data_1II7
# 
_entry.id   1II7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1II7         
RCSB  RCSB013291   
WWPDB D_1000013291 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1II8 . unspecified 
PDB 1F2T . unspecified 
PDB 1F2U . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1II7 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hopfner, K.-P.' 1 
'Karcher, A.'    2 
'Craig, L.'      3 
'Woo, T.T.'      4 
'Carney, J.P.'   5 
'Tainer, J.A.'   6 
# 
_citation.id                        primary 
_citation.title                     
'Structural biochemistry and interaction architecture of the DNA double-strand break repair Mre11 nuclease and Rad50-ATPase.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            105 
_citation.page_first                473 
_citation.page_last                 485 
_citation.year                      2001 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11371344 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(01)00335-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hopfner, K.P.' 1 
primary 'Karcher, A.'   2 
primary 'Craig, L.'     3 
primary 'Woo, T.T.'     4 
primary 'Carney, J.P.'  5 
primary 'Tainer, J.A.'  6 
# 
_cell.entry_id           1II7 
_cell.length_a           74.290 
_cell.length_b           88.740 
_cell.length_c           145.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1II7 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mre11 nuclease'                     38928.574 2   ? ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                 54.938    4   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                        96.063    3   ? ? ? ? 
4 non-polymer syn "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" 331.222   1   ? ? ? ? 
5 non-polymer syn 'PHOSPHATE ION'                      94.971    1   ? ? ? ? 
6 water       nat water                                18.015    264 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKFAHLADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDLFHSSRPSPGTLKKAIALLQIPKEHSIPVFA
IEGNHDRTQRGPSVLNLLEDFGLVYVIGMRKEKVENEYLTSERLGNGEYLVKGVYKDLEIHGMKYMSSAWFEANKEILKR
LFRPTDNAILMLHQGVREVSEARGEDYFEIGLGDLPEGYLYYALGHIHKRYETSYSGSPVVYPGSLERWDFGDYEVRYEW
DGIKFKERYGVNKGFYIVEDFKPRFVEIKVRPFIDVKIKGSEEEIRKAIKRLIPLIPKNAYVRLNIGWRKPFDLTEIKEL
LNVEYLKIDTWRI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKFAHLADIHLGYEQFHKPQREEEFAEAFKNALEIAVQENVDFILIAGDLFHSSRPSPGTLKKAIALLQIPKEHSIPVFA
IEGNHDRTQRGPSVLNLLEDFGLVYVIGMRKEKVENEYLTSERLGNGEYLVKGVYKDLEIHGMKYMSSAWFEANKEILKR
LFRPTDNAILMLHQGVREVSEARGEDYFEIGLGDLPEGYLYYALGHIHKRYETSYSGSPVVYPGSLERWDFGDYEVRYEW
DGIKFKERYGVNKGFYIVEDFKPRFVEIKVRPFIDVKIKGSEEEIRKAIKRLIPLIPKNAYVRLNIGWRKPFDLTEIKEL
LNVEYLKIDTWRI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   PHE n 
1 4   ALA n 
1 5   HIS n 
1 6   LEU n 
1 7   ALA n 
1 8   ASP n 
1 9   ILE n 
1 10  HIS n 
1 11  LEU n 
1 12  GLY n 
1 13  TYR n 
1 14  GLU n 
1 15  GLN n 
1 16  PHE n 
1 17  HIS n 
1 18  LYS n 
1 19  PRO n 
1 20  GLN n 
1 21  ARG n 
1 22  GLU n 
1 23  GLU n 
1 24  GLU n 
1 25  PHE n 
1 26  ALA n 
1 27  GLU n 
1 28  ALA n 
1 29  PHE n 
1 30  LYS n 
1 31  ASN n 
1 32  ALA n 
1 33  LEU n 
1 34  GLU n 
1 35  ILE n 
1 36  ALA n 
1 37  VAL n 
1 38  GLN n 
1 39  GLU n 
1 40  ASN n 
1 41  VAL n 
1 42  ASP n 
1 43  PHE n 
1 44  ILE n 
1 45  LEU n 
1 46  ILE n 
1 47  ALA n 
1 48  GLY n 
1 49  ASP n 
1 50  LEU n 
1 51  PHE n 
1 52  HIS n 
1 53  SER n 
1 54  SER n 
1 55  ARG n 
1 56  PRO n 
1 57  SER n 
1 58  PRO n 
1 59  GLY n 
1 60  THR n 
1 61  LEU n 
1 62  LYS n 
1 63  LYS n 
1 64  ALA n 
1 65  ILE n 
1 66  ALA n 
1 67  LEU n 
1 68  LEU n 
1 69  GLN n 
1 70  ILE n 
1 71  PRO n 
1 72  LYS n 
1 73  GLU n 
1 74  HIS n 
1 75  SER n 
1 76  ILE n 
1 77  PRO n 
1 78  VAL n 
1 79  PHE n 
1 80  ALA n 
1 81  ILE n 
1 82  GLU n 
1 83  GLY n 
1 84  ASN n 
1 85  HIS n 
1 86  ASP n 
1 87  ARG n 
1 88  THR n 
1 89  GLN n 
1 90  ARG n 
1 91  GLY n 
1 92  PRO n 
1 93  SER n 
1 94  VAL n 
1 95  LEU n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  GLU n 
1 100 ASP n 
1 101 PHE n 
1 102 GLY n 
1 103 LEU n 
1 104 VAL n 
1 105 TYR n 
1 106 VAL n 
1 107 ILE n 
1 108 GLY n 
1 109 MET n 
1 110 ARG n 
1 111 LYS n 
1 112 GLU n 
1 113 LYS n 
1 114 VAL n 
1 115 GLU n 
1 116 ASN n 
1 117 GLU n 
1 118 TYR n 
1 119 LEU n 
1 120 THR n 
1 121 SER n 
1 122 GLU n 
1 123 ARG n 
1 124 LEU n 
1 125 GLY n 
1 126 ASN n 
1 127 GLY n 
1 128 GLU n 
1 129 TYR n 
1 130 LEU n 
1 131 VAL n 
1 132 LYS n 
1 133 GLY n 
1 134 VAL n 
1 135 TYR n 
1 136 LYS n 
1 137 ASP n 
1 138 LEU n 
1 139 GLU n 
1 140 ILE n 
1 141 HIS n 
1 142 GLY n 
1 143 MET n 
1 144 LYS n 
1 145 TYR n 
1 146 MET n 
1 147 SER n 
1 148 SER n 
1 149 ALA n 
1 150 TRP n 
1 151 PHE n 
1 152 GLU n 
1 153 ALA n 
1 154 ASN n 
1 155 LYS n 
1 156 GLU n 
1 157 ILE n 
1 158 LEU n 
1 159 LYS n 
1 160 ARG n 
1 161 LEU n 
1 162 PHE n 
1 163 ARG n 
1 164 PRO n 
1 165 THR n 
1 166 ASP n 
1 167 ASN n 
1 168 ALA n 
1 169 ILE n 
1 170 LEU n 
1 171 MET n 
1 172 LEU n 
1 173 HIS n 
1 174 GLN n 
1 175 GLY n 
1 176 VAL n 
1 177 ARG n 
1 178 GLU n 
1 179 VAL n 
1 180 SER n 
1 181 GLU n 
1 182 ALA n 
1 183 ARG n 
1 184 GLY n 
1 185 GLU n 
1 186 ASP n 
1 187 TYR n 
1 188 PHE n 
1 189 GLU n 
1 190 ILE n 
1 191 GLY n 
1 192 LEU n 
1 193 GLY n 
1 194 ASP n 
1 195 LEU n 
1 196 PRO n 
1 197 GLU n 
1 198 GLY n 
1 199 TYR n 
1 200 LEU n 
1 201 TYR n 
1 202 TYR n 
1 203 ALA n 
1 204 LEU n 
1 205 GLY n 
1 206 HIS n 
1 207 ILE n 
1 208 HIS n 
1 209 LYS n 
1 210 ARG n 
1 211 TYR n 
1 212 GLU n 
1 213 THR n 
1 214 SER n 
1 215 TYR n 
1 216 SER n 
1 217 GLY n 
1 218 SER n 
1 219 PRO n 
1 220 VAL n 
1 221 VAL n 
1 222 TYR n 
1 223 PRO n 
1 224 GLY n 
1 225 SER n 
1 226 LEU n 
1 227 GLU n 
1 228 ARG n 
1 229 TRP n 
1 230 ASP n 
1 231 PHE n 
1 232 GLY n 
1 233 ASP n 
1 234 TYR n 
1 235 GLU n 
1 236 VAL n 
1 237 ARG n 
1 238 TYR n 
1 239 GLU n 
1 240 TRP n 
1 241 ASP n 
1 242 GLY n 
1 243 ILE n 
1 244 LYS n 
1 245 PHE n 
1 246 LYS n 
1 247 GLU n 
1 248 ARG n 
1 249 TYR n 
1 250 GLY n 
1 251 VAL n 
1 252 ASN n 
1 253 LYS n 
1 254 GLY n 
1 255 PHE n 
1 256 TYR n 
1 257 ILE n 
1 258 VAL n 
1 259 GLU n 
1 260 ASP n 
1 261 PHE n 
1 262 LYS n 
1 263 PRO n 
1 264 ARG n 
1 265 PHE n 
1 266 VAL n 
1 267 GLU n 
1 268 ILE n 
1 269 LYS n 
1 270 VAL n 
1 271 ARG n 
1 272 PRO n 
1 273 PHE n 
1 274 ILE n 
1 275 ASP n 
1 276 VAL n 
1 277 LYS n 
1 278 ILE n 
1 279 LYS n 
1 280 GLY n 
1 281 SER n 
1 282 GLU n 
1 283 GLU n 
1 284 GLU n 
1 285 ILE n 
1 286 ARG n 
1 287 LYS n 
1 288 ALA n 
1 289 ILE n 
1 290 LYS n 
1 291 ARG n 
1 292 LEU n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 ILE n 
1 297 PRO n 
1 298 LYS n 
1 299 ASN n 
1 300 ALA n 
1 301 TYR n 
1 302 VAL n 
1 303 ARG n 
1 304 LEU n 
1 305 ASN n 
1 306 ILE n 
1 307 GLY n 
1 308 TRP n 
1 309 ARG n 
1 310 LYS n 
1 311 PRO n 
1 312 PHE n 
1 313 ASP n 
1 314 LEU n 
1 315 THR n 
1 316 GLU n 
1 317 ILE n 
1 318 LYS n 
1 319 GLU n 
1 320 LEU n 
1 321 LEU n 
1 322 ASN n 
1 323 VAL n 
1 324 GLU n 
1 325 TYR n 
1 326 LEU n 
1 327 LYS n 
1 328 ILE n 
1 329 ASP n 
1 330 THR n 
1 331 TRP n 
1 332 ARG n 
1 333 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MRE11_PYRFU 
_struct_ref.pdbx_db_accession          Q8U1N9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1II7 A 1 ? 333 ? Q8U1N9 1 ? 333 ? 1 333 
2 1 1II7 B 1 ? 333 ? Q8U1N9 1 ? 333 ? 1 333 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                      ? 'O4 P -3'         94.971  
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1II7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.94 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.5 
_exptl_crystal_grow.pdbx_details    
;100 mM Ches, 400 mM ammonium sulfate, 35% OEG 6K, 1 mM manganese, 10 mM dAMP, pH 9.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-07-04 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98400 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98400 
# 
_reflns.entry_id                     1II7 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   431781 
_reflns.number_all                   431781 
_reflns.percent_possible_obs         98.1 
_reflns.pdbx_Rmerge_I_obs            0.046 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.0 
_reflns.B_iso_Wilson_estimate        29.7 
_reflns.pdbx_redundancy              8.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   86.1 
_reflns_shell.Rmerge_I_obs           0.326 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1II7 
_refine.ls_number_reflns_obs                     47867 
_refine.ls_number_reflns_all                     47867 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1830015.25 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    97.7 
_refine.ls_R_factor_obs                          0.222 
_refine.ls_R_factor_all                          0.222 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2397 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               44.8 
_refine.aniso_B[1][1]                            -5.65 
_refine.aniso_B[2][2]                            9.14 
_refine.aniso_B[3][3]                            -3.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.342 
_refine.solvent_model_param_bsol                 60.71 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       Engh&Huber 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1II7 
_refine_analyze.Luzzati_coordinate_error_obs    0.28 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.37 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5501 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             264 
_refine_hist.number_atoms_total               5811 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.013 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.99  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.52  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.48  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.21  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.24  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.34 
_refine_ls_shell.number_reflns_R_work             6548 
_refine_ls_shell.R_factor_R_work                  0.336 
_refine_ls_shell.percent_reflns_obs               85.0 
_refine_ls_shell.R_factor_R_free                  0.375 
_refine_ls_shell.R_factor_R_free_error            0.020 
_refine_ls_shell.percent_reflns_R_free            5.3 
_refine_ls_shell.number_reflns_R_free             368 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1II7 
_struct.title                     'Crystal structure of P. furiosus Mre11 with manganese and dAMP' 
_struct.pdbx_descriptor           
;Mre11 nuclease, 2'-DEOXY-ADENOSINE 3'-MONOPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1II7 
_struct_keywords.pdbx_keywords   REPLICATION 
_struct_keywords.text            'Rad50, Mre11, DNA double-strand break repair, dAMP, manganese, REPLICATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 2 ? 
K N N 2 ? 
L N N 6 ? 
M N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 14  ? HIS A 17  ? GLU A 14  HIS A 17  5 ? 4  
HELX_P HELX_P2  2  LYS A 18  ? GLU A 39  ? LYS A 18  GLU A 39  1 ? 22 
HELX_P HELX_P3  3  SER A 57  ? GLU A 73  ? SER A 57  GLU A 73  1 ? 17 
HELX_P HELX_P4  4  SER A 93  ? PHE A 101 ? SER A 93  PHE A 101 1 ? 9  
HELX_P HELX_P5  5  SER A 147 ? ALA A 153 ? SER A 147 ALA A 153 1 ? 7  
HELX_P HELX_P6  6  GLU A 156 ? PHE A 162 ? GLU A 156 PHE A 162 1 ? 7  
HELX_P HELX_P7  7  VAL A 176 ? ALA A 182 ? VAL A 176 ALA A 182 1 ? 7  
HELX_P HELX_P8  8  GLY A 191 ? LEU A 195 ? GLY A 191 LEU A 195 5 ? 5  
HELX_P HELX_P9  9  ASP A 230 ? TYR A 234 ? ASP A 230 TYR A 234 5 ? 5  
HELX_P HELX_P10 10 SER A 281 ? ILE A 293 ? SER A 281 ILE A 293 1 ? 13 
HELX_P HELX_P11 11 PRO A 294 ? ILE A 296 ? PRO A 294 ILE A 296 5 ? 3  
HELX_P HELX_P12 12 LEU A 314 ? LEU A 321 ? LEU A 314 LEU A 321 1 ? 8  
HELX_P HELX_P13 13 GLU B 14  ? HIS B 17  ? GLU B 14  HIS B 17  5 ? 4  
HELX_P HELX_P14 14 LYS B 18  ? GLU B 39  ? LYS B 18  GLU B 39  1 ? 22 
HELX_P HELX_P15 15 SER B 57  ? HIS B 74  ? SER B 57  HIS B 74  1 ? 18 
HELX_P HELX_P16 16 SER B 93  ? PHE B 101 ? SER B 93  PHE B 101 1 ? 9  
HELX_P HELX_P17 17 SER B 147 ? ALA B 153 ? SER B 147 ALA B 153 1 ? 7  
HELX_P HELX_P18 18 GLU B 156 ? PHE B 162 ? GLU B 156 PHE B 162 1 ? 7  
HELX_P HELX_P19 19 VAL B 176 ? ARG B 183 ? VAL B 176 ARG B 183 1 ? 8  
HELX_P HELX_P20 20 GLY B 191 ? LEU B 195 ? GLY B 191 LEU B 195 5 ? 5  
HELX_P HELX_P21 21 ASP B 230 ? TYR B 234 ? ASP B 230 TYR B 234 5 ? 5  
HELX_P HELX_P22 22 SER B 281 ? ILE B 293 ? SER B 281 ILE B 293 1 ? 13 
HELX_P HELX_P23 23 PRO B 294 ? ILE B 296 ? PRO B 294 ILE B 296 5 ? 3  
HELX_P HELX_P24 24 LEU B 314 ? ASN B 322 ? LEU B 314 ASN B 322 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 8  OD1 ? ? ? 1_555 C MN  . MN  ? ? A ASP 8   A MN  403 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc2  metalc ? ? A ASP 49 OD1 ? ? ? 1_555 D MN  . MN  ? ? A ASP 49  A MN  404 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc3  metalc ? ? A ASP 49 OD1 ? ? ? 1_555 C MN  . MN  ? ? A ASP 49  A MN  403 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc4  metalc ? ? A ASN 84 OD1 ? ? ? 1_555 D MN  . MN  ? ? A ASN 84  A MN  404 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc5  metalc ? ? B ASP 8  OD1 ? ? ? 1_555 K MN  . MN  ? ? B ASP 8   B MN  406 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc6  metalc ? ? B ASP 49 OD2 ? ? ? 1_555 J MN  . MN  ? ? B ASP 49  B MN  405 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc7  metalc ? ? B ASP 49 OD2 ? ? ? 1_555 K MN  . MN  ? ? B ASP 49  B MN  406 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc8  metalc ? ? B ASN 84 OD1 ? ? ? 1_555 J MN  . MN  ? ? B ASN 84  B MN  405 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc9  metalc ? ? I PO4 .  O1  ? ? ? 1_555 J MN  . MN  ? ? B PO4 402 B MN  405 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc10 metalc ? ? I PO4 .  O3  ? ? ? 1_555 K MN  . MN  ? ? B PO4 402 B MN  406 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc11 metalc ? ? C MN  .  MN  ? ? ? 1_555 L HOH . O   ? ? A MN  403 A HOH 407 1_555 ? ? ? ? ? ? ? 2.221 ? 
metalc12 metalc ? ? C MN  .  MN  ? ? ? 1_555 H DA  . OP3 ? ? A MN  403 A DA  401 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc13 metalc ? ? D MN  .  MN  ? ? ? 1_555 H DA  . OP2 ? ? A MN  404 A DA  401 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc14 metalc ? ? D MN  .  MN  ? ? ? 1_555 L HOH . O   ? ? A MN  404 A HOH 407 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc15 metalc ? ? J MN  .  MN  ? ? ? 1_555 M HOH . O   ? ? B MN  405 B HOH 408 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc16 metalc ? ? K MN  .  MN  ? ? ? 1_555 M HOH . O   ? ? B MN  406 B HOH 408 1_555 ? ? ? ? ? ? ? 2.129 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 7 ? 
D ? 5 ? 
E ? 6 ? 
F ? 3 ? 
G ? 7 ? 
H ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? parallel      
D 4 5 ? parallel      
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? parallel      
H 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 105 ? VAL A 106 ? TYR A 105 VAL A 106 
A 2 VAL A 78  ? ILE A 81  ? VAL A 78  ILE A 81  
A 3 PHE A 43  ? ALA A 47  ? PHE A 43  ALA A 47  
A 4 LYS A 2   ? LEU A 6   ? LYS A 2   LEU A 6   
A 5 GLY A 254 ? GLU A 259 ? GLY A 254 GLU A 259 
A 6 LYS A 262 ? GLU A 267 ? LYS A 262 GLU A 267 
B 1 TYR A 211 ? TYR A 215 ? TYR A 211 TYR A 215 
B 2 SER A 218 ? TYR A 222 ? SER A 218 TYR A 222 
B 3 TYR A 201 ? GLY A 205 ? TYR A 201 GLY A 205 
B 4 ALA A 168 ? HIS A 173 ? ALA A 168 HIS A 173 
B 5 LEU A 138 ? MET A 143 ? LEU A 138 MET A 143 
B 6 TYR A 129 ? TYR A 135 ? TYR A 129 TYR A 135 
B 7 GLY A 108 ? ARG A 110 ? GLY A 108 ARG A 110 
C 1 TYR A 211 ? TYR A 215 ? TYR A 211 TYR A 215 
C 2 SER A 218 ? TYR A 222 ? SER A 218 TYR A 222 
C 3 TYR A 201 ? GLY A 205 ? TYR A 201 GLY A 205 
C 4 ALA A 168 ? HIS A 173 ? ALA A 168 HIS A 173 
C 5 LEU A 138 ? MET A 143 ? LEU A 138 MET A 143 
C 6 TYR A 129 ? TYR A 135 ? TYR A 129 TYR A 135 
C 7 LEU A 119 ? ARG A 123 ? LEU A 119 ARG A 123 
D 1 PHE A 245 ? TYR A 249 ? PHE A 245 TYR A 249 
D 2 VAL A 236 ? TRP A 240 ? VAL A 236 TRP A 240 
D 3 PHE A 273 ? GLY A 280 ? PHE A 273 GLY A 280 
D 4 TYR A 301 ? TRP A 308 ? TYR A 301 TRP A 308 
D 5 TYR A 325 ? ARG A 332 ? TYR A 325 ARG A 332 
E 1 TYR B 105 ? VAL B 106 ? TYR B 105 VAL B 106 
E 2 VAL B 78  ? ILE B 81  ? VAL B 78  ILE B 81  
E 3 PHE B 43  ? ALA B 47  ? PHE B 43  ALA B 47  
E 4 LYS B 2   ? LEU B 6   ? LYS B 2   LEU B 6   
E 5 GLY B 254 ? GLU B 259 ? GLY B 254 GLU B 259 
E 6 LYS B 262 ? GLU B 267 ? LYS B 262 GLU B 267 
F 1 LEU B 119 ? ARG B 123 ? LEU B 119 ARG B 123 
F 2 TYR B 129 ? TYR B 135 ? TYR B 129 TYR B 135 
F 3 GLY B 108 ? ARG B 110 ? GLY B 108 ARG B 110 
G 1 LEU B 119 ? ARG B 123 ? LEU B 119 ARG B 123 
G 2 TYR B 129 ? TYR B 135 ? TYR B 129 TYR B 135 
G 3 LEU B 138 ? GLY B 142 ? LEU B 138 GLY B 142 
G 4 ALA B 168 ? HIS B 173 ? ALA B 168 HIS B 173 
G 5 TYR B 201 ? GLY B 205 ? TYR B 201 GLY B 205 
G 6 SER B 218 ? TYR B 222 ? SER B 218 TYR B 222 
G 7 TYR B 211 ? TYR B 215 ? TYR B 211 TYR B 215 
H 1 PHE B 245 ? TYR B 249 ? PHE B 245 TYR B 249 
H 2 VAL B 236 ? TRP B 240 ? VAL B 236 TRP B 240 
H 3 PHE B 273 ? LYS B 279 ? PHE B 273 LYS B 279 
H 4 TYR B 301 ? GLY B 307 ? TYR B 301 GLY B 307 
H 5 TYR B 325 ? ASP B 329 ? TYR B 325 ASP B 329 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 105 ? N TYR A 105 O VAL A 78  ? O VAL A 78  
A 2 3 N PHE A 79  ? N PHE A 79  O ILE A 44  ? O ILE A 44  
A 3 4 N PHE A 43  ? N PHE A 43  O LYS A 2   ? O LYS A 2   
A 4 5 N HIS A 5   ? N HIS A 5   O TYR A 256 ? O TYR A 256 
A 5 6 N GLU A 259 ? N GLU A 259 O LYS A 262 ? O LYS A 262 
B 1 2 N TYR A 215 ? N TYR A 215 O SER A 218 ? O SER A 218 
B 2 3 O PRO A 219 ? O PRO A 219 N TYR A 202 ? N TYR A 202 
B 3 4 N TYR A 201 ? N TYR A 201 O ALA A 168 ? O ALA A 168 
B 4 5 N ILE A 169 ? N ILE A 169 O GLU A 139 ? O GLU A 139 
B 5 6 O ILE A 140 ? O ILE A 140 N GLY A 133 ? N GLY A 133 
B 6 7 N VAL A 131 ? N VAL A 131 O GLY A 108 ? O GLY A 108 
C 1 2 N TYR A 215 ? N TYR A 215 O SER A 218 ? O SER A 218 
C 2 3 O PRO A 219 ? O PRO A 219 N TYR A 202 ? N TYR A 202 
C 3 4 N TYR A 201 ? N TYR A 201 O ALA A 168 ? O ALA A 168 
C 4 5 N ILE A 169 ? N ILE A 169 O GLU A 139 ? O GLU A 139 
C 5 6 O ILE A 140 ? O ILE A 140 N GLY A 133 ? N GLY A 133 
C 6 7 N LYS A 132 ? N LYS A 132 O THR A 120 ? O THR A 120 
D 1 2 O ARG A 248 ? O ARG A 248 N ARG A 237 ? N ARG A 237 
D 2 3 N VAL A 236 ? N VAL A 236 O PHE A 273 ? O PHE A 273 
D 3 4 N ILE A 274 ? N ILE A 274 O TYR A 301 ? O TYR A 301 
D 4 5 N VAL A 302 ? N VAL A 302 O TYR A 325 ? O TYR A 325 
E 1 2 N TYR B 105 ? N TYR B 105 O VAL B 78  ? O VAL B 78  
E 2 3 N PHE B 79  ? N PHE B 79  O ILE B 44  ? O ILE B 44  
E 3 4 N PHE B 43  ? N PHE B 43  O LYS B 2   ? O LYS B 2   
E 4 5 N HIS B 5   ? N HIS B 5   O TYR B 256 ? O TYR B 256 
E 5 6 N GLU B 259 ? N GLU B 259 O LYS B 262 ? O LYS B 262 
F 1 2 O GLU B 122 ? O GLU B 122 N LEU B 130 ? N LEU B 130 
F 2 3 N VAL B 131 ? N VAL B 131 O GLY B 108 ? O GLY B 108 
G 1 2 O GLU B 122 ? O GLU B 122 N LEU B 130 ? N LEU B 130 
G 2 3 N TYR B 135 ? N TYR B 135 O LEU B 138 ? O LEU B 138 
G 3 4 N HIS B 141 ? N HIS B 141 O ILE B 169 ? O ILE B 169 
G 4 5 N LEU B 170 ? N LEU B 170 O TYR B 201 ? O TYR B 201 
G 5 6 N TYR B 202 ? N TYR B 202 O PRO B 219 ? O PRO B 219 
G 6 7 N TYR B 222 ? N TYR B 222 O TYR B 211 ? O TYR B 211 
H 1 2 O ARG B 248 ? O ARG B 248 N ARG B 237 ? N ARG B 237 
H 2 3 N VAL B 236 ? N VAL B 236 O PHE B 273 ? O PHE B 273 
H 3 4 N ILE B 274 ? N ILE B 274 O TYR B 301 ? O TYR B 301 
H 4 5 N VAL B 302 ? N VAL B 302 O TYR B 325 ? O TYR B 325 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE PO4 B 402' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN A 403'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN A 404'  
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 405'  
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 406'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 501' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 502' 
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A 503' 
AC9 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE DA A 401'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  HIS B 10  ? HIS B 10  . ? 1_555 ? 
2  AC1 9  ASP B 49  ? ASP B 49  . ? 1_555 ? 
3  AC1 9  ASN B 84  ? ASN B 84  . ? 1_555 ? 
4  AC1 9  HIS B 85  ? HIS B 85  . ? 1_555 ? 
5  AC1 9  HIS B 206 ? HIS B 206 . ? 1_555 ? 
6  AC1 9  HIS B 208 ? HIS B 208 . ? 1_555 ? 
7  AC1 9  MN  J .   ? MN  B 405 . ? 1_555 ? 
8  AC1 9  MN  K .   ? MN  B 406 . ? 1_555 ? 
9  AC1 9  HOH M .   ? HOH B 408 . ? 1_555 ? 
10 AC2 7  ASP A 8   ? ASP A 8   . ? 1_555 ? 
11 AC2 7  HIS A 10  ? HIS A 10  . ? 1_555 ? 
12 AC2 7  ASP A 49  ? ASP A 49  . ? 1_555 ? 
13 AC2 7  HIS A 208 ? HIS A 208 . ? 1_555 ? 
14 AC2 7  DA  H .   ? DA  A 401 . ? 1_555 ? 
15 AC2 7  MN  D .   ? MN  A 404 . ? 1_555 ? 
16 AC2 7  HOH L .   ? HOH A 407 . ? 1_555 ? 
17 AC3 7  ASP A 49  ? ASP A 49  . ? 1_555 ? 
18 AC3 7  ASN A 84  ? ASN A 84  . ? 1_555 ? 
19 AC3 7  HIS A 173 ? HIS A 173 . ? 1_555 ? 
20 AC3 7  HIS A 206 ? HIS A 206 . ? 1_555 ? 
21 AC3 7  DA  H .   ? DA  A 401 . ? 1_555 ? 
22 AC3 7  MN  C .   ? MN  A 403 . ? 1_555 ? 
23 AC3 7  HOH L .   ? HOH A 407 . ? 1_555 ? 
24 AC4 7  ASP B 49  ? ASP B 49  . ? 1_555 ? 
25 AC4 7  ASN B 84  ? ASN B 84  . ? 1_555 ? 
26 AC4 7  HIS B 173 ? HIS B 173 . ? 1_555 ? 
27 AC4 7  HIS B 206 ? HIS B 206 . ? 1_555 ? 
28 AC4 7  PO4 I .   ? PO4 B 402 . ? 1_555 ? 
29 AC4 7  MN  K .   ? MN  B 406 . ? 1_555 ? 
30 AC4 7  HOH M .   ? HOH B 408 . ? 1_555 ? 
31 AC5 7  ASP B 8   ? ASP B 8   . ? 1_555 ? 
32 AC5 7  HIS B 10  ? HIS B 10  . ? 1_555 ? 
33 AC5 7  ASP B 49  ? ASP B 49  . ? 1_555 ? 
34 AC5 7  HIS B 208 ? HIS B 208 . ? 1_555 ? 
35 AC5 7  PO4 I .   ? PO4 B 402 . ? 1_555 ? 
36 AC5 7  MN  J .   ? MN  B 405 . ? 1_555 ? 
37 AC5 7  HOH M .   ? HOH B 408 . ? 1_555 ? 
38 AC6 4  SER A 53  ? SER A 53  . ? 1_555 ? 
39 AC6 4  HOH L .   ? HOH A 832 . ? 1_555 ? 
40 AC6 4  ARG B 55  ? ARG B 55  . ? 1_555 ? 
41 AC6 4  HOH M .   ? HOH B 786 . ? 1_555 ? 
42 AC7 4  ARG A 87  ? ARG A 87  . ? 1_555 ? 
43 AC7 4  MET A 146 ? MET A 146 . ? 1_555 ? 
44 AC7 4  SER A 147 ? SER A 147 . ? 1_555 ? 
45 AC7 4  TRP A 150 ? TRP A 150 . ? 1_555 ? 
46 AC8 2  ARG A 160 ? ARG A 160 . ? 1_555 ? 
47 AC8 2  LYS B 159 ? LYS B 159 . ? 1_455 ? 
48 AC9 13 HIS A 10  ? HIS A 10  . ? 1_555 ? 
49 AC9 13 ASP A 49  ? ASP A 49  . ? 1_555 ? 
50 AC9 13 ASN A 84  ? ASN A 84  . ? 1_555 ? 
51 AC9 13 HIS A 85  ? HIS A 85  . ? 1_555 ? 
52 AC9 13 TYR A 187 ? TYR A 187 . ? 1_555 ? 
53 AC9 13 HIS A 206 ? HIS A 206 . ? 1_555 ? 
54 AC9 13 ILE A 207 ? ILE A 207 . ? 1_555 ? 
55 AC9 13 HIS A 208 ? HIS A 208 . ? 1_555 ? 
56 AC9 13 MN  C .   ? MN  A 403 . ? 1_555 ? 
57 AC9 13 MN  D .   ? MN  A 404 . ? 1_555 ? 
58 AC9 13 HOH L .   ? HOH A 407 . ? 1_555 ? 
59 AC9 13 HOH L .   ? HOH A 867 . ? 1_555 ? 
60 AC9 13 HOH L .   ? HOH A 887 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1II7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1II7 
_atom_sites.fract_transf_matrix[1][1]   0.013461 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011269 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006891 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -2.310  49.568  7.072  1.00 54.15  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -2.152  48.881  8.385  1.00 51.18  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -1.530  47.514  8.110  1.00 49.84  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -2.222  46.563  7.720  1.00 49.58  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -3.511  48.752  9.087  1.00 51.00  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -3.502  47.897  10.363 1.00 51.84  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -1.833  47.641  10.867 1.00 47.05  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -1.470  49.393  11.393 1.00 48.69  ? 1   MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -0.217  47.453  8.358  1.00 45.90  ? 2   LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? 0.631   46.292  8.125  1.00 42.36  ? 2   LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? 1.492   45.929  9.353  1.00 39.80  ? 2   LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? 2.098   46.802  9.966  1.00 39.60  ? 2   LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? 1.538   46.662  6.967  1.00 43.52  ? 2   LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? 2.390   45.604  6.332  1.00 44.89  ? 2   LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? 2.905   46.270  5.051  1.00 46.62  ? 2   LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? 3.765   45.415  4.181  1.00 47.18  ? 2   LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? 4.231   46.322  3.072  1.00 48.76  ? 2   LYS A NZ    1 
ATOM   18   N  N     . PHE A 1 3   ? 1.574   44.649  9.700  1.00 35.92  ? 3   PHE A N     1 
ATOM   19   C  CA    . PHE A 1 3   ? 2.402   44.253  10.829 1.00 32.64  ? 3   PHE A CA    1 
ATOM   20   C  C     . PHE A 1 3   ? 3.004   42.864  10.664 1.00 33.01  ? 3   PHE A C     1 
ATOM   21   O  O     . PHE A 1 3   ? 2.463   42.022  9.922  1.00 32.07  ? 3   PHE A O     1 
ATOM   22   C  CB    . PHE A 1 3   ? 1.612   44.360  12.148 1.00 30.34  ? 3   PHE A CB    1 
ATOM   23   C  CG    . PHE A 1 3   ? 0.482   43.382  12.287 1.00 28.82  ? 3   PHE A CG    1 
ATOM   24   C  CD1   . PHE A 1 3   ? 0.698   42.132  12.835 1.00 28.26  ? 3   PHE A CD1   1 
ATOM   25   C  CD2   . PHE A 1 3   ? -0.819  43.733  11.913 1.00 27.21  ? 3   PHE A CD2   1 
ATOM   26   C  CE1   . PHE A 1 3   ? -0.359  41.246  13.021 1.00 28.14  ? 3   PHE A CE1   1 
ATOM   27   C  CE2   . PHE A 1 3   ? -1.888  42.852  12.095 1.00 25.66  ? 3   PHE A CE2   1 
ATOM   28   C  CZ    . PHE A 1 3   ? -1.657  41.611  12.651 1.00 28.07  ? 3   PHE A CZ    1 
ATOM   29   N  N     . ALA A 1 4   ? 4.157   42.637  11.298 1.00 29.88  ? 4   ALA A N     1 
ATOM   30   C  CA    . ALA A 1 4   ? 4.775   41.316  11.223 1.00 28.91  ? 4   ALA A CA    1 
ATOM   31   C  C     . ALA A 1 4   ? 4.354   40.574  12.479 1.00 29.85  ? 4   ALA A C     1 
ATOM   32   O  O     . ALA A 1 4   ? 4.268   41.151  13.579 1.00 30.53  ? 4   ALA A O     1 
ATOM   33   C  CB    . ALA A 1 4   ? 6.296   41.413  11.146 1.00 28.37  ? 4   ALA A CB    1 
ATOM   34   N  N     . HIS A 1 5   ? 4.048   39.302  12.307 1.00 27.93  ? 5   HIS A N     1 
ATOM   35   C  CA    . HIS A 1 5   ? 3.627   38.470  13.408 1.00 29.10  ? 5   HIS A CA    1 
ATOM   36   C  C     . HIS A 1 5   ? 4.656   37.335  13.536 1.00 29.53  ? 5   HIS A C     1 
ATOM   37   O  O     . HIS A 1 5   ? 4.744   36.464  12.668 1.00 31.57  ? 5   HIS A O     1 
ATOM   38   C  CB    . HIS A 1 5   ? 2.224   37.910  13.110 1.00 27.74  ? 5   HIS A CB    1 
ATOM   39   C  CG    . HIS A 1 5   ? 1.726   36.919  14.117 1.00 27.38  ? 5   HIS A CG    1 
ATOM   40   N  ND1   . HIS A 1 5   ? 0.603   36.156  13.904 1.00 25.84  ? 5   HIS A ND1   1 
ATOM   41   C  CD2   . HIS A 1 5   ? 2.199   36.554  15.334 1.00 29.77  ? 5   HIS A CD2   1 
ATOM   42   C  CE1   . HIS A 1 5   ? 0.404   35.355  14.938 1.00 28.29  ? 5   HIS A CE1   1 
ATOM   43   N  NE2   . HIS A 1 5   ? 1.359   35.575  15.824 1.00 27.64  ? 5   HIS A NE2   1 
ATOM   44   N  N     . LEU A 1 6   ? 5.449   37.370  14.600 1.00 29.02  ? 6   LEU A N     1 
ATOM   45   C  CA    . LEU A 1 6   ? 6.434   36.329  14.854 1.00 29.44  ? 6   LEU A CA    1 
ATOM   46   C  C     . LEU A 1 6   ? 6.129   35.649  16.191 1.00 29.43  ? 6   LEU A C     1 
ATOM   47   O  O     . LEU A 1 6   ? 5.230   36.078  16.951 1.00 28.43  ? 6   LEU A O     1 
ATOM   48   C  CB    . LEU A 1 6   ? 7.855   36.897  14.926 1.00 32.81  ? 6   LEU A CB    1 
ATOM   49   C  CG    . LEU A 1 6   ? 8.358   38.082  14.098 1.00 33.97  ? 6   LEU A CG    1 
ATOM   50   C  CD1   . LEU A 1 6   ? 9.889   38.112  14.170 1.00 38.90  ? 6   LEU A CD1   1 
ATOM   51   C  CD2   . LEU A 1 6   ? 7.973   37.953  12.693 1.00 36.68  ? 6   LEU A CD2   1 
ATOM   52   N  N     . ALA A 1 7   ? 6.881   34.583  16.472 1.00 27.20  ? 7   ALA A N     1 
ATOM   53   C  CA    . ALA A 1 7   ? 6.746   33.855  17.729 1.00 27.79  ? 7   ALA A CA    1 
ATOM   54   C  C     . ALA A 1 7   ? 7.805   32.761  17.842 1.00 27.91  ? 7   ALA A C     1 
ATOM   55   O  O     . ALA A 1 7   ? 8.473   32.410  16.849 1.00 28.53  ? 7   ALA A O     1 
ATOM   56   C  CB    . ALA A 1 7   ? 5.346   33.224  17.829 1.00 28.62  ? 7   ALA A CB    1 
ATOM   57   N  N     . ASP A 1 8   ? 7.977   32.254  19.055 1.00 26.65  ? 8   ASP A N     1 
ATOM   58   C  CA    . ASP A 1 8   ? 8.882   31.149  19.290 1.00 28.34  ? 8   ASP A CA    1 
ATOM   59   C  C     . ASP A 1 8   ? 10.273  31.305  18.659 1.00 27.71  ? 8   ASP A C     1 
ATOM   60   O  O     . ASP A 1 8   ? 10.740  30.453  17.907 1.00 29.27  ? 8   ASP A O     1 
ATOM   61   C  CB    . ASP A 1 8   ? 8.186   29.886  18.777 1.00 30.25  ? 8   ASP A CB    1 
ATOM   62   C  CG    . ASP A 1 8   ? 6.918   29.584  19.554 1.00 34.25  ? 8   ASP A CG    1 
ATOM   63   O  OD1   . ASP A 1 8   ? 7.041   29.177  20.724 1.00 33.37  ? 8   ASP A OD1   1 
ATOM   64   O  OD2   . ASP A 1 8   ? 5.801   29.770  19.010 1.00 35.77  ? 8   ASP A OD2   1 
ATOM   65   N  N     . ILE A 1 9   ? 10.913  32.423  18.967 1.00 26.84  ? 9   ILE A N     1 
ATOM   66   C  CA    . ILE A 1 9   ? 12.236  32.739  18.477 1.00 26.52  ? 9   ILE A CA    1 
ATOM   67   C  C     . ILE A 1 9   ? 13.285  31.864  19.173 1.00 28.22  ? 9   ILE A C     1 
ATOM   68   O  O     . ILE A 1 9   ? 14.257  31.426  18.550 1.00 28.01  ? 9   ILE A O     1 
ATOM   69   C  CB    . ILE A 1 9   ? 12.520  34.214  18.759 1.00 27.25  ? 9   ILE A CB    1 
ATOM   70   C  CG1   . ILE A 1 9   ? 11.338  35.051  18.249 1.00 26.35  ? 9   ILE A CG1   1 
ATOM   71   C  CG2   . ILE A 1 9   ? 13.823  34.640  18.094 1.00 26.40  ? 9   ILE A CG2   1 
ATOM   72   C  CD1   . ILE A 1 9   ? 11.011  34.845  16.725 1.00 25.85  ? 9   ILE A CD1   1 
ATOM   73   N  N     . HIS A 1 10  ? 13.072  31.599  20.462 1.00 26.69  ? 10  HIS A N     1 
ATOM   74   C  CA    . HIS A 1 10  ? 14.009  30.787  21.254 1.00 28.02  ? 10  HIS A CA    1 
ATOM   75   C  C     . HIS A 1 10  ? 15.483  31.203  21.181 1.00 27.57  ? 10  HIS A C     1 
ATOM   76   O  O     . HIS A 1 10  ? 16.357  30.359  21.019 1.00 23.99  ? 10  HIS A O     1 
ATOM   77   C  CB    . HIS A 1 10  ? 13.867  29.284  20.899 1.00 27.15  ? 10  HIS A CB    1 
ATOM   78   C  CG    . HIS A 1 10  ? 12.599  28.681  21.415 1.00 28.59  ? 10  HIS A CG    1 
ATOM   79   N  ND1   . HIS A 1 10  ? 12.536  27.980  22.603 1.00 30.06  ? 10  HIS A ND1   1 
ATOM   80   C  CD2   . HIS A 1 10  ? 11.319  28.794  20.978 1.00 26.35  ? 10  HIS A CD2   1 
ATOM   81   C  CE1   . HIS A 1 10  ? 11.276  27.691  22.875 1.00 27.36  ? 10  HIS A CE1   1 
ATOM   82   N  NE2   . HIS A 1 10  ? 10.519  28.180  21.909 1.00 28.44  ? 10  HIS A NE2   1 
ATOM   83   N  N     . LEU A 1 11  ? 15.758  32.503  21.303 1.00 26.85  ? 11  LEU A N     1 
ATOM   84   C  CA    . LEU A 1 11  ? 17.152  32.972  21.286 1.00 27.57  ? 11  LEU A CA    1 
ATOM   85   C  C     . LEU A 1 11  ? 17.879  32.257  22.409 1.00 28.11  ? 11  LEU A C     1 
ATOM   86   O  O     . LEU A 1 11  ? 17.323  32.093  23.505 1.00 29.47  ? 11  LEU A O     1 
ATOM   87   C  CB    . LEU A 1 11  ? 17.225  34.494  21.530 1.00 25.89  ? 11  LEU A CB    1 
ATOM   88   C  CG    . LEU A 1 11  ? 16.526  35.348  20.465 1.00 23.73  ? 11  LEU A CG    1 
ATOM   89   C  CD1   . LEU A 1 11  ? 16.604  36.805  20.823 1.00 24.72  ? 11  LEU A CD1   1 
ATOM   90   C  CD2   . LEU A 1 11  ? 17.179  35.102  19.081 1.00 22.96  ? 11  LEU A CD2   1 
ATOM   91   N  N     . GLY A 1 12  ? 19.113  31.830  22.152 1.00 28.05  ? 12  GLY A N     1 
ATOM   92   C  CA    . GLY A 1 12  ? 19.871  31.143  23.179 1.00 29.54  ? 12  GLY A CA    1 
ATOM   93   C  C     . GLY A 1 12  ? 19.713  29.623  23.181 1.00 31.92  ? 12  GLY A C     1 
ATOM   94   O  O     . GLY A 1 12  ? 20.382  28.937  23.948 1.00 32.60  ? 12  GLY A O     1 
ATOM   95   N  N     . TYR A 1 13  ? 18.843  29.081  22.331 1.00 31.55  ? 13  TYR A N     1 
ATOM   96   C  CA    . TYR A 1 13  ? 18.635  27.635  22.314 1.00 33.01  ? 13  TYR A CA    1 
ATOM   97   C  C     . TYR A 1 13  ? 19.814  26.935  21.636 1.00 33.93  ? 13  TYR A C     1 
ATOM   98   O  O     . TYR A 1 13  ? 20.045  27.114  20.436 1.00 33.05  ? 13  TYR A O     1 
ATOM   99   C  CB    . TYR A 1 13  ? 17.365  27.260  21.533 1.00 31.31  ? 13  TYR A CB    1 
ATOM   100  C  CG    . TYR A 1 13  ? 17.086  25.768  21.528 1.00 29.63  ? 13  TYR A CG    1 
ATOM   101  C  CD1   . TYR A 1 13  ? 16.254  25.197  20.571 1.00 30.30  ? 13  TYR A CD1   1 
ATOM   102  C  CD2   . TYR A 1 13  ? 17.557  24.954  22.557 1.00 31.60  ? 13  TYR A CD2   1 
ATOM   103  C  CE1   . TYR A 1 13  ? 15.870  23.847  20.636 1.00 30.49  ? 13  TYR A CE1   1 
ATOM   104  C  CE2   . TYR A 1 13  ? 17.188  23.614  22.640 1.00 32.14  ? 13  TYR A CE2   1 
ATOM   105  C  CZ    . TYR A 1 13  ? 16.340  23.068  21.675 1.00 31.01  ? 13  TYR A CZ    1 
ATOM   106  O  OH    . TYR A 1 13  ? 15.980  21.749  21.777 1.00 31.98  ? 13  TYR A OH    1 
ATOM   107  N  N     . GLU A 1 14  ? 20.542  26.135  22.394 1.00 34.35  ? 14  GLU A N     1 
ATOM   108  C  CA    . GLU A 1 14  ? 21.670  25.411  21.825 1.00 38.72  ? 14  GLU A CA    1 
ATOM   109  C  C     . GLU A 1 14  ? 21.108  24.021  21.481 1.00 37.21  ? 14  GLU A C     1 
ATOM   110  O  O     . GLU A 1 14  ? 21.341  23.034  22.182 1.00 37.78  ? 14  GLU A O     1 
ATOM   111  C  CB    . GLU A 1 14  ? 22.796  25.343  22.857 1.00 41.69  ? 14  GLU A CB    1 
ATOM   112  C  CG    . GLU A 1 14  ? 24.020  24.583  22.387 1.00 50.88  ? 14  GLU A CG    1 
ATOM   113  C  CD    . GLU A 1 14  ? 25.016  24.358  23.512 1.00 54.25  ? 14  GLU A CD    1 
ATOM   114  O  OE1   . GLU A 1 14  ? 25.795  25.292  23.815 1.00 57.03  ? 14  GLU A OE1   1 
ATOM   115  O  OE2   . GLU A 1 14  ? 24.997  23.256  24.107 1.00 56.91  ? 14  GLU A OE2   1 
ATOM   116  N  N     . GLN A 1 15  ? 20.324  23.979  20.413 1.00 35.25  ? 15  GLN A N     1 
ATOM   117  C  CA    . GLN A 1 15  ? 19.670  22.756  19.960 1.00 35.87  ? 15  GLN A CA    1 
ATOM   118  C  C     . GLN A 1 15  ? 20.670  21.629  19.698 1.00 35.70  ? 15  GLN A C     1 
ATOM   119  O  O     . GLN A 1 15  ? 21.658  21.824  19.019 1.00 34.83  ? 15  GLN A O     1 
ATOM   120  C  CB    . GLN A 1 15  ? 18.875  23.043  18.688 1.00 34.27  ? 15  GLN A CB    1 
ATOM   121  C  CG    . GLN A 1 15  ? 17.986  21.902  18.226 1.00 34.13  ? 15  GLN A CG    1 
ATOM   122  C  CD    . GLN A 1 15  ? 17.234  22.268  16.970 1.00 32.23  ? 15  GLN A CD    1 
ATOM   123  O  OE1   . GLN A 1 15  ? 17.827  22.714  15.989 1.00 34.71  ? 15  GLN A OE1   1 
ATOM   124  N  NE2   . GLN A 1 15  ? 15.926  22.099  16.993 1.00 32.55  ? 15  GLN A NE2   1 
ATOM   125  N  N     . PHE A 1 16  ? 20.396  20.454  20.240 1.00 36.44  ? 16  PHE A N     1 
ATOM   126  C  CA    . PHE A 1 16  ? 21.285  19.317  20.051 1.00 40.22  ? 16  PHE A CA    1 
ATOM   127  C  C     . PHE A 1 16  ? 22.697  19.656  20.551 1.00 41.98  ? 16  PHE A C     1 
ATOM   128  O  O     . PHE A 1 16  ? 23.680  19.144  20.031 1.00 44.28  ? 16  PHE A O     1 
ATOM   129  C  CB    . PHE A 1 16  ? 21.331  18.906  18.565 1.00 39.07  ? 16  PHE A CB    1 
ATOM   130  C  CG    . PHE A 1 16  ? 19.973  18.653  17.951 1.00 40.71  ? 16  PHE A CG    1 
ATOM   131  C  CD1   . PHE A 1 16  ? 19.717  19.026  16.632 1.00 40.97  ? 16  PHE A CD1   1 
ATOM   132  C  CD2   . PHE A 1 16  ? 18.957  18.044  18.684 1.00 39.96  ? 16  PHE A CD2   1 
ATOM   133  C  CE1   . PHE A 1 16  ? 18.468  18.797  16.042 1.00 40.68  ? 16  PHE A CE1   1 
ATOM   134  C  CE2   . PHE A 1 16  ? 17.703  17.807  18.113 1.00 41.77  ? 16  PHE A CE2   1 
ATOM   135  C  CZ    . PHE A 1 16  ? 17.456  18.185  16.784 1.00 42.58  ? 16  PHE A CZ    1 
ATOM   136  N  N     . HIS A 1 17  ? 22.784  20.529  21.551 1.00 42.76  ? 17  HIS A N     1 
ATOM   137  C  CA    . HIS A 1 17  ? 24.059  20.914  22.146 1.00 43.97  ? 17  HIS A CA    1 
ATOM   138  C  C     . HIS A 1 17  ? 25.043  21.446  21.143 1.00 45.51  ? 17  HIS A C     1 
ATOM   139  O  O     . HIS A 1 17  ? 26.248  21.299  21.328 1.00 46.88  ? 17  HIS A O     1 
ATOM   140  C  CB    . HIS A 1 17  ? 24.693  19.718  22.849 1.00 44.00  ? 17  HIS A CB    1 
ATOM   141  C  CG    . HIS A 1 17  ? 23.814  19.110  23.891 1.00 44.35  ? 17  HIS A CG    1 
ATOM   142  N  ND1   . HIS A 1 17  ? 23.766  19.576  25.187 1.00 44.87  ? 17  HIS A ND1   1 
ATOM   143  C  CD2   . HIS A 1 17  ? 22.894  18.122  23.808 1.00 43.91  ? 17  HIS A CD2   1 
ATOM   144  C  CE1   . HIS A 1 17  ? 22.850  18.902  25.859 1.00 44.13  ? 17  HIS A CE1   1 
ATOM   145  N  NE2   . HIS A 1 17  ? 22.305  18.017  25.044 1.00 44.82  ? 17  HIS A NE2   1 
ATOM   146  N  N     . LYS A 1 18  ? 24.542  22.063  20.082 1.00 45.95  ? 18  LYS A N     1 
ATOM   147  C  CA    . LYS A 1 18  ? 25.412  22.612  19.061 1.00 46.18  ? 18  LYS A CA    1 
ATOM   148  C  C     . LYS A 1 18  ? 25.366  24.124  19.057 1.00 47.00  ? 18  LYS A C     1 
ATOM   149  O  O     . LYS A 1 18  ? 24.368  24.718  18.657 1.00 47.31  ? 18  LYS A O     1 
ATOM   150  C  CB    . LYS A 1 18  ? 25.012  22.103  17.674 1.00 47.42  ? 18  LYS A CB    1 
ATOM   151  C  CG    . LYS A 1 18  ? 25.067  20.598  17.523 1.00 49.62  ? 18  LYS A CG    1 
ATOM   152  C  CD    . LYS A 1 18  ? 25.190  20.225  16.061 1.00 52.57  ? 18  LYS A CD    1 
ATOM   153  C  CE    . LYS A 1 18  ? 25.551  18.758  15.925 1.00 55.33  ? 18  LYS A CE    1 
ATOM   154  N  NZ    . LYS A 1 18  ? 26.765  18.421  16.744 1.00 57.09  ? 18  LYS A NZ    1 
ATOM   155  N  N     . PRO A 1 19  ? 26.453  24.770  19.506 1.00 46.66  ? 19  PRO A N     1 
ATOM   156  C  CA    . PRO A 1 19  ? 26.482  26.231  19.523 1.00 45.98  ? 19  PRO A CA    1 
ATOM   157  C  C     . PRO A 1 19  ? 26.179  26.809  18.157 1.00 44.50  ? 19  PRO A C     1 
ATOM   158  O  O     . PRO A 1 19  ? 25.824  27.975  18.036 1.00 44.83  ? 19  PRO A O     1 
ATOM   159  C  CB    . PRO A 1 19  ? 27.903  26.569  20.009 1.00 46.55  ? 19  PRO A CB    1 
ATOM   160  C  CG    . PRO A 1 19  ? 28.645  25.243  20.022 1.00 47.43  ? 19  PRO A CG    1 
ATOM   161  C  CD    . PRO A 1 19  ? 27.587  24.214  20.262 1.00 47.79  ? 19  PRO A CD    1 
ATOM   162  N  N     . GLN A 1 20  ? 26.295  25.986  17.129 1.00 42.67  ? 20  GLN A N     1 
ATOM   163  C  CA    . GLN A 1 20  ? 26.026  26.470  15.793 1.00 42.40  ? 20  GLN A CA    1 
ATOM   164  C  C     . GLN A 1 20  ? 24.529  26.671  15.567 1.00 39.38  ? 20  GLN A C     1 
ATOM   165  O  O     . GLN A 1 20  ? 24.132  27.594  14.848 1.00 39.76  ? 20  GLN A O     1 
ATOM   166  C  CB    . GLN A 1 20  ? 26.598  25.504  14.747 1.00 44.22  ? 20  GLN A CB    1 
ATOM   167  C  CG    . GLN A 1 20  ? 26.561  26.051  13.332 1.00 48.20  ? 20  GLN A CG    1 
ATOM   168  C  CD    . GLN A 1 20  ? 27.302  25.165  12.337 1.00 50.64  ? 20  GLN A CD    1 
ATOM   169  O  OE1   . GLN A 1 20  ? 27.477  25.528  11.166 1.00 50.15  ? 20  GLN A OE1   1 
ATOM   170  N  NE2   . GLN A 1 20  ? 27.742  23.997  12.799 1.00 51.68  ? 20  GLN A NE2   1 
ATOM   171  N  N     . ARG A 1 21  ? 23.698  25.804  16.148 1.00 36.50  ? 21  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 21  ? 22.256  25.951  15.976 1.00 34.41  ? 21  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 21  ? 21.793  27.217  16.714 1.00 35.40  ? 21  ARG A C     1 
ATOM   174  O  O     . ARG A 1 21  ? 20.949  27.971  16.216 1.00 34.24  ? 21  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 21  ? 21.533  24.714  16.494 1.00 34.64  ? 21  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 21  ? 21.637  23.513  15.545 1.00 30.65  ? 21  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 21  ? 20.993  23.838  14.210 1.00 30.46  ? 21  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 21  ? 19.544  23.783  14.251 1.00 28.72  ? 21  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 21  ? 18.736  24.346  13.347 1.00 33.80  ? 21  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 21  ? 17.414  24.225  13.480 1.00 32.99  ? 21  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 21  ? 19.229  25.058  12.331 1.00 29.83  ? 21  ARG A NH2   1 
ATOM   182  N  N     . GLU A 1 22  ? 22.380  27.457  17.889 1.00 35.28  ? 22  GLU A N     1 
ATOM   183  C  CA    . GLU A 1 22  ? 22.067  28.640  18.686 1.00 35.01  ? 22  GLU A CA    1 
ATOM   184  C  C     . GLU A 1 22  ? 22.326  29.857  17.816 1.00 32.82  ? 22  GLU A C     1 
ATOM   185  O  O     . GLU A 1 22  ? 21.538  30.815  17.795 1.00 30.31  ? 22  GLU A O     1 
ATOM   186  C  CB    . GLU A 1 22  ? 22.951  28.679  19.930 1.00 37.84  ? 22  GLU A CB    1 
ATOM   187  C  CG    . GLU A 1 22  ? 22.841  29.933  20.769 1.00 46.99  ? 22  GLU A CG    1 
ATOM   188  C  CD    . GLU A 1 22  ? 23.582  29.771  22.089 1.00 54.08  ? 22  GLU A CD    1 
ATOM   189  O  OE1   . GLU A 1 22  ? 23.745  30.771  22.828 1.00 58.13  ? 22  GLU A OE1   1 
ATOM   190  O  OE2   . GLU A 1 22  ? 23.999  28.626  22.392 1.00 57.76  ? 22  GLU A OE2   1 
ATOM   191  N  N     . GLU A 1 23  ? 23.428  29.814  17.082 1.00 31.82  ? 23  GLU A N     1 
ATOM   192  C  CA    . GLU A 1 23  ? 23.758  30.913  16.197 1.00 34.39  ? 23  GLU A CA    1 
ATOM   193  C  C     . GLU A 1 23  ? 22.716  30.987  15.077 1.00 31.80  ? 23  GLU A C     1 
ATOM   194  O  O     . GLU A 1 23  ? 22.334  32.066  14.641 1.00 30.56  ? 23  GLU A O     1 
ATOM   195  C  CB    . GLU A 1 23  ? 25.144  30.711  15.583 1.00 39.13  ? 23  GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 23  ? 26.303  30.840  16.566 1.00 45.40  ? 23  GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 23  ? 27.546  30.066  16.106 1.00 49.73  ? 23  GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 23  ? 28.448  29.829  16.951 1.00 52.80  ? 23  GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 23  ? 27.620  29.691  14.910 1.00 48.57  ? 23  GLU A OE2   1 
ATOM   200  N  N     . GLU A 1 24  ? 22.249  29.832  14.622 1.00 31.50  ? 24  GLU A N     1 
ATOM   201  C  CA    . GLU A 1 24  ? 21.269  29.818  13.541 1.00 31.76  ? 24  GLU A CA    1 
ATOM   202  C  C     . GLU A 1 24  ? 19.908  30.315  14.012 1.00 31.20  ? 24  GLU A C     1 
ATOM   203  O  O     . GLU A 1 24  ? 19.223  30.992  13.254 1.00 30.83  ? 24  GLU A O     1 
ATOM   204  C  CB    . GLU A 1 24  ? 21.184  28.424  12.908 1.00 33.48  ? 24  GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 24  ? 22.320  28.177  11.905 1.00 35.99  ? 24  GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 24  ? 22.586  26.693  11.622 1.00 39.07  ? 24  GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 24  ? 21.646  25.937  11.279 1.00 38.12  ? 24  GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 24  ? 23.756  26.285  11.741 1.00 41.32  ? 24  GLU A OE2   1 
ATOM   209  N  N     . PHE A 1 25  ? 19.516  30.022  15.256 1.00 30.46  ? 25  PHE A N     1 
ATOM   210  C  CA    . PHE A 1 25  ? 18.230  30.556  15.731 1.00 30.00  ? 25  PHE A CA    1 
ATOM   211  C  C     . PHE A 1 25  ? 18.308  32.085  15.762 1.00 29.09  ? 25  PHE A C     1 
ATOM   212  O  O     . PHE A 1 25  ? 17.377  32.782  15.359 1.00 31.28  ? 25  PHE A O     1 
ATOM   213  C  CB    . PHE A 1 25  ? 17.875  30.029  17.111 1.00 28.98  ? 25  PHE A CB    1 
ATOM   214  C  CG    . PHE A 1 25  ? 17.221  28.683  17.094 1.00 29.89  ? 25  PHE A CG    1 
ATOM   215  C  CD1   . PHE A 1 25  ? 17.970  27.521  16.830 1.00 28.10  ? 25  PHE A CD1   1 
ATOM   216  C  CD2   . PHE A 1 25  ? 15.854  28.557  17.370 1.00 30.26  ? 25  PHE A CD2   1 
ATOM   217  C  CE1   . PHE A 1 25  ? 17.373  26.276  16.845 1.00 25.39  ? 25  PHE A CE1   1 
ATOM   218  C  CE2   . PHE A 1 25  ? 15.239  27.301  17.388 1.00 28.37  ? 25  PHE A CE2   1 
ATOM   219  C  CZ    . PHE A 1 25  ? 15.991  26.160  17.127 1.00 28.61  ? 25  PHE A CZ    1 
ATOM   220  N  N     . ALA A 1 26  ? 19.439  32.613  16.199 1.00 28.15  ? 26  ALA A N     1 
ATOM   221  C  CA    . ALA A 1 26  ? 19.601  34.073  16.245 1.00 28.56  ? 26  ALA A CA    1 
ATOM   222  C  C     . ALA A 1 26  ? 19.608  34.675  14.849 1.00 27.88  ? 26  ALA A C     1 
ATOM   223  O  O     . ALA A 1 26  ? 18.978  35.708  14.605 1.00 28.51  ? 26  ALA A O     1 
ATOM   224  C  CB    . ALA A 1 26  ? 20.907  34.451  16.988 1.00 26.48  ? 26  ALA A CB    1 
ATOM   225  N  N     . GLU A 1 27  ? 20.329  34.032  13.932 1.00 28.76  ? 27  GLU A N     1 
ATOM   226  C  CA    . GLU A 1 27  ? 20.415  34.502  12.539 1.00 30.92  ? 27  GLU A CA    1 
ATOM   227  C  C     . GLU A 1 27  ? 19.021  34.502  11.913 1.00 29.90  ? 27  GLU A C     1 
ATOM   228  O  O     . GLU A 1 27  ? 18.653  35.411  11.169 1.00 32.79  ? 27  GLU A O     1 
ATOM   229  C  CB    . GLU A 1 27  ? 21.348  33.576  11.746 1.00 36.35  ? 27  GLU A CB    1 
ATOM   230  C  CG    . GLU A 1 27  ? 21.543  33.964  10.296 1.00 43.06  ? 27  GLU A CG    1 
ATOM   231  C  CD    . GLU A 1 27  ? 22.166  35.361  10.118 1.00 46.48  ? 27  GLU A CD    1 
ATOM   232  O  OE1   . GLU A 1 27  ? 22.974  35.806  10.976 1.00 43.65  ? 27  GLU A OE1   1 
ATOM   233  O  OE2   . GLU A 1 27  ? 21.841  36.002  9.092  1.00 50.53  ? 27  GLU A OE2   1 
ATOM   234  N  N     . ALA A 1 28  ? 18.243  33.475  12.222 1.00 28.50  ? 28  ALA A N     1 
ATOM   235  C  CA    . ALA A 1 28  ? 16.883  33.367  11.703 1.00 30.11  ? 28  ALA A CA    1 
ATOM   236  C  C     . ALA A 1 28  ? 16.094  34.613  12.133 1.00 29.25  ? 28  ALA A C     1 
ATOM   237  O  O     . ALA A 1 28  ? 15.394  35.238  11.331 1.00 28.28  ? 28  ALA A O     1 
ATOM   238  C  CB    . ALA A 1 28  ? 16.220  32.120  12.271 1.00 27.41  ? 28  ALA A CB    1 
ATOM   239  N  N     . PHE A 1 29  ? 16.216  34.949  13.417 1.00 28.35  ? 29  PHE A N     1 
ATOM   240  C  CA    . PHE A 1 29  ? 15.520  36.109  13.971 1.00 29.72  ? 29  PHE A CA    1 
ATOM   241  C  C     . PHE A 1 29  ? 15.982  37.373  13.263 1.00 28.66  ? 29  PHE A C     1 
ATOM   242  O  O     . PHE A 1 29  ? 15.189  38.220  12.914 1.00 27.84  ? 29  PHE A O     1 
ATOM   243  C  CB    . PHE A 1 29  ? 15.780  36.226  15.471 1.00 29.78  ? 29  PHE A CB    1 
ATOM   244  C  CG    . PHE A 1 29  ? 14.924  37.266  16.153 1.00 32.81  ? 29  PHE A CG    1 
ATOM   245  C  CD1   . PHE A 1 29  ? 15.433  38.021  17.213 1.00 30.06  ? 29  PHE A CD1   1 
ATOM   246  C  CD2   . PHE A 1 29  ? 13.603  37.480  15.743 1.00 29.49  ? 29  PHE A CD2   1 
ATOM   247  C  CE1   . PHE A 1 29  ? 14.641  38.973  17.852 1.00 32.46  ? 29  PHE A CE1   1 
ATOM   248  C  CE2   . PHE A 1 29  ? 12.804  38.428  16.379 1.00 32.22  ? 29  PHE A CE2   1 
ATOM   249  C  CZ    . PHE A 1 29  ? 13.320  39.174  17.433 1.00 32.77  ? 29  PHE A CZ    1 
ATOM   250  N  N     . LYS A 1 30  ? 17.278  37.486  13.030 1.00 30.32  ? 30  LYS A N     1 
ATOM   251  C  CA    . LYS A 1 30  ? 17.790  38.659  12.328 1.00 31.01  ? 30  LYS A CA    1 
ATOM   252  C  C     . LYS A 1 30  ? 17.235  38.719  10.902 1.00 31.74  ? 30  LYS A C     1 
ATOM   253  O  O     . LYS A 1 30  ? 16.865  39.788  10.424 1.00 32.18  ? 30  LYS A O     1 
ATOM   254  C  CB    . LYS A 1 30  ? 19.310  38.617  12.261 1.00 33.70  ? 30  LYS A CB    1 
ATOM   255  C  CG    . LYS A 1 30  ? 19.893  39.737  11.439 1.00 35.79  ? 30  LYS A CG    1 
ATOM   256  C  CD    . LYS A 1 30  ? 21.398  39.652  11.454 1.00 39.65  ? 30  LYS A CD    1 
ATOM   257  C  CE    . LYS A 1 30  ? 21.976  40.654  10.475 1.00 44.50  ? 30  LYS A CE    1 
ATOM   258  N  NZ    . LYS A 1 30  ? 23.453  40.639  10.538 1.00 48.00  ? 30  LYS A NZ    1 
ATOM   259  N  N     . ASN A 1 31  ? 17.187  37.584  10.214 1.00 31.68  ? 31  ASN A N     1 
ATOM   260  C  CA    . ASN A 1 31  ? 16.655  37.601  8.857  1.00 32.70  ? 31  ASN A CA    1 
ATOM   261  C  C     . ASN A 1 31  ? 15.208  38.086  8.871  1.00 33.29  ? 31  ASN A C     1 
ATOM   262  O  O     . ASN A 1 31  ? 14.847  38.975  8.095  1.00 33.32  ? 31  ASN A O     1 
ATOM   263  C  CB    . ASN A 1 31  ? 16.733  36.220  8.192  1.00 34.83  ? 31  ASN A CB    1 
ATOM   264  C  CG    . ASN A 1 31  ? 18.154  35.856  7.762  1.00 38.46  ? 31  ASN A CG    1 
ATOM   265  O  OD1   . ASN A 1 31  ? 18.907  36.719  7.333  1.00 41.46  ? 31  ASN A OD1   1 
ATOM   266  N  ND2   . ASN A 1 31  ? 18.514  34.575  7.859  1.00 37.84  ? 31  ASN A ND2   1 
ATOM   267  N  N     . ALA A 1 32  ? 14.400  37.539  9.780  1.00 30.28  ? 32  ALA A N     1 
ATOM   268  C  CA    . ALA A 1 32  ? 12.999  37.912  9.873  1.00 30.71  ? 32  ALA A CA    1 
ATOM   269  C  C     . ALA A 1 32  ? 12.805  39.400  10.127 1.00 34.03  ? 32  ALA A C     1 
ATOM   270  O  O     . ALA A 1 32  ? 12.009  40.069  9.422  1.00 34.32  ? 32  ALA A O     1 
ATOM   271  C  CB    . ALA A 1 32  ? 12.292  37.080  10.975 1.00 30.25  ? 32  ALA A CB    1 
ATOM   272  N  N     . LEU A 1 33  ? 13.534  39.934  11.111 1.00 32.75  ? 33  LEU A N     1 
ATOM   273  C  CA    . LEU A 1 33  ? 13.397  41.357  11.448 1.00 32.96  ? 33  LEU A CA    1 
ATOM   274  C  C     . LEU A 1 33  ? 13.782  42.246  10.276 1.00 31.28  ? 33  LEU A C     1 
ATOM   275  O  O     . LEU A 1 33  ? 13.169  43.284  10.053 1.00 31.29  ? 33  LEU A O     1 
ATOM   276  C  CB    . LEU A 1 33  ? 14.262  41.719  12.677 1.00 30.43  ? 33  LEU A CB    1 
ATOM   277  C  CG    . LEU A 1 33  ? 13.829  41.079  13.999 1.00 32.45  ? 33  LEU A CG    1 
ATOM   278  C  CD1   . LEU A 1 33  ? 14.971  41.248  15.052 1.00 34.31  ? 33  LEU A CD1   1 
ATOM   279  C  CD2   . LEU A 1 33  ? 12.517  41.730  14.474 1.00 29.36  ? 33  LEU A CD2   1 
ATOM   280  N  N     . GLU A 1 34  ? 14.803  41.846  9.533  1.00 32.52  ? 34  GLU A N     1 
ATOM   281  C  CA    . GLU A 1 34  ? 15.242  42.639  8.387  1.00 35.93  ? 34  GLU A CA    1 
ATOM   282  C  C     . GLU A 1 34  ? 14.207  42.629  7.274  1.00 35.70  ? 34  GLU A C     1 
ATOM   283  O  O     . GLU A 1 34  ? 14.023  43.625  6.577  1.00 38.32  ? 34  GLU A O     1 
ATOM   284  C  CB    . GLU A 1 34  ? 16.589  42.139  7.873  1.00 37.15  ? 34  GLU A CB    1 
ATOM   285  C  CG    . GLU A 1 34  ? 17.693  42.351  8.892  1.00 41.42  ? 34  GLU A CG    1 
ATOM   286  C  CD    . GLU A 1 34  ? 19.038  41.933  8.379  1.00 43.56  ? 34  GLU A CD    1 
ATOM   287  O  OE1   . GLU A 1 34  ? 19.084  41.016  7.540  1.00 48.08  ? 34  GLU A OE1   1 
ATOM   288  O  OE2   . GLU A 1 34  ? 20.049  42.506  8.819  1.00 46.26  ? 34  GLU A OE2   1 
ATOM   289  N  N     . ILE A 1 35  ? 13.521  41.508  7.105  1.00 35.33  ? 35  ILE A N     1 
ATOM   290  C  CA    . ILE A 1 35  ? 12.476  41.467  6.103  1.00 34.67  ? 35  ILE A CA    1 
ATOM   291  C  C     . ILE A 1 35  ? 11.316  42.350  6.590  1.00 35.03  ? 35  ILE A C     1 
ATOM   292  O  O     . ILE A 1 35  ? 10.670  43.028  5.778  1.00 35.56  ? 35  ILE A O     1 
ATOM   293  C  CB    . ILE A 1 35  ? 11.971  40.011  5.843  1.00 33.38  ? 35  ILE A CB    1 
ATOM   294  C  CG1   . ILE A 1 35  ? 13.044  39.219  5.095  1.00 31.39  ? 35  ILE A CG1   1 
ATOM   295  C  CG2   . ILE A 1 35  ? 10.681  40.044  5.026  1.00 31.44  ? 35  ILE A CG2   1 
ATOM   296  C  CD1   . ILE A 1 35  ? 12.710  37.728  4.944  1.00 32.38  ? 35  ILE A CD1   1 
ATOM   297  N  N     . ALA A 1 36  ? 11.060  42.364  7.905  1.00 33.93  ? 36  ALA A N     1 
ATOM   298  C  CA    . ALA A 1 36  ? 9.960   43.190  8.438  1.00 32.21  ? 36  ALA A CA    1 
ATOM   299  C  C     . ALA A 1 36  ? 10.238  44.651  8.124  1.00 31.51  ? 36  ALA A C     1 
ATOM   300  O  O     . ALA A 1 36  ? 9.369   45.391  7.674  1.00 33.45  ? 36  ALA A O     1 
ATOM   301  C  CB    . ALA A 1 36  ? 9.819   43.004  9.939  1.00 31.16  ? 36  ALA A CB    1 
ATOM   302  N  N     . VAL A 1 37  ? 11.469  45.067  8.351  1.00 33.08  ? 37  VAL A N     1 
ATOM   303  C  CA    . VAL A 1 37  ? 11.839  46.441  8.073  1.00 33.52  ? 37  VAL A CA    1 
ATOM   304  C  C     . VAL A 1 37  ? 11.748  46.737  6.569  1.00 35.10  ? 37  VAL A C     1 
ATOM   305  O  O     . VAL A 1 37  ? 11.204  47.774  6.176  1.00 31.11  ? 37  VAL A O     1 
ATOM   306  C  CB    . VAL A 1 37  ? 13.244  46.731  8.597  1.00 34.39  ? 37  VAL A CB    1 
ATOM   307  C  CG1   . VAL A 1 37  ? 13.682  48.139  8.168  1.00 35.04  ? 37  VAL A CG1   1 
ATOM   308  C  CG2   . VAL A 1 37  ? 13.255  46.575  10.146 1.00 33.22  ? 37  VAL A CG2   1 
ATOM   309  N  N     . GLN A 1 38  ? 12.254  45.818  5.740  1.00 35.83  ? 38  GLN A N     1 
ATOM   310  C  CA    . GLN A 1 38  ? 12.203  45.997  4.279  1.00 38.56  ? 38  GLN A CA    1 
ATOM   311  C  C     . GLN A 1 38  ? 10.771  46.117  3.795  1.00 36.19  ? 38  GLN A C     1 
ATOM   312  O  O     . GLN A 1 38  ? 10.515  46.799  2.823  1.00 37.98  ? 38  GLN A O     1 
ATOM   313  C  CB    . GLN A 1 38  ? 12.840  44.816  3.524  1.00 38.98  ? 38  GLN A CB    1 
ATOM   314  C  CG    . GLN A 1 38  ? 14.336  44.750  3.580  1.00 45.39  ? 38  GLN A CG    1 
ATOM   315  C  CD    . GLN A 1 38  ? 14.871  43.371  3.221  1.00 49.00  ? 38  GLN A CD    1 
ATOM   316  O  OE1   . GLN A 1 38  ? 14.140  42.514  2.714  1.00 52.66  ? 38  GLN A OE1   1 
ATOM   317  N  NE2   . GLN A 1 38  ? 16.150  43.150  3.486  1.00 50.18  ? 38  GLN A NE2   1 
ATOM   318  N  N     . GLU A 1 39  ? 9.856   45.429  4.464  1.00 35.64  ? 39  GLU A N     1 
ATOM   319  C  CA    . GLU A 1 39  ? 8.457   45.439  4.079  1.00 37.25  ? 39  GLU A CA    1 
ATOM   320  C  C     . GLU A 1 39  ? 7.743   46.646  4.646  1.00 37.62  ? 39  GLU A C     1 
ATOM   321  O  O     . GLU A 1 39  ? 6.518   46.750  4.536  1.00 37.86  ? 39  GLU A O     1 
ATOM   322  C  CB    . GLU A 1 39  ? 7.767   44.169  4.559  1.00 37.85  ? 39  GLU A CB    1 
ATOM   323  C  CG    . GLU A 1 39  ? 8.354   42.915  3.997  1.00 44.18  ? 39  GLU A CG    1 
ATOM   324  C  CD    . GLU A 1 39  ? 7.836   42.573  2.614  1.00 48.54  ? 39  GLU A CD    1 
ATOM   325  O  OE1   . GLU A 1 39  ? 8.608   41.926  1.869  1.00 53.24  ? 39  GLU A OE1   1 
ATOM   326  O  OE2   . GLU A 1 39  ? 6.672   42.925  2.279  1.00 49.56  ? 39  GLU A OE2   1 
ATOM   327  N  N     . ASN A 1 40  ? 8.505   47.544  5.278  1.00 36.73  ? 40  ASN A N     1 
ATOM   328  C  CA    . ASN A 1 40  ? 7.923   48.758  5.836  1.00 34.38  ? 40  ASN A CA    1 
ATOM   329  C  C     . ASN A 1 40  ? 6.770   48.465  6.803  1.00 32.92  ? 40  ASN A C     1 
ATOM   330  O  O     . ASN A 1 40  ? 5.742   49.145  6.756  1.00 33.02  ? 40  ASN A O     1 
ATOM   331  C  CB    . ASN A 1 40  ? 7.412   49.615  4.667  1.00 35.25  ? 40  ASN A CB    1 
ATOM   332  C  CG    . ASN A 1 40  ? 6.925   50.982  5.100  1.00 36.75  ? 40  ASN A CG    1 
ATOM   333  O  OD1   . ASN A 1 40  ? 5.957   51.516  4.545  1.00 39.29  ? 40  ASN A OD1   1 
ATOM   334  N  ND2   . ASN A 1 40  ? 7.597   51.563  6.070  1.00 35.14  ? 40  ASN A ND2   1 
ATOM   335  N  N     . VAL A 1 41  ? 6.898   47.476  7.687  1.00 31.39  ? 41  VAL A N     1 
ATOM   336  C  CA    . VAL A 1 41  ? 5.757   47.222  8.563  1.00 30.98  ? 41  VAL A CA    1 
ATOM   337  C  C     . VAL A 1 41  ? 5.568   48.335  9.588  1.00 34.00  ? 41  VAL A C     1 
ATOM   338  O  O     . VAL A 1 41  ? 6.511   49.070  9.921  1.00 35.03  ? 41  VAL A O     1 
ATOM   339  C  CB    . VAL A 1 41  ? 5.866   45.877  9.324  1.00 32.12  ? 41  VAL A CB    1 
ATOM   340  C  CG1   . VAL A 1 41  ? 5.903   44.722  8.321  1.00 29.18  ? 41  VAL A CG1   1 
ATOM   341  C  CG2   . VAL A 1 41  ? 7.118   45.875  10.272 1.00 29.23  ? 41  VAL A CG2   1 
ATOM   342  N  N     . ASP A 1 42  ? 4.349   48.469  10.082 1.00 34.52  ? 42  ASP A N     1 
ATOM   343  C  CA    . ASP A 1 42  ? 4.070   49.493  11.080 1.00 36.61  ? 42  ASP A CA    1 
ATOM   344  C  C     . ASP A 1 42  ? 4.573   49.066  12.460 1.00 35.52  ? 42  ASP A C     1 
ATOM   345  O  O     . ASP A 1 42  ? 5.062   49.881  13.237 1.00 36.39  ? 42  ASP A O     1 
ATOM   346  C  CB    . ASP A 1 42  ? 2.570   49.771  11.141 1.00 39.55  ? 42  ASP A CB    1 
ATOM   347  C  CG    . ASP A 1 42  ? 2.064   50.484  9.903  1.00 39.88  ? 42  ASP A CG    1 
ATOM   348  O  OD1   . ASP A 1 42  ? 1.416   49.844  9.061  1.00 42.65  ? 42  ASP A OD1   1 
ATOM   349  O  OD2   . ASP A 1 42  ? 2.330   51.691  9.776  1.00 43.66  ? 42  ASP A OD2   1 
ATOM   350  N  N     . PHE A 1 43  ? 4.412   47.791  12.779 1.00 33.61  ? 43  PHE A N     1 
ATOM   351  C  CA    . PHE A 1 43  ? 4.879   47.276  14.055 1.00 31.56  ? 43  PHE A CA    1 
ATOM   352  C  C     . PHE A 1 43  ? 5.113   45.781  13.971 1.00 32.89  ? 43  PHE A C     1 
ATOM   353  O  O     . PHE A 1 43  ? 4.799   45.140  12.966 1.00 35.48  ? 43  PHE A O     1 
ATOM   354  C  CB    . PHE A 1 43  ? 3.912   47.611  15.197 1.00 27.57  ? 43  PHE A CB    1 
ATOM   355  C  CG    . PHE A 1 43  ? 2.516   47.099  15.001 1.00 27.50  ? 43  PHE A CG    1 
ATOM   356  C  CD1   . PHE A 1 43  ? 1.558   47.875  14.358 1.00 27.35  ? 43  PHE A CD1   1 
ATOM   357  C  CD2   . PHE A 1 43  ? 2.145   45.850  15.479 1.00 26.16  ? 43  PHE A CD2   1 
ATOM   358  C  CE1   . PHE A 1 43  ? 0.243   47.401  14.197 1.00 29.21  ? 43  PHE A CE1   1 
ATOM   359  C  CE2   . PHE A 1 43  ? 0.832   45.374  15.321 1.00 27.02  ? 43  PHE A CE2   1 
ATOM   360  C  CZ    . PHE A 1 43  ? -0.112  46.150  14.681 1.00 26.24  ? 43  PHE A CZ    1 
ATOM   361  N  N     . ILE A 1 44  ? 5.655   45.232  15.043 1.00 33.36  ? 44  ILE A N     1 
ATOM   362  C  CA    . ILE A 1 44  ? 6.014   43.831  15.094 1.00 31.77  ? 44  ILE A CA    1 
ATOM   363  C  C     . ILE A 1 44  ? 5.453   43.198  16.344 1.00 30.94  ? 44  ILE A C     1 
ATOM   364  O  O     . ILE A 1 44  ? 5.512   43.792  17.415 1.00 33.03  ? 44  ILE A O     1 
ATOM   365  C  CB    . ILE A 1 44  ? 7.565   43.721  15.081 1.00 32.37  ? 44  ILE A CB    1 
ATOM   366  C  CG1   . ILE A 1 44  ? 8.089   44.316  13.772 1.00 30.80  ? 44  ILE A CG1   1 
ATOM   367  C  CG2   . ILE A 1 44  ? 8.025   42.282  15.324 1.00 28.46  ? 44  ILE A CG2   1 
ATOM   368  C  CD1   . ILE A 1 44  ? 9.598   44.467  13.698 1.00 31.28  ? 44  ILE A CD1   1 
ATOM   369  N  N     . LEU A 1 45  ? 4.884   42.008  16.199 1.00 28.70  ? 45  LEU A N     1 
ATOM   370  C  CA    . LEU A 1 45  ? 4.353   41.265  17.326 1.00 26.34  ? 45  LEU A CA    1 
ATOM   371  C  C     . LEU A 1 45  ? 5.192   40.020  17.558 1.00 30.16  ? 45  LEU A C     1 
ATOM   372  O  O     . LEU A 1 45  ? 5.498   39.290  16.600 1.00 29.17  ? 45  LEU A O     1 
ATOM   373  C  CB    . LEU A 1 45  ? 2.947   40.775  17.043 1.00 26.78  ? 45  LEU A CB    1 
ATOM   374  C  CG    . LEU A 1 45  ? 1.836   41.790  16.769 1.00 29.15  ? 45  LEU A CG    1 
ATOM   375  C  CD1   . LEU A 1 45  ? 0.527   41.024  16.428 1.00 25.64  ? 45  LEU A CD1   1 
ATOM   376  C  CD2   . LEU A 1 45  ? 1.662   42.668  18.008 1.00 25.27  ? 45  LEU A CD2   1 
ATOM   377  N  N     . ILE A 1 46  ? 5.543   39.761  18.814 1.00 28.08  ? 46  ILE A N     1 
ATOM   378  C  CA    . ILE A 1 46  ? 6.290   38.558  19.155 1.00 28.84  ? 46  ILE A CA    1 
ATOM   379  C  C     . ILE A 1 46  ? 5.452   37.904  20.240 1.00 29.18  ? 46  ILE A C     1 
ATOM   380  O  O     . ILE A 1 46  ? 5.461   38.305  21.416 1.00 27.33  ? 46  ILE A O     1 
ATOM   381  C  CB    . ILE A 1 46  ? 7.727   38.853  19.664 1.00 29.60  ? 46  ILE A CB    1 
ATOM   382  C  CG1   . ILE A 1 46  ? 8.493   39.680  18.626 1.00 27.78  ? 46  ILE A CG1   1 
ATOM   383  C  CG2   . ILE A 1 46  ? 8.457   37.542  19.893 1.00 27.75  ? 46  ILE A CG2   1 
ATOM   384  C  CD1   . ILE A 1 46  ? 9.988   39.865  18.927 1.00 28.95  ? 46  ILE A CD1   1 
ATOM   385  N  N     . ALA A 1 47  ? 4.700   36.902  19.798 1.00 29.10  ? 47  ALA A N     1 
ATOM   386  C  CA    . ALA A 1 47  ? 3.770   36.163  20.619 1.00 26.51  ? 47  ALA A CA    1 
ATOM   387  C  C     . ALA A 1 47  ? 4.372   35.106  21.553 1.00 27.03  ? 47  ALA A C     1 
ATOM   388  O  O     . ALA A 1 47  ? 3.939   33.951  21.580 1.00 27.39  ? 47  ALA A O     1 
ATOM   389  C  CB    . ALA A 1 47  ? 2.691   35.541  19.702 1.00 26.11  ? 47  ALA A CB    1 
ATOM   390  N  N     . GLY A 1 48  ? 5.381   35.500  22.316 1.00 26.07  ? 48  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 48  ? 5.935   34.587  23.293 1.00 27.20  ? 48  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 48  ? 7.112   33.736  22.884 1.00 29.30  ? 48  GLY A C     1 
ATOM   393  O  O     . GLY A 1 48  ? 7.283   33.381  21.709 1.00 29.25  ? 48  GLY A O     1 
ATOM   394  N  N     . ASP A 1 49  ? 7.899   33.373  23.889 1.00 28.57  ? 49  ASP A N     1 
ATOM   395  C  CA    . ASP A 1 49  ? 9.091   32.554  23.699 1.00 28.10  ? 49  ASP A CA    1 
ATOM   396  C  C     . ASP A 1 49  ? 10.100  33.250  22.827 1.00 27.16  ? 49  ASP A C     1 
ATOM   397  O  O     . ASP A 1 49  ? 10.601  32.676  21.869 1.00 29.08  ? 49  ASP A O     1 
ATOM   398  C  CB    . ASP A 1 49  ? 8.735   31.200  23.093 1.00 27.86  ? 49  ASP A CB    1 
ATOM   399  C  CG    . ASP A 1 49  ? 8.155   30.221  24.124 1.00 32.19  ? 49  ASP A CG    1 
ATOM   400  O  OD1   . ASP A 1 49  ? 7.861   29.073  23.740 1.00 29.67  ? 49  ASP A OD1   1 
ATOM   401  O  OD2   . ASP A 1 49  ? 7.992   30.586  25.313 1.00 31.41  ? 49  ASP A OD2   1 
ATOM   402  N  N     . LEU A 1 50  ? 10.375  34.509  23.128 1.00 27.16  ? 50  LEU A N     1 
ATOM   403  C  CA    . LEU A 1 50  ? 11.393  35.247  22.386 1.00 27.68  ? 50  LEU A CA    1 
ATOM   404  C  C     . LEU A 1 50  ? 12.754  34.607  22.792 1.00 27.01  ? 50  LEU A C     1 
ATOM   405  O  O     . LEU A 1 50  ? 13.642  34.421  21.963 1.00 27.43  ? 50  LEU A O     1 
ATOM   406  C  CB    . LEU A 1 50  ? 11.351  36.724  22.771 1.00 28.02  ? 50  LEU A CB    1 
ATOM   407  C  CG    . LEU A 1 50  ? 12.576  37.551  22.355 1.00 30.11  ? 50  LEU A CG    1 
ATOM   408  C  CD1   . LEU A 1 50  ? 12.751  37.437  20.827 1.00 28.61  ? 50  LEU A CD1   1 
ATOM   409  C  CD2   . LEU A 1 50  ? 12.425  39.035  22.798 1.00 23.77  ? 50  LEU A CD2   1 
ATOM   410  N  N     . PHE A 1 51  ? 12.852  34.230  24.067 1.00 27.74  ? 51  PHE A N     1 
ATOM   411  C  CA    . PHE A 1 51  ? 14.037  33.601  24.645 1.00 28.17  ? 51  PHE A CA    1 
ATOM   412  C  C     . PHE A 1 51  ? 13.787  32.143  25.002 1.00 28.73  ? 51  PHE A C     1 
ATOM   413  O  O     . PHE A 1 51  ? 12.683  31.759  25.416 1.00 28.27  ? 51  PHE A O     1 
ATOM   414  C  CB    . PHE A 1 51  ? 14.490  34.326  25.926 1.00 27.14  ? 51  PHE A CB    1 
ATOM   415  C  CG    . PHE A 1 51  ? 15.024  35.702  25.683 1.00 27.19  ? 51  PHE A CG    1 
ATOM   416  C  CD1   . PHE A 1 51  ? 14.167  36.809  25.655 1.00 25.91  ? 51  PHE A CD1   1 
ATOM   417  C  CD2   . PHE A 1 51  ? 16.367  35.886  25.396 1.00 23.42  ? 51  PHE A CD2   1 
ATOM   418  C  CE1   . PHE A 1 51  ? 14.651  38.088  25.330 1.00 25.61  ? 51  PHE A CE1   1 
ATOM   419  C  CE2   . PHE A 1 51  ? 16.856  37.154  25.071 1.00 27.14  ? 51  PHE A CE2   1 
ATOM   420  C  CZ    . PHE A 1 51  ? 15.989  38.260  25.038 1.00 26.14  ? 51  PHE A CZ    1 
ATOM   421  N  N     . HIS A 1 52  ? 14.829  31.334  24.863 1.00 28.19  ? 52  HIS A N     1 
ATOM   422  C  CA    . HIS A 1 52  ? 14.716  29.936  25.185 1.00 27.68  ? 52  HIS A CA    1 
ATOM   423  C  C     . HIS A 1 52  ? 14.692  29.721  26.673 1.00 27.10  ? 52  HIS A C     1 
ATOM   424  O  O     . HIS A 1 52  ? 14.085  28.765  27.149 1.00 26.83  ? 52  HIS A O     1 
ATOM   425  C  CB    . HIS A 1 52  ? 15.864  29.128  24.590 1.00 27.97  ? 52  HIS A CB    1 
ATOM   426  C  CG    . HIS A 1 52  ? 15.677  27.657  24.759 1.00 28.73  ? 52  HIS A CG    1 
ATOM   427  N  ND1   . HIS A 1 52  ? 14.623  26.983  24.184 1.00 28.51  ? 52  HIS A ND1   1 
ATOM   428  C  CD2   . HIS A 1 52  ? 16.347  26.745  25.504 1.00 29.09  ? 52  HIS A CD2   1 
ATOM   429  C  CE1   . HIS A 1 52  ? 14.650  25.718  24.565 1.00 28.03  ? 52  HIS A CE1   1 
ATOM   430  N  NE2   . HIS A 1 52  ? 15.686  25.548  25.366 1.00 29.26  ? 52  HIS A NE2   1 
ATOM   431  N  N     . SER A 1 53  ? 15.362  30.605  27.412 1.00 29.59  ? 53  SER A N     1 
ATOM   432  C  CA    . SER A 1 53  ? 15.403  30.508  28.880 1.00 29.26  ? 53  SER A CA    1 
ATOM   433  C  C     . SER A 1 53  ? 14.889  31.785  29.537 1.00 30.06  ? 53  SER A C     1 
ATOM   434  O  O     . SER A 1 53  ? 15.025  32.859  28.957 1.00 31.42  ? 53  SER A O     1 
ATOM   435  C  CB    . SER A 1 53  ? 16.841  30.271  29.318 1.00 29.69  ? 53  SER A CB    1 
ATOM   436  O  OG    . SER A 1 53  ? 17.048  30.664  30.665 1.00 30.82  ? 53  SER A OG    1 
ATOM   437  N  N     . SER A 1 54  ? 14.318  31.687  30.737 1.00 30.11  ? 54  SER A N     1 
ATOM   438  C  CA    . SER A 1 54  ? 13.837  32.888  31.439 1.00 31.53  ? 54  SER A CA    1 
ATOM   439  C  C     . SER A 1 54  ? 14.996  33.626  32.128 1.00 31.55  ? 54  SER A C     1 
ATOM   440  O  O     . SER A 1 54  ? 14.830  34.738  32.648 1.00 30.29  ? 54  SER A O     1 
ATOM   441  C  CB    . SER A 1 54  ? 12.769  32.536  32.484 1.00 33.64  ? 54  SER A CB    1 
ATOM   442  O  OG    . SER A 1 54  ? 13.300  31.648  33.440 1.00 37.19  ? 54  SER A OG    1 
ATOM   443  N  N     . ARG A 1 55  ? 16.168  33.000  32.117 1.00 31.41  ? 55  ARG A N     1 
ATOM   444  C  CA    . ARG A 1 55  ? 17.376  33.589  32.689 1.00 31.16  ? 55  ARG A CA    1 
ATOM   445  C  C     . ARG A 1 55  ? 18.452  33.441  31.610 1.00 29.34  ? 55  ARG A C     1 
ATOM   446  O  O     . ARG A 1 55  ? 19.401  32.690  31.752 1.00 29.80  ? 55  ARG A O     1 
ATOM   447  C  CB    . ARG A 1 55  ? 17.772  32.845  33.983 1.00 32.66  ? 55  ARG A CB    1 
ATOM   448  C  CG    . ARG A 1 55  ? 18.950  33.481  34.739 1.00 37.30  ? 55  ARG A CG    1 
ATOM   449  C  CD    . ARG A 1 55  ? 18.903  33.164  36.219 1.00 38.98  ? 55  ARG A CD    1 
ATOM   450  N  NE    . ARG A 1 55  ? 18.976  31.727  36.461 1.00 43.68  ? 55  ARG A NE    1 
ATOM   451  C  CZ    . ARG A 1 55  ? 20.102  31.013  36.433 1.00 46.17  ? 55  ARG A CZ    1 
ATOM   452  N  NH1   . ARG A 1 55  ? 20.054  29.699  36.657 1.00 44.77  ? 55  ARG A NH1   1 
ATOM   453  N  NH2   . ARG A 1 55  ? 21.278  31.615  36.207 1.00 45.94  ? 55  ARG A NH2   1 
ATOM   454  N  N     . PRO A 1 56  ? 18.297  34.157  30.495 1.00 30.91  ? 56  PRO A N     1 
ATOM   455  C  CA    . PRO A 1 56  ? 19.273  34.073  29.404 1.00 31.01  ? 56  PRO A CA    1 
ATOM   456  C  C     . PRO A 1 56  ? 20.661  34.544  29.842 1.00 32.17  ? 56  PRO A C     1 
ATOM   457  O  O     . PRO A 1 56  ? 20.793  35.385  30.726 1.00 34.67  ? 56  PRO A O     1 
ATOM   458  C  CB    . PRO A 1 56  ? 18.664  34.959  28.317 1.00 29.32  ? 56  PRO A CB    1 
ATOM   459  C  CG    . PRO A 1 56  ? 17.927  35.974  29.094 1.00 32.99  ? 56  PRO A CG    1 
ATOM   460  C  CD    . PRO A 1 56  ? 17.304  35.218  30.244 1.00 30.34  ? 56  PRO A CD    1 
ATOM   461  N  N     . SER A 1 57  ? 21.684  33.971  29.227 1.00 31.09  ? 57  SER A N     1 
ATOM   462  C  CA    . SER A 1 57  ? 23.058  34.305  29.527 1.00 31.45  ? 57  SER A CA    1 
ATOM   463  C  C     . SER A 1 57  ? 23.344  35.709  29.029 1.00 29.55  ? 57  SER A C     1 
ATOM   464  O  O     . SER A 1 57  ? 22.593  36.235  28.220 1.00 30.66  ? 57  SER A O     1 
ATOM   465  C  CB    . SER A 1 57  ? 24.000  33.335  28.800 1.00 31.41  ? 57  SER A CB    1 
ATOM   466  O  OG    . SER A 1 57  ? 24.099  33.720  27.436 1.00 37.51  ? 57  SER A OG    1 
ATOM   467  N  N     . PRO A 1 58  ? 24.438  36.335  29.516 1.00 29.76  ? 58  PRO A N     1 
ATOM   468  C  CA    . PRO A 1 58  ? 24.837  37.694  29.104 1.00 30.03  ? 58  PRO A CA    1 
ATOM   469  C  C     . PRO A 1 58  ? 24.998  37.731  27.575 1.00 29.65  ? 58  PRO A C     1 
ATOM   470  O  O     . PRO A 1 58  ? 24.622  38.695  26.909 1.00 30.80  ? 58  PRO A O     1 
ATOM   471  C  CB    . PRO A 1 58  ? 26.194  37.907  29.810 1.00 30.87  ? 58  PRO A CB    1 
ATOM   472  C  CG    . PRO A 1 58  ? 26.084  37.040  31.072 1.00 29.93  ? 58  PRO A CG    1 
ATOM   473  C  CD    . PRO A 1 58  ? 25.288  35.816  30.610 1.00 30.59  ? 58  PRO A CD    1 
ATOM   474  N  N     . GLY A 1 59  ? 25.560  36.661  27.024 1.00 30.76  ? 59  GLY A N     1 
ATOM   475  C  CA    . GLY A 1 59  ? 25.752  36.606  25.583 1.00 30.45  ? 59  GLY A CA    1 
ATOM   476  C  C     . GLY A 1 59  ? 24.452  36.645  24.793 1.00 29.65  ? 59  GLY A C     1 
ATOM   477  O  O     . GLY A 1 59  ? 24.349  37.363  23.808 1.00 29.14  ? 59  GLY A O     1 
ATOM   478  N  N     . THR A 1 60  ? 23.462  35.862  25.221 1.00 31.89  ? 60  THR A N     1 
ATOM   479  C  CA    . THR A 1 60  ? 22.161  35.825  24.547 1.00 31.14  ? 60  THR A CA    1 
ATOM   480  C  C     . THR A 1 60  ? 21.502  37.208  24.624 1.00 30.71  ? 60  THR A C     1 
ATOM   481  O  O     . THR A 1 60  ? 20.941  37.699  23.649 1.00 30.48  ? 60  THR A O     1 
ATOM   482  C  CB    . THR A 1 60  ? 21.274  34.736  25.201 1.00 31.98  ? 60  THR A CB    1 
ATOM   483  O  OG1   . THR A 1 60  ? 21.927  33.474  25.050 1.00 35.28  ? 60  THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 60  ? 19.887  34.636  24.536 1.00 31.95  ? 60  THR A CG2   1 
ATOM   485  N  N     . LEU A 1 61  ? 21.602  37.851  25.786 1.00 31.86  ? 61  LEU A N     1 
ATOM   486  C  CA    . LEU A 1 61  ? 21.030  39.178  25.976 1.00 32.66  ? 61  LEU A CA    1 
ATOM   487  C  C     . LEU A 1 61  ? 21.657  40.178  25.024 1.00 31.45  ? 61  LEU A C     1 
ATOM   488  O  O     . LEU A 1 61  ? 20.967  40.984  24.414 1.00 31.82  ? 61  LEU A O     1 
ATOM   489  C  CB    . LEU A 1 61  ? 21.238  39.666  27.425 1.00 32.78  ? 61  LEU A CB    1 
ATOM   490  C  CG    . LEU A 1 61  ? 20.391  38.923  28.451 1.00 38.90  ? 61  LEU A CG    1 
ATOM   491  C  CD1   . LEU A 1 61  ? 20.581  39.541  29.864 1.00 39.18  ? 61  LEU A CD1   1 
ATOM   492  C  CD2   . LEU A 1 61  ? 18.912  39.015  28.020 1.00 39.23  ? 61  LEU A CD2   1 
ATOM   493  N  N     . LYS A 1 62  ? 22.973  40.129  24.916 1.00 32.51  ? 62  LYS A N     1 
ATOM   494  C  CA    . LYS A 1 62  ? 23.704  41.033  24.033 1.00 35.04  ? 62  LYS A CA    1 
ATOM   495  C  C     . LYS A 1 62  ? 23.237  40.852  22.576 1.00 33.15  ? 62  LYS A C     1 
ATOM   496  O  O     . LYS A 1 62  ? 23.046  41.831  21.833 1.00 32.39  ? 62  LYS A O     1 
ATOM   497  C  CB    . LYS A 1 62  ? 25.201  40.730  24.164 1.00 37.21  ? 62  LYS A CB    1 
ATOM   498  C  CG    . LYS A 1 62  ? 26.151  41.716  23.548 1.00 38.23  ? 62  LYS A CG    1 
ATOM   499  C  CD    . LYS A 1 62  ? 27.563  41.254  23.942 1.00 44.08  ? 62  LYS A CD    1 
ATOM   500  C  CE    . LYS A 1 62  ? 28.631  42.330  23.756 1.00 44.01  ? 62  LYS A CE    1 
ATOM   501  N  NZ    . LYS A 1 62  ? 28.557  42.992  22.429 1.00 40.77  ? 62  LYS A NZ    1 
ATOM   502  N  N     . LYS A 1 63  ? 23.071  39.599  22.166 1.00 32.75  ? 63  LYS A N     1 
ATOM   503  C  CA    . LYS A 1 63  ? 22.603  39.311  20.808 1.00 34.01  ? 63  LYS A CA    1 
ATOM   504  C  C     . LYS A 1 63  ? 21.164  39.833  20.668 1.00 32.95  ? 63  LYS A C     1 
ATOM   505  O  O     . LYS A 1 63  ? 20.836  40.530  19.721 1.00 31.97  ? 63  LYS A O     1 
ATOM   506  C  CB    . LYS A 1 63  ? 22.614  37.804  20.547 1.00 38.85  ? 63  LYS A CB    1 
ATOM   507  C  CG    . LYS A 1 63  ? 23.528  37.361  19.416 1.00 46.69  ? 63  LYS A CG    1 
ATOM   508  C  CD    . LYS A 1 63  ? 23.057  37.902  18.054 1.00 50.73  ? 63  LYS A CD    1 
ATOM   509  C  CE    . LYS A 1 63  ? 23.963  37.413  16.920 1.00 53.37  ? 63  LYS A CE    1 
ATOM   510  N  NZ    . LYS A 1 63  ? 23.447  37.789  15.552 1.00 55.85  ? 63  LYS A NZ    1 
ATOM   511  N  N     . ALA A 1 64  ? 20.305  39.506  21.625 1.00 31.80  ? 64  ALA A N     1 
ATOM   512  C  CA    . ALA A 1 64  ? 18.936  39.972  21.526 1.00 33.42  ? 64  ALA A CA    1 
ATOM   513  C  C     . ALA A 1 64  ? 18.901  41.501  21.427 1.00 32.90  ? 64  ALA A C     1 
ATOM   514  O  O     . ALA A 1 64  ? 18.143  42.071  20.632 1.00 32.79  ? 64  ALA A O     1 
ATOM   515  C  CB    . ALA A 1 64  ? 18.117  39.485  22.715 1.00 30.92  ? 64  ALA A CB    1 
ATOM   516  N  N     . ILE A 1 65  ? 19.755  42.166  22.197 1.00 33.22  ? 65  ILE A N     1 
ATOM   517  C  CA    . ILE A 1 65  ? 19.775  43.624  22.178 1.00 31.05  ? 65  ILE A CA    1 
ATOM   518  C  C     . ILE A 1 65  ? 20.242  44.136  20.826 1.00 31.14  ? 65  ILE A C     1 
ATOM   519  O  O     . ILE A 1 65  ? 19.685  45.095  20.303 1.00 32.15  ? 65  ILE A O     1 
ATOM   520  C  CB    . ILE A 1 65  ? 20.677  44.185  23.293 1.00 30.63  ? 65  ILE A CB    1 
ATOM   521  C  CG1   . ILE A 1 65  ? 19.975  43.977  24.638 1.00 31.42  ? 65  ILE A CG1   1 
ATOM   522  C  CG2   . ILE A 1 65  ? 21.026  45.690  22.998 1.00 26.49  ? 65  ILE A CG2   1 
ATOM   523  C  CD1   . ILE A 1 65  ? 20.845  44.299  25.872 1.00 32.70  ? 65  ILE A CD1   1 
ATOM   524  N  N     . ALA A 1 66  ? 21.261  43.508  20.253 1.00 31.15  ? 66  ALA A N     1 
ATOM   525  C  CA    . ALA A 1 66  ? 21.726  43.966  18.946 1.00 33.68  ? 66  ALA A CA    1 
ATOM   526  C  C     . ALA A 1 66  ? 20.628  43.693  17.895 1.00 33.65  ? 66  ALA A C     1 
ATOM   527  O  O     . ALA A 1 66  ? 20.333  44.555  17.064 1.00 34.53  ? 66  ALA A O     1 
ATOM   528  C  CB    . ALA A 1 66  ? 23.046  43.262  18.555 1.00 30.69  ? 66  ALA A CB    1 
ATOM   529  N  N     . LEU A 1 67  ? 20.003  42.515  17.947 1.00 33.99  ? 67  LEU A N     1 
ATOM   530  C  CA    . LEU A 1 67  ? 18.950  42.195  16.972 1.00 34.27  ? 67  LEU A CA    1 
ATOM   531  C  C     . LEU A 1 67  ? 17.741  43.143  17.086 1.00 35.47  ? 67  LEU A C     1 
ATOM   532  O  O     . LEU A 1 67  ? 17.260  43.637  16.065 1.00 36.52  ? 67  LEU A O     1 
ATOM   533  C  CB    . LEU A 1 67  ? 18.512  40.730  17.115 1.00 32.96  ? 67  LEU A CB    1 
ATOM   534  C  CG    . LEU A 1 67  ? 19.672  39.747  16.861 1.00 34.41  ? 67  LEU A CG    1 
ATOM   535  C  CD1   . LEU A 1 67  ? 19.243  38.299  17.006 1.00 32.83  ? 67  LEU A CD1   1 
ATOM   536  C  CD2   . LEU A 1 67  ? 20.204  39.977  15.466 1.00 36.20  ? 67  LEU A CD2   1 
ATOM   537  N  N     . LEU A 1 68  ? 17.269  43.430  18.310 1.00 35.05  ? 68  LEU A N     1 
ATOM   538  C  CA    . LEU A 1 68  ? 16.128  44.328  18.471 1.00 33.11  ? 68  LEU A CA    1 
ATOM   539  C  C     . LEU A 1 68  ? 16.432  45.769  18.036 1.00 32.98  ? 68  LEU A C     1 
ATOM   540  O  O     . LEU A 1 68  ? 15.528  46.578  17.863 1.00 30.16  ? 68  LEU A O     1 
ATOM   541  C  CB    . LEU A 1 68  ? 15.599  44.273  19.912 1.00 33.60  ? 68  LEU A CB    1 
ATOM   542  C  CG    . LEU A 1 68  ? 14.888  42.945  20.249 1.00 33.25  ? 68  LEU A CG    1 
ATOM   543  C  CD1   . LEU A 1 68  ? 14.563  42.875  21.742 1.00 33.34  ? 68  LEU A CD1   1 
ATOM   544  C  CD2   . LEU A 1 68  ? 13.597  42.832  19.437 1.00 33.24  ? 68  LEU A CD2   1 
ATOM   545  N  N     . GLN A 1 69  ? 17.707  46.092  17.849 1.00 35.17  ? 69  GLN A N     1 
ATOM   546  C  CA    . GLN A 1 69  ? 18.061  47.434  17.391 1.00 38.73  ? 69  GLN A CA    1 
ATOM   547  C  C     . GLN A 1 69  ? 17.619  47.651  15.939 1.00 38.95  ? 69  GLN A C     1 
ATOM   548  O  O     . GLN A 1 69  ? 17.357  48.787  15.530 1.00 39.15  ? 69  GLN A O     1 
ATOM   549  C  CB    . GLN A 1 69  ? 19.571  47.673  17.464 1.00 42.49  ? 69  GLN A CB    1 
ATOM   550  C  CG    . GLN A 1 69  ? 20.006  48.492  18.666 1.00 47.73  ? 69  GLN A CG    1 
ATOM   551  C  CD    . GLN A 1 69  ? 19.230  49.777  18.792 1.00 47.01  ? 69  GLN A CD    1 
ATOM   552  O  OE1   . GLN A 1 69  ? 19.259  50.642  17.898 1.00 49.62  ? 69  GLN A OE1   1 
ATOM   553  N  NE2   . GLN A 1 69  ? 18.525  49.918  19.904 1.00 47.96  ? 69  GLN A NE2   1 
ATOM   554  N  N     . ILE A 1 70  ? 17.562  46.564  15.168 1.00 36.23  ? 70  ILE A N     1 
ATOM   555  C  CA    . ILE A 1 70  ? 17.170  46.636  13.763 1.00 35.58  ? 70  ILE A CA    1 
ATOM   556  C  C     . ILE A 1 70  ? 15.835  47.402  13.616 1.00 35.71  ? 70  ILE A C     1 
ATOM   557  O  O     . ILE A 1 70  ? 15.759  48.396  12.903 1.00 36.93  ? 70  ILE A O     1 
ATOM   558  C  CB    . ILE A 1 70  ? 17.085  45.202  13.173 1.00 35.94  ? 70  ILE A CB    1 
ATOM   559  C  CG1   . ILE A 1 70  ? 18.483  44.584  13.155 1.00 35.32  ? 70  ILE A CG1   1 
ATOM   560  C  CG2   . ILE A 1 70  ? 16.483  45.224  11.779 1.00 35.68  ? 70  ILE A CG2   1 
ATOM   561  C  CD1   . ILE A 1 70  ? 18.522  43.081  12.831 1.00 35.86  ? 70  ILE A CD1   1 
ATOM   562  N  N     . PRO A 1 71  ? 14.768  46.951  14.293 1.00 34.75  ? 71  PRO A N     1 
ATOM   563  C  CA    . PRO A 1 71  ? 13.522  47.698  14.145 1.00 35.23  ? 71  PRO A CA    1 
ATOM   564  C  C     . PRO A 1 71  ? 13.508  49.021  14.916 1.00 37.15  ? 71  PRO A C     1 
ATOM   565  O  O     . PRO A 1 71  ? 12.816  49.980  14.534 1.00 38.62  ? 71  PRO A O     1 
ATOM   566  C  CB    . PRO A 1 71  ? 12.463  46.711  14.644 1.00 34.58  ? 71  PRO A CB    1 
ATOM   567  C  CG    . PRO A 1 71  ? 13.224  45.848  15.639 1.00 32.37  ? 71  PRO A CG    1 
ATOM   568  C  CD    . PRO A 1 71  ? 14.543  45.650  14.955 1.00 32.40  ? 71  PRO A CD    1 
ATOM   569  N  N     . LYS A 1 72  ? 14.259  49.096  16.005 1.00 39.44  ? 72  LYS A N     1 
ATOM   570  C  CA    . LYS A 1 72  ? 14.260  50.335  16.770 1.00 40.18  ? 72  LYS A CA    1 
ATOM   571  C  C     . LYS A 1 72  ? 14.903  51.458  15.963 1.00 40.53  ? 72  LYS A C     1 
ATOM   572  O  O     . LYS A 1 72  ? 14.502  52.607  16.056 1.00 37.70  ? 72  LYS A O     1 
ATOM   573  C  CB    . LYS A 1 72  ? 15.016  50.189  18.086 1.00 42.23  ? 72  LYS A CB    1 
ATOM   574  C  CG    . LYS A 1 72  ? 14.848  51.442  18.927 1.00 43.87  ? 72  LYS A CG    1 
ATOM   575  C  CD    . LYS A 1 72  ? 15.607  51.371  20.188 1.00 49.41  ? 72  LYS A CD    1 
ATOM   576  C  CE    . LYS A 1 72  ? 15.292  52.558  21.084 1.00 50.45  ? 72  LYS A CE    1 
ATOM   577  N  NZ    . LYS A 1 72  ? 16.145  52.430  22.308 1.00 55.59  ? 72  LYS A NZ    1 
ATOM   578  N  N     . GLU A 1 73  ? 15.900  51.101  15.168 1.00 42.86  ? 73  GLU A N     1 
ATOM   579  C  CA    . GLU A 1 73  ? 16.607  52.053  14.336 1.00 46.26  ? 73  GLU A CA    1 
ATOM   580  C  C     . GLU A 1 73  ? 15.648  52.772  13.380 1.00 46.11  ? 73  GLU A C     1 
ATOM   581  O  O     . GLU A 1 73  ? 16.000  53.797  12.808 1.00 47.56  ? 73  GLU A O     1 
ATOM   582  C  CB    . GLU A 1 73  ? 17.697  51.322  13.550 1.00 50.22  ? 73  GLU A CB    1 
ATOM   583  C  CG    . GLU A 1 73  ? 19.003  52.084  13.409 1.00 56.43  ? 73  GLU A CG    1 
ATOM   584  C  CD    . GLU A 1 73  ? 19.622  52.445  14.757 1.00 60.40  ? 73  GLU A CD    1 
ATOM   585  O  OE1   . GLU A 1 73  ? 19.076  53.330  15.448 1.00 64.09  ? 73  GLU A OE1   1 
ATOM   586  O  OE2   . GLU A 1 73  ? 20.654  51.841  15.132 1.00 64.03  ? 73  GLU A OE2   1 
ATOM   587  N  N     . HIS A 1 74  ? 14.437  52.242  13.219 1.00 43.45  ? 74  HIS A N     1 
ATOM   588  C  CA    . HIS A 1 74  ? 13.446  52.860  12.342 1.00 42.70  ? 74  HIS A CA    1 
ATOM   589  C  C     . HIS A 1 74  ? 12.197  53.217  13.119 1.00 42.84  ? 74  HIS A C     1 
ATOM   590  O  O     . HIS A 1 74  ? 11.179  53.559  12.538 1.00 43.80  ? 74  HIS A O     1 
ATOM   591  C  CB    . HIS A 1 74  ? 13.070  51.917  11.188 1.00 42.62  ? 74  HIS A CB    1 
ATOM   592  C  CG    . HIS A 1 74  ? 14.230  51.537  10.324 1.00 40.50  ? 74  HIS A CG    1 
ATOM   593  N  ND1   . HIS A 1 74  ? 14.796  52.405  9.416  1.00 41.99  ? 74  HIS A ND1   1 
ATOM   594  C  CD2   . HIS A 1 74  ? 14.975  50.408  10.282 1.00 40.40  ? 74  HIS A CD2   1 
ATOM   595  C  CE1   . HIS A 1 74  ? 15.845  51.827  8.855  1.00 40.88  ? 74  HIS A CE1   1 
ATOM   596  N  NE2   . HIS A 1 74  ? 15.975  50.615  9.363  1.00 40.53  ? 74  HIS A NE2   1 
ATOM   597  N  N     . SER A 1 75  ? 12.275  53.149  14.438 1.00 42.26  ? 75  SER A N     1 
ATOM   598  C  CA    . SER A 1 75  ? 11.127  53.449  15.276 1.00 43.16  ? 75  SER A CA    1 
ATOM   599  C  C     . SER A 1 75  ? 9.917   52.544  15.031 1.00 41.85  ? 75  SER A C     1 
ATOM   600  O  O     . SER A 1 75  ? 8.776   52.993  15.100 1.00 43.26  ? 75  SER A O     1 
ATOM   601  C  CB    . SER A 1 75  ? 10.717  54.913  15.105 1.00 46.00  ? 75  SER A CB    1 
ATOM   602  O  OG    . SER A 1 75  ? 11.669  55.760  15.728 1.00 49.33  ? 75  SER A OG    1 
ATOM   603  N  N     . ILE A 1 76  ? 10.164  51.274  14.742 1.00 39.06  ? 76  ILE A N     1 
ATOM   604  C  CA    . ILE A 1 76  ? 9.080   50.329  14.517 1.00 36.50  ? 76  ILE A CA    1 
ATOM   605  C  C     . ILE A 1 76  ? 8.852   49.680  15.871 1.00 34.97  ? 76  ILE A C     1 
ATOM   606  O  O     . ILE A 1 76  ? 9.707   48.945  16.357 1.00 33.98  ? 76  ILE A O     1 
ATOM   607  C  CB    . ILE A 1 76  ? 9.485   49.232  13.488 1.00 35.71  ? 76  ILE A CB    1 
ATOM   608  C  CG1   . ILE A 1 76  ? 9.685   49.861  12.099 1.00 38.33  ? 76  ILE A CG1   1 
ATOM   609  C  CG2   . ILE A 1 76  ? 8.450   48.123  13.474 1.00 33.77  ? 76  ILE A CG2   1 
ATOM   610  C  CD1   . ILE A 1 76  ? 10.268  48.908  11.055 1.00 36.02  ? 76  ILE A CD1   1 
ATOM   611  N  N     . PRO A 1 77  ? 7.708   49.951  16.511 1.00 34.42  ? 77  PRO A N     1 
ATOM   612  C  CA    . PRO A 1 77  ? 7.507   49.318  17.816 1.00 32.01  ? 77  PRO A CA    1 
ATOM   613  C  C     . PRO A 1 77  ? 7.399   47.804  17.747 1.00 32.17  ? 77  PRO A C     1 
ATOM   614  O  O     . PRO A 1 77  ? 6.931   47.233  16.757 1.00 31.11  ? 77  PRO A O     1 
ATOM   615  C  CB    . PRO A 1 77  ? 6.228   49.976  18.334 1.00 32.78  ? 77  PRO A CB    1 
ATOM   616  C  CG    . PRO A 1 77  ? 5.517   50.352  17.102 1.00 34.29  ? 77  PRO A CG    1 
ATOM   617  C  CD    . PRO A 1 77  ? 6.581   50.834  16.164 1.00 32.26  ? 77  PRO A CD    1 
ATOM   618  N  N     . VAL A 1 78  ? 7.846   47.161  18.814 1.00 30.54  ? 78  VAL A N     1 
ATOM   619  C  CA    . VAL A 1 78  ? 7.812   45.718  18.935 1.00 29.60  ? 78  VAL A CA    1 
ATOM   620  C  C     . VAL A 1 78  ? 6.954   45.402  20.145 1.00 30.22  ? 78  VAL A C     1 
ATOM   621  O  O     . VAL A 1 78  ? 7.306   45.762  21.268 1.00 30.16  ? 78  VAL A O     1 
ATOM   622  C  CB    . VAL A 1 78  ? 9.245   45.147  19.171 1.00 31.39  ? 78  VAL A CB    1 
ATOM   623  C  CG1   . VAL A 1 78  ? 9.179   43.649  19.383 1.00 30.35  ? 78  VAL A CG1   1 
ATOM   624  C  CG2   . VAL A 1 78  ? 10.155  45.500  18.001 1.00 28.26  ? 78  VAL A CG2   1 
ATOM   625  N  N     . PHE A 1 79  ? 5.825   44.744  19.929 1.00 29.13  ? 79  PHE A N     1 
ATOM   626  C  CA    . PHE A 1 79  ? 4.946   44.405  21.031 1.00 28.72  ? 79  PHE A CA    1 
ATOM   627  C  C     . PHE A 1 79  ? 5.149   42.946  21.337 1.00 30.50  ? 79  PHE A C     1 
ATOM   628  O  O     . PHE A 1 79  ? 5.127   42.104  20.422 1.00 29.52  ? 79  PHE A O     1 
ATOM   629  C  CB    . PHE A 1 79  ? 3.480   44.652  20.655 1.00 28.67  ? 79  PHE A CB    1 
ATOM   630  C  CG    . PHE A 1 79  ? 3.152   46.099  20.424 1.00 31.51  ? 79  PHE A CG    1 
ATOM   631  C  CD1   . PHE A 1 79  ? 3.065   46.611  19.128 1.00 31.13  ? 79  PHE A CD1   1 
ATOM   632  C  CD2   . PHE A 1 79  ? 2.926   46.958  21.518 1.00 31.82  ? 79  PHE A CD2   1 
ATOM   633  C  CE1   . PHE A 1 79  ? 2.754   47.953  18.909 1.00 32.41  ? 79  PHE A CE1   1 
ATOM   634  C  CE2   . PHE A 1 79  ? 2.612   48.315  21.328 1.00 30.09  ? 79  PHE A CE2   1 
ATOM   635  C  CZ    . PHE A 1 79  ? 2.524   48.819  20.015 1.00 35.34  ? 79  PHE A CZ    1 
ATOM   636  N  N     . ALA A 1 80  ? 5.307   42.628  22.618 1.00 29.20  ? 80  ALA A N     1 
ATOM   637  C  CA    . ALA A 1 80  ? 5.545   41.252  22.983 1.00 30.06  ? 80  ALA A CA    1 
ATOM   638  C  C     . ALA A 1 80  ? 4.918   40.820  24.281 1.00 31.27  ? 80  ALA A C     1 
ATOM   639  O  O     . ALA A 1 80  ? 4.647   41.643  25.151 1.00 31.59  ? 80  ALA A O     1 
ATOM   640  C  CB    . ALA A 1 80  ? 7.050   41.004  23.052 1.00 30.63  ? 80  ALA A CB    1 
ATOM   641  N  N     . ILE A 1 81  ? 4.678   39.516  24.383 1.00 29.82  ? 81  ILE A N     1 
ATOM   642  C  CA    . ILE A 1 81  ? 4.173   38.897  25.601 1.00 28.71  ? 81  ILE A CA    1 
ATOM   643  C  C     . ILE A 1 81  ? 5.192   37.799  25.921 1.00 29.97  ? 81  ILE A C     1 
ATOM   644  O  O     . ILE A 1 81  ? 5.959   37.386  25.044 1.00 27.84  ? 81  ILE A O     1 
ATOM   645  C  CB    . ILE A 1 81  ? 2.788   38.222  25.412 1.00 28.58  ? 81  ILE A CB    1 
ATOM   646  C  CG1   . ILE A 1 81  ? 2.836   37.262  24.201 1.00 24.66  ? 81  ILE A CG1   1 
ATOM   647  C  CG2   . ILE A 1 81  ? 1.686   39.292  25.309 1.00 24.06  ? 81  ILE A CG2   1 
ATOM   648  C  CD1   . ILE A 1 81  ? 1.495   36.521  23.927 1.00 22.33  ? 81  ILE A CD1   1 
ATOM   649  N  N     . GLU A 1 82  ? 5.193   37.319  27.159 1.00 32.47  ? 82  GLU A N     1 
ATOM   650  C  CA    . GLU A 1 82  ? 6.120   36.253  27.567 1.00 33.75  ? 82  GLU A CA    1 
ATOM   651  C  C     . GLU A 1 82  ? 5.495   34.892  27.264 1.00 33.52  ? 82  GLU A C     1 
ATOM   652  O  O     . GLU A 1 82  ? 4.278   34.703  27.402 1.00 32.31  ? 82  GLU A O     1 
ATOM   653  C  CB    . GLU A 1 82  ? 6.443   36.368  29.089 1.00 36.44  ? 82  GLU A CB    1 
ATOM   654  C  CG    . GLU A 1 82  ? 6.719   37.828  29.517 1.00 41.05  ? 82  GLU A CG    1 
ATOM   655  C  CD    . GLU A 1 82  ? 6.908   38.067  31.009 1.00 44.55  ? 82  GLU A CD    1 
ATOM   656  O  OE1   . GLU A 1 82  ? 7.118   39.247  31.376 1.00 48.88  ? 82  GLU A OE1   1 
ATOM   657  O  OE2   . GLU A 1 82  ? 6.859   37.121  31.822 1.00 45.37  ? 82  GLU A OE2   1 
ATOM   658  N  N     . GLY A 1 83  ? 6.330   33.956  26.821 1.00 32.53  ? 83  GLY A N     1 
ATOM   659  C  CA    . GLY A 1 83  ? 5.866   32.612  26.553 1.00 30.87  ? 83  GLY A CA    1 
ATOM   660  C  C     . GLY A 1 83  ? 6.144   31.805  27.813 1.00 31.91  ? 83  GLY A C     1 
ATOM   661  O  O     . GLY A 1 83  ? 6.604   32.360  28.817 1.00 31.48  ? 83  GLY A O     1 
ATOM   662  N  N     . ASN A 1 84  ? 5.858   30.512  27.791 1.00 31.59  ? 84  ASN A N     1 
ATOM   663  C  CA    . ASN A 1 84  ? 6.135   29.690  28.965 1.00 35.41  ? 84  ASN A CA    1 
ATOM   664  C  C     . ASN A 1 84  ? 7.660   29.578  29.142 1.00 35.96  ? 84  ASN A C     1 
ATOM   665  O  O     . ASN A 1 84  ? 8.140   29.378  30.242 1.00 36.42  ? 84  ASN A O     1 
ATOM   666  C  CB    . ASN A 1 84  ? 5.534   28.291  28.791 1.00 35.58  ? 84  ASN A CB    1 
ATOM   667  C  CG    . ASN A 1 84  ? 5.907   27.673  27.460 1.00 36.97  ? 84  ASN A CG    1 
ATOM   668  O  OD1   . ASN A 1 84  ? 5.749   28.300  26.414 1.00 36.09  ? 84  ASN A OD1   1 
ATOM   669  N  ND2   . ASN A 1 84  ? 6.406   26.451  27.491 1.00 35.93  ? 84  ASN A ND2   1 
ATOM   670  N  N     . HIS A 1 85  ? 8.415   29.712  28.054 1.00 35.48  ? 85  HIS A N     1 
ATOM   671  C  CA    . HIS A 1 85  ? 9.862   29.631  28.153 1.00 36.16  ? 85  HIS A CA    1 
ATOM   672  C  C     . HIS A 1 85  ? 10.513  30.848  28.760 1.00 36.61  ? 85  HIS A C     1 
ATOM   673  O  O     . HIS A 1 85  ? 11.477  30.708  29.492 1.00 37.34  ? 85  HIS A O     1 
ATOM   674  C  CB    . HIS A 1 85  ? 10.509  29.378  26.785 1.00 35.60  ? 85  HIS A CB    1 
ATOM   675  C  CG    . HIS A 1 85  ? 10.582  27.931  26.417 1.00 36.62  ? 85  HIS A CG    1 
ATOM   676  N  ND1   . HIS A 1 85  ? 11.743  27.191  26.523 1.00 37.77  ? 85  HIS A ND1   1 
ATOM   677  C  CD2   . HIS A 1 85  ? 9.622   27.069  26.009 1.00 34.30  ? 85  HIS A CD2   1 
ATOM   678  C  CE1   . HIS A 1 85  ? 11.491  25.934  26.199 1.00 37.61  ? 85  HIS A CE1   1 
ATOM   679  N  NE2   . HIS A 1 85  ? 10.213  25.833  25.886 1.00 36.77  ? 85  HIS A NE2   1 
ATOM   680  N  N     . ASP A 1 86  ? 10.028  32.051  28.476 1.00 37.88  ? 86  ASP A N     1 
ATOM   681  C  CA    . ASP A 1 86  ? 10.739  33.177  29.065 1.00 38.98  ? 86  ASP A CA    1 
ATOM   682  C  C     . ASP A 1 86  ? 10.101  33.928  30.221 1.00 38.53  ? 86  ASP A C     1 
ATOM   683  O  O     . ASP A 1 86  ? 10.679  34.883  30.721 1.00 37.30  ? 86  ASP A O     1 
ATOM   684  C  CB    . ASP A 1 86  ? 11.220  34.153  27.975 1.00 40.99  ? 86  ASP A CB    1 
ATOM   685  C  CG    . ASP A 1 86  ? 10.135  34.528  26.984 1.00 42.70  ? 86  ASP A CG    1 
ATOM   686  O  OD1   . ASP A 1 86  ? 10.450  35.280  26.045 1.00 42.85  ? 86  ASP A OD1   1 
ATOM   687  O  OD2   . ASP A 1 86  ? 8.989   34.075  27.133 1.00 44.19  ? 86  ASP A OD2   1 
ATOM   688  N  N     . ARG A 1 87  ? 8.949   33.478  30.694 1.00 39.35  ? 87  ARG A N     1 
ATOM   689  C  CA    . ARG A 1 87  ? 8.332   34.160  31.828 1.00 44.80  ? 87  ARG A CA    1 
ATOM   690  C  C     . ARG A 1 87  ? 9.068   33.775  33.123 1.00 46.61  ? 87  ARG A C     1 
ATOM   691  O  O     . ARG A 1 87  ? 9.660   32.702  33.219 1.00 45.14  ? 87  ARG A O     1 
ATOM   692  C  CB    . ARG A 1 87  ? 6.855   33.794  31.955 1.00 44.26  ? 87  ARG A CB    1 
ATOM   693  C  CG    . ARG A 1 87  ? 6.609   32.393  32.417 1.00 45.51  ? 87  ARG A CG    1 
ATOM   694  C  CD    . ARG A 1 87  ? 5.134   32.212  32.626 1.00 49.20  ? 87  ARG A CD    1 
ATOM   695  N  NE    . ARG A 1 87  ? 4.816   30.892  33.151 1.00 50.73  ? 87  ARG A NE    1 
ATOM   696  C  CZ    . ARG A 1 87  ? 3.616   30.554  33.615 1.00 51.45  ? 87  ARG A CZ    1 
ATOM   697  N  NH1   . ARG A 1 87  ? 3.409   29.323  34.080 1.00 49.19  ? 87  ARG A NH1   1 
ATOM   698  N  NH2   . ARG A 1 87  ? 2.630   31.450  33.612 1.00 46.03  ? 87  ARG A NH2   1 
ATOM   699  N  N     . THR A 1 88  ? 9.038   34.635  34.127 1.00 49.79  ? 88  THR A N     1 
ATOM   700  C  CA    . THR A 1 88  ? 9.766   34.286  35.338 1.00 55.37  ? 88  THR A CA    1 
ATOM   701  C  C     . THR A 1 88  ? 8.910   33.837  36.528 1.00 56.73  ? 88  THR A C     1 
ATOM   702  O  O     . THR A 1 88  ? 7.890   34.456  36.825 1.00 54.82  ? 88  THR A O     1 
ATOM   703  C  CB    . THR A 1 88  ? 10.656  35.444  35.836 1.00 55.24  ? 88  THR A CB    1 
ATOM   704  O  OG1   . THR A 1 88  ? 9.835   36.585  36.110 1.00 56.65  ? 88  THR A OG1   1 
ATOM   705  C  CG2   . THR A 1 88  ? 11.700  35.812  34.797 1.00 57.64  ? 88  THR A CG2   1 
ATOM   706  N  N     . GLN A 1 89  ? 9.377   32.780  37.186 1.00 59.47  ? 89  GLN A N     1 
ATOM   707  C  CA    . GLN A 1 89  ? 8.753   32.218  38.378 1.00 62.86  ? 89  GLN A CA    1 
ATOM   708  C  C     . GLN A 1 89  ? 8.431   33.341  39.379 1.00 64.87  ? 89  GLN A C     1 
ATOM   709  O  O     . GLN A 1 89  ? 7.481   33.242  40.152 1.00 67.05  ? 89  GLN A O     1 
ATOM   710  C  CB    . GLN A 1 89  ? 9.711   31.208  39.008 1.00 63.73  ? 89  GLN A CB    1 
ATOM   711  C  CG    . GLN A 1 89  ? 10.197  30.119  38.062 0.00 65.07  ? 89  GLN A CG    1 
ATOM   712  C  CD    . GLN A 1 89  ? 11.590  30.368  37.501 0.00 65.73  ? 89  GLN A CD    1 
ATOM   713  O  OE1   . GLN A 1 89  ? 12.136  29.520  36.796 0.00 66.02  ? 89  GLN A OE1   1 
ATOM   714  N  NE2   . GLN A 1 89  ? 12.170  31.525  37.809 0.00 66.04  ? 89  GLN A NE2   1 
ATOM   715  N  N     . ARG A 1 90  ? 9.221   34.408  39.378 1.00 65.26  ? 90  ARG A N     1 
ATOM   716  C  CA    . ARG A 1 90  ? 8.937   35.512  40.292 1.00 65.43  ? 90  ARG A CA    1 
ATOM   717  C  C     . ARG A 1 90  ? 9.794   36.736  40.008 1.00 64.30  ? 90  ARG A C     1 
ATOM   718  O  O     . ARG A 1 90  ? 11.021  36.644  39.966 1.00 65.96  ? 90  ARG A O     1 
ATOM   719  C  CB    . ARG A 1 90  ? 9.137   35.071  41.743 0.00 67.28  ? 90  ARG A CB    1 
ATOM   720  C  CG    . ARG A 1 90  ? 8.930   36.220  42.729 0.00 69.61  ? 90  ARG A CG    1 
ATOM   721  C  CD    . ARG A 1 90  ? 8.647   35.710  44.152 0.00 71.94  ? 90  ARG A CD    1 
ATOM   722  N  NE    . ARG A 1 90  ? 9.511   36.384  45.162 0.00 74.62  ? 90  ARG A NE    1 
ATOM   723  C  CZ    . ARG A 1 90  ? 9.278   36.466  46.454 0.00 76.01  ? 90  ARG A CZ    1 
ATOM   724  N  NH1   . ARG A 1 90  ? 10.118  37.104  47.237 0.00 76.89  ? 90  ARG A NH1   1 
ATOM   725  N  NH2   . ARG A 1 90  ? 8.209   35.867  47.031 0.00 76.91  ? 90  ARG A NH2   1 
ATOM   726  N  N     . GLY A 1 91  ? 9.175   37.894  39.807 1.00 60.33  ? 91  GLY A N     1 
ATOM   727  C  CA    . GLY A 1 91  ? 10.000  39.068  39.559 1.00 54.47  ? 91  GLY A CA    1 
ATOM   728  C  C     . GLY A 1 91  ? 10.056  39.521  38.111 1.00 50.08  ? 91  GLY A C     1 
ATOM   729  O  O     . GLY A 1 91  ? 9.349   38.984  37.249 1.00 50.71  ? 91  GLY A O     1 
ATOM   730  N  N     . PRO A 1 92  ? 10.909  40.513  37.820 1.00 44.73  ? 92  PRO A N     1 
ATOM   731  C  CA    . PRO A 1 92  ? 11.050  41.035  36.464 1.00 41.08  ? 92  PRO A CA    1 
ATOM   732  C  C     . PRO A 1 92  ? 11.673  40.043  35.499 1.00 38.69  ? 92  PRO A C     1 
ATOM   733  O  O     . PRO A 1 92  ? 12.670  39.392  35.802 1.00 37.27  ? 92  PRO A O     1 
ATOM   734  C  CB    . PRO A 1 92  ? 11.855  42.322  36.656 1.00 41.84  ? 92  PRO A CB    1 
ATOM   735  C  CG    . PRO A 1 92  ? 12.624  42.098  37.876 1.00 42.09  ? 92  PRO A CG    1 
ATOM   736  C  CD    . PRO A 1 92  ? 11.818  41.192  38.761 1.00 44.11  ? 92  PRO A CD    1 
ATOM   737  N  N     . SER A 1 93  ? 11.041  39.902  34.343 1.00 36.25  ? 93  SER A N     1 
ATOM   738  C  CA    . SER A 1 93  ? 11.505  39.010  33.317 1.00 34.14  ? 93  SER A CA    1 
ATOM   739  C  C     . SER A 1 93  ? 12.429  39.759  32.367 1.00 33.28  ? 93  SER A C     1 
ATOM   740  O  O     . SER A 1 93  ? 12.605  40.989  32.449 1.00 31.37  ? 93  SER A O     1 
ATOM   741  C  CB    . SER A 1 93  ? 10.309  38.450  32.558 1.00 35.57  ? 93  SER A CB    1 
ATOM   742  O  OG    . SER A 1 93  ? 9.734   39.430  31.717 1.00 38.04  ? 93  SER A OG    1 
ATOM   743  N  N     . VAL A 1 94  ? 13.011  39.015  31.440 1.00 33.21  ? 94  VAL A N     1 
ATOM   744  C  CA    . VAL A 1 94  ? 13.900  39.612  30.472 1.00 31.07  ? 94  VAL A CA    1 
ATOM   745  C  C     . VAL A 1 94  ? 13.152  40.560  29.512 1.00 29.79  ? 94  VAL A C     1 
ATOM   746  O  O     . VAL A 1 94  ? 13.749  41.508  29.001 1.00 28.20  ? 94  VAL A O     1 
ATOM   747  C  CB    . VAL A 1 94  ? 14.682  38.498  29.710 1.00 33.13  ? 94  VAL A CB    1 
ATOM   748  C  CG1   . VAL A 1 94  ? 13.728  37.523  29.108 1.00 31.95  ? 94  VAL A CG1   1 
ATOM   749  C  CG2   . VAL A 1 94  ? 15.587  39.114  28.644 1.00 32.69  ? 94  VAL A CG2   1 
ATOM   750  N  N     . LEU A 1 95  ? 11.860  40.340  29.268 1.00 29.36  ? 95  LEU A N     1 
ATOM   751  C  CA    . LEU A 1 95  ? 11.128  41.282  28.395 1.00 30.99  ? 95  LEU A CA    1 
ATOM   752  C  C     . LEU A 1 95  ? 11.000  42.624  29.146 1.00 30.51  ? 95  LEU A C     1 
ATOM   753  O  O     . LEU A 1 95  ? 11.153  43.699  28.557 1.00 30.36  ? 95  LEU A O     1 
ATOM   754  C  CB    . LEU A 1 95  ? 9.727   40.753  28.029 1.00 31.97  ? 95  LEU A CB    1 
ATOM   755  C  CG    . LEU A 1 95  ? 9.603   39.412  27.289 1.00 34.34  ? 95  LEU A CG    1 
ATOM   756  C  CD1   . LEU A 1 95  ? 8.186   39.295  26.714 1.00 34.94  ? 95  LEU A CD1   1 
ATOM   757  C  CD2   . LEU A 1 95  ? 10.619  39.324  26.160 1.00 34.53  ? 95  LEU A CD2   1 
ATOM   758  N  N     . ASN A 1 96  ? 10.760  42.562  30.454 1.00 32.12  ? 96  ASN A N     1 
ATOM   759  C  CA    . ASN A 1 96  ? 10.648  43.800  31.256 1.00 33.64  ? 96  ASN A CA    1 
ATOM   760  C  C     . ASN A 1 96  ? 11.948  44.579  31.139 1.00 32.40  ? 96  ASN A C     1 
ATOM   761  O  O     . ASN A 1 96  ? 11.941  45.791  30.937 1.00 32.41  ? 96  ASN A O     1 
ATOM   762  C  CB    . ASN A 1 96  ? 10.396  43.480  32.728 1.00 36.79  ? 96  ASN A CB    1 
ATOM   763  C  CG    . ASN A 1 96  ? 9.059   42.831  32.962 1.00 40.76  ? 96  ASN A CG    1 
ATOM   764  O  OD1   . ASN A 1 96  ? 8.915   41.974  33.848 1.00 45.31  ? 96  ASN A OD1   1 
ATOM   765  N  ND2   . ASN A 1 96  ? 8.058   43.236  32.183 1.00 43.72  ? 96  ASN A ND2   1 
ATOM   766  N  N     . LEU A 1 97  ? 13.066  43.867  31.269 1.00 32.11  ? 97  LEU A N     1 
ATOM   767  C  CA    . LEU A 1 97  ? 14.388  44.478  31.163 1.00 32.60  ? 97  LEU A CA    1 
ATOM   768  C  C     . LEU A 1 97  ? 14.541  45.089  29.760 1.00 32.98  ? 97  LEU A C     1 
ATOM   769  O  O     . LEU A 1 97  ? 14.960  46.239  29.621 1.00 31.96  ? 97  LEU A O     1 
ATOM   770  C  CB    . LEU A 1 97  ? 15.477  43.415  31.404 1.00 33.45  ? 97  LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 97  ? 16.951  43.848  31.513 1.00 37.45  ? 97  LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 97  ? 17.151  44.640  32.793 1.00 37.67  ? 97  LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 97  ? 17.877  42.619  31.534 1.00 37.85  ? 97  LEU A CD2   1 
ATOM   774  N  N     . LEU A 1 98  ? 14.188  44.337  28.714 1.00 32.40  ? 98  LEU A N     1 
ATOM   775  C  CA    . LEU A 1 98  ? 14.316  44.872  27.357 1.00 31.40  ? 98  LEU A CA    1 
ATOM   776  C  C     . LEU A 1 98  ? 13.466  46.131  27.230 1.00 30.55  ? 98  LEU A C     1 
ATOM   777  O  O     . LEU A 1 98  ? 13.852  47.108  26.569 1.00 32.30  ? 98  LEU A O     1 
ATOM   778  C  CB    . LEU A 1 98  ? 13.909  43.820  26.312 1.00 30.71  ? 98  LEU A CB    1 
ATOM   779  C  CG    . LEU A 1 98  ? 14.921  42.666  26.223 1.00 32.91  ? 98  LEU A CG    1 
ATOM   780  C  CD1   . LEU A 1 98  ? 14.438  41.618  25.245 1.00 33.04  ? 98  LEU A CD1   1 
ATOM   781  C  CD2   . LEU A 1 98  ? 16.285  43.215  25.795 1.00 32.93  ? 98  LEU A CD2   1 
ATOM   782  N  N     . GLU A 1 99  ? 12.310  46.104  27.874 1.00 31.47  ? 99  GLU A N     1 
ATOM   783  C  CA    . GLU A 1 99  ? 11.412  47.251  27.876 1.00 33.65  ? 99  GLU A CA    1 
ATOM   784  C  C     . GLU A 1 99  ? 12.094  48.483  28.505 1.00 35.03  ? 99  GLU A C     1 
ATOM   785  O  O     . GLU A 1 99  ? 11.965  49.595  27.990 1.00 34.14  ? 99  GLU A O     1 
ATOM   786  C  CB    . GLU A 1 99  ? 10.133  46.920  28.646 1.00 34.73  ? 99  GLU A CB    1 
ATOM   787  C  CG    . GLU A 1 99  ? 9.075   47.992  28.516 1.00 38.73  ? 99  GLU A CG    1 
ATOM   788  C  CD    . GLU A 1 99  ? 7.771   47.571  29.137 1.00 43.76  ? 99  GLU A CD    1 
ATOM   789  O  OE1   . GLU A 1 99  ? 6.741   48.050  28.659 1.00 45.42  ? 99  GLU A OE1   1 
ATOM   790  O  OE2   . GLU A 1 99  ? 7.769   46.756  30.110 1.00 51.02  ? 99  GLU A OE2   1 
ATOM   791  N  N     . ASP A 1 100 ? 12.817  48.290  29.608 1.00 34.28  ? 100 ASP A N     1 
ATOM   792  C  CA    . ASP A 1 100 ? 13.521  49.414  30.237 1.00 36.43  ? 100 ASP A CA    1 
ATOM   793  C  C     . ASP A 1 100 ? 14.463  49.968  29.204 1.00 36.31  ? 100 ASP A C     1 
ATOM   794  O  O     . ASP A 1 100 ? 14.724  51.166  29.176 1.00 36.44  ? 100 ASP A O     1 
ATOM   795  C  CB    . ASP A 1 100 ? 14.374  48.970  31.438 1.00 38.61  ? 100 ASP A CB    1 
ATOM   796  C  CG    . ASP A 1 100 ? 13.543  48.554  32.633 1.00 42.00  ? 100 ASP A CG    1 
ATOM   797  O  OD1   . ASP A 1 100 ? 14.101  47.895  33.536 1.00 47.68  ? 100 ASP A OD1   1 
ATOM   798  O  OD2   . ASP A 1 100 ? 12.341  48.886  32.689 1.00 45.83  ? 100 ASP A OD2   1 
ATOM   799  N  N     . PHE A 1 101 ? 14.980  49.088  28.346 1.00 35.48  ? 101 PHE A N     1 
ATOM   800  C  CA    . PHE A 1 101 ? 15.924  49.520  27.325 1.00 35.42  ? 101 PHE A CA    1 
ATOM   801  C  C     . PHE A 1 101 ? 15.246  50.145  26.109 1.00 34.10  ? 101 PHE A C     1 
ATOM   802  O  O     . PHE A 1 101 ? 15.922  50.520  25.159 1.00 34.94  ? 101 PHE A O     1 
ATOM   803  C  CB    . PHE A 1 101 ? 16.806  48.343  26.858 1.00 38.79  ? 101 PHE A CB    1 
ATOM   804  C  CG    . PHE A 1 101 ? 17.585  47.657  27.967 1.00 39.60  ? 101 PHE A CG    1 
ATOM   805  C  CD1   . PHE A 1 101 ? 17.815  48.288  29.182 1.00 40.27  ? 101 PHE A CD1   1 
ATOM   806  C  CD2   . PHE A 1 101 ? 18.146  46.401  27.755 1.00 39.50  ? 101 PHE A CD2   1 
ATOM   807  C  CE1   . PHE A 1 101 ? 18.589  47.692  30.162 1.00 40.43  ? 101 PHE A CE1   1 
ATOM   808  C  CE2   . PHE A 1 101 ? 18.928  45.792  28.731 1.00 43.69  ? 101 PHE A CE2   1 
ATOM   809  C  CZ    . PHE A 1 101 ? 19.151  46.446  29.948 1.00 42.35  ? 101 PHE A CZ    1 
ATOM   810  N  N     . GLY A 1 102 ? 13.921  50.246  26.134 1.00 33.22  ? 102 GLY A N     1 
ATOM   811  C  CA    . GLY A 1 102 ? 13.195  50.818  25.011 1.00 34.54  ? 102 GLY A CA    1 
ATOM   812  C  C     . GLY A 1 102 ? 13.149  49.911  23.780 1.00 35.66  ? 102 GLY A C     1 
ATOM   813  O  O     . GLY A 1 102 ? 12.836  50.373  22.696 1.00 38.25  ? 102 GLY A O     1 
ATOM   814  N  N     . LEU A 1 103 ? 13.433  48.621  23.950 1.00 34.90  ? 103 LEU A N     1 
ATOM   815  C  CA    . LEU A 1 103 ? 13.461  47.672  22.831 1.00 34.37  ? 103 LEU A CA    1 
ATOM   816  C  C     . LEU A 1 103 ? 12.158  46.896  22.539 1.00 35.05  ? 103 LEU A C     1 
ATOM   817  O  O     . LEU A 1 103 ? 11.991  46.344  21.453 1.00 36.42  ? 103 LEU A O     1 
ATOM   818  C  CB    . LEU A 1 103 ? 14.644  46.713  23.033 1.00 30.12  ? 103 LEU A CB    1 
ATOM   819  C  CG    . LEU A 1 103 ? 15.991  47.484  23.010 1.00 27.79  ? 103 LEU A CG    1 
ATOM   820  C  CD1   . LEU A 1 103 ? 17.125  46.590  23.379 1.00 24.73  ? 103 LEU A CD1   1 
ATOM   821  C  CD2   . LEU A 1 103 ? 16.249  48.068  21.614 1.00 32.15  ? 103 LEU A CD2   1 
ATOM   822  N  N     . VAL A 1 104 ? 11.250  46.829  23.509 1.00 36.09  ? 104 VAL A N     1 
ATOM   823  C  CA    . VAL A 1 104 ? 9.962   46.165  23.317 1.00 34.24  ? 104 VAL A CA    1 
ATOM   824  C  C     . VAL A 1 104 ? 8.936   46.853  24.191 1.00 34.02  ? 104 VAL A C     1 
ATOM   825  O  O     . VAL A 1 104 ? 9.283   47.655  25.060 1.00 34.14  ? 104 VAL A O     1 
ATOM   826  C  CB    . VAL A 1 104 ? 9.952   44.683  23.755 1.00 33.99  ? 104 VAL A CB    1 
ATOM   827  C  CG1   . VAL A 1 104 ? 10.949  43.864  22.952 1.00 34.26  ? 104 VAL A CG1   1 
ATOM   828  C  CG2   . VAL A 1 104 ? 10.238  44.588  25.238 1.00 35.50  ? 104 VAL A CG2   1 
ATOM   829  N  N     . TYR A 1 105 ? 7.672   46.538  23.954 1.00 33.06  ? 105 TYR A N     1 
ATOM   830  C  CA    . TYR A 1 105 ? 6.599   47.036  24.784 1.00 33.04  ? 105 TYR A CA    1 
ATOM   831  C  C     . TYR A 1 105 ? 5.911   45.767  25.240 1.00 32.75  ? 105 TYR A C     1 
ATOM   832  O  O     . TYR A 1 105 ? 5.450   44.970  24.407 1.00 33.65  ? 105 TYR A O     1 
ATOM   833  C  CB    . TYR A 1 105 ? 5.662   47.943  23.994 1.00 36.48  ? 105 TYR A CB    1 
ATOM   834  C  CG    . TYR A 1 105 ? 6.337   49.230  23.584 1.00 39.26  ? 105 TYR A CG    1 
ATOM   835  C  CD1   . TYR A 1 105 ? 6.892   49.371  22.316 1.00 40.11  ? 105 TYR A CD1   1 
ATOM   836  C  CD2   . TYR A 1 105 ? 6.444   50.301  24.476 1.00 41.68  ? 105 TYR A CD2   1 
ATOM   837  C  CE1   . TYR A 1 105 ? 7.532   50.534  21.933 1.00 41.92  ? 105 TYR A CE1   1 
ATOM   838  C  CE2   . TYR A 1 105 ? 7.086   51.485  24.102 1.00 42.45  ? 105 TYR A CE2   1 
ATOM   839  C  CZ    . TYR A 1 105 ? 7.623   51.588  22.821 1.00 44.35  ? 105 TYR A CZ    1 
ATOM   840  O  OH    . TYR A 1 105 ? 8.224   52.752  22.407 1.00 47.35  ? 105 TYR A OH    1 
ATOM   841  N  N     . VAL A 1 106 ? 5.849   45.564  26.556 1.00 30.89  ? 106 VAL A N     1 
ATOM   842  C  CA    . VAL A 1 106 ? 5.257   44.349  27.090 1.00 30.26  ? 106 VAL A CA    1 
ATOM   843  C  C     . VAL A 1 106 ? 3.783   44.491  27.378 1.00 32.75  ? 106 VAL A C     1 
ATOM   844  O  O     . VAL A 1 106 ? 3.351   45.381  28.118 1.00 33.11  ? 106 VAL A O     1 
ATOM   845  C  CB    . VAL A 1 106 ? 5.989   43.875  28.371 1.00 29.50  ? 106 VAL A CB    1 
ATOM   846  C  CG1   . VAL A 1 106 ? 5.476   42.497  28.788 1.00 27.80  ? 106 VAL A CG1   1 
ATOM   847  C  CG2   . VAL A 1 106 ? 7.493   43.825  28.109 1.00 29.61  ? 106 VAL A CG2   1 
ATOM   848  N  N     . ILE A 1 107 ? 3.019   43.592  26.777 1.00 32.23  ? 107 ILE A N     1 
ATOM   849  C  CA    . ILE A 1 107 ? 1.576   43.555  26.898 1.00 34.08  ? 107 ILE A CA    1 
ATOM   850  C  C     . ILE A 1 107 ? 1.174   42.519  27.925 1.00 35.39  ? 107 ILE A C     1 
ATOM   851  O  O     . ILE A 1 107 ? 1.831   41.484  28.051 1.00 36.33  ? 107 ILE A O     1 
ATOM   852  C  CB    . ILE A 1 107 ? 0.974   43.226  25.528 1.00 34.19  ? 107 ILE A CB    1 
ATOM   853  C  CG1   . ILE A 1 107 ? 1.097   44.466  24.637 1.00 35.83  ? 107 ILE A CG1   1 
ATOM   854  C  CG2   . ILE A 1 107 ? -0.421  42.745  25.664 1.00 31.29  ? 107 ILE A CG2   1 
ATOM   855  C  CD1   . ILE A 1 107 ? 0.819   44.216  23.184 1.00 38.03  ? 107 ILE A CD1   1 
ATOM   856  N  N     . GLY A 1 108 ? 0.097   42.792  28.657 1.00 35.63  ? 108 GLY A N     1 
ATOM   857  C  CA    . GLY A 1 108 ? -0.351  41.869  29.686 1.00 35.57  ? 108 GLY A CA    1 
ATOM   858  C  C     . GLY A 1 108 ? -0.415  42.574  31.040 1.00 38.85  ? 108 GLY A C     1 
ATOM   859  O  O     . GLY A 1 108 ? -0.404  43.813  31.138 1.00 36.46  ? 108 GLY A O     1 
ATOM   860  N  N     . MET A 1 109 ? -0.450  41.799  32.108 1.00 41.09  ? 109 MET A N     1 
ATOM   861  C  CA    . MET A 1 109 ? -0.561  42.413  33.414 1.00 45.71  ? 109 MET A CA    1 
ATOM   862  C  C     . MET A 1 109 ? 0.723   42.711  34.145 1.00 47.30  ? 109 MET A C     1 
ATOM   863  O  O     . MET A 1 109 ? 1.652   41.907  34.162 1.00 48.58  ? 109 MET A O     1 
ATOM   864  C  CB    . MET A 1 109 ? -1.493  41.568  34.275 1.00 49.86  ? 109 MET A CB    1 
ATOM   865  C  CG    . MET A 1 109 ? -2.915  41.611  33.737 1.00 51.15  ? 109 MET A CG    1 
ATOM   866  S  SD    . MET A 1 109 ? -4.075  40.775  34.745 1.00 56.70  ? 109 MET A SD    1 
ATOM   867  C  CE    . MET A 1 109 ? -3.899  39.017  34.186 1.00 54.95  ? 109 MET A CE    1 
ATOM   868  N  N     . ARG A 1 110 ? 0.779   43.903  34.722 1.00 48.94  ? 110 ARG A N     1 
ATOM   869  C  CA    . ARG A 1 110 ? 1.932   44.333  35.493 1.00 51.05  ? 110 ARG A CA    1 
ATOM   870  C  C     . ARG A 1 110 ? 1.417   45.074  36.732 1.00 54.31  ? 110 ARG A C     1 
ATOM   871  O  O     . ARG A 1 110 ? 0.288   45.574  36.742 1.00 54.40  ? 110 ARG A O     1 
ATOM   872  C  CB    . ARG A 1 110 ? 2.837   45.228  34.649 1.00 50.20  ? 110 ARG A CB    1 
ATOM   873  C  CG    . ARG A 1 110 ? 2.200   46.506  34.172 1.00 49.85  ? 110 ARG A CG    1 
ATOM   874  C  CD    . ARG A 1 110 ? 3.210   47.340  33.384 1.00 50.66  ? 110 ARG A CD    1 
ATOM   875  N  NE    . ARG A 1 110 ? 3.517   46.785  32.061 1.00 47.83  ? 110 ARG A NE    1 
ATOM   876  C  CZ    . ARG A 1 110 ? 4.438   47.285  31.242 1.00 45.47  ? 110 ARG A CZ    1 
ATOM   877  N  NH1   . ARG A 1 110 ? 4.661   46.735  30.058 1.00 45.41  ? 110 ARG A NH1   1 
ATOM   878  N  NH2   . ARG A 1 110 ? 5.150   48.332  31.610 1.00 45.23  ? 110 ARG A NH2   1 
ATOM   879  N  N     . LYS A 1 111 ? 2.228   45.133  37.783 1.00 57.01  ? 111 LYS A N     1 
ATOM   880  C  CA    . LYS A 1 111 ? 1.800   45.791  39.011 1.00 60.02  ? 111 LYS A CA    1 
ATOM   881  C  C     . LYS A 1 111 ? 1.791   47.313  38.933 1.00 60.72  ? 111 LYS A C     1 
ATOM   882  O  O     . LYS A 1 111 ? 0.892   47.955  39.467 1.00 61.66  ? 111 LYS A O     1 
ATOM   883  C  CB    . LYS A 1 111 ? 2.661   45.311  40.176 1.00 62.48  ? 111 LYS A CB    1 
ATOM   884  C  CG    . LYS A 1 111 ? 2.533   43.808  40.403 1.00 66.18  ? 111 LYS A CG    1 
ATOM   885  C  CD    . LYS A 1 111 ? 3.158   43.364  41.719 1.00 68.67  ? 111 LYS A CD    1 
ATOM   886  C  CE    . LYS A 1 111 ? 2.876   41.887  41.991 1.00 69.52  ? 111 LYS A CE    1 
ATOM   887  N  NZ    . LYS A 1 111 ? 3.036   41.563  43.440 1.00 69.22  ? 111 LYS A NZ    1 
ATOM   888  N  N     . GLU A 1 112 ? 2.771   47.895  38.255 1.00 61.07  ? 112 GLU A N     1 
ATOM   889  C  CA    . GLU A 1 112 ? 2.815   49.340  38.118 1.00 61.45  ? 112 GLU A CA    1 
ATOM   890  C  C     . GLU A 1 112 ? 2.164   49.793  36.810 1.00 61.28  ? 112 GLU A C     1 
ATOM   891  O  O     . GLU A 1 112 ? 2.318   49.149  35.773 1.00 61.62  ? 112 GLU A O     1 
ATOM   892  C  CB    . GLU A 1 112 ? 4.253   49.839  38.161 1.00 63.47  ? 112 GLU A CB    1 
ATOM   893  C  CG    . GLU A 1 112 ? 4.351   51.326  37.874 1.00 67.48  ? 112 GLU A CG    1 
ATOM   894  C  CD    . GLU A 1 112 ? 5.776   51.810  37.770 1.00 70.14  ? 112 GLU A CD    1 
ATOM   895  O  OE1   . GLU A 1 112 ? 5.974   53.012  37.469 1.00 71.32  ? 112 GLU A OE1   1 
ATOM   896  O  OE2   . GLU A 1 112 ? 6.694   50.986  37.991 1.00 72.68  ? 112 GLU A OE2   1 
ATOM   897  N  N     . LYS A 1 113 ? 1.462   50.923  36.871 1.00 59.36  ? 113 LYS A N     1 
ATOM   898  C  CA    . LYS A 1 113 ? 0.755   51.490  35.732 1.00 56.72  ? 113 LYS A CA    1 
ATOM   899  C  C     . LYS A 1 113 ? 1.690   52.124  34.718 1.00 55.55  ? 113 LYS A C     1 
ATOM   900  O  O     . LYS A 1 113 ? 2.765   52.617  35.073 1.00 55.33  ? 113 LYS A O     1 
ATOM   901  C  CB    . LYS A 1 113 ? -0.236  52.535  36.234 1.00 58.85  ? 113 LYS A CB    1 
ATOM   902  C  CG    . LYS A 1 113 ? -1.204  53.075  35.193 1.00 61.11  ? 113 LYS A CG    1 
ATOM   903  C  CD    . LYS A 1 113 ? -2.237  53.982  35.864 1.00 61.98  ? 113 LYS A CD    1 
ATOM   904  C  CE    . LYS A 1 113 ? -3.343  54.386  34.907 1.00 61.69  ? 113 LYS A CE    1 
ATOM   905  N  NZ    . LYS A 1 113 ? -2.792  55.184  33.802 1.00 61.21  ? 113 LYS A NZ    1 
ATOM   906  N  N     . VAL A 1 114 ? 1.282   52.103  33.449 1.00 53.03  ? 114 VAL A N     1 
ATOM   907  C  CA    . VAL A 1 114 ? 2.087   52.690  32.384 1.00 50.10  ? 114 VAL A CA    1 
ATOM   908  C  C     . VAL A 1 114 ? 1.193   53.346  31.337 1.00 49.93  ? 114 VAL A C     1 
ATOM   909  O  O     . VAL A 1 114 ? 0.150   52.810  30.974 1.00 50.29  ? 114 VAL A O     1 
ATOM   910  C  CB    . VAL A 1 114 ? 2.977   51.615  31.697 1.00 49.85  ? 114 VAL A CB    1 
ATOM   911  C  CG1   . VAL A 1 114 ? 2.109   50.464  31.190 1.00 49.55  ? 114 VAL A CG1   1 
ATOM   912  C  CG2   . VAL A 1 114 ? 3.776   52.244  30.553 1.00 48.12  ? 114 VAL A CG2   1 
ATOM   913  N  N     . GLU A 1 115 ? 1.593   54.522  30.869 1.00 48.81  ? 115 GLU A N     1 
ATOM   914  C  CA    . GLU A 1 115 ? 0.843   55.233  29.852 1.00 48.37  ? 115 GLU A CA    1 
ATOM   915  C  C     . GLU A 1 115 ? 1.860   55.935  28.984 1.00 49.76  ? 115 GLU A C     1 
ATOM   916  O  O     . GLU A 1 115 ? 2.542   56.841  29.450 1.00 51.34  ? 115 GLU A O     1 
ATOM   917  C  CB    . GLU A 1 115 ? -0.100  56.282  30.472 1.00 48.71  ? 115 GLU A CB    1 
ATOM   918  C  CG    . GLU A 1 115 ? -1.184  55.704  31.370 1.00 47.32  ? 115 GLU A CG    1 
ATOM   919  C  CD    . GLU A 1 115 ? -2.243  54.951  30.591 1.00 47.05  ? 115 GLU A CD    1 
ATOM   920  O  OE1   . GLU A 1 115 ? -2.911  54.073  31.176 1.00 47.15  ? 115 GLU A OE1   1 
ATOM   921  O  OE2   . GLU A 1 115 ? -2.419  55.253  29.395 1.00 46.67  ? 115 GLU A OE2   1 
ATOM   922  N  N     . ASN A 1 116 ? 1.999   55.496  27.738 1.00 48.93  ? 116 ASN A N     1 
ATOM   923  C  CA    . ASN A 1 116 ? 2.922   56.152  26.837 1.00 48.48  ? 116 ASN A CA    1 
ATOM   924  C  C     . ASN A 1 116 ? 2.391   56.062  25.425 1.00 48.53  ? 116 ASN A C     1 
ATOM   925  O  O     . ASN A 1 116 ? 1.232   55.712  25.217 1.00 49.36  ? 116 ASN A O     1 
ATOM   926  C  CB    . ASN A 1 116 ? 4.345   55.581  26.955 1.00 48.96  ? 116 ASN A CB    1 
ATOM   927  C  CG    . ASN A 1 116 ? 4.448   54.138  26.525 1.00 48.21  ? 116 ASN A CG    1 
ATOM   928  O  OD1   . ASN A 1 116 ? 3.907   53.743  25.494 1.00 46.98  ? 116 ASN A OD1   1 
ATOM   929  N  ND2   . ASN A 1 116 ? 5.169   53.346  27.306 1.00 48.31  ? 116 ASN A ND2   1 
ATOM   930  N  N     . GLU A 1 117 ? 3.222   56.384  24.450 1.00 49.75  ? 117 GLU A N     1 
ATOM   931  C  CA    . GLU A 1 117 ? 2.770   56.387  23.075 1.00 51.54  ? 117 GLU A CA    1 
ATOM   932  C  C     . GLU A 1 117 ? 2.217   55.064  22.563 1.00 50.31  ? 117 GLU A C     1 
ATOM   933  O  O     . GLU A 1 117 ? 1.377   55.060  21.664 1.00 49.76  ? 117 GLU A O     1 
ATOM   934  C  CB    . GLU A 1 117 ? 3.900   56.878  22.163 1.00 55.62  ? 117 GLU A CB    1 
ATOM   935  C  CG    . GLU A 1 117 ? 3.521   56.968  20.685 1.00 61.70  ? 117 GLU A CG    1 
ATOM   936  C  CD    . GLU A 1 117 ? 4.509   57.805  19.875 1.00 66.28  ? 117 GLU A CD    1 
ATOM   937  O  OE1   . GLU A 1 117 ? 4.712   58.990  20.228 1.00 70.06  ? 117 GLU A OE1   1 
ATOM   938  O  OE2   . GLU A 1 117 ? 5.083   57.290  18.887 1.00 68.05  ? 117 GLU A OE2   1 
ATOM   939  N  N     . TYR A 1 118 ? 2.654   53.943  23.135 1.00 48.27  ? 118 TYR A N     1 
ATOM   940  C  CA    . TYR A 1 118 ? 2.176   52.658  22.642 1.00 47.25  ? 118 TYR A CA    1 
ATOM   941  C  C     . TYR A 1 118 ? 1.557   51.702  23.643 1.00 46.93  ? 118 TYR A C     1 
ATOM   942  O  O     . TYR A 1 118 ? 1.205   50.578  23.294 1.00 46.67  ? 118 TYR A O     1 
ATOM   943  C  CB    . TYR A 1 118 ? 3.301   51.948  21.901 1.00 46.80  ? 118 TYR A CB    1 
ATOM   944  C  CG    . TYR A 1 118 ? 3.852   52.755  20.764 1.00 46.90  ? 118 TYR A CG    1 
ATOM   945  C  CD1   . TYR A 1 118 ? 5.100   53.382  20.859 1.00 46.19  ? 118 TYR A CD1   1 
ATOM   946  C  CD2   . TYR A 1 118 ? 3.126   52.903  19.586 1.00 47.58  ? 118 TYR A CD2   1 
ATOM   947  C  CE1   . TYR A 1 118 ? 5.608   54.137  19.796 1.00 46.51  ? 118 TYR A CE1   1 
ATOM   948  C  CE2   . TYR A 1 118 ? 3.622   53.660  18.523 1.00 47.64  ? 118 TYR A CE2   1 
ATOM   949  C  CZ    . TYR A 1 118 ? 4.856   54.267  18.634 1.00 48.05  ? 118 TYR A CZ    1 
ATOM   950  O  OH    . TYR A 1 118 ? 5.337   54.983  17.559 1.00 51.62  ? 118 TYR A OH    1 
ATOM   951  N  N     . LEU A 1 119 ? 1.413   52.139  24.884 1.00 47.11  ? 119 LEU A N     1 
ATOM   952  C  CA    . LEU A 1 119 ? 0.830   51.282  25.910 1.00 46.60  ? 119 LEU A CA    1 
ATOM   953  C  C     . LEU A 1 119 ? -0.133  52.092  26.769 1.00 49.03  ? 119 LEU A C     1 
ATOM   954  O  O     . LEU A 1 119 ? 0.135   53.242  27.115 1.00 47.52  ? 119 LEU A O     1 
ATOM   955  C  CB    . LEU A 1 119 ? 1.926   50.691  26.804 1.00 43.63  ? 119 LEU A CB    1 
ATOM   956  C  CG    . LEU A 1 119 ? 2.988   49.756  26.229 1.00 43.38  ? 119 LEU A CG    1 
ATOM   957  C  CD1   . LEU A 1 119 ? 4.040   49.461  27.319 1.00 42.81  ? 119 LEU A CD1   1 
ATOM   958  C  CD2   . LEU A 1 119 ? 2.342   48.444  25.733 1.00 40.26  ? 119 LEU A CD2   1 
ATOM   959  N  N     . THR A 1 120 ? -1.266  51.487  27.096 1.00 51.49  ? 120 THR A N     1 
ATOM   960  C  CA    . THR A 1 120 ? -2.256  52.139  27.926 1.00 53.55  ? 120 THR A CA    1 
ATOM   961  C  C     . THR A 1 120 ? -2.625  51.105  28.971 1.00 54.60  ? 120 THR A C     1 
ATOM   962  O  O     . THR A 1 120 ? -2.733  49.920  28.661 1.00 54.25  ? 120 THR A O     1 
ATOM   963  C  CB    . THR A 1 120 ? -3.500  52.559  27.109 1.00 52.86  ? 120 THR A CB    1 
ATOM   964  O  OG1   . THR A 1 120 ? -4.308  53.434  27.904 1.00 54.99  ? 120 THR A OG1   1 
ATOM   965  C  CG2   . THR A 1 120 ? -4.324  51.352  26.722 1.00 50.44  ? 120 THR A CG2   1 
ATOM   966  N  N     . SER A 1 121 ? -2.795  51.554  30.212 1.00 56.67  ? 121 SER A N     1 
ATOM   967  C  CA    . SER A 1 121 ? -3.116  50.654  31.315 1.00 58.35  ? 121 SER A CA    1 
ATOM   968  C  C     . SER A 1 121 ? -4.563  50.717  31.778 1.00 60.82  ? 121 SER A C     1 
ATOM   969  O  O     . SER A 1 121 ? -5.262  51.718  31.593 1.00 62.31  ? 121 SER A O     1 
ATOM   970  C  CB    . SER A 1 121 ? -2.197  50.944  32.498 1.00 56.90  ? 121 SER A CB    1 
ATOM   971  O  OG    . SER A 1 121 ? -0.840  50.901  32.099 1.00 58.15  ? 121 SER A OG    1 
ATOM   972  N  N     . GLU A 1 122 ? -4.994  49.632  32.400 1.00 62.95  ? 122 GLU A N     1 
ATOM   973  C  CA    . GLU A 1 122 ? -6.347  49.495  32.904 1.00 65.30  ? 122 GLU A CA    1 
ATOM   974  C  C     . GLU A 1 122 ? -6.272  48.756  34.238 1.00 66.51  ? 122 GLU A C     1 
ATOM   975  O  O     . GLU A 1 122 ? -6.121  47.530  34.278 1.00 65.74  ? 122 GLU A O     1 
ATOM   976  C  CB    . GLU A 1 122 ? -7.183  48.714  31.882 1.00 66.31  ? 122 GLU A CB    1 
ATOM   977  C  CG    . GLU A 1 122 ? -8.391  47.959  32.424 1.00 68.34  ? 122 GLU A CG    1 
ATOM   978  C  CD    . GLU A 1 122 ? -9.027  47.067  31.361 1.00 69.67  ? 122 GLU A CD    1 
ATOM   979  O  OE1   . GLU A 1 122 ? -9.971  46.306  31.687 1.00 68.67  ? 122 GLU A OE1   1 
ATOM   980  O  OE2   . GLU A 1 122 ? -8.574  47.134  30.191 1.00 70.65  ? 122 GLU A OE2   1 
ATOM   981  N  N     . ARG A 1 123 ? -6.351  49.522  35.325 1.00 68.26  ? 123 ARG A N     1 
ATOM   982  C  CA    . ARG A 1 123 ? -6.295  48.982  36.685 1.00 69.51  ? 123 ARG A CA    1 
ATOM   983  C  C     . ARG A 1 123 ? -7.360  47.925  36.914 1.00 68.44  ? 123 ARG A C     1 
ATOM   984  O  O     . ARG A 1 123 ? -8.498  48.076  36.490 1.00 67.51  ? 123 ARG A O     1 
ATOM   985  C  CB    . ARG A 1 123 ? -6.462  50.121  37.704 1.00 72.54  ? 123 ARG A CB    1 
ATOM   986  C  CG    . ARG A 1 123 ? -6.609  49.685  39.161 1.00 75.82  ? 123 ARG A CG    1 
ATOM   987  C  CD    . ARG A 1 123 ? -8.079  49.639  39.598 1.00 79.02  ? 123 ARG A CD    1 
ATOM   988  N  NE    . ARG A 1 123 ? -8.232  49.235  41.002 1.00 81.52  ? 123 ARG A NE    1 
ATOM   989  C  CZ    . ARG A 1 123 ? -9.402  49.016  41.600 1.00 82.41  ? 123 ARG A CZ    1 
ATOM   990  N  NH1   . ARG A 1 123 ? -9.441  48.649  42.876 1.00 82.59  ? 123 ARG A NH1   1 
ATOM   991  N  NH2   . ARG A 1 123 ? -10.536 49.164  40.923 1.00 82.84  ? 123 ARG A NH2   1 
ATOM   992  N  N     . LEU A 1 124 ? -6.974  46.844  37.578 1.00 68.87  ? 124 LEU A N     1 
ATOM   993  C  CA    . LEU A 1 124 ? -7.900  45.761  37.872 1.00 70.31  ? 124 LEU A CA    1 
ATOM   994  C  C     . LEU A 1 124 ? -8.157  45.655  39.382 1.00 71.51  ? 124 LEU A C     1 
ATOM   995  O  O     . LEU A 1 124 ? -7.478  46.296  40.190 1.00 71.23  ? 124 LEU A O     1 
ATOM   996  C  CB    . LEU A 1 124 ? -7.351  44.429  37.347 1.00 69.58  ? 124 LEU A CB    1 
ATOM   997  C  CG    . LEU A 1 124 ? -7.153  44.203  35.840 1.00 69.12  ? 124 LEU A CG    1 
ATOM   998  C  CD1   . LEU A 1 124 ? -6.429  42.885  35.677 1.00 68.59  ? 124 LEU A CD1   1 
ATOM   999  C  CD2   . LEU A 1 124 ? -8.479  44.183  35.072 1.00 65.95  ? 124 LEU A CD2   1 
ATOM   1000 N  N     . GLY A 1 125 ? -9.134  44.829  39.744 1.00 73.24  ? 125 GLY A N     1 
ATOM   1001 C  CA    . GLY A 1 125 ? -9.506  44.640  41.137 1.00 75.39  ? 125 GLY A CA    1 
ATOM   1002 C  C     . GLY A 1 125 ? -8.419  44.118  42.054 1.00 76.18  ? 125 GLY A C     1 
ATOM   1003 O  O     . GLY A 1 125 ? -8.340  44.519  43.220 1.00 77.16  ? 125 GLY A O     1 
ATOM   1004 N  N     . ASN A 1 126 ? -7.587  43.214  41.544 1.00 76.20  ? 126 ASN A N     1 
ATOM   1005 C  CA    . ASN A 1 126 ? -6.501  42.662  42.347 1.00 75.56  ? 126 ASN A CA    1 
ATOM   1006 C  C     . ASN A 1 126 ? -5.381  43.695  42.447 1.00 74.84  ? 126 ASN A C     1 
ATOM   1007 O  O     . ASN A 1 126 ? -4.245  43.360  42.793 1.00 74.88  ? 126 ASN A O     1 
ATOM   1008 C  CB    . ASN A 1 126 ? -5.983  41.353  41.729 1.00 77.11  ? 126 ASN A CB    1 
ATOM   1009 C  CG    . ASN A 1 126 ? -5.308  41.558  40.371 1.00 78.64  ? 126 ASN A CG    1 
ATOM   1010 O  OD1   . ASN A 1 126 ? -5.822  42.268  39.505 1.00 79.16  ? 126 ASN A OD1   1 
ATOM   1011 N  ND2   . ASN A 1 126 ? -4.154  40.919  40.181 1.00 79.61  ? 126 ASN A ND2   1 
ATOM   1012 N  N     . GLY A 1 127 ? -5.719  44.949  42.135 1.00 73.53  ? 127 GLY A N     1 
ATOM   1013 C  CA    . GLY A 1 127 ? -4.760  46.044  42.198 1.00 72.19  ? 127 GLY A CA    1 
ATOM   1014 C  C     . GLY A 1 127 ? -3.732  46.087  41.078 1.00 71.12  ? 127 GLY A C     1 
ATOM   1015 O  O     . GLY A 1 127 ? -3.044  47.094  40.880 1.00 70.65  ? 127 GLY A O     1 
ATOM   1016 N  N     . GLU A 1 128 ? -3.622  44.985  40.347 1.00 69.74  ? 128 GLU A N     1 
ATOM   1017 C  CA    . GLU A 1 128 ? -2.680  44.884  39.240 1.00 68.25  ? 128 GLU A CA    1 
ATOM   1018 C  C     . GLU A 1 128 ? -3.312  45.487  37.975 1.00 65.14  ? 128 GLU A C     1 
ATOM   1019 O  O     . GLU A 1 128 ? -4.537  45.558  37.867 1.00 64.96  ? 128 GLU A O     1 
ATOM   1020 C  CB    . GLU A 1 128 ? -2.331  43.408  39.035 1.00 70.77  ? 128 GLU A CB    1 
ATOM   1021 C  CG    . GLU A 1 128 ? -1.240  43.128  38.020 1.00 75.11  ? 128 GLU A CG    1 
ATOM   1022 C  CD    . GLU A 1 128 ? -0.781  41.681  38.070 1.00 77.12  ? 128 GLU A CD    1 
ATOM   1023 O  OE1   . GLU A 1 128 ? -0.023  41.260  37.171 1.00 79.02  ? 128 GLU A OE1   1 
ATOM   1024 O  OE2   . GLU A 1 128 ? -1.176  40.963  39.017 1.00 78.23  ? 128 GLU A OE2   1 
ATOM   1025 N  N     . TYR A 1 129 ? -2.485  45.913  37.021 1.00 61.69  ? 129 TYR A N     1 
ATOM   1026 C  CA    . TYR A 1 129 ? -2.992  46.515  35.782 1.00 58.72  ? 129 TYR A CA    1 
ATOM   1027 C  C     . TYR A 1 129 ? -2.927  45.622  34.536 1.00 55.73  ? 129 TYR A C     1 
ATOM   1028 O  O     . TYR A 1 129 ? -2.020  44.802  34.382 1.00 54.12  ? 129 TYR A O     1 
ATOM   1029 C  CB    . TYR A 1 129 ? -2.237  47.807  35.455 1.00 60.10  ? 129 TYR A CB    1 
ATOM   1030 C  CG    . TYR A 1 129 ? -2.318  48.875  36.513 1.00 62.74  ? 129 TYR A CG    1 
ATOM   1031 C  CD1   . TYR A 1 129 ? -1.471  48.858  37.618 1.00 63.81  ? 129 TYR A CD1   1 
ATOM   1032 C  CD2   . TYR A 1 129 ? -3.260  49.898  36.418 1.00 64.66  ? 129 TYR A CD2   1 
ATOM   1033 C  CE1   . TYR A 1 129 ? -1.561  49.838  38.606 1.00 65.37  ? 129 TYR A CE1   1 
ATOM   1034 C  CE2   . TYR A 1 129 ? -3.362  50.878  37.398 1.00 65.79  ? 129 TYR A CE2   1 
ATOM   1035 C  CZ    . TYR A 1 129 ? -2.510  50.844  38.487 1.00 65.91  ? 129 TYR A CZ    1 
ATOM   1036 O  OH    . TYR A 1 129 ? -2.613  51.824  39.448 1.00 67.11  ? 129 TYR A OH    1 
ATOM   1037 N  N     . LEU A 1 130 ? -3.902  45.796  33.650 1.00 51.58  ? 130 LEU A N     1 
ATOM   1038 C  CA    . LEU A 1 130 ? -3.927  45.067  32.400 1.00 49.12  ? 130 LEU A CA    1 
ATOM   1039 C  C     . LEU A 1 130 ? -3.389  46.083  31.396 1.00 47.50  ? 130 LEU A C     1 
ATOM   1040 O  O     . LEU A 1 130 ? -3.947  47.177  31.256 1.00 48.21  ? 130 LEU A O     1 
ATOM   1041 C  CB    . LEU A 1 130 ? -5.355  44.640  32.037 1.00 49.84  ? 130 LEU A CB    1 
ATOM   1042 C  CG    . LEU A 1 130 ? -5.485  43.956  30.666 1.00 48.94  ? 130 LEU A CG    1 
ATOM   1043 C  CD1   . LEU A 1 130 ? -4.562  42.729  30.603 1.00 49.20  ? 130 LEU A CD1   1 
ATOM   1044 C  CD2   . LEU A 1 130 ? -6.914  43.550  30.432 1.00 46.87  ? 130 LEU A CD2   1 
ATOM   1045 N  N     . VAL A 1 131 ? -2.291  45.748  30.726 1.00 43.88  ? 131 VAL A N     1 
ATOM   1046 C  CA    . VAL A 1 131 ? -1.695  46.678  29.775 1.00 43.03  ? 131 VAL A CA    1 
ATOM   1047 C  C     . VAL A 1 131 ? -1.931  46.266  28.338 1.00 41.98  ? 131 VAL A C     1 
ATOM   1048 O  O     . VAL A 1 131 ? -1.692  45.119  27.957 1.00 42.33  ? 131 VAL A O     1 
ATOM   1049 C  CB    . VAL A 1 131 ? -0.176  46.836  30.019 1.00 42.93  ? 131 VAL A CB    1 
ATOM   1050 C  CG1   . VAL A 1 131 ? 0.398   47.888  29.071 1.00 42.44  ? 131 VAL A CG1   1 
ATOM   1051 C  CG2   . VAL A 1 131 ? 0.067   47.238  31.464 1.00 42.49  ? 131 VAL A CG2   1 
ATOM   1052 N  N     . LYS A 1 132 ? -2.408  47.221  27.549 1.00 41.93  ? 132 LYS A N     1 
ATOM   1053 C  CA    . LYS A 1 132 ? -2.719  47.000  26.147 1.00 40.73  ? 132 LYS A CA    1 
ATOM   1054 C  C     . LYS A 1 132 ? -1.842  47.836  25.246 1.00 40.11  ? 132 LYS A C     1 
ATOM   1055 O  O     . LYS A 1 132 ? -1.474  48.961  25.585 1.00 38.15  ? 132 LYS A O     1 
ATOM   1056 C  CB    . LYS A 1 132 ? -4.179  47.362  25.883 1.00 43.29  ? 132 LYS A CB    1 
ATOM   1057 C  CG    . LYS A 1 132 ? -5.157  46.520  26.673 1.00 47.11  ? 132 LYS A CG    1 
ATOM   1058 C  CD    . LYS A 1 132 ? -6.576  47.077  26.643 1.00 47.43  ? 132 LYS A CD    1 
ATOM   1059 C  CE    . LYS A 1 132 ? -7.513  46.130  27.401 1.00 51.08  ? 132 LYS A CE    1 
ATOM   1060 N  NZ    . LYS A 1 132 ? -8.952  46.572  27.409 1.00 52.29  ? 132 LYS A NZ    1 
ATOM   1061 N  N     . GLY A 1 133 ? -1.508  47.288  24.084 1.00 38.45  ? 133 GLY A N     1 
ATOM   1062 C  CA    . GLY A 1 133 ? -0.694  48.047  23.159 1.00 38.06  ? 133 GLY A CA    1 
ATOM   1063 C  C     . GLY A 1 133 ? -1.569  48.966  22.331 1.00 38.08  ? 133 GLY A C     1 
ATOM   1064 O  O     . GLY A 1 133 ? -2.744  48.687  22.083 1.00 38.06  ? 133 GLY A O     1 
ATOM   1065 N  N     . VAL A 1 134 ? -0.979  50.048  21.860 1.00 38.86  ? 134 VAL A N     1 
ATOM   1066 C  CA    . VAL A 1 134 ? -1.714  51.022  21.086 1.00 38.49  ? 134 VAL A CA    1 
ATOM   1067 C  C     . VAL A 1 134 ? -0.978  51.448  19.851 1.00 37.34  ? 134 VAL A C     1 
ATOM   1068 O  O     . VAL A 1 134 ? 0.178   51.810  19.912 1.00 39.22  ? 134 VAL A O     1 
ATOM   1069 C  CB    . VAL A 1 134 ? -1.962  52.300  21.923 1.00 40.28  ? 134 VAL A CB    1 
ATOM   1070 C  CG1   . VAL A 1 134 ? -2.675  53.352  21.082 1.00 37.26  ? 134 VAL A CG1   1 
ATOM   1071 C  CG2   . VAL A 1 134 ? -2.746  51.951  23.164 1.00 38.71  ? 134 VAL A CG2   1 
ATOM   1072 N  N     . TYR A 1 135 ? -1.641  51.393  18.715 1.00 38.97  ? 135 TYR A N     1 
ATOM   1073 C  CA    . TYR A 1 135 ? -1.020  51.864  17.493 1.00 40.79  ? 135 TYR A CA    1 
ATOM   1074 C  C     . TYR A 1 135 ? -2.111  52.646  16.776 1.00 42.12  ? 135 TYR A C     1 
ATOM   1075 O  O     . TYR A 1 135 ? -3.031  52.064  16.192 1.00 39.75  ? 135 TYR A O     1 
ATOM   1076 C  CB    . TYR A 1 135 ? -0.494  50.715  16.623 1.00 39.38  ? 135 TYR A CB    1 
ATOM   1077 C  CG    . TYR A 1 135 ? 0.309   51.244  15.467 1.00 39.92  ? 135 TYR A CG    1 
ATOM   1078 C  CD1   . TYR A 1 135 ? -0.266  51.417  14.209 1.00 40.37  ? 135 TYR A CD1   1 
ATOM   1079 C  CD2   . TYR A 1 135 ? 1.623   51.663  15.649 1.00 40.06  ? 135 TYR A CD2   1 
ATOM   1080 C  CE1   . TYR A 1 135 ? 0.446   52.001  13.156 1.00 39.72  ? 135 TYR A CE1   1 
ATOM   1081 C  CE2   . TYR A 1 135 ? 2.350   52.246  14.602 1.00 41.55  ? 135 TYR A CE2   1 
ATOM   1082 C  CZ    . TYR A 1 135 ? 1.755   52.410  13.355 1.00 41.95  ? 135 TYR A CZ    1 
ATOM   1083 O  OH    . TYR A 1 135 ? 2.491   52.938  12.306 1.00 42.36  ? 135 TYR A OH    1 
ATOM   1084 N  N     . LYS A 1 136 ? -1.998  53.974  16.851 1.00 45.01  ? 136 LYS A N     1 
ATOM   1085 C  CA    . LYS A 1 136 ? -2.979  54.884  16.261 1.00 44.55  ? 136 LYS A CA    1 
ATOM   1086 C  C     . LYS A 1 136 ? -4.347  54.438  16.754 1.00 44.75  ? 136 LYS A C     1 
ATOM   1087 O  O     . LYS A 1 136 ? -4.572  54.384  17.965 1.00 45.82  ? 136 LYS A O     1 
ATOM   1088 C  CB    . LYS A 1 136 ? -2.905  54.839  14.739 1.00 46.29  ? 136 LYS A CB    1 
ATOM   1089 C  CG    . LYS A 1 136 ? -1.604  55.366  14.189 1.00 47.79  ? 136 LYS A CG    1 
ATOM   1090 C  CD    . LYS A 1 136 ? -1.578  55.241  12.674 1.00 51.78  ? 136 LYS A CD    1 
ATOM   1091 C  CE    . LYS A 1 136 ? -0.251  55.693  12.093 1.00 54.06  ? 136 LYS A CE    1 
ATOM   1092 N  NZ    . LYS A 1 136 ? -0.332  55.845  10.607 1.00 57.12  ? 136 LYS A NZ    1 
ATOM   1093 N  N     . ASP A 1 137 ? -5.244  54.078  15.843 1.00 45.54  ? 137 ASP A N     1 
ATOM   1094 C  CA    . ASP A 1 137 ? -6.585  53.646  16.246 1.00 49.20  ? 137 ASP A CA    1 
ATOM   1095 C  C     . ASP A 1 137 ? -6.773  52.143  16.523 1.00 49.00  ? 137 ASP A C     1 
ATOM   1096 O  O     . ASP A 1 137 ? -7.895  51.697  16.762 1.00 49.69  ? 137 ASP A O     1 
ATOM   1097 C  CB    . ASP A 1 137 ? -7.603  54.076  15.191 1.00 52.95  ? 137 ASP A CB    1 
ATOM   1098 C  CG    . ASP A 1 137 ? -7.439  53.324  13.892 1.00 57.31  ? 137 ASP A CG    1 
ATOM   1099 O  OD1   . ASP A 1 137 ? -6.277  53.099  13.466 1.00 59.25  ? 137 ASP A OD1   1 
ATOM   1100 O  OD2   . ASP A 1 137 ? -8.476  52.967  13.290 1.00 61.19  ? 137 ASP A OD2   1 
ATOM   1101 N  N     . LEU A 1 138 ? -5.694  51.364  16.483 1.00 47.39  ? 138 LEU A N     1 
ATOM   1102 C  CA    . LEU A 1 138 ? -5.789  49.927  16.734 1.00 44.90  ? 138 LEU A CA    1 
ATOM   1103 C  C     . LEU A 1 138 ? -5.304  49.599  18.139 1.00 42.65  ? 138 LEU A C     1 
ATOM   1104 O  O     . LEU A 1 138 ? -4.379  50.221  18.646 1.00 42.29  ? 138 LEU A O     1 
ATOM   1105 C  CB    . LEU A 1 138 ? -4.931  49.154  15.715 1.00 45.25  ? 138 LEU A CB    1 
ATOM   1106 C  CG    . LEU A 1 138 ? -4.725  47.628  15.817 1.00 47.54  ? 138 LEU A CG    1 
ATOM   1107 C  CD1   . LEU A 1 138 ? -6.040  46.907  15.681 1.00 45.27  ? 138 LEU A CD1   1 
ATOM   1108 C  CD2   . LEU A 1 138 ? -3.787  47.151  14.689 1.00 47.65  ? 138 LEU A CD2   1 
ATOM   1109 N  N     . GLU A 1 139 ? -5.938  48.628  18.774 1.00 40.35  ? 139 GLU A N     1 
ATOM   1110 C  CA    . GLU A 1 139 ? -5.494  48.204  20.085 1.00 40.15  ? 139 GLU A CA    1 
ATOM   1111 C  C     . GLU A 1 139 ? -4.986  46.760  19.991 1.00 39.32  ? 139 GLU A C     1 
ATOM   1112 O  O     . GLU A 1 139 ? -5.504  45.947  19.198 1.00 39.43  ? 139 GLU A O     1 
ATOM   1113 C  CB    . GLU A 1 139 ? -6.633  48.323  21.111 1.00 42.18  ? 139 GLU A CB    1 
ATOM   1114 C  CG    . GLU A 1 139 ? -6.670  49.694  21.819 1.00 45.12  ? 139 GLU A CG    1 
ATOM   1115 C  CD    . GLU A 1 139 ? -7.788  49.826  22.870 1.00 47.35  ? 139 GLU A CD    1 
ATOM   1116 O  OE1   . GLU A 1 139 ? -8.322  48.803  23.360 1.00 49.30  ? 139 GLU A OE1   1 
ATOM   1117 O  OE2   . GLU A 1 139 ? -8.126  50.971  23.219 1.00 50.57  ? 139 GLU A OE2   1 
ATOM   1118 N  N     . ILE A 1 140 ? -3.951  46.452  20.772 1.00 37.54  ? 140 ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 140 ? -3.393  45.106  20.811 1.00 35.14  ? 140 ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 140 ? -3.554  44.573  22.212 1.00 34.35  ? 140 ILE A C     1 
ATOM   1121 O  O     . ILE A 1 140 ? -2.871  45.030  23.126 1.00 36.21  ? 140 ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 140 ? -1.912  45.101  20.464 1.00 36.57  ? 140 ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 140 ? -1.699  45.803  19.131 1.00 35.58  ? 140 ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 140 ? -1.402  43.657  20.417 1.00 35.25  ? 140 ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 140 ? -0.333  46.438  18.998 1.00 40.79  ? 140 ILE A CD1   1 
ATOM   1126 N  N     . HIS A 1 141 ? -4.459  43.611  22.388 1.00 33.99  ? 141 HIS A N     1 
ATOM   1127 C  CA    . HIS A 1 141 ? -4.728  43.024  23.695 1.00 33.20  ? 141 HIS A CA    1 
ATOM   1128 C  C     . HIS A 1 141 ? -3.963  41.721  23.866 1.00 35.26  ? 141 HIS A C     1 
ATOM   1129 O  O     . HIS A 1 141 ? -3.628  41.044  22.885 1.00 34.57  ? 141 HIS A O     1 
ATOM   1130 C  CB    . HIS A 1 141 ? -6.224  42.715  23.857 1.00 35.69  ? 141 HIS A CB    1 
ATOM   1131 C  CG    . HIS A 1 141 ? -7.113  43.917  23.808 1.00 37.85  ? 141 HIS A CG    1 
ATOM   1132 N  ND1   . HIS A 1 141 ? -8.474  43.836  24.005 1.00 38.69  ? 141 HIS A ND1   1 
ATOM   1133 C  CD2   . HIS A 1 141 ? -6.838  45.227  23.595 1.00 38.84  ? 141 HIS A CD2   1 
ATOM   1134 C  CE1   . HIS A 1 141 ? -9.001  45.044  23.913 1.00 40.97  ? 141 HIS A CE1   1 
ATOM   1135 N  NE2   . HIS A 1 141 ? -8.031  45.905  23.662 1.00 39.55  ? 141 HIS A NE2   1 
ATOM   1136 N  N     . GLY A 1 142 ? -3.736  41.321  25.107 1.00 34.31  ? 142 GLY A N     1 
ATOM   1137 C  CA    . GLY A 1 142 ? -3.009  40.085  25.288 1.00 36.76  ? 142 GLY A CA    1 
ATOM   1138 C  C     . GLY A 1 142 ? -2.578  39.821  26.706 1.00 36.54  ? 142 GLY A C     1 
ATOM   1139 O  O     . GLY A 1 142 ? -2.775  40.657  27.594 1.00 38.38  ? 142 GLY A O     1 
ATOM   1140 N  N     . MET A 1 143 ? -1.935  38.676  26.892 1.00 34.35  ? 143 MET A N     1 
ATOM   1141 C  CA    . MET A 1 143 ? -1.521  38.196  28.201 1.00 34.88  ? 143 MET A CA    1 
ATOM   1142 C  C     . MET A 1 143 ? -0.419  37.151  28.012 1.00 36.30  ? 143 MET A C     1 
ATOM   1143 O  O     . MET A 1 143 ? -0.388  36.437  27.007 1.00 36.30  ? 143 MET A O     1 
ATOM   1144 C  CB    . MET A 1 143 ? -2.745  37.546  28.824 1.00 34.02  ? 143 MET A CB    1 
ATOM   1145 C  CG    . MET A 1 143 ? -2.589  36.837  30.114 1.00 37.34  ? 143 MET A CG    1 
ATOM   1146 S  SD    . MET A 1 143 ? -4.193  36.082  30.520 1.00 29.46  ? 143 MET A SD    1 
ATOM   1147 C  CE    . MET A 1 143 ? -4.110  34.577  29.913 1.00 31.56  ? 143 MET A CE    1 
ATOM   1148 N  N     . LYS A 1 144 ? 0.477   37.046  28.977 1.00 35.62  ? 144 LYS A N     1 
ATOM   1149 C  CA    . LYS A 1 144 ? 1.543   36.068  28.864 1.00 35.32  ? 144 LYS A CA    1 
ATOM   1150 C  C     . LYS A 1 144 ? 0.977   34.658  29.056 1.00 35.75  ? 144 LYS A C     1 
ATOM   1151 O  O     . LYS A 1 144 ? -0.160  34.470  29.508 1.00 36.09  ? 144 LYS A O     1 
ATOM   1152 C  CB    . LYS A 1 144 ? 2.602   36.339  29.926 1.00 36.26  ? 144 LYS A CB    1 
ATOM   1153 C  CG    . LYS A 1 144 ? 2.131   35.968  31.334 1.00 39.02  ? 144 LYS A CG    1 
ATOM   1154 C  CD    . LYS A 1 144 ? 3.168   36.403  32.349 1.00 41.57  ? 144 LYS A CD    1 
ATOM   1155 C  CE    . LYS A 1 144 ? 2.816   35.950  33.746 1.00 42.99  ? 144 LYS A CE    1 
ATOM   1156 N  NZ    . LYS A 1 144 ? 3.910   36.335  34.673 1.00 46.13  ? 144 LYS A NZ    1 
ATOM   1157 N  N     . TYR A 1 145 ? 1.773   33.663  28.699 1.00 33.96  ? 145 TYR A N     1 
ATOM   1158 C  CA    . TYR A 1 145 ? 1.372   32.283  28.869 1.00 32.00  ? 145 TYR A CA    1 
ATOM   1159 C  C     . TYR A 1 145 ? 0.985   31.981  30.315 1.00 33.85  ? 145 TYR A C     1 
ATOM   1160 O  O     . TYR A 1 145 ? 1.638   32.455  31.257 1.00 31.90  ? 145 TYR A O     1 
ATOM   1161 C  CB    . TYR A 1 145 ? 2.523   31.356  28.465 1.00 32.30  ? 145 TYR A CB    1 
ATOM   1162 C  CG    . TYR A 1 145 ? 2.345   29.916  28.908 1.00 32.02  ? 145 TYR A CG    1 
ATOM   1163 C  CD1   . TYR A 1 145 ? 2.692   29.506  30.202 1.00 32.92  ? 145 TYR A CD1   1 
ATOM   1164 C  CD2   . TYR A 1 145 ? 1.822   28.969  28.039 1.00 30.54  ? 145 TYR A CD2   1 
ATOM   1165 C  CE1   . TYR A 1 145 ? 2.519   28.180  30.614 1.00 30.79  ? 145 TYR A CE1   1 
ATOM   1166 C  CE2   . TYR A 1 145 ? 1.643   27.658  28.430 1.00 29.86  ? 145 TYR A CE2   1 
ATOM   1167 C  CZ    . TYR A 1 145 ? 1.993   27.264  29.717 1.00 32.16  ? 145 TYR A CZ    1 
ATOM   1168 O  OH    . TYR A 1 145 ? 1.809   25.945  30.081 1.00 34.62  ? 145 TYR A OH    1 
ATOM   1169 N  N     . MET A 1 146 ? -0.078  31.184  30.472 1.00 34.18  ? 146 MET A N     1 
ATOM   1170 C  CA    . MET A 1 146 ? -0.551  30.745  31.773 1.00 34.79  ? 146 MET A CA    1 
ATOM   1171 C  C     . MET A 1 146 ? -0.794  29.258  31.612 1.00 36.48  ? 146 MET A C     1 
ATOM   1172 O  O     . MET A 1 146 ? -1.110  28.787  30.516 1.00 37.96  ? 146 MET A O     1 
ATOM   1173 C  CB    . MET A 1 146 ? -1.849  31.462  32.182 1.00 33.97  ? 146 MET A CB    1 
ATOM   1174 C  CG    . MET A 1 146 ? -1.666  32.940  32.532 1.00 31.57  ? 146 MET A CG    1 
ATOM   1175 S  SD    . MET A 1 146 ? -0.433  33.187  33.791 1.00 31.21  ? 146 MET A SD    1 
ATOM   1176 C  CE    . MET A 1 146 ? -0.034  34.554  33.582 1.00 27.38  ? 146 MET A CE    1 
ATOM   1177 N  N     . SER A 1 147 ? -0.642  28.505  32.690 1.00 37.75  ? 147 SER A N     1 
ATOM   1178 C  CA    . SER A 1 147 ? -0.832  27.064  32.610 1.00 41.47  ? 147 SER A CA    1 
ATOM   1179 C  C     . SER A 1 147 ? -2.283  26.634  32.424 1.00 43.57  ? 147 SER A C     1 
ATOM   1180 O  O     . SER A 1 147 ? -3.234  27.378  32.682 1.00 43.31  ? 147 SER A O     1 
ATOM   1181 C  CB    . SER A 1 147 ? -0.273  26.388  33.864 1.00 39.36  ? 147 SER A CB    1 
ATOM   1182 O  OG    . SER A 1 147 ? -1.048  26.719  35.000 1.00 42.86  ? 147 SER A OG    1 
ATOM   1183 N  N     . SER A 1 148 ? -2.429  25.405  31.967 1.00 47.42  ? 148 SER A N     1 
ATOM   1184 C  CA    . SER A 1 148 ? -3.726  24.797  31.760 1.00 50.12  ? 148 SER A CA    1 
ATOM   1185 C  C     . SER A 1 148 ? -4.539  24.817  33.066 1.00 51.42  ? 148 SER A C     1 
ATOM   1186 O  O     . SER A 1 148 ? -5.745  25.069  33.053 1.00 53.48  ? 148 SER A O     1 
ATOM   1187 C  CB    . SER A 1 148 ? -3.523  23.359  31.300 1.00 49.43  ? 148 SER A CB    1 
ATOM   1188 O  OG    . SER A 1 148 ? -4.765  22.750  31.051 1.00 54.69  ? 148 SER A OG    1 
ATOM   1189 N  N     . ALA A 1 149 ? -3.878  24.559  34.190 1.00 51.92  ? 149 ALA A N     1 
ATOM   1190 C  CA    . ALA A 1 149 ? -4.548  24.549  35.487 1.00 52.91  ? 149 ALA A CA    1 
ATOM   1191 C  C     . ALA A 1 149 ? -5.066  25.934  35.848 1.00 54.16  ? 149 ALA A C     1 
ATOM   1192 O  O     . ALA A 1 149 ? -6.155  26.074  36.418 1.00 55.29  ? 149 ALA A O     1 
ATOM   1193 C  CB    . ALA A 1 149 ? -3.600  24.052  36.578 1.00 51.43  ? 149 ALA A CB    1 
ATOM   1194 N  N     . TRP A 1 150 ? -4.291  26.962  35.524 1.00 53.32  ? 150 TRP A N     1 
ATOM   1195 C  CA    . TRP A 1 150 ? -4.709  28.320  35.830 1.00 52.64  ? 150 TRP A CA    1 
ATOM   1196 C  C     . TRP A 1 150 ? -6.002  28.654  35.114 1.00 53.47  ? 150 TRP A C     1 
ATOM   1197 O  O     . TRP A 1 150 ? -6.865  29.337  35.664 1.00 53.51  ? 150 TRP A O     1 
ATOM   1198 C  CB    . TRP A 1 150 ? -3.656  29.325  35.400 1.00 50.78  ? 150 TRP A CB    1 
ATOM   1199 C  CG    . TRP A 1 150 ? -4.045  30.723  35.723 1.00 48.27  ? 150 TRP A CG    1 
ATOM   1200 C  CD1   . TRP A 1 150 ? -3.850  31.372  36.902 1.00 46.66  ? 150 TRP A CD1   1 
ATOM   1201 C  CD2   . TRP A 1 150 ? -4.638  31.676  34.826 1.00 46.03  ? 150 TRP A CD2   1 
ATOM   1202 N  NE1   . TRP A 1 150 ? -4.270  32.674  36.796 1.00 45.64  ? 150 TRP A NE1   1 
ATOM   1203 C  CE2   . TRP A 1 150 ? -4.760  32.887  35.532 1.00 45.77  ? 150 TRP A CE2   1 
ATOM   1204 C  CE3   . TRP A 1 150 ? -5.074  31.620  33.494 1.00 44.28  ? 150 TRP A CE3   1 
ATOM   1205 C  CZ2   . TRP A 1 150 ? -5.294  34.042  34.952 1.00 46.20  ? 150 TRP A CZ2   1 
ATOM   1206 C  CZ3   . TRP A 1 150 ? -5.603  32.764  32.919 1.00 44.05  ? 150 TRP A CZ3   1 
ATOM   1207 C  CH2   . TRP A 1 150 ? -5.709  33.959  33.647 1.00 45.46  ? 150 TRP A CH2   1 
ATOM   1208 N  N     . PHE A 1 151 ? -6.118  28.184  33.876 1.00 55.39  ? 151 PHE A N     1 
ATOM   1209 C  CA    . PHE A 1 151 ? -7.314  28.420  33.087 1.00 56.32  ? 151 PHE A CA    1 
ATOM   1210 C  C     . PHE A 1 151 ? -8.468  27.608  33.675 1.00 58.70  ? 151 PHE A C     1 
ATOM   1211 O  O     . PHE A 1 151 ? -9.645  27.905  33.423 1.00 60.34  ? 151 PHE A O     1 
ATOM   1212 C  CB    . PHE A 1 151 ? -7.100  28.009  31.624 1.00 53.27  ? 151 PHE A CB    1 
ATOM   1213 C  CG    . PHE A 1 151 ? -6.413  29.057  30.775 1.00 51.85  ? 151 PHE A CG    1 
ATOM   1214 C  CD1   . PHE A 1 151 ? -5.053  28.944  30.456 1.00 48.73  ? 151 PHE A CD1   1 
ATOM   1215 C  CD2   . PHE A 1 151 ? -7.126  30.156  30.290 1.00 50.04  ? 151 PHE A CD2   1 
ATOM   1216 C  CE1   . PHE A 1 151 ? -4.411  29.908  29.670 1.00 47.25  ? 151 PHE A CE1   1 
ATOM   1217 C  CE2   . PHE A 1 151 ? -6.491  31.135  29.498 1.00 49.77  ? 151 PHE A CE2   1 
ATOM   1218 C  CZ    . PHE A 1 151 ? -5.126  31.008  29.188 1.00 48.34  ? 151 PHE A CZ    1 
ATOM   1219 N  N     . GLU A 1 152 ? -8.143  26.576  34.449 1.00 59.46  ? 152 GLU A N     1 
ATOM   1220 C  CA    . GLU A 1 152 ? -9.198  25.759  35.039 1.00 61.01  ? 152 GLU A CA    1 
ATOM   1221 C  C     . GLU A 1 152 ? -9.680  26.359  36.353 1.00 60.28  ? 152 GLU A C     1 
ATOM   1222 O  O     . GLU A 1 152 ? -10.786 26.081  36.788 1.00 61.60  ? 152 GLU A O     1 
ATOM   1223 C  CB    . GLU A 1 152 ? -8.720  24.322  35.265 1.00 61.69  ? 152 GLU A CB    1 
ATOM   1224 C  CG    . GLU A 1 152 ? -9.843  23.359  35.636 1.00 62.58  ? 152 GLU A CG    1 
ATOM   1225 C  CD    . GLU A 1 152 ? -9.351  21.941  35.851 0.00 62.47  ? 152 GLU A CD    1 
ATOM   1226 O  OE1   . GLU A 1 152 ? -10.174 21.076  36.215 0.00 62.59  ? 152 GLU A OE1   1 
ATOM   1227 O  OE2   . GLU A 1 152 ? -8.143  21.691  35.654 0.00 62.59  ? 152 GLU A OE2   1 
ATOM   1228 N  N     . ALA A 1 153 ? -8.844  27.186  36.972 1.00 60.13  ? 153 ALA A N     1 
ATOM   1229 C  CA    . ALA A 1 153 ? -9.184  27.840  38.235 1.00 59.29  ? 153 ALA A CA    1 
ATOM   1230 C  C     . ALA A 1 153 ? -9.760  29.225  37.978 1.00 59.74  ? 153 ALA A C     1 
ATOM   1231 O  O     . ALA A 1 153 ? -10.145 29.930  38.914 1.00 60.19  ? 153 ALA A O     1 
ATOM   1232 C  CB    . ALA A 1 153 ? -7.947  27.966  39.112 1.00 58.06  ? 153 ALA A CB    1 
ATOM   1233 N  N     . ASN A 1 154 ? -9.801  29.619  36.708 1.00 59.18  ? 154 ASN A N     1 
ATOM   1234 C  CA    . ASN A 1 154 ? -10.315 30.926  36.332 1.00 58.32  ? 154 ASN A CA    1 
ATOM   1235 C  C     . ASN A 1 154 ? -11.198 30.780  35.106 1.00 57.29  ? 154 ASN A C     1 
ATOM   1236 O  O     . ASN A 1 154 ? -10.902 31.328  34.042 1.00 57.48  ? 154 ASN A O     1 
ATOM   1237 C  CB    . ASN A 1 154 ? -9.152  31.867  36.032 1.00 59.20  ? 154 ASN A CB    1 
ATOM   1238 C  CG    . ASN A 1 154 ? -8.236  32.047  37.220 1.00 60.43  ? 154 ASN A CG    1 
ATOM   1239 O  OD1   . ASN A 1 154 ? -8.521  32.830  38.127 1.00 62.48  ? 154 ASN A OD1   1 
ATOM   1240 N  ND2   . ASN A 1 154 ? -7.130  31.311  37.231 1.00 61.53  ? 154 ASN A ND2   1 
ATOM   1241 N  N     . LYS A 1 155 ? -12.285 30.036  35.271 1.00 55.62  ? 155 LYS A N     1 
ATOM   1242 C  CA    . LYS A 1 155 ? -13.237 29.777  34.194 1.00 54.01  ? 155 LYS A CA    1 
ATOM   1243 C  C     . LYS A 1 155 ? -13.643 31.010  33.392 1.00 51.47  ? 155 LYS A C     1 
ATOM   1244 O  O     . LYS A 1 155 ? -13.936 32.062  33.963 1.00 51.00  ? 155 LYS A O     1 
ATOM   1245 C  CB    . LYS A 1 155 ? -14.482 29.090  34.768 1.00 54.61  ? 155 LYS A CB    1 
ATOM   1246 C  CG    . LYS A 1 155 ? -14.189 27.720  35.375 1.00 54.78  ? 155 LYS A CG    1 
ATOM   1247 C  CD    . LYS A 1 155 ? -15.429 27.115  36.008 0.00 55.00  ? 155 LYS A CD    1 
ATOM   1248 C  CE    . LYS A 1 155 ? -15.124 25.764  36.633 0.00 55.13  ? 155 LYS A CE    1 
ATOM   1249 N  NZ    . LYS A 1 155 ? -16.337 25.144  37.235 0.00 55.22  ? 155 LYS A NZ    1 
ATOM   1250 N  N     . GLU A 1 156 ? -13.632 30.869  32.065 1.00 49.41  ? 156 GLU A N     1 
ATOM   1251 C  CA    . GLU A 1 156 ? -14.005 31.947  31.147 1.00 48.14  ? 156 GLU A CA    1 
ATOM   1252 C  C     . GLU A 1 156 ? -13.189 33.218  31.362 1.00 46.51  ? 156 GLU A C     1 
ATOM   1253 O  O     . GLU A 1 156 ? -13.630 34.316  31.020 1.00 47.04  ? 156 GLU A O     1 
ATOM   1254 C  CB    . GLU A 1 156 ? -15.492 32.271  31.325 1.00 49.85  ? 156 GLU A CB    1 
ATOM   1255 C  CG    . GLU A 1 156 ? -16.428 31.093  31.108 1.00 51.35  ? 156 GLU A CG    1 
ATOM   1256 C  CD    . GLU A 1 156 ? -16.355 30.534  29.690 1.00 55.36  ? 156 GLU A CD    1 
ATOM   1257 O  OE1   . GLU A 1 156 ? -15.823 31.241  28.796 1.00 56.58  ? 156 GLU A OE1   1 
ATOM   1258 O  OE2   . GLU A 1 156 ? -16.837 29.390  29.472 1.00 55.41  ? 156 GLU A OE2   1 
ATOM   1259 N  N     . ILE A 1 157 ? -11.993 33.076  31.922 1.00 45.26  ? 157 ILE A N     1 
ATOM   1260 C  CA    . ILE A 1 157 ? -11.158 34.230  32.210 1.00 43.31  ? 157 ILE A CA    1 
ATOM   1261 C  C     . ILE A 1 157 ? -10.811 35.104  30.991 1.00 43.48  ? 157 ILE A C     1 
ATOM   1262 O  O     . ILE A 1 157 ? -10.683 36.330  31.129 1.00 42.62  ? 157 ILE A O     1 
ATOM   1263 C  CB    . ILE A 1 157 ? -9.865  33.781  32.929 1.00 44.24  ? 157 ILE A CB    1 
ATOM   1264 C  CG1   . ILE A 1 157 ? -9.057  35.004  33.365 1.00 43.88  ? 157 ILE A CG1   1 
ATOM   1265 C  CG2   . ILE A 1 157 ? -9.069  32.826  32.024 1.00 43.52  ? 157 ILE A CG2   1 
ATOM   1266 C  CD1   . ILE A 1 157 ? -9.818  35.939  34.315 1.00 45.72  ? 157 ILE A CD1   1 
ATOM   1267 N  N     . LEU A 1 158 ? -10.672 34.500  29.806 1.00 41.75  ? 158 LEU A N     1 
ATOM   1268 C  CA    . LEU A 1 158 ? -10.331 35.293  28.615 1.00 42.00  ? 158 LEU A CA    1 
ATOM   1269 C  C     . LEU A 1 158 ? -11.470 36.239  28.204 1.00 42.78  ? 158 LEU A C     1 
ATOM   1270 O  O     . LEU A 1 158 ? -11.228 37.425  27.918 1.00 43.71  ? 158 LEU A O     1 
ATOM   1271 C  CB    . LEU A 1 158 ? -9.928  34.384  27.430 1.00 39.88  ? 158 LEU A CB    1 
ATOM   1272 C  CG    . LEU A 1 158 ? -8.634  33.525  27.515 1.00 39.75  ? 158 LEU A CG    1 
ATOM   1273 C  CD1   . LEU A 1 158 ? -8.473  32.691  26.242 1.00 38.86  ? 158 LEU A CD1   1 
ATOM   1274 C  CD2   . LEU A 1 158 ? -7.417  34.412  27.703 1.00 35.45  ? 158 LEU A CD2   1 
ATOM   1275 N  N     . LYS A 1 159 ? -12.707 35.741  28.173 1.00 44.18  ? 159 LYS A N     1 
ATOM   1276 C  CA    . LYS A 1 159 ? -13.836 36.603  27.806 1.00 44.76  ? 159 LYS A CA    1 
ATOM   1277 C  C     . LYS A 1 159 ? -14.053 37.698  28.849 1.00 45.15  ? 159 LYS A C     1 
ATOM   1278 O  O     . LYS A 1 159 ? -14.532 38.783  28.515 1.00 45.69  ? 159 LYS A O     1 
ATOM   1279 C  CB    . LYS A 1 159 ? -15.115 35.783  27.618 1.00 46.48  ? 159 LYS A CB    1 
ATOM   1280 C  CG    . LYS A 1 159 ? -15.233 35.174  26.221 1.00 46.97  ? 159 LYS A CG    1 
ATOM   1281 C  CD    . LYS A 1 159 ? -16.223 34.019  26.175 1.00 48.08  ? 159 LYS A CD    1 
ATOM   1282 C  CE    . LYS A 1 159 ? -16.095 33.264  24.855 1.00 49.82  ? 159 LYS A CE    1 
ATOM   1283 N  NZ    . LYS A 1 159 ? -16.910 32.023  24.832 1.00 51.50  ? 159 LYS A NZ    1 
ATOM   1284 N  N     . ARG A 1 160 ? -13.688 37.417  30.102 1.00 44.31  ? 160 ARG A N     1 
ATOM   1285 C  CA    . ARG A 1 160 ? -13.810 38.398  31.189 1.00 45.32  ? 160 ARG A CA    1 
ATOM   1286 C  C     . ARG A 1 160 ? -12.741 39.485  31.100 1.00 46.17  ? 160 ARG A C     1 
ATOM   1287 O  O     . ARG A 1 160 ? -13.008 40.662  31.375 1.00 46.92  ? 160 ARG A O     1 
ATOM   1288 C  CB    . ARG A 1 160 ? -13.673 37.708  32.558 1.00 45.24  ? 160 ARG A CB    1 
ATOM   1289 C  CG    . ARG A 1 160 ? -14.888 36.886  32.981 1.00 48.50  ? 160 ARG A CG    1 
ATOM   1290 C  CD    . ARG A 1 160 ? -14.527 35.819  33.996 1.00 48.28  ? 160 ARG A CD    1 
ATOM   1291 N  NE    . ARG A 1 160 ? -13.876 36.407  35.153 1.00 49.74  ? 160 ARG A NE    1 
ATOM   1292 C  CZ    . ARG A 1 160 ? -13.244 35.717  36.095 1.00 50.87  ? 160 ARG A CZ    1 
ATOM   1293 N  NH1   . ARG A 1 160 ? -12.684 36.366  37.111 1.00 50.88  ? 160 ARG A NH1   1 
ATOM   1294 N  NH2   . ARG A 1 160 ? -13.161 34.389  36.022 1.00 50.25  ? 160 ARG A NH2   1 
ATOM   1295 N  N     . LEU A 1 161 ? -11.520 39.101  30.717 1.00 45.36  ? 161 LEU A N     1 
ATOM   1296 C  CA    . LEU A 1 161 ? -10.423 40.068  30.659 1.00 43.06  ? 161 LEU A CA    1 
ATOM   1297 C  C     . LEU A 1 161 ? -10.326 40.836  29.366 1.00 41.27  ? 161 LEU A C     1 
ATOM   1298 O  O     . LEU A 1 161 ? -9.972  42.009  29.358 1.00 40.46  ? 161 LEU A O     1 
ATOM   1299 C  CB    . LEU A 1 161 ? -9.072  39.368  30.904 1.00 45.41  ? 161 LEU A CB    1 
ATOM   1300 C  CG    . LEU A 1 161 ? -8.745  38.768  32.280 1.00 47.04  ? 161 LEU A CG    1 
ATOM   1301 C  CD1   . LEU A 1 161 ? -7.488  37.889  32.176 1.00 46.88  ? 161 LEU A CD1   1 
ATOM   1302 C  CD2   . LEU A 1 161 ? -8.540  39.900  33.294 1.00 46.19  ? 161 LEU A CD2   1 
ATOM   1303 N  N     . PHE A 1 162 ? -10.642 40.181  28.261 1.00 40.50  ? 162 PHE A N     1 
ATOM   1304 C  CA    . PHE A 1 162 ? -10.492 40.846  26.982 1.00 39.02  ? 162 PHE A CA    1 
ATOM   1305 C  C     . PHE A 1 162 ? -11.763 41.057  26.194 1.00 38.12  ? 162 PHE A C     1 
ATOM   1306 O  O     . PHE A 1 162 ? -12.430 40.109  25.776 1.00 39.26  ? 162 PHE A O     1 
ATOM   1307 C  CB    . PHE A 1 162 ? -9.469  40.087  26.125 1.00 34.99  ? 162 PHE A CB    1 
ATOM   1308 C  CG    . PHE A 1 162 ? -8.180  39.811  26.838 1.00 32.49  ? 162 PHE A CG    1 
ATOM   1309 C  CD1   . PHE A 1 162 ? -7.915  38.543  27.355 1.00 32.90  ? 162 PHE A CD1   1 
ATOM   1310 C  CD2   . PHE A 1 162 ? -7.239  40.819  27.005 1.00 32.25  ? 162 PHE A CD2   1 
ATOM   1311 C  CE1   . PHE A 1 162 ? -6.737  38.281  28.026 1.00 33.64  ? 162 PHE A CE1   1 
ATOM   1312 C  CE2   . PHE A 1 162 ? -6.056  40.580  27.673 1.00 32.33  ? 162 PHE A CE2   1 
ATOM   1313 C  CZ    . PHE A 1 162 ? -5.797  39.305  28.190 1.00 34.57  ? 162 PHE A CZ    1 
ATOM   1314 N  N     . ARG A 1 163 ? -12.073 42.327  25.981 1.00 38.49  ? 163 ARG A N     1 
ATOM   1315 C  CA    . ARG A 1 163 ? -13.251 42.709  25.234 1.00 39.93  ? 163 ARG A CA    1 
ATOM   1316 C  C     . ARG A 1 163 ? -12.697 43.562  24.115 1.00 38.87  ? 163 ARG A C     1 
ATOM   1317 O  O     . ARG A 1 163 ? -12.037 44.559  24.354 1.00 39.68  ? 163 ARG A O     1 
ATOM   1318 C  CB    . ARG A 1 163 ? -14.210 43.512  26.125 1.00 41.02  ? 163 ARG A CB    1 
ATOM   1319 C  CG    . ARG A 1 163 ? -15.470 43.971  25.410 0.00 40.99  ? 163 ARG A CG    1 
ATOM   1320 C  CD    . ARG A 1 163 ? -16.364 44.786  26.327 0.00 41.50  ? 163 ARG A CD    1 
ATOM   1321 N  NE    . ARG A 1 163 ? -17.578 45.227  25.648 0.00 41.88  ? 163 ARG A NE    1 
ATOM   1322 C  CZ    . ARG A 1 163 ? -18.526 45.964  26.217 0.00 42.12  ? 163 ARG A CZ    1 
ATOM   1323 N  NH1   . ARG A 1 163 ? -19.598 46.320  25.522 0.00 42.25  ? 163 ARG A NH1   1 
ATOM   1324 N  NH2   . ARG A 1 163 ? -18.403 46.346  27.480 0.00 42.25  ? 163 ARG A NH2   1 
ATOM   1325 N  N     . PRO A 1 164 ? -12.947 43.165  22.876 1.00 39.22  ? 164 PRO A N     1 
ATOM   1326 C  CA    . PRO A 1 164 ? -12.440 43.918  21.734 1.00 43.10  ? 164 PRO A CA    1 
ATOM   1327 C  C     . PRO A 1 164 ? -13.082 45.277  21.534 1.00 45.80  ? 164 PRO A C     1 
ATOM   1328 O  O     . PRO A 1 164 ? -14.229 45.480  21.915 1.00 47.18  ? 164 PRO A O     1 
ATOM   1329 C  CB    . PRO A 1 164 ? -12.724 42.982  20.562 1.00 43.06  ? 164 PRO A CB    1 
ATOM   1330 C  CG    . PRO A 1 164 ? -14.030 42.342  20.979 1.00 42.43  ? 164 PRO A CG    1 
ATOM   1331 C  CD    . PRO A 1 164 ? -13.771 42.025  22.443 1.00 39.54  ? 164 PRO A CD    1 
ATOM   1332 N  N     . THR A 1 165 ? -12.322 46.210  20.974 1.00 47.25  ? 165 THR A N     1 
ATOM   1333 C  CA    . THR A 1 165 ? -12.857 47.515  20.644 1.00 49.40  ? 165 THR A CA    1 
ATOM   1334 C  C     . THR A 1 165 ? -13.256 47.286  19.183 1.00 51.76  ? 165 THR A C     1 
ATOM   1335 O  O     . THR A 1 165 ? -13.148 46.166  18.677 1.00 53.14  ? 165 THR A O     1 
ATOM   1336 C  CB    . THR A 1 165 ? -11.783 48.602  20.673 1.00 50.07  ? 165 THR A CB    1 
ATOM   1337 O  OG1   . THR A 1 165 ? -10.831 48.354  19.630 1.00 49.71  ? 165 THR A OG1   1 
ATOM   1338 C  CG2   . THR A 1 165 ? -11.071 48.625  22.019 1.00 50.51  ? 165 THR A CG2   1 
ATOM   1339 N  N     . ASP A 1 166 ? -13.701 48.328  18.501 1.00 53.42  ? 166 ASP A N     1 
ATOM   1340 C  CA    . ASP A 1 166 ? -14.088 48.193  17.097 1.00 55.77  ? 166 ASP A CA    1 
ATOM   1341 C  C     . ASP A 1 166 ? -12.909 47.724  16.252 1.00 54.73  ? 166 ASP A C     1 
ATOM   1342 O  O     . ASP A 1 166 ? -13.093 47.071  15.221 1.00 55.11  ? 166 ASP A O     1 
ATOM   1343 C  CB    . ASP A 1 166 ? -14.576 49.546  16.551 1.00 59.86  ? 166 ASP A CB    1 
ATOM   1344 C  CG    . ASP A 1 166 ? -16.084 49.707  16.634 1.00 65.09  ? 166 ASP A CG    1 
ATOM   1345 O  OD1   . ASP A 1 166 ? -16.695 49.206  17.611 1.00 67.57  ? 166 ASP A OD1   1 
ATOM   1346 O  OD2   . ASP A 1 166 ? -16.657 50.347  15.720 1.00 67.73  ? 166 ASP A OD2   1 
ATOM   1347 N  N     . ASN A 1 167 ? -11.702 48.058  16.708 1.00 52.25  ? 167 ASN A N     1 
ATOM   1348 C  CA    . ASN A 1 167 ? -10.469 47.740  15.988 1.00 50.19  ? 167 ASN A CA    1 
ATOM   1349 C  C     . ASN A 1 167 ? -9.376  47.118  16.889 1.00 47.52  ? 167 ASN A C     1 
ATOM   1350 O  O     . ASN A 1 167 ? -8.478  47.811  17.357 1.00 45.84  ? 167 ASN A O     1 
ATOM   1351 C  CB    . ASN A 1 167 ? -9.955  49.037  15.358 1.00 48.39  ? 167 ASN A CB    1 
ATOM   1352 C  CG    . ASN A 1 167 ? -8.943  48.799  14.280 1.00 48.88  ? 167 ASN A CG    1 
ATOM   1353 O  OD1   . ASN A 1 167 ? -8.310  49.731  13.795 1.00 52.60  ? 167 ASN A OD1   1 
ATOM   1354 N  ND2   . ASN A 1 167 ? -8.782  47.551  13.888 1.00 50.15  ? 167 ASN A ND2   1 
ATOM   1355 N  N     . ALA A 1 168 ? -9.422  45.813  17.115 1.00 45.51  ? 168 ALA A N     1 
ATOM   1356 C  CA    . ALA A 1 168 ? -8.419  45.223  17.992 1.00 44.17  ? 168 ALA A CA    1 
ATOM   1357 C  C     . ALA A 1 168 ? -7.867  43.852  17.606 1.00 42.38  ? 168 ALA A C     1 
ATOM   1358 O  O     . ALA A 1 168 ? -8.494  43.092  16.860 1.00 41.86  ? 168 ALA A O     1 
ATOM   1359 C  CB    . ALA A 1 168 ? -8.967  45.170  19.410 1.00 43.27  ? 168 ALA A CB    1 
ATOM   1360 N  N     . ILE A 1 169 ? -6.689  43.556  18.157 1.00 41.92  ? 169 ILE A N     1 
ATOM   1361 C  CA    . ILE A 1 169 ? -5.952  42.295  17.951 1.00 39.95  ? 169 ILE A CA    1 
ATOM   1362 C  C     . ILE A 1 169 ? -5.790  41.603  19.304 1.00 37.42  ? 169 ILE A C     1 
ATOM   1363 O  O     . ILE A 1 169 ? -5.500  42.257  20.289 1.00 35.47  ? 169 ILE A O     1 
ATOM   1364 C  CB    . ILE A 1 169 ? -4.483  42.548  17.478 1.00 41.90  ? 169 ILE A CB    1 
ATOM   1365 C  CG1   . ILE A 1 169 ? -4.429  43.103  16.068 1.00 43.23  ? 169 ILE A CG1   1 
ATOM   1366 C  CG2   . ILE A 1 169 ? -3.670  41.245  17.545 1.00 43.14  ? 169 ILE A CG2   1 
ATOM   1367 C  CD1   . ILE A 1 169 ? -2.972  43.189  15.559 1.00 43.01  ? 169 ILE A CD1   1 
ATOM   1368 N  N     . LEU A 1 170 ? -5.971  40.289  19.361 1.00 36.16  ? 170 LEU A N     1 
ATOM   1369 C  CA    . LEU A 1 170 ? -5.732  39.573  20.605 1.00 33.84  ? 170 LEU A CA    1 
ATOM   1370 C  C     . LEU A 1 170 ? -4.457  38.688  20.399 1.00 34.42  ? 170 LEU A C     1 
ATOM   1371 O  O     . LEU A 1 170 ? -4.374  37.943  19.412 1.00 35.15  ? 170 LEU A O     1 
ATOM   1372 C  CB    . LEU A 1 170 ? -6.928  38.709  20.963 1.00 33.05  ? 170 LEU A CB    1 
ATOM   1373 C  CG    . LEU A 1 170 ? -6.702  37.922  22.253 1.00 32.29  ? 170 LEU A CG    1 
ATOM   1374 C  CD1   . LEU A 1 170 ? -6.514  38.869  23.411 1.00 33.00  ? 170 LEU A CD1   1 
ATOM   1375 C  CD2   . LEU A 1 170 ? -7.861  36.999  22.513 1.00 32.21  ? 170 LEU A CD2   1 
ATOM   1376 N  N     . MET A 1 171 ? -3.477  38.805  21.308 1.00 32.36  ? 171 MET A N     1 
ATOM   1377 C  CA    . MET A 1 171 ? -2.208  38.049  21.267 1.00 29.51  ? 171 MET A CA    1 
ATOM   1378 C  C     . MET A 1 171 ? -2.045  37.184  22.531 1.00 32.12  ? 171 MET A C     1 
ATOM   1379 O  O     . MET A 1 171 ? -2.052  37.692  23.663 1.00 33.97  ? 171 MET A O     1 
ATOM   1380 C  CB    . MET A 1 171 ? -1.005  39.008  21.118 1.00 27.72  ? 171 MET A CB    1 
ATOM   1381 C  CG    . MET A 1 171 ? 0.407   38.303  20.986 1.00 23.67  ? 171 MET A CG    1 
ATOM   1382 S  SD    . MET A 1 171 ? 1.807   39.336  20.405 1.00 19.32  ? 171 MET A SD    1 
ATOM   1383 C  CE    . MET A 1 171 ? 1.586   40.832  21.434 1.00 22.89  ? 171 MET A CE    1 
ATOM   1384 N  N     . LEU A 1 172 ? -1.927  35.876  22.331 1.00 29.50  ? 172 LEU A N     1 
ATOM   1385 C  CA    . LEU A 1 172 ? -1.760  34.920  23.417 1.00 30.86  ? 172 LEU A CA    1 
ATOM   1386 C  C     . LEU A 1 172 ? -0.700  33.877  23.030 1.00 31.64  ? 172 LEU A C     1 
ATOM   1387 O  O     . LEU A 1 172 ? -0.474  33.625  21.853 1.00 33.13  ? 172 LEU A O     1 
ATOM   1388 C  CB    . LEU A 1 172 ? -3.079  34.172  23.683 1.00 32.40  ? 172 LEU A CB    1 
ATOM   1389 C  CG    . LEU A 1 172 ? -4.344  34.955  24.082 1.00 34.42  ? 172 LEU A CG    1 
ATOM   1390 C  CD1   . LEU A 1 172 ? -5.528  34.015  24.069 1.00 35.89  ? 172 LEU A CD1   1 
ATOM   1391 C  CD2   . LEU A 1 172 ? -4.172  35.561  25.472 1.00 31.00  ? 172 LEU A CD2   1 
ATOM   1392 N  N     . HIS A 1 173 ? -0.055  33.286  24.028 1.00 33.21  ? 173 HIS A N     1 
ATOM   1393 C  CA    . HIS A 1 173 ? 0.931   32.230  23.821 1.00 33.47  ? 173 HIS A CA    1 
ATOM   1394 C  C     . HIS A 1 173 ? 0.289   31.040  24.522 1.00 34.11  ? 173 HIS A C     1 
ATOM   1395 O  O     . HIS A 1 173 ? 0.487   30.804  25.718 1.00 31.17  ? 173 HIS A O     1 
ATOM   1396 C  CB    . HIS A 1 173 ? 2.260   32.555  24.499 1.00 33.20  ? 173 HIS A CB    1 
ATOM   1397 C  CG    . HIS A 1 173 ? 3.337   31.556  24.200 1.00 32.23  ? 173 HIS A CG    1 
ATOM   1398 N  ND1   . HIS A 1 173 ? 4.092   31.596  23.046 1.00 29.74  ? 173 HIS A ND1   1 
ATOM   1399 C  CD2   . HIS A 1 173 ? 3.759   30.469  24.888 1.00 28.39  ? 173 HIS A CD2   1 
ATOM   1400 C  CE1   . HIS A 1 173 ? 4.935   30.581  23.040 1.00 30.40  ? 173 HIS A CE1   1 
ATOM   1401 N  NE2   . HIS A 1 173 ? 4.753   29.883  24.148 1.00 31.32  ? 173 HIS A NE2   1 
ATOM   1402 N  N     . GLN A 1 174 ? -0.479  30.283  23.759 1.00 34.56  ? 174 GLN A N     1 
ATOM   1403 C  CA    . GLN A 1 174 ? -1.202  29.171  24.328 1.00 37.19  ? 174 GLN A CA    1 
ATOM   1404 C  C     . GLN A 1 174 ? -1.439  28.139  23.226 1.00 39.45  ? 174 GLN A C     1 
ATOM   1405 O  O     . GLN A 1 174 ? -1.487  28.494  22.028 1.00 40.07  ? 174 GLN A O     1 
ATOM   1406 C  CB    . GLN A 1 174 ? -2.545  29.715  24.826 1.00 37.01  ? 174 GLN A CB    1 
ATOM   1407 C  CG    . GLN A 1 174 ? -2.976  29.352  26.198 1.00 38.73  ? 174 GLN A CG    1 
ATOM   1408 C  CD    . GLN A 1 174 ? -2.072  29.830  27.313 1.00 35.69  ? 174 GLN A CD    1 
ATOM   1409 O  OE1   . GLN A 1 174 ? -1.914  31.027  27.572 1.00 35.70  ? 174 GLN A OE1   1 
ATOM   1410 N  NE2   . GLN A 1 174 ? -1.501  28.876  28.008 1.00 35.73  ? 174 GLN A NE2   1 
ATOM   1411 N  N     . GLY A 1 175 ? -1.572  26.875  23.617 1.00 38.95  ? 175 GLY A N     1 
ATOM   1412 C  CA    . GLY A 1 175 ? -1.864  25.844  22.636 1.00 42.22  ? 175 GLY A CA    1 
ATOM   1413 C  C     . GLY A 1 175 ? -3.385  25.732  22.571 1.00 42.53  ? 175 GLY A C     1 
ATOM   1414 O  O     . GLY A 1 175 ? -4.034  25.619  23.605 1.00 41.64  ? 175 GLY A O     1 
ATOM   1415 N  N     . VAL A 1 176 ? -3.956  25.802  21.374 1.00 43.95  ? 176 VAL A N     1 
ATOM   1416 C  CA    . VAL A 1 176 ? -5.400  25.708  21.208 1.00 45.28  ? 176 VAL A CA    1 
ATOM   1417 C  C     . VAL A 1 176 ? -5.816  24.298  20.808 1.00 48.44  ? 176 VAL A C     1 
ATOM   1418 O  O     . VAL A 1 176 ? -5.305  23.735  19.837 1.00 47.99  ? 176 VAL A O     1 
ATOM   1419 C  CB    . VAL A 1 176 ? -5.890  26.704  20.158 1.00 45.53  ? 176 VAL A CB    1 
ATOM   1420 C  CG1   . VAL A 1 176 ? -7.378  26.481  19.853 1.00 43.96  ? 176 VAL A CG1   1 
ATOM   1421 C  CG2   . VAL A 1 176 ? -5.650  28.114  20.666 1.00 44.22  ? 176 VAL A CG2   1 
ATOM   1422 N  N     . ARG A 1 177 ? -6.755  23.739  21.565 1.00 51.72  ? 177 ARG A N     1 
ATOM   1423 C  CA    . ARG A 1 177 ? -7.245  22.373  21.349 1.00 55.59  ? 177 ARG A CA    1 
ATOM   1424 C  C     . ARG A 1 177 ? -7.477  21.932  19.906 1.00 56.08  ? 177 ARG A C     1 
ATOM   1425 O  O     . ARG A 1 177 ? -6.868  20.960  19.453 1.00 56.13  ? 177 ARG A O     1 
ATOM   1426 C  CB    . ARG A 1 177 ? -8.521  22.149  22.156 1.00 58.75  ? 177 ARG A CB    1 
ATOM   1427 C  CG    . ARG A 1 177 ? -8.985  20.717  22.169 1.00 63.53  ? 177 ARG A CG    1 
ATOM   1428 C  CD    . ARG A 1 177 ? -9.977  20.480  23.294 1.00 68.44  ? 177 ARG A CD    1 
ATOM   1429 N  NE    . ARG A 1 177 ? -10.197 19.051  23.483 1.00 73.93  ? 177 ARG A NE    1 
ATOM   1430 C  CZ    . ARG A 1 177 ? -10.688 18.500  24.589 1.00 75.58  ? 177 ARG A CZ    1 
ATOM   1431 N  NH1   . ARG A 1 177 ? -10.845 17.180  24.651 1.00 76.86  ? 177 ARG A NH1   1 
ATOM   1432 N  NH2   . ARG A 1 177 ? -11.011 19.261  25.632 1.00 75.81  ? 177 ARG A NH2   1 
ATOM   1433 N  N     . GLU A 1 178 ? -8.343  22.627  19.177 1.00 56.55  ? 178 GLU A N     1 
ATOM   1434 C  CA    . GLU A 1 178 ? -8.592  22.226  17.799 1.00 58.55  ? 178 GLU A CA    1 
ATOM   1435 C  C     . GLU A 1 178 ? -7.347  22.197  16.929 1.00 59.82  ? 178 GLU A C     1 
ATOM   1436 O  O     . GLU A 1 178 ? -7.287  21.420  15.970 1.00 60.64  ? 178 GLU A O     1 
ATOM   1437 C  CB    . GLU A 1 178 ? -9.639  23.119  17.130 1.00 60.10  ? 178 GLU A CB    1 
ATOM   1438 C  CG    . GLU A 1 178 ? -9.826  24.482  17.752 1.00 62.85  ? 178 GLU A CG    1 
ATOM   1439 C  CD    . GLU A 1 178 ? -10.706 24.444  18.988 1.00 62.31  ? 178 GLU A CD    1 
ATOM   1440 O  OE1   . GLU A 1 178 ? -11.904 24.104  18.873 1.00 61.21  ? 178 GLU A OE1   1 
ATOM   1441 O  OE2   . GLU A 1 178 ? -10.189 24.757  20.076 1.00 63.36  ? 178 GLU A OE2   1 
ATOM   1442 N  N     . VAL A 1 179 ? -6.350  23.025  17.238 1.00 59.34  ? 179 VAL A N     1 
ATOM   1443 C  CA    . VAL A 1 179 ? -5.158  23.019  16.408 1.00 59.24  ? 179 VAL A CA    1 
ATOM   1444 C  C     . VAL A 1 179 ? -4.237  21.856  16.721 1.00 60.46  ? 179 VAL A C     1 
ATOM   1445 O  O     . VAL A 1 179 ? -3.761  21.195  15.803 1.00 59.48  ? 179 VAL A O     1 
ATOM   1446 C  CB    . VAL A 1 179 ? -4.369  24.350  16.490 1.00 58.52  ? 179 VAL A CB    1 
ATOM   1447 C  CG1   . VAL A 1 179 ? -3.041  24.219  15.745 1.00 56.66  ? 179 VAL A CG1   1 
ATOM   1448 C  CG2   . VAL A 1 179 ? -5.187  25.475  15.861 1.00 56.51  ? 179 VAL A CG2   1 
ATOM   1449 N  N     . SER A 1 180 ? -3.985  21.577  17.996 1.00 61.93  ? 180 SER A N     1 
ATOM   1450 C  CA    . SER A 1 180 ? -3.101  20.459  18.304 1.00 63.97  ? 180 SER A CA    1 
ATOM   1451 C  C     . SER A 1 180 ? -3.792  19.156  17.926 1.00 64.54  ? 180 SER A C     1 
ATOM   1452 O  O     . SER A 1 180 ? -3.143  18.203  17.493 1.00 64.63  ? 180 SER A O     1 
ATOM   1453 C  CB    . SER A 1 180 ? -2.709  20.447  19.783 1.00 64.70  ? 180 SER A CB    1 
ATOM   1454 O  OG    . SER A 1 180 ? -3.801  20.108  20.601 1.00 67.23  ? 180 SER A OG    1 
ATOM   1455 N  N     . GLU A 1 181 ? -5.114  19.130  18.071 1.00 65.49  ? 181 GLU A N     1 
ATOM   1456 C  CA    . GLU A 1 181 ? -5.906  17.948  17.731 1.00 66.28  ? 181 GLU A CA    1 
ATOM   1457 C  C     . GLU A 1 181 ? -5.823  17.680  16.223 1.00 66.18  ? 181 GLU A C     1 
ATOM   1458 O  O     . GLU A 1 181 ? -5.807  16.527  15.787 1.00 66.16  ? 181 GLU A O     1 
ATOM   1459 C  CB    . GLU A 1 181 ? -7.367  18.150  18.166 1.00 67.03  ? 181 GLU A CB    1 
ATOM   1460 C  CG    . GLU A 1 181 ? -7.897  17.061  19.116 1.00 68.37  ? 181 GLU A CG    1 
ATOM   1461 C  CD    . GLU A 1 181 ? -9.059  17.532  19.997 1.00 68.73  ? 181 GLU A CD    1 
ATOM   1462 O  OE1   . GLU A 1 181 ? -9.997  18.163  19.465 1.00 69.29  ? 181 GLU A OE1   1 
ATOM   1463 O  OE2   . GLU A 1 181 ? -9.034  17.265  21.222 1.00 68.28  ? 181 GLU A OE2   1 
ATOM   1464 N  N     . ALA A 1 182 ? -5.748  18.743  15.429 1.00 65.55  ? 182 ALA A N     1 
ATOM   1465 C  CA    . ALA A 1 182 ? -5.650  18.589  13.986 1.00 66.32  ? 182 ALA A CA    1 
ATOM   1466 C  C     . ALA A 1 182 ? -4.308  17.980  13.600 1.00 67.33  ? 182 ALA A C     1 
ATOM   1467 O  O     . ALA A 1 182 ? -4.004  17.841  12.410 1.00 68.33  ? 182 ALA A O     1 
ATOM   1468 C  CB    . ALA A 1 182 ? -5.822  19.934  13.296 1.00 66.10  ? 182 ALA A CB    1 
ATOM   1469 N  N     . ARG A 1 183 ? -3.510  17.616  14.602 1.00 67.70  ? 183 ARG A N     1 
ATOM   1470 C  CA    . ARG A 1 183 ? -2.193  17.026  14.360 1.00 67.48  ? 183 ARG A CA    1 
ATOM   1471 C  C     . ARG A 1 183 ? -1.842  15.877  15.302 1.00 69.10  ? 183 ARG A C     1 
ATOM   1472 O  O     . ARG A 1 183 ? -0.675  15.681  15.635 1.00 70.18  ? 183 ARG A O     1 
ATOM   1473 C  CB    . ARG A 1 183 ? -1.123  18.112  14.458 1.00 64.37  ? 183 ARG A CB    1 
ATOM   1474 C  CG    . ARG A 1 183 ? -1.146  19.079  13.298 1.00 61.73  ? 183 ARG A CG    1 
ATOM   1475 C  CD    . ARG A 1 183 ? -0.374  20.331  13.628 1.00 59.00  ? 183 ARG A CD    1 
ATOM   1476 N  NE    . ARG A 1 183 ? -0.029  21.091  12.431 1.00 54.84  ? 183 ARG A NE    1 
ATOM   1477 C  CZ    . ARG A 1 183 ? 0.539   22.290  12.450 1.00 51.24  ? 183 ARG A CZ    1 
ATOM   1478 N  NH1   . ARG A 1 183 ? 0.829   22.910  11.317 1.00 49.61  ? 183 ARG A NH1   1 
ATOM   1479 N  NH2   . ARG A 1 183 ? 0.805   22.871  13.607 1.00 50.12  ? 183 ARG A NH2   1 
ATOM   1480 N  N     . GLY A 1 184 ? -2.850  15.121  15.727 1.00 70.87  ? 184 GLY A N     1 
ATOM   1481 C  CA    . GLY A 1 184 ? -2.620  13.997  16.620 1.00 71.57  ? 184 GLY A CA    1 
ATOM   1482 C  C     . GLY A 1 184 ? -2.017  14.381  17.960 1.00 72.46  ? 184 GLY A C     1 
ATOM   1483 O  O     . GLY A 1 184 ? -1.602  13.518  18.734 1.00 72.67  ? 184 GLY A O     1 
ATOM   1484 N  N     . GLU A 1 185 ? -1.961  15.677  18.235 1.00 73.14  ? 185 GLU A N     1 
ATOM   1485 C  CA    . GLU A 1 185 ? -1.407  16.167  19.491 1.00 73.98  ? 185 GLU A CA    1 
ATOM   1486 C  C     . GLU A 1 185 ? -2.532  16.273  20.522 1.00 73.75  ? 185 GLU A C     1 
ATOM   1487 O  O     . GLU A 1 185 ? -3.709  16.335  20.160 1.00 72.95  ? 185 GLU A O     1 
ATOM   1488 C  CB    . GLU A 1 185 ? -0.777  17.546  19.285 1.00 75.60  ? 185 GLU A CB    1 
ATOM   1489 C  CG    . GLU A 1 185 ? 0.175   17.649  18.104 1.00 77.88  ? 185 GLU A CG    1 
ATOM   1490 C  CD    . GLU A 1 185 ? 1.468   16.891  18.317 1.00 78.93  ? 185 GLU A CD    1 
ATOM   1491 O  OE1   . GLU A 1 185 ? 1.429   15.647  18.392 1.00 79.97  ? 185 GLU A OE1   1 
ATOM   1492 O  OE2   . GLU A 1 185 ? 2.526   17.546  18.412 1.00 80.48  ? 185 GLU A OE2   1 
ATOM   1493 N  N     . ASP A 1 186 ? -2.165  16.316  21.800 1.00 73.73  ? 186 ASP A N     1 
ATOM   1494 C  CA    . ASP A 1 186 ? -3.148  16.413  22.876 1.00 74.11  ? 186 ASP A CA    1 
ATOM   1495 C  C     . ASP A 1 186 ? -2.808  17.537  23.854 1.00 73.29  ? 186 ASP A C     1 
ATOM   1496 O  O     . ASP A 1 186 ? -3.400  17.636  24.932 1.00 73.85  ? 186 ASP A O     1 
ATOM   1497 C  CB    . ASP A 1 186 ? -3.206  15.095  23.640 1.00 76.44  ? 186 ASP A CB    1 
ATOM   1498 C  CG    . ASP A 1 186 ? -1.876  14.745  24.277 1.00 79.36  ? 186 ASP A CG    1 
ATOM   1499 O  OD1   . ASP A 1 186 ? -0.892  14.566  23.525 1.00 81.02  ? 186 ASP A OD1   1 
ATOM   1500 O  OD2   . ASP A 1 186 ? -1.809  14.658  25.526 1.00 81.13  ? 186 ASP A OD2   1 
ATOM   1501 N  N     . TYR A 1 187 ? -1.852  18.379  23.479 1.00 71.38  ? 187 TYR A N     1 
ATOM   1502 C  CA    . TYR A 1 187 ? -1.431  19.483  24.335 1.00 69.27  ? 187 TYR A CA    1 
ATOM   1503 C  C     . TYR A 1 187 ? -2.132  20.806  24.004 1.00 65.93  ? 187 TYR A C     1 
ATOM   1504 O  O     . TYR A 1 187 ? -2.143  21.247  22.855 1.00 66.21  ? 187 TYR A O     1 
ATOM   1505 C  CB    . TYR A 1 187 ? 0.094   19.655  24.243 1.00 71.54  ? 187 TYR A CB    1 
ATOM   1506 C  CG    . TYR A 1 187 ? 0.630   19.924  22.842 1.00 74.28  ? 187 TYR A CG    1 
ATOM   1507 C  CD1   . TYR A 1 187 ? 0.453   21.168  22.226 1.00 76.08  ? 187 TYR A CD1   1 
ATOM   1508 C  CD2   . TYR A 1 187 ? 1.322   18.937  22.135 1.00 75.24  ? 187 TYR A CD2   1 
ATOM   1509 C  CE1   . TYR A 1 187 ? 0.949   21.423  20.942 1.00 76.72  ? 187 TYR A CE1   1 
ATOM   1510 C  CE2   . TYR A 1 187 ? 1.827   19.184  20.854 1.00 76.38  ? 187 TYR A CE2   1 
ATOM   1511 C  CZ    . TYR A 1 187 ? 1.636   20.431  20.265 1.00 77.04  ? 187 TYR A CZ    1 
ATOM   1512 O  OH    . TYR A 1 187 ? 2.147   20.699  19.012 1.00 77.51  ? 187 TYR A OH    1 
ATOM   1513 N  N     . PHE A 1 188 ? -2.726  21.432  25.014 1.00 61.36  ? 188 PHE A N     1 
ATOM   1514 C  CA    . PHE A 1 188 ? -3.404  22.708  24.820 1.00 55.93  ? 188 PHE A CA    1 
ATOM   1515 C  C     . PHE A 1 188 ? -3.901  23.148  26.168 1.00 51.76  ? 188 PHE A C     1 
ATOM   1516 O  O     . PHE A 1 188 ? -4.036  22.326  27.063 1.00 49.88  ? 188 PHE A O     1 
ATOM   1517 C  CB    . PHE A 1 188 ? -4.567  22.547  23.841 1.00 58.11  ? 188 PHE A CB    1 
ATOM   1518 C  CG    . PHE A 1 188 ? -5.551  21.483  24.243 1.00 61.15  ? 188 PHE A CG    1 
ATOM   1519 C  CD1   . PHE A 1 188 ? -6.527  21.744  25.198 1.00 61.40  ? 188 PHE A CD1   1 
ATOM   1520 C  CD2   . PHE A 1 188 ? -5.465  20.201  23.704 1.00 62.26  ? 188 PHE A CD2   1 
ATOM   1521 C  CE1   . PHE A 1 188 ? -7.403  20.746  25.619 1.00 62.69  ? 188 PHE A CE1   1 
ATOM   1522 C  CE2   . PHE A 1 188 ? -6.333  19.199  24.117 1.00 63.15  ? 188 PHE A CE2   1 
ATOM   1523 C  CZ    . PHE A 1 188 ? -7.306  19.474  25.080 1.00 63.61  ? 188 PHE A CZ    1 
ATOM   1524 N  N     . GLU A 1 189 ? -4.138  24.444  26.330 1.00 48.19  ? 189 GLU A N     1 
ATOM   1525 C  CA    . GLU A 1 189 ? -4.647  24.953  27.596 1.00 46.76  ? 189 GLU A CA    1 
ATOM   1526 C  C     . GLU A 1 189 ? -6.047  25.524  27.409 1.00 46.53  ? 189 GLU A C     1 
ATOM   1527 O  O     . GLU A 1 189 ? -6.785  25.700  28.383 1.00 47.70  ? 189 GLU A O     1 
ATOM   1528 C  CB    . GLU A 1 189 ? -3.734  26.041  28.186 1.00 46.22  ? 189 GLU A CB    1 
ATOM   1529 C  CG    . GLU A 1 189 ? -2.289  25.603  28.452 1.00 46.03  ? 189 GLU A CG    1 
ATOM   1530 C  CD    . GLU A 1 189 ? -1.510  25.455  27.169 1.00 47.26  ? 189 GLU A CD    1 
ATOM   1531 O  OE1   . GLU A 1 189 ? -1.533  26.419  26.374 1.00 47.65  ? 189 GLU A OE1   1 
ATOM   1532 O  OE2   . GLU A 1 189 ? -0.888  24.387  26.948 1.00 48.76  ? 189 GLU A OE2   1 
ATOM   1533 N  N     . ILE A 1 190 ? -6.405  25.819  26.159 1.00 45.09  ? 190 ILE A N     1 
ATOM   1534 C  CA    . ILE A 1 190 ? -7.717  26.373  25.844 1.00 43.57  ? 190 ILE A CA    1 
ATOM   1535 C  C     . ILE A 1 190 ? -8.223  25.805  24.532 1.00 43.79  ? 190 ILE A C     1 
ATOM   1536 O  O     . ILE A 1 190 ? -7.511  25.055  23.854 1.00 45.51  ? 190 ILE A O     1 
ATOM   1537 C  CB    . ILE A 1 190 ? -7.677  27.908  25.654 1.00 42.58  ? 190 ILE A CB    1 
ATOM   1538 C  CG1   . ILE A 1 190 ? -6.708  28.248  24.515 1.00 42.10  ? 190 ILE A CG1   1 
ATOM   1539 C  CG2   . ILE A 1 190 ? -7.316  28.607  26.963 1.00 41.51  ? 190 ILE A CG2   1 
ATOM   1540 C  CD1   . ILE A 1 190 ? -6.757  29.711  24.072 1.00 42.24  ? 190 ILE A CD1   1 
ATOM   1541 N  N     . GLY A 1 191 ? -9.451  26.194  24.188 1.00 42.70  ? 191 GLY A N     1 
ATOM   1542 C  CA    . GLY A 1 191 ? -10.094 25.802  22.947 1.00 40.79  ? 191 GLY A CA    1 
ATOM   1543 C  C     . GLY A 1 191 ? -10.469 27.113  22.267 1.00 41.04  ? 191 GLY A C     1 
ATOM   1544 O  O     . GLY A 1 191 ? -10.444 28.163  22.912 1.00 39.32  ? 191 GLY A O     1 
ATOM   1545 N  N     . LEU A 1 192 ? -10.783 27.070  20.973 1.00 43.13  ? 192 LEU A N     1 
ATOM   1546 C  CA    . LEU A 1 192 ? -11.157 28.273  20.229 1.00 45.77  ? 192 LEU A CA    1 
ATOM   1547 C  C     . LEU A 1 192 ? -12.356 28.989  20.856 1.00 46.61  ? 192 LEU A C     1 
ATOM   1548 O  O     . LEU A 1 192 ? -12.460 30.214  20.793 1.00 46.30  ? 192 LEU A O     1 
ATOM   1549 C  CB    . LEU A 1 192 ? -11.480 27.924  18.770 1.00 45.87  ? 192 LEU A CB    1 
ATOM   1550 C  CG    . LEU A 1 192 ? -10.324 27.705  17.786 1.00 47.80  ? 192 LEU A CG    1 
ATOM   1551 C  CD1   . LEU A 1 192 ? -10.866 27.228  16.436 1.00 47.05  ? 192 LEU A CD1   1 
ATOM   1552 C  CD2   . LEU A 1 192 ? -9.554  28.997  17.596 1.00 45.78  ? 192 LEU A CD2   1 
ATOM   1553 N  N     . GLY A 1 193 ? -13.247 28.209  21.465 1.00 48.51  ? 193 GLY A N     1 
ATOM   1554 C  CA    . GLY A 1 193 ? -14.442 28.752  22.088 1.00 49.13  ? 193 GLY A CA    1 
ATOM   1555 C  C     . GLY A 1 193 ? -14.162 29.632  23.288 1.00 50.18  ? 193 GLY A C     1 
ATOM   1556 O  O     . GLY A 1 193 ? -14.986 30.467  23.672 1.00 49.99  ? 193 GLY A O     1 
ATOM   1557 N  N     . ASP A 1 194 ? -12.991 29.450  23.882 1.00 49.97  ? 194 ASP A N     1 
ATOM   1558 C  CA    . ASP A 1 194 ? -12.605 30.236  25.039 1.00 49.60  ? 194 ASP A CA    1 
ATOM   1559 C  C     . ASP A 1 194 ? -12.214 31.634  24.612 1.00 47.26  ? 194 ASP A C     1 
ATOM   1560 O  O     . ASP A 1 194 ? -12.248 32.563  25.407 1.00 47.86  ? 194 ASP A O     1 
ATOM   1561 C  CB    . ASP A 1 194 ? -11.434 29.564  25.756 1.00 52.59  ? 194 ASP A CB    1 
ATOM   1562 C  CG    . ASP A 1 194 ? -11.831 28.263  26.397 1.00 54.75  ? 194 ASP A CG    1 
ATOM   1563 O  OD1   . ASP A 1 194 ? -12.752 28.313  27.230 1.00 58.68  ? 194 ASP A OD1   1 
ATOM   1564 O  OD2   . ASP A 1 194 ? -11.243 27.204  26.085 1.00 54.97  ? 194 ASP A OD2   1 
ATOM   1565 N  N     . LEU A 1 195 ? -11.848 31.780  23.351 1.00 44.83  ? 195 LEU A N     1 
ATOM   1566 C  CA    . LEU A 1 195 ? -11.443 33.075  22.826 1.00 45.02  ? 195 LEU A CA    1 
ATOM   1567 C  C     . LEU A 1 195 ? -12.613 34.053  22.731 1.00 46.06  ? 195 LEU A C     1 
ATOM   1568 O  O     . LEU A 1 195 ? -13.709 33.681  22.330 1.00 45.99  ? 195 LEU A O     1 
ATOM   1569 C  CB    . LEU A 1 195 ? -10.850 32.903  21.429 1.00 43.99  ? 195 LEU A CB    1 
ATOM   1570 C  CG    . LEU A 1 195 ? -9.576  32.074  21.242 1.00 41.94  ? 195 LEU A CG    1 
ATOM   1571 C  CD1   . LEU A 1 195 ? -9.260  32.004  19.763 1.00 40.54  ? 195 LEU A CD1   1 
ATOM   1572 C  CD2   . LEU A 1 195 ? -8.414  32.720  21.997 1.00 41.30  ? 195 LEU A CD2   1 
ATOM   1573 N  N     . PRO A 1 196 ? -12.396 35.322  23.102 1.00 46.21  ? 196 PRO A N     1 
ATOM   1574 C  CA    . PRO A 1 196 ? -13.506 36.269  23.003 1.00 45.37  ? 196 PRO A CA    1 
ATOM   1575 C  C     . PRO A 1 196 ? -13.732 36.630  21.537 1.00 46.41  ? 196 PRO A C     1 
ATOM   1576 O  O     . PRO A 1 196 ? -12.783 36.806  20.772 1.00 44.70  ? 196 PRO A O     1 
ATOM   1577 C  CB    . PRO A 1 196 ? -13.017 37.455  23.819 1.00 45.62  ? 196 PRO A CB    1 
ATOM   1578 C  CG    . PRO A 1 196 ? -11.539 37.412  23.602 1.00 46.12  ? 196 PRO A CG    1 
ATOM   1579 C  CD    . PRO A 1 196 ? -11.241 35.940  23.773 1.00 46.07  ? 196 PRO A CD    1 
ATOM   1580 N  N     . GLU A 1 197 ? -14.991 36.752  21.143 1.00 47.35  ? 197 GLU A N     1 
ATOM   1581 C  CA    . GLU A 1 197 ? -15.295 37.087  19.763 1.00 48.19  ? 197 GLU A CA    1 
ATOM   1582 C  C     . GLU A 1 197 ? -15.109 38.572  19.535 1.00 45.71  ? 197 GLU A C     1 
ATOM   1583 O  O     . GLU A 1 197 ? -15.037 39.348  20.486 1.00 46.59  ? 197 GLU A O     1 
ATOM   1584 C  CB    . GLU A 1 197 ? -16.735 36.696  19.425 1.00 50.14  ? 197 GLU A CB    1 
ATOM   1585 C  CG    . GLU A 1 197 ? -17.095 35.287  19.805 1.00 54.65  ? 197 GLU A CG    1 
ATOM   1586 C  CD    . GLU A 1 197 ? -18.336 34.817  19.071 1.00 59.58  ? 197 GLU A CD    1 
ATOM   1587 O  OE1   . GLU A 1 197 ? -19.106 34.001  19.638 1.00 59.13  ? 197 GLU A OE1   1 
ATOM   1588 O  OE2   . GLU A 1 197 ? -18.528 35.271  17.914 1.00 60.96  ? 197 GLU A OE2   1 
ATOM   1589 N  N     . GLY A 1 198 ? -15.012 38.967  18.272 1.00 44.61  ? 198 GLY A N     1 
ATOM   1590 C  CA    . GLY A 1 198 ? -14.874 40.380  17.966 1.00 43.02  ? 198 GLY A CA    1 
ATOM   1591 C  C     . GLY A 1 198 ? -13.506 40.904  17.600 1.00 42.81  ? 198 GLY A C     1 
ATOM   1592 O  O     . GLY A 1 198 ? -13.377 42.042  17.123 1.00 41.06  ? 198 GLY A O     1 
ATOM   1593 N  N     . TYR A 1 199 ? -12.470 40.104  17.831 1.00 42.03  ? 199 TYR A N     1 
ATOM   1594 C  CA    . TYR A 1 199 ? -11.131 40.561  17.466 1.00 40.06  ? 199 TYR A CA    1 
ATOM   1595 C  C     . TYR A 1 199 ? -10.935 40.425  15.964 1.00 39.54  ? 199 TYR A C     1 
ATOM   1596 O  O     . TYR A 1 199 ? -11.487 39.522  15.333 1.00 41.24  ? 199 TYR A O     1 
ATOM   1597 C  CB    . TYR A 1 199 ? -10.069 39.776  18.246 1.00 38.48  ? 199 TYR A CB    1 
ATOM   1598 C  CG    . TYR A 1 199 ? -9.942  40.279  19.656 1.00 34.58  ? 199 TYR A CG    1 
ATOM   1599 C  CD1   . TYR A 1 199 ? -10.633 39.676  20.701 1.00 35.08  ? 199 TYR A CD1   1 
ATOM   1600 C  CD2   . TYR A 1 199 ? -9.195  41.425  19.932 1.00 34.43  ? 199 TYR A CD2   1 
ATOM   1601 C  CE1   . TYR A 1 199 ? -10.597 40.218  21.999 1.00 35.47  ? 199 TYR A CE1   1 
ATOM   1602 C  CE2   . TYR A 1 199 ? -9.142  41.972  21.225 1.00 32.48  ? 199 TYR A CE2   1 
ATOM   1603 C  CZ    . TYR A 1 199 ? -9.847  41.373  22.247 1.00 33.62  ? 199 TYR A CZ    1 
ATOM   1604 O  OH    . TYR A 1 199 ? -9.835  41.943  23.504 1.00 34.14  ? 199 TYR A OH    1 
ATOM   1605 N  N     . LEU A 1 200 ? -10.163 41.330  15.384 1.00 39.19  ? 200 LEU A N     1 
ATOM   1606 C  CA    . LEU A 1 200 ? -9.936  41.296  13.953 1.00 39.15  ? 200 LEU A CA    1 
ATOM   1607 C  C     . LEU A 1 200 ? -8.818  40.329  13.556 1.00 40.21  ? 200 LEU A C     1 
ATOM   1608 O  O     . LEU A 1 200 ? -8.625  40.026  12.367 1.00 38.85  ? 200 LEU A O     1 
ATOM   1609 C  CB    . LEU A 1 200 ? -9.617  42.704  13.467 1.00 38.98  ? 200 LEU A CB    1 
ATOM   1610 C  CG    . LEU A 1 200 ? -10.729 43.736  13.712 1.00 40.89  ? 200 LEU A CG    1 
ATOM   1611 C  CD1   . LEU A 1 200 ? -10.326 45.022  13.043 1.00 40.86  ? 200 LEU A CD1   1 
ATOM   1612 C  CD2   . LEU A 1 200 ? -12.083 43.265  13.136 1.00 40.03  ? 200 LEU A CD2   1 
ATOM   1613 N  N     . TYR A 1 201 ? -8.102  39.826  14.558 1.00 38.90  ? 201 TYR A N     1 
ATOM   1614 C  CA    . TYR A 1 201 ? -6.983  38.913  14.313 1.00 37.08  ? 201 TYR A CA    1 
ATOM   1615 C  C     . TYR A 1 201 ? -6.526  38.327  15.648 1.00 36.37  ? 201 TYR A C     1 
ATOM   1616 O  O     . TYR A 1 201 ? -6.397  39.044  16.636 1.00 35.03  ? 201 TYR A O     1 
ATOM   1617 C  CB    . TYR A 1 201 ? -5.831  39.692  13.651 1.00 34.69  ? 201 TYR A CB    1 
ATOM   1618 C  CG    . TYR A 1 201 ? -4.653  38.853  13.182 1.00 35.63  ? 201 TYR A CG    1 
ATOM   1619 C  CD1   . TYR A 1 201 ? -4.642  38.267  11.913 1.00 35.27  ? 201 TYR A CD1   1 
ATOM   1620 C  CD2   . TYR A 1 201 ? -3.529  38.659  14.015 1.00 36.29  ? 201 TYR A CD2   1 
ATOM   1621 C  CE1   . TYR A 1 201 ? -3.528  37.503  11.469 1.00 33.99  ? 201 TYR A CE1   1 
ATOM   1622 C  CE2   . TYR A 1 201 ? -2.423  37.907  13.593 1.00 33.64  ? 201 TYR A CE2   1 
ATOM   1623 C  CZ    . TYR A 1 201 ? -2.428  37.336  12.323 1.00 35.17  ? 201 TYR A CZ    1 
ATOM   1624 O  OH    . TYR A 1 201 ? -1.338  36.609  11.921 1.00 32.87  ? 201 TYR A OH    1 
ATOM   1625 N  N     . TYR A 1 202 ? -6.324  37.015  15.676 1.00 38.08  ? 202 TYR A N     1 
ATOM   1626 C  CA    . TYR A 1 202 ? -5.849  36.323  16.872 1.00 37.56  ? 202 TYR A CA    1 
ATOM   1627 C  C     . TYR A 1 202 ? -4.417  35.864  16.587 1.00 37.59  ? 202 TYR A C     1 
ATOM   1628 O  O     . TYR A 1 202 ? -4.190  34.856  15.902 1.00 35.24  ? 202 TYR A O     1 
ATOM   1629 C  CB    . TYR A 1 202 ? -6.737  35.133  17.192 1.00 38.96  ? 202 TYR A CB    1 
ATOM   1630 C  CG    . TYR A 1 202 ? -8.146  35.553  17.476 1.00 42.84  ? 202 TYR A CG    1 
ATOM   1631 C  CD1   . TYR A 1 202 ? -9.001  35.951  16.440 1.00 43.28  ? 202 TYR A CD1   1 
ATOM   1632 C  CD2   . TYR A 1 202 ? -8.612  35.623  18.784 1.00 42.01  ? 202 TYR A CD2   1 
ATOM   1633 C  CE1   . TYR A 1 202 ? -10.287 36.409  16.711 1.00 44.63  ? 202 TYR A CE1   1 
ATOM   1634 C  CE2   . TYR A 1 202 ? -9.882  36.078  19.065 1.00 43.25  ? 202 TYR A CE2   1 
ATOM   1635 C  CZ    . TYR A 1 202 ? -10.721 36.471  18.031 1.00 43.78  ? 202 TYR A CZ    1 
ATOM   1636 O  OH    . TYR A 1 202 ? -11.987 36.940  18.328 1.00 44.48  ? 202 TYR A OH    1 
ATOM   1637 N  N     . ALA A 1 203 ? -3.470  36.649  17.096 1.00 35.21  ? 203 ALA A N     1 
ATOM   1638 C  CA    . ALA A 1 203 ? -2.048  36.414  16.915 1.00 34.74  ? 203 ALA A CA    1 
ATOM   1639 C  C     . ALA A 1 203 ? -1.545  35.511  18.024 1.00 33.53  ? 203 ALA A C     1 
ATOM   1640 O  O     . ALA A 1 203 ? -1.361  35.928  19.165 1.00 34.45  ? 203 ALA A O     1 
ATOM   1641 C  CB    . ALA A 1 203 ? -1.313  37.747  16.930 1.00 34.13  ? 203 ALA A CB    1 
ATOM   1642 N  N     . LEU A 1 204 ? -1.326  34.260  17.686 1.00 32.36  ? 204 LEU A N     1 
ATOM   1643 C  CA    . LEU A 1 204 ? -0.896  33.294  18.677 1.00 33.86  ? 204 LEU A CA    1 
ATOM   1644 C  C     . LEU A 1 204 ? 0.556   32.912  18.547 1.00 33.61  ? 204 LEU A C     1 
ATOM   1645 O  O     . LEU A 1 204 ? 1.240   33.303  17.603 1.00 30.94  ? 204 LEU A O     1 
ATOM   1646 C  CB    . LEU A 1 204 ? -1.746  32.013  18.577 1.00 32.73  ? 204 LEU A CB    1 
ATOM   1647 C  CG    . LEU A 1 204 ? -3.269  32.253  18.611 1.00 35.79  ? 204 LEU A CG    1 
ATOM   1648 C  CD1   . LEU A 1 204 ? -4.050  30.926  18.585 1.00 37.17  ? 204 LEU A CD1   1 
ATOM   1649 C  CD2   . LEU A 1 204 ? -3.607  33.042  19.872 1.00 33.81  ? 204 LEU A CD2   1 
ATOM   1650 N  N     . GLY A 1 205 ? 0.988   32.142  19.538 1.00 35.09  ? 205 GLY A N     1 
ATOM   1651 C  CA    . GLY A 1 205 ? 2.321   31.593  19.588 1.00 36.71  ? 205 GLY A CA    1 
ATOM   1652 C  C     . GLY A 1 205 ? 2.226   30.378  20.499 1.00 38.23  ? 205 GLY A C     1 
ATOM   1653 O  O     . GLY A 1 205 ? 1.252   30.224  21.248 1.00 38.20  ? 205 GLY A O     1 
ATOM   1654 N  N     . HIS A 1 206 ? 3.227   29.511  20.400 1.00 39.63  ? 206 HIS A N     1 
ATOM   1655 C  CA    . HIS A 1 206 ? 3.383   28.305  21.205 1.00 39.57  ? 206 HIS A CA    1 
ATOM   1656 C  C     . HIS A 1 206 ? 3.514   27.058  20.346 1.00 40.81  ? 206 HIS A C     1 
ATOM   1657 O  O     . HIS A 1 206 ? 4.359   26.231  20.636 1.00 43.10  ? 206 HIS A O     1 
ATOM   1658 C  CB    . HIS A 1 206 ? 2.253   28.136  22.235 1.00 40.50  ? 206 HIS A CB    1 
ATOM   1659 C  CG    . HIS A 1 206 ? 2.462   26.985  23.174 1.00 42.75  ? 206 HIS A CG    1 
ATOM   1660 N  ND1   . HIS A 1 206 ? 3.572   26.876  23.984 1.00 44.08  ? 206 HIS A ND1   1 
ATOM   1661 C  CD2   . HIS A 1 206 ? 1.695   25.901  23.444 1.00 44.03  ? 206 HIS A CD2   1 
ATOM   1662 C  CE1   . HIS A 1 206 ? 3.481   25.779  24.715 1.00 44.76  ? 206 HIS A CE1   1 
ATOM   1663 N  NE2   . HIS A 1 206 ? 2.349   25.168  24.407 1.00 46.66  ? 206 HIS A NE2   1 
ATOM   1664 N  N     . ILE A 1 207 ? 2.715   26.911  19.293 1.00 40.14  ? 207 ILE A N     1 
ATOM   1665 C  CA    . ILE A 1 207 ? 2.836   25.727  18.423 1.00 39.70  ? 207 ILE A CA    1 
ATOM   1666 C  C     . ILE A 1 207 ? 3.893   26.028  17.351 1.00 38.14  ? 207 ILE A C     1 
ATOM   1667 O  O     . ILE A 1 207 ? 3.811   27.032  16.651 1.00 37.51  ? 207 ILE A O     1 
ATOM   1668 C  CB    . ILE A 1 207 ? 1.460   25.344  17.799 1.00 41.49  ? 207 ILE A CB    1 
ATOM   1669 C  CG1   . ILE A 1 207 ? 0.504   24.930  18.935 1.00 41.95  ? 207 ILE A CG1   1 
ATOM   1670 C  CG2   . ILE A 1 207 ? 1.615   24.210  16.784 1.00 40.69  ? 207 ILE A CG2   1 
ATOM   1671 C  CD1   . ILE A 1 207 ? -0.735  24.117  18.497 1.00 44.42  ? 207 ILE A CD1   1 
ATOM   1672 N  N     . HIS A 1 208 ? 4.891   25.158  17.229 1.00 37.58  ? 208 HIS A N     1 
ATOM   1673 C  CA    . HIS A 1 208 ? 5.993   25.412  16.304 1.00 37.95  ? 208 HIS A CA    1 
ATOM   1674 C  C     . HIS A 1 208 ? 5.832   25.242  14.792 1.00 36.82  ? 208 HIS A C     1 
ATOM   1675 O  O     . HIS A 1 208 ? 6.597   25.822  14.022 1.00 35.00  ? 208 HIS A O     1 
ATOM   1676 C  CB    . HIS A 1 208 ? 7.227   24.657  16.788 1.00 39.95  ? 208 HIS A CB    1 
ATOM   1677 C  CG    . HIS A 1 208 ? 7.798   25.208  18.054 1.00 41.07  ? 208 HIS A CG    1 
ATOM   1678 N  ND1   . HIS A 1 208 ? 9.010   24.802  18.568 1.00 43.43  ? 208 HIS A ND1   1 
ATOM   1679 C  CD2   . HIS A 1 208 ? 7.328   26.151  18.907 1.00 43.42  ? 208 HIS A CD2   1 
ATOM   1680 C  CE1   . HIS A 1 208 ? 9.262   25.472  19.679 1.00 43.57  ? 208 HIS A CE1   1 
ATOM   1681 N  NE2   . HIS A 1 208 ? 8.257   26.296  19.906 1.00 43.72  ? 208 HIS A NE2   1 
ATOM   1682 N  N     . LYS A 1 209 ? 4.861   24.459  14.349 1.00 37.29  ? 209 LYS A N     1 
ATOM   1683 C  CA    . LYS A 1 209 ? 4.655   24.325  12.906 1.00 38.09  ? 209 LYS A CA    1 
ATOM   1684 C  C     . LYS A 1 209 ? 3.542   25.292  12.636 1.00 36.77  ? 209 LYS A C     1 
ATOM   1685 O  O     . LYS A 1 209 ? 2.455   25.137  13.186 1.00 37.96  ? 209 LYS A O     1 
ATOM   1686 C  CB    . LYS A 1 209 ? 4.205   22.920  12.535 1.00 38.91  ? 209 LYS A CB    1 
ATOM   1687 C  CG    . LYS A 1 209 ? 5.193   21.848  12.882 1.00 44.99  ? 209 LYS A CG    1 
ATOM   1688 C  CD    . LYS A 1 209 ? 4.671   20.493  12.401 1.00 47.63  ? 209 LYS A CD    1 
ATOM   1689 C  CE    . LYS A 1 209 ? 5.388   19.357  13.100 1.00 48.38  ? 209 LYS A CE    1 
ATOM   1690 N  NZ    . LYS A 1 209 ? 4.893   18.023  12.644 1.00 52.45  ? 209 LYS A NZ    1 
ATOM   1691 N  N     . ARG A 1 210 ? 3.804   26.290  11.803 1.00 36.89  ? 210 ARG A N     1 
ATOM   1692 C  CA    . ARG A 1 210 ? 2.806   27.306  11.499 1.00 37.88  ? 210 ARG A CA    1 
ATOM   1693 C  C     . ARG A 1 210 ? 1.446   26.707  11.156 1.00 39.25  ? 210 ARG A C     1 
ATOM   1694 O  O     . ARG A 1 210 ? 1.360   25.585  10.679 1.00 38.69  ? 210 ARG A O     1 
ATOM   1695 C  CB    . ARG A 1 210 ? 3.284   28.193  10.368 1.00 37.12  ? 210 ARG A CB    1 
ATOM   1696 C  CG    . ARG A 1 210 ? 3.336   27.505  9.039  1.00 41.18  ? 210 ARG A CG    1 
ATOM   1697 C  CD    . ARG A 1 210 ? 4.203   28.313  8.109  1.00 41.72  ? 210 ARG A CD    1 
ATOM   1698 N  NE    . ARG A 1 210 ? 4.117   27.845  6.739  1.00 43.59  ? 210 ARG A NE    1 
ATOM   1699 C  CZ    . ARG A 1 210 ? 3.090   28.096  5.936  1.00 46.23  ? 210 ARG A CZ    1 
ATOM   1700 N  NH1   . ARG A 1 210 ? 3.091   27.631  4.690  1.00 45.74  ? 210 ARG A NH1   1 
ATOM   1701 N  NH2   . ARG A 1 210 ? 2.068   28.811  6.383  1.00 44.24  ? 210 ARG A NH2   1 
ATOM   1702 N  N     . TYR A 1 211 ? 0.388   27.479  11.395 1.00 40.53  ? 211 TYR A N     1 
ATOM   1703 C  CA    . TYR A 1 211 ? -0.973  27.021  11.175 1.00 41.11  ? 211 TYR A CA    1 
ATOM   1704 C  C     . TYR A 1 211 ? -1.891  28.224  11.113 1.00 41.86  ? 211 TYR A C     1 
ATOM   1705 O  O     . TYR A 1 211 ? -1.755  29.176  11.902 1.00 38.20  ? 211 TYR A O     1 
ATOM   1706 C  CB    . TYR A 1 211 ? -1.402  26.154  12.356 1.00 45.45  ? 211 TYR A CB    1 
ATOM   1707 C  CG    . TYR A 1 211 ? -2.589  25.268  12.112 1.00 50.83  ? 211 TYR A CG    1 
ATOM   1708 C  CD1   . TYR A 1 211 ? -2.445  24.058  11.423 1.00 54.46  ? 211 TYR A CD1   1 
ATOM   1709 C  CD2   . TYR A 1 211 ? -3.857  25.603  12.606 1.00 53.48  ? 211 TYR A CD2   1 
ATOM   1710 C  CE1   . TYR A 1 211 ? -3.540  23.192  11.236 1.00 56.65  ? 211 TYR A CE1   1 
ATOM   1711 C  CE2   . TYR A 1 211 ? -4.963  24.744  12.423 1.00 54.73  ? 211 TYR A CE2   1 
ATOM   1712 C  CZ    . TYR A 1 211 ? -4.790  23.544  11.739 1.00 56.66  ? 211 TYR A CZ    1 
ATOM   1713 O  OH    . TYR A 1 211 ? -5.851  22.683  11.560 1.00 59.57  ? 211 TYR A OH    1 
ATOM   1714 N  N     . GLU A 1 212 ? -2.820  28.189  10.164 1.00 41.92  ? 212 GLU A N     1 
ATOM   1715 C  CA    . GLU A 1 212 ? -3.796  29.253  10.017 1.00 41.78  ? 212 GLU A CA    1 
ATOM   1716 C  C     . GLU A 1 212 ? -5.177  28.647  9.968  1.00 43.07  ? 212 GLU A C     1 
ATOM   1717 O  O     . GLU A 1 212 ? -5.422  27.715  9.205  1.00 42.54  ? 212 GLU A O     1 
ATOM   1718 C  CB    . GLU A 1 212 ? -3.585  30.056  8.726  1.00 42.52  ? 212 GLU A CB    1 
ATOM   1719 C  CG    . GLU A 1 212 ? -4.651  31.150  8.569  1.00 44.21  ? 212 GLU A CG    1 
ATOM   1720 C  CD    . GLU A 1 212 ? -4.503  32.006  7.316  1.00 46.14  ? 212 GLU A CD    1 
ATOM   1721 O  OE1   . GLU A 1 212 ? -5.369  32.888  7.100  1.00 44.75  ? 212 GLU A OE1   1 
ATOM   1722 O  OE2   . GLU A 1 212 ? -3.531  31.806  6.553  1.00 47.17  ? 212 GLU A OE2   1 
ATOM   1723 N  N     . THR A 1 213 ? -6.070  29.156  10.803 1.00 44.15  ? 213 THR A N     1 
ATOM   1724 C  CA    . THR A 1 213 ? -7.460  28.722  10.803 1.00 44.31  ? 213 THR A CA    1 
ATOM   1725 C  C     . THR A 1 213 ? -8.239  30.003  11.084 1.00 43.50  ? 213 THR A C     1 
ATOM   1726 O  O     . THR A 1 213 ? -7.728  31.089  10.826 1.00 42.97  ? 213 THR A O     1 
ATOM   1727 C  CB    . THR A 1 213 ? -7.738  27.637  11.869 1.00 45.68  ? 213 THR A CB    1 
ATOM   1728 O  OG1   . THR A 1 213 ? -9.127  27.277  11.819 1.00 47.89  ? 213 THR A OG1   1 
ATOM   1729 C  CG2   . THR A 1 213 ? -7.392  28.128  13.251 1.00 44.49  ? 213 THR A CG2   1 
ATOM   1730 N  N     . SER A 1 214 ? -9.462  29.910  11.581 1.00 42.82  ? 214 SER A N     1 
ATOM   1731 C  CA    . SER A 1 214 ? -10.212 31.137  11.852 1.00 44.21  ? 214 SER A CA    1 
ATOM   1732 C  C     . SER A 1 214 ? -11.213 30.957  12.981 1.00 42.99  ? 214 SER A C     1 
ATOM   1733 O  O     . SER A 1 214 ? -11.480 29.838  13.416 1.00 41.41  ? 214 SER A O     1 
ATOM   1734 C  CB    . SER A 1 214 ? -10.932 31.633  10.592 1.00 46.11  ? 214 SER A CB    1 
ATOM   1735 O  OG    . SER A 1 214 ? -11.891 30.683  10.171 1.00 51.94  ? 214 SER A OG    1 
ATOM   1736 N  N     . TYR A 1 215 ? -11.732 32.082  13.459 1.00 42.37  ? 215 TYR A N     1 
ATOM   1737 C  CA    . TYR A 1 215 ? -12.675 32.110  14.565 1.00 43.30  ? 215 TYR A CA    1 
ATOM   1738 C  C     . TYR A 1 215 ? -13.389 33.454  14.550 1.00 43.53  ? 215 TYR A C     1 
ATOM   1739 O  O     . TYR A 1 215 ? -12.753 34.513  14.508 1.00 43.66  ? 215 TYR A O     1 
ATOM   1740 C  CB    . TYR A 1 215 ? -11.940 31.926  15.897 1.00 43.58  ? 215 TYR A CB    1 
ATOM   1741 C  CG    . TYR A 1 215 ? -12.825 32.059  17.121 1.00 44.83  ? 215 TYR A CG    1 
ATOM   1742 C  CD1   . TYR A 1 215 ? -13.739 31.058  17.463 1.00 43.02  ? 215 TYR A CD1   1 
ATOM   1743 C  CD2   . TYR A 1 215 ? -12.716 33.170  17.962 1.00 43.36  ? 215 TYR A CD2   1 
ATOM   1744 C  CE1   . TYR A 1 215 ? -14.508 31.157  18.616 1.00 44.26  ? 215 TYR A CE1   1 
ATOM   1745 C  CE2   . TYR A 1 215 ? -13.480 33.280  19.113 1.00 43.96  ? 215 TYR A CE2   1 
ATOM   1746 C  CZ    . TYR A 1 215 ? -14.369 32.273  19.438 1.00 44.68  ? 215 TYR A CZ    1 
ATOM   1747 O  OH    . TYR A 1 215 ? -15.096 32.369  20.598 1.00 43.32  ? 215 TYR A OH    1 
ATOM   1748 N  N     . SER A 1 216 ? -14.719 33.384  14.594 1.00 43.60  ? 216 SER A N     1 
ATOM   1749 C  CA    . SER A 1 216 ? -15.607 34.540  14.532 1.00 42.73  ? 216 SER A CA    1 
ATOM   1750 C  C     . SER A 1 216 ? -15.238 35.448  13.374 1.00 40.47  ? 216 SER A C     1 
ATOM   1751 O  O     . SER A 1 216 ? -15.071 36.648  13.543 1.00 39.90  ? 216 SER A O     1 
ATOM   1752 C  CB    . SER A 1 216 ? -15.588 35.333  15.835 1.00 44.76  ? 216 SER A CB    1 
ATOM   1753 O  OG    . SER A 1 216 ? -14.455 36.169  15.898 1.00 51.26  ? 216 SER A OG    1 
ATOM   1754 N  N     . GLY A 1 217 ? -15.077 34.857  12.199 1.00 40.15  ? 217 GLY A N     1 
ATOM   1755 C  CA    . GLY A 1 217 ? -14.757 35.641  11.017 1.00 40.59  ? 217 GLY A CA    1 
ATOM   1756 C  C     . GLY A 1 217 ? -13.380 36.265  10.854 1.00 41.29  ? 217 GLY A C     1 
ATOM   1757 O  O     . GLY A 1 217 ? -13.175 37.066  9.937  1.00 44.01  ? 217 GLY A O     1 
ATOM   1758 N  N     . SER A 1 218 ? -12.428 35.910  11.705 1.00 41.24  ? 218 SER A N     1 
ATOM   1759 C  CA    . SER A 1 218 ? -11.078 36.479  11.608 1.00 39.08  ? 218 SER A CA    1 
ATOM   1760 C  C     . SER A 1 218 ? -9.988  35.413  11.666 1.00 36.65  ? 218 SER A C     1 
ATOM   1761 O  O     . SER A 1 218 ? -10.198 34.310  12.172 1.00 36.04  ? 218 SER A O     1 
ATOM   1762 C  CB    . SER A 1 218 ? -10.844 37.464  12.741 1.00 38.48  ? 218 SER A CB    1 
ATOM   1763 O  OG    . SER A 1 218 ? -11.706 38.563  12.628 1.00 42.96  ? 218 SER A OG    1 
ATOM   1764 N  N     . PRO A 1 219 ? -8.793  35.742  11.172 1.00 35.23  ? 219 PRO A N     1 
ATOM   1765 C  CA    . PRO A 1 219 ? -7.713  34.750  11.208 1.00 35.44  ? 219 PRO A CA    1 
ATOM   1766 C  C     . PRO A 1 219 ? -7.216  34.380  12.608 1.00 36.04  ? 219 PRO A C     1 
ATOM   1767 O  O     . PRO A 1 219 ? -7.198  35.211  13.530 1.00 36.12  ? 219 PRO A O     1 
ATOM   1768 C  CB    . PRO A 1 219 ? -6.606  35.413  10.397 1.00 35.38  ? 219 PRO A CB    1 
ATOM   1769 C  CG    . PRO A 1 219 ? -7.355  36.377  9.497  1.00 35.85  ? 219 PRO A CG    1 
ATOM   1770 C  CD    . PRO A 1 219 ? -8.402  36.932  10.398 1.00 33.30  ? 219 PRO A CD    1 
ATOM   1771 N  N     . VAL A 1 220 ? -6.863  33.113  12.772 1.00 35.89  ? 220 VAL A N     1 
ATOM   1772 C  CA    . VAL A 1 220 ? -6.263  32.645  14.015 1.00 36.68  ? 220 VAL A CA    1 
ATOM   1773 C  C     . VAL A 1 220 ? -4.946  32.075  13.490 1.00 37.46  ? 220 VAL A C     1 
ATOM   1774 O  O     . VAL A 1 220 ? -4.942  31.086  12.756 1.00 37.22  ? 220 VAL A O     1 
ATOM   1775 C  CB    . VAL A 1 220 ? -7.082  31.552  14.699 1.00 35.96  ? 220 VAL A CB    1 
ATOM   1776 C  CG1   . VAL A 1 220 ? -6.392  31.127  15.974 1.00 30.90  ? 220 VAL A CG1   1 
ATOM   1777 C  CG2   . VAL A 1 220 ? -8.474  32.083  15.031 1.00 34.50  ? 220 VAL A CG2   1 
ATOM   1778 N  N     . VAL A 1 221 ? -3.828  32.715  13.830 1.00 36.90  ? 221 VAL A N     1 
ATOM   1779 C  CA    . VAL A 1 221 ? -2.538  32.260  13.314 1.00 33.83  ? 221 VAL A CA    1 
ATOM   1780 C  C     . VAL A 1 221 ? -1.411  31.948  14.306 1.00 34.52  ? 221 VAL A C     1 
ATOM   1781 O  O     . VAL A 1 221 ? -1.173  32.709  15.260 1.00 33.36  ? 221 VAL A O     1 
ATOM   1782 C  CB    . VAL A 1 221 ? -1.964  33.294  12.323 1.00 34.65  ? 221 VAL A CB    1 
ATOM   1783 C  CG1   . VAL A 1 221 ? -0.629  32.790  11.777 1.00 33.20  ? 221 VAL A CG1   1 
ATOM   1784 C  CG2   . VAL A 1 221 ? -2.970  33.608  11.213 1.00 30.94  ? 221 VAL A CG2   1 
ATOM   1785 N  N     . TYR A 1 222 ? -0.733  30.825  14.055 1.00 33.12  ? 222 TYR A N     1 
ATOM   1786 C  CA    . TYR A 1 222 ? 0.464   30.377  14.797 1.00 31.26  ? 222 TYR A CA    1 
ATOM   1787 C  C     . TYR A 1 222 ? 1.529   30.560  13.742 1.00 31.99  ? 222 TYR A C     1 
ATOM   1788 O  O     . TYR A 1 222 ? 1.517   29.889  12.713 1.00 30.14  ? 222 TYR A O     1 
ATOM   1789 C  CB    . TYR A 1 222 ? 0.429   28.896  15.162 1.00 31.76  ? 222 TYR A CB    1 
ATOM   1790 C  CG    . TYR A 1 222 ? -0.355  28.585  16.408 1.00 32.52  ? 222 TYR A CG    1 
ATOM   1791 C  CD1   . TYR A 1 222 ? -1.616  27.979  16.332 1.00 34.44  ? 222 TYR A CD1   1 
ATOM   1792 C  CD2   . TYR A 1 222 ? 0.161   28.890  17.670 1.00 31.07  ? 222 TYR A CD2   1 
ATOM   1793 C  CE1   . TYR A 1 222 ? -2.343  27.678  17.480 1.00 33.54  ? 222 TYR A CE1   1 
ATOM   1794 C  CE2   . TYR A 1 222 ? -0.554  28.596  18.829 1.00 32.44  ? 222 TYR A CE2   1 
ATOM   1795 C  CZ    . TYR A 1 222 ? -1.811  27.984  18.728 1.00 34.57  ? 222 TYR A CZ    1 
ATOM   1796 O  OH    . TYR A 1 222 ? -2.510  27.640  19.873 1.00 35.41  ? 222 TYR A OH    1 
ATOM   1797 N  N     . PRO A 1 223 ? 2.446   31.509  13.951 1.00 32.68  ? 223 PRO A N     1 
ATOM   1798 C  CA    . PRO A 1 223 ? 3.468   31.680  12.921 1.00 30.58  ? 223 PRO A CA    1 
ATOM   1799 C  C     . PRO A 1 223 ? 4.511   30.565  12.914 1.00 31.42  ? 223 PRO A C     1 
ATOM   1800 O  O     . PRO A 1 223 ? 5.245   30.402  11.938 1.00 31.29  ? 223 PRO A O     1 
ATOM   1801 C  CB    . PRO A 1 223 ? 4.070   33.049  13.252 1.00 33.52  ? 223 PRO A CB    1 
ATOM   1802 C  CG    . PRO A 1 223 ? 3.870   33.200  14.727 1.00 33.42  ? 223 PRO A CG    1 
ATOM   1803 C  CD    . PRO A 1 223 ? 2.538   32.528  15.016 1.00 32.41  ? 223 PRO A CD    1 
ATOM   1804 N  N     . GLY A 1 224 ? 4.559   29.793  14.000 1.00 30.45  ? 224 GLY A N     1 
ATOM   1805 C  CA    . GLY A 1 224 ? 5.548   28.743  14.126 1.00 30.01  ? 224 GLY A CA    1 
ATOM   1806 C  C     . GLY A 1 224 ? 6.934   29.290  14.485 1.00 30.51  ? 224 GLY A C     1 
ATOM   1807 O  O     . GLY A 1 224 ? 7.168   30.511  14.477 1.00 28.43  ? 224 GLY A O     1 
ATOM   1808 N  N     . SER A 1 225 ? 7.859   28.393  14.836 1.00 29.91  ? 225 SER A N     1 
ATOM   1809 C  CA    . SER A 1 225 ? 9.239   28.794  15.124 1.00 29.44  ? 225 SER A CA    1 
ATOM   1810 C  C     . SER A 1 225 ? 9.860   29.168  13.769 1.00 29.32  ? 225 SER A C     1 
ATOM   1811 O  O     . SER A 1 225 ? 9.338   28.778  12.734 1.00 30.86  ? 225 SER A O     1 
ATOM   1812 C  CB    . SER A 1 225 ? 10.020  27.624  15.731 1.00 32.07  ? 225 SER A CB    1 
ATOM   1813 O  OG    . SER A 1 225 ? 10.033  26.495  14.855 1.00 29.81  ? 225 SER A OG    1 
ATOM   1814 N  N     . LEU A 1 226 ? 10.945  29.935  13.776 1.00 29.80  ? 226 LEU A N     1 
ATOM   1815 C  CA    . LEU A 1 226 ? 11.650  30.323  12.548 1.00 30.45  ? 226 LEU A CA    1 
ATOM   1816 C  C     . LEU A 1 226 ? 12.633  29.209  12.149 1.00 30.59  ? 226 LEU A C     1 
ATOM   1817 O  O     . LEU A 1 226 ? 12.937  29.050  10.974 1.00 33.20  ? 226 LEU A O     1 
ATOM   1818 C  CB    . LEU A 1 226 ? 12.420  31.652  12.726 1.00 27.94  ? 226 LEU A CB    1 
ATOM   1819 C  CG    . LEU A 1 226 ? 11.557  32.903  13.032 1.00 31.01  ? 226 LEU A CG    1 
ATOM   1820 C  CD1   . LEU A 1 226 ? 12.453  34.085  13.428 1.00 24.69  ? 226 LEU A CD1   1 
ATOM   1821 C  CD2   . LEU A 1 226 ? 10.670  33.267  11.814 1.00 26.99  ? 226 LEU A CD2   1 
ATOM   1822 N  N     . GLU A 1 227 ? 13.118  28.447  13.124 1.00 30.51  ? 227 GLU A N     1 
ATOM   1823 C  CA    . GLU A 1 227 ? 14.039  27.351  12.868 1.00 32.11  ? 227 GLU A CA    1 
ATOM   1824 C  C     . GLU A 1 227 ? 13.336  26.035  13.198 1.00 34.23  ? 227 GLU A C     1 
ATOM   1825 O  O     . GLU A 1 227 ? 12.490  25.994  14.104 1.00 34.01  ? 227 GLU A O     1 
ATOM   1826 C  CB    . GLU A 1 227 ? 15.308  27.489  13.720 1.00 33.02  ? 227 GLU A CB    1 
ATOM   1827 C  CG    . GLU A 1 227 ? 16.407  28.349  13.095 1.00 34.23  ? 227 GLU A CG    1 
ATOM   1828 C  CD    . GLU A 1 227 ? 17.079  27.680  11.904 1.00 40.16  ? 227 GLU A CD    1 
ATOM   1829 O  OE1   . GLU A 1 227 ? 17.825  28.374  11.159 1.00 38.54  ? 227 GLU A OE1   1 
ATOM   1830 O  OE2   . GLU A 1 227 ? 16.876  26.451  11.720 1.00 40.89  ? 227 GLU A OE2   1 
ATOM   1831 N  N     . ARG A 1 228 ? 13.682  24.966  12.470 1.00 33.11  ? 228 ARG A N     1 
ATOM   1832 C  CA    . ARG A 1 228 ? 13.057  23.660  12.699 1.00 33.94  ? 228 ARG A CA    1 
ATOM   1833 C  C     . ARG A 1 228 ? 13.307  23.258  14.135 1.00 34.20  ? 228 ARG A C     1 
ATOM   1834 O  O     . ARG A 1 228 ? 14.439  23.333  14.637 1.00 33.14  ? 228 ARG A O     1 
ATOM   1835 C  CB    . ARG A 1 228 ? 13.582  22.621  11.700 1.00 33.99  ? 228 ARG A CB    1 
ATOM   1836 C  CG    . ARG A 1 228 ? 13.140  22.984  10.284 1.00 33.41  ? 228 ARG A CG    1 
ATOM   1837 C  CD    . ARG A 1 228 ? 13.536  21.982  9.180  1.00 34.34  ? 228 ARG A CD    1 
ATOM   1838 N  NE    . ARG A 1 228 ? 12.943  22.414  7.922  1.00 33.89  ? 228 ARG A NE    1 
ATOM   1839 C  CZ    . ARG A 1 228 ? 11.631  22.413  7.668  1.00 34.98  ? 228 ARG A CZ    1 
ATOM   1840 N  NH1   . ARG A 1 228 ? 11.189  22.845  6.506  1.00 34.68  ? 228 ARG A NH1   1 
ATOM   1841 N  NH2   . ARG A 1 228 ? 10.756  21.953  8.556  1.00 35.10  ? 228 ARG A NH2   1 
ATOM   1842 N  N     . TRP A 1 229 ? 12.222  22.856  14.791 1.00 34.33  ? 229 TRP A N     1 
ATOM   1843 C  CA    . TRP A 1 229 ? 12.238  22.529  16.206 1.00 35.66  ? 229 TRP A CA    1 
ATOM   1844 C  C     . TRP A 1 229 ? 12.729  21.156  16.587 1.00 35.02  ? 229 TRP A C     1 
ATOM   1845 O  O     . TRP A 1 229 ? 13.461  21.004  17.547 1.00 36.07  ? 229 TRP A O     1 
ATOM   1846 C  CB    . TRP A 1 229 ? 10.840  22.759  16.789 1.00 35.50  ? 229 TRP A CB    1 
ATOM   1847 C  CG    . TRP A 1 229 ? 10.820  22.631  18.265 1.00 37.66  ? 229 TRP A CG    1 
ATOM   1848 C  CD1   . TRP A 1 229 ? 10.153  21.697  18.992 1.00 38.35  ? 229 TRP A CD1   1 
ATOM   1849 C  CD2   . TRP A 1 229 ? 11.515  23.458  19.213 1.00 37.37  ? 229 TRP A CD2   1 
ATOM   1850 N  NE1   . TRP A 1 229 ? 10.383  21.885  20.331 1.00 36.63  ? 229 TRP A NE1   1 
ATOM   1851 C  CE2   . TRP A 1 229 ? 11.213  22.960  20.498 1.00 38.17  ? 229 TRP A CE2   1 
ATOM   1852 C  CE3   . TRP A 1 229 ? 12.352  24.573  19.102 1.00 36.53  ? 229 TRP A CE3   1 
ATOM   1853 C  CZ2   . TRP A 1 229 ? 11.727  23.540  21.676 1.00 36.65  ? 229 TRP A CZ2   1 
ATOM   1854 C  CZ3   . TRP A 1 229 ? 12.861  25.150  20.278 1.00 36.06  ? 229 TRP A CZ3   1 
ATOM   1855 C  CH2   . TRP A 1 229 ? 12.544  24.630  21.538 1.00 34.70  ? 229 TRP A CH2   1 
ATOM   1856 N  N     . ASP A 1 230 ? 12.298  20.148  15.856 1.00 34.47  ? 230 ASP A N     1 
ATOM   1857 C  CA    . ASP A 1 230 ? 12.729  18.790  16.131 1.00 34.92  ? 230 ASP A CA    1 
ATOM   1858 C  C     . ASP A 1 230 ? 12.460  18.015  14.872 1.00 34.60  ? 230 ASP A C     1 
ATOM   1859 O  O     . ASP A 1 230 ? 12.125  18.616  13.854 1.00 31.99  ? 230 ASP A O     1 
ATOM   1860 C  CB    . ASP A 1 230 ? 11.986  18.198  17.341 1.00 36.34  ? 230 ASP A CB    1 
ATOM   1861 C  CG    . ASP A 1 230 ? 10.483  18.173  17.170 1.00 37.81  ? 230 ASP A CG    1 
ATOM   1862 O  OD1   . ASP A 1 230 ? 9.799   17.968  18.185 1.00 40.08  ? 230 ASP A OD1   1 
ATOM   1863 O  OD2   . ASP A 1 230 ? 9.974   18.348  16.045 1.00 39.27  ? 230 ASP A OD2   1 
ATOM   1864 N  N     . PHE A 1 231 ? 12.603  16.697  14.915 1.00 36.33  ? 231 PHE A N     1 
ATOM   1865 C  CA    . PHE A 1 231 ? 12.402  15.917  13.710 1.00 37.83  ? 231 PHE A CA    1 
ATOM   1866 C  C     . PHE A 1 231 ? 10.966  15.722  13.278 1.00 40.13  ? 231 PHE A C     1 
ATOM   1867 O  O     . PHE A 1 231 ? 10.691  15.303  12.140 1.00 41.50  ? 231 PHE A O     1 
ATOM   1868 C  CB    . PHE A 1 231 ? 13.161  14.604  13.814 1.00 40.15  ? 231 PHE A CB    1 
ATOM   1869 C  CG    . PHE A 1 231 ? 14.637  14.800  13.743 1.00 41.09  ? 231 PHE A CG    1 
ATOM   1870 C  CD1   . PHE A 1 231 ? 15.399  14.831  14.891 1.00 41.44  ? 231 PHE A CD1   1 
ATOM   1871 C  CD2   . PHE A 1 231 ? 15.251  15.061  12.518 1.00 41.91  ? 231 PHE A CD2   1 
ATOM   1872 C  CE1   . PHE A 1 231 ? 16.754  15.122  14.833 1.00 41.84  ? 231 PHE A CE1   1 
ATOM   1873 C  CE2   . PHE A 1 231 ? 16.604  15.355  12.454 1.00 41.68  ? 231 PHE A CE2   1 
ATOM   1874 C  CZ    . PHE A 1 231 ? 17.351  15.385  13.616 1.00 41.19  ? 231 PHE A CZ    1 
ATOM   1875 N  N     . GLY A 1 232 ? 10.045  16.044  14.178 1.00 40.11  ? 232 GLY A N     1 
ATOM   1876 C  CA    . GLY A 1 232 ? 8.652   15.985  13.808 1.00 39.18  ? 232 GLY A CA    1 
ATOM   1877 C  C     . GLY A 1 232 ? 8.461   17.220  12.928 1.00 39.77  ? 232 GLY A C     1 
ATOM   1878 O  O     . GLY A 1 232 ? 7.504   17.296  12.179 1.00 43.34  ? 232 GLY A O     1 
ATOM   1879 N  N     . ASP A 1 233 ? 9.373   18.189  13.016 1.00 37.80  ? 233 ASP A N     1 
ATOM   1880 C  CA    . ASP A 1 233 ? 9.282   19.426  12.220 1.00 37.24  ? 233 ASP A CA    1 
ATOM   1881 C  C     . ASP A 1 233 ? 10.167  19.276  10.978 1.00 37.00  ? 233 ASP A C     1 
ATOM   1882 O  O     . ASP A 1 233 ? 10.874  20.201  10.591 1.00 35.14  ? 233 ASP A O     1 
ATOM   1883 C  CB    . ASP A 1 233 ? 9.757   20.638  13.070 1.00 34.80  ? 233 ASP A CB    1 
ATOM   1884 C  CG    . ASP A 1 233 ? 9.431   22.003  12.426 1.00 37.40  ? 233 ASP A CG    1 
ATOM   1885 O  OD1   . ASP A 1 233 ? 9.870   23.025  12.993 1.00 36.74  ? 233 ASP A OD1   1 
ATOM   1886 O  OD2   . ASP A 1 233 ? 8.738   22.075  11.369 1.00 35.99  ? 233 ASP A OD2   1 
ATOM   1887 N  N     . TYR A 1 234 ? 10.111  18.108  10.342 1.00 38.38  ? 234 TYR A N     1 
ATOM   1888 C  CA    . TYR A 1 234 ? 10.964  17.846  9.180  1.00 37.40  ? 234 TYR A CA    1 
ATOM   1889 C  C     . TYR A 1 234 ? 10.673  18.639  7.927  1.00 37.35  ? 234 TYR A C     1 
ATOM   1890 O  O     . TYR A 1 234 ? 9.548   19.094  7.714  1.00 36.38  ? 234 TYR A O     1 
ATOM   1891 C  CB    . TYR A 1 234 ? 10.914  16.360  8.807  1.00 37.32  ? 234 TYR A CB    1 
ATOM   1892 C  CG    . TYR A 1 234 ? 9.508   15.860  8.569  1.00 39.44  ? 234 TYR A CG    1 
ATOM   1893 C  CD1   . TYR A 1 234 ? 8.833   16.129  7.367  1.00 39.18  ? 234 TYR A CD1   1 
ATOM   1894 C  CD2   . TYR A 1 234 ? 8.824   15.166  9.568  1.00 41.16  ? 234 TYR A CD2   1 
ATOM   1895 C  CE1   . TYR A 1 234 ? 7.509   15.716  7.173  1.00 40.96  ? 234 TYR A CE1   1 
ATOM   1896 C  CE2   . TYR A 1 234 ? 7.495   14.750  9.383  1.00 42.79  ? 234 TYR A CE2   1 
ATOM   1897 C  CZ    . TYR A 1 234 ? 6.852   15.028  8.185  1.00 42.35  ? 234 TYR A CZ    1 
ATOM   1898 O  OH    . TYR A 1 234 ? 5.552   14.615  8.011  1.00 44.67  ? 234 TYR A OH    1 
ATOM   1899 N  N     . GLU A 1 235 ? 11.704  18.800  7.102  1.00 36.16  ? 235 GLU A N     1 
ATOM   1900 C  CA    . GLU A 1 235 ? 11.528  19.450  5.828  1.00 38.56  ? 235 GLU A CA    1 
ATOM   1901 C  C     . GLU A 1 235 ? 10.928  18.366  4.915  1.00 39.05  ? 235 GLU A C     1 
ATOM   1902 O  O     . GLU A 1 235 ? 10.050  18.644  4.108  1.00 40.34  ? 235 GLU A O     1 
ATOM   1903 C  CB    . GLU A 1 235 ? 12.849  19.919  5.242  1.00 37.71  ? 235 GLU A CB    1 
ATOM   1904 C  CG    . GLU A 1 235 ? 12.632  20.642  3.923  1.00 43.70  ? 235 GLU A CG    1 
ATOM   1905 C  CD    . GLU A 1 235 ? 13.915  21.045  3.245  1.00 45.82  ? 235 GLU A CD    1 
ATOM   1906 O  OE1   . GLU A 1 235 ? 14.663  21.882  3.791  1.00 48.36  ? 235 GLU A OE1   1 
ATOM   1907 O  OE2   . GLU A 1 235 ? 14.184  20.509  2.157  1.00 49.83  ? 235 GLU A OE2   1 
ATOM   1908 N  N     . VAL A 1 236 ? 11.414  17.136  5.060  1.00 38.29  ? 236 VAL A N     1 
ATOM   1909 C  CA    . VAL A 1 236 ? 10.940  15.982  4.283  1.00 39.36  ? 236 VAL A CA    1 
ATOM   1910 C  C     . VAL A 1 236 ? 11.059  14.692  5.101  1.00 38.71  ? 236 VAL A C     1 
ATOM   1911 O  O     . VAL A 1 236 ? 12.053  14.482  5.789  1.00 38.92  ? 236 VAL A O     1 
ATOM   1912 C  CB    . VAL A 1 236 ? 11.772  15.714  3.012  1.00 38.95  ? 236 VAL A CB    1 
ATOM   1913 C  CG1   . VAL A 1 236 ? 11.092  14.625  2.189  1.00 42.61  ? 236 VAL A CG1   1 
ATOM   1914 C  CG2   . VAL A 1 236 ? 11.920  16.960  2.182  1.00 43.38  ? 236 VAL A CG2   1 
ATOM   1915 N  N     . ARG A 1 237 ? 10.035  13.853  5.031  1.00 40.19  ? 237 ARG A N     1 
ATOM   1916 C  CA    . ARG A 1 237 ? 10.041  12.552  5.693  1.00 44.09  ? 237 ARG A CA    1 
ATOM   1917 C  C     . ARG A 1 237 ? 10.075  11.438  4.629  1.00 45.64  ? 237 ARG A C     1 
ATOM   1918 O  O     . ARG A 1 237 ? 9.238   11.397  3.714  1.00 44.91  ? 237 ARG A O     1 
ATOM   1919 C  CB    . ARG A 1 237 ? 8.807   12.342  6.560  1.00 45.50  ? 237 ARG A CB    1 
ATOM   1920 C  CG    . ARG A 1 237 ? 8.838   10.991  7.263  1.00 49.25  ? 237 ARG A CG    1 
ATOM   1921 C  CD    . ARG A 1 237 ? 7.603   10.735  8.083  1.00 51.91  ? 237 ARG A CD    1 
ATOM   1922 N  NE    . ARG A 1 237 ? 7.426   11.734  9.129  1.00 58.02  ? 237 ARG A NE    1 
ATOM   1923 C  CZ    . ARG A 1 237 ? 7.687   11.529  10.416 1.00 60.74  ? 237 ARG A CZ    1 
ATOM   1924 N  NH1   . ARG A 1 237 ? 7.490   12.503  11.294 1.00 59.34  ? 237 ARG A NH1   1 
ATOM   1925 N  NH2   . ARG A 1 237 ? 8.146   10.347  10.830 1.00 64.01  ? 237 ARG A NH2   1 
ATOM   1926 N  N     . TYR A 1 238 ? 11.049  10.544  4.755  1.00 45.25  ? 238 TYR A N     1 
ATOM   1927 C  CA    . TYR A 1 238 ? 11.209  9.437   3.826  1.00 44.98  ? 238 TYR A CA    1 
ATOM   1928 C  C     . TYR A 1 238 ? 10.842  8.127   4.488  1.00 46.22  ? 238 TYR A C     1 
ATOM   1929 O  O     . TYR A 1 238 ? 11.269  7.850   5.618  1.00 47.90  ? 238 TYR A O     1 
ATOM   1930 C  CB    . TYR A 1 238 ? 12.652  9.351   3.332  1.00 43.08  ? 238 TYR A CB    1 
ATOM   1931 C  CG    . TYR A 1 238 ? 13.051  10.485  2.424  1.00 43.95  ? 238 TYR A CG    1 
ATOM   1932 C  CD1   . TYR A 1 238 ? 14.079  11.356  2.773  1.00 42.98  ? 238 TYR A CD1   1 
ATOM   1933 C  CD2   . TYR A 1 238 ? 12.416  10.673  1.198  1.00 43.56  ? 238 TYR A CD2   1 
ATOM   1934 C  CE1   . TYR A 1 238 ? 14.467  12.394  1.916  1.00 44.27  ? 238 TYR A CE1   1 
ATOM   1935 C  CE2   . TYR A 1 238 ? 12.795  11.689  0.344  1.00 44.50  ? 238 TYR A CE2   1 
ATOM   1936 C  CZ    . TYR A 1 238 ? 13.816  12.547  0.704  1.00 45.15  ? 238 TYR A CZ    1 
ATOM   1937 O  OH    . TYR A 1 238 ? 14.174  13.564  -0.150 1.00 47.50  ? 238 TYR A OH    1 
ATOM   1938 N  N     . GLU A 1 239 ? 10.055  7.319   3.785  1.00 44.73  ? 239 GLU A N     1 
ATOM   1939 C  CA    . GLU A 1 239 ? 9.659   6.028   4.310  1.00 47.13  ? 239 GLU A CA    1 
ATOM   1940 C  C     . GLU A 1 239 ? 9.941   4.973   3.242  1.00 47.58  ? 239 GLU A C     1 
ATOM   1941 O  O     . GLU A 1 239 ? 9.566   5.125   2.071  1.00 46.74  ? 239 GLU A O     1 
ATOM   1942 C  CB    . GLU A 1 239 ? 8.176   6.028   4.712  1.00 48.51  ? 239 GLU A CB    1 
ATOM   1943 C  CG    . GLU A 1 239 ? 7.735   4.709   5.343  1.00 51.84  ? 239 GLU A CG    1 
ATOM   1944 C  CD    . GLU A 1 239 ? 6.519   4.836   6.256  1.00 53.99  ? 239 GLU A CD    1 
ATOM   1945 O  OE1   . GLU A 1 239 ? 6.296   3.905   7.060  1.00 55.77  ? 239 GLU A OE1   1 
ATOM   1946 O  OE2   . GLU A 1 239 ? 5.782   5.847   6.174  1.00 55.87  ? 239 GLU A OE2   1 
ATOM   1947 N  N     . TRP A 1 240 ? 10.633  3.917   3.653  1.00 47.67  ? 240 TRP A N     1 
ATOM   1948 C  CA    . TRP A 1 240 ? 10.996  2.828   2.747  1.00 47.65  ? 240 TRP A CA    1 
ATOM   1949 C  C     . TRP A 1 240 ? 9.787   1.936   2.472  1.00 48.33  ? 240 TRP A C     1 
ATOM   1950 O  O     . TRP A 1 240 ? 9.187   1.410   3.411  1.00 46.40  ? 240 TRP A O     1 
ATOM   1951 C  CB    . TRP A 1 240 ? 12.110  1.995   3.384  1.00 46.53  ? 240 TRP A CB    1 
ATOM   1952 C  CG    . TRP A 1 240 ? 12.623  0.898   2.518  1.00 45.36  ? 240 TRP A CG    1 
ATOM   1953 C  CD1   . TRP A 1 240 ? 12.603  -0.439  2.789  1.00 45.18  ? 240 TRP A CD1   1 
ATOM   1954 C  CD2   . TRP A 1 240 ? 13.276  1.046   1.251  1.00 44.84  ? 240 TRP A CD2   1 
ATOM   1955 N  NE1   . TRP A 1 240 ? 13.212  -1.136  1.771  1.00 44.97  ? 240 TRP A NE1   1 
ATOM   1956 C  CE2   . TRP A 1 240 ? 13.631  -0.247  0.813  1.00 44.76  ? 240 TRP A CE2   1 
ATOM   1957 C  CE3   . TRP A 1 240 ? 13.600  2.149   0.447  1.00 44.27  ? 240 TRP A CE3   1 
ATOM   1958 C  CZ2   . TRP A 1 240 ? 14.293  -0.471  -0.402 1.00 44.99  ? 240 TRP A CZ2   1 
ATOM   1959 C  CZ3   . TRP A 1 240 ? 14.256  1.931   -0.757 1.00 46.40  ? 240 TRP A CZ3   1 
ATOM   1960 C  CH2   . TRP A 1 240 ? 14.598  0.625   -1.173 1.00 44.80  ? 240 TRP A CH2   1 
ATOM   1961 N  N     . ASP A 1 241 ? 9.426   1.769   1.199  1.00 50.39  ? 241 ASP A N     1 
ATOM   1962 C  CA    . ASP A 1 241 ? 8.282   0.904   0.864  1.00 53.22  ? 241 ASP A CA    1 
ATOM   1963 C  C     . ASP A 1 241 ? 8.715   -0.463  0.334  1.00 54.62  ? 241 ASP A C     1 
ATOM   1964 O  O     . ASP A 1 241 ? 7.882   -1.281  -0.049 1.00 56.56  ? 241 ASP A O     1 
ATOM   1965 C  CB    . ASP A 1 241 ? 7.344   1.583   -0.149 1.00 53.33  ? 241 ASP A CB    1 
ATOM   1966 C  CG    . ASP A 1 241 ? 7.942   1.691   -1.535 1.00 54.75  ? 241 ASP A CG    1 
ATOM   1967 O  OD1   . ASP A 1 241 ? 7.284   2.296   -2.403 1.00 56.41  ? 241 ASP A OD1   1 
ATOM   1968 O  OD2   . ASP A 1 241 ? 9.055   1.175   -1.777 1.00 56.67  ? 241 ASP A OD2   1 
ATOM   1969 N  N     . GLY A 1 242 ? 10.020  -0.717  0.326  1.00 55.54  ? 242 GLY A N     1 
ATOM   1970 C  CA    . GLY A 1 242 ? 10.516  -1.996  -0.148 1.00 55.85  ? 242 GLY A CA    1 
ATOM   1971 C  C     . GLY A 1 242 ? 11.273  -1.847  -1.451 1.00 56.34  ? 242 GLY A C     1 
ATOM   1972 O  O     . GLY A 1 242 ? 12.114  -2.680  -1.807 1.00 57.35  ? 242 GLY A O     1 
ATOM   1973 N  N     . ILE A 1 243 ? 10.989  -0.778  -2.176 1.00 55.88  ? 243 ILE A N     1 
ATOM   1974 C  CA    . ILE A 1 243 ? 11.668  -0.557  -3.448 1.00 57.80  ? 243 ILE A CA    1 
ATOM   1975 C  C     . ILE A 1 243 ? 12.006  0.917   -3.574 1.00 56.45  ? 243 ILE A C     1 
ATOM   1976 O  O     . ILE A 1 243 ? 13.009  1.301   -4.190 1.00 55.27  ? 243 ILE A O     1 
ATOM   1977 C  CB    . ILE A 1 243 ? 10.755  -0.951  -4.638 1.00 60.23  ? 243 ILE A CB    1 
ATOM   1978 C  CG1   . ILE A 1 243 ? 10.241  -2.380  -4.450 1.00 61.35  ? 243 ILE A CG1   1 
ATOM   1979 C  CG2   . ILE A 1 243 ? 11.523  -0.843  -5.955 1.00 61.40  ? 243 ILE A CG2   1 
ATOM   1980 C  CD1   . ILE A 1 243 ? 9.160   -2.757  -5.420 1.00 61.89  ? 243 ILE A CD1   1 
ATOM   1981 N  N     . LYS A 1 244 ? 11.160  1.732   -2.952 1.00 55.17  ? 244 LYS A N     1 
ATOM   1982 C  CA    . LYS A 1 244 ? 11.308  3.172   -3.007 1.00 54.37  ? 244 LYS A CA    1 
ATOM   1983 C  C     . LYS A 1 244 ? 11.022  3.848   -1.665 1.00 52.46  ? 244 LYS A C     1 
ATOM   1984 O  O     . LYS A 1 244 ? 10.469  3.252   -0.738 1.00 50.99  ? 244 LYS A O     1 
ATOM   1985 C  CB    . LYS A 1 244 ? 10.338  3.718   -4.068 1.00 53.94  ? 244 LYS A CB    1 
ATOM   1986 C  CG    . LYS A 1 244 ? 10.455  5.202   -4.338 1.00 54.56  ? 244 LYS A CG    1 
ATOM   1987 C  CD    . LYS A 1 244 ? 9.631   5.619   -5.544 0.00 54.51  ? 244 LYS A CD    1 
ATOM   1988 C  CE    . LYS A 1 244 ? 9.869   7.081   -5.885 0.00 54.66  ? 244 LYS A CE    1 
ATOM   1989 N  NZ    . LYS A 1 244 ? 9.105   7.506   -7.089 0.00 54.69  ? 244 LYS A NZ    1 
ATOM   1990 N  N     . PHE A 1 245 ? 11.423  5.107   -1.582 1.00 51.79  ? 245 PHE A N     1 
ATOM   1991 C  CA    . PHE A 1 245 ? 11.168  5.910   -0.407 1.00 50.95  ? 245 PHE A CA    1 
ATOM   1992 C  C     . PHE A 1 245 ? 9.950   6.778   -0.736 1.00 51.28  ? 245 PHE A C     1 
ATOM   1993 O  O     . PHE A 1 245 ? 9.958   7.536   -1.702 1.00 50.84  ? 245 PHE A O     1 
ATOM   1994 C  CB    . PHE A 1 245 ? 12.380  6.798   -0.079 1.00 47.88  ? 245 PHE A CB    1 
ATOM   1995 C  CG    . PHE A 1 245 ? 13.409  6.129   0.792  1.00 46.93  ? 245 PHE A CG    1 
ATOM   1996 C  CD1   . PHE A 1 245 ? 14.687  5.858   0.306  1.00 44.62  ? 245 PHE A CD1   1 
ATOM   1997 C  CD2   . PHE A 1 245 ? 13.097  5.767   2.105  1.00 45.70  ? 245 PHE A CD2   1 
ATOM   1998 C  CE1   . PHE A 1 245 ? 15.646  5.229   1.117  1.00 43.36  ? 245 PHE A CE1   1 
ATOM   1999 C  CE2   . PHE A 1 245 ? 14.045  5.139   2.924  1.00 45.25  ? 245 PHE A CE2   1 
ATOM   2000 C  CZ    . PHE A 1 245 ? 15.326  4.871   2.422  1.00 44.11  ? 245 PHE A CZ    1 
ATOM   2001 N  N     . LYS A 1 246 ? 8.893   6.623   0.047  1.00 53.11  ? 246 LYS A N     1 
ATOM   2002 C  CA    . LYS A 1 246 ? 7.682   7.419   -0.110 1.00 54.24  ? 246 LYS A CA    1 
ATOM   2003 C  C     . LYS A 1 246 ? 8.025   8.770   0.534  1.00 56.06  ? 246 LYS A C     1 
ATOM   2004 O  O     . LYS A 1 246 ? 8.646   8.807   1.606  1.00 55.44  ? 246 LYS A O     1 
ATOM   2005 C  CB    . LYS A 1 246 ? 6.529   6.753   0.641  1.00 53.62  ? 246 LYS A CB    1 
ATOM   2006 C  CG    . LYS A 1 246 ? 5.227   7.534   0.593  0.00 54.05  ? 246 LYS A CG    1 
ATOM   2007 C  CD    . LYS A 1 246 ? 4.138   6.835   1.387  0.00 54.16  ? 246 LYS A CD    1 
ATOM   2008 C  CE    . LYS A 1 246 ? 2.840   7.624   1.355  0.00 54.33  ? 246 LYS A CE    1 
ATOM   2009 N  NZ    . LYS A 1 246 ? 1.762   6.952   2.130  0.00 54.44  ? 246 LYS A NZ    1 
ATOM   2010 N  N     . GLU A 1 247 ? 7.634   9.870   -0.108 1.00 57.21  ? 247 GLU A N     1 
ATOM   2011 C  CA    . GLU A 1 247 ? 7.950   11.198  0.410  1.00 58.35  ? 247 GLU A CA    1 
ATOM   2012 C  C     . GLU A 1 247 ? 6.781   11.969  0.996  1.00 58.48  ? 247 GLU A C     1 
ATOM   2013 O  O     . GLU A 1 247 ? 5.676   11.969  0.452  1.00 59.54  ? 247 GLU A O     1 
ATOM   2014 C  CB    . GLU A 1 247 ? 8.587   12.054  -0.676 1.00 59.86  ? 247 GLU A CB    1 
ATOM   2015 C  CG    . GLU A 1 247 ? 9.622   11.337  -1.493 1.00 64.19  ? 247 GLU A CG    1 
ATOM   2016 C  CD    . GLU A 1 247 ? 10.391  12.287  -2.378 1.00 67.32  ? 247 GLU A CD    1 
ATOM   2017 O  OE1   . GLU A 1 247 ? 9.785   13.291  -2.815 1.00 69.41  ? 247 GLU A OE1   1 
ATOM   2018 O  OE2   . GLU A 1 247 ? 11.590  12.027  -2.644 1.00 68.34  ? 247 GLU A OE2   1 
ATOM   2019 N  N     . ARG A 1 248 ? 7.071   12.653  2.099  1.00 57.22  ? 248 ARG A N     1 
ATOM   2020 C  CA    . ARG A 1 248 ? 6.125   13.469  2.848  1.00 55.50  ? 248 ARG A CA    1 
ATOM   2021 C  C     . ARG A 1 248 ? 6.819   14.783  3.195  1.00 54.70  ? 248 ARG A C     1 
ATOM   2022 O  O     . ARG A 1 248 ? 7.793   14.789  3.950  1.00 52.74  ? 248 ARG A O     1 
ATOM   2023 C  CB    . ARG A 1 248 ? 5.762   12.765  4.147  1.00 57.59  ? 248 ARG A CB    1 
ATOM   2024 C  CG    . ARG A 1 248 ? 4.550   11.903  4.072  1.00 61.19  ? 248 ARG A CG    1 
ATOM   2025 C  CD    . ARG A 1 248 ? 3.437   12.567  4.822  1.00 63.97  ? 248 ARG A CD    1 
ATOM   2026 N  NE    . ARG A 1 248 ? 3.449   12.233  6.239  1.00 67.08  ? 248 ARG A NE    1 
ATOM   2027 C  CZ    . ARG A 1 248 ? 2.688   12.841  7.142  1.00 68.74  ? 248 ARG A CZ    1 
ATOM   2028 N  NH1   . ARG A 1 248 ? 1.869   13.820  6.761  1.00 68.85  ? 248 ARG A NH1   1 
ATOM   2029 N  NH2   . ARG A 1 248 ? 2.725   12.456  8.414  1.00 67.84  ? 248 ARG A NH2   1 
ATOM   2030 N  N     . TYR A 1 249 ? 6.333   15.893  2.656  1.00 52.94  ? 249 TYR A N     1 
ATOM   2031 C  CA    . TYR A 1 249 ? 6.950   17.168  2.965  1.00 51.63  ? 249 TYR A CA    1 
ATOM   2032 C  C     . TYR A 1 249 ? 6.313   17.794  4.201  1.00 49.38  ? 249 TYR A C     1 
ATOM   2033 O  O     . TYR A 1 249 ? 5.130   17.593  4.472  1.00 47.75  ? 249 TYR A O     1 
ATOM   2034 C  CB    . TYR A 1 249 ? 6.848   18.113  1.775  1.00 54.48  ? 249 TYR A CB    1 
ATOM   2035 C  CG    . TYR A 1 249 ? 7.366   17.492  0.507  1.00 57.64  ? 249 TYR A CG    1 
ATOM   2036 C  CD1   . TYR A 1 249 ? 6.574   16.603  -0.222 1.00 60.40  ? 249 TYR A CD1   1 
ATOM   2037 C  CD2   . TYR A 1 249 ? 8.664   17.737  0.066  1.00 58.68  ? 249 TYR A CD2   1 
ATOM   2038 C  CE1   . TYR A 1 249 ? 7.061   15.964  -1.356 1.00 61.84  ? 249 TYR A CE1   1 
ATOM   2039 C  CE2   . TYR A 1 249 ? 9.165   17.108  -1.069 1.00 61.73  ? 249 TYR A CE2   1 
ATOM   2040 C  CZ    . TYR A 1 249 ? 8.353   16.219  -1.773 1.00 63.15  ? 249 TYR A CZ    1 
ATOM   2041 O  OH    . TYR A 1 249 ? 8.830   15.572  -2.887 1.00 65.51  ? 249 TYR A OH    1 
ATOM   2042 N  N     . GLY A 1 250 ? 7.133   18.516  4.962  1.00 46.86  ? 250 GLY A N     1 
ATOM   2043 C  CA    . GLY A 1 250 ? 6.665   19.186  6.159  1.00 44.37  ? 250 GLY A CA    1 
ATOM   2044 C  C     . GLY A 1 250 ? 6.301   20.623  5.826  1.00 44.06  ? 250 GLY A C     1 
ATOM   2045 O  O     . GLY A 1 250 ? 6.131   20.979  4.657  1.00 43.08  ? 250 GLY A O     1 
ATOM   2046 N  N     . VAL A 1 251 ? 6.193   21.468  6.838  1.00 43.02  ? 251 VAL A N     1 
ATOM   2047 C  CA    . VAL A 1 251 ? 5.817   22.851  6.588  1.00 42.21  ? 251 VAL A CA    1 
ATOM   2048 C  C     . VAL A 1 251 ? 7.034   23.739  6.390  1.00 41.31  ? 251 VAL A C     1 
ATOM   2049 O  O     . VAL A 1 251 ? 8.113   23.442  6.890  1.00 42.42  ? 251 VAL A O     1 
ATOM   2050 C  CB    . VAL A 1 251 ? 4.939   23.383  7.762  1.00 43.00  ? 251 VAL A CB    1 
ATOM   2051 C  CG1   . VAL A 1 251 ? 3.769   22.433  7.982  1.00 42.93  ? 251 VAL A CG1   1 
ATOM   2052 C  CG2   . VAL A 1 251 ? 5.777   23.488  9.067  1.00 42.63  ? 251 VAL A CG2   1 
ATOM   2053 N  N     . ASN A 1 252 ? 6.880   24.806  5.617  1.00 41.81  ? 252 ASN A N     1 
ATOM   2054 C  CA    . ASN A 1 252 ? 7.975   25.737  5.422  1.00 41.46  ? 252 ASN A CA    1 
ATOM   2055 C  C     . ASN A 1 252 ? 8.108   26.480  6.752  1.00 40.03  ? 252 ASN A C     1 
ATOM   2056 O  O     . ASN A 1 252 ? 7.209   26.440  7.591  1.00 39.61  ? 252 ASN A O     1 
ATOM   2057 C  CB    . ASN A 1 252 ? 7.655   26.755  4.328  1.00 45.79  ? 252 ASN A CB    1 
ATOM   2058 C  CG    . ASN A 1 252 ? 7.318   26.114  3.021  1.00 52.51  ? 252 ASN A CG    1 
ATOM   2059 O  OD1   . ASN A 1 252 ? 8.000   25.181  2.576  1.00 54.74  ? 252 ASN A OD1   1 
ATOM   2060 N  ND2   . ASN A 1 252 ? 6.264   26.611  2.374  1.00 53.28  ? 252 ASN A ND2   1 
ATOM   2061 N  N     . LYS A 1 253 ? 9.216   27.186  6.920  1.00 37.27  ? 253 LYS A N     1 
ATOM   2062 C  CA    . LYS A 1 253 ? 9.482   27.926  8.145  1.00 33.54  ? 253 LYS A CA    1 
ATOM   2063 C  C     . LYS A 1 253 ? 9.523   29.399  7.790  1.00 32.63  ? 253 LYS A C     1 
ATOM   2064 O  O     . LYS A 1 253 ? 9.981   29.781  6.705  1.00 31.67  ? 253 LYS A O     1 
ATOM   2065 C  CB    . LYS A 1 253 ? 10.830  27.500  8.722  1.00 32.49  ? 253 LYS A CB    1 
ATOM   2066 C  CG    . LYS A 1 253 ? 10.971  25.995  8.890  1.00 33.92  ? 253 LYS A CG    1 
ATOM   2067 C  CD    . LYS A 1 253 ? 10.729  25.492  10.336 1.00 37.20  ? 253 LYS A CD    1 
ATOM   2068 C  CE    . LYS A 1 253 ? 9.419   25.928  10.935 1.00 34.62  ? 253 LYS A CE    1 
ATOM   2069 N  NZ    . LYS A 1 253 ? 9.067   25.209  12.198 1.00 30.64  ? 253 LYS A NZ    1 
ATOM   2070 N  N     . GLY A 1 254 ? 9.027   30.224  8.697  1.00 31.68  ? 254 GLY A N     1 
ATOM   2071 C  CA    . GLY A 1 254 ? 9.036   31.655  8.464  1.00 29.97  ? 254 GLY A CA    1 
ATOM   2072 C  C     . GLY A 1 254 ? 8.139   32.354  9.453  1.00 31.03  ? 254 GLY A C     1 
ATOM   2073 O  O     . GLY A 1 254 ? 8.027   31.937  10.629 1.00 30.71  ? 254 GLY A O     1 
ATOM   2074 N  N     . PHE A 1 255 ? 7.473   33.406  8.984  1.00 29.16  ? 255 PHE A N     1 
ATOM   2075 C  CA    . PHE A 1 255 ? 6.593   34.164  9.861  1.00 29.87  ? 255 PHE A CA    1 
ATOM   2076 C  C     . PHE A 1 255 ? 5.527   34.842  8.997  1.00 31.25  ? 255 PHE A C     1 
ATOM   2077 O  O     . PHE A 1 255 ? 5.463   34.603  7.790  1.00 33.35  ? 255 PHE A O     1 
ATOM   2078 C  CB    . PHE A 1 255 ? 7.427   35.189  10.645 1.00 26.96  ? 255 PHE A CB    1 
ATOM   2079 C  CG    . PHE A 1 255 ? 8.055   36.258  9.773  1.00 29.93  ? 255 PHE A CG    1 
ATOM   2080 C  CD1   . PHE A 1 255 ? 7.463   37.512  9.653  1.00 28.52  ? 255 PHE A CD1   1 
ATOM   2081 C  CD2   . PHE A 1 255 ? 9.221   35.997  9.057  1.00 28.19  ? 255 PHE A CD2   1 
ATOM   2082 C  CE1   . PHE A 1 255 ? 8.025   38.479  8.839  1.00 29.78  ? 255 PHE A CE1   1 
ATOM   2083 C  CE2   . PHE A 1 255 ? 9.782   36.959  8.242  1.00 27.31  ? 255 PHE A CE2   1 
ATOM   2084 C  CZ    . PHE A 1 255 ? 9.189   38.197  8.132  1.00 29.35  ? 255 PHE A CZ    1 
ATOM   2085 N  N     . TYR A 1 256 ? 4.677   35.671  9.587  1.00 31.18  ? 256 TYR A N     1 
ATOM   2086 C  CA    . TYR A 1 256 ? 3.657   36.321  8.770  1.00 33.02  ? 256 TYR A CA    1 
ATOM   2087 C  C     . TYR A 1 256 ? 3.654   37.837  8.723  1.00 34.22  ? 256 TYR A C     1 
ATOM   2088 O  O     . TYR A 1 256 ? 3.923   38.502  9.720  1.00 34.45  ? 256 TYR A O     1 
ATOM   2089 C  CB    . TYR A 1 256 ? 2.247   35.909  9.203  1.00 31.20  ? 256 TYR A CB    1 
ATOM   2090 C  CG    . TYR A 1 256 ? 1.878   34.476  8.922  1.00 33.17  ? 256 TYR A CG    1 
ATOM   2091 C  CD1   . TYR A 1 256 ? 2.282   33.447  9.781  1.00 30.13  ? 256 TYR A CD1   1 
ATOM   2092 C  CD2   . TYR A 1 256 ? 1.078   34.156  7.823  1.00 32.01  ? 256 TYR A CD2   1 
ATOM   2093 C  CE1   . TYR A 1 256 ? 1.884   32.141  9.548  1.00 35.38  ? 256 TYR A CE1   1 
ATOM   2094 C  CE2   . TYR A 1 256 ? 0.673   32.855  7.575  1.00 33.79  ? 256 TYR A CE2   1 
ATOM   2095 C  CZ    . TYR A 1 256 ? 1.077   31.854  8.432  1.00 34.98  ? 256 TYR A CZ    1 
ATOM   2096 O  OH    . TYR A 1 256 ? 0.704   30.575  8.171  1.00 35.60  ? 256 TYR A OH    1 
ATOM   2097 N  N     . ILE A 1 257 ? 3.345   38.367  7.547  1.00 33.54  ? 257 ILE A N     1 
ATOM   2098 C  CA    . ILE A 1 257 ? 3.167   39.792  7.398  1.00 35.07  ? 257 ILE A CA    1 
ATOM   2099 C  C     . ILE A 1 257 ? 1.653   39.924  7.165  1.00 35.19  ? 257 ILE A C     1 
ATOM   2100 O  O     . ILE A 1 257 ? 1.055   39.249  6.325  1.00 37.32  ? 257 ILE A O     1 
ATOM   2101 C  CB    . ILE A 1 257 ? 4.013   40.379  6.256  1.00 36.26  ? 257 ILE A CB    1 
ATOM   2102 C  CG1   . ILE A 1 257 ? 5.481   40.380  6.716  1.00 36.73  ? 257 ILE A CG1   1 
ATOM   2103 C  CG2   . ILE A 1 257 ? 3.570   41.836  5.958  1.00 35.50  ? 257 ILE A CG2   1 
ATOM   2104 C  CD1   . ILE A 1 257 ? 6.417   41.219  5.903  1.00 39.70  ? 257 ILE A CD1   1 
ATOM   2105 N  N     . VAL A 1 258 ? 1.025   40.753  7.965  1.00 34.12  ? 258 VAL A N     1 
ATOM   2106 C  CA    . VAL A 1 258 ? -0.404  40.909  7.901  1.00 35.17  ? 258 VAL A CA    1 
ATOM   2107 C  C     . VAL A 1 258 ? -0.773  42.325  7.446  1.00 37.50  ? 258 VAL A C     1 
ATOM   2108 O  O     . VAL A 1 258 ? -0.347  43.304  8.041  1.00 37.69  ? 258 VAL A O     1 
ATOM   2109 C  CB    . VAL A 1 258 ? -1.039  40.633  9.298  1.00 34.14  ? 258 VAL A CB    1 
ATOM   2110 C  CG1   . VAL A 1 258 ? -2.554  40.621  9.181  1.00 32.03  ? 258 VAL A CG1   1 
ATOM   2111 C  CG2   . VAL A 1 258 ? -0.481  39.283  9.930  1.00 29.62  ? 258 VAL A CG2   1 
ATOM   2112 N  N     . GLU A 1 259 ? -1.539  42.427  6.370  1.00 38.67  ? 259 GLU A N     1 
ATOM   2113 C  CA    . GLU A 1 259 ? -1.981  43.735  5.894  1.00 40.47  ? 259 GLU A CA    1 
ATOM   2114 C  C     . GLU A 1 259 ? -3.495  43.656  5.776  1.00 41.02  ? 259 GLU A C     1 
ATOM   2115 O  O     . GLU A 1 259 ? -4.027  42.717  5.188  1.00 40.21  ? 259 GLU A O     1 
ATOM   2116 C  CB    . GLU A 1 259 ? -1.349  44.085  4.540  1.00 40.49  ? 259 GLU A CB    1 
ATOM   2117 C  CG    . GLU A 1 259 ? -1.733  45.479  4.061  1.00 44.91  ? 259 GLU A CG    1 
ATOM   2118 C  CD    . GLU A 1 259 ? -0.751  46.073  3.076  1.00 48.89  ? 259 GLU A CD    1 
ATOM   2119 O  OE1   . GLU A 1 259 ? -0.878  47.282  2.762  1.00 51.95  ? 259 GLU A OE1   1 
ATOM   2120 O  OE2   . GLU A 1 259 ? 0.157   45.345  2.618  1.00 51.58  ? 259 GLU A OE2   1 
ATOM   2121 N  N     . ASP A 1 260 ? -4.190  44.620  6.362  1.00 42.71  ? 260 ASP A N     1 
ATOM   2122 C  CA    . ASP A 1 260 ? -5.644  44.615  6.300  1.00 45.48  ? 260 ASP A CA    1 
ATOM   2123 C  C     . ASP A 1 260 ? -6.160  43.313  6.915  1.00 45.15  ? 260 ASP A C     1 
ATOM   2124 O  O     . ASP A 1 260 ? -7.150  42.749  6.456  1.00 44.81  ? 260 ASP A O     1 
ATOM   2125 C  CB    . ASP A 1 260 ? -6.106  44.735  4.837  1.00 50.48  ? 260 ASP A CB    1 
ATOM   2126 C  CG    . ASP A 1 260 ? -5.529  45.980  4.128  1.00 55.20  ? 260 ASP A CG    1 
ATOM   2127 O  OD1   . ASP A 1 260 ? -5.358  45.943  2.886  1.00 58.90  ? 260 ASP A OD1   1 
ATOM   2128 O  OD2   . ASP A 1 260 ? -5.250  47.002  4.800  1.00 57.49  ? 260 ASP A OD2   1 
ATOM   2129 N  N     . PHE A 1 261 ? -5.463  42.837  7.949  1.00 43.53  ? 261 PHE A N     1 
ATOM   2130 C  CA    . PHE A 1 261 ? -5.827  41.621  8.669  1.00 41.29  ? 261 PHE A CA    1 
ATOM   2131 C  C     . PHE A 1 261 ? -5.848  40.338  7.853  1.00 41.09  ? 261 PHE A C     1 
ATOM   2132 O  O     . PHE A 1 261 ? -6.438  39.325  8.249  1.00 40.64  ? 261 PHE A O     1 
ATOM   2133 C  CB    . PHE A 1 261 ? -7.151  41.836  9.368  1.00 40.49  ? 261 PHE A CB    1 
ATOM   2134 C  CG    . PHE A 1 261 ? -7.112  42.972  10.332 1.00 44.84  ? 261 PHE A CG    1 
ATOM   2135 C  CD1   . PHE A 1 261 ? -7.743  44.169  10.041 1.00 44.04  ? 261 PHE A CD1   1 
ATOM   2136 C  CD2   . PHE A 1 261 ? -6.377  42.869  11.516 1.00 44.87  ? 261 PHE A CD2   1 
ATOM   2137 C  CE1   . PHE A 1 261 ? -7.649  45.247  10.902 1.00 45.96  ? 261 PHE A CE1   1 
ATOM   2138 C  CE2   . PHE A 1 261 ? -6.277  43.952  12.388 1.00 44.51  ? 261 PHE A CE2   1 
ATOM   2139 C  CZ    . PHE A 1 261 ? -6.912  45.139  12.080 1.00 45.84  ? 261 PHE A CZ    1 
ATOM   2140 N  N     . LYS A 1 262 ? -5.166  40.391  6.719  1.00 39.76  ? 262 LYS A N     1 
ATOM   2141 C  CA    . LYS A 1 262 ? -5.045  39.258  5.828  1.00 39.07  ? 262 LYS A CA    1 
ATOM   2142 C  C     . LYS A 1 262 ? -3.601  38.821  6.026  1.00 37.78  ? 262 LYS A C     1 
ATOM   2143 O  O     . LYS A 1 262 ? -2.664  39.536  5.650  1.00 36.74  ? 262 LYS A O     1 
ATOM   2144 C  CB    . LYS A 1 262 ? -5.290  39.722  4.392  1.00 41.67  ? 262 LYS A CB    1 
ATOM   2145 C  CG    . LYS A 1 262 ? -5.283  38.623  3.371  1.00 46.16  ? 262 LYS A CG    1 
ATOM   2146 C  CD    . LYS A 1 262 ? -5.646  39.180  1.994  1.00 49.43  ? 262 LYS A CD    1 
ATOM   2147 C  CE    . LYS A 1 262 ? -5.845  38.068  0.973  1.00 49.49  ? 262 LYS A CE    1 
ATOM   2148 N  NZ    . LYS A 1 262 ? -6.397  38.613  -0.296 1.00 54.01  ? 262 LYS A NZ    1 
ATOM   2149 N  N     . PRO A 1 263 ? -3.395  37.653  6.648  1.00 38.83  ? 263 PRO A N     1 
ATOM   2150 C  CA    . PRO A 1 263 ? -2.024  37.201  6.871  1.00 38.99  ? 263 PRO A CA    1 
ATOM   2151 C  C     . PRO A 1 263 ? -1.388  36.615  5.629  1.00 40.40  ? 263 PRO A C     1 
ATOM   2152 O  O     . PRO A 1 263 ? -2.003  35.830  4.926  1.00 42.29  ? 263 PRO A O     1 
ATOM   2153 C  CB    . PRO A 1 263 ? -2.188  36.175  7.981  1.00 38.26  ? 263 PRO A CB    1 
ATOM   2154 C  CG    . PRO A 1 263 ? -3.529  35.551  7.643  1.00 38.57  ? 263 PRO A CG    1 
ATOM   2155 C  CD    . PRO A 1 263 ? -4.368  36.747  7.296  1.00 38.22  ? 263 PRO A CD    1 
ATOM   2156 N  N     . ARG A 1 264 ? -0.143  36.997  5.378  1.00 40.21  ? 264 ARG A N     1 
ATOM   2157 C  CA    . ARG A 1 264 ? 0.610   36.512  4.229  1.00 40.87  ? 264 ARG A CA    1 
ATOM   2158 C  C     . ARG A 1 264 ? 1.912   35.836  4.736  1.00 40.19  ? 264 ARG A C     1 
ATOM   2159 O  O     . ARG A 1 264 ? 2.742   36.465  5.395  1.00 41.31  ? 264 ARG A O     1 
ATOM   2160 C  CB    . ARG A 1 264 ? 0.936   37.694  3.325  1.00 40.16  ? 264 ARG A CB    1 
ATOM   2161 C  CG    . ARG A 1 264 ? 1.234   37.321  1.902  1.00 47.54  ? 264 ARG A CG    1 
ATOM   2162 C  CD    . ARG A 1 264 ? 2.560   37.911  1.457  1.00 49.69  ? 264 ARG A CD    1 
ATOM   2163 N  NE    . ARG A 1 264 ? 2.642   39.352  1.690  1.00 48.25  ? 264 ARG A NE    1 
ATOM   2164 C  CZ    . ARG A 1 264 ? 3.794   39.999  1.803  1.00 48.23  ? 264 ARG A CZ    1 
ATOM   2165 N  NH1   . ARG A 1 264 ? 4.940   39.328  1.707  1.00 46.72  ? 264 ARG A NH1   1 
ATOM   2166 N  NH2   . ARG A 1 264 ? 3.805   41.303  2.014  1.00 47.05  ? 264 ARG A NH2   1 
ATOM   2167 N  N     . PHE A 1 265 ? 2.091   34.561  4.426  1.00 39.03  ? 265 PHE A N     1 
ATOM   2168 C  CA    . PHE A 1 265 ? 3.273   33.841  4.875  1.00 37.42  ? 265 PHE A CA    1 
ATOM   2169 C  C     . PHE A 1 265 ? 4.556   34.230  4.150  1.00 37.71  ? 265 PHE A C     1 
ATOM   2170 O  O     . PHE A 1 265 ? 4.601   34.340  2.921  1.00 36.50  ? 265 PHE A O     1 
ATOM   2171 C  CB    . PHE A 1 265 ? 3.049   32.336  4.767  1.00 36.45  ? 265 PHE A CB    1 
ATOM   2172 C  CG    . PHE A 1 265 ? 4.243   31.518  5.171  1.00 39.36  ? 265 PHE A CG    1 
ATOM   2173 C  CD1   . PHE A 1 265 ? 4.666   31.480  6.495  1.00 37.87  ? 265 PHE A CD1   1 
ATOM   2174 C  CD2   . PHE A 1 265 ? 4.954   30.786  4.220  1.00 39.11  ? 265 PHE A CD2   1 
ATOM   2175 C  CE1   . PHE A 1 265 ? 5.780   30.720  6.864  1.00 39.67  ? 265 PHE A CE1   1 
ATOM   2176 C  CE2   . PHE A 1 265 ? 6.065   30.030  4.590  1.00 40.88  ? 265 PHE A CE2   1 
ATOM   2177 C  CZ    . PHE A 1 265 ? 6.474   30.001  5.916  1.00 37.24  ? 265 PHE A CZ    1 
ATOM   2178 N  N     . VAL A 1 266 ? 5.601   34.464  4.941  1.00 37.95  ? 266 VAL A N     1 
ATOM   2179 C  CA    . VAL A 1 266 ? 6.904   34.834  4.414  1.00 38.36  ? 266 VAL A CA    1 
ATOM   2180 C  C     . VAL A 1 266 ? 7.886   33.738  4.832  1.00 39.91  ? 266 VAL A C     1 
ATOM   2181 O  O     . VAL A 1 266 ? 8.160   33.534  6.016  1.00 40.82  ? 266 VAL A O     1 
ATOM   2182 C  CB    . VAL A 1 266 ? 7.373   36.209  4.952  1.00 37.53  ? 266 VAL A CB    1 
ATOM   2183 C  CG1   . VAL A 1 266 ? 8.714   36.575  4.326  1.00 35.22  ? 266 VAL A CG1   1 
ATOM   2184 C  CG2   . VAL A 1 266 ? 6.330   37.289  4.612  1.00 35.21  ? 266 VAL A CG2   1 
ATOM   2185 N  N     . GLU A 1 267 ? 8.389   33.010  3.849  1.00 39.95  ? 267 GLU A N     1 
ATOM   2186 C  CA    . GLU A 1 267 ? 9.294   31.931  4.130  1.00 41.70  ? 267 GLU A CA    1 
ATOM   2187 C  C     . GLU A 1 267 ? 10.722  32.385  4.276  1.00 41.62  ? 267 GLU A C     1 
ATOM   2188 O  O     . GLU A 1 267 ? 11.173  33.307  3.595  1.00 40.82  ? 267 GLU A O     1 
ATOM   2189 C  CB    . GLU A 1 267 ? 9.234   30.864  3.036  1.00 42.78  ? 267 GLU A CB    1 
ATOM   2190 C  CG    . GLU A 1 267 ? 9.980   29.584  3.449  1.00 48.54  ? 267 GLU A CG    1 
ATOM   2191 C  CD    . GLU A 1 267 ? 10.051  28.521  2.352  1.00 49.90  ? 267 GLU A CD    1 
ATOM   2192 O  OE1   . GLU A 1 267 ? 8.998   28.108  1.831  1.00 50.51  ? 267 GLU A OE1   1 
ATOM   2193 O  OE2   . GLU A 1 267 ? 11.176  28.096  2.022  1.00 52.58  ? 267 GLU A OE2   1 
ATOM   2194 N  N     . ILE A 1 268 ? 11.412  31.748  5.208  1.00 41.65  ? 268 ILE A N     1 
ATOM   2195 C  CA    . ILE A 1 268 ? 12.822  31.993  5.419  1.00 44.07  ? 268 ILE A CA    1 
ATOM   2196 C  C     . ILE A 1 268 ? 13.463  30.600  5.322  1.00 44.61  ? 268 ILE A C     1 
ATOM   2197 O  O     . ILE A 1 268 ? 13.121  29.684  6.065  1.00 41.73  ? 268 ILE A O     1 
ATOM   2198 C  CB    . ILE A 1 268 ? 13.106  32.626  6.772  1.00 45.79  ? 268 ILE A CB    1 
ATOM   2199 C  CG1   . ILE A 1 268 ? 12.654  34.091  6.751  1.00 46.84  ? 268 ILE A CG1   1 
ATOM   2200 C  CG2   . ILE A 1 268 ? 14.600  32.559  7.055  1.00 49.56  ? 268 ILE A CG2   1 
ATOM   2201 C  CD1   . ILE A 1 268 ? 12.990  34.881  8.009  1.00 46.26  ? 268 ILE A CD1   1 
ATOM   2202 N  N     . LYS A 1 269 ? 14.354  30.447  4.347  1.00 46.05  ? 269 LYS A N     1 
ATOM   2203 C  CA    . LYS A 1 269 ? 15.030  29.192  4.090  1.00 45.54  ? 269 LYS A CA    1 
ATOM   2204 C  C     . LYS A 1 269 ? 15.965  28.865  5.229  1.00 42.97  ? 269 LYS A C     1 
ATOM   2205 O  O     . LYS A 1 269 ? 16.810  29.661  5.611  1.00 44.50  ? 269 LYS A O     1 
ATOM   2206 C  CB    . LYS A 1 269 ? 15.774  29.293  2.762  1.00 51.48  ? 269 LYS A CB    1 
ATOM   2207 C  CG    . LYS A 1 269 ? 14.822  29.589  1.587  1.00 56.07  ? 269 LYS A CG    1 
ATOM   2208 C  CD    . LYS A 1 269 ? 15.590  29.748  0.285  1.00 60.25  ? 269 LYS A CD    1 
ATOM   2209 C  CE    . LYS A 1 269 ? 14.654  29.858  -0.908 1.00 61.98  ? 269 LYS A CE    1 
ATOM   2210 N  NZ    . LYS A 1 269 ? 15.439  29.743  -2.173 1.00 63.47  ? 269 LYS A NZ    1 
ATOM   2211 N  N     . VAL A 1 270 ? 15.810  27.663  5.748  1.00 39.73  ? 270 VAL A N     1 
ATOM   2212 C  CA    . VAL A 1 270 ? 16.564  27.208  6.890  1.00 38.88  ? 270 VAL A CA    1 
ATOM   2213 C  C     . VAL A 1 270 ? 17.129  25.792  6.655  1.00 39.39  ? 270 VAL A C     1 
ATOM   2214 O  O     . VAL A 1 270 ? 16.727  25.100  5.722  1.00 37.53  ? 270 VAL A O     1 
ATOM   2215 C  CB    . VAL A 1 270 ? 15.602  27.263  8.101  1.00 40.53  ? 270 VAL A CB    1 
ATOM   2216 C  CG1   . VAL A 1 270 ? 15.839  26.131  9.028  1.00 43.73  ? 270 VAL A CG1   1 
ATOM   2217 C  CG2   . VAL A 1 270 ? 15.732  28.612  8.798  1.00 39.05  ? 270 VAL A CG2   1 
ATOM   2218 N  N     . ARG A 1 271 ? 18.070  25.386  7.503  1.00 39.29  ? 271 ARG A N     1 
ATOM   2219 C  CA    . ARG A 1 271 ? 18.710  24.080  7.419  1.00 37.07  ? 271 ARG A CA    1 
ATOM   2220 C  C     . ARG A 1 271 ? 17.689  22.957  7.364  1.00 37.87  ? 271 ARG A C     1 
ATOM   2221 O  O     . ARG A 1 271 ? 16.736  22.923  8.140  1.00 36.27  ? 271 ARG A O     1 
ATOM   2222 C  CB    . ARG A 1 271 ? 19.624  23.863  8.632  1.00 37.45  ? 271 ARG A CB    1 
ATOM   2223 C  CG    . ARG A 1 271 ? 20.329  22.512  8.660  1.00 37.63  ? 271 ARG A CG    1 
ATOM   2224 C  CD    . ARG A 1 271 ? 21.116  22.289  9.967  1.00 37.52  ? 271 ARG A CD    1 
ATOM   2225 N  NE    . ARG A 1 271 ? 22.235  23.224  10.143 1.00 40.13  ? 271 ARG A NE    1 
ATOM   2226 C  CZ    . ARG A 1 271 ? 23.492  23.028  9.727  1.00 41.78  ? 271 ARG A CZ    1 
ATOM   2227 N  NH1   . ARG A 1 271 ? 24.407  23.959  9.965  1.00 39.75  ? 271 ARG A NH1   1 
ATOM   2228 N  NH2   . ARG A 1 271 ? 23.852  21.916  9.084  1.00 41.05  ? 271 ARG A NH2   1 
ATOM   2229 N  N     . PRO A 1 272 ? 17.884  22.000  6.448  1.00 37.81  ? 272 PRO A N     1 
ATOM   2230 C  CA    . PRO A 1 272 ? 16.892  20.923  6.406  1.00 37.65  ? 272 PRO A CA    1 
ATOM   2231 C  C     . PRO A 1 272 ? 17.087  19.870  7.488  1.00 36.88  ? 272 PRO A C     1 
ATOM   2232 O  O     . PRO A 1 272 ? 18.206  19.614  7.933  1.00 36.84  ? 272 PRO A O     1 
ATOM   2233 C  CB    . PRO A 1 272 ? 17.058  20.341  4.989  1.00 38.10  ? 272 PRO A CB    1 
ATOM   2234 C  CG    . PRO A 1 272 ? 18.483  20.594  4.664  1.00 38.01  ? 272 PRO A CG    1 
ATOM   2235 C  CD    . PRO A 1 272 ? 18.768  21.971  5.265  1.00 37.96  ? 272 PRO A CD    1 
ATOM   2236 N  N     . PHE A 1 273 ? 15.968  19.301  7.917  1.00 36.42  ? 273 PHE A N     1 
ATOM   2237 C  CA    . PHE A 1 273 ? 15.917  18.214  8.892  1.00 35.42  ? 273 PHE A CA    1 
ATOM   2238 C  C     . PHE A 1 273 ? 15.233  17.147  8.015  1.00 37.29  ? 273 PHE A C     1 
ATOM   2239 O  O     . PHE A 1 273 ? 14.204  17.421  7.389  1.00 36.71  ? 273 PHE A O     1 
ATOM   2240 C  CB    . PHE A 1 273 ? 14.997  18.557  10.069 1.00 34.27  ? 273 PHE A CB    1 
ATOM   2241 C  CG    . PHE A 1 273 ? 15.666  19.317  11.195 1.00 33.93  ? 273 PHE A CG    1 
ATOM   2242 C  CD1   . PHE A 1 273 ? 16.744  20.179  10.954 1.00 34.61  ? 273 PHE A CD1   1 
ATOM   2243 C  CD2   . PHE A 1 273 ? 15.183  19.195  12.493 1.00 31.61  ? 273 PHE A CD2   1 
ATOM   2244 C  CE1   . PHE A 1 273 ? 17.332  20.915  12.000 1.00 34.91  ? 273 PHE A CE1   1 
ATOM   2245 C  CE2   . PHE A 1 273 ? 15.752  19.926  13.553 1.00 35.59  ? 273 PHE A CE2   1 
ATOM   2246 C  CZ    . PHE A 1 273 ? 16.831  20.790  13.309 1.00 33.34  ? 273 PHE A CZ    1 
ATOM   2247 N  N     . ILE A 1 274 ? 15.809  15.955  7.950  1.00 35.90  ? 274 ILE A N     1 
ATOM   2248 C  CA    . ILE A 1 274 ? 15.252  14.892  7.134  1.00 34.49  ? 274 ILE A CA    1 
ATOM   2249 C  C     . ILE A 1 274 ? 14.878  13.784  8.099  1.00 34.71  ? 274 ILE A C     1 
ATOM   2250 O  O     . ILE A 1 274 ? 15.706  13.373  8.910  1.00 34.91  ? 274 ILE A O     1 
ATOM   2251 C  CB    . ILE A 1 274 ? 16.316  14.366  6.124  1.00 35.20  ? 274 ILE A CB    1 
ATOM   2252 C  CG1   . ILE A 1 274 ? 16.869  15.515  5.287  1.00 36.29  ? 274 ILE A CG1   1 
ATOM   2253 C  CG2   . ILE A 1 274 ? 15.708  13.333  5.192  1.00 34.42  ? 274 ILE A CG2   1 
ATOM   2254 C  CD1   . ILE A 1 274 ? 15.826  16.148  4.366  1.00 38.54  ? 274 ILE A CD1   1 
ATOM   2255 N  N     . ASP A 1 275 ? 13.631  13.323  8.050  1.00 34.86  ? 275 ASP A N     1 
ATOM   2256 C  CA    . ASP A 1 275 ? 13.208  12.234  8.931  1.00 37.07  ? 275 ASP A CA    1 
ATOM   2257 C  C     . ASP A 1 275 ? 13.118  10.986  8.039  1.00 38.70  ? 275 ASP A C     1 
ATOM   2258 O  O     . ASP A 1 275 ? 12.601  11.050  6.915  1.00 38.97  ? 275 ASP A O     1 
ATOM   2259 C  CB    . ASP A 1 275 ? 11.846  12.517  9.560  1.00 37.01  ? 275 ASP A CB    1 
ATOM   2260 C  CG    . ASP A 1 275 ? 11.587  11.653  10.782 1.00 40.68  ? 275 ASP A CG    1 
ATOM   2261 O  OD1   . ASP A 1 275 ? 10.411  11.418  11.113 1.00 41.84  ? 275 ASP A OD1   1 
ATOM   2262 O  OD2   . ASP A 1 275 ? 12.559  11.204  11.431 1.00 41.23  ? 275 ASP A OD2   1 
ATOM   2263 N  N     . VAL A 1 276 ? 13.627  9.862   8.536  1.00 39.02  ? 276 VAL A N     1 
ATOM   2264 C  CA    . VAL A 1 276 ? 13.639  8.628   7.761  1.00 39.02  ? 276 VAL A CA    1 
ATOM   2265 C  C     . VAL A 1 276 ? 13.081  7.431   8.523  1.00 40.59  ? 276 VAL A C     1 
ATOM   2266 O  O     . VAL A 1 276 ? 13.410  7.186   9.687  1.00 41.52  ? 276 VAL A O     1 
ATOM   2267 C  CB    . VAL A 1 276 ? 15.086  8.289   7.276  1.00 37.33  ? 276 VAL A CB    1 
ATOM   2268 C  CG1   . VAL A 1 276 ? 15.055  7.148   6.241  1.00 34.61  ? 276 VAL A CG1   1 
ATOM   2269 C  CG2   . VAL A 1 276 ? 15.733  9.526   6.674  1.00 33.35  ? 276 VAL A CG2   1 
ATOM   2270 N  N     . LYS A 1 277 ? 12.226  6.682   7.850  1.00 42.68  ? 277 LYS A N     1 
ATOM   2271 C  CA    . LYS A 1 277 ? 11.631  5.497   8.449  1.00 44.86  ? 277 LYS A CA    1 
ATOM   2272 C  C     . LYS A 1 277 ? 12.019  4.319   7.562  1.00 44.24  ? 277 LYS A C     1 
ATOM   2273 O  O     . LYS A 1 277 ? 11.783  4.338   6.352  1.00 43.69  ? 277 LYS A O     1 
ATOM   2274 C  CB    . LYS A 1 277 ? 10.114  5.649   8.497  1.00 47.26  ? 277 LYS A CB    1 
ATOM   2275 C  CG    . LYS A 1 277 ? 9.479   5.290   9.833  1.00 49.70  ? 277 LYS A CG    1 
ATOM   2276 C  CD    . LYS A 1 277 ? 7.961   5.310   9.717  0.00 49.13  ? 277 LYS A CD    1 
ATOM   2277 C  CE    . LYS A 1 277 ? 7.294   4.566   10.863 0.00 49.48  ? 277 LYS A CE    1 
ATOM   2278 N  NZ    . LYS A 1 277 ? 7.579   3.104   10.814 0.00 49.45  ? 277 LYS A NZ    1 
ATOM   2279 N  N     . ILE A 1 278 ? 12.652  3.321   8.162  1.00 44.74  ? 278 ILE A N     1 
ATOM   2280 C  CA    . ILE A 1 278 ? 13.084  2.133   7.440  1.00 45.58  ? 278 ILE A CA    1 
ATOM   2281 C  C     . ILE A 1 278 ? 12.873  0.962   8.364  1.00 47.53  ? 278 ILE A C     1 
ATOM   2282 O  O     . ILE A 1 278 ? 13.278  0.992   9.533  1.00 47.21  ? 278 ILE A O     1 
ATOM   2283 C  CB    . ILE A 1 278 ? 14.573  2.170   7.057  1.00 44.35  ? 278 ILE A CB    1 
ATOM   2284 C  CG1   . ILE A 1 278 ? 14.895  3.430   6.266  1.00 43.14  ? 278 ILE A CG1   1 
ATOM   2285 C  CG2   . ILE A 1 278 ? 14.900  0.974   6.170  1.00 46.53  ? 278 ILE A CG2   1 
ATOM   2286 C  CD1   . ILE A 1 278 ? 16.357  3.546   5.893  1.00 43.84  ? 278 ILE A CD1   1 
ATOM   2287 N  N     . LYS A 1 279 ? 12.233  -0.075  7.835  1.00 48.91  ? 279 LYS A N     1 
ATOM   2288 C  CA    . LYS A 1 279 ? 11.936  -1.263  8.623  1.00 49.52  ? 279 LYS A CA    1 
ATOM   2289 C  C     . LYS A 1 279 ? 12.356  -2.492  7.835  1.00 49.14  ? 279 LYS A C     1 
ATOM   2290 O  O     . LYS A 1 279 ? 12.337  -2.482  6.604  1.00 49.31  ? 279 LYS A O     1 
ATOM   2291 C  CB    . LYS A 1 279 ? 10.434  -1.298  8.926  1.00 51.41  ? 279 LYS A CB    1 
ATOM   2292 C  CG    . LYS A 1 279 ? 9.972   -2.427  9.819  1.00 53.97  ? 279 LYS A CG    1 
ATOM   2293 C  CD    . LYS A 1 279 ? 8.458   -2.441  9.954  0.00 53.44  ? 279 LYS A CD    1 
ATOM   2294 C  CE    . LYS A 1 279 ? 7.988   -3.638  10.766 0.00 53.78  ? 279 LYS A CE    1 
ATOM   2295 N  NZ    . LYS A 1 279 ? 6.505   -3.677  10.897 0.00 53.77  ? 279 LYS A NZ    1 
ATOM   2296 N  N     . GLY A 1 280 ? 12.769  -3.540  8.542  1.00 49.73  ? 280 GLY A N     1 
ATOM   2297 C  CA    . GLY A 1 280 ? 13.176  -4.757  7.863  1.00 49.20  ? 280 GLY A CA    1 
ATOM   2298 C  C     . GLY A 1 280 ? 14.429  -5.410  8.405  1.00 49.72  ? 280 GLY A C     1 
ATOM   2299 O  O     . GLY A 1 280 ? 14.886  -5.107  9.505  1.00 50.25  ? 280 GLY A O     1 
ATOM   2300 N  N     . SER A 1 281 ? 14.978  -6.332  7.626  1.00 48.65  ? 281 SER A N     1 
ATOM   2301 C  CA    . SER A 1 281 ? 16.186  -7.037  8.005  1.00 48.86  ? 281 SER A CA    1 
ATOM   2302 C  C     . SER A 1 281 ? 17.363  -6.098  7.779  1.00 49.25  ? 281 SER A C     1 
ATOM   2303 O  O     . SER A 1 281 ? 17.247  -5.104  7.050  1.00 49.23  ? 281 SER A O     1 
ATOM   2304 C  CB    . SER A 1 281 ? 16.366  -8.262  7.119  1.00 46.27  ? 281 SER A CB    1 
ATOM   2305 O  OG    . SER A 1 281 ? 16.637  -7.828  5.799  1.00 45.19  ? 281 SER A OG    1 
ATOM   2306 N  N     . GLU A 1 282 ? 18.504  -6.433  8.367  1.00 49.32  ? 282 GLU A N     1 
ATOM   2307 C  CA    . GLU A 1 282 ? 19.683  -5.600  8.205  1.00 50.58  ? 282 GLU A CA    1 
ATOM   2308 C  C     . GLU A 1 282 ? 19.977  -5.402  6.725  1.00 50.95  ? 282 GLU A C     1 
ATOM   2309 O  O     . GLU A 1 282 ? 20.312  -4.303  6.269  1.00 47.91  ? 282 GLU A O     1 
ATOM   2310 C  CB    . GLU A 1 282 ? 20.891  -6.246  8.871  1.00 51.00  ? 282 GLU A CB    1 
ATOM   2311 C  CG    . GLU A 1 282 ? 22.123  -5.387  8.792  1.00 52.00  ? 282 GLU A CG    1 
ATOM   2312 C  CD    . GLU A 1 282 ? 23.275  -5.935  9.602  1.00 53.94  ? 282 GLU A CD    1 
ATOM   2313 O  OE1   . GLU A 1 282 ? 24.271  -5.201  9.740  1.00 56.12  ? 282 GLU A OE1   1 
ATOM   2314 O  OE2   . GLU A 1 282 ? 23.190  -7.082  10.092 1.00 53.01  ? 282 GLU A OE2   1 
ATOM   2315 N  N     . GLU A 1 283 ? 19.850  -6.487  5.976  1.00 51.83  ? 283 GLU A N     1 
ATOM   2316 C  CA    . GLU A 1 283 ? 20.110  -6.456  4.539  1.00 53.40  ? 283 GLU A CA    1 
ATOM   2317 C  C     . GLU A 1 283 ? 19.170  -5.507  3.828  1.00 52.07  ? 283 GLU A C     1 
ATOM   2318 O  O     . GLU A 1 283 ? 19.594  -4.709  2.997  1.00 51.96  ? 283 GLU A O     1 
ATOM   2319 C  CB    . GLU A 1 283 ? 19.944  -7.856  3.961  1.00 55.60  ? 283 GLU A CB    1 
ATOM   2320 C  CG    . GLU A 1 283 ? 19.305  -8.823  4.936  1.00 59.73  ? 283 GLU A CG    1 
ATOM   2321 C  CD    . GLU A 1 283 ? 20.257  -9.255  6.037  1.00 61.78  ? 283 GLU A CD    1 
ATOM   2322 O  OE1   . GLU A 1 283 ? 19.777  -9.505  7.162  1.00 61.97  ? 283 GLU A OE1   1 
ATOM   2323 O  OE2   . GLU A 1 283 ? 21.479  -9.361  5.777  1.00 63.39  ? 283 GLU A OE2   1 
ATOM   2324 N  N     . GLU A 1 284 ? 17.888  -5.614  4.155  1.00 51.16  ? 284 GLU A N     1 
ATOM   2325 C  CA    . GLU A 1 284 ? 16.891  -4.747  3.555  1.00 51.54  ? 284 GLU A CA    1 
ATOM   2326 C  C     . GLU A 1 284 ? 17.245  -3.305  3.929  1.00 50.71  ? 284 GLU A C     1 
ATOM   2327 O  O     . GLU A 1 284 ? 17.191  -2.405  3.084  1.00 50.80  ? 284 GLU A O     1 
ATOM   2328 C  CB    . GLU A 1 284 ? 15.503  -5.108  4.085  1.00 51.63  ? 284 GLU A CB    1 
ATOM   2329 C  CG    . GLU A 1 284 ? 14.361  -4.359  3.439  1.00 54.09  ? 284 GLU A CG    1 
ATOM   2330 C  CD    . GLU A 1 284 ? 14.197  -4.674  1.962  1.00 56.94  ? 284 GLU A CD    1 
ATOM   2331 O  OE1   . GLU A 1 284 ? 13.407  -3.966  1.301  1.00 59.62  ? 284 GLU A OE1   1 
ATOM   2332 O  OE2   . GLU A 1 284 ? 14.844  -5.620  1.455  1.00 57.27  ? 284 GLU A OE2   1 
ATOM   2333 N  N     . ILE A 1 285 ? 17.623  -3.095  5.191  1.00 48.73  ? 285 ILE A N     1 
ATOM   2334 C  CA    . ILE A 1 285 ? 17.984  -1.760  5.661  1.00 47.82  ? 285 ILE A CA    1 
ATOM   2335 C  C     . ILE A 1 285 ? 19.206  -1.204  4.922  1.00 47.28  ? 285 ILE A C     1 
ATOM   2336 O  O     . ILE A 1 285 ? 19.253  -0.009  4.605  1.00 47.10  ? 285 ILE A O     1 
ATOM   2337 C  CB    . ILE A 1 285 ? 18.226  -1.756  7.187  1.00 47.15  ? 285 ILE A CB    1 
ATOM   2338 C  CG1   . ILE A 1 285 ? 16.921  -2.099  7.911  1.00 45.35  ? 285 ILE A CG1   1 
ATOM   2339 C  CG2   . ILE A 1 285 ? 18.734  -0.371  7.637  1.00 48.44  ? 285 ILE A CG2   1 
ATOM   2340 C  CD1   . ILE A 1 285 ? 17.082  -2.434  9.376  1.00 42.81  ? 285 ILE A CD1   1 
ATOM   2341 N  N     . ARG A 1 286 ? 20.179  -2.062  4.618  1.00 46.96  ? 286 ARG A N     1 
ATOM   2342 C  CA    . ARG A 1 286 ? 21.375  -1.609  3.891  1.00 47.60  ? 286 ARG A CA    1 
ATOM   2343 C  C     . ARG A 1 286 ? 20.995  -1.176  2.472  1.00 48.29  ? 286 ARG A C     1 
ATOM   2344 O  O     . ARG A 1 286 ? 21.518  -0.191  1.933  1.00 48.77  ? 286 ARG A O     1 
ATOM   2345 C  CB    . ARG A 1 286 ? 22.434  -2.721  3.818  1.00 46.70  ? 286 ARG A CB    1 
ATOM   2346 C  CG    . ARG A 1 286 ? 23.577  -2.419  2.833  1.00 45.69  ? 286 ARG A CG    1 
ATOM   2347 C  CD    . ARG A 1 286 ? 24.603  -3.551  2.788  1.00 45.65  ? 286 ARG A CD    1 
ATOM   2348 N  NE    . ARG A 1 286 ? 25.136  -3.813  4.115  1.00 46.36  ? 286 ARG A NE    1 
ATOM   2349 C  CZ    . ARG A 1 286 ? 24.872  -4.902  4.829  1.00 48.63  ? 286 ARG A CZ    1 
ATOM   2350 N  NH1   . ARG A 1 286 ? 25.401  -5.038  6.043  1.00 47.92  ? 286 ARG A NH1   1 
ATOM   2351 N  NH2   . ARG A 1 286 ? 24.096  -5.863  4.327  1.00 46.50  ? 286 ARG A NH2   1 
ATOM   2352 N  N     . LYS A 1 287 ? 20.089  -1.937  1.874  1.00 47.77  ? 287 LYS A N     1 
ATOM   2353 C  CA    . LYS A 1 287 ? 19.595  -1.656  0.543  1.00 48.45  ? 287 LYS A CA    1 
ATOM   2354 C  C     . LYS A 1 287 ? 18.958  -0.269  0.543  1.00 48.26  ? 287 LYS A C     1 
ATOM   2355 O  O     . LYS A 1 287 ? 19.254  0.566   -0.303 1.00 48.77  ? 287 LYS A O     1 
ATOM   2356 C  CB    . LYS A 1 287 ? 18.547  -2.704  0.170  1.00 51.36  ? 287 LYS A CB    1 
ATOM   2357 C  CG    . LYS A 1 287 ? 17.810  -2.435  -1.129 1.00 56.21  ? 287 LYS A CG    1 
ATOM   2358 C  CD    . LYS A 1 287 ? 16.657  -3.425  -1.333 1.00 58.79  ? 287 LYS A CD    1 
ATOM   2359 C  CE    . LYS A 1 287 ? 15.977  -3.191  -2.680 1.00 62.07  ? 287 LYS A CE    1 
ATOM   2360 N  NZ    . LYS A 1 287 ? 14.755  -4.034  -2.853 1.00 65.75  ? 287 LYS A NZ    1 
ATOM   2361 N  N     . ALA A 1 288 ? 18.071  -0.039  1.500  1.00 47.21  ? 288 ALA A N     1 
ATOM   2362 C  CA    . ALA A 1 288 ? 17.371  1.234   1.619  1.00 46.94  ? 288 ALA A CA    1 
ATOM   2363 C  C     . ALA A 1 288 ? 18.329  2.400   1.870  1.00 46.73  ? 288 ALA A C     1 
ATOM   2364 O  O     . ALA A 1 288 ? 18.243  3.435   1.199  1.00 46.23  ? 288 ALA A O     1 
ATOM   2365 C  CB    . ALA A 1 288 ? 16.336  1.145   2.743  1.00 45.90  ? 288 ALA A CB    1 
ATOM   2366 N  N     . ILE A 1 289 ? 19.245  2.231   2.824  1.00 47.00  ? 289 ILE A N     1 
ATOM   2367 C  CA    . ILE A 1 289 ? 20.214  3.286   3.156  1.00 46.13  ? 289 ILE A CA    1 
ATOM   2368 C  C     . ILE A 1 289 ? 21.036  3.717   1.933  1.00 47.28  ? 289 ILE A C     1 
ATOM   2369 O  O     . ILE A 1 289 ? 21.415  4.882   1.810  1.00 46.73  ? 289 ILE A O     1 
ATOM   2370 C  CB    . ILE A 1 289 ? 21.182  2.817   4.279  1.00 45.66  ? 289 ILE A CB    1 
ATOM   2371 C  CG1   . ILE A 1 289 ? 20.475  2.866   5.634  1.00 44.94  ? 289 ILE A CG1   1 
ATOM   2372 C  CG2   . ILE A 1 289 ? 22.458  3.670   4.281  1.00 43.36  ? 289 ILE A CG2   1 
ATOM   2373 C  CD1   . ILE A 1 289 ? 20.139  4.252   6.111  1.00 45.54  ? 289 ILE A CD1   1 
ATOM   2374 N  N     . LYS A 1 290 ? 21.319  2.766   1.045  1.00 47.13  ? 290 LYS A N     1 
ATOM   2375 C  CA    . LYS A 1 290 ? 22.081  3.055   -0.155 1.00 48.73  ? 290 LYS A CA    1 
ATOM   2376 C  C     . LYS A 1 290 ? 21.261  3.961   -1.085 1.00 48.39  ? 290 LYS A C     1 
ATOM   2377 O  O     . LYS A 1 290 ? 21.809  4.876   -1.708 1.00 47.05  ? 290 LYS A O     1 
ATOM   2378 C  CB    . LYS A 1 290 ? 22.452  1.747   -0.870 1.00 53.30  ? 290 LYS A CB    1 
ATOM   2379 C  CG    . LYS A 1 290 ? 23.306  1.933   -2.120 1.00 55.87  ? 290 LYS A CG    1 
ATOM   2380 C  CD    . LYS A 1 290 ? 23.784  0.595   -2.684 1.00 59.89  ? 290 LYS A CD    1 
ATOM   2381 C  CE    . LYS A 1 290 ? 24.692  0.807   -3.903 1.00 62.30  ? 290 LYS A CE    1 
ATOM   2382 N  NZ    . LYS A 1 290 ? 25.121  -0.497  -4.502 1.00 65.33  ? 290 LYS A NZ    1 
ATOM   2383 N  N     . ARG A 1 291 ? 19.955  3.709   -1.176 1.00 47.05  ? 291 ARG A N     1 
ATOM   2384 C  CA    . ARG A 1 291 ? 19.085  4.532   -2.012 1.00 48.46  ? 291 ARG A CA    1 
ATOM   2385 C  C     . ARG A 1 291 ? 18.808  5.893   -1.344 1.00 48.31  ? 291 ARG A C     1 
ATOM   2386 O  O     . ARG A 1 291 ? 18.441  6.860   -2.006 1.00 48.15  ? 291 ARG A O     1 
ATOM   2387 C  CB    . ARG A 1 291 ? 17.769  3.793   -2.311 1.00 49.45  ? 291 ARG A CB    1 
ATOM   2388 C  CG    . ARG A 1 291 ? 17.912  2.731   -3.411 1.00 52.39  ? 291 ARG A CG    1 
ATOM   2389 C  CD    . ARG A 1 291 ? 16.715  1.811   -3.536 0.00 52.70  ? 291 ARG A CD    1 
ATOM   2390 N  NE    . ARG A 1 291 ? 17.002  0.733   -4.480 0.00 53.78  ? 291 ARG A NE    1 
ATOM   2391 C  CZ    . ARG A 1 291 ? 16.172  -0.265  -4.762 0.00 54.19  ? 291 ARG A CZ    1 
ATOM   2392 N  NH1   . ARG A 1 291 ? 16.530  -1.196  -5.635 0.00 54.53  ? 291 ARG A NH1   1 
ATOM   2393 N  NH2   . ARG A 1 291 ? 14.987  -0.334  -4.174 0.00 54.53  ? 291 ARG A NH2   1 
ATOM   2394 N  N     . LEU A 1 292 ? 19.005  5.968   -0.032 1.00 47.00  ? 292 LEU A N     1 
ATOM   2395 C  CA    . LEU A 1 292 ? 18.785  7.218   0.684  1.00 45.06  ? 292 LEU A CA    1 
ATOM   2396 C  C     . LEU A 1 292 ? 19.947  8.211   0.499  1.00 44.74  ? 292 LEU A C     1 
ATOM   2397 O  O     . LEU A 1 292 ? 19.726  9.405   0.353  1.00 43.69  ? 292 LEU A O     1 
ATOM   2398 C  CB    . LEU A 1 292 ? 18.584  6.929   2.173  1.00 42.83  ? 292 LEU A CB    1 
ATOM   2399 C  CG    . LEU A 1 292 ? 18.523  8.150   3.092  1.00 43.12  ? 292 LEU A CG    1 
ATOM   2400 C  CD1   . LEU A 1 292 ? 17.216  8.913   2.840  1.00 40.48  ? 292 LEU A CD1   1 
ATOM   2401 C  CD2   . LEU A 1 292 ? 18.620  7.709   4.553  1.00 40.35  ? 292 LEU A CD2   1 
ATOM   2402 N  N     . ILE A 1 293 ? 21.180  7.712   0.492  1.00 45.82  ? 293 ILE A N     1 
ATOM   2403 C  CA    . ILE A 1 293 ? 22.364  8.571   0.360  1.00 47.35  ? 293 ILE A CA    1 
ATOM   2404 C  C     . ILE A 1 293 ? 22.234  9.726   -0.642 1.00 48.05  ? 293 ILE A C     1 
ATOM   2405 O  O     . ILE A 1 293 ? 22.562  10.877  -0.334 1.00 49.31  ? 293 ILE A O     1 
ATOM   2406 C  CB    . ILE A 1 293 ? 23.627  7.760   -0.039 1.00 48.04  ? 293 ILE A CB    1 
ATOM   2407 C  CG1   . ILE A 1 293 ? 23.935  6.677   1.004  1.00 49.69  ? 293 ILE A CG1   1 
ATOM   2408 C  CG2   . ILE A 1 293 ? 24.805  8.702   -0.217 1.00 45.34  ? 293 ILE A CG2   1 
ATOM   2409 C  CD1   . ILE A 1 293 ? 24.186  7.193   2.427  1.00 51.42  ? 293 ILE A CD1   1 
ATOM   2410 N  N     . PRO A 1 294 ? 21.765  9.438   -1.860 1.00 48.83  ? 294 PRO A N     1 
ATOM   2411 C  CA    . PRO A 1 294 ? 21.660  10.566  -2.797 1.00 49.36  ? 294 PRO A CA    1 
ATOM   2412 C  C     . PRO A 1 294 ? 20.536  11.572  -2.501 1.00 49.26  ? 294 PRO A C     1 
ATOM   2413 O  O     . PRO A 1 294 ? 20.526  12.671  -3.054 1.00 49.36  ? 294 PRO A O     1 
ATOM   2414 C  CB    . PRO A 1 294 ? 21.494  9.869   -4.155 1.00 48.49  ? 294 PRO A CB    1 
ATOM   2415 C  CG    . PRO A 1 294 ? 20.758  8.600   -3.776 1.00 49.29  ? 294 PRO A CG    1 
ATOM   2416 C  CD    . PRO A 1 294 ? 21.423  8.153   -2.503 1.00 46.32  ? 294 PRO A CD    1 
ATOM   2417 N  N     . LEU A 1 295 ? 19.599  11.210  -1.630 1.00 48.40  ? 295 LEU A N     1 
ATOM   2418 C  CA    . LEU A 1 295 ? 18.489  12.107  -1.324 1.00 48.45  ? 295 LEU A CA    1 
ATOM   2419 C  C     . LEU A 1 295 ? 18.818  13.137  -0.249 1.00 48.35  ? 295 LEU A C     1 
ATOM   2420 O  O     . LEU A 1 295 ? 18.130  14.148  -0.114 1.00 48.83  ? 295 LEU A O     1 
ATOM   2421 C  CB    . LEU A 1 295 ? 17.268  11.304  -0.873 1.00 48.05  ? 295 LEU A CB    1 
ATOM   2422 C  CG    . LEU A 1 295 ? 16.677  10.257  -1.820 1.00 47.87  ? 295 LEU A CG    1 
ATOM   2423 C  CD1   . LEU A 1 295 ? 15.512  9.593   -1.124 1.00 47.42  ? 295 LEU A CD1   1 
ATOM   2424 C  CD2   . LEU A 1 295 ? 16.218  10.912  -3.133 1.00 47.48  ? 295 LEU A CD2   1 
ATOM   2425 N  N     . ILE A 1 296 ? 19.883  12.887  0.497  1.00 48.15  ? 296 ILE A N     1 
ATOM   2426 C  CA    . ILE A 1 296 ? 20.280  13.767  1.596  1.00 48.02  ? 296 ILE A CA    1 
ATOM   2427 C  C     . ILE A 1 296 ? 21.374  14.803  1.354  1.00 47.85  ? 296 ILE A C     1 
ATOM   2428 O  O     . ILE A 1 296 ? 22.504  14.450  1.038  1.00 46.39  ? 296 ILE A O     1 
ATOM   2429 C  CB    . ILE A 1 296 ? 20.770  12.938  2.790  1.00 48.44  ? 296 ILE A CB    1 
ATOM   2430 C  CG1   . ILE A 1 296 ? 19.685  11.965  3.224  1.00 48.02  ? 296 ILE A CG1   1 
ATOM   2431 C  CG2   . ILE A 1 296 ? 21.200  13.862  3.927  1.00 47.88  ? 296 ILE A CG2   1 
ATOM   2432 C  CD1   . ILE A 1 296 ? 20.168  11.004  4.250  1.00 51.87  ? 296 ILE A CD1   1 
ATOM   2433 N  N     . PRO A 1 297 ? 21.056  16.099  1.514  1.00 48.57  ? 297 PRO A N     1 
ATOM   2434 C  CA    . PRO A 1 297 ? 22.121  17.093  1.308  1.00 49.35  ? 297 PRO A CA    1 
ATOM   2435 C  C     . PRO A 1 297 ? 23.058  17.016  2.517  1.00 50.61  ? 297 PRO A C     1 
ATOM   2436 O  O     . PRO A 1 297 ? 22.608  16.717  3.622  1.00 51.20  ? 297 PRO A O     1 
ATOM   2437 C  CB    . PRO A 1 297 ? 21.368  18.415  1.228  1.00 49.76  ? 297 PRO A CB    1 
ATOM   2438 C  CG    . PRO A 1 297 ? 20.064  18.136  1.951  1.00 50.77  ? 297 PRO A CG    1 
ATOM   2439 C  CD    . PRO A 1 297 ? 19.727  16.726  1.592  1.00 47.00  ? 297 PRO A CD    1 
ATOM   2440 N  N     . LYS A 1 298 ? 24.351  17.263  2.304  1.00 51.42  ? 298 LYS A N     1 
ATOM   2441 C  CA    . LYS A 1 298 ? 25.368  17.202  3.370  1.00 51.52  ? 298 LYS A CA    1 
ATOM   2442 C  C     . LYS A 1 298 ? 25.112  18.042  4.625  1.00 51.19  ? 298 LYS A C     1 
ATOM   2443 O  O     . LYS A 1 298 ? 25.433  17.606  5.745  1.00 51.99  ? 298 LYS A O     1 
ATOM   2444 C  CB    . LYS A 1 298 ? 26.745  17.582  2.803  1.00 53.12  ? 298 LYS A CB    1 
ATOM   2445 C  CG    . LYS A 1 298 ? 27.888  17.545  3.802  0.00 53.03  ? 298 LYS A CG    1 
ATOM   2446 C  CD    . LYS A 1 298 ? 29.194  17.946  3.133  0.00 53.55  ? 298 LYS A CD    1 
ATOM   2447 C  CE    . LYS A 1 298 ? 30.358  17.919  4.108  0.00 53.75  ? 298 LYS A CE    1 
ATOM   2448 N  NZ    . LYS A 1 298 ? 31.635  18.312  3.449  0.00 53.94  ? 298 LYS A NZ    1 
ATOM   2449 N  N     . ASN A 1 299 ? 24.537  19.231  4.455  1.00 47.98  ? 299 ASN A N     1 
ATOM   2450 C  CA    . ASN A 1 299 ? 24.275  20.097  5.599  1.00 46.81  ? 299 ASN A CA    1 
ATOM   2451 C  C     . ASN A 1 299 ? 23.015  19.698  6.381  1.00 45.63  ? 299 ASN A C     1 
ATOM   2452 O  O     . ASN A 1 299 ? 22.631  20.351  7.348  1.00 45.35  ? 299 ASN A O     1 
ATOM   2453 C  CB    . ASN A 1 299 ? 24.152  21.538  5.117  1.00 48.48  ? 299 ASN A CB    1 
ATOM   2454 C  CG    . ASN A 1 299 ? 22.911  21.762  4.274  1.00 52.41  ? 299 ASN A CG    1 
ATOM   2455 O  OD1   . ASN A 1 299 ? 22.506  20.899  3.475  1.00 51.85  ? 299 ASN A OD1   1 
ATOM   2456 N  ND2   . ASN A 1 299 ? 22.304  22.935  4.434  1.00 53.01  ? 299 ASN A ND2   1 
ATOM   2457 N  N     . ALA A 1 300 ? 22.372  18.616  5.978  1.00 42.09  ? 300 ALA A N     1 
ATOM   2458 C  CA    . ALA A 1 300 ? 21.166  18.212  6.670  1.00 41.61  ? 300 ALA A CA    1 
ATOM   2459 C  C     . ALA A 1 300 ? 21.376  17.547  8.020  1.00 39.48  ? 300 ALA A C     1 
ATOM   2460 O  O     . ALA A 1 300 ? 22.421  16.974  8.308  1.00 39.44  ? 300 ALA A O     1 
ATOM   2461 C  CB    . ALA A 1 300 ? 20.332  17.276  5.773  1.00 40.05  ? 300 ALA A CB    1 
ATOM   2462 N  N     . TYR A 1 301 ? 20.349  17.638  8.848  1.00 37.14  ? 301 TYR A N     1 
ATOM   2463 C  CA    . TYR A 1 301 ? 20.338  16.976  10.125 1.00 37.00  ? 301 TYR A CA    1 
ATOM   2464 C  C     . TYR A 1 301 ? 19.381  15.822  9.821  1.00 37.38  ? 301 TYR A C     1 
ATOM   2465 O  O     . TYR A 1 301 ? 18.331  16.017  9.209  1.00 37.36  ? 301 TYR A O     1 
ATOM   2466 C  CB    . TYR A 1 301 ? 19.804  17.910  11.204 1.00 38.16  ? 301 TYR A CB    1 
ATOM   2467 C  CG    . TYR A 1 301 ? 20.874  18.803  11.827 1.00 38.27  ? 301 TYR A CG    1 
ATOM   2468 C  CD1   . TYR A 1 301 ? 22.069  19.085  11.151 1.00 37.71  ? 301 TYR A CD1   1 
ATOM   2469 C  CD2   . TYR A 1 301 ? 20.675  19.380  13.084 1.00 37.42  ? 301 TYR A CD2   1 
ATOM   2470 C  CE1   . TYR A 1 301 ? 23.036  19.929  11.720 1.00 41.45  ? 301 TYR A CE1   1 
ATOM   2471 C  CE2   . TYR A 1 301 ? 21.624  20.218  13.660 1.00 39.65  ? 301 TYR A CE2   1 
ATOM   2472 C  CZ    . TYR A 1 301 ? 22.799  20.497  12.981 1.00 40.65  ? 301 TYR A CZ    1 
ATOM   2473 O  OH    . TYR A 1 301 ? 23.707  21.369  13.539 1.00 40.31  ? 301 TYR A OH    1 
ATOM   2474 N  N     . VAL A 1 302 ? 19.738  14.619  10.241 1.00 37.47  ? 302 VAL A N     1 
ATOM   2475 C  CA    . VAL A 1 302 ? 18.933  13.465  9.917  1.00 36.27  ? 302 VAL A CA    1 
ATOM   2476 C  C     . VAL A 1 302 ? 18.591  12.588  11.089 1.00 37.77  ? 302 VAL A C     1 
ATOM   2477 O  O     . VAL A 1 302 ? 19.427  12.350  11.963 1.00 37.04  ? 302 VAL A O     1 
ATOM   2478 C  CB    . VAL A 1 302 ? 19.687  12.585  8.883  1.00 37.70  ? 302 VAL A CB    1 
ATOM   2479 C  CG1   . VAL A 1 302 ? 18.854  11.364  8.489  1.00 35.30  ? 302 VAL A CG1   1 
ATOM   2480 C  CG2   . VAL A 1 302 ? 20.083  13.441  7.661  1.00 36.33  ? 302 VAL A CG2   1 
ATOM   2481 N  N     . ARG A 1 303 ? 17.349  12.117  11.113 1.00 36.86  ? 303 ARG A N     1 
ATOM   2482 C  CA    . ARG A 1 303 ? 16.944  11.173  12.127 1.00 37.39  ? 303 ARG A CA    1 
ATOM   2483 C  C     . ARG A 1 303 ? 16.526  9.889   11.381 1.00 40.06  ? 303 ARG A C     1 
ATOM   2484 O  O     . ARG A 1 303 ? 15.776  9.944   10.391 1.00 38.08  ? 303 ARG A O     1 
ATOM   2485 C  CB    . ARG A 1 303 ? 15.766  11.665  12.955 1.00 37.41  ? 303 ARG A CB    1 
ATOM   2486 C  CG    . ARG A 1 303 ? 15.247  10.545  13.837 1.00 38.49  ? 303 ARG A CG    1 
ATOM   2487 C  CD    . ARG A 1 303 ? 14.172  10.959  14.823 1.00 41.71  ? 303 ARG A CD    1 
ATOM   2488 N  NE    . ARG A 1 303 ? 12.917  11.290  14.167 1.00 44.25  ? 303 ARG A NE    1 
ATOM   2489 C  CZ    . ARG A 1 303 ? 11.782  11.572  14.802 1.00 46.12  ? 303 ARG A CZ    1 
ATOM   2490 N  NH1   . ARG A 1 303 ? 10.698  11.866  14.096 1.00 47.01  ? 303 ARG A NH1   1 
ATOM   2491 N  NH2   . ARG A 1 303 ? 11.719  11.550  16.131 1.00 44.15  ? 303 ARG A NH2   1 
ATOM   2492 N  N     . LEU A 1 304 ? 17.043  8.747   11.835 1.00 40.68  ? 304 LEU A N     1 
ATOM   2493 C  CA    . LEU A 1 304 ? 16.688  7.470   11.238 1.00 43.12  ? 304 LEU A CA    1 
ATOM   2494 C  C     . LEU A 1 304 ? 15.946  6.691   12.301 1.00 43.78  ? 304 LEU A C     1 
ATOM   2495 O  O     . LEU A 1 304 ? 16.458  6.510   13.408 1.00 43.52  ? 304 LEU A O     1 
ATOM   2496 C  CB    . LEU A 1 304 ? 17.918  6.653   10.837 1.00 43.37  ? 304 LEU A CB    1 
ATOM   2497 C  CG    . LEU A 1 304 ? 19.005  7.195   9.922  1.00 46.95  ? 304 LEU A CG    1 
ATOM   2498 C  CD1   . LEU A 1 304 ? 20.043  6.079   9.723  1.00 47.31  ? 304 LEU A CD1   1 
ATOM   2499 C  CD2   . LEU A 1 304 ? 18.424  7.629   8.579  1.00 47.46  ? 304 LEU A CD2   1 
ATOM   2500 N  N     . ASN A 1 305 ? 14.739  6.250   11.969 1.00 45.41  ? 305 ASN A N     1 
ATOM   2501 C  CA    . ASN A 1 305 ? 13.932  5.448   12.880 1.00 46.74  ? 305 ASN A CA    1 
ATOM   2502 C  C     . ASN A 1 305 ? 14.047  4.088   12.244 1.00 46.70  ? 305 ASN A C     1 
ATOM   2503 O  O     . ASN A 1 305 ? 13.526  3.856   11.156 1.00 47.21  ? 305 ASN A O     1 
ATOM   2504 C  CB    . ASN A 1 305 ? 12.468  5.894   12.873 1.00 49.93  ? 305 ASN A CB    1 
ATOM   2505 C  CG    . ASN A 1 305 ? 12.312  7.385   13.110 1.00 52.16  ? 305 ASN A CG    1 
ATOM   2506 O  OD1   . ASN A 1 305 ? 12.522  8.209   12.202 1.00 51.00  ? 305 ASN A OD1   1 
ATOM   2507 N  ND2   . ASN A 1 305 ? 11.952  7.747   14.346 1.00 55.05  ? 305 ASN A ND2   1 
ATOM   2508 N  N     . ILE A 1 306 ? 14.751  3.189   12.902 1.00 46.57  ? 306 ILE A N     1 
ATOM   2509 C  CA    . ILE A 1 306 ? 14.941  1.884   12.325 1.00 46.24  ? 306 ILE A CA    1 
ATOM   2510 C  C     . ILE A 1 306 ? 14.232  0.773   13.068 1.00 47.08  ? 306 ILE A C     1 
ATOM   2511 O  O     . ILE A 1 306 ? 14.427  0.588   14.269 1.00 46.20  ? 306 ILE A O     1 
ATOM   2512 C  CB    . ILE A 1 306 ? 16.424  1.552   12.251 1.00 46.88  ? 306 ILE A CB    1 
ATOM   2513 C  CG1   . ILE A 1 306 ? 17.129  2.583   11.366 1.00 45.64  ? 306 ILE A CG1   1 
ATOM   2514 C  CG2   . ILE A 1 306 ? 16.607  0.125   11.737 1.00 45.46  ? 306 ILE A CG2   1 
ATOM   2515 C  CD1   . ILE A 1 306 ? 18.634  2.483   11.404 1.00 48.41  ? 306 ILE A CD1   1 
ATOM   2516 N  N     . GLY A 1 307 ? 13.383  0.056   12.339 1.00 47.44  ? 307 GLY A N     1 
ATOM   2517 C  CA    . GLY A 1 307 ? 12.694  -1.068  12.923 1.00 46.83  ? 307 GLY A CA    1 
ATOM   2518 C  C     . GLY A 1 307 ? 13.504  -2.261  12.466 1.00 46.86  ? 307 GLY A C     1 
ATOM   2519 O  O     . GLY A 1 307 ? 13.439  -2.638  11.296 1.00 45.76  ? 307 GLY A O     1 
ATOM   2520 N  N     . TRP A 1 308 ? 14.293  -2.843  13.363 1.00 47.35  ? 308 TRP A N     1 
ATOM   2521 C  CA    . TRP A 1 308 ? 15.096  -3.993  12.977 1.00 48.12  ? 308 TRP A CA    1 
ATOM   2522 C  C     . TRP A 1 308 ? 14.582  -5.312  13.547 1.00 50.09  ? 308 TRP A C     1 
ATOM   2523 O  O     . TRP A 1 308 ? 13.932  -5.344  14.588 1.00 50.62  ? 308 TRP A O     1 
ATOM   2524 C  CB    . TRP A 1 308 ? 16.572  -3.802  13.376 1.00 45.16  ? 308 TRP A CB    1 
ATOM   2525 C  CG    . TRP A 1 308 ? 16.826  -3.424  14.809 1.00 41.51  ? 308 TRP A CG    1 
ATOM   2526 C  CD1   . TRP A 1 308 ? 16.007  -3.639  15.880 1.00 41.24  ? 308 TRP A CD1   1 
ATOM   2527 C  CD2   . TRP A 1 308 ? 18.004  -2.777  15.327 1.00 40.05  ? 308 TRP A CD2   1 
ATOM   2528 N  NE1   . TRP A 1 308 ? 16.594  -3.162  17.035 1.00 41.14  ? 308 TRP A NE1   1 
ATOM   2529 C  CE2   . TRP A 1 308 ? 17.819  -2.628  16.726 1.00 39.89  ? 308 TRP A CE2   1 
ATOM   2530 C  CE3   . TRP A 1 308 ? 19.190  -2.306  14.744 1.00 37.52  ? 308 TRP A CE3   1 
ATOM   2531 C  CZ2   . TRP A 1 308 ? 18.785  -2.029  17.558 1.00 38.98  ? 308 TRP A CZ2   1 
ATOM   2532 C  CZ3   . TRP A 1 308 ? 20.153  -1.710  15.567 1.00 39.17  ? 308 TRP A CZ3   1 
ATOM   2533 C  CH2   . TRP A 1 308 ? 19.938  -1.574  16.964 1.00 36.45  ? 308 TRP A CH2   1 
ATOM   2534 N  N     . ARG A 1 309 ? 14.888  -6.403  12.854 1.00 52.31  ? 309 ARG A N     1 
ATOM   2535 C  CA    . ARG A 1 309 ? 14.461  -7.726  13.299 1.00 54.36  ? 309 ARG A CA    1 
ATOM   2536 C  C     . ARG A 1 309 ? 15.219  -8.002  14.586 1.00 55.45  ? 309 ARG A C     1 
ATOM   2537 O  O     . ARG A 1 309 ? 14.627  -8.389  15.594 1.00 57.80  ? 309 ARG A O     1 
ATOM   2538 C  CB    . ARG A 1 309 ? 14.802  -8.776  12.235 1.00 53.97  ? 309 ARG A CB    1 
ATOM   2539 C  CG    . ARG A 1 309 ? 14.488  -10.209 12.626 0.00 54.46  ? 309 ARG A CG    1 
ATOM   2540 C  CD    . ARG A 1 309 ? 14.923  -11.169 11.529 0.00 54.72  ? 309 ARG A CD    1 
ATOM   2541 N  NE    . ARG A 1 309 ? 14.674  -12.564 11.879 0.00 55.04  ? 309 ARG A NE    1 
ATOM   2542 C  CZ    . ARG A 1 309 ? 14.985  -13.595 11.100 0.00 55.19  ? 309 ARG A CZ    1 
ATOM   2543 N  NH1   . ARG A 1 309 ? 14.723  -14.832 11.498 0.00 55.28  ? 309 ARG A NH1   1 
ATOM   2544 N  NH2   . ARG A 1 309 ? 15.560  -13.390 9.922  0.00 55.28  ? 309 ARG A NH2   1 
ATOM   2545 N  N     . LYS A 1 310 ? 16.536  -7.788  14.537 1.00 54.81  ? 310 LYS A N     1 
ATOM   2546 C  CA    . LYS A 1 310 ? 17.424  -7.976  15.684 1.00 53.39  ? 310 LYS A CA    1 
ATOM   2547 C  C     . LYS A 1 310 ? 18.503  -6.896  15.646 1.00 51.71  ? 310 LYS A C     1 
ATOM   2548 O  O     . LYS A 1 310 ? 18.934  -6.493  14.570 1.00 52.41  ? 310 LYS A O     1 
ATOM   2549 C  CB    . LYS A 1 310 ? 18.077  -9.363  15.639 1.00 54.11  ? 310 LYS A CB    1 
ATOM   2550 C  CG    . LYS A 1 310 ? 18.730  -9.727  14.309 1.00 53.98  ? 310 LYS A CG    1 
ATOM   2551 C  CD    . LYS A 1 310 ? 19.360  -11.109 14.364 0.00 54.37  ? 310 LYS A CD    1 
ATOM   2552 C  CE    . LYS A 1 310 ? 20.008  -11.471 13.039 0.00 54.49  ? 310 LYS A CE    1 
ATOM   2553 N  NZ    . LYS A 1 310 ? 20.625  -12.826 13.073 0.00 54.64  ? 310 LYS A NZ    1 
ATOM   2554 N  N     . PRO A 1 311 ? 18.934  -6.396  16.814 1.00 49.45  ? 311 PRO A N     1 
ATOM   2555 C  CA    . PRO A 1 311 ? 19.972  -5.354  16.861 1.00 48.05  ? 311 PRO A CA    1 
ATOM   2556 C  C     . PRO A 1 311 ? 21.308  -5.732  16.196 1.00 46.73  ? 311 PRO A C     1 
ATOM   2557 O  O     . PRO A 1 311 ? 21.727  -6.889  16.208 1.00 46.11  ? 311 PRO A O     1 
ATOM   2558 C  CB    . PRO A 1 311 ? 20.117  -5.059  18.364 1.00 48.17  ? 311 PRO A CB    1 
ATOM   2559 C  CG    . PRO A 1 311 ? 19.488  -6.247  19.041 1.00 49.25  ? 311 PRO A CG    1 
ATOM   2560 C  CD    . PRO A 1 311 ? 18.356  -6.628  18.146 1.00 48.88  ? 311 PRO A CD    1 
ATOM   2561 N  N     . PHE A 1 312 ? 21.947  -4.753  15.568 1.00 43.43  ? 312 PHE A N     1 
ATOM   2562 C  CA    . PHE A 1 312 ? 23.226  -4.997  14.921 1.00 40.89  ? 312 PHE A CA    1 
ATOM   2563 C  C     . PHE A 1 312 ? 24.148  -3.789  15.025 1.00 38.77  ? 312 PHE A C     1 
ATOM   2564 O  O     . PHE A 1 312 ? 23.776  -2.749  15.583 1.00 39.16  ? 312 PHE A O     1 
ATOM   2565 C  CB    . PHE A 1 312 ? 23.029  -5.394  13.451 1.00 39.69  ? 312 PHE A CB    1 
ATOM   2566 C  CG    . PHE A 1 312 ? 22.147  -4.456  12.666 1.00 41.11  ? 312 PHE A CG    1 
ATOM   2567 C  CD1   . PHE A 1 312 ? 20.811  -4.775  12.419 1.00 40.14  ? 312 PHE A CD1   1 
ATOM   2568 C  CD2   . PHE A 1 312 ? 22.665  -3.283  12.119 1.00 38.77  ? 312 PHE A CD2   1 
ATOM   2569 C  CE1   . PHE A 1 312 ? 20.006  -3.946  11.629 1.00 39.37  ? 312 PHE A CE1   1 
ATOM   2570 C  CE2   . PHE A 1 312 ? 21.863  -2.451  11.329 1.00 40.84  ? 312 PHE A CE2   1 
ATOM   2571 C  CZ    . PHE A 1 312 ? 20.533  -2.784  11.081 1.00 37.48  ? 312 PHE A CZ    1 
ATOM   2572 N  N     . ASP A 1 313 ? 25.357  -3.941  14.499 1.00 37.11  ? 313 ASP A N     1 
ATOM   2573 C  CA    . ASP A 1 313 ? 26.345  -2.873  14.521 1.00 36.17  ? 313 ASP A CA    1 
ATOM   2574 C  C     . ASP A 1 313 ? 25.889  -1.705  13.632 1.00 35.84  ? 313 ASP A C     1 
ATOM   2575 O  O     . ASP A 1 313 ? 25.674  -1.883  12.436 1.00 35.78  ? 313 ASP A O     1 
ATOM   2576 C  CB    . ASP A 1 313 ? 27.697  -3.413  14.038 1.00 32.70  ? 313 ASP A CB    1 
ATOM   2577 C  CG    . ASP A 1 313 ? 28.825  -2.393  14.164 1.00 35.08  ? 313 ASP A CG    1 
ATOM   2578 O  OD1   . ASP A 1 313 ? 29.908  -2.642  13.588 1.00 33.76  ? 313 ASP A OD1   1 
ATOM   2579 O  OD2   . ASP A 1 313 ? 28.652  -1.347  14.840 1.00 33.22  ? 313 ASP A OD2   1 
ATOM   2580 N  N     . LEU A 1 314 ? 25.756  -0.513  14.216 1.00 34.82  ? 314 LEU A N     1 
ATOM   2581 C  CA    . LEU A 1 314 ? 25.348  0.676   13.461 1.00 34.46  ? 314 LEU A CA    1 
ATOM   2582 C  C     . LEU A 1 314 ? 26.529  1.455   12.898 1.00 33.44  ? 314 LEU A C     1 
ATOM   2583 O  O     . LEU A 1 314 ? 26.340  2.519   12.294 1.00 34.52  ? 314 LEU A O     1 
ATOM   2584 C  CB    . LEU A 1 314 ? 24.516  1.621   14.337 1.00 33.83  ? 314 LEU A CB    1 
ATOM   2585 C  CG    . LEU A 1 314 ? 23.253  0.939   14.840 1.00 36.20  ? 314 LEU A CG    1 
ATOM   2586 C  CD1   . LEU A 1 314 ? 22.651  1.702   15.990 1.00 35.64  ? 314 LEU A CD1   1 
ATOM   2587 C  CD2   . LEU A 1 314 ? 22.292  0.815   13.683 1.00 36.70  ? 314 LEU A CD2   1 
ATOM   2588 N  N     . THR A 1 315 ? 27.741  0.940   13.072 1.00 32.32  ? 315 THR A N     1 
ATOM   2589 C  CA    . THR A 1 315 ? 28.919  1.655   12.572 1.00 32.89  ? 315 THR A CA    1 
ATOM   2590 C  C     . THR A 1 315 ? 28.907  1.869   11.061 1.00 32.67  ? 315 THR A C     1 
ATOM   2591 O  O     . THR A 1 315 ? 29.261  2.943   10.584 1.00 31.32  ? 315 THR A O     1 
ATOM   2592 C  CB    . THR A 1 315 ? 30.246  0.937   12.949 1.00 33.00  ? 315 THR A CB    1 
ATOM   2593 O  OG1   . THR A 1 315 ? 30.383  0.910   14.370 1.00 32.46  ? 315 THR A OG1   1 
ATOM   2594 C  CG2   . THR A 1 315 ? 31.450  1.674   12.354 1.00 31.33  ? 315 THR A CG2   1 
ATOM   2595 N  N     . GLU A 1 316 ? 28.490  0.852   10.317 1.00 34.52  ? 316 GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 316 ? 28.458  0.942   8.853  1.00 36.92  ? 316 GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 316 ? 27.513  2.062   8.435  1.00 34.43  ? 316 GLU A C     1 
ATOM   2598 O  O     . GLU A 1 316 ? 27.890  2.988   7.742  1.00 35.31  ? 316 GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 316 ? 27.986  -0.388  8.245  1.00 39.10  ? 316 GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 316 ? 27.777  -0.352  6.713  1.00 44.39  ? 316 GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 316 ? 26.908  -1.524  6.204  1.00 48.06  ? 316 GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 316 ? 26.695  -1.605  4.973  1.00 48.21  ? 316 GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 316 ? 26.436  -2.353  7.036  1.00 48.89  ? 316 GLU A OE2   1 
ATOM   2604 N  N     . ILE A 1 317 ? 26.274  1.960   8.864  1.00 34.23  ? 317 ILE A N     1 
ATOM   2605 C  CA    . ILE A 1 317 ? 25.283  2.968   8.546  1.00 35.14  ? 317 ILE A CA    1 
ATOM   2606 C  C     . ILE A 1 317 ? 25.723  4.389   8.950  1.00 35.75  ? 317 ILE A C     1 
ATOM   2607 O  O     . ILE A 1 317 ? 25.649  5.305   8.131  1.00 34.21  ? 317 ILE A O     1 
ATOM   2608 C  CB    . ILE A 1 317 ? 23.941  2.602   9.215  1.00 33.31  ? 317 ILE A CB    1 
ATOM   2609 C  CG1   . ILE A 1 317 ? 23.341  1.384   8.496  1.00 31.93  ? 317 ILE A CG1   1 
ATOM   2610 C  CG2   . ILE A 1 317 ? 22.989  3.801   9.211  1.00 32.42  ? 317 ILE A CG2   1 
ATOM   2611 C  CD1   . ILE A 1 317 ? 22.026  0.859   9.151  1.00 31.36  ? 317 ILE A CD1   1 
ATOM   2612 N  N     . LYS A 1 318 ? 26.208  4.571   10.182 1.00 36.22  ? 318 LYS A N     1 
ATOM   2613 C  CA    . LYS A 1 318 ? 26.625  5.908   10.618 1.00 37.23  ? 318 LYS A CA    1 
ATOM   2614 C  C     . LYS A 1 318 ? 27.692  6.468   9.724  1.00 38.12  ? 318 LYS A C     1 
ATOM   2615 O  O     . LYS A 1 318 ? 27.621  7.611   9.311  1.00 38.33  ? 318 LYS A O     1 
ATOM   2616 C  CB    . LYS A 1 318 ? 27.165  5.905   12.053 1.00 37.64  ? 318 LYS A CB    1 
ATOM   2617 C  CG    . LYS A 1 318 ? 26.121  5.953   13.146 1.00 39.25  ? 318 LYS A CG    1 
ATOM   2618 C  CD    . LYS A 1 318 ? 26.753  5.814   14.533 1.00 37.84  ? 318 LYS A CD    1 
ATOM   2619 C  CE    . LYS A 1 318 ? 27.702  6.960   14.859 1.00 40.88  ? 318 LYS A CE    1 
ATOM   2620 N  NZ    . LYS A 1 318 ? 28.589  6.730   16.063 1.00 37.58  ? 318 LYS A NZ    1 
ATOM   2621 N  N     . GLU A 1 319 ? 28.685  5.648   9.407  1.00 40.11  ? 319 GLU A N     1 
ATOM   2622 C  CA    . GLU A 1 319 ? 29.779  6.106   8.588  1.00 41.86  ? 319 GLU A CA    1 
ATOM   2623 C  C     . GLU A 1 319 ? 29.433  6.266   7.109  1.00 43.45  ? 319 GLU A C     1 
ATOM   2624 O  O     . GLU A 1 319 ? 30.110  7.006   6.405  1.00 44.94  ? 319 GLU A O     1 
ATOM   2625 C  CB    . GLU A 1 319 ? 31.005  5.206   8.837  1.00 43.48  ? 319 GLU A CB    1 
ATOM   2626 C  CG    . GLU A 1 319 ? 31.339  5.135   10.361 1.00 45.59  ? 319 GLU A CG    1 
ATOM   2627 C  CD    . GLU A 1 319 ? 32.621  4.356   10.712 1.00 48.46  ? 319 GLU A CD    1 
ATOM   2628 O  OE1   . GLU A 1 319 ? 33.150  3.612   9.843  1.00 46.74  ? 319 GLU A OE1   1 
ATOM   2629 O  OE2   . GLU A 1 319 ? 33.084  4.491   11.878 1.00 48.11  ? 319 GLU A OE2   1 
ATOM   2630 N  N     . LEU A 1 320 ? 28.384  5.601   6.635  1.00 43.74  ? 320 LEU A N     1 
ATOM   2631 C  CA    . LEU A 1 320 ? 27.957  5.770   5.239  1.00 46.27  ? 320 LEU A CA    1 
ATOM   2632 C  C     . LEU A 1 320 ? 27.280  7.135   5.086  1.00 46.87  ? 320 LEU A C     1 
ATOM   2633 O  O     . LEU A 1 320 ? 27.393  7.769   4.051  1.00 48.10  ? 320 LEU A O     1 
ATOM   2634 C  CB    . LEU A 1 320 ? 26.944  4.695   4.816  1.00 46.34  ? 320 LEU A CB    1 
ATOM   2635 C  CG    . LEU A 1 320 ? 27.462  3.355   4.296  1.00 47.92  ? 320 LEU A CG    1 
ATOM   2636 C  CD1   . LEU A 1 320 ? 26.301  2.389   4.066  1.00 47.56  ? 320 LEU A CD1   1 
ATOM   2637 C  CD2   . LEU A 1 320 ? 28.244  3.598   3.014  1.00 46.21  ? 320 LEU A CD2   1 
ATOM   2638 N  N     . LEU A 1 321 ? 26.551  7.565   6.109  1.00 48.53  ? 321 LEU A N     1 
ATOM   2639 C  CA    . LEU A 1 321 ? 25.863  8.859   6.075  1.00 49.56  ? 321 LEU A CA    1 
ATOM   2640 C  C     . LEU A 1 321 ? 26.800  9.977   6.521  1.00 51.70  ? 321 LEU A C     1 
ATOM   2641 O  O     . LEU A 1 321 ? 27.128  10.110  7.697  1.00 53.24  ? 321 LEU A O     1 
ATOM   2642 C  CB    . LEU A 1 321 ? 24.604  8.814   6.958  1.00 46.95  ? 321 LEU A CB    1 
ATOM   2643 C  CG    . LEU A 1 321 ? 23.498  7.908   6.388  1.00 47.17  ? 321 LEU A CG    1 
ATOM   2644 C  CD1   . LEU A 1 321 ? 22.429  7.648   7.408  1.00 44.91  ? 321 LEU A CD1   1 
ATOM   2645 C  CD2   . LEU A 1 321 ? 22.910  8.554   5.133  1.00 45.11  ? 321 LEU A CD2   1 
ATOM   2646 N  N     . ASN A 1 322 ? 27.247  10.784  5.570  1.00 54.41  ? 322 ASN A N     1 
ATOM   2647 C  CA    . ASN A 1 322 ? 28.159  11.884  5.886  1.00 56.88  ? 322 ASN A CA    1 
ATOM   2648 C  C     . ASN A 1 322 ? 27.351  13.145  6.134  1.00 55.43  ? 322 ASN A C     1 
ATOM   2649 O  O     . ASN A 1 322 ? 27.359  14.058  5.306  1.00 56.64  ? 322 ASN A O     1 
ATOM   2650 C  CB    . ASN A 1 322 ? 29.104  12.130  4.711  1.00 61.30  ? 322 ASN A CB    1 
ATOM   2651 C  CG    . ASN A 1 322 ? 28.356  12.282  3.394  1.00 65.18  ? 322 ASN A CG    1 
ATOM   2652 O  OD1   . ASN A 1 322 ? 27.857  11.298  2.833  1.00 68.94  ? 322 ASN A OD1   1 
ATOM   2653 N  ND2   . ASN A 1 322 ? 28.255  13.516  2.903  1.00 66.81  ? 322 ASN A ND2   1 
ATOM   2654 N  N     . VAL A 1 323 ? 26.645  13.198  7.259  1.00 53.09  ? 323 VAL A N     1 
ATOM   2655 C  CA    . VAL A 1 323 ? 25.820  14.368  7.580  1.00 51.32  ? 323 VAL A CA    1 
ATOM   2656 C  C     . VAL A 1 323 ? 26.317  15.076  8.834  1.00 50.76  ? 323 VAL A C     1 
ATOM   2657 O  O     . VAL A 1 323 ? 26.930  14.459  9.711  1.00 51.57  ? 323 VAL A O     1 
ATOM   2658 C  CB    . VAL A 1 323 ? 24.335  13.974  7.798  1.00 49.22  ? 323 VAL A CB    1 
ATOM   2659 C  CG1   . VAL A 1 323 ? 23.780  13.344  6.540  1.00 49.20  ? 323 VAL A CG1   1 
ATOM   2660 C  CG2   . VAL A 1 323 ? 24.215  13.019  8.977  1.00 46.76  ? 323 VAL A CG2   1 
ATOM   2661 N  N     . GLU A 1 324 ? 26.027  16.369  8.930  1.00 50.78  ? 324 GLU A N     1 
ATOM   2662 C  CA    . GLU A 1 324 ? 26.467  17.152  10.075 1.00 48.94  ? 324 GLU A CA    1 
ATOM   2663 C  C     . GLU A 1 324 ? 25.896  16.651  11.399 1.00 47.29  ? 324 GLU A C     1 
ATOM   2664 O  O     . GLU A 1 324 ? 26.526  16.797  12.434 1.00 47.79  ? 324 GLU A O     1 
ATOM   2665 C  CB    . GLU A 1 324 ? 26.133  18.625  9.841  1.00 51.77  ? 324 GLU A CB    1 
ATOM   2666 C  CG    . GLU A 1 324 ? 26.725  19.150  8.540  1.00 55.54  ? 324 GLU A CG    1 
ATOM   2667 C  CD    . GLU A 1 324 ? 26.729  20.666  8.451  1.00 59.16  ? 324 GLU A CD    1 
ATOM   2668 O  OE1   . GLU A 1 324 ? 26.872  21.207  7.331  1.00 60.14  ? 324 GLU A OE1   1 
ATOM   2669 O  OE2   . GLU A 1 324 ? 26.602  21.322  9.506  1.00 62.74  ? 324 GLU A OE2   1 
ATOM   2670 N  N     . TYR A 1 325 ? 24.712  16.046  11.369 1.00 44.39  ? 325 TYR A N     1 
ATOM   2671 C  CA    . TYR A 1 325 ? 24.096  15.516  12.586 1.00 42.28  ? 325 TYR A CA    1 
ATOM   2672 C  C     . TYR A 1 325 ? 23.175  14.360  12.226 1.00 39.70  ? 325 TYR A C     1 
ATOM   2673 O  O     . TYR A 1 325 ? 22.293  14.489  11.365 1.00 36.74  ? 325 TYR A O     1 
ATOM   2674 C  CB    . TYR A 1 325 ? 23.274  16.596  13.319 1.00 43.51  ? 325 TYR A CB    1 
ATOM   2675 C  CG    . TYR A 1 325 ? 22.646  16.117  14.625 1.00 44.26  ? 325 TYR A CG    1 
ATOM   2676 C  CD1   . TYR A 1 325 ? 23.427  15.914  15.773 1.00 46.06  ? 325 TYR A CD1   1 
ATOM   2677 C  CD2   . TYR A 1 325 ? 21.268  15.878  14.716 1.00 45.32  ? 325 TYR A CD2   1 
ATOM   2678 C  CE1   . TYR A 1 325 ? 22.853  15.486  16.987 1.00 45.58  ? 325 TYR A CE1   1 
ATOM   2679 C  CE2   . TYR A 1 325 ? 20.682  15.451  15.918 1.00 46.62  ? 325 TYR A CE2   1 
ATOM   2680 C  CZ    . TYR A 1 325 ? 21.481  15.257  17.047 1.00 47.57  ? 325 TYR A CZ    1 
ATOM   2681 O  OH    . TYR A 1 325 ? 20.898  14.833  18.222 1.00 48.17  ? 325 TYR A OH    1 
ATOM   2682 N  N     . LEU A 1 326 ? 23.365  13.244  12.910 1.00 37.94  ? 326 LEU A N     1 
ATOM   2683 C  CA    . LEU A 1 326 ? 22.571  12.060  12.654 1.00 38.56  ? 326 LEU A CA    1 
ATOM   2684 C  C     . LEU A 1 326 ? 22.091  11.457  13.935 1.00 38.59  ? 326 LEU A C     1 
ATOM   2685 O  O     . LEU A 1 326 ? 22.888  11.142  14.799 1.00 39.73  ? 326 LEU A O     1 
ATOM   2686 C  CB    . LEU A 1 326 ? 23.400  11.000  11.905 1.00 37.94  ? 326 LEU A CB    1 
ATOM   2687 C  CG    . LEU A 1 326 ? 22.736  9.624   11.765 1.00 38.56  ? 326 LEU A CG    1 
ATOM   2688 C  CD1   . LEU A 1 326 ? 21.577  9.724   10.770 1.00 37.10  ? 326 LEU A CD1   1 
ATOM   2689 C  CD2   . LEU A 1 326 ? 23.758  8.578   11.287 1.00 37.80  ? 326 LEU A CD2   1 
ATOM   2690 N  N     . LYS A 1 327 ? 20.784  11.296  14.072 1.00 39.73  ? 327 LYS A N     1 
ATOM   2691 C  CA    . LYS A 1 327 ? 20.254  10.659  15.258 1.00 39.62  ? 327 LYS A CA    1 
ATOM   2692 C  C     . LYS A 1 327 ? 19.637  9.336   14.811 1.00 40.28  ? 327 LYS A C     1 
ATOM   2693 O  O     . LYS A 1 327 ? 18.984  9.263   13.754 1.00 39.75  ? 327 LYS A O     1 
ATOM   2694 C  CB    . LYS A 1 327 ? 19.182  11.499  15.941 1.00 40.69  ? 327 LYS A CB    1 
ATOM   2695 C  CG    . LYS A 1 327 ? 18.827  10.856  17.267 1.00 44.49  ? 327 LYS A CG    1 
ATOM   2696 C  CD    . LYS A 1 327 ? 17.622  11.414  17.974 1.00 48.22  ? 327 LYS A CD    1 
ATOM   2697 C  CE    . LYS A 1 327 ? 17.519  10.704  19.336 1.00 48.92  ? 327 LYS A CE    1 
ATOM   2698 N  NZ    . LYS A 1 327 ? 16.139  10.733  19.928 1.00 51.74  ? 327 LYS A NZ    1 
ATOM   2699 N  N     . ILE A 1 328 ? 19.833  8.291   15.603 1.00 39.85  ? 328 ILE A N     1 
ATOM   2700 C  CA    . ILE A 1 328 ? 19.300  7.002   15.230 1.00 42.78  ? 328 ILE A CA    1 
ATOM   2701 C  C     . ILE A 1 328 ? 18.468  6.413   16.338 1.00 45.06  ? 328 ILE A C     1 
ATOM   2702 O  O     . ILE A 1 328 ? 18.960  6.187   17.437 1.00 45.94  ? 328 ILE A O     1 
ATOM   2703 C  CB    . ILE A 1 328 ? 20.433  5.998   14.861 1.00 42.80  ? 328 ILE A CB    1 
ATOM   2704 C  CG1   . ILE A 1 328 ? 21.215  6.495   13.647 1.00 42.00  ? 328 ILE A CG1   1 
ATOM   2705 C  CG2   . ILE A 1 328 ? 19.839  4.656   14.514 1.00 41.02  ? 328 ILE A CG2   1 
ATOM   2706 C  CD1   . ILE A 1 328 ? 22.357  5.576   13.216 1.00 42.73  ? 328 ILE A CD1   1 
ATOM   2707 N  N     . ASP A 1 329 ? 17.193  6.195   16.038 1.00 47.49  ? 329 ASP A N     1 
ATOM   2708 C  CA    . ASP A 1 329 ? 16.251  5.600   16.975 1.00 49.42  ? 329 ASP A CA    1 
ATOM   2709 C  C     . ASP A 1 329 ? 15.963  4.226   16.402 1.00 50.63  ? 329 ASP A C     1 
ATOM   2710 O  O     . ASP A 1 329 ? 15.923  4.056   15.188 1.00 49.66  ? 329 ASP A O     1 
ATOM   2711 C  CB    . ASP A 1 329 ? 14.959  6.419   17.038 1.00 51.52  ? 329 ASP A CB    1 
ATOM   2712 C  CG    . ASP A 1 329 ? 15.164  7.796   17.668 1.00 53.74  ? 329 ASP A CG    1 
ATOM   2713 O  OD1   . ASP A 1 329 ? 14.296  8.673   17.481 1.00 54.40  ? 329 ASP A OD1   1 
ATOM   2714 O  OD2   . ASP A 1 329 ? 16.187  8.002   18.359 1.00 55.22  ? 329 ASP A OD2   1 
ATOM   2715 N  N     . THR A 1 330 ? 15.782  3.243   17.270 1.00 51.77  ? 330 THR A N     1 
ATOM   2716 C  CA    . THR A 1 330 ? 15.519  1.893   16.811 1.00 55.26  ? 330 THR A CA    1 
ATOM   2717 C  C     . THR A 1 330 ? 14.467  1.218   17.679 1.00 58.09  ? 330 THR A C     1 
ATOM   2718 O  O     . THR A 1 330 ? 14.353  1.507   18.870 1.00 58.51  ? 330 THR A O     1 
ATOM   2719 C  CB    . THR A 1 330 ? 16.792  1.020   16.868 1.00 55.05  ? 330 THR A CB    1 
ATOM   2720 O  OG1   . THR A 1 330 ? 17.213  0.895   18.232 1.00 55.33  ? 330 THR A OG1   1 
ATOM   2721 C  CG2   . THR A 1 330 ? 17.915  1.630   16.049 1.00 54.65  ? 330 THR A CG2   1 
ATOM   2722 N  N     . TRP A 1 331 ? 13.695  0.326   17.069 1.00 61.18  ? 331 TRP A N     1 
ATOM   2723 C  CA    . TRP A 1 331 ? 12.678  -0.433  17.782 1.00 65.31  ? 331 TRP A CA    1 
ATOM   2724 C  C     . TRP A 1 331 ? 12.587  -1.798  17.106 1.00 67.04  ? 331 TRP A C     1 
ATOM   2725 O  O     . TRP A 1 331 ? 12.737  -1.898  15.888 1.00 67.10  ? 331 TRP A O     1 
ATOM   2726 C  CB    . TRP A 1 331 ? 11.328  0.292   17.747 1.00 67.25  ? 331 TRP A CB    1 
ATOM   2727 C  CG    . TRP A 1 331 ? 10.853  0.566   16.384 1.00 69.72  ? 331 TRP A CG    1 
ATOM   2728 C  CD1   . TRP A 1 331 ? 11.145  1.657   15.613 1.00 70.36  ? 331 TRP A CD1   1 
ATOM   2729 C  CD2   . TRP A 1 331 ? 10.057  -0.302  15.574 1.00 71.05  ? 331 TRP A CD2   1 
ATOM   2730 N  NE1   . TRP A 1 331 ? 10.578  1.518   14.364 1.00 71.00  ? 331 TRP A NE1   1 
ATOM   2731 C  CE2   . TRP A 1 331 ? 9.904   0.324   14.315 1.00 71.52  ? 331 TRP A CE2   1 
ATOM   2732 C  CE3   . TRP A 1 331 ? 9.458   -1.550  15.789 1.00 72.03  ? 331 TRP A CE3   1 
ATOM   2733 C  CZ2   . TRP A 1 331 ? 9.179   -0.261  13.270 1.00 72.22  ? 331 TRP A CZ2   1 
ATOM   2734 C  CZ3   . TRP A 1 331 ? 8.738   -2.134  14.750 1.00 73.38  ? 331 TRP A CZ3   1 
ATOM   2735 C  CH2   . TRP A 1 331 ? 8.605   -1.486  13.504 1.00 73.35  ? 331 TRP A CH2   1 
ATOM   2736 N  N     . ARG A 1 332 ? 12.374  -2.844  17.902 1.00 70.38  ? 332 ARG A N     1 
ATOM   2737 C  CA    . ARG A 1 332 ? 12.286  -4.211  17.384 1.00 73.84  ? 332 ARG A CA    1 
ATOM   2738 C  C     . ARG A 1 332 ? 10.921  -4.513  16.793 1.00 74.93  ? 332 ARG A C     1 
ATOM   2739 O  O     . ARG A 1 332 ? 9.900   -4.107  17.344 1.00 75.43  ? 332 ARG A O     1 
ATOM   2740 C  CB    . ARG A 1 332 ? 12.586  -5.218  18.490 1.00 75.74  ? 332 ARG A CB    1 
ATOM   2741 C  CG    . ARG A 1 332 ? 13.964  -5.047  19.105 1.00 79.12  ? 332 ARG A CG    1 
ATOM   2742 C  CD    . ARG A 1 332 ? 14.222  -6.083  20.183 1.00 81.01  ? 332 ARG A CD    1 
ATOM   2743 N  NE    . ARG A 1 332 ? 15.534  -5.887  20.782 1.00 83.56  ? 332 ARG A NE    1 
ATOM   2744 C  CZ    . ARG A 1 332 ? 16.018  -6.608  21.787 1.00 85.10  ? 332 ARG A CZ    1 
ATOM   2745 N  NH1   . ARG A 1 332 ? 17.232  -6.350  22.266 1.00 84.20  ? 332 ARG A NH1   1 
ATOM   2746 N  NH2   . ARG A 1 332 ? 15.287  -7.584  22.315 1.00 86.46  ? 332 ARG A NH2   1 
ATOM   2747 N  N     . ILE A 1 333 ? 10.922  -5.253  15.688 1.00 76.36  ? 333 ILE A N     1 
ATOM   2748 C  CA    . ILE A 1 333 ? 9.705   -5.611  14.967 1.00 77.39  ? 333 ILE A CA    1 
ATOM   2749 C  C     . ILE A 1 333 ? 8.737   -6.674  15.493 1.00 77.84  ? 333 ILE A C     1 
ATOM   2750 O  O     . ILE A 1 333 ? 8.145   -7.389  16.315 1.00 78.71  ? 333 ILE A O     1 
ATOM   2751 C  CB    . ILE A 1 333 ? 10.027  -5.925  13.504 1.00 77.61  ? 333 ILE A CB    1 
ATOM   2752 C  CG1   . ILE A 1 333 ? 10.592  -4.669  12.835 1.00 77.26  ? 333 ILE A CG1   1 
ATOM   2753 C  CG2   . ILE A 1 333 ? 8.771   -6.400  12.788 1.00 78.21  ? 333 ILE A CG2   1 
ATOM   2754 C  CD1   . ILE A 1 333 ? 11.210  -4.936  11.470 1.00 76.71  ? 333 ILE A CD1   1 
ATOM   2755 O  OXT   . ILE A 1 333 ? 8.277   -5.675  16.027 0.00 77.86  ? 333 ILE A OXT   1 
ATOM   2756 N  N     . MET B 1 1   ? 45.368  61.832  43.795 1.00 48.39  ? 1   MET B N     1 
ATOM   2757 C  CA    . MET B 1 1   ? 44.673  60.695  43.145 1.00 46.59  ? 1   MET B CA    1 
ATOM   2758 C  C     . MET B 1 1   ? 43.956  59.905  44.237 1.00 45.35  ? 1   MET B C     1 
ATOM   2759 O  O     . MET B 1 1   ? 44.592  59.392  45.164 1.00 44.20  ? 1   MET B O     1 
ATOM   2760 C  CB    . MET B 1 1   ? 45.675  59.782  42.453 1.00 51.77  ? 1   MET B CB    1 
ATOM   2761 C  CG    . MET B 1 1   ? 45.019  58.761  41.532 1.00 53.95  ? 1   MET B CG    1 
ATOM   2762 S  SD    . MET B 1 1   ? 44.393  59.651  40.079 1.00 61.18  ? 1   MET B SD    1 
ATOM   2763 C  CE    . MET B 1 1   ? 45.798  59.556  38.996 1.00 56.30  ? 1   MET B CE    1 
ATOM   2764 N  N     . LYS B 1 2   ? 42.639  59.798  44.112 1.00 41.12  ? 2   LYS B N     1 
ATOM   2765 C  CA    . LYS B 1 2   ? 41.833  59.100  45.100 1.00 39.55  ? 2   LYS B CA    1 
ATOM   2766 C  C     . LYS B 1 2   ? 40.873  58.090  44.439 1.00 37.10  ? 2   LYS B C     1 
ATOM   2767 O  O     . LYS B 1 2   ? 40.166  58.427  43.500 1.00 36.11  ? 2   LYS B O     1 
ATOM   2768 C  CB    . LYS B 1 2   ? 41.054  60.152  45.884 1.00 37.56  ? 2   LYS B CB    1 
ATOM   2769 C  CG    . LYS B 1 2   ? 40.221  59.676  47.029 1.00 38.61  ? 2   LYS B CG    1 
ATOM   2770 C  CD    . LYS B 1 2   ? 39.647  60.899  47.749 1.00 41.04  ? 2   LYS B CD    1 
ATOM   2771 C  CE    . LYS B 1 2   ? 38.741  60.507  48.891 1.00 43.69  ? 2   LYS B CE    1 
ATOM   2772 N  NZ    . LYS B 1 2   ? 38.141  61.688  49.546 1.00 44.54  ? 2   LYS B NZ    1 
ATOM   2773 N  N     . PHE B 1 3   ? 40.860  56.850  44.919 1.00 34.80  ? 3   PHE B N     1 
ATOM   2774 C  CA    . PHE B 1 3   ? 39.954  55.865  44.344 1.00 33.84  ? 3   PHE B CA    1 
ATOM   2775 C  C     . PHE B 1 3   ? 39.344  54.965  45.384 1.00 32.20  ? 3   PHE B C     1 
ATOM   2776 O  O     . PHE B 1 3   ? 39.891  54.818  46.471 1.00 31.04  ? 3   PHE B O     1 
ATOM   2777 C  CB    . PHE B 1 3   ? 40.654  55.024  43.257 1.00 32.85  ? 3   PHE B CB    1 
ATOM   2778 C  CG    . PHE B 1 3   ? 41.812  54.202  43.752 1.00 32.97  ? 3   PHE B CG    1 
ATOM   2779 C  CD1   . PHE B 1 3   ? 41.621  52.865  44.150 1.00 32.06  ? 3   PHE B CD1   1 
ATOM   2780 C  CD2   . PHE B 1 3   ? 43.115  54.739  43.753 1.00 30.92  ? 3   PHE B CD2   1 
ATOM   2781 C  CE1   . PHE B 1 3   ? 42.711  52.068  44.530 1.00 30.27  ? 3   PHE B CE1   1 
ATOM   2782 C  CE2   . PHE B 1 3   ? 44.222  53.963  44.132 1.00 29.97  ? 3   PHE B CE2   1 
ATOM   2783 C  CZ    . PHE B 1 3   ? 44.029  52.619  44.520 1.00 31.43  ? 3   PHE B CZ    1 
ATOM   2784 N  N     . ALA B 1 4   ? 38.184  54.390  45.058 1.00 30.54  ? 4   ALA B N     1 
ATOM   2785 C  CA    . ALA B 1 4   ? 37.527  53.457  45.980 1.00 29.48  ? 4   ALA B CA    1 
ATOM   2786 C  C     . ALA B 1 4   ? 37.927  52.067  45.521 1.00 29.02  ? 4   ALA B C     1 
ATOM   2787 O  O     . ALA B 1 4   ? 38.004  51.791  44.320 1.00 29.99  ? 4   ALA B O     1 
ATOM   2788 C  CB    . ALA B 1 4   ? 35.996  53.623  45.942 1.00 27.75  ? 4   ALA B CB    1 
ATOM   2789 N  N     . HIS B 1 5   ? 38.235  51.202  46.466 1.00 27.38  ? 5   HIS B N     1 
ATOM   2790 C  CA    . HIS B 1 5   ? 38.610  49.844  46.120 1.00 28.73  ? 5   HIS B CA    1 
ATOM   2791 C  C     . HIS B 1 5   ? 37.583  48.869  46.734 1.00 28.36  ? 5   HIS B C     1 
ATOM   2792 O  O     . HIS B 1 5   ? 37.461  48.760  47.968 1.00 28.58  ? 5   HIS B O     1 
ATOM   2793 C  CB    . HIS B 1 5   ? 40.029  49.538  46.642 1.00 27.02  ? 5   HIS B CB    1 
ATOM   2794 C  CG    . HIS B 1 5   ? 40.421  48.097  46.498 1.00 28.60  ? 5   HIS B CG    1 
ATOM   2795 N  ND1   . HIS B 1 5   ? 41.496  47.543  47.162 1.00 27.04  ? 5   HIS B ND1   1 
ATOM   2796 C  CD2   . HIS B 1 5   ? 39.896  47.104  45.738 1.00 26.71  ? 5   HIS B CD2   1 
ATOM   2797 C  CE1   . HIS B 1 5   ? 41.616  46.274  46.815 1.00 28.16  ? 5   HIS B CE1   1 
ATOM   2798 N  NE2   . HIS B 1 5   ? 40.658  45.984  45.952 1.00 26.73  ? 5   HIS B NE2   1 
ATOM   2799 N  N     . LEU B 1 6   ? 36.829  48.194  45.875 1.00 28.07  ? 6   LEU B N     1 
ATOM   2800 C  CA    . LEU B 1 6   ? 35.821  47.218  46.310 1.00 26.77  ? 6   LEU B CA    1 
ATOM   2801 C  C     . LEU B 1 6   ? 36.036  45.866  45.612 1.00 28.69  ? 6   LEU B C     1 
ATOM   2802 O  O     . LEU B 1 6   ? 36.822  45.754  44.657 1.00 25.40  ? 6   LEU B O     1 
ATOM   2803 C  CB    . LEU B 1 6   ? 34.422  47.669  45.962 1.00 29.98  ? 6   LEU B CB    1 
ATOM   2804 C  CG    . LEU B 1 6   ? 33.916  49.010  46.490 1.00 34.35  ? 6   LEU B CG    1 
ATOM   2805 C  CD1   . LEU B 1 6   ? 34.373  50.076  45.566 1.00 35.03  ? 6   LEU B CD1   1 
ATOM   2806 C  CD2   . LEU B 1 6   ? 32.428  49.006  46.534 1.00 35.94  ? 6   LEU B CD2   1 
ATOM   2807 N  N     . ALA B 1 7   ? 35.307  44.859  46.091 1.00 25.45  ? 7   ALA B N     1 
ATOM   2808 C  CA    . ALA B 1 7   ? 35.373  43.532  45.529 1.00 26.68  ? 7   ALA B CA    1 
ATOM   2809 C  C     . ALA B 1 7   ? 34.285  42.697  46.202 1.00 26.37  ? 7   ALA B C     1 
ATOM   2810 O  O     . ALA B 1 7   ? 33.675  43.127  47.184 1.00 23.50  ? 7   ALA B O     1 
ATOM   2811 C  CB    . ALA B 1 7   ? 36.778  42.913  45.795 1.00 23.79  ? 7   ALA B CB    1 
ATOM   2812 N  N     . ASP B 1 8   ? 33.994  41.541  45.619 1.00 25.97  ? 8   ASP B N     1 
ATOM   2813 C  CA    . ASP B 1 8   ? 33.061  40.616  46.237 1.00 24.53  ? 8   ASP B CA    1 
ATOM   2814 C  C     . ASP B 1 8   ? 31.708  41.164  46.692 1.00 21.79  ? 8   ASP B C     1 
ATOM   2815 O  O     . ASP B 1 8   ? 31.244  40.890  47.797 1.00 21.39  ? 8   ASP B O     1 
ATOM   2816 C  CB    . ASP B 1 8   ? 33.792  39.935  47.410 1.00 25.18  ? 8   ASP B CB    1 
ATOM   2817 C  CG    . ASP B 1 8   ? 35.028  39.149  46.943 1.00 30.08  ? 8   ASP B CG    1 
ATOM   2818 O  OD1   . ASP B 1 8   ? 34.846  38.125  46.245 1.00 30.75  ? 8   ASP B OD1   1 
ATOM   2819 O  OD2   . ASP B 1 8   ? 36.181  39.563  47.243 1.00 33.20  ? 8   ASP B OD2   1 
ATOM   2820 N  N     . ILE B 1 9   ? 31.062  41.879  45.791 1.00 21.64  ? 9   ILE B N     1 
ATOM   2821 C  CA    . ILE B 1 9   ? 29.753  42.446  46.007 1.00 22.73  ? 9   ILE B CA    1 
ATOM   2822 C  C     . ILE B 1 9   ? 28.701  41.332  46.006 1.00 25.45  ? 9   ILE B C     1 
ATOM   2823 O  O     . ILE B 1 9   ? 27.781  41.339  46.825 1.00 25.02  ? 9   ILE B O     1 
ATOM   2824 C  CB    . ILE B 1 9   ? 29.432  43.437  44.884 1.00 23.91  ? 9   ILE B CB    1 
ATOM   2825 C  CG1   . ILE B 1 9   ? 30.576  44.461  44.788 1.00 25.44  ? 9   ILE B CG1   1 
ATOM   2826 C  CG2   . ILE B 1 9   ? 28.120  44.154  45.163 1.00 22.89  ? 9   ILE B CG2   1 
ATOM   2827 C  CD1   . ILE B 1 9   ? 30.859  45.170  46.132 1.00 24.84  ? 9   ILE B CD1   1 
ATOM   2828 N  N     . HIS B 1 10  ? 28.860  40.358  45.110 1.00 24.45  ? 10  HIS B N     1 
ATOM   2829 C  CA    . HIS B 1 10  ? 27.890  39.260  45.006 1.00 25.51  ? 10  HIS B CA    1 
ATOM   2830 C  C     . HIS B 1 10  ? 26.426  39.691  44.824 1.00 25.72  ? 10  HIS B C     1 
ATOM   2831 O  O     . HIS B 1 10  ? 25.525  39.203  45.508 1.00 23.90  ? 10  HIS B O     1 
ATOM   2832 C  CB    . HIS B 1 10  ? 28.018  38.359  46.215 1.00 26.24  ? 10  HIS B CB    1 
ATOM   2833 C  CG    . HIS B 1 10  ? 29.289  37.571  46.217 1.00 29.94  ? 10  HIS B CG    1 
ATOM   2834 N  ND1   . HIS B 1 10  ? 29.391  36.337  45.612 1.00 27.30  ? 10  HIS B ND1   1 
ATOM   2835 C  CD2   . HIS B 1 10  ? 30.542  37.906  46.609 1.00 27.02  ? 10  HIS B CD2   1 
ATOM   2836 C  CE1   . HIS B 1 10  ? 30.652  35.950  45.624 1.00 29.92  ? 10  HIS B CE1   1 
ATOM   2837 N  NE2   . HIS B 1 10  ? 31.369  36.885  46.223 1.00 30.98  ? 10  HIS B NE2   1 
ATOM   2838 N  N     . LEU B 1 11  ? 26.184  40.621  43.906 1.00 25.78  ? 11  LEU B N     1 
ATOM   2839 C  CA    . LEU B 1 11  ? 24.803  41.017  43.651 1.00 25.82  ? 11  LEU B CA    1 
ATOM   2840 C  C     . LEU B 1 11  ? 24.054  39.735  43.249 1.00 28.61  ? 11  LEU B C     1 
ATOM   2841 O  O     . LEU B 1 11  ? 24.618  38.876  42.568 1.00 27.80  ? 11  LEU B O     1 
ATOM   2842 C  CB    . LEU B 1 11  ? 24.752  42.032  42.521 1.00 22.92  ? 11  LEU B CB    1 
ATOM   2843 C  CG    . LEU B 1 11  ? 25.458  43.362  42.833 1.00 24.86  ? 11  LEU B CG    1 
ATOM   2844 C  CD1   . LEU B 1 11  ? 25.422  44.302  41.604 1.00 24.58  ? 11  LEU B CD1   1 
ATOM   2845 C  CD2   . LEU B 1 11  ? 24.768  44.002  44.041 1.00 24.34  ? 11  LEU B CD2   1 
ATOM   2846 N  N     . GLY B 1 12  ? 22.799  39.605  43.680 1.00 30.80  ? 12  GLY B N     1 
ATOM   2847 C  CA    . GLY B 1 12  ? 22.014  38.429  43.345 1.00 31.29  ? 12  GLY B CA    1 
ATOM   2848 C  C     . GLY B 1 12  ? 22.117  37.272  44.332 1.00 32.55  ? 12  GLY B C     1 
ATOM   2849 O  O     . GLY B 1 12  ? 21.403  36.284  44.195 1.00 33.40  ? 12  GLY B O     1 
ATOM   2850 N  N     . TYR B 1 13  ? 22.987  37.375  45.331 1.00 32.15  ? 13  TYR B N     1 
ATOM   2851 C  CA    . TYR B 1 13  ? 23.118  36.285  46.288 1.00 32.97  ? 13  TYR B CA    1 
ATOM   2852 C  C     . TYR B 1 13  ? 21.985  36.216  47.322 1.00 34.67  ? 13  TYR B C     1 
ATOM   2853 O  O     . TYR B 1 13  ? 21.878  37.059  48.213 1.00 31.97  ? 13  TYR B O     1 
ATOM   2854 C  CB    . TYR B 1 13  ? 24.447  36.382  47.028 1.00 32.14  ? 13  TYR B CB    1 
ATOM   2855 C  CG    . TYR B 1 13  ? 24.715  35.248  47.998 1.00 30.33  ? 13  TYR B CG    1 
ATOM   2856 C  CD1   . TYR B 1 13  ? 25.611  35.417  49.051 1.00 31.90  ? 13  TYR B CD1   1 
ATOM   2857 C  CD2   . TYR B 1 13  ? 24.154  33.997  47.816 1.00 32.16  ? 13  TYR B CD2   1 
ATOM   2858 C  CE1   . TYR B 1 13  ? 25.951  34.379  49.896 1.00 31.36  ? 13  TYR B CE1   1 
ATOM   2859 C  CE2   . TYR B 1 13  ? 24.488  32.930  48.658 1.00 34.39  ? 13  TYR B CE2   1 
ATOM   2860 C  CZ    . TYR B 1 13  ? 25.390  33.139  49.699 1.00 34.43  ? 13  TYR B CZ    1 
ATOM   2861 O  OH    . TYR B 1 13  ? 25.717  32.125  50.559 1.00 35.48  ? 13  TYR B OH    1 
ATOM   2862 N  N     . GLU B 1 14  ? 21.152  35.189  47.204 1.00 37.18  ? 14  GLU B N     1 
ATOM   2863 C  CA    . GLU B 1 14  ? 20.057  34.994  48.152 1.00 40.35  ? 14  GLU B CA    1 
ATOM   2864 C  C     . GLU B 1 14  ? 20.604  34.110  49.265 1.00 40.01  ? 14  GLU B C     1 
ATOM   2865 O  O     . GLU B 1 14  ? 20.231  32.939  49.389 1.00 40.28  ? 14  GLU B O     1 
ATOM   2866 C  CB    . GLU B 1 14  ? 18.868  34.310  47.471 1.00 43.07  ? 14  GLU B CB    1 
ATOM   2867 C  CG    . GLU B 1 14  ? 17.648  34.239  48.366 1.00 48.81  ? 14  GLU B CG    1 
ATOM   2868 C  CD    . GLU B 1 14  ? 16.549  33.392  47.779 1.00 52.36  ? 14  GLU B CD    1 
ATOM   2869 O  OE1   . GLU B 1 14  ? 15.954  33.813  46.760 1.00 54.32  ? 14  GLU B OE1   1 
ATOM   2870 O  OE2   . GLU B 1 14  ? 16.294  32.303  48.340 1.00 55.19  ? 14  GLU B OE2   1 
ATOM   2871 N  N     . GLN B 1 15  ? 21.517  34.681  50.051 1.00 39.46  ? 15  GLN B N     1 
ATOM   2872 C  CA    . GLN B 1 15  ? 22.182  33.975  51.142 1.00 37.93  ? 15  GLN B CA    1 
ATOM   2873 C  C     . GLN B 1 15  ? 21.176  33.281  52.076 1.00 37.97  ? 15  GLN B C     1 
ATOM   2874 O  O     . GLN B 1 15  ? 20.187  33.877  52.471 1.00 35.47  ? 15  GLN B O     1 
ATOM   2875 C  CB    . GLN B 1 15  ? 23.033  34.985  51.931 1.00 37.74  ? 15  GLN B CB    1 
ATOM   2876 C  CG    . GLN B 1 15  ? 24.062  34.397  52.876 1.00 33.05  ? 15  GLN B CG    1 
ATOM   2877 C  CD    . GLN B 1 15  ? 24.738  35.484  53.706 1.00 35.08  ? 15  GLN B CD    1 
ATOM   2878 O  OE1   . GLN B 1 15  ? 24.072  36.390  54.216 1.00 37.00  ? 15  GLN B OE1   1 
ATOM   2879 N  NE2   . GLN B 1 15  ? 26.048  35.399  53.851 1.00 32.61  ? 15  GLN B NE2   1 
ATOM   2880 N  N     . PHE B 1 16  ? 21.450  32.030  52.433 1.00 38.72  ? 16  PHE B N     1 
ATOM   2881 C  CA    . PHE B 1 16  ? 20.560  31.272  53.309 1.00 41.58  ? 16  PHE B CA    1 
ATOM   2882 C  C     . PHE B 1 16  ? 19.131  31.236  52.745 1.00 43.00  ? 16  PHE B C     1 
ATOM   2883 O  O     . PHE B 1 16  ? 18.163  31.132  53.504 1.00 42.88  ? 16  PHE B O     1 
ATOM   2884 C  CB    . PHE B 1 16  ? 20.524  31.906  54.706 1.00 40.40  ? 16  PHE B CB    1 
ATOM   2885 C  CG    . PHE B 1 16  ? 21.864  32.043  55.341 1.00 40.10  ? 16  PHE B CG    1 
ATOM   2886 C  CD1   . PHE B 1 16  ? 22.214  33.217  55.988 1.00 41.61  ? 16  PHE B CD1   1 
ATOM   2887 C  CD2   . PHE B 1 16  ? 22.791  31.013  55.274 1.00 41.31  ? 16  PHE B CD2   1 
ATOM   2888 C  CE1   . PHE B 1 16  ? 23.473  33.367  56.558 1.00 41.80  ? 16  PHE B CE1   1 
ATOM   2889 C  CE2   . PHE B 1 16  ? 24.055  31.153  55.842 1.00 40.88  ? 16  PHE B CE2   1 
ATOM   2890 C  CZ    . PHE B 1 16  ? 24.392  32.335  56.485 1.00 40.92  ? 16  PHE B CZ    1 
ATOM   2891 N  N     . HIS B 1 17  ? 19.005  31.351  51.424 1.00 44.54  ? 17  HIS B N     1 
ATOM   2892 C  CA    . HIS B 1 17  ? 17.692  31.347  50.773 1.00 48.05  ? 17  HIS B CA    1 
ATOM   2893 C  C     . HIS B 1 17  ? 16.754  32.438  51.274 1.00 50.39  ? 17  HIS B C     1 
ATOM   2894 O  O     . HIS B 1 17  ? 15.540  32.247  51.319 1.00 52.49  ? 17  HIS B O     1 
ATOM   2895 C  CB    . HIS B 1 17  ? 17.047  29.966  50.937 1.00 46.46  ? 17  HIS B CB    1 
ATOM   2896 C  CG    . HIS B 1 17  ? 17.827  28.888  50.261 1.00 47.20  ? 17  HIS B CG    1 
ATOM   2897 N  ND1   . HIS B 1 17  ? 17.843  28.740  48.891 1.00 49.00  ? 17  HIS B ND1   1 
ATOM   2898 C  CD2   . HIS B 1 17  ? 18.748  28.021  50.741 1.00 48.41  ? 17  HIS B CD2   1 
ATOM   2899 C  CE1   . HIS B 1 17  ? 18.745  27.836  48.554 1.00 49.65  ? 17  HIS B CE1   1 
ATOM   2900 N  NE2   . HIS B 1 17  ? 19.310  27.385  49.659 1.00 50.81  ? 17  HIS B NE2   1 
ATOM   2901 N  N     . LYS B 1 18  ? 17.305  33.595  51.627 1.00 50.15  ? 18  LYS B N     1 
ATOM   2902 C  CA    . LYS B 1 18  ? 16.473  34.684  52.108 1.00 51.36  ? 18  LYS B CA    1 
ATOM   2903 C  C     . LYS B 1 18  ? 16.514  35.937  51.222 1.00 51.80  ? 18  LYS B C     1 
ATOM   2904 O  O     . LYS B 1 18  ? 17.501  36.664  51.201 1.00 51.33  ? 18  LYS B O     1 
ATOM   2905 C  CB    . LYS B 1 18  ? 16.875  35.030  53.543 1.00 52.44  ? 18  LYS B CB    1 
ATOM   2906 C  CG    . LYS B 1 18  ? 16.568  33.906  54.514 1.00 54.54  ? 18  LYS B CG    1 
ATOM   2907 C  CD    . LYS B 1 18  ? 16.934  34.262  55.925 1.00 55.20  ? 18  LYS B CD    1 
ATOM   2908 C  CE    . LYS B 1 18  ? 15.865  33.789  56.871 1.00 55.77  ? 18  LYS B CE    1 
ATOM   2909 N  NZ    . LYS B 1 18  ? 14.630  34.594  56.723 1.00 54.75  ? 18  LYS B NZ    1 
ATOM   2910 N  N     . PRO B 1 19  ? 15.418  36.217  50.496 1.00 52.49  ? 19  PRO B N     1 
ATOM   2911 C  CA    . PRO B 1 19  ? 15.367  37.395  49.618 1.00 51.71  ? 19  PRO B CA    1 
ATOM   2912 C  C     . PRO B 1 19  ? 15.777  38.669  50.346 1.00 50.57  ? 19  PRO B C     1 
ATOM   2913 O  O     . PRO B 1 19  ? 16.299  39.607  49.746 1.00 51.85  ? 19  PRO B O     1 
ATOM   2914 C  CB    . PRO B 1 19  ? 13.911  37.418  49.149 1.00 52.76  ? 19  PRO B CB    1 
ATOM   2915 C  CG    . PRO B 1 19  ? 13.178  36.710  50.258 1.00 53.55  ? 19  PRO B CG    1 
ATOM   2916 C  CD    . PRO B 1 19  ? 14.098  35.572  50.590 1.00 52.24  ? 19  PRO B CD    1 
ATOM   2917 N  N     . GLN B 1 20  ? 15.530  38.694  51.647 1.00 49.43  ? 20  GLN B N     1 
ATOM   2918 C  CA    . GLN B 1 20  ? 15.901  39.831  52.473 1.00 47.85  ? 20  GLN B CA    1 
ATOM   2919 C  C     . GLN B 1 20  ? 17.415  40.031  52.343 1.00 46.22  ? 20  GLN B C     1 
ATOM   2920 O  O     . GLN B 1 20  ? 17.897  41.154  52.175 1.00 45.64  ? 20  GLN B O     1 
ATOM   2921 C  CB    . GLN B 1 20  ? 15.500  39.539  53.917 1.00 49.70  ? 20  GLN B CB    1 
ATOM   2922 C  CG    . GLN B 1 20  ? 16.210  40.315  54.992 1.00 53.34  ? 20  GLN B CG    1 
ATOM   2923 C  CD    . GLN B 1 20  ? 15.418  40.296  56.296 1.00 57.05  ? 20  GLN B CD    1 
ATOM   2924 O  OE1   . GLN B 1 20  ? 14.515  41.119  56.484 1.00 58.94  ? 20  GLN B OE1   1 
ATOM   2925 N  NE2   . GLN B 1 20  ? 15.733  39.344  57.190 1.00 56.15  ? 20  GLN B NE2   1 
ATOM   2926 N  N     . ARG B 1 21  ? 18.158  38.929  52.412 1.00 41.94  ? 21  ARG B N     1 
ATOM   2927 C  CA    . ARG B 1 21  ? 19.594  39.000  52.279 1.00 40.24  ? 21  ARG B CA    1 
ATOM   2928 C  C     . ARG B 1 21  ? 20.012  39.503  50.904 1.00 39.16  ? 21  ARG B C     1 
ATOM   2929 O  O     . ARG B 1 21  ? 20.890  40.364  50.796 1.00 37.53  ? 21  ARG B O     1 
ATOM   2930 C  CB    . ARG B 1 21  ? 20.229  37.639  52.567 1.00 37.45  ? 21  ARG B CB    1 
ATOM   2931 C  CG    . ARG B 1 21  ? 20.208  37.328  54.040 1.00 38.08  ? 21  ARG B CG    1 
ATOM   2932 C  CD    . ARG B 1 21  ? 20.952  38.442  54.810 1.00 39.10  ? 21  ARG B CD    1 
ATOM   2933 N  NE    . ARG B 1 21  ? 22.408  38.298  54.760 1.00 35.94  ? 21  ARG B NE    1 
ATOM   2934 C  CZ    . ARG B 1 21  ? 23.259  39.236  55.159 1.00 35.47  ? 21  ARG B CZ    1 
ATOM   2935 N  NH1   . ARG B 1 21  ? 24.572  39.032  55.105 1.00 30.48  ? 21  ARG B NH1   1 
ATOM   2936 N  NH2   . ARG B 1 21  ? 22.789  40.398  55.591 1.00 36.05  ? 21  ARG B NH2   1 
ATOM   2937 N  N     . GLU B 1 22  ? 19.378  38.984  49.858 1.00 37.73  ? 22  GLU B N     1 
ATOM   2938 C  CA    . GLU B 1 22  ? 19.722  39.413  48.509 1.00 38.32  ? 22  GLU B CA    1 
ATOM   2939 C  C     . GLU B 1 22  ? 19.585  40.926  48.393 1.00 36.98  ? 22  GLU B C     1 
ATOM   2940 O  O     . GLU B 1 22  ? 20.446  41.601  47.815 1.00 33.95  ? 22  GLU B O     1 
ATOM   2941 C  CB    . GLU B 1 22  ? 18.831  38.696  47.487 1.00 40.63  ? 22  GLU B CB    1 
ATOM   2942 C  CG    . GLU B 1 22  ? 19.000  39.145  46.048 1.00 44.40  ? 22  GLU B CG    1 
ATOM   2943 C  CD    . GLU B 1 22  ? 18.266  38.218  45.073 1.00 50.31  ? 22  GLU B CD    1 
ATOM   2944 O  OE1   . GLU B 1 22  ? 18.186  38.561  43.874 1.00 53.53  ? 22  GLU B OE1   1 
ATOM   2945 O  OE2   . GLU B 1 22  ? 17.775  37.141  45.499 1.00 50.07  ? 22  GLU B OE2   1 
ATOM   2946 N  N     . GLU B 1 23  ? 18.499  41.460  48.948 1.00 36.84  ? 23  GLU B N     1 
ATOM   2947 C  CA    . GLU B 1 23  ? 18.272  42.902  48.931 1.00 37.45  ? 23  GLU B CA    1 
ATOM   2948 C  C     . GLU B 1 23  ? 19.381  43.604  49.710 1.00 36.11  ? 23  GLU B C     1 
ATOM   2949 O  O     . GLU B 1 23  ? 19.865  44.665  49.319 1.00 36.44  ? 23  GLU B O     1 
ATOM   2950 C  CB    . GLU B 1 23  ? 16.916  43.228  49.560 1.00 41.37  ? 23  GLU B CB    1 
ATOM   2951 C  CG    . GLU B 1 23  ? 15.711  42.765  48.741 1.00 47.76  ? 23  GLU B CG    1 
ATOM   2952 C  CD    . GLU B 1 23  ? 14.400  42.776  49.544 1.00 52.68  ? 23  GLU B CD    1 
ATOM   2953 O  OE1   . GLU B 1 23  ? 13.314  42.712  48.919 1.00 53.71  ? 23  GLU B OE1   1 
ATOM   2954 O  OE2   . GLU B 1 23  ? 14.456  42.837  50.798 1.00 55.39  ? 23  GLU B OE2   1 
ATOM   2955 N  N     . GLU B 1 24  ? 19.793  42.999  50.816 1.00 34.91  ? 24  GLU B N     1 
ATOM   2956 C  CA    . GLU B 1 24  ? 20.842  43.578  51.636 1.00 34.87  ? 24  GLU B CA    1 
ATOM   2957 C  C     . GLU B 1 24  ? 22.209  43.612  50.923 1.00 34.05  ? 24  GLU B C     1 
ATOM   2958 O  O     . GLU B 1 24  ? 22.991  44.570  51.099 1.00 32.95  ? 24  GLU B O     1 
ATOM   2959 C  CB    . GLU B 1 24  ? 20.919  42.827  52.977 1.00 36.34  ? 24  GLU B CB    1 
ATOM   2960 C  CG    . GLU B 1 24  ? 20.062  43.492  54.071 1.00 38.82  ? 24  GLU B CG    1 
ATOM   2961 C  CD    . GLU B 1 24  ? 19.642  42.535  55.191 1.00 39.99  ? 24  GLU B CD    1 
ATOM   2962 O  OE1   . GLU B 1 24  ? 20.488  41.770  55.693 1.00 37.55  ? 24  GLU B OE1   1 
ATOM   2963 O  OE2   . GLU B 1 24  ? 18.454  42.556  55.574 1.00 43.46  ? 24  GLU B OE2   1 
ATOM   2964 N  N     . PHE B 1 25  ? 22.514  42.595  50.121 1.00 30.02  ? 25  PHE B N     1 
ATOM   2965 C  CA    . PHE B 1 25  ? 23.791  42.644  49.419 1.00 30.00  ? 25  PHE B CA    1 
ATOM   2966 C  C     . PHE B 1 25  ? 23.735  43.819  48.417 1.00 30.22  ? 25  PHE B C     1 
ATOM   2967 O  O     . PHE B 1 25  ? 24.721  44.535  48.238 1.00 30.34  ? 25  PHE B O     1 
ATOM   2968 C  CB    . PHE B 1 25  ? 24.097  41.315  48.704 1.00 28.72  ? 25  PHE B CB    1 
ATOM   2969 C  CG    . PHE B 1 25  ? 24.748  40.266  49.600 1.00 30.92  ? 25  PHE B CG    1 
ATOM   2970 C  CD1   . PHE B 1 25  ? 24.014  39.568  50.548 1.00 29.51  ? 25  PHE B CD1   1 
ATOM   2971 C  CD2   . PHE B 1 25  ? 26.107  39.973  49.477 1.00 32.03  ? 25  PHE B CD2   1 
ATOM   2972 C  CE1   . PHE B 1 25  ? 24.626  38.593  51.356 1.00 30.55  ? 25  PHE B CE1   1 
ATOM   2973 C  CE2   . PHE B 1 25  ? 26.724  38.991  50.285 1.00 29.67  ? 25  PHE B CE2   1 
ATOM   2974 C  CZ    . PHE B 1 25  ? 25.979  38.307  51.219 1.00 27.57  ? 25  PHE B CZ    1 
ATOM   2975 N  N     . ALA B 1 26  ? 22.573  44.046  47.803 1.00 29.33  ? 26  ALA B N     1 
ATOM   2976 C  CA    . ALA B 1 26  ? 22.427  45.148  46.842 1.00 31.08  ? 26  ALA B CA    1 
ATOM   2977 C  C     . ALA B 1 26  ? 22.503  46.523  47.549 1.00 31.57  ? 26  ALA B C     1 
ATOM   2978 O  O     . ALA B 1 26  ? 23.153  47.474  47.068 1.00 29.69  ? 26  ALA B O     1 
ATOM   2979 C  CB    . ALA B 1 26  ? 21.098  45.015  46.098 1.00 27.96  ? 26  ALA B CB    1 
ATOM   2980 N  N     . GLU B 1 27  ? 21.826  46.610  48.688 1.00 31.28  ? 27  GLU B N     1 
ATOM   2981 C  CA    . GLU B 1 27  ? 21.807  47.841  49.496 1.00 33.51  ? 27  GLU B CA    1 
ATOM   2982 C  C     . GLU B 1 27  ? 23.239  48.191  49.965 1.00 31.72  ? 27  GLU B C     1 
ATOM   2983 O  O     . GLU B 1 27  ? 23.650  49.355  49.945 1.00 31.26  ? 27  GLU B O     1 
ATOM   2984 C  CB    . GLU B 1 27  ? 20.849  47.646  50.682 1.00 33.98  ? 27  GLU B CB    1 
ATOM   2985 C  CG    . GLU B 1 27  ? 20.718  48.827  51.649 1.00 45.94  ? 27  GLU B CG    1 
ATOM   2986 C  CD    . GLU B 1 27  ? 20.388  50.134  50.962 1.00 51.30  ? 27  GLU B CD    1 
ATOM   2987 O  OE1   . GLU B 1 27  ? 19.381  50.181  50.212 1.00 54.71  ? 27  GLU B OE1   1 
ATOM   2988 O  OE2   . GLU B 1 27  ? 21.145  51.122  51.167 1.00 57.64  ? 27  GLU B OE2   1 
ATOM   2989 N  N     . ALA B 1 28  ? 24.014  47.188  50.358 1.00 31.58  ? 28  ALA B N     1 
ATOM   2990 C  CA    . ALA B 1 28  ? 25.382  47.468  50.799 1.00 30.96  ? 28  ALA B CA    1 
ATOM   2991 C  C     . ALA B 1 28  ? 26.199  48.089  49.651 1.00 30.05  ? 28  ALA B C     1 
ATOM   2992 O  O     . ALA B 1 28  ? 26.950  49.043  49.864 1.00 29.91  ? 28  ALA B O     1 
ATOM   2993 C  CB    . ALA B 1 28  ? 26.055  46.188  51.304 1.00 29.57  ? 28  ALA B CB    1 
ATOM   2994 N  N     . PHE B 1 29  ? 26.058  47.546  48.443 1.00 28.21  ? 29  PHE B N     1 
ATOM   2995 C  CA    . PHE B 1 29  ? 26.769  48.083  47.279 1.00 27.68  ? 29  PHE B CA    1 
ATOM   2996 C  C     . PHE B 1 29  ? 26.295  49.522  47.057 1.00 27.04  ? 29  PHE B C     1 
ATOM   2997 O  O     . PHE B 1 29  ? 27.087  50.417  46.744 1.00 25.96  ? 29  PHE B O     1 
ATOM   2998 C  CB    . PHE B 1 29  ? 26.468  47.259  46.018 1.00 26.24  ? 29  PHE B CB    1 
ATOM   2999 C  CG    . PHE B 1 29  ? 27.244  47.689  44.803 1.00 26.65  ? 29  PHE B CG    1 
ATOM   3000 C  CD1   . PHE B 1 29  ? 26.636  47.691  43.536 1.00 29.87  ? 29  PHE B CD1   1 
ATOM   3001 C  CD2   . PHE B 1 29  ? 28.603  47.990  44.892 1.00 28.25  ? 29  PHE B CD2   1 
ATOM   3002 C  CE1   . PHE B 1 29  ? 27.375  47.981  42.372 1.00 27.94  ? 29  PHE B CE1   1 
ATOM   3003 C  CE2   . PHE B 1 29  ? 29.362  48.280  43.730 1.00 28.70  ? 29  PHE B CE2   1 
ATOM   3004 C  CZ    . PHE B 1 29  ? 28.744  48.275  42.466 1.00 26.49  ? 29  PHE B CZ    1 
ATOM   3005 N  N     . LYS B 1 30  ? 24.995  49.737  47.196 1.00 28.60  ? 30  LYS B N     1 
ATOM   3006 C  CA    . LYS B 1 30  ? 24.470  51.088  47.034 1.00 30.81  ? 30  LYS B CA    1 
ATOM   3007 C  C     . LYS B 1 30  ? 25.143  52.055  48.009 1.00 30.83  ? 30  LYS B C     1 
ATOM   3008 O  O     . LYS B 1 30  ? 25.584  53.120  47.606 1.00 31.65  ? 30  LYS B O     1 
ATOM   3009 C  CB    . LYS B 1 30  ? 22.971  51.125  47.267 1.00 31.40  ? 30  LYS B CB    1 
ATOM   3010 C  CG    . LYS B 1 30  ? 22.380  52.468  46.921 1.00 35.50  ? 30  LYS B CG    1 
ATOM   3011 C  CD    . LYS B 1 30  ? 20.929  52.530  47.336 1.00 39.04  ? 30  LYS B CD    1 
ATOM   3012 C  CE    . LYS B 1 30  ? 20.249  53.714  46.717 1.00 42.41  ? 30  LYS B CE    1 
ATOM   3013 N  NZ    . LYS B 1 30  ? 19.021  54.015  47.477 1.00 49.31  ? 30  LYS B NZ    1 
ATOM   3014 N  N     . ASN B 1 31  ? 25.222  51.682  49.287 1.00 32.26  ? 31  ASN B N     1 
ATOM   3015 C  CA    . ASN B 1 31  ? 25.846  52.545  50.295 1.00 33.27  ? 31  ASN B CA    1 
ATOM   3016 C  C     . ASN B 1 31  ? 27.334  52.816  49.998 1.00 34.26  ? 31  ASN B C     1 
ATOM   3017 O  O     . ASN B 1 31  ? 27.814  53.957  50.133 1.00 33.87  ? 31  ASN B O     1 
ATOM   3018 C  CB    . ASN B 1 31  ? 25.699  51.948  51.702 1.00 34.79  ? 31  ASN B CB    1 
ATOM   3019 C  CG    . ASN B 1 31  ? 24.236  51.870  52.170 1.00 40.90  ? 31  ASN B CG    1 
ATOM   3020 O  OD1   . ASN B 1 31  ? 23.385  52.698  51.789 1.00 43.97  ? 31  ASN B OD1   1 
ATOM   3021 N  ND2   . ASN B 1 31  ? 23.944  50.886  53.029 1.00 41.26  ? 31  ASN B ND2   1 
ATOM   3022 N  N     . ALA B 1 32  ? 28.065  51.786  49.564 1.00 32.45  ? 32  ALA B N     1 
ATOM   3023 C  CA    . ALA B 1 32  ? 29.470  51.992  49.260 1.00 30.69  ? 32  ALA B CA    1 
ATOM   3024 C  C     . ALA B 1 32  ? 29.679  52.974  48.101 1.00 30.39  ? 32  ALA B C     1 
ATOM   3025 O  O     . ALA B 1 32  ? 30.582  53.811  48.132 1.00 31.67  ? 32  ALA B O     1 
ATOM   3026 C  CB    . ALA B 1 32  ? 30.148  50.659  48.950 1.00 31.37  ? 32  ALA B CB    1 
ATOM   3027 N  N     . LEU B 1 33  ? 28.867  52.856  47.065 1.00 29.54  ? 33  LEU B N     1 
ATOM   3028 C  CA    . LEU B 1 33  ? 28.995  53.731  45.913 1.00 30.08  ? 33  LEU B CA    1 
ATOM   3029 C  C     . LEU B 1 33  ? 28.630  55.153  46.327 1.00 30.94  ? 33  LEU B C     1 
ATOM   3030 O  O     . LEU B 1 33  ? 29.260  56.110  45.897 1.00 28.93  ? 33  LEU B O     1 
ATOM   3031 C  CB    . LEU B 1 33  ? 28.067  53.266  44.779 1.00 29.37  ? 33  LEU B CB    1 
ATOM   3032 C  CG    . LEU B 1 33  ? 28.391  51.919  44.092 1.00 32.44  ? 33  LEU B CG    1 
ATOM   3033 C  CD1   . LEU B 1 33  ? 27.236  51.542  43.159 1.00 29.66  ? 33  LEU B CD1   1 
ATOM   3034 C  CD2   . LEU B 1 33  ? 29.724  52.000  43.322 1.00 25.95  ? 33  LEU B CD2   1 
ATOM   3035 N  N     . GLU B 1 34  ? 27.594  55.299  47.143 1.00 31.59  ? 34  GLU B N     1 
ATOM   3036 C  CA    . GLU B 1 34  ? 27.231  56.644  47.587 1.00 35.59  ? 34  GLU B CA    1 
ATOM   3037 C  C     . GLU B 1 34  ? 28.359  57.256  48.416 1.00 36.17  ? 34  GLU B C     1 
ATOM   3038 O  O     . GLU B 1 34  ? 28.627  58.456  48.296 1.00 36.36  ? 34  GLU B O     1 
ATOM   3039 C  CB    . GLU B 1 34  ? 25.925  56.615  48.376 1.00 36.71  ? 34  GLU B CB    1 
ATOM   3040 C  CG    . GLU B 1 34  ? 24.721  56.726  47.464 1.00 40.94  ? 34  GLU B CG    1 
ATOM   3041 C  CD    . GLU B 1 34  ? 23.435  56.275  48.113 1.00 42.16  ? 34  GLU B CD    1 
ATOM   3042 O  OE1   . GLU B 1 34  ? 23.410  56.060  49.347 1.00 43.72  ? 34  GLU B OE1   1 
ATOM   3043 O  OE2   . GLU B 1 34  ? 22.439  56.140  47.371 1.00 46.37  ? 34  GLU B OE2   1 
ATOM   3044 N  N     . ILE B 1 35  ? 29.033  56.447  49.242 1.00 36.07  ? 35  ILE B N     1 
ATOM   3045 C  CA    . ILE B 1 35  ? 30.152  56.981  50.030 1.00 35.96  ? 35  ILE B CA    1 
ATOM   3046 C  C     . ILE B 1 35  ? 31.291  57.362  49.067 1.00 36.21  ? 35  ILE B C     1 
ATOM   3047 O  O     . ILE B 1 35  ? 31.980  58.359  49.257 1.00 34.94  ? 35  ILE B O     1 
ATOM   3048 C  CB    . ILE B 1 35  ? 30.643  55.959  51.082 1.00 36.37  ? 35  ILE B CB    1 
ATOM   3049 C  CG1   . ILE B 1 35  ? 29.543  55.754  52.139 1.00 36.26  ? 35  ILE B CG1   1 
ATOM   3050 C  CG2   . ILE B 1 35  ? 31.921  56.445  51.761 1.00 32.69  ? 35  ILE B CG2   1 
ATOM   3051 C  CD1   . ILE B 1 35  ? 29.864  54.648  53.149 1.00 36.24  ? 35  ILE B CD1   1 
ATOM   3052 N  N     . ALA B 1 36  ? 31.465  56.586  48.006 1.00 35.85  ? 36  ALA B N     1 
ATOM   3053 C  CA    . ALA B 1 36  ? 32.521  56.895  47.049 1.00 35.94  ? 36  ALA B CA    1 
ATOM   3054 C  C     . ALA B 1 36  ? 32.231  58.236  46.365 1.00 35.22  ? 36  ALA B C     1 
ATOM   3055 O  O     . ALA B 1 36  ? 33.136  59.007  46.055 1.00 34.21  ? 36  ALA B O     1 
ATOM   3056 C  CB    . ALA B 1 36  ? 32.637  55.784  45.999 1.00 33.97  ? 36  ALA B CB    1 
ATOM   3057 N  N     . VAL B 1 37  ? 30.964  58.503  46.130 1.00 36.69  ? 37  VAL B N     1 
ATOM   3058 C  CA    . VAL B 1 37  ? 30.575  59.746  45.492 1.00 38.58  ? 37  VAL B CA    1 
ATOM   3059 C  C     . VAL B 1 37  ? 30.882  60.892  46.450 1.00 40.51  ? 37  VAL B C     1 
ATOM   3060 O  O     . VAL B 1 37  ? 31.621  61.798  46.090 1.00 42.68  ? 37  VAL B O     1 
ATOM   3061 C  CB    . VAL B 1 37  ? 29.089  59.705  45.100 1.00 37.26  ? 37  VAL B CB    1 
ATOM   3062 C  CG1   . VAL B 1 37  ? 28.595  61.101  44.680 1.00 37.28  ? 37  VAL B CG1   1 
ATOM   3063 C  CG2   . VAL B 1 37  ? 28.910  58.705  43.947 1.00 33.34  ? 37  VAL B CG2   1 
ATOM   3064 N  N     . GLN B 1 38  ? 30.361  60.829  47.674 1.00 41.15  ? 38  GLN B N     1 
ATOM   3065 C  CA    . GLN B 1 38  ? 30.610  61.872  48.676 1.00 42.47  ? 38  GLN B CA    1 
ATOM   3066 C  C     . GLN B 1 38  ? 32.102  62.111  48.939 1.00 42.24  ? 38  GLN B C     1 
ATOM   3067 O  O     . GLN B 1 38  ? 32.503  63.214  49.292 1.00 41.43  ? 38  GLN B O     1 
ATOM   3068 C  CB    . GLN B 1 38  ? 29.947  61.509  50.000 1.00 43.79  ? 38  GLN B CB    1 
ATOM   3069 C  CG    . GLN B 1 38  ? 28.466  61.228  49.915 1.00 50.37  ? 38  GLN B CG    1 
ATOM   3070 C  CD    . GLN B 1 38  ? 27.888  60.828  51.268 1.00 57.45  ? 38  GLN B CD    1 
ATOM   3071 O  OE1   . GLN B 1 38  ? 28.405  59.916  51.944 1.00 60.07  ? 38  GLN B OE1   1 
ATOM   3072 N  NE2   . GLN B 1 38  ? 26.810  61.508  51.677 1.00 60.36  ? 38  GLN B NE2   1 
ATOM   3073 N  N     . GLU B 1 39  ? 32.913  61.067  48.768 1.00 40.84  ? 39  GLU B N     1 
ATOM   3074 C  CA    . GLU B 1 39  ? 34.349  61.155  48.982 1.00 39.33  ? 39  GLU B CA    1 
ATOM   3075 C  C     . GLU B 1 39  ? 35.043  61.738  47.766 1.00 39.19  ? 39  GLU B C     1 
ATOM   3076 O  O     . GLU B 1 39  ? 36.241  61.947  47.792 1.00 39.25  ? 39  GLU B O     1 
ATOM   3077 C  CB    . GLU B 1 39  ? 34.926  59.767  49.273 1.00 40.90  ? 39  GLU B CB    1 
ATOM   3078 C  CG    . GLU B 1 39  ? 34.605  59.236  50.660 1.00 43.74  ? 39  GLU B CG    1 
ATOM   3079 C  CD    . GLU B 1 39  ? 35.674  59.599  51.692 1.00 47.69  ? 39  GLU B CD    1 
ATOM   3080 O  OE1   . GLU B 1 39  ? 36.713  60.198  51.316 1.00 48.95  ? 39  GLU B OE1   1 
ATOM   3081 O  OE2   . GLU B 1 39  ? 35.477  59.265  52.881 1.00 50.00  ? 39  GLU B OE2   1 
ATOM   3082 N  N     . ASN B 1 40  ? 34.294  61.959  46.690 1.00 38.68  ? 40  ASN B N     1 
ATOM   3083 C  CA    . ASN B 1 40  ? 34.847  62.534  45.469 1.00 40.43  ? 40  ASN B CA    1 
ATOM   3084 C  C     . ASN B 1 40  ? 36.010  61.735  44.877 1.00 39.37  ? 40  ASN B C     1 
ATOM   3085 O  O     . ASN B 1 40  ? 37.011  62.297  44.415 1.00 35.88  ? 40  ASN B O     1 
ATOM   3086 C  CB    . ASN B 1 40  ? 35.309  63.977  45.732 1.00 44.06  ? 40  ASN B CB    1 
ATOM   3087 C  CG    . ASN B 1 40  ? 35.399  64.810  44.454 1.00 49.44  ? 40  ASN B CG    1 
ATOM   3088 O  OD1   . ASN B 1 40  ? 36.038  65.867  44.437 1.00 54.22  ? 40  ASN B OD1   1 
ATOM   3089 N  ND2   . ASN B 1 40  ? 34.757  64.346  43.383 1.00 49.84  ? 40  ASN B ND2   1 
ATOM   3090 N  N     . VAL B 1 41  ? 35.893  60.416  44.884 1.00 37.90  ? 41  VAL B N     1 
ATOM   3091 C  CA    . VAL B 1 41  ? 36.961  59.617  44.314 1.00 34.22  ? 41  VAL B CA    1 
ATOM   3092 C  C     . VAL B 1 41  ? 37.050  59.898  42.805 1.00 35.61  ? 41  VAL B C     1 
ATOM   3093 O  O     . VAL B 1 41  ? 36.068  60.315  42.172 1.00 34.62  ? 41  VAL B O     1 
ATOM   3094 C  CB    . VAL B 1 41  ? 36.709  58.114  44.530 1.00 35.15  ? 41  VAL B CB    1 
ATOM   3095 C  CG1   . VAL B 1 41  ? 36.639  57.794  46.024 1.00 29.37  ? 41  VAL B CG1   1 
ATOM   3096 C  CG2   . VAL B 1 41  ? 35.411  57.709  43.836 1.00 31.37  ? 41  VAL B CG2   1 
ATOM   3097 N  N     . ASP B 1 42  ? 38.234  59.663  42.244 1.00 33.76  ? 42  ASP B N     1 
ATOM   3098 C  CA    . ASP B 1 42  ? 38.508  59.852  40.835 1.00 34.94  ? 42  ASP B CA    1 
ATOM   3099 C  C     . ASP B 1 42  ? 37.942  58.674  40.041 1.00 35.34  ? 42  ASP B C     1 
ATOM   3100 O  O     . ASP B 1 42  ? 37.472  58.830  38.908 1.00 34.87  ? 42  ASP B O     1 
ATOM   3101 C  CB    . ASP B 1 42  ? 40.022  59.932  40.626 1.00 38.17  ? 42  ASP B CB    1 
ATOM   3102 C  CG    . ASP B 1 42  ? 40.626  61.146  41.296 1.00 40.67  ? 42  ASP B CG    1 
ATOM   3103 O  OD1   . ASP B 1 42  ? 41.774  61.066  41.794 1.00 43.18  ? 42  ASP B OD1   1 
ATOM   3104 O  OD2   . ASP B 1 42  ? 39.932  62.179  41.309 1.00 40.27  ? 42  ASP B OD2   1 
ATOM   3105 N  N     . PHE B 1 43  ? 38.050  57.484  40.615 1.00 33.05  ? 43  PHE B N     1 
ATOM   3106 C  CA    . PHE B 1 43  ? 37.509  56.305  39.971 1.00 32.21  ? 43  PHE B CA    1 
ATOM   3107 C  C     . PHE B 1 43  ? 37.254  55.207  40.998 1.00 32.09  ? 43  PHE B C     1 
ATOM   3108 O  O     . PHE B 1 43  ? 37.664  55.312  42.167 1.00 32.58  ? 43  PHE B O     1 
ATOM   3109 C  CB    . PHE B 1 43  ? 38.423  55.818  38.844 1.00 30.41  ? 43  PHE B CB    1 
ATOM   3110 C  CG    . PHE B 1 43  ? 39.827  55.499  39.280 1.00 32.49  ? 43  PHE B CG    1 
ATOM   3111 C  CD1   . PHE B 1 43  ? 40.824  56.490  39.270 1.00 31.85  ? 43  PHE B CD1   1 
ATOM   3112 C  CD2   . PHE B 1 43  ? 40.158  54.214  39.720 1.00 29.63  ? 43  PHE B CD2   1 
ATOM   3113 C  CE1   . PHE B 1 43  ? 42.129  56.196  39.698 1.00 31.40  ? 43  PHE B CE1   1 
ATOM   3114 C  CE2   . PHE B 1 43  ? 41.463  53.911  40.150 1.00 31.57  ? 43  PHE B CE2   1 
ATOM   3115 C  CZ    . PHE B 1 43  ? 42.449  54.902  40.139 1.00 31.85  ? 43  PHE B CZ    1 
ATOM   3116 N  N     . ILE B 1 44  ? 36.557  54.170  40.559 1.00 32.10  ? 44  ILE B N     1 
ATOM   3117 C  CA    . ILE B 1 44  ? 36.211  53.050  41.414 1.00 30.55  ? 44  ILE B CA    1 
ATOM   3118 C  C     . ILE B 1 44  ? 36.765  51.751  40.841 1.00 30.86  ? 44  ILE B C     1 
ATOM   3119 O  O     . ILE B 1 44  ? 36.711  51.535  39.631 1.00 32.85  ? 44  ILE B O     1 
ATOM   3120 C  CB    . ILE B 1 44  ? 34.674  52.964  41.555 1.00 29.62  ? 44  ILE B CB    1 
ATOM   3121 C  CG1   . ILE B 1 44  ? 34.177  54.213  42.303 1.00 29.84  ? 44  ILE B CG1   1 
ATOM   3122 C  CG2   . ILE B 1 44  ? 34.264  51.669  42.308 1.00 30.00  ? 44  ILE B CG2   1 
ATOM   3123 C  CD1   . ILE B 1 44  ? 32.671  54.467  42.207 1.00 30.97  ? 44  ILE B CD1   1 
ATOM   3124 N  N     . LEU B 1 45  ? 37.355  50.921  41.696 1.00 27.55  ? 45  LEU B N     1 
ATOM   3125 C  CA    . LEU B 1 45  ? 37.845  49.634  41.252 1.00 27.05  ? 45  LEU B CA    1 
ATOM   3126 C  C     . LEU B 1 45  ? 36.937  48.576  41.864 1.00 26.67  ? 45  LEU B C     1 
ATOM   3127 O  O     . LEU B 1 45  ? 36.575  48.684  43.028 1.00 24.20  ? 45  LEU B O     1 
ATOM   3128 C  CB    . LEU B 1 45  ? 39.264  49.363  41.728 1.00 27.47  ? 45  LEU B CB    1 
ATOM   3129 C  CG    . LEU B 1 45  ? 40.341  50.352  41.273 1.00 31.61  ? 45  LEU B CG    1 
ATOM   3130 C  CD1   . LEU B 1 45  ? 41.682  49.946  41.921 1.00 29.13  ? 45  LEU B CD1   1 
ATOM   3131 C  CD2   . LEU B 1 45  ? 40.418  50.368  39.741 1.00 25.91  ? 45  LEU B CD2   1 
ATOM   3132 N  N     . ILE B 1 46  ? 36.523  47.596  41.067 1.00 25.23  ? 46  ILE B N     1 
ATOM   3133 C  CA    . ILE B 1 46  ? 35.733  46.487  41.594 1.00 26.55  ? 46  ILE B CA    1 
ATOM   3134 C  C     . ILE B 1 46  ? 36.535  45.243  41.209 1.00 27.97  ? 46  ILE B C     1 
ATOM   3135 O  O     . ILE B 1 46  ? 36.498  44.771  40.062 1.00 27.38  ? 46  ILE B O     1 
ATOM   3136 C  CB    . ILE B 1 46  ? 34.311  46.470  41.025 1.00 29.02  ? 46  ILE B CB    1 
ATOM   3137 C  CG1   . ILE B 1 46  ? 33.579  47.763  41.469 1.00 27.75  ? 46  ILE B CG1   1 
ATOM   3138 C  CG2   . ILE B 1 46  ? 33.553  45.228  41.558 1.00 24.62  ? 46  ILE B CG2   1 
ATOM   3139 C  CD1   . ILE B 1 46  ? 32.150  47.863  40.980 1.00 29.12  ? 46  ILE B CD1   1 
ATOM   3140 N  N     . ALA B 1 47  ? 37.270  44.718  42.186 1.00 26.22  ? 47  ALA B N     1 
ATOM   3141 C  CA    . ALA B 1 47  ? 38.153  43.594  41.937 1.00 27.40  ? 47  ALA B CA    1 
ATOM   3142 C  C     . ALA B 1 47  ? 37.544  42.206  41.845 1.00 27.30  ? 47  ALA B C     1 
ATOM   3143 O  O     . ALA B 1 47  ? 37.993  41.280  42.529 1.00 25.84  ? 47  ALA B O     1 
ATOM   3144 C  CB    . ALA B 1 47  ? 39.316  43.604  42.969 1.00 26.13  ? 47  ALA B CB    1 
ATOM   3145 N  N     . GLY B 1 48  ? 36.517  42.063  41.007 1.00 28.58  ? 48  GLY B N     1 
ATOM   3146 C  CA    . GLY B 1 48  ? 35.911  40.747  40.816 1.00 28.78  ? 48  GLY B CA    1 
ATOM   3147 C  C     . GLY B 1 48  ? 34.781  40.352  41.746 1.00 29.27  ? 48  GLY B C     1 
ATOM   3148 O  O     . GLY B 1 48  ? 34.683  40.857  42.876 1.00 27.68  ? 48  GLY B O     1 
ATOM   3149 N  N     . ASP B 1 49  ? 33.940  39.436  41.255 1.00 26.88  ? 49  ASP B N     1 
ATOM   3150 C  CA    . ASP B 1 49  ? 32.775  38.920  41.970 1.00 25.02  ? 49  ASP B CA    1 
ATOM   3151 C  C     . ASP B 1 49  ? 31.734  40.011  42.179 1.00 25.57  ? 49  ASP B C     1 
ATOM   3152 O  O     . ASP B 1 49  ? 31.099  40.100  43.235 1.00 23.44  ? 49  ASP B O     1 
ATOM   3153 C  CB    . ASP B 1 49  ? 33.172  38.285  43.308 1.00 24.40  ? 49  ASP B CB    1 
ATOM   3154 C  CG    . ASP B 1 49  ? 33.618  36.822  43.159 1.00 30.13  ? 49  ASP B CG    1 
ATOM   3155 O  OD1   . ASP B 1 49  ? 33.676  36.298  42.011 1.00 28.65  ? 49  ASP B OD1   1 
ATOM   3156 O  OD2   . ASP B 1 49  ? 33.917  36.190  44.193 1.00 26.02  ? 49  ASP B OD2   1 
ATOM   3157 N  N     . LEU B 1 50  ? 31.563  40.854  41.165 1.00 26.34  ? 50  LEU B N     1 
ATOM   3158 C  CA    . LEU B 1 50  ? 30.553  41.905  41.244 1.00 26.84  ? 50  LEU B CA    1 
ATOM   3159 C  C     . LEU B 1 50  ? 29.197  41.185  41.347 1.00 28.32  ? 50  LEU B C     1 
ATOM   3160 O  O     . LEU B 1 50  ? 28.314  41.612  42.108 1.00 28.36  ? 50  LEU B O     1 
ATOM   3161 C  CB    . LEU B 1 50  ? 30.579  42.789  39.992 1.00 25.27  ? 50  LEU B CB    1 
ATOM   3162 C  CG    . LEU B 1 50  ? 29.377  43.737  39.855 1.00 25.43  ? 50  LEU B CG    1 
ATOM   3163 C  CD1   . LEU B 1 50  ? 29.166  44.523  41.158 1.00 23.73  ? 50  LEU B CD1   1 
ATOM   3164 C  CD2   . LEU B 1 50  ? 29.609  44.709  38.700 1.00 25.62  ? 50  LEU B CD2   1 
ATOM   3165 N  N     . PHE B 1 51  ? 29.048  40.108  40.565 1.00 24.29  ? 51  PHE B N     1 
ATOM   3166 C  CA    . PHE B 1 51  ? 27.838  39.294  40.570 1.00 25.80  ? 51  PHE B CA    1 
ATOM   3167 C  C     . PHE B 1 51  ? 28.120  37.937  41.183 1.00 25.85  ? 51  PHE B C     1 
ATOM   3168 O  O     . PHE B 1 51  ? 29.208  37.399  41.042 1.00 27.57  ? 51  PHE B O     1 
ATOM   3169 C  CB    . PHE B 1 51  ? 27.293  39.082  39.155 1.00 23.31  ? 51  PHE B CB    1 
ATOM   3170 C  CG    . PHE B 1 51  ? 26.778  40.332  38.526 1.00 24.98  ? 51  PHE B CG    1 
ATOM   3171 C  CD1   . PHE B 1 51  ? 27.637  41.185  37.837 1.00 24.53  ? 51  PHE B CD1   1 
ATOM   3172 C  CD2   . PHE B 1 51  ? 25.451  40.680  38.653 1.00 24.99  ? 51  PHE B CD2   1 
ATOM   3173 C  CE1   . PHE B 1 51  ? 27.179  42.364  37.288 1.00 26.24  ? 51  PHE B CE1   1 
ATOM   3174 C  CE2   . PHE B 1 51  ? 24.983  41.866  38.098 1.00 27.70  ? 51  PHE B CE2   1 
ATOM   3175 C  CZ    . PHE B 1 51  ? 25.851  42.707  37.419 1.00 28.04  ? 51  PHE B CZ    1 
ATOM   3176 N  N     . HIS B 1 52  ? 27.123  37.386  41.856 1.00 26.38  ? 52  HIS B N     1 
ATOM   3177 C  CA    . HIS B 1 52  ? 27.250  36.091  42.503 1.00 25.54  ? 52  HIS B CA    1 
ATOM   3178 C  C     . HIS B 1 52  ? 27.177  34.970  41.470 1.00 27.16  ? 52  HIS B C     1 
ATOM   3179 O  O     . HIS B 1 52  ? 27.732  33.887  41.670 1.00 28.78  ? 52  HIS B O     1 
ATOM   3180 C  CB    . HIS B 1 52  ? 26.108  35.913  43.501 1.00 25.61  ? 52  HIS B CB    1 
ATOM   3181 C  CG    . HIS B 1 52  ? 26.191  34.644  44.292 1.00 28.31  ? 52  HIS B CG    1 
ATOM   3182 N  ND1   . HIS B 1 52  ? 27.180  34.416  45.231 1.00 27.23  ? 52  HIS B ND1   1 
ATOM   3183 C  CD2   . HIS B 1 52  ? 25.396  33.543  44.300 1.00 26.55  ? 52  HIS B CD2   1 
ATOM   3184 C  CE1   . HIS B 1 52  ? 26.987  33.232  45.786 1.00 30.43  ? 52  HIS B CE1   1 
ATOM   3185 N  NE2   . HIS B 1 52  ? 25.913  32.681  45.239 1.00 32.07  ? 52  HIS B NE2   1 
ATOM   3186 N  N     . SER B 1 53  ? 26.480  35.230  40.368 1.00 28.49  ? 53  SER B N     1 
ATOM   3187 C  CA    . SER B 1 53  ? 26.325  34.238  39.306 1.00 29.74  ? 53  SER B CA    1 
ATOM   3188 C  C     . SER B 1 53  ? 26.863  34.783  38.006 1.00 29.42  ? 53  SER B C     1 
ATOM   3189 O  O     . SER B 1 53  ? 26.813  35.988  37.764 1.00 29.61  ? 53  SER B O     1 
ATOM   3190 C  CB    . SER B 1 53  ? 24.839  33.895  39.118 1.00 29.10  ? 53  SER B CB    1 
ATOM   3191 O  OG    . SER B 1 53  ? 24.621  33.227  37.885 1.00 33.41  ? 53  SER B OG    1 
ATOM   3192 N  N     . SER B 1 54  ? 27.350  33.904  37.142 1.00 29.18  ? 54  SER B N     1 
ATOM   3193 C  CA    . SER B 1 54  ? 27.850  34.362  35.850 1.00 29.55  ? 54  SER B CA    1 
ATOM   3194 C  C     . SER B 1 54  ? 26.674  34.538  34.868 1.00 29.85  ? 54  SER B C     1 
ATOM   3195 O  O     . SER B 1 54  ? 26.815  35.132  33.802 1.00 28.78  ? 54  SER B O     1 
ATOM   3196 C  CB    . SER B 1 54  ? 28.880  33.372  35.309 1.00 32.34  ? 54  SER B CB    1 
ATOM   3197 O  OG    . SER B 1 54  ? 28.298  32.108  35.122 1.00 34.16  ? 54  SER B OG    1 
ATOM   3198 N  N     . ARG B 1 55  ? 25.502  34.063  35.271 1.00 30.48  ? 55  ARG B N     1 
ATOM   3199 C  CA    . ARG B 1 55  ? 24.289  34.176  34.456 1.00 33.03  ? 55  ARG B CA    1 
ATOM   3200 C  C     . ARG B 1 55  ? 23.239  34.801  35.374 1.00 32.04  ? 55  ARG B C     1 
ATOM   3201 O  O     . ARG B 1 55  ? 22.250  34.163  35.740 1.00 31.07  ? 55  ARG B O     1 
ATOM   3202 C  CB    . ARG B 1 55  ? 23.821  32.779  33.969 1.00 33.78  ? 55  ARG B CB    1 
ATOM   3203 C  CG    . ARG B 1 55  ? 22.867  32.872  32.766 1.00 39.45  ? 55  ARG B CG    1 
ATOM   3204 C  CD    . ARG B 1 55  ? 22.695  31.560  31.982 1.00 43.80  ? 55  ARG B CD    1 
ATOM   3205 N  NE    . ARG B 1 55  ? 21.593  30.765  32.510 1.00 50.50  ? 55  ARG B NE    1 
ATOM   3206 C  CZ    . ARG B 1 55  ? 21.748  29.750  33.353 1.00 54.14  ? 55  ARG B CZ    1 
ATOM   3207 N  NH1   . ARG B 1 55  ? 20.690  29.092  33.804 1.00 53.69  ? 55  ARG B NH1   1 
ATOM   3208 N  NH2   . ARG B 1 55  ? 22.972  29.376  33.723 1.00 56.23  ? 55  ARG B NH2   1 
ATOM   3209 N  N     . PRO B 1 56  ? 23.462  36.058  35.783 1.00 32.94  ? 56  PRO B N     1 
ATOM   3210 C  CA    . PRO B 1 56  ? 22.497  36.707  36.675 1.00 32.26  ? 56  PRO B CA    1 
ATOM   3211 C  C     . PRO B 1 56  ? 21.110  36.801  36.038 1.00 33.88  ? 56  PRO B C     1 
ATOM   3212 O  O     . PRO B 1 56  ? 20.963  36.759  34.817 1.00 33.46  ? 56  PRO B O     1 
ATOM   3213 C  CB    . PRO B 1 56  ? 23.133  38.072  36.930 1.00 31.03  ? 56  PRO B CB    1 
ATOM   3214 C  CG    . PRO B 1 56  ? 23.842  38.352  35.636 1.00 33.51  ? 56  PRO B CG    1 
ATOM   3215 C  CD    . PRO B 1 56  ? 24.471  37.017  35.294 1.00 30.86  ? 56  PRO B CD    1 
ATOM   3216 N  N     . SER B 1 57  ? 20.094  36.924  36.877 1.00 34.09  ? 57  SER B N     1 
ATOM   3217 C  CA    . SER B 1 57  ? 18.716  37.025  36.407 1.00 33.50  ? 57  SER B CA    1 
ATOM   3218 C  C     . SER B 1 57  ? 18.421  38.439  35.939 1.00 32.54  ? 57  SER B C     1 
ATOM   3219 O  O     . SER B 1 57  ? 19.149  39.371  36.271 1.00 32.86  ? 57  SER B O     1 
ATOM   3220 C  CB    . SER B 1 57  ? 17.753  36.705  37.548 1.00 32.94  ? 57  SER B CB    1 
ATOM   3221 O  OG    . SER B 1 57  ? 17.795  37.780  38.491 1.00 33.43  ? 57  SER B OG    1 
ATOM   3222 N  N     . PRO B 1 58  ? 17.324  38.615  35.176 1.00 32.57  ? 58  PRO B N     1 
ATOM   3223 C  CA    . PRO B 1 58  ? 16.909  39.926  34.665 1.00 31.58  ? 58  PRO B CA    1 
ATOM   3224 C  C     . PRO B 1 58  ? 16.763  40.934  35.838 1.00 32.15  ? 58  PRO B C     1 
ATOM   3225 O  O     . PRO B 1 58  ? 17.110  42.104  35.701 1.00 30.17  ? 58  PRO B O     1 
ATOM   3226 C  CB    . PRO B 1 58  ? 15.566  39.623  33.991 1.00 29.22  ? 58  PRO B CB    1 
ATOM   3227 C  CG    . PRO B 1 58  ? 15.763  38.217  33.475 1.00 31.30  ? 58  PRO B CG    1 
ATOM   3228 C  CD    . PRO B 1 58  ? 16.443  37.543  34.658 1.00 32.26  ? 58  PRO B CD    1 
ATOM   3229 N  N     . GLY B 1 59  ? 16.275  40.445  36.981 1.00 32.19  ? 59  GLY B N     1 
ATOM   3230 C  CA    . GLY B 1 59  ? 16.081  41.278  38.156 1.00 31.35  ? 59  GLY B CA    1 
ATOM   3231 C  C     . GLY B 1 59  ? 17.396  41.773  38.739 1.00 32.86  ? 59  GLY B C     1 
ATOM   3232 O  O     . GLY B 1 59  ? 17.528  42.952  39.075 1.00 33.37  ? 59  GLY B O     1 
ATOM   3233 N  N     . THR B 1 60  ? 18.373  40.877  38.865 1.00 32.37  ? 60  THR B N     1 
ATOM   3234 C  CA    . THR B 1 60  ? 19.686  41.251  39.393 1.00 31.24  ? 60  THR B CA    1 
ATOM   3235 C  C     . THR B 1 60  ? 20.344  42.284  38.464 1.00 31.51  ? 60  THR B C     1 
ATOM   3236 O  O     . THR B 1 60  ? 20.885  43.299  38.902 1.00 32.61  ? 60  THR B O     1 
ATOM   3237 C  CB    . THR B 1 60  ? 20.596  40.016  39.499 1.00 29.10  ? 60  THR B CB    1 
ATOM   3238 O  OG1   . THR B 1 60  ? 20.002  39.083  40.396 1.00 29.80  ? 60  THR B OG1   1 
ATOM   3239 C  CG2   . THR B 1 60  ? 21.998  40.395  39.997 1.00 27.48  ? 60  THR B CG2   1 
ATOM   3240 N  N     . LEU B 1 61  ? 20.306  41.998  37.171 1.00 31.91  ? 61  LEU B N     1 
ATOM   3241 C  CA    . LEU B 1 61  ? 20.863  42.887  36.169 1.00 32.79  ? 61  LEU B CA    1 
ATOM   3242 C  C     . LEU B 1 61  ? 20.241  44.267  36.260 1.00 31.35  ? 61  LEU B C     1 
ATOM   3243 O  O     . LEU B 1 61  ? 20.923  45.278  36.173 1.00 31.03  ? 61  LEU B O     1 
ATOM   3244 C  CB    . LEU B 1 61  ? 20.575  42.326  34.779 1.00 35.15  ? 61  LEU B CB    1 
ATOM   3245 C  CG    . LEU B 1 61  ? 21.403  41.087  34.503 1.00 39.29  ? 61  LEU B CG    1 
ATOM   3246 C  CD1   . LEU B 1 61  ? 20.957  40.411  33.196 1.00 41.11  ? 61  LEU B CD1   1 
ATOM   3247 C  CD2   . LEU B 1 61  ? 22.872  41.557  34.420 1.00 42.30  ? 61  LEU B CD2   1 
ATOM   3248 N  N     . LYS B 1 62  ? 18.926  44.288  36.401 1.00 31.86  ? 62  LYS B N     1 
ATOM   3249 C  CA    . LYS B 1 62  ? 18.201  45.539  36.490 1.00 34.41  ? 62  LYS B CA    1 
ATOM   3250 C  C     . LYS B 1 62  ? 18.648  46.357  37.704 1.00 32.83  ? 62  LYS B C     1 
ATOM   3251 O  O     . LYS B 1 62  ? 18.753  47.568  37.622 1.00 33.63  ? 62  LYS B O     1 
ATOM   3252 C  CB    . LYS B 1 62  ? 16.697  45.259  36.553 1.00 36.27  ? 62  LYS B CB    1 
ATOM   3253 C  CG    . LYS B 1 62  ? 15.840  46.517  36.466 1.00 41.67  ? 62  LYS B CG    1 
ATOM   3254 C  CD    . LYS B 1 62  ? 14.360  46.173  36.294 1.00 47.34  ? 62  LYS B CD    1 
ATOM   3255 C  CE    . LYS B 1 62  ? 13.506  47.421  36.409 1.00 50.31  ? 62  LYS B CE    1 
ATOM   3256 N  NZ    . LYS B 1 62  ? 12.089  47.101  36.101 1.00 56.26  ? 62  LYS B NZ    1 
ATOM   3257 N  N     . LYS B 1 63  ? 18.904  45.688  38.825 1.00 34.62  ? 63  LYS B N     1 
ATOM   3258 C  CA    . LYS B 1 63  ? 19.365  46.359  40.047 1.00 35.37  ? 63  LYS B CA    1 
ATOM   3259 C  C     . LYS B 1 63  ? 20.797  46.863  39.881 1.00 33.46  ? 63  LYS B C     1 
ATOM   3260 O  O     . LYS B 1 63  ? 21.119  47.986  40.266 1.00 30.79  ? 63  LYS B O     1 
ATOM   3261 C  CB    . LYS B 1 63  ? 19.318  45.405  41.239 1.00 39.22  ? 63  LYS B CB    1 
ATOM   3262 C  CG    . LYS B 1 63  ? 19.812  46.040  42.561 1.00 44.73  ? 63  LYS B CG    1 
ATOM   3263 C  CD    . LYS B 1 63  ? 19.007  47.319  42.900 1.00 47.58  ? 63  LYS B CD    1 
ATOM   3264 C  CE    . LYS B 1 63  ? 18.751  47.457  44.392 1.00 50.17  ? 63  LYS B CE    1 
ATOM   3265 N  NZ    . LYS B 1 63  ? 18.132  48.786  44.706 1.00 52.89  ? 63  LYS B NZ    1 
ATOM   3266 N  N     . ALA B 1 64  ? 21.654  46.020  39.299 1.00 32.21  ? 64  ALA B N     1 
ATOM   3267 C  CA    . ALA B 1 64  ? 23.035  46.400  39.066 1.00 30.71  ? 64  ALA B CA    1 
ATOM   3268 C  C     . ALA B 1 64  ? 23.108  47.648  38.174 1.00 31.64  ? 64  ALA B C     1 
ATOM   3269 O  O     . ALA B 1 64  ? 23.898  48.557  38.439 1.00 30.74  ? 64  ALA B O     1 
ATOM   3270 C  CB    . ALA B 1 64  ? 23.797  45.242  38.409 1.00 30.50  ? 64  ALA B CB    1 
ATOM   3271 N  N     . ILE B 1 65  ? 22.291  47.675  37.117 1.00 31.79  ? 65  ILE B N     1 
ATOM   3272 C  CA    . ILE B 1 65  ? 22.254  48.807  36.185 1.00 31.96  ? 65  ILE B CA    1 
ATOM   3273 C  C     . ILE B 1 65  ? 21.860  50.077  36.913 1.00 32.27  ? 65  ILE B C     1 
ATOM   3274 O  O     . ILE B 1 65  ? 22.497  51.112  36.732 1.00 32.49  ? 65  ILE B O     1 
ATOM   3275 C  CB    . ILE B 1 65  ? 21.244  48.560  35.012 1.00 31.70  ? 65  ILE B CB    1 
ATOM   3276 C  CG1   . ILE B 1 65  ? 21.814  47.499  34.051 1.00 30.32  ? 65  ILE B CG1   1 
ATOM   3277 C  CG2   . ILE B 1 65  ? 20.964  49.880  34.248 1.00 28.35  ? 65  ILE B CG2   1 
ATOM   3278 C  CD1   . ILE B 1 65  ? 20.848  47.091  32.948 1.00 32.11  ? 65  ILE B CD1   1 
ATOM   3279 N  N     . ALA B 1 66  ? 20.818  49.995  37.739 1.00 32.59  ? 66  ALA B N     1 
ATOM   3280 C  CA    . ALA B 1 66  ? 20.365  51.166  38.481 1.00 35.09  ? 66  ALA B CA    1 
ATOM   3281 C  C     . ALA B 1 66  ? 21.463  51.633  39.458 1.00 36.79  ? 66  ALA B C     1 
ATOM   3282 O  O     . ALA B 1 66  ? 21.761  52.823  39.524 1.00 36.87  ? 66  ALA B O     1 
ATOM   3283 C  CB    . ALA B 1 66  ? 19.063  50.853  39.225 1.00 32.91  ? 66  ALA B CB    1 
ATOM   3284 N  N     . LEU B 1 67  ? 22.088  50.693  40.176 1.00 36.55  ? 67  LEU B N     1 
ATOM   3285 C  CA    . LEU B 1 67  ? 23.146  51.037  41.137 1.00 34.45  ? 67  LEU B CA    1 
ATOM   3286 C  C     . LEU B 1 67  ? 24.358  51.664  40.463 1.00 34.35  ? 67  LEU B C     1 
ATOM   3287 O  O     . LEU B 1 67  ? 24.926  52.627  40.979 1.00 31.72  ? 67  LEU B O     1 
ATOM   3288 C  CB    . LEU B 1 67  ? 23.590  49.804  41.934 1.00 32.84  ? 67  LEU B CB    1 
ATOM   3289 C  CG    . LEU B 1 67  ? 22.507  49.167  42.802 1.00 35.34  ? 67  LEU B CG    1 
ATOM   3290 C  CD1   . LEU B 1 67  ? 23.076  48.066  43.695 1.00 34.51  ? 67  LEU B CD1   1 
ATOM   3291 C  CD2   . LEU B 1 67  ? 21.874  50.247  43.649 1.00 36.90  ? 67  LEU B CD2   1 
ATOM   3292 N  N     . LEU B 1 68  ? 24.764  51.116  39.321 1.00 33.42  ? 68  LEU B N     1 
ATOM   3293 C  CA    . LEU B 1 68  ? 25.911  51.652  38.603 1.00 33.38  ? 68  LEU B CA    1 
ATOM   3294 C  C     . LEU B 1 68  ? 25.624  53.048  38.018 1.00 35.89  ? 68  LEU B C     1 
ATOM   3295 O  O     . LEU B 1 68  ? 26.563  53.753  37.578 1.00 34.77  ? 68  LEU B O     1 
ATOM   3296 C  CB    . LEU B 1 68  ? 26.370  50.668  37.499 1.00 30.77  ? 68  LEU B CB    1 
ATOM   3297 C  CG    . LEU B 1 68  ? 27.095  49.419  38.058 1.00 30.65  ? 68  LEU B CG    1 
ATOM   3298 C  CD1   . LEU B 1 68  ? 27.360  48.387  36.975 1.00 27.56  ? 68  LEU B CD1   1 
ATOM   3299 C  CD2   . LEU B 1 68  ? 28.394  49.848  38.709 1.00 24.70  ? 68  LEU B CD2   1 
ATOM   3300 N  N     . GLN B 1 69  ? 24.345  53.449  38.015 1.00 36.09  ? 69  GLN B N     1 
ATOM   3301 C  CA    . GLN B 1 69  ? 23.982  54.780  37.528 1.00 39.67  ? 69  GLN B CA    1 
ATOM   3302 C  C     . GLN B 1 69  ? 24.505  55.831  38.506 1.00 40.36  ? 69  GLN B C     1 
ATOM   3303 O  O     . GLN B 1 69  ? 24.685  56.986  38.136 1.00 42.53  ? 69  GLN B O     1 
ATOM   3304 C  CB    . GLN B 1 69  ? 22.467  54.986  37.441 1.00 39.48  ? 69  GLN B CB    1 
ATOM   3305 C  CG    . GLN B 1 69  ? 21.732  54.203  36.376 1.00 47.30  ? 69  GLN B CG    1 
ATOM   3306 C  CD    . GLN B 1 69  ? 22.322  54.394  34.978 1.00 49.93  ? 69  GLN B CD    1 
ATOM   3307 O  OE1   . GLN B 1 69  ? 22.739  55.506  34.595 1.00 47.82  ? 69  GLN B OE1   1 
ATOM   3308 N  NE2   . GLN B 1 69  ? 22.355  53.300  34.203 1.00 50.13  ? 69  GLN B NE2   1 
ATOM   3309 N  N     . ILE B 1 70  ? 24.724  55.431  39.756 1.00 39.16  ? 70  ILE B N     1 
ATOM   3310 C  CA    . ILE B 1 70  ? 25.194  56.361  40.773 1.00 38.39  ? 70  ILE B CA    1 
ATOM   3311 C  C     . ILE B 1 70  ? 26.562  56.956  40.400 1.00 37.49  ? 70  ILE B C     1 
ATOM   3312 O  O     . ILE B 1 70  ? 26.703  58.173  40.308 1.00 37.52  ? 70  ILE B O     1 
ATOM   3313 C  CB    . ILE B 1 70  ? 25.231  55.671  42.172 1.00 37.81  ? 70  ILE B CB    1 
ATOM   3314 C  CG1   . ILE B 1 70  ? 23.818  55.248  42.574 1.00 37.05  ? 70  ILE B CG1   1 
ATOM   3315 C  CG2   . ILE B 1 70  ? 25.810  56.614  43.228 1.00 37.80  ? 70  ILE B CG2   1 
ATOM   3316 C  CD1   . ILE B 1 70  ? 23.780  54.336  43.813 1.00 36.81  ? 70  ILE B CD1   1 
ATOM   3317 N  N     . PRO B 1 71  ? 27.586  56.114  40.186 1.00 36.54  ? 71  PRO B N     1 
ATOM   3318 C  CA    . PRO B 1 71  ? 28.859  56.739  39.821 1.00 35.53  ? 71  PRO B CA    1 
ATOM   3319 C  C     . PRO B 1 71  ? 28.814  57.357  38.421 1.00 38.89  ? 71  PRO B C     1 
ATOM   3320 O  O     . PRO B 1 71  ? 29.534  58.334  38.117 1.00 39.47  ? 71  PRO B O     1 
ATOM   3321 C  CB    . PRO B 1 71  ? 29.859  55.590  39.915 1.00 35.30  ? 71  PRO B CB    1 
ATOM   3322 C  CG    . PRO B 1 71  ? 29.023  54.348  39.759 1.00 34.21  ? 71  PRO B CG    1 
ATOM   3323 C  CD    . PRO B 1 71  ? 27.773  54.696  40.538 1.00 34.00  ? 71  PRO B CD    1 
ATOM   3324 N  N     . LYS B 1 72  ? 27.977  56.782  37.568 1.00 40.28  ? 72  LYS B N     1 
ATOM   3325 C  CA    . LYS B 1 72  ? 27.826  57.263  36.202 1.00 41.75  ? 72  LYS B CA    1 
ATOM   3326 C  C     . LYS B 1 72  ? 27.359  58.710  36.234 1.00 42.62  ? 72  LYS B C     1 
ATOM   3327 O  O     . LYS B 1 72  ? 27.902  59.550  35.508 1.00 42.07  ? 72  LYS B O     1 
ATOM   3328 C  CB    . LYS B 1 72  ? 26.816  56.403  35.438 1.00 43.51  ? 72  LYS B CB    1 
ATOM   3329 C  CG    . LYS B 1 72  ? 26.609  56.804  33.969 1.00 46.32  ? 72  LYS B CG    1 
ATOM   3330 C  CD    . LYS B 1 72  ? 27.772  56.386  33.078 1.00 48.04  ? 72  LYS B CD    1 
ATOM   3331 C  CE    . LYS B 1 72  ? 27.430  56.581  31.589 1.00 49.94  ? 72  LYS B CE    1 
ATOM   3332 N  NZ    . LYS B 1 72  ? 28.593  56.306  30.683 1.00 48.58  ? 72  LYS B NZ    1 
ATOM   3333 N  N     . GLU B 1 73  ? 26.379  59.008  37.087 1.00 42.64  ? 73  GLU B N     1 
ATOM   3334 C  CA    . GLU B 1 73  ? 25.871  60.380  37.189 1.00 46.84  ? 73  GLU B CA    1 
ATOM   3335 C  C     . GLU B 1 73  ? 26.986  61.413  37.470 1.00 46.64  ? 73  GLU B C     1 
ATOM   3336 O  O     . GLU B 1 73  ? 26.887  62.558  37.060 1.00 46.29  ? 73  GLU B O     1 
ATOM   3337 C  CB    . GLU B 1 73  ? 24.824  60.513  38.302 1.00 48.30  ? 73  GLU B CB    1 
ATOM   3338 C  CG    . GLU B 1 73  ? 23.665  59.529  38.279 1.00 55.19  ? 73  GLU B CG    1 
ATOM   3339 C  CD    . GLU B 1 73  ? 22.930  59.477  36.950 1.00 59.34  ? 73  GLU B CD    1 
ATOM   3340 O  OE1   . GLU B 1 73  ? 23.477  58.889  35.984 1.00 63.36  ? 73  GLU B OE1   1 
ATOM   3341 O  OE2   . GLU B 1 73  ? 21.803  60.016  36.872 1.00 60.37  ? 73  GLU B OE2   1 
ATOM   3342 N  N     . HIS B 1 74  ? 28.049  60.999  38.151 1.00 46.51  ? 74  HIS B N     1 
ATOM   3343 C  CA    . HIS B 1 74  ? 29.136  61.911  38.489 1.00 46.25  ? 74  HIS B CA    1 
ATOM   3344 C  C     . HIS B 1 74  ? 30.383  61.718  37.669 1.00 46.67  ? 74  HIS B C     1 
ATOM   3345 O  O     . HIS B 1 74  ? 31.457  62.188  38.040 1.00 47.56  ? 74  HIS B O     1 
ATOM   3346 C  CB    . HIS B 1 74  ? 29.478  61.767  39.962 1.00 45.81  ? 74  HIS B CB    1 
ATOM   3347 C  CG    . HIS B 1 74  ? 28.304  61.967  40.856 1.00 44.33  ? 74  HIS B CG    1 
ATOM   3348 N  ND1   . HIS B 1 74  ? 27.982  63.193  41.397 1.00 45.40  ? 74  HIS B ND1   1 
ATOM   3349 C  CD2   . HIS B 1 74  ? 27.330  61.115  41.248 1.00 45.10  ? 74  HIS B CD2   1 
ATOM   3350 C  CE1   . HIS B 1 74  ? 26.859  63.086  42.085 1.00 45.64  ? 74  HIS B CE1   1 
ATOM   3351 N  NE2   . HIS B 1 74  ? 26.441  61.835  42.010 1.00 45.33  ? 74  HIS B NE2   1 
ATOM   3352 N  N     . SER B 1 75  ? 30.241  61.035  36.545 1.00 46.84  ? 75  SER B N     1 
ATOM   3353 C  CA    . SER B 1 75  ? 31.380  60.786  35.671 1.00 47.87  ? 75  SER B CA    1 
ATOM   3354 C  C     . SER B 1 75  ? 32.542  60.116  36.396 1.00 45.84  ? 75  SER B C     1 
ATOM   3355 O  O     . SER B 1 75  ? 33.708  60.428  36.145 1.00 45.81  ? 75  SER B O     1 
ATOM   3356 C  CB    . SER B 1 75  ? 31.849  62.097  35.029 1.00 50.23  ? 75  SER B CB    1 
ATOM   3357 O  OG    . SER B 1 75  ? 30.871  62.574  34.109 1.00 55.40  ? 75  SER B OG    1 
ATOM   3358 N  N     . ILE B 1 76  ? 32.215  59.204  37.308 1.00 42.77  ? 76  ILE B N     1 
ATOM   3359 C  CA    . ILE B 1 76  ? 33.233  58.462  38.029 1.00 38.72  ? 76  ILE B CA    1 
ATOM   3360 C  C     . ILE B 1 76  ? 33.374  57.122  37.320 1.00 37.91  ? 76  ILE B C     1 
ATOM   3361 O  O     . ILE B 1 76  ? 32.537  56.257  37.481 1.00 38.11  ? 76  ILE B O     1 
ATOM   3362 C  CB    . ILE B 1 76  ? 32.821  58.178  39.494 1.00 38.86  ? 76  ILE B CB    1 
ATOM   3363 C  CG1   . ILE B 1 76  ? 32.682  59.495  40.268 1.00 38.14  ? 76  ILE B CG1   1 
ATOM   3364 C  CG2   . ILE B 1 76  ? 33.863  57.239  40.171 1.00 35.54  ? 76  ILE B CG2   1 
ATOM   3365 C  CD1   . ILE B 1 76  ? 32.194  59.307  41.698 1.00 38.01  ? 76  ILE B CD1   1 
ATOM   3366 N  N     . PRO B 1 77  ? 34.434  56.940  36.523 1.00 36.65  ? 77  PRO B N     1 
ATOM   3367 C  CA    . PRO B 1 77  ? 34.622  55.667  35.825 1.00 34.90  ? 77  PRO B CA    1 
ATOM   3368 C  C     . PRO B 1 77  ? 34.762  54.477  36.798 1.00 34.52  ? 77  PRO B C     1 
ATOM   3369 O  O     . PRO B 1 77  ? 35.316  54.611  37.894 1.00 33.20  ? 77  PRO B O     1 
ATOM   3370 C  CB    . PRO B 1 77  ? 35.894  55.906  34.998 1.00 36.27  ? 77  PRO B CB    1 
ATOM   3371 C  CG    . PRO B 1 77  ? 36.640  56.869  35.791 1.00 37.78  ? 77  PRO B CG    1 
ATOM   3372 C  CD    . PRO B 1 77  ? 35.606  57.817  36.352 1.00 34.46  ? 77  PRO B CD    1 
ATOM   3373 N  N     . VAL B 1 78  ? 34.232  53.329  36.385 1.00 32.10  ? 78  VAL B N     1 
ATOM   3374 C  CA    . VAL B 1 78  ? 34.263  52.094  37.167 1.00 31.55  ? 78  VAL B CA    1 
ATOM   3375 C  C     . VAL B 1 78  ? 35.079  51.024  36.434 1.00 31.91  ? 78  VAL B C     1 
ATOM   3376 O  O     . VAL B 1 78  ? 34.642  50.499  35.399 1.00 31.23  ? 78  VAL B O     1 
ATOM   3377 C  CB    . VAL B 1 78  ? 32.818  51.542  37.396 1.00 31.11  ? 78  VAL B CB    1 
ATOM   3378 C  CG1   . VAL B 1 78  ? 32.863  50.259  38.226 1.00 29.98  ? 78  VAL B CG1   1 
ATOM   3379 C  CG2   . VAL B 1 78  ? 31.966  52.578  38.089 1.00 30.70  ? 78  VAL B CG2   1 
ATOM   3380 N  N     . PHE B 1 79  ? 36.257  50.699  36.955 1.00 29.75  ? 79  PHE B N     1 
ATOM   3381 C  CA    . PHE B 1 79  ? 37.103  49.679  36.331 1.00 30.61  ? 79  PHE B CA    1 
ATOM   3382 C  C     . PHE B 1 79  ? 36.858  48.373  37.041 1.00 30.78  ? 79  PHE B C     1 
ATOM   3383 O  O     . PHE B 1 79  ? 36.855  48.346  38.272 1.00 30.62  ? 79  PHE B O     1 
ATOM   3384 C  CB    . PHE B 1 79  ? 38.582  50.034  36.468 1.00 30.41  ? 79  PHE B CB    1 
ATOM   3385 C  CG    . PHE B 1 79  ? 38.958  51.301  35.786 1.00 31.25  ? 79  PHE B CG    1 
ATOM   3386 C  CD1   . PHE B 1 79  ? 38.949  52.502  36.479 1.00 31.76  ? 79  PHE B CD1   1 
ATOM   3387 C  CD2   . PHE B 1 79  ? 39.304  51.296  34.428 1.00 30.98  ? 79  PHE B CD2   1 
ATOM   3388 C  CE1   . PHE B 1 79  ? 39.281  53.694  35.841 1.00 33.43  ? 79  PHE B CE1   1 
ATOM   3389 C  CE2   . PHE B 1 79  ? 39.637  52.474  33.777 1.00 32.89  ? 79  PHE B CE2   1 
ATOM   3390 C  CZ    . PHE B 1 79  ? 39.629  53.683  34.478 1.00 33.70  ? 79  PHE B CZ    1 
ATOM   3391 N  N     . ALA B 1 80  ? 36.677  47.288  36.288 1.00 29.25  ? 80  ALA B N     1 
ATOM   3392 C  CA    . ALA B 1 80  ? 36.410  45.998  36.923 1.00 29.79  ? 80  ALA B CA    1 
ATOM   3393 C  C     . ALA B 1 80  ? 36.992  44.816  36.184 1.00 30.45  ? 80  ALA B C     1 
ATOM   3394 O  O     . ALA B 1 80  ? 37.273  44.897  34.995 1.00 33.41  ? 80  ALA B O     1 
ATOM   3395 C  CB    . ALA B 1 80  ? 34.888  45.783  37.052 1.00 29.81  ? 80  ALA B CB    1 
ATOM   3396 N  N     . ILE B 1 81  ? 37.193  43.726  36.912 1.00 29.19  ? 81  ILE B N     1 
ATOM   3397 C  CA    . ILE B 1 81  ? 37.631  42.483  36.317 1.00 28.32  ? 81  ILE B CA    1 
ATOM   3398 C  C     . ILE B 1 81  ? 36.564  41.478  36.807 1.00 28.95  ? 81  ILE B C     1 
ATOM   3399 O  O     . ILE B 1 81  ? 35.847  41.758  37.774 1.00 26.93  ? 81  ILE B O     1 
ATOM   3400 C  CB    . ILE B 1 81  ? 38.984  41.992  36.838 1.00 29.08  ? 81  ILE B CB    1 
ATOM   3401 C  CG1   . ILE B 1 81  ? 38.995  42.057  38.367 1.00 29.35  ? 81  ILE B CG1   1 
ATOM   3402 C  CG2   . ILE B 1 81  ? 40.144  42.756  36.149 1.00 28.26  ? 81  ILE B CG2   1 
ATOM   3403 C  CD1   . ILE B 1 81  ? 40.241  41.453  38.987 1.00 29.08  ? 81  ILE B CD1   1 
ATOM   3404 N  N     . GLU B 1 82  ? 36.482  40.323  36.153 1.00 27.26  ? 82  GLU B N     1 
ATOM   3405 C  CA    . GLU B 1 82  ? 35.551  39.272  36.541 1.00 27.89  ? 82  GLU B CA    1 
ATOM   3406 C  C     . GLU B 1 82  ? 36.227  38.393  37.620 1.00 28.26  ? 82  GLU B C     1 
ATOM   3407 O  O     . GLU B 1 82  ? 37.440  38.133  37.576 1.00 29.35  ? 82  GLU B O     1 
ATOM   3408 C  CB    . GLU B 1 82  ? 35.194  38.417  35.295 1.00 30.47  ? 82  GLU B CB    1 
ATOM   3409 C  CG    . GLU B 1 82  ? 34.795  39.272  34.073 1.00 37.19  ? 82  GLU B CG    1 
ATOM   3410 C  CD    . GLU B 1 82  ? 34.790  38.548  32.721 1.00 44.01  ? 82  GLU B CD    1 
ATOM   3411 O  OE1   . GLU B 1 82  ? 34.901  39.268  31.704 1.00 47.73  ? 82  GLU B OE1   1 
ATOM   3412 O  OE2   . GLU B 1 82  ? 34.663  37.292  32.640 1.00 46.65  ? 82  GLU B OE2   1 
ATOM   3413 N  N     . GLY B 1 83  ? 35.458  37.952  38.601 1.00 27.24  ? 83  GLY B N     1 
ATOM   3414 C  CA    . GLY B 1 83  ? 35.993  37.048  39.609 1.00 27.15  ? 83  GLY B CA    1 
ATOM   3415 C  C     . GLY B 1 83  ? 35.583  35.630  39.185 1.00 29.30  ? 83  GLY B C     1 
ATOM   3416 O  O     . GLY B 1 83  ? 35.052  35.474  38.091 1.00 28.61  ? 83  GLY B O     1 
ATOM   3417 N  N     . ASN B 1 84  ? 35.824  34.608  40.006 1.00 28.03  ? 84  ASN B N     1 
ATOM   3418 C  CA    . ASN B 1 84  ? 35.443  33.237  39.623 1.00 31.55  ? 84  ASN B CA    1 
ATOM   3419 C  C     . ASN B 1 84  ? 33.922  33.095  39.559 1.00 31.56  ? 84  ASN B C     1 
ATOM   3420 O  O     . ASN B 1 84  ? 33.392  32.274  38.817 1.00 30.93  ? 84  ASN B O     1 
ATOM   3421 C  CB    . ASN B 1 84  ? 35.985  32.224  40.640 1.00 31.17  ? 84  ASN B CB    1 
ATOM   3422 C  CG    . ASN B 1 84  ? 35.698  32.652  42.063 1.00 32.69  ? 84  ASN B CG    1 
ATOM   3423 O  OD1   . ASN B 1 84  ? 35.890  33.810  42.390 1.00 32.90  ? 84  ASN B OD1   1 
ATOM   3424 N  ND2   . ASN B 1 84  ? 35.243  31.734  42.910 1.00 30.04  ? 84  ASN B ND2   1 
ATOM   3425 N  N     . HIS B 1 85  ? 33.215  33.890  40.354 1.00 30.03  ? 85  HIS B N     1 
ATOM   3426 C  CA    . HIS B 1 85  ? 31.779  33.800  40.344 1.00 30.32  ? 85  HIS B CA    1 
ATOM   3427 C  C     . HIS B 1 85  ? 31.133  34.362  39.103 1.00 30.84  ? 85  HIS B C     1 
ATOM   3428 O  O     . HIS B 1 85  ? 30.175  33.804  38.607 1.00 31.21  ? 85  HIS B O     1 
ATOM   3429 C  CB    . HIS B 1 85  ? 31.174  34.489  41.583 1.00 33.06  ? 85  HIS B CB    1 
ATOM   3430 C  CG    . HIS B 1 85  ? 31.033  33.575  42.764 1.00 33.38  ? 85  HIS B CG    1 
ATOM   3431 N  ND1   . HIS B 1 85  ? 29.817  33.084  43.188 1.00 32.41  ? 85  HIS B ND1   1 
ATOM   3432 C  CD2   . HIS B 1 85  ? 31.963  33.026  43.579 1.00 33.14  ? 85  HIS B CD2   1 
ATOM   3433 C  CE1   . HIS B 1 85  ? 30.003  32.269  44.210 1.00 30.80  ? 85  HIS B CE1   1 
ATOM   3434 N  NE2   . HIS B 1 85  ? 31.296  32.217  44.468 1.00 32.17  ? 85  HIS B NE2   1 
ATOM   3435 N  N     . ASP B 1 86  ? 31.630  35.463  38.573 1.00 31.63  ? 86  ASP B N     1 
ATOM   3436 C  CA    . ASP B 1 86  ? 30.923  35.997  37.436 1.00 32.24  ? 86  ASP B CA    1 
ATOM   3437 C  C     . ASP B 1 86  ? 31.593  35.911  36.072 1.00 32.74  ? 86  ASP B C     1 
ATOM   3438 O  O     . ASP B 1 86  ? 31.047  36.391  35.087 1.00 32.04  ? 86  ASP B O     1 
ATOM   3439 C  CB    . ASP B 1 86  ? 30.463  37.439  37.731 1.00 35.36  ? 86  ASP B CB    1 
ATOM   3440 C  CG    . ASP B 1 86  ? 31.599  38.352  38.174 1.00 35.45  ? 86  ASP B CG    1 
ATOM   3441 O  OD1   . ASP B 1 86  ? 31.362  39.564  38.284 1.00 37.79  ? 86  ASP B OD1   1 
ATOM   3442 O  OD2   . ASP B 1 86  ? 32.715  37.876  38.432 1.00 37.47  ? 86  ASP B OD2   1 
ATOM   3443 N  N     . ARG B 1 87  ? 32.752  35.281  35.979 1.00 33.54  ? 87  ARG B N     1 
ATOM   3444 C  CA    . ARG B 1 87  ? 33.363  35.187  34.656 1.00 37.88  ? 87  ARG B CA    1 
ATOM   3445 C  C     . ARG B 1 87  ? 32.675  34.090  33.858 1.00 40.22  ? 87  ARG B C     1 
ATOM   3446 O  O     . ARG B 1 87  ? 32.002  33.218  34.427 1.00 38.31  ? 87  ARG B O     1 
ATOM   3447 C  CB    . ARG B 1 87  ? 34.844  34.838  34.745 1.00 35.02  ? 87  ARG B CB    1 
ATOM   3448 C  CG    . ARG B 1 87  ? 35.081  33.491  35.363 1.00 36.48  ? 87  ARG B CG    1 
ATOM   3449 C  CD    . ARG B 1 87  ? 36.503  33.087  35.164 1.00 39.10  ? 87  ARG B CD    1 
ATOM   3450 N  NE    . ARG B 1 87  ? 36.751  31.713  35.567 1.00 40.98  ? 87  ARG B NE    1 
ATOM   3451 C  CZ    . ARG B 1 87  ? 37.827  31.036  35.186 1.00 42.01  ? 87  ARG B CZ    1 
ATOM   3452 N  NH1   . ARG B 1 87  ? 38.718  31.631  34.401 1.00 36.73  ? 87  ARG B NH1   1 
ATOM   3453 N  NH2   . ARG B 1 87  ? 38.008  29.780  35.592 1.00 41.13  ? 87  ARG B NH2   1 
ATOM   3454 N  N     . THR B 1 88  ? 32.845  34.160  32.544 1.00 43.30  ? 88  THR B N     1 
ATOM   3455 C  CA    . THR B 1 88  ? 32.320  33.147  31.637 1.00 50.24  ? 88  THR B CA    1 
ATOM   3456 C  C     . THR B 1 88  ? 33.524  32.725  30.788 1.00 53.34  ? 88  THR B C     1 
ATOM   3457 O  O     . THR B 1 88  ? 34.286  33.568  30.322 1.00 55.86  ? 88  THR B O     1 
ATOM   3458 C  CB    . THR B 1 88  ? 31.215  33.699  30.696 1.00 48.07  ? 88  THR B CB    1 
ATOM   3459 O  OG1   . THR B 1 88  ? 31.734  34.809  29.964 1.00 50.41  ? 88  THR B OG1   1 
ATOM   3460 C  CG2   . THR B 1 88  ? 29.998  34.146  31.480 1.00 46.84  ? 88  THR B CG2   1 
ATOM   3461 N  N     . GLN B 1 89  ? 33.727  31.428  30.625 1.00 58.07  ? 89  GLN B N     1 
ATOM   3462 C  CA    . GLN B 1 89  ? 34.844  30.961  29.810 1.00 62.49  ? 89  GLN B CA    1 
ATOM   3463 C  C     . GLN B 1 89  ? 34.552  31.260  28.335 1.00 62.86  ? 89  GLN B C     1 
ATOM   3464 O  O     . GLN B 1 89  ? 35.399  31.787  27.626 1.00 63.63  ? 89  GLN B O     1 
ATOM   3465 C  CB    . GLN B 1 89  ? 35.055  29.455  29.997 1.00 66.49  ? 89  GLN B CB    1 
ATOM   3466 C  CG    . GLN B 1 89  ? 35.948  28.832  28.923 1.00 71.88  ? 89  GLN B CG    1 
ATOM   3467 C  CD    . GLN B 1 89  ? 35.746  27.328  28.775 1.00 74.75  ? 89  GLN B CD    1 
ATOM   3468 O  OE1   . GLN B 1 89  ? 36.272  26.708  27.843 1.00 77.19  ? 89  GLN B OE1   1 
ATOM   3469 N  NE2   . GLN B 1 89  ? 34.983  26.734  29.692 1.00 75.78  ? 89  GLN B NE2   1 
ATOM   3470 N  N     . ARG B 1 90  ? 33.354  30.917  27.873 1.00 63.02  ? 90  ARG B N     1 
ATOM   3471 C  CA    . ARG B 1 90  ? 32.988  31.170  26.481 1.00 63.23  ? 90  ARG B CA    1 
ATOM   3472 C  C     . ARG B 1 90  ? 31.794  32.113  26.354 1.00 60.96  ? 90  ARG B C     1 
ATOM   3473 O  O     . ARG B 1 90  ? 30.715  31.861  26.914 1.00 62.45  ? 90  ARG B O     1 
ATOM   3474 C  CB    . ARG B 1 90  ? 32.686  29.848  25.743 1.00 64.78  ? 90  ARG B CB    1 
ATOM   3475 C  CG    . ARG B 1 90  ? 33.930  29.083  25.244 1.00 67.54  ? 90  ARG B CG    1 
ATOM   3476 C  CD    . ARG B 1 90  ? 33.548  27.802  24.486 1.00 70.48  ? 90  ARG B CD    1 
ATOM   3477 N  NE    . ARG B 1 90  ? 32.726  28.068  23.302 1.00 74.25  ? 90  ARG B NE    1 
ATOM   3478 C  CZ    . ARG B 1 90  ? 31.982  27.153  22.666 1.00 76.83  ? 90  ARG B CZ    1 
ATOM   3479 N  NH1   . ARG B 1 90  ? 31.267  27.492  21.593 1.00 76.52  ? 90  ARG B NH1   1 
ATOM   3480 N  NH2   . ARG B 1 90  ? 31.939  25.895  23.099 1.00 77.55  ? 90  ARG B NH2   1 
ATOM   3481 N  N     . GLY B 1 91  ? 31.997  33.199  25.615 1.00 57.00  ? 91  GLY B N     1 
ATOM   3482 C  CA    . GLY B 1 91  ? 30.936  34.167  25.403 1.00 51.99  ? 91  GLY B CA    1 
ATOM   3483 C  C     . GLY B 1 91  ? 31.113  35.365  26.302 1.00 49.26  ? 91  GLY B C     1 
ATOM   3484 O  O     . GLY B 1 91  ? 31.835  35.278  27.300 1.00 48.63  ? 91  GLY B O     1 
ATOM   3485 N  N     . PRO B 1 92  ? 30.496  36.510  25.968 1.00 45.98  ? 92  PRO B N     1 
ATOM   3486 C  CA    . PRO B 1 92  ? 30.666  37.670  26.845 1.00 43.43  ? 92  PRO B CA    1 
ATOM   3487 C  C     . PRO B 1 92  ? 30.098  37.437  28.248 1.00 40.45  ? 92  PRO B C     1 
ATOM   3488 O  O     . PRO B 1 92  ? 29.171  36.654  28.441 1.00 38.79  ? 92  PRO B O     1 
ATOM   3489 C  CB    . PRO B 1 92  ? 29.956  38.797  26.082 1.00 43.21  ? 92  PRO B CB    1 
ATOM   3490 C  CG    . PRO B 1 92  ? 28.984  38.076  25.207 1.00 45.36  ? 92  PRO B CG    1 
ATOM   3491 C  CD    . PRO B 1 92  ? 29.749  36.871  24.753 1.00 44.35  ? 92  PRO B CD    1 
ATOM   3492 N  N     . SER B 1 93  ? 30.696  38.114  29.221 1.00 37.83  ? 93  SER B N     1 
ATOM   3493 C  CA    . SER B 1 93  ? 30.290  38.020  30.619 1.00 35.54  ? 93  SER B CA    1 
ATOM   3494 C  C     . SER B 1 93  ? 29.319  39.162  30.922 1.00 32.90  ? 93  SER B C     1 
ATOM   3495 O  O     . SER B 1 93  ? 29.116  40.054  30.094 1.00 30.70  ? 93  SER B O     1 
ATOM   3496 C  CB    . SER B 1 93  ? 31.534  38.170  31.515 1.00 36.28  ? 93  SER B CB    1 
ATOM   3497 O  OG    . SER B 1 93  ? 32.069  39.494  31.414 1.00 36.76  ? 93  SER B OG    1 
ATOM   3498 N  N     . VAL B 1 94  ? 28.734  39.154  32.115 1.00 31.02  ? 94  VAL B N     1 
ATOM   3499 C  CA    . VAL B 1 94  ? 27.845  40.242  32.471 1.00 30.89  ? 94  VAL B CA    1 
ATOM   3500 C  C     . VAL B 1 94  ? 28.633  41.577  32.498 1.00 30.41  ? 94  VAL B C     1 
ATOM   3501 O  O     . VAL B 1 94  ? 28.062  42.636  32.232 1.00 28.75  ? 94  VAL B O     1 
ATOM   3502 C  CB    . VAL B 1 94  ? 27.089  39.967  33.843 1.00 31.87  ? 94  VAL B CB    1 
ATOM   3503 C  CG1   . VAL B 1 94  ? 28.059  39.761  34.977 1.00 30.44  ? 94  VAL B CG1   1 
ATOM   3504 C  CG2   . VAL B 1 94  ? 26.141  41.120  34.166 1.00 29.66  ? 94  VAL B CG2   1 
ATOM   3505 N  N     . LEU B 1 95  ? 29.941  41.537  32.774 1.00 29.91  ? 95  LEU B N     1 
ATOM   3506 C  CA    . LEU B 1 95  ? 30.720  42.796  32.768 1.00 30.30  ? 95  LEU B CA    1 
ATOM   3507 C  C     . LEU B 1 95  ? 30.812  43.378  31.344 1.00 31.34  ? 95  LEU B C     1 
ATOM   3508 O  O     . LEU B 1 95  ? 30.693  44.599  31.143 1.00 31.79  ? 95  LEU B O     1 
ATOM   3509 C  CB    . LEU B 1 95  ? 32.141  42.596  33.336 1.00 27.52  ? 95  LEU B CB    1 
ATOM   3510 C  CG    . LEU B 1 95  ? 32.272  42.209  34.816 1.00 31.24  ? 95  LEU B CG    1 
ATOM   3511 C  CD1   . LEU B 1 95  ? 33.726  42.370  35.263 1.00 32.36  ? 95  LEU B CD1   1 
ATOM   3512 C  CD2   . LEU B 1 95  ? 31.381  43.115  35.683 1.00 29.40  ? 95  LEU B CD2   1 
ATOM   3513 N  N     . ASN B 1 96  ? 31.032  42.509  30.356 1.00 31.99  ? 96  ASN B N     1 
ATOM   3514 C  CA    . ASN B 1 96  ? 31.103  42.956  28.963 1.00 34.07  ? 96  ASN B CA    1 
ATOM   3515 C  C     . ASN B 1 96  ? 29.785  43.641  28.613 1.00 33.68  ? 96  ASN B C     1 
ATOM   3516 O  O     . ASN B 1 96  ? 29.770  44.717  28.019 1.00 35.20  ? 96  ASN B O     1 
ATOM   3517 C  CB    . ASN B 1 96  ? 31.333  41.759  28.033 1.00 37.01  ? 96  ASN B CB    1 
ATOM   3518 C  CG    . ASN B 1 96  ? 32.684  41.109  28.246 1.00 39.50  ? 96  ASN B CG    1 
ATOM   3519 O  OD1   . ASN B 1 96  ? 32.808  39.881  28.207 1.00 43.97  ? 96  ASN B OD1   1 
ATOM   3520 N  ND2   . ASN B 1 96  ? 33.714  41.927  28.459 1.00 41.75  ? 96  ASN B ND2   1 
ATOM   3521 N  N     . LEU B 1 97  ? 28.676  43.013  28.994 1.00 34.10  ? 97  LEU B N     1 
ATOM   3522 C  CA    . LEU B 1 97  ? 27.353  43.579  28.752 1.00 35.11  ? 97  LEU B CA    1 
ATOM   3523 C  C     . LEU B 1 97  ? 27.257  44.967  29.405 1.00 35.86  ? 97  LEU B C     1 
ATOM   3524 O  O     . LEU B 1 97  ? 26.823  45.952  28.765 1.00 38.27  ? 97  LEU B O     1 
ATOM   3525 C  CB    . LEU B 1 97  ? 26.274  42.653  29.323 1.00 37.04  ? 97  LEU B CB    1 
ATOM   3526 C  CG    . LEU B 1 97  ? 24.801  43.014  29.074 1.00 40.38  ? 97  LEU B CG    1 
ATOM   3527 C  CD1   . LEU B 1 97  ? 24.529  42.925  27.574 1.00 41.70  ? 97  LEU B CD1   1 
ATOM   3528 C  CD2   . LEU B 1 97  ? 23.870  42.053  29.824 1.00 38.56  ? 97  LEU B CD2   1 
ATOM   3529 N  N     . LEU B 1 98  ? 27.649  45.069  30.673 1.00 33.84  ? 98  LEU B N     1 
ATOM   3530 C  CA    . LEU B 1 98  ? 27.595  46.373  31.337 1.00 34.14  ? 98  LEU B CA    1 
ATOM   3531 C  C     . LEU B 1 98  ? 28.507  47.430  30.662 1.00 33.54  ? 98  LEU B C     1 
ATOM   3532 O  O     . LEU B 1 98  ? 28.201  48.618  30.697 1.00 32.18  ? 98  LEU B O     1 
ATOM   3533 C  CB    . LEU B 1 98  ? 27.978  46.244  32.811 1.00 34.74  ? 98  LEU B CB    1 
ATOM   3534 C  CG    . LEU B 1 98  ? 27.053  45.430  33.713 1.00 35.14  ? 98  LEU B CG    1 
ATOM   3535 C  CD1   . LEU B 1 98  ? 27.698  45.351  35.076 1.00 32.44  ? 98  LEU B CD1   1 
ATOM   3536 C  CD2   . LEU B 1 98  ? 25.668  46.071  33.809 1.00 33.60  ? 98  LEU B CD2   1 
ATOM   3537 N  N     . GLU B 1 99  ? 29.628  47.009  30.079 1.00 34.07  ? 99  GLU B N     1 
ATOM   3538 C  CA    . GLU B 1 99  ? 30.504  47.966  29.403 1.00 37.08  ? 99  GLU B CA    1 
ATOM   3539 C  C     . GLU B 1 99  ? 29.784  48.540  28.178 1.00 38.43  ? 99  GLU B C     1 
ATOM   3540 O  O     . GLU B 1 99  ? 29.906  49.735  27.895 1.00 37.02  ? 99  GLU B O     1 
ATOM   3541 C  CB    . GLU B 1 99  ? 31.832  47.329  28.952 1.00 40.12  ? 99  GLU B CB    1 
ATOM   3542 C  CG    . GLU B 1 99  ? 32.844  48.386  28.448 1.00 44.31  ? 99  GLU B CG    1 
ATOM   3543 C  CD    . GLU B 1 99  ? 34.173  47.815  27.941 1.00 45.56  ? 99  GLU B CD    1 
ATOM   3544 O  OE1   . GLU B 1 99  ? 34.818  47.017  28.639 1.00 44.50  ? 99  GLU B OE1   1 
ATOM   3545 O  OE2   . GLU B 1 99  ? 34.597  48.196  26.830 1.00 51.68  ? 99  GLU B OE2   1 
ATOM   3546 N  N     . ASP B 1 100 ? 29.042  47.686  27.462 1.00 38.92  ? 100 ASP B N     1 
ATOM   3547 C  CA    . ASP B 1 100 ? 28.270  48.114  26.280 1.00 39.24  ? 100 ASP B CA    1 
ATOM   3548 C  C     . ASP B 1 100 ? 27.312  49.205  26.738 1.00 39.43  ? 100 ASP B C     1 
ATOM   3549 O  O     . ASP B 1 100 ? 26.953  50.097  25.960 1.00 40.99  ? 100 ASP B O     1 
ATOM   3550 C  CB    . ASP B 1 100 ? 27.426  46.965  25.693 1.00 38.90  ? 100 ASP B CB    1 
ATOM   3551 C  CG    . ASP B 1 100 ? 28.262  45.857  25.070 1.00 40.23  ? 100 ASP B CG    1 
ATOM   3552 O  OD1   . ASP B 1 100 ? 27.671  44.836  24.687 1.00 44.57  ? 100 ASP B OD1   1 
ATOM   3553 O  OD2   . ASP B 1 100 ? 29.492  45.989  24.944 1.00 44.08  ? 100 ASP B OD2   1 
ATOM   3554 N  N     . PHE B 1 101 ? 26.883  49.129  27.998 1.00 38.08  ? 101 PHE B N     1 
ATOM   3555 C  CA    . PHE B 1 101 ? 25.968  50.133  28.536 1.00 37.14  ? 101 PHE B CA    1 
ATOM   3556 C  C     . PHE B 1 101 ? 26.698  51.367  29.047 1.00 37.93  ? 101 PHE B C     1 
ATOM   3557 O  O     . PHE B 1 101 ? 26.071  52.333  29.493 1.00 40.38  ? 101 PHE B O     1 
ATOM   3558 C  CB    . PHE B 1 101 ? 25.105  49.552  29.664 1.00 36.05  ? 101 PHE B CB    1 
ATOM   3559 C  CG    . PHE B 1 101 ? 24.295  48.337  29.262 1.00 39.23  ? 101 PHE B CG    1 
ATOM   3560 C  CD1   . PHE B 1 101 ? 24.100  48.013  27.925 1.00 39.43  ? 101 PHE B CD1   1 
ATOM   3561 C  CD2   . PHE B 1 101 ? 23.736  47.515  30.232 1.00 40.04  ? 101 PHE B CD2   1 
ATOM   3562 C  CE1   . PHE B 1 101 ? 23.365  46.886  27.565 1.00 41.25  ? 101 PHE B CE1   1 
ATOM   3563 C  CE2   . PHE B 1 101 ? 22.994  46.384  29.888 1.00 43.74  ? 101 PHE B CE2   1 
ATOM   3564 C  CZ    . PHE B 1 101 ? 22.809  46.070  28.541 1.00 42.81  ? 101 PHE B CZ    1 
ATOM   3565 N  N     . GLY B 1 102 ? 28.023  51.333  28.980 1.00 37.95  ? 102 GLY B N     1 
ATOM   3566 C  CA    . GLY B 1 102 ? 28.823  52.450  29.443 1.00 39.39  ? 102 GLY B CA    1 
ATOM   3567 C  C     . GLY B 1 102 ? 28.869  52.583  30.956 1.00 40.18  ? 102 GLY B C     1 
ATOM   3568 O  O     . GLY B 1 102 ? 29.128  53.665  31.464 1.00 41.01  ? 102 GLY B O     1 
ATOM   3569 N  N     . LEU B 1 103 ? 28.655  51.479  31.672 1.00 39.54  ? 103 LEU B N     1 
ATOM   3570 C  CA    . LEU B 1 103 ? 28.619  51.503  33.130 1.00 37.62  ? 103 LEU B CA    1 
ATOM   3571 C  C     . LEU B 1 103 ? 29.886  51.032  33.828 1.00 36.98  ? 103 LEU B C     1 
ATOM   3572 O  O     . LEU B 1 103 ? 30.080  51.308  35.009 1.00 37.25  ? 103 LEU B O     1 
ATOM   3573 C  CB    . LEU B 1 103 ? 27.415  50.695  33.612 1.00 34.45  ? 103 LEU B CB    1 
ATOM   3574 C  CG    . LEU B 1 103 ? 26.084  51.258  33.096 1.00 35.72  ? 103 LEU B CG    1 
ATOM   3575 C  CD1   . LEU B 1 103 ? 24.951  50.344  33.516 1.00 32.03  ? 103 LEU B CD1   1 
ATOM   3576 C  CD2   . LEU B 1 103 ? 25.861  52.685  33.641 1.00 33.79  ? 103 LEU B CD2   1 
ATOM   3577 N  N     . VAL B 1 104 ? 30.735  50.310  33.107 1.00 35.93  ? 104 VAL B N     1 
ATOM   3578 C  CA    . VAL B 1 104 ? 32.008  49.838  33.650 1.00 33.46  ? 104 VAL B CA    1 
ATOM   3579 C  C     . VAL B 1 104 ? 33.011  49.748  32.496 1.00 33.80  ? 104 VAL B C     1 
ATOM   3580 O  O     . VAL B 1 104 ? 32.644  49.811  31.329 1.00 34.35  ? 104 VAL B O     1 
ATOM   3581 C  CB    . VAL B 1 104 ? 31.914  48.421  34.293 1.00 32.60  ? 104 VAL B CB    1 
ATOM   3582 C  CG1   . VAL B 1 104 ? 30.858  48.390  35.341 1.00 30.60  ? 104 VAL B CG1   1 
ATOM   3583 C  CG2   . VAL B 1 104 ? 31.645  47.345  33.216 1.00 31.24  ? 104 VAL B CG2   1 
ATOM   3584 N  N     . TYR B 1 105 ? 34.281  49.602  32.828 1.00 34.37  ? 105 TYR B N     1 
ATOM   3585 C  CA    . TYR B 1 105 ? 35.304  49.448  31.824 1.00 35.16  ? 105 TYR B CA    1 
ATOM   3586 C  C     . TYR B 1 105 ? 35.958  48.171  32.271 1.00 34.10  ? 105 TYR B C     1 
ATOM   3587 O  O     . TYR B 1 105 ? 36.450  48.079  33.395 1.00 32.92  ? 105 TYR B O     1 
ATOM   3588 C  CB    . TYR B 1 105 ? 36.281  50.627  31.844 1.00 37.44  ? 105 TYR B CB    1 
ATOM   3589 C  CG    . TYR B 1 105 ? 35.636  51.934  31.440 1.00 39.84  ? 105 TYR B CG    1 
ATOM   3590 C  CD1   . TYR B 1 105 ? 35.319  52.896  32.392 1.00 42.82  ? 105 TYR B CD1   1 
ATOM   3591 C  CD2   . TYR B 1 105 ? 35.344  52.208  30.100 1.00 41.71  ? 105 TYR B CD2   1 
ATOM   3592 C  CE1   . TYR B 1 105 ? 34.730  54.112  32.028 1.00 45.16  ? 105 TYR B CE1   1 
ATOM   3593 C  CE2   . TYR B 1 105 ? 34.752  53.413  29.721 1.00 43.98  ? 105 TYR B CE2   1 
ATOM   3594 C  CZ    . TYR B 1 105 ? 34.451  54.366  30.693 1.00 45.79  ? 105 TYR B CZ    1 
ATOM   3595 O  OH    . TYR B 1 105 ? 33.892  55.581  30.342 1.00 46.91  ? 105 TYR B OH    1 
ATOM   3596 N  N     . VAL B 1 106 ? 35.942  47.171  31.396 1.00 35.51  ? 106 VAL B N     1 
ATOM   3597 C  CA    . VAL B 1 106 ? 36.498  45.875  31.745 1.00 33.75  ? 106 VAL B CA    1 
ATOM   3598 C  C     . VAL B 1 106 ? 37.949  45.760  31.404 1.00 35.74  ? 106 VAL B C     1 
ATOM   3599 O  O     . VAL B 1 106 ? 38.337  45.883  30.254 1.00 37.51  ? 106 VAL B O     1 
ATOM   3600 C  CB    . VAL B 1 106 ? 35.749  44.752  31.061 1.00 31.72  ? 106 VAL B CB    1 
ATOM   3601 C  CG1   . VAL B 1 106 ? 36.246  43.408  31.593 1.00 29.67  ? 106 VAL B CG1   1 
ATOM   3602 C  CG2   . VAL B 1 106 ? 34.259  44.933  31.283 1.00 28.71  ? 106 VAL B CG2   1 
ATOM   3603 N  N     . ILE B 1 107 ? 38.749  45.502  32.425 1.00 36.74  ? 107 ILE B N     1 
ATOM   3604 C  CA    . ILE B 1 107 ? 40.184  45.371  32.272 1.00 37.73  ? 107 ILE B CA    1 
ATOM   3605 C  C     . ILE B 1 107 ? 40.533  43.902  32.087 1.00 37.77  ? 107 ILE B C     1 
ATOM   3606 O  O     . ILE B 1 107 ? 39.855  43.040  32.639 1.00 36.93  ? 107 ILE B O     1 
ATOM   3607 C  CB    . ILE B 1 107 ? 40.888  45.973  33.532 1.00 38.39  ? 107 ILE B CB    1 
ATOM   3608 C  CG1   . ILE B 1 107 ? 40.899  47.492  33.405 1.00 39.96  ? 107 ILE B CG1   1 
ATOM   3609 C  CG2   . ILE B 1 107 ? 42.271  45.383  33.727 1.00 37.04  ? 107 ILE B CG2   1 
ATOM   3610 C  CD1   . ILE B 1 107 ? 41.456  48.224  34.617 1.00 42.17  ? 107 ILE B CD1   1 
ATOM   3611 N  N     . GLY B 1 108 ? 41.585  43.626  31.309 1.00 38.05  ? 108 GLY B N     1 
ATOM   3612 C  CA    . GLY B 1 108 ? 42.008  42.253  31.073 1.00 37.91  ? 108 GLY B CA    1 
ATOM   3613 C  C     . GLY B 1 108 ? 42.013  41.836  29.602 1.00 39.98  ? 108 GLY B C     1 
ATOM   3614 O  O     . GLY B 1 108 ? 42.001  42.668  28.688 1.00 38.75  ? 108 GLY B O     1 
ATOM   3615 N  N     . MET B 1 109 ? 42.033  40.535  29.368 1.00 40.52  ? 109 MET B N     1 
ATOM   3616 C  CA    . MET B 1 109 ? 42.030  40.011  28.003 1.00 44.42  ? 109 MET B CA    1 
ATOM   3617 C  C     . MET B 1 109 ? 40.675  40.149  27.329 1.00 45.92  ? 109 MET B C     1 
ATOM   3618 O  O     . MET B 1 109 ? 39.633  40.152  27.994 1.00 45.13  ? 109 MET B O     1 
ATOM   3619 C  CB    . MET B 1 109 ? 42.396  38.536  28.016 1.00 42.77  ? 109 MET B CB    1 
ATOM   3620 C  CG    . MET B 1 109 ? 43.660  38.287  28.758 1.00 46.19  ? 109 MET B CG    1 
ATOM   3621 S  SD    . MET B 1 109 ? 45.126  38.611  27.761 1.00 45.42  ? 109 MET B SD    1 
ATOM   3622 C  CE    . MET B 1 109 ? 46.038  37.159  28.345 1.00 43.49  ? 109 MET B CE    1 
ATOM   3623 N  N     . ARG B 1 110 ? 40.710  40.268  26.006 1.00 47.16  ? 110 ARG B N     1 
ATOM   3624 C  CA    . ARG B 1 110 ? 39.509  40.344  25.186 1.00 48.76  ? 110 ARG B CA    1 
ATOM   3625 C  C     . ARG B 1 110 ? 39.925  40.215  23.719 1.00 51.46  ? 110 ARG B C     1 
ATOM   3626 O  O     . ARG B 1 110 ? 41.060  40.539  23.343 1.00 51.21  ? 110 ARG B O     1 
ATOM   3627 C  CB    . ARG B 1 110 ? 38.727  41.636  25.434 1.00 45.96  ? 110 ARG B CB    1 
ATOM   3628 C  CG    . ARG B 1 110 ? 39.314  42.881  24.842 1.00 44.64  ? 110 ARG B CG    1 
ATOM   3629 C  CD    . ARG B 1 110 ? 38.295  44.020  24.884 1.00 43.35  ? 110 ARG B CD    1 
ATOM   3630 N  NE    . ARG B 1 110 ? 38.091  44.569  26.230 1.00 42.10  ? 110 ARG B NE    1 
ATOM   3631 C  CZ    . ARG B 1 110 ? 37.224  45.531  26.523 1.00 39.82  ? 110 ARG B CZ    1 
ATOM   3632 N  NH1   . ARG B 1 110 ? 37.113  45.965  27.771 1.00 37.18  ? 110 ARG B NH1   1 
ATOM   3633 N  NH2   . ARG B 1 110 ? 36.461  46.058  25.566 1.00 38.77  ? 110 ARG B NH2   1 
ATOM   3634 N  N     . LYS B 1 111 ? 39.007  39.725  22.894 1.00 53.56  ? 111 LYS B N     1 
ATOM   3635 C  CA    . LYS B 1 111 ? 39.296  39.502  21.491 1.00 54.37  ? 111 LYS B CA    1 
ATOM   3636 C  C     . LYS B 1 111 ? 39.340  40.738  20.599 1.00 54.70  ? 111 LYS B C     1 
ATOM   3637 O  O     . LYS B 1 111 ? 40.111  40.770  19.642 1.00 55.47  ? 111 LYS B O     1 
ATOM   3638 C  CB    . LYS B 1 111 ? 38.315  38.461  20.938 1.00 54.31  ? 111 LYS B CB    1 
ATOM   3639 C  CG    . LYS B 1 111 ? 38.569  37.067  21.514 1.00 54.93  ? 111 LYS B CG    1 
ATOM   3640 C  CD    . LYS B 1 111 ? 37.555  36.032  21.027 1.00 54.47  ? 111 LYS B CD    1 
ATOM   3641 C  CE    . LYS B 1 111 ? 37.824  34.661  21.623 0.00 54.75  ? 111 LYS B CE    1 
ATOM   3642 N  NZ    . LYS B 1 111 ? 36.836  33.650  21.152 0.00 54.82  ? 111 LYS B NZ    1 
ATOM   3643 N  N     . GLU B 1 112 ? 38.538  41.752  20.909 1.00 54.80  ? 112 GLU B N     1 
ATOM   3644 C  CA    . GLU B 1 112 ? 38.514  42.968  20.098 1.00 55.10  ? 112 GLU B CA    1 
ATOM   3645 C  C     . GLU B 1 112 ? 39.242  44.134  20.769 1.00 55.87  ? 112 GLU B C     1 
ATOM   3646 O  O     . GLU B 1 112 ? 39.104  44.370  21.967 1.00 57.07  ? 112 GLU B O     1 
ATOM   3647 C  CB    . GLU B 1 112 ? 37.069  43.380  19.798 1.00 54.35  ? 112 GLU B CB    1 
ATOM   3648 C  CG    . GLU B 1 112 ? 36.932  44.622  18.928 0.00 54.89  ? 112 GLU B CG    1 
ATOM   3649 C  CD    . GLU B 1 112 ? 35.484  44.998  18.666 0.00 54.95  ? 112 GLU B CD    1 
ATOM   3650 O  OE1   . GLU B 1 112 ? 35.246  45.998  17.955 0.00 55.07  ? 112 GLU B OE1   1 
ATOM   3651 O  OE2   . GLU B 1 112 ? 34.583  44.296  19.172 0.00 55.07  ? 112 GLU B OE2   1 
ATOM   3652 N  N     . LYS B 1 113 ? 40.014  44.859  19.976 1.00 54.84  ? 113 LYS B N     1 
ATOM   3653 C  CA    . LYS B 1 113 ? 40.776  46.006  20.441 1.00 54.42  ? 113 LYS B CA    1 
ATOM   3654 C  C     . LYS B 1 113 ? 39.836  47.139  20.856 1.00 53.24  ? 113 LYS B C     1 
ATOM   3655 O  O     . LYS B 1 113 ? 38.705  47.233  20.364 1.00 54.55  ? 113 LYS B O     1 
ATOM   3656 C  CB    . LYS B 1 113 ? 41.696  46.463  19.311 1.00 55.35  ? 113 LYS B CB    1 
ATOM   3657 C  CG    . LYS B 1 113 ? 42.569  47.648  19.619 1.00 58.17  ? 113 LYS B CG    1 
ATOM   3658 C  CD    . LYS B 1 113 ? 43.329  48.081  18.356 1.00 58.68  ? 113 LYS B CD    1 
ATOM   3659 C  CE    . LYS B 1 113 ? 44.262  49.244  18.652 0.00 58.58  ? 113 LYS B CE    1 
ATOM   3660 N  NZ    . LYS B 1 113 ? 45.033  49.663  17.449 0.00 58.69  ? 113 LYS B NZ    1 
ATOM   3661 N  N     . VAL B 1 114 ? 40.296  47.989  21.772 1.00 50.61  ? 114 VAL B N     1 
ATOM   3662 C  CA    . VAL B 1 114 ? 39.498  49.121  22.243 1.00 48.39  ? 114 VAL B CA    1 
ATOM   3663 C  C     . VAL B 1 114 ? 40.403  50.286  22.618 1.00 48.78  ? 114 VAL B C     1 
ATOM   3664 O  O     . VAL B 1 114 ? 41.481  50.089  23.179 1.00 49.73  ? 114 VAL B O     1 
ATOM   3665 C  CB    . VAL B 1 114 ? 38.623  48.736  23.479 1.00 46.99  ? 114 VAL B CB    1 
ATOM   3666 C  CG1   . VAL B 1 114 ? 39.503  48.214  24.599 1.00 46.17  ? 114 VAL B CG1   1 
ATOM   3667 C  CG2   . VAL B 1 114 ? 37.829  49.940  23.959 1.00 44.64  ? 114 VAL B CG2   1 
ATOM   3668 N  N     . GLU B 1 115 ? 39.968  51.503  22.318 1.00 48.67  ? 115 GLU B N     1 
ATOM   3669 C  CA    . GLU B 1 115 ? 40.768  52.671  22.635 1.00 49.97  ? 115 GLU B CA    1 
ATOM   3670 C  C     . GLU B 1 115 ? 39.851  53.836  22.925 1.00 52.05  ? 115 GLU B C     1 
ATOM   3671 O  O     . GLU B 1 115 ? 39.186  54.353  22.030 1.00 54.86  ? 115 GLU B O     1 
ATOM   3672 C  CB    . GLU B 1 115 ? 41.695  53.022  21.467 1.00 49.42  ? 115 GLU B CB    1 
ATOM   3673 C  CG    . GLU B 1 115 ? 42.745  51.960  21.179 1.00 50.03  ? 115 GLU B CG    1 
ATOM   3674 C  CD    . GLU B 1 115 ? 43.809  51.876  22.263 1.00 50.92  ? 115 GLU B CD    1 
ATOM   3675 O  OE1   . GLU B 1 115 ? 44.481  50.828  22.356 1.00 49.67  ? 115 GLU B OE1   1 
ATOM   3676 O  OE2   . GLU B 1 115 ? 43.978  52.858  23.018 1.00 52.22  ? 115 GLU B OE2   1 
ATOM   3677 N  N     . ASN B 1 116 ? 39.804  54.253  24.180 1.00 51.72  ? 116 ASN B N     1 
ATOM   3678 C  CA    . ASN B 1 116 ? 38.949  55.361  24.547 1.00 50.75  ? 116 ASN B CA    1 
ATOM   3679 C  C     . ASN B 1 116 ? 39.602  56.142  25.670 1.00 50.37  ? 116 ASN B C     1 
ATOM   3680 O  O     . ASN B 1 116 ? 40.762  55.924  25.994 1.00 51.32  ? 116 ASN B O     1 
ATOM   3681 C  CB    . ASN B 1 116 ? 37.562  54.852  24.958 1.00 51.11  ? 116 ASN B CB    1 
ATOM   3682 C  CG    . ASN B 1 116 ? 37.614  53.902  26.136 1.00 52.14  ? 116 ASN B CG    1 
ATOM   3683 O  OD1   . ASN B 1 116 ? 38.287  54.178  27.127 1.00 53.13  ? 116 ASN B OD1   1 
ATOM   3684 N  ND2   . ASN B 1 116 ? 36.897  52.784  26.041 1.00 49.55  ? 116 ASN B ND2   1 
ATOM   3685 N  N     . GLU B 1 117 ? 38.869  57.055  26.278 1.00 51.30  ? 117 GLU B N     1 
ATOM   3686 C  CA    . GLU B 1 117 ? 39.472  57.857  27.325 1.00 51.27  ? 117 GLU B CA    1 
ATOM   3687 C  C     . GLU B 1 117 ? 39.962  57.042  28.512 1.00 50.10  ? 117 GLU B C     1 
ATOM   3688 O  O     . GLU B 1 117 ? 40.871  57.485  29.220 1.00 51.24  ? 117 GLU B O     1 
ATOM   3689 C  CB    . GLU B 1 117 ? 38.499  58.924  27.816 1.00 52.18  ? 117 GLU B CB    1 
ATOM   3690 C  CG    . GLU B 1 117 ? 39.157  59.968  28.705 1.00 57.05  ? 117 GLU B CG    1 
ATOM   3691 C  CD    . GLU B 1 117 ? 38.171  61.002  29.205 1.00 59.89  ? 117 GLU B CD    1 
ATOM   3692 O  OE1   . GLU B 1 117 ? 37.074  61.103  28.614 1.00 61.08  ? 117 GLU B OE1   1 
ATOM   3693 O  OE2   . GLU B 1 117 ? 38.487  61.721  30.182 1.00 62.76  ? 117 GLU B OE2   1 
ATOM   3694 N  N     . TYR B 1 118 ? 39.404  55.852  28.720 1.00 47.34  ? 118 TYR B N     1 
ATOM   3695 C  CA    . TYR B 1 118 ? 39.804  55.057  29.876 1.00 45.86  ? 118 TYR B CA    1 
ATOM   3696 C  C     . TYR B 1 118 ? 40.346  53.664  29.662 1.00 46.32  ? 118 TYR B C     1 
ATOM   3697 O  O     . TYR B 1 118 ? 40.636  52.963  30.630 1.00 45.69  ? 118 TYR B O     1 
ATOM   3698 C  CB    . TYR B 1 118 ? 38.647  54.991  30.855 1.00 47.73  ? 118 TYR B CB    1 
ATOM   3699 C  CG    . TYR B 1 118 ? 38.172  56.357  31.292 1.00 46.87  ? 118 TYR B CG    1 
ATOM   3700 C  CD1   . TYR B 1 118 ? 36.910  56.823  30.941 1.00 47.94  ? 118 TYR B CD1   1 
ATOM   3701 C  CD2   . TYR B 1 118 ? 38.985  57.173  32.068 1.00 46.71  ? 118 TYR B CD2   1 
ATOM   3702 C  CE1   . TYR B 1 118 ? 36.462  58.087  31.359 1.00 47.98  ? 118 TYR B CE1   1 
ATOM   3703 C  CE2   . TYR B 1 118 ? 38.556  58.427  32.495 1.00 48.29  ? 118 TYR B CE2   1 
ATOM   3704 C  CZ    . TYR B 1 118 ? 37.296  58.878  32.138 1.00 48.14  ? 118 TYR B CZ    1 
ATOM   3705 O  OH    . TYR B 1 118 ? 36.883  60.113  32.574 1.00 46.92  ? 118 TYR B OH    1 
ATOM   3706 N  N     . LEU B 1 119 ? 40.480  53.249  28.407 1.00 45.30  ? 119 LEU B N     1 
ATOM   3707 C  CA    . LEU B 1 119 ? 41.025  51.932  28.117 1.00 46.48  ? 119 LEU B CA    1 
ATOM   3708 C  C     . LEU B 1 119 ? 41.970  52.001  26.921 1.00 47.37  ? 119 LEU B C     1 
ATOM   3709 O  O     . LEU B 1 119 ? 41.758  52.793  25.992 1.00 47.02  ? 119 LEU B O     1 
ATOM   3710 C  CB    . LEU B 1 119 ? 39.895  50.928  27.830 1.00 46.85  ? 119 LEU B CB    1 
ATOM   3711 C  CG    . LEU B 1 119 ? 38.902  50.570  28.961 1.00 48.55  ? 119 LEU B CG    1 
ATOM   3712 C  CD1   . LEU B 1 119 ? 37.839  49.584  28.441 1.00 45.60  ? 119 LEU B CD1   1 
ATOM   3713 C  CD2   . LEU B 1 119 ? 39.661  49.954  30.149 1.00 46.23  ? 119 LEU B CD2   1 
ATOM   3714 N  N     . THR B 1 120 ? 43.023  51.192  26.960 1.00 47.25  ? 120 THR B N     1 
ATOM   3715 C  CA    . THR B 1 120 ? 43.982  51.133  25.866 1.00 49.95  ? 120 THR B CA    1 
ATOM   3716 C  C     . THR B 1 120 ? 44.363  49.672  25.720 1.00 50.30  ? 120 THR B C     1 
ATOM   3717 O  O     . THR B 1 120 ? 44.375  48.944  26.710 1.00 51.11  ? 120 THR B O     1 
ATOM   3718 C  CB    . THR B 1 120 ? 45.249  51.997  26.135 1.00 50.70  ? 120 THR B CB    1 
ATOM   3719 O  OG1   . THR B 1 120 ? 46.127  51.900  25.001 1.00 52.45  ? 120 THR B OG1   1 
ATOM   3720 C  CG2   . THR B 1 120 ? 45.986  51.532  27.388 1.00 48.81  ? 120 THR B CG2   1 
ATOM   3721 N  N     . SER B 1 121 ? 44.669  49.243  24.497 1.00 50.91  ? 121 SER B N     1 
ATOM   3722 C  CA    . SER B 1 121 ? 44.992  47.845  24.237 1.00 52.75  ? 121 SER B CA    1 
ATOM   3723 C  C     . SER B 1 121 ? 46.420  47.509  23.774 1.00 54.97  ? 121 SER B C     1 
ATOM   3724 O  O     . SER B 1 121 ? 47.121  48.325  23.185 1.00 55.37  ? 121 SER B O     1 
ATOM   3725 C  CB    . SER B 1 121 ? 43.992  47.287  23.225 1.00 53.00  ? 121 SER B CB    1 
ATOM   3726 O  OG    . SER B 1 121 ? 42.679  47.771  23.486 1.00 53.02  ? 121 SER B OG    1 
ATOM   3727 N  N     . GLU B 1 122 ? 46.818  46.271  24.030 1.00 56.58  ? 122 GLU B N     1 
ATOM   3728 C  CA    . GLU B 1 122 ? 48.132  45.769  23.693 1.00 58.96  ? 122 GLU B CA    1 
ATOM   3729 C  C     . GLU B 1 122 ? 47.992  44.355  23.125 1.00 59.52  ? 122 GLU B C     1 
ATOM   3730 O  O     . GLU B 1 122 ? 47.690  43.411  23.857 1.00 58.51  ? 122 GLU B O     1 
ATOM   3731 C  CB    . GLU B 1 122 ? 48.985  45.747  24.963 1.00 61.17  ? 122 GLU B CB    1 
ATOM   3732 C  CG    . GLU B 1 122 ? 50.248  44.921  24.884 1.00 64.99  ? 122 GLU B CG    1 
ATOM   3733 C  CD    . GLU B 1 122 ? 51.025  44.936  26.192 1.00 67.03  ? 122 GLU B CD    1 
ATOM   3734 O  OE1   . GLU B 1 122 ? 52.050  44.228  26.282 1.00 67.90  ? 122 GLU B OE1   1 
ATOM   3735 O  OE2   . GLU B 1 122 ? 50.613  45.659  27.125 1.00 68.54  ? 122 GLU B OE2   1 
ATOM   3736 N  N     . ARG B 1 123 ? 48.212  44.208  21.821 1.00 60.03  ? 123 ARG B N     1 
ATOM   3737 C  CA    . ARG B 1 123 ? 48.096  42.899  21.180 1.00 59.68  ? 123 ARG B CA    1 
ATOM   3738 C  C     . ARG B 1 123 ? 49.115  41.909  21.717 1.00 60.14  ? 123 ARG B C     1 
ATOM   3739 O  O     . ARG B 1 123 ? 50.280  42.252  21.934 1.00 60.66  ? 123 ARG B O     1 
ATOM   3740 C  CB    . ARG B 1 123 ? 48.257  43.028  19.664 1.00 59.74  ? 123 ARG B CB    1 
ATOM   3741 C  CG    . ARG B 1 123 ? 48.120  41.715  18.912 0.00 59.59  ? 123 ARG B CG    1 
ATOM   3742 C  CD    . ARG B 1 123 ? 48.294  41.915  17.415 0.00 59.54  ? 123 ARG B CD    1 
ATOM   3743 N  NE    . ARG B 1 123 ? 48.172  40.661  16.677 0.00 59.49  ? 123 ARG B NE    1 
ATOM   3744 C  CZ    . ARG B 1 123 ? 48.985  39.620  16.828 0.00 59.46  ? 123 ARG B CZ    1 
ATOM   3745 N  NH1   . ARG B 1 123 ? 48.795  38.520  16.113 0.00 59.44  ? 123 ARG B NH1   1 
ATOM   3746 N  NH2   . ARG B 1 123 ? 49.989  39.677  17.692 0.00 59.44  ? 123 ARG B NH2   1 
ATOM   3747 N  N     . LEU B 1 124 ? 48.667  40.678  21.932 1.00 60.61  ? 124 LEU B N     1 
ATOM   3748 C  CA    . LEU B 1 124 ? 49.528  39.621  22.444 1.00 61.84  ? 124 LEU B CA    1 
ATOM   3749 C  C     . LEU B 1 124 ? 49.880  38.596  21.365 1.00 63.83  ? 124 LEU B C     1 
ATOM   3750 O  O     . LEU B 1 124 ? 49.235  38.512  20.317 1.00 62.86  ? 124 LEU B O     1 
ATOM   3751 C  CB    . LEU B 1 124 ? 48.850  38.888  23.602 1.00 60.42  ? 124 LEU B CB    1 
ATOM   3752 C  CG    . LEU B 1 124 ? 48.478  39.683  24.854 1.00 60.66  ? 124 LEU B CG    1 
ATOM   3753 C  CD1   . LEU B 1 124 ? 47.708  38.770  25.779 1.00 59.77  ? 124 LEU B CD1   1 
ATOM   3754 C  CD2   . LEU B 1 124 ? 49.716  40.223  25.545 1.00 58.54  ? 124 LEU B CD2   1 
ATOM   3755 N  N     . GLY B 1 125 ? 50.900  37.796  21.657 1.00 65.52  ? 125 GLY B N     1 
ATOM   3756 C  CA    . GLY B 1 125 ? 51.341  36.786  20.722 1.00 67.88  ? 125 GLY B CA    1 
ATOM   3757 C  C     . GLY B 1 125 ? 50.259  35.798  20.347 1.00 69.19  ? 125 GLY B C     1 
ATOM   3758 O  O     . GLY B 1 125 ? 50.430  35.017  19.407 1.00 69.84  ? 125 GLY B O     1 
ATOM   3759 N  N     . ASN B 1 126 ? 49.139  35.837  21.063 1.00 69.45  ? 126 ASN B N     1 
ATOM   3760 C  CA    . ASN B 1 126 ? 48.050  34.902  20.795 1.00 69.45  ? 126 ASN B CA    1 
ATOM   3761 C  C     . ASN B 1 126 ? 46.961  35.482  19.893 1.00 69.15  ? 126 ASN B C     1 
ATOM   3762 O  O     . ASN B 1 126 ? 46.011  34.783  19.533 1.00 70.35  ? 126 ASN B O     1 
ATOM   3763 C  CB    . ASN B 1 126 ? 47.439  34.435  22.123 1.00 69.48  ? 126 ASN B CB    1 
ATOM   3764 C  CG    . ASN B 1 126 ? 46.418  35.414  22.680 1.00 69.88  ? 126 ASN B CG    1 
ATOM   3765 O  OD1   . ASN B 1 126 ? 46.538  36.631  22.512 1.00 68.56  ? 126 ASN B OD1   1 
ATOM   3766 N  ND2   . ASN B 1 126 ? 45.407  34.880  23.359 1.00 71.19  ? 126 ASN B ND2   1 
ATOM   3767 N  N     . GLY B 1 127 ? 47.099  36.752  19.525 1.00 68.27  ? 127 GLY B N     1 
ATOM   3768 C  CA    . GLY B 1 127 ? 46.096  37.382  18.680 1.00 67.19  ? 127 GLY B CA    1 
ATOM   3769 C  C     . GLY B 1 127 ? 45.144  38.239  19.495 1.00 66.48  ? 127 GLY B C     1 
ATOM   3770 O  O     . GLY B 1 127 ? 44.606  39.233  19.005 1.00 66.40  ? 127 GLY B O     1 
ATOM   3771 N  N     . GLU B 1 128 ? 44.937  37.847  20.750 1.00 66.39  ? 128 GLU B N     1 
ATOM   3772 C  CA    . GLU B 1 128 ? 44.062  38.575  21.665 1.00 65.56  ? 128 GLU B CA    1 
ATOM   3773 C  C     . GLU B 1 128 ? 44.701  39.883  22.129 1.00 63.78  ? 128 GLU B C     1 
ATOM   3774 O  O     . GLU B 1 128 ? 45.875  40.147  21.853 1.00 63.64  ? 128 GLU B O     1 
ATOM   3775 C  CB    . GLU B 1 128 ? 43.733  37.709  22.886 1.00 68.42  ? 128 GLU B CB    1 
ATOM   3776 C  CG    . GLU B 1 128 ? 42.767  36.561  22.603 1.00 72.42  ? 128 GLU B CG    1 
ATOM   3777 C  CD    . GLU B 1 128 ? 42.019  36.090  23.855 1.00 75.22  ? 128 GLU B CD    1 
ATOM   3778 O  OE1   . GLU B 1 128 ? 40.990  35.395  23.700 1.00 77.46  ? 128 GLU B OE1   1 
ATOM   3779 O  OE2   . GLU B 1 128 ? 42.453  36.407  24.988 1.00 76.11  ? 128 GLU B OE2   1 
ATOM   3780 N  N     . TYR B 1 129 ? 43.934  40.694  22.852 1.00 61.39  ? 129 TYR B N     1 
ATOM   3781 C  CA    . TYR B 1 129 ? 44.437  41.973  23.334 1.00 58.40  ? 129 TYR B CA    1 
ATOM   3782 C  C     . TYR B 1 129 ? 44.391  42.136  24.850 1.00 55.77  ? 129 TYR B C     1 
ATOM   3783 O  O     . TYR B 1 129 ? 43.396  41.805  25.497 1.00 54.52  ? 129 TYR B O     1 
ATOM   3784 C  CB    . TYR B 1 129 ? 43.647  43.115  22.703 1.00 61.73  ? 129 TYR B CB    1 
ATOM   3785 C  CG    . TYR B 1 129 ? 43.673  43.129  21.194 1.00 65.01  ? 129 TYR B CG    1 
ATOM   3786 C  CD1   . TYR B 1 129 ? 43.072  42.108  20.455 1.00 66.20  ? 129 TYR B CD1   1 
ATOM   3787 C  CD2   . TYR B 1 129 ? 44.312  44.157  20.502 1.00 66.17  ? 129 TYR B CD2   1 
ATOM   3788 C  CE1   . TYR B 1 129 ? 43.110  42.110  19.062 1.00 68.21  ? 129 TYR B CE1   1 
ATOM   3789 C  CE2   . TYR B 1 129 ? 44.356  44.169  19.111 1.00 68.23  ? 129 TYR B CE2   1 
ATOM   3790 C  CZ    . TYR B 1 129 ? 43.754  43.145  18.399 1.00 68.76  ? 129 TYR B CZ    1 
ATOM   3791 O  OH    . TYR B 1 129 ? 43.798  43.158  17.024 1.00 71.35  ? 129 TYR B OH    1 
ATOM   3792 N  N     . LEU B 1 130 ? 45.479  42.652  25.412 1.00 51.64  ? 130 LEU B N     1 
ATOM   3793 C  CA    . LEU B 1 130 ? 45.545  42.908  26.837 1.00 47.05  ? 130 LEU B CA    1 
ATOM   3794 C  C     . LEU B 1 130 ? 45.055  44.325  26.996 1.00 46.23  ? 130 LEU B C     1 
ATOM   3795 O  O     . LEU B 1 130 ? 45.675  45.251  26.488 1.00 45.55  ? 130 LEU B O     1 
ATOM   3796 C  CB    . LEU B 1 130 ? 46.974  42.825  27.358 1.00 44.91  ? 130 LEU B CB    1 
ATOM   3797 C  CG    . LEU B 1 130 ? 47.098  43.092  28.866 1.00 42.95  ? 130 LEU B CG    1 
ATOM   3798 C  CD1   . LEU B 1 130 ? 46.244  42.102  29.664 1.00 39.44  ? 130 LEU B CD1   1 
ATOM   3799 C  CD2   . LEU B 1 130 ? 48.554  42.952  29.263 1.00 41.38  ? 130 LEU B CD2   1 
ATOM   3800 N  N     . VAL B 1 131 ? 43.931  44.491  27.686 1.00 44.79  ? 131 VAL B N     1 
ATOM   3801 C  CA    . VAL B 1 131 ? 43.367  45.811  27.896 1.00 42.76  ? 131 VAL B CA    1 
ATOM   3802 C  C     . VAL B 1 131 ? 43.711  46.333  29.290 1.00 42.96  ? 131 VAL B C     1 
ATOM   3803 O  O     . VAL B 1 131 ? 43.568  45.625  30.295 1.00 41.98  ? 131 VAL B O     1 
ATOM   3804 C  CB    . VAL B 1 131 ? 41.839  45.778  27.681 1.00 41.75  ? 131 VAL B CB    1 
ATOM   3805 C  CG1   . VAL B 1 131 ? 41.229  47.137  27.960 1.00 39.58  ? 131 VAL B CG1   1 
ATOM   3806 C  CG2   . VAL B 1 131 ? 41.548  45.368  26.239 1.00 41.54  ? 131 VAL B CG2   1 
ATOM   3807 N  N     . LYS B 1 132 ? 44.190  47.572  29.331 1.00 42.29  ? 132 LYS B N     1 
ATOM   3808 C  CA    . LYS B 1 132 ? 44.572  48.220  30.574 1.00 41.96  ? 132 LYS B CA    1 
ATOM   3809 C  C     . LYS B 1 132 ? 43.722  49.453  30.783 1.00 40.82  ? 132 LYS B C     1 
ATOM   3810 O  O     . LYS B 1 132 ? 43.291  50.091  29.823 1.00 42.07  ? 132 LYS B O     1 
ATOM   3811 C  CB    . LYS B 1 132 ? 46.052  48.598  30.531 1.00 43.28  ? 132 LYS B CB    1 
ATOM   3812 C  CG    . LYS B 1 132 ? 46.967  47.389  30.437 1.00 45.93  ? 132 LYS B CG    1 
ATOM   3813 C  CD    . LYS B 1 132 ? 48.424  47.766  30.108 1.00 47.07  ? 132 LYS B CD    1 
ATOM   3814 C  CE    . LYS B 1 132 ? 49.320  46.521  30.244 1.00 49.12  ? 132 LYS B CE    1 
ATOM   3815 N  NZ    . LYS B 1 132 ? 50.739  46.766  29.804 1.00 50.26  ? 132 LYS B NZ    1 
ATOM   3816 N  N     . GLY B 1 133 ? 43.458  49.776  32.042 1.00 39.99  ? 133 GLY B N     1 
ATOM   3817 C  CA    . GLY B 1 133 ? 42.654  50.939  32.334 1.00 38.96  ? 133 GLY B CA    1 
ATOM   3818 C  C     . GLY B 1 133 ? 43.539  52.159  32.381 1.00 40.32  ? 133 GLY B C     1 
ATOM   3819 O  O     . GLY B 1 133 ? 44.695  52.082  32.804 1.00 41.07  ? 133 GLY B O     1 
ATOM   3820 N  N     . VAL B 1 134 ? 42.995  53.294  31.970 1.00 41.47  ? 134 VAL B N     1 
ATOM   3821 C  CA    . VAL B 1 134 ? 43.762  54.522  31.960 1.00 42.11  ? 134 VAL B CA    1 
ATOM   3822 C  C     . VAL B 1 134 ? 43.032  55.673  32.631 1.00 42.22  ? 134 VAL B C     1 
ATOM   3823 O  O     . VAL B 1 134 ? 41.865  55.930  32.363 1.00 41.63  ? 134 VAL B O     1 
ATOM   3824 C  CB    . VAL B 1 134 ? 44.140  54.904  30.487 1.00 43.85  ? 134 VAL B CB    1 
ATOM   3825 C  CG1   . VAL B 1 134 ? 44.938  56.198  30.449 1.00 43.08  ? 134 VAL B CG1   1 
ATOM   3826 C  CG2   . VAL B 1 134 ? 44.966  53.768  29.859 1.00 43.14  ? 134 VAL B CG2   1 
ATOM   3827 N  N     . TYR B 1 135 ? 43.724  56.343  33.540 1.00 43.13  ? 135 TYR B N     1 
ATOM   3828 C  CA    . TYR B 1 135 ? 43.160  57.498  34.210 1.00 43.94  ? 135 TYR B CA    1 
ATOM   3829 C  C     . TYR B 1 135 ? 44.293  58.517  34.280 1.00 46.22  ? 135 TYR B C     1 
ATOM   3830 O  O     . TYR B 1 135 ? 45.138  58.481  35.192 1.00 47.07  ? 135 TYR B O     1 
ATOM   3831 C  CB    . TYR B 1 135 ? 42.642  57.147  35.620 1.00 43.18  ? 135 TYR B CB    1 
ATOM   3832 C  CG    . TYR B 1 135 ? 41.767  58.242  36.188 1.00 43.45  ? 135 TYR B CG    1 
ATOM   3833 C  CD1   . TYR B 1 135 ? 42.307  59.268  36.979 1.00 43.55  ? 135 TYR B CD1   1 
ATOM   3834 C  CD2   . TYR B 1 135 ? 40.418  58.323  35.838 1.00 43.78  ? 135 TYR B CD2   1 
ATOM   3835 C  CE1   . TYR B 1 135 ? 41.525  60.353  37.395 1.00 43.43  ? 135 TYR B CE1   1 
ATOM   3836 C  CE2   . TYR B 1 135 ? 39.623  59.402  36.248 1.00 45.65  ? 135 TYR B CE2   1 
ATOM   3837 C  CZ    . TYR B 1 135 ? 40.186  60.411  37.019 1.00 46.11  ? 135 TYR B CZ    1 
ATOM   3838 O  OH    . TYR B 1 135 ? 39.403  61.482  37.386 1.00 49.98  ? 135 TYR B OH    1 
ATOM   3839 N  N     . LYS B 1 136 ? 44.321  59.407  33.292 1.00 47.41  ? 136 LYS B N     1 
ATOM   3840 C  CA    . LYS B 1 136 ? 45.354  60.426  33.214 1.00 47.61  ? 136 LYS B CA    1 
ATOM   3841 C  C     . LYS B 1 136 ? 46.715  59.759  33.166 1.00 48.16  ? 136 LYS B C     1 
ATOM   3842 O  O     . LYS B 1 136 ? 46.944  58.892  32.329 1.00 49.92  ? 136 LYS B O     1 
ATOM   3843 C  CB    . LYS B 1 136 ? 45.233  61.381  34.409 1.00 47.27  ? 136 LYS B CB    1 
ATOM   3844 C  CG    . LYS B 1 136 ? 43.965  62.207  34.317 1.00 50.41  ? 136 LYS B CG    1 
ATOM   3845 C  CD    . LYS B 1 136 ? 43.644  63.018  35.557 1.00 52.40  ? 136 LYS B CD    1 
ATOM   3846 C  CE    . LYS B 1 136 ? 42.333  63.766  35.329 1.00 54.16  ? 136 LYS B CE    1 
ATOM   3847 N  NZ    . LYS B 1 136 ? 41.819  64.489  36.525 1.00 57.37  ? 136 LYS B NZ    1 
ATOM   3848 N  N     . ASP B 1 137 ? 47.603  60.144  34.077 1.00 49.89  ? 137 ASP B N     1 
ATOM   3849 C  CA    . ASP B 1 137 ? 48.969  59.608  34.146 1.00 51.33  ? 137 ASP B CA    1 
ATOM   3850 C  C     . ASP B 1 137 ? 49.061  58.192  34.720 1.00 49.96  ? 137 ASP B C     1 
ATOM   3851 O  O     . ASP B 1 137 ? 50.114  57.542  34.629 1.00 47.91  ? 137 ASP B O     1 
ATOM   3852 C  CB    . ASP B 1 137 ? 49.842  60.545  35.004 1.00 55.12  ? 137 ASP B CB    1 
ATOM   3853 C  CG    . ASP B 1 137 ? 49.221  60.825  36.384 1.00 60.50  ? 137 ASP B CG    1 
ATOM   3854 O  OD1   . ASP B 1 137 ? 48.102  61.398  36.441 1.00 61.24  ? 137 ASP B OD1   1 
ATOM   3855 O  OD2   . ASP B 1 137 ? 49.843  60.472  37.416 1.00 63.02  ? 137 ASP B OD2   1 
ATOM   3856 N  N     . LEU B 1 138 ? 47.963  57.721  35.307 1.00 48.51  ? 138 LEU B N     1 
ATOM   3857 C  CA    . LEU B 1 138 ? 47.926  56.394  35.937 1.00 47.60  ? 138 LEU B CA    1 
ATOM   3858 C  C     . LEU B 1 138 ? 47.352  55.241  35.095 1.00 46.16  ? 138 LEU B C     1 
ATOM   3859 O  O     . LEU B 1 138 ? 46.355  55.403  34.393 1.00 46.37  ? 138 LEU B O     1 
ATOM   3860 C  CB    . LEU B 1 138 ? 47.135  56.489  37.246 1.00 48.13  ? 138 LEU B CB    1 
ATOM   3861 C  CG    . LEU B 1 138 ? 46.792  55.170  37.939 1.00 50.09  ? 138 LEU B CG    1 
ATOM   3862 C  CD1   . LEU B 1 138 ? 48.046  54.573  38.562 1.00 50.24  ? 138 LEU B CD1   1 
ATOM   3863 C  CD2   . LEU B 1 138 ? 45.743  55.414  38.997 1.00 50.71  ? 138 LEU B CD2   1 
ATOM   3864 N  N     . GLU B 1 139 ? 47.991  54.082  35.168 1.00 44.51  ? 139 GLU B N     1 
ATOM   3865 C  CA    . GLU B 1 139 ? 47.498  52.905  34.467 1.00 45.25  ? 139 GLU B CA    1 
ATOM   3866 C  C     . GLU B 1 139 ? 47.041  51.817  35.465 1.00 44.97  ? 139 GLU B C     1 
ATOM   3867 O  O     . GLU B 1 139 ? 47.644  51.624  36.538 1.00 42.74  ? 139 GLU B O     1 
ATOM   3868 C  CB    . GLU B 1 139 ? 48.565  52.309  33.542 1.00 46.54  ? 139 GLU B CB    1 
ATOM   3869 C  CG    . GLU B 1 139 ? 49.041  53.251  32.448 1.00 49.33  ? 139 GLU B CG    1 
ATOM   3870 C  CD    . GLU B 1 139 ? 49.663  52.516  31.290 1.00 51.72  ? 139 GLU B CD    1 
ATOM   3871 O  OE1   . GLU B 1 139 ? 50.181  51.393  31.492 1.00 53.19  ? 139 GLU B OE1   1 
ATOM   3872 O  OE2   . GLU B 1 139 ? 49.640  53.067  30.168 1.00 55.32  ? 139 GLU B OE2   1 
ATOM   3873 N  N     . ILE B 1 140 ? 45.976  51.110  35.083 1.00 42.90  ? 140 ILE B N     1 
ATOM   3874 C  CA    . ILE B 1 140 ? 45.418  50.039  35.881 1.00 39.31  ? 140 ILE B CA    1 
ATOM   3875 C  C     . ILE B 1 140 ? 45.525  48.744  35.107 1.00 38.39  ? 140 ILE B C     1 
ATOM   3876 O  O     . ILE B 1 140 ? 44.813  48.521  34.123 1.00 38.91  ? 140 ILE B O     1 
ATOM   3877 C  CB    . ILE B 1 140 ? 43.950  50.320  36.227 1.00 41.33  ? 140 ILE B CB    1 
ATOM   3878 C  CG1   . ILE B 1 140 ? 43.855  51.667  36.957 1.00 41.43  ? 140 ILE B CG1   1 
ATOM   3879 C  CG2   . ILE B 1 140 ? 43.413  49.215  37.147 1.00 39.05  ? 140 ILE B CG2   1 
ATOM   3880 C  CD1   . ILE B 1 140 ? 42.633  52.483  36.634 1.00 42.61  ? 140 ILE B CD1   1 
ATOM   3881 N  N     . HIS B 1 141 ? 46.431  47.889  35.554 1.00 36.68  ? 141 HIS B N     1 
ATOM   3882 C  CA    . HIS B 1 141 ? 46.658  46.615  34.909 1.00 36.05  ? 141 HIS B CA    1 
ATOM   3883 C  C     . HIS B 1 141 ? 45.905  45.535  35.669 1.00 37.00  ? 141 HIS B C     1 
ATOM   3884 O  O     . HIS B 1 141 ? 45.599  45.686  36.870 1.00 34.42  ? 141 HIS B O     1 
ATOM   3885 C  CB    . HIS B 1 141 ? 48.145  46.270  34.933 1.00 38.88  ? 141 HIS B CB    1 
ATOM   3886 C  CG    . HIS B 1 141 ? 49.017  47.250  34.213 1.00 39.98  ? 141 HIS B CG    1 
ATOM   3887 N  ND1   . HIS B 1 141 ? 48.533  48.409  33.648 1.00 42.02  ? 141 HIS B ND1   1 
ATOM   3888 C  CD2   . HIS B 1 141 ? 50.348  47.230  33.953 1.00 39.61  ? 141 HIS B CD2   1 
ATOM   3889 C  CE1   . HIS B 1 141 ? 49.526  49.061  33.067 1.00 42.21  ? 141 HIS B CE1   1 
ATOM   3890 N  NE2   . HIS B 1 141 ? 50.637  48.367  33.238 1.00 40.60  ? 141 HIS B NE2   1 
ATOM   3891 N  N     . GLY B 1 142 ? 45.625  44.437  34.983 1.00 34.80  ? 142 GLY B N     1 
ATOM   3892 C  CA    . GLY B 1 142 ? 44.929  43.360  35.640 1.00 35.96  ? 142 GLY B CA    1 
ATOM   3893 C  C     . GLY B 1 142 ? 44.256  42.415  34.676 1.00 37.76  ? 142 GLY B C     1 
ATOM   3894 O  O     . GLY B 1 142 ? 44.237  42.629  33.452 1.00 40.03  ? 142 GLY B O     1 
ATOM   3895 N  N     . MET B 1 143 ? 43.696  41.356  35.233 1.00 36.88  ? 143 MET B N     1 
ATOM   3896 C  CA    . MET B 1 143 ? 43.032  40.351  34.428 1.00 37.60  ? 143 MET B CA    1 
ATOM   3897 C  C     . MET B 1 143 ? 42.006  39.675  35.318 1.00 37.52  ? 143 MET B C     1 
ATOM   3898 O  O     . MET B 1 143 ? 42.008  39.847  36.551 1.00 38.03  ? 143 MET B O     1 
ATOM   3899 C  CB    . MET B 1 143 ? 44.057  39.325  33.891 1.00 35.85  ? 143 MET B CB    1 
ATOM   3900 C  CG    . MET B 1 143 ? 44.538  38.269  34.879 1.00 36.25  ? 143 MET B CG    1 
ATOM   3901 S  SD    . MET B 1 143 ? 45.753  37.037  34.193 1.00 31.67  ? 143 MET B SD    1 
ATOM   3902 C  CE    . MET B 1 143 ? 45.330  37.155  32.690 1.00 36.51  ? 143 MET B CE    1 
ATOM   3903 N  N     . LYS B 1 144 ? 41.125  38.912  34.701 1.00 36.01  ? 144 LYS B N     1 
ATOM   3904 C  CA    . LYS B 1 144 ? 40.119  38.212  35.465 1.00 34.33  ? 144 LYS B CA    1 
ATOM   3905 C  C     . LYS B 1 144 ? 40.740  37.039  36.181 1.00 32.96  ? 144 LYS B C     1 
ATOM   3906 O  O     . LYS B 1 144 ? 41.889  36.657  35.931 1.00 34.94  ? 144 LYS B O     1 
ATOM   3907 C  CB    . LYS B 1 144 ? 39.016  37.702  34.550 1.00 35.45  ? 144 LYS B CB    1 
ATOM   3908 C  CG    . LYS B 1 144 ? 39.472  36.657  33.554 1.00 40.00  ? 144 LYS B CG    1 
ATOM   3909 C  CD    . LYS B 1 144 ? 38.285  36.204  32.736 1.00 43.66  ? 144 LYS B CD    1 
ATOM   3910 C  CE    . LYS B 1 144 ? 38.640  35.072  31.813 1.00 43.67  ? 144 LYS B CE    1 
ATOM   3911 N  NZ    . LYS B 1 144 ? 37.379  34.450  31.346 1.00 50.14  ? 144 LYS B NZ    1 
ATOM   3912 N  N     . TYR B 1 145 ? 39.949  36.448  37.057 1.00 30.14  ? 145 TYR B N     1 
ATOM   3913 C  CA    . TYR B 1 145 ? 40.358  35.295  37.807 1.00 29.40  ? 145 TYR B CA    1 
ATOM   3914 C  C     . TYR B 1 145 ? 40.705  34.132  36.868 1.00 32.27  ? 145 TYR B C     1 
ATOM   3915 O  O     . TYR B 1 145 ? 40.020  33.899  35.872 1.00 29.95  ? 145 TYR B O     1 
ATOM   3916 C  CB    . TYR B 1 145 ? 39.208  34.875  38.738 1.00 27.72  ? 145 TYR B CB    1 
ATOM   3917 C  CG    . TYR B 1 145 ? 39.339  33.480  39.312 1.00 29.85  ? 145 TYR B CG    1 
ATOM   3918 C  CD1   . TYR B 1 145 ? 38.926  32.349  38.578 1.00 31.18  ? 145 TYR B CD1   1 
ATOM   3919 C  CD2   . TYR B 1 145 ? 39.888  33.276  40.578 1.00 31.04  ? 145 TYR B CD2   1 
ATOM   3920 C  CE1   . TYR B 1 145 ? 39.068  31.050  39.105 1.00 29.80  ? 145 TYR B CE1   1 
ATOM   3921 C  CE2   . TYR B 1 145 ? 40.032  31.986  41.120 1.00 30.58  ? 145 TYR B CE2   1 
ATOM   3922 C  CZ    . TYR B 1 145 ? 39.622  30.886  40.373 1.00 33.00  ? 145 TYR B CZ    1 
ATOM   3923 O  OH    . TYR B 1 145 ? 39.771  29.640  40.910 1.00 35.19  ? 145 TYR B OH    1 
ATOM   3924 N  N     . MET B 1 146 ? 41.767  33.408  37.211 1.00 33.74  ? 146 MET B N     1 
ATOM   3925 C  CA    . MET B 1 146 ? 42.190  32.225  36.479 1.00 34.49  ? 146 MET B CA    1 
ATOM   3926 C  C     . MET B 1 146 ? 42.469  31.183  37.557 1.00 35.74  ? 146 MET B C     1 
ATOM   3927 O  O     . MET B 1 146 ? 42.880  31.524  38.676 1.00 33.31  ? 146 MET B O     1 
ATOM   3928 C  CB    . MET B 1 146 ? 43.432  32.510  35.630 1.00 34.47  ? 146 MET B CB    1 
ATOM   3929 C  CG    . MET B 1 146 ? 43.157  33.465  34.465 1.00 34.91  ? 146 MET B CG    1 
ATOM   3930 S  SD    . MET B 1 146 ? 41.781  32.926  33.366 1.00 31.69  ? 146 MET B SD    1 
ATOM   3931 C  CE    . MET B 1 146 ? 41.627  34.167  32.503 1.00 22.05  ? 146 MET B CE    1 
ATOM   3932 N  N     . SER B 1 147 ? 42.205  29.916  37.231 1.00 37.16  ? 147 SER B N     1 
ATOM   3933 C  CA    . SER B 1 147 ? 42.405  28.807  38.167 1.00 39.06  ? 147 SER B CA    1 
ATOM   3934 C  C     . SER B 1 147 ? 43.871  28.519  38.454 1.00 38.43  ? 147 SER B C     1 
ATOM   3935 O  O     . SER B 1 147 ? 44.754  28.977  37.726 1.00 39.63  ? 147 SER B O     1 
ATOM   3936 C  CB    . SER B 1 147 ? 41.786  27.526  37.596 1.00 41.72  ? 147 SER B CB    1 
ATOM   3937 O  OG    . SER B 1 147 ? 42.366  27.254  36.326 1.00 44.76  ? 147 SER B OG    1 
ATOM   3938 N  N     . SER B 1 148 ? 44.103  27.758  39.520 1.00 39.04  ? 148 SER B N     1 
ATOM   3939 C  CA    . SER B 1 148 ? 45.437  27.316  39.913 1.00 44.10  ? 148 SER B CA    1 
ATOM   3940 C  C     . SER B 1 148 ? 46.083  26.615  38.731 1.00 44.85  ? 148 SER B C     1 
ATOM   3941 O  O     . SER B 1 148 ? 47.182  26.956  38.306 1.00 46.48  ? 148 SER B O     1 
ATOM   3942 C  CB    . SER B 1 148 ? 45.353  26.294  41.034 1.00 44.67  ? 148 SER B CB    1 
ATOM   3943 O  OG    . SER B 1 148 ? 45.152  26.922  42.274 1.00 51.58  ? 148 SER B OG    1 
ATOM   3944 N  N     . ALA B 1 149 ? 45.376  25.618  38.218 1.00 47.65  ? 149 ALA B N     1 
ATOM   3945 C  CA    . ALA B 1 149 ? 45.843  24.834  37.091 1.00 48.61  ? 149 ALA B CA    1 
ATOM   3946 C  C     . ALA B 1 149 ? 46.396  25.740  36.016 1.00 49.45  ? 149 ALA B C     1 
ATOM   3947 O  O     . ALA B 1 149 ? 47.495  25.512  35.518 1.00 52.72  ? 149 ALA B O     1 
ATOM   3948 C  CB    . ALA B 1 149 ? 44.701  23.983  36.533 1.00 48.67  ? 149 ALA B CB    1 
ATOM   3949 N  N     . TRP B 1 150 ? 45.660  26.781  35.657 1.00 49.37  ? 150 TRP B N     1 
ATOM   3950 C  CA    . TRP B 1 150 ? 46.146  27.670  34.617 1.00 48.91  ? 150 TRP B CA    1 
ATOM   3951 C  C     . TRP B 1 150 ? 47.418  28.427  35.020 1.00 51.61  ? 150 TRP B C     1 
ATOM   3952 O  O     . TRP B 1 150 ? 48.211  28.800  34.154 1.00 51.92  ? 150 TRP B O     1 
ATOM   3953 C  CB    . TRP B 1 150 ? 45.059  28.651  34.222 1.00 47.38  ? 150 TRP B CB    1 
ATOM   3954 C  CG    . TRP B 1 150 ? 45.459  29.652  33.187 1.00 46.20  ? 150 TRP B CG    1 
ATOM   3955 C  CD1   . TRP B 1 150 ? 45.186  29.602  31.848 1.00 46.65  ? 150 TRP B CD1   1 
ATOM   3956 C  CD2   . TRP B 1 150 ? 46.096  30.913  33.419 1.00 45.05  ? 150 TRP B CD2   1 
ATOM   3957 N  NE1   . TRP B 1 150 ? 45.597  30.763  31.236 1.00 45.80  ? 150 TRP B NE1   1 
ATOM   3958 C  CE2   . TRP B 1 150 ? 46.158  31.586  32.177 1.00 46.07  ? 150 TRP B CE2   1 
ATOM   3959 C  CE3   . TRP B 1 150 ? 46.614  31.548  34.559 1.00 45.00  ? 150 TRP B CE3   1 
ATOM   3960 C  CZ2   . TRP B 1 150 ? 46.720  32.866  32.042 1.00 46.64  ? 150 TRP B CZ2   1 
ATOM   3961 C  CZ3   . TRP B 1 150 ? 47.170  32.817  34.426 1.00 43.47  ? 150 TRP B CZ3   1 
ATOM   3962 C  CH2   . TRP B 1 150 ? 47.217  33.465  33.176 1.00 45.60  ? 150 TRP B CH2   1 
ATOM   3963 N  N     . PHE B 1 151 ? 47.625  28.675  36.312 1.00 52.43  ? 151 PHE B N     1 
ATOM   3964 C  CA    . PHE B 1 151 ? 48.850  29.378  36.705 1.00 54.49  ? 151 PHE B CA    1 
ATOM   3965 C  C     . PHE B 1 151 ? 50.018  28.388  36.672 1.00 56.74  ? 151 PHE B C     1 
ATOM   3966 O  O     . PHE B 1 151 ? 51.152  28.769  36.383 1.00 57.36  ? 151 PHE B O     1 
ATOM   3967 C  CB    . PHE B 1 151 ? 48.730  30.020  38.102 1.00 50.53  ? 151 PHE B CB    1 
ATOM   3968 C  CG    . PHE B 1 151 ? 48.064  31.375  38.090 1.00 48.60  ? 151 PHE B CG    1 
ATOM   3969 C  CD1   . PHE B 1 151 ? 46.708  31.511  38.390 1.00 45.27  ? 151 PHE B CD1   1 
ATOM   3970 C  CD2   . PHE B 1 151 ? 48.783  32.508  37.722 1.00 46.21  ? 151 PHE B CD2   1 
ATOM   3971 C  CE1   . PHE B 1 151 ? 46.082  32.750  38.320 1.00 44.97  ? 151 PHE B CE1   1 
ATOM   3972 C  CE2   . PHE B 1 151 ? 48.171  33.749  37.646 1.00 46.09  ? 151 PHE B CE2   1 
ATOM   3973 C  CZ    . PHE B 1 151 ? 46.810  33.874  37.947 1.00 46.34  ? 151 PHE B CZ    1 
ATOM   3974 N  N     . GLU B 1 152 ? 49.733  27.118  36.953 1.00 59.36  ? 152 GLU B N     1 
ATOM   3975 C  CA    . GLU B 1 152 ? 50.765  26.083  36.935 1.00 62.20  ? 152 GLU B CA    1 
ATOM   3976 C  C     . GLU B 1 152 ? 51.249  25.838  35.506 1.00 62.26  ? 152 GLU B C     1 
ATOM   3977 O  O     . GLU B 1 152 ? 52.408  25.499  35.295 1.00 63.51  ? 152 GLU B O     1 
ATOM   3978 C  CB    . GLU B 1 152 ? 50.232  24.767  37.514 1.00 64.14  ? 152 GLU B CB    1 
ATOM   3979 C  CG    . GLU B 1 152 ? 49.596  24.891  38.896 1.00 68.66  ? 152 GLU B CG    1 
ATOM   3980 C  CD    . GLU B 1 152 ? 49.132  23.545  39.465 1.00 72.43  ? 152 GLU B CD    1 
ATOM   3981 O  OE1   . GLU B 1 152 ? 49.996  22.764  39.937 1.00 74.67  ? 152 GLU B OE1   1 
ATOM   3982 O  OE2   . GLU B 1 152 ? 47.907  23.265  39.435 1.00 72.88  ? 152 GLU B OE2   1 
ATOM   3983 N  N     . ALA B 1 153 ? 50.367  26.038  34.530 1.00 62.29  ? 153 ALA B N     1 
ATOM   3984 C  CA    . ALA B 1 153 ? 50.699  25.821  33.125 1.00 62.31  ? 153 ALA B CA    1 
ATOM   3985 C  C     . ALA B 1 153 ? 51.163  27.065  32.375 1.00 63.62  ? 153 ALA B C     1 
ATOM   3986 O  O     . ALA B 1 153 ? 51.312  27.032  31.149 1.00 63.73  ? 153 ALA B O     1 
ATOM   3987 C  CB    . ALA B 1 153 ? 49.508  25.226  32.408 1.00 62.93  ? 153 ALA B CB    1 
ATOM   3988 N  N     . ASN B 1 154 ? 51.379  28.158  33.101 1.00 63.42  ? 154 ASN B N     1 
ATOM   3989 C  CA    . ASN B 1 154 ? 51.830  29.412  32.504 1.00 62.37  ? 154 ASN B CA    1 
ATOM   3990 C  C     . ASN B 1 154 ? 52.716  30.107  33.537 1.00 62.13  ? 154 ASN B C     1 
ATOM   3991 O  O     . ASN B 1 154 ? 52.457  31.246  33.953 1.00 62.18  ? 154 ASN B O     1 
ATOM   3992 C  CB    . ASN B 1 154 ? 50.630  30.296  32.151 1.00 63.32  ? 154 ASN B CB    1 
ATOM   3993 C  CG    . ASN B 1 154 ? 49.689  29.642  31.156 1.00 64.09  ? 154 ASN B CG    1 
ATOM   3994 O  OD1   . ASN B 1 154 ? 49.654  30.004  29.975 1.00 65.17  ? 154 ASN B OD1   1 
ATOM   3995 N  ND2   . ASN B 1 154 ? 48.920  28.670  31.627 1.00 63.75  ? 154 ASN B ND2   1 
ATOM   3996 N  N     . LYS B 1 155 ? 53.758  29.393  33.952 1.00 60.69  ? 155 LYS B N     1 
ATOM   3997 C  CA    . LYS B 1 155 ? 54.715  29.872  34.944 1.00 57.57  ? 155 LYS B CA    1 
ATOM   3998 C  C     . LYS B 1 155 ? 55.143  31.320  34.713 1.00 55.19  ? 155 LYS B C     1 
ATOM   3999 O  O     . LYS B 1 155 ? 55.384  31.752  33.569 1.00 53.58  ? 155 LYS B O     1 
ATOM   4000 C  CB    . LYS B 1 155 ? 55.943  28.949  34.959 1.00 59.21  ? 155 LYS B CB    1 
ATOM   4001 C  CG    . LYS B 1 155 ? 55.632  27.520  35.385 0.00 58.79  ? 155 LYS B CG    1 
ATOM   4002 C  CD    . LYS B 1 155 ? 55.082  27.468  36.804 0.00 59.13  ? 155 LYS B CD    1 
ATOM   4003 C  CE    . LYS B 1 155 ? 54.777  26.040  37.229 0.00 59.17  ? 155 LYS B CE    1 
ATOM   4004 N  NZ    . LYS B 1 155 ? 54.232  25.975  38.613 0.00 59.28  ? 155 LYS B NZ    1 
ATOM   4005 N  N     . GLU B 1 156 ? 55.215  32.065  35.813 1.00 51.70  ? 156 GLU B N     1 
ATOM   4006 C  CA    . GLU B 1 156 ? 55.611  33.455  35.772 1.00 48.61  ? 156 GLU B CA    1 
ATOM   4007 C  C     . GLU B 1 156 ? 54.774  34.258  34.791 1.00 46.99  ? 156 GLU B C     1 
ATOM   4008 O  O     . GLU B 1 156 ? 55.216  35.305  34.315 1.00 47.15  ? 156 GLU B O     1 
ATOM   4009 C  CB    . GLU B 1 156 ? 57.075  33.566  35.371 1.00 50.78  ? 156 GLU B CB    1 
ATOM   4010 C  CG    . GLU B 1 156 ? 58.027  32.783  36.249 1.00 52.18  ? 156 GLU B CG    1 
ATOM   4011 C  CD    . GLU B 1 156 ? 58.062  33.294  37.663 1.00 54.07  ? 156 GLU B CD    1 
ATOM   4012 O  OE1   . GLU B 1 156 ? 57.789  34.494  37.861 1.00 56.47  ? 156 GLU B OE1   1 
ATOM   4013 O  OE2   . GLU B 1 156 ? 58.378  32.506  38.578 1.00 55.85  ? 156 GLU B OE2   1 
ATOM   4014 N  N     . ILE B 1 157 ? 53.561  33.801  34.496 1.00 44.59  ? 157 ILE B N     1 
ATOM   4015 C  CA    . ILE B 1 157 ? 52.733  34.533  33.544 1.00 42.56  ? 157 ILE B CA    1 
ATOM   4016 C  C     . ILE B 1 157 ? 52.418  35.981  33.968 1.00 42.08  ? 157 ILE B C     1 
ATOM   4017 O  O     . ILE B 1 157 ? 52.354  36.877  33.116 1.00 41.21  ? 157 ILE B O     1 
ATOM   4018 C  CB    . ILE B 1 157 ? 51.417  33.779  33.258 1.00 42.96  ? 157 ILE B CB    1 
ATOM   4019 C  CG1   . ILE B 1 157 ? 50.719  34.408  32.052 1.00 44.34  ? 157 ILE B CG1   1 
ATOM   4020 C  CG2   . ILE B 1 157 ? 50.522  33.789  34.494 1.00 42.11  ? 157 ILE B CG2   1 
ATOM   4021 C  CD1   . ILE B 1 157 ? 51.576  34.409  30.780 1.00 44.73  ? 157 ILE B CD1   1 
ATOM   4022 N  N     . LEU B 1 158 ? 52.225  36.214  35.270 1.00 39.90  ? 158 LEU B N     1 
ATOM   4023 C  CA    . LEU B 1 158 ? 51.932  37.556  35.738 1.00 39.31  ? 158 LEU B CA    1 
ATOM   4024 C  C     . LEU B 1 158 ? 53.113  38.480  35.437 1.00 40.13  ? 158 LEU B C     1 
ATOM   4025 O  O     . LEU B 1 158 ? 52.939  39.578  34.908 1.00 40.20  ? 158 LEU B O     1 
ATOM   4026 C  CB    . LEU B 1 158 ? 51.606  37.557  37.243 1.00 37.57  ? 158 LEU B CB    1 
ATOM   4027 C  CG    . LEU B 1 158 ? 50.310  36.851  37.681 1.00 38.68  ? 158 LEU B CG    1 
ATOM   4028 C  CD1   . LEU B 1 158 ? 50.086  37.051  39.168 1.00 37.67  ? 158 LEU B CD1   1 
ATOM   4029 C  CD2   . LEU B 1 158 ? 49.117  37.411  36.898 1.00 36.64  ? 158 LEU B CD2   1 
ATOM   4030 N  N     . LYS B 1 159 ? 54.323  38.032  35.739 1.00 42.81  ? 159 LYS B N     1 
ATOM   4031 C  CA    . LYS B 1 159 ? 55.478  38.872  35.463 1.00 46.00  ? 159 LYS B CA    1 
ATOM   4032 C  C     . LYS B 1 159 ? 55.649  39.143  33.959 1.00 47.31  ? 159 LYS B C     1 
ATOM   4033 O  O     . LYS B 1 159 ? 56.100  40.228  33.567 1.00 47.16  ? 159 LYS B O     1 
ATOM   4034 C  CB    . LYS B 1 159 ? 56.730  38.249  36.077 1.00 47.01  ? 159 LYS B CB    1 
ATOM   4035 C  CG    . LYS B 1 159 ? 56.754  38.399  37.594 1.00 46.08  ? 159 LYS B CG    1 
ATOM   4036 C  CD    . LYS B 1 159 ? 57.840  37.570  38.258 1.00 46.55  ? 159 LYS B CD    1 
ATOM   4037 C  CE    . LYS B 1 159 ? 57.781  37.726  39.767 1.00 47.19  ? 159 LYS B CE    1 
ATOM   4038 N  NZ    . LYS B 1 159 ? 58.626  36.721  40.485 1.00 48.86  ? 159 LYS B NZ    1 
ATOM   4039 N  N     . ARG B 1 160 ? 55.254  38.184  33.121 1.00 47.11  ? 160 ARG B N     1 
ATOM   4040 C  CA    . ARG B 1 160 ? 55.338  38.365  31.671 1.00 48.33  ? 160 ARG B CA    1 
ATOM   4041 C  C     . ARG B 1 160 ? 54.257  39.269  31.109 1.00 48.55  ? 160 ARG B C     1 
ATOM   4042 O  O     . ARG B 1 160 ? 54.498  40.041  30.174 1.00 48.36  ? 160 ARG B O     1 
ATOM   4043 C  CB    . ARG B 1 160 ? 55.234  37.030  30.955 1.00 50.14  ? 160 ARG B CB    1 
ATOM   4044 C  CG    . ARG B 1 160 ? 56.502  36.249  30.973 1.00 52.61  ? 160 ARG B CG    1 
ATOM   4045 C  CD    . ARG B 1 160 ? 56.335  35.060  30.106 1.00 54.89  ? 160 ARG B CD    1 
ATOM   4046 N  NE    . ARG B 1 160 ? 55.657  33.972  30.794 1.00 54.90  ? 160 ARG B NE    1 
ATOM   4047 C  CZ    . ARG B 1 160 ? 54.878  33.096  30.175 1.00 54.68  ? 160 ARG B CZ    1 
ATOM   4048 N  NH1   . ARG B 1 160 ? 54.313  32.119  30.866 1.00 53.64  ? 160 ARG B NH1   1 
ATOM   4049 N  NH2   . ARG B 1 160 ? 54.641  33.226  28.871 1.00 54.10  ? 160 ARG B NH2   1 
ATOM   4050 N  N     . LEU B 1 161 ? 53.056  39.168  31.669 1.00 47.51  ? 161 LEU B N     1 
ATOM   4051 C  CA    . LEU B 1 161 ? 51.947  39.976  31.188 1.00 46.89  ? 161 LEU B CA    1 
ATOM   4052 C  C     . LEU B 1 161 ? 51.919  41.411  31.690 1.00 44.55  ? 161 LEU B C     1 
ATOM   4053 O  O     . LEU B 1 161 ? 51.610  42.339  30.941 1.00 41.79  ? 161 LEU B O     1 
ATOM   4054 C  CB    . LEU B 1 161 ? 50.624  39.305  31.560 1.00 49.56  ? 161 LEU B CB    1 
ATOM   4055 C  CG    . LEU B 1 161 ? 50.212  38.079  30.751 1.00 50.63  ? 161 LEU B CG    1 
ATOM   4056 C  CD1   . LEU B 1 161 ? 49.075  37.352  31.468 1.00 52.81  ? 161 LEU B CD1   1 
ATOM   4057 C  CD2   . LEU B 1 161 ? 49.777  38.516  29.365 1.00 50.04  ? 161 LEU B CD2   1 
ATOM   4058 N  N     . PHE B 1 162 ? 52.265  41.595  32.958 1.00 44.14  ? 162 PHE B N     1 
ATOM   4059 C  CA    . PHE B 1 162 ? 52.186  42.920  33.550 1.00 44.06  ? 162 PHE B CA    1 
ATOM   4060 C  C     . PHE B 1 162 ? 53.507  43.576  33.976 1.00 44.76  ? 162 PHE B C     1 
ATOM   4061 O  O     . PHE B 1 162 ? 54.134  43.173  34.958 1.00 45.65  ? 162 PHE B O     1 
ATOM   4062 C  CB    . PHE B 1 162 ? 51.214  42.858  34.735 1.00 42.06  ? 162 PHE B CB    1 
ATOM   4063 C  CG    . PHE B 1 162 ? 49.919  42.143  34.426 1.00 42.26  ? 162 PHE B CG    1 
ATOM   4064 C  CD1   . PHE B 1 162 ? 49.705  40.840  34.863 1.00 42.23  ? 162 PHE B CD1   1 
ATOM   4065 C  CD2   . PHE B 1 162 ? 48.911  42.778  33.709 1.00 41.71  ? 162 PHE B CD2   1 
ATOM   4066 C  CE1   . PHE B 1 162 ? 48.497  40.183  34.588 1.00 43.01  ? 162 PHE B CE1   1 
ATOM   4067 C  CE2   . PHE B 1 162 ? 47.699  42.127  33.432 1.00 43.36  ? 162 PHE B CE2   1 
ATOM   4068 C  CZ    . PHE B 1 162 ? 47.491  40.835  33.870 1.00 38.57  ? 162 PHE B CZ    1 
ATOM   4069 N  N     . ARG B 1 163 ? 53.915  44.580  33.210 1.00 45.54  ? 163 ARG B N     1 
ATOM   4070 C  CA    . ARG B 1 163 ? 55.138  45.352  33.466 1.00 47.03  ? 163 ARG B CA    1 
ATOM   4071 C  C     . ARG B 1 163 ? 54.597  46.718  33.875 1.00 46.33  ? 163 ARG B C     1 
ATOM   4072 O  O     . ARG B 1 163 ? 53.964  47.411  33.083 1.00 46.18  ? 163 ARG B O     1 
ATOM   4073 C  CB    . ARG B 1 163 ? 55.985  45.489  32.191 1.00 47.31  ? 163 ARG B CB    1 
ATOM   4074 C  CG    . ARG B 1 163 ? 56.460  44.162  31.587 1.00 48.65  ? 163 ARG B CG    1 
ATOM   4075 C  CD    . ARG B 1 163 ? 57.337  44.380  30.364 0.00 49.46  ? 163 ARG B CD    1 
ATOM   4076 N  NE    . ARG B 1 163 ? 58.740  44.071  30.628 0.00 50.46  ? 163 ARG B NE    1 
ATOM   4077 C  CZ    . ARG B 1 163 ? 59.500  44.710  31.513 0.00 50.98  ? 163 ARG B CZ    1 
ATOM   4078 N  NH1   . ARG B 1 163 ? 60.765  44.351  31.680 0.00 51.33  ? 163 ARG B NH1   1 
ATOM   4079 N  NH2   . ARG B 1 163 ? 58.999  45.708  32.227 0.00 51.33  ? 163 ARG B NH2   1 
ATOM   4080 N  N     . PRO B 1 164 ? 54.832  47.117  35.124 1.00 45.84  ? 164 PRO B N     1 
ATOM   4081 C  CA    . PRO B 1 164 ? 54.318  48.412  35.564 1.00 46.72  ? 164 PRO B CA    1 
ATOM   4082 C  C     . PRO B 1 164 ? 54.934  49.634  34.927 1.00 48.66  ? 164 PRO B C     1 
ATOM   4083 O  O     . PRO B 1 164 ? 56.103  49.646  34.563 1.00 48.78  ? 164 PRO B O     1 
ATOM   4084 C  CB    . PRO B 1 164 ? 54.550  48.384  37.074 1.00 44.78  ? 164 PRO B CB    1 
ATOM   4085 C  CG    . PRO B 1 164 ? 55.780  47.561  37.204 1.00 45.96  ? 164 PRO B CG    1 
ATOM   4086 C  CD    . PRO B 1 164 ? 55.534  46.421  36.215 1.00 45.15  ? 164 PRO B CD    1 
ATOM   4087 N  N     . THR B 1 165 ? 54.124  50.665  34.772 1.00 50.27  ? 165 THR B N     1 
ATOM   4088 C  CA    . THR B 1 165 ? 54.655  51.893  34.252 1.00 52.60  ? 165 THR B CA    1 
ATOM   4089 C  C     . THR B 1 165 ? 55.188  52.572  35.494 1.00 54.68  ? 165 THR B C     1 
ATOM   4090 O  O     . THR B 1 165 ? 55.273  51.976  36.574 1.00 54.67  ? 165 THR B O     1 
ATOM   4091 C  CB    . THR B 1 165 ? 53.586  52.806  33.654 1.00 52.72  ? 165 THR B CB    1 
ATOM   4092 O  OG1   . THR B 1 165 ? 52.675  53.218  34.686 1.00 51.92  ? 165 THR B OG1   1 
ATOM   4093 C  CG2   . THR B 1 165 ? 52.850  52.091  32.533 1.00 52.67  ? 165 THR B CG2   1 
ATOM   4094 N  N     . ASP B 1 166 ? 55.528  53.834  35.313 1.00 55.93  ? 166 ASP B N     1 
ATOM   4095 C  CA    . ASP B 1 166 ? 56.046  54.698  36.351 1.00 57.02  ? 166 ASP B CA    1 
ATOM   4096 C  C     . ASP B 1 166 ? 55.013  54.858  37.453 1.00 55.73  ? 166 ASP B C     1 
ATOM   4097 O  O     . ASP B 1 166 ? 55.340  54.939  38.637 1.00 56.88  ? 166 ASP B O     1 
ATOM   4098 C  CB    . ASP B 1 166 ? 56.309  56.065  35.718 1.00 61.33  ? 166 ASP B CB    1 
ATOM   4099 C  CG    . ASP B 1 166 ? 56.913  57.041  36.680 1.00 64.73  ? 166 ASP B CG    1 
ATOM   4100 O  OD1   . ASP B 1 166 ? 56.925  58.257  36.368 1.00 67.17  ? 166 ASP B OD1   1 
ATOM   4101 O  OD2   . ASP B 1 166 ? 57.383  56.582  37.742 1.00 67.65  ? 166 ASP B OD2   1 
ATOM   4102 N  N     . ASN B 1 167 ? 53.757  54.889  37.033 1.00 52.58  ? 167 ASN B N     1 
ATOM   4103 C  CA    . ASN B 1 167 ? 52.632  55.121  37.917 1.00 50.95  ? 167 ASN B CA    1 
ATOM   4104 C  C     . ASN B 1 167 ? 51.517  54.113  37.640 1.00 49.29  ? 167 ASN B C     1 
ATOM   4105 O  O     . ASN B 1 167 ? 50.595  54.420  36.889 1.00 47.77  ? 167 ASN B O     1 
ATOM   4106 C  CB    . ASN B 1 167 ? 52.134  56.537  37.631 1.00 52.14  ? 167 ASN B CB    1 
ATOM   4107 C  CG    . ASN B 1 167 ? 51.165  57.033  38.647 1.00 52.67  ? 167 ASN B CG    1 
ATOM   4108 O  OD1   . ASN B 1 167 ? 50.484  58.034  38.427 1.00 55.76  ? 167 ASN B OD1   1 
ATOM   4109 N  ND2   . ASN B 1 167 ? 51.099  56.355  39.780 1.00 56.00  ? 167 ASN B ND2   1 
ATOM   4110 N  N     . ALA B 1 168 ? 51.568  52.935  38.260 1.00 47.07  ? 168 ALA B N     1 
ATOM   4111 C  CA    . ALA B 1 168 ? 50.548  51.928  37.982 1.00 44.94  ? 168 ALA B CA    1 
ATOM   4112 C  C     . ALA B 1 168 ? 49.984  51.093  39.158 1.00 43.75  ? 168 ALA B C     1 
ATOM   4113 O  O     . ALA B 1 168 ? 50.631  50.928  40.185 1.00 43.77  ? 168 ALA B O     1 
ATOM   4114 C  CB    . ALA B 1 168 ? 51.087  50.993  36.890 1.00 43.88  ? 168 ALA B CB    1 
ATOM   4115 N  N     . ILE B 1 169 ? 48.769  50.569  38.967 1.00 44.16  ? 169 ILE B N     1 
ATOM   4116 C  CA    . ILE B 1 169 ? 48.047  49.717  39.935 1.00 41.08  ? 169 ILE B CA    1 
ATOM   4117 C  C     . ILE B 1 169 ? 47.881  48.330  39.293 1.00 39.81  ? 169 ILE B C     1 
ATOM   4118 O  O     . ILE B 1 169 ? 47.700  48.234  38.087 1.00 38.51  ? 169 ILE B O     1 
ATOM   4119 C  CB    . ILE B 1 169 ? 46.573  50.168  40.168 1.00 42.96  ? 169 ILE B CB    1 
ATOM   4120 C  CG1   . ILE B 1 169 ? 46.475  51.590  40.698 1.00 45.56  ? 169 ILE B CG1   1 
ATOM   4121 C  CG2   . ILE B 1 169 ? 45.893  49.192  41.105 1.00 43.14  ? 169 ILE B CG2   1 
ATOM   4122 C  CD1   . ILE B 1 169 ? 47.179  51.808  42.000 1.00 48.40  ? 169 ILE B CD1   1 
ATOM   4123 N  N     . LEU B 1 170 ? 47.920  47.263  40.084 1.00 36.86  ? 170 LEU B N     1 
ATOM   4124 C  CA    . LEU B 1 170 ? 47.680  45.939  39.534 1.00 36.64  ? 170 LEU B CA    1 
ATOM   4125 C  C     . LEU B 1 170 ? 46.422  45.394  40.250 1.00 36.47  ? 170 LEU B C     1 
ATOM   4126 O  O     . LEU B 1 170 ? 46.352  45.422  41.478 1.00 37.54  ? 170 LEU B O     1 
ATOM   4127 C  CB    . LEU B 1 170 ? 48.874  45.021  39.775 1.00 35.76  ? 170 LEU B CB    1 
ATOM   4128 C  CG    . LEU B 1 170 ? 48.668  43.624  39.179 1.00 35.08  ? 170 LEU B CG    1 
ATOM   4129 C  CD1   . LEU B 1 170 ? 48.577  43.742  37.681 1.00 36.70  ? 170 LEU B CD1   1 
ATOM   4130 C  CD2   . LEU B 1 170 ? 49.788  42.692  39.561 1.00 33.68  ? 170 LEU B CD2   1 
ATOM   4131 N  N     . MET B 1 171 ? 45.427  44.939  39.484 1.00 34.92  ? 171 MET B N     1 
ATOM   4132 C  CA    . MET B 1 171 ? 44.153  44.419  40.034 1.00 33.86  ? 171 MET B CA    1 
ATOM   4133 C  C     . MET B 1 171 ? 43.992  42.956  39.645 1.00 33.65  ? 171 MET B C     1 
ATOM   4134 O  O     . MET B 1 171 ? 44.074  42.613  38.471 1.00 36.88  ? 171 MET B O     1 
ATOM   4135 C  CB    . MET B 1 171 ? 42.935  45.244  39.514 1.00 28.55  ? 171 MET B CB    1 
ATOM   4136 C  CG    . MET B 1 171 ? 41.518  44.792  40.062 1.00 25.32  ? 171 MET B CG    1 
ATOM   4137 S  SD    . MET B 1 171 ? 40.184  46.062  40.010 1.00 16.45  ? 171 MET B SD    1 
ATOM   4138 C  CE    . MET B 1 171 ? 40.394  46.626  38.401 1.00 26.32  ? 171 MET B CE    1 
ATOM   4139 N  N     . LEU B 1 172 ? 43.784  42.089  40.623 1.00 32.24  ? 172 LEU B N     1 
ATOM   4140 C  CA    . LEU B 1 172 ? 43.604  40.673  40.339 1.00 29.89  ? 172 LEU B CA    1 
ATOM   4141 C  C     . LEU B 1 172 ? 42.582  40.084  41.291 1.00 32.36  ? 172 LEU B C     1 
ATOM   4142 O  O     . LEU B 1 172 ? 42.379  40.602  42.400 1.00 31.61  ? 172 LEU B O     1 
ATOM   4143 C  CB    . LEU B 1 172 ? 44.914  39.917  40.533 1.00 31.05  ? 172 LEU B CB    1 
ATOM   4144 C  CG    . LEU B 1 172 ? 46.115  40.447  39.752 1.00 32.40  ? 172 LEU B CG    1 
ATOM   4145 C  CD1   . LEU B 1 172 ? 47.402  39.819  40.287 1.00 34.32  ? 172 LEU B CD1   1 
ATOM   4146 C  CD2   . LEU B 1 172 ? 45.899  40.146  38.283 1.00 33.83  ? 172 LEU B CD2   1 
ATOM   4147 N  N     . HIS B 1 173 ? 41.944  38.999  40.863 1.00 30.50  ? 173 HIS B N     1 
ATOM   4148 C  CA    . HIS B 1 173 ? 40.972  38.294  41.692 1.00 30.75  ? 173 HIS B CA    1 
ATOM   4149 C  C     . HIS B 1 173 ? 41.541  36.881  41.876 1.00 30.69  ? 173 HIS B C     1 
ATOM   4150 O  O     . HIS B 1 173 ? 41.327  35.998  41.041 1.00 29.97  ? 173 HIS B O     1 
ATOM   4151 C  CB    . HIS B 1 173 ? 39.606  38.213  41.000 1.00 31.57  ? 173 HIS B CB    1 
ATOM   4152 C  CG    . HIS B 1 173 ? 38.511  37.736  41.904 1.00 31.71  ? 173 HIS B CG    1 
ATOM   4153 N  ND1   . HIS B 1 173 ? 37.750  38.593  42.674 1.00 31.20  ? 173 HIS B ND1   1 
ATOM   4154 C  CD2   . HIS B 1 173 ? 38.093  36.485  42.214 1.00 29.71  ? 173 HIS B CD2   1 
ATOM   4155 C  CE1   . HIS B 1 173 ? 36.914  37.890  43.416 1.00 30.05  ? 173 HIS B CE1   1 
ATOM   4156 N  NE2   . HIS B 1 173 ? 37.103  36.609  43.158 1.00 28.50  ? 173 HIS B NE2   1 
ATOM   4157 N  N     . GLN B 1 174 ? 42.286  36.680  42.954 1.00 29.83  ? 174 GLN B N     1 
ATOM   4158 C  CA    . GLN B 1 174 ? 42.908  35.386  43.209 1.00 31.92  ? 174 GLN B CA    1 
ATOM   4159 C  C     . GLN B 1 174 ? 43.215  35.306  44.685 1.00 33.75  ? 174 GLN B C     1 
ATOM   4160 O  O     . GLN B 1 174 ? 43.433  36.337  45.336 1.00 36.47  ? 174 GLN B O     1 
ATOM   4161 C  CB    . GLN B 1 174 ? 44.269  35.258  42.482 1.00 30.10  ? 174 GLN B CB    1 
ATOM   4162 C  CG    . GLN B 1 174 ? 44.323  35.720  41.030 1.00 28.51  ? 174 GLN B CG    1 
ATOM   4163 C  CD    . GLN B 1 174 ? 43.719  34.706  40.058 1.00 29.62  ? 174 GLN B CD    1 
ATOM   4164 O  OE1   . GLN B 1 174 ? 43.596  34.977  38.868 1.00 30.15  ? 174 GLN B OE1   1 
ATOM   4165 N  NE2   . GLN B 1 174 ? 43.366  33.539  40.562 1.00 24.32  ? 174 GLN B NE2   1 
ATOM   4166 N  N     . GLY B 1 175 ? 43.237  34.093  45.213 1.00 32.98  ? 175 GLY B N     1 
ATOM   4167 C  CA    . GLY B 1 175 ? 43.625  33.913  46.601 1.00 34.11  ? 175 GLY B CA    1 
ATOM   4168 C  C     . GLY B 1 175 ? 45.166  33.831  46.596 1.00 36.93  ? 175 GLY B C     1 
ATOM   4169 O  O     . GLY B 1 175 ? 45.773  33.180  45.726 1.00 34.56  ? 175 GLY B O     1 
ATOM   4170 N  N     . VAL B 1 176 ? 45.801  34.506  47.551 1.00 36.71  ? 176 VAL B N     1 
ATOM   4171 C  CA    . VAL B 1 176 ? 47.251  34.526  47.672 1.00 36.42  ? 176 VAL B CA    1 
ATOM   4172 C  C     . VAL B 1 176 ? 47.664  33.583  48.806 1.00 37.64  ? 176 VAL B C     1 
ATOM   4173 O  O     . VAL B 1 176 ? 47.092  33.633  49.898 1.00 36.87  ? 176 VAL B O     1 
ATOM   4174 C  CB    . VAL B 1 176 ? 47.732  35.975  47.966 1.00 38.40  ? 176 VAL B CB    1 
ATOM   4175 C  CG1   . VAL B 1 176 ? 49.171  35.982  48.441 1.00 36.69  ? 176 VAL B CG1   1 
ATOM   4176 C  CG2   . VAL B 1 176 ? 47.559  36.835  46.724 1.00 34.03  ? 176 VAL B CG2   1 
ATOM   4177 N  N     . ARG B 1 177 ? 48.661  32.732  48.543 1.00 39.15  ? 177 ARG B N     1 
ATOM   4178 C  CA    . ARG B 1 177 ? 49.148  31.729  49.514 1.00 40.72  ? 177 ARG B CA    1 
ATOM   4179 C  C     . ARG B 1 177 ? 49.376  32.237  50.938 1.00 41.07  ? 177 ARG B C     1 
ATOM   4180 O  O     . ARG B 1 177 ? 48.813  31.700  51.892 1.00 41.94  ? 177 ARG B O     1 
ATOM   4181 C  CB    . ARG B 1 177 ? 50.453  31.093  49.003 1.00 42.30  ? 177 ARG B CB    1 
ATOM   4182 C  CG    . ARG B 1 177 ? 50.968  29.889  49.844 1.00 44.17  ? 177 ARG B CG    1 
ATOM   4183 C  CD    . ARG B 1 177 ? 52.405  29.473  49.414 1.00 41.91  ? 177 ARG B CD    1 
ATOM   4184 N  NE    . ARG B 1 177 ? 52.933  28.353  50.187 0.00 43.07  ? 177 ARG B NE    1 
ATOM   4185 C  CZ    . ARG B 1 177 ? 52.577  27.085  50.009 0.00 43.10  ? 177 ARG B CZ    1 
ATOM   4186 N  NH1   . ARG B 1 177 ? 53.110  26.133  50.761 0.00 43.35  ? 177 ARG B NH1   1 
ATOM   4187 N  NH2   . ARG B 1 177 ? 51.694  26.767  49.073 0.00 43.35  ? 177 ARG B NH2   1 
ATOM   4188 N  N     . GLU B 1 178 ? 50.198  33.271  51.085 1.00 40.61  ? 178 GLU B N     1 
ATOM   4189 C  CA    . GLU B 1 178 ? 50.482  33.805  52.411 1.00 42.04  ? 178 GLU B CA    1 
ATOM   4190 C  C     . GLU B 1 178 ? 49.236  34.279  53.150 1.00 41.93  ? 178 GLU B C     1 
ATOM   4191 O  O     . GLU B 1 178 ? 49.150  34.167  54.373 1.00 39.83  ? 178 GLU B O     1 
ATOM   4192 C  CB    . GLU B 1 178 ? 51.491  34.947  52.308 1.00 43.10  ? 178 GLU B CB    1 
ATOM   4193 C  CG    . GLU B 1 178 ? 52.858  34.519  51.787 1.00 46.15  ? 178 GLU B CG    1 
ATOM   4194 C  CD    . GLU B 1 178 ? 52.910  34.339  50.272 1.00 47.66  ? 178 GLU B CD    1 
ATOM   4195 O  OE1   . GLU B 1 178 ? 51.888  34.561  49.584 1.00 49.08  ? 178 GLU B OE1   1 
ATOM   4196 O  OE2   . GLU B 1 178 ? 53.991  33.978  49.764 1.00 50.98  ? 178 GLU B OE2   1 
ATOM   4197 N  N     . VAL B 1 179 ? 48.266  34.802  52.404 1.00 43.50  ? 179 VAL B N     1 
ATOM   4198 C  CA    . VAL B 1 179 ? 47.024  35.287  53.008 1.00 45.44  ? 179 VAL B CA    1 
ATOM   4199 C  C     . VAL B 1 179 ? 46.114  34.129  53.427 1.00 47.09  ? 179 VAL B C     1 
ATOM   4200 O  O     . VAL B 1 179 ? 45.501  34.176  54.485 1.00 43.89  ? 179 VAL B O     1 
ATOM   4201 C  CB    . VAL B 1 179 ? 46.263  36.233  52.044 1.00 43.94  ? 179 VAL B CB    1 
ATOM   4202 C  CG1   . VAL B 1 179 ? 45.024  36.788  52.721 1.00 43.95  ? 179 VAL B CG1   1 
ATOM   4203 C  CG2   . VAL B 1 179 ? 47.178  37.375  51.626 1.00 43.37  ? 179 VAL B CG2   1 
ATOM   4204 N  N     . SER B 1 180 ? 46.029  33.088  52.604 1.00 50.27  ? 180 SER B N     1 
ATOM   4205 C  CA    . SER B 1 180 ? 45.192  31.941  52.957 1.00 54.59  ? 180 SER B CA    1 
ATOM   4206 C  C     . SER B 1 180 ? 45.816  31.188  54.128 1.00 56.47  ? 180 SER B C     1 
ATOM   4207 O  O     . SER B 1 180 ? 45.137  30.858  55.102 1.00 57.96  ? 180 SER B O     1 
ATOM   4208 C  CB    . SER B 1 180 ? 45.047  30.992  51.771 1.00 54.76  ? 180 SER B CB    1 
ATOM   4209 O  OG    . SER B 1 180 ? 44.572  31.689  50.634 1.00 58.62  ? 180 SER B OG    1 
ATOM   4210 N  N     . GLU B 1 181 ? 47.114  30.925  54.036 1.00 58.22  ? 181 GLU B N     1 
ATOM   4211 C  CA    . GLU B 1 181 ? 47.802  30.205  55.099 1.00 61.06  ? 181 GLU B CA    1 
ATOM   4212 C  C     . GLU B 1 181 ? 47.678  30.933  56.435 1.00 61.72  ? 181 GLU B C     1 
ATOM   4213 O  O     . GLU B 1 181 ? 47.382  30.310  57.459 1.00 62.10  ? 181 GLU B O     1 
ATOM   4214 C  CB    . GLU B 1 181 ? 49.285  29.986  54.736 1.00 61.96  ? 181 GLU B CB    1 
ATOM   4215 C  CG    . GLU B 1 181 ? 49.482  29.067  53.514 1.00 65.41  ? 181 GLU B CG    1 
ATOM   4216 C  CD    . GLU B 1 181 ? 50.942  28.680  53.249 1.00 67.93  ? 181 GLU B CD    1 
ATOM   4217 O  OE1   . GLU B 1 181 ? 51.182  27.855  52.340 1.00 69.64  ? 181 GLU B OE1   1 
ATOM   4218 O  OE2   . GLU B 1 181 ? 51.851  29.192  53.940 1.00 69.74  ? 181 GLU B OE2   1 
ATOM   4219 N  N     . ALA B 1 182 ? 47.891  32.249  56.421 1.00 61.36  ? 182 ALA B N     1 
ATOM   4220 C  CA    . ALA B 1 182 ? 47.803  33.048  57.640 1.00 61.37  ? 182 ALA B CA    1 
ATOM   4221 C  C     . ALA B 1 182 ? 46.526  32.727  58.393 1.00 60.93  ? 182 ALA B C     1 
ATOM   4222 O  O     . ALA B 1 182 ? 46.509  32.729  59.618 1.00 61.02  ? 182 ALA B O     1 
ATOM   4223 C  CB    . ALA B 1 182 ? 47.844  34.545  57.306 1.00 59.97  ? 182 ALA B CB    1 
ATOM   4224 N  N     . ARG B 1 183 ? 45.462  32.450  57.646 1.00 61.21  ? 183 ARG B N     1 
ATOM   4225 C  CA    . ARG B 1 183 ? 44.166  32.135  58.229 1.00 62.29  ? 183 ARG B CA    1 
ATOM   4226 C  C     . ARG B 1 183 ? 43.827  30.651  58.264 1.00 63.82  ? 183 ARG B C     1 
ATOM   4227 O  O     . ARG B 1 183 ? 42.663  30.276  58.425 1.00 64.34  ? 183 ARG B O     1 
ATOM   4228 C  CB    . ARG B 1 183 ? 43.074  32.892  57.484 1.00 61.65  ? 183 ARG B CB    1 
ATOM   4229 C  CG    . ARG B 1 183 ? 43.009  34.329  57.911 1.00 61.13  ? 183 ARG B CG    1 
ATOM   4230 C  CD    . ARG B 1 183 ? 42.193  35.155  56.983 1.00 59.19  ? 183 ARG B CD    1 
ATOM   4231 N  NE    . ARG B 1 183 ? 42.072  36.511  57.494 1.00 55.98  ? 183 ARG B NE    1 
ATOM   4232 C  CZ    . ARG B 1 183 ? 41.652  37.538  56.765 1.00 54.56  ? 183 ARG B CZ    1 
ATOM   4233 N  NH1   . ARG B 1 183 ? 41.563  38.750  57.305 1.00 52.16  ? 183 ARG B NH1   1 
ATOM   4234 N  NH2   . ARG B 1 183 ? 41.333  37.345  55.490 1.00 51.38  ? 183 ARG B NH2   1 
ATOM   4235 N  N     . GLY B 1 184 ? 44.850  29.814  58.113 1.00 65.05  ? 184 GLY B N     1 
ATOM   4236 C  CA    . GLY B 1 184 ? 44.653  28.379  58.154 1.00 65.67  ? 184 GLY B CA    1 
ATOM   4237 C  C     . GLY B 1 184 ? 43.860  27.792  57.004 1.00 66.57  ? 184 GLY B C     1 
ATOM   4238 O  O     . GLY B 1 184 ? 43.464  26.628  57.059 1.00 67.50  ? 184 GLY B O     1 
ATOM   4239 N  N     . GLU B 1 185 ? 43.614  28.576  55.963 1.00 67.22  ? 185 GLU B N     1 
ATOM   4240 C  CA    . GLU B 1 185 ? 42.874  28.061  54.823 1.00 68.24  ? 185 GLU B CA    1 
ATOM   4241 C  C     . GLU B 1 185 ? 43.867  27.532  53.797 1.00 68.66  ? 185 GLU B C     1 
ATOM   4242 O  O     . GLU B 1 185 ? 45.051  27.868  53.852 1.00 68.22  ? 185 GLU B O     1 
ATOM   4243 C  CB    . GLU B 1 185 ? 42.015  29.161  54.221 1.00 69.00  ? 185 GLU B CB    1 
ATOM   4244 C  CG    . GLU B 1 185 ? 40.960  29.663  55.171 1.00 72.23  ? 185 GLU B CG    1 
ATOM   4245 C  CD    . GLU B 1 185 ? 40.161  30.805  54.580 1.00 75.33  ? 185 GLU B CD    1 
ATOM   4246 O  OE1   . GLU B 1 185 ? 40.777  31.852  54.240 1.00 76.56  ? 185 GLU B OE1   1 
ATOM   4247 O  OE2   . GLU B 1 185 ? 38.921  30.658  54.453 1.00 77.31  ? 185 GLU B OE2   1 
ATOM   4248 N  N     . ASP B 1 186 ? 43.400  26.696  52.872 1.00 69.25  ? 186 ASP B N     1 
ATOM   4249 C  CA    . ASP B 1 186 ? 44.301  26.145  51.857 1.00 70.71  ? 186 ASP B CA    1 
ATOM   4250 C  C     . ASP B 1 186 ? 43.844  26.394  50.424 1.00 69.67  ? 186 ASP B C     1 
ATOM   4251 O  O     . ASP B 1 186 ? 44.019  25.547  49.553 1.00 70.59  ? 186 ASP B O     1 
ATOM   4252 C  CB    . ASP B 1 186 ? 44.503  24.636  52.066 1.00 72.69  ? 186 ASP B CB    1 
ATOM   4253 C  CG    . ASP B 1 186 ? 43.196  23.854  52.041 1.00 74.82  ? 186 ASP B CG    1 
ATOM   4254 O  OD1   . ASP B 1 186 ? 42.507  23.791  53.087 1.00 76.76  ? 186 ASP B OD1   1 
ATOM   4255 O  OD2   . ASP B 1 186 ? 42.854  23.303  50.970 1.00 76.04  ? 186 ASP B OD2   1 
ATOM   4256 N  N     . TYR B 1 187 ? 43.284  27.569  50.173 1.00 68.15  ? 187 TYR B N     1 
ATOM   4257 C  CA    . TYR B 1 187 ? 42.808  27.888  48.840 1.00 65.93  ? 187 TYR B CA    1 
ATOM   4258 C  C     . TYR B 1 187 ? 43.546  29.081  48.248 1.00 62.60  ? 187 TYR B C     1 
ATOM   4259 O  O     . TYR B 1 187 ? 43.367  30.210  48.720 1.00 62.38  ? 187 TYR B O     1 
ATOM   4260 C  CB    . TYR B 1 187 ? 41.313  28.203  48.891 1.00 70.22  ? 187 TYR B CB    1 
ATOM   4261 C  CG    . TYR B 1 187 ? 40.458  27.065  49.417 1.00 75.01  ? 187 TYR B CG    1 
ATOM   4262 C  CD1   . TYR B 1 187 ? 40.423  25.824  48.758 1.00 76.37  ? 187 TYR B CD1   1 
ATOM   4263 C  CD2   . TYR B 1 187 ? 39.678  27.226  50.575 1.00 76.44  ? 187 TYR B CD2   1 
ATOM   4264 C  CE1   . TYR B 1 187 ? 39.632  24.765  49.238 1.00 77.83  ? 187 TYR B CE1   1 
ATOM   4265 C  CE2   . TYR B 1 187 ? 38.877  26.173  51.067 1.00 78.16  ? 187 TYR B CE2   1 
ATOM   4266 C  CZ    . TYR B 1 187 ? 38.857  24.950  50.389 1.00 78.71  ? 187 TYR B CZ    1 
ATOM   4267 O  OH    . TYR B 1 187 ? 38.023  23.934  50.821 1.00 80.14  ? 187 TYR B OH    1 
ATOM   4268 N  N     . PHE B 1 188 ? 44.351  28.841  47.212 1.00 55.52  ? 188 PHE B N     1 
ATOM   4269 C  CA    . PHE B 1 188 ? 45.079  29.927  46.565 1.00 51.45  ? 188 PHE B CA    1 
ATOM   4270 C  C     . PHE B 1 188 ? 45.572  29.494  45.194 1.00 48.40  ? 188 PHE B C     1 
ATOM   4271 O  O     . PHE B 1 188 ? 45.698  28.307  44.928 1.00 47.35  ? 188 PHE B O     1 
ATOM   4272 C  CB    . PHE B 1 188 ? 46.259  30.360  47.442 1.00 51.40  ? 188 PHE B CB    1 
ATOM   4273 C  CG    . PHE B 1 188 ? 47.205  29.243  47.768 1.00 51.47  ? 188 PHE B CG    1 
ATOM   4274 C  CD1   . PHE B 1 188 ? 48.224  28.894  46.885 1.00 50.81  ? 188 PHE B CD1   1 
ATOM   4275 C  CD2   . PHE B 1 188 ? 47.038  28.496  48.932 1.00 51.30  ? 188 PHE B CD2   1 
ATOM   4276 C  CE1   . PHE B 1 188 ? 49.062  27.813  47.155 1.00 51.52  ? 188 PHE B CE1   1 
ATOM   4277 C  CE2   . PHE B 1 188 ? 47.873  27.413  49.212 1.00 49.54  ? 188 PHE B CE2   1 
ATOM   4278 C  CZ    . PHE B 1 188 ? 48.882  27.071  48.324 1.00 49.05  ? 188 PHE B CZ    1 
ATOM   4279 N  N     . GLU B 1 189 ? 45.839  30.456  44.323 1.00 45.18  ? 189 GLU B N     1 
ATOM   4280 C  CA    . GLU B 1 189 ? 46.324  30.139  42.991 1.00 43.68  ? 189 GLU B CA    1 
ATOM   4281 C  C     . GLU B 1 189 ? 47.711  30.714  42.742 1.00 44.30  ? 189 GLU B C     1 
ATOM   4282 O  O     . GLU B 1 189 ? 48.367  30.353  41.765 1.00 46.08  ? 189 GLU B O     1 
ATOM   4283 C  CB    . GLU B 1 189 ? 45.365  30.664  41.913 1.00 41.82  ? 189 GLU B CB    1 
ATOM   4284 C  CG    . GLU B 1 189 ? 43.911  30.240  42.093 1.00 40.88  ? 189 GLU B CG    1 
ATOM   4285 C  CD    . GLU B 1 189 ? 43.170  31.135  43.090 1.00 42.85  ? 189 GLU B CD    1 
ATOM   4286 O  OE1   . GLU B 1 189 ? 43.234  32.371  42.900 1.00 40.00  ? 189 GLU B OE1   1 
ATOM   4287 O  OE2   . GLU B 1 189 ? 42.531  30.605  44.041 1.00 40.26  ? 189 GLU B OE2   1 
ATOM   4288 N  N     . ILE B 1 190 ? 48.161  31.619  43.608 1.00 43.11  ? 190 ILE B N     1 
ATOM   4289 C  CA    . ILE B 1 190 ? 49.486  32.218  43.445 1.00 41.00  ? 190 ILE B CA    1 
ATOM   4290 C  C     . ILE B 1 190 ? 50.019  32.598  44.805 1.00 41.53  ? 190 ILE B C     1 
ATOM   4291 O  O     . ILE B 1 190 ? 49.323  32.472  45.806 1.00 42.16  ? 190 ILE B O     1 
ATOM   4292 C  CB    . ILE B 1 190 ? 49.444  33.499  42.610 1.00 40.75  ? 190 ILE B CB    1 
ATOM   4293 C  CG1   . ILE B 1 190 ? 48.626  34.567  43.356 1.00 39.30  ? 190 ILE B CG1   1 
ATOM   4294 C  CG2   . ILE B 1 190 ? 48.857  33.218  41.244 1.00 37.98  ? 190 ILE B CG2   1 
ATOM   4295 C  CD1   . ILE B 1 190 ? 48.523  35.872  42.614 1.00 38.98  ? 190 ILE B CD1   1 
ATOM   4296 N  N     . GLY B 1 191 ? 51.268  33.051  44.837 1.00 40.71  ? 191 GLY B N     1 
ATOM   4297 C  CA    . GLY B 1 191 ? 51.860  33.484  46.082 1.00 39.11  ? 191 GLY B CA    1 
ATOM   4298 C  C     . GLY B 1 191 ? 52.281  34.914  45.827 1.00 40.35  ? 191 GLY B C     1 
ATOM   4299 O  O     . GLY B 1 191 ? 52.363  35.325  44.662 1.00 40.60  ? 191 GLY B O     1 
ATOM   4300 N  N     . LEU B 1 192 ? 52.534  35.672  46.890 1.00 40.10  ? 192 LEU B N     1 
ATOM   4301 C  CA    . LEU B 1 192 ? 52.956  37.058  46.749 1.00 40.62  ? 192 LEU B CA    1 
ATOM   4302 C  C     . LEU B 1 192 ? 54.125  37.148  45.791 1.00 41.38  ? 192 LEU B C     1 
ATOM   4303 O  O     . LEU B 1 192 ? 54.206  38.064  44.968 1.00 41.52  ? 192 LEU B O     1 
ATOM   4304 C  CB    . LEU B 1 192 ? 53.365  37.628  48.107 1.00 40.69  ? 192 LEU B CB    1 
ATOM   4305 C  CG    . LEU B 1 192 ? 52.224  38.010  49.033 1.00 41.17  ? 192 LEU B CG    1 
ATOM   4306 C  CD1   . LEU B 1 192 ? 52.800  38.401  50.389 1.00 40.87  ? 192 LEU B CD1   1 
ATOM   4307 C  CD2   . LEU B 1 192 ? 51.413  39.181  48.404 1.00 38.36  ? 192 LEU B CD2   1 
ATOM   4308 N  N     . GLY B 1 193 ? 55.031  36.182  45.897 1.00 42.60  ? 193 GLY B N     1 
ATOM   4309 C  CA    . GLY B 1 193 ? 56.192  36.159  45.027 1.00 42.71  ? 193 GLY B CA    1 
ATOM   4310 C  C     . GLY B 1 193 ? 55.851  36.165  43.545 1.00 42.48  ? 193 GLY B C     1 
ATOM   4311 O  O     . GLY B 1 193 ? 56.642  36.635  42.713 1.00 41.32  ? 193 GLY B O     1 
ATOM   4312 N  N     . ASP B 1 194 ? 54.670  35.663  43.195 1.00 42.22  ? 194 ASP B N     1 
ATOM   4313 C  CA    . ASP B 1 194 ? 54.290  35.633  41.784 1.00 41.37  ? 194 ASP B CA    1 
ATOM   4314 C  C     . ASP B 1 194 ? 53.945  37.023  41.260 1.00 40.75  ? 194 ASP B C     1 
ATOM   4315 O  O     . ASP B 1 194 ? 54.042  37.289  40.063 1.00 42.68  ? 194 ASP B O     1 
ATOM   4316 C  CB    . ASP B 1 194 ? 53.112  34.673  41.570 1.00 42.48  ? 194 ASP B CB    1 
ATOM   4317 C  CG    . ASP B 1 194 ? 53.435  33.255  42.002 1.00 43.25  ? 194 ASP B CG    1 
ATOM   4318 O  OD1   . ASP B 1 194 ? 54.479  32.727  41.574 1.00 46.04  ? 194 ASP B OD1   1 
ATOM   4319 O  OD2   . ASP B 1 194 ? 52.650  32.655  42.769 1.00 47.54  ? 194 ASP B OD2   1 
ATOM   4320 N  N     . LEU B 1 195 ? 53.564  37.925  42.148 1.00 39.79  ? 195 LEU B N     1 
ATOM   4321 C  CA    . LEU B 1 195 ? 53.205  39.266  41.714 1.00 40.99  ? 195 LEU B CA    1 
ATOM   4322 C  C     . LEU B 1 195 ? 54.376  40.055  41.117 1.00 42.96  ? 195 LEU B C     1 
ATOM   4323 O  O     . LEU B 1 195 ? 55.505  39.971  41.599 1.00 46.56  ? 195 LEU B O     1 
ATOM   4324 C  CB    . LEU B 1 195 ? 52.623  40.060  42.893 1.00 39.52  ? 195 LEU B CB    1 
ATOM   4325 C  CG    . LEU B 1 195 ? 51.315  39.587  43.567 1.00 39.81  ? 195 LEU B CG    1 
ATOM   4326 C  CD1   . LEU B 1 195 ? 51.101  40.399  44.848 1.00 38.48  ? 195 LEU B CD1   1 
ATOM   4327 C  CD2   . LEU B 1 195 ? 50.112  39.740  42.625 1.00 34.83  ? 195 LEU B CD2   1 
ATOM   4328 N  N     . PRO B 1 196 ? 54.130  40.823  40.045 1.00 43.35  ? 196 PRO B N     1 
ATOM   4329 C  CA    . PRO B 1 196 ? 55.251  41.587  39.498 1.00 43.63  ? 196 PRO B CA    1 
ATOM   4330 C  C     . PRO B 1 196 ? 55.553  42.758  40.454 1.00 45.31  ? 196 PRO B C     1 
ATOM   4331 O  O     . PRO B 1 196 ? 54.632  43.372  41.020 1.00 44.33  ? 196 PRO B O     1 
ATOM   4332 C  CB    . PRO B 1 196 ? 54.723  42.045  38.137 1.00 43.92  ? 196 PRO B CB    1 
ATOM   4333 C  CG    . PRO B 1 196 ? 53.251  42.144  38.350 1.00 43.09  ? 196 PRO B CG    1 
ATOM   4334 C  CD    . PRO B 1 196 ? 52.954  40.911  39.163 1.00 42.13  ? 196 PRO B CD    1 
ATOM   4335 N  N     . GLU B 1 197 ? 56.835  43.052  40.648 1.00 44.01  ? 197 GLU B N     1 
ATOM   4336 C  CA    . GLU B 1 197 ? 57.242  44.128  41.538 1.00 43.62  ? 197 GLU B CA    1 
ATOM   4337 C  C     . GLU B 1 197 ? 57.169  45.442  40.812 1.00 42.51  ? 197 GLU B C     1 
ATOM   4338 O  O     . GLU B 1 197 ? 57.258  45.469  39.587 1.00 43.98  ? 197 GLU B O     1 
ATOM   4339 C  CB    . GLU B 1 197 ? 58.672  43.900  42.015 1.00 47.06  ? 197 GLU B CB    1 
ATOM   4340 C  CG    . GLU B 1 197 ? 58.900  42.520  42.610 1.00 52.05  ? 197 GLU B CG    1 
ATOM   4341 C  CD    . GLU B 1 197 ? 60.231  42.406  43.335 1.00 56.15  ? 197 GLU B CD    1 
ATOM   4342 O  OE1   . GLU B 1 197 ? 60.725  41.269  43.481 1.00 58.47  ? 197 GLU B OE1   1 
ATOM   4343 O  OE2   . GLU B 1 197 ? 60.775  43.448  43.772 1.00 57.89  ? 197 GLU B OE2   1 
ATOM   4344 N  N     . GLY B 1 198 ? 56.996  46.543  41.543 1.00 41.18  ? 198 GLY B N     1 
ATOM   4345 C  CA    . GLY B 1 198 ? 56.938  47.833  40.870 1.00 38.77  ? 198 GLY B CA    1 
ATOM   4346 C  C     . GLY B 1 198 ? 55.600  48.544  40.793 1.00 40.43  ? 198 GLY B C     1 
ATOM   4347 O  O     . GLY B 1 198 ? 55.551  49.738  40.443 1.00 41.52  ? 198 GLY B O     1 
ATOM   4348 N  N     . TYR B 1 199 ? 54.496  47.852  41.081 1.00 38.54  ? 199 TYR B N     1 
ATOM   4349 C  CA    . TYR B 1 199 ? 53.217  48.556  41.052 1.00 36.91  ? 199 TYR B CA    1 
ATOM   4350 C  C     . TYR B 1 199 ? 53.078  49.347  42.352 1.00 35.95  ? 199 TYR B C     1 
ATOM   4351 O  O     . TYR B 1 199 ? 53.634  48.953  43.370 1.00 37.00  ? 199 TYR B O     1 
ATOM   4352 C  CB    . TYR B 1 199 ? 52.045  47.578  40.870 1.00 36.88  ? 199 TYR B CB    1 
ATOM   4353 C  CG    . TYR B 1 199 ? 51.948  47.058  39.444 1.00 34.56  ? 199 TYR B CG    1 
ATOM   4354 C  CD1   . TYR B 1 199 ? 52.648  45.920  39.054 1.00 33.81  ? 199 TYR B CD1   1 
ATOM   4355 C  CD2   . TYR B 1 199 ? 51.182  47.725  38.490 1.00 33.65  ? 199 TYR B CD2   1 
ATOM   4356 C  CE1   . TYR B 1 199 ? 52.592  45.453  37.768 1.00 35.50  ? 199 TYR B CE1   1 
ATOM   4357 C  CE2   . TYR B 1 199 ? 51.120  47.268  37.192 1.00 35.80  ? 199 TYR B CE2   1 
ATOM   4358 C  CZ    . TYR B 1 199 ? 51.835  46.118  36.834 1.00 38.14  ? 199 TYR B CZ    1 
ATOM   4359 O  OH    . TYR B 1 199 ? 51.805  45.630  35.543 1.00 38.23  ? 199 TYR B OH    1 
ATOM   4360 N  N     . LEU B 1 200 ? 52.365  50.467  42.306 1.00 35.65  ? 200 LEU B N     1 
ATOM   4361 C  CA    . LEU B 1 200 ? 52.169  51.317  43.476 1.00 35.64  ? 200 LEU B CA    1 
ATOM   4362 C  C     . LEU B 1 200 ? 51.069  50.844  44.426 1.00 37.17  ? 200 LEU B C     1 
ATOM   4363 O  O     . LEU B 1 200 ? 50.952  51.356  45.543 1.00 34.97  ? 200 LEU B O     1 
ATOM   4364 C  CB    . LEU B 1 200 ? 51.864  52.754  43.032 1.00 38.13  ? 200 LEU B CB    1 
ATOM   4365 C  CG    . LEU B 1 200 ? 53.011  53.382  42.209 1.00 40.15  ? 200 LEU B CG    1 
ATOM   4366 C  CD1   . LEU B 1 200 ? 52.671  54.814  41.777 1.00 39.44  ? 200 LEU B CD1   1 
ATOM   4367 C  CD2   . LEU B 1 200 ? 54.283  53.352  43.050 1.00 39.90  ? 200 LEU B CD2   1 
ATOM   4368 N  N     . TYR B 1 201 ? 50.259  49.878  43.987 1.00 34.74  ? 201 TYR B N     1 
ATOM   4369 C  CA    . TYR B 1 201 ? 49.174  49.367  44.824 1.00 34.59  ? 201 TYR B CA    1 
ATOM   4370 C  C     . TYR B 1 201 ? 48.685  48.067  44.209 1.00 32.32  ? 201 TYR B C     1 
ATOM   4371 O  O     . TYR B 1 201 ? 48.567  47.972  43.001 1.00 33.12  ? 201 TYR B O     1 
ATOM   4372 C  CB    . TYR B 1 201 ? 48.018  50.377  44.862 1.00 31.74  ? 201 TYR B CB    1 
ATOM   4373 C  CG    . TYR B 1 201 ? 46.884  50.017  45.802 1.00 30.91  ? 201 TYR B CG    1 
ATOM   4374 C  CD1   . TYR B 1 201 ? 46.919  50.404  47.125 1.00 30.72  ? 201 TYR B CD1   1 
ATOM   4375 C  CD2   . TYR B 1 201 ? 45.742  49.339  45.344 1.00 31.56  ? 201 TYR B CD2   1 
ATOM   4376 C  CE1   . TYR B 1 201 ? 45.849  50.141  47.994 1.00 31.01  ? 201 TYR B CE1   1 
ATOM   4377 C  CE2   . TYR B 1 201 ? 44.660  49.079  46.196 1.00 31.47  ? 201 TYR B CE2   1 
ATOM   4378 C  CZ    . TYR B 1 201 ? 44.721  49.488  47.534 1.00 32.97  ? 201 TYR B CZ    1 
ATOM   4379 O  OH    . TYR B 1 201 ? 43.661  49.277  48.413 1.00 30.20  ? 201 TYR B OH    1 
ATOM   4380 N  N     . TYR B 1 202 ? 48.432  47.063  45.024 1.00 30.90  ? 202 TYR B N     1 
ATOM   4381 C  CA    . TYR B 1 202 ? 47.937  45.792  44.499 1.00 29.35  ? 202 TYR B CA    1 
ATOM   4382 C  C     . TYR B 1 202 ? 46.508  45.657  44.993 1.00 30.10  ? 202 TYR B C     1 
ATOM   4383 O  O     . TYR B 1 202 ? 46.257  45.290  46.157 1.00 30.60  ? 202 TYR B O     1 
ATOM   4384 C  CB    . TYR B 1 202 ? 48.813  44.620  44.978 1.00 29.65  ? 202 TYR B CB    1 
ATOM   4385 C  CG    . TYR B 1 202 ? 50.234  44.706  44.455 1.00 30.96  ? 202 TYR B CG    1 
ATOM   4386 C  CD1   . TYR B 1 202 ? 51.192  45.489  45.099 1.00 29.79  ? 202 TYR B CD1   1 
ATOM   4387 C  CD2   . TYR B 1 202 ? 50.601  44.058  43.278 1.00 31.14  ? 202 TYR B CD2   1 
ATOM   4388 C  CE1   . TYR B 1 202 ? 52.456  45.626  44.587 1.00 31.28  ? 202 TYR B CE1   1 
ATOM   4389 C  CE2   . TYR B 1 202 ? 51.865  44.187  42.752 1.00 30.67  ? 202 TYR B CE2   1 
ATOM   4390 C  CZ    . TYR B 1 202 ? 52.800  44.981  43.407 1.00 33.40  ? 202 TYR B CZ    1 
ATOM   4391 O  OH    . TYR B 1 202 ? 54.064  45.160  42.860 1.00 31.94  ? 202 TYR B OH    1 
ATOM   4392 N  N     . ALA B 1 203 ? 45.579  46.019  44.112 1.00 28.92  ? 203 ALA B N     1 
ATOM   4393 C  CA    . ALA B 1 203 ? 44.152  45.980  44.411 1.00 28.68  ? 203 ALA B CA    1 
ATOM   4394 C  C     . ALA B 1 203 ? 43.621  44.566  44.136 1.00 28.96  ? 203 ALA B C     1 
ATOM   4395 O  O     . ALA B 1 203 ? 43.372  44.190  42.986 1.00 29.87  ? 203 ALA B O     1 
ATOM   4396 C  CB    . ALA B 1 203 ? 43.406  47.035  43.540 1.00 26.93  ? 203 ALA B CB    1 
ATOM   4397 N  N     . LEU B 1 204 ? 43.460  43.785  45.192 1.00 27.80  ? 204 LEU B N     1 
ATOM   4398 C  CA    . LEU B 1 204 ? 42.986  42.424  45.047 1.00 27.52  ? 204 LEU B CA    1 
ATOM   4399 C  C     . LEU B 1 204 ? 41.520  42.241  45.414 1.00 29.94  ? 204 LEU B C     1 
ATOM   4400 O  O     . LEU B 1 204 ? 40.853  43.167  45.921 1.00 30.31  ? 204 LEU B O     1 
ATOM   4401 C  CB    . LEU B 1 204 ? 43.825  41.476  45.914 1.00 27.03  ? 204 LEU B CB    1 
ATOM   4402 C  CG    . LEU B 1 204 ? 45.350  41.424  45.717 1.00 27.98  ? 204 LEU B CG    1 
ATOM   4403 C  CD1   . LEU B 1 204 ? 45.939  40.280  46.585 1.00 27.69  ? 204 LEU B CD1   1 
ATOM   4404 C  CD2   . LEU B 1 204 ? 45.698  41.201  44.231 1.00 29.36  ? 204 LEU B CD2   1 
ATOM   4405 N  N     . GLY B 1 205 ? 41.025  41.040  45.126 1.00 28.31  ? 205 GLY B N     1 
ATOM   4406 C  CA    . GLY B 1 205 ? 39.667  40.656  45.453 1.00 29.22  ? 205 GLY B CA    1 
ATOM   4407 C  C     . GLY B 1 205 ? 39.652  39.129  45.525 1.00 31.42  ? 205 GLY B C     1 
ATOM   4408 O  O     . GLY B 1 205 ? 40.564  38.494  44.984 1.00 31.10  ? 205 GLY B O     1 
ATOM   4409 N  N     . HIS B 1 206 ? 38.660  38.560  46.211 1.00 33.97  ? 206 HIS B N     1 
ATOM   4410 C  CA    . HIS B 1 206 ? 38.453  37.100  46.352 1.00 35.56  ? 206 HIS B CA    1 
ATOM   4411 C  C     . HIS B 1 206 ? 38.343  36.619  47.798 1.00 35.57  ? 206 HIS B C     1 
ATOM   4412 O  O     . HIS B 1 206 ? 37.503  35.787  48.108 1.00 38.00  ? 206 HIS B O     1 
ATOM   4413 C  CB    . HIS B 1 206 ? 39.553  36.291  45.642 1.00 37.54  ? 206 HIS B CB    1 
ATOM   4414 C  CG    . HIS B 1 206 ? 39.252  34.829  45.539 1.00 41.21  ? 206 HIS B CG    1 
ATOM   4415 N  ND1   . HIS B 1 206 ? 38.151  34.339  44.865 1.00 42.83  ? 206 HIS B ND1   1 
ATOM   4416 C  CD2   . HIS B 1 206 ? 39.897  33.749  46.042 1.00 42.25  ? 206 HIS B CD2   1 
ATOM   4417 C  CE1   . HIS B 1 206 ? 38.130  33.023  44.957 1.00 44.11  ? 206 HIS B CE1   1 
ATOM   4418 N  NE2   . HIS B 1 206 ? 39.178  32.638  45.666 1.00 45.86  ? 206 HIS B NE2   1 
ATOM   4419 N  N     . ILE B 1 207 ? 39.191  37.118  48.687 1.00 34.15  ? 207 ILE B N     1 
ATOM   4420 C  CA    . ILE B 1 207 ? 39.111  36.713  50.086 1.00 32.79  ? 207 ILE B CA    1 
ATOM   4421 C  C     . ILE B 1 207 ? 38.120  37.680  50.755 1.00 31.80  ? 207 ILE B C     1 
ATOM   4422 O  O     . ILE B 1 207 ? 38.260  38.906  50.657 1.00 30.27  ? 207 ILE B O     1 
ATOM   4423 C  CB    . ILE B 1 207 ? 40.527  36.696  50.702 1.00 34.53  ? 207 ILE B CB    1 
ATOM   4424 C  CG1   . ILE B 1 207 ? 41.221  35.403  50.215 1.00 36.04  ? 207 ILE B CG1   1 
ATOM   4425 C  CG2   . ILE B 1 207 ? 40.470  36.744  52.240 1.00 33.16  ? 207 ILE B CG2   1 
ATOM   4426 C  CD1   . ILE B 1 207 ? 42.702  35.334  50.468 1.00 39.42  ? 207 ILE B CD1   1 
ATOM   4427 N  N     . HIS B 1 208 ? 37.118  37.115  51.419 1.00 29.01  ? 208 HIS B N     1 
ATOM   4428 C  CA    . HIS B 1 208 ? 36.032  37.902  51.986 1.00 30.30  ? 208 HIS B CA    1 
ATOM   4429 C  C     . HIS B 1 208 ? 36.204  38.693  53.288 1.00 29.68  ? 208 HIS B C     1 
ATOM   4430 O  O     . HIS B 1 208 ? 35.384  39.541  53.604 1.00 28.05  ? 208 HIS B O     1 
ATOM   4431 C  CB    . HIS B 1 208 ? 34.777  37.019  52.036 1.00 31.31  ? 208 HIS B CB    1 
ATOM   4432 C  CG    . HIS B 1 208 ? 34.246  36.682  50.677 1.00 34.25  ? 208 HIS B CG    1 
ATOM   4433 N  ND1   . HIS B 1 208 ? 33.121  35.912  50.479 1.00 37.14  ? 208 HIS B ND1   1 
ATOM   4434 C  CD2   . HIS B 1 208 ? 34.683  37.035  49.441 1.00 35.01  ? 208 HIS B CD2   1 
ATOM   4435 C  CE1   . HIS B 1 208 ? 32.884  35.811  49.180 1.00 37.64  ? 208 HIS B CE1   1 
ATOM   4436 N  NE2   . HIS B 1 208 ? 33.818  36.482  48.529 1.00 34.05  ? 208 HIS B NE2   1 
ATOM   4437 N  N     . LYS B 1 209 ? 37.252  38.397  54.030 1.00 29.17  ? 209 LYS B N     1 
ATOM   4438 C  CA    . LYS B 1 209 ? 37.556  39.114  55.261 1.00 32.05  ? 209 LYS B CA    1 
ATOM   4439 C  C     . LYS B 1 209 ? 38.757  40.023  54.942 1.00 30.89  ? 209 LYS B C     1 
ATOM   4440 O  O     . LYS B 1 209 ? 39.849  39.533  54.622 1.00 29.56  ? 209 LYS B O     1 
ATOM   4441 C  CB    . LYS B 1 209 ? 37.902  38.112  56.366 1.00 32.92  ? 209 LYS B CB    1 
ATOM   4442 C  CG    . LYS B 1 209 ? 36.714  37.232  56.694 1.00 37.91  ? 209 LYS B CG    1 
ATOM   4443 C  CD    . LYS B 1 209 ? 36.854  36.535  58.033 1.00 41.87  ? 209 LYS B CD    1 
ATOM   4444 C  CE    . LYS B 1 209 ? 37.211  35.098  57.852 1.00 45.31  ? 209 LYS B CE    1 
ATOM   4445 N  NZ    . LYS B 1 209 ? 36.893  34.319  59.093 1.00 48.78  ? 209 LYS B NZ    1 
ATOM   4446 N  N     . ARG B 1 210 ? 38.533  41.334  54.996 1.00 29.23  ? 210 ARG B N     1 
ATOM   4447 C  CA    . ARG B 1 210 ? 39.566  42.314  54.664 1.00 29.54  ? 210 ARG B CA    1 
ATOM   4448 C  C     . ARG B 1 210 ? 40.955  41.939  55.177 1.00 30.08  ? 210 ARG B C     1 
ATOM   4449 O  O     . ARG B 1 210 ? 41.112  41.381  56.255 1.00 30.46  ? 210 ARG B O     1 
ATOM   4450 C  CB    . ARG B 1 210 ? 39.175  43.691  55.193 1.00 29.85  ? 210 ARG B CB    1 
ATOM   4451 C  CG    . ARG B 1 210 ? 39.200  43.834  56.705 1.00 30.10  ? 210 ARG B CG    1 
ATOM   4452 C  CD    . ARG B 1 210 ? 38.501  45.120  57.080 1.00 33.48  ? 210 ARG B CD    1 
ATOM   4453 N  NE    . ARG B 1 210 ? 38.581  45.430  58.499 1.00 35.07  ? 210 ARG B NE    1 
ATOM   4454 C  CZ    . ARG B 1 210 ? 39.362  46.380  59.018 1.00 33.91  ? 210 ARG B CZ    1 
ATOM   4455 N  NH1   . ARG B 1 210 ? 39.369  46.598  60.327 1.00 30.74  ? 210 ARG B NH1   1 
ATOM   4456 N  NH2   . ARG B 1 210 ? 40.130  47.109  58.231 1.00 32.72  ? 210 ARG B NH2   1 
ATOM   4457 N  N     . TYR B 1 211 ? 41.958  42.266  54.388 1.00 30.14  ? 211 TYR B N     1 
ATOM   4458 C  CA    . TYR B 1 211 ? 43.336  41.953  54.720 1.00 31.74  ? 211 TYR B CA    1 
ATOM   4459 C  C     . TYR B 1 211 ? 44.205  43.006  54.038 1.00 32.96  ? 211 TYR B C     1 
ATOM   4460 O  O     . TYR B 1 211 ? 43.944  43.388  52.896 1.00 34.44  ? 211 TYR B O     1 
ATOM   4461 C  CB    . TYR B 1 211 ? 43.694  40.595  54.143 1.00 33.63  ? 211 TYR B CB    1 
ATOM   4462 C  CG    . TYR B 1 211 ? 44.961  39.994  54.676 1.00 36.44  ? 211 TYR B CG    1 
ATOM   4463 C  CD1   . TYR B 1 211 ? 44.933  39.236  55.839 1.00 37.41  ? 211 TYR B CD1   1 
ATOM   4464 C  CD2   . TYR B 1 211 ? 46.170  40.104  53.980 1.00 37.56  ? 211 TYR B CD2   1 
ATOM   4465 C  CE1   . TYR B 1 211 ? 46.057  38.582  56.309 1.00 39.75  ? 211 TYR B CE1   1 
ATOM   4466 C  CE2   . TYR B 1 211 ? 47.333  39.440  54.455 1.00 40.61  ? 211 TYR B CE2   1 
ATOM   4467 C  CZ    . TYR B 1 211 ? 47.246  38.679  55.630 1.00 41.23  ? 211 TYR B CZ    1 
ATOM   4468 O  OH    . TYR B 1 211 ? 48.328  37.994  56.156 1.00 45.97  ? 211 TYR B OH    1 
ATOM   4469 N  N     . GLU B 1 212 ? 45.237  43.464  54.725 1.00 31.09  ? 212 GLU B N     1 
ATOM   4470 C  CA    . GLU B 1 212 ? 46.130  44.465  54.160 1.00 30.99  ? 212 GLU B CA    1 
ATOM   4471 C  C     . GLU B 1 212 ? 47.558  44.084  54.516 1.00 31.21  ? 212 GLU B C     1 
ATOM   4472 O  O     . GLU B 1 212 ? 47.902  43.952  55.703 1.00 31.68  ? 212 GLU B O     1 
ATOM   4473 C  CB    . GLU B 1 212 ? 45.842  45.868  54.729 1.00 30.12  ? 212 GLU B CB    1 
ATOM   4474 C  CG    . GLU B 1 212 ? 46.919  46.899  54.328 1.00 32.64  ? 212 GLU B CG    1 
ATOM   4475 C  CD    . GLU B 1 212 ? 46.676  48.313  54.867 1.00 31.55  ? 212 GLU B CD    1 
ATOM   4476 O  OE1   . GLU B 1 212 ? 47.534  49.178  54.628 1.00 37.94  ? 212 GLU B OE1   1 
ATOM   4477 O  OE2   . GLU B 1 212 ? 45.647  48.574  55.513 1.00 31.28  ? 212 GLU B OE2   1 
ATOM   4478 N  N     . THR B 1 213 ? 48.381  43.878  53.499 1.00 30.71  ? 213 THR B N     1 
ATOM   4479 C  CA    . THR B 1 213 ? 49.765  43.576  53.755 1.00 33.28  ? 213 THR B CA    1 
ATOM   4480 C  C     . THR B 1 213 ? 50.650  44.443  52.874 1.00 32.81  ? 213 THR B C     1 
ATOM   4481 O  O     . THR B 1 213 ? 50.204  45.464  52.348 1.00 31.74  ? 213 THR B O     1 
ATOM   4482 C  CB    . THR B 1 213 ? 50.070  42.070  53.587 1.00 34.48  ? 213 THR B CB    1 
ATOM   4483 O  OG1   . THR B 1 213 ? 51.327  41.782  54.212 1.00 36.43  ? 213 THR B OG1   1 
ATOM   4484 C  CG2   . THR B 1 213 ? 50.096  41.663  52.133 1.00 34.10  ? 213 THR B CG2   1 
ATOM   4485 N  N     . SER B 1 214 ? 51.900  44.054  52.718 1.00 32.87  ? 214 SER B N     1 
ATOM   4486 C  CA    . SER B 1 214 ? 52.812  44.853  51.939 1.00 34.94  ? 214 SER B CA    1 
ATOM   4487 C  C     . SER B 1 214 ? 53.664  44.014  50.995 1.00 36.33  ? 214 SER B C     1 
ATOM   4488 O  O     . SER B 1 214 ? 54.068  42.911  51.343 1.00 36.34  ? 214 SER B O     1 
ATOM   4489 C  CB    . SER B 1 214 ? 53.711  45.635  52.893 1.00 37.09  ? 214 SER B CB    1 
ATOM   4490 O  OG    . SER B 1 214 ? 54.670  46.371  52.167 1.00 42.05  ? 214 SER B OG    1 
ATOM   4491 N  N     . TYR B 1 215 ? 53.906  44.523  49.787 1.00 34.95  ? 215 TYR B N     1 
ATOM   4492 C  CA    . TYR B 1 215 ? 54.740  43.809  48.831 1.00 35.50  ? 215 TYR B CA    1 
ATOM   4493 C  C     . TYR B 1 215 ? 55.465  44.778  47.896 1.00 36.44  ? 215 TYR B C     1 
ATOM   4494 O  O     . TYR B 1 215 ? 54.858  45.706  47.338 1.00 35.36  ? 215 TYR B O     1 
ATOM   4495 C  CB    . TYR B 1 215 ? 53.913  42.823  48.012 1.00 33.96  ? 215 TYR B CB    1 
ATOM   4496 C  CG    . TYR B 1 215 ? 54.724  42.071  46.984 1.00 35.28  ? 215 TYR B CG    1 
ATOM   4497 C  CD1   . TYR B 1 215 ? 55.540  40.982  47.350 1.00 35.14  ? 215 TYR B CD1   1 
ATOM   4498 C  CD2   . TYR B 1 215 ? 54.662  42.424  45.633 1.00 36.93  ? 215 TYR B CD2   1 
ATOM   4499 C  CE1   . TYR B 1 215 ? 56.269  40.253  46.379 1.00 33.01  ? 215 TYR B CE1   1 
ATOM   4500 C  CE2   . TYR B 1 215 ? 55.377  41.705  44.655 1.00 37.81  ? 215 TYR B CE2   1 
ATOM   4501 C  CZ    . TYR B 1 215 ? 56.174  40.616  45.036 1.00 36.47  ? 215 TYR B CZ    1 
ATOM   4502 O  OH    . TYR B 1 215 ? 56.797  39.871  44.042 1.00 36.81  ? 215 TYR B OH    1 
ATOM   4503 N  N     . SER B 1 216 ? 56.771  44.563  47.744 1.00 39.33  ? 216 SER B N     1 
ATOM   4504 C  CA    . SER B 1 216 ? 57.600  45.402  46.886 1.00 40.21  ? 216 SER B CA    1 
ATOM   4505 C  C     . SER B 1 216 ? 57.415  46.870  47.277 1.00 40.07  ? 216 SER B C     1 
ATOM   4506 O  O     . SER B 1 216 ? 57.363  47.756  46.422 1.00 39.74  ? 216 SER B O     1 
ATOM   4507 C  CB    . SER B 1 216 ? 57.201  45.177  45.421 1.00 43.38  ? 216 SER B CB    1 
ATOM   4508 O  OG    . SER B 1 216 ? 58.152  45.737  44.527 1.00 49.38  ? 216 SER B OG    1 
ATOM   4509 N  N     . GLY B 1 217 ? 57.296  47.116  48.579 1.00 39.43  ? 217 GLY B N     1 
ATOM   4510 C  CA    . GLY B 1 217 ? 57.121  48.474  49.071 1.00 37.74  ? 217 GLY B CA    1 
ATOM   4511 C  C     . GLY B 1 217 ? 55.722  49.064  48.924 1.00 39.60  ? 217 GLY B C     1 
ATOM   4512 O  O     . GLY B 1 217 ? 55.517  50.251  49.226 1.00 38.53  ? 217 GLY B O     1 
ATOM   4513 N  N     . SER B 1 218 ? 54.750  48.259  48.491 1.00 36.85  ? 218 SER B N     1 
ATOM   4514 C  CA    . SER B 1 218 ? 53.396  48.781  48.287 1.00 35.20  ? 218 SER B CA    1 
ATOM   4515 C  C     . SER B 1 218 ? 52.300  48.027  49.029 1.00 33.58  ? 218 SER B C     1 
ATOM   4516 O  O     . SER B 1 218 ? 52.492  46.909  49.508 1.00 33.79  ? 218 SER B O     1 
ATOM   4517 C  CB    . SER B 1 218 ? 53.039  48.805  46.789 1.00 37.48  ? 218 SER B CB    1 
ATOM   4518 O  OG    . SER B 1 218 ? 53.938  49.585  46.012 1.00 36.76  ? 218 SER B OG    1 
ATOM   4519 N  N     . PRO B 1 219 ? 51.126  48.658  49.165 1.00 32.93  ? 219 PRO B N     1 
ATOM   4520 C  CA    . PRO B 1 219 ? 50.045  47.966  49.866 1.00 30.88  ? 219 PRO B CA    1 
ATOM   4521 C  C     . PRO B 1 219 ? 49.498  46.844  48.983 1.00 32.02  ? 219 PRO B C     1 
ATOM   4522 O  O     . PRO B 1 219 ? 49.468  46.972  47.760 1.00 33.56  ? 219 PRO B O     1 
ATOM   4523 C  CB    . PRO B 1 219 ? 49.003  49.060  50.067 1.00 30.57  ? 219 PRO B CB    1 
ATOM   4524 C  CG    . PRO B 1 219 ? 49.816  50.366  50.029 1.00 31.42  ? 219 PRO B CG    1 
ATOM   4525 C  CD    . PRO B 1 219 ? 50.809  50.081  48.947 1.00 29.21  ? 219 PRO B CD    1 
ATOM   4526 N  N     . VAL B 1 220 ? 49.105  45.744  49.613 1.00 30.77  ? 220 VAL B N     1 
ATOM   4527 C  CA    . VAL B 1 220 ? 48.468  44.604  48.945 1.00 30.50  ? 220 VAL B CA    1 
ATOM   4528 C  C     . VAL B 1 220 ? 47.185  44.540  49.763 1.00 30.23  ? 220 VAL B C     1 
ATOM   4529 O  O     . VAL B 1 220 ? 47.219  44.285  50.979 1.00 30.81  ? 220 VAL B O     1 
ATOM   4530 C  CB    . VAL B 1 220 ? 49.251  43.279  49.111 1.00 30.62  ? 220 VAL B CB    1 
ATOM   4531 C  CG1   . VAL B 1 220 ? 48.449  42.133  48.523 1.00 28.11  ? 220 VAL B CG1   1 
ATOM   4532 C  CG2   . VAL B 1 220 ? 50.582  43.372  48.391 1.00 32.28  ? 220 VAL B CG2   1 
ATOM   4533 N  N     . VAL B 1 221 ? 46.056  44.771  49.110 1.00 28.56  ? 221 VAL B N     1 
ATOM   4534 C  CA    . VAL B 1 221 ? 44.779  44.822  49.822 1.00 26.42  ? 221 VAL B CA    1 
ATOM   4535 C  C     . VAL B 1 221 ? 43.631  43.961  49.283 1.00 26.53  ? 221 VAL B C     1 
ATOM   4536 O  O     . VAL B 1 221 ? 43.362  43.983  48.071 1.00 25.56  ? 221 VAL B O     1 
ATOM   4537 C  CB    . VAL B 1 221 ? 44.237  46.314  49.815 1.00 26.76  ? 221 VAL B CB    1 
ATOM   4538 C  CG1   . VAL B 1 221 ? 42.857  46.409  50.436 1.00 22.04  ? 221 VAL B CG1   1 
ATOM   4539 C  CG2   . VAL B 1 221 ? 45.237  47.256  50.497 1.00 27.25  ? 221 VAL B CG2   1 
ATOM   4540 N  N     . TYR B 1 222 ? 42.965  43.240  50.190 1.00 24.92  ? 222 TYR B N     1 
ATOM   4541 C  CA    . TYR B 1 222 ? 41.714  42.525  49.886 1.00 26.16  ? 222 TYR B CA    1 
ATOM   4542 C  C     . TYR B 1 222 ? 40.723  43.380  50.705 1.00 26.65  ? 222 TYR B C     1 
ATOM   4543 O  O     . TYR B 1 222 ? 40.835  43.462  51.924 1.00 26.84  ? 222 TYR B O     1 
ATOM   4544 C  CB    . TYR B 1 222 ? 41.650  41.097  50.452 1.00 27.34  ? 222 TYR B CB    1 
ATOM   4545 C  CG    . TYR B 1 222 ? 42.412  40.051  49.667 1.00 28.32  ? 222 TYR B CG    1 
ATOM   4546 C  CD1   . TYR B 1 222 ? 43.661  39.615  50.092 1.00 28.74  ? 222 TYR B CD1   1 
ATOM   4547 C  CD2   . TYR B 1 222 ? 41.864  39.481  48.506 1.00 26.32  ? 222 TYR B CD2   1 
ATOM   4548 C  CE1   . TYR B 1 222 ? 44.353  38.616  49.382 1.00 32.65  ? 222 TYR B CE1   1 
ATOM   4549 C  CE2   . TYR B 1 222 ? 42.534  38.517  47.799 1.00 29.09  ? 222 TYR B CE2   1 
ATOM   4550 C  CZ    . TYR B 1 222 ? 43.786  38.073  48.240 1.00 31.17  ? 222 TYR B CZ    1 
ATOM   4551 O  OH    . TYR B 1 222 ? 44.457  37.083  47.538 1.00 31.46  ? 222 TYR B OH    1 
ATOM   4552 N  N     . PRO B 1 223 ? 39.748  44.030  50.058 1.00 26.17  ? 223 PRO B N     1 
ATOM   4553 C  CA    . PRO B 1 223 ? 38.833  44.834  50.880 1.00 27.40  ? 223 PRO B CA    1 
ATOM   4554 C  C     . PRO B 1 223 ? 37.755  44.007  51.568 1.00 27.77  ? 223 PRO B C     1 
ATOM   4555 O  O     . PRO B 1 223 ? 37.070  44.502  52.470 1.00 27.44  ? 223 PRO B O     1 
ATOM   4556 C  CB    . PRO B 1 223 ? 38.246  45.812  49.875 1.00 28.20  ? 223 PRO B CB    1 
ATOM   4557 C  CG    . PRO B 1 223 ? 38.153  44.959  48.644 1.00 26.72  ? 223 PRO B CG    1 
ATOM   4558 C  CD    . PRO B 1 223 ? 39.453  44.184  48.627 1.00 25.37  ? 223 PRO B CD    1 
ATOM   4559 N  N     . GLY B 1 224 ? 37.641  42.742  51.151 1.00 27.48  ? 224 GLY B N     1 
ATOM   4560 C  CA    . GLY B 1 224 ? 36.642  41.842  51.693 1.00 25.98  ? 224 GLY B CA    1 
ATOM   4561 C  C     . GLY B 1 224 ? 35.257  42.103  51.101 1.00 28.17  ? 224 GLY B C     1 
ATOM   4562 O  O     . GLY B 1 224 ? 35.037  43.054  50.323 1.00 25.54  ? 224 GLY B O     1 
ATOM   4563 N  N     . SER B 1 225 ? 34.305  41.245  51.453 1.00 27.86  ? 225 SER B N     1 
ATOM   4564 C  CA    . SER B 1 225 ? 32.931  41.412  50.984 1.00 28.06  ? 225 SER B CA    1 
ATOM   4565 C  C     . SER B 1 225 ? 32.319  42.575  51.788 1.00 27.66  ? 225 SER B C     1 
ATOM   4566 O  O     . SER B 1 225 ? 32.854  42.931  52.836 1.00 28.77  ? 225 SER B O     1 
ATOM   4567 C  CB    . SER B 1 225 ? 32.134  40.134  51.266 1.00 27.50  ? 225 SER B CB    1 
ATOM   4568 O  OG    . SER B 1 225 ? 32.081  39.883  52.662 1.00 30.66  ? 225 SER B OG    1 
ATOM   4569 N  N     . LEU B 1 226 ? 31.218  43.147  51.307 1.00 26.70  ? 226 LEU B N     1 
ATOM   4570 C  CA    . LEU B 1 226 ? 30.530  44.215  52.034 1.00 28.47  ? 226 LEU B CA    1 
ATOM   4571 C  C     . LEU B 1 226 ? 29.632  43.607  53.097 1.00 28.62  ? 226 LEU B C     1 
ATOM   4572 O  O     . LEU B 1 226 ? 29.552  44.128  54.217 1.00 29.23  ? 226 LEU B O     1 
ATOM   4573 C  CB    . LEU B 1 226 ? 29.691  45.098  51.095 1.00 26.12  ? 226 LEU B CB    1 
ATOM   4574 C  CG    . LEU B 1 226 ? 30.553  45.879  50.092 1.00 28.79  ? 226 LEU B CG    1 
ATOM   4575 C  CD1   . LEU B 1 226 ? 29.620  46.699  49.161 1.00 31.66  ? 226 LEU B CD1   1 
ATOM   4576 C  CD2   . LEU B 1 226 ? 31.561  46.786  50.807 1.00 24.85  ? 226 LEU B CD2   1 
ATOM   4577 N  N     . GLU B 1 227 ? 28.957  42.507  52.756 1.00 27.21  ? 227 GLU B N     1 
ATOM   4578 C  CA    . GLU B 1 227 ? 28.091  41.827  53.714 1.00 29.48  ? 227 GLU B CA    1 
ATOM   4579 C  C     . GLU B 1 227 ? 28.786  40.592  54.269 1.00 29.53  ? 227 GLU B C     1 
ATOM   4580 O  O     . GLU B 1 227 ? 29.692  40.043  53.643 1.00 30.00  ? 227 GLU B O     1 
ATOM   4581 C  CB    . GLU B 1 227 ? 26.760  41.410  53.075 1.00 31.48  ? 227 GLU B CB    1 
ATOM   4582 C  CG    . GLU B 1 227 ? 25.691  42.524  53.006 1.00 32.50  ? 227 GLU B CG    1 
ATOM   4583 C  CD    . GLU B 1 227 ? 25.086  42.883  54.377 1.00 33.71  ? 227 GLU B CD    1 
ATOM   4584 O  OE1   . GLU B 1 227 ? 24.334  43.878  54.451 1.00 34.90  ? 227 GLU B OE1   1 
ATOM   4585 O  OE2   . GLU B 1 227 ? 25.350  42.181  55.373 1.00 32.92  ? 227 GLU B OE2   1 
ATOM   4586 N  N     . ARG B 1 228 ? 28.372  40.168  55.456 1.00 30.07  ? 228 ARG B N     1 
ATOM   4587 C  CA    . ARG B 1 228 ? 28.948  38.980  56.077 1.00 30.03  ? 228 ARG B CA    1 
ATOM   4588 C  C     . ARG B 1 228 ? 28.656  37.784  55.182 1.00 29.86  ? 228 ARG B C     1 
ATOM   4589 O  O     . ARG B 1 228 ? 27.516  37.552  54.756 1.00 27.40  ? 228 ARG B O     1 
ATOM   4590 C  CB    . ARG B 1 228 ? 28.418  38.812  57.516 1.00 28.85  ? 228 ARG B CB    1 
ATOM   4591 C  CG    . ARG B 1 228 ? 29.077  39.880  58.432 1.00 32.93  ? 228 ARG B CG    1 
ATOM   4592 C  CD    . ARG B 1 228 ? 28.776  39.762  59.942 1.00 31.33  ? 228 ARG B CD    1 
ATOM   4593 N  NE    . ARG B 1 228 ? 29.437  40.862  60.639 1.00 32.21  ? 228 ARG B NE    1 
ATOM   4594 C  CZ    . ARG B 1 228 ? 30.751  40.977  60.795 1.00 32.35  ? 228 ARG B CZ    1 
ATOM   4595 N  NH1   . ARG B 1 228 ? 31.263  42.026  61.432 1.00 32.20  ? 228 ARG B NH1   1 
ATOM   4596 N  NH2   . ARG B 1 228 ? 31.558  40.041  60.338 1.00 32.39  ? 228 ARG B NH2   1 
ATOM   4597 N  N     . TRP B 1 229 ? 29.725  37.056  54.888 1.00 32.26  ? 229 TRP B N     1 
ATOM   4598 C  CA    . TRP B 1 229 ? 29.693  35.921  53.974 1.00 36.23  ? 229 TRP B CA    1 
ATOM   4599 C  C     . TRP B 1 229 ? 29.057  34.648  54.492 1.00 36.87  ? 229 TRP B C     1 
ATOM   4600 O  O     . TRP B 1 229 ? 28.276  34.014  53.798 1.00 37.63  ? 229 TRP B O     1 
ATOM   4601 C  CB    . TRP B 1 229 ? 31.113  35.620  53.492 1.00 35.78  ? 229 TRP B CB    1 
ATOM   4602 C  CG    . TRP B 1 229 ? 31.120  34.640  52.373 1.00 36.94  ? 229 TRP B CG    1 
ATOM   4603 C  CD1   . TRP B 1 229 ? 31.744  33.424  52.348 1.00 37.16  ? 229 TRP B CD1   1 
ATOM   4604 C  CD2   . TRP B 1 229 ? 30.454  34.781  51.116 1.00 35.57  ? 229 TRP B CD2   1 
ATOM   4605 N  NE1   . TRP B 1 229 ? 31.504  32.799  51.152 1.00 37.41  ? 229 TRP B NE1   1 
ATOM   4606 C  CE2   . TRP B 1 229 ? 30.714  33.606  50.374 1.00 37.37  ? 229 TRP B CE2   1 
ATOM   4607 C  CE3   . TRP B 1 229 ? 29.660  35.791  50.538 1.00 35.87  ? 229 TRP B CE3   1 
ATOM   4608 C  CZ2   . TRP B 1 229 ? 30.204  33.404  49.070 1.00 35.36  ? 229 TRP B CZ2   1 
ATOM   4609 C  CZ3   . TRP B 1 229 ? 29.151  35.591  49.244 1.00 32.98  ? 229 TRP B CZ3   1 
ATOM   4610 C  CH2   . TRP B 1 229 ? 29.428  34.405  48.531 1.00 35.86  ? 229 TRP B CH2   1 
ATOM   4611 N  N     . ASP B 1 230 ? 29.425  34.262  55.701 1.00 38.03  ? 230 ASP B N     1 
ATOM   4612 C  CA    . ASP B 1 230 ? 28.872  33.072  56.332 1.00 39.11  ? 230 ASP B CA    1 
ATOM   4613 C  C     . ASP B 1 230 ? 29.201  33.169  57.821 1.00 40.05  ? 230 ASP B C     1 
ATOM   4614 O  O     . ASP B 1 230 ? 29.731  34.200  58.290 1.00 40.47  ? 230 ASP B O     1 
ATOM   4615 C  CB    . ASP B 1 230 ? 29.465  31.801  55.702 1.00 38.98  ? 230 ASP B CB    1 
ATOM   4616 C  CG    . ASP B 1 230 ? 30.971  31.734  55.830 1.00 40.72  ? 230 ASP B CG    1 
ATOM   4617 O  OD1   . ASP B 1 230 ? 31.602  30.965  55.089 1.00 43.18  ? 230 ASP B OD1   1 
ATOM   4618 O  OD2   . ASP B 1 230 ? 31.544  32.443  56.671 1.00 44.57  ? 230 ASP B OD2   1 
ATOM   4619 N  N     . PHE B 1 231 ? 28.893  32.117  58.568 1.00 39.02  ? 231 PHE B N     1 
ATOM   4620 C  CA    . PHE B 1 231 ? 29.151  32.132  59.997 1.00 37.47  ? 231 PHE B CA    1 
ATOM   4621 C  C     . PHE B 1 231 ? 30.622  32.082  60.370 1.00 37.54  ? 231 PHE B C     1 
ATOM   4622 O  O     . PHE B 1 231 ? 30.999  32.336  61.515 1.00 40.15  ? 231 PHE B O     1 
ATOM   4623 C  CB    . PHE B 1 231 ? 28.313  31.053  60.674 1.00 37.24  ? 231 PHE B CB    1 
ATOM   4624 C  CG    . PHE B 1 231 ? 26.850  31.407  60.720 1.00 37.87  ? 231 PHE B CG    1 
ATOM   4625 C  CD1   . PHE B 1 231 ? 25.939  30.813  59.858 1.00 37.82  ? 231 PHE B CD1   1 
ATOM   4626 C  CD2   . PHE B 1 231 ? 26.397  32.411  61.576 1.00 38.29  ? 231 PHE B CD2   1 
ATOM   4627 C  CE1   . PHE B 1 231 ? 24.593  31.208  59.839 1.00 35.78  ? 231 PHE B CE1   1 
ATOM   4628 C  CE2   . PHE B 1 231 ? 25.049  32.816  61.563 1.00 40.45  ? 231 PHE B CE2   1 
ATOM   4629 C  CZ    . PHE B 1 231 ? 24.146  32.204  60.685 1.00 36.96  ? 231 PHE B CZ    1 
ATOM   4630 N  N     . GLY B 1 232 ? 31.477  31.770  59.414 1.00 35.72  ? 232 GLY B N     1 
ATOM   4631 C  CA    . GLY B 1 232 ? 32.884  31.843  59.733 1.00 32.13  ? 232 GLY B CA    1 
ATOM   4632 C  C     . GLY B 1 232 ? 33.224  33.349  59.678 1.00 33.29  ? 232 GLY B C     1 
ATOM   4633 O  O     . GLY B 1 232 ? 34.279  33.770  60.156 1.00 32.49  ? 232 GLY B O     1 
ATOM   4634 N  N     . ASP B 1 233 ? 32.341  34.167  59.084 1.00 31.89  ? 233 ASP B N     1 
ATOM   4635 C  CA    . ASP B 1 233 ? 32.567  35.621  58.978 1.00 31.04  ? 233 ASP B CA    1 
ATOM   4636 C  C     . ASP B 1 233 ? 31.704  36.336  60.041 1.00 30.97  ? 233 ASP B C     1 
ATOM   4637 O  O     . ASP B 1 233 ? 31.005  37.322  59.740 1.00 29.42  ? 233 ASP B O     1 
ATOM   4638 C  CB    . ASP B 1 233 ? 32.153  36.118  57.585 1.00 31.53  ? 233 ASP B CB    1 
ATOM   4639 C  CG    . ASP B 1 233 ? 32.622  37.559  57.295 1.00 31.94  ? 233 ASP B CG    1 
ATOM   4640 O  OD1   . ASP B 1 233 ? 32.220  38.107  56.250 1.00 31.06  ? 233 ASP B OD1   1 
ATOM   4641 O  OD2   . ASP B 1 233 ? 33.400  38.143  58.095 1.00 34.98  ? 233 ASP B OD2   1 
ATOM   4642 N  N     . TYR B 1 234 ? 31.749  35.820  61.267 1.00 28.91  ? 234 TYR B N     1 
ATOM   4643 C  CA    . TYR B 1 234 ? 30.952  36.341  62.373 1.00 29.73  ? 234 TYR B CA    1 
ATOM   4644 C  C     . TYR B 1 234 ? 31.368  37.711  62.902 1.00 27.75  ? 234 TYR B C     1 
ATOM   4645 O  O     . TYR B 1 234 ? 32.500  38.145  62.739 1.00 28.16  ? 234 TYR B O     1 
ATOM   4646 C  CB    . TYR B 1 234 ? 30.961  35.332  63.549 1.00 29.20  ? 234 TYR B CB    1 
ATOM   4647 C  CG    . TYR B 1 234 ? 32.358  34.951  63.996 1.00 29.84  ? 234 TYR B CG    1 
ATOM   4648 C  CD1   . TYR B 1 234 ? 33.142  35.827  64.761 1.00 31.30  ? 234 TYR B CD1   1 
ATOM   4649 C  CD2   . TYR B 1 234 ? 32.941  33.768  63.558 1.00 31.39  ? 234 TYR B CD2   1 
ATOM   4650 C  CE1   . TYR B 1 234 ? 34.486  35.527  65.062 1.00 29.09  ? 234 TYR B CE1   1 
ATOM   4651 C  CE2   . TYR B 1 234 ? 34.264  33.461  63.847 1.00 31.47  ? 234 TYR B CE2   1 
ATOM   4652 C  CZ    . TYR B 1 234 ? 35.031  34.341  64.591 1.00 32.10  ? 234 TYR B CZ    1 
ATOM   4653 O  OH    . TYR B 1 234 ? 36.350  34.033  64.820 1.00 34.16  ? 234 TYR B OH    1 
ATOM   4654 N  N     . GLU B 1 235 ? 30.412  38.397  63.501 1.00 28.46  ? 235 GLU B N     1 
ATOM   4655 C  CA    . GLU B 1 235 ? 30.687  39.664  64.140 1.00 30.21  ? 235 GLU B CA    1 
ATOM   4656 C  C     . GLU B 1 235 ? 31.329  39.238  65.472 1.00 31.18  ? 235 GLU B C     1 
ATOM   4657 O  O     . GLU B 1 235 ? 32.328  39.813  65.914 1.00 32.36  ? 235 GLU B O     1 
ATOM   4658 C  CB    . GLU B 1 235 ? 29.398  40.434  64.412 1.00 31.03  ? 235 GLU B CB    1 
ATOM   4659 C  CG    . GLU B 1 235 ? 29.618  41.643  65.338 1.00 33.48  ? 235 GLU B CG    1 
ATOM   4660 C  CD    . GLU B 1 235 ? 28.400  42.511  65.439 1.00 35.32  ? 235 GLU B CD    1 
ATOM   4661 O  OE1   . GLU B 1 235 ? 28.185  43.357  64.550 1.00 36.79  ? 235 GLU B OE1   1 
ATOM   4662 O  OE2   . GLU B 1 235 ? 27.632  42.336  66.401 1.00 40.51  ? 235 GLU B OE2   1 
ATOM   4663 N  N     . VAL B 1 236 ? 30.756  38.208  66.089 1.00 32.40  ? 236 VAL B N     1 
ATOM   4664 C  CA    . VAL B 1 236 ? 31.267  37.673  67.350 1.00 34.92  ? 236 VAL B CA    1 
ATOM   4665 C  C     . VAL B 1 236 ? 31.013  36.167  67.410 1.00 36.25  ? 236 VAL B C     1 
ATOM   4666 O  O     . VAL B 1 236 ? 29.990  35.675  66.922 1.00 37.27  ? 236 VAL B O     1 
ATOM   4667 C  CB    . VAL B 1 236 ? 30.564  38.315  68.611 1.00 35.47  ? 236 VAL B CB    1 
ATOM   4668 C  CG1   . VAL B 1 236 ? 31.107  37.675  69.896 1.00 37.93  ? 236 VAL B CG1   1 
ATOM   4669 C  CG2   . VAL B 1 236 ? 30.828  39.795  68.668 1.00 36.28  ? 236 VAL B CG2   1 
ATOM   4670 N  N     . ARG B 1 237 ? 31.956  35.441  67.996 1.00 35.31  ? 237 ARG B N     1 
ATOM   4671 C  CA    . ARG B 1 237 ? 31.793  34.016  68.173 1.00 38.27  ? 237 ARG B CA    1 
ATOM   4672 C  C     . ARG B 1 237 ? 31.822  33.740  69.682 1.00 38.87  ? 237 ARG B C     1 
ATOM   4673 O  O     . ARG B 1 237 ? 32.752  34.134  70.372 1.00 38.86  ? 237 ARG B O     1 
ATOM   4674 C  CB    . ARG B 1 237 ? 32.925  33.252  67.490 1.00 37.35  ? 237 ARG B CB    1 
ATOM   4675 C  CG    . ARG B 1 237 ? 32.837  31.735  67.691 1.00 37.59  ? 237 ARG B CG    1 
ATOM   4676 C  CD    . ARG B 1 237 ? 34.158  31.046  67.314 1.00 38.69  ? 237 ARG B CD    1 
ATOM   4677 N  NE    . ARG B 1 237 ? 34.120  29.605  67.543 0.00 39.58  ? 237 ARG B NE    1 
ATOM   4678 C  CZ    . ARG B 1 237 ? 35.163  28.798  67.377 0.00 40.06  ? 237 ARG B CZ    1 
ATOM   4679 N  NH1   . ARG B 1 237 ? 35.043  27.498  67.606 0.00 40.37  ? 237 ARG B NH1   1 
ATOM   4680 N  NH2   . ARG B 1 237 ? 36.329  29.291  66.984 0.00 40.37  ? 237 ARG B NH2   1 
ATOM   4681 N  N     . TYR B 1 238 ? 30.797  33.063  70.181 1.00 41.73  ? 238 TYR B N     1 
ATOM   4682 C  CA    . TYR B 1 238 ? 30.701  32.719  71.603 1.00 44.85  ? 238 TYR B CA    1 
ATOM   4683 C  C     . TYR B 1 238 ? 30.810  31.212  71.839 1.00 47.62  ? 238 TYR B C     1 
ATOM   4684 O  O     . TYR B 1 238 ? 30.227  30.412  71.097 1.00 49.67  ? 238 TYR B O     1 
ATOM   4685 C  CB    . TYR B 1 238 ? 29.353  33.182  72.177 1.00 42.35  ? 238 TYR B CB    1 
ATOM   4686 C  CG    . TYR B 1 238 ? 29.135  34.671  72.160 1.00 39.22  ? 238 TYR B CG    1 
ATOM   4687 C  CD1   . TYR B 1 238 ? 28.095  35.232  71.420 1.00 36.91  ? 238 TYR B CD1   1 
ATOM   4688 C  CD2   . TYR B 1 238 ? 29.942  35.515  72.914 1.00 38.92  ? 238 TYR B CD2   1 
ATOM   4689 C  CE1   . TYR B 1 238 ? 27.858  36.601  71.434 1.00 36.57  ? 238 TYR B CE1   1 
ATOM   4690 C  CE2   . TYR B 1 238 ? 29.717  36.894  72.939 1.00 39.11  ? 238 TYR B CE2   1 
ATOM   4691 C  CZ    . TYR B 1 238 ? 28.674  37.426  72.197 1.00 37.38  ? 238 TYR B CZ    1 
ATOM   4692 O  OH    . TYR B 1 238 ? 28.444  38.781  72.244 1.00 39.01  ? 238 TYR B OH    1 
ATOM   4693 N  N     . GLU B 1 239 ? 31.542  30.824  72.876 1.00 50.08  ? 239 GLU B N     1 
ATOM   4694 C  CA    . GLU B 1 239 ? 31.664  29.413  73.221 1.00 53.30  ? 239 GLU B CA    1 
ATOM   4695 C  C     . GLU B 1 239 ? 31.476  29.205  74.729 1.00 53.98  ? 239 GLU B C     1 
ATOM   4696 O  O     . GLU B 1 239 ? 32.245  29.713  75.543 1.00 52.60  ? 239 GLU B O     1 
ATOM   4697 C  CB    . GLU B 1 239 ? 33.018  28.846  72.795 1.00 56.49  ? 239 GLU B CB    1 
ATOM   4698 C  CG    . GLU B 1 239 ? 33.122  27.336  73.052 1.00 61.83  ? 239 GLU B CG    1 
ATOM   4699 C  CD    . GLU B 1 239 ? 34.457  26.738  72.631 1.00 65.40  ? 239 GLU B CD    1 
ATOM   4700 O  OE1   . GLU B 1 239 ? 34.562  25.488  72.587 1.00 67.17  ? 239 GLU B OE1   1 
ATOM   4701 O  OE2   . GLU B 1 239 ? 35.400  27.511  72.350 1.00 67.63  ? 239 GLU B OE2   1 
ATOM   4702 N  N     . TRP B 1 240 ? 30.440  28.456  75.085 1.00 55.11  ? 240 TRP B N     1 
ATOM   4703 C  CA    . TRP B 1 240 ? 30.120  28.156  76.476 1.00 57.46  ? 240 TRP B CA    1 
ATOM   4704 C  C     . TRP B 1 240 ? 31.216  27.320  77.152 1.00 58.54  ? 240 TRP B C     1 
ATOM   4705 O  O     . TRP B 1 240 ? 31.565  26.251  76.655 1.00 58.84  ? 240 TRP B O     1 
ATOM   4706 C  CB    . TRP B 1 240 ? 28.784  27.411  76.520 1.00 57.50  ? 240 TRP B CB    1 
ATOM   4707 C  CG    . TRP B 1 240 ? 28.283  27.118  77.892 1.00 59.59  ? 240 TRP B CG    1 
ATOM   4708 C  CD1   . TRP B 1 240 ? 28.257  25.900  78.519 1.00 58.90  ? 240 TRP B CD1   1 
ATOM   4709 C  CD2   . TRP B 1 240 ? 27.733  28.059  78.819 1.00 59.55  ? 240 TRP B CD2   1 
ATOM   4710 N  NE1   . TRP B 1 240 ? 27.725  26.028  79.777 1.00 58.56  ? 240 TRP B NE1   1 
ATOM   4711 C  CE2   . TRP B 1 240 ? 27.393  27.338  79.991 1.00 59.71  ? 240 TRP B CE2   1 
ATOM   4712 C  CE3   . TRP B 1 240 ? 27.493  29.439  78.775 1.00 59.65  ? 240 TRP B CE3   1 
ATOM   4713 C  CZ2   . TRP B 1 240 ? 26.827  27.955  81.113 1.00 59.59  ? 240 TRP B CZ2   1 
ATOM   4714 C  CZ3   . TRP B 1 240 ? 26.927  30.057  79.894 1.00 60.33  ? 240 TRP B CZ3   1 
ATOM   4715 C  CH2   . TRP B 1 240 ? 26.600  29.310  81.047 1.00 60.85  ? 240 TRP B CH2   1 
ATOM   4716 N  N     . ASP B 1 241 ? 31.760  27.813  78.268 1.00 59.15  ? 241 ASP B N     1 
ATOM   4717 C  CA    . ASP B 1 241 ? 32.805  27.091  79.002 1.00 60.11  ? 241 ASP B CA    1 
ATOM   4718 C  C     . ASP B 1 241 ? 32.282  26.447  80.297 1.00 60.61  ? 241 ASP B C     1 
ATOM   4719 O  O     . ASP B 1 241 ? 33.050  26.174  81.226 1.00 61.59  ? 241 ASP B O     1 
ATOM   4720 C  CB    . ASP B 1 241 ? 33.986  28.021  79.338 1.00 59.78  ? 241 ASP B CB    1 
ATOM   4721 C  CG    . ASP B 1 241 ? 33.638  29.073  80.387 1.00 61.17  ? 241 ASP B CG    1 
ATOM   4722 O  OD1   . ASP B 1 241 ? 32.556  28.991  81.001 1.00 60.90  ? 241 ASP B OD1   1 
ATOM   4723 O  OD2   . ASP B 1 241 ? 34.457  29.991  80.607 1.00 61.92  ? 241 ASP B OD2   1 
ATOM   4724 N  N     . GLY B 1 242 ? 30.978  26.209  80.359 1.00 61.00  ? 242 GLY B N     1 
ATOM   4725 C  CA    . GLY B 1 242 ? 30.399  25.608  81.548 1.00 60.76  ? 242 GLY B CA    1 
ATOM   4726 C  C     . GLY B 1 242 ? 29.817  26.636  82.502 1.00 60.39  ? 242 GLY B C     1 
ATOM   4727 O  O     . GLY B 1 242 ? 28.840  26.362  83.203 1.00 59.97  ? 242 GLY B O     1 
ATOM   4728 N  N     . ILE B 1 243 ? 30.414  27.825  82.532 1.00 59.89  ? 243 ILE B N     1 
ATOM   4729 C  CA    . ILE B 1 243 ? 29.939  28.892  83.404 1.00 59.10  ? 243 ILE B CA    1 
ATOM   4730 C  C     . ILE B 1 243 ? 29.620  30.177  82.644 1.00 58.15  ? 243 ILE B C     1 
ATOM   4731 O  O     . ILE B 1 243 ? 28.641  30.862  82.945 1.00 58.22  ? 243 ILE B O     1 
ATOM   4732 C  CB    . ILE B 1 243 ? 30.982  29.215  84.507 1.00 59.82  ? 243 ILE B CB    1 
ATOM   4733 C  CG1   . ILE B 1 243 ? 31.294  27.947  85.304 0.00 60.18  ? 243 ILE B CG1   1 
ATOM   4734 C  CG2   . ILE B 1 243 ? 30.451  30.302  85.433 0.00 59.74  ? 243 ILE B CG2   1 
ATOM   4735 C  CD1   . ILE B 1 243 ? 30.063  27.245  85.841 1.00 61.52  ? 243 ILE B CD1   1 
ATOM   4736 N  N     . LYS B 1 244 ? 30.432  30.490  81.644 1.00 57.07  ? 244 LYS B N     1 
ATOM   4737 C  CA    . LYS B 1 244 ? 30.253  31.720  80.877 1.00 56.46  ? 244 LYS B CA    1 
ATOM   4738 C  C     . LYS B 1 244 ? 30.593  31.511  79.404 1.00 53.96  ? 244 LYS B C     1 
ATOM   4739 O  O     . LYS B 1 244 ? 31.179  30.489  79.047 1.00 54.10  ? 244 LYS B O     1 
ATOM   4740 C  CB    . LYS B 1 244 ? 31.174  32.786  81.484 1.00 58.23  ? 244 LYS B CB    1 
ATOM   4741 C  CG    . LYS B 1 244 ? 31.249  34.108  80.761 1.00 63.12  ? 244 LYS B CG    1 
ATOM   4742 C  CD    . LYS B 1 244 ? 32.237  35.033  81.470 1.00 64.74  ? 244 LYS B CD    1 
ATOM   4743 C  CE    . LYS B 1 244 ? 32.482  36.310  80.675 1.00 65.20  ? 244 LYS B CE    1 
ATOM   4744 N  NZ    . LYS B 1 244 ? 33.188  36.052  79.394 1.00 67.28  ? 244 LYS B NZ    1 
ATOM   4745 N  N     . PHE B 1 245 ? 30.218  32.462  78.547 1.00 50.54  ? 245 PHE B N     1 
ATOM   4746 C  CA    . PHE B 1 245 ? 30.570  32.355  77.136 1.00 48.01  ? 245 PHE B CA    1 
ATOM   4747 C  C     . PHE B 1 245 ? 31.902  33.034  76.880 1.00 48.08  ? 245 PHE B C     1 
ATOM   4748 O  O     . PHE B 1 245 ? 32.074  34.219  77.202 1.00 47.93  ? 245 PHE B O     1 
ATOM   4749 C  CB    . PHE B 1 245 ? 29.527  33.013  76.235 1.00 45.96  ? 245 PHE B CB    1 
ATOM   4750 C  CG    . PHE B 1 245 ? 28.319  32.171  75.991 1.00 44.83  ? 245 PHE B CG    1 
ATOM   4751 C  CD1   . PHE B 1 245 ? 27.122  32.435  76.650 1.00 44.16  ? 245 PHE B CD1   1 
ATOM   4752 C  CD2   . PHE B 1 245 ? 28.373  31.114  75.093 1.00 44.61  ? 245 PHE B CD2   1 
ATOM   4753 C  CE1   . PHE B 1 245 ? 25.979  31.650  76.412 1.00 45.01  ? 245 PHE B CE1   1 
ATOM   4754 C  CE2   . PHE B 1 245 ? 27.237  30.316  74.841 1.00 44.04  ? 245 PHE B CE2   1 
ATOM   4755 C  CZ    . PHE B 1 245 ? 26.041  30.584  75.500 1.00 44.79  ? 245 PHE B CZ    1 
ATOM   4756 N  N     . LYS B 1 246 ? 32.855  32.281  76.337 1.00 47.11  ? 246 LYS B N     1 
ATOM   4757 C  CA    . LYS B 1 246 ? 34.155  32.848  75.977 1.00 47.96  ? 246 LYS B CA    1 
ATOM   4758 C  C     . LYS B 1 246 ? 33.856  33.639  74.699 1.00 45.26  ? 246 LYS B C     1 
ATOM   4759 O  O     . LYS B 1 246 ? 32.906  33.326  73.998 1.00 43.39  ? 246 LYS B O     1 
ATOM   4760 C  CB    . LYS B 1 246 ? 35.169  31.753  75.660 1.00 51.10  ? 246 LYS B CB    1 
ATOM   4761 C  CG    . LYS B 1 246 ? 35.576  30.878  76.830 1.00 56.59  ? 246 LYS B CG    1 
ATOM   4762 C  CD    . LYS B 1 246 ? 36.439  29.729  76.319 1.00 58.73  ? 246 LYS B CD    1 
ATOM   4763 C  CE    . LYS B 1 246 ? 36.886  28.811  77.446 1.00 62.22  ? 246 LYS B CE    1 
ATOM   4764 N  NZ    . LYS B 1 246 ? 37.531  27.555  76.937 1.00 63.68  ? 246 LYS B NZ    1 
ATOM   4765 N  N     . GLU B 1 247 ? 34.679  34.629  74.381 1.00 45.18  ? 247 GLU B N     1 
ATOM   4766 C  CA    . GLU B 1 247 ? 34.436  35.475  73.206 1.00 44.14  ? 247 GLU B CA    1 
ATOM   4767 C  C     . GLU B 1 247 ? 35.555  35.609  72.230 1.00 42.40  ? 247 GLU B C     1 
ATOM   4768 O  O     . GLU B 1 247 ? 36.723  35.640  72.601 1.00 41.42  ? 247 GLU B O     1 
ATOM   4769 C  CB    . GLU B 1 247 ? 34.145  36.898  73.618 1.00 43.46  ? 247 GLU B CB    1 
ATOM   4770 C  CG    . GLU B 1 247 ? 32.794  37.140  74.084 1.00 46.48  ? 247 GLU B CG    1 
ATOM   4771 C  CD    . GLU B 1 247 ? 32.660  38.540  74.583 1.00 44.43  ? 247 GLU B CD    1 
ATOM   4772 O  OE1   . GLU B 1 247 ? 31.548  38.875  75.018 1.00 48.16  ? 247 GLU B OE1   1 
ATOM   4773 O  OE2   . GLU B 1 247 ? 33.663  39.292  74.541 1.00 43.98  ? 247 GLU B OE2   1 
ATOM   4774 N  N     . ARG B 1 248 ? 35.162  35.781  70.978 1.00 42.26  ? 248 ARG B N     1 
ATOM   4775 C  CA    . ARG B 1 248 ? 36.101  35.986  69.894 1.00 43.25  ? 248 ARG B CA    1 
ATOM   4776 C  C     . ARG B 1 248 ? 35.414  36.955  68.930 1.00 41.78  ? 248 ARG B C     1 
ATOM   4777 O  O     . ARG B 1 248 ? 34.296  36.698  68.472 1.00 41.73  ? 248 ARG B O     1 
ATOM   4778 C  CB    . ARG B 1 248 ? 36.391  34.643  69.219 1.00 44.61  ? 248 ARG B CB    1 
ATOM   4779 C  CG    . ARG B 1 248 ? 37.437  34.671  68.141 1.00 47.41  ? 248 ARG B CG    1 
ATOM   4780 C  CD    . ARG B 1 248 ? 37.633  33.266  67.591 0.00 46.99  ? 248 ARG B CD    1 
ATOM   4781 N  NE    . ARG B 1 248 ? 38.501  33.236  66.420 0.00 47.61  ? 248 ARG B NE    1 
ATOM   4782 C  CZ    . ARG B 1 248 ? 38.864  32.123  65.790 0.00 47.75  ? 248 ARG B CZ    1 
ATOM   4783 N  NH1   . ARG B 1 248 ? 39.658  32.187  64.730 0.00 47.90  ? 248 ARG B NH1   1 
ATOM   4784 N  NH2   . ARG B 1 248 ? 38.436  30.945  66.222 0.00 47.90  ? 248 ARG B NH2   1 
ATOM   4785 N  N     . TYR B 1 249 ? 36.058  38.079  68.655 1.00 40.69  ? 249 TYR B N     1 
ATOM   4786 C  CA    . TYR B 1 249 ? 35.490  39.055  67.729 1.00 41.64  ? 249 TYR B CA    1 
ATOM   4787 C  C     . TYR B 1 249 ? 35.930  38.815  66.289 1.00 39.16  ? 249 TYR B C     1 
ATOM   4788 O  O     . TYR B 1 249 ? 37.072  38.457  66.034 1.00 38.64  ? 249 TYR B O     1 
ATOM   4789 C  CB    . TYR B 1 249 ? 35.858  40.480  68.153 1.00 46.29  ? 249 TYR B CB    1 
ATOM   4790 C  CG    . TYR B 1 249 ? 34.942  40.999  69.240 1.00 53.38  ? 249 TYR B CG    1 
ATOM   4791 C  CD1   . TYR B 1 249 ? 35.231  40.799  70.589 1.00 55.84  ? 249 TYR B CD1   1 
ATOM   4792 C  CD2   . TYR B 1 249 ? 33.741  41.620  68.912 1.00 56.17  ? 249 TYR B CD2   1 
ATOM   4793 C  CE1   . TYR B 1 249 ? 34.339  41.200  71.584 1.00 58.68  ? 249 TYR B CE1   1 
ATOM   4794 C  CE2   . TYR B 1 249 ? 32.848  42.024  69.894 1.00 59.40  ? 249 TYR B CE2   1 
ATOM   4795 C  CZ    . TYR B 1 249 ? 33.147  41.808  71.224 1.00 59.91  ? 249 TYR B CZ    1 
ATOM   4796 O  OH    . TYR B 1 249 ? 32.213  42.170  72.176 1.00 64.29  ? 249 TYR B OH    1 
ATOM   4797 N  N     . GLY B 1 250 ? 35.007  38.994  65.356 1.00 36.85  ? 250 GLY B N     1 
ATOM   4798 C  CA    . GLY B 1 250 ? 35.319  38.797  63.959 1.00 36.59  ? 250 GLY B CA    1 
ATOM   4799 C  C     . GLY B 1 250 ? 35.916  40.052  63.355 1.00 36.83  ? 250 GLY B C     1 
ATOM   4800 O  O     . GLY B 1 250 ? 36.423  40.912  64.095 1.00 36.13  ? 250 GLY B O     1 
ATOM   4801 N  N     . VAL B 1 251 ? 35.853  40.171  62.027 1.00 35.47  ? 251 VAL B N     1 
ATOM   4802 C  CA    . VAL B 1 251 ? 36.398  41.349  61.359 1.00 35.61  ? 251 VAL B CA    1 
ATOM   4803 C  C     . VAL B 1 251 ? 35.299  42.296  60.933 1.00 34.04  ? 251 VAL B C     1 
ATOM   4804 O  O     . VAL B 1 251 ? 34.185  41.879  60.644 1.00 35.05  ? 251 VAL B O     1 
ATOM   4805 C  CB    . VAL B 1 251 ? 37.247  40.975  60.111 1.00 36.11  ? 251 VAL B CB    1 
ATOM   4806 C  CG1   . VAL B 1 251 ? 38.342  40.013  60.507 1.00 37.26  ? 251 VAL B CG1   1 
ATOM   4807 C  CG2   . VAL B 1 251 ? 36.373  40.368  59.043 1.00 39.06  ? 251 VAL B CG2   1 
ATOM   4808 N  N     . ASN B 1 252 ? 35.606  43.582  60.940 1.00 32.60  ? 252 ASN B N     1 
ATOM   4809 C  CA    . ASN B 1 252 ? 34.642  44.581  60.508 1.00 34.06  ? 252 ASN B CA    1 
ATOM   4810 C  C     . ASN B 1 252 ? 34.480  44.446  58.982 1.00 31.53  ? 252 ASN B C     1 
ATOM   4811 O  O     . ASN B 1 252 ? 35.383  43.940  58.316 1.00 29.50  ? 252 ASN B O     1 
ATOM   4812 C  CB    . ASN B 1 252 ? 35.150  45.989  60.878 1.00 37.30  ? 252 ASN B CB    1 
ATOM   4813 C  CG    . ASN B 1 252 ? 35.379  46.150  62.381 1.00 40.29  ? 252 ASN B CG    1 
ATOM   4814 O  OD1   . ASN B 1 252 ? 34.514  45.832  63.191 1.00 42.69  ? 252 ASN B OD1   1 
ATOM   4815 N  ND2   . ASN B 1 252 ? 36.547  46.637  62.750 1.00 42.34  ? 252 ASN B ND2   1 
ATOM   4816 N  N     . LYS B 1 253 ? 33.327  44.876  58.466 1.00 29.85  ? 253 LYS B N     1 
ATOM   4817 C  CA    . LYS B 1 253 ? 32.995  44.843  57.034 1.00 29.78  ? 253 LYS B CA    1 
ATOM   4818 C  C     . LYS B 1 253 ? 32.966  46.258  56.416 1.00 30.55  ? 253 LYS B C     1 
ATOM   4819 O  O     . LYS B 1 253 ? 32.524  47.206  57.045 1.00 30.13  ? 253 LYS B O     1 
ATOM   4820 C  CB    . LYS B 1 253 ? 31.620  44.198  56.843 1.00 30.37  ? 253 LYS B CB    1 
ATOM   4821 C  CG    . LYS B 1 253 ? 31.404  42.893  57.645 1.00 26.80  ? 253 LYS B CG    1 
ATOM   4822 C  CD    . LYS B 1 253 ? 32.476  41.840  57.316 1.00 26.46  ? 253 LYS B CD    1 
ATOM   4823 C  CE    . LYS B 1 253 ? 32.432  41.429  55.838 1.00 24.86  ? 253 LYS B CE    1 
ATOM   4824 N  NZ    . LYS B 1 253 ? 33.495  40.416  55.505 1.00 24.28  ? 253 LYS B NZ    1 
ATOM   4825 N  N     . GLY B 1 254 ? 33.438  46.398  55.178 1.00 32.18  ? 254 GLY B N     1 
ATOM   4826 C  CA    . GLY B 1 254 ? 33.427  47.697  54.520 1.00 28.73  ? 254 GLY B CA    1 
ATOM   4827 C  C     . GLY B 1 254 ? 34.259  47.625  53.265 1.00 28.64  ? 254 GLY B C     1 
ATOM   4828 O  O     . GLY B 1 254 ? 34.304  46.577  52.611 1.00 28.01  ? 254 GLY B O     1 
ATOM   4829 N  N     . PHE B 1 255 ? 34.903  48.736  52.905 1.00 28.75  ? 255 PHE B N     1 
ATOM   4830 C  CA    . PHE B 1 255 ? 35.766  48.759  51.727 1.00 28.43  ? 255 PHE B CA    1 
ATOM   4831 C  C     . PHE B 1 255 ? 36.874  49.785  51.948 1.00 29.43  ? 255 PHE B C     1 
ATOM   4832 O  O     . PHE B 1 255 ? 37.008  50.335  53.039 1.00 30.39  ? 255 PHE B O     1 
ATOM   4833 C  CB    . PHE B 1 255 ? 34.955  49.081  50.464 1.00 25.75  ? 255 PHE B CB    1 
ATOM   4834 C  CG    . PHE B 1 255 ? 34.377  50.470  50.442 1.00 25.73  ? 255 PHE B CG    1 
ATOM   4835 C  CD1   . PHE B 1 255 ? 34.958  51.468  49.660 1.00 26.52  ? 255 PHE B CD1   1 
ATOM   4836 C  CD2   . PHE B 1 255 ? 33.270  50.786  51.210 1.00 26.64  ? 255 PHE B CD2   1 
ATOM   4837 C  CE1   . PHE B 1 255 ? 34.438  52.769  49.652 1.00 29.21  ? 255 PHE B CE1   1 
ATOM   4838 C  CE2   . PHE B 1 255 ? 32.743  52.085  51.205 1.00 28.73  ? 255 PHE B CE2   1 
ATOM   4839 C  CZ    . PHE B 1 255 ? 33.331  53.069  50.428 1.00 28.98  ? 255 PHE B CZ    1 
ATOM   4840 N  N     . TYR B 1 256 ? 37.665  50.048  50.924 1.00 28.63  ? 256 TYR B N     1 
ATOM   4841 C  CA    . TYR B 1 256 ? 38.751  50.983  51.083 1.00 30.62  ? 256 TYR B CA    1 
ATOM   4842 C  C     . TYR B 1 256 ? 38.745  52.206  50.172 1.00 31.87  ? 256 TYR B C     1 
ATOM   4843 O  O     . TYR B 1 256 ? 38.399  52.125  49.002 1.00 32.13  ? 256 TYR B O     1 
ATOM   4844 C  CB    . TYR B 1 256 ? 40.100  50.264  50.913 1.00 29.05  ? 256 TYR B CB    1 
ATOM   4845 C  CG    . TYR B 1 256 ? 40.467  49.358  52.082 1.00 31.81  ? 256 TYR B CG    1 
ATOM   4846 C  CD1   . TYR B 1 256 ? 39.905  48.087  52.206 1.00 30.14  ? 256 TYR B CD1   1 
ATOM   4847 C  CD2   . TYR B 1 256 ? 41.354  49.787  53.068 1.00 29.20  ? 256 TYR B CD2   1 
ATOM   4848 C  CE1   . TYR B 1 256 ? 40.214  47.268  53.282 1.00 34.07  ? 256 TYR B CE1   1 
ATOM   4849 C  CE2   . TYR B 1 256 ? 41.675  48.978  54.160 1.00 32.39  ? 256 TYR B CE2   1 
ATOM   4850 C  CZ    . TYR B 1 256 ? 41.095  47.720  54.260 1.00 33.85  ? 256 TYR B CZ    1 
ATOM   4851 O  OH    . TYR B 1 256 ? 41.333  46.931  55.351 1.00 34.40  ? 256 TYR B OH    1 
ATOM   4852 N  N     . ILE B 1 257 ? 39.134  53.339  50.751 1.00 32.93  ? 257 ILE B N     1 
ATOM   4853 C  CA    . ILE B 1 257 ? 39.293  54.594  50.019 1.00 33.45  ? 257 ILE B CA    1 
ATOM   4854 C  C     . ILE B 1 257 ? 40.807  54.731  50.035 1.00 31.99  ? 257 ILE B C     1 
ATOM   4855 O  O     . ILE B 1 257 ? 41.428  54.728  51.100 1.00 33.16  ? 257 ILE B O     1 
ATOM   4856 C  CB    . ILE B 1 257 ? 38.637  55.761  50.762 1.00 33.73  ? 257 ILE B CB    1 
ATOM   4857 C  CG1   . ILE B 1 257 ? 37.121  55.641  50.634 1.00 34.09  ? 257 ILE B CG1   1 
ATOM   4858 C  CG2   . ILE B 1 257 ? 39.107  57.093  50.189 1.00 34.19  ? 257 ILE B CG2   1 
ATOM   4859 C  CD1   . ILE B 1 257 ? 36.610  55.971  49.272 1.00 34.69  ? 257 ILE B CD1   1 
ATOM   4860 N  N     . VAL B 1 258 ? 41.396  54.791  48.852 1.00 32.21  ? 258 VAL B N     1 
ATOM   4861 C  CA    . VAL B 1 258 ? 42.835  54.881  48.698 1.00 32.63  ? 258 VAL B CA    1 
ATOM   4862 C  C     . VAL B 1 258 ? 43.182  56.284  48.202 1.00 35.37  ? 258 VAL B C     1 
ATOM   4863 O  O     . VAL B 1 258 ? 42.733  56.718  47.146 1.00 35.63  ? 258 VAL B O     1 
ATOM   4864 C  CB    . VAL B 1 258 ? 43.336  53.786  47.716 1.00 33.36  ? 258 VAL B CB    1 
ATOM   4865 C  CG1   . VAL B 1 258 ? 44.874  53.735  47.696 1.00 29.78  ? 258 VAL B CG1   1 
ATOM   4866 C  CG2   . VAL B 1 258 ? 42.736  52.417  48.120 1.00 29.90  ? 258 VAL B CG2   1 
ATOM   4867 N  N     . GLU B 1 259 ? 43.981  56.976  49.009 1.00 37.28  ? 259 GLU B N     1 
ATOM   4868 C  CA    . GLU B 1 259 ? 44.401  58.357  48.783 1.00 38.94  ? 259 GLU B CA    1 
ATOM   4869 C  C     . GLU B 1 259 ? 45.915  58.422  48.617 1.00 37.37  ? 259 GLU B C     1 
ATOM   4870 O  O     . GLU B 1 259 ? 46.638  58.215  49.571 1.00 36.83  ? 259 GLU B O     1 
ATOM   4871 C  CB    . GLU B 1 259 ? 43.976  59.182  50.007 1.00 41.59  ? 259 GLU B CB    1 
ATOM   4872 C  CG    . GLU B 1 259 ? 42.464  59.150  50.245 1.00 49.14  ? 259 GLU B CG    1 
ATOM   4873 C  CD    . GLU B 1 259 ? 42.023  59.372  51.712 1.00 51.99  ? 259 GLU B CD    1 
ATOM   4874 O  OE1   . GLU B 1 259 ? 40.932  59.963  51.894 1.00 51.62  ? 259 GLU B OE1   1 
ATOM   4875 O  OE2   . GLU B 1 259 ? 42.729  58.940  52.666 1.00 53.01  ? 259 GLU B OE2   1 
ATOM   4876 N  N     . ASP B 1 260 ? 46.382  58.714  47.411 1.00 37.04  ? 260 ASP B N     1 
ATOM   4877 C  CA    . ASP B 1 260 ? 47.810  58.766  47.137 1.00 38.41  ? 260 ASP B CA    1 
ATOM   4878 C  C     . ASP B 1 260 ? 48.412  57.406  47.471 1.00 39.12  ? 260 ASP B C     1 
ATOM   4879 O  O     . ASP B 1 260 ? 49.485  57.298  48.067 1.00 38.30  ? 260 ASP B O     1 
ATOM   4880 C  CB    . ASP B 1 260 ? 48.475  59.902  47.939 1.00 40.61  ? 260 ASP B CB    1 
ATOM   4881 C  CG    . ASP B 1 260 ? 47.937  61.264  47.538 1.00 41.05  ? 260 ASP B CG    1 
ATOM   4882 O  OD1   . ASP B 1 260 ? 47.336  61.971  48.378 1.00 40.40  ? 260 ASP B OD1   1 
ATOM   4883 O  OD2   . ASP B 1 260 ? 48.089  61.612  46.348 1.00 45.19  ? 260 ASP B OD2   1 
ATOM   4884 N  N     . PHE B 1 261 ? 47.682  56.365  47.067 1.00 38.42  ? 261 PHE B N     1 
ATOM   4885 C  CA    . PHE B 1 261 ? 48.076  54.986  47.271 1.00 37.83  ? 261 PHE B CA    1 
ATOM   4886 C  C     . PHE B 1 261 ? 48.189  54.534  48.721 1.00 36.42  ? 261 PHE B C     1 
ATOM   4887 O  O     . PHE B 1 261 ? 48.862  53.557  49.003 1.00 37.31  ? 261 PHE B O     1 
ATOM   4888 C  CB    . PHE B 1 261 ? 49.381  54.701  46.540 1.00 37.63  ? 261 PHE B CB    1 
ATOM   4889 C  CG    . PHE B 1 261 ? 49.353  55.089  45.090 1.00 40.22  ? 261 PHE B CG    1 
ATOM   4890 C  CD1   . PHE B 1 261 ? 50.110  56.175  44.630 1.00 40.36  ? 261 PHE B CD1   1 
ATOM   4891 C  CD2   . PHE B 1 261 ? 48.571  54.377  44.182 1.00 38.30  ? 261 PHE B CD2   1 
ATOM   4892 C  CE1   . PHE B 1 261 ? 50.089  56.550  43.276 1.00 42.55  ? 261 PHE B CE1   1 
ATOM   4893 C  CE2   . PHE B 1 261 ? 48.536  54.737  42.830 1.00 41.04  ? 261 PHE B CE2   1 
ATOM   4894 C  CZ    . PHE B 1 261 ? 49.295  55.829  42.370 1.00 40.91  ? 261 PHE B CZ    1 
ATOM   4895 N  N     . LYS B 1 262 ? 47.534  55.244  49.627 1.00 36.26  ? 262 LYS B N     1 
ATOM   4896 C  CA    . LYS B 1 262 ? 47.524  54.889  51.057 1.00 36.60  ? 262 LYS B CA    1 
ATOM   4897 C  C     . LYS B 1 262 ? 46.100  54.419  51.324 1.00 36.05  ? 262 LYS B C     1 
ATOM   4898 O  O     . LYS B 1 262 ? 45.165  55.215  51.257 1.00 33.13  ? 262 LYS B O     1 
ATOM   4899 C  CB    . LYS B 1 262 ? 47.791  56.110  51.937 1.00 38.00  ? 262 LYS B CB    1 
ATOM   4900 C  CG    . LYS B 1 262 ? 49.192  56.653  51.833 1.00 44.05  ? 262 LYS B CG    1 
ATOM   4901 C  CD    . LYS B 1 262 ? 50.042  56.099  52.947 1.00 50.52  ? 262 LYS B CD    1 
ATOM   4902 C  CE    . LYS B 1 262 ? 49.583  56.633  54.320 1.00 52.05  ? 262 LYS B CE    1 
ATOM   4903 N  NZ    . LYS B 1 262 ? 50.596  56.296  55.357 1.00 52.84  ? 262 LYS B NZ    1 
ATOM   4904 N  N     . PRO B 1 263 ? 45.915  53.123  51.613 1.00 35.03  ? 263 PRO B N     1 
ATOM   4905 C  CA    . PRO B 1 263 ? 44.566  52.623  51.869 1.00 34.75  ? 263 PRO B CA    1 
ATOM   4906 C  C     . PRO B 1 263 ? 43.991  52.977  53.232 1.00 35.23  ? 263 PRO B C     1 
ATOM   4907 O  O     . PRO B 1 263 ? 44.628  52.782  54.252 1.00 34.85  ? 263 PRO B O     1 
ATOM   4908 C  CB    . PRO B 1 263 ? 44.719  51.107  51.690 1.00 34.33  ? 263 PRO B CB    1 
ATOM   4909 C  CG    . PRO B 1 263 ? 46.086  50.863  52.202 1.00 36.06  ? 263 PRO B CG    1 
ATOM   4910 C  CD    . PRO B 1 263 ? 46.883  52.011  51.578 1.00 34.77  ? 263 PRO B CD    1 
ATOM   4911 N  N     . ARG B 1 264 ? 42.767  53.485  53.225 1.00 34.96  ? 264 ARG B N     1 
ATOM   4912 C  CA    . ARG B 1 264 ? 42.070  53.831  54.446 1.00 35.17  ? 264 ARG B CA    1 
ATOM   4913 C  C     . ARG B 1 264 ? 40.760  53.025  54.429 1.00 34.06  ? 264 ARG B C     1 
ATOM   4914 O  O     . ARG B 1 264 ? 39.989  53.065  53.469 1.00 34.12  ? 264 ARG B O     1 
ATOM   4915 C  CB    . ARG B 1 264 ? 41.804  55.343  54.476 1.00 34.75  ? 264 ARG B CB    1 
ATOM   4916 C  CG    . ARG B 1 264 ? 40.827  55.801  55.531 1.00 37.48  ? 264 ARG B CG    1 
ATOM   4917 C  CD    . ARG B 1 264 ? 40.870  57.330  55.687 1.00 38.35  ? 264 ARG B CD    1 
ATOM   4918 N  NE    . ARG B 1 264 ? 40.455  58.070  54.488 1.00 36.61  ? 264 ARG B NE    1 
ATOM   4919 C  CZ    . ARG B 1 264 ? 39.190  58.224  54.103 1.00 36.88  ? 264 ARG B CZ    1 
ATOM   4920 N  NH1   . ARG B 1 264 ? 38.906  58.915  53.006 1.00 37.65  ? 264 ARG B NH1   1 
ATOM   4921 N  NH2   . ARG B 1 264 ? 38.203  57.694  54.816 1.00 37.99  ? 264 ARG B NH2   1 
ATOM   4922 N  N     . PHE B 1 265 ? 40.525  52.288  55.499 1.00 33.67  ? 265 PHE B N     1 
ATOM   4923 C  CA    . PHE B 1 265 ? 39.345  51.472  55.621 1.00 34.64  ? 265 PHE B CA    1 
ATOM   4924 C  C     . PHE B 1 265 ? 38.131  52.304  55.918 1.00 35.93  ? 265 PHE B C     1 
ATOM   4925 O  O     . PHE B 1 265 ? 38.190  53.227  56.723 1.00 38.18  ? 265 PHE B O     1 
ATOM   4926 C  CB    . PHE B 1 265 ? 39.534  50.467  56.745 1.00 35.52  ? 265 PHE B CB    1 
ATOM   4927 C  CG    . PHE B 1 265 ? 38.372  49.525  56.928 1.00 37.05  ? 265 PHE B CG    1 
ATOM   4928 C  CD1   . PHE B 1 265 ? 37.951  48.703  55.879 1.00 36.13  ? 265 PHE B CD1   1 
ATOM   4929 C  CD2   . PHE B 1 265 ? 37.729  49.424  58.160 1.00 39.15  ? 265 PHE B CD2   1 
ATOM   4930 C  CE1   . PHE B 1 265 ? 36.927  47.803  56.049 1.00 35.17  ? 265 PHE B CE1   1 
ATOM   4931 C  CE2   . PHE B 1 265 ? 36.682  48.515  58.345 1.00 37.89  ? 265 PHE B CE2   1 
ATOM   4932 C  CZ    . PHE B 1 265 ? 36.283  47.703  57.287 1.00 37.20  ? 265 PHE B CZ    1 
ATOM   4933 N  N     . VAL B 1 266 ? 37.021  51.977  55.267 1.00 36.43  ? 266 VAL B N     1 
ATOM   4934 C  CA    . VAL B 1 266 ? 35.756  52.665  55.512 1.00 34.81  ? 266 VAL B CA    1 
ATOM   4935 C  C     . VAL B 1 266 ? 34.778  51.571  55.908 1.00 36.29  ? 266 VAL B C     1 
ATOM   4936 O  O     . VAL B 1 266 ? 34.392  50.731  55.093 1.00 35.01  ? 266 VAL B O     1 
ATOM   4937 C  CB    . VAL B 1 266 ? 35.235  53.358  54.263 1.00 34.73  ? 266 VAL B CB    1 
ATOM   4938 C  CG1   . VAL B 1 266 ? 33.830  53.961  54.535 1.00 31.26  ? 266 VAL B CG1   1 
ATOM   4939 C  CG2   . VAL B 1 266 ? 36.232  54.433  53.839 1.00 34.80  ? 266 VAL B CG2   1 
ATOM   4940 N  N     . GLU B 1 267 ? 34.397  51.566  57.171 1.00 37.79  ? 267 GLU B N     1 
ATOM   4941 C  CA    . GLU B 1 267 ? 33.475  50.562  57.675 1.00 40.19  ? 267 GLU B CA    1 
ATOM   4942 C  C     . GLU B 1 267 ? 32.028  50.908  57.445 1.00 41.30  ? 267 GLU B C     1 
ATOM   4943 O  O     . GLU B 1 267 ? 31.605  52.052  57.575 1.00 40.46  ? 267 GLU B O     1 
ATOM   4944 C  CB    . GLU B 1 267 ? 33.715  50.331  59.170 1.00 42.56  ? 267 GLU B CB    1 
ATOM   4945 C  CG    . GLU B 1 267 ? 32.619  49.532  59.889 1.00 46.65  ? 267 GLU B CG    1 
ATOM   4946 C  CD    . GLU B 1 267 ? 33.065  49.033  61.268 1.00 49.07  ? 267 GLU B CD    1 
ATOM   4947 O  OE1   . GLU B 1 267 ? 33.654  49.823  62.038 1.00 51.43  ? 267 GLU B OE1   1 
ATOM   4948 O  OE2   . GLU B 1 267 ? 32.827  47.846  61.583 1.00 52.78  ? 267 GLU B OE2   1 
ATOM   4949 N  N     . ILE B 1 268 ? 31.264  49.898  57.078 1.00 43.05  ? 268 ILE B N     1 
ATOM   4950 C  CA    . ILE B 1 268 ? 29.846  50.069  56.874 1.00 44.56  ? 268 ILE B CA    1 
ATOM   4951 C  C     . ILE B 1 268 ? 29.228  49.031  57.797 1.00 45.59  ? 268 ILE B C     1 
ATOM   4952 O  O     . ILE B 1 268 ? 29.431  47.835  57.603 1.00 45.35  ? 268 ILE B O     1 
ATOM   4953 C  CB    . ILE B 1 268 ? 29.463  49.793  55.437 1.00 45.06  ? 268 ILE B CB    1 
ATOM   4954 C  CG1   . ILE B 1 268 ? 30.217  50.769  54.520 1.00 44.80  ? 268 ILE B CG1   1 
ATOM   4955 C  CG2   . ILE B 1 268 ? 27.954  49.928  55.287 1.00 46.78  ? 268 ILE B CG2   1 
ATOM   4956 C  CD1   . ILE B 1 268 ? 29.936  50.581  53.042 1.00 47.79  ? 268 ILE B CD1   1 
ATOM   4957 N  N     . LYS B 1 269 ? 28.519  49.493  58.828 1.00 45.99  ? 269 LYS B N     1 
ATOM   4958 C  CA    . LYS B 1 269 ? 27.919  48.577  59.795 1.00 45.15  ? 269 LYS B CA    1 
ATOM   4959 C  C     . LYS B 1 269 ? 26.937  47.701  59.056 1.00 42.21  ? 269 LYS B C     1 
ATOM   4960 O  O     . LYS B 1 269 ? 26.208  48.162  58.190 1.00 42.48  ? 269 LYS B O     1 
ATOM   4961 C  CB    . LYS B 1 269 ? 27.231  49.342  60.930 1.00 47.25  ? 269 LYS B CB    1 
ATOM   4962 C  CG    . LYS B 1 269 ? 28.206  50.042  61.887 1.00 48.92  ? 269 LYS B CG    1 
ATOM   4963 C  CD    . LYS B 1 269 ? 29.129  49.045  62.613 1.00 51.78  ? 269 LYS B CD    1 
ATOM   4964 C  CE    . LYS B 1 269 ? 30.006  49.771  63.645 1.00 51.86  ? 269 LYS B CE    1 
ATOM   4965 N  NZ    . LYS B 1 269 ? 31.036  48.898  64.280 1.00 52.90  ? 269 LYS B NZ    1 
ATOM   4966 N  N     . VAL B 1 270 ? 26.918  46.429  59.401 1.00 37.47  ? 270 VAL B N     1 
ATOM   4967 C  CA    . VAL B 1 270 ? 26.049  45.525  58.691 1.00 35.79  ? 270 VAL B CA    1 
ATOM   4968 C  C     . VAL B 1 270 ? 25.403  44.537  59.664 1.00 34.47  ? 270 VAL B C     1 
ATOM   4969 O  O     . VAL B 1 270 ? 25.822  44.432  60.809 1.00 34.29  ? 270 VAL B O     1 
ATOM   4970 C  CB    . VAL B 1 270 ? 26.912  44.854  57.585 1.00 37.55  ? 270 VAL B CB    1 
ATOM   4971 C  CG1   . VAL B 1 270 ? 27.544  43.578  58.077 1.00 35.06  ? 270 VAL B CG1   1 
ATOM   4972 C  CG2   . VAL B 1 270 ? 26.131  44.718  56.354 1.00 39.42  ? 270 VAL B CG2   1 
ATOM   4973 N  N     . ARG B 1 271 ? 24.367  43.839  59.222 1.00 33.41  ? 271 ARG B N     1 
ATOM   4974 C  CA    . ARG B 1 271 ? 23.666  42.891  60.084 1.00 33.86  ? 271 ARG B CA    1 
ATOM   4975 C  C     . ARG B 1 271 ? 24.646  41.927  60.774 1.00 33.39  ? 271 ARG B C     1 
ATOM   4976 O  O     . ARG B 1 271 ? 25.517  41.356  60.140 1.00 32.29  ? 271 ARG B O     1 
ATOM   4977 C  CB    . ARG B 1 271 ? 22.637  42.106  59.256 1.00 34.21  ? 271 ARG B CB    1 
ATOM   4978 C  CG    . ARG B 1 271 ? 21.772  41.156  60.052 1.00 34.23  ? 271 ARG B CG    1 
ATOM   4979 C  CD    . ARG B 1 271 ? 21.010  40.200  59.126 1.00 33.59  ? 271 ARG B CD    1 
ATOM   4980 N  NE    . ARG B 1 271 ? 19.956  40.882  58.379 1.00 35.38  ? 271 ARG B NE    1 
ATOM   4981 C  CZ    . ARG B 1 271 ? 18.744  41.146  58.863 1.00 39.25  ? 271 ARG B CZ    1 
ATOM   4982 N  NH1   . ARG B 1 271 ? 17.855  41.773  58.105 1.00 39.21  ? 271 ARG B NH1   1 
ATOM   4983 N  NH2   . ARG B 1 271 ? 18.415  40.770  60.100 1.00 38.03  ? 271 ARG B NH2   1 
ATOM   4984 N  N     . PRO B 1 272 ? 24.535  41.770  62.103 1.00 33.66  ? 272 PRO B N     1 
ATOM   4985 C  CA    . PRO B 1 272 ? 25.470  40.847  62.760 1.00 33.03  ? 272 PRO B CA    1 
ATOM   4986 C  C     . PRO B 1 272 ? 25.138  39.344  62.607 1.00 32.51  ? 272 PRO B C     1 
ATOM   4987 O  O     . PRO B 1 272 ? 23.978  38.956  62.563 1.00 31.50  ? 272 PRO B O     1 
ATOM   4988 C  CB    . PRO B 1 272 ? 25.437  41.296  64.225 1.00 33.30  ? 272 PRO B CB    1 
ATOM   4989 C  CG    . PRO B 1 272 ? 24.084  41.880  64.375 1.00 33.63  ? 272 PRO B CG    1 
ATOM   4990 C  CD    . PRO B 1 272 ? 23.837  42.619  63.086 1.00 31.30  ? 272 PRO B CD    1 
ATOM   4991 N  N     . PHE B 1 273 ? 26.192  38.540  62.509 1.00 31.80  ? 273 PHE B N     1 
ATOM   4992 C  CA    . PHE B 1 273 ? 26.126  37.085  62.412 1.00 31.52  ? 273 PHE B CA    1 
ATOM   4993 C  C     . PHE B 1 273 ? 26.787  36.668  63.705 1.00 32.06  ? 273 PHE B C     1 
ATOM   4994 O  O     . PHE B 1 273 ? 27.909  37.074  63.976 1.00 31.12  ? 273 PHE B O     1 
ATOM   4995 C  CB    . PHE B 1 273 ? 26.988  36.543  61.251 1.00 30.23  ? 273 PHE B CB    1 
ATOM   4996 C  CG    . PHE B 1 273 ? 26.318  36.593  59.881 1.00 27.64  ? 273 PHE B CG    1 
ATOM   4997 C  CD1   . PHE B 1 273 ? 25.292  37.483  59.612 1.00 28.84  ? 273 PHE B CD1   1 
ATOM   4998 C  CD2   . PHE B 1 273 ? 26.725  35.722  58.873 1.00 30.93  ? 273 PHE B CD2   1 
ATOM   4999 C  CE1   . PHE B 1 273 ? 24.659  37.504  58.338 1.00 31.74  ? 273 PHE B CE1   1 
ATOM   5000 C  CE2   . PHE B 1 273 ? 26.117  35.730  57.616 1.00 31.23  ? 273 PHE B CE2   1 
ATOM   5001 C  CZ    . PHE B 1 273 ? 25.076  36.626  57.347 1.00 31.38  ? 273 PHE B CZ    1 
ATOM   5002 N  N     . ILE B 1 274 ? 26.090  35.885  64.516 1.00 34.01  ? 274 ILE B N     1 
ATOM   5003 C  CA    . ILE B 1 274 ? 26.670  35.401  65.753 1.00 35.44  ? 274 ILE B CA    1 
ATOM   5004 C  C     . ILE B 1 274 ? 26.780  33.883  65.697 1.00 36.86  ? 274 ILE B C     1 
ATOM   5005 O  O     . ILE B 1 274 ? 25.792  33.193  65.501 1.00 37.47  ? 274 ILE B O     1 
ATOM   5006 C  CB    . ILE B 1 274 ? 25.809  35.806  66.953 1.00 38.10  ? 274 ILE B CB    1 
ATOM   5007 C  CG1   . ILE B 1 274 ? 25.617  37.331  66.928 1.00 36.94  ? 274 ILE B CG1   1 
ATOM   5008 C  CG2   . ILE B 1 274 ? 26.478  35.310  68.261 1.00 33.89  ? 274 ILE B CG2   1 
ATOM   5009 C  CD1   . ILE B 1 274 ? 24.555  37.810  67.878 1.00 44.24  ? 274 ILE B CD1   1 
ATOM   5010 N  N     . ASP B 1 275 ? 27.992  33.380  65.875 1.00 37.47  ? 275 ASP B N     1 
ATOM   5011 C  CA    . ASP B 1 275 ? 28.267  31.959  65.837 1.00 38.56  ? 275 ASP B CA    1 
ATOM   5012 C  C     . ASP B 1 275 ? 28.400  31.497  67.287 1.00 41.59  ? 275 ASP B C     1 
ATOM   5013 O  O     . ASP B 1 275 ? 29.216  32.043  68.047 1.00 41.03  ? 275 ASP B O     1 
ATOM   5014 C  CB    . ASP B 1 275 ? 29.580  31.719  65.087 1.00 37.88  ? 275 ASP B CB    1 
ATOM   5015 C  CG    . ASP B 1 275 ? 29.712  30.300  64.558 1.00 40.27  ? 275 ASP B CG    1 
ATOM   5016 O  OD1   . ASP B 1 275 ? 30.871  29.878  64.314 1.00 40.95  ? 275 ASP B OD1   1 
ATOM   5017 O  OD2   . ASP B 1 275 ? 28.671  29.625  64.361 1.00 38.05  ? 275 ASP B OD2   1 
ATOM   5018 N  N     . VAL B 1 276 ? 27.622  30.482  67.665 1.00 43.25  ? 276 VAL B N     1 
ATOM   5019 C  CA    . VAL B 1 276 ? 27.632  29.994  69.047 1.00 46.34  ? 276 VAL B CA    1 
ATOM   5020 C  C     . VAL B 1 276 ? 27.867  28.490  69.161 1.00 48.79  ? 276 VAL B C     1 
ATOM   5021 O  O     . VAL B 1 276 ? 27.241  27.700  68.445 1.00 48.75  ? 276 VAL B O     1 
ATOM   5022 C  CB    . VAL B 1 276 ? 26.288  30.297  69.753 1.00 45.02  ? 276 VAL B CB    1 
ATOM   5023 C  CG1   . VAL B 1 276 ? 26.382  29.947  71.245 1.00 45.35  ? 276 VAL B CG1   1 
ATOM   5024 C  CG2   . VAL B 1 276 ? 25.903  31.748  69.553 1.00 43.00  ? 276 VAL B CG2   1 
ATOM   5025 N  N     . LYS B 1 277 ? 28.771  28.106  70.056 1.00 50.80  ? 277 LYS B N     1 
ATOM   5026 C  CA    . LYS B 1 277 ? 29.069  26.695  70.307 1.00 54.40  ? 277 LYS B CA    1 
ATOM   5027 C  C     . LYS B 1 277 ? 28.687  26.321  71.746 1.00 56.41  ? 277 LYS B C     1 
ATOM   5028 O  O     . LYS B 1 277 ? 29.243  26.866  72.703 1.00 54.78  ? 277 LYS B O     1 
ATOM   5029 C  CB    . LYS B 1 277 ? 30.558  26.403  70.112 1.00 54.81  ? 277 LYS B CB    1 
ATOM   5030 C  CG    . LYS B 1 277 ? 31.037  26.435  68.685 1.00 58.25  ? 277 LYS B CG    1 
ATOM   5031 C  CD    . LYS B 1 277 ? 32.550  26.290  68.627 1.00 61.15  ? 277 LYS B CD    1 
ATOM   5032 C  CE    . LYS B 1 277 ? 33.006  24.969  69.256 1.00 65.31  ? 277 LYS B CE    1 
ATOM   5033 N  NZ    . LYS B 1 277 ? 34.500  24.776  69.247 1.00 65.64  ? 277 LYS B NZ    1 
ATOM   5034 N  N     . ILE B 1 278 ? 27.748  25.386  71.895 1.00 59.94  ? 278 ILE B N     1 
ATOM   5035 C  CA    . ILE B 1 278 ? 27.310  24.925  73.214 1.00 63.17  ? 278 ILE B CA    1 
ATOM   5036 C  C     . ILE B 1 278 ? 27.487  23.412  73.341 1.00 66.42  ? 278 ILE B C     1 
ATOM   5037 O  O     . ILE B 1 278 ? 27.219  22.673  72.394 1.00 66.85  ? 278 ILE B O     1 
ATOM   5038 C  CB    . ILE B 1 278 ? 25.820  25.249  73.462 1.00 62.73  ? 278 ILE B CB    1 
ATOM   5039 C  CG1   . ILE B 1 278 ? 25.565  26.735  73.245 1.00 61.35  ? 278 ILE B CG1   1 
ATOM   5040 C  CG2   . ILE B 1 278 ? 25.429  24.905  74.897 1.00 63.27  ? 278 ILE B CG2   1 
ATOM   5041 C  CD1   . ILE B 1 278 ? 24.118  27.102  73.412 1.00 60.82  ? 278 ILE B CD1   1 
ATOM   5042 N  N     . LYS B 1 279 ? 27.939  22.969  74.515 1.00 70.41  ? 279 LYS B N     1 
ATOM   5043 C  CA    . LYS B 1 279 ? 28.167  21.544  74.827 1.00 73.55  ? 279 LYS B CA    1 
ATOM   5044 C  C     . LYS B 1 279 ? 27.481  21.213  76.153 1.00 75.73  ? 279 LYS B C     1 
ATOM   5045 O  O     . LYS B 1 279 ? 27.141  22.112  76.926 1.00 76.64  ? 279 LYS B O     1 
ATOM   5046 C  CB    . LYS B 1 279 ? 29.664  21.237  75.007 1.00 73.37  ? 279 LYS B CB    1 
ATOM   5047 C  CG    . LYS B 1 279 ? 30.449  20.899  73.757 1.00 74.83  ? 279 LYS B CG    1 
ATOM   5048 C  CD    . LYS B 1 279 ? 31.466  19.817  74.103 1.00 75.96  ? 279 LYS B CD    1 
ATOM   5049 C  CE    . LYS B 1 279 ? 32.900  20.232  73.810 1.00 76.92  ? 279 LYS B CE    1 
ATOM   5050 N  NZ    . LYS B 1 279 ? 33.836  19.544  74.748 1.00 77.93  ? 279 LYS B NZ    1 
ATOM   5051 N  N     . GLY B 1 280 ? 27.293  19.925  76.427 1.00 77.51  ? 280 GLY B N     1 
ATOM   5052 C  CA    . GLY B 1 280 ? 26.677  19.537  77.685 1.00 78.43  ? 280 GLY B CA    1 
ATOM   5053 C  C     . GLY B 1 280 ? 25.288  18.940  77.592 1.00 78.82  ? 280 GLY B C     1 
ATOM   5054 O  O     . GLY B 1 280 ? 24.769  18.698  76.499 1.00 79.74  ? 280 GLY B O     1 
ATOM   5055 N  N     . SER B 1 281 ? 24.688  18.707  78.759 1.00 77.83  ? 281 SER B N     1 
ATOM   5056 C  CA    . SER B 1 281 ? 23.354  18.125  78.864 1.00 76.56  ? 281 SER B CA    1 
ATOM   5057 C  C     . SER B 1 281 ? 22.286  19.121  78.477 1.00 76.46  ? 281 SER B C     1 
ATOM   5058 O  O     . SER B 1 281 ? 22.543  20.318  78.397 1.00 76.91  ? 281 SER B O     1 
ATOM   5059 C  CB    . SER B 1 281 ? 23.094  17.666  80.296 1.00 76.99  ? 281 SER B CB    1 
ATOM   5060 O  OG    . SER B 1 281 ? 23.169  18.759  81.198 1.00 75.03  ? 281 SER B OG    1 
ATOM   5061 N  N     . GLU B 1 282 ? 21.078  18.624  78.258 1.00 76.22  ? 282 GLU B N     1 
ATOM   5062 C  CA    . GLU B 1 282 ? 19.974  19.488  77.882 1.00 76.52  ? 282 GLU B CA    1 
ATOM   5063 C  C     . GLU B 1 282 ? 19.755  20.553  78.949 1.00 76.72  ? 282 GLU B C     1 
ATOM   5064 O  O     . GLU B 1 282 ? 19.521  21.720  78.637 1.00 77.74  ? 282 GLU B O     1 
ATOM   5065 C  CB    . GLU B 1 282 ? 18.702  18.666  77.703 1.00 76.64  ? 282 GLU B CB    1 
ATOM   5066 C  CG    . GLU B 1 282 ? 17.487  19.501  77.362 1.00 77.26  ? 282 GLU B CG    1 
ATOM   5067 C  CD    . GLU B 1 282 ? 16.204  18.701  77.390 1.00 77.86  ? 282 GLU B CD    1 
ATOM   5068 O  OE1   . GLU B 1 282 ? 15.126  19.324  77.480 1.00 78.06  ? 282 GLU B OE1   1 
ATOM   5069 O  OE2   . GLU B 1 282 ? 16.270  17.455  77.318 1.00 78.68  ? 282 GLU B OE2   1 
ATOM   5070 N  N     . GLU B 1 283 ? 19.839  20.143  80.210 1.00 76.23  ? 283 GLU B N     1 
ATOM   5071 C  CA    . GLU B 1 283 ? 19.648  21.056  81.327 1.00 75.34  ? 283 GLU B CA    1 
ATOM   5072 C  C     . GLU B 1 283 ? 20.622  22.235  81.266 1.00 74.89  ? 283 GLU B C     1 
ATOM   5073 O  O     . GLU B 1 283 ? 20.217  23.393  81.396 1.00 74.93  ? 283 GLU B O     1 
ATOM   5074 C  CB    . GLU B 1 283 ? 19.830  20.303  82.647 0.00 75.08  ? 283 GLU B CB    1 
ATOM   5075 C  CG    . GLU B 1 283 ? 19.568  21.136  83.889 0.00 74.54  ? 283 GLU B CG    1 
ATOM   5076 C  CD    . GLU B 1 283 ? 19.848  20.372  85.169 0.00 74.27  ? 283 GLU B CD    1 
ATOM   5077 O  OE1   . GLU B 1 283 ? 19.746  20.974  86.258 0.00 74.10  ? 283 GLU B OE1   1 
ATOM   5078 O  OE2   . GLU B 1 283 ? 20.169  19.167  85.086 0.00 74.10  ? 283 GLU B OE2   1 
ATOM   5079 N  N     . GLU B 1 284 ? 21.903  21.942  81.070 1.00 73.62  ? 284 GLU B N     1 
ATOM   5080 C  CA    . GLU B 1 284 ? 22.902  22.999  81.008 1.00 73.84  ? 284 GLU B CA    1 
ATOM   5081 C  C     . GLU B 1 284 ? 22.701  23.849  79.757 1.00 72.60  ? 284 GLU B C     1 
ATOM   5082 O  O     . GLU B 1 284 ? 22.769  25.076  79.806 1.00 73.19  ? 284 GLU B O     1 
ATOM   5083 C  CB    . GLU B 1 284 ? 24.308  22.405  81.011 1.00 75.28  ? 284 GLU B CB    1 
ATOM   5084 C  CG    . GLU B 1 284 ? 25.391  23.452  81.186 1.00 77.64  ? 284 GLU B CG    1 
ATOM   5085 C  CD    . GLU B 1 284 ? 26.772  22.852  81.336 1.00 78.89  ? 284 GLU B CD    1 
ATOM   5086 O  OE1   . GLU B 1 284 ? 27.711  23.604  81.690 1.00 79.85  ? 284 GLU B OE1   1 
ATOM   5087 O  OE2   . GLU B 1 284 ? 26.921  21.633  81.096 1.00 80.83  ? 284 GLU B OE2   1 
ATOM   5088 N  N     . ILE B 1 285 ? 22.450  23.183  78.639 1.00 70.27  ? 285 ILE B N     1 
ATOM   5089 C  CA    . ILE B 1 285 ? 22.224  23.870  77.390 1.00 68.67  ? 285 ILE B CA    1 
ATOM   5090 C  C     . ILE B 1 285 ? 21.090  24.859  77.575 1.00 68.99  ? 285 ILE B C     1 
ATOM   5091 O  O     . ILE B 1 285 ? 21.107  25.951  77.005 1.00 69.52  ? 285 ILE B O     1 
ATOM   5092 C  CB    . ILE B 1 285 ? 21.869  22.874  76.275 1.00 67.98  ? 285 ILE B CB    1 
ATOM   5093 C  CG1   . ILE B 1 285 ? 23.153  22.199  75.778 1.00 67.89  ? 285 ILE B CG1   1 
ATOM   5094 C  CG2   . ILE B 1 285 ? 21.114  23.582  75.155 1.00 66.92  ? 285 ILE B CG2   1 
ATOM   5095 C  CD1   . ILE B 1 285 ? 22.946  21.162  74.702 1.00 68.22  ? 285 ILE B CD1   1 
ATOM   5096 N  N     . ARG B 1 286 ? 20.103  24.478  78.377 1.00 68.26  ? 286 ARG B N     1 
ATOM   5097 C  CA    . ARG B 1 286 ? 18.970  25.357  78.626 1.00 67.38  ? 286 ARG B CA    1 
ATOM   5098 C  C     . ARG B 1 286 ? 19.510  26.589  79.332 1.00 66.43  ? 286 ARG B C     1 
ATOM   5099 O  O     . ARG B 1 286 ? 19.132  27.720  79.014 1.00 65.28  ? 286 ARG B O     1 
ATOM   5100 C  CB    . ARG B 1 286 ? 17.931  24.657  79.509 1.00 67.93  ? 286 ARG B CB    1 
ATOM   5101 C  CG    . ARG B 1 286 ? 16.706  25.488  79.853 0.00 68.27  ? 286 ARG B CG    1 
ATOM   5102 C  CD    . ARG B 1 286 ? 15.759  24.694  80.742 0.00 68.68  ? 286 ARG B CD    1 
ATOM   5103 N  NE    . ARG B 1 286 ? 14.563  25.451  81.101 0.00 69.01  ? 286 ARG B NE    1 
ATOM   5104 C  CZ    . ARG B 1 286 ? 13.586  24.980  81.870 0.00 69.19  ? 286 ARG B CZ    1 
ATOM   5105 N  NH1   . ARG B 1 286 ? 12.533  25.737  82.146 0.00 69.29  ? 286 ARG B NH1   1 
ATOM   5106 N  NH2   . ARG B 1 286 ? 13.661  23.751  82.363 0.00 69.29  ? 286 ARG B NH2   1 
ATOM   5107 N  N     . LYS B 1 287 ? 20.417  26.359  80.278 1.00 64.70  ? 287 LYS B N     1 
ATOM   5108 C  CA    . LYS B 1 287 ? 21.001  27.447  81.050 1.00 63.88  ? 287 LYS B CA    1 
ATOM   5109 C  C     . LYS B 1 287 ? 21.841  28.345  80.148 1.00 63.12  ? 287 LYS B C     1 
ATOM   5110 O  O     . LYS B 1 287 ? 21.661  29.569  80.137 1.00 63.13  ? 287 LYS B O     1 
ATOM   5111 C  CB    . LYS B 1 287 ? 21.857  26.885  82.191 1.00 64.36  ? 287 LYS B CB    1 
ATOM   5112 C  CG    . LYS B 1 287 ? 22.471  27.945  83.089 0.00 64.44  ? 287 LYS B CG    1 
ATOM   5113 C  CD    . LYS B 1 287 ? 23.287  27.310  84.202 0.00 64.61  ? 287 LYS B CD    1 
ATOM   5114 C  CE    . LYS B 1 287 ? 23.898  28.363  85.110 0.00 64.68  ? 287 LYS B CE    1 
ATOM   5115 N  NZ    . LYS B 1 287 ? 24.699  27.750  86.206 0.00 64.72  ? 287 LYS B NZ    1 
ATOM   5116 N  N     . ALA B 1 288 ? 22.749  27.727  79.394 1.00 60.95  ? 288 ALA B N     1 
ATOM   5117 C  CA    . ALA B 1 288 ? 23.620  28.456  78.481 1.00 60.42  ? 288 ALA B CA    1 
ATOM   5118 C  C     . ALA B 1 288 ? 22.813  29.440  77.623 1.00 59.49  ? 288 ALA B C     1 
ATOM   5119 O  O     . ALA B 1 288 ? 23.167  30.619  77.517 1.00 60.35  ? 288 ALA B O     1 
ATOM   5120 C  CB    . ALA B 1 288 ? 24.384  27.473  77.589 1.00 59.34  ? 288 ALA B CB    1 
ATOM   5121 N  N     . ILE B 1 289 ? 21.726  28.952  77.034 1.00 57.44  ? 289 ILE B N     1 
ATOM   5122 C  CA    . ILE B 1 289 ? 20.861  29.760  76.182 1.00 56.46  ? 289 ILE B CA    1 
ATOM   5123 C  C     . ILE B 1 289 ? 20.218  30.909  76.958 1.00 56.80  ? 289 ILE B C     1 
ATOM   5124 O  O     . ILE B 1 289 ? 19.885  31.959  76.392 1.00 57.42  ? 289 ILE B O     1 
ATOM   5125 C  CB    . ILE B 1 289 ? 19.743  28.883  75.554 1.00 54.35  ? 289 ILE B CB    1 
ATOM   5126 C  CG1   . ILE B 1 289 ? 20.363  27.809  74.659 1.00 53.66  ? 289 ILE B CG1   1 
ATOM   5127 C  CG2   . ILE B 1 289 ? 18.761  29.745  74.779 1.00 52.98  ? 289 ILE B CG2   1 
ATOM   5128 C  CD1   . ILE B 1 289 ? 20.989  28.336  73.394 1.00 52.96  ? 289 ILE B CD1   1 
ATOM   5129 N  N     . LYS B 1 290 ? 20.029  30.705  78.256 1.00 56.52  ? 290 LYS B N     1 
ATOM   5130 C  CA    . LYS B 1 290 ? 19.426  31.733  79.090 1.00 55.48  ? 290 LYS B CA    1 
ATOM   5131 C  C     . LYS B 1 290 ? 20.412  32.885  79.219 1.00 53.93  ? 290 LYS B C     1 
ATOM   5132 O  O     . LYS B 1 290 ? 20.021  34.040  79.321 1.00 53.22  ? 290 LYS B O     1 
ATOM   5133 C  CB    . LYS B 1 290 ? 19.086  31.167  80.476 1.00 56.68  ? 290 LYS B CB    1 
ATOM   5134 C  CG    . LYS B 1 290 ? 18.373  32.149  81.390 0.00 57.13  ? 290 LYS B CG    1 
ATOM   5135 C  CD    . LYS B 1 290 ? 18.017  31.506  82.721 0.00 57.76  ? 290 LYS B CD    1 
ATOM   5136 C  CE    . LYS B 1 290 ? 17.280  32.482  83.624 0.00 58.08  ? 290 LYS B CE    1 
ATOM   5137 N  NZ    . LYS B 1 290 ? 16.915  31.866  84.929 0.00 58.33  ? 290 LYS B NZ    1 
ATOM   5138 N  N     . ARG B 1 291 ? 21.699  32.571  79.211 1.00 53.32  ? 291 ARG B N     1 
ATOM   5139 C  CA    . ARG B 1 291 ? 22.704  33.621  79.321 1.00 53.99  ? 291 ARG B CA    1 
ATOM   5140 C  C     . ARG B 1 291 ? 23.078  34.265  77.974 1.00 52.55  ? 291 ARG B C     1 
ATOM   5141 O  O     . ARG B 1 291 ? 23.523  35.421  77.929 1.00 51.07  ? 291 ARG B O     1 
ATOM   5142 C  CB    . ARG B 1 291 ? 23.930  33.078  80.064 1.00 57.02  ? 291 ARG B CB    1 
ATOM   5143 C  CG    . ARG B 1 291 ? 23.724  33.178  81.593 1.00 62.54  ? 291 ARG B CG    1 
ATOM   5144 C  CD    . ARG B 1 291 ? 24.779  32.445  82.401 1.00 66.50  ? 291 ARG B CD    1 
ATOM   5145 N  NE    . ARG B 1 291 ? 24.588  32.590  83.849 1.00 69.20  ? 291 ARG B NE    1 
ATOM   5146 C  CZ    . ARG B 1 291 ? 23.467  32.289  84.511 1.00 70.15  ? 291 ARG B CZ    1 
ATOM   5147 N  NH1   . ARG B 1 291 ? 23.409  32.460  85.832 1.00 68.10  ? 291 ARG B NH1   1 
ATOM   5148 N  NH2   . ARG B 1 291 ? 22.402  31.828  83.858 1.00 69.42  ? 291 ARG B NH2   1 
ATOM   5149 N  N     . LEU B 1 292 ? 22.836  33.532  76.883 1.00 50.56  ? 292 LEU B N     1 
ATOM   5150 C  CA    . LEU B 1 292 ? 23.119  34.004  75.525 1.00 47.83  ? 292 LEU B CA    1 
ATOM   5151 C  C     . LEU B 1 292 ? 22.156  35.103  75.081 1.00 46.99  ? 292 LEU B C     1 
ATOM   5152 O  O     . LEU B 1 292 ? 22.564  36.075  74.458 1.00 47.50  ? 292 LEU B O     1 
ATOM   5153 C  CB    . LEU B 1 292 ? 23.023  32.833  74.539 1.00 48.17  ? 292 LEU B CB    1 
ATOM   5154 C  CG    . LEU B 1 292 ? 23.225  33.081  73.037 1.00 48.01  ? 292 LEU B CG    1 
ATOM   5155 C  CD1   . LEU B 1 292 ? 24.687  33.405  72.776 1.00 44.43  ? 292 LEU B CD1   1 
ATOM   5156 C  CD2   . LEU B 1 292 ? 22.814  31.834  72.228 1.00 47.34  ? 292 LEU B CD2   1 
ATOM   5157 N  N     . ILE B 1 293 ? 20.880  34.950  75.416 1.00 45.39  ? 293 ILE B N     1 
ATOM   5158 C  CA    . ILE B 1 293 ? 19.851  35.904  75.014 1.00 46.03  ? 293 ILE B CA    1 
ATOM   5159 C  C     . ILE B 1 293 ? 20.230  37.395  74.974 1.00 45.54  ? 293 ILE B C     1 
ATOM   5160 O  O     . ILE B 1 293 ? 20.124  38.042  73.926 1.00 44.71  ? 293 ILE B O     1 
ATOM   5161 C  CB    . ILE B 1 293 ? 18.579  35.748  75.887 1.00 46.93  ? 293 ILE B CB    1 
ATOM   5162 C  CG1   . ILE B 1 293 ? 18.031  34.329  75.760 1.00 49.99  ? 293 ILE B CG1   1 
ATOM   5163 C  CG2   . ILE B 1 293 ? 17.505  36.722  75.432 1.00 46.94  ? 293 ILE B CG2   1 
ATOM   5164 C  CD1   . ILE B 1 293 ? 16.621  34.173  76.305 1.00 51.76  ? 293 ILE B CD1   1 
ATOM   5165 N  N     . PRO B 1 294 ? 20.649  37.965  76.119 1.00 45.31  ? 294 PRO B N     1 
ATOM   5166 C  CA    . PRO B 1 294 ? 21.018  39.384  76.144 1.00 44.52  ? 294 PRO B CA    1 
ATOM   5167 C  C     . PRO B 1 294 ? 22.223  39.699  75.257 1.00 43.88  ? 294 PRO B C     1 
ATOM   5168 O  O     . PRO B 1 294 ? 22.419  40.834  74.847 1.00 44.78  ? 294 PRO B O     1 
ATOM   5169 C  CB    . PRO B 1 294 ? 21.292  39.637  77.625 1.00 44.37  ? 294 PRO B CB    1 
ATOM   5170 C  CG    . PRO B 1 294 ? 21.820  38.326  78.088 1.00 44.15  ? 294 PRO B CG    1 
ATOM   5171 C  CD    . PRO B 1 294 ? 20.885  37.342  77.437 1.00 44.17  ? 294 PRO B CD    1 
ATOM   5172 N  N     . LEU B 1 295 ? 23.025  38.689  74.964 1.00 42.00  ? 295 LEU B N     1 
ATOM   5173 C  CA    . LEU B 1 295 ? 24.181  38.881  74.120 1.00 41.90  ? 295 LEU B CA    1 
ATOM   5174 C  C     . LEU B 1 295 ? 23.833  39.038  72.633 1.00 42.47  ? 295 LEU B C     1 
ATOM   5175 O  O     . LEU B 1 295 ? 24.649  39.520  71.857 1.00 43.84  ? 295 LEU B O     1 
ATOM   5176 C  CB    . LEU B 1 295 ? 25.141  37.707  74.293 1.00 40.36  ? 295 LEU B CB    1 
ATOM   5177 C  CG    . LEU B 1 295 ? 25.708  37.465  75.698 1.00 39.74  ? 295 LEU B CG    1 
ATOM   5178 C  CD1   . LEU B 1 295 ? 26.753  36.336  75.649 1.00 34.86  ? 295 LEU B CD1   1 
ATOM   5179 C  CD2   . LEU B 1 295 ? 26.344  38.743  76.214 1.00 36.01  ? 295 LEU B CD2   1 
ATOM   5180 N  N     . ILE B 1 296 ? 22.618  38.673  72.241 1.00 42.58  ? 296 ILE B N     1 
ATOM   5181 C  CA    . ILE B 1 296 ? 22.225  38.719  70.830 1.00 42.38  ? 296 ILE B CA    1 
ATOM   5182 C  C     . ILE B 1 296 ? 21.468  39.930  70.333 1.00 43.49  ? 296 ILE B C     1 
ATOM   5183 O  O     . ILE B 1 296 ? 20.363  40.174  70.777 1.00 43.63  ? 296 ILE B O     1 
ATOM   5184 C  CB    . ILE B 1 296 ? 21.291  37.543  70.448 1.00 42.34  ? 296 ILE B CB    1 
ATOM   5185 C  CG1   . ILE B 1 296 ? 21.850  36.201  70.933 1.00 41.40  ? 296 ILE B CG1   1 
ATOM   5186 C  CG2   . ILE B 1 296 ? 21.027  37.577  68.951 1.00 40.49  ? 296 ILE B CG2   1 
ATOM   5187 C  CD1   . ILE B 1 296 ? 23.210  35.852  70.424 1.00 44.79  ? 296 ILE B CD1   1 
ATOM   5188 N  N     . PRO B 1 297 ? 22.035  40.706  69.393 1.00 45.98  ? 297 PRO B N     1 
ATOM   5189 C  CA    . PRO B 1 297 ? 21.164  41.823  68.994 1.00 47.08  ? 297 PRO B CA    1 
ATOM   5190 C  C     . PRO B 1 297 ? 19.971  41.227  68.215 1.00 48.57  ? 297 PRO B C     1 
ATOM   5191 O  O     . PRO B 1 297 ? 20.110  40.227  67.525 1.00 48.67  ? 297 PRO B O     1 
ATOM   5192 C  CB    . PRO B 1 297 ? 22.084  42.725  68.162 1.00 46.43  ? 297 PRO B CB    1 
ATOM   5193 C  CG    . PRO B 1 297 ? 23.227  41.832  67.750 1.00 47.96  ? 297 PRO B CG    1 
ATOM   5194 C  CD    . PRO B 1 297 ? 23.415  40.882  68.908 1.00 45.24  ? 297 PRO B CD    1 
ATOM   5195 N  N     . LYS B 1 298 ? 18.793  41.818  68.360 1.00 51.25  ? 298 LYS B N     1 
ATOM   5196 C  CA    . LYS B 1 298 ? 17.571  41.318  67.715 1.00 53.06  ? 298 LYS B CA    1 
ATOM   5197 C  C     . LYS B 1 298 ? 17.570  41.044  66.197 1.00 53.87  ? 298 LYS B C     1 
ATOM   5198 O  O     . LYS B 1 298 ? 16.887  40.111  65.733 1.00 56.18  ? 298 LYS B O     1 
ATOM   5199 C  CB    . LYS B 1 298 ? 16.416  42.270  68.041 0.00 53.02  ? 298 LYS B CB    1 
ATOM   5200 C  CG    . LYS B 1 298 ? 15.091  41.913  67.389 0.00 53.33  ? 298 LYS B CG    1 
ATOM   5201 C  CD    . LYS B 1 298 ? 14.034  42.957  67.709 0.00 53.54  ? 298 LYS B CD    1 
ATOM   5202 C  CE    . LYS B 1 298 ? 12.709  42.632  67.043 0.00 53.69  ? 298 LYS B CE    1 
ATOM   5203 N  NZ    . LYS B 1 298 ? 11.677  43.662  67.344 0.00 53.78  ? 298 LYS B NZ    1 
ATOM   5204 N  N     . ASN B 1 299 ? 18.308  41.843  65.425 1.00 51.13  ? 299 ASN B N     1 
ATOM   5205 C  CA    . ASN B 1 299 ? 18.347  41.676  63.967 1.00 49.47  ? 299 ASN B CA    1 
ATOM   5206 C  C     . ASN B 1 299 ? 19.470  40.727  63.521 1.00 47.25  ? 299 ASN B C     1 
ATOM   5207 O  O     . ASN B 1 299 ? 19.804  40.649  62.339 1.00 46.23  ? 299 ASN B O     1 
ATOM   5208 C  CB    . ASN B 1 299 ? 18.545  43.038  63.314 1.00 51.37  ? 299 ASN B CB    1 
ATOM   5209 C  CG    . ASN B 1 299 ? 19.845  43.686  63.744 1.00 55.00  ? 299 ASN B CG    1 
ATOM   5210 O  OD1   . ASN B 1 299 ? 20.350  43.410  64.844 1.00 54.22  ? 299 ASN B OD1   1 
ATOM   5211 N  ND2   . ASN B 1 299 ? 20.396  44.558  62.891 1.00 56.18  ? 299 ASN B ND2   1 
ATOM   5212 N  N     . ALA B 1 300 ? 20.024  39.997  64.480 1.00 42.94  ? 300 ALA B N     1 
ATOM   5213 C  CA    . ALA B 1 300 ? 21.099  39.068  64.226 1.00 41.78  ? 300 ALA B CA    1 
ATOM   5214 C  C     . ALA B 1 300 ? 20.686  37.744  63.575 1.00 41.56  ? 300 ALA B C     1 
ATOM   5215 O  O     . ALA B 1 300 ? 19.561  37.274  63.727 1.00 41.64  ? 300 ALA B O     1 
ATOM   5216 C  CB    . ALA B 1 300 ? 21.828  38.772  65.533 1.00 37.09  ? 300 ALA B CB    1 
ATOM   5217 N  N     . TYR B 1 301 ? 21.622  37.162  62.837 1.00 39.75  ? 301 TYR B N     1 
ATOM   5218 C  CA    . TYR B 1 301 ? 21.436  35.856  62.234 1.00 39.79  ? 301 TYR B CA    1 
ATOM   5219 C  C     . TYR B 1 301 ? 22.329  35.058  63.149 1.00 38.80  ? 301 TYR B C     1 
ATOM   5220 O  O     . TYR B 1 301 ? 23.464  35.461  63.407 1.00 39.25  ? 301 TYR B O     1 
ATOM   5221 C  CB    . TYR B 1 301 ? 21.973  35.812  60.807 1.00 39.45  ? 301 TYR B CB    1 
ATOM   5222 C  CG    . TYR B 1 301 ? 20.943  36.196  59.788 1.00 38.87  ? 301 TYR B CG    1 
ATOM   5223 C  CD1   . TYR B 1 301 ? 19.875  37.032  60.128 1.00 39.23  ? 301 TYR B CD1   1 
ATOM   5224 C  CD2   . TYR B 1 301 ? 21.035  35.747  58.485 1.00 37.18  ? 301 TYR B CD2   1 
ATOM   5225 C  CE1   . TYR B 1 301 ? 18.928  37.410  59.179 1.00 40.24  ? 301 TYR B CE1   1 
ATOM   5226 C  CE2   . TYR B 1 301 ? 20.088  36.111  57.536 1.00 39.64  ? 301 TYR B CE2   1 
ATOM   5227 C  CZ    . TYR B 1 301 ? 19.042  36.945  57.883 1.00 38.76  ? 301 TYR B CZ    1 
ATOM   5228 O  OH    . TYR B 1 301 ? 18.132  37.335  56.920 1.00 39.91  ? 301 TYR B OH    1 
ATOM   5229 N  N     . VAL B 1 302 ? 21.825  33.936  63.641 1.00 38.29  ? 302 VAL B N     1 
ATOM   5230 C  CA    . VAL B 1 302 ? 22.583  33.132  64.578 1.00 38.91  ? 302 VAL B CA    1 
ATOM   5231 C  C     . VAL B 1 302 ? 22.817  31.681  64.162 1.00 41.00  ? 302 VAL B C     1 
ATOM   5232 O  O     . VAL B 1 302 ? 21.954  31.049  63.552 1.00 39.94  ? 302 VAL B O     1 
ATOM   5233 C  CB    . VAL B 1 302 ? 21.849  33.122  65.938 1.00 39.21  ? 302 VAL B CB    1 
ATOM   5234 C  CG1   . VAL B 1 302 ? 22.672  32.362  67.005 1.00 38.87  ? 302 VAL B CG1   1 
ATOM   5235 C  CG2   . VAL B 1 302 ? 21.551  34.561  66.372 1.00 39.24  ? 302 VAL B CG2   1 
ATOM   5236 N  N     . ARG B 1 303 ? 23.999  31.164  64.470 1.00 42.12  ? 303 ARG B N     1 
ATOM   5237 C  CA    . ARG B 1 303 ? 24.257  29.765  64.218 1.00 44.63  ? 303 ARG B CA    1 
ATOM   5238 C  C     . ARG B 1 303 ? 24.600  29.139  65.566 1.00 47.73  ? 303 ARG B C     1 
ATOM   5239 O  O     . ARG B 1 303 ? 25.584  29.521  66.206 1.00 47.23  ? 303 ARG B O     1 
ATOM   5240 C  CB    . ARG B 1 303 ? 25.415  29.522  63.252 1.00 44.59  ? 303 ARG B CB    1 
ATOM   5241 C  CG    . ARG B 1 303 ? 25.581  28.019  62.974 1.00 41.06  ? 303 ARG B CG    1 
ATOM   5242 C  CD    . ARG B 1 303 ? 26.562  27.718  61.880 1.00 41.09  ? 303 ARG B CD    1 
ATOM   5243 N  NE    . ARG B 1 303 ? 27.926  28.024  62.278 1.00 43.79  ? 303 ARG B NE    1 
ATOM   5244 C  CZ    . ARG B 1 303 ? 28.994  27.744  61.542 1.00 45.38  ? 303 ARG B CZ    1 
ATOM   5245 N  NH1   . ARG B 1 303 ? 30.209  28.067  61.974 1.00 44.77  ? 303 ARG B NH1   1 
ATOM   5246 N  NH2   . ARG B 1 303 ? 28.841  27.124  60.376 1.00 47.92  ? 303 ARG B NH2   1 
ATOM   5247 N  N     . LEU B 1 304 ? 23.766  28.193  65.992 1.00 50.68  ? 304 LEU B N     1 
ATOM   5248 C  CA    . LEU B 1 304 ? 23.963  27.479  67.250 1.00 53.91  ? 304 LEU B CA    1 
ATOM   5249 C  C     . LEU B 1 304 ? 24.517  26.111  66.941 1.00 55.32  ? 304 LEU B C     1 
ATOM   5250 O  O     . LEU B 1 304 ? 23.879  25.347  66.233 1.00 56.43  ? 304 LEU B O     1 
ATOM   5251 C  CB    . LEU B 1 304 ? 22.642  27.261  67.988 1.00 53.17  ? 304 LEU B CB    1 
ATOM   5252 C  CG    . LEU B 1 304 ? 21.802  28.450  68.414 1.00 56.12  ? 304 LEU B CG    1 
ATOM   5253 C  CD1   . LEU B 1 304 ? 20.511  27.944  69.042 1.00 56.28  ? 304 LEU B CD1   1 
ATOM   5254 C  CD2   . LEU B 1 304 ? 22.591  29.310  69.395 1.00 55.91  ? 304 LEU B CD2   1 
ATOM   5255 N  N     . ASN B 1 305 ? 25.705  25.806  67.439 1.00 56.98  ? 305 ASN B N     1 
ATOM   5256 C  CA    . ASN B 1 305 ? 26.257  24.483  67.234 1.00 59.95  ? 305 ASN B CA    1 
ATOM   5257 C  C     . ASN B 1 305 ? 26.091  23.773  68.580 1.00 61.64  ? 305 ASN B C     1 
ATOM   5258 O  O     . ASN B 1 305 ? 26.928  23.897  69.470 1.00 61.25  ? 305 ASN B O     1 
ATOM   5259 C  CB    . ASN B 1 305 ? 27.729  24.544  66.834 1.00 61.04  ? 305 ASN B CB    1 
ATOM   5260 C  CG    . ASN B 1 305 ? 28.307  23.161  66.555 1.00 64.04  ? 305 ASN B CG    1 
ATOM   5261 O  OD1   . ASN B 1 305 ? 27.582  22.248  66.153 1.00 63.49  ? 305 ASN B OD1   1 
ATOM   5262 N  ND2   . ASN B 1 305 ? 29.617  23.003  66.755 1.00 65.19  ? 305 ASN B ND2   1 
ATOM   5263 N  N     . ILE B 1 306 ? 24.988  23.045  68.719 1.00 63.17  ? 306 ILE B N     1 
ATOM   5264 C  CA    . ILE B 1 306 ? 24.679  22.341  69.955 1.00 66.40  ? 306 ILE B CA    1 
ATOM   5265 C  C     . ILE B 1 306 ? 25.175  20.897  70.018 1.00 67.56  ? 306 ILE B C     1 
ATOM   5266 O  O     . ILE B 1 306 ? 24.663  20.024  69.320 1.00 68.60  ? 306 ILE B O     1 
ATOM   5267 C  CB    . ILE B 1 306 ? 23.164  22.328  70.203 1.00 66.49  ? 306 ILE B CB    1 
ATOM   5268 C  CG1   . ILE B 1 306 ? 22.638  23.763  70.254 1.00 67.47  ? 306 ILE B CG1   1 
ATOM   5269 C  CG2   . ILE B 1 306 ? 22.862  21.568  71.492 1.00 68.85  ? 306 ILE B CG2   1 
ATOM   5270 C  CD1   . ILE B 1 306 ? 21.143  23.883  70.533 1.00 68.03  ? 306 ILE B CD1   1 
ATOM   5271 N  N     . GLY B 1 307 ? 26.174  20.652  70.859 1.00 69.01  ? 307 GLY B N     1 
ATOM   5272 C  CA    . GLY B 1 307 ? 26.696  19.308  71.018 1.00 70.16  ? 307 GLY B CA    1 
ATOM   5273 C  C     . GLY B 1 307 ? 25.943  18.631  72.154 1.00 71.79  ? 307 GLY B C     1 
ATOM   5274 O  O     . GLY B 1 307 ? 26.058  19.047  73.315 1.00 71.26  ? 307 GLY B O     1 
ATOM   5275 N  N     . TRP B 1 308 ? 25.164  17.597  71.831 1.00 72.43  ? 308 TRP B N     1 
ATOM   5276 C  CA    . TRP B 1 308 ? 24.392  16.884  72.851 1.00 73.31  ? 308 TRP B CA    1 
ATOM   5277 C  C     . TRP B 1 308 ? 24.691  15.373  72.938 1.00 74.01  ? 308 TRP B C     1 
ATOM   5278 O  O     . TRP B 1 308 ? 25.189  14.758  71.983 1.00 74.00  ? 308 TRP B O     1 
ATOM   5279 C  CB    . TRP B 1 308 ? 22.889  17.110  72.617 1.00 71.59  ? 308 TRP B CB    1 
ATOM   5280 C  CG    . TRP B 1 308 ? 22.433  16.749  71.234 1.00 70.34  ? 308 TRP B CG    1 
ATOM   5281 C  CD1   . TRP B 1 308 ? 23.071  15.926  70.353 1.00 69.91  ? 308 TRP B CD1   1 
ATOM   5282 C  CD2   . TRP B 1 308 ? 21.213  17.151  70.596 1.00 69.49  ? 308 TRP B CD2   1 
ATOM   5283 N  NE1   . TRP B 1 308 ? 22.327  15.788  69.209 1.00 70.89  ? 308 TRP B NE1   1 
ATOM   5284 C  CE2   . TRP B 1 308 ? 21.180  16.529  69.329 1.00 69.72  ? 308 TRP B CE2   1 
ATOM   5285 C  CE3   . TRP B 1 308 ? 20.146  17.975  70.970 1.00 69.34  ? 308 TRP B CE3   1 
ATOM   5286 C  CZ2   . TRP B 1 308 ? 20.115  16.701  68.431 1.00 68.77  ? 308 TRP B CZ2   1 
ATOM   5287 C  CZ3   . TRP B 1 308 ? 19.081  18.147  70.074 1.00 69.33  ? 308 TRP B CZ3   1 
ATOM   5288 C  CH2   . TRP B 1 308 ? 19.080  17.511  68.820 1.00 68.62  ? 308 TRP B CH2   1 
ATOM   5289 N  N     . ARG B 1 309 ? 24.388  14.788  74.097 1.00 74.93  ? 309 ARG B N     1 
ATOM   5290 C  CA    . ARG B 1 309 ? 24.609  13.360  74.331 1.00 75.54  ? 309 ARG B CA    1 
ATOM   5291 C  C     . ARG B 1 309 ? 23.402  12.590  73.809 1.00 76.66  ? 309 ARG B C     1 
ATOM   5292 O  O     . ARG B 1 309 ? 23.463  11.384  73.587 1.00 77.98  ? 309 ARG B O     1 
ATOM   5293 C  CB    . ARG B 1 309 ? 24.803  13.096  75.826 0.00 73.97  ? 309 ARG B CB    1 
ATOM   5294 C  CG    . ARG B 1 309 ? 25.146  11.657  76.185 0.00 71.92  ? 309 ARG B CG    1 
ATOM   5295 C  CD    . ARG B 1 309 ? 25.353  11.521  77.686 0.00 70.03  ? 309 ARG B CD    1 
ATOM   5296 N  NE    . ARG B 1 309 ? 25.681  10.157  78.091 0.00 68.42  ? 309 ARG B NE    1 
ATOM   5297 C  CZ    . ARG B 1 309 ? 25.903  9.790   79.349 0.00 67.61  ? 309 ARG B CZ    1 
ATOM   5298 N  NH1   . ARG B 1 309 ? 26.196  8.528   79.633 0.00 67.14  ? 309 ARG B NH1   1 
ATOM   5299 N  NH2   . ARG B 1 309 ? 25.832  10.685  80.325 0.00 67.14  ? 309 ARG B NH2   1 
ATOM   5300 N  N     . LYS B 1 310 ? 22.309  13.314  73.599 1.00 77.55  ? 310 LYS B N     1 
ATOM   5301 C  CA    . LYS B 1 310 ? 21.073  12.739  73.099 1.00 78.01  ? 310 LYS B CA    1 
ATOM   5302 C  C     . LYS B 1 310 ? 20.168  13.911  72.702 1.00 79.59  ? 310 LYS B C     1 
ATOM   5303 O  O     . LYS B 1 310 ? 20.093  14.912  73.419 1.00 79.40  ? 310 LYS B O     1 
ATOM   5304 C  CB    . LYS B 1 310 ? 20.411  11.900  74.188 0.00 76.98  ? 310 LYS B CB    1 
ATOM   5305 C  CG    . LYS B 1 310 ? 19.137  11.278  73.709 0.00 75.44  ? 310 LYS B CG    1 
ATOM   5306 C  CD    . LYS B 1 310 ? 18.385  10.514  74.768 0.00 74.34  ? 310 LYS B CD    1 
ATOM   5307 C  CE    . LYS B 1 310 ? 17.104  10.010  74.120 0.00 73.71  ? 310 LYS B CE    1 
ATOM   5308 N  NZ    . LYS B 1 310 ? 15.983  9.648   75.004 0.00 73.28  ? 310 LYS B NZ    1 
ATOM   5309 N  N     . PRO B 1 311 ? 19.476  13.808  71.551 1.00 80.70  ? 311 PRO B N     1 
ATOM   5310 C  CA    . PRO B 1 311 ? 18.579  14.865  71.056 1.00 81.69  ? 311 PRO B CA    1 
ATOM   5311 C  C     . PRO B 1 311 ? 17.397  15.228  71.947 1.00 82.64  ? 311 PRO B C     1 
ATOM   5312 O  O     . PRO B 1 311 ? 17.124  14.557  72.943 1.00 84.03  ? 311 PRO B O     1 
ATOM   5313 C  CB    . PRO B 1 311 ? 18.110  14.316  69.709 1.00 81.45  ? 311 PRO B CB    1 
ATOM   5314 C  CG    . PRO B 1 311 ? 18.111  12.835  69.943 1.00 81.96  ? 311 PRO B CG    1 
ATOM   5315 C  CD    . PRO B 1 311 ? 19.447  12.646  70.647 1.00 81.01  ? 311 PRO B CD    1 
ATOM   5316 N  N     . PHE B 1 312 ? 16.708  16.305  71.578 1.00 83.05  ? 312 PHE B N     1 
ATOM   5317 C  CA    . PHE B 1 312 ? 15.516  16.766  72.291 1.00 83.76  ? 312 PHE B CA    1 
ATOM   5318 C  C     . PHE B 1 312 ? 14.836  17.903  71.534 1.00 84.29  ? 312 PHE B C     1 
ATOM   5319 O  O     . PHE B 1 312 ? 15.425  18.489  70.625 1.00 84.48  ? 312 PHE B O     1 
ATOM   5320 C  CB    . PHE B 1 312 ? 15.837  17.203  73.733 1.00 84.02  ? 312 PHE B CB    1 
ATOM   5321 C  CG    . PHE B 1 312 ? 16.774  18.376  73.839 1.00 84.88  ? 312 PHE B CG    1 
ATOM   5322 C  CD1   . PHE B 1 312 ? 18.152  18.205  73.701 1.00 85.11  ? 312 PHE B CD1   1 
ATOM   5323 C  CD2   . PHE B 1 312 ? 16.281  19.648  74.124 1.00 85.22  ? 312 PHE B CD2   1 
ATOM   5324 C  CE1   . PHE B 1 312 ? 19.027  19.284  73.852 1.00 84.81  ? 312 PHE B CE1   1 
ATOM   5325 C  CE2   . PHE B 1 312 ? 17.147  20.735  74.276 1.00 85.11  ? 312 PHE B CE2   1 
ATOM   5326 C  CZ    . PHE B 1 312 ? 18.522  20.550  74.141 1.00 85.05  ? 312 PHE B CZ    1 
ATOM   5327 N  N     . ASP B 1 313 ? 13.591  18.202  71.902 1.00 84.58  ? 313 ASP B N     1 
ATOM   5328 C  CA    . ASP B 1 313 ? 12.826  19.256  71.242 1.00 84.89  ? 313 ASP B CA    1 
ATOM   5329 C  C     . ASP B 1 313 ? 13.547  20.602  71.324 1.00 84.88  ? 313 ASP B C     1 
ATOM   5330 O  O     . ASP B 1 313 ? 13.951  21.035  72.408 1.00 85.65  ? 313 ASP B O     1 
ATOM   5331 C  CB    . ASP B 1 313 ? 11.438  19.378  71.873 1.00 85.29  ? 313 ASP B CB    1 
ATOM   5332 C  CG    . ASP B 1 313 ? 10.470  20.166  71.007 1.00 86.38  ? 313 ASP B CG    1 
ATOM   5333 O  OD1   . ASP B 1 313 ? 10.853  21.254  70.521 1.00 86.35  ? 313 ASP B OD1   1 
ATOM   5334 O  OD2   . ASP B 1 313 ? 9.323   19.699  70.816 1.00 86.59  ? 313 ASP B OD2   1 
ATOM   5335 N  N     . LEU B 1 314 ? 13.695  21.262  70.175 1.00 83.89  ? 314 LEU B N     1 
ATOM   5336 C  CA    . LEU B 1 314 ? 14.376  22.554  70.109 1.00 82.13  ? 314 LEU B CA    1 
ATOM   5337 C  C     . LEU B 1 314 ? 13.422  23.743  70.032 1.00 81.33  ? 314 LEU B C     1 
ATOM   5338 O  O     . LEU B 1 314 ? 13.860  24.889  70.045 1.00 81.54  ? 314 LEU B O     1 
ATOM   5339 C  CB    . LEU B 1 314 ? 15.316  22.582  68.904 1.00 81.44  ? 314 LEU B CB    1 
ATOM   5340 C  CG    . LEU B 1 314 ? 16.472  21.579  68.933 1.00 81.22  ? 314 LEU B CG    1 
ATOM   5341 C  CD1   . LEU B 1 314 ? 17.135  21.504  67.569 1.00 80.11  ? 314 LEU B CD1   1 
ATOM   5342 C  CD2   . LEU B 1 314 ? 17.473  21.990  70.005 1.00 81.31  ? 314 LEU B CD2   1 
ATOM   5343 N  N     . THR B 1 315 ? 12.122  23.476  69.953 1.00 80.26  ? 315 THR B N     1 
ATOM   5344 C  CA    . THR B 1 315 ? 11.129  24.547  69.870 1.00 79.24  ? 315 THR B CA    1 
ATOM   5345 C  C     . THR B 1 315 ? 11.291  25.569  70.994 1.00 78.79  ? 315 THR B C     1 
ATOM   5346 O  O     . THR B 1 315 ? 11.007  26.757  70.814 1.00 77.97  ? 315 THR B O     1 
ATOM   5347 C  CB    . THR B 1 315 ? 9.699   23.987  69.931 1.00 78.18  ? 315 THR B CB    1 
ATOM   5348 O  OG1   . THR B 1 315 ? 9.536   22.999  68.913 1.00 78.54  ? 315 THR B OG1   1 
ATOM   5349 C  CG2   . THR B 1 315 ? 8.684   25.097  69.712 1.00 77.26  ? 315 THR B CG2   1 
ATOM   5350 N  N     . GLU B 1 316 ? 11.735  25.091  72.154 1.00 78.70  ? 316 GLU B N     1 
ATOM   5351 C  CA    . GLU B 1 316 ? 11.953  25.947  73.320 1.00 78.25  ? 316 GLU B CA    1 
ATOM   5352 C  C     . GLU B 1 316 ? 13.039  26.981  72.979 1.00 77.13  ? 316 GLU B C     1 
ATOM   5353 O  O     . GLU B 1 316 ? 12.798  28.192  72.982 1.00 76.51  ? 316 GLU B O     1 
ATOM   5354 C  CB    . GLU B 1 316 ? 12.397  25.087  74.508 1.00 78.85  ? 316 GLU B CB    1 
ATOM   5355 C  CG    . GLU B 1 316 ? 12.632  25.846  75.806 1.00 80.09  ? 316 GLU B CG    1 
ATOM   5356 C  CD    . GLU B 1 316 ? 13.332  24.987  76.853 1.00 81.44  ? 316 GLU B CD    1 
ATOM   5357 O  OE1   . GLU B 1 316 ? 13.587  25.486  77.977 1.00 82.79  ? 316 GLU B OE1   1 
ATOM   5358 O  OE2   . GLU B 1 316 ? 13.633  23.811  76.549 1.00 81.13  ? 316 GLU B OE2   1 
ATOM   5359 N  N     . ILE B 1 317 ? 14.233  26.479  72.677 1.00 75.51  ? 317 ILE B N     1 
ATOM   5360 C  CA    . ILE B 1 317 ? 15.362  27.320  72.320 1.00 73.95  ? 317 ILE B CA    1 
ATOM   5361 C  C     . ILE B 1 317 ? 15.019  28.256  71.160 1.00 73.54  ? 317 ILE B C     1 
ATOM   5362 O  O     . ILE B 1 317 ? 15.280  29.457  71.225 1.00 73.50  ? 317 ILE B O     1 
ATOM   5363 C  CB    . ILE B 1 317 ? 16.576  26.456  71.941 1.00 72.98  ? 317 ILE B CB    1 
ATOM   5364 C  CG1   . ILE B 1 317 ? 17.021  25.647  73.163 1.00 72.63  ? 317 ILE B CG1   1 
ATOM   5365 C  CG2   . ILE B 1 317 ? 17.705  27.337  71.426 1.00 72.83  ? 317 ILE B CG2   1 
ATOM   5366 C  CD1   . ILE B 1 317 ? 18.167  24.693  72.907 1.00 72.19  ? 317 ILE B CD1   1 
ATOM   5367 N  N     . LYS B 1 318 ? 14.429  27.707  70.105 1.00 72.26  ? 318 LYS B N     1 
ATOM   5368 C  CA    . LYS B 1 318 ? 14.056  28.506  68.946 1.00 72.19  ? 318 LYS B CA    1 
ATOM   5369 C  C     . LYS B 1 318 ? 13.222  29.745  69.296 1.00 71.87  ? 318 LYS B C     1 
ATOM   5370 O  O     . LYS B 1 318 ? 13.477  30.834  68.780 1.00 72.51  ? 318 LYS B O     1 
ATOM   5371 C  CB    . LYS B 1 318 ? 13.288  27.645  67.941 1.00 72.16  ? 318 LYS B CB    1 
ATOM   5372 C  CG    . LYS B 1 318 ? 14.059  26.430  67.460 1.00 71.47  ? 318 LYS B CG    1 
ATOM   5373 C  CD    . LYS B 1 318 ? 13.256  25.636  66.444 1.00 71.85  ? 318 LYS B CD    1 
ATOM   5374 C  CE    . LYS B 1 318 ? 14.071  24.479  65.878 1.00 71.43  ? 318 LYS B CE    1 
ATOM   5375 N  NZ    . LYS B 1 318 ? 13.340  23.796  64.769 1.00 73.02  ? 318 LYS B NZ    1 
ATOM   5376 N  N     . GLU B 1 319 ? 12.230  29.585  70.167 1.00 70.97  ? 319 GLU B N     1 
ATOM   5377 C  CA    . GLU B 1 319 ? 11.378  30.712  70.545 1.00 69.91  ? 319 GLU B CA    1 
ATOM   5378 C  C     . GLU B 1 319 ? 12.024  31.618  71.586 1.00 69.25  ? 319 GLU B C     1 
ATOM   5379 O  O     . GLU B 1 319 ? 11.655  32.782  71.720 1.00 69.85  ? 319 GLU B O     1 
ATOM   5380 C  CB    . GLU B 1 319 ? 10.027  30.208  71.062 1.00 70.15  ? 319 GLU B CB    1 
ATOM   5381 C  CG    . GLU B 1 319 ? 9.220   29.439  70.027 0.00 69.79  ? 319 GLU B CG    1 
ATOM   5382 C  CD    . GLU B 1 319 ? 7.861   29.013  70.545 0.00 69.72  ? 319 GLU B CD    1 
ATOM   5383 O  OE1   . GLU B 1 319 ? 7.058   29.897  70.910 0.00 69.65  ? 319 GLU B OE1   1 
ATOM   5384 O  OE2   . GLU B 1 319 ? 7.594   27.793  70.585 0.00 69.65  ? 319 GLU B OE2   1 
ATOM   5385 N  N     . LEU B 1 320 ? 12.993  31.084  72.318 1.00 67.98  ? 320 LEU B N     1 
ATOM   5386 C  CA    . LEU B 1 320 ? 13.682  31.858  73.342 1.00 67.29  ? 320 LEU B CA    1 
ATOM   5387 C  C     . LEU B 1 320 ? 14.609  32.908  72.711 1.00 66.58  ? 320 LEU B C     1 
ATOM   5388 O  O     . LEU B 1 320 ? 14.801  33.998  73.258 1.00 66.27  ? 320 LEU B O     1 
ATOM   5389 C  CB    . LEU B 1 320 ? 14.478  30.907  74.238 1.00 67.42  ? 320 LEU B CB    1 
ATOM   5390 C  CG    . LEU B 1 320 ? 14.612  31.282  75.716 1.00 68.39  ? 320 LEU B CG    1 
ATOM   5391 C  CD1   . LEU B 1 320 ? 13.243  31.613  76.295 1.00 67.51  ? 320 LEU B CD1   1 
ATOM   5392 C  CD2   . LEU B 1 320 ? 15.253  30.128  76.472 1.00 68.06  ? 320 LEU B CD2   1 
ATOM   5393 N  N     . LEU B 1 321 ? 15.173  32.572  71.552 1.00 65.68  ? 321 LEU B N     1 
ATOM   5394 C  CA    . LEU B 1 321 ? 16.066  33.469  70.829 1.00 63.71  ? 321 LEU B CA    1 
ATOM   5395 C  C     . LEU B 1 321 ? 15.289  34.497  70.016 1.00 64.24  ? 321 LEU B C     1 
ATOM   5396 O  O     . LEU B 1 321 ? 15.639  35.672  69.999 1.00 64.51  ? 321 LEU B O     1 
ATOM   5397 C  CB    . LEU B 1 321 ? 17.002  32.655  69.938 1.00 61.28  ? 321 LEU B CB    1 
ATOM   5398 C  CG    . LEU B 1 321 ? 17.923  31.773  70.788 1.00 60.24  ? 321 LEU B CG    1 
ATOM   5399 C  CD1   . LEU B 1 321 ? 18.919  31.004  69.931 1.00 58.94  ? 321 LEU B CD1   1 
ATOM   5400 C  CD2   . LEU B 1 321 ? 18.652  32.662  71.779 1.00 59.62  ? 321 LEU B CD2   1 
ATOM   5401 N  N     . ASN B 1 322 ? 14.226  34.061  69.352 1.00 64.99  ? 322 ASN B N     1 
ATOM   5402 C  CA    . ASN B 1 322 ? 13.395  34.973  68.571 1.00 65.32  ? 322 ASN B CA    1 
ATOM   5403 C  C     . ASN B 1 322 ? 14.238  35.845  67.634 1.00 65.05  ? 322 ASN B C     1 
ATOM   5404 O  O     . ASN B 1 322 ? 14.156  37.082  67.681 1.00 64.82  ? 322 ASN B O     1 
ATOM   5405 C  CB    . ASN B 1 322 ? 12.584  35.878  69.518 1.00 66.43  ? 322 ASN B CB    1 
ATOM   5406 C  CG    . ASN B 1 322 ? 11.431  36.608  68.814 1.00 67.13  ? 322 ASN B CG    1 
ATOM   5407 O  OD1   . ASN B 1 322 ? 11.187  37.794  69.061 1.00 66.67  ? 322 ASN B OD1   1 
ATOM   5408 N  ND2   . ASN B 1 322 ? 10.708  35.894  67.955 1.00 65.99  ? 322 ASN B ND2   1 
ATOM   5409 N  N     . VAL B 1 323 ? 15.051  35.208  66.790 1.00 63.03  ? 323 VAL B N     1 
ATOM   5410 C  CA    . VAL B 1 323 ? 15.882  35.954  65.848 1.00 60.79  ? 323 VAL B CA    1 
ATOM   5411 C  C     . VAL B 1 323 ? 15.414  35.774  64.412 1.00 59.92  ? 323 VAL B C     1 
ATOM   5412 O  O     . VAL B 1 323 ? 14.793  34.768  64.076 1.00 59.24  ? 323 VAL B O     1 
ATOM   5413 C  CB    . VAL B 1 323 ? 17.340  35.538  65.950 1.00 59.84  ? 323 VAL B CB    1 
ATOM   5414 C  CG1   . VAL B 1 323 ? 17.901  36.005  67.283 1.00 60.48  ? 323 VAL B CG1   1 
ATOM   5415 C  CG2   . VAL B 1 323 ? 17.462  34.036  65.810 1.00 58.38  ? 323 VAL B CG2   1 
ATOM   5416 N  N     . GLU B 1 324 ? 15.721  36.759  63.574 1.00 59.49  ? 324 GLU B N     1 
ATOM   5417 C  CA    . GLU B 1 324 ? 15.327  36.750  62.167 1.00 58.91  ? 324 GLU B CA    1 
ATOM   5418 C  C     . GLU B 1 324 ? 15.605  35.417  61.502 1.00 57.22  ? 324 GLU B C     1 
ATOM   5419 O  O     . GLU B 1 324 ? 14.797  34.914  60.740 1.00 58.02  ? 324 GLU B O     1 
ATOM   5420 C  CB    . GLU B 1 324 ? 16.083  37.825  61.401 1.00 60.83  ? 324 GLU B CB    1 
ATOM   5421 C  CG    . GLU B 1 324 ? 16.130  39.167  62.071 1.00 63.39  ? 324 GLU B CG    1 
ATOM   5422 C  CD    . GLU B 1 324 ? 15.344  40.209  61.312 1.00 65.12  ? 324 GLU B CD    1 
ATOM   5423 O  OE1   . GLU B 1 324 ? 15.522  41.413  61.618 1.00 66.64  ? 324 GLU B OE1   1 
ATOM   5424 O  OE2   . GLU B 1 324 ? 14.551  39.820  60.420 1.00 64.17  ? 324 GLU B OE2   1 
ATOM   5425 N  N     . TYR B 1 325 ? 16.764  34.850  61.792 1.00 55.73  ? 325 TYR B N     1 
ATOM   5426 C  CA    . TYR B 1 325 ? 17.154  33.585  61.202 1.00 53.47  ? 325 TYR B CA    1 
ATOM   5427 C  C     . TYR B 1 325 ? 18.007  32.838  62.203 1.00 52.51  ? 325 TYR B C     1 
ATOM   5428 O  O     . TYR B 1 325 ? 18.888  33.416  62.827 1.00 52.35  ? 325 TYR B O     1 
ATOM   5429 C  CB    . TYR B 1 325 ? 17.952  33.835  59.917 1.00 53.01  ? 325 TYR B CB    1 
ATOM   5430 C  CG    . TYR B 1 325 ? 18.530  32.594  59.288 1.00 52.21  ? 325 TYR B CG    1 
ATOM   5431 C  CD1   . TYR B 1 325 ? 17.710  31.636  58.695 1.00 51.26  ? 325 TYR B CD1   1 
ATOM   5432 C  CD2   . TYR B 1 325 ? 19.908  32.373  59.290 1.00 52.96  ? 325 TYR B CD2   1 
ATOM   5433 C  CE1   . TYR B 1 325 ? 18.258  30.472  58.112 1.00 52.89  ? 325 TYR B CE1   1 
ATOM   5434 C  CE2   . TYR B 1 325 ? 20.464  31.224  58.719 1.00 52.84  ? 325 TYR B CE2   1 
ATOM   5435 C  CZ    . TYR B 1 325 ? 19.633  30.274  58.131 1.00 52.76  ? 325 TYR B CZ    1 
ATOM   5436 O  OH    . TYR B 1 325 ? 20.192  29.136  57.583 1.00 52.80  ? 325 TYR B OH    1 
ATOM   5437 N  N     . LEU B 1 326 ? 17.755  31.545  62.341 1.00 52.55  ? 326 LEU B N     1 
ATOM   5438 C  CA    . LEU B 1 326 ? 18.495  30.728  63.287 1.00 52.15  ? 326 LEU B CA    1 
ATOM   5439 C  C     . LEU B 1 326 ? 18.859  29.397  62.663 1.00 52.58  ? 326 LEU B C     1 
ATOM   5440 O  O     . LEU B 1 326 ? 17.984  28.620  62.303 1.00 52.33  ? 326 LEU B O     1 
ATOM   5441 C  CB    . LEU B 1 326 ? 17.644  30.493  64.541 1.00 50.64  ? 326 LEU B CB    1 
ATOM   5442 C  CG    . LEU B 1 326 ? 18.200  29.601  65.649 1.00 50.38  ? 326 LEU B CG    1 
ATOM   5443 C  CD1   . LEU B 1 326 ? 19.511  30.176  66.184 1.00 50.27  ? 326 LEU B CD1   1 
ATOM   5444 C  CD2   . LEU B 1 326 ? 17.167  29.515  66.762 1.00 49.72  ? 326 LEU B CD2   1 
ATOM   5445 N  N     . LYS B 1 327 ? 20.153  29.148  62.528 1.00 52.79  ? 327 LYS B N     1 
ATOM   5446 C  CA    . LYS B 1 327 ? 20.638  27.904  61.975 1.00 55.59  ? 327 LYS B CA    1 
ATOM   5447 C  C     . LYS B 1 327 ? 21.170  27.047  63.118 1.00 57.31  ? 327 LYS B C     1 
ATOM   5448 O  O     . LYS B 1 327 ? 22.021  27.495  63.890 1.00 57.18  ? 327 LYS B O     1 
ATOM   5449 C  CB    . LYS B 1 327 ? 21.762  28.159  60.967 1.00 55.93  ? 327 LYS B CB    1 
ATOM   5450 C  CG    . LYS B 1 327 ? 22.521  26.892  60.568 1.00 57.38  ? 327 LYS B CG    1 
ATOM   5451 C  CD    . LYS B 1 327 ? 23.549  27.159  59.484 1.00 59.35  ? 327 LYS B CD    1 
ATOM   5452 C  CE    . LYS B 1 327 ? 24.315  25.895  59.135 0.00 58.91  ? 327 LYS B CE    1 
ATOM   5453 N  NZ    . LYS B 1 327 ? 25.392  26.148  58.141 0.00 59.36  ? 327 LYS B NZ    1 
ATOM   5454 N  N     . ILE B 1 328 ? 20.670  25.819  63.231 1.00 59.13  ? 328 ILE B N     1 
ATOM   5455 C  CA    . ILE B 1 328 ? 21.124  24.922  64.293 1.00 61.34  ? 328 ILE B CA    1 
ATOM   5456 C  C     . ILE B 1 328 ? 21.797  23.663  63.758 1.00 62.22  ? 328 ILE B C     1 
ATOM   5457 O  O     . ILE B 1 328 ? 21.206  22.911  62.988 1.00 62.87  ? 328 ILE B O     1 
ATOM   5458 C  CB    . ILE B 1 328 ? 19.965  24.497  65.207 1.00 61.04  ? 328 ILE B CB    1 
ATOM   5459 C  CG1   . ILE B 1 328 ? 19.181  25.730  65.658 1.00 62.33  ? 328 ILE B CG1   1 
ATOM   5460 C  CG2   . ILE B 1 328 ? 20.514  23.772  66.415 1.00 61.57  ? 328 ILE B CG2   1 
ATOM   5461 C  CD1   . ILE B 1 328 ? 17.999  25.437  66.550 1.00 62.17  ? 328 ILE B CD1   1 
ATOM   5462 N  N     . ASP B 1 329 ? 23.042  23.459  64.170 1.00 63.92  ? 329 ASP B N     1 
ATOM   5463 C  CA    . ASP B 1 329 ? 23.832  22.304  63.776 1.00 66.47  ? 329 ASP B CA    1 
ATOM   5464 C  C     . ASP B 1 329 ? 24.083  21.429  64.994 1.00 68.49  ? 329 ASP B C     1 
ATOM   5465 O  O     . ASP B 1 329 ? 23.673  21.753  66.111 1.00 68.70  ? 329 ASP B O     1 
ATOM   5466 C  CB    . ASP B 1 329 ? 25.186  22.734  63.208 1.00 66.75  ? 329 ASP B CB    1 
ATOM   5467 C  CG    . ASP B 1 329 ? 25.087  23.280  61.803 1.00 68.32  ? 329 ASP B CG    1 
ATOM   5468 O  OD1   . ASP B 1 329 ? 26.086  23.872  61.330 1.00 69.02  ? 329 ASP B OD1   1 
ATOM   5469 O  OD2   . ASP B 1 329 ? 24.020  23.109  61.170 1.00 67.98  ? 329 ASP B OD2   1 
ATOM   5470 N  N     . THR B 1 330 ? 24.770  20.319  64.769 1.00 70.97  ? 330 THR B N     1 
ATOM   5471 C  CA    . THR B 1 330 ? 25.094  19.398  65.843 1.00 72.46  ? 330 THR B CA    1 
ATOM   5472 C  C     . THR B 1 330 ? 25.994  18.248  65.422 1.00 72.95  ? 330 THR B C     1 
ATOM   5473 O  O     . THR B 1 330 ? 25.847  17.659  64.345 1.00 72.76  ? 330 THR B O     1 
ATOM   5474 C  CB    . THR B 1 330 ? 23.837  18.778  66.485 1.00 72.15  ? 330 THR B CB    1 
ATOM   5475 O  OG1   . THR B 1 330 ? 24.222  17.608  67.220 1.00 72.47  ? 330 THR B OG1   1 
ATOM   5476 C  CG2   . THR B 1 330 ? 22.818  18.398  65.429 1.00 72.26  ? 330 THR B CG2   1 
ATOM   5477 N  N     . TRP B 1 331 ? 26.951  17.951  66.288 1.00 72.95  ? 331 TRP B N     1 
ATOM   5478 C  CA    . TRP B 1 331 ? 27.855  16.844  66.063 1.00 72.56  ? 331 TRP B CA    1 
ATOM   5479 C  C     . TRP B 1 331 ? 27.363  15.829  67.053 1.00 72.84  ? 331 TRP B C     1 
ATOM   5480 O  O     . TRP B 1 331 ? 26.970  16.174  68.167 1.00 73.85  ? 331 TRP B O     1 
ATOM   5481 C  CB    . TRP B 1 331 ? 29.297  17.219  66.373 0.00 72.80  ? 331 TRP B CB    1 
ATOM   5482 C  CG    . TRP B 1 331 ? 29.499  17.751  67.761 0.00 72.92  ? 331 TRP B CG    1 
ATOM   5483 C  CD1   . TRP B 1 331 ? 28.969  18.895  68.275 0.00 72.98  ? 331 TRP B CD1   1 
ATOM   5484 C  CD2   . TRP B 1 331 ? 30.308  17.181  68.806 0.00 73.02  ? 331 TRP B CD2   1 
ATOM   5485 N  NE1   . TRP B 1 331 ? 29.394  19.081  69.566 0.00 73.04  ? 331 TRP B NE1   1 
ATOM   5486 C  CE2   . TRP B 1 331 ? 30.216  18.045  69.920 0.00 73.06  ? 331 TRP B CE2   1 
ATOM   5487 C  CE3   . TRP B 1 331 ? 31.101  16.027  68.910 0.00 73.08  ? 331 TRP B CE3   1 
ATOM   5488 C  CZ2   . TRP B 1 331 ? 30.885  17.797  71.124 0.00 73.11  ? 331 TRP B CZ2   1 
ATOM   5489 C  CZ3   . TRP B 1 331 ? 31.770  15.780  70.113 0.00 73.12  ? 331 TRP B CZ3   1 
ATOM   5490 C  CH2   . TRP B 1 331 ? 31.655  16.664  71.202 0.00 73.13  ? 331 TRP B CH2   1 
ATOM   5491 N  N     . ARG B 1 332 ? 27.381  14.567  66.659 0.00 71.82  ? 332 ARG B N     1 
ATOM   5492 C  CA    . ARG B 1 332 ? 26.913  13.525  67.553 0.00 70.87  ? 332 ARG B CA    1 
ATOM   5493 C  C     . ARG B 1 332 ? 28.213  12.936  67.938 0.00 70.82  ? 332 ARG B C     1 
ATOM   5494 O  O     . ARG B 1 332 ? 28.541  11.830  67.432 0.00 70.73  ? 332 ARG B O     1 
ATOM   5495 C  CB    . ARG B 1 332 ? 26.025  12.536  66.819 0.00 69.94  ? 332 ARG B CB    1 
ATOM   5496 C  CG    . ARG B 1 332 ? 24.677  13.185  66.411 0.00 68.65  ? 332 ARG B CG    1 
ATOM   5497 C  CD    . ARG B 1 332 ? 23.629  12.258  65.706 0.00 67.55  ? 332 ARG B CD    1 
ATOM   5498 N  NE    . ARG B 1 332 ? 22.359  12.925  65.331 0.00 66.56  ? 332 ARG B NE    1 
ATOM   5499 C  CZ    . ARG B 1 332 ? 21.319  12.320  64.740 0.00 66.07  ? 332 ARG B CZ    1 
ATOM   5500 N  NH1   . ARG B 1 332 ? 20.213  12.997  64.436 0.00 65.76  ? 332 ARG B NH1   1 
ATOM   5501 N  NH2   . ARG B 1 332 ? 21.376  11.028  64.450 0.00 65.76  ? 332 ARG B NH2   1 
HETATM 5502 MN MN    . MN  C 2 .   ? 8.130   27.788  21.899 1.00 36.09  ? 403 MN  A MN    1 
HETATM 5503 MN MN    . MN  D 2 .   ? 5.801   27.935  24.271 1.00 39.57  ? 404 MN  A MN    1 
HETATM 5504 S  S     . SO4 E 3 .   ? 17.175  28.112  32.476 1.00 100.80 ? 501 SO4 A S     1 
HETATM 5505 O  O1    . SO4 E 3 .   ? 18.136  28.230  31.357 1.00 100.18 ? 501 SO4 A O1    1 
HETATM 5506 O  O2    . SO4 E 3 .   ? 17.097  26.692  32.887 1.00 100.80 ? 501 SO4 A O2    1 
HETATM 5507 O  O3    . SO4 E 3 .   ? 17.633  28.926  33.626 1.00 100.14 ? 501 SO4 A O3    1 
HETATM 5508 O  O4    . SO4 E 3 .   ? 15.834  28.575  32.045 1.00 100.56 ? 501 SO4 A O4    1 
HETATM 5509 S  S     . SO4 F 3 .   ? 0.566   29.512  36.007 1.00 86.73  ? 502 SO4 A S     1 
HETATM 5510 O  O1    . SO4 F 3 .   ? 1.690   28.556  35.971 1.00 87.27  ? 502 SO4 A O1    1 
HETATM 5511 O  O2    . SO4 F 3 .   ? -0.620  28.803  36.523 1.00 87.87  ? 502 SO4 A O2    1 
HETATM 5512 O  O3    . SO4 F 3 .   ? 0.896   30.642  36.905 1.00 86.58  ? 502 SO4 A O3    1 
HETATM 5513 O  O4    . SO4 F 3 .   ? 0.287   30.037  34.658 1.00 86.51  ? 502 SO4 A O4    1 
HETATM 5514 S  S     . SO4 G 3 .   ? -13.586 39.644  36.031 1.00 100.28 ? 503 SO4 A S     1 
HETATM 5515 O  O1    . SO4 G 3 .   ? -12.340 39.512  35.250 1.00 100.72 ? 503 SO4 A O1    1 
HETATM 5516 O  O2    . SO4 G 3 .   ? -14.638 38.811  35.421 1.00 100.46 ? 503 SO4 A O2    1 
HETATM 5517 O  O3    . SO4 G 3 .   ? -13.347 39.201  37.420 1.00 99.66  ? 503 SO4 A O3    1 
HETATM 5518 O  O4    . SO4 G 3 .   ? -14.020 41.056  36.015 1.00 99.97  ? 503 SO4 A O4    1 
HETATM 5519 O  OP3   . DA  H 4 .   ? 8.637   26.026  23.216 1.00 53.97  ? 401 DA  A OP3   1 
HETATM 5520 P  P     . DA  H 4 .   ? 7.599   25.305  23.994 1.00 56.33  ? 401 DA  A P     1 
HETATM 5521 O  OP1   . DA  H 4 .   ? 8.249   24.467  25.030 1.00 56.70  ? 401 DA  A OP1   1 
HETATM 5522 O  OP2   . DA  H 4 .   ? 6.700   26.285  24.649 1.00 54.49  ? 401 DA  A OP2   1 
HETATM 5523 O  "O5'" . DA  H 4 .   ? 7.095   23.970  23.128 1.00 59.20  ? 401 DA  A "O5'" 1 
HETATM 5524 C  "C5'" . DA  H 4 .   ? 7.073   23.961  21.762 1.00 66.74  ? 401 DA  A "C5'" 1 
HETATM 5525 C  "C4'" . DA  H 4 .   ? 6.041   23.013  21.296 1.00 71.22  ? 401 DA  A "C4'" 1 
HETATM 5526 O  "O4'" . DA  H 4 .   ? 6.029   21.855  22.189 1.00 73.78  ? 401 DA  A "O4'" 1 
HETATM 5527 C  "C3'" . DA  H 4 .   ? 4.736   23.676  21.350 1.00 73.80  ? 401 DA  A "C3'" 1 
HETATM 5528 O  "O3'" . DA  H 4 .   ? 4.355   23.874  19.995 1.00 76.51  ? 401 DA  A "O3'" 1 
HETATM 5529 C  "C2'" . DA  H 4 .   ? 3.864   22.749  22.165 1.00 74.04  ? 401 DA  A "C2'" 1 
HETATM 5530 C  "C1'" . DA  H 4 .   ? 4.682   21.474  22.506 1.00 74.70  ? 401 DA  A "C1'" 1 
HETATM 5531 N  N9    . DA  H 4 .   ? 4.578   21.123  23.969 1.00 76.71  ? 401 DA  A N9    1 
HETATM 5532 C  C8    . DA  H 4 .   ? 3.630   21.533  24.876 1.00 76.87  ? 401 DA  A C8    1 
HETATM 5533 N  N7    . DA  H 4 .   ? 3.758   21.069  26.081 1.00 77.50  ? 401 DA  A N7    1 
HETATM 5534 C  C5    . DA  H 4 .   ? 4.896   20.300  25.989 1.00 77.78  ? 401 DA  A C5    1 
HETATM 5535 C  C6    . DA  H 4 .   ? 5.570   19.479  26.941 1.00 78.16  ? 401 DA  A C6    1 
HETATM 5536 N  N6    . DA  H 4 .   ? 5.155   19.409  28.200 1.00 78.77  ? 401 DA  A N6    1 
HETATM 5537 N  N1    . DA  H 4 .   ? 6.682   18.805  26.554 1.00 78.32  ? 401 DA  A N1    1 
HETATM 5538 C  C2    . DA  H 4 .   ? 7.090   18.888  25.277 1.00 78.14  ? 401 DA  A C2    1 
HETATM 5539 N  N3    . DA  H 4 .   ? 6.541   19.611  24.271 1.00 78.05  ? 401 DA  A N3    1 
HETATM 5540 C  C4    . DA  H 4 .   ? 5.403   20.288  24.700 1.00 78.10  ? 401 DA  A C4    1 
HETATM 5541 P  P     . PO4 I 5 .   ? 34.178  32.996  46.387 1.00 60.84  ? 402 PO4 B P     1 
HETATM 5542 O  O1    . PO4 I 5 .   ? 35.146  33.243  45.291 1.00 57.95  ? 402 PO4 B O1    1 
HETATM 5543 O  O2    . PO4 I 5 .   ? 34.912  32.751  47.670 1.00 59.15  ? 402 PO4 B O2    1 
HETATM 5544 O  O3    . PO4 I 5 .   ? 33.291  34.184  46.538 1.00 58.92  ? 402 PO4 B O3    1 
HETATM 5545 O  O4    . PO4 I 5 .   ? 33.352  31.796  46.060 1.00 61.86  ? 402 PO4 B O4    1 
HETATM 5546 MN MN    . MN  J 2 .   ? 36.023  34.916  44.253 1.00 39.52  ? 405 MN  B MN    1 
HETATM 5547 MN MN    . MN  K 2 .   ? 33.658  36.365  46.296 1.00 33.69  ? 406 MN  B MN    1 
HETATM 5548 O  O     . HOH L 6 .   ? 5.997   27.242  22.189 1.00 38.84  ? 407 HOH A O     1 
HETATM 5549 O  O     . HOH L 6 .   ? 20.825  31.690  27.031 1.00 20.90  ? 600 HOH A O     1 
HETATM 5550 O  O     . HOH L 6 .   ? -1.211  33.853  26.590 1.00 28.27  ? 603 HOH A O     1 
HETATM 5551 O  O     . HOH L 6 .   ? 24.474  -2.795  8.722  1.00 39.79  ? 614 HOH A O     1 
HETATM 5552 O  O     . HOH L 6 .   ? 20.148  32.378  19.797 1.00 26.96  ? 615 HOH A O     1 
HETATM 5553 O  O     . HOH L 6 .   ? 12.873  29.850  15.998 1.00 26.89  ? 619 HOH A O     1 
HETATM 5554 O  O     . HOH L 6 .   ? 10.794  50.000  7.623  1.00 30.65  ? 620 HOH A O     1 
HETATM 5555 O  O     . HOH L 6 .   ? 12.664  36.246  32.068 1.00 33.33  ? 623 HOH A O     1 
HETATM 5556 O  O     . HOH L 6 .   ? 8.170   50.745  8.634  1.00 36.49  ? 624 HOH A O     1 
HETATM 5557 O  O     . HOH L 6 .   ? 8.619   36.613  24.609 1.00 39.28  ? 625 HOH A O     1 
HETATM 5558 O  O     . HOH L 6 .   ? 17.404  32.152  26.387 1.00 34.61  ? 630 HOH A O     1 
HETATM 5559 O  O     . HOH L 6 .   ? 18.138  19.947  22.036 1.00 33.87  ? 633 HOH A O     1 
HETATM 5560 O  O     . HOH L 6 .   ? 16.478  24.049  10.645 1.00 38.08  ? 636 HOH A O     1 
HETATM 5561 O  O     . HOH L 6 .   ? 3.815   29.742  16.933 1.00 31.81  ? 642 HOH A O     1 
HETATM 5562 O  O     . HOH L 6 .   ? 13.241  47.354  19.018 1.00 33.48  ? 643 HOH A O     1 
HETATM 5563 O  O     . HOH L 6 .   ? 5.075   36.347  1.223  1.00 47.85  ? 644 HOH A O     1 
HETATM 5564 O  O     . HOH L 6 .   ? -11.770 44.227  17.033 1.00 42.51  ? 649 HOH A O     1 
HETATM 5565 O  O     . HOH L 6 .   ? 22.713  36.615  32.490 1.00 35.93  ? 650 HOH A O     1 
HETATM 5566 O  O     . HOH L 6 .   ? 14.733  31.819  15.898 1.00 31.24  ? 653 HOH A O     1 
HETATM 5567 O  O     . HOH L 6 .   ? 0.389   38.918  31.459 1.00 32.87  ? 654 HOH A O     1 
HETATM 5568 O  O     . HOH L 6 .   ? 25.307  -0.365  10.465 1.00 43.84  ? 658 HOH A O     1 
HETATM 5569 O  O     . HOH L 6 .   ? 32.483  -1.947  13.766 1.00 32.20  ? 659 HOH A O     1 
HETATM 5570 O  O     . HOH L 6 .   ? 14.183  38.287  37.478 1.00 39.60  ? 661 HOH A O     1 
HETATM 5571 O  O     . HOH L 6 .   ? 17.063  23.589  26.335 1.00 62.36  ? 663 HOH A O     1 
HETATM 5572 O  O     . HOH L 6 .   ? 9.509   48.664  20.554 1.00 42.70  ? 667 HOH A O     1 
HETATM 5573 O  O     . HOH L 6 .   ? 7.593   20.254  9.281  1.00 39.35  ? 668 HOH A O     1 
HETATM 5574 O  O     . HOH L 6 .   ? -3.304  44.228  9.287  1.00 37.27  ? 670 HOH A O     1 
HETATM 5575 O  O     . HOH L 6 .   ? 25.058  31.711  26.031 1.00 39.21  ? 674 HOH A O     1 
HETATM 5576 O  O     . HOH L 6 .   ? 3.419   39.285  28.874 1.00 44.32  ? 680 HOH A O     1 
HETATM 5577 O  O     . HOH L 6 .   ? 7.276   28.870  10.933 1.00 37.21  ? 681 HOH A O     1 
HETATM 5578 O  O     . HOH L 6 .   ? 30.608  -4.998  12.689 1.00 52.87  ? 687 HOH A O     1 
HETATM 5579 O  O     . HOH L 6 .   ? 27.003  23.812  8.871  1.00 52.22  ? 691 HOH A O     1 
HETATM 5580 O  O     . HOH L 6 .   ? 29.240  -1.762  10.904 1.00 50.99  ? 693 HOH A O     1 
HETATM 5581 O  O     . HOH L 6 .   ? 23.751  1.033   2.585  1.00 46.93  ? 696 HOH A O     1 
HETATM 5582 O  O     . HOH L 6 .   ? 20.256  25.997  25.191 1.00 37.52  ? 697 HOH A O     1 
HETATM 5583 O  O     . HOH L 6 .   ? -16.756 40.666  29.195 1.00 52.18  ? 698 HOH A O     1 
HETATM 5584 O  O     . HOH L 6 .   ? -1.518  30.392  6.490  1.00 35.24  ? 699 HOH A O     1 
HETATM 5585 O  O     . HOH L 6 .   ? -3.681  43.478  27.408 1.00 45.01  ? 700 HOH A O     1 
HETATM 5586 O  O     . HOH L 6 .   ? 24.716  -8.362  12.051 1.00 42.74  ? 702 HOH A O     1 
HETATM 5587 O  O     . HOH L 6 .   ? -10.280 44.101  27.983 1.00 51.10  ? 704 HOH A O     1 
HETATM 5588 O  O     . HOH L 6 .   ? 11.508  49.226  18.428 1.00 34.73  ? 706 HOH A O     1 
HETATM 5589 O  O     . HOH L 6 .   ? -10.889 31.548  28.969 1.00 46.62  ? 707 HOH A O     1 
HETATM 5590 O  O     . HOH L 6 .   ? 19.550  26.974  9.604  1.00 39.81  ? 708 HOH A O     1 
HETATM 5591 O  O     . HOH L 6 .   ? 6.543   26.314  10.570 1.00 36.68  ? 710 HOH A O     1 
HETATM 5592 O  O     . HOH L 6 .   ? 24.439  44.355  21.770 1.00 32.46  ? 711 HOH A O     1 
HETATM 5593 O  O     . HOH L 6 .   ? 19.193  28.714  26.693 1.00 47.73  ? 716 HOH A O     1 
HETATM 5594 O  O     . HOH L 6 .   ? 13.866  26.267  4.861  1.00 40.33  ? 721 HOH A O     1 
HETATM 5595 O  O     . HOH L 6 .   ? 20.612  21.901  1.641  1.00 54.11  ? 723 HOH A O     1 
HETATM 5596 O  O     . HOH L 6 .   ? 21.388  12.028  19.150 1.00 53.64  ? 725 HOH A O     1 
HETATM 5597 O  O     . HOH L 6 .   ? 9.167   20.276  22.215 1.00 60.10  ? 726 HOH A O     1 
HETATM 5598 O  O     . HOH L 6 .   ? -10.556 40.625  10.223 1.00 37.70  ? 734 HOH A O     1 
HETATM 5599 O  O     . HOH L 6 .   ? 9.836   30.151  32.358 1.00 39.67  ? 736 HOH A O     1 
HETATM 5600 O  O     . HOH L 6 .   ? -9.991  43.259  6.587  1.00 46.12  ? 737 HOH A O     1 
HETATM 5601 O  O     . HOH L 6 .   ? 21.036  22.105  24.426 1.00 40.76  ? 739 HOH A O     1 
HETATM 5602 O  O     . HOH L 6 .   ? 21.496  8.524   17.696 1.00 56.04  ? 742 HOH A O     1 
HETATM 5603 O  O     . HOH L 6 .   ? 2.416   44.717  30.928 1.00 42.94  ? 743 HOH A O     1 
HETATM 5604 O  O     . HOH L 6 .   ? -16.261 31.516  15.305 1.00 52.12  ? 746 HOH A O     1 
HETATM 5605 O  O     . HOH L 6 .   ? 11.378  27.237  4.886  1.00 41.71  ? 751 HOH A O     1 
HETATM 5606 O  O     . HOH L 6 .   ? 5.788   9.512   -2.188 1.00 55.21  ? 752 HOH A O     1 
HETATM 5607 O  O     . HOH L 6 .   ? 33.418  -1.638  11.651 1.00 43.83  ? 753 HOH A O     1 
HETATM 5608 O  O     . HOH L 6 .   ? 7.144   36.455  34.339 1.00 64.77  ? 755 HOH A O     1 
HETATM 5609 O  O     . HOH L 6 .   ? 7.808   32.984  13.692 1.00 44.25  ? 758 HOH A O     1 
HETATM 5610 O  O     . HOH L 6 .   ? 31.632  -0.955  9.666  1.00 37.36  ? 761 HOH A O     1 
HETATM 5611 O  O     . HOH L 6 .   ? -7.643  32.514  8.291  1.00 47.24  ? 762 HOH A O     1 
HETATM 5612 O  O     . HOH L 6 .   ? 9.679   50.363  31.138 1.00 54.29  ? 764 HOH A O     1 
HETATM 5613 O  O     . HOH L 6 .   ? 18.842  30.665  10.658 1.00 41.88  ? 767 HOH A O     1 
HETATM 5614 O  O     . HOH L 6 .   ? 10.575  51.821  22.179 1.00 51.44  ? 768 HOH A O     1 
HETATM 5615 O  O     . HOH L 6 .   ? 11.942  42.114  1.432  1.00 55.98  ? 772 HOH A O     1 
HETATM 5616 O  O     . HOH L 6 .   ? 23.579  46.363  20.572 1.00 44.31  ? 773 HOH A O     1 
HETATM 5617 O  O     . HOH L 6 .   ? 11.925  52.321  7.841  1.00 54.45  ? 775 HOH A O     1 
HETATM 5618 O  O     . HOH L 6 .   ? 9.569   47.275  32.316 1.00 50.21  ? 777 HOH A O     1 
HETATM 5619 O  O     . HOH L 6 .   ? 6.650   50.885  28.065 1.00 50.78  ? 784 HOH A O     1 
HETATM 5620 O  O     . HOH L 6 .   ? 28.279  22.701  15.210 1.00 52.40  ? 790 HOH A O     1 
HETATM 5621 O  O     . HOH L 6 .   ? -9.491  48.671  25.778 1.00 49.21  ? 792 HOH A O     1 
HETATM 5622 O  O     . HOH L 6 .   ? -11.033 43.027  9.273  1.00 51.61  ? 793 HOH A O     1 
HETATM 5623 O  O     . HOH L 6 .   ? 24.034  -7.943  6.583  1.00 63.37  ? 795 HOH A O     1 
HETATM 5624 O  O     . HOH L 6 .   ? 25.979  0.330   1.082  1.00 49.73  ? 796 HOH A O     1 
HETATM 5625 O  O     . HOH L 6 .   ? 26.855  37.836  22.018 1.00 51.14  ? 800 HOH A O     1 
HETATM 5626 O  O     . HOH L 6 .   ? 17.145  48.593  10.626 1.00 46.88  ? 801 HOH A O     1 
HETATM 5627 O  O     . HOH L 6 .   ? 21.439  38.397  8.132  1.00 59.77  ? 804 HOH A O     1 
HETATM 5628 O  O     . HOH L 6 .   ? 24.784  8.790   14.885 1.00 42.30  ? 805 HOH A O     1 
HETATM 5629 O  O     . HOH L 6 .   ? 0.317   12.358  16.395 1.00 67.66  ? 808 HOH A O     1 
HETATM 5630 O  O     . HOH L 6 .   ? 2.061   57.047  10.761 1.00 59.69  ? 809 HOH A O     1 
HETATM 5631 O  O     . HOH L 6 .   ? 28.465  -3.973  9.216  1.00 47.36  ? 810 HOH A O     1 
HETATM 5632 O  O     . HOH L 6 .   ? -14.261 38.933  15.247 1.00 51.44  ? 814 HOH A O     1 
HETATM 5633 O  O     . HOH L 6 .   ? 26.604  10.150  10.012 1.00 40.42  ? 822 HOH A O     1 
HETATM 5634 O  O     . HOH L 6 .   ? 17.313  17.434  21.944 1.00 60.01  ? 827 HOH A O     1 
HETATM 5635 O  O     . HOH L 6 .   ? 16.174  54.249  23.857 1.00 53.17  ? 830 HOH A O     1 
HETATM 5636 O  O     . HOH L 6 .   ? 18.685  26.844  28.705 1.00 54.61  ? 832 HOH A O     1 
HETATM 5637 O  O     . HOH L 6 .   ? 0.121   32.704  3.136  1.00 44.93  ? 833 HOH A O     1 
HETATM 5638 O  O     . HOH L 6 .   ? 2.980   15.318  1.991  1.00 58.85  ? 835 HOH A O     1 
HETATM 5639 O  O     . HOH L 6 .   ? 10.589  47.069  0.056  1.00 52.42  ? 836 HOH A O     1 
HETATM 5640 O  O     . HOH L 6 .   ? 21.537  33.784  6.861  1.00 58.82  ? 837 HOH A O     1 
HETATM 5641 O  O     . HOH L 6 .   ? 16.058  45.499  6.222  1.00 47.52  ? 838 HOH A O     1 
HETATM 5642 O  O     . HOH L 6 .   ? 17.630  31.982  8.735  1.00 39.56  ? 841 HOH A O     1 
HETATM 5643 O  O     . HOH L 6 .   ? 17.011  48.693  33.478 1.00 45.39  ? 844 HOH A O     1 
HETATM 5644 O  O     . HOH L 6 .   ? 26.025  22.143  12.126 1.00 53.76  ? 846 HOH A O     1 
HETATM 5645 O  O     . HOH L 6 .   ? 4.507   42.840  32.018 1.00 44.03  ? 854 HOH A O     1 
HETATM 5646 O  O     . HOH L 6 .   ? 13.413  15.305  17.706 1.00 50.03  ? 856 HOH A O     1 
HETATM 5647 O  O     . HOH L 6 .   ? 0.261   30.021  2.932  1.00 52.59  ? 857 HOH A O     1 
HETATM 5648 O  O     . HOH L 6 .   ? 24.471  19.769  1.611  1.00 68.08  ? 862 HOH A O     1 
HETATM 5649 O  O     . HOH L 6 .   ? 5.237   38.450  34.124 1.00 62.03  ? 865 HOH A O     1 
HETATM 5650 O  O     . HOH L 6 .   ? 10.093  22.657  25.008 1.00 64.19  ? 867 HOH A O     1 
HETATM 5651 O  O     . HOH L 6 .   ? 11.783  29.060  33.287 1.00 57.87  ? 868 HOH A O     1 
HETATM 5652 O  O     . HOH L 6 .   ? 17.584  46.821  8.452  1.00 53.20  ? 878 HOH A O     1 
HETATM 5653 O  O     . HOH L 6 .   ? -16.764 36.528  23.731 1.00 56.15  ? 880 HOH A O     1 
HETATM 5654 O  O     . HOH L 6 .   ? 3.616   32.864  0.808  1.00 50.07  ? 884 HOH A O     1 
HETATM 5655 O  O     . HOH L 6 .   ? 7.458   23.273  27.283 1.00 63.44  ? 887 HOH A O     1 
HETATM 5656 O  O     . HOH L 6 .   ? 32.461  -5.066  10.855 1.00 57.06  ? 895 HOH A O     1 
HETATM 5657 O  O     . HOH L 6 .   ? -17.852 30.910  17.390 1.00 63.66  ? 899 HOH A O     1 
HETATM 5658 O  O     . HOH L 6 .   ? -15.107 50.054  20.441 1.00 59.33  ? 901 HOH A O     1 
HETATM 5659 O  O     . HOH L 6 .   ? 23.636  33.144  22.835 1.00 46.41  ? 904 HOH A O     1 
HETATM 5660 O  O     . HOH L 6 .   ? -12.145 46.917  25.325 1.00 51.67  ? 908 HOH A O     1 
HETATM 5661 O  O     . HOH L 6 .   ? 24.699  38.278  9.758  1.00 70.25  ? 912 HOH A O     1 
HETATM 5662 O  O     . HOH L 6 .   ? 24.347  11.867  1.354  1.00 58.42  ? 914 HOH A O     1 
HETATM 5663 O  O     . HOH L 6 .   ? -10.701 29.806  31.106 1.00 51.73  ? 916 HOH A O     1 
HETATM 5664 O  O     . HOH L 6 .   ? 18.101  -3.241  21.476 1.00 46.72  ? 919 HOH A O     1 
HETATM 5665 O  O     . HOH L 6 .   ? -2.581  26.001  8.305  1.00 38.48  ? 922 HOH A O     1 
HETATM 5666 O  O     . HOH L 6 .   ? 21.470  -5.387  0.646  1.00 67.89  ? 923 HOH A O     1 
HETATM 5667 O  O     . HOH L 6 .   ? -8.903  38.174  0.379  1.00 67.04  ? 928 HOH A O     1 
HETATM 5668 O  O     . HOH L 6 .   ? 1.427   43.228  2.850  1.00 57.55  ? 933 HOH A O     1 
HETATM 5669 O  O     . HOH L 6 .   ? 26.521  29.948  12.049 1.00 57.61  ? 940 HOH A O     1 
HETATM 5670 O  O     . HOH L 6 .   ? 21.918  45.839  15.491 1.00 56.59  ? 941 HOH A O     1 
HETATM 5671 O  O     . HOH L 6 .   ? -0.336  24.212  30.827 1.00 59.15  ? 947 HOH A O     1 
HETATM 5672 O  O     . HOH L 6 .   ? 8.819   53.878  6.584  1.00 49.80  ? 966 HOH A O     1 
HETATM 5673 O  O     . HOH L 6 .   ? 24.248  31.623  11.848 1.00 51.18  ? 974 HOH A O     1 
HETATM 5674 O  O     . HOH L 6 .   ? -9.085  39.225  7.505  1.00 58.86  ? 978 HOH A O     1 
HETATM 5675 O  O     . HOH L 6 .   ? -13.420 32.604  28.192 1.00 51.45  ? 979 HOH A O     1 
HETATM 5676 O  O     . HOH M 6 .   ? 35.697  35.756  46.350 1.00 41.39  ? 408 HOH B O     1 
HETATM 5677 O  O     . HOH M 6 .   ? 20.997  36.531  39.985 1.00 22.64  ? 601 HOH B O     1 
HETATM 5678 O  O     . HOH M 6 .   ? 35.836  42.309  56.013 1.00 25.80  ? 602 HOH B O     1 
HETATM 5679 O  O     . HOH M 6 .   ? 38.084  40.907  48.744 1.00 25.31  ? 604 HOH B O     1 
HETATM 5680 O  O     . HOH M 6 .   ? 25.740  40.923  57.531 1.00 30.50  ? 605 HOH B O     1 
HETATM 5681 O  O     . HOH M 6 .   ? 35.049  43.979  54.121 1.00 23.99  ? 606 HOH B O     1 
HETATM 5682 O  O     . HOH M 6 .   ? 34.323  37.978  60.673 1.00 35.31  ? 607 HOH B O     1 
HETATM 5683 O  O     . HOH M 6 .   ? 47.969  37.682  58.725 1.00 41.27  ? 608 HOH B O     1 
HETATM 5684 O  O     . HOH M 6 .   ? 28.927  36.759  33.269 1.00 34.26  ? 609 HOH B O     1 
HETATM 5685 O  O     . HOH M 6 .   ? 42.959  37.796  38.531 1.00 27.77  ? 610 HOH B O     1 
HETATM 5686 O  O     . HOH M 6 .   ? 21.771  41.684  45.343 1.00 23.71  ? 611 HOH B O     1 
HETATM 5687 O  O     . HOH M 6 .   ? 29.355  41.888  49.670 1.00 28.66  ? 612 HOH B O     1 
HETATM 5688 O  O     . HOH M 6 .   ? 21.556  33.136  45.172 1.00 33.90  ? 613 HOH B O     1 
HETATM 5689 O  O     . HOH M 6 .   ? 41.301  38.833  31.644 1.00 34.70  ? 616 HOH B O     1 
HETATM 5690 O  O     . HOH M 6 .   ? 27.380  43.371  48.621 1.00 29.28  ? 617 HOH B O     1 
HETATM 5691 O  O     . HOH M 6 .   ? 45.713  56.792  45.221 1.00 30.92  ? 618 HOH B O     1 
HETATM 5692 O  O     . HOH M 6 .   ? 27.946  43.119  61.883 1.00 33.40  ? 621 HOH B O     1 
HETATM 5693 O  O     . HOH M 6 .   ? 56.973  45.533  50.802 1.00 38.52  ? 622 HOH B O     1 
HETATM 5694 O  O     . HOH M 6 .   ? 23.463  46.020  53.495 1.00 37.49  ? 626 HOH B O     1 
HETATM 5695 O  O     . HOH M 6 .   ? 40.993  28.777  34.384 1.00 46.12  ? 629 HOH B O     1 
HETATM 5696 O  O     . HOH M 6 .   ? 24.290  37.317  40.198 1.00 30.37  ? 631 HOH B O     1 
HETATM 5697 O  O     . HOH M 6 .   ? 24.769  45.339  24.226 1.00 41.06  ? 634 HOH B O     1 
HETATM 5698 O  O     . HOH M 6 .   ? 37.414  55.968  56.997 1.00 50.97  ? 635 HOH B O     1 
HETATM 5699 O  O     . HOH M 6 .   ? 27.417  34.483  27.700 1.00 38.59  ? 637 HOH B O     1 
HETATM 5700 O  O     . HOH M 6 .   ? 27.012  39.778  70.660 1.00 38.59  ? 638 HOH B O     1 
HETATM 5701 O  O     . HOH M 6 .   ? 41.952  63.581  43.451 1.00 50.41  ? 640 HOH B O     1 
HETATM 5702 O  O     . HOH M 6 .   ? 38.491  44.126  61.686 1.00 45.17  ? 641 HOH B O     1 
HETATM 5703 O  O     . HOH M 6 .   ? 28.816  53.537  36.245 1.00 36.84  ? 645 HOH B O     1 
HETATM 5704 O  O     . HOH M 6 .   ? 25.020  48.230  54.025 1.00 37.74  ? 646 HOH B O     1 
HETATM 5705 O  O     . HOH M 6 .   ? 18.946  35.906  43.198 1.00 47.18  ? 647 HOH B O     1 
HETATM 5706 O  O     . HOH M 6 .   ? 43.571  47.459  56.578 1.00 26.83  ? 652 HOH B O     1 
HETATM 5707 O  O     . HOH M 6 .   ? 33.284  41.411  38.937 1.00 41.21  ? 656 HOH B O     1 
HETATM 5708 O  O     . HOH M 6 .   ? 52.325  44.821  30.679 1.00 46.20  ? 657 HOH B O     1 
HETATM 5709 O  O     . HOH M 6 .   ? 52.302  34.459  37.537 1.00 55.28  ? 660 HOH B O     1 
HETATM 5710 O  O     . HOH M 6 .   ? 18.503  40.405  42.488 1.00 48.03  ? 662 HOH B O     1 
HETATM 5711 O  O     . HOH M 6 .   ? 15.023  36.692  46.583 1.00 70.81  ? 664 HOH B O     1 
HETATM 5712 O  O     . HOH M 6 .   ? 24.592  30.211  45.833 1.00 56.68  ? 666 HOH B O     1 
HETATM 5713 O  O     . HOH M 6 .   ? 27.721  31.877  51.977 1.00 43.74  ? 671 HOH B O     1 
HETATM 5714 O  O     . HOH M 6 .   ? 27.471  29.388  56.944 1.00 52.24  ? 675 HOH B O     1 
HETATM 5715 O  O     . HOH M 6 .   ? 33.194  45.997  48.245 1.00 39.57  ? 676 HOH B O     1 
HETATM 5716 O  O     . HOH M 6 .   ? 28.916  45.487  60.956 1.00 36.99  ? 677 HOH B O     1 
HETATM 5717 O  O     . HOH M 6 .   ? 52.649  53.106  46.741 1.00 41.65  ? 679 HOH B O     1 
HETATM 5718 O  O     . HOH M 6 .   ? 19.114  36.539  32.773 1.00 31.98  ? 682 HOH B O     1 
HETATM 5719 O  O     . HOH M 6 .   ? 32.294  53.438  34.300 1.00 43.37  ? 690 HOH B O     1 
HETATM 5720 O  O     . HOH M 6 .   ? 23.663  30.566  51.330 1.00 40.68  ? 694 HOH B O     1 
HETATM 5721 O  O     . HOH M 6 .   ? 22.513  52.322  31.249 1.00 57.89  ? 695 HOH B O     1 
HETATM 5722 O  O     . HOH M 6 .   ? 17.735  49.548  36.011 1.00 37.51  ? 705 HOH B O     1 
HETATM 5723 O  O     . HOH M 6 .   ? 32.148  62.879  43.262 1.00 54.35  ? 709 HOH B O     1 
HETATM 5724 O  O     . HOH M 6 .   ? 23.296  55.660  31.672 1.00 59.17  ? 712 HOH B O     1 
HETATM 5725 O  O     . HOH M 6 .   ? 35.332  53.664  59.097 1.00 41.18  ? 713 HOH B O     1 
HETATM 5726 O  O     . HOH M 6 .   ? 10.893  49.164  35.292 1.00 67.49  ? 714 HOH B O     1 
HETATM 5727 O  O     . HOH M 6 .   ? 34.204  62.382  42.003 1.00 49.93  ? 715 HOH B O     1 
HETATM 5728 O  O     . HOH M 6 .   ? 48.183  33.876  61.330 1.00 56.01  ? 717 HOH B O     1 
HETATM 5729 O  O     . HOH M 6 .   ? 34.747  30.290  37.621 1.00 43.10  ? 718 HOH B O     1 
HETATM 5730 O  O     . HOH M 6 .   ? 53.073  49.299  51.890 1.00 54.69  ? 719 HOH B O     1 
HETATM 5731 O  O     . HOH M 6 .   ? 55.339  34.105  47.303 1.00 45.72  ? 720 HOH B O     1 
HETATM 5732 O  O     . HOH M 6 .   ? 59.809  48.120  44.253 1.00 54.72  ? 722 HOH B O     1 
HETATM 5733 O  O     . HOH M 6 .   ? 30.446  40.918  73.893 1.00 52.20  ? 724 HOH B O     1 
HETATM 5734 O  O     . HOH M 6 .   ? 30.715  55.427  35.490 1.00 31.90  ? 727 HOH B O     1 
HETATM 5735 O  O     . HOH M 6 .   ? 32.009  31.680  36.404 1.00 45.68  ? 728 HOH B O     1 
HETATM 5736 O  O     . HOH M 6 .   ? 45.347  44.586  31.841 1.00 49.33  ? 733 HOH B O     1 
HETATM 5737 O  O     . HOH M 6 .   ? 32.640  30.092  50.587 1.00 54.72  ? 735 HOH B O     1 
HETATM 5738 O  O     . HOH M 6 .   ? 51.231  55.353  34.031 1.00 46.18  ? 740 HOH B O     1 
HETATM 5739 O  O     . HOH M 6 .   ? 54.045  51.663  39.358 1.00 46.05  ? 744 HOH B O     1 
HETATM 5740 O  O     . HOH M 6 .   ? 44.172  25.567  45.958 1.00 66.10  ? 745 HOH B O     1 
HETATM 5741 O  O     . HOH M 6 .   ? 21.177  46.867  54.553 1.00 54.27  ? 749 HOH B O     1 
HETATM 5742 O  O     . HOH M 6 .   ? 19.332  48.758  46.887 1.00 43.80  ? 750 HOH B O     1 
HETATM 5743 O  O     . HOH M 6 .   ? 37.762  35.111  54.066 1.00 46.20  ? 756 HOH B O     1 
HETATM 5744 O  O     . HOH M 6 .   ? 40.569  34.494  66.143 1.00 60.36  ? 759 HOH B O     1 
HETATM 5745 O  O     . HOH M 6 .   ? 18.396  51.802  35.620 1.00 48.59  ? 760 HOH B O     1 
HETATM 5746 O  O     . HOH M 6 .   ? 39.322  26.628  34.794 1.00 55.12  ? 763 HOH B O     1 
HETATM 5747 O  O     . HOH M 6 .   ? 51.751  42.526  27.912 1.00 48.40  ? 765 HOH B O     1 
HETATM 5748 O  O     . HOH M 6 .   ? 35.936  36.115  61.402 1.00 36.28  ? 766 HOH B O     1 
HETATM 5749 O  O     . HOH M 6 .   ? 19.669  42.582  43.820 1.00 40.94  ? 770 HOH B O     1 
HETATM 5750 O  O     . HOH M 6 .   ? 42.888  49.686  58.367 1.00 45.84  ? 774 HOH B O     1 
HETATM 5751 O  O     . HOH M 6 .   ? 25.258  27.683  33.745 1.00 57.09  ? 778 HOH B O     1 
HETATM 5752 O  O     . HOH M 6 .   ? 28.225  52.236  59.866 1.00 58.25  ? 779 HOH B O     1 
HETATM 5753 O  O     . HOH M 6 .   ? 51.409  53.344  49.549 1.00 45.59  ? 780 HOH B O     1 
HETATM 5754 O  O     . HOH M 6 .   ? 16.143  40.955  41.826 1.00 52.29  ? 782 HOH B O     1 
HETATM 5755 O  O     . HOH M 6 .   ? 34.780  50.702  26.601 1.00 50.99  ? 783 HOH B O     1 
HETATM 5756 O  O     . HOH M 6 .   ? 20.373  29.636  30.228 1.00 56.64  ? 786 HOH B O     1 
HETATM 5757 O  O     . HOH M 6 .   ? 36.016  39.919  74.579 1.00 55.75  ? 788 HOH B O     1 
HETATM 5758 O  O     . HOH M 6 .   ? 35.440  30.136  64.674 1.00 52.52  ? 789 HOH B O     1 
HETATM 5759 O  O     . HOH M 6 .   ? 56.475  48.066  43.923 1.00 48.23  ? 791 HOH B O     1 
HETATM 5760 O  O     . HOH M 6 .   ? 24.360  48.383  56.607 1.00 49.41  ? 797 HOH B O     1 
HETATM 5761 O  O     . HOH M 6 .   ? 30.593  65.113  50.027 1.00 68.97  ? 799 HOH B O     1 
HETATM 5762 O  O     . HOH M 6 .   ? 22.174  34.607  41.884 1.00 55.26  ? 802 HOH B O     1 
HETATM 5763 O  O     . HOH M 6 .   ? 31.527  46.322  59.978 1.00 42.16  ? 803 HOH B O     1 
HETATM 5764 O  O     . HOH M 6 .   ? 42.448  58.802  31.331 1.00 49.46  ? 806 HOH B O     1 
HETATM 5765 O  O     . HOH M 6 .   ? 53.662  55.763  46.582 1.00 44.85  ? 807 HOH B O     1 
HETATM 5766 O  O     . HOH M 6 .   ? 33.082  30.133  63.227 1.00 43.20  ? 812 HOH B O     1 
HETATM 5767 O  O     . HOH M 6 .   ? 30.410  46.742  55.099 1.00 42.73  ? 813 HOH B O     1 
HETATM 5768 O  O     . HOH M 6 .   ? 25.914  44.447  66.879 1.00 49.66  ? 816 HOH B O     1 
HETATM 5769 O  O     . HOH M 6 .   ? 29.730  29.011  57.789 1.00 50.35  ? 817 HOH B O     1 
HETATM 5770 O  O     . HOH M 6 .   ? 33.792  29.658  35.177 1.00 56.56  ? 818 HOH B O     1 
HETATM 5771 O  O     . HOH M 6 .   ? 45.737  37.235  59.676 1.00 48.97  ? 821 HOH B O     1 
HETATM 5772 O  O     . HOH M 6 .   ? 42.088  56.699  23.023 1.00 65.78  ? 824 HOH B O     1 
HETATM 5773 O  O     . HOH M 6 .   ? 26.445  60.211  47.869 1.00 44.03  ? 825 HOH B O     1 
HETATM 5774 O  O     . HOH M 6 .   ? 15.681  27.400  63.679 1.00 57.80  ? 826 HOH B O     1 
HETATM 5775 O  O     . HOH M 6 .   ? 33.556  42.765  65.421 1.00 62.03  ? 829 HOH B O     1 
HETATM 5776 O  O     . HOH M 6 .   ? 38.296  39.392  70.298 1.00 55.98  ? 842 HOH B O     1 
HETATM 5777 O  O     . HOH M 6 .   ? 35.604  64.889  48.575 1.00 72.83  ? 843 HOH B O     1 
HETATM 5778 O  O     . HOH M 6 .   ? 34.740  45.682  49.794 1.00 34.08  ? 847 HOH B O     1 
HETATM 5779 O  O     . HOH M 6 .   ? 49.978  48.031  53.447 1.00 48.49  ? 848 HOH B O     1 
HETATM 5780 O  O     . HOH M 6 .   ? 32.058  29.155  30.709 1.00 61.72  ? 852 HOH B O     1 
HETATM 5781 O  O     . HOH M 6 .   ? 30.766  30.594  28.969 1.00 59.59  ? 855 HOH B O     1 
HETATM 5782 O  O     . HOH M 6 .   ? 36.457  31.580  50.139 1.00 65.04  ? 860 HOH B O     1 
HETATM 5783 O  O     . HOH M 6 .   ? 37.752  66.418  46.751 1.00 49.17  ? 861 HOH B O     1 
HETATM 5784 O  O     . HOH M 6 .   ? 48.378  22.336  36.584 1.00 56.60  ? 863 HOH B O     1 
HETATM 5785 O  O     . HOH M 6 .   ? 21.555  57.365  44.841 1.00 59.95  ? 866 HOH B O     1 
HETATM 5786 O  O     . HOH M 6 .   ? 32.107  44.229  63.176 1.00 41.01  ? 872 HOH B O     1 
HETATM 5787 O  O     . HOH M 6 .   ? 38.743  27.766  39.517 1.00 47.37  ? 876 HOH B O     1 
HETATM 5788 O  O     . HOH M 6 .   ? 26.905  31.306  41.549 1.00 57.49  ? 877 HOH B O     1 
HETATM 5789 O  O     . HOH M 6 .   ? 36.734  61.357  37.936 1.00 47.30  ? 885 HOH B O     1 
HETATM 5790 O  O     . HOH M 6 .   ? 18.152  46.579  47.585 1.00 51.45  ? 888 HOH B O     1 
HETATM 5791 O  O     . HOH M 6 .   ? 31.889  51.793  29.552 1.00 52.49  ? 889 HOH B O     1 
HETATM 5792 O  O     . HOH M 6 .   ? 46.856  61.705  50.676 1.00 58.00  ? 892 HOH B O     1 
HETATM 5793 O  O     . HOH M 6 .   ? 32.280  47.866  24.985 1.00 57.09  ? 894 HOH B O     1 
HETATM 5794 O  O     . HOH M 6 .   ? 22.789  29.468  29.834 1.00 57.45  ? 900 HOH B O     1 
HETATM 5795 O  O     . HOH M 6 .   ? 55.042  57.529  39.912 1.00 64.08  ? 905 HOH B O     1 
HETATM 5796 O  O     . HOH M 6 .   ? 36.664  52.452  60.886 1.00 57.82  ? 917 HOH B O     1 
HETATM 5797 O  O     . HOH M 6 .   ? 31.200  57.407  33.579 1.00 60.66  ? 932 HOH B O     1 
HETATM 5798 O  O     . HOH M 6 .   ? 37.441  49.919  61.967 1.00 57.01  ? 935 HOH B O     1 
HETATM 5799 O  O     . HOH M 6 .   ? 59.021  55.220  35.875 1.00 71.83  ? 936 HOH B O     1 
HETATM 5800 O  O     . HOH M 6 .   ? 22.396  29.033  49.625 1.00 53.97  ? 937 HOH B O     1 
HETATM 5801 O  O     . HOH M 6 .   ? 52.222  31.913  37.049 1.00 48.04  ? 942 HOH B O     1 
HETATM 5802 O  O     . HOH M 6 .   ? 25.278  28.755  30.443 1.00 64.18  ? 951 HOH B O     1 
HETATM 5803 O  O     . HOH M 6 .   ? 31.601  54.140  31.344 1.00 57.29  ? 953 HOH B O     1 
HETATM 5804 O  O     . HOH M 6 .   ? 42.445  27.876  43.753 1.00 62.94  ? 954 HOH B O     1 
HETATM 5805 O  O     . HOH M 6 .   ? 25.116  54.772  30.460 1.00 57.98  ? 958 HOH B O     1 
HETATM 5806 O  O     . HOH M 6 .   ? 52.813  58.172  41.129 1.00 58.15  ? 965 HOH B O     1 
HETATM 5807 O  O     . HOH M 6 .   ? 42.034  38.138  18.881 1.00 58.91  ? 972 HOH B O     1 
HETATM 5808 O  O     . HOH M 6 .   ? 46.227  46.934  16.538 1.00 62.50  ? 973 HOH B O     1 
HETATM 5809 O  O     . HOH M 6 .   ? 37.868  29.869  48.402 1.00 57.13  ? 975 HOH B O     1 
HETATM 5810 O  O     . HOH M 6 .   ? 56.495  54.813  32.642 1.00 52.55  ? 976 HOH B O     1 
HETATM 5811 O  O     . HOH M 6 .   ? 24.568  27.665  56.213 1.00 65.78  ? 977 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   PHE 3   3   3   PHE PHE A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  HIS 10  10  10  HIS HIS A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ASN 31  31  31  ASN ASN A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  PHE 51  51  51  PHE PHE A . n 
A 1 52  HIS 52  52  52  HIS HIS A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  SER 54  54  54  SER SER A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  HIS 85  85  85  HIS HIS A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 TYR 129 129 129 TYR TYR A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 VAL 134 134 134 VAL VAL A . n 
A 1 135 TYR 135 135 135 TYR TYR A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 MET 143 143 143 MET MET A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 MET 146 146 146 MET MET A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 TRP 150 150 150 TRP TRP A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 PRO 164 164 164 PRO PRO A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 ILE 190 190 190 ILE ILE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 TYR 201 201 201 TYR TYR A . n 
A 1 202 TYR 202 202 202 TYR TYR A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 HIS 206 206 206 HIS HIS A . n 
A 1 207 ILE 207 207 207 ILE ILE A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 TYR 215 215 215 TYR TYR A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 PRO 219 219 219 PRO PRO A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 GLU 227 227 227 GLU GLU A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 GLU 235 235 235 GLU GLU A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 ARG 237 237 237 ARG ARG A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 TRP 240 240 240 TRP TRP A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 ILE 243 243 243 ILE ILE A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 PHE 245 245 245 PHE PHE A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 TYR 249 249 249 TYR TYR A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 TYR 256 256 256 TYR TYR A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 PRO 263 263 263 PRO PRO A . n 
A 1 264 ARG 264 264 264 ARG ARG A . n 
A 1 265 PHE 265 265 265 PHE PHE A . n 
A 1 266 VAL 266 266 266 VAL VAL A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 ILE 268 268 268 ILE ILE A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 PHE 273 273 273 PHE PHE A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 ILE 278 278 278 ILE ILE A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 GLU 284 284 284 GLU GLU A . n 
A 1 285 ILE 285 285 285 ILE ILE A . n 
A 1 286 ARG 286 286 286 ARG ARG A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 PRO 297 297 297 PRO PRO A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 TYR 301 301 301 TYR TYR A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 ASN 305 305 305 ASN ASN A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 TRP 308 308 308 TRP TRP A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 LYS 310 310 310 LYS LYS A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 PHE 312 312 312 PHE PHE A . n 
A 1 313 ASP 313 313 313 ASP ASP A . n 
A 1 314 LEU 314 314 314 LEU LEU A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 GLU 316 316 316 GLU GLU A . n 
A 1 317 ILE 317 317 317 ILE ILE A . n 
A 1 318 LYS 318 318 318 LYS LYS A . n 
A 1 319 GLU 319 319 319 GLU GLU A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 ILE 328 328 328 ILE ILE A . n 
A 1 329 ASP 329 329 329 ASP ASP A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 TRP 331 331 331 TRP TRP A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   LYS 2   2   2   LYS LYS B . n 
B 1 3   PHE 3   3   3   PHE PHE B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ASP 8   8   8   ASP ASP B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  HIS 10  10  10  HIS HIS B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  TYR 13  13  13  TYR TYR B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  PHE 16  16  16  PHE PHE B . n 
B 1 17  HIS 17  17  17  HIS HIS B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  PRO 19  19  19  PRO PRO B . n 
B 1 20  GLN 20  20  20  GLN GLN B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  PHE 25  25  25  PHE PHE B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  ALA 28  28  28  ALA ALA B . n 
B 1 29  PHE 29  29  29  PHE PHE B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  ASN 31  31  31  ASN ASN B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ALA 36  36  36  ALA ALA B . n 
B 1 37  VAL 37  37  37  VAL VAL B . n 
B 1 38  GLN 38  38  38  GLN GLN B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  ASN 40  40  40  ASN ASN B . n 
B 1 41  VAL 41  41  41  VAL VAL B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  ILE 44  44  44  ILE ILE B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  PHE 51  51  51  PHE PHE B . n 
B 1 52  HIS 52  52  52  HIS HIS B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  SER 54  54  54  SER SER B . n 
B 1 55  ARG 55  55  55  ARG ARG B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  PRO 71  71  71  PRO PRO B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  HIS 74  74  74  HIS HIS B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  ILE 76  76  76  ILE ILE B . n 
B 1 77  PRO 77  77  77  PRO PRO B . n 
B 1 78  VAL 78  78  78  VAL VAL B . n 
B 1 79  PHE 79  79  79  PHE PHE B . n 
B 1 80  ALA 80  80  80  ALA ALA B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  ASN 84  84  84  ASN ASN B . n 
B 1 85  HIS 85  85  85  HIS HIS B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  PRO 92  92  92  PRO PRO B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  ASN 96  96  96  ASN ASN B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  GLU 99  99  99  GLU GLU B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 VAL 104 104 104 VAL VAL B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 VAL 106 106 106 VAL VAL B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 MET 109 109 109 MET MET B . n 
B 1 110 ARG 110 110 110 ARG ARG B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 TYR 118 118 118 TYR TYR B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 GLU 122 122 122 GLU GLU B . n 
B 1 123 ARG 123 123 123 ARG ARG B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 ASN 126 126 126 ASN ASN B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 TYR 129 129 129 TYR TYR B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 VAL 134 134 134 VAL VAL B . n 
B 1 135 TYR 135 135 135 TYR TYR B . n 
B 1 136 LYS 136 136 136 LYS LYS B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 ILE 140 140 140 ILE ILE B . n 
B 1 141 HIS 141 141 141 HIS HIS B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 MET 143 143 143 MET MET B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 TYR 145 145 145 TYR TYR B . n 
B 1 146 MET 146 146 146 MET MET B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 TRP 150 150 150 TRP TRP B . n 
B 1 151 PHE 151 151 151 PHE PHE B . n 
B 1 152 GLU 152 152 152 GLU GLU B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 ASN 154 154 154 ASN ASN B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 GLU 156 156 156 GLU GLU B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 ARG 163 163 163 ARG ARG B . n 
B 1 164 PRO 164 164 164 PRO PRO B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 ILE 169 169 169 ILE ILE B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 MET 171 171 171 MET MET B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 HIS 173 173 173 HIS HIS B . n 
B 1 174 GLN 174 174 174 GLN GLN B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 VAL 176 176 176 VAL VAL B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 GLU 178 178 178 GLU GLU B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 ALA 182 182 182 ALA ALA B . n 
B 1 183 ARG 183 183 183 ARG ARG B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASP 186 186 186 ASP ASP B . n 
B 1 187 TYR 187 187 187 TYR TYR B . n 
B 1 188 PHE 188 188 188 PHE PHE B . n 
B 1 189 GLU 189 189 189 GLU GLU B . n 
B 1 190 ILE 190 190 190 ILE ILE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 LEU 195 195 195 LEU LEU B . n 
B 1 196 PRO 196 196 196 PRO PRO B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 GLY 198 198 198 GLY GLY B . n 
B 1 199 TYR 199 199 199 TYR TYR B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 TYR 201 201 201 TYR TYR B . n 
B 1 202 TYR 202 202 202 TYR TYR B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 HIS 206 206 206 HIS HIS B . n 
B 1 207 ILE 207 207 207 ILE ILE B . n 
B 1 208 HIS 208 208 208 HIS HIS B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 ARG 210 210 210 ARG ARG B . n 
B 1 211 TYR 211 211 211 TYR TYR B . n 
B 1 212 GLU 212 212 212 GLU GLU B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 TYR 215 215 215 TYR TYR B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 PRO 219 219 219 PRO PRO B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 VAL 221 221 221 VAL VAL B . n 
B 1 222 TYR 222 222 222 TYR TYR B . n 
B 1 223 PRO 223 223 223 PRO PRO B . n 
B 1 224 GLY 224 224 224 GLY GLY B . n 
B 1 225 SER 225 225 225 SER SER B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 GLU 227 227 227 GLU GLU B . n 
B 1 228 ARG 228 228 228 ARG ARG B . n 
B 1 229 TRP 229 229 229 TRP TRP B . n 
B 1 230 ASP 230 230 230 ASP ASP B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 TYR 234 234 234 TYR TYR B . n 
B 1 235 GLU 235 235 235 GLU GLU B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 ARG 237 237 237 ARG ARG B . n 
B 1 238 TYR 238 238 238 TYR TYR B . n 
B 1 239 GLU 239 239 239 GLU GLU B . n 
B 1 240 TRP 240 240 240 TRP TRP B . n 
B 1 241 ASP 241 241 241 ASP ASP B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 ILE 243 243 243 ILE ILE B . n 
B 1 244 LYS 244 244 244 LYS LYS B . n 
B 1 245 PHE 245 245 245 PHE PHE B . n 
B 1 246 LYS 246 246 246 LYS LYS B . n 
B 1 247 GLU 247 247 247 GLU GLU B . n 
B 1 248 ARG 248 248 248 ARG ARG B . n 
B 1 249 TYR 249 249 249 TYR TYR B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 ASN 252 252 252 ASN ASN B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 GLY 254 254 254 GLY GLY B . n 
B 1 255 PHE 255 255 255 PHE PHE B . n 
B 1 256 TYR 256 256 256 TYR TYR B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 VAL 258 258 258 VAL VAL B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 PHE 261 261 261 PHE PHE B . n 
B 1 262 LYS 262 262 262 LYS LYS B . n 
B 1 263 PRO 263 263 263 PRO PRO B . n 
B 1 264 ARG 264 264 264 ARG ARG B . n 
B 1 265 PHE 265 265 265 PHE PHE B . n 
B 1 266 VAL 266 266 266 VAL VAL B . n 
B 1 267 GLU 267 267 267 GLU GLU B . n 
B 1 268 ILE 268 268 268 ILE ILE B . n 
B 1 269 LYS 269 269 269 LYS LYS B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 PRO 272 272 272 PRO PRO B . n 
B 1 273 PHE 273 273 273 PHE PHE B . n 
B 1 274 ILE 274 274 274 ILE ILE B . n 
B 1 275 ASP 275 275 275 ASP ASP B . n 
B 1 276 VAL 276 276 276 VAL VAL B . n 
B 1 277 LYS 277 277 277 LYS LYS B . n 
B 1 278 ILE 278 278 278 ILE ILE B . n 
B 1 279 LYS 279 279 279 LYS LYS B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 SER 281 281 281 SER SER B . n 
B 1 282 GLU 282 282 282 GLU GLU B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 GLU 284 284 284 GLU GLU B . n 
B 1 285 ILE 285 285 285 ILE ILE B . n 
B 1 286 ARG 286 286 286 ARG ARG B . n 
B 1 287 LYS 287 287 287 LYS LYS B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 ILE 289 289 289 ILE ILE B . n 
B 1 290 LYS 290 290 290 LYS LYS B . n 
B 1 291 ARG 291 291 291 ARG ARG B . n 
B 1 292 LEU 292 292 292 LEU LEU B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 ILE 296 296 296 ILE ILE B . n 
B 1 297 PRO 297 297 297 PRO PRO B . n 
B 1 298 LYS 298 298 298 LYS LYS B . n 
B 1 299 ASN 299 299 299 ASN ASN B . n 
B 1 300 ALA 300 300 300 ALA ALA B . n 
B 1 301 TYR 301 301 301 TYR TYR B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 ARG 303 303 303 ARG ARG B . n 
B 1 304 LEU 304 304 304 LEU LEU B . n 
B 1 305 ASN 305 305 305 ASN ASN B . n 
B 1 306 ILE 306 306 306 ILE ILE B . n 
B 1 307 GLY 307 307 307 GLY GLY B . n 
B 1 308 TRP 308 308 308 TRP TRP B . n 
B 1 309 ARG 309 309 309 ARG ARG B . n 
B 1 310 LYS 310 310 310 LYS LYS B . n 
B 1 311 PRO 311 311 311 PRO PRO B . n 
B 1 312 PHE 312 312 312 PHE PHE B . n 
B 1 313 ASP 313 313 313 ASP ASP B . n 
B 1 314 LEU 314 314 314 LEU LEU B . n 
B 1 315 THR 315 315 315 THR THR B . n 
B 1 316 GLU 316 316 316 GLU GLU B . n 
B 1 317 ILE 317 317 317 ILE ILE B . n 
B 1 318 LYS 318 318 318 LYS LYS B . n 
B 1 319 GLU 319 319 319 GLU GLU B . n 
B 1 320 LEU 320 320 320 LEU LEU B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 ASN 322 322 322 ASN ASN B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 GLU 324 324 324 GLU GLU B . n 
B 1 325 TYR 325 325 325 TYR TYR B . n 
B 1 326 LEU 326 326 326 LEU LEU B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 ILE 328 328 328 ILE ILE B . n 
B 1 329 ASP 329 329 329 ASP ASP B . n 
B 1 330 THR 330 330 330 THR THR B . n 
B 1 331 TRP 331 331 331 TRP TRP B . n 
B 1 332 ARG 332 332 332 ARG ARG B . n 
B 1 333 ILE 333 333 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3240  ? 
1 MORE         -85   ? 
1 'SSA (A^2)'  30160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 8  ? A ASP 8   ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 91.0  ? 
2  OD1 ? A ASP 8  ? A ASP 8   ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 O   ? L HOH .  ? A HOH 407 ? 1_555 74.9  ? 
3  OD1 ? A ASP 49 ? A ASP 49  ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 O   ? L HOH .  ? A HOH 407 ? 1_555 85.4  ? 
4  OD1 ? A ASP 8  ? A ASP 8   ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 OP3 ? H DA  .  ? A DA  401 ? 1_555 161.8 ? 
5  OD1 ? A ASP 49 ? A ASP 49  ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 OP3 ? H DA  .  ? A DA  401 ? 1_555 89.7  ? 
6  O   ? L HOH .  ? A HOH 407 ? 1_555 MN ? C MN . ? A MN 403 ? 1_555 OP3 ? H DA  .  ? A DA  401 ? 1_555 87.0  ? 
7  OD1 ? A ASP 49 ? A ASP 49  ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 OD1 ? A ASN 84 ? A ASN 84  ? 1_555 99.1  ? 
8  OD1 ? A ASP 49 ? A ASP 49  ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 OP2 ? H DA  .  ? A DA  401 ? 1_555 92.8  ? 
9  OD1 ? A ASN 84 ? A ASN 84  ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 OP2 ? H DA  .  ? A DA  401 ? 1_555 87.8  ? 
10 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 O   ? L HOH .  ? A HOH 407 ? 1_555 82.2  ? 
11 OD1 ? A ASN 84 ? A ASN 84  ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 O   ? L HOH .  ? A HOH 407 ? 1_555 170.5 ? 
12 OP2 ? H DA  .  ? A DA  401 ? 1_555 MN ? D MN . ? A MN 404 ? 1_555 O   ? L HOH .  ? A HOH 407 ? 1_555 82.8  ? 
13 OD1 ? B ASP 8  ? B ASP 8   ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 88.6  ? 
14 OD1 ? B ASP 8  ? B ASP 8   ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 O3  ? I PO4 .  ? B PO4 402 ? 1_555 155.1 ? 
15 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 O3  ? I PO4 .  ? B PO4 402 ? 1_555 92.7  ? 
16 OD1 ? B ASP 8  ? B ASP 8   ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 72.7  ? 
17 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 83.4  ? 
18 O3  ? I PO4 .  ? B PO4 402 ? 1_555 MN ? K MN . ? B MN 406 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 82.8  ? 
19 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 OD1 ? B ASN 84 ? B ASN 84  ? 1_555 101.0 ? 
20 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 O1  ? I PO4 .  ? B PO4 402 ? 1_555 93.7  ? 
21 OD1 ? B ASN 84 ? B ASN 84  ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 O1  ? I PO4 .  ? B PO4 402 ? 1_555 89.6  ? 
22 OD2 ? B ASP 49 ? B ASP 49  ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 73.1  ? 
23 OD1 ? B ASN 84 ? B ASN 84  ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 165.3 ? 
24 O1  ? I PO4 .  ? B PO4 402 ? 1_555 MN ? J MN . ? B MN 405 ? 1_555 O   ? M HOH .  ? B HOH 408 ? 1_555 77.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-05-30 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE phasing          .            ? 1 
CNS     refinement       1.0          ? 2 
DENZO   'data reduction' .            ? 3 
CCP4    'data scaling'   '(TRUNCATE)' ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ILE 
_pdbx_validate_rmsd_angle.auth_seq_id_1              333 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             C 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ILE 
_pdbx_validate_rmsd_angle.auth_seq_id_2              333 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             O 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ILE 
_pdbx_validate_rmsd_angle.auth_seq_id_3              333 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                158.45 
_pdbx_validate_rmsd_angle.angle_target_value         120.10 
_pdbx_validate_rmsd_angle.angle_deviation            38.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 90  ? ? -170.78 125.65  
2  1 LYS A 136 ? ? 51.08   -120.20 
3  1 ALA A 182 ? ? -68.13  4.28    
4  1 TYR A 201 ? ? -170.27 133.67  
5  1 HIS A 206 ? ? 124.25  -42.95  
6  1 ARG A 210 ? ? -47.70  153.61  
7  1 THR A 213 ? ? -142.94 -157.93 
8  1 ASP A 233 ? ? -97.17  42.98   
9  1 ILE A 243 ? ? -139.29 -30.01  
10 1 LYS B 136 ? ? 58.02   -125.74 
11 1 ASN B 154 ? ? -147.30 57.16   
12 1 HIS B 206 ? ? 126.02  -42.93  
13 1 ARG B 210 ? ? -39.90  143.84  
14 1 ASP B 233 ? ? -102.55 46.85   
15 1 THR B 330 ? ? -174.65 138.08  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 0 A GLN 89  ? CG  ? A GLN 89  CG  
2   1 Y 0 A GLN 89  ? CD  ? A GLN 89  CD  
3   1 Y 0 A GLN 89  ? OE1 ? A GLN 89  OE1 
4   1 Y 0 A GLN 89  ? NE2 ? A GLN 89  NE2 
5   1 Y 0 A ARG 90  ? CB  ? A ARG 90  CB  
6   1 Y 0 A ARG 90  ? CG  ? A ARG 90  CG  
7   1 Y 0 A ARG 90  ? CD  ? A ARG 90  CD  
8   1 Y 0 A ARG 90  ? NE  ? A ARG 90  NE  
9   1 Y 0 A ARG 90  ? CZ  ? A ARG 90  CZ  
10  1 Y 0 A ARG 90  ? NH1 ? A ARG 90  NH1 
11  1 Y 0 A ARG 90  ? NH2 ? A ARG 90  NH2 
12  1 Y 0 A GLU 152 ? CD  ? A GLU 152 CD  
13  1 Y 0 A GLU 152 ? OE1 ? A GLU 152 OE1 
14  1 Y 0 A GLU 152 ? OE2 ? A GLU 152 OE2 
15  1 Y 0 A LYS 155 ? CD  ? A LYS 155 CD  
16  1 Y 0 A LYS 155 ? CE  ? A LYS 155 CE  
17  1 Y 0 A LYS 155 ? NZ  ? A LYS 155 NZ  
18  1 Y 0 A ARG 163 ? CG  ? A ARG 163 CG  
19  1 Y 0 A ARG 163 ? CD  ? A ARG 163 CD  
20  1 Y 0 A ARG 163 ? NE  ? A ARG 163 NE  
21  1 Y 0 A ARG 163 ? CZ  ? A ARG 163 CZ  
22  1 Y 0 A ARG 163 ? NH1 ? A ARG 163 NH1 
23  1 Y 0 A ARG 163 ? NH2 ? A ARG 163 NH2 
24  1 Y 0 A LYS 244 ? CD  ? A LYS 244 CD  
25  1 Y 0 A LYS 244 ? CE  ? A LYS 244 CE  
26  1 Y 0 A LYS 244 ? NZ  ? A LYS 244 NZ  
27  1 Y 0 A LYS 246 ? CG  ? A LYS 246 CG  
28  1 Y 0 A LYS 246 ? CD  ? A LYS 246 CD  
29  1 Y 0 A LYS 246 ? CE  ? A LYS 246 CE  
30  1 Y 0 A LYS 246 ? NZ  ? A LYS 246 NZ  
31  1 Y 0 A LYS 277 ? CD  ? A LYS 277 CD  
32  1 Y 0 A LYS 277 ? CE  ? A LYS 277 CE  
33  1 Y 0 A LYS 277 ? NZ  ? A LYS 277 NZ  
34  1 Y 0 A LYS 279 ? CD  ? A LYS 279 CD  
35  1 Y 0 A LYS 279 ? CE  ? A LYS 279 CE  
36  1 Y 0 A LYS 279 ? NZ  ? A LYS 279 NZ  
37  1 Y 0 A ARG 291 ? CD  ? A ARG 291 CD  
38  1 Y 0 A ARG 291 ? NE  ? A ARG 291 NE  
39  1 Y 0 A ARG 291 ? CZ  ? A ARG 291 CZ  
40  1 Y 0 A ARG 291 ? NH1 ? A ARG 291 NH1 
41  1 Y 0 A ARG 291 ? NH2 ? A ARG 291 NH2 
42  1 Y 0 A LYS 298 ? CG  ? A LYS 298 CG  
43  1 Y 0 A LYS 298 ? CD  ? A LYS 298 CD  
44  1 Y 0 A LYS 298 ? CE  ? A LYS 298 CE  
45  1 Y 0 A LYS 298 ? NZ  ? A LYS 298 NZ  
46  1 Y 0 A ARG 309 ? CG  ? A ARG 309 CG  
47  1 Y 0 A ARG 309 ? CD  ? A ARG 309 CD  
48  1 Y 0 A ARG 309 ? NE  ? A ARG 309 NE  
49  1 Y 0 A ARG 309 ? CZ  ? A ARG 309 CZ  
50  1 Y 0 A ARG 309 ? NH1 ? A ARG 309 NH1 
51  1 Y 0 A ARG 309 ? NH2 ? A ARG 309 NH2 
52  1 Y 0 A LYS 310 ? CD  ? A LYS 310 CD  
53  1 Y 0 A LYS 310 ? CE  ? A LYS 310 CE  
54  1 Y 0 A LYS 310 ? NZ  ? A LYS 310 NZ  
55  1 Y 0 A ILE 333 ? OXT ? A ILE 333 OXT 
56  1 Y 0 B LYS 111 ? CE  ? B LYS 111 CE  
57  1 Y 0 B LYS 111 ? NZ  ? B LYS 111 NZ  
58  1 Y 0 B GLU 112 ? CG  ? B GLU 112 CG  
59  1 Y 0 B GLU 112 ? CD  ? B GLU 112 CD  
60  1 Y 0 B GLU 112 ? OE1 ? B GLU 112 OE1 
61  1 Y 0 B GLU 112 ? OE2 ? B GLU 112 OE2 
62  1 Y 0 B LYS 113 ? CE  ? B LYS 113 CE  
63  1 Y 0 B LYS 113 ? NZ  ? B LYS 113 NZ  
64  1 Y 0 B ARG 123 ? CG  ? B ARG 123 CG  
65  1 Y 0 B ARG 123 ? CD  ? B ARG 123 CD  
66  1 Y 0 B ARG 123 ? NE  ? B ARG 123 NE  
67  1 Y 0 B ARG 123 ? CZ  ? B ARG 123 CZ  
68  1 Y 0 B ARG 123 ? NH1 ? B ARG 123 NH1 
69  1 Y 0 B ARG 123 ? NH2 ? B ARG 123 NH2 
70  1 Y 0 B LYS 155 ? CG  ? B LYS 155 CG  
71  1 Y 0 B LYS 155 ? CD  ? B LYS 155 CD  
72  1 Y 0 B LYS 155 ? CE  ? B LYS 155 CE  
73  1 Y 0 B LYS 155 ? NZ  ? B LYS 155 NZ  
74  1 Y 0 B ARG 163 ? CD  ? B ARG 163 CD  
75  1 Y 0 B ARG 163 ? NE  ? B ARG 163 NE  
76  1 Y 0 B ARG 163 ? CZ  ? B ARG 163 CZ  
77  1 Y 0 B ARG 163 ? NH1 ? B ARG 163 NH1 
78  1 Y 0 B ARG 163 ? NH2 ? B ARG 163 NH2 
79  1 Y 0 B ARG 177 ? NE  ? B ARG 177 NE  
80  1 Y 0 B ARG 177 ? CZ  ? B ARG 177 CZ  
81  1 Y 0 B ARG 177 ? NH1 ? B ARG 177 NH1 
82  1 Y 0 B ARG 177 ? NH2 ? B ARG 177 NH2 
83  1 Y 0 B ARG 237 ? NE  ? B ARG 237 NE  
84  1 Y 0 B ARG 237 ? CZ  ? B ARG 237 CZ  
85  1 Y 0 B ARG 237 ? NH1 ? B ARG 237 NH1 
86  1 Y 0 B ARG 237 ? NH2 ? B ARG 237 NH2 
87  1 Y 0 B ILE 243 ? CG1 ? B ILE 243 CG1 
88  1 Y 0 B ILE 243 ? CG2 ? B ILE 243 CG2 
89  1 Y 0 B ARG 248 ? CD  ? B ARG 248 CD  
90  1 Y 0 B ARG 248 ? NE  ? B ARG 248 NE  
91  1 Y 0 B ARG 248 ? CZ  ? B ARG 248 CZ  
92  1 Y 0 B ARG 248 ? NH1 ? B ARG 248 NH1 
93  1 Y 0 B ARG 248 ? NH2 ? B ARG 248 NH2 
94  1 Y 0 B GLU 283 ? CB  ? B GLU 283 CB  
95  1 Y 0 B GLU 283 ? CG  ? B GLU 283 CG  
96  1 Y 0 B GLU 283 ? CD  ? B GLU 283 CD  
97  1 Y 0 B GLU 283 ? OE1 ? B GLU 283 OE1 
98  1 Y 0 B GLU 283 ? OE2 ? B GLU 283 OE2 
99  1 Y 0 B ARG 286 ? CG  ? B ARG 286 CG  
100 1 Y 0 B ARG 286 ? CD  ? B ARG 286 CD  
101 1 Y 0 B ARG 286 ? NE  ? B ARG 286 NE  
102 1 Y 0 B ARG 286 ? CZ  ? B ARG 286 CZ  
103 1 Y 0 B ARG 286 ? NH1 ? B ARG 286 NH1 
104 1 Y 0 B ARG 286 ? NH2 ? B ARG 286 NH2 
105 1 Y 0 B LYS 287 ? CG  ? B LYS 287 CG  
106 1 Y 0 B LYS 287 ? CD  ? B LYS 287 CD  
107 1 Y 0 B LYS 287 ? CE  ? B LYS 287 CE  
108 1 Y 0 B LYS 287 ? NZ  ? B LYS 287 NZ  
109 1 Y 0 B LYS 290 ? CG  ? B LYS 290 CG  
110 1 Y 0 B LYS 290 ? CD  ? B LYS 290 CD  
111 1 Y 0 B LYS 290 ? CE  ? B LYS 290 CE  
112 1 Y 0 B LYS 290 ? NZ  ? B LYS 290 NZ  
113 1 Y 0 B LYS 298 ? CB  ? B LYS 298 CB  
114 1 Y 0 B LYS 298 ? CG  ? B LYS 298 CG  
115 1 Y 0 B LYS 298 ? CD  ? B LYS 298 CD  
116 1 Y 0 B LYS 298 ? CE  ? B LYS 298 CE  
117 1 Y 0 B LYS 298 ? NZ  ? B LYS 298 NZ  
118 1 Y 0 B ARG 309 ? CB  ? B ARG 309 CB  
119 1 Y 0 B ARG 309 ? CG  ? B ARG 309 CG  
120 1 Y 0 B ARG 309 ? CD  ? B ARG 309 CD  
121 1 Y 0 B ARG 309 ? NE  ? B ARG 309 NE  
122 1 Y 0 B ARG 309 ? CZ  ? B ARG 309 CZ  
123 1 Y 0 B ARG 309 ? NH1 ? B ARG 309 NH1 
124 1 Y 0 B ARG 309 ? NH2 ? B ARG 309 NH2 
125 1 Y 0 B LYS 310 ? CB  ? B LYS 310 CB  
126 1 Y 0 B LYS 310 ? CG  ? B LYS 310 CG  
127 1 Y 0 B LYS 310 ? CD  ? B LYS 310 CD  
128 1 Y 0 B LYS 310 ? CE  ? B LYS 310 CE  
129 1 Y 0 B LYS 310 ? NZ  ? B LYS 310 NZ  
130 1 Y 0 B GLU 319 ? CG  ? B GLU 319 CG  
131 1 Y 0 B GLU 319 ? CD  ? B GLU 319 CD  
132 1 Y 0 B GLU 319 ? OE1 ? B GLU 319 OE1 
133 1 Y 0 B GLU 319 ? OE2 ? B GLU 319 OE2 
134 1 Y 0 B LYS 327 ? CE  ? B LYS 327 CE  
135 1 Y 0 B LYS 327 ? NZ  ? B LYS 327 NZ  
136 1 Y 0 B TRP 331 ? CB  ? B TRP 331 CB  
137 1 Y 0 B TRP 331 ? CG  ? B TRP 331 CG  
138 1 Y 0 B TRP 331 ? CD1 ? B TRP 331 CD1 
139 1 Y 0 B TRP 331 ? CD2 ? B TRP 331 CD2 
140 1 Y 0 B TRP 331 ? NE1 ? B TRP 331 NE1 
141 1 Y 0 B TRP 331 ? CE2 ? B TRP 331 CE2 
142 1 Y 0 B TRP 331 ? CE3 ? B TRP 331 CE3 
143 1 Y 0 B TRP 331 ? CZ2 ? B TRP 331 CZ2 
144 1 Y 0 B TRP 331 ? CZ3 ? B TRP 331 CZ3 
145 1 Y 0 B TRP 331 ? CH2 ? B TRP 331 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 0 B ARG 332 ? B ARG 332 
2 1 Y 1 B ILE 333 ? B ILE 333 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'                 MN  
3 'SULFATE ION'                        SO4 
4 "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" DA  
5 'PHOSPHATE ION'                      PO4 
6 water                                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   403 403 MN  MN2 A . 
D 2 MN  1   404 404 MN  MN2 A . 
E 3 SO4 1   501 501 SO4 SO4 A . 
F 3 SO4 1   502 502 SO4 SO4 A . 
G 3 SO4 1   503 503 SO4 SO4 A . 
H 4 DA  1   401 401 DA  AMP A . 
I 5 PO4 1   402 402 PO4 PO4 B . 
J 2 MN  1   405 405 MN  MN2 B . 
K 2 MN  1   406 406 MN  MN2 B . 
L 6 HOH 1   407 407 HOH HOH A . 
L 6 HOH 2   600 600 HOH HOH A . 
L 6 HOH 3   603 603 HOH HOH A . 
L 6 HOH 4   614 614 HOH HOH A . 
L 6 HOH 5   615 615 HOH HOH A . 
L 6 HOH 6   619 619 HOH HOH A . 
L 6 HOH 7   620 620 HOH HOH A . 
L 6 HOH 8   623 623 HOH HOH A . 
L 6 HOH 9   624 624 HOH HOH A . 
L 6 HOH 10  625 625 HOH HOH A . 
L 6 HOH 11  630 630 HOH HOH A . 
L 6 HOH 12  633 633 HOH HOH A . 
L 6 HOH 13  636 636 HOH HOH A . 
L 6 HOH 14  642 642 HOH HOH A . 
L 6 HOH 15  643 643 HOH HOH A . 
L 6 HOH 16  644 644 HOH HOH A . 
L 6 HOH 17  649 649 HOH HOH A . 
L 6 HOH 18  650 650 HOH HOH A . 
L 6 HOH 19  653 653 HOH HOH A . 
L 6 HOH 20  654 654 HOH HOH A . 
L 6 HOH 21  658 658 HOH HOH A . 
L 6 HOH 22  659 659 HOH HOH A . 
L 6 HOH 23  661 661 HOH HOH A . 
L 6 HOH 24  663 663 HOH HOH A . 
L 6 HOH 25  667 667 HOH HOH A . 
L 6 HOH 26  668 668 HOH HOH A . 
L 6 HOH 27  670 670 HOH HOH A . 
L 6 HOH 28  674 674 HOH HOH A . 
L 6 HOH 29  680 680 HOH HOH A . 
L 6 HOH 30  681 681 HOH HOH A . 
L 6 HOH 31  687 687 HOH HOH A . 
L 6 HOH 32  691 691 HOH HOH A . 
L 6 HOH 33  693 693 HOH HOH A . 
L 6 HOH 34  696 696 HOH HOH A . 
L 6 HOH 35  697 697 HOH HOH A . 
L 6 HOH 36  698 698 HOH HOH A . 
L 6 HOH 37  699 699 HOH HOH A . 
L 6 HOH 38  700 700 HOH HOH A . 
L 6 HOH 39  702 702 HOH HOH A . 
L 6 HOH 40  704 704 HOH HOH A . 
L 6 HOH 41  706 706 HOH HOH A . 
L 6 HOH 42  707 707 HOH HOH A . 
L 6 HOH 43  708 708 HOH HOH A . 
L 6 HOH 44  710 710 HOH HOH A . 
L 6 HOH 45  711 711 HOH HOH A . 
L 6 HOH 46  716 716 HOH HOH A . 
L 6 HOH 47  721 721 HOH HOH A . 
L 6 HOH 48  723 723 HOH HOH A . 
L 6 HOH 49  725 725 HOH HOH A . 
L 6 HOH 50  726 726 HOH HOH A . 
L 6 HOH 51  734 734 HOH HOH A . 
L 6 HOH 52  736 736 HOH HOH A . 
L 6 HOH 53  737 737 HOH HOH A . 
L 6 HOH 54  739 739 HOH HOH A . 
L 6 HOH 55  742 742 HOH HOH A . 
L 6 HOH 56  743 743 HOH HOH A . 
L 6 HOH 57  746 746 HOH HOH A . 
L 6 HOH 58  751 751 HOH HOH A . 
L 6 HOH 59  752 752 HOH HOH A . 
L 6 HOH 60  753 753 HOH HOH A . 
L 6 HOH 61  755 755 HOH HOH A . 
L 6 HOH 62  758 758 HOH HOH A . 
L 6 HOH 63  761 761 HOH HOH A . 
L 6 HOH 64  762 762 HOH HOH A . 
L 6 HOH 65  764 764 HOH HOH A . 
L 6 HOH 66  767 767 HOH HOH A . 
L 6 HOH 67  768 768 HOH HOH A . 
L 6 HOH 68  772 772 HOH HOH A . 
L 6 HOH 69  773 773 HOH HOH A . 
L 6 HOH 70  775 775 HOH HOH A . 
L 6 HOH 71  777 777 HOH HOH A . 
L 6 HOH 72  784 784 HOH HOH A . 
L 6 HOH 73  790 790 HOH HOH A . 
L 6 HOH 74  792 792 HOH HOH A . 
L 6 HOH 75  793 793 HOH HOH A . 
L 6 HOH 76  795 795 HOH HOH A . 
L 6 HOH 77  796 796 HOH HOH A . 
L 6 HOH 78  800 800 HOH HOH A . 
L 6 HOH 79  801 801 HOH HOH A . 
L 6 HOH 80  804 804 HOH HOH A . 
L 6 HOH 81  805 805 HOH HOH A . 
L 6 HOH 82  808 808 HOH HOH A . 
L 6 HOH 83  809 809 HOH HOH A . 
L 6 HOH 84  810 810 HOH HOH A . 
L 6 HOH 85  814 814 HOH HOH A . 
L 6 HOH 86  822 822 HOH HOH A . 
L 6 HOH 87  827 827 HOH HOH A . 
L 6 HOH 88  830 830 HOH HOH A . 
L 6 HOH 89  832 832 HOH HOH A . 
L 6 HOH 90  833 833 HOH HOH A . 
L 6 HOH 91  835 835 HOH HOH A . 
L 6 HOH 92  836 836 HOH HOH A . 
L 6 HOH 93  837 837 HOH HOH A . 
L 6 HOH 94  838 838 HOH HOH A . 
L 6 HOH 95  841 841 HOH HOH A . 
L 6 HOH 96  844 844 HOH HOH A . 
L 6 HOH 97  846 846 HOH HOH A . 
L 6 HOH 98  854 854 HOH HOH A . 
L 6 HOH 99  856 856 HOH HOH A . 
L 6 HOH 100 857 857 HOH HOH A . 
L 6 HOH 101 862 862 HOH HOH A . 
L 6 HOH 102 865 865 HOH HOH A . 
L 6 HOH 103 867 867 HOH HOH A . 
L 6 HOH 104 868 868 HOH HOH A . 
L 6 HOH 105 878 878 HOH HOH A . 
L 6 HOH 106 880 880 HOH HOH A . 
L 6 HOH 107 884 884 HOH HOH A . 
L 6 HOH 108 887 887 HOH HOH A . 
L 6 HOH 109 895 895 HOH HOH A . 
L 6 HOH 110 899 899 HOH HOH A . 
L 6 HOH 111 901 901 HOH HOH A . 
L 6 HOH 112 904 904 HOH HOH A . 
L 6 HOH 113 908 908 HOH HOH A . 
L 6 HOH 114 912 912 HOH HOH A . 
L 6 HOH 115 914 914 HOH HOH A . 
L 6 HOH 116 916 916 HOH HOH A . 
L 6 HOH 117 919 919 HOH HOH A . 
L 6 HOH 118 922 922 HOH HOH A . 
L 6 HOH 119 923 923 HOH HOH A . 
L 6 HOH 120 928 928 HOH HOH A . 
L 6 HOH 121 933 933 HOH HOH A . 
L 6 HOH 122 940 940 HOH HOH A . 
L 6 HOH 123 941 941 HOH HOH A . 
L 6 HOH 124 947 947 HOH HOH A . 
L 6 HOH 125 966 966 HOH HOH A . 
L 6 HOH 126 974 974 HOH HOH A . 
L 6 HOH 127 978 978 HOH HOH A . 
L 6 HOH 128 979 979 HOH HOH A . 
M 6 HOH 1   408 408 HOH HOH B . 
M 6 HOH 2   601 601 HOH HOH B . 
M 6 HOH 3   602 602 HOH HOH B . 
M 6 HOH 4   604 604 HOH HOH B . 
M 6 HOH 5   605 605 HOH HOH B . 
M 6 HOH 6   606 606 HOH HOH B . 
M 6 HOH 7   607 607 HOH HOH B . 
M 6 HOH 8   608 608 HOH HOH B . 
M 6 HOH 9   609 609 HOH HOH B . 
M 6 HOH 10  610 610 HOH HOH B . 
M 6 HOH 11  611 611 HOH HOH B . 
M 6 HOH 12  612 612 HOH HOH B . 
M 6 HOH 13  613 613 HOH HOH B . 
M 6 HOH 14  616 616 HOH HOH B . 
M 6 HOH 15  617 617 HOH HOH B . 
M 6 HOH 16  618 618 HOH HOH B . 
M 6 HOH 17  621 621 HOH HOH B . 
M 6 HOH 18  622 622 HOH HOH B . 
M 6 HOH 19  626 626 HOH HOH B . 
M 6 HOH 20  629 629 HOH HOH B . 
M 6 HOH 21  631 631 HOH HOH B . 
M 6 HOH 22  634 634 HOH HOH B . 
M 6 HOH 23  635 635 HOH HOH B . 
M 6 HOH 24  637 637 HOH HOH B . 
M 6 HOH 25  638 638 HOH HOH B . 
M 6 HOH 26  640 640 HOH HOH B . 
M 6 HOH 27  641 641 HOH HOH B . 
M 6 HOH 28  645 645 HOH HOH B . 
M 6 HOH 29  646 646 HOH HOH B . 
M 6 HOH 30  647 647 HOH HOH B . 
M 6 HOH 31  652 652 HOH HOH B . 
M 6 HOH 32  656 656 HOH HOH B . 
M 6 HOH 33  657 657 HOH HOH B . 
M 6 HOH 34  660 660 HOH HOH B . 
M 6 HOH 35  662 662 HOH HOH B . 
M 6 HOH 36  664 664 HOH HOH B . 
M 6 HOH 37  666 666 HOH HOH B . 
M 6 HOH 38  671 671 HOH HOH B . 
M 6 HOH 39  675 675 HOH HOH B . 
M 6 HOH 40  676 676 HOH HOH B . 
M 6 HOH 41  677 677 HOH HOH B . 
M 6 HOH 42  679 679 HOH HOH B . 
M 6 HOH 43  682 682 HOH HOH B . 
M 6 HOH 44  690 690 HOH HOH B . 
M 6 HOH 45  694 694 HOH HOH B . 
M 6 HOH 46  695 695 HOH HOH B . 
M 6 HOH 47  705 705 HOH HOH B . 
M 6 HOH 48  709 709 HOH HOH B . 
M 6 HOH 49  712 712 HOH HOH B . 
M 6 HOH 50  713 713 HOH HOH B . 
M 6 HOH 51  714 714 HOH HOH B . 
M 6 HOH 52  715 715 HOH HOH B . 
M 6 HOH 53  717 717 HOH HOH B . 
M 6 HOH 54  718 718 HOH HOH B . 
M 6 HOH 55  719 719 HOH HOH B . 
M 6 HOH 56  720 720 HOH HOH B . 
M 6 HOH 57  722 722 HOH HOH B . 
M 6 HOH 58  724 724 HOH HOH B . 
M 6 HOH 59  727 727 HOH HOH B . 
M 6 HOH 60  728 728 HOH HOH B . 
M 6 HOH 61  733 733 HOH HOH B . 
M 6 HOH 62  735 735 HOH HOH B . 
M 6 HOH 63  740 740 HOH HOH B . 
M 6 HOH 64  744 744 HOH HOH B . 
M 6 HOH 65  745 745 HOH HOH B . 
M 6 HOH 66  749 749 HOH HOH B . 
M 6 HOH 67  750 750 HOH HOH B . 
M 6 HOH 68  756 756 HOH HOH B . 
M 6 HOH 69  759 759 HOH HOH B . 
M 6 HOH 70  760 760 HOH HOH B . 
M 6 HOH 71  763 763 HOH HOH B . 
M 6 HOH 72  765 765 HOH HOH B . 
M 6 HOH 73  766 766 HOH HOH B . 
M 6 HOH 74  770 770 HOH HOH B . 
M 6 HOH 75  774 774 HOH HOH B . 
M 6 HOH 76  778 778 HOH HOH B . 
M 6 HOH 77  779 779 HOH HOH B . 
M 6 HOH 78  780 780 HOH HOH B . 
M 6 HOH 79  782 782 HOH HOH B . 
M 6 HOH 80  783 783 HOH HOH B . 
M 6 HOH 81  786 786 HOH HOH B . 
M 6 HOH 82  788 788 HOH HOH B . 
M 6 HOH 83  789 789 HOH HOH B . 
M 6 HOH 84  791 791 HOH HOH B . 
M 6 HOH 85  797 797 HOH HOH B . 
M 6 HOH 86  799 799 HOH HOH B . 
M 6 HOH 87  802 802 HOH HOH B . 
M 6 HOH 88  803 803 HOH HOH B . 
M 6 HOH 89  806 806 HOH HOH B . 
M 6 HOH 90  807 807 HOH HOH B . 
M 6 HOH 91  812 812 HOH HOH B . 
M 6 HOH 92  813 813 HOH HOH B . 
M 6 HOH 93  816 816 HOH HOH B . 
M 6 HOH 94  817 817 HOH HOH B . 
M 6 HOH 95  818 818 HOH HOH B . 
M 6 HOH 96  821 821 HOH HOH B . 
M 6 HOH 97  824 824 HOH HOH B . 
M 6 HOH 98  825 825 HOH HOH B . 
M 6 HOH 99  826 826 HOH HOH B . 
M 6 HOH 100 829 829 HOH HOH B . 
M 6 HOH 101 842 842 HOH HOH B . 
M 6 HOH 102 843 843 HOH HOH B . 
M 6 HOH 103 847 847 HOH HOH B . 
M 6 HOH 104 848 848 HOH HOH B . 
M 6 HOH 105 852 852 HOH HOH B . 
M 6 HOH 106 855 855 HOH HOH B . 
M 6 HOH 107 860 860 HOH HOH B . 
M 6 HOH 108 861 861 HOH HOH B . 
M 6 HOH 109 863 863 HOH HOH B . 
M 6 HOH 110 866 866 HOH HOH B . 
M 6 HOH 111 872 872 HOH HOH B . 
M 6 HOH 112 876 876 HOH HOH B . 
M 6 HOH 113 877 877 HOH HOH B . 
M 6 HOH 114 885 885 HOH HOH B . 
M 6 HOH 115 888 888 HOH HOH B . 
M 6 HOH 116 889 889 HOH HOH B . 
M 6 HOH 117 892 892 HOH HOH B . 
M 6 HOH 118 894 894 HOH HOH B . 
M 6 HOH 119 900 900 HOH HOH B . 
M 6 HOH 120 905 905 HOH HOH B . 
M 6 HOH 121 917 917 HOH HOH B . 
M 6 HOH 122 932 932 HOH HOH B . 
M 6 HOH 123 935 935 HOH HOH B . 
M 6 HOH 124 936 936 HOH HOH B . 
M 6 HOH 125 937 937 HOH HOH B . 
M 6 HOH 126 942 942 HOH HOH B . 
M 6 HOH 127 951 951 HOH HOH B . 
M 6 HOH 128 953 953 HOH HOH B . 
M 6 HOH 129 954 954 HOH HOH B . 
M 6 HOH 130 958 958 HOH HOH B . 
M 6 HOH 131 965 965 HOH HOH B . 
M 6 HOH 132 972 972 HOH HOH B . 
M 6 HOH 133 973 973 HOH HOH B . 
M 6 HOH 134 975 975 HOH HOH B . 
M 6 HOH 135 976 976 HOH HOH B . 
M 6 HOH 136 977 977 HOH HOH B . 
#