM 10072 O O   . THR H 2 187 ? 39.869  -15.006 14.709  1.00 59.35 ? 333 THR H O   1 
ATOM 10073 C CB  . THR H 2 187 ? 43.216  -14.904 14.309  1.00 55.43 ? 333 THR H CB  1 
ATOM 10074 O OG1 . THR H 2 187 ? 42.709  -13.698 13.734  1.00 51.78 ? 333 THR H OG1 1 
ATOM 10075 C CG2 . THR H 2 187 ? 44.270  -15.467 13.397  1.00 55.32 ? 333 THR H CG2 1 
ATOM 10076 N N   . PHE H 2 188 ? 41.188  -14.893 16.517  1.00 59.36 ? 334 PHE H N   1 
ATOM 10077 C CA  . PHE H 2 188 ? 40.187  -14.201 17.312  1.00 59.61 ? 334 PHE H CA  1 
ATOM 10078 C C   . PHE H 2 188 ? 39.877  -12.862 16.657  1.00 59.09 ? 334 PHE H C   1 
ATOM 10079 O O   . PHE H 2 188 ? 38.837  -12.258 16.912  1.00 59.34 ? 334 PHE H O   1 
ATOM 10080 C CB  . PHE H 2 188 ? 40.699  -13.989 18.742  1.00 60.40 ? 334 PHE H CB  1 
ATOM 10081 C CG  . PHE H 2 188 ? 40.503  -15.182 19.639  1.00 61.25 ? 334 PHE H CG  1 
ATOM 10082 C CD1 . PHE H 2 188 ? 41.539  -15.635 20.452  1.00 61.79 ? 334 PHE H CD1 1 
ATOM 10083 C CD2 . PHE H 2 188 ? 39.280  -15.860 19.668  1.00 61.89 ? 334 PHE H CD2 1 
ATOM 10084 C CE1 . PHE H 2 188 ? 41.362  -16.750 21.283  1.00 62.50 ? 334 PHE H CE1 1 
ATOM 10085 C CE2 . PHE H 2 188 ? 39.091  -16.974 20.493  1.00 62.11 ? 334 PHE H CE2 1 
ATOM 10086 C CZ  . PHE H 2 188 ? 40.135  -17.420 21.301  1.00 62.56 ? 334 PHE H CZ  1 
ATOM 10087 N N   . GLU H 2 189 ? 40.787  -12.403 15.809  1.00 58.49 ? 335 GLU H N   1 
ATOM 10088 C CA  . GLU H 2 189 ? 40.596  -11.140 15.111  1.00 58.04 ? 335 GLU H CA  1 
ATOM 10089 C C   . GLU H 2 189 ? 39.489  -11.306 14.062  1.00 57.76 ? 335 GLU H C   1 
ATOM 10090 O O   . GLU H 2 189 ? 38.650  -10.419 13.873  1.00 58.05 ? 335 GLU H O   1 
ATOM 10091 C CB  . GLU H 2 189 ? 41.906  -10.706 14.441  1.00 56.34 ? 335 GLU H CB  1 
ATOM 10092 N N   . ASP H 2 190 ? 39.482  -12.464 13.404  1.00 56.02 ? 336 ASP H N   1 
ATOM 10093 C CA  . ASP H 2 190 ? 38.514  -12.767 12.368  1.00 53.73 ? 336 ASP H CA  1 
ATOM 10094 C C   . ASP H 2 190 ? 37.061  -12.840 12.828  1.00 52.73 ? 336 ASP H C   1 
ATOM 10095 O O   . ASP H 2 190 ? 36.139  -12.639 12.030  1.00 52.77 ? 336 ASP H O   1 
ATOM 10096 C CB  . ASP H 2 190 ? 38.924  -14.056 11.673  1.00 53.48 ? 336 ASP H CB  1 
ATOM 10097 C CG  . ASP H 2 190 ? 40.301  -13.955 11.069  1.00 53.92 ? 336 ASP H CG  1 
ATOM 10098 O OD1 . ASP H 2 190 ? 40.593  -12.907 10.452  1.00 53.42 ? 336 ASP H OD1 1 
ATOM 10099 O OD2 . ASP H 2 190 ? 41.093  -14.909 11.204  1.00 54.81 ? 336 ASP H OD2 1 
ATOM 10100 N N   . ALA H 2 191 ? 36.846  -13.113 14.108  1.00 50.74 ? 337 ALA H N   1 
ATOM 10101 C CA  . ALA H 2 191 ? 35.486  -13.189 14.629  1.00 49.43 ? 337 ALA H CA  1 
ATOM 10102 C C   . ALA H 2 191 ? 34.711  -11.909 14.267  1.00 48.15 ? 337 ALA H C   1 
ATOM 10103 O O   . ALA H 2 191 ? 35.311  -10.880 13.952  1.00 47.94 ? 337 ALA H O   1 
ATOM 10104 C CB  . ALA H 2 191 ? 35.520  -13.393 16.143  1.00 47.82 ? 337 ALA H CB  1 
ATOM 10105 N N   . GLY H 2 192 ? 33.384  -11.976 14.297  1.00 46.55 ? 338 GLY H N   1 
ATOM 10106 C CA  . GLY H 2 192 ? 32.593  -10.805 13.962  1.00 45.61 ? 338 GLY H CA  1 
ATOM 10107 C C   . GLY H 2 192 ? 31.505  -11.047 12.923  1.00 45.27 ? 338 GLY H C   1 
ATOM 10108 O O   . GLY H 2 192 ? 31.244  -12.191 12.532  1.00 44.82 ? 338 GLY H O   1 
ATOM 10109 N N   . GLU H 2 193 ? 30.877  -9.962  12.470  1.00 44.39 ? 339 GLU H N   1 
ATOM 10110 C CA  . GLU H 2 193 ? 29.797  -10.051 11.490  1.00 43.64 ? 339 GLU H CA  1 
ATOM 10111 C C   . GLU H 2 193 ? 30.217  -9.846  10.040  1.00 42.94 ? 339 GLU H C   1 
ATOM 10112 O O   . GLU H 2 193 ? 30.705  -8.786  9.661   1.00 42.68 ? 339 GLU H O   1 
ATOM 10113 C CB  . GLU H 2 193 ? 28.684  -9.059  11.829  1.00 43.09 ? 339 GLU H CB  1 
ATOM 10114 C CG  . GLU H 2 193 ? 27.526  -9.085  10.840  1.00 43.47 ? 339 GLU H CG  1 
ATOM 10115 C CD  . GLU H 2 193 ? 26.411  -8.134  11.229  1.00 44.73 ? 339 GLU H CD  1 
ATOM 10116 O OE1 . GLU H 2 193 ? 26.722  -6.956  11.508  1.00 44.00 ? 339 GLU H OE1 1 
ATOM 10117 O OE2 . GLU H 2 193 ? 25.230  -8.558  11.254  1.00 45.04 ? 339 GLU H OE2 1 
ATOM 10118 N N   . TYR H 2 194 ? 29.998  -10.881 9.236   1.00 41.76 ? 340 TYR H N   1 
ATOM 10119 C CA  . TYR H 2 194 ? 30.322  -10.862 7.818   1.00 40.43 ? 340 TYR H CA  1 
ATOM 10120 C C   . TYR H 2 194 ? 29.062  -10.619 6.999   1.00 39.32 ? 340 TYR H C   1 
ATOM 10121 O O   . TYR H 2 194 ? 28.004  -11.158 7.316   1.00 39.64 ? 340 TYR H O   1 
ATOM 10122 C CB  . TYR H 2 194 ? 30.949  -12.192 7.414   1.00 40.47 ? 340 TYR H CB  1 
ATOM 10123 C CG  . TYR H 2 194 ? 32.338  -12.390 7.969   1.00 40.24 ? 340 TYR H CG  1 
ATOM 10124 C CD1 . TYR H 2 194 ? 32.555  -12.509 9.341   1.00 39.88 ? 340 TYR H CD1 1 
ATOM 10125 C CD2 . TYR H 2 194 ? 33.443  -12.422 7.119   1.00 40.75 ? 340 TYR H CD2 1 
ATOM 10126 C CE1 . TYR H 2 194 ? 33.840  -12.650 9.855   1.00 39.88 ? 340 TYR H CE1 1 
ATOM 10127 C CE2 . TYR H 2 194 ? 34.728  -12.563 7.619   1.00 40.41 ? 340 TYR H CE2 1 
ATOM 10128 C CZ  . TYR H 2 194 ? 34.920  -12.674 8.986   1.00 40.19 ? 340 TYR H CZ  1 
ATOM 10129 O OH  . TYR H 2 194 ? 36.194  -12.787 9.478   1.00 39.35 ? 340 TYR H OH  1 
ATOM 10130 N N   . THR H 2 195 ? 29.171  -9.816  5.945   1.00 37.11 ? 341 THR H N   1 
ATOM 10131 C CA  . THR H 2 195 ? 28.007  -9.517  5.128   1.00 35.08 ? 341 THR H CA  1 
ATOM 10132 C C   . THR H 2 195 ? 28.234  -9.675  3.639   1.00 34.07 ? 341 THR H C   1 
ATOM 10133 O O   . THR H 2 195 ? 29.284  -9.300  3.114   1.00 33.38 ? 341 THR H O   1 
ATOM 10134 C CB  . THR H 2 195 ? 27.498  -8.071  5.382   1.00 34.10 ? 341 THR H CB  1 
ATOM 10135 O OG1 . THR H 2 195 ? 27.160  -7.918  6.765   1.00 33.92 ? 341 THR H OG1 1 
ATOM 10136 C CG2 . THR H 2 195 ? 26.260  -7.779  4.545   1.00 33.46 ? 341 THR H CG2 1 
ATOM 10137 N N   . CYS H 2 196 ? 27.243  -10.252 2.963   1.00 32.86 ? 342 CYS H N   1 
ATOM 10138 C CA  . CYS H 2 196 ? 27.312  -10.400 1.522   1.00 31.83 ? 342 CYS H CA  1 
ATOM 10139 C C   . CYS H 2 196 ? 26.396  -9.322  0.968   1.00 31.35 ? 342 CYS H C   1 
ATOM 10140 O O   . CYS H 2 196 ? 25.189  -9.331  1.226   1.00 32.26 ? 342 CYS H O   1 
ATOM 10141 C CB  . CYS H 2 196 ? 26.819  -11.771 1.068   1.00 32.22 ? 342 CYS H CB  1 
ATOM 10142 S SG  . CYS H 2 196 ? 26.792  -11.862 -0.733  1.00 31.42 ? 342 CYS H SG  1 
ATOM 10143 N N   . LEU H 2 197 ? 26.975  -8.390  0.222   1.00 30.60 ? 343 LEU H N   1 
ATOM 10144 C CA  . LEU H 2 197 ? 26.233  -7.277  -0.355  1.00 29.36 ? 343 LEU H CA  1 
ATOM 10145 C C   . LEU H 2 197 ? 26.169  -7.370  -1.873  1.00 28.47 ? 343 LEU H C   1 
ATOM 10146 O O   . LEU H 2 197 ? 27.197  -7.458  -2.539  1.00 28.72 ? 343 LEU H O   1 
ATOM 10147 C CB  . LEU H 2 197 ? 26.913  -5.972  0.036   1.00 30.16 ? 343 LEU H CB  1 
ATOM 10148 C CG  . LEU H 2 197 ? 26.325  -4.683  -0.542  1.00 30.02 ? 343 LEU H CG  1 
ATOM 10149 C CD1 . LEU H 2 197 ? 25.059  -4.344  0.206   1.00 29.89 ? 343 LEU H CD1 1 
ATOM 10150 C CD2 . LEU H 2 197 ? 27.326  -3.547  -0.377  1.00 30.33 ? 343 LEU H CD2 1 
ATOM 10151 N N   . ALA H 2 198 ? 24.958  -7.348  -2.411  1.00 27.64 ? 344 ALA H N   1 
ATOM 10152 C CA  . ALA H 2 198 ? 24.731  -7.429  -3.850  1.00 26.79 ? 344 ALA H CA  1 
ATOM 10153 C C   . ALA H 2 198 ? 23.960  -6.198  -4.294  1.00 25.96 ? 344 ALA H C   1 
ATOM 10154 O O   . ALA H 2 198 ? 22.970  -5.821  -3.663  1.00 25.68 ? 344 ALA H O   1 
ATOM 10155 C CB  . ALA H 2 198 ? 23.918  -8.713  -4.207  1.00 26.15 ? 344 ALA H CB  1 
ATOM 10156 N N   . GLY H 2 199 ? 24.404  -5.579  -5.384  1.00 25.46 ? 345 GLY H N   1 
ATOM 10157 C CA  . GLY H 2 199 ? 23.714  -4.404  -5.874  1.00 26.04 ? 345 GLY H CA  1 
ATOM 10158 C C   . GLY H 2 199 ? 23.699  -4.293  -7.381  1.00 26.93 ? 345 GLY H C   1 
ATOM 10159 O O   . GLY H 2 199 ? 24.621  -4.753  -8.056  1.00 28.08 ? 345 GLY H O   1 
ATOM 10160 N N   . ASN H 2 200 ? 22.633  -3.702  -7.908  1.00 26.44 ? 346 ASN H N   1 
ATOM 10161 C CA  . ASN H 2 200 ? 22.492  -3.485  -9.334  1.00 26.82 ? 346 ASN H CA  1 
ATOM 10162 C C   . ASN H 2 200 ? 22.000  -2.052  -9.552  1.00 28.04 ? 346 ASN H C   1 
ATOM 10163 O O   . ASN H 2 200 ? 21.842  -1.293  -8.597  1.00 27.33 ? 346 ASN H O   1 
ATOM 10164 C CB  . ASN H 2 200 ? 21.512  -4.500  -9.939  1.00 25.54 ? 346 ASN H CB  1 
ATOM 10165 C CG  . ASN H 2 200 ? 20.132  -4.486  -9.273  1.00 26.52 ? 346 ASN H CG  1 
ATOM 10166 O OD1 . ASN H 2 200 ? 19.676  -3.466  -8.755  1.00 27.40 ? 346 ASN H OD1 1 
ATOM 10167 N ND2 . ASN H 2 200 ? 19.454  -5.624  -9.314  1.00 25.42 ? 346 ASN H ND2 1 
ATOM 10168 N N   . SER H 2 201 ? 21.751  -1.680  -10.802 1.00 30.08 ? 347 SER H N   1 
ATOM 10169 C CA  . SER H 2 201 ? 21.287  -0.335  -11.094 1.00 30.69 ? 347 SER H CA  1 
ATOM 10170 C C   . SER H 2 201 ? 20.003  -0.035  -10.336 1.00 31.29 ? 347 SER H C   1 
ATOM 10171 O O   . SER H 2 201 ? 19.776  1.099   -9.927  1.00 32.74 ? 347 SER H O   1 
ATOM 10172 C CB  . SER H 2 201 ? 21.059  -0.156  -12.594 1.00 30.90 ? 347 SER H CB  1 
ATOM 10173 O OG  . SER H 2 201 ? 19.927  -0.891  -13.028 1.00 34.37 ? 347 SER H OG  1 
ATOM 10174 N N   . ILE H 2 202 ? 19.163  -1.042  -10.130 1.00 30.45 ? 348 ILE H N   1 
ATOM 10175 C CA  . ILE H 2 202 ? 17.914  -0.809  -9.422  1.00 30.22 ? 348 ILE H CA  1 
ATOM 10176 C C   . ILE H 2 202 ? 18.094  -0.601  -7.918  1.00 30.61 ? 348 ILE H C   1 
ATOM 10177 O O   . ILE H 2 202 ? 17.542  0.337   -7.342  1.00 31.97 ? 348 ILE H O   1 
ATOM 10178 C CB  . ILE H 2 202 ? 16.924  -1.960  -9.652  1.00 30.35 ? 348 ILE H CB  1 
ATOM 10179 C CG1 . ILE H 2 202 ? 16.562  -2.013  -11.137 1.00 28.42 ? 348 ILE H CG1 1 
ATOM 10180 C CG2 . ILE H 2 202 ? 15.677  -1.774  -8.761  1.00 28.64 ? 348 ILE H CG2 1 
ATOM 10181 C CD1 . ILE H 2 202 ? 15.839  -3.269  -11.550 1.00 30.51 ? 348 ILE H CD1 1 
ATOM 10182 N N   . GLY H 2 203 ? 18.874  -1.457  -7.275  1.00 30.43 ? 349 GLY H N   1 
ATOM 10183 C CA  . GLY H 2 203 ? 19.045  -1.300  -5.846  1.00 29.85 ? 349 GLY H CA  1 
ATOM 10184 C C   . GLY H 2 203 ? 20.058  -2.230  -5.220  1.00 29.85 ? 349 GLY H C   1 
ATOM 10185 O O   . GLY H 2 203 ? 20.711  -3.001  -5.915  1.00 30.85 ? 349 GLY H O   1 
ATOM 10186 N N   . ILE H 2 204 ? 20.157  -2.157  -3.895  1.00 29.19 ? 350 ILE H N   1 
ATOM 10187 C CA  . ILE H 2 204 ? 21.098  -2.935  -3.094  1.00 28.48 ? 350 ILE H CA  1 
ATOM 10188 C C   . ILE H 2 204 ? 20.417  -3.887  -2.112  1.00 28.23 ? 350 ILE H C   1 
ATOM 10189 O O   . ILE H 2 204 ? 19.358  -3.580  -1.594  1.00 28.83 ? 350 ILE H O   1 
ATOM 10190 C CB  . ILE H 2 204 ? 21.978  -1.987  -2.265  1.00 28.80 ? 350 ILE H CB  1 
ATOM 10191 C CG1 . ILE H 2 204 ? 23.009  -1.320  -3.175  1.00 28.50 ? 350 ILE H CG1 1 
ATOM 10192 C CG2 . ILE H 2 204 ? 22.616  -2.732  -1.098  1.00 27.39 ? 350 ILE H CG2 1 
ATOM 10193 C CD1 . ILE H 2 204 ? 23.596  -0.041  -2.599  1.00 28.03 ? 350 ILE H CD1 1 
ATOM 10194 N N   . SER H 2 205 ? 21.048  -5.026  -1.840  1.00 28.18 ? 351 SER H N   1 
ATOM 10195 C CA  . SER H 2 205 ? 20.509  -6.018  -0.909  1.00 28.27 ? 351 SER H CA  1 
ATOM 10196 C C   . SER H 2 205 ? 21.666  -6.720  -0.219  1.00 29.28 ? 351 SER H C   1 
ATOM 10197 O O   . SER H 2 205 ? 22.737  -6.861  -0.808  1.00 31.07 ? 351 SER H O   1 
ATOM 10198 C CB  . SER H 2 205 ? 19.676  -7.056  -1.651  1.00 27.47 ? 351 SER H CB  1 
ATOM 10199 O OG  . SER H 2 205 ? 18.553  -6.471  -2.284  1.00 26.63 ? 351 SER H OG  1 
ATOM 10200 N N   . PHE H 2 206 ? 21.466  -7.177  1.014   1.00 29.07 ? 352 PHE H N   1 
ATOM 10201 C CA  . PHE H 2 206 ? 22.553  -7.835  1.737   1.00 28.57 ? 352 PHE H CA  1 
ATOM 10202 C C   . PHE H 2 206 ? 22.093  -8.739  2.873   1.00 29.48 ? 352 PHE H C   1 
ATOM 10203 O O   . PHE H 2 206 ? 21.078  -8.477  3.510   1.00 29.87 ? 352 PHE H O   1 
ATOM 10204 C CB  . PHE H 2 206 ? 23.491  -6.772  2.306   1.00 26.68 ? 352 PHE H CB  1 
ATOM 10205 C CG  . PHE H 2 206 ? 22.882  -5.949  3.420   1.00 25.88 ? 352 PHE H CG  1 
ATOM 10206 C CD1 . PHE H 2 206 ? 22.814  -6.451  4.730   1.00 26.78 ? 352 PHE H CD1 1 
ATOM 10207 C CD2 . PHE H 2 206 ? 22.372  -4.674  3.168   1.00 24.08 ? 352 PHE H CD2 1 
ATOM 10208 C CE1 . PHE H 2 206 ? 22.249  -5.696  5.775   1.00 25.35 ? 352 PHE H CE1 1 
ATOM 10209 C CE2 . PHE H 2 206 ? 21.801  -3.907  4.202   1.00 24.44 ? 352 PHE H CE2 1 
ATOM 10210 C CZ  . PHE H 2 206 ? 21.741  -4.422  5.508   1.00 25.15 ? 352 PHE H CZ  1 
ATOM 10211 N N   . HIS H 2 207 ? 22.858  -9.798  3.130   1.00 30.89 ? 353 HIS H N   1 
ATOM 10212 C CA  . HIS H 2 207 ? 22.567  -10.733 4.225   1.00 31.23 ? 353 HIS H CA  1 
ATOM 10213 C C   . HIS H 2 207 ? 23.822  -10.836 5.078   1.00 32.56 ? 353 HIS H C   1 
ATOM 10214 O O   . HIS H 2 207 ? 24.920  -10.976 4.546   1.00 33.55 ? 353 HIS H O   1 
ATOM 10215 C CB  . HIS H 2 207 ? 22.222  -12.127 3.697   1.00 29.60 ? 353 HIS H CB  1 
ATOM 10216 C CG  . HIS H 2 207 ? 20.860  -12.237 3.090   1.00 28.99 ? 353 HIS H CG  1 
ATOM 10217 N ND1 . HIS H 2 207 ? 20.319  -13.444 2.697   1.00 28.65 ? 353 HIS H ND1 1 
ATOM 10218 C CD2 . HIS H 2 207 ? 19.932  -11.295 2.783   1.00 28.33 ? 353 HIS H CD2 1 
ATOM 10219 C CE1 . HIS H 2 207 ? 19.122  -13.244 2.174   1.00 28.50 ? 353 HIS H CE1 1 
ATOM 10220 N NE2 . HIS H 2 207 ? 18.865  -11.947 2.216   1.00 28.14 ? 353 HIS H NE2 1 
ATOM 10221 N N   . SER H 2 208 ? 23.660  -10.777 6.394   1.00 33.82 ? 354 SER H N   1 
ATOM 10222 C CA  . SER H 2 208 ? 24.792  -10.856 7.309   1.00 34.11 ? 354 SER H CA  1 
ATOM 10223 C C   . SER H 2 208 ? 24.798  -12.161 8.097   1.00 35.31 ? 354 SER H C   1 
ATOM 10224 O O   . SER H 2 208 ? 23.751  -12.741 8.381   1.00 34.90 ? 354 SER H O   1 
ATOM 10225 C CB  . SER H 2 208 ? 24.755  -9.668  8.278   1.00 34.46 ? 354 SER H CB  1 
ATOM 10226 O OG  . SER H 2 208 ? 24.534  -8.446  7.592   1.00 32.33 ? 354 SER H OG  1 
ATOM 10227 N N   . ALA H 2 209 ? 25.995  -12.616 8.439   1.00 37.68 ? 355 ALA H N   1 
ATOM 10228 C CA  . ALA H 2 209 ? 26.188  -13.839 9.204   1.00 40.24 ? 355 ALA H CA  1 
ATOM 10229 C C   . ALA H 2 209 ? 27.224  -13.519 10.280  1.00 42.47 ? 355 ALA H C   1 
ATOM 10230 O O   . ALA H 2 209 ? 27.941  -12.526 10.181  1.00 42.06 ? 355 ALA H O   1 
ATOM 10231 C CB  . ALA H 2 209 ? 26.689  -14.956 8.293   1.00 39.53 ? 355 ALA H CB  1 
ATOM 10232 N N   . TRP H 2 210 ? 27.307  -14.361 11.303  1.00 45.88 ? 356 TRP H N   1 
ATOM 10233 C CA  . TRP H 2 210 ? 28.243  -14.142 12.400  1.00 49.08 ? 356 TRP H CA  1 
ATOM 10234 C C   . TRP H 2 210 ? 29.265  -15.253 12.593  1.00 50.22 ? 356 TRP H C   1 
ATOM 10235 O O   . TRP H 2 210 ? 28.899  -16.418 12.756  1.00 50.68 ? 356 TRP H O   1 
ATOM 10236 C CB  . TRP H 2 210 ? 27.473  -13.982 13.703  1.00 51.24 ? 356 TRP H CB  1 
ATOM 10237 C CG  . TRP H 2 210 ? 27.605  -12.639 14.313  1.00 54.72 ? 356 TRP H CG  1 
ATOM 10238 C CD1 . TRP H 2 210 ? 28.715  -12.106 14.924  1.00 55.25 ? 356 TRP H CD1 1 
ATOM 10239 C CD2 . TRP H 2 210 ? 26.586  -11.644 14.386  1.00 56.62 ? 356 TRP H CD2 1 
ATOM 10240 N NE1 . TRP H 2 210 ? 28.441  -10.833 15.376  1.00 56.70 ? 356 TRP H NE1 1 
ATOM 10241 C CE2 . TRP H 2 210 ? 27.141  -10.526 15.058  1.00 57.96 ? 356 TRP H CE2 1 
ATOM 10242 C CE3 . TRP H 2 210 ? 25.254  -11.586 13.954  1.00 58.37 ? 356 TRP H CE3 1 
ATOM 10243 C CZ2 . TRP H 2 210 ? 26.402  -9.360  15.306  1.00 59.26 ? 356 TRP H CZ2 1 
ATOM 10244 C CZ3 . TRP H 2 210 ? 24.514  -10.423 14.202  1.00 60.19 ? 356 TRP H CZ3 1 
ATOM 10245 C CH2 . TRP H 2 210 ? 25.093  -9.328  14.874  1.00 60.26 ? 356 TRP H CH2 1 
ATOM 10246 N N   . LEU H 2 211 ? 30.542  -14.883 12.588  1.00 50.33 ? 357 LEU H N   1 
ATOM 10247 C CA  . LEU H 2 211 ? 31.612  -15.847 12.797  1.00 50.82 ? 357 LEU H CA  1 
ATOM 10248 C C   . LEU H 2 211 ? 32.025  -15.815 14.260  1.00 51.49 ? 357 LEU H C   1 
ATOM 10249 O O   . LEU H 2 211 ? 32.403  -14.765 14.777  1.00 51.16 ? 357 LEU H O   1 
ATOM 10250 C CB  . LEU H 2 211 ? 32.831  -15.513 11.933  1.00 49.67 ? 357 LEU H CB  1 
ATOM 10251 C CG  . LEU H 2 211 ? 34.095  -16.332 12.227  1.00 47.78 ? 357 LEU H CG  1 
ATOM 10252 C CD1 . LEU H 2 211 ? 33.836  -17.794 11.958  1.00 47.52 ? 357 LEU H CD1 1 
ATOM 10253 C CD2 . LEU H 2 211 ? 35.236  -15.847 11.358  1.00 47.46 ? 357 LEU H CD2 1 
ATOM 10254 N N   . THR H 2 212 ? 31.942  -16.969 14.920  1.00 52.52 ? 358 THR H N   1 
ATOM 10255 C CA  . THR H 2 212 ? 32.316  -17.103 16.328  1.00 52.85 ? 358 THR H CA  1 
ATOM 10256 C C   . THR H 2 212 ? 33.583  -17.940 16.450  1.00 53.80 ? 358 THR H C   1 
ATOM 10257 O O   . THR H 2 212 ? 33.607  -19.102 16.044  1.00 53.38 ? 358 THR H O   1 
ATOM 10258 C CB  . THR H 2 212 ? 31.217  -17.822 17.150  1.00 51.06 ? 358 THR H CB  1 
ATOM 10259 O OG1 . THR H 2 212 ? 29.992  -17.097 17.064  1.00 49.58 ? 358 THR H OG1 1 
ATOM 10260 C CG2 . THR H 2 212 ? 31.613  -17.914 18.598  1.00 49.90 ? 358 THR H CG2 1 
ATOM 10261 N N   . VAL H 2 213 ? 34.628  -17.343 17.012  1.00 55.45 ? 359 VAL H N   1 
ATOM 10262 C CA  . VAL H 2 213 ? 35.895  -18.035 17.207  1.00 57.66 ? 359 VAL H CA  1 
ATOM 10263 C C   . VAL H 2 213 ? 36.058  -18.435 18.674  1.00 58.72 ? 359 VAL H C   1 
ATOM 10264 O O   . VAL H 2 213 ? 36.004  -17.588 19.560  1.00 58.98 ? 359 VAL H O   1 
ATOM 10265 C CB  . VAL H 2 213 ? 37.091  -17.140 16.816  1.00 57.07 ? 359 VAL H CB  1 
ATOM 10266 C CG1 . VAL H 2 213 ? 38.389  -17.925 16.944  1.00 55.67 ? 359 VAL H CG1 1 
ATOM 10267 C CG2 . VAL H 2 213 ? 36.906  -16.615 15.401  1.00 56.56 ? 359 VAL H CG2 1 
ATOM 10268 N N   . LEU H 2 214 ? 36.264  -19.728 18.917  1.00 60.08 ? 360 LEU H N   1 
ATOM 10269 C CA  . LEU H 2 214 ? 36.442  -20.255 20.270  1.00 60.93 ? 360 LEU H CA  1 
ATOM 10270 C C   . LEU H 2 214 ? 37.895  -20.625 20.578  1.00 62.10 ? 360 LEU H C   1 
ATOM 10271 O O   . LEU H 2 214 ? 38.693  -20.890 19.673  1.00 62.84 ? 360 LEU H O   1 
ATOM 10272 C CB  . LEU H 2 214 ? 35.553  -21.483 20.475  1.00 59.32 ? 360 LEU H CB  1 
ATOM 10273 C CG  . LEU H 2 214 ? 34.054  -21.278 20.242  1.00 58.92 ? 360 LEU H CG  1 
ATOM 10274 C CD1 . LEU H 2 214 ? 33.336  -22.593 20.415  1.00 57.82 ? 360 LEU H CD1 1 
ATOM 10275 C CD2 . LEU H 2 214 ? 33.504  -20.248 21.208  1.00 58.62 ? 360 LEU H CD2 1 
ATOM 10276 N N   . PRO H 2 215 ? 38.233  -20.644 21.864  1.00 62.82 ? 361 PRO H N   1 
ATOM 10277 C CA  . PRO H 2 215 ? 39.584  -20.980 22.291  1.00 63.20 ? 361 PRO H CA  1 
ATOM 10278 C C   . PRO H 2 215 ? 39.871  -22.470 22.108  1.00 63.63 ? 361 PRO H C   1 
ATOM 10279 O O   . PRO H 2 215 ? 41.027  -22.797 21.758  1.00 63.88 ? 361 PRO H O   1 
ATOM 10280 C CB  . PRO H 2 215 ? 39.773  -20.591 23.753  1.00 63.17 ? 361 PRO H CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   ?   ?   ?   A . n 
A 1 6   ILE 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  PRO 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  LEU 12  12  ?   ?   ?   A . n 
A 1 13  PRO 13  13  ?   ?   ?   A . n 
A 1 14  GLU 14  14  ?   ?   ?   A . n 
A 1 15  ASP 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  SER 18  18  ?   ?   ?   A . n 
A 1 19  GLY 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  PRO 29  29  29  PRO PRO A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  CYS 34  34  34  CYS CYS A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ARG 42  42  42  ARG ARG A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  HIS 44  44  44  HIS HIS A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  SER 56  56  56  SER SER A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  GLU 68  68  68  GLU GLU A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ILE 74  74  74  ILE ILE A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  TYR 82  82  82  TYR TYR A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 TRP 123 123 123 TRP TRP A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ARG 129 129 129 ARG ARG A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 GLN 132 132 132 GLN GLN A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 MET 151 151 151 MET MET A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 SER 155 155 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   GLY 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   ?   ?   ?   B . n 
B 1 6   ILE 6   6   ?   ?   ?   B . n 
B 1 7   THR 7   7   ?   ?   ?   B . n 
B 1 8   THR 8   8   ?   ?   ?   B . n 
B 1 9   LEU 9   9   ?   ?   ?   B . n 
B 1 10  PRO 10  10  ?   ?   ?   B . n 
B 1 11  ALA 11  11  ?   ?   ?   B . n 
B 1 12  LEU 12  12  ?   ?   ?   B . n 
B 1 13  PRO 13  13  ?   ?   ?   B . n 
B 1 14  GLU 14  14  ?   ?   ?   B . n 
B 1 15  ASP 15  15  ?   ?   ?   B . n 
B 1 16  GLY 16  16  ?   ?   ?   B . n 
B 1 17  GLY 17  17  ?   ?   ?   B . n 
B 1 18  SER 18  18  ?   ?   ?   B . n 
B 1 19  GLY 19  19  ?   ?   ?   B . n 
B 1 20  ALA 20  20  ?   ?   ?   B . n 
B 1 21  PHE 21  21  21  PHE PHE B . n 
B 1 22  PRO 22  22  22  PRO PRO B . n 
B 1 23  PRO 23  23  23  PRO PRO B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  HIS 25  25  25  HIS HIS B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  ASP 28  28  28  ASP ASP B . n 
B 1 29  PRO 29  29  29  PRO PRO B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  ARG 31  31  31  ARG ARG B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  TYR 33  33  33  TYR TYR B . n 
B 1 34  CYS 34  34  34  CYS CYS B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  ASN 36  36  36  ASN ASN B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  PHE 40  40  40  PHE PHE B . n 
B 1 41  LEU 41  41  41  LEU LEU B . n 
B 1 42  ARG 42  42  42  ARG ARG B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  HIS 44  44  44  HIS HIS B . n 
B 1 45  PRO 45  45  45  PRO PRO B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  VAL 49  49  49  VAL VAL B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  ARG 53  53  53  ARG ARG B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  SER 56  56  56  SER SER B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  HIS 59  59  59  HIS HIS B . n 
B 1 60  ILE 60  60  60  ILE ILE B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  GLU 67  67  67  GLU GLU B . n 
B 1 68  GLU 68  68  68  GLU GLU B . n 
B 1 69  ARG 69  69  69  ARG ARG B . n 
B 1 70  GLY 70  70  70  GLY GLY B . n 
B 1 71  VAL 71  71  71  VAL VAL B . n 
B 1 72  VAL 72  72  72  VAL VAL B . n 
B 1 73  SER 73  73  73  SER SER B . n 
B 1 74  ILE 74  74  74  ILE ILE B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  GLY 76  76  76  GLY GLY B . n 
B 1 77  VAL 77  77  77  VAL VAL B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  ARG 81  81  81  ARG ARG B . n 
B 1 82  TYR 82  82  82  TYR TYR B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  ALA 84  84  84  ALA ALA B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  GLY 89  89  89  GLY GLY B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  LYS 95  95  95  LYS LYS B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ASP 99  99  99  ASP ASP B . n 
B 1 100 GLU 100 100 100 GLU GLU B . n 
B 1 101 CYS 101 101 101 CYS CYS B . n 
B 1 102 PHE 102 102 102 PHE PHE B . n 
B 1 103 PHE 103 103 103 PHE PHE B . n 
B 1 104 PHE 104 104 104 PHE PHE B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 ASN 111 111 111 ASN ASN B . n 
B 1 112 TYR 112 112 112 TYR TYR B . n 
B 1 113 ASN 113 113 113 ASN ASN B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 TYR 115 115 115 TYR TYR B . n 
B 1 116 ARG 116 116 116 ARG ARG B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 TYR 120 120 120 TYR TYR B . n 
B 1 121 THR 121 121 121 THR THR B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 TRP 123 123 123 TRP TRP B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 ARG 129 129 129 ARG ARG B . n 
B 1 130 THR 130 130 130 THR THR B . n 
B 1 131 GLY 131 131 131 GLY GLY B . n 
B 1 132 GLN 132 132 132 GLN GLN B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 GLY 136 136 136 GLY GLY B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 LYS 138 138 138 LYS LYS B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 PRO 141 141 141 PRO PRO B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 PRO 150 150 150 PRO PRO B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 SER 152 152 152 SER SER B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 LYS 154 154 154 LYS LYS B . n 
B 1 155 SER 155 155 ?   ?   ?   B . n 
C 1 1   MET 1   1   ?   ?   ?   C . n 
C 1 2   ALA 2   2   ?   ?   ?   C . n 
C 1 3   ALA 3   3   ?   ?   ?   C . n 
C 1 4   GLY 4   4   ?   ?   ?   C . n 
C 1 5   SER 5   5   ?   ?   ?   C . n 
C 1 6   ILE 6   6   ?   ?   ?   C . n 
C 1 7   THR 7   7   ?   ?   ?   C . n 
C 1 8   THR 8   8   ?   ?   ?   C . n 
C 1 9   LEU 9   9   ?   ?   ?   C . n 
C 1 10  PRO 10  10  ?   ?   ?   C . n 
C 1 11  ALA 11  11  ?   ?   ?   C . n 
C 1 12  LEU 12  12  ?   ?   ?   C . n 
C 1 13  PRO 13  13  ?   ?   ?   C . n 
C 1 14  GLU 14  14  ?   ?   ?   C . n 
C 1 15  ASP 15  15  ?   ?   ?   C . n 
C 1 16  GLY 16  16  ?   ?   ?   C . n 
C 1 17  GLY 17  17  ?   ?   ?   C . n 
C 1 18  SER 18  18  ?   ?   ?   C . n 
C 1 19  GLY 19  19  ?   ?   ?   C . n 
C 1 20  ALA 20  20  ?   ?   ?   C . n 
C 1 21  PHE 21  21  21  PHE PHE C . n 
C 1 22  PRO 22  22  22  PRO PRO C . n 
C 1 23  PRO 23  23  23  PRO PRO C . n 
C 1 24  GLY 24  24  24  GLY GLY C . n 
C 1 25  HIS 25  25  25  HIS HIS C . n 
C 1 26  PHE 26  26  26  PHE PHE C . n 
C 1 27  LYS 27  27  27  LYS LYS C . n 
C 1 28  ASP 28  28  28  ASP ASP C . n 
C 1 29  PRO 29  29  29  PRO PRO C . n 
C 1 30  LYS 30  30  30  LYS LYS C . n 
C 1 31  ARG 31  31  31  ARG ARG C . n 
C 1 32  LEU 32  32  32  LEU LEU C . n 
C 1 33  TYR 33  33  33  TYR TYR C . n 
C 1 34  CYS 34  34  34  CYS CYS C . n 
C 1 35  LYS 35  35  35  LYS LYS C . n 
C 1 36  ASN 36  36  36  ASN ASN C . n 
C 1 37  GLY 37  37  37  GLY GLY C . n 
C 1 38  GLY 38  38  38  GLY GLY C . n 
C 1 39  PHE 39  39  39  PHE PHE C . n 
C 1 40  PHE 40  40  40  PHE PHE C . n 
C 1 41  LEU 41  41  41  LEU LEU C . n 
C 1 42  ARG 42  42  42  ARG ARG C . n 
C 1 43  ILE 43  43  43  ILE ILE C . n 
C 1 44  HIS 44  44  44  HIS HIS C . n 
C 1 45  PRO 45  45  45  PRO PRO C . n 
C 1 46  ASP 46  46  46  ASP ASP C . n 
C 1 47  GLY 47  47  47  GLY GLY C . n 
C 1 48  ARG 48  48  48  ARG ARG C . n 
C 1 49  VAL 49  49  49  VAL VAL C . n 
C 1 50  ASP 50  50  50  ASP ASP C . n 
C 1 51  GLY 51  51  51  GLY GLY C . n 
C 1 52  VAL 52  52  52  VAL VAL C . n 
C 1 53  ARG 53  53  53  ARG ARG C . n 
C 1 54  GLU 54  54  54  GLU GLU C . n 
C 1 55  LYS 55  55  55  LYS LYS C . n 
C 1 56  SER 56  56  56  SER SER C . n 
C 1 57  ASP 57  57  57  ASP ASP C . n 
C 1 58  PRO 58  58  58  PRO PRO C . n 
C 1 59  HIS 59  59  59  HIS HIS C . n 
C 1 60  ILE 60  60  60  ILE ILE C . n 
C 1 61  LYS 61  61  61  LYS LYS C . n 
C 1 62  LEU 62  62  62  LEU LEU C . n 
C 1 63  GLN 63  63  63  GLN GLN C . n 
C 1 64  LEU 64  64  64  LEU LEU C . n 
C 1 65  GLN 65  65  65  GLN GLN C . n 
C 1 66  ALA 66  66  66  ALA ALA C . n 
C 1 67  GLU 67  67  67  GLU GLU C . n 
C 1 68  GLU 68  68  68  GLU GLU C . n 
C 1 69  ARG 69  69  69  ARG ARG C . n 
C 1 70  GLY 70  70  70  GLY GLY C . n 
C 1 71  VAL 71  71  71  VAL VAL C . n 
C 1 72  VAL 72  72  72  VAL VAL C . n 
C 1 73  SER 73  73  73  SER SER C . n 
C 1 74  ILE 74  74  74  ILE ILE C . n 
C 1 75  LYS 75  75  75  LYS LYS C . n 
C 1 76  GLY 76  76  76  GLY GLY C . n 
C 1 77  VAL 77  77  77  VAL VAL C . n 
C 1 78  SER 78  78  78  SER SER C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  ASN 80  80  80  ASN ASN C . n 
C 1 81  ARG 81  81  81  ARG ARG C . n 
C 1 82  TYR 82  82  82  TYR TYR C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  ALA 84  84  84  ALA ALA C . n 
C 1 85  MET 85  85  85  MET MET C . n 
C 1 86  LYS 86  86  86  LYS LYS C . n 
C 1 87  GLU 87  87  87  GLU GLU C . n 
C 1 88  ASP 88  88  88  ASP ASP C . n 
C 1 89  GLY 89  89  89  GLY GLY C . n 
C 1 90  ARG 90  90  90  ARG ARG C . n 
C 1 91  LEU 91  91  91  LEU LEU C . n 
C 1 92  LEU 92  92  92  LEU LEU C . n 
C 1 93  ALA 93  93  93  ALA ALA C . n 
C 1 94  SER 94  94  94  SER SER C . n 
C 1 95  LYS 95  95  95  LYS LYS C . n 
C 1 96  SER 96  96  96  SER SER C . n 
C 1 97  VAL 97  97  97  VAL VAL C . n 
C 1 98  THR 98  98  98  THR THR C . n 
C 1 99  ASP 99  99  99  ASP ASP C . n 
C 1 100 GLU 100 100 100 GLU GLU C . n 
C 1 101 CYS 101 101 101 CYS CYS C . n 
C 1 102 PHE 102 102 102 PHE PHE C . n 
C 1 103 PHE 103 103 103 PHE PHE C . n 
C 1 104 PHE 104 104 104 PHE PHE C . n 
C 1 105 GLU 105 105 105 GLU GLU C . n 
C 1 106 ARG 106 106 106 ARG ARG C . n 
C 1 107 LEU 107 107 107 LEU LEU C . n 
C 1 108 GLU 108 108 108 GLU GLU C . n 
C 1 109 SER 109 109 109 SER SER C . n 
C 1 110 ASN 110 110 110 ASN ASN C . n 
C 1 111 ASN 111 111 111 ASN ASN C . n 
C 1 112 TYR 112 112 112 TYR TYR C . n 
C 1 113 ASN 113 113 113 ASN ASN C . n 
C 1 114 THR 114 114 114 THR THR C . n 
C 1 115 TYR 115 115 115 TYR TYR C . n 
C 1 116 ARG 116 116 116 ARG ARG C . n 
C 1 117 SER 117 117 117 SER SER C . n 
C 1 118 ARG 118 118 118 ARG ARG C . n 
C 1 119 LYS 119 119 119 LYS LYS C . n 
C 1 120 TYR 120 120 120 TYR TYR C . n 
C 1 121 THR 121 121 121 THR THR C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 TRP 123 123 123 TRP TRP C . n 
C 1 124 TYR 124 124 124 TYR TYR C . n 
C 1 125 VAL 125 125 125 VAL VAL C . n 
C 1 126 ALA 126 126 126 ALA ALA C . n 
C 1 127 LEU 127 127 127 LEU LEU C . n 
C 1 128 LYS 128 128 128 LYS LYS C . n 
C 1 129 ARG 129 129 129 ARG ARG C . n 
C 1 130 THR 130 130 130 THR THR C . n 
C 1 131 GLY 131 131 131 GLY GLY C . n 
C 1 132 GLN 132 132 132 GLN GLN C . n 
C 1 133 TYR 133 133 133 TYR TYR C . n 
C 1 134 LYS 134 134 134 LYS LYS C . n 
C 1 135 LEU 135 135 135 LEU LEU C . n 
C 1 136 GLY 136 136 136 GLY GLY C . n 
C 1 137 SER 137 137 137 SER SER C . n 
C 1 138 LYS 138 138 138 LYS LYS C . n 
C 1 139 THR 139 139 139 THR THR C . n 
C 1 140 GLY 140 140 140 GLY GLY C . n 
C 1 141 PRO 141 141 141 PRO PRO C . n 
C 1 142 GLY 142 142 142 GLY GLY C . n 
C 1 143 GLN 143 143 143 GLN GLN C . n 
C 1 144 LYS 144 144 144 LYS LYS C . n 
C 1 145 ALA 145 145 145 ALA ALA C . n 
C 1 146 ILE 146 146 146 ILE ILE C . n 
C 1 147 LEU 147 147 147 LEU LEU C . n 
C 1 148 PHE 148 148 148 PHE PHE C . n 
C 1 149 LEU 149 149 149 LEU LEU C . n 
C 1 150 PRO 150 150 150 PRO PRO C . n 
C 1 151 MET 151 151 151 MET MET C . n 
C 1 152 SER 152 152 152 SER SER C . n 
C 1 153 ALA 153 153 153 ALA ALA C . n 
C 1 154 LYS 154 154 154 LYS LYS C . n 
C 1 155 SER 155 155 ?   ?   ?   C . n 
D 1 1   MET 1   1   ?   ?   ?   D . n 
D 1 2   ALA 2   2   ?   ?   ?   D . n 
D 1 3   ALA 3   3   ?   ?   ?   D . n 
D 1 4   GLY 4   4   ?   ?   ?   D . n 
D 1 5   SER 5   5   ?   ?   ?   D . n 
D 1 6   ILE 6   6   ?   ?   ?   D . n 
D 1 7   THR 7   7   ?   ?   ?   D . n 
D 1 8   THR 8   8   ?   ?   ?   D . n 
D 1 9   LEU 9   9   ?   ?   ?   D . n 
D 1 10  PRO 10  10  ?   ?   ?   D . n 
D 1 11  ALA 11  11  ?   ?   ?   D . n 
D 1 12  LEU 12  12  ?   ?   ?   D . n 
D 1 13  PRO 13  13  ?   ?   ?   D . n 
D 1 14  GLU 14  14  ?   ?   ?   D . n 
D 1 15  ASP 15  15  ?   ?   ?   D . n 
D 1 16  GLY 16  16  ?   ?   ?   D . n 
D 1 17  GLY 17  17  ?   ?   ?   D . n 
D 1 18  SER 18  18  ?   ?   ?   D . n 
D 1 19  GLY 19  19  ?   ?   ?   D . n 
D 1 20  ALA 20  20  ?   ?   ?   D . n 
D 1 21  PHE 21  21  21  PHE PHE D . n 
D 1 22  PRO 22  22  22  PRO PRO D . n 
D 1 23  PRO 23  23  23  PRO PRO D . n 
D 1 24  GLY 24  24  24  GLY GLY D . n 
D 1 25  HIS 25  25  25  HIS HIS D . n 
D 1 26  PHE 26  26  26  PHE PHE D . n 
D 1 27  LYS 27  27  27  LYS LYS D . n 
D 1 28  ASP 28  28  28  ASP ASP D . n 
D 1 29  PRO 29  29  29  PRO PRO D . n 
D 1 30  LYS 30  30  30  LYS LYS D . n 
D 1 31  ARG 31  31  31  ARG ARG D . n 
D 1 32  LEU 32  32  32  LEU LEU D . n 
D 1 33  TYR 33  33  33  TYR TYR D . n 
D 1 34  CYS 34  34  34  CYS CYS D . n 
D 1 35  LYS 35  35  35  LYS LYS D . n 
D 1 36  ASN 36  36  36  ASN ASN D . n 
D 1 37  GLY 37  37  37  GLY GLY D . n 
D 1 38  GLY 38  38  38  GLY GLY D . n 
D 1 39  PHE 39  39  39  PHE PHE D . n 
D 1 40  PHE 40  40  40  PHE PHE D . n 
D 1 41  LEU 41  41  41  LEU LEU D . n 
D 1 42  ARG 42  42  42  ARG ARG D . n 
D 1 43  ILE 43  43  43  ILE ILE D . n 
D 1 44  HIS 44  44  44  HIS HIS D . n 
D 1 45  PRO 45  45  45  PRO PRO D . n 
D 1 46  ASP 46  46  46  ASP ASP D . n 
D 1 47  GLY 47  47  47  GLY GLY D . n 
D 1 48  ARG 48  48  48  ARG ARG D . n 
D 1 49  VAL 49  49  49  VAL VAL D . n 
D 1 50  ASP 50  50  50  ASP ASP D . n 
D 1 51  GLY 51  51  51  GLY GLY D . n 
D 1 52  VAL 52  52  52  VAL VAL D . n 
D 1 53  ARG 53  53  53  ARG ARG D . n 
D 1 54  GLU 54  54  54  GLU GLU D . n 
D 1 55  LYS 55  55  55  LYS LYS D . n 
D 1 56  SER 56  56  56  SER SER D . n 
D 1 57  ASP 57  57  57  ASP ASP D . n 
D 1 58  PRO 58  58  58  PRO PRO D . n 
D 1 59  HIS 59  59  59  HIS HIS D . n 
D 1 60  ILE 60  60  60  ILE ILE D . n 
D 1 61  LYS 61  61  61  LYS LYS D . n 
D 1 62  LEU 62  62  62  LEU LEU D . n 
D 1 63  GLN 63  63  63  GLN GLN D . n 
D 1 64  LEU 64  64  64  LEU LEU D . n 
D 1 65  GLN 65  65  65  GLN GLN D . n 
D 1 66  ALA 66  66  66  ALA ALA D . n 
D 1 67  GLU 67  67  67  GLU GLU D . n 
D 1 68  GLU 68  68  68  GLU GLU D . n 
D 1 69  ARG 69  69  69  ARG ARG D . n 
D 1 70  GLY 70  70  70  GLY GLY D . n 
D 1 71  VAL 71  71  71  VAL VAL D . n 
D 1 72  VAL 72  72  72  VAL VAL D . n 
D 1 73  SER 73  73  73  SER SER D . n 
D 1 74  ILE 74  74  74  ILE ILE D . n 
D 1 75  LYS 75  75  75  LYS LYS D . n 
D 1 76  GLY 76  76  76  GLY GLY D . n 
D 1 77  VAL 77  77  77  VAL VAL D . n 
D 1 78  SER 78  78  78  SER SER D . n 
D 1 79  ALA 79  79  79  ALA ALA D . n 
D 1 80  ASN 80  80  80  ASN ASN D . n 
D 1 81  ARG 81  81  81  ARG ARG D . n 
D 1 82  TYR 82  82  82  TYR TYR D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  ALA 84  84  84  ALA ALA D . n 
D 1 85  MET 85  85  85  MET MET D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  GLU 87  87  87  GLU GLU D . n 
D 1 88  ASP 88  88  88  ASP ASP D . n 
D 1 89  GLY 89  89  89  GLY GLY D . n 
D 1 90  ARG 90  90  90  ARG ARG D . n 
D 1 91  LEU 91  91  91  LEU LEU D . n 
D 1 92  LEU 92  92  92  LEU LEU D . n 
D 1 93  ALA 93  93  93  ALA ALA D . n 
D 1 94  SER 94  94  94  SER SER D . n 
D 1 95  LYS 95  95  95  LYS LYS D . n 
D 1 96  SER 96  96  96  SER SER D . n 
D 1 97  VAL 97  97  97  VAL VAL D . n 
D 1 98  THR 98  98  98  THR THR D . n 
D 1 99  ASP 99  99  99  ASP ASP D . n 
D 1 100 GLU 100 100 100 GLU GLU D . n 
D 1 101 CYS 101 101 101 CYS CYS D . n 
D 1 102 PHE 102 102 102 PHE PHE D . n 
D 1 103 PHE 103 103 103 PHE PHE D . n 
D 1 104 PHE 104 104 104 PHE PHE D . n 
D 1 105 GLU 105 105 105 GLU GLU D . n 
D 1 106 ARG 106 106 106 ARG ARG D . n 
D 1 107 LEU 107 107 107 LEU LEU D . n 
D 1 108 GLU 108 108 108 GLU GLU D . n 
D 1 109 SER 109 109 109 SER SER D . n 
D 1 110 ASN 110 110 110 ASN ASN D . n 
D 1 111 ASN 111 111 111 ASN ASN D . n 
D 1 112 TYR 112 112 112 TYR TYR D . n 
D 1 113 ASN 113 113 113 ASN ASN D . n 
D 1 114 THR 114 114 114 THR THR D . n 
D 1 115 TYR 115 115 115 TYR TYR D . n 
D 1 116 ARG 116 116 116 ARG ARG D . n 
D 1 117 SER 117 117 117 SER SER D . n 
D 1 118 ARG 118 118 118 ARG ARG D . n 
D 1 119 LYS 119 119 119 LYS LYS D . n 
D 1 120 TYR 120 120 120 TYR TYR D . n 
D 1 121 THR 121 121 121 THR THR D . n 
D 1 122 SER 122 122 122 SER SER D . n 
D 1 123 TRP 123 123 123 TRP TRP D . n 
D 1 124 TYR 124 124 124 TYR TYR D . n 
D 1 125 VAL 125 125 125 VAL VAL D . n 
D 1 126 ALA 126 126 126 ALA ALA D . n 
D 1 127 LEU 127 127 127 LEU LEU D . n 
D 1 128 LYS 128 128 128 LYS LYS D . n 
D 1 129 ARG 129 129 129 ARG ARG D . n 
D 1 130 THR 130 130 130 THR THR D . n 
D 1 131 GLY 131 131 131 GLY GLY D . n 
D 1 132 GLN 132 132 132 GLN GLN D . n 
D 1 133 TYR 133 133 133 TYR TYR D . n 
D 1 134 LYS 134 134 134 LYS LYS D . n 
D 1 135 LEU 135 135 135 LEU LEU D . n 
D 1 136 GLY 136 136 136 GLY GLY D . n 
D 1 137 SER 137 137 137 SER SER D . n 
D 1 138 LYS 138 138 138 LYS LYS D . n 
D 1 139 THR 139 139 139 THR THR D . n 
D 1 140 GLY 140 140 140 GLY GLY D . n 
D 1 141 PRO 141 141 141 PRO PRO D . n 
D 1 142 GLY 142 142 142 GLY GLY D . n 
D 1 143 GLN 143 143 143 GLN GLN D . n 
D 1 144 LYS 144 144 144 LYS LYS D . n 
D 1 145 ALA 145 145 145 ALA ALA D . n 
D 1 146 ILE 146 146 146 ILE ILE D . n 
D 1 147 LEU 147 147 147 LEU LEU D . n 
D 1 148 PHE 148 148 148 PHE PHE D . n 
D 1 149 LEU 149 149 149 LEU LEU D . n 
D 1 150 PRO 150 150 150 PRO PRO D . n 
D 1 151 MET 151 151 151 MET MET D . n 
D 1 152 SER 152 152 152 SER SER D . n 
D 1 153 ALA 153 153 153 ALA ALA D . n 
D 1 154 LYS 154 154 154 LYS LYS D . n 
D 1 155 SER 155 155 ?   ?   ?   D . n 
E 2 1   ASN 1   147 ?   ?   ?   E . n 
E 2 2   SER 2   148 ?   ?   ?   E . n 
E 2 3   ASN 3   149 ?   ?   ?   E . n 
E 2 4   ASN 4   150 150 ASN ASN E . n 
E 2 5   LYS 5   151 151 LYS LYS E . n 
E 2 6   ARG 6   152 152 ARG ARG E . n 
E 2 7   ALA 7   153 153 ALA ALA E . n 
E 2 8   PRO 8   154 154 PRO PRO E . n 
E 2 9   TYR 9   155 155 TYR TYR E . n 
E 2 10  TRP 10  156 156 TRP TRP E . n 
E 2 11  THR 11  157 157 THR THR E . n 
E 2 12  ASN 12  158 158 ASN ASN E . n 
E 2 13  THR 13  159 159 THR THR E . n 
E 2 14  GLU 14  160 160 GLU GLU E . n 
E 2 15  LYS 15  161 161 LYS LYS E . n 
E 2 16  MET 16  162 162 MET MET E . n 
E 2 17  GLU 17  163 163 GLU GLU E . n 
E 2 18  LYS 18  164 164 LYS LYS E . n 
E 2 19  ARG 19  165 165 ARG ARG E . n 
E 2 20  LEU 20  166 166 LEU LEU E . n 
E 2 21  HIS 21  167 167 HIS HIS E . n 
E 2 22  ALA 22  168 168 ALA ALA E . n 
E 2 23  VAL 23  169 169 VAL VAL E . n 
E 2 24  PRO 24  170 170 PRO PRO E . n 
E 2 25  ALA 25  171 171 ALA ALA E . n 
E 2 26  ALA 26  172 172 ALA ALA E . n 
E 2 27  ASN 27  173 173 ASN ASN E . n 
E 2 28  THR 28  174 174 THR THR E . n 
E 2 29  VAL 29  175 175 VAL VAL E . n 
E 2 30  LYS 30  176 176 LYS LYS E . n 
E 2 31  PHE 31  177 177 PHE PHE E . n 
E 2 32  ARG 32  178 178 ARG ARG E . n 
E 2 33  CYS 33  179 179 CYS CYS E . n 
E 2 34  PRO 34  180 180 PRO PRO E . n 
E 2 35  ALA 35  181 181 ALA ALA E . n 
E 2 36  GLY 36  182 182 GLY GLY E . n 
E 2 37  GLY 37  183 183 GLY GLY E . n 
E 2 38  ASN 38  184 184 ASN ASN E . n 
E 2 39  PRO 39  185 185 PRO PRO E . n 
E 2 40  MET 40  186 186 MET MET E . n 
E 2 41  PRO 41  187 187 PRO PRO E . n 
E 2 42  THR 42  188 188 THR THR E . n 
E 2 43  MET 43  189 189 MET MET E . n 
E 2 44  ARG 44  190 190 ARG ARG E . n 
E 2 45  TRP 45  191 191 TRP TRP E . n 
E 2 46  LEU 46  192 192 LEU LEU E . n 
E 2 47  LYS 47  193 193 LYS LYS E . n 
E 2 48  ASN 48  194 194 ASN ASN E . n 
E 2 49  GLY 49  195 195 GLY GLY E . n 
E 2 50  LYS 50  196 196 LYS LYS E . n 
E 2 51  GLU 51  197 197 GLU GLU E . n 
E 2 52  PHE 52  198 198 PHE PHE E . n 
E 2 53  LYS 53  199 199 LYS LYS E . n 
E 2 54  GLN 54  200 200 GLN GLN E . n 
E 2 55  GLU 55  201 201 GLU GLU E . n 
E 2 56  HIS 56  202 202 HIS HIS E . n 
E 2 57  ARG 57  203 203 ARG ARG E . n 
E 2 58  ILE 58  204 204 ILE ILE E . n 
E 2 59  GLY 59  205 205 GLY GLY E . n 
E 2 60  GLY 60  206 206 GLY GLY E . n 
E 2 61  TYR 61  207 207 TYR TYR E . n 
E 2 62  LYS 62  208 208 LYS LYS E . n 
E 2 63  VAL 63  209 209 VAL VAL E . n 
E 2 64  ARG 64  210 210 ARG ARG E . n 
E 2 65  ASN 65  211 211 ASN ASN E . n 
E 2 66  GLN 66  212 212 GLN GLN E . n 
E 2 67  HIS 67  213 213 HIS HIS E . n 
E 2 68  TRP 68  214 214 TRP TRP E . n 
E 2 69  SER 69  215 215 SER SER E . n 
E 2 70  LEU 70  216 216 LEU LEU E . n 
E 2 71  ILE 71  217 217 ILE ILE E . n 
E 2 72  MET 72  218 218 MET MET E . n 
E 2 73  GLU 73  219 219 GLU GLU E . n 
E 2 74  SER 74  220 220 SER SER E . n 
E 2 75  VAL 75  221 221 VAL VAL E . n 
E 2 76  VAL 76  222 222 VAL VAL E . n 
E 2 77  PRO 77  223 223 PRO PRO E . n 
E 2 78  SER 78  224 224 SER SER E . n 
E 2 79  ASP 79  225 225 ASP ASP E . n 
E 2 80  LYS 80  226 226 LYS LYS E . n 
E 2 81  GLY 81  227 227 GLY GLY E . n 
E 2 82  ASN 82  228 228 ASN ASN E . n 
E 2 83  TYR 83  229 229 TYR TYR E . n 
E 2 84  THR 84  230 230 THR THR E . n 
E 2 85  CYS 85  231 231 CYS CYS E . n 
E 2 86  VAL 86  232 232 VAL VAL E . n 
E 2 87  VAL 87  233 233 VAL VAL E . n 
E 2 88  GLU 88  234 234 GLU GLU E . n 
E 2 89  ASN 89  235 235 ASN ASN E . n 
E 2 90  GLU 90  236 236 GLU GLU E . n 
E 2 91  TYR 91  237 237 TYR TYR E . n 
E 2 92  GLY 92  238 238 GLY GLY E . n 
E 2 93  SER 93  239 239 SER SER E . n 
E 2 94  ILE 94  240 240 ILE ILE E . n 
E 2 95  ASN 95  241 241 ASN ASN E . n 
E 2 96  HIS 96  242 242 HIS HIS E . n 
E 2 97  THR 97  243 243 THR THR E . n 
E 2 98  TYR 98  244 244 TYR TYR E . n 
E 2 99  HIS 99  245 245 HIS HIS E . n 
E 2 100 LEU 100 246 246 LEU LEU E . n 
E 2 101 ASP 101 247 247 ASP ASP E . n 
E 2 102 VAL 102 248 248 VAL VAL E . n 
E 2 103 VAL 103 249 249 VAL VAL E . n 
E 2 104 GLU 104 250 250 GLU GLU E . n 
E 2 105 ARG 105 251 251 ARG ARG E . n 
E 2 106 TRP 106 252 252 TRP TRP E . n 
E 2 107 PRO 107 253 253 PRO PRO E . n 
E 2 108 HIS 108 254 254 HIS HIS E . n 
E 2 109 ARG 109 255 255 ARG ARG E . n 
E 2 110 PRO 110 256 256 PRO PRO E . n 
E 2 111 ILE 111 257 257 ILE ILE E . n 
E 2 112 LEU 112 258 258 LEU LEU E . n 
E 2 113 GLN 113 259 259 GLN GLN E . n 
E 2 114 ALA 114 260 260 ALA ALA E . n 
E 2 115 GLY 115 261 261 GLY GLY E . n 
E 2 116 LEU 116 262 262 LEU LEU E . n 
E 2 117 PRO 117 263 263 PRO PRO E . n 
E 2 118 ALA 118 264 264 ALA ALA E . n 
E 2 119 ASN 119 265 265 ASN ASN E . n 
E 2 120 ALA 120 266 266 ALA ALA E . n 
E 2 121 SER 121 267 267 SER SER E . n 
E 2 122 THR 122 268 268 THR THR E . n 
E 2 123 VAL 123 269 269 VAL VAL E . n 
E 2 124 VAL 124 270 270 VAL VAL E . n 
E 2 125 GLY 125 271 271 GLY GLY E . n 
E 2 126 GLY 126 272 272 GLY GLY E . n 
E 2 127 ASP 127 273 273 ASP ASP E . n 
E 2 128 VAL 128 274 274 VAL VAL E . n 
E 2 129 GLU 129 275 275 GLU GLU E . n 
E 2 130 PHE 130 276 276 PHE PHE E . n 
E 2 131 VAL 131 277 277 VAL VAL E . n 
E 2 132 CYS 132 278 278 CYS CYS E . n 
E 2 133 LYS 133 279 279 LYS LYS E . n 
E 2 134 VAL 134 280 280 VAL VAL E . n 
E 2 135 TYR 135 281 281 TYR TYR E . n 
E 2 136 SER 136 282 282 SER SER E . n 
E 2 137 ASP 137 283 283 ASP ASP E . n 
E 2 138 ALA 138 284 284 ALA ALA E . n 
E 2 139 GLN 139 285 285 GLN GLN E . n 
E 2 140 PRO 140 286 286 PRO PRO E . n 
E 2 141 HIS 141 287 287 HIS HIS E . n 
E 2 142 ILE 142 288 288 ILE ILE E . n 
E 2 143 GLN 143 289 289 GLN GLN E . n 
E 2 144 TRP 144 290 290 TRP TRP E . n 
E 2 145 ILE 145 291 291 ILE ILE E . n 
E 2 146 LYS 146 292 292 LYS LYS E . n 
E 2 147 HIS 147 293 293 HIS HIS E . n 
E 2 148 VAL 148 294 294 VAL VAL E . n 
E 2 149 GLU 149 295 ?   ?   ?   E . n 
E 2 150 LYS 150 296 ?   ?   ?   E . n 
E 2 151 ASN 151 297 ?   ?   ?   E . n 
E 2 152 GLY 152 298 ?   ?   ?   E . n 
E 2 153 SER 153 299 ?   ?   ?   E . n 
E 2 154 LYS 154 300 ?   ?   ?   E . n 
E 2 155 TYR 155 301 ?   ?   ?   E . n 
E 2 156 GLY 156 302 ?   ?   ?   E . n 
E 2 157 PRO 157 303 ?   ?   ?   E . n 
E 2 158 ASP 158 304 ?   ?   ?   E . n 
E 2 159 GLY 159 305 ?   ?   ?   E . n 
E 2 160 LEU 160 306 ?   ?   ?   E . n 
E 2 161 PRO 161 307 307 PRO PRO E . n 
E 2 162 TYR 162 308 308 TYR TYR E . n 
E 2 163 LEU 163 309 309 LEU LEU E . n 
E 2 164 LYS 164 310 310 LYS LYS E . n 
E 2 165 VAL 165 311 311 VAL VAL E . n 
E 2 166 LEU 166 312 312 LEU LEU E . n 
E 2 167 LYS 167 313 313 LYS LYS E . n 
E 2 168 ALA 168 314 314 ALA ALA E . n 
E 2 169 ALA 169 315 315 ALA ALA E . n 
E 2 170 GLY 170 316 316 GLY GLY E . n 
E 2 171 VAL 171 317 317 VAL VAL E . n 
E 2 172 ASN 172 318 318 ASN ASN E . n 
E 2 173 THR 173 319 319 THR THR E . n 
E 2 174 THR 174 320 320 THR THR E . n 
E 2 175 ASP 175 321 321 ASP ASP E . n 
E 2 176 LYS 176 322 322 LYS LYS E . n 
E 2 177 GLU 177 323 323 GLU GLU E . n 
E 2 178 ILE 178 324 324 ILE ILE E . n 
E 2 179 GLU 179 325 325 GLU GLU E . n 
E 2 180 VAL 180 326 326 VAL VAL E . n 
E 2 181 LEU 181 327 327 LEU LEU E . n 
E 2 182 TYR 182 328 328 TYR TYR E . n 
E 2 183 ILE 183 329 329 ILE ILE E . n 
E 2 184 ARG 184 330 330 ARG ARG E . n 
E 2 185 ASN 185 331 331 ASN ASN E . n 
E 2 186 VAL 186 332 332 VAL VAL E . n 
E 2 187 THR 187 333 333 THR THR E . n 
E 2 188 PHE 188 334 334 PHE PHE E . n 
E 2 189 GLU 189 335 335 GLU GLU E . n 
E 2 190 ASP 190 336 336 ASP ASP E . n 
E 2 191 ALA 191 337 337 ALA ALA E . n 
E 2 192 GLY 192 338 338 GLY GLY E . n 
E 2 193 GLU 193 339 339 GLU GLU E . n 
E 2 194 TYR 194 340 340 TYR TYR E . n 
E 2 195 THR 195 341 341 THR THR E . n 
E 2 196 CYS 196 342 342 CYS CYS E . n 
E 2 197 LEU 197 343 343 LEU LEU E . n 
E 2 198 ALA 198 344 344 ALA ALA E . n 
E 2 199 GLY 199 345 345 GLY GLY E . n 
E 2 200 ASN 200 346 346 ASN ASN E . n 
E 2 201 SER 201 347 347 SER SER E . n 
E 2 202 ILE 202 348 348 ILE ILE E . n 
E 2 203 GLY 203 349 349 GLY GLY E . n 
E 2 204 ILE 204 350 350 ILE ILE E . n 
E 2 205 SER 205 351 351 SER SER E . n 
E 2 206 PHE 206 352 352 PHE PHE E . n 
E 2 207 HIS 207 353 353 HIS HIS E . n 
E 2 208 SER 208 354 354 SER SER E . n 
E 2 209 ALA 209 355 355 ALA ALA E . n 
E 2 210 TRP 210 356 356 TRP TRP E . n 
E 2 211 LEU 211 357 357 LEU LEU E . n 
E 2 212 THR 212 358 358 THR THR E . n 
E 2 213 VAL 213 359 359 VAL VAL E . n 
E 2 214 LEU 214 360 360 LEU LEU E . n 
E 2 215 PRO 215 361 361 PRO PRO E . n 
E 2 216 ALA 216 362 ?   ?   ?   E . n 
E 2 217 PRO 217 363 ?   ?   ?   E . n 
E 2 218 GLY 218 364 ?   ?   ?   E . n 
E 2 219 ARG 219 365 ?   ?   ?   E . n 
E 2 220 GLU 220 366 ?   ?   ?   E . n 
F 2 1   ASN 1   147 ?   ?   ?   F . n 
F 2 2   SER 2   148 ?   ?   ?   F . n 
F 2 3   ASN 3   149 ?   ?   ?   F . n 
F 2 4   ASN 4   150 150 ASN ASN F . n 
F 2 5   LYS 5   151 151 LYS LYS F . n 
F 2 6   ARG 6   152 152 ARG ARG F . n 
F 2 7   ALA 7   153 153 ALA ALA F . n 
F 2 8   PRO 8   154 154 PRO PRO F . n 
F 2 9   TYR 9   155 155 TYR TYR F . n 
F 2 10  TRP 10  156 156 TRP TRP F . n 
F 2 11  THR 11  157 157 THR THR F . n 
F 2 12  ASN 12  158 158 ASN ASN F . n 
F 2 13  THR 13  159 159 THR THR F . n 
F 2 14  GLU 14  160 160 GLU GLU F . n 
F 2 15  LYS 15  161 161 LYS LYS F . n 
F 2 16  MET 16  162 162 MET MET F . n 
F 2 17  GLU 17  163 163 GLU GLU F . n 
F 2 18  LYS 18  164 164 LYS LYS F . n 
F 2 19  ARG 19  165 165 ARG ARG F . n 
F 2 20  LEU 20  166 166 LEU LEU F . n 
F 2 21  HIS 21  167 167 HIS HIS F . n 
F 2 22  ALA 22  168 168 ALA ALA F . n 
F 2 23  VAL 23  169 169 VAL VAL F . n 
F 2 24  PRO 24  170 170 PRO PRO F . n 
F 2 25  ALA 25  171 171 ALA ALA F . n 
F 2 26  ALA 26  172 172 ALA ALA F . n 
F 2 27  ASN 27  173 173 ASN ASN F . n 
F 2 28  THR 28  174 174 THR THR F . n 
F 2 29  VAL 29  175 175 VAL VAL F . n 
F 2 30  LYS 30  176 176 LYS LYS F . n 
F 2 31  PHE 31  177 177 PHE PHE F . n 
F 2 32  ARG 32  178 178 ARG ARG F . n 
F 2 33  CYS 33  179 179 CYS CYS F . n 
F 2 34  PRO 34  180 180 PRO PRO F . n 
F 2 35  ALA 35  181 181 ALA ALA F . n 
F 2 36  GLY 36  182 182 GLY GLY F . n 
F 2 37  GLY 37  183 183 GLY GLY F . n 
F 2 38  ASN 38  184 184 ASN ASN F . n 
F 2 39  PRO 39  185 185 PRO PRO F . n 
F 2 40  MET 40  186 186 MET MET F . n 
F 2 41  PRO 41  187 187 PRO PRO F . n 
F 2 42  THR 42  188 188 THR THR F . n 
F 2 43  MET 43  189 189 MET MET F . n 
F 2 44  ARG 44  190 190 ARG ARG F . n 
F 2 45  TRP 45  191 191 TRP TRP F . n 
F 2 46  LEU 46  192 192 LEU LEU F . n 
F 2 47  LYS 47  193 193 LYS LYS F . n 
F 2 48  ASN 48  194 194 ASN ASN F . n 
F 2 49  GLY 49  195 195 GLY GLY F . n 
F 2 50  LYS 50  196 196 LYS LYS F . n 
F 2 51  GLU 51  197 197 GLU GLU F . n 
F 2 52  PHE 52  198 198 PHE PHE F . n 
F 2 53  LYS 53  199 199 LYS LYS F . n 
F 2 54  GLN 54  200 200 GLN GLN F . n 
F 2 55  GLU 55  201 201 GLU GLU F . n 
F 2 56  HIS 56  202 202 HIS HIS F . n 
F 2 57  ARG 57  203 203 ARG ARG F . n 
F 2 58  ILE 58  204 204 ILE ILE F . n 
F 2 59  GLY 59  205 205 GLY GLY F . n 
F 2 60  GLY 60  206 206 GLY GLY F . n 
F 2 61  TYR 61  207 207 TYR TYR F . n 
F 2 62  LYS 62  208 208 LYS LYS F . n 
F 2 63  VAL 63  209 209 VAL VAL F . n 
F 2 64  ARG 64  210 210 ARG ARG F . n 
F 2 65  ASN 65  211 211 ASN ASN F . n 
F 2 66  GLN 66  212 212 GLN GLN F . n 
F 2 67  HIS 67  213 213 HIS HIS F . n 
F 2 68  TRP 68  214 214 TRP TRP F . n 
F 2 69  SER 69  215 215 SER SER F . n 
F 2 70  LEU 70  216 216 LEU LEU F . n 
F 2 71  ILE 71  217 217 ILE ILE F . n 
F 2 72  MET 72  218 218 MET MET F . n 
F 2 73  GLU 73  219 219 GLU GLU F . n 
F 2 74  SER 74  220 220 SER SER F . n 
F 2 75  VAL 75  221 221 VAL VAL F . n 
F 2 76  VAL 76  222 222 VAL VAL F . n 
F 2 77  PRO 77  223 223 PRO PRO F . n 
F 2 78  SER 78  224 224 SER SER F . n 
F 2 79  ASP 79  225 225 ASP ASP F . n 
F 2 80  LYS 80  226 226 LYS LYS F . n 
F 2 81  GLY 81  227 227 GLY GLY F . n 
F 2 82  ASN 82  228 228 ASN ASN F . n 
F 2 83  TYR 83  229 229 TYR TYR F . n 
F 2 84  THR 84  230 230 THR THR F . n 
F 2 85  CYS 85  231 231 CYS CYS F . n 
F 2 86  VAL 86  232 232 VAL VAL F . n 
F 2 87  VAL 87  233 233 VAL VAL F . n 
F 2 88  GLU 88  234 234 GLU GLU F . n 
F 2 89  ASN 89  235 235 ASN ASN F . n 
F 2 90  GLU 90  236 236 GLU GLU F . n 
F 2 91  TYR 91  237 237 TYR TYR F . n 
F 2 92  GLY 92  238 238 GLY GLY F . n 
F 2 93  SER 93  239 239 SER SER F . n 
F 2 94  ILE 94  240 240 ILE ILE F . n 
F 2 95  ASN 95  241 241 ASN ASN F . n 
F 2 96  HIS 96  242 242 HIS HIS F . n 
F 2 97  THR 97  243 243 THR THR F . n 
F 2 98  TYR 98  244 244 TYR TYR F . n 
F 2 99  HIS 99  245 245 HIS HIS F . n 
F 2 100 LEU 100 246 246 LEU LEU F . n 
F 2 101 ASP 101 247 247 ASP ASP F . n 
F 2 102 VAL 102 248 248 VAL VAL F . n 
F 2 103 VAL 103 249 249 VAL VAL F . n 
F 2 104 GLU 104 250 250 GLU GLU F . n 
F 2 105 ARG 105 251 251 ARG ARG F . n 
F 2 106 TRP 106 252 252 TRP TRP F . n 
F 2 107 PRO 107 253 253 PRO PRO F . n 
F 2 108 HIS 108 254 254 HIS HIS F . n 
F 2 109 ARG 109 255 255 ARG ARG F . n 
F 2 110 PRO 110 256 256 PRO PRO F . n 
F 2 111 ILE 111 257 257 ILE ILE F . n 
F 2 112 LEU 112 258 258 LEU LEU F . n 
F 2 113 GLN 113 259 259 GLN GLN F . n 
F 2 114 ALA 114 260 260 ALA ALA F . n 
F 2 115 GLY 115 261 261 GLY GLY F . n 
F 2 116 LEU 116 262 262 LEU LEU F . n 
F 2 117 PRO 117 263 263 PRO PRO F . n 
F 2 118 ALA 118 264 264 ALA ALA F . n 
F 2 119 ASN 119 265 265 ASN ASN F . n 
F 2 120 ALA 120 266 266 ALA ALA F . n 
F 2 121 SER 121 267 267 SER SER F . n 
F 2 122 THR 122 268 268 THR THR F . n 
F 2 123 VAL 123 269 269 VAL VAL F . n 
F 2 124 VAL 124 270 270 VAL VAL F . n 
F 2 125 GLY 125 271 271 GLY GLY F . n 
F 2 126 GLY 126 272 272 GLY GLY F . n 
F 2 127 ASP 127 273 273 ASP ASP F . n 
F 2 128 VAL 128 274 274 VAL VAL F . n 
F 2 129 GLU 129 275 275 GLU GLU F . n 
F 2 130 PHE 130 276 276 PHE PHE F . n 
F 2 131 VAL 131 277 277 VAL VAL F . n 
F 2 132 CYS 132 278 278 CYS CYS F . n 
F 2 133 LYS 133 279 279 LYS LYS F . n 
F 2 134 VAL 134 280 280 VAL VAL F . n 
F 2 135 TYR 135 281 281 TYR TYR F . n 
F 2 136 SER 136 282 282 SER SER F . n 
F 2 137 ASP 137 283 283 ASP ASP F . n 
F 2 138 ALA 138 284 284 ALA ALA F . n 
F 2 139 GLN 139 285 285 GLN GLN F . n 
F 2 140 PRO 140 286 286 PRO PRO F . n 
F 2 141 HIS 141 287 287 HIS HIS F . n 
F 2 142 ILE 142 288 288 ILE ILE F . n 
F 2 143 GLN 143 289 289 GLN GLN F . n 
F 2 144 TRP 144 290 290 TRP TRP F . n 
F 2 145 ILE 145 291 291 ILE ILE F . n 
F 2 146 LYS 146 292 292 LYS LYS F . n 
F 2 147 HIS 147 293 293 HIS HIS F . n 
F 2 148 VAL 148 294 294 VAL VAL F . n 
F 2 149 GLU 149 295 ?   ?   ?   F . n 
F 2 150 LYS 150 296 ?   ?   ?   F . n 
F 2 151 ASN 151 297 ?   ?   ?   F . n 
F 2 152 GLY 152 298 ?   ?   ?   F . n 
F 2 153 SER 153 299 ?   ?   ?   F . n 
F 2 154 LYS 154 300 ?   ?   ?   F . n 
F 2 155 TYR 155 301 ?   ?   ?   F . n 
F 2 156 GLY 156 302 ?   ?   ?   F . n 
F 2 157 PRO 157 303 ?   ?   ?   F . n 
F 2 158 ASP 158 304 ?   ?   ?   F . n 
F 2 159 GLY 159 305 ?   ?   ?   F . n 
F 2 160 LEU 160 306 ?   ?   ?   F . n 
F 2 161 PRO 161 307 307 PRO PRO F . n 
F 2 162 TYR 162 308 308 TYR TYR F . n 
F 2 163 LEU 163 309 309 LEU LEU F . n 
F 2 164 LYS 164 310 310 LYS LYS F . n 
F 2 165 VAL 165 311 311 VAL VAL F . n 
F 2 166 LEU 166 312 312 LEU LEU F . n 
F 2 167 LYS 167 313 313 LYS LYS F . n 
F 2 168 ALA 168 314 314 ALA ALA F . n 
F 2 169 ALA 169 315 315 ALA ALA F . n 
F 2 170 GLY 170 316 316 GLY GLY F . n 
F 2 171 VAL 171 317 317 VAL VAL F . n 
F 2 172 ASN 172 318 318 ASN ASN F . n 
F 2 173 THR 173 319 319 THR THR F . n 
F 2 174 THR 174 320 320 THR THR F . n 
F 2 175 ASP 175 321 321 ASP ASP F . n 
F 2 176 LYS 176 322 322 LYS LYS F . n 
F 2 177 GLU 177 323 323 GLU GLU F . n 
F 2 178 ILE 178 324 324 ILE ILE F . n 
F 2 179 GLU 179 325 325 GLU GLU F . n 
F 2 180 VAL 180 326 326 VAL VAL F . n 
F 2 181 LEU 181 327 327 LEU LEU F . n 
F 2 182 TYR 182 328 328 TYR TYR F . n 
F 2 183 ILE 183 329 329 ILE ILE F . n 
F 2 184 ARG 184 330 330 ARG ARG F . n 
F 2 185 ASN 185 331 331 ASN ASN F . n 
F 2 186 VAL 186 332 332 VAL VAL F . n 
F 2 187 THR 187 333 333 THR THR F . n 
F 2 188 PHE 188 334 334 PHE PHE F . n 
F 2 189 GLU 189 335 335 GLU GLU F . n 
F 2 190 ASP 190 336 336 ASP ASP F . n 
F 2 191 ALA 191 337 337 ALA ALA F . n 
F 2 192 GLY 192 338 338 GLY GLY F . n 
F 2 193 GLU 193 339 339 GLU GLU F . n 
F 2 194 TYR 194 340 340 TYR TYR F . n 
F 2 195 THR 195 341 341 THR THR F . n 
F 2 196 CYS 196 342 342 CYS CYS F . n 
F 2 197 LEU 197 343 343 LEU LEU F . n 
F 2 198 ALA 198 344 344 ALA ALA F . n 
F 2 199 GLY 199 345 345 GLY GLY F . n 
F 2 200 ASN 200 346 346 ASN ASN F . n 
F 2 201 SER 201 347 347 SER SER F . n 
F 2 202 ILE 202 348 348 ILE ILE F . n 
F 2 203 GLY 203 349 349 GLY GLY F . n 
F 2 204 ILE 204 350 350 ILE ILE F . n 
F 2 205 SER 205 351 351 SER SER F . n 
F 2 206 PHE 206 352 352 PHE PHE F . n 
F 2 207 HIS 207 353 353 HIS HIS F . n 
F 2 208 SER 208 354 354 SER SER F . n 
F 2 209 ALA 209 355 355 ALA ALA F . n 
F 2 210 TRP 210 356 356 TRP TRP F . n 
F 2 211 LEU 211 357 357 LEU LEU F . n 
F 2 212 THR 212 358 358 THR THR F . n 
F 2 213 VAL 213 359 359 VAL VAL F . n 
F 2 214 LEU 214 360 360 LEU LEU F . n 
F 2 215 PRO 215 361 361 PRO PRO F . n 
F 2 216 ALA 216 362 ?   ?   ?   F . n 
F 2 217 PRO 217 363 ?   ?   ?   F . n 
F 2 218 GLY 218 364 ?   ?   ?   F . n 
F 2 219 ARG 219 365 ?   ?   ?   F . n 
F 2 220 GLU 220 366 ?   ?   ?   F . n 
G 2 1   ASN 1   147 ?   ?   ?   G . n 
G 2 2   SER 2   148 ?   ?   ?   G . n 
G 2 3   ASN 3   149 ?   ?   ?   G . n 
G 2 4   ASN 4   150 150 ASN ASN G . n 
G 2 5   LYS 5   151 151 LYS LYS G . n 
G 2 6   ARG 6   152 152 ARG ARG G . n 
G 2 7   ALA 7   153 153 ALA ALA G . n 
G 2 8   PRO 8   154 154 PRO PRO G . n 
G 2 9   TYR 9   155 155 TYR TYR G . n 
G 2 10  TRP 10  156 156 TRP TRP G . n 
G 2 11  THR 11  157 157 THR THR G . n 
G 2 12  ASN 12  158 158 ASN ASN G . n 
G 2 13  THR 13  159 159 THR THR G . n 
G 2 14  GLU 14  160 160 GLU GLU G . n 
G 2 15  LYS 15  161 161 LYS LYS G . n 
G 2 16  MET 16  162 162 MET MET G . n 
G 2 17  GLU 17  163 163 GLU GLU G . n 
G 2 18  LYS 18  164 164 LYS LYS G . n 
G 2 19  ARG 19  165 165 ARG ARG G . n 
G 2 20  LEU 20  166 166 LEU LEU G . n 
G 2 21  HIS 21  167 167 HIS HIS G . n 
G 2 22  ALA 22  168 168 ALA ALA G . n 
G 2 23  VAL 23  169 169 VAL VAL G . n 
G 2 24  PRO 24  170 170 PRO PRO G . n 
G 2 25  ALA 25  171 171 ALA ALA G . n 
G 2 26  ALA 26  172 172 ALA ALA G . n 
G 2 27  ASN 27  173 173 ASN ASN G . n 
G 2 28  THR 28  174 174 THR THR G . n 
G 2 29  VAL 29  175 175 VAL VAL G . n 
G 2 30  LYS 30  176 176 LYS LYS G . n 
G 2 31  PHE 31  177 177 PHE PHE G . n 
G 2 32  ARG 32  178 178 ARG ARG G . n 
G 2 33  CYS 33  179 179 CYS CYS G . n 
G 2 34  PRO 34  180 180 PRO PRO G . n 
G 2 35  ALA 35  181 181 ALA ALA G . n 
G 2 36  GLY 36  182 182 GLY GLY G . n 
G 2 37  GLY 37  183 183 GLY GLY G . n 
G 2 38  ASN 38  184 184 ASN ASN G . n 
G 2 39  PRO 39  185 185 PRO PRO G . n 
G 2 40  MET 40  186 186 MET MET G . n 
G 2 41  PRO 41  187 187 PRO PRO G . n 
G 2 42  THR 42  188 188 THR THR G . n 
G 2 43  MET 43  189 189 MET MET G . n 
G 2 44  ARG 44  190 190 ARG ARG G . n 
G 2 45  TRP 45  191 191 TRP TRP G . n 
G 2 46  LEU 46  192 192 LEU LEU G . n 
G 2 47  LYS 47  193 193 LYS LYS G . n 
G 2 48  ASN 48  194 194 ASN ASN G . n 
G 2 49  GLY 49  195 195 GLY GLY G . n 
G 2 50  LYS 50  196 196 LYS LYS G . n 
G 2 51  GLU 51  197 197 GLU GLU G . n 
G 2 52  PHE 52  198 198 PHE PHE G . n 
G 2 53  LYS 53  199 199 LYS LYS G . n 
G 2 54  GLN 54  200 200 GLN GLN G . n 
G 2 55  GLU 55  201 201 GLU GLU G . n 
G 2 56  HIS 56  202 202 HIS HIS G . n 
G 2 57  ARG 57  203 203 ARG ARG G . n 
G 2 58  ILE 58  204 204 ILE ILE G . n 
G 2 59  GLY 59  205 205 GLY GLY G . n 
G 2 60  GLY 60  206 206 GLY GLY G . n 
G 2 61  TYR 61  207 207 TYR TYR G . n 
G 2 62  LYS 62  208 208 LYS LYS G . n 
G 2 63  VAL 63  209 209 VAL VAL G . n 
G 2 64  ARG 64  210 210 ARG ARG G . n 
G 2 65  ASN 65  211 211 ASN ASN G . n 
G 2 66  GLN 66  212 212 GLN GLN G . n 
G 2 67  HIS 67  213 213 HIS HIS G . n 
G 2 68  TRP 68  214 214 TRP TRP G . n 
G 2 69  SER 69  215 215 SER SER G . n 
G 2 70  LEU 70  216 216 LEU LEU G . n 
G 2 71  ILE 71  217 217 ILE ILE G . n 
G 2 72  MET 72  218 218 MET MET G . n 
G 2 73  GLU 73  219 219 GLU GLU G . n 
G 2 74  SER 74  220 220 SER SER G . n 
G 2 75  VAL 75  221 221 VAL VAL G . n 
G 2 76  VAL 76  222 222 VAL VAL G . n 
G 2 77  PRO 77  223 223 PRO PRO G . n 
G 2 78  SER 78  224 224 SER SER G . n 
G 2 79  ASP 79  225 225 ASP ASP G . n 
G 2 80  LYS 80  226 226 LYS LYS G . n 
G 2 81  GLY 81  227 227 GLY GLY G . n 
G 2 82  ASN 82  228 228 ASN ASN G . n 
G 2 83  TYR 83  229 229 TYR TYR G . n 
G 2 84  THR 84  230 230 THR THR G . n 
G 2 85  CYS 85  231 231 CYS CYS G . n 
G 2 86  VAL 86  232 232 VAL VAL G . n 
G 2 87  VAL 87  233 233 VAL VAL G . n 
G 2 88  GLU 88  234 234 GLU GLU G . n 
G 2 89  ASN 89  235 235 ASN ASN G . n 
G 2 90  GLU 90  236 236 GLU GLU G . n 
G 2 91  TYR 91  237 237 TYR TYR G . n 
G 2 92  GLY 92  238 238 GLY GLY G . n 
G 2 93  SER 93  239 239 SER SER G . n 
G 2 94  ILE 94  240 240 ILE ILE G . n 
G 2 95  ASN 95  241 241 ASN ASN G . n 
G 2 96  HIS 96  242 242 HIS HIS G . n 
G 2 97  THR 97  243 243 THR THR G . n 
G 2 98  TYR 98  244 244 TYR TYR G . n 
G 2 99  HIS 99  245 245 HIS HIS G . n 
G 2 100 LEU 100 246 246 LEU LEU G . n 
G 2 101 ASP 101 247 247 ASP ASP G . n 
G 2 102 VAL 102 248 248 VAL VAL G . n 
G 2 103 VAL 103 249 249 VAL VAL G . n 
G 2 104 GLU 104 250 250 GLU GLU G . n 
G 2 105 ARG 105 251 251 ARG ARG G . n 
G 2 106 TRP 106 252 252 TRP TRP G . n 
G 2 107 PRO 107 253 253 PRO PRO G . n 
G 2 108 HIS 108 254 254 HIS HIS G . n 
G 2 109 ARG 109 255 255 ARG ARG G . n 
G 2 110 PRO 110 256 256 PRO PRO G . n 
G 2 111 ILE 111 257 257 ILE ILE G . n 
G 2 112 LEU 112 258 258 LEU LEU G . n 
G 2 113 GLN 113 259 259 GLN GLN G . n 
G 2 114 ALA 114 260 260 ALA ALA G . n 
G 2 115 GLY 115 261 261 GLY GLY G . n 
G 2 116 LEU 116 262 262 LEU LEU G . n 
G 2 117 PRO 117 263 263 PRO PRO G . n 
G 2 118 ALA 118 264 264 ALA ALA G . n 
G 2 119 ASN 119 265 265 ASN ASN G . n 
G 2 120 ALA 120 266 266 ALA ALA G . n 
G 2 121 SER 121 267 267 SER SER G . n 
G 2 122 THR 122 268 268 THR THR G . n 
G 2 123 VAL 123 269 269 VAL VAL G . n 
G 2 124 VAL 124 270 270 VAL VAL G . n 
G 2 125 GLY 125 271 271 GLY GLY G . n 
G 2 126 GLY 126 272 272 GLY GLY G . n 
G 2 127 ASP 127 273 273 ASP ASP G . n 
G 2 128 VAL 128 274 274 VAL VAL G . n 
G 2 129 GLU 129 275 275 GLU GLU G . n 
G 2 130 PHE 130 276 276 PHE PHE G . n 
G 2 131 VAL 131 277 277 VAL VAL G . n 
G 2 132 CYS 132 278 278 CYS CYS G . n 
G 2 133 LYS 133 279 279 LYS LYS G . n 
G 2 134 VAL 134 280 280 VAL VAL G . n 
G 2 135 TYR 135 281 281 TYR TYR G . n 
G 2 136 SER 136 282 282 SER SER G . n 
G 2 137 ASP 137 283 283 ASP ASP G . n 
G 2 138 ALA 138 284 284 ALA ALA G . n 
G 2 139 GLN 139 285 285 GLN GLN G . n 
G 2 140 PRO 140 286 286 PRO PRO G . n 
G 2 141 HIS 141 287 287 HIS HIS G . n 
G 2 142 ILE 142 288 288 ILE ILE G . n 
G 2 143 GLN 143 289 289 GLN GLN G . n 
G 2 144 TRP 144 290 290 TRP TRP G . n 
G 2 145 ILE 145 291 291 ILE ILE G . n 
G 2 146 LYS 146 292 292 LYS LYS G . n 
G 2 147 HIS 147 293 293 HIS HIS G . n 
G 2 148 VAL 148 294 294 VAL VAL G . n 
G 2 149 GLU 149 295 ?   ?   ?   G . n 
G 2 150 LYS 150 296 ?   ?   ?   G . n 
G 2 151 ASN 151 297 ?   ?   ?   G . n 
G 2 152 GLY 152 298 ?   ?   ?   G . n 
G 2 153 SER 153 299 ?   ?   ?   G . n 
G 2 154 LYS 154 300 ?   ?   ?   G . n 
G 2 155 TYR 155 301 ?   ?   ?   G . n 
G 2 156 GLY 156 302 ?   ?   ?   G . n 
G 2 157 PRO 157 303 ?   ?   ?   G . n 
G 2 158 ASP 158 304 ?   ?   ?   G . n 
G 2 159 GLY 159 305 ?   ?   ?   G . n 
G 2 160 LEU 160 306 ?   ?   ?   G . n 
G 2 161 PRO 161 307 307 PRO PRO G . n 
G 2 162 TYR 162 308 308 TYR TYR G . n 
G 2 163 LEU 163 309 309 LEU LEU G . n 
G 2 164 LYS 164 310 310 LYS LYS G . n 
G 2 165 VAL 165 311 311 VAL VAL G . n 
G 2 166 LEU 166 312 312 LEU LEU G . n 
G 2 167 LYS 167 313 313 LYS LYS G . n 
G 2 168 ALA 168 314 314 ALA ALA G . n 
G 2 169 ALA 169 315 315 ALA ALA G . n 
G 2 170 GLY 170 316 316 GLY GLY G . n 
G 2 171 VAL 171 317 317 VAL VAL G . n 
G 2 172 ASN 172 318 318 ASN ASN G . n 
G 2 173 THR 173 319 319 THR THR G . n 
G 2 174 THR 174 320 320 THR THR G . n 
G 2 175 ASP 175 321 321 ASP ASP G . n 
G 2 176 LYS 176 322 322 LYS LYS G . n 
G 2 177 GLU 177 323 323 GLU GLU G . n 
G 2 178 ILE 178 324 324 ILE ILE G . n 
G 2 179 GLU 179 325 325 GLU GLU G . n 
G 2 180 VAL 180 326 326 VAL VAL G . n 
G 2 181 LEU 181 327 327 LEU LEU G . n 
G 2 182 TYR 182 328 328 TYR TYR G . n 
G 2 183 ILE 183 329 329 ILE ILE G . n 
G 2 184 ARG 184 330 330 ARG ARG G . n 
G 2 185 ASN 185 331 331 ASN ASN G . n 
G 2 186 VAL 186 332 332 VAL VAL G . n 
G 2 187 THR 187 333 333 THR THR G . n 
G 2 188 PHE 188 334 334 PHE PHE G . n 
G 2 189 GLU 189 335 335 GLU GLU G . n 
G 2 190 ASP 190 336 336 ASP ASP G . n 
G 2 191 ALA 191 337 337 ALA ALA G . n 
G 2 192 GLY 192 338 338 GLY GLY G . n 
G 2 193 GLU 193 339 339 GLU GLU G . n 
G 2 194 TYR 194 340 340 TYR TYR G . n 
G 2 195 THR 195 341 341 THR THR G . n 
G 2 196 CYS 196 342 342 CYS CYS G . n 
G 2 197 LEU 197 343 343 LEU LEU G . n 
G 2 198 ALA 198 344 344 ALA ALA G . n 
G 2 199 GLY 199 345 345 GLY GLY G . n 
G 2 200 ASN 200 346 346 ASN ASN G . n 
G 2 201 SER 201 347 347 SER SER G . n 
G 2 202 ILE 202 348 348 ILE ILE G . n 
G 2 203 GLY 203 349 349 GLY GLY G . n 
G 2 204 ILE 204 350 350 ILE ILE G . n 
G 2 205 SER 205 351 351 SER SER G . n 
G 2 206 PHE 206 352 352 PHE PHE G . n 
G 2 207 HIS 207 353 353 HIS HIS G . n 
G 2 208 SER 208 354 354 SER SER G . n 
G 2 209 ALA 209 355 355 ALA ALA G . n 
G 2 210 TRP 210 356 356 TRP TRP G . n 
G 2 211 LEU 211 357 357 LEU LEU G . n 
G 2 212 THR 212 358 358 THR THR G . n 
G 2 213 VAL 213 359 359 VAL VAL G . n 
G 2 214 LEU 214 360 360 LEU LEU G . n 
G 2 215 PRO 215 361 361 PRO PRO G . n 
G 2 216 ALA 216 362 ?   ?   ?   G . n 
G 2 217 PRO 217 363 ?   ?   ?   G . n 
G 2 218 GLY 218 364 ?   ?   ?   G . n 
G 2 219 ARG 219 365 ?   ?   ?   G . n 
G 2 220 GLU 220 366 ?   ?   ?   G . n 
H 2 1   ASN 1   147 ?   ?   ?   H . n 
H 2 2   SER 2   148 ?   ?   ?   H . n 
H 2 3   ASN 3   149 ?   ?   ?   H . n 
H 2 4   ASN 4   150 150 ASN ASN H . n 
H 2 5   LYS 5   151 151 LYS LYS H . n 
H 2 6   ARG 6   152 152 ARG ARG H . n 
H 2 7   ALA 7   153 153 ALA ALA H . n 
H 2 8   PRO 8   154 154 PRO PRO H . n 
H 2 9   TYR 9   155 155 TYR TYR H . n 
H 2 10  TRP 10  156 156 TRP TRP H . n 
H 2 11  THR 11  157 157 THR THR H . n 
H 2 12  ASN 12  158 158 ASN ASN H . n 
H 2 13  THR 13  159 159 THR THR H . n 
H 2 14  GLU 14  160 160 GLU GLU H . n 
H 2 15  LYS 15  161 161 LYS LYS H . n 
H 2 16  MET 16  162 162 MET MET H . n 
H 2 17  GLU 17  163 163 GLU GLU H . n 
H 2 18  LYS 18  164 164 LYS LYS H . n 
H 2 19  ARG 19  165 165 ARG ARG H . n 
H 2 20  LEU 20  166 166 LEU LEU H . n 
H 2 21  HIS 21  167 167 HIS HIS H . n 
H 2 22  ALA 22  168 168 ALA ALA H . n 
H 2 23  VAL 23  169 169 VAL VAL H . n 
H 2 24  PRO 24  170 170 PRO PRO H . n 
H 2 25  ALA 25  171 171 ALA ALA H . n 
H 2 26  ALA 26  172 172 ALA ALA H . n 
H 2 27  ASN 27  173 173 ASN ASN H . n 
H 2 28  THR 28  174 174 THR THR H . n 
H 2 29  VAL 29  175 175 VAL VAL H . n 
H 2 30  LYS 30  176 176 LYS LYS H . n 
H 2 31  PHE 31  177 177 PHE PHE H . n 
H 2 32  ARG 32  178 178 ARG ARG H . n 
H 2 33  CYS 33  179 179 CYS CYS H . n 
H 2 34  PRO 34  180 180 PRO PRO H . n 
H 2 35  ALA 35  181 181 ALA ALA H . n 
H 2 36  GLY 36  182 182 GLY GLY H . n 
H 2 37  GLY 37  183 183 GLY GLY H . n 
H 2 38  ASN 38  184 184 ASN ASN H . n 
H 2 39  PRO 39  185 185 PRO PRO H . n 
H 2 40  MET 40  186 186 MET MET H . n 
H 2 41  PRO 41  187 187 PRO PRO H . n 
H 2 42  THR 42  188 188 THR THR H . n 
H 2 43  MET 43  189 189 MET MET H . n 
H 2 44  ARG 44  190 190 ARG ARG H . n 
H 2 45  TRP 45  191 191 TRP TRP H . n 
H 2 46  LEU 46  192 192 LEU LEU H . n 
H 2 47  LYS 47  193 193 LYS LYS H . n 
H 2 48  ASN 48  194 194 ASN ASN H . n 
H 2 49  GLY 49  195 195 GLY GLY H . n 
H 2 50  LYS 50  196 196 LYS LYS H . n 
H 2 51  GLU 51  197 197 GLU GLU H . n 
H 2 52  PHE 52  198 198 PHE PHE H . n 
H 2 53  LYS 53  199 199 LYS LYS H . n 
H 2 54  GLN 54  200 200 GLN GLN H . n 
H 2 55  GLU 55  201 201 GLU GLU H . n 
H 2 56  HIS 56  202 202 HIS HIS H . n 
H 2 57  ARG 57  203 203 ARG ARG H . n 
H 2 58  ILE 58  204 204 ILE ILE H . n 
H 2 59  GLY 59  205 205 GLY GLY H . n 
H 2 60  GLY 60  206 206 GLY GLY H . n 
H 2 61  TYR 61  207 207 TYR TYR H . n 
H 2 62  LYS 62  208 208 LYS LYS H . n 
H 2 63  VAL 63  209 209 VAL VAL H . n 
H 2 64  ARG 64  210 210 ARG ARG H . n 
H 2 65  ASN 65  211 211 ASN ASN H . n 
H 2 66  GLN 66  212 212 GLN GLN H . n 
H 2 67  HIS 67  213 213 HIS HIS H . n 
H 2 68  TRP 68  214 214 TRP TRP H . n 
H 2 69  SER 69  215 215 SER SER H . n 
H 2 70  LEU 70  216 216 LEU LEU H . n 
H 2 71  ILE 71  217 217 ILE ILE H . n 
H 2 72  MET 72  218 218 MET MET H . n 
H 2 73  GLU 73  219 219 GLU GLU H . n 
H 2 74  SER 74  220 220 SER SER H . n 
H 2 75  VAL 75  221 221 VAL VAL H . n 
H 2 76  VAL 76  222 222 VAL VAL H . n 
H 2 77  PRO 77  223 223 PRO PRO H . n 
H 2 78  SER 78  224 224 SER SER H . n 
H 2 79  ASP 79  225 225 ASP ASP H . n 
H 2 80  LYS 80  226 226 LYS LYS H . n 
H 2 81  GLY 81  227 227 GLY GLY H . n 
H 2 82  ASN 82  228 228 ASN ASN H . n 
H 2 83  TYR 83  229 229 TYR TYR H . n 
H 2 84  THR 84  230 230 THR THR H . n 
H 2 85  CYS 85  231 231 CYS CYS H . n 
H 2 86  VAL 86  232 232 VAL VAL H . n 
H 2 87  VAL 87  233 233 VAL VAL H . n 
H 2 88  GLU 88  234 234 GLU GLU H . n 
H 2 89  ASN 89  235 235 ASN ASN H . n 
H 2 90  GLU 90  236 236 GLU GLU H . n 
H 2 91  TYR 91  237 237 TYR TYR H . n 
H 2 92  GLY 92  238 238 GLY GLY H . n 
H 2 93  SER 93  239 239 SER SER H . n 
H 2 94  ILE 94  240 240 ILE ILE H . n 
H 2 95  ASN 95  241 241 ASN ASN H . n 
H 2 96  HIS 96  242 242 HIS HIS H . n 
H 2 97  THR 97  243 243 THR THR H . n 
H 2 98  TYR 98  244 244 TYR TYR H . n 
H 2 99  HIS 99  245 245 HIS HIS H . n 
H 2 100 LEU 100 246 246 LEU LEU H . n 
H 2 101 ASP 101 247 247 ASP ASP H . n 
H 2 102 VAL 102 248 248 VAL VAL H . n 
H 2 103 VAL 103 249 249 VAL VAL H . n 
H 2 104 GLU 104 250 250 GLU GLU H . n 
H 2 105 ARG 105 251 251 ARG ARG H . n 
H 2 106 TRP 106 252 252 TRP TRP H . n 
H 2 107 PRO 107 253 253 PRO PRO H . n 
H 2 108 HIS 108 254 254 HIS HIS H . n 
H 2 109 ARG 109 255 255 ARG ARG H . n 
H 2 110 PRO 110 256 256 PRO PRO H . n 
H 2 111 ILE 111 257 257 ILE ILE H . n 
H 2 112 LEU 112 258 258 LEU LEU H . n 
H 2 113 GLN 113 259 259 GLN GLN H . n 
H 2 114 ALA 114 260 260 ALA ALA H . n 
H 2 115 GLY 115 261 261 GLY GLY H . n 
H 2 116 LEU 116 262 262 LEU LEU H . n 
H 2 117 PRO 117 263 263 PRO PRO H . n 
H 2 118 ALA 118 264 264 ALA ALA H . n 
H 2 119 ASN 119 265 265 ASN ASN H . n 
H 2 120 ALA 120 266 266 ALA ALA H . n 
H 2 121 SER 121 267 267 SER SER H . n 
H 2 122 THR 122 268 268 THR THR H . n 
H 2 123 VAL 123 269 269 VAL VAL H . n 
H 2 124 VAL 124 270 270 VAL VAL H . n 
H 2 125 GLY 125 271 271 GLY GLY H . n 
H 2 126 GLY 126 272 272 GLY GLY H . n 
H 2 127 ASP 127 273 273 ASP ASP H . n 
H 2 128 VAL 128 274 274 VAL VAL H . n 
H 2 129 GLU 129 275 275 GLU GLU H . n 
H 2 130 PHE 130 276 276 PHE PHE H . n 
H 2 131 VAL 131 277 277 VAL VAL H . n 
H 2 132 CYS 132 278 278 CYS CYS H . n 
H 2 133 LYS 133 279 279 LYS LYS H . n 
H 2 134 VAL 134 280 280 VAL VAL H . n 
H 2 135 TYR 135 281 281 TYR TYR H . n 
H 2 136 SER 136 282 282 SER SER H . n 
H 2 137 ASP 137 283 283 ASP ASP H . n 
H 2 138 ALA 138 284 284 ALA ALA H . n 
H 2 139 GLN 139 285 285 GLN GLN H . n 
H 2 140 PRO 140 286 286 PRO PRO H . n 
H 2 141 HIS 141 287 287 HIS HIS H . n 
H 2 142 ILE 142 288 288 ILE ILE H . n 
H 2 143 GLN 143 289 289 GLN GLN H . n 
H 2 144 TRP 144 290 290 TRP TRP H . n 
H 2 145 ILE 145 291 291 ILE ILE H . n 
H 2 146 LYS 146 292 292 LYS LYS H . n 
H 2 147 HIS 147 293 293 HIS HIS H . n 
H 2 148 VAL 148 294 294 VAL VAL H . n 
H 2 149 GLU 149 295 ?   ?   ?   H . n 
H 2 150 LYS 150 296 ?   ?   ?   H . n 
H 2 151 ASN 151 297 ?   ?   ?   H . n 
H 2 152 GLY 152 298 ?   ?   ?   H . n 
H 2 153 SER 153 299 ?   ?   ?   H . n 
H 2 154 LYS 154 300 ?   ?   ?   H . n 
H 2 155 TYR 155 301 ?   ?   ?   H . n 
H 2 156 GLY 156 302 ?   ?   ?   H . n 
H 2 157 PRO 157 303 ?   ?   ?   H . n 
H 2 158 ASP 158 304 ?   ?   ?   H . n 
H 2 159 GLY 159 305 ?   ?   ?   H . n 
H 2 160 LEU 160 306 ?   ?   ?   H . n 
H 2 161 PRO 161 307 307 PRO PRO H . n 
H 2 162 TYR 162 308 308 TYR TYR H . n 
H 2 163 LEU 163 309 309 LEU LEU H . n 
H 2 164 LYS 164 310 310 LYS LYS H . n 
H 2 165 VAL 165 311 311 VAL VAL H . n 
H 2 166 LEU 166 312 312 LEU LEU H . n 
H 2 167 LYS 167 313 313 LYS LYS H . n 
H 2 168 ALA 168 314 314 ALA ALA H . n 
H 2 169 ALA 169 315 315 ALA ALA H . n 
H 2 170 GLY 170 316 316 GLY GLY H . n 
H 2 171 VAL 171 317 317 VAL VAL H . n 
H 2 172 ASN 172 318 318 ASN ASN H . n 
H 2 173 THR 173 319 319 THR THR H . n 
H 2 174 THR 174 320 320 THR THR H . n 
H 2 175 ASP 175 321 321 ASP ASP H . n 
H 2 176 LYS 176 322 322 LYS LYS H . n 
H 2 177 GLU 177 323 323 GLU GLU H . n 
H 2 178 ILE 178 324 324 ILE ILE H . n 
H 2 179 GLU 179 325 325 GLU GLU H . n 
H 2 180 VAL 180 326 326 VAL VAL H . n 
H 2 181 LEU 181 327 327 LEU LEU H . n 
H 2 182 TYR 182 328 328 TYR TYR H . n 
H 2 183 ILE 183 329 329 ILE ILE H . n 
H 2 184 ARG 184 330 330 ARG ARG H . n 
H 2 185 ASN 185 331 331 ASN ASN H . n 
H 2 186 VAL 186 332 332 VAL VAL H . n 
H 2 187 THR 187 333 333 THR THR H . n 
H 2 188 PHE 188 334 334 PHE PHE H . n 
H 2 189 GLU 189 335 335 GLU GLU H . n 
H 2 190 ASP 190 336 336 ASP ASP H . n 
H 2 191 ALA 191 337 337 ALA ALA H . n 
H 2 192 GLY 192 338 338 GLY GLY H . n 
H 2 193 GLU 193 339 339 GLU GLU H . n 
H 2 194 TYR 194 340 340 TYR TYR H . n 
H 2 195 THR 195 341 341 THR THR H . n 
H 2 196 CYS 196 342 342 CYS CYS H . n 
H 2 197 LEU 197 343 343 LEU LEU H . n 
H 2 198 ALA 198 344 344 ALA ALA H . n 
H 2 199 GLY 199 345 345 GLY GLY H . n 
H 2 200 ASN 200 346 346 ASN ASN H . n 
H 2 201 SER 201 347 347 SER SER H . n 
H 2 202 ILE 202 348 348 ILE ILE H . n 
H 2 203 GLY 203 349 349 GLY GLY H . n 
H 2 204 ILE 204 350 350 ILE ILE H . n 
H 2 205 SER 205 351 351 SER SER H . n 
H 2 206 PHE 206 352 352 PHE PHE H . n 
H 2 207 HIS 207 353 353 HIS HIS H . n 
H 2 208 SER 208 354 354 SER SER H . n 
H 2 209 ALA 209 355 355 ALA ALA H . n 
H 2 210 TRP 210 356 356 TRP TRP H . n 
H 2 211 LEU 211 357 357 LEU LEU H . n 
H 2 212 THR 212 358 358 THR THR H . n 
H 2 213 VAL 213 359 359 VAL VAL H . n 
H 2 214 LEU 214 360 360 LEU LEU H . n 
H 2 215 PRO 215 361 361 PRO PRO H . n 
H 2 216 ALA 216 362 ?   ?   ?   H . n 
H 2 217 PRO 217 363 ?   ?   ?   H . n 
H 2 218 GLY 218 364 ?   ?   ?   H . n 
H 2 219 ARG 219 365 ?   ?   ?   H . n 
H 2 220 GLU 220 366 ?   ?   ?   H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E 
2 1 B,F 
3 1 C,G 
4 1 D,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3100  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  15390 ? 
2 'ABSA (A^2)' 3080  ? 
2 MORE         -16   ? 
2 'SSA (A^2)'  15380 ? 
3 'ABSA (A^2)' 3100  ? 
3 MORE         -16   ? 
3 'SSA (A^2)'  15390 ? 
4 'ABSA (A^2)' 3100  ? 
4 MORE         -16   ? 
4 'SSA (A^2)'  15420 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-05-09 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 23  ? ? -43.24  -83.41  
2  1 ASN A 36  ? ? -65.67  94.60   
3  1 ASP A 50  ? ? -165.92 -163.04 
4  1 THR A 121 ? ? -51.83  -3.47   
5  1 ALA A 153 ? ? -92.28  47.70   
6  1 PRO B 23  ? ? -43.24  -83.68  
7  1 ASN B 36  ? ? -64.95  94.09   
8  1 ASP B 50  ? ? -166.34 -163.12 
9  1 THR B 121 ? ? -52.07  -3.92   
10 1 ALA B 153 ? ? -93.43  48.45   
11 1 PRO C 23  ? ? -42.82  -85.08  
12 1 ASN C 36  ? ? -62.31  91.98   
13 1 ASP C 50  ? ? -165.91 -162.62 
14 1 THR C 121 ? ? -56.79  2.26    
15 1 ALA C 153 ? ? -91.26  47.73   
16 1 PRO D 23  ? ? -43.18  -85.76  
17 1 ASN D 36  ? ? -64.48  94.12   
18 1 ASP D 50  ? ? -166.23 -162.43 
19 1 THR D 121 ? ? -55.45  0.72    
20 1 ALA D 153 ? ? -91.83  47.89   
21 1 PRO E 253 ? ? -67.07  68.94   
22 1 THR E 320 ? ? -49.92  151.40  
23 1 ALA G 171 ? ? -48.83  154.65  
24 1 ASP G 283 ? ? -83.74  -70.45  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 35  ? CG  ? A LYS 35  CG  
2   1 Y 1 A LYS 35  ? CD  ? A LYS 35  CD  
3   1 Y 1 A LYS 35  ? CE  ? A LYS 35  CE  
4   1 Y 1 A LYS 35  ? NZ  ? A LYS 35  NZ  
5   1 Y 1 A LYS 55  ? CG  ? A LYS 55  CG  
6   1 Y 1 A LYS 55  ? CD  ? A LYS 55  CD  
7   1 Y 1 A LYS 55  ? CE  ? A LYS 55  CE  
8   1 Y 1 A LYS 55  ? NZ  ? A LYS 55  NZ  
9   1 Y 1 A LYS 61  ? CG  ? A LYS 61  CG  
10  1 Y 1 A LYS 61  ? CD  ? A LYS 61  CD  
11  1 Y 1 A LYS 61  ? CE  ? A LYS 61  CE  
12  1 Y 1 A LYS 61  ? NZ  ? A LYS 61  NZ  
13  1 Y 1 A LYS 86  ? CG  ? A LYS 86  CG  
14  1 Y 1 A LYS 86  ? CD  ? A LYS 86  CD  
15  1 Y 1 A LYS 86  ? CE  ? A LYS 86  CE  
16  1 Y 1 A LYS 86  ? NZ  ? A LYS 86  NZ  
17  1 Y 1 A GLU 87  ? CG  ? A GLU 87  CG  
18  1 Y 1 A GLU 87  ? CD  ? A GLU 87  CD  
19  1 Y 1 A GLU 87  ? OE1 ? A GLU 87  OE1 
20  1 Y 1 A GLU 87  ? OE2 ? A GLU 87  OE2 
21  1 Y 1 A ARG 90  ? CG  ? A ARG 90  CG  
22  1 Y 1 A ARG 90  ? CD  ? A ARG 90  CD  
23  1 Y 1 A ARG 90  ? NE  ? A ARG 90  NE  
24  1 Y 1 A ARG 90  ? CZ  ? A ARG 90  CZ  
25  1 Y 1 A ARG 90  ? NH1 ? A ARG 90  NH1 
26  1 Y 1 A ARG 90  ? NH2 ? A ARG 90  NH2 
27  1 Y 1 A LYS 95  ? CG  ? A LYS 95  CG  
28  1 Y 1 A LYS 95  ? CD  ? A LYS 95  CD  
29  1 Y 1 A LYS 95  ? CE  ? A LYS 95  CE  
30  1 Y 1 A LYS 95  ? NZ  ? A LYS 95  NZ  
31  1 Y 1 A LYS 128 ? CG  ? A LYS 128 CG  
32  1 Y 1 A LYS 128 ? CD  ? A LYS 128 CD  
33  1 Y 1 A LYS 128 ? CE  ? A LYS 128 CE  
34  1 Y 1 A LYS 128 ? NZ  ? A LYS 128 NZ  
35  1 Y 1 A ARG 129 ? CG  ? A ARG 129 CG  
36  1 Y 1 A ARG 129 ? CD  ? A ARG 129 CD  
37  1 Y 1 A ARG 129 ? NE  ? A ARG 129 NE  
38  1 Y 1 A ARG 129 ? CZ  ? A ARG 129 CZ  
39  1 Y 1 A ARG 129 ? NH1 ? A ARG 129 NH1 
40  1 Y 1 A ARG 129 ? NH2 ? A ARG 129 NH2 
41  1 Y 1 A LYS 134 ? CG  ? A LYS 134 CG  
42  1 Y 1 A LYS 134 ? CD  ? A LYS 134 CD  
43  1 Y 1 A LYS 134 ? CE  ? A LYS 134 CE  
44  1 Y 1 A LYS 134 ? NZ  ? A LYS 134 NZ  
45  1 Y 1 A LYS 154 ? CG  ? A LYS 154 CG  
46  1 Y 1 A LYS 154 ? CD  ? A LYS 154 CD  
47  1 Y 1 A LYS 154 ? CE  ? A LYS 154 CE  
48  1 Y 1 A LYS 154 ? NZ  ? A LYS 154 NZ  
49  1 Y 1 B LYS 35  ? CG  ? B LYS 35  CG  
50  1 Y 1 B LYS 35  ? CD  ? B LYS 35  CD  
51  1 Y 1 B LYS 35  ? CE  ? B LYS 35  CE  
52  1 Y 1 B LYS 35  ? NZ  ? B LYS 35  NZ  
53  1 Y 1 B LYS 55  ? CG  ? B LYS 55  CG  
54  1 Y 1 B LYS 55  ? CD  ? B LYS 55  CD  
55  1 Y 1 B LYS 55  ? CE  ? B LYS 55  CE  
56  1 Y 1 B LYS 55  ? NZ  ? B LYS 55  NZ  
57  1 Y 1 B LYS 61  ? CG  ? B LYS 61  CG  
58  1 Y 1 B LYS 61  ? CD  ? B LYS 61  CD  
59  1 Y 1 B LYS 61  ? CE  ? B LYS 61  CE  
60  1 Y 1 B LYS 61  ? NZ  ? B LYS 61  NZ  
61  1 Y 1 B LYS 86  ? CG  ? B LYS 86  CG  
62  1 Y 1 B LYS 86  ? CD  ? B LYS 86  CD  
63  1 Y 1 B LYS 86  ? CE  ? B LYS 86  CE  
64  1 Y 1 B LYS 86  ? NZ  ? B LYS 86  NZ  
65  1 Y 1 B GLU 87  ? CG  ? B GLU 87  CG  
66  1 Y 1 B GLU 87  ? CD  ? B GLU 87  CD  
67  1 Y 1 B GLU 87  ? OE1 ? B GLU 87  OE1 
68  1 Y 1 B GLU 87  ? OE2 ? B GLU 87  OE2 
69  1 Y 1 B ARG 90  ? CG  ? B ARG 90  CG  
70  1 Y 1 B ARG 90  ? CD  ? B ARG 90  CD  
71  1 Y 1 B ARG 90  ? NE  ? B ARG 90  NE  
72  1 Y 1 B ARG 90  ? CZ  ? B ARG 90  CZ  
73  1 Y 1 B ARG 90  ? NH1 ? B ARG 90  NH1 
74  1 Y 1 B ARG 90  ? NH2 ? B ARG 90  NH2 
75  1 Y 1 B LYS 95  ? CG  ? B LYS 95  CG  
76  1 Y 1 B LYS 95  ? CD  ? B LYS 95  CD  
77  1 Y 1 B LYS 95  ? CE  ? B LYS 95  CE  
78  1 Y 1 B LYS 95  ? NZ  ? B LYS 95  NZ  
79  1 Y 1 B LYS 128 ? CG  ? B LYS 128 CG  
80  1 Y 1 B LYS 128 ? CD  ? B LYS 128 CD  
81  1 Y 1 B LYS 128 ? CE  ? B LYS 128 CE  
82  1 Y 1 B LYS 128 ? NZ  ? B LYS 128 NZ  
83  1 Y 1 B ARG 129 ? CG  ? B ARG 129 CG  
84  1 Y 1 B ARG 129 ? CD  ? B ARG 129 CD  
85  1 Y 1 B ARG 129 ? NE  ? B ARG 129 NE  
86  1 Y 1 B ARG 129 ? CZ  ? B ARG 129 CZ  
87  1 Y 1 B ARG 129 ? NH1 ? B ARG 129 NH1 
88  1 Y 1 B ARG 129 ? NH2 ? B ARG 129 NH2 
89  1 Y 1 B LYS 134 ? CG  ? B LYS 134 CG  
90  1 Y 1 B LYS 134 ? CD  ? B LYS 134 CD  
91  1 Y 1 B LYS 134 ? CE  ? B LYS 134 CE  
92  1 Y 1 B LYS 134 ? NZ  ? B LYS 134 NZ  
93  1 Y 1 B LYS 154 ? CG  ? B LYS 154 CG  
94  1 Y 1 B LYS 154 ? CD  ? B LYS 154 CD  
95  1 Y 1 B LYS 154 ? CE  ? B LYS 154 CE  
96  1 Y 1 B LYS 154 ? NZ  ? B LYS 154 NZ  
97  1 Y 1 C LYS 35  ? CG  ? C LYS 35  CG  
98  1 Y 1 C LYS 35  ? CD  ? C LYS 35  CD  
99  1 Y 1 C LYS 35  ? CE  ? C LYS 35  CE  
100 1 Y 1 C LYS 35  ? NZ  ? C LYS 35  NZ  
101 1 Y 1 C LYS 55  ? CG  ? C LYS 55  CG  
102 1 Y 1 C LYS 55  ? CD  ? C LYS 55  CD  
103 1 Y 1 C LYS 55  ? CE  ? C LYS 55  CE  
104 1 Y 1 C LYS 55  ? NZ  ? C LYS 55  NZ  
105 1 Y 1 C LYS 61  ? CG  ? C LYS 61  CG  
106 1 Y 1 C LYS 61  ? CD  ? C LYS 61  CD  
107 1 Y 1 C LYS 61  ? CE  ? C LYS 61  CE  
108 1 Y 1 C LYS 61  ? NZ  ? C LYS 61  NZ  
109 1 Y 1 C LYS 86  ? CG  ? C LYS 86  CG  
110 1 Y 1 C LYS 86  ? CD  ? C LYS 86  CD  
111 1 Y 1 C LYS 86  ? CE  ? C LYS 86  CE  
112 1 Y 1 C LYS 86  ? NZ  ? C LYS 86  NZ  
113 1 Y 1 C GLU 87  ? CG  ? C GLU 87  CG  
114 1 Y 1 C GLU 87  ? CD  ? C GLU 87  CD  
115 1 Y 1 C GLU 87  ? OE1 ? C GLU 87  OE1 
116 1 Y 1 C GLU 87  ? OE2 ? C GLU 87  OE2 
117 1 Y 1 C ARG 90  ? CG  ? C ARG 90  CG  
118 1 Y 1 C ARG 90  ? CD  ? C ARG 90  CD  
119 1 Y 1 C ARG 90  ? NE  ? C ARG 90  NE  
120 1 Y 1 C ARG 90  ? CZ  ? C ARG 90  CZ  
121 1 Y 1 C ARG 90  ? NH1 ? C ARG 90  NH1 
122 1 Y 1 C ARG 90  ? NH2 ? C ARG 90  NH2 
123 1 Y 1 C LYS 95  ? CG  ? C LYS 95  CG  
124 1 Y 1 C LYS 95  ? CD  ? C LYS 95  CD  
125 1 Y 1 C LYS 95  ? CE  ? C LYS 95  CE  
126 1 Y 1 C LYS 95  ? NZ  ? C LYS 95  NZ  
127 1 Y 1 C LYS 128 ? CG  ? C LYS 128 CG  
128 1 Y 1 C LYS 128 ? CD  ? C LYS 128 CD  
129 1 Y 1 C LYS 128 ? CE  ? C LYS 128 CE  
130 1 Y 1 C LYS 128 ? NZ  ? C LYS 128 NZ  
131 1 Y 1 C ARG 129 ? CG  ? C ARG 129 CG  
132 1 Y 1 C ARG 129 ? CD  ? C ARG 129 CD  
133 1 Y 1 C ARG 129 ? NE  ? C ARG 129 NE  
134 1 Y 1 C ARG 129 ? CZ  ? C ARG 129 CZ  
135 1 Y 1 C ARG 129 ? NH1 ? C ARG 129 NH1 
136 1 Y 1 C ARG 129 ? NH2 ? C ARG 129 NH2 
137 1 Y 1 C LYS 134 ? CG  ? C LYS 134 CG  
138 1 Y 1 C LYS 134 ? CD  ? C LYS 134 CD  
139 1 Y 1 C LYS 134 ? CE  ? C LYS 134 CE  
140 1 Y 1 C LYS 134 ? NZ  ? C LYS 134 NZ  
141 1 Y 1 C LYS 154 ? CG  ? C LYS 154 CG  
142 1 Y 1 C LYS 154 ? CD  ? C LYS 154 CD  
143 1 Y 1 C LYS 154 ? CE  ? C LYS 154 CE  
144 1 Y 1 C LYS 154 ? NZ  ? C LYS 154 NZ  
145 1 Y 1 D LYS 35  ? CG  ? D LYS 35  CG  
146 1 Y 1 D LYS 35  ? CD  ? D LYS 35  CD  
147 1 Y 1 D LYS 35  ? CE  ? D LYS 35  CE  
148 1 Y 1 D LYS 35  ? NZ  ? D LYS 35  NZ  
149 1 Y 1 D LYS 55  ? CG  ? D LYS 55  CG  
150 1 Y 1 D LYS 55  ? CD  ? D LYS 55  CD  
151 1 Y 1 D LYS 55  ? CE  ? D LYS 55  CE  
152 1 Y 1 D LYS 55  ? NZ  ? D LYS 55  NZ  
153 1 Y 1 D LYS 61  ? CG  ? D LYS 61  CG  
154 1 Y 1 D LYS 61  ? CD  ? D LYS 61  CD  
155 1 Y 1 D LYS 61  ? CE  ? D LYS 61  CE  
156 1 Y 1 D LYS 61  ? NZ  ? D LYS 61  NZ  
157 1 Y 1 D LYS 86  ? CG  ? D LYS 86  CG  
158 1 Y 1 D LYS 86  ? CD  ? D LYS 86  CD  
159 1 Y 1 D LYS 86  ? CE  ? D LYS 86  CE  
160 1 Y 1 D LYS 86  ? NZ  ? D LYS 86  NZ  
161 1 Y 1 D GLU 87  ? CG  ? D GLU 87  CG  
162 1 Y 1 D GLU 87  ? CD  ? D GLU 87  CD  
163 1 Y 1 D GLU 87  ? OE1 ? D GLU 87  OE1 
164 1 Y 1 D GLU 87  ? OE2 ? D GLU 87  OE2 
165 1 Y 1 D ARG 90  ? CG  ? D ARG 90  CG  
166 1 Y 1 D ARG 90  ? CD  ? D ARG 90  CD  
167 1 Y 1 D ARG 90  ? NE  ? D ARG 90  NE  
168 1 Y 1 D ARG 90  ? CZ  ? D ARG 90  CZ  
169 1 Y 1 D ARG 90  ? NH1 ? D ARG 90  NH1 
170 1 Y 1 D ARG 90  ? NH2 ? D ARG 90  NH2 
171 1 Y 1 D LYS 95  ? CG  ? D LYS 95  CG  
172 1 Y 1 D LYS 95  ? CD  ? D LYS 95  CD  
173 1 Y 1 D LYS 95  ? CE  ? D LYS 95  CE  
174 1 Y 1 D LYS 95  ? NZ  ? D LYS 95  NZ  
175 1 Y 1 D LYS 128 ? CG  ? D LYS 128 CG  
176 1 Y 1 D LYS 128 ? CD  ? D LYS 128 CD  
177 1 Y 1 D LYS 128 ? CE  ? D LYS 128 CE  
178 1 Y 1 D LYS 128 ? NZ  ? D LYS 128 NZ  
179 1 Y 1 D ARG 129 ? CG  ? D ARG 129 CG  
180 1 Y 1 D ARG 129 ? CD  ? D ARG 129 CD  
181 1 Y 1 D ARG 129 ? NE  ? D ARG 129 NE  
182 1 Y 1 D ARG 129 ? CZ  ? D ARG 129 CZ  
183 1 Y 1 D ARG 129 ? NH1 ? D ARG 129 NH1 
184 1 Y 1 D ARG 129 ? NH2 ? D ARG 129 NH2 
185 1 Y 1 D LYS 134 ? CG  ? D LYS 134 CG  
186 1 Y 1 D LYS 134 ? CD  ? D LYS 134 CD  
187 1 Y 1 D LYS 134 ? CE  ? D LYS 134 CE  
188 1 Y 1 D LYS 134 ? NZ  ? D LYS 134 NZ  
189 1 Y 1 D LYS 154 ? CG  ? D LYS 154 CG  
190 1 Y 1 D LYS 154 ? CD  ? D LYS 154 CD  
191 1 Y 1 D LYS 154 ? CE  ? D LYS 154 CE  
192 1 Y 1 D LYS 154 ? NZ  ? D LYS 154 NZ  
193 1 Y 1 E ASN 150 ? CG  ? E ASN 4   CG  
194 1 Y 1 E ASN 150 ? OD1 ? E ASN 4   OD1 
195 1 Y 1 E ASN 150 ? ND2 ? E ASN 4   ND2 
196 1 Y 1 E LYS 151 ? CG  ? E LYS 5   CG  
197 1 Y 1 E LYS 151 ? CD  ? E LYS 5   CD  
198 1 Y 1 E LYS 151 ? CE  ? E LYS 5   CE  
199 1 Y 1 E LYS 151 ? NZ  ? E LYS 5   NZ  
200 1 Y 1 E GLU 160 ? CG  ? E GLU 14  CG  
201 1 Y 1 E GLU 160 ? CD  ? E GLU 14  CD  
202 1 Y 1 E GLU 160 ? OE1 ? E GLU 14  OE1 
203 1 Y 1 E GLU 160 ? OE2 ? E GLU 14  OE2 
204 1 Y 1 E LYS 161 ? CG  ? E LYS 15  CG  
205 1 Y 1 E LYS 161 ? CD  ? E LYS 15  CD  
206 1 Y 1 E LYS 161 ? CE  ? E LYS 15  CE  
207 1 Y 1 E LYS 161 ? NZ  ? E LYS 15  NZ  
208 1 Y 1 E GLU 163 ? CG  ? E GLU 17  CG  
209 1 Y 1 E GLU 163 ? CD  ? E GLU 17  CD  
210 1 Y 1 E GLU 163 ? OE1 ? E GLU 17  OE1 
211 1 Y 1 E GLU 163 ? OE2 ? E GLU 17  OE2 
212 1 Y 1 E LYS 196 ? CG  ? E LYS 50  CG  
213 1 Y 1 E LYS 196 ? CD  ? E LYS 50  CD  
214 1 Y 1 E LYS 196 ? CE  ? E LYS 50  CE  
215 1 Y 1 E LYS 196 ? NZ  ? E LYS 50  NZ  
216 1 Y 1 E HIS 245 ? CG  ? E HIS 99  CG  
217 1 Y 1 E HIS 245 ? ND1 ? E HIS 99  ND1 
218 1 Y 1 E HIS 245 ? CD2 ? E HIS 99  CD2 
219 1 Y 1 E HIS 245 ? CE1 ? E HIS 99  CE1 
220 1 Y 1 E HIS 245 ? NE2 ? E HIS 99  NE2 
221 1 Y 1 E VAL 269 ? CG1 ? E VAL 123 CG1 
222 1 Y 1 E VAL 269 ? CG2 ? E VAL 123 CG2 
223 1 Y 1 E LYS 292 ? CG  ? E LYS 146 CG  
224 1 Y 1 E LYS 292 ? CD  ? E LYS 146 CD  
225 1 Y 1 E LYS 292 ? CE  ? E LYS 146 CE  
226 1 Y 1 E LYS 292 ? NZ  ? E LYS 146 NZ  
227 1 Y 1 E TYR 308 ? CG  ? E TYR 162 CG  
228 1 Y 1 E TYR 308 ? CD1 ? E TYR 162 CD1 
229 1 Y 1 E TYR 308 ? CD2 ? E TYR 162 CD2 
230 1 Y 1 E TYR 308 ? CE1 ? E TYR 162 CE1 
231 1 Y 1 E TYR 308 ? CE2 ? E TYR 162 CE2 
232 1 Y 1 E TYR 308 ? CZ  ? E TYR 162 CZ  
233 1 Y 1 E TYR 308 ? OH  ? E TYR 162 OH  
234 1 Y 1 E LYS 322 ? CG  ? E LYS 176 CG  
235 1 Y 1 E LYS 322 ? CD  ? E LYS 176 CD  
236 1 Y 1 E LYS 322 ? CE  ? E LYS 176 CE  
237 1 Y 1 E LYS 322 ? NZ  ? E LYS 176 NZ  
238 1 Y 1 E ARG 330 ? CG  ? E ARG 184 CG  
239 1 Y 1 E ARG 330 ? CD  ? E ARG 184 CD  
240 1 Y 1 E ARG 330 ? NE  ? E ARG 184 NE  
241 1 Y 1 E ARG 330 ? CZ  ? E ARG 184 CZ  
242 1 Y 1 E ARG 330 ? NH1 ? E ARG 184 NH1 
243 1 Y 1 E ARG 330 ? NH2 ? E ARG 184 NH2 
244 1 Y 1 E ASN 331 ? CG  ? E ASN 185 CG  
245 1 Y 1 E ASN 331 ? OD1 ? E ASN 185 OD1 
246 1 Y 1 E ASN 331 ? ND2 ? E ASN 185 ND2 
247 1 Y 1 E GLU 335 ? CG  ? E GLU 189 CG  
248 1 Y 1 E GLU 335 ? CD  ? E GLU 189 CD  
249 1 Y 1 E GLU 335 ? OE1 ? E GLU 189 OE1 
250 1 Y 1 E GLU 335 ? OE2 ? E GLU 189 OE2 
251 1 Y 1 E PRO 361 ? CG  ? E PRO 215 CG  
252 1 Y 1 E PRO 361 ? CD  ? E PRO 215 CD  
253 1 Y 1 F ASN 150 ? CG  ? F ASN 4   CG  
254 1 Y 1 F ASN 150 ? OD1 ? F ASN 4   OD1 
255 1 Y 1 F ASN 150 ? ND2 ? F ASN 4   ND2 
256 1 Y 1 F LYS 151 ? CG  ? F LYS 5   CG  
257 1 Y 1 F LYS 151 ? CD  ? F LYS 5   CD  
258 1 Y 1 F LYS 151 ? CE  ? F LYS 5   CE  
259 1 Y 1 F LYS 151 ? NZ  ? F LYS 5   NZ  
260 1 Y 1 F GLU 160 ? CG  ? F GLU 14  CG  
261 1 Y 1 F GLU 160 ? CD  ? F GLU 14  CD  
262 1 Y 1 F GLU 160 ? OE1 ? F GLU 14  OE1 
263 1 Y 1 F GLU 160 ? OE2 ? F GLU 14  OE2 
264 1 Y 1 F LYS 161 ? CG  ? F LYS 15  CG  
265 1 Y 1 F LYS 161 ? CD  ? F LYS 15  CD  
266 1 Y 1 F LYS 161 ? CE  ? F LYS 15  CE  
267 1 Y 1 F LYS 161 ? NZ  ? F LYS 15  NZ  
268 1 Y 1 F GLU 163 ? CG  ? F GLU 17  CG  
269 1 Y 1 F GLU 163 ? CD  ? F GLU 17  CD  
270 1 Y 1 F GLU 163 ? OE1 ? F GLU 17  OE1 
271 1 Y 1 F GLU 163 ? OE2 ? F GLU 17  OE2 
272 1 Y 1 F LYS 196 ? CG  ? F LYS 50  CG  
273 1 Y 1 F LYS 196 ? CD  ? F LYS 50  CD  
274 1 Y 1 F LYS 196 ? CE  ? F LYS 50  CE  
275 1 Y 1 F LYS 196 ? NZ  ? F LYS 50  NZ  
276 1 Y 1 F HIS 245 ? CG  ? F HIS 99  CG  
277 1 Y 1 F HIS 245 ? ND1 ? F HIS 99  ND1 
278 1 Y 1 F HIS 245 ? CD2 ? F HIS 99  CD2 
279 1 Y 1 F HIS 245 ? CE1 ? F HIS 99  CE1 
280 1 Y 1 F HIS 245 ? NE2 ? F HIS 99  NE2 
281 1 Y 1 F VAL 269 ? CG1 ? F VAL 123 CG1 
282 1 Y 1 F VAL 269 ? CG2 ? F VAL 123 CG2 
283 1 Y 1 F LYS 292 ? CG  ? F LYS 146 CG  
284 1 Y 1 F LYS 292 ? CD  ? F LYS 146 CD  
285 1 Y 1 F LYS 292 ? CE  ? F LYS 146 CE  
286 1 Y 1 F LYS 292 ? NZ  ? F LYS 146 NZ  
287 1 Y 1 F TYR 308 ? CG  ? F TYR 162 CG  
288 1 Y 1 F TYR 308 ? CD1 ? F TYR 162 CD1 
289 1 Y 1 F TYR 308 ? CD2 ? F TYR 162 CD2 
290 1 Y 1 F TYR 308 ? CE1 ? F TYR 162 CE1 
291 1 Y 1 F TYR 308 ? CE2 ? F TYR 162 CE2 
292 1 Y 1 F TYR 308 ? CZ  ? F TYR 162 CZ  
293 1 Y 1 F TYR 308 ? OH  ? F TYR 162 OH  
294 1 Y 1 F LYS 322 ? CG  ? F LYS 176 CG  
295 1 Y 1 F LYS 322 ? CD  ? F LYS 176 CD  
296 1 Y 1 F LYS 322 ? CE  ? F LYS 176 CE  
297 1 Y 1 F LYS 322 ? NZ  ? F LYS 176 NZ  
298 1 Y 1 F ARG 330 ? CG  ? F ARG 184 CG  
299 1 Y 1 F ARG 330 ? CD  ? F ARG 184 CD  
300 1 Y 1 F ARG 330 ? NE  ? F ARG 184 NE  
301 1 Y 1 F ARG 330 ? CZ  ? F ARG 184 CZ  
302 1 Y 1 F ARG 330 ? NH1 ? F ARG 184 NH1 
303 1 Y 1 F ARG 330 ? NH2 ? F ARG 184 NH2 
304 1 Y 1 F ASN 331 ? CG  ? F ASN 185 CG  
305 1 Y 1 F ASN 331 ? OD1 ? F ASN 185 OD1 
306 1 Y 1 F ASN 331 ? ND2 ? F ASN 185 ND2 
307 1 Y 1 F GLU 335 ? CG  ? F GLU 189 CG  
308 1 Y 1 F GLU 335 ? CD  ? F GLU 189 CD  
309 1 Y 1 F GLU 335 ? OE1 ? F GLU 189 OE1 
310 1 Y 1 F GLU 335 ? OE2 ? F GLU 189 OE2 
311 1 Y 1 F PRO 361 ? CG  ? F PRO 215 CG  
312 1 Y 1 F PRO 361 ? CD  ? F PRO 215 CD  
313 1 Y 1 G ASN 150 ? CG  ? G ASN 4   CG  
314 1 Y 1 G ASN 150 ? OD1 ? G ASN 4   OD1 
315 1 Y 1 G ASN 150 ? ND2 ? G ASN 4   ND2 
316 1 Y 1 G LYS 151 ? CG  ? G LYS 5   CG  
317 1 Y 1 G LYS 151 ? CD  ? G LYS 5   CD  
318 1 Y 1 G LYS 151 ? CE  ? G LYS 5   CE  
319 1 Y 1 G LYS 151 ? NZ  ? G LYS 5   NZ  
320 1 Y 1 G GLU 160 ? CG  ? G GLU 14  CG  
321 1 Y 1 G GLU 160 ? CD  ? G GLU 14  CD  
322 1 Y 1 G GLU 160 ? OE1 ? G GLU 14  OE1 
323 1 Y 1 G GLU 160 ? OE2 ? G GLU 14  OE2 
324 1 Y 1 G LYS 161 ? CG  ? G LYS 15  CG  
325 1 Y 1 G LYS 161 ? CD  ? G LYS 15  CD  
326 1 Y 1 G LYS 161 ? CE  ? G LYS 15  CE  
327 1 Y 1 G LYS 161 ? NZ  ? G LYS 15  NZ  
328 1 Y 1 G GLU 163 ? CG  ? G GLU 17  CG  
329 1 Y 1 G GLU 163 ? CD  ? G GLU 17  CD  
330 1 Y 1 G GLU 163 ? OE1 ? G GLU 17  OE1 
331 1 Y 1 G GLU 163 ? OE2 ? G GLU 17  OE2 
332 1 Y 1 G LYS 196 ? CG  ? G LYS 50  CG  
333 1 Y 1 G LYS 196 ? CD  ? G LYS 50  CD  
334 1 Y 1 G LYS 196 ? CE  ? G LYS 50  CE  
335 1 Y 1 G LYS 196 ? NZ  ? G LYS 50  NZ  
336 1 Y 1 G HIS 245 ? CG  ? G HIS 99  CG  
337 1 Y 1 G HIS 245 ? ND1 ? G HIS 99  ND1 
338 1 Y 1 G HIS 245 ? CD2 ? G HIS 99  CD2 
339 1 Y 1 G HIS 245 ? CE1 ? G HIS 99  CE1 
340 1 Y 1 G HIS 245 ? NE2 ? G HIS 99  NE2 
341 1 Y 1 G VAL 269 ? CG1 ? G VAL 123 CG1 
342 1 Y 1 G VAL 269 ? CG2 ? G VAL 123 CG2 
343 1 Y 1 G LYS 292 ? CG  ? G LYS 146 CG  
344 1 Y 1 G LYS 292 ? CD  ? G LYS 146 CD  
345 1 Y 1 G LYS 292 ? CE  ? G LYS 146 CE  
346 1 Y 1 G LYS 292 ? NZ  ? G LYS 146 NZ  
347 1 Y 1 G TYR 308 ? CG  ? G TYR 162 CG  
348 1 Y 1 G TYR 308 ? CD1 ? G TYR 162 CD1 
349 1 Y 1 G TYR 308 ? CD2 ? G TYR 162 CD2 
350 1 Y 1 G TYR 308 ? CE1 ? G TYR 162 CE1 
351 1 Y 1 G TYR 308 ? CE2 ? G TYR 162 CE2 
352 1 Y 1 G TYR 308 ? CZ  ? G TYR 162 CZ  
353 1 Y 1 G TYR 308 ? OH  ? G TYR 162 OH  
354 1 Y 1 G LYS 322 ? CG  ? G LYS 176 CG  
355 1 Y 1 G LYS 322 ? CD  ? G LYS 176 CD  
356 1 Y 1 G LYS 322 ? CE  ? G LYS 176 CE  
357 1 Y 1 G LYS 322 ? NZ  ? G LYS 176 NZ  
358 1 Y 1 G ARG 330 ? CG  ? G ARG 184 CG  
359 1 Y 1 G ARG 330 ? CD  ? G ARG 184 CD  
360 1 Y 1 G ARG 330 ? NE  ? G ARG 184 NE  
361 1 Y 1 G ARG 330 ? CZ  ? G ARG 184 CZ  
362 1 Y 1 G ARG 330 ? NH1 ? G ARG 184 NH1 
363 1 Y 1 G ARG 330 ? NH2 ? G ARG 184 NH2 
364 1 Y 1 G ASN 331 ? CG  ? G ASN 185 CG  
365 1 Y 1 G ASN 331 ? OD1 ? G ASN 185 OD1 
366 1 Y 1 G ASN 331 ? ND2 ? G ASN 185 ND2 
367 1 Y 1 G GLU 335 ? CG  ? G GLU 189 CG  
368 1 Y 1 G GLU 335 ? CD  ? G GLU 189 CD  
369 1 Y 1 G GLU 335 ? OE1 ? G GLU 189 OE1 
370 1 Y 1 G GLU 335 ? OE2 ? G GLU 189 OE2 
371 1 Y 1 G PRO 361 ? CG  ? G PRO 215 CG  
372 1 Y 1 G PRO 361 ? CD  ? G PRO 215 CD  
373 1 Y 1 H ASN 150 ? CG  ? H ASN 4   CG  
374 1 Y 1 H ASN 150 ? OD1 ? H ASN 4   OD1 
375 1 Y 1 H ASN 150 ? ND2 ? H ASN 4   ND2 
376 1 Y 1 H LYS 151 ? CG  ? H LYS 5   CG  
377 1 Y 1 H LYS 151 ? CD  ? H LYS 5   CD  
378 1 Y 1 H LYS 151 ? CE  ? H LYS 5   CE  
379 1 Y 1 H LYS 151 ? NZ  ? H LYS 5   NZ  
380 1 Y 1 H GLU 160 ? CG  ? H GLU 14  CG  
381 1 Y 1 H GLU 160 ? CD  ? H GLU 14  CD  
382 1 Y 1 H GLU 160 ? OE1 ? H GLU 14  OE1 
383 1 Y 1 H GLU 160 ? OE2 ? H GLU 14  OE2 
384 1 Y 1 H LYS 161 ? CG  ? H LYS 15  CG  
385 1 Y 1 H LYS 161 ? CD  ? H LYS 15  CD  
386 1 Y 1 H LYS 161 ? CE  ? H LYS 15  CE  
387 1 Y 1 H LYS 161 ? NZ  ? H LYS 15  NZ  
388 1 Y 1 H GLU 163 ? CG  ? H GLU 17  CG  
389 1 Y 1 H GLU 163 ? CD  ? H GLU 17  CD  
390 1 Y 1 H GLU 163 ? OE1 ? H GLU 17  OE1 
391 1 Y 1 H GLU 163 ? OE2 ? H GLU 17  OE2 
392 1 Y 1 H LYS 196 ? CG  ? H LYS 50  CG  
393 1 Y 1 H LYS 196 ? CD  ? H LYS 50  CD  
394 1 Y 1 H LYS 196 ? CE  ? H LYS 50  CE  
395 1 Y 1 H LYS 196 ? NZ  ? H LYS 50  NZ  
396 1 Y 1 H HIS 245 ? CG  ? H HIS 99  CG  
397 1 Y 1 H HIS 245 ? ND1 ? H HIS 99  ND1 
398 1 Y 1 H HIS 245 ? CD2 ? H HIS 99  CD2 
399 1 Y 1 H HIS 245 ? CE1 ? H HIS 99  CE1 
400 1 Y 1 H HIS 245 ? NE2 ? H HIS 99  NE2 
401 1 Y 1 H VAL 269 ? CG1 ? H VAL 123 CG1 
402 1 Y 1 H VAL 269 ? CG2 ? H VAL 123 CG2 
403 1 Y 1 H LYS 292 ? CG  ? H LYS 146 CG  
404 1 Y 1 H LYS 292 ? CD  ? H LYS 146 CD  
405 1 Y 1 H LYS 292 ? CE  ? H LYS 146 CE  
406 1 Y 1 H LYS 292 ? NZ  ? H LYS 146 NZ  
407 1 Y 1 H TYR 308 ? CG  ? H TYR 162 CG  
408 1 Y 1 H TYR 308 ? CD1 ? H TYR 162 CD1 
409 1 Y 1 H TYR 308 ? CD2 ? H TYR 162 CD2 
410 1 Y 1 H TYR 308 ? CE1 ? H TYR 162 CE1 
411 1 Y 1 H TYR 308 ? CE2 ? H TYR 162 CE2 
412 1 Y 1 H TYR 308 ? CZ  ? H TYR 162 CZ  
413 1 Y 1 H TYR 308 ? OH  ? H TYR 162 OH  
414 1 Y 1 H LYS 322 ? CG  ? H LYS 176 CG  
415 1 Y 1 H LYS 322 ? CD  ? H LYS 176 CD  
416 1 Y 1 H LYS 322 ? CE  ? H LYS 176 CE  
417 1 Y 1 H LYS 322 ? NZ  ? H LYS 176 NZ  
418 1 Y 1 H ARG 330 ? CG  ? H ARG 184 CG  
419 1 Y 1 H ARG 330 ? CD  ? H ARG 184 CD  
420 1 Y 1 H ARG 330 ? NE  ? H ARG 184 NE  
421 1 Y 1 H ARG 330 ? CZ  ? H ARG 184 CZ  
422 1 Y 1 H ARG 330 ? NH1 ? H ARG 184 NH1 
423 1 Y 1 H ARG 330 ? NH2 ? H ARG 184 NH2 
424 1 Y 1 H ASN 331 ? CG  ? H ASN 185 CG  
425 1 Y 1 H ASN 331 ? OD1 ? H ASN 185 OD1 
426 1 Y 1 H ASN 331 ? ND2 ? H ASN 185 ND2 
427 1 Y 1 H GLU 335 ? CG  ? H GLU 189 CG  
428 1 Y 1 H GLU 335 ? CD  ? H GLU 189 CD  
429 1 Y 1 H GLU 335 ? OE1 ? H GLU 189 OE1 
430 1 Y 1 H GLU 335 ? OE2 ? H GLU 189 OE2 
431 1 Y 1 H PRO 361 ? CG  ? H PRO 215 CG  
432 1 Y 1 H PRO 361 ? CD  ? H PRO 215 CD  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A ALA 2   ? A ALA 2   
3   1 Y 1 A ALA 3   ? A ALA 3   
4   1 Y 1 A GLY 4   ? A GLY 4   
5   1 Y 1 A SER 5   ? A SER 5   
6   1 Y 1 A ILE 6   ? A ILE 6   
7   1 Y 1 A THR 7   ? A THR 7   
8   1 Y 1 A THR 8   ? A THR 8   
9   1 Y 1 A LEU 9   ? A LEU 9   
10  1 Y 1 A PRO 10  ? A PRO 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A LEU 12  ? A LEU 12  
13  1 Y 1 A PRO 13  ? A PRO 13  
14  1 Y 1 A GLU 14  ? A GLU 14  
15  1 Y 1 A ASP 15  ? A ASP 15  
16  1 Y 1 A GLY 16  ? A GLY 16  
17  1 Y 1 A GLY 17  ? A GLY 17  
18  1 Y 1 A SER 18  ? A SER 18  
19  1 Y 1 A GLY 19  ? A GLY 19  
20  1 Y 1 A ALA 20  ? A ALA 20  
21  1 Y 1 A SER 155 ? A SER 155 
22  1 Y 1 B MET 1   ? B MET 1   
23  1 Y 1 B ALA 2   ? B ALA 2   
24  1 Y 1 B ALA 3   ? B ALA 3   
25  1 Y 1 B GLY 4   ? B GLY 4   
26  1 Y 1 B SER 5   ? B SER 5   
27  1 Y 1 B ILE 6   ? B ILE 6   
28  1 Y 1 B THR 7   ? B THR 7   
29  1 Y 1 B THR 8   ? B THR 8   
30  1 Y 1 B LEU 9   ? B LEU 9   
31  1 Y 1 B PRO 10  ? B PRO 10  
32  1 Y 1 B ALA 11  ? B ALA 11  
33  1 Y 1 B LEU 12  ? B LEU 12  
34  1 Y 1 B PRO 13  ? B PRO 13  
35  1 Y 1 B GLU 14  ? B GLU 14  
36  1 Y 1 B ASP 15  ? B ASP 15  
37  1 Y 1 B GLY 16  ? B GLY 16  
38  1 Y 1 B GLY 17  ? B GLY 17  
39  1 Y 1 B SER 18  ? B SER 18  
40  1 Y 1 B GLY 19  ? B GLY 19  
41  1 Y 1 B ALA 20  ? B ALA 20  
42  1 Y 1 B SER 155 ? B SER 155 
43  1 Y 1 C MET 1   ? C MET 1   
44  1 Y 1 C ALA 2   ? C ALA 2   
45  1 Y 1 C ALA 3   ? C ALA 3   
46  1 Y 1 C GLY 4   ? C GLY 4   
47  1 Y 1 C SER 5   ? C SER 5   
48  1 Y 1 C ILE 6   ? C ILE 6   
49  1 Y 1 C THR 7   ? C THR 7   
50  1 Y 1 C THR 8   ? C THR 8   
51  1 Y 1 C LEU 9   ? C LEU 9   
52  1 Y 1 C PRO 10  ? C PRO 10  
53  1 Y 1 C ALA 11  ? C ALA 11  
54  1 Y 1 C LEU 12  ? C LEU 12  
55  1 Y 1 C PRO 13  ? C PRO 13  
56  1 Y 1 C GLU 14  ? C GLU 14  
57  1 Y 1 C ASP 15  ? C ASP 15  
58  1 Y 1 C GLY 16  ? C GLY 16  
59  1 Y 1 C GLY 17  ? C GLY 17  
60  1 Y 1 C SER 18  ? C SER 18  
61  1 Y 1 C GLY 19  ? C GLY 19  
62  1 Y 1 C ALA 20  ? C ALA 20  
63  1 Y 1 C SER 155 ? C SER 155 
64  1 Y 1 D MET 1   ? D MET 1   
65  1 Y 1 D ALA 2   ? D ALA 2   
66  1 Y 1 D ALA 3   ? D ALA 3   
67  1 Y 1 D GLY 4   ? D GLY 4   
68  1 Y 1 D SER 5   ? D SER 5   
69  1 Y 1 D ILE 6   ? D ILE 6   
70  1 Y 1 D THR 7   ? D THR 7   
71  1 Y 1 D THR 8   ? D THR 8   
72  1 Y 1 D LEU 9   ? D LEU 9   
73  1 Y 1 D PRO 10  ? D PRO 10  
74  1 Y 1 D ALA 11  ? D ALA 11  
75  1 Y 1 D LEU 12  ? D LEU 12  
76  1 Y 1 D PRO 13  ? D PRO 13  
77  1 Y 1 D GLU 14  ? D GLU 14  
78  1 Y 1 D ASP 15  ? D ASP 15  
79  1 Y 1 D GLY 16  ? D GLY 16  
80  1 Y 1 D GLY 17  ? D GLY 17  
81  1 Y 1 D SER 18  ? D SER 18  
82  1 Y 1 D GLY 19  ? D GLY 19  
83  1 Y 1 D ALA 20  ? D ALA 20  
84  1 Y 1 D SER 155 ? D SER 155 
85  1 Y 1 E ASN 147 ? E ASN 1   
86  1 Y 1 E SER 148 ? E SER 2   
87  1 Y 1 E ASN 149 ? E ASN 3   
88  1 Y 1 E GLU 295 ? E GLU 149 
89  1 Y 1 E LYS 296 ? E LYS 150 
90  1 Y 1 E ASN 297 ? E ASN 151 
91  1 Y 1 E GLY 298 ? E GLY 152 
92  1 Y 1 E SER 299 ? E SER 153 
93  1 Y 1 E LYS 300 ? E LYS 154 
94  1 Y 1 E TYR 301 ? E TYR 155 
95  1 Y 1 E GLY 302 ? E GLY 156 
96  1 Y 1 E PRO 303 ? E PRO 157 
97  1 Y 1 E ASP 304 ? E ASP 158 
98  1 Y 1 E GLY 305 ? E GLY 159 
99  1 Y 1 E LEU 306 ? E LEU 160 
100 1 Y 1 E ALA 362 ? E ALA 216 
101 1 Y 1 E PRO 363 ? E PRO 217 
102 1 Y 1 E GLY 364 ? E GLY 218 
103 1 Y 1 E ARG 365 ? E ARG 219 
104 1 Y 1 E GLU 366 ? E GLU 220 
105 1 Y 1 F ASN 147 ? F ASN 1   
106 1 Y 1 F SER 148 ? F SER 2   
107 1 Y 1 F ASN 149 ? F ASN 3   
108 1 Y 1 F GLU 295 ? F GLU 149 
109 1 Y 1 F LYS 296 ? F LYS 150 
110 1 Y 1 F ASN 297 ? F ASN 151 
111 1 Y 1 F GLY 298 ? F GLY 152 
112 1 Y 1 F SER 299 ? F SER 153 
113 1 Y 1 F LYS 300 ? F LYS 154 
114 1 Y 1 F TYR 301 ? F TYR 155 
115 1 Y 1 F GLY 302 ? F GLY 156 
116 1 Y 1 F PRO 303 ? F PRO 157 
117 1 Y 1 F ASP 304 ? F ASP 158 
118 1 Y 1 F GLY 305 ? F GLY 159 
119 1 Y 1 F LEU 306 ? F LEU 160 
120 1 Y 1 F ALA 362 ? F ALA 216 
121 1 Y 1 F PRO 363 ? F PRO 217 
122 1 Y 1 F GLY 364 ? F GLY 218 
123 1 Y 1 F ARG 365 ? F ARG 219 
124 1 Y 1 F GLU 366 ? F GLU 220 
125 1 Y 1 G ASN 147 ? G ASN 1   
126 1 Y 1 G SER 148 ? G SER 2   
127 1 Y 1 G ASN 149 ? G ASN 3   
128 1 Y 1 G GLU 295 ? G GLU 149 
129 1 Y 1 G LYS 296 ? G LYS 150 
130 1 Y 1 G ASN 297 ? G ASN 151 
131 1 Y 1 G GLY 298 ? G GLY 152 
132 1 Y 1 G SER 299 ? G SER 153 
133 1 Y 1 G LYS 300 ? G LYS 154 
134 1 Y 1 G TYR 301 ? G TYR 155 
135 1 Y 1 G GLY 302 ? G GLY 156 
136 1 Y 1 G PRO 303 ? G PRO 157 
137 1 Y 1 G ASP 304 ? G ASP 158 
138 1 Y 1 G GLY 305 ? G GLY 159 
139 1 Y 1 G LEU 306 ? G LEU 160 
140 1 Y 1 G ALA 362 ? G ALA 216 
141 1 Y 1 G PRO 363 ? G PRO 217 
142 1 Y 1 G GLY 364 ? G GLY 218 
143 1 Y 1 G ARG 365 ? G ARG 219 
144 1 Y 1 G GLU 366 ? G GLU 220 
145 1 Y 1 H ASN 147 ? H ASN 1   
146 1 Y 1 H SER 148 ? H SER 2   
147 1 Y 1 H ASN 149 ? H ASN 3   
148 1 Y 1 H GLU 295 ? H GLU 149 
149 1 Y 1 H LYS 296 ? H LYS 150 
150 1 Y 1 H ASN 297 ? H ASN 151 
151 1 Y 1 H GLY 298 ? H GLY 152 
152 1 Y 1 H SER 299 ? H SER 153 
153 1 Y 1 H LYS 300 ? H LYS 154 
154 1 Y 1 H TYR 301 ? H TYR 155 
155 1 Y 1 H GLY 302 ? H GLY 156 
156 1 Y 1 H PRO 303 ? H PRO 157 
157 1 Y 1 H ASP 304 ? H ASP 158 
158 1 Y 1 H GLY 305 ? H GLY 159 
159 1 Y 1 H LEU 306 ? H LEU 160 
160 1 Y 1 H ALA 362 ? H ALA 216 
161 1 Y 1 H PRO 363 ? H PRO 217 
162 1 Y 1 H GLY 364 ? H GLY 218 
163 1 Y 1 H ARG 365 ? H ARG 219 
164 1 Y 1 H GLU 366 ? H GLU 220 
#